data_2GIX
# 
_entry.id   2GIX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2GIX         pdb_00002gix 10.2210/pdb2gix/pdb 
RCSB  RCSB037174   ?            ?                   
WWPDB D_1000037174 ?            ?                   
# 
_pdbx_database_status.entry_id                        2GIX 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-29 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pegan, S.'       1 
'Arrabit, C.'     2 
'Slesinger, P.A.' 3 
'Choe, S.'        4 
# 
_citation.id                        primary 
_citation.title                     
;Andersen's Syndrome Mutation Effects on the Structure and Assembly of the Cytoplasmic Domains of Kir2.1.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            45 
_citation.page_first                8599 
_citation.page_last                 8606 
_citation.year                      2006 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16834334 
_citation.pdbx_database_id_DOI      10.1021/bi060653d 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pegan, S.'       1 ? 
primary 'Arrabit, C.'     2 ? 
primary 'Slesinger, P.A.' 3 ? 
primary 'Choe, S.'        4 ? 
# 
_cell.length_a           140.674 
_cell.length_b           98.876 
_cell.length_c           98.094 
_cell.angle_alpha        90.00 
_cell.angle_beta         130.68 
_cell.angle_gamma        90.00 
_cell.entry_id           2GIX 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         2GIX 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Inward rectifier potassium channel 2' 23908.197 4   ? 'R218Q, T309K' ? ? 
2 non-polymer syn 'POTASSIUM ION'                        39.098    1   ? ?              ? ? 
3 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL'        118.174   4   ? ?              ? ? 
4 water       nat water                                  18.015    700 ? ?              ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Potassium channel, inwardly rectifying subfamily J member 2, Inward rectifier K+, channel Kir2.1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHGRSRFVKKDGHCNVQFINVGEKRNETLVFSHNAVIAMRDGKLCLMWRVGNLQKSHLVEAHVRAQLLKSRITSEGEYI
PLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTKQCRSSYLANEILWG
HRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHGRSRFVKKDGHCNVQFINVGEKRNETLVFSHNAVIAMRDGKLCLMWRVGNLQKSHLVEAHVRAQLLKSRITSEGEYI
PLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTKQCRSSYLANEILWG
HRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILSNA
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   GLY n 
1 5   ARG n 
1 6   SER n 
1 7   ARG n 
1 8   PHE n 
1 9   VAL n 
1 10  LYS n 
1 11  LYS n 
1 12  ASP n 
1 13  GLY n 
1 14  HIS n 
1 15  CYS n 
1 16  ASN n 
1 17  VAL n 
1 18  GLN n 
1 19  PHE n 
1 20  ILE n 
1 21  ASN n 
1 22  VAL n 
1 23  GLY n 
1 24  GLU n 
1 25  LYS n 
1 26  ARG n 
1 27  ASN n 
1 28  GLU n 
1 29  THR n 
1 30  LEU n 
1 31  VAL n 
1 32  PHE n 
1 33  SER n 
1 34  HIS n 
1 35  ASN n 
1 36  ALA n 
1 37  VAL n 
1 38  ILE n 
1 39  ALA n 
1 40  MET n 
1 41  ARG n 
1 42  ASP n 
1 43  GLY n 
1 44  LYS n 
1 45  LEU n 
1 46  CYS n 
1 47  LEU n 
1 48  MET n 
1 49  TRP n 
1 50  ARG n 
1 51  VAL n 
1 52  GLY n 
1 53  ASN n 
1 54  LEU n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  HIS n 
1 59  LEU n 
1 60  VAL n 
1 61  GLU n 
1 62  ALA n 
1 63  HIS n 
1 64  VAL n 
1 65  ARG n 
1 66  ALA n 
1 67  GLN n 
1 68  LEU n 
1 69  LEU n 
1 70  LYS n 
1 71  SER n 
1 72  ARG n 
1 73  ILE n 
1 74  THR n 
1 75  SER n 
1 76  GLU n 
1 77  GLY n 
1 78  GLU n 
1 79  TYR n 
1 80  ILE n 
1 81  PRO n 
1 82  LEU n 
1 83  ASP n 
1 84  GLN n 
1 85  ILE n 
1 86  ASP n 
1 87  ILE n 
1 88  ASN n 
1 89  VAL n 
1 90  GLY n 
1 91  PHE n 
1 92  ASP n 
1 93  SER n 
1 94  GLY n 
1 95  ILE n 
1 96  ASP n 
1 97  ARG n 
1 98  ILE n 
1 99  PHE n 
1 100 LEU n 
1 101 VAL n 
1 102 SER n 
1 103 PRO n 
1 104 ILE n 
1 105 THR n 
1 106 ILE n 
1 107 VAL n 
1 108 HIS n 
1 109 GLU n 
1 110 ILE n 
1 111 ASP n 
1 112 GLU n 
1 113 ASP n 
1 114 SER n 
1 115 PRO n 
1 116 LEU n 
1 117 TYR n 
1 118 ASP n 
1 119 LEU n 
1 120 SER n 
1 121 LYS n 
1 122 GLN n 
1 123 ASP n 
1 124 ILE n 
1 125 ASP n 
1 126 ASN n 
1 127 ALA n 
1 128 ASP n 
1 129 PHE n 
1 130 GLU n 
1 131 ILE n 
1 132 VAL n 
1 133 VAL n 
1 134 ILE n 
1 135 LEU n 
1 136 GLU n 
1 137 GLY n 
1 138 MET n 
1 139 VAL n 
1 140 GLU n 
1 141 ALA n 
1 142 THR n 
1 143 ALA n 
1 144 MET n 
1 145 THR n 
1 146 LYS n 
1 147 GLN n 
1 148 CYS n 
1 149 ARG n 
1 150 SER n 
1 151 SER n 
1 152 TYR n 
1 153 LEU n 
1 154 ALA n 
1 155 ASN n 
1 156 GLU n 
1 157 ILE n 
1 158 LEU n 
1 159 TRP n 
1 160 GLY n 
1 161 HIS n 
1 162 ARG n 
1 163 TYR n 
1 164 GLU n 
1 165 PRO n 
1 166 VAL n 
1 167 LEU n 
1 168 PHE n 
1 169 GLU n 
1 170 GLU n 
1 171 LYS n 
1 172 HIS n 
1 173 TYR n 
1 174 TYR n 
1 175 LYS n 
1 176 VAL n 
1 177 ASP n 
1 178 TYR n 
1 179 SER n 
1 180 ARG n 
1 181 PHE n 
1 182 HIS n 
1 183 LYS n 
1 184 THR n 
1 185 TYR n 
1 186 GLU n 
1 187 VAL n 
1 188 PRO n 
1 189 ASN n 
1 190 THR n 
1 191 PRO n 
1 192 LEU n 
1 193 CYS n 
1 194 SER n 
1 195 ALA n 
1 196 ARG n 
1 197 ASP n 
1 198 LEU n 
1 199 ALA n 
1 200 GLU n 
1 201 LYS n 
1 202 LYS n 
1 203 TYR n 
1 204 ILE n 
1 205 LEU n 
1 206 SER n 
1 207 ASN n 
1 208 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 5  25  'house mouse' Mus 'Kcnj2, Irk1' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pHis8 ? ? 
1 2 sample ? 26 208 'house mouse' Mus 'Kcnj2, Irk1' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pHis8 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP IRK2_MOUSE P35561 1 
;RNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPIT
IVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTY
EVPNTPLCSARDLAEKKYILSNA
;
189 ? 
2 UNP IRK2_MOUSE P35561 1 GSHGRSRFVKKDGHCNVQFINVGEK 44  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2GIX A 26 ? 208 ? P35561 189 ? 371 ? 189 371 
2 1 2GIX B 26 ? 208 ? P35561 189 ? 371 ? 189 371 
3 1 2GIX C 26 ? 208 ? P35561 189 ? 371 ? 189 371 
4 1 2GIX D 26 ? 208 ? P35561 189 ? 371 ? 189 371 
5 2 2GIX A 5  ? 25  ? P35561 44  ? 64  ? 44  64  
6 2 2GIX B 5  ? 25  ? P35561 44  ? 64  ? 44  64  
7 2 2GIX C 5  ? 25  ? P35561 44  ? 64  ? 44  64  
8 2 2GIX D 5  ? 25  ? P35561 44  ? 64  ? 44  64  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2GIX GLN A 55  ? UNP P35561 ARG 218 'engineered mutation' 218 1  
1 2GIX LYS A 146 ? UNP P35561 THR 309 'engineered mutation' 309 2  
2 2GIX GLN B 55  ? UNP P35561 ARG 218 'engineered mutation' 218 3  
2 2GIX LYS B 146 ? UNP P35561 THR 309 'engineered mutation' 309 4  
3 2GIX GLN C 55  ? UNP P35561 ARG 218 'engineered mutation' 218 5  
3 2GIX LYS C 146 ? UNP P35561 THR 309 'engineered mutation' 309 6  
4 2GIX GLN D 55  ? UNP P35561 ARG 218 'engineered mutation' 218 7  
4 2GIX LYS D 146 ? UNP P35561 THR 309 'engineered mutation' 309 8  
1 2GIX GLY A 1   ? UNP P35561 ?   ?   'cloning artifact'    40  9  
1 2GIX SER A 2   ? UNP P35561 ?   ?   'cloning artifact'    41  10 
1 2GIX HIS A 3   ? UNP P35561 ?   ?   'cloning artifact'    42  11 
1 2GIX GLY A 4   ? UNP P35561 ?   ?   'cloning artifact'    43  12 
2 2GIX GLY B 1   ? UNP P35561 ?   ?   'cloning artifact'    40  13 
2 2GIX SER B 2   ? UNP P35561 ?   ?   'cloning artifact'    41  14 
2 2GIX HIS B 3   ? UNP P35561 ?   ?   'cloning artifact'    42  15 
2 2GIX GLY B 4   ? UNP P35561 ?   ?   'cloning artifact'    43  16 
3 2GIX GLY C 1   ? UNP P35561 ?   ?   'cloning artifact'    40  17 
3 2GIX SER C 2   ? UNP P35561 ?   ?   'cloning artifact'    41  18 
3 2GIX HIS C 3   ? UNP P35561 ?   ?   'cloning artifact'    42  19 
3 2GIX GLY C 4   ? UNP P35561 ?   ?   'cloning artifact'    43  20 
4 2GIX GLY D 1   ? UNP P35561 ?   ?   'cloning artifact'    40  21 
4 2GIX SER D 2   ? UNP P35561 ?   ?   'cloning artifact'    41  22 
4 2GIX HIS D 3   ? UNP P35561 ?   ?   'cloning artifact'    42  23 
4 2GIX GLY D 4   ? UNP P35561 ?   ?   'cloning artifact'    43  24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                      ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION'                 ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                      ? 'C5 H11 N O2 S'  149.211 
MPD non-polymer         . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2'      118.174 
PHE 'L-peptide linking' y PHENYLALANINE                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2GIX 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.70 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   54.52 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '35% MPD, 0.1 NaPO4/KPO4, 50mM NaCl, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-10-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
# 
_reflns.entry_id                     2GIX 
_reflns.d_resolution_high            2.020 
_reflns.d_resolution_low             50.0 
_reflns.number_obs                   66107 
_reflns.pdbx_Rmerge_I_obs            0.086 
_reflns.pdbx_netI_over_sigmaI        8.800 
_reflns.pdbx_chi_squared             1.016 
_reflns.pdbx_redundancy              3.600 
_reflns.percent_possible_obs         99.600 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   66471 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.02 
_reflns_shell.d_res_low              2.09 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      6428 
_reflns_shell.Rmerge_I_obs           0.347 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.952 
_reflns_shell.pdbx_redundancy        2.80 
_reflns_shell.percent_possible_obs   97.10 
_reflns_shell.number_unique_all      ? 
_reflns_shell.percent_possible_all   99.45 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2GIX 
_refine.ls_d_res_high                            2.020 
_refine.ls_d_res_low                             ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.450 
_refine.ls_number_reflns_obs                     66106 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.177 
_refine.ls_R_factor_R_free                       0.229 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  3363 
_refine.B_iso_mean                               27.865 
_refine.aniso_B[1][1]                            1.910 
_refine.aniso_B[2][2]                            -0.600 
_refine.aniso_B[3][3]                            0.160 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            1.130 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.930 
_refine.pdbx_overall_ESU_R                       0.170 
_refine.pdbx_overall_ESU_R_Free                  0.161 
_refine.overall_SU_ML                            0.113 
_refine.overall_SU_B                             4.028 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     66471 
_refine.ls_R_factor_obs                          0.191 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'Cytoplasmic Domains of Kir2.1' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6570 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             732 
_refine_hist.number_atoms_total               7303 
_refine_hist.d_res_high                       2.020 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         6709 0.018  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      9074 1.656  1.951  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   814  6.958  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   325  33.617 24.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1184 15.599 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   44   22.591 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1012 0.118  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     5036 0.007  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            2840 0.208  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          4471 0.312  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    736  0.179  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      4    0.112  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   66   0.241  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 26   0.245  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              4070 1.112  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             6588 2.066  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              2658 3.072  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             2486 4.675  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.020 
_refine_ls_shell.d_res_low                        2.075 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               94.170 
_refine_ls_shell.number_reflns_R_work             4381 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.211 
_refine_ls_shell.R_factor_R_free                  0.28 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             239 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                4620 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2GIX 
_struct.title                     
;Cytoplasmic Domain Structure of Kir2.1 containing Andersen's Mutation R218Q and Rescue Mutation T309K
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GIX 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            
;Cytoplasmic Domains of Kir2.1, Andersen's Mutation, METAL TRANSPORT
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'Biological Assembly is a tetramer' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 120 ? ASN A 126 ? SER A 283 ASN A 289 1 ? 7  
HELX_P HELX_P2  2  SER A 179 ? PHE A 181 ? SER A 342 PHE A 344 5 ? 3  
HELX_P HELX_P3  3  SER A 194 ? ASN A 207 ? SER A 357 ASN A 370 1 ? 14 
HELX_P HELX_P4  4  SER B 120 ? ASN B 126 ? SER B 283 ASN B 289 1 ? 7  
HELX_P HELX_P5  5  SER B 179 ? PHE B 181 ? SER B 342 PHE B 344 5 ? 3  
HELX_P HELX_P6  6  SER B 194 ? GLU B 200 ? SER B 357 GLU B 363 1 ? 7  
HELX_P HELX_P7  7  SER C 120 ? ASN C 126 ? SER C 283 ASN C 289 1 ? 7  
HELX_P HELX_P8  8  SER C 179 ? PHE C 181 ? SER C 342 PHE C 344 5 ? 3  
HELX_P HELX_P9  9  SER C 194 ? SER C 206 ? SER C 357 SER C 369 1 ? 13 
HELX_P HELX_P10 10 GLU D 24  ? GLU D 28  ? GLU D 63  GLU D 191 5 ? 5  
HELX_P HELX_P11 11 SER D 120 ? ALA D 127 ? SER D 283 ALA D 290 1 ? 8  
HELX_P HELX_P12 12 SER D 179 ? PHE D 181 ? SER D 342 PHE D 344 5 ? 3  
HELX_P HELX_P13 13 SER D 194 ? LYS D 201 ? SER D 357 LYS D 364 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? E K . K ? ? ? 1_555 J HOH . O ? ? A K 800 A HOH 820 1_555 ? ? ? ? ? ? ? 2.785 ? ? 
metalc2  metalc ? ? E K . K ? ? ? 1_555 J HOH . O ? ? A K 800 A HOH 823 1_555 ? ? ? ? ? ? ? 2.772 ? ? 
metalc3  metalc ? ? E K . K ? ? ? 1_555 J HOH . O ? ? A K 800 A HOH 942 1_555 ? ? ? ? ? ? ? 2.647 ? ? 
metalc4  metalc ? ? E K . K ? ? ? 1_555 K HOH . O ? ? A K 800 B HOH 825 1_555 ? ? ? ? ? ? ? 2.859 ? ? 
metalc5  metalc ? ? E K . K ? ? ? 1_555 K HOH . O ? ? A K 800 B HOH 903 1_555 ? ? ? ? ? ? ? 2.891 ? ? 
metalc6  metalc ? ? E K . K ? ? ? 1_555 K HOH . O ? ? A K 800 B HOH 960 1_555 ? ? ? ? ? ? ? 3.670 ? ? 
metalc7  metalc ? ? E K . K ? ? ? 1_555 L HOH . O ? ? A K 800 C HOH 832 1_555 ? ? ? ? ? ? ? 3.027 ? ? 
metalc8  metalc ? ? E K . K ? ? ? 1_555 L HOH . O ? ? A K 800 C HOH 901 1_555 ? ? ? ? ? ? ? 2.635 ? ? 
metalc9  metalc ? ? E K . K ? ? ? 1_555 M HOH . O ? ? A K 800 D HOH 871 1_555 ? ? ? ? ? ? ? 2.866 ? ? 
metalc10 metalc ? ? E K . K ? ? ? 1_555 M HOH . O ? ? A K 800 D HOH 976 1_555 ? ? ? ? ? ? ? 3.606 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 4 ? 
D ? 3 ? 
E ? 4 ? 
F ? 2 ? 
G ? 3 ? 
H ? 4 ? 
I ? 3 ? 
J ? 4 ? 
K ? 2 ? 
L ? 3 ? 
M ? 3 ? 
N ? 4 ? 
O ? 4 ? 
P ? 2 ? 
Q ? 3 ? 
R ? 3 ? 
S ? 4 ? 
T ? 3 ? 
U ? 4 ? 
V ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? parallel      
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? parallel      
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
V 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 17  ? ILE A 20  ? VAL A 56  ILE A 59  
A 2 TYR A 174 ? ASP A 177 ? TYR A 337 ASP A 340 
A 3 LEU A 167 ? GLU A 169 ? LEU A 330 GLU A 332 
B 1 LEU A 30  ? PHE A 32  ? LEU A 193 PHE A 195 
B 2 LYS A 44  ? ASN A 53  ? LYS A 207 ASN A 216 
B 3 ILE A 104 ? GLU A 109 ? ILE A 267 GLU A 272 
C 1 LEU A 30  ? PHE A 32  ? LEU A 193 PHE A 195 
C 2 LYS A 44  ? ASN A 53  ? LYS A 207 ASN A 216 
C 3 ALA A 36  ? ARG A 41  ? ALA A 199 ARG A 204 
C 4 ILE A 157 ? TRP A 159 ? ILE A 320 TRP A 322 
D 1 TYR A 79  ? ILE A 87  ? TYR A 242 ILE A 250 
D 2 LEU A 59  ? ILE A 73  ? LEU A 222 ILE A 236 
D 3 ARG A 97  ? ILE A 98  ? ARG A 260 ILE A 261 
E 1 TYR A 79  ? ILE A 87  ? TYR A 242 ILE A 250 
E 2 LEU A 59  ? ILE A 73  ? LEU A 222 ILE A 236 
E 3 GLU A 130 ? VAL A 139 ? GLU A 293 VAL A 302 
E 4 THR A 145 ? LEU A 153 ? THR A 308 LEU A 316 
F 1 HIS A 161 ? TYR A 163 ? HIS A 324 TYR A 326 
F 2 THR A 184 ? GLU A 186 ? THR A 347 GLU A 349 
G 1 VAL B 17  ? ILE B 20  ? VAL B 56  ILE B 59  
G 2 TYR B 174 ? ASP B 177 ? TYR B 337 ASP B 340 
G 3 LEU B 167 ? GLU B 169 ? LEU B 330 GLU B 332 
H 1 ILE B 104 ? GLU B 109 ? ILE B 267 GLU B 272 
H 2 LYS B 44  ? VAL B 51  ? LYS B 207 VAL B 214 
H 3 ALA B 36  ? ARG B 41  ? ALA B 199 ARG B 204 
H 4 ILE B 157 ? TRP B 159 ? ILE B 320 TRP B 322 
I 1 TYR B 79  ? ASP B 86  ? TYR B 242 ASP B 249 
I 2 LEU B 59  ? ILE B 73  ? LEU B 222 ILE B 236 
I 3 ARG B 97  ? ILE B 98  ? ARG B 260 ILE B 261 
J 1 TYR B 79  ? ASP B 86  ? TYR B 242 ASP B 249 
J 2 LEU B 59  ? ILE B 73  ? LEU B 222 ILE B 236 
J 3 GLU B 130 ? VAL B 139 ? GLU B 293 VAL B 302 
J 4 THR B 145 ? LEU B 153 ? THR B 308 LEU B 316 
K 1 HIS B 161 ? TYR B 163 ? HIS B 324 TYR B 326 
K 2 THR B 184 ? GLU B 186 ? THR B 347 GLU B 349 
L 1 VAL C 17  ? ILE C 20  ? VAL C 56  ILE C 59  
L 2 TYR C 174 ? ASP C 177 ? TYR C 337 ASP C 340 
L 3 LEU C 167 ? GLU C 169 ? LEU C 330 GLU C 332 
M 1 LEU C 30  ? PHE C 32  ? LEU C 193 PHE C 195 
M 2 LYS C 44  ? ASN C 53  ? LYS C 207 ASN C 216 
M 3 ILE C 104 ? GLU C 109 ? ILE C 267 GLU C 272 
N 1 LEU C 30  ? PHE C 32  ? LEU C 193 PHE C 195 
N 2 LYS C 44  ? ASN C 53  ? LYS C 207 ASN C 216 
N 3 ALA C 36  ? ARG C 41  ? ALA C 199 ARG C 204 
N 4 ILE C 157 ? TRP C 159 ? ILE C 320 TRP C 322 
O 1 TYR C 79  ? ILE C 87  ? TYR C 242 ILE C 250 
O 2 LEU C 59  ? ILE C 73  ? LEU C 222 ILE C 236 
O 3 GLU C 130 ? VAL C 139 ? GLU C 293 VAL C 302 
O 4 MET C 144 ? LEU C 153 ? MET C 307 LEU C 316 
P 1 HIS C 161 ? TYR C 163 ? HIS C 324 TYR C 326 
P 2 THR C 184 ? GLU C 186 ? THR C 347 GLU C 349 
Q 1 VAL D 17  ? ILE D 20  ? VAL D 56  ILE D 59  
Q 2 TYR D 174 ? ASP D 177 ? TYR D 337 ASP D 340 
Q 3 LEU D 167 ? GLU D 169 ? LEU D 330 GLU D 332 
R 1 LEU D 30  ? PHE D 32  ? LEU D 193 PHE D 195 
R 2 LYS D 44  ? ASN D 53  ? LYS D 207 ASN D 216 
R 3 ILE D 104 ? GLU D 109 ? ILE D 267 GLU D 272 
S 1 LEU D 30  ? PHE D 32  ? LEU D 193 PHE D 195 
S 2 LYS D 44  ? ASN D 53  ? LYS D 207 ASN D 216 
S 3 ALA D 36  ? ARG D 41  ? ALA D 199 ARG D 204 
S 4 ILE D 157 ? TRP D 159 ? ILE D 320 TRP D 322 
T 1 TYR D 79  ? ASP D 86  ? TYR D 242 ASP D 249 
T 2 LEU D 59  ? ILE D 73  ? LEU D 222 ILE D 236 
T 3 ARG D 97  ? ILE D 98  ? ARG D 260 ILE D 261 
U 1 TYR D 79  ? ASP D 86  ? TYR D 242 ASP D 249 
U 2 LEU D 59  ? ILE D 73  ? LEU D 222 ILE D 236 
U 3 GLU D 130 ? VAL D 139 ? GLU D 293 VAL D 302 
U 4 THR D 145 ? LEU D 153 ? THR D 308 LEU D 316 
V 1 HIS D 161 ? TYR D 163 ? HIS D 324 TYR D 326 
V 2 THR D 184 ? GLU D 186 ? THR D 347 GLU D 349 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 18  ? N GLN A 57  O VAL A 176 ? O VAL A 339 
A 2 3 O LYS A 175 ? O LYS A 338 N PHE A 168 ? N PHE A 331 
B 1 2 N VAL A 31  ? N VAL A 194 O GLY A 52  ? O GLY A 215 
B 2 3 N TRP A 49  ? N TRP A 212 O ILE A 106 ? O ILE A 269 
C 1 2 N VAL A 31  ? N VAL A 194 O GLY A 52  ? O GLY A 215 
C 2 3 O MET A 48  ? O MET A 211 N VAL A 37  ? N VAL A 200 
C 3 4 N ALA A 36  ? N ALA A 199 O LEU A 158 ? O LEU A 321 
D 1 2 O ASP A 83  ? O ASP A 246 N LYS A 70  ? N LYS A 233 
D 2 3 N ALA A 62  ? N ALA A 225 O ILE A 98  ? O ILE A 261 
E 1 2 O ASP A 83  ? O ASP A 246 N LYS A 70  ? N LYS A 233 
E 2 3 N VAL A 60  ? N VAL A 223 O MET A 138 ? O MET A 301 
E 3 4 N LEU A 135 ? N LEU A 298 O CYS A 148 ? O CYS A 311 
F 1 2 N ARG A 162 ? N ARG A 325 O TYR A 185 ? O TYR A 348 
G 1 2 N GLN B 18  ? N GLN B 57  O TYR B 174 ? O TYR B 337 
G 2 3 O LYS B 175 ? O LYS B 338 N PHE B 168 ? N PHE B 331 
H 1 2 O HIS B 108 ? O HIS B 271 N LEU B 47  ? N LEU B 210 
H 2 3 O CYS B 46  ? O CYS B 209 N ALA B 39  ? N ALA B 202 
H 3 4 N ALA B 36  ? N ALA B 199 O LEU B 158 ? O LEU B 321 
I 1 2 O ASP B 83  ? O ASP B 246 N LYS B 70  ? N LYS B 233 
I 2 3 N ALA B 62  ? N ALA B 225 O ILE B 98  ? O ILE B 261 
J 1 2 O ASP B 83  ? O ASP B 246 N LYS B 70  ? N LYS B 233 
J 2 3 N LEU B 69  ? N LEU B 232 O GLU B 130 ? O GLU B 293 
J 3 4 N LEU B 135 ? N LEU B 298 O CYS B 148 ? O CYS B 311 
K 1 2 N ARG B 162 ? N ARG B 325 O TYR B 185 ? O TYR B 348 
L 1 2 N ILE C 20  ? N ILE C 59  O VAL C 176 ? O VAL C 339 
L 2 3 O LYS C 175 ? O LYS C 338 N PHE C 168 ? N PHE C 331 
M 1 2 N VAL C 31  ? N VAL C 194 O GLY C 52  ? O GLY C 215 
M 2 3 N LEU C 47  ? N LEU C 210 O HIS C 108 ? O HIS C 271 
N 1 2 N VAL C 31  ? N VAL C 194 O GLY C 52  ? O GLY C 215 
N 2 3 O CYS C 46  ? O CYS C 209 N ALA C 39  ? N ALA C 202 
N 3 4 N ALA C 36  ? N ALA C 199 O LEU C 158 ? O LEU C 321 
O 1 2 O ASP C 83  ? O ASP C 246 N LYS C 70  ? N LYS C 233 
O 2 3 N LEU C 69  ? N LEU C 232 O GLU C 130 ? O GLU C 293 
O 3 4 N GLY C 137 ? N GLY C 300 O LYS C 146 ? O LYS C 309 
P 1 2 N ARG C 162 ? N ARG C 325 O TYR C 185 ? O TYR C 348 
Q 1 2 N GLN D 18  ? N GLN D 57  O VAL D 176 ? O VAL D 339 
Q 2 3 O LYS D 175 ? O LYS D 338 N PHE D 168 ? N PHE D 331 
R 1 2 N VAL D 31  ? N VAL D 194 O GLY D 52  ? O GLY D 215 
R 2 3 N TRP D 49  ? N TRP D 212 O ILE D 106 ? O ILE D 269 
S 1 2 N VAL D 31  ? N VAL D 194 O GLY D 52  ? O GLY D 215 
S 2 3 O MET D 48  ? O MET D 211 N VAL D 37  ? N VAL D 200 
S 3 4 N ALA D 36  ? N ALA D 199 O LEU D 158 ? O LEU D 321 
T 1 2 O ASP D 83  ? O ASP D 246 N LYS D 70  ? N LYS D 233 
T 2 3 N ALA D 62  ? N ALA D 225 O ILE D 98  ? O ILE D 261 
U 1 2 O ASP D 83  ? O ASP D 246 N LYS D 70  ? N LYS D 233 
U 2 3 N VAL D 60  ? N VAL D 223 O MET D 138 ? O MET D 301 
U 3 4 N LEU D 135 ? N LEU D 298 O CYS D 148 ? O CYS D 311 
V 1 2 N ARG D 162 ? N ARG D 325 O TYR D 185 ? O TYR D 348 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A K   800 ? 8 'BINDING SITE FOR RESIDUE K A 800'   
AC2 Software D MPD 801 ? 6 'BINDING SITE FOR RESIDUE MPD D 801' 
AC3 Software B MPD 802 ? 6 'BINDING SITE FOR RESIDUE MPD B 802' 
AC4 Software A MPD 803 ? 7 'BINDING SITE FOR RESIDUE MPD A 803' 
AC5 Software C MPD 804 ? 7 'BINDING SITE FOR RESIDUE MPD C 804' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 HOH J .   ? HOH A 820 . ? 1_555 ? 
2  AC1 8 HOH J .   ? HOH A 823 . ? 1_555 ? 
3  AC1 8 HOH J .   ? HOH A 942 . ? 1_555 ? 
4  AC1 8 HOH K .   ? HOH B 825 . ? 1_555 ? 
5  AC1 8 HOH K .   ? HOH B 903 . ? 1_555 ? 
6  AC1 8 HOH L .   ? HOH C 832 . ? 1_555 ? 
7  AC1 8 HOH L .   ? HOH C 901 . ? 1_555 ? 
8  AC1 8 HOH M .   ? HOH D 871 . ? 1_555 ? 
9  AC2 6 SER C 71  ? SER C 234 . ? 1_555 ? 
10 AC2 6 PRO C 81  ? PRO C 244 . ? 1_555 ? 
11 AC2 6 HIS D 3   ? HIS D 42  . ? 1_555 ? 
12 AC2 6 GLY D 4   ? GLY D 43  . ? 1_555 ? 
13 AC2 6 TYR D 174 ? TYR D 337 . ? 1_555 ? 
14 AC2 6 HOH M .   ? HOH D 849 . ? 1_555 ? 
15 AC3 6 SER A 71  ? SER A 234 . ? 1_555 ? 
16 AC3 6 PRO A 81  ? PRO A 244 . ? 1_555 ? 
17 AC3 6 HOH J .   ? HOH A 882 . ? 1_555 ? 
18 AC3 6 HIS B 3   ? HIS B 42  . ? 1_555 ? 
19 AC3 6 GLY B 4   ? GLY B 43  . ? 1_555 ? 
20 AC3 6 TYR B 174 ? TYR B 337 . ? 1_555 ? 
21 AC4 7 HIS A 3   ? HIS A 42  . ? 1_555 ? 
22 AC4 7 GLY A 4   ? GLY A 43  . ? 1_555 ? 
23 AC4 7 TYR A 174 ? TYR A 337 . ? 1_555 ? 
24 AC4 7 HOH J .   ? HOH A 891 . ? 1_555 ? 
25 AC4 7 LYS D 70  ? LYS D 233 . ? 1_555 ? 
26 AC4 7 SER D 71  ? SER D 234 . ? 1_555 ? 
27 AC4 7 PRO D 81  ? PRO D 244 . ? 1_555 ? 
28 AC5 7 SER B 71  ? SER B 234 . ? 1_555 ? 
29 AC5 7 PRO B 81  ? PRO B 244 . ? 1_555 ? 
30 AC5 7 HOH K .   ? HOH B 930 . ? 1_555 ? 
31 AC5 7 HIS C 3   ? HIS C 42  . ? 1_555 ? 
32 AC5 7 GLY C 4   ? GLY C 43  . ? 1_555 ? 
33 AC5 7 PHE C 8   ? PHE C 47  . ? 1_555 ? 
34 AC5 7 TYR C 174 ? TYR C 337 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2GIX 
_atom_sites.fract_transf_matrix[1][1]   0.00711 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00611 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.01011 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.01344 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 2   ? 30.081  -46.684 4.044   1.00 45.24 ? 41  SER A N   1 
ATOM   2    C CA  . SER A 1 2   ? 30.033  -46.524 5.528   1.00 45.29 ? 41  SER A CA  1 
ATOM   3    C C   . SER A 1 2   ? 31.396  -46.606 6.304   1.00 44.35 ? 41  SER A C   1 
ATOM   4    O O   . SER A 1 2   ? 31.973  -45.556 6.522   1.00 44.30 ? 41  SER A O   1 
ATOM   5    C CB  . SER A 1 2   ? 28.893  -47.349 6.166   1.00 46.02 ? 41  SER A CB  1 
ATOM   6    O OG  . SER A 1 2   ? 28.648  -46.974 7.532   1.00 46.32 ? 41  SER A OG  1 
ATOM   7    N N   . HIS A 1 3   ? 31.919  -47.770 6.729   1.00 42.76 ? 42  HIS A N   1 
ATOM   8    C CA  . HIS A 1 3   ? 32.854  -47.727 7.931   1.00 41.58 ? 42  HIS A CA  1 
ATOM   9    C C   . HIS A 1 3   ? 34.114  -48.610 7.968   1.00 41.41 ? 42  HIS A C   1 
ATOM   10   O O   . HIS A 1 3   ? 34.111  -49.732 7.463   1.00 41.15 ? 42  HIS A O   1 
ATOM   11   C CB  . HIS A 1 3   ? 32.046  -47.946 9.244   1.00 41.05 ? 42  HIS A CB  1 
ATOM   12   C CG  . HIS A 1 3   ? 32.662  -47.357 10.494  1.00 38.92 ? 42  HIS A CG  1 
ATOM   13   N ND1 . HIS A 1 3   ? 32.139  -46.242 11.126  1.00 38.18 ? 42  HIS A ND1 1 
ATOM   14   C CD2 . HIS A 1 3   ? 33.692  -47.778 11.279  1.00 35.57 ? 42  HIS A CD2 1 
ATOM   15   C CE1 . HIS A 1 3   ? 32.852  -45.977 12.215  1.00 33.93 ? 42  HIS A CE1 1 
ATOM   16   N NE2 . HIS A 1 3   ? 33.781  -46.906 12.344  1.00 32.64 ? 42  HIS A NE2 1 
ATOM   17   N N   . GLY A 1 4   ? 35.178  -48.078 8.585   1.00 40.81 ? 43  GLY A N   1 
ATOM   18   C CA  . GLY A 1 4   ? 36.445  -48.785 8.819   1.00 41.04 ? 43  GLY A CA  1 
ATOM   19   C C   . GLY A 1 4   ? 36.304  -49.905 9.856   1.00 40.63 ? 43  GLY A C   1 
ATOM   20   O O   . GLY A 1 4   ? 35.254  -50.037 10.497  1.00 40.68 ? 43  GLY A O   1 
ATOM   21   N N   . ARG A 1 5   ? 37.338  -50.739 9.984   1.00 40.12 ? 44  ARG A N   1 
ATOM   22   C CA  . ARG A 1 5   ? 37.297  -51.921 10.882  1.00 39.51 ? 44  ARG A CA  1 
ATOM   23   C C   . ARG A 1 5   ? 37.196  -51.469 12.344  1.00 37.78 ? 44  ARG A C   1 
ATOM   24   O O   . ARG A 1 5   ? 36.464  -52.025 13.160  1.00 38.14 ? 44  ARG A O   1 
ATOM   25   C CB  . ARG A 1 5   ? 38.563  -52.758 10.690  1.00 40.51 ? 44  ARG A CB  1 
ATOM   26   C CG  . ARG A 1 5   ? 38.651  -54.035 11.526  1.00 44.90 ? 44  ARG A CG  1 
ATOM   27   C CD  . ARG A 1 5   ? 40.107  -54.197 11.972  1.00 51.90 ? 44  ARG A CD  1 
ATOM   28   N NE  . ARG A 1 5   ? 40.508  -55.570 12.279  1.00 57.32 ? 44  ARG A NE  1 
ATOM   29   C CZ  . ARG A 1 5   ? 41.728  -56.065 12.031  1.00 60.87 ? 44  ARG A CZ  1 
ATOM   30   N NH1 . ARG A 1 5   ? 42.660  -55.306 11.459  1.00 61.91 ? 44  ARG A NH1 1 
ATOM   31   N NH2 . ARG A 1 5   ? 42.025  -57.326 12.339  1.00 61.55 ? 44  ARG A NH2 1 
ATOM   32   N N   . SER A 1 6   ? 37.942  -50.430 12.657  1.00 35.22 ? 45  SER A N   1 
ATOM   33   C CA  . SER A 1 6   ? 38.082  -49.979 14.017  1.00 33.14 ? 45  SER A CA  1 
ATOM   34   C C   . SER A 1 6   ? 37.030  -48.900 14.297  1.00 30.20 ? 45  SER A C   1 
ATOM   35   O O   . SER A 1 6   ? 36.670  -48.106 13.411  1.00 30.19 ? 45  SER A O   1 
ATOM   36   C CB  . SER A 1 6   ? 39.481  -49.428 14.143  1.00 33.63 ? 45  SER A CB  1 
ATOM   37   O OG  . SER A 1 6   ? 39.720  -48.939 15.442  1.00 40.25 ? 45  SER A OG  1 
ATOM   38   N N   . ARG A 1 7   ? 36.505  -48.878 15.505  1.00 26.76 ? 46  ARG A N   1 
ATOM   39   C CA  . ARG A 1 7   ? 35.681  -47.734 15.903  1.00 24.06 ? 46  ARG A CA  1 
ATOM   40   C C   . ARG A 1 7   ? 36.477  -46.426 15.953  1.00 22.93 ? 46  ARG A C   1 
ATOM   41   O O   . ARG A 1 7   ? 37.663  -46.416 16.254  1.00 22.66 ? 46  ARG A O   1 
ATOM   42   C CB  . ARG A 1 7   ? 34.968  -47.994 17.225  1.00 23.18 ? 46  ARG A CB  1 
ATOM   43   C CG  . ARG A 1 7   ? 35.872  -48.172 18.461  1.00 22.24 ? 46  ARG A CG  1 
ATOM   44   C CD  . ARG A 1 7   ? 35.074  -48.842 19.613  1.00 21.06 ? 46  ARG A CD  1 
ATOM   45   N NE  . ARG A 1 7   ? 33.777  -48.160 19.861  1.00 20.85 ? 46  ARG A NE  1 
ATOM   46   C CZ  . ARG A 1 7   ? 32.639  -48.784 20.120  1.00 21.55 ? 46  ARG A CZ  1 
ATOM   47   N NH1 . ARG A 1 7   ? 32.630  -50.098 20.177  1.00 19.67 ? 46  ARG A NH1 1 
ATOM   48   N NH2 . ARG A 1 7   ? 31.509  -48.112 20.329  1.00 20.27 ? 46  ARG A NH2 1 
ATOM   49   N N   . PHE A 1 8   ? 35.794  -45.313 15.713  1.00 21.76 ? 47  PHE A N   1 
ATOM   50   C CA  . PHE A 1 8   ? 36.434  -44.036 15.740  1.00 21.37 ? 47  PHE A CA  1 
ATOM   51   C C   . PHE A 1 8   ? 36.547  -43.523 17.166  1.00 20.68 ? 47  PHE A C   1 
ATOM   52   O O   . PHE A 1 8   ? 37.569  -42.915 17.550  1.00 20.62 ? 47  PHE A O   1 
ATOM   53   C CB  . PHE A 1 8   ? 35.635  -43.072 14.878  1.00 21.27 ? 47  PHE A CB  1 
ATOM   54   C CG  . PHE A 1 8   ? 36.384  -41.862 14.507  1.00 24.74 ? 47  PHE A CG  1 
ATOM   55   C CD1 . PHE A 1 8   ? 37.510  -41.953 13.667  1.00 23.15 ? 47  PHE A CD1 1 
ATOM   56   C CD2 . PHE A 1 8   ? 35.972  -40.608 14.979  1.00 26.57 ? 47  PHE A CD2 1 
ATOM   57   C CE1 . PHE A 1 8   ? 38.205  -40.812 13.315  1.00 25.28 ? 47  PHE A CE1 1 
ATOM   58   C CE2 . PHE A 1 8   ? 36.674  -39.440 14.617  1.00 27.13 ? 47  PHE A CE2 1 
ATOM   59   C CZ  . PHE A 1 8   ? 37.786  -39.538 13.808  1.00 26.00 ? 47  PHE A CZ  1 
ATOM   60   N N   . VAL A 1 9   ? 35.497  -43.771 17.960  1.00 19.96 ? 48  VAL A N   1 
ATOM   61   C CA  . VAL A 1 9   ? 35.430  -43.289 19.340  1.00 19.27 ? 48  VAL A CA  1 
ATOM   62   C C   . VAL A 1 9   ? 35.220  -44.537 20.219  1.00 19.34 ? 48  VAL A C   1 
ATOM   63   O O   . VAL A 1 9   ? 34.281  -45.299 20.005  1.00 17.33 ? 48  VAL A O   1 
ATOM   64   C CB  . VAL A 1 9   ? 34.257  -42.248 19.566  1.00 19.69 ? 48  VAL A CB  1 
ATOM   65   C CG1 . VAL A 1 9   ? 34.137  -41.880 21.053  1.00 18.24 ? 48  VAL A CG1 1 
ATOM   66   C CG2 . VAL A 1 9   ? 34.400  -40.968 18.682  1.00 17.51 ? 48  VAL A CG2 1 
ATOM   67   N N   . LYS A 1 10  ? 36.121  -44.769 21.157  1.00 19.76 ? 49  LYS A N   1 
ATOM   68   C CA  . LYS A 1 10  ? 35.947  -45.863 22.117  1.00 22.85 ? 49  LYS A CA  1 
ATOM   69   C C   . LYS A 1 10  ? 34.881  -45.527 23.166  1.00 23.62 ? 49  LYS A C   1 
ATOM   70   O O   . LYS A 1 10  ? 34.564  -44.344 23.358  1.00 22.18 ? 49  LYS A O   1 
ATOM   71   C CB  . LYS A 1 10  ? 37.278  -46.196 22.797  1.00 23.62 ? 49  LYS A CB  1 
ATOM   72   C CG  . LYS A 1 10  ? 38.435  -46.328 21.758  1.00 28.32 ? 49  LYS A CG  1 
ATOM   73   C CD  . LYS A 1 10  ? 39.283  -47.547 21.975  1.00 35.12 ? 49  LYS A CD  1 
ATOM   74   C CE  . LYS A 1 10  ? 39.934  -47.558 23.341  1.00 35.78 ? 49  LYS A CE  1 
ATOM   75   N NZ  . LYS A 1 10  ? 41.263  -46.871 23.270  1.00 42.60 ? 49  LYS A NZ  1 
ATOM   76   N N   . LYS A 1 11  ? 34.356  -46.574 23.840  1.00 24.65 ? 50  LYS A N   1 
ATOM   77   C CA  . LYS A 1 11  ? 33.276  -46.434 24.836  1.00 26.47 ? 50  LYS A CA  1 
ATOM   78   C C   . LYS A 1 11  ? 33.614  -45.473 25.940  1.00 27.14 ? 50  LYS A C   1 
ATOM   79   O O   . LYS A 1 11  ? 32.712  -44.813 26.509  1.00 28.66 ? 50  LYS A O   1 
ATOM   80   C CB  . LYS A 1 11  ? 32.874  -47.801 25.434  1.00 25.41 ? 50  LYS A CB  1 
ATOM   81   C CG  . LYS A 1 11  ? 32.146  -48.700 24.454  1.00 29.33 ? 50  LYS A CG  1 
ATOM   82   C CD  . LYS A 1 11  ? 30.692  -48.325 24.422  1.00 29.53 ? 50  LYS A CD  1 
ATOM   83   C CE  . LYS A 1 11  ? 29.907  -49.217 23.530  1.00 27.63 ? 50  LYS A CE  1 
ATOM   84   N NZ  . LYS A 1 11  ? 28.676  -48.452 23.178  1.00 22.74 ? 50  LYS A NZ  1 
ATOM   85   N N   . ASP A 1 12  ? 34.903  -45.397 26.253  1.00 27.61 ? 51  ASP A N   1 
ATOM   86   C CA  . ASP A 1 12  ? 35.413  -44.493 27.270  1.00 27.21 ? 51  ASP A CA  1 
ATOM   87   C C   . ASP A 1 12  ? 35.677  -43.085 26.742  1.00 26.31 ? 51  ASP A C   1 
ATOM   88   O O   . ASP A 1 12  ? 36.305  -42.296 27.450  1.00 27.00 ? 51  ASP A O   1 
ATOM   89   C CB  . ASP A 1 12  ? 36.696  -45.073 27.914  1.00 26.78 ? 51  ASP A CB  1 
ATOM   90   C CG  . ASP A 1 12  ? 37.964  -44.965 27.019  1.00 30.65 ? 51  ASP A CG  1 
ATOM   91   O OD1 . ASP A 1 12  ? 37.957  -44.410 25.902  1.00 30.42 ? 51  ASP A OD1 1 
ATOM   92   O OD2 . ASP A 1 12  ? 39.029  -45.457 27.446  1.00 36.78 ? 51  ASP A OD2 1 
ATOM   93   N N   . GLY A 1 13  ? 35.260  -42.788 25.499  1.00 25.15 ? 52  GLY A N   1 
ATOM   94   C CA  . GLY A 1 13  ? 35.428  -41.438 24.917  1.00 21.71 ? 52  GLY A CA  1 
ATOM   95   C C   . GLY A 1 13  ? 36.778  -41.131 24.283  1.00 21.79 ? 52  GLY A C   1 
ATOM   96   O O   . GLY A 1 13  ? 36.931  -40.100 23.619  1.00 19.49 ? 52  GLY A O   1 
ATOM   97   N N   . HIS A 1 14  ? 37.763  -42.004 24.487  1.00 21.12 ? 53  HIS A N   1 
ATOM   98   C CA  . HIS A 1 14  ? 39.035  -41.948 23.744  1.00 22.11 ? 53  HIS A CA  1 
ATOM   99   C C   . HIS A 1 14  ? 38.803  -42.044 22.227  1.00 22.39 ? 53  HIS A C   1 
ATOM   100  O O   . HIS A 1 14  ? 38.134  -42.948 21.745  1.00 21.37 ? 53  HIS A O   1 
ATOM   101  C CB  . HIS A 1 14  ? 40.002  -43.049 24.192  1.00 23.12 ? 53  HIS A CB  1 
ATOM   102  C CG  . HIS A 1 14  ? 41.319  -43.027 23.462  1.00 28.33 ? 53  HIS A CG  1 
ATOM   103  N ND1 . HIS A 1 14  ? 42.318  -42.119 23.752  1.00 28.71 ? 53  HIS A ND1 1 
ATOM   104  C CD2 . HIS A 1 14  ? 41.788  -43.783 22.434  1.00 30.85 ? 53  HIS A CD2 1 
ATOM   105  C CE1 . HIS A 1 14  ? 43.338  -42.305 22.929  1.00 31.34 ? 53  HIS A CE1 1 
ATOM   106  N NE2 . HIS A 1 14  ? 43.046  -43.312 22.124  1.00 31.77 ? 53  HIS A NE2 1 
ATOM   107  N N   . CYS A 1 15  ? 39.329  -41.089 21.477  1.00 22.81 ? 54  CYS A N   1 
ATOM   108  C CA  . CYS A 1 15  ? 39.297  -41.205 20.040  1.00 24.29 ? 54  CYS A CA  1 
ATOM   109  C C   . CYS A 1 15  ? 40.499  -41.991 19.534  1.00 24.57 ? 54  CYS A C   1 
ATOM   110  O O   . CYS A 1 15  ? 41.665  -41.656 19.816  1.00 26.47 ? 54  CYS A O   1 
ATOM   111  C CB  . CYS A 1 15  ? 39.222  -39.843 19.372  1.00 24.49 ? 54  CYS A CB  1 
ATOM   112  S SG  . CYS A 1 15  ? 37.743  -38.886 19.886  1.00 27.22 ? 54  CYS A SG  1 
ATOM   113  N N   . ASN A 1 16  ? 40.182  -42.982 18.733  1.00 25.40 ? 55  ASN A N   1 
ATOM   114  C CA  . ASN A 1 16  ? 41.094  -43.984 18.186  1.00 26.07 ? 55  ASN A CA  1 
ATOM   115  C C   . ASN A 1 16  ? 41.887  -43.452 16.968  1.00 25.48 ? 55  ASN A C   1 
ATOM   116  O O   . ASN A 1 16  ? 41.860  -44.019 15.886  1.00 24.44 ? 55  ASN A O   1 
ATOM   117  C CB  . ASN A 1 16  ? 40.202  -45.168 17.805  1.00 27.82 ? 55  ASN A CB  1 
ATOM   118  C CG  . ASN A 1 16  ? 40.943  -46.468 17.690  1.00 32.11 ? 55  ASN A CG  1 
ATOM   119  O OD1 . ASN A 1 16  ? 42.023  -46.623 18.245  1.00 38.07 ? 55  ASN A OD1 1 
ATOM   120  N ND2 . ASN A 1 16  ? 40.347  -47.438 16.971  1.00 31.37 ? 55  ASN A ND2 1 
ATOM   121  N N   . VAL A 1 17  ? 42.595  -42.344 17.165  1.00 25.84 ? 56  VAL A N   1 
ATOM   122  C CA  . VAL A 1 17  ? 43.250  -41.629 16.087  1.00 26.33 ? 56  VAL A CA  1 
ATOM   123  C C   . VAL A 1 17  ? 44.702  -41.365 16.485  1.00 28.33 ? 56  VAL A C   1 
ATOM   124  O O   . VAL A 1 17  ? 45.019  -41.046 17.667  1.00 27.15 ? 56  VAL A O   1 
ATOM   125  C CB  . VAL A 1 17  ? 42.526  -40.307 15.741  1.00 27.15 ? 56  VAL A CB  1 
ATOM   126  C CG1 . VAL A 1 17  ? 43.177  -39.688 14.571  1.00 28.77 ? 56  VAL A CG1 1 
ATOM   127  C CG2 . VAL A 1 17  ? 41.070  -40.537 15.336  1.00 26.61 ? 56  VAL A CG2 1 
ATOM   128  N N   . GLN A 1 18  ? 45.608  -41.526 15.528  1.00 27.93 ? 57  GLN A N   1 
ATOM   129  C CA  . GLN A 1 18  ? 46.976  -41.137 15.795  1.00 28.70 ? 57  GLN A CA  1 
ATOM   130  C C   . GLN A 1 18  ? 47.379  -40.114 14.748  1.00 27.49 ? 57  GLN A C   1 
ATOM   131  O O   . GLN A 1 18  ? 47.073  -40.271 13.577  1.00 27.06 ? 57  GLN A O   1 
ATOM   132  C CB  . GLN A 1 18  ? 47.847  -42.392 15.790  1.00 29.24 ? 57  GLN A CB  1 
ATOM   133  C CG  . GLN A 1 18  ? 49.317  -42.111 15.671  1.00 35.90 ? 57  GLN A CG  1 
ATOM   134  C CD  . GLN A 1 18  ? 50.118  -43.320 15.216  1.00 42.42 ? 57  GLN A CD  1 
ATOM   135  O OE1 . GLN A 1 18  ? 51.099  -43.185 14.472  1.00 44.40 ? 57  GLN A OE1 1 
ATOM   136  N NE2 . GLN A 1 18  ? 49.699  -44.518 15.665  1.00 43.44 ? 57  GLN A NE2 1 
ATOM   137  N N   . PHE A 1 19  ? 48.002  -39.032 15.181  1.00 28.29 ? 58  PHE A N   1 
ATOM   138  C CA  . PHE A 1 19  ? 48.429  -37.944 14.302  1.00 28.60 ? 58  PHE A CA  1 
ATOM   139  C C   . PHE A 1 19  ? 49.861  -38.150 13.887  1.00 28.46 ? 58  PHE A C   1 
ATOM   140  O O   . PHE A 1 19  ? 50.691  -38.440 14.713  1.00 28.83 ? 58  PHE A O   1 
ATOM   141  C CB  . PHE A 1 19  ? 48.276  -36.612 15.033  1.00 29.41 ? 58  PHE A CB  1 
ATOM   142  C CG  . PHE A 1 19  ? 46.852  -36.283 15.348  1.00 32.80 ? 58  PHE A CG  1 
ATOM   143  C CD1 . PHE A 1 19  ? 46.235  -36.799 16.472  1.00 39.09 ? 58  PHE A CD1 1 
ATOM   144  C CD2 . PHE A 1 19  ? 46.113  -35.486 14.502  1.00 37.49 ? 58  PHE A CD2 1 
ATOM   145  C CE1 . PHE A 1 19  ? 44.893  -36.502 16.751  1.00 40.95 ? 58  PHE A CE1 1 
ATOM   146  C CE2 . PHE A 1 19  ? 44.766  -35.180 14.783  1.00 39.19 ? 58  PHE A CE2 1 
ATOM   147  C CZ  . PHE A 1 19  ? 44.170  -35.681 15.896  1.00 38.19 ? 58  PHE A CZ  1 
ATOM   148  N N   . ILE A 1 20  ? 50.155  -38.033 12.597  1.00 28.53 ? 59  ILE A N   1 
ATOM   149  C CA  . ILE A 1 20  ? 51.546  -38.149 12.139  1.00 28.20 ? 59  ILE A CA  1 
ATOM   150  C C   . ILE A 1 20  ? 51.939  -36.912 11.325  1.00 29.04 ? 59  ILE A C   1 
ATOM   151  O O   . ILE A 1 20  ? 51.076  -36.222 10.781  1.00 27.82 ? 59  ILE A O   1 
ATOM   152  C CB  . ILE A 1 20  ? 51.814  -39.489 11.372  1.00 27.82 ? 59  ILE A CB  1 
ATOM   153  C CG1 . ILE A 1 20  ? 51.048  -39.543 10.042  1.00 24.87 ? 59  ILE A CG1 1 
ATOM   154  C CG2 . ILE A 1 20  ? 51.507  -40.723 12.307  1.00 27.85 ? 59  ILE A CG2 1 
ATOM   155  C CD1 . ILE A 1 20  ? 51.538  -40.627 9.039   1.00 25.82 ? 59  ILE A CD1 1 
ATOM   156  N N   . ASN A 1 21  ? 53.236  -36.625 11.273  1.00 30.31 ? 60  ASN A N   1 
ATOM   157  C CA  . ASN A 1 21  ? 53.775  -35.523 10.472  1.00 32.03 ? 60  ASN A CA  1 
ATOM   158  C C   . ASN A 1 21  ? 53.239  -34.156 10.871  1.00 33.85 ? 60  ASN A C   1 
ATOM   159  O O   . ASN A 1 21  ? 53.022  -33.321 10.017  1.00 33.55 ? 60  ASN A O   1 
ATOM   160  C CB  . ASN A 1 21  ? 53.504  -35.744 8.990   1.00 31.46 ? 60  ASN A CB  1 
ATOM   161  C CG  . ASN A 1 21  ? 54.168  -36.997 8.445   1.00 32.23 ? 60  ASN A CG  1 
ATOM   162  O OD1 . ASN A 1 21  ? 55.278  -37.320 8.828   1.00 34.15 ? 60  ASN A OD1 1 
ATOM   163  N ND2 . ASN A 1 21  ? 53.482  -37.705 7.553   1.00 26.62 ? 60  ASN A ND2 1 
ATOM   164  N N   . VAL A 1 22  ? 52.997  -33.958 12.166  1.00 37.08 ? 61  VAL A N   1 
ATOM   165  C CA  . VAL A 1 22  ? 52.526  -32.690 12.709  1.00 40.95 ? 61  VAL A CA  1 
ATOM   166  C C   . VAL A 1 22  ? 53.791  -31.842 12.882  1.00 44.66 ? 61  VAL A C   1 
ATOM   167  O O   . VAL A 1 22  ? 54.691  -32.205 13.662  1.00 45.77 ? 61  VAL A O   1 
ATOM   168  C CB  . VAL A 1 22  ? 51.726  -32.889 14.026  1.00 39.98 ? 61  VAL A CB  1 
ATOM   169  C CG1 . VAL A 1 22  ? 50.551  -33.803 13.778  1.00 39.74 ? 61  VAL A CG1 1 
ATOM   170  C CG2 . VAL A 1 22  ? 52.556  -33.513 15.111  1.00 40.56 ? 61  VAL A CG2 1 
ATOM   171  N N   . GLY A 1 23  ? 53.919  -30.778 12.094  1.00 47.99 ? 62  GLY A N   1 
ATOM   172  C CA  . GLY A 1 23  ? 55.206  -30.053 12.015  1.00 52.46 ? 62  GLY A CA  1 
ATOM   173  C C   . GLY A 1 23  ? 56.028  -30.326 13.268  1.00 54.94 ? 62  GLY A C   1 
ATOM   174  O O   . GLY A 1 23  ? 57.019  -31.050 13.212  1.00 56.32 ? 62  GLY A O   1 
ATOM   175  N N   . GLU A 1 24  ? 55.575  -29.743 14.387  1.00 57.25 ? 63  GLU A N   1 
ATOM   176  C CA  . GLU A 1 24  ? 55.965  -30.060 15.774  1.00 59.08 ? 63  GLU A CA  1 
ATOM   177  C C   . GLU A 1 24  ? 56.022  -28.774 16.606  1.00 60.15 ? 63  GLU A C   1 
ATOM   178  O O   . GLU A 1 24  ? 56.427  -27.727 16.093  1.00 60.66 ? 63  GLU A O   1 
ATOM   179  C CB  . GLU A 1 24  ? 57.301  -30.818 15.852  1.00 59.47 ? 63  GLU A CB  1 
ATOM   180  N N   . LYS A 1 25  ? 55.603  -28.868 17.874  1.00 61.07 ? 64  LYS A N   1 
ATOM   181  C CA  . LYS A 1 25  ? 55.768  -27.793 18.874  1.00 61.84 ? 64  LYS A CA  1 
ATOM   182  C C   . LYS A 1 25  ? 55.429  -26.389 18.355  1.00 62.26 ? 64  LYS A C   1 
ATOM   183  O O   . LYS A 1 25  ? 56.314  -25.613 17.952  1.00 62.76 ? 64  LYS A O   1 
ATOM   184  C CB  . LYS A 1 25  ? 57.190  -27.831 19.467  1.00 62.09 ? 64  LYS A CB  1 
ATOM   185  N N   . ARG A 1 26  ? 54.142  -26.065 18.372  1.00 62.33 ? 189 ARG A N   1 
ATOM   186  C CA  . ARG A 1 26  ? 53.669  -24.806 17.803  1.00 62.13 ? 189 ARG A CA  1 
ATOM   187  C C   . ARG A 1 26  ? 53.037  -23.892 18.853  1.00 61.92 ? 189 ARG A C   1 
ATOM   188  O O   . ARG A 1 26  ? 52.627  -24.342 19.942  1.00 62.73 ? 189 ARG A O   1 
ATOM   189  C CB  . ARG A 1 26  ? 52.670  -25.074 16.643  1.00 62.05 ? 189 ARG A CB  1 
ATOM   190  N N   . ASN A 1 27  ? 53.004  -22.600 18.538  1.00 60.68 ? 190 ASN A N   1 
ATOM   191  C CA  . ASN A 1 27  ? 52.078  -21.693 19.179  1.00 59.23 ? 190 ASN A CA  1 
ATOM   192  C C   . ASN A 1 27  ? 50.853  -21.794 18.284  1.00 58.08 ? 190 ASN A C   1 
ATOM   193  O O   . ASN A 1 27  ? 50.989  -21.837 17.045  1.00 59.13 ? 190 ASN A O   1 
ATOM   194  C CB  . ASN A 1 27  ? 52.630  -20.279 19.188  1.00 59.50 ? 190 ASN A CB  1 
ATOM   195  N N   . GLU A 1 28  ? 49.665  -21.834 18.883  1.00 55.55 ? 191 GLU A N   1 
ATOM   196  C CA  . GLU A 1 28  ? 48.410  -22.095 18.138  1.00 52.72 ? 191 GLU A CA  1 
ATOM   197  C C   . GLU A 1 28  ? 48.359  -23.547 17.632  1.00 49.52 ? 191 GLU A C   1 
ATOM   198  O O   . GLU A 1 28  ? 49.063  -23.935 16.694  1.00 50.09 ? 191 GLU A O   1 
ATOM   199  C CB  . GLU A 1 28  ? 48.156  -21.108 16.968  1.00 53.37 ? 191 GLU A CB  1 
ATOM   200  C CG  . GLU A 1 28  ? 48.428  -19.612 17.232  1.00 56.01 ? 191 GLU A CG  1 
ATOM   201  C CD  . GLU A 1 28  ? 49.638  -19.058 16.444  1.00 60.04 ? 191 GLU A CD  1 
ATOM   202  O OE1 . GLU A 1 28  ? 49.758  -19.350 15.229  1.00 61.47 ? 191 GLU A OE1 1 
ATOM   203  O OE2 . GLU A 1 28  ? 50.461  -18.310 17.036  1.00 60.86 ? 191 GLU A OE2 1 
ATOM   204  N N   . THR A 1 29  ? 47.522  -24.344 18.274  1.00 45.04 ? 192 THR A N   1 
ATOM   205  C CA  . THR A 1 29  ? 47.354  -25.726 17.920  1.00 40.33 ? 192 THR A CA  1 
ATOM   206  C C   . THR A 1 29  ? 46.073  -25.931 17.099  1.00 36.06 ? 192 THR A C   1 
ATOM   207  O O   . THR A 1 29  ? 45.922  -26.966 16.465  1.00 35.31 ? 192 THR A O   1 
ATOM   208  C CB  . THR A 1 29  ? 47.361  -26.588 19.176  1.00 42.03 ? 192 THR A CB  1 
ATOM   209  O OG1 . THR A 1 29  ? 46.664  -25.877 20.209  1.00 44.23 ? 192 THR A OG1 1 
ATOM   210  C CG2 . THR A 1 29  ? 48.824  -26.872 19.644  1.00 41.78 ? 192 THR A CG2 1 
ATOM   211  N N   . LEU A 1 30  ? 45.174  -24.943 17.066  1.00 30.49 ? 193 LEU A N   1 
ATOM   212  C CA  . LEU A 1 30  ? 44.122  -24.926 16.034  1.00 25.50 ? 193 LEU A CA  1 
ATOM   213  C C   . LEU A 1 30  ? 44.719  -24.341 14.720  1.00 23.64 ? 193 LEU A C   1 
ATOM   214  O O   . LEU A 1 30  ? 45.490  -23.407 14.769  1.00 21.54 ? 193 LEU A O   1 
ATOM   215  C CB  . LEU A 1 30  ? 42.908  -24.130 16.511  1.00 25.31 ? 193 LEU A CB  1 
ATOM   216  C CG  . LEU A 1 30  ? 42.242  -24.609 17.811  1.00 22.58 ? 193 LEU A CG  1 
ATOM   217  C CD1 . LEU A 1 30  ? 41.101  -23.662 18.251  1.00 23.59 ? 193 LEU A CD1 1 
ATOM   218  C CD2 . LEU A 1 30  ? 41.743  -26.051 17.651  1.00 21.18 ? 193 LEU A CD2 1 
ATOM   219  N N   . VAL A 1 31  ? 44.411  -24.925 13.565  1.00 21.18 ? 194 VAL A N   1 
ATOM   220  C CA  . VAL A 1 31  ? 45.027  -24.470 12.284  1.00 20.34 ? 194 VAL A CA  1 
ATOM   221  C C   . VAL A 1 31  ? 43.990  -24.448 11.139  1.00 18.09 ? 194 VAL A C   1 
ATOM   222  O O   . VAL A 1 31  ? 43.109  -25.302 11.109  1.00 18.23 ? 194 VAL A O   1 
ATOM   223  C CB  . VAL A 1 31  ? 46.293  -25.373 11.978  1.00 19.99 ? 194 VAL A CB  1 
ATOM   224  C CG1 . VAL A 1 31  ? 45.920  -26.829 11.897  1.00 21.97 ? 194 VAL A CG1 1 
ATOM   225  C CG2 . VAL A 1 31  ? 47.014  -24.938 10.698  1.00 24.36 ? 194 VAL A CG2 1 
ATOM   226  N N   . PHE A 1 32  ? 44.054  -23.451 10.240  1.00 15.88 ? 195 PHE A N   1 
ATOM   227  C CA  . PHE A 1 32  ? 43.247  -23.451 9.016   1.00 15.53 ? 195 PHE A CA  1 
ATOM   228  C C   . PHE A 1 32  ? 44.112  -23.785 7.833   1.00 15.16 ? 195 PHE A C   1 
ATOM   229  O O   . PHE A 1 32  ? 45.312  -23.475 7.855   1.00 17.08 ? 195 PHE A O   1 
ATOM   230  C CB  . PHE A 1 32  ? 42.650  -22.075 8.779   1.00 14.71 ? 195 PHE A CB  1 
ATOM   231  C CG  . PHE A 1 32  ? 41.448  -21.776 9.647   1.00 15.09 ? 195 PHE A CG  1 
ATOM   232  C CD1 . PHE A 1 32  ? 41.574  -21.000 10.785  1.00 15.89 ? 195 PHE A CD1 1 
ATOM   233  C CD2 . PHE A 1 32  ? 40.188  -22.231 9.285   1.00 14.65 ? 195 PHE A CD2 1 
ATOM   234  C CE1 . PHE A 1 32  ? 40.448  -20.703 11.585  1.00 14.08 ? 195 PHE A CE1 1 
ATOM   235  C CE2 . PHE A 1 32  ? 39.066  -21.927 10.080  1.00 16.54 ? 195 PHE A CE2 1 
ATOM   236  C CZ  . PHE A 1 32  ? 39.213  -21.176 11.221  1.00 16.10 ? 195 PHE A CZ  1 
ATOM   237  N N   . SER A 1 33  ? 43.563  -24.432 6.823   1.00 15.35 ? 196 SER A N   1 
ATOM   238  C CA  . SER A 1 33  ? 44.322  -24.688 5.575   1.00 15.87 ? 196 SER A CA  1 
ATOM   239  C C   . SER A 1 33  ? 44.811  -23.339 4.970   1.00 17.46 ? 196 SER A C   1 
ATOM   240  O O   . SER A 1 33  ? 44.147  -22.292 5.142   1.00 16.43 ? 196 SER A O   1 
ATOM   241  C CB  . SER A 1 33  ? 43.467  -25.467 4.576   1.00 15.64 ? 196 SER A CB  1 
ATOM   242  O OG  . SER A 1 33  ? 42.244  -24.803 4.324   1.00 15.30 ? 196 SER A OG  1 
ATOM   243  N N   . HIS A 1 34  ? 45.958  -23.360 4.285   1.00 18.42 ? 197 HIS A N   1 
ATOM   244  C CA  . HIS A 1 34  ? 46.543  -22.135 3.677   1.00 19.42 ? 197 HIS A CA  1 
ATOM   245  C C   . HIS A 1 34  ? 45.594  -21.554 2.644   1.00 18.30 ? 197 HIS A C   1 
ATOM   246  O O   . HIS A 1 34  ? 45.501  -20.347 2.512   1.00 18.31 ? 197 HIS A O   1 
ATOM   247  C CB  . HIS A 1 34  ? 47.934  -22.387 3.024   1.00 20.83 ? 197 HIS A CB  1 
ATOM   248  C CG  . HIS A 1 34  ? 49.033  -22.679 4.007   1.00 28.00 ? 197 HIS A CG  1 
ATOM   249  N ND1 . HIS A 1 34  ? 50.077  -23.549 3.731   1.00 33.55 ? 197 HIS A ND1 1 
ATOM   250  C CD2 . HIS A 1 34  ? 49.271  -22.193 5.256   1.00 32.00 ? 197 HIS A CD2 1 
ATOM   251  C CE1 . HIS A 1 34  ? 50.902  -23.594 4.771   1.00 35.63 ? 197 HIS A CE1 1 
ATOM   252  N NE2 . HIS A 1 34  ? 50.425  -22.798 5.717   1.00 33.64 ? 197 HIS A NE2 1 
ATOM   253  N N   . ASN A 1 35  ? 44.885  -22.416 1.916   1.00 17.66 ? 198 ASN A N   1 
ATOM   254  C CA  . ASN A 1 35  ? 43.925  -21.984 0.910   1.00 18.24 ? 198 ASN A CA  1 
ATOM   255  C C   . ASN A 1 35  ? 42.509  -22.432 1.145   1.00 17.74 ? 198 ASN A C   1 
ATOM   256  O O   . ASN A 1 35  ? 42.268  -23.461 1.731   1.00 18.01 ? 198 ASN A O   1 
ATOM   257  C CB  . ASN A 1 35  ? 44.308  -22.535 -0.486  1.00 18.29 ? 198 ASN A CB  1 
ATOM   258  C CG  . ASN A 1 35  ? 45.662  -22.055 -0.935  1.00 23.20 ? 198 ASN A CG  1 
ATOM   259  O OD1 . ASN A 1 35  ? 46.662  -22.747 -0.742  1.00 28.38 ? 198 ASN A OD1 1 
ATOM   260  N ND2 . ASN A 1 35  ? 45.717  -20.830 -1.455  1.00 21.01 ? 198 ASN A ND2 1 
ATOM   261  N N   . ALA A 1 36  ? 41.573  -21.698 0.565   1.00 18.04 ? 199 ALA A N   1 
ATOM   262  C CA  . ALA A 1 36  ? 40.204  -22.161 0.481   1.00 17.15 ? 199 ALA A CA  1 
ATOM   263  C C   . ALA A 1 36  ? 39.977  -22.654 -0.947  1.00 17.72 ? 199 ALA A C   1 
ATOM   264  O O   . ALA A 1 36  ? 40.814  -22.418 -1.885  1.00 19.13 ? 199 ALA A O   1 
ATOM   265  C CB  . ALA A 1 36  ? 39.276  -21.068 0.833   1.00 14.94 ? 199 ALA A CB  1 
ATOM   266  N N   . VAL A 1 37  ? 38.870  -23.341 -1.157  1.00 16.85 ? 200 VAL A N   1 
ATOM   267  C CA  . VAL A 1 37  ? 38.606  -23.911 -2.502  1.00 17.57 ? 200 VAL A CA  1 
ATOM   268  C C   . VAL A 1 37  ? 37.193  -23.649 -2.885  1.00 17.60 ? 200 VAL A C   1 
ATOM   269  O O   . VAL A 1 37  ? 36.341  -23.482 -2.028  1.00 19.43 ? 200 VAL A O   1 
ATOM   270  C CB  . VAL A 1 37  ? 38.920  -25.412 -2.613  1.00 14.88 ? 200 VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 37  ? 40.406  -25.662 -2.232  1.00 14.55 ? 200 VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 37  ? 37.997  -26.235 -1.703  1.00 15.52 ? 200 VAL A CG2 1 
ATOM   273  N N   . ILE A 1 38  ? 36.946  -23.596 -4.176  1.00 17.45 ? 201 ILE A N   1 
ATOM   274  C CA  . ILE A 1 38  ? 35.596  -23.618 -4.654  1.00 17.77 ? 201 ILE A CA  1 
ATOM   275  C C   . ILE A 1 38  ? 35.433  -24.880 -5.510  1.00 19.76 ? 201 ILE A C   1 
ATOM   276  O O   . ILE A 1 38  ? 36.252  -25.124 -6.425  1.00 20.56 ? 201 ILE A O   1 
ATOM   277  C CB  . ILE A 1 38  ? 35.222  -22.311 -5.385  1.00 19.35 ? 201 ILE A CB  1 
ATOM   278  C CG1 . ILE A 1 38  ? 34.961  -21.184 -4.342  1.00 16.23 ? 201 ILE A CG1 1 
ATOM   279  C CG2 . ILE A 1 38  ? 33.907  -22.536 -6.180  1.00 17.08 ? 201 ILE A CG2 1 
ATOM   280  C CD1 . ILE A 1 38  ? 34.956  -19.771 -4.873  1.00 18.84 ? 201 ILE A CD1 1 
ATOM   281  N N   . ALA A 1 39  ? 34.414  -25.705 -5.209  1.00 18.71 ? 202 ALA A N   1 
ATOM   282  C CA  . ALA A 1 39  ? 34.200  -26.909 -6.004  1.00 19.39 ? 202 ALA A CA  1 
ATOM   283  C C   . ALA A 1 39  ? 32.774  -27.386 -5.905  1.00 19.94 ? 202 ALA A C   1 
ATOM   284  O O   . ALA A 1 39  ? 32.006  -26.921 -5.046  1.00 19.12 ? 202 ALA A O   1 
ATOM   285  C CB  . ALA A 1 39  ? 35.167  -28.024 -5.561  1.00 18.50 ? 202 ALA A CB  1 
ATOM   286  N N   . MET A 1 40  ? 32.404  -28.307 -6.793  1.00 21.11 ? 203 MET A N   1 
ATOM   287  C CA  . MET A 1 40  ? 31.054  -28.917 -6.733  1.00 22.13 ? 203 MET A CA  1 
ATOM   288  C C   . MET A 1 40  ? 30.988  -29.999 -5.617  1.00 22.66 ? 203 MET A C   1 
ATOM   289  O O   . MET A 1 40  ? 31.889  -30.819 -5.454  1.00 22.15 ? 203 MET A O   1 
ATOM   290  C CB  . MET A 1 40  ? 30.658  -29.555 -8.073  1.00 21.82 ? 203 MET A CB  1 
ATOM   291  C CG  . MET A 1 40  ? 30.503  -28.614 -9.263  1.00 22.56 ? 203 MET A CG  1 
ATOM   292  S SD  . MET A 1 40  ? 29.288  -27.303 -9.034  1.00 24.11 ? 203 MET A SD  1 
ATOM   293  C CE  . MET A 1 40  ? 27.743  -28.239 -9.233  1.00 24.47 ? 203 MET A CE  1 
ATOM   294  N N   . ARG A 1 41  ? 29.916  -29.984 -4.856  1.00 23.85 ? 204 ARG A N   1 
ATOM   295  C CA  . ARG A 1 41  ? 29.690  -31.016 -3.879  1.00 26.03 ? 204 ARG A CA  1 
ATOM   296  C C   . ARG A 1 41  ? 28.206  -31.317 -3.901  1.00 27.05 ? 204 ARG A C   1 
ATOM   297  O O   . ARG A 1 41  ? 27.378  -30.456 -3.612  1.00 27.23 ? 204 ARG A O   1 
ATOM   298  C CB  . ARG A 1 41  ? 30.193  -30.620 -2.488  1.00 26.44 ? 204 ARG A CB  1 
ATOM   299  C CG  . ARG A 1 41  ? 30.291  -31.845 -1.630  1.00 30.14 ? 204 ARG A CG  1 
ATOM   300  C CD  . ARG A 1 41  ? 30.912  -31.540 -0.378  1.00 31.20 ? 204 ARG A CD  1 
ATOM   301  N NE  . ARG A 1 41  ? 32.327  -31.882 -0.398  1.00 29.31 ? 204 ARG A NE  1 
ATOM   302  C CZ  . ARG A 1 41  ? 32.984  -31.971 0.732   1.00 24.84 ? 204 ARG A CZ  1 
ATOM   303  N NH1 . ARG A 1 41  ? 32.290  -31.717 1.823   1.00 25.12 ? 204 ARG A NH1 1 
ATOM   304  N NH2 . ARG A 1 41  ? 34.267  -32.290 0.778   1.00 26.27 ? 204 ARG A NH2 1 
ATOM   305  N N   . ASP A 1 42  ? 27.889  -32.530 -4.330  1.00 27.86 ? 205 ASP A N   1 
ATOM   306  C CA  . ASP A 1 42  ? 26.514  -32.984 -4.552  1.00 29.88 ? 205 ASP A CA  1 
ATOM   307  C C   . ASP A 1 42  ? 25.601  -31.983 -5.265  1.00 29.24 ? 205 ASP A C   1 
ATOM   308  O O   . ASP A 1 42  ? 24.543  -31.610 -4.758  1.00 29.83 ? 205 ASP A O   1 
ATOM   309  C CB  . ASP A 1 42  ? 25.915  -33.507 -3.254  1.00 31.09 ? 205 ASP A CB  1 
ATOM   310  C CG  . ASP A 1 42  ? 26.564  -34.835 -2.819  1.00 33.95 ? 205 ASP A CG  1 
ATOM   311  O OD1 . ASP A 1 42  ? 27.124  -34.801 -1.703  1.00 33.45 ? 205 ASP A OD1 1 
ATOM   312  O OD2 . ASP A 1 42  ? 26.514  -35.873 -3.592  1.00 34.38 ? 205 ASP A OD2 1 
ATOM   313  N N   . GLY A 1 43  ? 26.053  -31.536 -6.428  1.00 28.32 ? 206 GLY A N   1 
ATOM   314  C CA  . GLY A 1 43  ? 25.260  -30.701 -7.326  1.00 27.69 ? 206 GLY A CA  1 
ATOM   315  C C   . GLY A 1 43  ? 25.278  -29.222 -7.011  1.00 27.33 ? 206 GLY A C   1 
ATOM   316  O O   . GLY A 1 43  ? 24.574  -28.451 -7.664  1.00 27.31 ? 206 GLY A O   1 
ATOM   317  N N   . LYS A 1 44  ? 26.078  -28.808 -6.025  1.00 25.46 ? 207 LYS A N   1 
ATOM   318  C CA  . LYS A 1 44  ? 26.059  -27.431 -5.594  1.00 24.27 ? 207 LYS A CA  1 
ATOM   319  C C   . LYS A 1 44  ? 27.464  -26.882 -5.538  1.00 22.75 ? 207 LYS A C   1 
ATOM   320  O O   . LYS A 1 44  ? 28.406  -27.581 -5.124  1.00 20.99 ? 207 LYS A O   1 
ATOM   321  C CB  . LYS A 1 44  ? 25.369  -27.330 -4.229  1.00 25.04 ? 207 LYS A CB  1 
ATOM   322  C CG  . LYS A 1 44  ? 23.900  -27.739 -4.241  1.00 29.01 ? 207 LYS A CG  1 
ATOM   323  C CD  . LYS A 1 44  ? 23.458  -28.120 -2.852  1.00 35.57 ? 207 LYS A CD  1 
ATOM   324  C CE  . LYS A 1 44  ? 21.940  -28.477 -2.829  1.00 38.27 ? 207 LYS A CE  1 
ATOM   325  N NZ  . LYS A 1 44  ? 21.414  -28.258 -1.434  1.00 40.38 ? 207 LYS A NZ  1 
ATOM   326  N N   . LEU A 1 45  ? 27.617  -25.635 -5.971  1.00 20.99 ? 208 LEU A N   1 
ATOM   327  C CA  . LEU A 1 45  ? 28.924  -24.999 -5.967  1.00 20.88 ? 208 LEU A CA  1 
ATOM   328  C C   . LEU A 1 45  ? 29.137  -24.486 -4.555  1.00 20.18 ? 208 LEU A C   1 
ATOM   329  O O   . LEU A 1 45  ? 28.268  -23.786 -4.015  1.00 20.56 ? 208 LEU A O   1 
ATOM   330  C CB  . LEU A 1 45  ? 28.940  -23.824 -6.964  1.00 20.87 ? 208 LEU A CB  1 
ATOM   331  C CG  . LEU A 1 45  ? 30.268  -23.184 -7.388  1.00 24.26 ? 208 LEU A CG  1 
ATOM   332  C CD1 . LEU A 1 45  ? 31.109  -24.140 -8.228  1.00 22.43 ? 208 LEU A CD1 1 
ATOM   333  C CD2 . LEU A 1 45  ? 30.022  -21.855 -8.198  1.00 22.84 ? 208 LEU A CD2 1 
ATOM   334  N N   . CYS A 1 46  ? 30.262  -24.856 -3.947  1.00 20.19 ? 209 CYS A N   1 
ATOM   335  C CA  . CYS A 1 46  ? 30.527  -24.559 -2.546  1.00 19.79 ? 209 CYS A CA  1 
ATOM   336  C C   . CYS A 1 46  ? 31.897  -23.945 -2.388  1.00 19.06 ? 209 CYS A C   1 
ATOM   337  O O   . CYS A 1 46  ? 32.868  -24.372 -3.075  1.00 19.53 ? 209 CYS A O   1 
ATOM   338  C CB  . CYS A 1 46  ? 30.504  -25.836 -1.704  1.00 19.93 ? 209 CYS A CB  1 
ATOM   339  S SG  . CYS A 1 46  ? 28.947  -26.675 -1.696  1.00 24.24 ? 209 CYS A SG  1 
ATOM   340  N N   . LEU A 1 47  ? 31.974  -22.984 -1.462  1.00 16.66 ? 210 LEU A N   1 
ATOM   341  C CA  . LEU A 1 47  ? 33.258  -22.501 -0.900  1.00 16.63 ? 210 LEU A CA  1 
ATOM   342  C C   . LEU A 1 47  ? 33.607  -23.339 0.340   1.00 17.25 ? 210 LEU A C   1 
ATOM   343  O O   . LEU A 1 47  ? 32.758  -23.489 1.235   1.00 16.65 ? 210 LEU A O   1 
ATOM   344  C CB  . LEU A 1 47  ? 33.104  -21.045 -0.475  1.00 16.03 ? 210 LEU A CB  1 
ATOM   345  C CG  . LEU A 1 47  ? 34.295  -20.390 0.235   1.00 16.43 ? 210 LEU A CG  1 
ATOM   346  C CD1 . LEU A 1 47  ? 35.500  -20.222 -0.690  1.00 13.93 ? 210 LEU A CD1 1 
ATOM   347  C CD2 . LEU A 1 47  ? 33.831  -19.038 0.805   1.00 16.51 ? 210 LEU A CD2 1 
ATOM   348  N N   . MET A 1 48  ? 34.819  -23.903 0.388   1.00 16.58 ? 211 MET A N   1 
ATOM   349  C CA  . MET A 1 48  ? 35.194  -24.800 1.494   1.00 17.37 ? 211 MET A CA  1 
ATOM   350  C C   . MET A 1 48  ? 36.543  -24.398 2.016   1.00 16.06 ? 211 MET A C   1 
ATOM   351  O O   . MET A 1 48  ? 37.332  -23.810 1.284   1.00 15.63 ? 211 MET A O   1 
ATOM   352  C CB  . MET A 1 48  ? 35.217  -26.287 1.046   1.00 18.36 ? 211 MET A CB  1 
ATOM   353  C CG  . MET A 1 48  ? 33.843  -26.760 0.539   1.00 20.17 ? 211 MET A CG  1 
ATOM   354  S SD  . MET A 1 48  ? 33.863  -28.399 -0.210  1.00 25.22 ? 211 MET A SD  1 
ATOM   355  C CE  . MET A 1 48  ? 34.801  -28.162 -1.702  1.00 31.38 ? 211 MET A CE  1 
ATOM   356  N N   . TRP A 1 49  ? 36.798  -24.686 3.290   1.00 15.97 ? 212 TRP A N   1 
ATOM   357  C CA  . TRP A 1 49  ? 38.097  -24.488 3.856   1.00 15.58 ? 212 TRP A CA  1 
ATOM   358  C C   . TRP A 1 49  ? 38.258  -25.525 4.937   1.00 16.64 ? 212 TRP A C   1 
ATOM   359  O O   . TRP A 1 49  ? 37.285  -26.109 5.407   1.00 17.10 ? 212 TRP A O   1 
ATOM   360  C CB  . TRP A 1 49  ? 38.288  -23.065 4.404   1.00 17.50 ? 212 TRP A CB  1 
ATOM   361  C CG  . TRP A 1 49  ? 37.244  -22.591 5.405   1.00 16.06 ? 212 TRP A CG  1 
ATOM   362  C CD1 . TRP A 1 49  ? 37.341  -22.659 6.756   1.00 14.20 ? 212 TRP A CD1 1 
ATOM   363  C CD2 . TRP A 1 49  ? 35.961  -22.007 5.113   1.00 16.37 ? 212 TRP A CD2 1 
ATOM   364  N NE1 . TRP A 1 49  ? 36.200  -22.137 7.351   1.00 15.59 ? 212 TRP A NE1 1 
ATOM   365  C CE2 . TRP A 1 49  ? 35.330  -21.743 6.363   1.00 17.10 ? 212 TRP A CE2 1 
ATOM   366  C CE3 . TRP A 1 49  ? 35.276  -21.679 3.926   1.00 17.74 ? 212 TRP A CE3 1 
ATOM   367  C CZ2 . TRP A 1 49  ? 34.085  -21.125 6.452   1.00 16.26 ? 212 TRP A CZ2 1 
ATOM   368  C CZ3 . TRP A 1 49  ? 34.004  -21.090 4.021   1.00 17.50 ? 212 TRP A CZ3 1 
ATOM   369  C CH2 . TRP A 1 49  ? 33.433  -20.809 5.262   1.00 15.77 ? 212 TRP A CH2 1 
ATOM   370  N N   . ARG A 1 50  ? 39.487  -25.756 5.349   1.00 16.09 ? 213 ARG A N   1 
ATOM   371  C CA  . ARG A 1 50  ? 39.731  -26.864 6.230   1.00 17.44 ? 213 ARG A CA  1 
ATOM   372  C C   . ARG A 1 50  ? 40.194  -26.379 7.578   1.00 16.09 ? 213 ARG A C   1 
ATOM   373  O O   . ARG A 1 50  ? 41.005  -25.468 7.655   1.00 15.48 ? 213 ARG A O   1 
ATOM   374  C CB  . ARG A 1 50  ? 40.763  -27.822 5.577   1.00 17.80 ? 213 ARG A CB  1 
ATOM   375  C CG  . ARG A 1 50  ? 41.021  -29.069 6.348   1.00 17.85 ? 213 ARG A CG  1 
ATOM   376  C CD  . ARG A 1 50  ? 42.137  -29.922 5.628   1.00 20.36 ? 213 ARG A CD  1 
ATOM   377  N NE  . ARG A 1 50  ? 41.561  -31.171 5.165   1.00 19.26 ? 213 ARG A NE  1 
ATOM   378  C CZ  . ARG A 1 50  ? 42.153  -32.019 4.346   1.00 20.90 ? 213 ARG A CZ  1 
ATOM   379  N NH1 . ARG A 1 50  ? 43.359  -31.752 3.816   1.00 13.89 ? 213 ARG A NH1 1 
ATOM   380  N NH2 . ARG A 1 50  ? 41.501  -33.113 4.026   1.00 17.07 ? 213 ARG A NH2 1 
ATOM   381  N N   . VAL A 1 51  ? 39.730  -27.035 8.641   1.00 15.62 ? 214 VAL A N   1 
ATOM   382  C CA  . VAL A 1 51  ? 40.199  -26.684 9.964   1.00 17.22 ? 214 VAL A CA  1 
ATOM   383  C C   . VAL A 1 51  ? 40.693  -27.926 10.729  1.00 17.89 ? 214 VAL A C   1 
ATOM   384  O O   . VAL A 1 51  ? 40.168  -29.013 10.555  1.00 17.69 ? 214 VAL A O   1 
ATOM   385  C CB  . VAL A 1 51  ? 39.111  -25.837 10.757  1.00 17.33 ? 214 VAL A CB  1 
ATOM   386  C CG1 . VAL A 1 51  ? 38.018  -26.745 11.327  1.00 16.30 ? 214 VAL A CG1 1 
ATOM   387  C CG2 . VAL A 1 51  ? 39.777  -25.020 11.860  1.00 19.12 ? 214 VAL A CG2 1 
ATOM   388  N N   . GLY A 1 52  ? 41.729  -27.761 11.539  1.00 17.33 ? 215 GLY A N   1 
ATOM   389  C CA  . GLY A 1 52  ? 42.298  -28.870 12.309  1.00 20.90 ? 215 GLY A CA  1 
ATOM   390  C C   . GLY A 1 52  ? 42.652  -28.538 13.742  1.00 23.70 ? 215 GLY A C   1 
ATOM   391  O O   . GLY A 1 52  ? 42.821  -27.360 14.104  1.00 22.38 ? 215 GLY A O   1 
ATOM   392  N N   . ASN A 1 53  ? 42.754  -29.595 14.550  1.00 26.09 ? 216 ASN A N   1 
ATOM   393  C CA  . ASN A 1 53  ? 42.976  -29.508 15.969  1.00 29.52 ? 216 ASN A CA  1 
ATOM   394  C C   . ASN A 1 53  ? 44.199  -30.366 16.227  1.00 31.90 ? 216 ASN A C   1 
ATOM   395  O O   . ASN A 1 53  ? 44.184  -31.592 15.996  1.00 30.71 ? 216 ASN A O   1 
ATOM   396  C CB  . ASN A 1 53  ? 41.738  -30.106 16.665  1.00 29.65 ? 216 ASN A CB  1 
ATOM   397  C CG  . ASN A 1 53  ? 41.752  -30.000 18.209  1.00 32.69 ? 216 ASN A CG  1 
ATOM   398  O OD1 . ASN A 1 53  ? 42.718  -29.549 18.834  1.00 30.50 ? 216 ASN A OD1 1 
ATOM   399  N ND2 . ASN A 1 53  ? 40.628  -30.464 18.827  1.00 35.68 ? 216 ASN A ND2 1 
ATOM   400  N N   . LEU A 1 54  ? 45.262  -29.711 16.673  1.00 34.80 ? 217 LEU A N   1 
ATOM   401  C CA  . LEU A 1 54  ? 46.484  -30.389 17.092  1.00 38.35 ? 217 LEU A CA  1 
ATOM   402  C C   . LEU A 1 54  ? 46.657  -30.346 18.613  1.00 40.09 ? 217 LEU A C   1 
ATOM   403  O O   . LEU A 1 54  ? 47.679  -30.791 19.148  1.00 40.79 ? 217 LEU A O   1 
ATOM   404  C CB  . LEU A 1 54  ? 47.682  -29.754 16.386  1.00 38.79 ? 217 LEU A CB  1 
ATOM   405  C CG  . LEU A 1 54  ? 47.677  -30.025 14.898  1.00 38.21 ? 217 LEU A CG  1 
ATOM   406  C CD1 . LEU A 1 54  ? 48.789  -29.256 14.214  1.00 41.02 ? 217 LEU A CD1 1 
ATOM   407  C CD2 . LEU A 1 54  ? 47.930  -31.472 14.761  1.00 40.19 ? 217 LEU A CD2 1 
ATOM   408  N N   . GLN A 1 55  ? 45.648  -29.821 19.315  1.00 41.45 ? 218 GLN A N   1 
ATOM   409  C CA  . GLN A 1 55  ? 45.694  -29.762 20.779  1.00 42.15 ? 218 GLN A CA  1 
ATOM   410  C C   . GLN A 1 55  ? 45.966  -31.144 21.402  1.00 42.89 ? 218 GLN A C   1 
ATOM   411  O O   . GLN A 1 55  ? 45.918  -32.203 20.714  1.00 43.06 ? 218 GLN A O   1 
ATOM   412  C CB  . GLN A 1 55  ? 44.375  -29.180 21.364  1.00 42.49 ? 218 GLN A CB  1 
ATOM   413  C CG  . GLN A 1 55  ? 44.237  -27.666 21.301  1.00 40.30 ? 218 GLN A CG  1 
ATOM   414  C CD  . GLN A 1 55  ? 42.809  -27.174 21.584  1.00 41.82 ? 218 GLN A CD  1 
ATOM   415  O OE1 . GLN A 1 55  ? 42.439  -26.074 21.156  1.00 41.18 ? 218 GLN A OE1 1 
ATOM   416  N NE2 . GLN A 1 55  ? 41.999  -27.985 22.294  1.00 37.88 ? 218 GLN A NE2 1 
ATOM   417  N N   . LYS A 1 56  ? 46.250  -31.091 22.707  1.00 42.59 ? 219 LYS A N   1 
ATOM   418  C CA  . LYS A 1 56  ? 46.360  -32.255 23.591  1.00 42.94 ? 219 LYS A CA  1 
ATOM   419  C C   . LYS A 1 56  ? 44.975  -32.605 24.141  1.00 41.72 ? 219 LYS A C   1 
ATOM   420  O O   . LYS A 1 56  ? 44.808  -33.619 24.840  1.00 42.20 ? 219 LYS A O   1 
ATOM   421  C CB  . LYS A 1 56  ? 47.313  -31.942 24.769  1.00 43.20 ? 219 LYS A CB  1 
ATOM   422  C CG  . LYS A 1 56  ? 48.789  -31.663 24.371  1.00 45.55 ? 219 LYS A CG  1 
ATOM   423  C CD  . LYS A 1 56  ? 49.626  -31.153 25.576  1.00 48.50 ? 219 LYS A CD  1 
ATOM   424  C CE  . LYS A 1 56  ? 51.075  -30.734 25.167  1.00 50.98 ? 219 LYS A CE  1 
ATOM   425  N NZ  . LYS A 1 56  ? 51.151  -29.404 24.450  1.00 49.18 ? 219 LYS A NZ  1 
ATOM   426  N N   . SER A 1 57  ? 43.991  -31.766 23.797  1.00 39.61 ? 220 SER A N   1 
ATOM   427  C CA  . SER A 1 57  ? 42.675  -31.794 24.413  1.00 37.14 ? 220 SER A CA  1 
ATOM   428  C C   . SER A 1 57  ? 41.585  -31.644 23.327  1.00 34.70 ? 220 SER A C   1 
ATOM   429  O O   . SER A 1 57  ? 41.858  -31.186 22.235  1.00 34.74 ? 220 SER A O   1 
ATOM   430  C CB  . SER A 1 57  ? 42.584  -30.623 25.428  1.00 37.98 ? 220 SER A CB  1 
ATOM   431  O OG  . SER A 1 57  ? 41.814  -30.934 26.561  1.00 35.53 ? 220 SER A OG  1 
ATOM   432  N N   . HIS A 1 58  ? 40.361  -32.026 23.660  1.00 30.16 ? 221 HIS A N   1 
ATOM   433  C CA  . HIS A 1 58  ? 39.212  -31.786 22.818  1.00 27.45 ? 221 HIS A CA  1 
ATOM   434  C C   . HIS A 1 58  ? 38.778  -30.319 22.858  1.00 25.64 ? 221 HIS A C   1 
ATOM   435  O O   . HIS A 1 58  ? 39.062  -29.621 23.837  1.00 24.91 ? 221 HIS A O   1 
ATOM   436  C CB  . HIS A 1 58  ? 38.094  -32.734 23.235  1.00 27.93 ? 221 HIS A CB  1 
ATOM   437  C CG  . HIS A 1 58  ? 38.335  -34.128 22.761  1.00 28.56 ? 221 HIS A CG  1 
ATOM   438  N ND1 . HIS A 1 58  ? 38.984  -35.070 23.530  1.00 30.17 ? 221 HIS A ND1 1 
ATOM   439  C CD2 . HIS A 1 58  ? 38.097  -34.711 21.564  1.00 28.98 ? 221 HIS A CD2 1 
ATOM   440  C CE1 . HIS A 1 58  ? 39.096  -36.189 22.835  1.00 28.63 ? 221 HIS A CE1 1 
ATOM   441  N NE2 . HIS A 1 58  ? 38.563  -35.997 21.645  1.00 29.80 ? 221 HIS A NE2 1 
ATOM   442  N N   . LEU A 1 59  ? 38.176  -29.841 21.775  1.00 21.94 ? 222 LEU A N   1 
ATOM   443  C CA  . LEU A 1 59  ? 37.643  -28.497 21.750  1.00 20.99 ? 222 LEU A CA  1 
ATOM   444  C C   . LEU A 1 59  ? 36.160  -28.594 22.064  1.00 19.63 ? 222 LEU A C   1 
ATOM   445  O O   . LEU A 1 59  ? 35.385  -29.138 21.291  1.00 20.56 ? 222 LEU A O   1 
ATOM   446  C CB  . LEU A 1 59  ? 37.906  -27.849 20.376  1.00 20.50 ? 222 LEU A CB  1 
ATOM   447  C CG  . LEU A 1 59  ? 37.750  -26.329 20.267  1.00 22.13 ? 222 LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 59  ? 38.721  -25.582 21.196  1.00 22.84 ? 222 LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 59  ? 38.004  -25.920 18.841  1.00 22.06 ? 222 LEU A CD2 1 
ATOM   450  N N   . VAL A 1 60  ? 35.761  -28.102 23.226  1.00 17.90 ? 223 VAL A N   1 
ATOM   451  C CA  . VAL A 1 60  ? 34.386  -28.254 23.707  1.00 17.27 ? 223 VAL A CA  1 
ATOM   452  C C   . VAL A 1 60  ? 33.478  -27.143 23.180  1.00 17.28 ? 223 VAL A C   1 
ATOM   453  O O   . VAL A 1 60  ? 33.925  -25.989 23.066  1.00 18.14 ? 223 VAL A O   1 
ATOM   454  C CB  . VAL A 1 60  ? 34.355  -28.340 25.294  1.00 17.28 ? 223 VAL A CB  1 
ATOM   455  C CG1 . VAL A 1 60  ? 32.946  -28.607 25.782  1.00 14.87 ? 223 VAL A CG1 1 
ATOM   456  C CG2 . VAL A 1 60  ? 35.265  -29.508 25.756  1.00 14.40 ? 223 VAL A CG2 1 
ATOM   457  N N   . GLU A 1 61  ? 32.237  -27.471 22.824  1.00 15.47 ? 224 GLU A N   1 
ATOM   458  C CA  . GLU A 1 61  ? 31.307  -26.487 22.255  1.00 16.39 ? 224 GLU A CA  1 
ATOM   459  C C   . GLU A 1 61  ? 31.988  -25.675 21.129  1.00 15.97 ? 224 GLU A C   1 
ATOM   460  O O   . GLU A 1 61  ? 31.977  -24.460 21.107  1.00 15.69 ? 224 GLU A O   1 
ATOM   461  C CB  . GLU A 1 61  ? 30.713  -25.580 23.370  1.00 16.36 ? 224 GLU A CB  1 
ATOM   462  C CG  . GLU A 1 61  ? 29.871  -26.393 24.371  1.00 17.52 ? 224 GLU A CG  1 
ATOM   463  C CD  . GLU A 1 61  ? 29.269  -25.557 25.541  1.00 26.98 ? 224 GLU A CD  1 
ATOM   464  O OE1 . GLU A 1 61  ? 29.721  -24.412 25.796  1.00 24.16 ? 224 GLU A OE1 1 
ATOM   465  O OE2 . GLU A 1 61  ? 28.340  -26.087 26.233  1.00 30.24 ? 224 GLU A OE2 1 
ATOM   466  N N   . ALA A 1 62  ? 32.586  -26.395 20.192  1.00 15.33 ? 225 ALA A N   1 
ATOM   467  C CA  . ALA A 1 62  ? 33.268  -25.774 19.036  1.00 15.23 ? 225 ALA A CA  1 
ATOM   468  C C   . ALA A 1 62  ? 32.266  -25.380 17.965  1.00 14.97 ? 225 ALA A C   1 
ATOM   469  O O   . ALA A 1 62  ? 31.268  -26.071 17.721  1.00 14.90 ? 225 ALA A O   1 
ATOM   470  C CB  . ALA A 1 62  ? 34.300  -26.754 18.443  1.00 14.12 ? 225 ALA A CB  1 
ATOM   471  N N   . HIS A 1 63  ? 32.521  -24.241 17.332  1.00 13.57 ? 226 HIS A N   1 
ATOM   472  C CA  . HIS A 1 63  ? 31.627  -23.777 16.335  1.00 14.44 ? 226 HIS A CA  1 
ATOM   473  C C   . HIS A 1 63  ? 32.425  -22.809 15.428  1.00 13.30 ? 226 HIS A C   1 
ATOM   474  O O   . HIS A 1 63  ? 33.395  -22.194 15.860  1.00 11.86 ? 226 HIS A O   1 
ATOM   475  C CB  . HIS A 1 63  ? 30.385  -23.098 16.951  1.00 14.88 ? 226 HIS A CB  1 
ATOM   476  C CG  . HIS A 1 63  ? 30.720  -21.963 17.843  1.00 16.58 ? 226 HIS A CG  1 
ATOM   477  N ND1 . HIS A 1 63  ? 30.474  -20.655 17.493  1.00 19.95 ? 226 HIS A ND1 1 
ATOM   478  C CD2 . HIS A 1 63  ? 31.326  -21.931 19.052  1.00 21.43 ? 226 HIS A CD2 1 
ATOM   479  C CE1 . HIS A 1 63  ? 30.901  -19.859 18.459  1.00 17.74 ? 226 HIS A CE1 1 
ATOM   480  N NE2 . HIS A 1 63  ? 31.409  -20.607 19.424  1.00 21.15 ? 226 HIS A NE2 1 
ATOM   481  N N   . VAL A 1 64  ? 31.994  -22.734 14.178  1.00 13.64 ? 227 VAL A N   1 
ATOM   482  C CA  . VAL A 1 64  ? 32.656  -21.937 13.142  1.00 13.99 ? 227 VAL A CA  1 
ATOM   483  C C   . VAL A 1 64  ? 31.838  -20.773 12.637  1.00 13.52 ? 227 VAL A C   1 
ATOM   484  O O   . VAL A 1 64  ? 30.615  -20.827 12.656  1.00 12.18 ? 227 VAL A O   1 
ATOM   485  C CB  . VAL A 1 64  ? 33.052  -22.826 11.910  1.00 13.07 ? 227 VAL A CB  1 
ATOM   486  C CG1 . VAL A 1 64  ? 34.149  -23.780 12.309  1.00 12.04 ? 227 VAL A CG1 1 
ATOM   487  C CG2 . VAL A 1 64  ? 31.853  -23.629 11.311  1.00 17.97 ? 227 VAL A CG2 1 
ATOM   488  N N   . ARG A 1 65  ? 32.524  -19.750 12.099  1.00 13.38 ? 228 ARG A N   1 
ATOM   489  C CA  . ARG A 1 65  ? 31.851  -18.680 11.374  1.00 14.59 ? 228 ARG A CA  1 
ATOM   490  C C   . ARG A 1 65  ? 32.784  -18.245 10.272  1.00 15.33 ? 228 ARG A C   1 
ATOM   491  O O   . ARG A 1 65  ? 33.981  -18.527 10.334  1.00 15.32 ? 228 ARG A O   1 
ATOM   492  C CB  . ARG A 1 65  ? 31.620  -17.406 12.208  1.00 14.06 ? 228 ARG A CB  1 
ATOM   493  C CG  . ARG A 1 65  ? 30.805  -17.568 13.444  1.00 21.12 ? 228 ARG A CG  1 
ATOM   494  C CD  . ARG A 1 65  ? 31.092  -16.322 14.295  1.00 25.59 ? 228 ARG A CD  1 
ATOM   495  N NE  . ARG A 1 65  ? 30.421  -15.164 13.698  1.00 21.03 ? 228 ARG A NE  1 
ATOM   496  C CZ  . ARG A 1 65  ? 30.256  -14.006 14.332  1.00 25.19 ? 228 ARG A CZ  1 
ATOM   497  N NH1 . ARG A 1 65  ? 30.709  -13.896 15.581  1.00 20.62 ? 228 ARG A NH1 1 
ATOM   498  N NH2 . ARG A 1 65  ? 29.619  -12.979 13.729  1.00 22.48 ? 228 ARG A NH2 1 
ATOM   499  N N   . ALA A 1 66  ? 32.229  -17.476 9.335   1.00 14.62 ? 229 ALA A N   1 
ATOM   500  C CA  . ALA A 1 66  ? 33.031  -16.803 8.292   1.00 15.24 ? 229 ALA A CA  1 
ATOM   501  C C   . ALA A 1 66  ? 32.379  -15.461 7.962   1.00 15.24 ? 229 ALA A C   1 
ATOM   502  O O   . ALA A 1 66  ? 31.150  -15.338 8.074   1.00 16.08 ? 229 ALA A O   1 
ATOM   503  C CB  . ALA A 1 66  ? 33.171  -17.712 7.035   1.00 14.29 ? 229 ALA A CB  1 
ATOM   504  N N   . GLN A 1 67  ? 33.183  -14.445 7.625   1.00 15.77 ? 230 GLN A N   1 
ATOM   505  C CA  . GLN A 1 67  ? 32.598  -13.179 7.230   1.00 16.62 ? 230 GLN A CA  1 
ATOM   506  C C   . GLN A 1 67  ? 33.320  -12.686 6.027   1.00 17.11 ? 230 GLN A C   1 
ATOM   507  O O   . GLN A 1 67  ? 34.507  -12.812 5.950   1.00 17.01 ? 230 GLN A O   1 
ATOM   508  C CB  . GLN A 1 67  ? 32.790  -12.129 8.303   1.00 17.44 ? 230 GLN A CB  1 
ATOM   509  C CG  . GLN A 1 67  ? 32.001  -12.359 9.623   1.00 18.44 ? 230 GLN A CG  1 
ATOM   510  C CD  . GLN A 1 67  ? 32.296  -11.223 10.622  1.00 22.80 ? 230 GLN A CD  1 
ATOM   511  O OE1 . GLN A 1 67  ? 33.410  -10.687 10.646  1.00 21.78 ? 230 GLN A OE1 1 
ATOM   512  N NE2 . GLN A 1 67  ? 31.281  -10.826 11.421  1.00 21.97 ? 230 GLN A NE2 1 
ATOM   513  N N   . LEU A 1 68  ? 32.592  -12.105 5.097   1.00 17.91 ? 231 LEU A N   1 
ATOM   514  C CA  . LEU A 1 68  ? 33.213  -11.303 4.016   1.00 19.08 ? 231 LEU A CA  1 
ATOM   515  C C   . LEU A 1 68  ? 33.396  -9.862  4.486   1.00 19.65 ? 231 LEU A C   1 
ATOM   516  O O   . LEU A 1 68  ? 32.475  -9.244  5.028   1.00 19.11 ? 231 LEU A O   1 
ATOM   517  C CB  . LEU A 1 68  ? 32.369  -11.403 2.759   1.00 19.29 ? 231 LEU A CB  1 
ATOM   518  C CG  . LEU A 1 68  ? 33.113  -10.943 1.508   1.00 25.14 ? 231 LEU A CG  1 
ATOM   519  C CD1 . LEU A 1 68  ? 32.896  -11.916 0.343   1.00 29.13 ? 231 LEU A CD1 1 
ATOM   520  C CD2 . LEU A 1 68  ? 32.576  -9.553  1.201   1.00 25.57 ? 231 LEU A CD2 1 
ATOM   521  N N   . LEU A 1 69  ? 34.627  -9.379  4.353   1.00 20.02 ? 232 LEU A N   1 
ATOM   522  C CA  . LEU A 1 69  ? 35.028  -8.068  4.782   1.00 21.14 ? 232 LEU A CA  1 
ATOM   523  C C   . LEU A 1 69  ? 35.139  -7.143  3.570   1.00 22.56 ? 232 LEU A C   1 
ATOM   524  O O   . LEU A 1 69  ? 35.887  -7.441  2.621   1.00 22.13 ? 232 LEU A O   1 
ATOM   525  C CB  . LEU A 1 69  ? 36.381  -8.139  5.497   1.00 20.60 ? 232 LEU A CB  1 
ATOM   526  C CG  . LEU A 1 69  ? 36.512  -9.049  6.706   1.00 22.66 ? 232 LEU A CG  1 
ATOM   527  C CD1 . LEU A 1 69  ? 37.893  -8.819  7.407   1.00 23.00 ? 232 LEU A CD1 1 
ATOM   528  C CD2 . LEU A 1 69  ? 35.338  -8.928  7.728   1.00 21.58 ? 232 LEU A CD2 1 
ATOM   529  N N   . LYS A 1 70  ? 34.356  -6.053  3.567   1.00 22.99 ? 233 LYS A N   1 
ATOM   530  C CA  . LYS A 1 70  ? 34.520  -5.014  2.526   1.00 23.47 ? 233 LYS A CA  1 
ATOM   531  C C   . LYS A 1 70  ? 34.047  -3.663  3.055   1.00 23.84 ? 233 LYS A C   1 
ATOM   532  O O   . LYS A 1 70  ? 33.349  -3.598  4.086   1.00 23.38 ? 233 LYS A O   1 
ATOM   533  C CB  . LYS A 1 70  ? 33.730  -5.370  1.301   1.00 23.60 ? 233 LYS A CB  1 
ATOM   534  C CG  . LYS A 1 70  ? 32.291  -5.669  1.636   1.00 26.61 ? 233 LYS A CG  1 
ATOM   535  C CD  . LYS A 1 70  ? 31.498  -6.038  0.406   1.00 33.66 ? 233 LYS A CD  1 
ATOM   536  C CE  . LYS A 1 70  ? 30.877  -4.818  -0.242  1.00 39.27 ? 233 LYS A CE  1 
ATOM   537  N NZ  . LYS A 1 70  ? 29.750  -5.232  -1.168  1.00 43.96 ? 233 LYS A NZ  1 
ATOM   538  N N   . SER A 1 71  ? 34.439  -2.592  2.374   1.00 22.62 ? 234 SER A N   1 
ATOM   539  C CA  . SER A 1 71  ? 33.864  -1.300  2.692   1.00 23.15 ? 234 SER A CA  1 
ATOM   540  C C   . SER A 1 71  ? 32.622  -1.189  1.818   1.00 23.18 ? 234 SER A C   1 
ATOM   541  O O   . SER A 1 71  ? 32.487  -1.924  0.822   1.00 23.93 ? 234 SER A O   1 
ATOM   542  C CB  . SER A 1 71  ? 34.872  -0.214  2.342   1.00 22.33 ? 234 SER A CB  1 
ATOM   543  O OG  . SER A 1 71  ? 34.998  -0.218  0.927   1.00 23.45 ? 234 SER A OG  1 
ATOM   544  N N   . ARG A 1 72  ? 31.684  -0.320  2.194   1.00 23.10 ? 235 ARG A N   1 
ATOM   545  C CA  . ARG A 1 72  ? 30.586  0.017   1.296   1.00 22.27 ? 235 ARG A CA  1 
ATOM   546  C C   . ARG A 1 72  ? 30.031  1.408   1.537   1.00 21.08 ? 235 ARG A C   1 
ATOM   547  O O   . ARG A 1 72  ? 30.319  2.040   2.571   1.00 21.92 ? 235 ARG A O   1 
ATOM   548  C CB  . ARG A 1 72  ? 29.458  -1.039  1.336   1.00 23.08 ? 235 ARG A CB  1 
ATOM   549  C CG  . ARG A 1 72  ? 28.488  -0.882  2.438   1.00 26.31 ? 235 ARG A CG  1 
ATOM   550  C CD  . ARG A 1 72  ? 27.310  -1.882  2.221   1.00 31.27 ? 235 ARG A CD  1 
ATOM   551  N NE  . ARG A 1 72  ? 26.428  -1.828  3.378   1.00 30.65 ? 235 ARG A NE  1 
ATOM   552  C CZ  . ARG A 1 72  ? 25.264  -1.199  3.420   1.00 30.14 ? 235 ARG A CZ  1 
ATOM   553  N NH1 . ARG A 1 72  ? 24.778  -0.567  2.351   1.00 27.31 ? 235 ARG A NH1 1 
ATOM   554  N NH2 . ARG A 1 72  ? 24.555  -1.245  4.540   1.00 34.30 ? 235 ARG A NH2 1 
ATOM   555  N N   . ILE A 1 73  ? 29.237  1.872   0.576   1.00 21.08 ? 236 ILE A N   1 
ATOM   556  C CA  . ILE A 1 73  ? 28.531  3.155   0.640   1.00 21.54 ? 236 ILE A CA  1 
ATOM   557  C C   . ILE A 1 73  ? 27.040  2.883   0.648   1.00 21.48 ? 236 ILE A C   1 
ATOM   558  O O   . ILE A 1 73  ? 26.541  2.212   -0.227  1.00 21.34 ? 236 ILE A O   1 
ATOM   559  C CB  . ILE A 1 73  ? 28.845  4.053   -0.619  1.00 21.18 ? 236 ILE A CB  1 
ATOM   560  C CG1 . ILE A 1 73  ? 30.344  4.156   -0.899  1.00 20.70 ? 236 ILE A CG1 1 
ATOM   561  C CG2 . ILE A 1 73  ? 28.139  5.421   -0.515  1.00 19.88 ? 236 ILE A CG2 1 
ATOM   562  C CD1 . ILE A 1 73  ? 31.215  4.610   0.315   1.00 15.63 ? 236 ILE A CD1 1 
ATOM   563  N N   . THR A 1 74  ? 26.324  3.415   1.630   1.00 22.02 ? 237 THR A N   1 
ATOM   564  C CA  . THR A 1 74  ? 24.878  3.297   1.624   1.00 22.18 ? 237 THR A CA  1 
ATOM   565  C C   . THR A 1 74  ? 24.238  4.183   0.535   1.00 22.99 ? 237 THR A C   1 
ATOM   566  O O   . THR A 1 74  ? 24.884  5.102   -0.006  1.00 23.56 ? 237 THR A O   1 
ATOM   567  C CB  . THR A 1 74  ? 24.280  3.643   3.003   1.00 21.32 ? 237 THR A CB  1 
ATOM   568  O OG1 . THR A 1 74  ? 24.431  5.047   3.261   1.00 20.19 ? 237 THR A OG1 1 
ATOM   569  C CG2 . THR A 1 74  ? 24.988  2.851   4.100   1.00 19.88 ? 237 THR A CG2 1 
ATOM   570  N N   . SER A 1 75  ? 22.975  3.912   0.218   1.00 22.82 ? 238 SER A N   1 
ATOM   571  C CA  . SER A 1 75  ? 22.218  4.797   -0.635  1.00 25.18 ? 238 SER A CA  1 
ATOM   572  C C   . SER A 1 75  ? 22.134  6.215   -0.095  1.00 25.07 ? 238 SER A C   1 
ATOM   573  O O   . SER A 1 75  ? 21.945  7.142   -0.872  1.00 24.52 ? 238 SER A O   1 
ATOM   574  C CB  . SER A 1 75  ? 20.799  4.280   -0.859  1.00 26.60 ? 238 SER A CB  1 
ATOM   575  O OG  . SER A 1 75  ? 20.092  4.312   0.368   1.00 29.35 ? 238 SER A OG  1 
ATOM   576  N N   . GLU A 1 76  ? 22.259  6.404   1.215   1.00 24.42 ? 239 GLU A N   1 
ATOM   577  C CA  . GLU A 1 76  ? 22.246  7.775   1.754   1.00 24.38 ? 239 GLU A CA  1 
ATOM   578  C C   . GLU A 1 76  ? 23.609  8.431   1.597   1.00 23.43 ? 239 GLU A C   1 
ATOM   579  O O   . GLU A 1 76  ? 23.816  9.556   2.046   1.00 24.83 ? 239 GLU A O   1 
ATOM   580  C CB  . GLU A 1 76  ? 21.819  7.800   3.236   1.00 23.40 ? 239 GLU A CB  1 
ATOM   581  C CG  . GLU A 1 76  ? 20.371  7.355   3.501   1.00 25.13 ? 239 GLU A CG  1 
ATOM   582  C CD  . GLU A 1 76  ? 20.109  5.838   3.382   1.00 28.54 ? 239 GLU A CD  1 
ATOM   583  O OE1 . GLU A 1 76  ? 21.050  4.997   3.394   1.00 27.43 ? 239 GLU A OE1 1 
ATOM   584  O OE2 . GLU A 1 76  ? 18.910  5.479   3.304   1.00 31.11 ? 239 GLU A OE2 1 
ATOM   585  N N   . GLY A 1 77  ? 24.568  7.747   0.991   1.00 22.83 ? 240 GLY A N   1 
ATOM   586  C CA  . GLY A 1 77  ? 25.920  8.320   0.929   1.00 21.48 ? 240 GLY A CA  1 
ATOM   587  C C   . GLY A 1 77  ? 26.813  8.065   2.115   1.00 22.31 ? 240 GLY A C   1 
ATOM   588  O O   . GLY A 1 77  ? 27.900  8.659   2.233   1.00 22.95 ? 240 GLY A O   1 
ATOM   589  N N   . GLU A 1 78  ? 26.438  7.146   3.010   1.00 21.52 ? 241 GLU A N   1 
ATOM   590  C CA  . GLU A 1 78  ? 27.305  6.927   4.169   1.00 20.22 ? 241 GLU A CA  1 
ATOM   591  C C   . GLU A 1 78  ? 28.438  5.975   3.822   1.00 19.60 ? 241 GLU A C   1 
ATOM   592  O O   . GLU A 1 78  ? 28.206  4.973   3.223   1.00 19.16 ? 241 GLU A O   1 
ATOM   593  C CB  . GLU A 1 78  ? 26.512  6.398   5.371   1.00 20.92 ? 241 GLU A CB  1 
ATOM   594  C CG  . GLU A 1 78  ? 27.398  6.216   6.612   1.00 20.23 ? 241 GLU A CG  1 
ATOM   595  C CD  . GLU A 1 78  ? 26.662  5.635   7.797   1.00 23.26 ? 241 GLU A CD  1 
ATOM   596  O OE1 . GLU A 1 78  ? 27.261  5.670   8.914   1.00 23.62 ? 241 GLU A OE1 1 
ATOM   597  O OE2 . GLU A 1 78  ? 25.506  5.169   7.610   1.00 21.87 ? 241 GLU A OE2 1 
ATOM   598  N N   . TYR A 1 79  ? 29.655  6.306   4.211   1.00 19.83 ? 242 TYR A N   1 
ATOM   599  C CA  . TYR A 1 79  ? 30.795  5.426   4.004   1.00 20.96 ? 242 TYR A CA  1 
ATOM   600  C C   . TYR A 1 79  ? 30.965  4.525   5.215   1.00 20.71 ? 242 TYR A C   1 
ATOM   601  O O   . TYR A 1 79  ? 31.120  5.003   6.345   1.00 20.68 ? 242 TYR A O   1 
ATOM   602  C CB  . TYR A 1 79  ? 32.066  6.271   3.759   1.00 19.97 ? 242 TYR A CB  1 
ATOM   603  C CG  . TYR A 1 79  ? 33.384  5.596   4.010   1.00 21.68 ? 242 TYR A CG  1 
ATOM   604  C CD1 . TYR A 1 79  ? 33.786  4.502   3.247   1.00 20.18 ? 242 TYR A CD1 1 
ATOM   605  C CD2 . TYR A 1 79  ? 34.263  6.090   4.978   1.00 18.26 ? 242 TYR A CD2 1 
ATOM   606  C CE1 . TYR A 1 79  ? 34.963  3.875   3.493   1.00 20.87 ? 242 TYR A CE1 1 
ATOM   607  C CE2 . TYR A 1 79  ? 35.467  5.491   5.205   1.00 19.10 ? 242 TYR A CE2 1 
ATOM   608  C CZ  . TYR A 1 79  ? 35.814  4.373   4.439   1.00 20.46 ? 242 TYR A CZ  1 
ATOM   609  O OH  . TYR A 1 79  ? 37.023  3.747   4.644   1.00 18.85 ? 242 TYR A OH  1 
ATOM   610  N N   . ILE A 1 80  ? 30.965  3.219   4.975   1.00 21.04 ? 243 ILE A N   1 
ATOM   611  C CA  . ILE A 1 80  ? 31.190  2.234   6.038   1.00 20.06 ? 243 ILE A CA  1 
ATOM   612  C C   . ILE A 1 80  ? 32.547  1.637   5.791   1.00 20.23 ? 243 ILE A C   1 
ATOM   613  O O   . ILE A 1 80  ? 32.717  0.939   4.802   1.00 20.86 ? 243 ILE A O   1 
ATOM   614  C CB  . ILE A 1 80  ? 30.087  1.154   5.978   1.00 20.13 ? 243 ILE A CB  1 
ATOM   615  C CG1 . ILE A 1 80  ? 28.714  1.815   6.245   1.00 20.74 ? 243 ILE A CG1 1 
ATOM   616  C CG2 . ILE A 1 80  ? 30.364  0.010   7.000   1.00 19.81 ? 243 ILE A CG2 1 
ATOM   617  C CD1 . ILE A 1 80  ? 27.531  0.854   6.253   1.00 24.90 ? 243 ILE A CD1 1 
ATOM   618  N N   . PRO A 1 81  ? 33.563  1.979   6.605   1.00 21.19 ? 244 PRO A N   1 
ATOM   619  C CA  . PRO A 1 81  ? 34.879  1.409   6.262   1.00 21.32 ? 244 PRO A CA  1 
ATOM   620  C C   . PRO A 1 81  ? 34.941  -0.105  6.315   1.00 21.97 ? 244 PRO A C   1 
ATOM   621  O O   . PRO A 1 81  ? 35.700  -0.697  5.597   1.00 21.14 ? 244 PRO A O   1 
ATOM   622  C CB  . PRO A 1 81  ? 35.815  2.018   7.299   1.00 22.42 ? 244 PRO A CB  1 
ATOM   623  C CG  . PRO A 1 81  ? 35.072  3.306   7.756   1.00 21.69 ? 244 PRO A CG  1 
ATOM   624  C CD  . PRO A 1 81  ? 33.637  2.939   7.720   1.00 20.79 ? 244 PRO A CD  1 
ATOM   625  N N   . LEU A 1 82  ? 34.193  -0.737  7.215   1.00 22.55 ? 245 LEU A N   1 
ATOM   626  C CA  . LEU A 1 82  ? 34.253  -2.180  7.305   1.00 23.44 ? 245 LEU A CA  1 
ATOM   627  C C   . LEU A 1 82  ? 32.883  -2.747  7.551   1.00 23.81 ? 245 LEU A C   1 
ATOM   628  O O   . LEU A 1 82  ? 32.283  -2.567  8.624   1.00 23.44 ? 245 LEU A O   1 
ATOM   629  C CB  . LEU A 1 82  ? 35.214  -2.603  8.410   1.00 23.80 ? 245 LEU A CB  1 
ATOM   630  C CG  . LEU A 1 82  ? 35.363  -4.103  8.675   1.00 25.49 ? 245 LEU A CG  1 
ATOM   631  C CD1 . LEU A 1 82  ? 35.727  -4.886  7.437   1.00 23.76 ? 245 LEU A CD1 1 
ATOM   632  C CD2 . LEU A 1 82  ? 36.425  -4.252  9.735   1.00 23.66 ? 245 LEU A CD2 1 
ATOM   633  N N   . ASP A 1 83  ? 32.364  -3.382  6.521   1.00 23.97 ? 246 ASP A N   1 
ATOM   634  C CA  . ASP A 1 83  ? 31.099  -4.024  6.588   1.00 25.14 ? 246 ASP A CA  1 
ATOM   635  C C   . ASP A 1 83  ? 31.462  -5.503  6.702   1.00 24.86 ? 246 ASP A C   1 
ATOM   636  O O   . ASP A 1 83  ? 32.194  -6.029  5.859   1.00 24.53 ? 246 ASP A O   1 
ATOM   637  C CB  . ASP A 1 83  ? 30.353  -3.753  5.298   1.00 26.68 ? 246 ASP A CB  1 
ATOM   638  C CG  . ASP A 1 83  ? 28.882  -4.032  5.404   1.00 32.49 ? 246 ASP A CG  1 
ATOM   639  O OD1 . ASP A 1 83  ? 28.347  -4.130  6.549   1.00 40.26 ? 246 ASP A OD1 1 
ATOM   640  O OD2 . ASP A 1 83  ? 28.256  -4.117  4.344   1.00 37.60 ? 246 ASP A OD2 1 
ATOM   641  N N   . GLN A 1 84  ? 31.021  -6.150  7.778   1.00 23.42 ? 247 GLN A N   1 
ATOM   642  C CA  . GLN A 1 84  ? 31.360  -7.546  8.022   1.00 23.85 ? 247 GLN A CA  1 
ATOM   643  C C   . GLN A 1 84  ? 30.124  -8.365  7.779   1.00 24.41 ? 247 GLN A C   1 
ATOM   644  O O   . GLN A 1 84  ? 29.198  -8.328  8.594   1.00 24.59 ? 247 GLN A O   1 
ATOM   645  C CB  . GLN A 1 84  ? 31.841  -7.732  9.463   1.00 22.58 ? 247 GLN A CB  1 
ATOM   646  C CG  . GLN A 1 84  ? 33.015  -6.841  9.785   1.00 23.95 ? 247 GLN A CG  1 
ATOM   647  C CD  . GLN A 1 84  ? 33.418  -6.892  11.248  1.00 24.18 ? 247 GLN A CD  1 
ATOM   648  O OE1 . GLN A 1 84  ? 33.616  -5.850  11.888  1.00 25.43 ? 247 GLN A OE1 1 
ATOM   649  N NE2 . GLN A 1 84  ? 33.555  -8.087  11.783  1.00 21.95 ? 247 GLN A NE2 1 
ATOM   650  N N   . ILE A 1 85  ? 30.132  -9.115  6.673   1.00 24.48 ? 248 ILE A N   1 
ATOM   651  C CA  . ILE A 1 85  ? 28.959  -9.778  6.135   1.00 24.75 ? 248 ILE A CA  1 
ATOM   652  C C   . ILE A 1 85  ? 29.083  -11.248 6.471   1.00 24.79 ? 248 ILE A C   1 
ATOM   653  O O   . ILE A 1 85  ? 29.976  -11.938 5.987   1.00 22.81 ? 248 ILE A O   1 
ATOM   654  C CB  . ILE A 1 85  ? 28.878  -9.563  4.589   1.00 26.08 ? 248 ILE A CB  1 
ATOM   655  C CG1 . ILE A 1 85  ? 28.928  -8.054  4.254   1.00 29.29 ? 248 ILE A CG1 1 
ATOM   656  C CG2 . ILE A 1 85  ? 27.618  -10.207 3.994   1.00 24.75 ? 248 ILE A CG2 1 
ATOM   657  C CD1 . ILE A 1 85  ? 29.081  -7.706  2.741   1.00 32.14 ? 248 ILE A CD1 1 
ATOM   658  N N   . ASP A 1 86  ? 28.199  -11.736 7.327   1.00 25.40 ? 249 ASP A N   1 
ATOM   659  C CA  . ASP A 1 86  ? 28.266  -13.136 7.736   1.00 25.91 ? 249 ASP A CA  1 
ATOM   660  C C   . ASP A 1 86  ? 28.007  -14.091 6.597   1.00 25.31 ? 249 ASP A C   1 
ATOM   661  O O   . ASP A 1 86  ? 27.166  -13.842 5.781   1.00 26.52 ? 249 ASP A O   1 
ATOM   662  C CB  . ASP A 1 86  ? 27.389  -13.373 8.967   1.00 27.75 ? 249 ASP A CB  1 
ATOM   663  C CG  . ASP A 1 86  ? 28.025  -12.730 10.231  1.00 31.14 ? 249 ASP A CG  1 
ATOM   664  O OD1 . ASP A 1 86  ? 29.074  -13.296 10.714  1.00 37.11 ? 249 ASP A OD1 1 
ATOM   665  O OD2 . ASP A 1 86  ? 27.516  -11.659 10.691  1.00 33.74 ? 249 ASP A OD2 1 
ATOM   666  N N   . ILE A 1 87  ? 28.811  -15.136 6.508   1.00 23.30 ? 250 ILE A N   1 
ATOM   667  C CA  . ILE A 1 87  ? 28.695  -16.186 5.481   1.00 23.25 ? 250 ILE A CA  1 
ATOM   668  C C   . ILE A 1 87  ? 28.137  -17.469 6.127   1.00 21.40 ? 250 ILE A C   1 
ATOM   669  O O   . ILE A 1 87  ? 28.668  -17.950 7.141   1.00 21.49 ? 250 ILE A O   1 
ATOM   670  C CB  . ILE A 1 87  ? 30.118  -16.412 4.876   1.00 23.52 ? 250 ILE A CB  1 
ATOM   671  C CG1 . ILE A 1 87  ? 30.445  -15.259 3.926   1.00 25.37 ? 250 ILE A CG1 1 
ATOM   672  C CG2 . ILE A 1 87  ? 30.306  -17.740 4.198   1.00 24.46 ? 250 ILE A CG2 1 
ATOM   673  C CD1 . ILE A 1 87  ? 31.823  -15.388 3.325   1.00 31.57 ? 250 ILE A CD1 1 
ATOM   674  N N   . ASN A 1 88  ? 27.058  -17.986 5.557   1.00 20.43 ? 251 ASN A N   1 
ATOM   675  C CA  . ASN A 1 88  ? 26.312  -19.112 6.126   1.00 20.09 ? 251 ASN A CA  1 
ATOM   676  C C   . ASN A 1 88  ? 27.076  -20.424 6.128   1.00 19.21 ? 251 ASN A C   1 
ATOM   677  O O   . ASN A 1 88  ? 27.410  -21.008 5.056   1.00 19.71 ? 251 ASN A O   1 
ATOM   678  C CB  . ASN A 1 88  ? 24.956  -19.266 5.406   1.00 20.09 ? 251 ASN A CB  1 
ATOM   679  C CG  . ASN A 1 88  ? 24.025  -20.298 6.074   1.00 23.52 ? 251 ASN A CG  1 
ATOM   680  O OD1 . ASN A 1 88  ? 24.360  -20.934 7.054   1.00 22.61 ? 251 ASN A OD1 1 
ATOM   681  N ND2 . ASN A 1 88  ? 22.828  -20.442 5.513   1.00 27.63 ? 251 ASN A ND2 1 
ATOM   682  N N   . VAL A 1 89  ? 27.366  -20.877 7.342   1.00 18.22 ? 252 VAL A N   1 
ATOM   683  C CA  . VAL A 1 89  ? 28.001  -22.172 7.548   1.00 18.57 ? 252 VAL A CA  1 
ATOM   684  C C   . VAL A 1 89  ? 27.131  -23.011 8.529   1.00 18.19 ? 252 VAL A C   1 
ATOM   685  O O   . VAL A 1 89  ? 27.608  -23.863 9.228   1.00 18.70 ? 252 VAL A O   1 
ATOM   686  C CB  . VAL A 1 89  ? 29.498  -22.054 8.011   1.00 17.37 ? 252 VAL A CB  1 
ATOM   687  C CG1 . VAL A 1 89  ? 30.385  -21.367 6.905   1.00 16.91 ? 252 VAL A CG1 1 
ATOM   688  C CG2 . VAL A 1 89  ? 29.589  -21.300 9.243   1.00 17.43 ? 252 VAL A CG2 1 
ATOM   689  N N   . GLY A 1 90  ? 25.835  -22.776 8.533   1.00 17.20 ? 253 GLY A N   1 
ATOM   690  C CA  . GLY A 1 90  ? 24.976  -23.680 9.270   1.00 16.59 ? 253 GLY A CA  1 
ATOM   691  C C   . GLY A 1 90  ? 24.426  -23.167 10.605  1.00 15.68 ? 253 GLY A C   1 
ATOM   692  O O   . GLY A 1 90  ? 23.740  -23.916 11.323  1.00 17.17 ? 253 GLY A O   1 
ATOM   693  N N   . PHE A 1 91  ? 24.592  -21.888 10.895  1.00 15.08 ? 254 PHE A N   1 
ATOM   694  C CA  . PHE A 1 91  ? 24.072  -21.361 12.178  1.00 15.73 ? 254 PHE A CA  1 
ATOM   695  C C   . PHE A 1 91  ? 22.634  -21.740 12.492  1.00 16.36 ? 254 PHE A C   1 
ATOM   696  O O   . PHE A 1 91  ? 22.305  -22.204 13.585  1.00 16.68 ? 254 PHE A O   1 
ATOM   697  C CB  . PHE A 1 91  ? 24.224  -19.844 12.278  1.00 16.28 ? 254 PHE A CB  1 
ATOM   698  C CG  . PHE A 1 91  ? 23.692  -19.277 13.589  1.00 15.31 ? 254 PHE A CG  1 
ATOM   699  C CD1 . PHE A 1 91  ? 24.378  -19.507 14.773  1.00 14.30 ? 254 PHE A CD1 1 
ATOM   700  C CD2 . PHE A 1 91  ? 22.492  -18.577 13.623  1.00 16.66 ? 254 PHE A CD2 1 
ATOM   701  C CE1 . PHE A 1 91  ? 23.882  -18.988 15.994  1.00 17.88 ? 254 PHE A CE1 1 
ATOM   702  C CE2 . PHE A 1 91  ? 21.978  -18.054 14.877  1.00 16.81 ? 254 PHE A CE2 1 
ATOM   703  C CZ  . PHE A 1 91  ? 22.683  -18.269 16.017  1.00 15.48 ? 254 PHE A CZ  1 
ATOM   704  N N   . ASP A 1 92  ? 21.781  -21.570 11.512  1.00 18.28 ? 255 ASP A N   1 
ATOM   705  C CA  . ASP A 1 92  ? 20.348  -21.649 11.740  1.00 20.77 ? 255 ASP A CA  1 
ATOM   706  C C   . ASP A 1 92  ? 19.849  -23.051 12.074  1.00 20.08 ? 255 ASP A C   1 
ATOM   707  O O   . ASP A 1 92  ? 18.817  -23.171 12.740  1.00 18.82 ? 255 ASP A O   1 
ATOM   708  C CB  . ASP A 1 92  ? 19.561  -20.970 10.590  1.00 22.81 ? 255 ASP A CB  1 
ATOM   709  C CG  . ASP A 1 92  ? 19.472  -19.420 10.764  1.00 29.88 ? 255 ASP A CG  1 
ATOM   710  O OD1 . ASP A 1 92  ? 19.107  -18.849 11.883  1.00 33.81 ? 255 ASP A OD1 1 
ATOM   711  O OD2 . ASP A 1 92  ? 19.752  -18.744 9.737   1.00 37.92 ? 255 ASP A OD2 1 
ATOM   712  N N   . SER A 1 93  ? 20.570  -24.104 11.653  1.00 18.85 ? 256 SER A N   1 
ATOM   713  C CA  . SER A 1 93  ? 20.216  -25.483 12.080  1.00 17.98 ? 256 SER A CA  1 
ATOM   714  C C   . SER A 1 93  ? 21.178  -26.082 13.120  1.00 18.10 ? 256 SER A C   1 
ATOM   715  O O   . SER A 1 93  ? 20.996  -27.222 13.584  1.00 19.36 ? 256 SER A O   1 
ATOM   716  C CB  . SER A 1 93  ? 20.071  -26.410 10.852  1.00 19.15 ? 256 SER A CB  1 
ATOM   717  O OG  . SER A 1 93  ? 21.271  -26.423 10.088  1.00 19.81 ? 256 SER A OG  1 
ATOM   718  N N   . GLY A 1 94  ? 22.189  -25.330 13.532  1.00 15.39 ? 257 GLY A N   1 
ATOM   719  C CA  . GLY A 1 94  ? 23.115  -25.847 14.536  1.00 16.26 ? 257 GLY A CA  1 
ATOM   720  C C   . GLY A 1 94  ? 24.262  -26.647 13.953  1.00 16.24 ? 257 GLY A C   1 
ATOM   721  O O   . GLY A 1 94  ? 25.056  -27.219 14.687  1.00 16.00 ? 257 GLY A O   1 
ATOM   722  N N   . ILE A 1 95  ? 24.377  -26.693 12.633  1.00 16.18 ? 258 ILE A N   1 
ATOM   723  C CA  . ILE A 1 95  ? 25.479  -27.465 12.069  1.00 16.95 ? 258 ILE A CA  1 
ATOM   724  C C   . ILE A 1 95  ? 26.763  -26.638 11.853  1.00 17.39 ? 258 ILE A C   1 
ATOM   725  O O   . ILE A 1 95  ? 27.716  -27.144 11.264  1.00 17.19 ? 258 ILE A O   1 
ATOM   726  C CB  . ILE A 1 95  ? 25.084  -28.249 10.771  1.00 17.99 ? 258 ILE A CB  1 
ATOM   727  C CG1 . ILE A 1 95  ? 24.836  -27.288 9.589   1.00 18.98 ? 258 ILE A CG1 1 
ATOM   728  C CG2 . ILE A 1 95  ? 23.884  -29.247 11.100  1.00 15.95 ? 258 ILE A CG2 1 
ATOM   729  C CD1 . ILE A 1 95  ? 24.437  -27.992 8.278   1.00 24.32 ? 258 ILE A CD1 1 
ATOM   730  N N   . ASP A 1 96  ? 26.783  -25.398 12.349  1.00 15.60 ? 259 ASP A N   1 
ATOM   731  C CA  . ASP A 1 96  ? 28.026  -24.622 12.518  1.00 15.97 ? 259 ASP A CA  1 
ATOM   732  C C   . ASP A 1 96  ? 28.794  -25.168 13.739  1.00 15.90 ? 259 ASP A C   1 
ATOM   733  O O   . ASP A 1 96  ? 29.987  -24.843 13.983  1.00 16.56 ? 259 ASP A O   1 
ATOM   734  C CB  . ASP A 1 96  ? 27.663  -23.147 12.775  1.00 15.36 ? 259 ASP A CB  1 
ATOM   735  C CG  . ASP A 1 96  ? 26.859  -22.992 14.083  1.00 19.70 ? 259 ASP A CG  1 
ATOM   736  O OD1 . ASP A 1 96  ? 25.872  -23.751 14.215  1.00 19.99 ? 259 ASP A OD1 1 
ATOM   737  O OD2 . ASP A 1 96  ? 27.213  -22.163 14.978  1.00 23.92 ? 259 ASP A OD2 1 
ATOM   738  N N   . ARG A 1 97  ? 28.120  -26.033 14.509  1.00 15.98 ? 260 ARG A N   1 
ATOM   739  C CA  . ARG A 1 97  ? 28.721  -26.655 15.687  1.00 15.61 ? 260 ARG A CA  1 
ATOM   740  C C   . ARG A 1 97  ? 29.401  -27.920 15.232  1.00 16.16 ? 260 ARG A C   1 
ATOM   741  O O   . ARG A 1 97  ? 28.806  -28.704 14.521  1.00 17.45 ? 260 ARG A O   1 
ATOM   742  C CB  . ARG A 1 97  ? 27.666  -27.043 16.716  1.00 15.96 ? 260 ARG A CB  1 
ATOM   743  C CG  . ARG A 1 97  ? 26.816  -25.843 17.206  1.00 15.57 ? 260 ARG A CG  1 
ATOM   744  C CD  . ARG A 1 97  ? 25.685  -26.229 18.239  1.00 13.98 ? 260 ARG A CD  1 
ATOM   745  N NE  . ARG A 1 97  ? 24.841  -27.311 17.731  1.00 17.22 ? 260 ARG A NE  1 
ATOM   746  C CZ  . ARG A 1 97  ? 24.214  -28.185 18.520  1.00 19.12 ? 260 ARG A CZ  1 
ATOM   747  N NH1 . ARG A 1 97  ? 23.520  -29.185 17.995  1.00 18.13 ? 260 ARG A NH1 1 
ATOM   748  N NH2 . ARG A 1 97  ? 24.341  -28.092 19.854  1.00 13.81 ? 260 ARG A NH2 1 
ATOM   749  N N   . ILE A 1 98  ? 30.626  -28.142 15.662  1.00 15.86 ? 261 ILE A N   1 
ATOM   750  C CA  . ILE A 1 98  ? 31.406  -29.253 15.073  1.00 16.32 ? 261 ILE A CA  1 
ATOM   751  C C   . ILE A 1 98  ? 32.006  -30.054 16.195  1.00 16.22 ? 261 ILE A C   1 
ATOM   752  O O   . ILE A 1 98  ? 32.161  -29.542 17.309  1.00 16.16 ? 261 ILE A O   1 
ATOM   753  C CB  . ILE A 1 98  ? 32.527  -28.763 14.069  1.00 16.40 ? 261 ILE A CB  1 
ATOM   754  C CG1 . ILE A 1 98  ? 33.607  -27.916 14.782  1.00 15.06 ? 261 ILE A CG1 1 
ATOM   755  C CG2 . ILE A 1 98  ? 31.917  -27.942 12.891  1.00 17.79 ? 261 ILE A CG2 1 
ATOM   756  C CD1 . ILE A 1 98  ? 34.811  -27.511 13.767  1.00 12.19 ? 261 ILE A CD1 1 
ATOM   757  N N   . PHE A 1 99  ? 32.299  -31.317 15.911  1.00 17.09 ? 262 PHE A N   1 
ATOM   758  C CA  . PHE A 1 99  ? 32.991  -32.195 16.816  1.00 17.35 ? 262 PHE A CA  1 
ATOM   759  C C   . PHE A 1 99  ? 34.307  -32.480 16.096  1.00 18.46 ? 262 PHE A C   1 
ATOM   760  O O   . PHE A 1 99  ? 34.369  -33.297 15.148  1.00 17.97 ? 262 PHE A O   1 
ATOM   761  C CB  . PHE A 1 99  ? 32.179  -33.488 17.095  1.00 17.67 ? 262 PHE A CB  1 
ATOM   762  C CG  . PHE A 1 99  ? 32.959  -34.554 17.859  1.00 20.33 ? 262 PHE A CG  1 
ATOM   763  C CD1 . PHE A 1 99  ? 33.675  -34.226 19.018  1.00 20.13 ? 262 PHE A CD1 1 
ATOM   764  C CD2 . PHE A 1 99  ? 32.948  -35.889 17.435  1.00 20.65 ? 262 PHE A CD2 1 
ATOM   765  C CE1 . PHE A 1 99  ? 34.392  -35.215 19.712  1.00 20.10 ? 262 PHE A CE1 1 
ATOM   766  C CE2 . PHE A 1 99  ? 33.621  -36.886 18.114  1.00 21.54 ? 262 PHE A CE2 1 
ATOM   767  C CZ  . PHE A 1 99  ? 34.379  -36.546 19.260  1.00 18.95 ? 262 PHE A CZ  1 
ATOM   768  N N   . LEU A 1 100 ? 35.347  -31.776 16.512  1.00 17.95 ? 263 LEU A N   1 
ATOM   769  C CA  . LEU A 1 100 ? 36.553  -31.706 15.706  1.00 20.21 ? 263 LEU A CA  1 
ATOM   770  C C   . LEU A 1 100 ? 37.560  -32.701 16.229  1.00 20.74 ? 263 LEU A C   1 
ATOM   771  O O   . LEU A 1 100 ? 38.214  -32.444 17.243  1.00 21.38 ? 263 LEU A O   1 
ATOM   772  C CB  . LEU A 1 100 ? 37.151  -30.289 15.756  1.00 19.19 ? 263 LEU A CB  1 
ATOM   773  C CG  . LEU A 1 100 ? 38.489  -30.006 15.039  1.00 21.36 ? 263 LEU A CG  1 
ATOM   774  C CD1 . LEU A 1 100 ? 38.458  -30.361 13.572  1.00 19.69 ? 263 LEU A CD1 1 
ATOM   775  C CD2 . LEU A 1 100 ? 38.771  -28.514 15.230  1.00 19.11 ? 263 LEU A CD2 1 
ATOM   776  N N   . VAL A 1 101 ? 37.719  -33.813 15.530  1.00 20.39 ? 264 VAL A N   1 
ATOM   777  C CA  . VAL A 1 101 ? 38.783  -34.761 15.898  1.00 22.17 ? 264 VAL A CA  1 
ATOM   778  C C   . VAL A 1 101 ? 39.846  -34.845 14.809  1.00 22.24 ? 264 VAL A C   1 
ATOM   779  O O   . VAL A 1 101 ? 40.985  -34.384 15.005  1.00 24.30 ? 264 VAL A O   1 
ATOM   780  C CB  . VAL A 1 101 ? 38.222  -36.177 16.247  1.00 22.34 ? 264 VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 101 ? 39.368  -37.118 16.560  1.00 24.49 ? 264 VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 101 ? 37.248  -36.082 17.445  1.00 24.31 ? 264 VAL A CG2 1 
ATOM   783  N N   . SER A 1 102 ? 39.454  -35.411 13.669  1.00 21.09 ? 265 SER A N   1 
ATOM   784  C CA  . SER A 1 102 ? 40.211  -35.397 12.403  1.00 20.72 ? 265 SER A CA  1 
ATOM   785  C C   . SER A 1 102 ? 39.867  -34.083 11.637  1.00 19.60 ? 265 SER A C   1 
ATOM   786  O O   . SER A 1 102 ? 38.748  -33.534 11.817  1.00 18.64 ? 265 SER A O   1 
ATOM   787  C CB  . SER A 1 102 ? 39.718  -36.619 11.600  1.00 21.09 ? 265 SER A CB  1 
ATOM   788  O OG  . SER A 1 102 ? 40.575  -36.858 10.480  1.00 26.96 ? 265 SER A OG  1 
ATOM   789  N N   . PRO A 1 103 ? 40.823  -33.512 10.857  1.00 18.45 ? 266 PRO A N   1 
ATOM   790  C CA  . PRO A 1 103 ? 40.498  -32.252 10.167  1.00 17.50 ? 266 PRO A CA  1 
ATOM   791  C C   . PRO A 1 103 ? 39.159  -32.222 9.467   1.00 18.00 ? 266 PRO A C   1 
ATOM   792  O O   . PRO A 1 103 ? 38.781  -33.160 8.780   1.00 18.02 ? 266 PRO A O   1 
ATOM   793  C CB  . PRO A 1 103 ? 41.670  -32.062 9.194   1.00 16.47 ? 266 PRO A CB  1 
ATOM   794  C CG  . PRO A 1 103 ? 42.855  -32.629 9.973   1.00 17.45 ? 266 PRO A CG  1 
ATOM   795  C CD  . PRO A 1 103 ? 42.259  -33.852 10.730  1.00 17.65 ? 266 PRO A CD  1 
ATOM   796  N N   . ILE A 1 104 ? 38.435  -31.136 9.641   1.00 16.51 ? 267 ILE A N   1 
ATOM   797  C CA  . ILE A 1 104 ? 37.123  -31.004 9.029   1.00 16.13 ? 267 ILE A CA  1 
ATOM   798  C C   . ILE A 1 104 ? 37.137  -29.940 7.880   1.00 16.62 ? 267 ILE A C   1 
ATOM   799  O O   . ILE A 1 104 ? 37.726  -28.863 8.021   1.00 16.90 ? 267 ILE A O   1 
ATOM   800  C CB  . ILE A 1 104 ? 36.052  -30.597 10.098  1.00 15.82 ? 267 ILE A CB  1 
ATOM   801  C CG1 . ILE A 1 104 ? 35.706  -31.805 11.009  1.00 16.26 ? 267 ILE A CG1 1 
ATOM   802  C CG2 . ILE A 1 104 ? 34.776  -30.104 9.419   1.00 16.09 ? 267 ILE A CG2 1 
ATOM   803  C CD1 . ILE A 1 104 ? 34.819  -31.416 12.302  1.00 17.35 ? 267 ILE A CD1 1 
ATOM   804  N N   . THR A 1 105 ? 36.500  -30.278 6.770   1.00 15.21 ? 268 THR A N   1 
ATOM   805  C CA  . THR A 1 105 ? 36.248  -29.352 5.659   1.00 16.10 ? 268 THR A CA  1 
ATOM   806  C C   . THR A 1 105 ? 34.933  -28.637 5.917   1.00 16.54 ? 268 THR A C   1 
ATOM   807  O O   . THR A 1 105 ? 33.860  -29.243 5.916   1.00 16.20 ? 268 THR A O   1 
ATOM   808  C CB  . THR A 1 105 ? 36.252  -30.094 4.309   1.00 16.51 ? 268 THR A CB  1 
ATOM   809  O OG1 . THR A 1 105 ? 37.553  -30.690 4.185   1.00 17.41 ? 268 THR A OG1 1 
ATOM   810  C CG2 . THR A 1 105 ? 36.020  -29.113 3.112   1.00 15.74 ? 268 THR A CG2 1 
ATOM   811  N N   . ILE A 1 106 ? 35.037  -27.346 6.186   1.00 16.66 ? 269 ILE A N   1 
ATOM   812  C CA  . ILE A 1 106 ? 33.856  -26.518 6.444   1.00 17.02 ? 269 ILE A CA  1 
ATOM   813  C C   . ILE A 1 106 ? 33.293  -26.131 5.081   1.00 17.19 ? 269 ILE A C   1 
ATOM   814  O O   . ILE A 1 106 ? 34.053  -25.792 4.173   1.00 17.84 ? 269 ILE A O   1 
ATOM   815  C CB  . ILE A 1 106 ? 34.225  -25.257 7.321   1.00 16.23 ? 269 ILE A CB  1 
ATOM   816  C CG1 . ILE A 1 106 ? 34.913  -25.672 8.634   1.00 14.96 ? 269 ILE A CG1 1 
ATOM   817  C CG2 . ILE A 1 106 ? 33.000  -24.328 7.536   1.00 13.74 ? 269 ILE A CG2 1 
ATOM   818  C CD1 . ILE A 1 106 ? 33.956  -26.494 9.610   1.00 18.22 ? 269 ILE A CD1 1 
ATOM   819  N N   . VAL A 1 107 ? 31.974  -26.205 4.935   1.00 17.87 ? 270 VAL A N   1 
ATOM   820  C CA  . VAL A 1 107 ? 31.301  -25.999 3.659   1.00 19.04 ? 270 VAL A CA  1 
ATOM   821  C C   . VAL A 1 107 ? 30.313  -24.812 3.692   1.00 19.80 ? 270 VAL A C   1 
ATOM   822  O O   . VAL A 1 107 ? 29.391  -24.787 4.487   1.00 20.53 ? 270 VAL A O   1 
ATOM   823  C CB  . VAL A 1 107 ? 30.548  -27.291 3.191   1.00 18.89 ? 270 VAL A CB  1 
ATOM   824  C CG1 . VAL A 1 107 ? 29.820  -27.045 1.856   1.00 21.27 ? 270 VAL A CG1 1 
ATOM   825  C CG2 . VAL A 1 107 ? 31.521  -28.440 3.047   1.00 18.56 ? 270 VAL A CG2 1 
ATOM   826  N N   . HIS A 1 108 ? 30.534  -23.838 2.821   1.00 18.86 ? 271 HIS A N   1 
ATOM   827  C CA  . HIS A 1 108 ? 29.568  -22.784 2.536   1.00 19.49 ? 271 HIS A CA  1 
ATOM   828  C C   . HIS A 1 108 ? 28.938  -23.052 1.168   1.00 20.42 ? 271 HIS A C   1 
ATOM   829  O O   . HIS A 1 108 ? 29.601  -22.882 0.126   1.00 19.68 ? 271 HIS A O   1 
ATOM   830  C CB  . HIS A 1 108 ? 30.264  -21.417 2.463   1.00 18.27 ? 271 HIS A CB  1 
ATOM   831  C CG  . HIS A 1 108 ? 29.391  -20.331 1.924   1.00 19.31 ? 271 HIS A CG  1 
ATOM   832  N ND1 . HIS A 1 108 ? 28.264  -19.896 2.581   1.00 17.10 ? 271 HIS A ND1 1 
ATOM   833  C CD2 . HIS A 1 108 ? 29.492  -19.578 0.802   1.00 18.78 ? 271 HIS A CD2 1 
ATOM   834  C CE1 . HIS A 1 108 ? 27.691  -18.936 1.871   1.00 20.21 ? 271 HIS A CE1 1 
ATOM   835  N NE2 . HIS A 1 108 ? 28.410  -18.736 0.782   1.00 17.73 ? 271 HIS A NE2 1 
ATOM   836  N N   . GLU A 1 109 ? 27.665  -23.425 1.173   1.00 19.57 ? 272 GLU A N   1 
ATOM   837  C CA  . GLU A 1 109 ? 26.935  -23.541 -0.074  1.00 20.94 ? 272 GLU A CA  1 
ATOM   838  C C   . GLU A 1 109 ? 26.673  -22.187 -0.711  1.00 20.27 ? 272 GLU A C   1 
ATOM   839  O O   . GLU A 1 109 ? 26.061  -21.305 -0.099  1.00 20.37 ? 272 GLU A O   1 
ATOM   840  C CB  . GLU A 1 109 ? 25.602  -24.256 0.136   1.00 20.50 ? 272 GLU A CB  1 
ATOM   841  C CG  . GLU A 1 109 ? 24.843  -24.316 -1.187  1.00 25.17 ? 272 GLU A CG  1 
ATOM   842  C CD  . GLU A 1 109 ? 23.408  -24.839 -1.043  1.00 34.71 ? 272 GLU A CD  1 
ATOM   843  O OE1 . GLU A 1 109 ? 22.667  -24.856 -2.063  1.00 37.36 ? 272 GLU A OE1 1 
ATOM   844  O OE2 . GLU A 1 109 ? 23.034  -25.242 0.086   1.00 37.11 ? 272 GLU A OE2 1 
ATOM   845  N N   . ILE A 1 110 ? 27.124  -22.013 -1.946  1.00 21.05 ? 273 ILE A N   1 
ATOM   846  C CA  . ILE A 1 110 ? 26.947  -20.721 -2.622  1.00 22.65 ? 273 ILE A CA  1 
ATOM   847  C C   . ILE A 1 110 ? 25.541  -20.791 -3.257  1.00 24.43 ? 273 ILE A C   1 
ATOM   848  O O   . ILE A 1 110 ? 25.362  -21.281 -4.374  1.00 24.93 ? 273 ILE A O   1 
ATOM   849  C CB  . ILE A 1 110 ? 28.061  -20.430 -3.672  1.00 22.48 ? 273 ILE A CB  1 
ATOM   850  C CG1 . ILE A 1 110 ? 29.460  -20.425 -3.009  1.00 22.03 ? 273 ILE A CG1 1 
ATOM   851  C CG2 . ILE A 1 110 ? 27.800  -19.087 -4.411  1.00 21.32 ? 273 ILE A CG2 1 
ATOM   852  C CD1 . ILE A 1 110 ? 30.598  -20.755 -3.983  1.00 22.09 ? 273 ILE A CD1 1 
ATOM   853  N N   . ASP A 1 111 ? 24.546  -20.343 -2.505  1.00 24.96 ? 274 ASP A N   1 
ATOM   854  C CA  . ASP A 1 111 ? 23.190  -20.287 -3.023  1.00 26.63 ? 274 ASP A CA  1 
ATOM   855  C C   . ASP A 1 111 ? 22.779  -18.819 -3.250  1.00 27.25 ? 274 ASP A C   1 
ATOM   856  O O   . ASP A 1 111 ? 23.618  -17.908 -3.183  1.00 26.63 ? 274 ASP A O   1 
ATOM   857  C CB  . ASP A 1 111 ? 22.230  -21.039 -2.081  1.00 26.13 ? 274 ASP A CB  1 
ATOM   858  C CG  . ASP A 1 111 ? 22.057  -20.359 -0.704  1.00 28.93 ? 274 ASP A CG  1 
ATOM   859  O OD1 . ASP A 1 111 ? 22.596  -19.259 -0.440  1.00 29.03 ? 274 ASP A OD1 1 
ATOM   860  O OD2 . ASP A 1 111 ? 21.349  -20.942 0.142   1.00 29.78 ? 274 ASP A OD2 1 
ATOM   861  N N   . GLU A 1 112 ? 21.496  -18.586 -3.499  1.00 27.98 ? 275 GLU A N   1 
ATOM   862  C CA  . GLU A 1 112 ? 21.037  -17.226 -3.829  1.00 30.21 ? 275 GLU A CA  1 
ATOM   863  C C   . GLU A 1 112 ? 21.301  -16.194 -2.741  1.00 29.41 ? 275 GLU A C   1 
ATOM   864  O O   . GLU A 1 112 ? 21.465  -15.022 -3.046  1.00 29.55 ? 275 GLU A O   1 
ATOM   865  C CB  . GLU A 1 112 ? 19.560  -17.211 -4.225  1.00 30.83 ? 275 GLU A CB  1 
ATOM   866  C CG  . GLU A 1 112 ? 18.621  -17.762 -3.137  1.00 36.94 ? 275 GLU A CG  1 
ATOM   867  C CD  . GLU A 1 112 ? 18.423  -19.286 -3.146  1.00 44.81 ? 275 GLU A CD  1 
ATOM   868  O OE1 . GLU A 1 112 ? 17.512  -19.737 -2.397  1.00 48.55 ? 275 GLU A OE1 1 
ATOM   869  O OE2 . GLU A 1 112 ? 19.147  -20.040 -3.869  1.00 48.32 ? 275 GLU A OE2 1 
ATOM   870  N N   . ASP A 1 113 ? 21.361  -16.631 -1.485  1.00 28.54 ? 276 ASP A N   1 
ATOM   871  C CA  . ASP A 1 113 ? 21.648  -15.735 -0.362  1.00 28.92 ? 276 ASP A CA  1 
ATOM   872  C C   . ASP A 1 113 ? 23.139  -15.571 -0.048  1.00 28.21 ? 276 ASP A C   1 
ATOM   873  O O   . ASP A 1 113 ? 23.516  -14.815 0.828   1.00 27.95 ? 276 ASP A O   1 
ATOM   874  C CB  . ASP A 1 113 ? 20.880  -16.193 0.880   1.00 29.53 ? 276 ASP A CB  1 
ATOM   875  C CG  . ASP A 1 113 ? 19.374  -16.201 0.646   1.00 33.08 ? 276 ASP A CG  1 
ATOM   876  O OD1 . ASP A 1 113 ? 18.889  -15.384 -0.182  1.00 37.03 ? 276 ASP A OD1 1 
ATOM   877  O OD2 . ASP A 1 113 ? 18.683  -17.020 1.286   1.00 36.00 ? 276 ASP A OD2 1 
ATOM   878  N N   . SER A 1 114 ? 23.996  -16.241 -0.801  1.00 27.21 ? 277 SER A N   1 
ATOM   879  C CA  . SER A 1 114 ? 25.406  -16.103 -0.546  1.00 26.48 ? 277 SER A CA  1 
ATOM   880  C C   . SER A 1 114 ? 25.972  -14.849 -1.211  1.00 26.85 ? 277 SER A C   1 
ATOM   881  O O   . SER A 1 114 ? 25.654  -14.593 -2.366  1.00 27.85 ? 277 SER A O   1 
ATOM   882  C CB  . SER A 1 114 ? 26.154  -17.311 -1.107  1.00 25.29 ? 277 SER A CB  1 
ATOM   883  O OG  . SER A 1 114 ? 27.517  -16.962 -1.186  1.00 24.39 ? 277 SER A OG  1 
ATOM   884  N N   . PRO A 1 115 ? 26.893  -14.120 -0.534  1.00 26.65 ? 278 PRO A N   1 
ATOM   885  C CA  . PRO A 1 115 ? 27.566  -13.008 -1.214  1.00 25.90 ? 278 PRO A CA  1 
ATOM   886  C C   . PRO A 1 115 ? 28.287  -13.410 -2.491  1.00 26.04 ? 278 PRO A C   1 
ATOM   887  O O   . PRO A 1 115 ? 28.603  -12.559 -3.290  1.00 25.51 ? 278 PRO A O   1 
ATOM   888  C CB  . PRO A 1 115 ? 28.601  -12.515 -0.183  1.00 27.29 ? 278 PRO A CB  1 
ATOM   889  C CG  . PRO A 1 115 ? 28.145  -13.048 1.170   1.00 26.99 ? 278 PRO A CG  1 
ATOM   890  C CD  . PRO A 1 115 ? 27.331  -14.294 0.869   1.00 26.59 ? 278 PRO A CD  1 
ATOM   891  N N   . LEU A 1 116 ? 28.554  -14.702 -2.689  1.00 25.97 ? 279 LEU A N   1 
ATOM   892  C CA  . LEU A 1 116 ? 29.331  -15.163 -3.840  1.00 25.92 ? 279 LEU A CA  1 
ATOM   893  C C   . LEU A 1 116 ? 28.484  -15.700 -4.982  1.00 26.11 ? 279 LEU A C   1 
ATOM   894  O O   . LEU A 1 116 ? 29.010  -16.211 -5.963  1.00 26.16 ? 279 LEU A O   1 
ATOM   895  C CB  . LEU A 1 116 ? 30.318  -16.264 -3.418  1.00 26.37 ? 279 LEU A CB  1 
ATOM   896  C CG  . LEU A 1 116 ? 31.281  -16.171 -2.220  1.00 26.55 ? 279 LEU A CG  1 
ATOM   897  C CD1 . LEU A 1 116 ? 32.426  -17.114 -2.565  1.00 29.32 ? 279 LEU A CD1 1 
ATOM   898  C CD2 . LEU A 1 116 ? 31.844  -14.788 -2.031  1.00 30.99 ? 279 LEU A CD2 1 
ATOM   899  N N   . TYR A 1 117 ? 27.168  -15.629 -4.831  1.00 26.40 ? 280 TYR A N   1 
ATOM   900  C CA  . TYR A 1 117 ? 26.257  -16.215 -5.782  1.00 26.21 ? 280 TYR A CA  1 
ATOM   901  C C   . TYR A 1 117 ? 26.580  -15.829 -7.235  1.00 27.31 ? 280 TYR A C   1 
ATOM   902  O O   . TYR A 1 117 ? 26.586  -16.674 -8.120  1.00 26.75 ? 280 TYR A O   1 
ATOM   903  C CB  . TYR A 1 117 ? 24.871  -15.777 -5.409  1.00 26.21 ? 280 TYR A CB  1 
ATOM   904  C CG  . TYR A 1 117 ? 23.780  -16.461 -6.158  1.00 25.33 ? 280 TYR A CG  1 
ATOM   905  C CD1 . TYR A 1 117 ? 23.759  -17.849 -6.264  1.00 25.67 ? 280 TYR A CD1 1 
ATOM   906  C CD2 . TYR A 1 117 ? 22.738  -15.723 -6.738  1.00 26.11 ? 280 TYR A CD2 1 
ATOM   907  C CE1 . TYR A 1 117 ? 22.763  -18.511 -6.914  1.00 24.13 ? 280 TYR A CE1 1 
ATOM   908  C CE2 . TYR A 1 117 ? 21.694  -16.387 -7.429  1.00 25.72 ? 280 TYR A CE2 1 
ATOM   909  C CZ  . TYR A 1 117 ? 21.732  -17.776 -7.507  1.00 27.26 ? 280 TYR A CZ  1 
ATOM   910  O OH  . TYR A 1 117 ? 20.745  -18.478 -8.146  1.00 30.56 ? 280 TYR A OH  1 
ATOM   911  N N   . ASP A 1 118 ? 26.887  -14.561 -7.481  1.00 28.32 ? 281 ASP A N   1 
ATOM   912  C CA  . ASP A 1 118 ? 27.209  -14.123 -8.848  1.00 29.79 ? 281 ASP A CA  1 
ATOM   913  C C   . ASP A 1 118 ? 28.655  -14.183 -9.278  1.00 29.50 ? 281 ASP A C   1 
ATOM   914  O O   . ASP A 1 118 ? 29.020  -13.567 -10.289 1.00 29.50 ? 281 ASP A O   1 
ATOM   915  C CB  . ASP A 1 118 ? 26.746  -12.690 -9.060  1.00 31.67 ? 281 ASP A CB  1 
ATOM   916  C CG  . ASP A 1 118 ? 25.325  -12.621 -9.467  1.00 36.48 ? 281 ASP A CG  1 
ATOM   917  O OD1 . ASP A 1 118 ? 25.026  -12.953 -10.663 1.00 40.69 ? 281 ASP A OD1 1 
ATOM   918  O OD2 . ASP A 1 118 ? 24.512  -12.245 -8.583  1.00 41.49 ? 281 ASP A OD2 1 
ATOM   919  N N   . LEU A 1 119 ? 29.501  -14.907 -8.569  1.00 28.33 ? 282 LEU A N   1 
ATOM   920  C CA  . LEU A 1 119 ? 30.918  -14.805 -8.896  1.00 27.82 ? 282 LEU A CA  1 
ATOM   921  C C   . LEU A 1 119 ? 31.409  -16.031 -9.636  1.00 26.43 ? 282 LEU A C   1 
ATOM   922  O O   . LEU A 1 119 ? 31.247  -17.128 -9.170  1.00 25.64 ? 282 LEU A O   1 
ATOM   923  C CB  . LEU A 1 119 ? 31.738  -14.545 -7.632  1.00 28.44 ? 282 LEU A CB  1 
ATOM   924  C CG  . LEU A 1 119 ? 31.262  -13.309 -6.842  1.00 30.70 ? 282 LEU A CG  1 
ATOM   925  C CD1 . LEU A 1 119 ? 32.269  -13.031 -5.745  1.00 34.28 ? 282 LEU A CD1 1 
ATOM   926  C CD2 . LEU A 1 119 ? 31.066  -12.035 -7.724  1.00 34.39 ? 282 LEU A CD2 1 
ATOM   927  N N   . SER A 1 120 ? 31.954  -15.807 -10.815 1.00 25.70 ? 283 SER A N   1 
ATOM   928  C CA  . SER A 1 120 ? 32.528  -16.836 -11.661 1.00 25.31 ? 283 SER A CA  1 
ATOM   929  C C   . SER A 1 120 ? 33.987  -16.931 -11.312 1.00 25.22 ? 283 SER A C   1 
ATOM   930  O O   . SER A 1 120 ? 34.477  -16.125 -10.520 1.00 23.66 ? 283 SER A O   1 
ATOM   931  C CB  . SER A 1 120 ? 32.388  -16.418 -13.132 1.00 25.95 ? 283 SER A CB  1 
ATOM   932  O OG  . SER A 1 120 ? 33.269  -15.334 -13.390 1.00 26.54 ? 283 SER A OG  1 
ATOM   933  N N   . LYS A 1 121 ? 34.691  -17.886 -11.912 1.00 25.36 ? 284 LYS A N   1 
ATOM   934  C CA  . LYS A 1 121 ? 36.078  -18.076 -11.620 1.00 27.44 ? 284 LYS A CA  1 
ATOM   935  C C   . LYS A 1 121 ? 36.865  -16.836 -12.073 1.00 29.38 ? 284 LYS A C   1 
ATOM   936  O O   . LYS A 1 121 ? 37.813  -16.406 -11.426 1.00 26.88 ? 284 LYS A O   1 
ATOM   937  C CB  . LYS A 1 121 ? 36.611  -19.273 -12.388 1.00 28.05 ? 284 LYS A CB  1 
ATOM   938  C CG  . LYS A 1 121 ? 38.091  -19.454 -12.142 1.00 30.15 ? 284 LYS A CG  1 
ATOM   939  C CD  . LYS A 1 121 ? 38.772  -19.873 -13.375 1.00 36.94 ? 284 LYS A CD  1 
ATOM   940  C CE  . LYS A 1 121 ? 40.241  -19.512 -13.296 1.00 39.76 ? 284 LYS A CE  1 
ATOM   941  N NZ  . LYS A 1 121 ? 40.919  -20.547 -12.512 1.00 40.28 ? 284 LYS A NZ  1 
ATOM   942  N N   . GLN A 1 122 ? 36.460  -16.309 -13.230 1.00 31.48 ? 285 GLN A N   1 
ATOM   943  C CA  . GLN A 1 122 ? 37.025  -15.090 -13.790 1.00 34.22 ? 285 GLN A CA  1 
ATOM   944  C C   . GLN A 1 122 ? 36.819  -13.901 -12.839 1.00 33.84 ? 285 GLN A C   1 
ATOM   945  O O   . GLN A 1 122 ? 37.777  -13.187 -12.531 1.00 34.45 ? 285 GLN A O   1 
ATOM   946  C CB  . GLN A 1 122 ? 36.338  -14.844 -15.132 1.00 35.11 ? 285 GLN A CB  1 
ATOM   947  C CG  . GLN A 1 122 ? 37.303  -14.736 -16.282 1.00 41.95 ? 285 GLN A CG  1 
ATOM   948  C CD  . GLN A 1 122 ? 37.764  -13.311 -16.474 1.00 45.98 ? 285 GLN A CD  1 
ATOM   949  O OE1 . GLN A 1 122 ? 38.903  -12.954 -16.096 1.00 49.45 ? 285 GLN A OE1 1 
ATOM   950  N NE2 . GLN A 1 122 ? 36.884  -12.475 -17.054 1.00 45.04 ? 285 GLN A NE2 1 
ATOM   951  N N   . ASP A 1 123 ? 35.586  -13.696 -12.370 1.00 33.98 ? 286 ASP A N   1 
ATOM   952  C CA  . ASP A 1 123 ? 35.271  -12.680 -11.347 1.00 35.07 ? 286 ASP A CA  1 
ATOM   953  C C   . ASP A 1 123 ? 36.196  -12.794 -10.130 1.00 35.57 ? 286 ASP A C   1 
ATOM   954  O O   . ASP A 1 123 ? 36.836  -11.824 -9.737  1.00 35.69 ? 286 ASP A O   1 
ATOM   955  C CB  . ASP A 1 123 ? 33.814  -12.802 -10.848 1.00 35.42 ? 286 ASP A CB  1 
ATOM   956  C CG  . ASP A 1 123 ? 32.797  -12.331 -11.854 1.00 38.07 ? 286 ASP A CG  1 
ATOM   957  O OD1 . ASP A 1 123 ? 33.123  -11.412 -12.635 1.00 40.37 ? 286 ASP A OD1 1 
ATOM   958  O OD2 . ASP A 1 123 ? 31.656  -12.878 -11.873 1.00 40.49 ? 286 ASP A OD2 1 
ATOM   959  N N   . ILE A 1 124 ? 36.268  -13.975 -9.524  1.00 35.38 ? 287 ILE A N   1 
ATOM   960  C CA  . ILE A 1 124 ? 37.172  -14.169 -8.383  1.00 36.06 ? 287 ILE A CA  1 
ATOM   961  C C   . ILE A 1 124 ? 38.643  -13.821 -8.721  1.00 36.31 ? 287 ILE A C   1 
ATOM   962  O O   . ILE A 1 124 ? 39.330  -13.200 -7.903  1.00 35.99 ? 287 ILE A O   1 
ATOM   963  C CB  . ILE A 1 124 ? 37.072  -15.614 -7.776  1.00 35.73 ? 287 ILE A CB  1 
ATOM   964  C CG1 . ILE A 1 124 ? 35.606  -16.058 -7.586  1.00 35.23 ? 287 ILE A CG1 1 
ATOM   965  C CG2 . ILE A 1 124 ? 37.797  -15.694 -6.460  1.00 35.26 ? 287 ILE A CG2 1 
ATOM   966  C CD1 . ILE A 1 124 ? 34.870  -15.532 -6.374  1.00 34.80 ? 287 ILE A CD1 1 
ATOM   967  N N   . ASP A 1 125 ? 39.109  -14.219 -9.911  1.00 37.08 ? 288 ASP A N   1 
ATOM   968  C CA  . ASP A 1 125 ? 40.465  -13.878 -10.394 1.00 38.47 ? 288 ASP A CA  1 
ATOM   969  C C   . ASP A 1 125 ? 40.759  -12.368 -10.397 1.00 38.63 ? 288 ASP A C   1 
ATOM   970  O O   . ASP A 1 125 ? 41.916  -11.964 -10.321 1.00 38.91 ? 288 ASP A O   1 
ATOM   971  C CB  . ASP A 1 125 ? 40.703  -14.426 -11.806 1.00 38.98 ? 288 ASP A CB  1 
ATOM   972  C CG  . ASP A 1 125 ? 40.908  -15.928 -11.833 1.00 41.57 ? 288 ASP A CG  1 
ATOM   973  O OD1 . ASP A 1 125 ? 41.222  -16.515 -10.772 1.00 47.30 ? 288 ASP A OD1 1 
ATOM   974  O OD2 . ASP A 1 125 ? 40.771  -16.530 -12.921 1.00 43.77 ? 288 ASP A OD2 1 
ATOM   975  N N   . ASN A 1 126 ? 39.718  -11.540 -10.454 1.00 38.72 ? 289 ASN A N   1 
ATOM   976  C CA  . ASN A 1 126 ? 39.902  -10.092 -10.523 1.00 39.16 ? 289 ASN A CA  1 
ATOM   977  C C   . ASN A 1 126 ? 39.336  -9.350  -9.335  1.00 38.07 ? 289 ASN A C   1 
ATOM   978  O O   . ASN A 1 126 ? 39.204  -8.131  -9.366  1.00 38.03 ? 289 ASN A O   1 
ATOM   979  C CB  . ASN A 1 126 ? 39.318  -9.544  -11.841 1.00 39.86 ? 289 ASN A CB  1 
ATOM   980  C CG  . ASN A 1 126 ? 40.044  -10.081 -13.043 1.00 41.07 ? 289 ASN A CG  1 
ATOM   981  O OD1 . ASN A 1 126 ? 41.275  -10.000 -13.123 1.00 45.58 ? 289 ASN A OD1 1 
ATOM   982  N ND2 . ASN A 1 126 ? 39.301  -10.693 -13.959 1.00 43.02 ? 289 ASN A ND2 1 
ATOM   983  N N   . ALA A 1 127 ? 38.995  -10.105 -8.291  1.00 36.44 ? 290 ALA A N   1 
ATOM   984  C CA  . ALA A 1 127 ? 38.391  -9.562  -7.103  1.00 34.23 ? 290 ALA A CA  1 
ATOM   985  C C   . ALA A 1 127 ? 39.442  -9.276  -6.011  1.00 33.28 ? 290 ALA A C   1 
ATOM   986  O O   . ALA A 1 127 ? 40.578  -9.773  -6.052  1.00 32.64 ? 290 ALA A O   1 
ATOM   987  C CB  . ALA A 1 127 ? 37.329  -10.518 -6.602  1.00 34.51 ? 290 ALA A CB  1 
ATOM   988  N N   . ASP A 1 128 ? 39.058  -8.478  -5.030  1.00 33.08 ? 291 ASP A N   1 
ATOM   989  C CA  . ASP A 1 128 ? 40.000  -8.038  -3.998  1.00 33.15 ? 291 ASP A CA  1 
ATOM   990  C C   . ASP A 1 128 ? 39.473  -8.282  -2.565  1.00 31.52 ? 291 ASP A C   1 
ATOM   991  O O   . ASP A 1 128 ? 40.086  -7.830  -1.578  1.00 31.72 ? 291 ASP A O   1 
ATOM   992  C CB  . ASP A 1 128 ? 40.394  -6.547  -4.230  1.00 34.51 ? 291 ASP A CB  1 
ATOM   993  C CG  . ASP A 1 128 ? 39.275  -5.570  -3.820  1.00 39.60 ? 291 ASP A CG  1 
ATOM   994  O OD1 . ASP A 1 128 ? 38.069  -5.805  -4.145  1.00 43.17 ? 291 ASP A OD1 1 
ATOM   995  O OD2 . ASP A 1 128 ? 39.599  -4.569  -3.146  1.00 42.79 ? 291 ASP A OD2 1 
ATOM   996  N N   . PHE A 1 129 ? 38.340  -8.984  -2.452  1.00 28.65 ? 292 PHE A N   1 
ATOM   997  C CA  . PHE A 1 129 ? 37.690  -9.169  -1.145  1.00 25.69 ? 292 PHE A CA  1 
ATOM   998  C C   . PHE A 1 129 ? 38.493  -10.064 -0.180  1.00 22.85 ? 292 PHE A C   1 
ATOM   999  O O   . PHE A 1 129 ? 39.458  -10.723 -0.578  1.00 21.38 ? 292 PHE A O   1 
ATOM   1000 C CB  . PHE A 1 129 ? 36.252  -9.676  -1.322  1.00 25.77 ? 292 PHE A CB  1 
ATOM   1001 C CG  . PHE A 1 129 ? 36.137  -11.038 -1.979  1.00 27.99 ? 292 PHE A CG  1 
ATOM   1002 C CD1 . PHE A 1 129 ? 36.281  -12.219 -1.222  1.00 28.17 ? 292 PHE A CD1 1 
ATOM   1003 C CD2 . PHE A 1 129 ? 35.794  -11.139 -3.339  1.00 29.16 ? 292 PHE A CD2 1 
ATOM   1004 C CE1 . PHE A 1 129 ? 36.140  -13.493 -1.817  1.00 30.08 ? 292 PHE A CE1 1 
ATOM   1005 C CE2 . PHE A 1 129 ? 35.643  -12.392 -3.955  1.00 30.31 ? 292 PHE A CE2 1 
ATOM   1006 C CZ  . PHE A 1 129 ? 35.820  -13.592 -3.180  1.00 32.65 ? 292 PHE A CZ  1 
ATOM   1007 N N   . GLU A 1 130 ? 38.086  -10.083 1.091   1.00 22.27 ? 293 GLU A N   1 
ATOM   1008 C CA  . GLU A 1 130 ? 38.754  -10.889 2.120   1.00 19.35 ? 293 GLU A CA  1 
ATOM   1009 C C   . GLU A 1 130 ? 37.669  -11.626 2.917   1.00 20.26 ? 293 GLU A C   1 
ATOM   1010 O O   . GLU A 1 130 ? 36.644  -11.033 3.306   1.00 19.85 ? 293 GLU A O   1 
ATOM   1011 C CB  . GLU A 1 130 ? 39.598  -10.014 3.051   1.00 19.34 ? 293 GLU A CB  1 
ATOM   1012 C CG  . GLU A 1 130 ? 40.305  -10.792 4.174   1.00 19.20 ? 293 GLU A CG  1 
ATOM   1013 C CD  . GLU A 1 130 ? 41.210  -9.918  5.034   1.00 18.93 ? 293 GLU A CD  1 
ATOM   1014 O OE1 . GLU A 1 130 ? 41.834  -10.447 5.965   1.00 21.72 ? 293 GLU A OE1 1 
ATOM   1015 O OE2 . GLU A 1 130 ? 41.301  -8.698  4.800   1.00 19.95 ? 293 GLU A OE2 1 
ATOM   1016 N N   . ILE A 1 131 ? 37.869  -12.923 3.094   1.00 19.09 ? 294 ILE A N   1 
ATOM   1017 C CA  . ILE A 1 131 ? 36.962  -13.736 3.899   1.00 18.77 ? 294 ILE A CA  1 
ATOM   1018 C C   . ILE A 1 131 ? 37.688  -14.173 5.163   1.00 17.94 ? 294 ILE A C   1 
ATOM   1019 O O   . ILE A 1 131 ? 38.713  -14.828 5.094   1.00 18.13 ? 294 ILE A O   1 
ATOM   1020 C CB  . ILE A 1 131 ? 36.407  -14.899 3.079   1.00 18.31 ? 294 ILE A CB  1 
ATOM   1021 C CG1 . ILE A 1 131 ? 35.460  -14.368 2.003   1.00 20.19 ? 294 ILE A CG1 1 
ATOM   1022 C CG2 . ILE A 1 131 ? 35.635  -15.912 3.993   1.00 18.01 ? 294 ILE A CG2 1 
ATOM   1023 C CD1 . ILE A 1 131 ? 34.944  -15.430 1.074   1.00 20.78 ? 294 ILE A CD1 1 
ATOM   1024 N N   . VAL A 1 132 ? 37.179  -13.768 6.325   1.00 17.41 ? 295 VAL A N   1 
ATOM   1025 C CA  . VAL A 1 132 ? 37.785  -14.175 7.585   1.00 17.10 ? 295 VAL A CA  1 
ATOM   1026 C C   . VAL A 1 132 ? 37.020  -15.414 8.030   1.00 15.89 ? 295 VAL A C   1 
ATOM   1027 O O   . VAL A 1 132 ? 35.790  -15.490 7.853   1.00 15.30 ? 295 VAL A O   1 
ATOM   1028 C CB  . VAL A 1 132 ? 37.623  -13.116 8.724   1.00 18.10 ? 295 VAL A CB  1 
ATOM   1029 C CG1 . VAL A 1 132 ? 38.290  -13.639 10.039  1.00 17.57 ? 295 VAL A CG1 1 
ATOM   1030 C CG2 . VAL A 1 132 ? 38.300  -11.844 8.330   1.00 23.26 ? 295 VAL A CG2 1 
ATOM   1031 N N   . VAL A 1 133 ? 37.763  -16.363 8.577   1.00 15.64 ? 296 VAL A N   1 
ATOM   1032 C CA  . VAL A 1 133 ? 37.201  -17.622 9.026   1.00 14.85 ? 296 VAL A CA  1 
ATOM   1033 C C   . VAL A 1 133 ? 37.623  -17.752 10.463  1.00 15.47 ? 296 VAL A C   1 
ATOM   1034 O O   . VAL A 1 133 ? 38.688  -17.260 10.836  1.00 14.42 ? 296 VAL A O   1 
ATOM   1035 C CB  . VAL A 1 133 ? 37.668  -18.834 8.153   1.00 15.13 ? 296 VAL A CB  1 
ATOM   1036 C CG1 . VAL A 1 133 ? 37.036  -18.731 6.746   1.00 12.43 ? 296 VAL A CG1 1 
ATOM   1037 C CG2 . VAL A 1 133 ? 39.186  -18.902 8.097   1.00 12.87 ? 296 VAL A CG2 1 
ATOM   1038 N N   . ILE A 1 134 ? 36.727  -18.320 11.278  1.00 15.41 ? 297 ILE A N   1 
ATOM   1039 C CA  . ILE A 1 134 ? 36.897  -18.351 12.717  1.00 16.02 ? 297 ILE A CA  1 
ATOM   1040 C C   . ILE A 1 134 ? 36.407  -19.686 13.213  1.00 14.71 ? 297 ILE A C   1 
ATOM   1041 O O   . ILE A 1 134 ? 35.399  -20.230 12.720  1.00 14.54 ? 297 ILE A O   1 
ATOM   1042 C CB  . ILE A 1 134 ? 36.065  -17.228 13.441  1.00 17.49 ? 297 ILE A CB  1 
ATOM   1043 C CG1 . ILE A 1 134 ? 36.665  -15.815 13.173  1.00 20.85 ? 297 ILE A CG1 1 
ATOM   1044 C CG2 . ILE A 1 134 ? 35.999  -17.502 14.943  1.00 16.76 ? 297 ILE A CG2 1 
ATOM   1045 C CD1 . ILE A 1 134 ? 35.599  -14.701 13.285  1.00 23.97 ? 297 ILE A CD1 1 
ATOM   1046 N N   . LEU A 1 135 ? 37.148  -20.193 14.189  1.00 13.79 ? 298 LEU A N   1 
ATOM   1047 C CA  . LEU A 1 135 ? 36.789  -21.406 14.940  1.00 14.02 ? 298 LEU A CA  1 
ATOM   1048 C C   . LEU A 1 135 ? 36.939  -20.985 16.396  1.00 14.18 ? 298 LEU A C   1 
ATOM   1049 O O   . LEU A 1 135 ? 38.021  -20.495 16.807  1.00 14.63 ? 298 LEU A O   1 
ATOM   1050 C CB  . LEU A 1 135 ? 37.767  -22.565 14.612  1.00 13.25 ? 298 LEU A CB  1 
ATOM   1051 C CG  . LEU A 1 135 ? 37.633  -23.811 15.537  1.00 15.62 ? 298 LEU A CG  1 
ATOM   1052 C CD1 . LEU A 1 135 ? 36.240  -24.437 15.382  1.00 11.21 ? 298 LEU A CD1 1 
ATOM   1053 C CD2 . LEU A 1 135 ? 38.776  -24.850 15.314  1.00 18.47 ? 298 LEU A CD2 1 
ATOM   1054 N N   . GLU A 1 136 ? 35.868  -21.190 17.165  1.00 14.40 ? 299 GLU A N   1 
ATOM   1055 C CA  . GLU A 1 136 ? 35.818  -20.856 18.589  1.00 16.22 ? 299 GLU A CA  1 
ATOM   1056 C C   . GLU A 1 136 ? 35.422  -22.094 19.392  1.00 16.01 ? 299 GLU A C   1 
ATOM   1057 O O   . GLU A 1 136 ? 34.646  -22.904 18.916  1.00 16.85 ? 299 GLU A O   1 
ATOM   1058 C CB  . GLU A 1 136 ? 34.806  -19.720 18.883  1.00 15.96 ? 299 GLU A CB  1 
ATOM   1059 C CG  . GLU A 1 136 ? 35.307  -18.315 18.411  1.00 17.78 ? 299 GLU A CG  1 
ATOM   1060 C CD  . GLU A 1 136 ? 34.202  -17.300 18.291  1.00 19.53 ? 299 GLU A CD  1 
ATOM   1061 O OE1 . GLU A 1 136 ? 33.094  -17.633 17.781  1.00 20.98 ? 299 GLU A OE1 1 
ATOM   1062 O OE2 . GLU A 1 136 ? 34.456  -16.154 18.696  1.00 19.21 ? 299 GLU A OE2 1 
ATOM   1063 N N   . GLY A 1 137 ? 35.879  -22.193 20.626  1.00 15.91 ? 300 GLY A N   1 
ATOM   1064 C CA  . GLY A 1 137 ? 35.482  -23.314 21.505  1.00 16.92 ? 300 GLY A CA  1 
ATOM   1065 C C   . GLY A 1 137 ? 36.307  -23.241 22.756  1.00 16.51 ? 300 GLY A C   1 
ATOM   1066 O O   . GLY A 1 137 ? 37.148  -22.348 22.875  1.00 16.93 ? 300 GLY A O   1 
ATOM   1067 N N   . MET A 1 138 ? 36.107  -24.182 23.676  1.00 16.40 ? 301 MET A N   1 
ATOM   1068 C CA  . MET A 1 138 ? 36.854  -24.221 24.944  1.00 17.18 ? 301 MET A CA  1 
ATOM   1069 C C   . MET A 1 138 ? 37.799  -25.388 24.948  1.00 17.68 ? 301 MET A C   1 
ATOM   1070 O O   . MET A 1 138 ? 37.398  -26.505 24.576  1.00 16.81 ? 301 MET A O   1 
ATOM   1071 C CB  . MET A 1 138 ? 35.892  -24.381 26.120  1.00 16.73 ? 301 MET A CB  1 
ATOM   1072 C CG  . MET A 1 138 ? 34.904  -23.225 26.228  1.00 19.33 ? 301 MET A CG  1 
ATOM   1073 S SD  . MET A 1 138 ? 33.816  -23.524 27.645  1.00 25.17 ? 301 MET A SD  1 
ATOM   1074 C CE  . MET A 1 138 ? 32.621  -24.595 26.850  1.00 22.65 ? 301 MET A CE  1 
ATOM   1075 N N   . VAL A 1 139 ? 39.051  -25.155 25.335  1.00 17.21 ? 302 VAL A N   1 
ATOM   1076 C CA  . VAL A 1 139 ? 39.978  -26.278 25.527  1.00 18.39 ? 302 VAL A CA  1 
ATOM   1077 C C   . VAL A 1 139 ? 39.455  -27.125 26.677  1.00 19.09 ? 302 VAL A C   1 
ATOM   1078 O O   . VAL A 1 139 ? 39.239  -26.599 27.780  1.00 17.88 ? 302 VAL A O   1 
ATOM   1079 C CB  . VAL A 1 139 ? 41.385  -25.816 25.893  1.00 18.91 ? 302 VAL A CB  1 
ATOM   1080 C CG1 . VAL A 1 139 ? 42.317  -27.047 26.071  1.00 19.96 ? 302 VAL A CG1 1 
ATOM   1081 C CG2 . VAL A 1 139 ? 41.930  -24.840 24.837  1.00 21.13 ? 302 VAL A CG2 1 
ATOM   1082 N N   . GLU A 1 140 ? 39.241  -28.424 26.437  1.00 19.52 ? 303 GLU A N   1 
ATOM   1083 C CA  . GLU A 1 140 ? 38.649  -29.341 27.457  1.00 21.38 ? 303 GLU A CA  1 
ATOM   1084 C C   . GLU A 1 140 ? 39.372  -29.217 28.829  1.00 22.41 ? 303 GLU A C   1 
ATOM   1085 O O   . GLU A 1 140 ? 38.739  -29.035 29.879  1.00 22.26 ? 303 GLU A O   1 
ATOM   1086 C CB  . GLU A 1 140 ? 38.713  -30.806 26.992  1.00 21.10 ? 303 GLU A CB  1 
ATOM   1087 C CG  . GLU A 1 140 ? 37.982  -31.817 27.915  1.00 25.13 ? 303 GLU A CG  1 
ATOM   1088 C CD  . GLU A 1 140 ? 37.980  -33.241 27.315  1.00 30.89 ? 303 GLU A CD  1 
ATOM   1089 O OE1 . GLU A 1 140 ? 38.866  -33.531 26.457  1.00 35.67 ? 303 GLU A OE1 1 
ATOM   1090 O OE2 . GLU A 1 140 ? 37.104  -34.053 27.672  1.00 32.63 ? 303 GLU A OE2 1 
ATOM   1091 N N   . ALA A 1 141 ? 40.702  -29.303 28.789  1.00 22.63 ? 304 ALA A N   1 
ATOM   1092 C CA  . ALA A 1 141 ? 41.494  -29.440 29.995  1.00 22.72 ? 304 ALA A CA  1 
ATOM   1093 C C   . ALA A 1 141 ? 41.459  -28.179 30.887  1.00 23.20 ? 304 ALA A C   1 
ATOM   1094 O O   . ALA A 1 141 ? 41.535  -28.286 32.137  1.00 23.94 ? 304 ALA A O   1 
ATOM   1095 C CB  . ALA A 1 141 ? 42.955  -29.859 29.629  1.00 21.69 ? 304 ALA A CB  1 
ATOM   1096 N N   . THR A 1 142 ? 41.304  -26.997 30.285  1.00 22.52 ? 305 THR A N   1 
ATOM   1097 C CA  . THR A 1 142 ? 41.404  -25.749 31.069  1.00 22.13 ? 305 THR A CA  1 
ATOM   1098 C C   . THR A 1 142 ? 40.253  -24.785 30.912  1.00 22.25 ? 305 THR A C   1 
ATOM   1099 O O   . THR A 1 142 ? 40.276  -23.695 31.504  1.00 22.28 ? 305 THR A O   1 
ATOM   1100 C CB  . THR A 1 142 ? 42.603  -24.958 30.632  1.00 21.60 ? 305 THR A CB  1 
ATOM   1101 O OG1 . THR A 1 142 ? 42.448  -24.677 29.245  1.00 21.40 ? 305 THR A OG1 1 
ATOM   1102 C CG2 . THR A 1 142 ? 43.891  -25.752 30.806  1.00 23.98 ? 305 THR A CG2 1 
ATOM   1103 N N   . ALA A 1 143 ? 39.268  -25.147 30.095  1.00 22.58 ? 306 ALA A N   1 
ATOM   1104 C CA  . ALA A 1 143 ? 38.161  -24.230 29.692  1.00 22.28 ? 306 ALA A CA  1 
ATOM   1105 C C   . ALA A 1 143 ? 38.620  -22.914 29.012  1.00 23.47 ? 306 ALA A C   1 
ATOM   1106 O O   . ALA A 1 143 ? 37.806  -22.031 28.821  1.00 24.65 ? 306 ALA A O   1 
ATOM   1107 C CB  . ALA A 1 143 ? 37.194  -23.918 30.884  1.00 21.51 ? 306 ALA A CB  1 
ATOM   1108 N N   . MET A 1 144 ? 39.898  -22.792 28.649  1.00 23.36 ? 307 MET A N   1 
ATOM   1109 C CA  . MET A 1 144 ? 40.391  -21.662 27.845  1.00 24.15 ? 307 MET A CA  1 
ATOM   1110 C C   . MET A 1 144 ? 39.568  -21.467 26.564  1.00 23.66 ? 307 MET A C   1 
ATOM   1111 O O   . MET A 1 144 ? 39.513  -22.361 25.721  1.00 22.36 ? 307 MET A O   1 
ATOM   1112 C CB  . MET A 1 144 ? 41.839  -21.880 27.411  1.00 24.14 ? 307 MET A CB  1 
ATOM   1113 C CG  . MET A 1 144 ? 42.907  -21.627 28.448  1.00 31.64 ? 307 MET A CG  1 
ATOM   1114 S SD  . MET A 1 144 ? 44.613  -21.620 27.702  1.00 43.83 ? 307 MET A SD  1 
ATOM   1115 C CE  . MET A 1 144 ? 44.243  -21.059 26.019  1.00 21.08 ? 307 MET A CE  1 
ATOM   1116 N N   . THR A 1 145 ? 38.957  -20.294 26.406  1.00 22.12 ? 308 THR A N   1 
ATOM   1117 C CA  . THR A 1 145 ? 38.237  -19.997 25.195  1.00 22.38 ? 308 THR A CA  1 
ATOM   1118 C C   . THR A 1 145 ? 39.201  -19.569 24.077  1.00 21.47 ? 308 THR A C   1 
ATOM   1119 O O   . THR A 1 145 ? 39.940  -18.596 24.203  1.00 22.30 ? 308 THR A O   1 
ATOM   1120 C CB  . THR A 1 145 ? 37.147  -18.931 25.420  1.00 23.02 ? 308 THR A CB  1 
ATOM   1121 O OG1 . THR A 1 145 ? 36.250  -19.387 26.432  1.00 24.24 ? 308 THR A OG1 1 
ATOM   1122 C CG2 . THR A 1 145 ? 36.354  -18.788 24.143  1.00 25.02 ? 308 THR A CG2 1 
ATOM   1123 N N   . LYS A 1 146 ? 39.212  -20.314 22.990  1.00 20.36 ? 309 LYS A N   1 
ATOM   1124 C CA  . LYS A 1 146 ? 40.049  -19.944 21.852  1.00 20.33 ? 309 LYS A CA  1 
ATOM   1125 C C   . LYS A 1 146 ? 39.217  -19.327 20.776  1.00 18.92 ? 309 LYS A C   1 
ATOM   1126 O O   . LYS A 1 146 ? 38.042  -19.692 20.621  1.00 18.67 ? 309 LYS A O   1 
ATOM   1127 C CB  . LYS A 1 146 ? 40.705  -21.232 21.300  1.00 21.20 ? 309 LYS A CB  1 
ATOM   1128 C CG  . LYS A 1 146 ? 41.880  -21.641 22.173  1.00 23.99 ? 309 LYS A CG  1 
ATOM   1129 C CD  . LYS A 1 146 ? 42.610  -22.825 21.583  1.00 28.93 ? 309 LYS A CD  1 
ATOM   1130 C CE  . LYS A 1 146 ? 43.969  -23.072 22.246  1.00 33.55 ? 309 LYS A CE  1 
ATOM   1131 N NZ  . LYS A 1 146 ? 44.550  -24.294 21.593  1.00 33.71 ? 309 LYS A NZ  1 
ATOM   1132 N N   . GLN A 1 147 ? 39.806  -18.397 20.036  1.00 16.76 ? 310 GLN A N   1 
ATOM   1133 C CA  . GLN A 1 147 ? 39.242  -17.964 18.793  1.00 16.68 ? 310 GLN A CA  1 
ATOM   1134 C C   . GLN A 1 147 ? 40.367  -18.065 17.773  1.00 18.64 ? 310 GLN A C   1 
ATOM   1135 O O   . GLN A 1 147 ? 41.270  -17.213 17.710  1.00 19.83 ? 310 GLN A O   1 
ATOM   1136 C CB  . GLN A 1 147 ? 38.667  -16.546 18.892  1.00 17.20 ? 310 GLN A CB  1 
ATOM   1137 C CG  . GLN A 1 147 ? 38.113  -15.997 17.599  1.00 15.71 ? 310 GLN A CG  1 
ATOM   1138 C CD  . GLN A 1 147 ? 37.841  -14.540 17.677  1.00 17.49 ? 310 GLN A CD  1 
ATOM   1139 O OE1 . GLN A 1 147 ? 38.740  -13.734 17.580  1.00 19.01 ? 310 GLN A OE1 1 
ATOM   1140 N NE2 . GLN A 1 147 ? 36.580  -14.184 17.849  1.00 18.25 ? 310 GLN A NE2 1 
ATOM   1141 N N   . CYS A 1 148 ? 40.334  -19.147 16.999  1.00 18.21 ? 311 CYS A N   1 
ATOM   1142 C CA  . CYS A 1 148 ? 41.320  -19.310 15.954  1.00 17.30 ? 311 CYS A CA  1 
ATOM   1143 C C   . CYS A 1 148 ? 40.843  -18.529 14.731  1.00 16.40 ? 311 CYS A C   1 
ATOM   1144 O O   . CYS A 1 148 ? 39.701  -18.653 14.349  1.00 15.89 ? 311 CYS A O   1 
ATOM   1145 C CB  . CYS A 1 148 ? 41.471  -20.796 15.650  1.00 16.68 ? 311 CYS A CB  1 
ATOM   1146 S SG  . CYS A 1 148 ? 42.715  -21.036 14.356  1.00 21.75 ? 311 CYS A SG  1 
ATOM   1147 N N   . ARG A 1 149 ? 41.695  -17.687 14.140  1.00 15.92 ? 312 ARG A N   1 
ATOM   1148 C CA  . ARG A 1 149 ? 41.239  -16.867 13.019  1.00 16.90 ? 312 ARG A CA  1 
ATOM   1149 C C   . ARG A 1 149 ? 42.198  -17.101 11.873  1.00 16.67 ? 312 ARG A C   1 
ATOM   1150 O O   . ARG A 1 149 ? 43.386  -17.300 12.080  1.00 16.31 ? 312 ARG A O   1 
ATOM   1151 C CB  . ARG A 1 149 ? 41.300  -15.363 13.347  1.00 17.48 ? 312 ARG A CB  1 
ATOM   1152 C CG  . ARG A 1 149 ? 40.426  -14.897 14.492  1.00 19.68 ? 312 ARG A CG  1 
ATOM   1153 C CD  . ARG A 1 149 ? 40.815  -13.497 14.925  1.00 22.86 ? 312 ARG A CD  1 
ATOM   1154 N NE  . ARG A 1 149 ? 42.153  -13.452 15.509  1.00 22.99 ? 312 ARG A NE  1 
ATOM   1155 C CZ  . ARG A 1 149 ? 42.450  -13.590 16.795  1.00 28.56 ? 312 ARG A CZ  1 
ATOM   1156 N NH1 . ARG A 1 149 ? 41.498  -13.771 17.720  1.00 26.16 ? 312 ARG A NH1 1 
ATOM   1157 N NH2 . ARG A 1 149 ? 43.728  -13.565 17.161  1.00 27.48 ? 312 ARG A NH2 1 
ATOM   1158 N N   . SER A 1 150 ? 41.673  -17.042 10.670  1.00 16.98 ? 313 SER A N   1 
ATOM   1159 C CA  . SER A 1 150 ? 42.525  -16.910 9.483   1.00 16.79 ? 313 SER A CA  1 
ATOM   1160 C C   . SER A 1 150 ? 41.778  -16.073 8.467   1.00 16.50 ? 313 SER A C   1 
ATOM   1161 O O   . SER A 1 150 ? 40.701  -15.530 8.769   1.00 16.18 ? 313 SER A O   1 
ATOM   1162 C CB  . SER A 1 150 ? 42.945  -18.281 8.938   1.00 15.69 ? 313 SER A CB  1 
ATOM   1163 O OG  . SER A 1 150 ? 44.117  -18.133 8.156   1.00 19.03 ? 313 SER A OG  1 
ATOM   1164 N N   . SER A 1 151 ? 42.338  -15.977 7.266   1.00 16.49 ? 314 SER A N   1 
ATOM   1165 C CA  . SER A 1 151 ? 41.850  -15.101 6.237   1.00 17.60 ? 314 SER A CA  1 
ATOM   1166 C C   . SER A 1 151 ? 42.177  -15.694 4.863   1.00 17.71 ? 314 SER A C   1 
ATOM   1167 O O   . SER A 1 151 ? 43.291  -16.207 4.663   1.00 17.34 ? 314 SER A O   1 
ATOM   1168 C CB  . SER A 1 151 ? 42.606  -13.766 6.394   1.00 17.36 ? 314 SER A CB  1 
ATOM   1169 O OG  . SER A 1 151 ? 42.389  -12.897 5.335   1.00 19.27 ? 314 SER A OG  1 
ATOM   1170 N N   . TYR A 1 152 ? 41.204  -15.605 3.946   1.00 16.17 ? 315 TYR A N   1 
ATOM   1171 C CA  . TYR A 1 152 ? 41.408  -15.903 2.549   1.00 15.82 ? 315 TYR A CA  1 
ATOM   1172 C C   . TYR A 1 152 ? 41.065  -14.638 1.762   1.00 16.46 ? 315 TYR A C   1 
ATOM   1173 O O   . TYR A 1 152 ? 39.887  -14.175 1.745   1.00 15.05 ? 315 TYR A O   1 
ATOM   1174 C CB  . TYR A 1 152 ? 40.565  -17.100 2.082   1.00 14.91 ? 315 TYR A CB  1 
ATOM   1175 C CG  . TYR A 1 152 ? 40.780  -18.312 2.943   1.00 15.19 ? 315 TYR A CG  1 
ATOM   1176 C CD1 . TYR A 1 152 ? 41.921  -19.103 2.783   1.00 14.39 ? 315 TYR A CD1 1 
ATOM   1177 C CD2 . TYR A 1 152 ? 39.840  -18.683 3.920   1.00 15.29 ? 315 TYR A CD2 1 
ATOM   1178 C CE1 . TYR A 1 152 ? 42.159  -20.213 3.605   1.00 15.72 ? 315 TYR A CE1 1 
ATOM   1179 C CE2 . TYR A 1 152 ? 40.075  -19.815 4.757   1.00 12.08 ? 315 TYR A CE2 1 
ATOM   1180 C CZ  . TYR A 1 152 ? 41.219  -20.560 4.604   1.00 14.40 ? 315 TYR A CZ  1 
ATOM   1181 O OH  . TYR A 1 152 ? 41.401  -21.664 5.404   1.00 16.07 ? 315 TYR A OH  1 
ATOM   1182 N N   . LEU A 1 153 ? 42.099  -14.072 1.147   1.00 15.89 ? 316 LEU A N   1 
ATOM   1183 C CA  . LEU A 1 153 ? 41.879  -13.128 0.067   1.00 17.73 ? 316 LEU A CA  1 
ATOM   1184 C C   . LEU A 1 153 ? 41.325  -13.880 -1.145  1.00 19.30 ? 316 LEU A C   1 
ATOM   1185 O O   . LEU A 1 153 ? 41.547  -15.094 -1.263  1.00 18.84 ? 316 LEU A O   1 
ATOM   1186 C CB  . LEU A 1 153 ? 43.189  -12.430 -0.298  1.00 17.87 ? 316 LEU A CB  1 
ATOM   1187 C CG  . LEU A 1 153 ? 43.812  -11.577 0.815   1.00 19.40 ? 316 LEU A CG  1 
ATOM   1188 C CD1 . LEU A 1 153 ? 45.056  -10.858 0.247   1.00 22.72 ? 316 LEU A CD1 1 
ATOM   1189 C CD2 . LEU A 1 153 ? 42.804  -10.546 1.374   1.00 20.47 ? 316 LEU A CD2 1 
ATOM   1190 N N   . ALA A 1 154 ? 40.671  -13.150 -2.059  1.00 20.63 ? 317 ALA A N   1 
ATOM   1191 C CA  . ALA A 1 154 ? 40.088  -13.748 -3.269  1.00 22.77 ? 317 ALA A CA  1 
ATOM   1192 C C   . ALA A 1 154 ? 41.078  -14.578 -4.061  1.00 23.68 ? 317 ALA A C   1 
ATOM   1193 O O   . ALA A 1 154 ? 40.718  -15.646 -4.570  1.00 24.39 ? 317 ALA A O   1 
ATOM   1194 C CB  . ALA A 1 154 ? 39.428  -12.679 -4.157  1.00 22.47 ? 317 ALA A CB  1 
ATOM   1195 N N   . ASN A 1 155 ? 42.333  -14.115 -4.122  1.00 25.17 ? 318 ASN A N   1 
ATOM   1196 C CA  . ASN A 1 155 ? 43.426  -14.832 -4.785  1.00 25.75 ? 318 ASN A CA  1 
ATOM   1197 C C   . ASN A 1 155 ? 43.982  -16.039 -4.015  1.00 26.37 ? 318 ASN A C   1 
ATOM   1198 O O   . ASN A 1 155 ? 44.825  -16.783 -4.534  1.00 25.78 ? 318 ASN A O   1 
ATOM   1199 C CB  . ASN A 1 155 ? 44.557  -13.862 -5.202  1.00 26.79 ? 318 ASN A CB  1 
ATOM   1200 C CG  . ASN A 1 155 ? 45.218  -13.152 -4.025  1.00 30.41 ? 318 ASN A CG  1 
ATOM   1201 O OD1 . ASN A 1 155 ? 45.398  -11.924 -4.075  1.00 41.09 ? 318 ASN A OD1 1 
ATOM   1202 N ND2 . ASN A 1 155 ? 45.628  -13.885 -2.997  1.00 28.51 ? 318 ASN A ND2 1 
ATOM   1203 N N   . GLU A 1 156 ? 43.535  -16.230 -2.769  1.00 25.58 ? 319 GLU A N   1 
ATOM   1204 C CA  . GLU A 1 156 ? 43.918  -17.415 -1.987  1.00 24.55 ? 319 GLU A CA  1 
ATOM   1205 C C   . GLU A 1 156 ? 42.846  -18.536 -2.061  1.00 23.33 ? 319 GLU A C   1 
ATOM   1206 O O   . GLU A 1 156 ? 42.994  -19.620 -1.469  1.00 22.76 ? 319 GLU A O   1 
ATOM   1207 C CB  . GLU A 1 156 ? 44.256  -17.000 -0.551  1.00 25.50 ? 319 GLU A CB  1 
ATOM   1208 C CG  . GLU A 1 156 ? 45.373  -15.932 -0.528  1.00 27.21 ? 319 GLU A CG  1 
ATOM   1209 C CD  . GLU A 1 156 ? 45.586  -15.298 0.827   1.00 30.14 ? 319 GLU A CD  1 
ATOM   1210 O OE1 . GLU A 1 156 ? 44.749  -15.520 1.730   1.00 29.32 ? 319 GLU A OE1 1 
ATOM   1211 O OE2 . GLU A 1 156 ? 46.591  -14.549 0.995   1.00 27.74 ? 319 GLU A OE2 1 
ATOM   1212 N N   . ILE A 1 157 ? 41.802  -18.278 -2.847  1.00 21.47 ? 320 ILE A N   1 
ATOM   1213 C CA  . ILE A 1 157 ? 40.770  -19.263 -3.151  1.00 21.38 ? 320 ILE A CA  1 
ATOM   1214 C C   . ILE A 1 157 ? 41.056  -19.999 -4.489  1.00 21.58 ? 320 ILE A C   1 
ATOM   1215 O O   . ILE A 1 157 ? 41.153  -19.367 -5.548  1.00 22.08 ? 320 ILE A O   1 
ATOM   1216 C CB  . ILE A 1 157 ? 39.326  -18.621 -3.226  1.00 20.63 ? 320 ILE A CB  1 
ATOM   1217 C CG1 . ILE A 1 157 ? 39.007  -17.835 -1.935  1.00 21.35 ? 320 ILE A CG1 1 
ATOM   1218 C CG2 . ILE A 1 157 ? 38.270  -19.736 -3.383  1.00 20.64 ? 320 ILE A CG2 1 
ATOM   1219 C CD1 . ILE A 1 157 ? 37.699  -16.976 -2.030  1.00 20.52 ? 320 ILE A CD1 1 
ATOM   1220 N N   . LEU A 1 158 ? 41.124  -21.321 -4.416  1.00 20.04 ? 321 LEU A N   1 
ATOM   1221 C CA  . LEU A 1 158 ? 41.483  -22.160 -5.532  1.00 19.60 ? 321 LEU A CA  1 
ATOM   1222 C C   . LEU A 1 158 ? 40.224  -22.704 -6.145  1.00 19.44 ? 321 LEU A C   1 
ATOM   1223 O O   . LEU A 1 158 ? 39.602  -23.604 -5.623  1.00 19.90 ? 321 LEU A O   1 
ATOM   1224 C CB  . LEU A 1 158 ? 42.438  -23.267 -5.043  1.00 18.82 ? 321 LEU A CB  1 
ATOM   1225 C CG  . LEU A 1 158 ? 43.750  -22.750 -4.412  1.00 20.79 ? 321 LEU A CG  1 
ATOM   1226 C CD1 . LEU A 1 158 ? 44.602  -23.872 -3.861  1.00 22.07 ? 321 LEU A CD1 1 
ATOM   1227 C CD2 . LEU A 1 158 ? 44.569  -21.889 -5.406  1.00 23.87 ? 321 LEU A CD2 1 
ATOM   1228 N N   . TRP A 1 159 ? 39.817  -22.108 -7.253  1.00 19.44 ? 322 TRP A N   1 
ATOM   1229 C CA  . TRP A 1 159 ? 38.637  -22.528 -7.989  1.00 20.06 ? 322 TRP A CA  1 
ATOM   1230 C C   . TRP A 1 159 ? 38.943  -23.893 -8.615  1.00 21.35 ? 322 TRP A C   1 
ATOM   1231 O O   . TRP A 1 159 ? 40.024  -24.103 -9.204  1.00 21.87 ? 322 TRP A O   1 
ATOM   1232 C CB  . TRP A 1 159 ? 38.249  -21.490 -9.046  1.00 20.14 ? 322 TRP A CB  1 
ATOM   1233 C CG  . TRP A 1 159 ? 36.878  -21.772 -9.686  1.00 20.40 ? 322 TRP A CG  1 
ATOM   1234 C CD1 . TRP A 1 159 ? 36.581  -22.758 -10.593 1.00 18.88 ? 322 TRP A CD1 1 
ATOM   1235 C CD2 . TRP A 1 159 ? 35.651  -21.060 -9.444  1.00 18.52 ? 322 TRP A CD2 1 
ATOM   1236 N NE1 . TRP A 1 159 ? 35.248  -22.697 -10.930 1.00 21.10 ? 322 TRP A NE1 1 
ATOM   1237 C CE2 . TRP A 1 159 ? 34.654  -21.667 -10.240 1.00 18.31 ? 322 TRP A CE2 1 
ATOM   1238 C CE3 . TRP A 1 159 ? 35.309  -19.954 -8.649  1.00 16.89 ? 322 TRP A CE3 1 
ATOM   1239 C CZ2 . TRP A 1 159 ? 33.331  -21.218 -10.258 1.00 21.05 ? 322 TRP A CZ2 1 
ATOM   1240 C CZ3 . TRP A 1 159 ? 33.987  -19.504 -8.655  1.00 21.40 ? 322 TRP A CZ3 1 
ATOM   1241 C CH2 . TRP A 1 159 ? 33.009  -20.131 -9.467  1.00 20.64 ? 322 TRP A CH2 1 
ATOM   1242 N N   . GLY A 1 160 ? 38.018  -24.839 -8.418  1.00 21.45 ? 323 GLY A N   1 
ATOM   1243 C CA  . GLY A 1 160 ? 38.158  -26.163 -8.972  1.00 21.81 ? 323 GLY A CA  1 
ATOM   1244 C C   . GLY A 1 160 ? 39.141  -27.072 -8.288  1.00 22.52 ? 323 GLY A C   1 
ATOM   1245 O O   . GLY A 1 160 ? 39.691  -27.982 -8.935  1.00 23.88 ? 323 GLY A O   1 
ATOM   1246 N N   . HIS A 1 161 ? 39.299  -26.901 -6.975  1.00 21.26 ? 324 HIS A N   1 
ATOM   1247 C CA  . HIS A 1 161 ? 40.162  -27.732 -6.186  1.00 20.31 ? 324 HIS A CA  1 
ATOM   1248 C C   . HIS A 1 161 ? 39.387  -28.435 -5.073  1.00 19.77 ? 324 HIS A C   1 
ATOM   1249 O O   . HIS A 1 161 ? 38.320  -27.976 -4.672  1.00 18.66 ? 324 HIS A O   1 
ATOM   1250 C CB  . HIS A 1 161 ? 41.300  -26.900 -5.602  1.00 20.33 ? 324 HIS A CB  1 
ATOM   1251 C CG  . HIS A 1 161 ? 42.358  -26.504 -6.596  1.00 22.27 ? 324 HIS A CG  1 
ATOM   1252 N ND1 . HIS A 1 161 ? 43.679  -26.881 -6.460  1.00 22.70 ? 324 HIS A ND1 1 
ATOM   1253 C CD2 . HIS A 1 161 ? 42.302  -25.736 -7.709  1.00 24.11 ? 324 HIS A CD2 1 
ATOM   1254 C CE1 . HIS A 1 161 ? 44.392  -26.356 -7.443  1.00 24.14 ? 324 HIS A CE1 1 
ATOM   1255 N NE2 . HIS A 1 161 ? 43.573  -25.685 -8.232  1.00 23.38 ? 324 HIS A NE2 1 
ATOM   1256 N N   . ARG A 1 162 ? 39.958  -29.534 -4.586  1.00 19.76 ? 325 ARG A N   1 
ATOM   1257 C CA  . ARG A 1 162 ? 39.433  -30.313 -3.451  1.00 21.26 ? 325 ARG A CA  1 
ATOM   1258 C C   . ARG A 1 162 ? 40.621  -30.637 -2.608  1.00 20.61 ? 325 ARG A C   1 
ATOM   1259 O O   . ARG A 1 162 ? 41.729  -30.669 -3.118  1.00 21.46 ? 325 ARG A O   1 
ATOM   1260 C CB  . ARG A 1 162 ? 38.659  -31.580 -3.907  1.00 20.72 ? 325 ARG A CB  1 
ATOM   1261 C CG  . ARG A 1 162 ? 37.436  -31.179 -4.751  1.00 23.26 ? 325 ARG A CG  1 
ATOM   1262 C CD  . ARG A 1 162 ? 36.418  -32.248 -5.076  1.00 27.55 ? 325 ARG A CD  1 
ATOM   1263 N NE  . ARG A 1 162 ? 36.969  -33.530 -5.465  1.00 26.15 ? 325 ARG A NE  1 
ATOM   1264 C CZ  . ARG A 1 162 ? 36.456  -34.347 -6.412  1.00 27.93 ? 325 ARG A CZ  1 
ATOM   1265 N NH1 . ARG A 1 162 ? 35.388  -34.052 -7.141  1.00 20.07 ? 325 ARG A NH1 1 
ATOM   1266 N NH2 . ARG A 1 162 ? 37.038  -35.504 -6.627  1.00 24.11 ? 325 ARG A NH2 1 
ATOM   1267 N N   . TYR A 1 163 ? 40.407  -30.810 -1.305  1.00 19.44 ? 326 TYR A N   1 
ATOM   1268 C CA  . TYR A 1 163 ? 41.465  -31.177 -0.384  1.00 17.84 ? 326 TYR A CA  1 
ATOM   1269 C C   . TYR A 1 163 ? 41.868  -32.657 -0.529  1.00 18.45 ? 326 TYR A C   1 
ATOM   1270 O O   . TYR A 1 163 ? 41.008  -33.505 -0.775  1.00 19.92 ? 326 TYR A O   1 
ATOM   1271 C CB  . TYR A 1 163 ? 41.032  -30.874 1.074   1.00 17.63 ? 326 TYR A CB  1 
ATOM   1272 C CG  . TYR A 1 163 ? 40.877  -29.390 1.311   1.00 17.84 ? 326 TYR A CG  1 
ATOM   1273 C CD1 . TYR A 1 163 ? 39.618  -28.807 1.361   1.00 19.55 ? 326 TYR A CD1 1 
ATOM   1274 C CD2 . TYR A 1 163 ? 42.012  -28.556 1.380   1.00 17.04 ? 326 TYR A CD2 1 
ATOM   1275 C CE1 . TYR A 1 163 ? 39.457  -27.437 1.514   1.00 15.96 ? 326 TYR A CE1 1 
ATOM   1276 C CE2 . TYR A 1 163 ? 41.879  -27.183 1.527   1.00 17.43 ? 326 TYR A CE2 1 
ATOM   1277 C CZ  . TYR A 1 163 ? 40.600  -26.638 1.594   1.00 15.48 ? 326 TYR A CZ  1 
ATOM   1278 O OH  . TYR A 1 163 ? 40.472  -25.309 1.690   1.00 14.53 ? 326 TYR A OH  1 
ATOM   1279 N N   . GLU A 1 164 ? 43.154  -32.946 -0.327  1.00 17.36 ? 327 GLU A N   1 
ATOM   1280 C CA  . GLU A 1 164 ? 43.653  -34.287 -0.199  1.00 18.93 ? 327 GLU A CA  1 
ATOM   1281 C C   . GLU A 1 164 ? 43.128  -34.829 1.140   1.00 19.54 ? 327 GLU A C   1 
ATOM   1282 O O   . GLU A 1 164 ? 43.195  -34.106 2.171   1.00 20.11 ? 327 GLU A O   1 
ATOM   1283 C CB  . GLU A 1 164 ? 45.173  -34.298 -0.131  1.00 18.97 ? 327 GLU A CB  1 
ATOM   1284 C CG  . GLU A 1 164 ? 45.877  -34.072 -1.505  1.00 22.54 ? 327 GLU A CG  1 
ATOM   1285 C CD  . GLU A 1 164 ? 46.025  -35.377 -2.300  1.00 30.82 ? 327 GLU A CD  1 
ATOM   1286 O OE1 . GLU A 1 164 ? 45.601  -36.469 -1.819  1.00 31.71 ? 327 GLU A OE1 1 
ATOM   1287 O OE2 . GLU A 1 164 ? 46.546  -35.317 -3.440  1.00 32.24 ? 327 GLU A OE2 1 
ATOM   1288 N N   . PRO A 1 165 ? 42.621  -36.090 1.135   1.00 18.44 ? 328 PRO A N   1 
ATOM   1289 C CA  . PRO A 1 165 ? 42.228  -36.784 2.364   1.00 18.86 ? 328 PRO A CA  1 
ATOM   1290 C C   . PRO A 1 165 ? 43.426  -36.778 3.319   1.00 19.19 ? 328 PRO A C   1 
ATOM   1291 O O   . PRO A 1 165 ? 44.556  -37.003 2.876   1.00 19.94 ? 328 PRO A O   1 
ATOM   1292 C CB  . PRO A 1 165 ? 42.003  -38.221 1.907   1.00 18.19 ? 328 PRO A CB  1 
ATOM   1293 C CG  . PRO A 1 165 ? 41.722  -38.136 0.461   1.00 20.28 ? 328 PRO A CG  1 
ATOM   1294 C CD  . PRO A 1 165 ? 42.406  -36.897 -0.071  1.00 16.57 ? 328 PRO A CD  1 
ATOM   1295 N N   . VAL A 1 166 ? 43.182  -36.566 4.607   1.00 18.98 ? 329 VAL A N   1 
ATOM   1296 C CA  . VAL A 1 166 ? 44.223  -36.704 5.666   1.00 18.80 ? 329 VAL A CA  1 
ATOM   1297 C C   . VAL A 1 166 ? 44.016  -37.946 6.549   1.00 18.97 ? 329 VAL A C   1 
ATOM   1298 O O   . VAL A 1 166 ? 44.943  -38.418 7.227   1.00 19.16 ? 329 VAL A O   1 
ATOM   1299 C CB  . VAL A 1 166 ? 44.273  -35.465 6.578   1.00 18.78 ? 329 VAL A CB  1 
ATOM   1300 C CG1 . VAL A 1 166 ? 44.818  -34.256 5.801   1.00 17.53 ? 329 VAL A CG1 1 
ATOM   1301 C CG2 . VAL A 1 166 ? 42.896  -35.160 7.148   1.00 19.45 ? 329 VAL A CG2 1 
ATOM   1302 N N   . LEU A 1 167 ? 42.801  -38.473 6.528   1.00 18.70 ? 330 LEU A N   1 
ATOM   1303 C CA  . LEU A 1 167 ? 42.389  -39.526 7.464   1.00 19.44 ? 330 LEU A CA  1 
ATOM   1304 C C   . LEU A 1 167 ? 42.416  -40.877 6.757   1.00 19.56 ? 330 LEU A C   1 
ATOM   1305 O O   . LEU A 1 167 ? 41.741  -41.037 5.732   1.00 19.22 ? 330 LEU A O   1 
ATOM   1306 C CB  . LEU A 1 167 ? 40.963  -39.274 7.993   1.00 17.94 ? 330 LEU A CB  1 
ATOM   1307 C CG  . LEU A 1 167 ? 40.354  -40.346 8.927   1.00 19.32 ? 330 LEU A CG  1 
ATOM   1308 C CD1 . LEU A 1 167 ? 41.104  -40.375 10.228  1.00 18.76 ? 330 LEU A CD1 1 
ATOM   1309 C CD2 . LEU A 1 167 ? 38.878  -40.025 9.170   1.00 20.68 ? 330 LEU A CD2 1 
ATOM   1310 N N   . PHE A 1 168 ? 43.185  -41.800 7.331   1.00 20.12 ? 331 PHE A N   1 
ATOM   1311 C CA  . PHE A 1 168 ? 43.412  -43.158 6.809   1.00 22.64 ? 331 PHE A CA  1 
ATOM   1312 C C   . PHE A 1 168 ? 43.182  -44.264 7.835   1.00 24.07 ? 331 PHE A C   1 
ATOM   1313 O O   . PHE A 1 168 ? 43.547  -44.165 9.002   1.00 24.56 ? 331 PHE A O   1 
ATOM   1314 C CB  . PHE A 1 168 ? 44.820  -43.280 6.223   1.00 22.33 ? 331 PHE A CB  1 
ATOM   1315 C CG  . PHE A 1 168 ? 45.013  -42.465 4.982   1.00 23.76 ? 331 PHE A CG  1 
ATOM   1316 C CD1 . PHE A 1 168 ? 44.702  -43.005 3.732   1.00 23.11 ? 331 PHE A CD1 1 
ATOM   1317 C CD2 . PHE A 1 168 ? 45.441  -41.137 5.059   1.00 25.71 ? 331 PHE A CD2 1 
ATOM   1318 C CE1 . PHE A 1 168 ? 44.845  -42.268 2.600   1.00 23.70 ? 331 PHE A CE1 1 
ATOM   1319 C CE2 . PHE A 1 168 ? 45.590  -40.367 3.900   1.00 26.42 ? 331 PHE A CE2 1 
ATOM   1320 C CZ  . PHE A 1 168 ? 45.293  -40.928 2.677   1.00 26.06 ? 331 PHE A CZ  1 
ATOM   1321 N N   . GLU A 1 169 ? 42.615  -45.344 7.355   1.00 26.65 ? 332 GLU A N   1 
ATOM   1322 C CA  . GLU A 1 169 ? 42.319  -46.503 8.176   1.00 29.35 ? 332 GLU A CA  1 
ATOM   1323 C C   . GLU A 1 169 ? 43.566  -47.394 8.358   1.00 30.70 ? 332 GLU A C   1 
ATOM   1324 O O   . GLU A 1 169 ? 44.229  -47.795 7.388   1.00 30.51 ? 332 GLU A O   1 
ATOM   1325 C CB  . GLU A 1 169 ? 41.190  -47.293 7.502   1.00 28.99 ? 332 GLU A CB  1 
ATOM   1326 C CG  . GLU A 1 169 ? 40.404  -48.175 8.419   1.00 34.04 ? 332 GLU A CG  1 
ATOM   1327 C CD  . GLU A 1 169 ? 39.617  -49.230 7.656   1.00 39.88 ? 332 GLU A CD  1 
ATOM   1328 O OE1 . GLU A 1 169 ? 39.104  -48.935 6.542   1.00 39.41 ? 332 GLU A OE1 1 
ATOM   1329 O OE2 . GLU A 1 169 ? 39.503  -50.353 8.202   1.00 43.90 ? 332 GLU A OE2 1 
ATOM   1330 N N   . GLU A 1 170 ? 43.895  -47.680 9.610   1.00 31.81 ? 333 GLU A N   1 
ATOM   1331 C CA  . GLU A 1 170 ? 44.786  -48.788 9.919   1.00 34.18 ? 333 GLU A CA  1 
ATOM   1332 C C   . GLU A 1 170 ? 43.940  -49.920 10.503  1.00 35.32 ? 333 GLU A C   1 
ATOM   1333 O O   . GLU A 1 170 ? 42.707  -49.796 10.641  1.00 35.94 ? 333 GLU A O   1 
ATOM   1334 C CB  . GLU A 1 170 ? 45.903  -48.375 10.880  1.00 33.52 ? 333 GLU A CB  1 
ATOM   1335 C CG  . GLU A 1 170 ? 46.825  -47.285 10.342  1.00 36.35 ? 333 GLU A CG  1 
ATOM   1336 C CD  . GLU A 1 170 ? 47.703  -47.725 9.145   1.00 43.47 ? 333 GLU A CD  1 
ATOM   1337 O OE1 . GLU A 1 170 ? 48.283  -48.841 9.182   1.00 44.82 ? 333 GLU A OE1 1 
ATOM   1338 O OE2 . GLU A 1 170 ? 47.798  -46.955 8.157   1.00 45.93 ? 333 GLU A OE2 1 
ATOM   1339 N N   . LYS A 1 171 ? 44.596  -51.032 10.827  1.00 37.08 ? 334 LYS A N   1 
ATOM   1340 C CA  . LYS A 1 171 ? 43.905  -52.199 11.371  1.00 37.69 ? 334 LYS A CA  1 
ATOM   1341 C C   . LYS A 1 171 ? 43.108  -51.870 12.637  1.00 36.93 ? 334 LYS A C   1 
ATOM   1342 O O   . LYS A 1 171 ? 41.901  -52.118 12.698  1.00 36.03 ? 334 LYS A O   1 
ATOM   1343 C CB  . LYS A 1 171 ? 44.906  -53.341 11.631  1.00 39.05 ? 334 LYS A CB  1 
ATOM   1344 C CG  . LYS A 1 171 ? 45.113  -54.243 10.436  1.00 41.81 ? 334 LYS A CG  1 
ATOM   1345 C CD  . LYS A 1 171 ? 46.575  -54.651 10.270  1.00 47.99 ? 334 LYS A CD  1 
ATOM   1346 C CE  . LYS A 1 171 ? 46.891  -55.007 8.806   1.00 49.83 ? 334 LYS A CE  1 
ATOM   1347 N NZ  . LYS A 1 171 ? 48.377  -54.984 8.623   1.00 52.01 ? 334 LYS A NZ  1 
ATOM   1348 N N   . HIS A 1 172 ? 43.783  -51.295 13.624  1.00 36.88 ? 335 HIS A N   1 
ATOM   1349 C CA  . HIS A 1 172 ? 43.142  -51.004 14.915  1.00 37.06 ? 335 HIS A CA  1 
ATOM   1350 C C   . HIS A 1 172 ? 42.911  -49.528 15.219  1.00 35.51 ? 335 HIS A C   1 
ATOM   1351 O O   . HIS A 1 172 ? 42.466  -49.189 16.302  1.00 35.75 ? 335 HIS A O   1 
ATOM   1352 C CB  . HIS A 1 172 ? 43.978  -51.595 16.054  1.00 38.27 ? 335 HIS A CB  1 
ATOM   1353 C CG  . HIS A 1 172 ? 44.379  -53.009 15.812  1.00 41.32 ? 335 HIS A CG  1 
ATOM   1354 N ND1 . HIS A 1 172 ? 43.477  -54.050 15.859  1.00 45.77 ? 335 HIS A ND1 1 
ATOM   1355 C CD2 . HIS A 1 172 ? 45.569  -53.550 15.456  1.00 43.81 ? 335 HIS A CD2 1 
ATOM   1356 C CE1 . HIS A 1 172 ? 44.101  -55.181 15.574  1.00 46.46 ? 335 HIS A CE1 1 
ATOM   1357 N NE2 . HIS A 1 172 ? 45.372  -54.906 15.332  1.00 46.17 ? 335 HIS A NE2 1 
ATOM   1358 N N   . TYR A 1 173 ? 43.249  -48.639 14.297  1.00 32.77 ? 336 TYR A N   1 
ATOM   1359 C CA  . TYR A 1 173 ? 43.146  -47.241 14.611  1.00 29.87 ? 336 TYR A CA  1 
ATOM   1360 C C   . TYR A 1 173 ? 43.115  -46.456 13.317  1.00 28.62 ? 336 TYR A C   1 
ATOM   1361 O O   . TYR A 1 173 ? 43.207  -47.029 12.220  1.00 28.60 ? 336 TYR A O   1 
ATOM   1362 C CB  . TYR A 1 173 ? 44.301  -46.799 15.529  1.00 29.40 ? 336 TYR A CB  1 
ATOM   1363 C CG  . TYR A 1 173 ? 45.652  -46.798 14.845  1.00 26.60 ? 336 TYR A CG  1 
ATOM   1364 C CD1 . TYR A 1 173 ? 46.113  -45.674 14.201  1.00 25.73 ? 336 TYR A CD1 1 
ATOM   1365 C CD2 . TYR A 1 173 ? 46.458  -47.957 14.839  1.00 27.00 ? 336 TYR A CD2 1 
ATOM   1366 C CE1 . TYR A 1 173 ? 47.346  -45.687 13.526  1.00 28.67 ? 336 TYR A CE1 1 
ATOM   1367 C CE2 . TYR A 1 173 ? 47.685  -47.975 14.174  1.00 28.00 ? 336 TYR A CE2 1 
ATOM   1368 C CZ  . TYR A 1 173 ? 48.121  -46.824 13.544  1.00 28.96 ? 336 TYR A CZ  1 
ATOM   1369 O OH  . TYR A 1 173 ? 49.360  -46.796 12.873  1.00 27.63 ? 336 TYR A OH  1 
ATOM   1370 N N   . TYR A 1 174 ? 42.951  -45.149 13.448  1.00 25.94 ? 337 TYR A N   1 
ATOM   1371 C CA  . TYR A 1 174 ? 42.915  -44.256 12.310  1.00 24.26 ? 337 TYR A CA  1 
ATOM   1372 C C   . TYR A 1 174 ? 44.127  -43.367 12.409  1.00 23.78 ? 337 TYR A C   1 
ATOM   1373 O O   . TYR A 1 174 ? 44.581  -43.074 13.500  1.00 23.72 ? 337 TYR A O   1 
ATOM   1374 C CB  . TYR A 1 174 ? 41.611  -43.450 12.312  1.00 23.69 ? 337 TYR A CB  1 
ATOM   1375 C CG  . TYR A 1 174 ? 40.440  -44.343 12.016  1.00 24.27 ? 337 TYR A CG  1 
ATOM   1376 C CD1 . TYR A 1 174 ? 39.725  -44.949 13.055  1.00 24.45 ? 337 TYR A CD1 1 
ATOM   1377 C CD2 . TYR A 1 174 ? 40.102  -44.666 10.698  1.00 24.94 ? 337 TYR A CD2 1 
ATOM   1378 C CE1 . TYR A 1 174 ? 38.650  -45.816 12.792  1.00 23.61 ? 337 TYR A CE1 1 
ATOM   1379 C CE2 . TYR A 1 174 ? 39.042  -45.563 10.412  1.00 25.15 ? 337 TYR A CE2 1 
ATOM   1380 C CZ  . TYR A 1 174 ? 38.318  -46.128 11.474  1.00 27.87 ? 337 TYR A CZ  1 
ATOM   1381 O OH  . TYR A 1 174 ? 37.259  -47.000 11.214  1.00 29.96 ? 337 TYR A OH  1 
ATOM   1382 N N   . LYS A 1 175 ? 44.708  -43.010 11.278  1.00 23.63 ? 338 LYS A N   1 
ATOM   1383 C CA  . LYS A 1 175 ? 45.840  -42.126 11.324  1.00 24.39 ? 338 LYS A CA  1 
ATOM   1384 C C   . LYS A 1 175 ? 45.497  -40.849 10.583  1.00 23.05 ? 338 LYS A C   1 
ATOM   1385 O O   . LYS A 1 175 ? 44.790  -40.864 9.591   1.00 22.75 ? 338 LYS A O   1 
ATOM   1386 C CB  . LYS A 1 175 ? 47.125  -42.802 10.863  1.00 26.01 ? 338 LYS A CB  1 
ATOM   1387 C CG  . LYS A 1 175 ? 47.177  -43.104 9.433   1.00 30.70 ? 338 LYS A CG  1 
ATOM   1388 C CD  . LYS A 1 175 ? 48.548  -42.699 8.862   1.00 36.97 ? 338 LYS A CD  1 
ATOM   1389 C CE  . LYS A 1 175 ? 48.771  -43.273 7.462   1.00 39.44 ? 338 LYS A CE  1 
ATOM   1390 N NZ  . LYS A 1 175 ? 49.308  -44.682 7.511   1.00 41.41 ? 338 LYS A NZ  1 
ATOM   1391 N N   . VAL A 1 176 ? 45.926  -39.728 11.131  1.00 23.84 ? 339 VAL A N   1 
ATOM   1392 C CA  . VAL A 1 176 ? 45.700  -38.438 10.487  1.00 23.01 ? 339 VAL A CA  1 
ATOM   1393 C C   . VAL A 1 176 ? 47.047  -37.949 9.994   1.00 23.04 ? 339 VAL A C   1 
ATOM   1394 O O   . VAL A 1 176 ? 47.917  -37.661 10.791  1.00 23.07 ? 339 VAL A O   1 
ATOM   1395 C CB  . VAL A 1 176 ? 45.031  -37.385 11.437  1.00 23.34 ? 339 VAL A CB  1 
ATOM   1396 C CG1 . VAL A 1 176 ? 44.993  -36.071 10.764  1.00 21.36 ? 339 VAL A CG1 1 
ATOM   1397 C CG2 . VAL A 1 176 ? 43.603  -37.816 11.791  1.00 22.76 ? 339 VAL A CG2 1 
ATOM   1398 N N   . ASP A 1 177 ? 47.215  -37.885 8.674   1.00 23.10 ? 340 ASP A N   1 
ATOM   1399 C CA  . ASP A 1 177 ? 48.498  -37.493 8.092   1.00 22.58 ? 340 ASP A CA  1 
ATOM   1400 C C   . ASP A 1 177 ? 48.526  -35.992 7.822   1.00 21.56 ? 340 ASP A C   1 
ATOM   1401 O O   . ASP A 1 177 ? 47.985  -35.516 6.833   1.00 20.62 ? 340 ASP A O   1 
ATOM   1402 C CB  . ASP A 1 177 ? 48.813  -38.326 6.836   1.00 22.76 ? 340 ASP A CB  1 
ATOM   1403 C CG  . ASP A 1 177 ? 50.177  -37.995 6.236   1.00 24.79 ? 340 ASP A CG  1 
ATOM   1404 O OD1 . ASP A 1 177 ? 50.847  -37.062 6.717   1.00 25.86 ? 340 ASP A OD1 1 
ATOM   1405 O OD2 . ASP A 1 177 ? 50.596  -38.679 5.285   1.00 24.91 ? 340 ASP A OD2 1 
ATOM   1406 N N   . TYR A 1 178 ? 49.147  -35.235 8.726   1.00 22.24 ? 341 TYR A N   1 
ATOM   1407 C CA  . TYR A 1 178 ? 49.102  -33.775 8.619   1.00 22.91 ? 341 TYR A CA  1 
ATOM   1408 C C   . TYR A 1 178 ? 49.951  -33.211 7.478   1.00 23.71 ? 341 TYR A C   1 
ATOM   1409 O O   . TYR A 1 178 ? 49.817  -32.048 7.134   1.00 22.69 ? 341 TYR A O   1 
ATOM   1410 C CB  . TYR A 1 178 ? 49.403  -33.103 9.983   1.00 23.84 ? 341 TYR A CB  1 
ATOM   1411 C CG  . TYR A 1 178 ? 48.141  -32.695 10.715  1.00 25.42 ? 341 TYR A CG  1 
ATOM   1412 C CD1 . TYR A 1 178 ? 47.469  -33.561 11.579  1.00 28.70 ? 341 TYR A CD1 1 
ATOM   1413 C CD2 . TYR A 1 178 ? 47.598  -31.452 10.484  1.00 30.05 ? 341 TYR A CD2 1 
ATOM   1414 C CE1 . TYR A 1 178 ? 46.260  -33.131 12.228  1.00 33.53 ? 341 TYR A CE1 1 
ATOM   1415 C CE2 . TYR A 1 178 ? 46.460  -31.028 11.107  1.00 33.68 ? 341 TYR A CE2 1 
ATOM   1416 C CZ  . TYR A 1 178 ? 45.793  -31.855 11.966  1.00 33.80 ? 341 TYR A CZ  1 
ATOM   1417 O OH  . TYR A 1 178 ? 44.657  -31.327 12.528  1.00 39.92 ? 341 TYR A OH  1 
ATOM   1418 N N   . SER A 1 179 ? 50.809  -34.045 6.872   1.00 23.88 ? 342 SER A N   1 
ATOM   1419 C CA  . SER A 1 179 ? 51.561  -33.627 5.700   1.00 23.55 ? 342 SER A CA  1 
ATOM   1420 C C   . SER A 1 179 ? 50.603  -33.379 4.539   1.00 23.39 ? 342 SER A C   1 
ATOM   1421 O O   . SER A 1 179 ? 50.950  -32.681 3.609   1.00 23.44 ? 342 SER A O   1 
ATOM   1422 C CB  . SER A 1 179 ? 52.646  -34.657 5.326   1.00 23.45 ? 342 SER A CB  1 
ATOM   1423 O OG  . SER A 1 179 ? 52.056  -35.805 4.760   1.00 24.22 ? 342 SER A OG  1 
ATOM   1424 N N   . ARG A 1 180 ? 49.375  -33.901 4.617   1.00 22.84 ? 343 ARG A N   1 
ATOM   1425 C CA  . ARG A 1 180 ? 48.391  -33.669 3.568   1.00 23.24 ? 343 ARG A CA  1 
ATOM   1426 C C   . ARG A 1 180 ? 47.395  -32.543 3.868   1.00 22.77 ? 343 ARG A C   1 
ATOM   1427 O O   . ARG A 1 180 ? 46.593  -32.207 3.022   1.00 21.35 ? 343 ARG A O   1 
ATOM   1428 C CB  . ARG A 1 180 ? 47.565  -34.920 3.303   1.00 23.56 ? 343 ARG A CB  1 
ATOM   1429 C CG  . ARG A 1 180 ? 48.372  -36.211 3.133   1.00 28.08 ? 343 ARG A CG  1 
ATOM   1430 C CD  . ARG A 1 180 ? 48.665  -36.558 1.722   1.00 31.50 ? 343 ARG A CD  1 
ATOM   1431 N NE  . ARG A 1 180 ? 49.649  -37.653 1.671   1.00 33.03 ? 343 ARG A NE  1 
ATOM   1432 C CZ  . ARG A 1 180 ? 49.362  -38.942 1.465   1.00 32.72 ? 343 ARG A CZ  1 
ATOM   1433 N NH1 . ARG A 1 180 ? 48.094  -39.357 1.296   1.00 26.03 ? 343 ARG A NH1 1 
ATOM   1434 N NH2 . ARG A 1 180 ? 50.374  -39.818 1.407   1.00 31.69 ? 343 ARG A NH2 1 
ATOM   1435 N N   . PHE A 1 181 ? 47.438  -32.007 5.085   1.00 22.19 ? 344 PHE A N   1 
ATOM   1436 C CA  . PHE A 1 181 ? 46.478  -30.999 5.545   1.00 20.64 ? 344 PHE A CA  1 
ATOM   1437 C C   . PHE A 1 181 ? 46.222  -29.847 4.542   1.00 20.68 ? 344 PHE A C   1 
ATOM   1438 O O   . PHE A 1 181 ? 45.075  -29.545 4.224   1.00 19.83 ? 344 PHE A O   1 
ATOM   1439 C CB  . PHE A 1 181 ? 46.930  -30.466 6.909   1.00 20.62 ? 344 PHE A CB  1 
ATOM   1440 C CG  . PHE A 1 181 ? 45.984  -29.483 7.503   1.00 18.61 ? 344 PHE A CG  1 
ATOM   1441 C CD1 . PHE A 1 181 ? 44.817  -29.925 8.156   1.00 20.72 ? 344 PHE A CD1 1 
ATOM   1442 C CD2 . PHE A 1 181 ? 46.197  -28.132 7.339   1.00 17.12 ? 344 PHE A CD2 1 
ATOM   1443 C CE1 . PHE A 1 181 ? 43.902  -29.008 8.683   1.00 21.45 ? 344 PHE A CE1 1 
ATOM   1444 C CE2 . PHE A 1 181 ? 45.286  -27.194 7.893   1.00 20.38 ? 344 PHE A CE2 1 
ATOM   1445 C CZ  . PHE A 1 181 ? 44.137  -27.654 8.555   1.00 20.41 ? 344 PHE A CZ  1 
ATOM   1446 N N   . HIS A 1 182 ? 47.290  -29.218 4.048   1.00 19.62 ? 345 HIS A N   1 
ATOM   1447 C CA  . HIS A 1 182 ? 47.169  -28.080 3.156   1.00 19.68 ? 345 HIS A CA  1 
ATOM   1448 C C   . HIS A 1 182 ? 47.088  -28.421 1.707   1.00 21.26 ? 345 HIS A C   1 
ATOM   1449 O O   . HIS A 1 182 ? 46.886  -27.516 0.864   1.00 21.88 ? 345 HIS A O   1 
ATOM   1450 C CB  . HIS A 1 182 ? 48.364  -27.098 3.312   1.00 18.77 ? 345 HIS A CB  1 
ATOM   1451 C CG  . HIS A 1 182 ? 48.516  -26.556 4.701   1.00 19.08 ? 345 HIS A CG  1 
ATOM   1452 N ND1 . HIS A 1 182 ? 47.672  -25.592 5.220   1.00 18.15 ? 345 HIS A ND1 1 
ATOM   1453 C CD2 . HIS A 1 182 ? 49.417  -26.830 5.671   1.00 16.15 ? 345 HIS A CD2 1 
ATOM   1454 C CE1 . HIS A 1 182 ? 48.045  -25.300 6.449   1.00 17.85 ? 345 HIS A CE1 1 
ATOM   1455 N NE2 . HIS A 1 182 ? 49.103  -26.030 6.746   1.00 20.56 ? 345 HIS A NE2 1 
ATOM   1456 N N   . LYS A 1 183 ? 47.247  -29.701 1.383   1.00 20.41 ? 346 LYS A N   1 
ATOM   1457 C CA  . LYS A 1 183 ? 47.356  -30.083 -0.016  1.00 21.96 ? 346 LYS A CA  1 
ATOM   1458 C C   . LYS A 1 183 ? 45.992  -30.217 -0.700  1.00 21.78 ? 346 LYS A C   1 
ATOM   1459 O O   . LYS A 1 183 ? 44.987  -30.569 -0.074  1.00 19.22 ? 346 LYS A O   1 
ATOM   1460 C CB  . LYS A 1 183 ? 48.179  -31.360 -0.114  1.00 21.32 ? 346 LYS A CB  1 
ATOM   1461 C CG  . LYS A 1 183 ? 49.539  -31.196 0.503   1.00 22.52 ? 346 LYS A CG  1 
ATOM   1462 C CD  . LYS A 1 183 ? 50.448  -32.317 -0.013  1.00 27.82 ? 346 LYS A CD  1 
ATOM   1463 C CE  . LYS A 1 183 ? 51.865  -32.063 0.445   1.00 31.43 ? 346 LYS A CE  1 
ATOM   1464 N NZ  . LYS A 1 183 ? 52.547  -33.385 0.412   1.00 36.44 ? 346 LYS A NZ  1 
ATOM   1465 N N   . THR A 1 184 ? 45.957  -29.878 -1.981  1.00 22.74 ? 347 THR A N   1 
ATOM   1466 C CA  . THR A 1 184 ? 44.756  -30.006 -2.774  1.00 25.93 ? 347 THR A CA  1 
ATOM   1467 C C   . THR A 1 184 ? 45.055  -30.703 -4.083  1.00 28.33 ? 347 THR A C   1 
ATOM   1468 O O   . THR A 1 184 ? 46.211  -30.795 -4.529  1.00 30.16 ? 347 THR A O   1 
ATOM   1469 C CB  . THR A 1 184 ? 44.045  -28.622 -3.056  1.00 26.68 ? 347 THR A CB  1 
ATOM   1470 O OG1 . THR A 1 184 ? 44.800  -27.829 -3.995  1.00 30.51 ? 347 THR A OG1 1 
ATOM   1471 C CG2 . THR A 1 184 ? 43.841  -27.824 -1.741  1.00 22.82 ? 347 THR A CG2 1 
ATOM   1472 N N   . TYR A 1 185 ? 44.006  -31.194 -4.710  1.00 29.24 ? 348 TYR A N   1 
ATOM   1473 C CA  . TYR A 1 185 ? 44.130  -31.590 -6.086  1.00 30.12 ? 348 TYR A CA  1 
ATOM   1474 C C   . TYR A 1 185 ? 43.087  -30.859 -6.947  1.00 29.57 ? 348 TYR A C   1 
ATOM   1475 O O   . TYR A 1 185 ? 42.138  -30.254 -6.443  1.00 26.98 ? 348 TYR A O   1 
ATOM   1476 C CB  . TYR A 1 185 ? 44.125  -33.100 -6.218  1.00 30.60 ? 348 TYR A CB  1 
ATOM   1477 C CG  . TYR A 1 185 ? 42.847  -33.759 -5.772  1.00 32.07 ? 348 TYR A CG  1 
ATOM   1478 C CD1 . TYR A 1 185 ? 41.780  -33.874 -6.644  1.00 35.54 ? 348 TYR A CD1 1 
ATOM   1479 C CD2 . TYR A 1 185 ? 42.717  -34.291 -4.493  1.00 31.91 ? 348 TYR A CD2 1 
ATOM   1480 C CE1 . TYR A 1 185 ? 40.616  -34.494 -6.257  1.00 36.42 ? 348 TYR A CE1 1 
ATOM   1481 C CE2 . TYR A 1 185 ? 41.552  -34.901 -4.096  1.00 32.00 ? 348 TYR A CE2 1 
ATOM   1482 C CZ  . TYR A 1 185 ? 40.507  -35.007 -4.985  1.00 33.35 ? 348 TYR A CZ  1 
ATOM   1483 O OH  . TYR A 1 185 ? 39.308  -35.605 -4.630  1.00 35.76 ? 348 TYR A OH  1 
ATOM   1484 N N   . GLU A 1 186 ? 43.341  -30.868 -8.250  1.00 29.44 ? 349 GLU A N   1 
ATOM   1485 C CA  . GLU A 1 186 ? 42.643  -30.026 -9.179  1.00 29.70 ? 349 GLU A CA  1 
ATOM   1486 C C   . GLU A 1 186 ? 41.608  -30.882 -9.918  1.00 28.58 ? 349 GLU A C   1 
ATOM   1487 O O   . GLU A 1 186 ? 41.874  -32.044 -10.283 1.00 29.19 ? 349 GLU A O   1 
ATOM   1488 C CB  . GLU A 1 186 ? 43.646  -29.335 -10.106 1.00 30.15 ? 349 GLU A CB  1 
ATOM   1489 C CG  . GLU A 1 186 ? 43.039  -28.651 -11.335 1.00 36.49 ? 349 GLU A CG  1 
ATOM   1490 C CD  . GLU A 1 186 ? 44.040  -28.593 -12.490 1.00 45.47 ? 349 GLU A CD  1 
ATOM   1491 O OE1 . GLU A 1 186 ? 43.787  -29.227 -13.551 1.00 47.95 ? 349 GLU A OE1 1 
ATOM   1492 O OE2 . GLU A 1 186 ? 45.112  -27.961 -12.314 1.00 49.10 ? 349 GLU A OE2 1 
ATOM   1493 N N   . VAL A 1 187 ? 40.425  -30.303 -10.104 1.00 26.08 ? 350 VAL A N   1 
ATOM   1494 C CA  . VAL A 1 187 ? 39.306  -30.984 -10.720 1.00 25.58 ? 350 VAL A CA  1 
ATOM   1495 C C   . VAL A 1 187 ? 38.869  -30.226 -11.959 1.00 25.76 ? 350 VAL A C   1 
ATOM   1496 O O   . VAL A 1 187 ? 38.002  -29.356 -11.861 1.00 25.22 ? 350 VAL A O   1 
ATOM   1497 C CB  . VAL A 1 187 ? 38.128  -31.187 -9.720  1.00 25.17 ? 350 VAL A CB  1 
ATOM   1498 C CG1 . VAL A 1 187 ? 36.994  -31.945 -10.378 1.00 23.87 ? 350 VAL A CG1 1 
ATOM   1499 C CG2 . VAL A 1 187 ? 38.637  -31.937 -8.486  1.00 24.88 ? 350 VAL A CG2 1 
ATOM   1500 N N   . PRO A 1 188 ? 39.479  -30.549 -13.130 1.00 26.39 ? 351 PRO A N   1 
ATOM   1501 C CA  . PRO A 1 188 ? 39.236  -29.842 -14.423 1.00 27.43 ? 351 PRO A CA  1 
ATOM   1502 C C   . PRO A 1 188 ? 37.773  -29.788 -14.853 1.00 28.20 ? 351 PRO A C   1 
ATOM   1503 O O   . PRO A 1 188 ? 37.378  -28.900 -15.586 1.00 29.22 ? 351 PRO A O   1 
ATOM   1504 C CB  . PRO A 1 188 ? 40.059  -30.658 -15.453 1.00 27.66 ? 351 PRO A CB  1 
ATOM   1505 C CG  . PRO A 1 188 ? 41.135  -31.369 -14.644 1.00 27.62 ? 351 PRO A CG  1 
ATOM   1506 C CD  . PRO A 1 188 ? 40.498  -31.617 -13.258 1.00 26.35 ? 351 PRO A CD  1 
ATOM   1507 N N   . ASN A 1 189 ? 36.996  -30.744 -14.381 1.00 29.05 ? 352 ASN A N   1 
ATOM   1508 C CA  . ASN A 1 189 ? 35.573  -30.899 -14.646 1.00 30.81 ? 352 ASN A CA  1 
ATOM   1509 C C   . ASN A 1 189 ? 34.660  -29.810 -13.982 1.00 30.18 ? 352 ASN A C   1 
ATOM   1510 O O   . ASN A 1 189 ? 33.520  -29.635 -14.383 1.00 31.14 ? 352 ASN A O   1 
ATOM   1511 C CB  . ASN A 1 189 ? 35.225  -32.342 -14.207 1.00 30.82 ? 352 ASN A CB  1 
ATOM   1512 C CG  . ASN A 1 189 ? 33.786  -32.739 -14.474 1.00 35.80 ? 352 ASN A CG  1 
ATOM   1513 O OD1 . ASN A 1 189 ? 33.198  -32.370 -15.507 1.00 34.64 ? 352 ASN A OD1 1 
ATOM   1514 N ND2 . ASN A 1 189 ? 33.202  -33.533 -13.532 1.00 36.93 ? 352 ASN A ND2 1 
ATOM   1515 N N   . THR A 1 190 ? 35.192  -29.029 -13.042 1.00 29.81 ? 353 THR A N   1 
ATOM   1516 C CA  . THR A 1 190 ? 34.449  -27.957 -12.342 1.00 27.64 ? 353 THR A CA  1 
ATOM   1517 C C   . THR A 1 190 ? 33.984  -26.866 -13.304 1.00 28.63 ? 353 THR A C   1 
ATOM   1518 O O   . THR A 1 190 ? 34.789  -26.337 -14.053 1.00 29.35 ? 353 THR A O   1 
ATOM   1519 C CB  . THR A 1 190 ? 35.367  -27.277 -11.293 1.00 27.29 ? 353 THR A CB  1 
ATOM   1520 O OG1 . THR A 1 190 ? 35.982  -28.276 -10.484 1.00 23.98 ? 353 THR A OG1 1 
ATOM   1521 C CG2 . THR A 1 190 ? 34.609  -26.317 -10.390 1.00 26.08 ? 353 THR A CG2 1 
ATOM   1522 N N   . PRO A 1 191 ? 32.687  -26.471 -13.248 1.00 29.06 ? 354 PRO A N   1 
ATOM   1523 C CA  . PRO A 1 191 ? 32.235  -25.359 -14.067 1.00 28.51 ? 354 PRO A CA  1 
ATOM   1524 C C   . PRO A 1 191 ? 33.004  -24.095 -13.706 1.00 28.92 ? 354 PRO A C   1 
ATOM   1525 O O   . PRO A 1 191 ? 33.374  -23.913 -12.546 1.00 27.96 ? 354 PRO A O   1 
ATOM   1526 C CB  . PRO A 1 191 ? 30.761  -25.186 -13.657 1.00 27.92 ? 354 PRO A CB  1 
ATOM   1527 C CG  . PRO A 1 191 ? 30.375  -26.469 -13.054 1.00 29.87 ? 354 PRO A CG  1 
ATOM   1528 C CD  . PRO A 1 191 ? 31.601  -27.012 -12.406 1.00 28.31 ? 354 PRO A CD  1 
ATOM   1529 N N   . LEU A 1 192 ? 33.226  -23.230 -14.694 1.00 29.33 ? 355 LEU A N   1 
ATOM   1530 C CA  . LEU A 1 192 ? 33.947  -21.960 -14.494 1.00 29.58 ? 355 LEU A CA  1 
ATOM   1531 C C   . LEU A 1 192 ? 33.007  -20.770 -14.243 1.00 29.34 ? 355 LEU A C   1 
ATOM   1532 O O   . LEU A 1 192 ? 33.436  -19.685 -13.866 1.00 30.31 ? 355 LEU A O   1 
ATOM   1533 C CB  . LEU A 1 192 ? 34.885  -21.688 -15.673 1.00 29.28 ? 355 LEU A CB  1 
ATOM   1534 C CG  . LEU A 1 192 ? 35.941  -22.770 -15.964 1.00 31.41 ? 355 LEU A CG  1 
ATOM   1535 C CD1 . LEU A 1 192 ? 36.963  -22.299 -17.004 1.00 31.61 ? 355 LEU A CD1 1 
ATOM   1536 C CD2 . LEU A 1 192 ? 36.676  -23.163 -14.700 1.00 29.86 ? 355 LEU A CD2 1 
ATOM   1537 N N   . CYS A 1 193 ? 31.719  -20.989 -14.425 1.00 29.14 ? 356 CYS A N   1 
ATOM   1538 C CA  . CYS A 1 193 ? 30.737  -19.936 -14.310 1.00 29.25 ? 356 CYS A CA  1 
ATOM   1539 C C   . CYS A 1 193 ? 30.234  -19.839 -12.873 1.00 28.61 ? 356 CYS A C   1 
ATOM   1540 O O   . CYS A 1 193 ? 30.534  -20.695 -12.056 1.00 28.95 ? 356 CYS A O   1 
ATOM   1541 C CB  . CYS A 1 193 ? 29.574  -20.281 -15.238 1.00 29.20 ? 356 CYS A CB  1 
ATOM   1542 S SG  . CYS A 1 193 ? 28.736  -21.800 -14.738 1.00 36.34 ? 356 CYS A SG  1 
ATOM   1543 N N   . SER A 1 194 ? 29.401  -18.850 -12.597 1.00 27.66 ? 357 SER A N   1 
ATOM   1544 C CA  . SER A 1 194 ? 28.920  -18.595 -11.246 1.00 27.17 ? 357 SER A CA  1 
ATOM   1545 C C   . SER A 1 194 ? 27.843  -19.577 -10.835 1.00 26.55 ? 357 SER A C   1 
ATOM   1546 O O   . SER A 1 194 ? 27.289  -20.289 -11.673 1.00 26.44 ? 357 SER A O   1 
ATOM   1547 C CB  . SER A 1 194 ? 28.375  -17.185 -11.119 1.00 25.45 ? 357 SER A CB  1 
ATOM   1548 O OG  . SER A 1 194 ? 27.112  -17.068 -11.743 1.00 27.78 ? 357 SER A OG  1 
ATOM   1549 N N   . ALA A 1 195 ? 27.543  -19.592 -9.534  1.00 26.75 ? 358 ALA A N   1 
ATOM   1550 C CA  . ALA A 1 195 ? 26.471  -20.411 -8.979  1.00 26.59 ? 358 ALA A CA  1 
ATOM   1551 C C   . ALA A 1 195 ? 25.131  -20.008 -9.582  1.00 27.61 ? 358 ALA A C   1 
ATOM   1552 O O   . ALA A 1 195 ? 24.288  -20.868 -9.828  1.00 26.53 ? 358 ALA A O   1 
ATOM   1553 C CB  . ALA A 1 195 ? 26.427  -20.302 -7.483  1.00 25.88 ? 358 ALA A CB  1 
ATOM   1554 N N   . ARG A 1 196 ? 24.953  -18.712 -9.834  1.00 28.69 ? 359 ARG A N   1 
ATOM   1555 C CA  . ARG A 1 196 ? 23.718  -18.210 -10.440 1.00 30.14 ? 359 ARG A CA  1 
ATOM   1556 C C   . ARG A 1 196 ? 23.543  -18.734 -11.871 1.00 30.72 ? 359 ARG A C   1 
ATOM   1557 O O   . ARG A 1 196 ? 22.453  -19.190 -12.237 1.00 31.54 ? 359 ARG A O   1 
ATOM   1558 C CB  . ARG A 1 196 ? 23.660  -16.676 -10.402 1.00 30.56 ? 359 ARG A CB  1 
ATOM   1559 C CG  . ARG A 1 196 ? 22.354  -16.091 -10.976 1.00 33.91 ? 359 ARG A CG  1 
ATOM   1560 C CD  . ARG A 1 196 ? 22.361  -14.551 -10.979 1.00 39.58 ? 359 ARG A CD  1 
ATOM   1561 N NE  . ARG A 1 196 ? 21.181  -14.057 -10.283 1.00 45.25 ? 359 ARG A NE  1 
ATOM   1562 C CZ  . ARG A 1 196 ? 21.189  -13.328 -9.160  1.00 49.08 ? 359 ARG A CZ  1 
ATOM   1563 N NH1 . ARG A 1 196 ? 22.330  -12.945 -8.599  1.00 52.31 ? 359 ARG A NH1 1 
ATOM   1564 N NH2 . ARG A 1 196 ? 20.045  -12.959 -8.592  1.00 49.19 ? 359 ARG A NH2 1 
ATOM   1565 N N   . ASP A 1 197 ? 24.608  -18.670 -12.666 1.00 31.50 ? 360 ASP A N   1 
ATOM   1566 C CA  . ASP A 1 197 ? 24.618  -19.268 -13.990 1.00 32.22 ? 360 ASP A CA  1 
ATOM   1567 C C   . ASP A 1 197 ? 24.223  -20.738 -13.908 1.00 32.47 ? 360 ASP A C   1 
ATOM   1568 O O   . ASP A 1 197 ? 23.417  -21.200 -14.699 1.00 31.94 ? 360 ASP A O   1 
ATOM   1569 C CB  . ASP A 1 197 ? 25.986  -19.162 -14.634 1.00 32.02 ? 360 ASP A CB  1 
ATOM   1570 C CG  . ASP A 1 197 ? 26.277  -17.787 -15.169 1.00 36.51 ? 360 ASP A CG  1 
ATOM   1571 O OD1 . ASP A 1 197 ? 27.398  -17.630 -15.691 1.00 42.40 ? 360 ASP A OD1 1 
ATOM   1572 O OD2 . ASP A 1 197 ? 25.422  -16.863 -15.082 1.00 37.81 ? 360 ASP A OD2 1 
ATOM   1573 N N   . LEU A 1 198 ? 24.795  -21.465 -12.947 1.00 32.74 ? 361 LEU A N   1 
ATOM   1574 C CA  . LEU A 1 198 ? 24.482  -22.884 -12.802 1.00 34.24 ? 361 LEU A CA  1 
ATOM   1575 C C   . LEU A 1 198 ? 22.976  -23.094 -12.550 1.00 33.76 ? 361 LEU A C   1 
ATOM   1576 O O   . LEU A 1 198 ? 22.375  -23.972 -13.133 1.00 33.26 ? 361 LEU A O   1 
ATOM   1577 C CB  . LEU A 1 198 ? 25.351  -23.552 -11.726 1.00 33.33 ? 361 LEU A CB  1 
ATOM   1578 C CG  . LEU A 1 198 ? 26.820  -23.799 -12.081 1.00 35.44 ? 361 LEU A CG  1 
ATOM   1579 C CD1 . LEU A 1 198 ? 27.550  -24.270 -10.814 1.00 36.28 ? 361 LEU A CD1 1 
ATOM   1580 C CD2 . LEU A 1 198 ? 27.004  -24.818 -13.254 1.00 35.83 ? 361 LEU A CD2 1 
ATOM   1581 N N   . ALA A 1 199 ? 22.398  -22.270 -11.685 1.00 34.83 ? 362 ALA A N   1 
ATOM   1582 C CA  . ALA A 1 199 ? 20.992  -22.337 -11.338 1.00 36.48 ? 362 ALA A CA  1 
ATOM   1583 C C   . ALA A 1 199 ? 20.118  -22.029 -12.550 1.00 38.12 ? 362 ALA A C   1 
ATOM   1584 O O   . ALA A 1 199 ? 19.051  -22.643 -12.717 1.00 38.21 ? 362 ALA A O   1 
ATOM   1585 C CB  . ALA A 1 199 ? 20.680  -21.365 -10.197 1.00 36.33 ? 362 ALA A CB  1 
ATOM   1586 N N   . GLU A 1 200 ? 20.551  -21.070 -13.381 1.00 39.83 ? 363 GLU A N   1 
ATOM   1587 C CA  . GLU A 1 200 ? 19.826  -20.740 -14.642 1.00 41.59 ? 363 GLU A CA  1 
ATOM   1588 C C   . GLU A 1 200 ? 19.864  -21.869 -15.656 1.00 42.01 ? 363 GLU A C   1 
ATOM   1589 O O   . GLU A 1 200 ? 18.834  -22.220 -16.212 1.00 42.03 ? 363 GLU A O   1 
ATOM   1590 C CB  . GLU A 1 200 ? 20.343  -19.454 -15.298 1.00 41.85 ? 363 GLU A CB  1 
ATOM   1591 C CG  . GLU A 1 200 ? 19.916  -18.185 -14.589 1.00 43.28 ? 363 GLU A CG  1 
ATOM   1592 C CD  . GLU A 1 200 ? 20.637  -16.948 -15.114 1.00 48.14 ? 363 GLU A CD  1 
ATOM   1593 O OE1 . GLU A 1 200 ? 20.675  -15.935 -14.354 1.00 50.48 ? 363 GLU A OE1 1 
ATOM   1594 O OE2 . GLU A 1 200 ? 21.157  -16.984 -16.273 1.00 48.32 ? 363 GLU A OE2 1 
ATOM   1595 N N   . LYS A 1 201 ? 21.042  -22.449 -15.872 1.00 43.40 ? 364 LYS A N   1 
ATOM   1596 C CA  . LYS A 1 201 ? 21.179  -23.584 -16.798 1.00 44.84 ? 364 LYS A CA  1 
ATOM   1597 C C   . LYS A 1 201 ? 20.350  -24.813 -16.380 1.00 45.57 ? 364 LYS A C   1 
ATOM   1598 O O   . LYS A 1 201 ? 19.681  -25.419 -17.214 1.00 45.35 ? 364 LYS A O   1 
ATOM   1599 C CB  . LYS A 1 201 ? 22.647  -23.938 -17.036 1.00 44.94 ? 364 LYS A CB  1 
ATOM   1600 C CG  . LYS A 1 201 ? 23.441  -22.813 -17.724 1.00 46.64 ? 364 LYS A CG  1 
ATOM   1601 C CD  . LYS A 1 201 ? 24.874  -23.270 -18.000 1.00 50.43 ? 364 LYS A CD  1 
ATOM   1602 C CE  . LYS A 1 201 ? 25.762  -22.120 -18.480 1.00 52.19 ? 364 LYS A CE  1 
ATOM   1603 N NZ  . LYS A 1 201 ? 27.223  -22.385 -18.179 1.00 51.70 ? 364 LYS A NZ  1 
ATOM   1604 N N   . LYS A 1 202 ? 20.378  -25.148 -15.094 1.00 46.61 ? 365 LYS A N   1 
ATOM   1605 C CA  . LYS A 1 202 ? 19.543  -26.201 -14.517 1.00 47.83 ? 365 LYS A CA  1 
ATOM   1606 C C   . LYS A 1 202 ? 18.063  -25.937 -14.775 1.00 48.72 ? 365 LYS A C   1 
ATOM   1607 O O   . LYS A 1 202 ? 17.306  -26.861 -15.045 1.00 48.68 ? 365 LYS A O   1 
ATOM   1608 C CB  . LYS A 1 202 ? 19.789  -26.322 -13.008 1.00 47.67 ? 365 LYS A CB  1 
ATOM   1609 C CG  . LYS A 1 202 ? 19.201  -27.586 -12.382 1.00 49.40 ? 365 LYS A CG  1 
ATOM   1610 C CD  . LYS A 1 202 ? 19.566  -27.745 -10.893 1.00 53.67 ? 365 LYS A CD  1 
ATOM   1611 C CE  . LYS A 1 202 ? 18.729  -28.872 -10.235 1.00 55.62 ? 365 LYS A CE  1 
ATOM   1612 N NZ  . LYS A 1 202 ? 18.628  -28.816 -8.728  1.00 56.61 ? 365 LYS A NZ  1 
ATOM   1613 N N   . TYR A 1 203 ? 17.661  -24.672 -14.688 1.00 50.03 ? 366 TYR A N   1 
ATOM   1614 C CA  . TYR A 1 203 ? 16.272  -24.277 -14.877 1.00 51.18 ? 366 TYR A CA  1 
ATOM   1615 C C   . TYR A 1 203 ? 15.872  -24.463 -16.328 1.00 51.99 ? 366 TYR A C   1 
ATOM   1616 O O   . TYR A 1 203 ? 14.837  -25.081 -16.629 1.00 51.97 ? 366 TYR A O   1 
ATOM   1617 C CB  . TYR A 1 203 ? 16.092  -22.827 -14.474 1.00 51.46 ? 366 TYR A CB  1 
ATOM   1618 C CG  . TYR A 1 203 ? 14.656  -22.391 -14.430 1.00 53.09 ? 366 TYR A CG  1 
ATOM   1619 C CD1 . TYR A 1 203 ? 13.852  -22.715 -13.341 1.00 54.11 ? 366 TYR A CD1 1 
ATOM   1620 C CD2 . TYR A 1 203 ? 14.098  -21.649 -15.470 1.00 54.39 ? 366 TYR A CD2 1 
ATOM   1621 C CE1 . TYR A 1 203 ? 12.526  -22.311 -13.276 1.00 55.69 ? 366 TYR A CE1 1 
ATOM   1622 C CE2 . TYR A 1 203 ? 12.764  -21.242 -15.421 1.00 56.28 ? 366 TYR A CE2 1 
ATOM   1623 C CZ  . TYR A 1 203 ? 11.984  -21.580 -14.316 1.00 56.85 ? 366 TYR A CZ  1 
ATOM   1624 O OH  . TYR A 1 203 ? 10.659  -21.184 -14.226 1.00 59.35 ? 366 TYR A OH  1 
ATOM   1625 N N   . ILE A 1 204 ? 16.719  -23.947 -17.218 1.00 52.93 ? 367 ILE A N   1 
ATOM   1626 C CA  . ILE A 1 204 ? 16.535  -24.055 -18.657 1.00 54.01 ? 367 ILE A CA  1 
ATOM   1627 C C   . ILE A 1 204 ? 16.457  -25.520 -19.099 1.00 55.17 ? 367 ILE A C   1 
ATOM   1628 O O   . ILE A 1 204 ? 15.616  -25.879 -19.923 1.00 55.23 ? 367 ILE A O   1 
ATOM   1629 C CB  . ILE A 1 204 ? 17.625  -23.278 -19.424 1.00 53.85 ? 367 ILE A CB  1 
ATOM   1630 C CG1 . ILE A 1 204 ? 17.443  -21.778 -19.197 1.00 53.77 ? 367 ILE A CG1 1 
ATOM   1631 C CG2 . ILE A 1 204 ? 17.571  -23.586 -20.921 1.00 54.38 ? 367 ILE A CG2 1 
ATOM   1632 C CD1 . ILE A 1 204 ? 18.486  -20.912 -19.863 1.00 56.15 ? 367 ILE A CD1 1 
ATOM   1633 N N   . LEU A 1 205 ? 17.306  -26.361 -18.519 1.00 56.47 ? 368 LEU A N   1 
ATOM   1634 C CA  . LEU A 1 205 ? 17.320  -27.784 -18.818 1.00 57.62 ? 368 LEU A CA  1 
ATOM   1635 C C   . LEU A 1 205 ? 16.015  -28.504 -18.479 1.00 58.54 ? 368 LEU A C   1 
ATOM   1636 O O   . LEU A 1 205 ? 15.593  -29.398 -19.219 1.00 58.90 ? 368 LEU A O   1 
ATOM   1637 C CB  . LEU A 1 205 ? 18.477  -28.470 -18.110 1.00 57.37 ? 368 LEU A CB  1 
ATOM   1638 C CG  . LEU A 1 205 ? 19.187  -29.472 -19.007 1.00 57.61 ? 368 LEU A CG  1 
ATOM   1639 C CD1 . LEU A 1 205 ? 19.510  -28.813 -20.342 1.00 58.09 ? 368 LEU A CD1 1 
ATOM   1640 C CD2 . LEU A 1 205 ? 20.454  -29.958 -18.326 1.00 58.44 ? 368 LEU A CD2 1 
ATOM   1641 N N   . SER A 1 206 ? 15.378  -28.128 -17.377 1.00 59.32 ? 369 SER A N   1 
ATOM   1642 C CA  . SER A 1 206 ? 14.168  -28.829 -16.960 1.00 60.37 ? 369 SER A CA  1 
ATOM   1643 C C   . SER A 1 206 ? 12.882  -28.295 -17.625 1.00 61.05 ? 369 SER A C   1 
ATOM   1644 O O   . SER A 1 206 ? 11.876  -29.010 -17.687 1.00 61.09 ? 369 SER A O   1 
ATOM   1645 C CB  . SER A 1 206 ? 14.051  -28.859 -15.424 1.00 60.19 ? 369 SER A CB  1 
ATOM   1646 O OG  . SER A 1 206 ? 13.265  -27.788 -14.922 1.00 60.68 ? 369 SER A OG  1 
ATOM   1647 N N   . ASN A 1 207 ? 12.934  -27.061 -18.140 1.00 61.91 ? 370 ASN A N   1 
ATOM   1648 C CA  . ASN A 1 207 ? 11.745  -26.354 -18.660 1.00 62.55 ? 370 ASN A CA  1 
ATOM   1649 C C   . ASN A 1 207 ? 11.684  -26.191 -20.193 1.00 62.56 ? 370 ASN A C   1 
ATOM   1650 O O   . ASN A 1 207 ? 12.549  -26.666 -20.939 1.00 62.33 ? 370 ASN A O   1 
ATOM   1651 C CB  . ASN A 1 207 ? 11.590  -24.974 -17.988 1.00 62.88 ? 370 ASN A CB  1 
ATOM   1652 C CG  . ASN A 1 207 ? 11.347  -25.063 -16.468 1.00 64.50 ? 370 ASN A CG  1 
ATOM   1653 O OD1 . ASN A 1 207 ? 10.292  -24.646 -15.974 1.00 66.38 ? 370 ASN A OD1 1 
ATOM   1654 N ND2 . ASN A 1 207 ? 12.326  -25.587 -15.727 1.00 65.05 ? 370 ASN A ND2 1 
ATOM   1655 N N   . SER B 1 2   ? 36.599  -2.423  -3.266  1.00 35.93 ? 41  SER B N   1 
ATOM   1656 C CA  . SER B 1 2   ? 36.026  -2.184  -1.894  1.00 36.21 ? 41  SER B CA  1 
ATOM   1657 C C   . SER B 1 2   ? 36.827  -2.849  -0.747  1.00 35.31 ? 41  SER B C   1 
ATOM   1658 O O   . SER B 1 2   ? 36.257  -3.281  0.290   1.00 34.89 ? 41  SER B O   1 
ATOM   1659 C CB  . SER B 1 2   ? 34.566  -2.632  -1.854  1.00 36.21 ? 41  SER B CB  1 
ATOM   1660 O OG  . SER B 1 2   ? 34.452  -3.984  -2.305  1.00 39.79 ? 41  SER B OG  1 
ATOM   1661 N N   . HIS B 1 3   ? 38.140  -2.950  -0.933  1.00 33.82 ? 42  HIS B N   1 
ATOM   1662 C CA  . HIS B 1 3   ? 39.018  -3.481  0.114   1.00 32.37 ? 42  HIS B CA  1 
ATOM   1663 C C   . HIS B 1 3   ? 40.332  -2.720  0.036   1.00 32.33 ? 42  HIS B C   1 
ATOM   1664 O O   . HIS B 1 3   ? 40.833  -2.463  -1.058  1.00 32.32 ? 42  HIS B O   1 
ATOM   1665 C CB  . HIS B 1 3   ? 39.232  -5.001  -0.022  1.00 32.11 ? 42  HIS B CB  1 
ATOM   1666 C CG  . HIS B 1 3   ? 40.002  -5.616  1.122   1.00 31.09 ? 42  HIS B CG  1 
ATOM   1667 N ND1 . HIS B 1 3   ? 39.422  -6.465  2.048   1.00 30.58 ? 42  HIS B ND1 1 
ATOM   1668 C CD2 . HIS B 1 3   ? 41.304  -5.503  1.487   1.00 28.99 ? 42  HIS B CD2 1 
ATOM   1669 C CE1 . HIS B 1 3   ? 40.340  -6.859  2.922   1.00 26.59 ? 42  HIS B CE1 1 
ATOM   1670 N NE2 . HIS B 1 3   ? 41.485  -6.282  2.609   1.00 30.26 ? 42  HIS B NE2 1 
ATOM   1671 N N   . GLY B 1 4   ? 40.850  -2.304  1.190   1.00 31.47 ? 43  GLY B N   1 
ATOM   1672 C CA  . GLY B 1 4   ? 42.144  -1.667  1.281   1.00 31.75 ? 43  GLY B CA  1 
ATOM   1673 C C   . GLY B 1 4   ? 43.268  -2.557  0.755   1.00 32.26 ? 43  GLY B C   1 
ATOM   1674 O O   . GLY B 1 4   ? 43.056  -3.735  0.435   1.00 31.10 ? 43  GLY B O   1 
ATOM   1675 N N   . ARG B 1 5   ? 44.459  -1.970  0.668   1.00 32.11 ? 44  ARG B N   1 
ATOM   1676 C CA  . ARG B 1 5   ? 45.611  -2.615  0.086   1.00 33.24 ? 44  ARG B CA  1 
ATOM   1677 C C   . ARG B 1 5   ? 46.056  -3.805  0.933   1.00 32.52 ? 44  ARG B C   1 
ATOM   1678 O O   . ARG B 1 5   ? 46.335  -4.887  0.408   1.00 33.08 ? 44  ARG B O   1 
ATOM   1679 C CB  . ARG B 1 5   ? 46.751  -1.590  -0.004  1.00 34.48 ? 44  ARG B CB  1 
ATOM   1680 C CG  . ARG B 1 5   ? 48.025  -2.104  -0.683  1.00 38.20 ? 44  ARG B CG  1 
ATOM   1681 C CD  . ARG B 1 5   ? 49.219  -1.159  -0.378  1.00 42.83 ? 44  ARG B CD  1 
ATOM   1682 N NE  . ARG B 1 5   ? 50.520  -1.783  -0.647  1.00 46.89 ? 44  ARG B NE  1 
ATOM   1683 C CZ  . ARG B 1 5   ? 51.108  -2.698  0.134   1.00 50.10 ? 44  ARG B CZ  1 
ATOM   1684 N NH1 . ARG B 1 5   ? 50.521  -3.121  1.271   1.00 50.93 ? 44  ARG B NH1 1 
ATOM   1685 N NH2 . ARG B 1 5   ? 52.295  -3.189  -0.217  1.00 50.23 ? 44  ARG B NH2 1 
ATOM   1686 N N   . SER B 1 6   ? 46.147  -3.590  2.238   1.00 29.85 ? 45  SER B N   1 
ATOM   1687 C CA  . SER B 1 6   ? 46.549  -4.636  3.175   1.00 29.73 ? 45  SER B CA  1 
ATOM   1688 C C   . SER B 1 6   ? 45.380  -5.550  3.607   1.00 27.27 ? 45  SER B C   1 
ATOM   1689 O O   . SER B 1 6   ? 44.241  -5.128  3.601   1.00 27.25 ? 45  SER B O   1 
ATOM   1690 C CB  . SER B 1 6   ? 47.129  -3.967  4.404   1.00 28.58 ? 45  SER B CB  1 
ATOM   1691 O OG  . SER B 1 6   ? 47.829  -4.918  5.156   1.00 38.76 ? 45  SER B OG  1 
ATOM   1692 N N   . ARG B 1 7   ? 45.692  -6.787  3.982   1.00 25.44 ? 46  ARG B N   1 
ATOM   1693 C CA  . ARG B 1 7   ? 44.714  -7.692  4.585   1.00 23.99 ? 46  ARG B CA  1 
ATOM   1694 C C   . ARG B 1 7   ? 44.366  -7.233  6.008   1.00 21.85 ? 46  ARG B C   1 
ATOM   1695 O O   . ARG B 1 7   ? 45.196  -6.693  6.743   1.00 20.65 ? 46  ARG B O   1 
ATOM   1696 C CB  . ARG B 1 7   ? 45.210  -9.145  4.555   1.00 22.74 ? 46  ARG B CB  1 
ATOM   1697 C CG  . ARG B 1 7   ? 46.400  -9.491  5.421   1.00 22.49 ? 46  ARG B CG  1 
ATOM   1698 C CD  . ARG B 1 7   ? 46.998  -10.855 4.986   1.00 20.32 ? 46  ARG B CD  1 
ATOM   1699 N NE  . ARG B 1 7   ? 45.948  -11.865 4.858   1.00 17.62 ? 46  ARG B NE  1 
ATOM   1700 C CZ  . ARG B 1 7   ? 45.874  -12.773 3.889   1.00 21.01 ? 46  ARG B CZ  1 
ATOM   1701 N NH1 . ARG B 1 7   ? 46.845  -12.858 2.988   1.00 13.59 ? 46  ARG B NH1 1 
ATOM   1702 N NH2 . ARG B 1 7   ? 44.832  -13.620 3.812   1.00 19.81 ? 46  ARG B NH2 1 
ATOM   1703 N N   . PHE B 1 8   ? 43.113  -7.423  6.372   1.00 20.85 ? 47  PHE B N   1 
ATOM   1704 C CA  . PHE B 1 8   ? 42.668  -7.035  7.731   1.00 19.67 ? 47  PHE B CA  1 
ATOM   1705 C C   . PHE B 1 8   ? 43.139  -8.080  8.765   1.00 19.28 ? 47  PHE B C   1 
ATOM   1706 O O   . PHE B 1 8   ? 43.500  -7.734  9.911   1.00 19.43 ? 47  PHE B O   1 
ATOM   1707 C CB  . PHE B 1 8   ? 41.155  -6.927  7.751   1.00 18.74 ? 47  PHE B CB  1 
ATOM   1708 C CG  . PHE B 1 8   ? 40.595  -6.276  8.987   1.00 19.44 ? 47  PHE B CG  1 
ATOM   1709 C CD1 . PHE B 1 8   ? 40.740  -4.919  9.199   1.00 20.56 ? 47  PHE B CD1 1 
ATOM   1710 C CD2 . PHE B 1 8   ? 39.886  -7.038  9.926   1.00 22.63 ? 47  PHE B CD2 1 
ATOM   1711 C CE1 . PHE B 1 8   ? 40.206  -4.307  10.335  1.00 21.98 ? 47  PHE B CE1 1 
ATOM   1712 C CE2 . PHE B 1 8   ? 39.325  -6.452  11.060  1.00 23.23 ? 47  PHE B CE2 1 
ATOM   1713 C CZ  . PHE B 1 8   ? 39.505  -5.091  11.286  1.00 23.16 ? 47  PHE B CZ  1 
ATOM   1714 N N   . VAL B 1 9   ? 43.121  -9.357  8.375   1.00 19.27 ? 48  VAL B N   1 
ATOM   1715 C CA  . VAL B 1 9   ? 43.507  -10.444 9.267   1.00 18.61 ? 48  VAL B CA  1 
ATOM   1716 C C   . VAL B 1 9   ? 44.655  -11.216 8.585   1.00 18.79 ? 48  VAL B C   1 
ATOM   1717 O O   . VAL B 1 9   ? 44.525  -11.625 7.430   1.00 17.57 ? 48  VAL B O   1 
ATOM   1718 C CB  . VAL B 1 9   ? 42.268  -11.400 9.560   1.00 19.00 ? 48  VAL B CB  1 
ATOM   1719 C CG1 . VAL B 1 9   ? 42.664  -12.660 10.420  1.00 17.62 ? 48  VAL B CG1 1 
ATOM   1720 C CG2 . VAL B 1 9   ? 41.130  -10.638 10.235  1.00 19.58 ? 48  VAL B CG2 1 
ATOM   1721 N N   . LYS B 1 10  ? 45.767  -11.417 9.281   1.00 19.47 ? 49  LYS B N   1 
ATOM   1722 C CA  . LYS B 1 10  ? 46.859  -12.156 8.688   1.00 21.37 ? 49  LYS B CA  1 
ATOM   1723 C C   . LYS B 1 10  ? 46.588  -13.658 8.715   1.00 22.62 ? 49  LYS B C   1 
ATOM   1724 O O   . LYS B 1 10  ? 45.735  -14.131 9.493   1.00 20.39 ? 49  LYS B O   1 
ATOM   1725 C CB  . LYS B 1 10  ? 48.186  -11.787 9.373   1.00 22.34 ? 49  LYS B CB  1 
ATOM   1726 C CG  . LYS B 1 10  ? 48.527  -10.300 9.109   1.00 26.49 ? 49  LYS B CG  1 
ATOM   1727 C CD  . LYS B 1 10  ? 49.972  -9.964  9.353   1.00 35.64 ? 49  LYS B CD  1 
ATOM   1728 C CE  . LYS B 1 10  ? 50.160  -9.400  10.756  1.00 40.91 ? 49  LYS B CE  1 
ATOM   1729 N NZ  . LYS B 1 10  ? 51.369  -8.459  10.866  1.00 45.33 ? 49  LYS B NZ  1 
ATOM   1730 N N   . LYS B 1 11  ? 47.311  -14.403 7.868   1.00 22.83 ? 50  LYS B N   1 
ATOM   1731 C CA  . LYS B 1 11  ? 47.127  -15.861 7.797   1.00 25.05 ? 50  LYS B CA  1 
ATOM   1732 C C   . LYS B 1 11  ? 47.250  -16.556 9.146   1.00 25.29 ? 50  LYS B C   1 
ATOM   1733 O O   . LYS B 1 11  ? 46.559  -17.566 9.400   1.00 25.03 ? 50  LYS B O   1 
ATOM   1734 C CB  . LYS B 1 11  ? 48.120  -16.493 6.812   1.00 24.47 ? 50  LYS B CB  1 
ATOM   1735 C CG  . LYS B 1 11  ? 47.820  -16.172 5.359   1.00 28.11 ? 50  LYS B CG  1 
ATOM   1736 C CD  . LYS B 1 11  ? 46.555  -16.850 5.035   1.00 26.73 ? 50  LYS B CD  1 
ATOM   1737 C CE  . LYS B 1 11  ? 46.602  -17.481 3.719   1.00 24.76 ? 50  LYS B CE  1 
ATOM   1738 N NZ  . LYS B 1 11  ? 45.145  -17.806 3.495   1.00 18.90 ? 50  LYS B NZ  1 
ATOM   1739 N N   . ASP B 1 12  ? 48.153  -16.031 9.980   1.00 25.72 ? 51  ASP B N   1 
ATOM   1740 C CA  . ASP B 1 12  ? 48.380  -16.523 11.331  1.00 26.71 ? 51  ASP B CA  1 
ATOM   1741 C C   . ASP B 1 12  ? 47.332  -16.050 12.337  1.00 25.73 ? 51  ASP B C   1 
ATOM   1742 O O   . ASP B 1 12  ? 47.446  -16.375 13.499  1.00 26.53 ? 51  ASP B O   1 
ATOM   1743 C CB  . ASP B 1 12  ? 49.787  -16.137 11.828  1.00 27.40 ? 51  ASP B CB  1 
ATOM   1744 C CG  . ASP B 1 12  ? 49.941  -14.636 12.162  1.00 31.04 ? 51  ASP B CG  1 
ATOM   1745 O OD1 . ASP B 1 12  ? 48.989  -13.823 12.043  1.00 32.69 ? 51  ASP B OD1 1 
ATOM   1746 O OD2 . ASP B 1 12  ? 51.056  -14.243 12.546  1.00 33.84 ? 51  ASP B OD2 1 
ATOM   1747 N N   . GLY B 1 13  ? 46.334  -15.288 11.895  1.00 24.76 ? 52  GLY B N   1 
ATOM   1748 C CA  . GLY B 1 13  ? 45.240  -14.848 12.789  1.00 25.00 ? 52  GLY B CA  1 
ATOM   1749 C C   . GLY B 1 13  ? 45.425  -13.512 13.469  1.00 25.63 ? 52  GLY B C   1 
ATOM   1750 O O   . GLY B 1 13  ? 44.476  -12.929 14.004  1.00 24.91 ? 52  GLY B O   1 
ATOM   1751 N N   . HIS B 1 14  ? 46.633  -12.978 13.421  1.00 25.59 ? 53  HIS B N   1 
ATOM   1752 C CA  . HIS B 1 14  ? 46.854  -11.646 13.951  1.00 27.25 ? 53  HIS B CA  1 
ATOM   1753 C C   . HIS B 1 14  ? 46.042  -10.636 13.137  1.00 25.35 ? 53  HIS B C   1 
ATOM   1754 O O   . HIS B 1 14  ? 46.074  -10.641 11.910  1.00 25.07 ? 53  HIS B O   1 
ATOM   1755 C CB  . HIS B 1 14  ? 48.359  -11.330 13.954  1.00 29.10 ? 53  HIS B CB  1 
ATOM   1756 C CG  . HIS B 1 14  ? 48.685  -9.885  14.187  1.00 35.06 ? 53  HIS B CG  1 
ATOM   1757 N ND1 . HIS B 1 14  ? 48.698  -9.317  15.446  1.00 38.97 ? 53  HIS B ND1 1 
ATOM   1758 C CD2 . HIS B 1 14  ? 49.011  -8.890  13.322  1.00 38.93 ? 53  HIS B CD2 1 
ATOM   1759 C CE1 . HIS B 1 14  ? 49.018  -8.037  15.349  1.00 39.47 ? 53  HIS B CE1 1 
ATOM   1760 N NE2 . HIS B 1 14  ? 49.217  -7.753  14.073  1.00 40.92 ? 53  HIS B NE2 1 
ATOM   1761 N N   . CYS B 1 15  ? 45.315  -9.756  13.817  1.00 24.52 ? 54  CYS B N   1 
ATOM   1762 C CA  . CYS B 1 15  ? 44.585  -8.686  13.111  1.00 24.67 ? 54  CYS B CA  1 
ATOM   1763 C C   . CYS B 1 15  ? 45.531  -7.555  12.767  1.00 23.95 ? 54  CYS B C   1 
ATOM   1764 O O   . CYS B 1 15  ? 46.322  -7.155  13.575  1.00 24.29 ? 54  CYS B O   1 
ATOM   1765 C CB  . CYS B 1 15  ? 43.354  -8.220  13.909  1.00 24.89 ? 54  CYS B CB  1 
ATOM   1766 S SG  . CYS B 1 15  ? 42.164  -9.640  14.173  1.00 29.67 ? 54  CYS B SG  1 
ATOM   1767 N N   . ASN B 1 16  ? 45.491  -7.072  11.537  1.00 24.18 ? 55  ASN B N   1 
ATOM   1768 C CA  . ASN B 1 16  ? 46.444  -6.053  11.082  1.00 25.37 ? 55  ASN B CA  1 
ATOM   1769 C C   . ASN B 1 16  ? 45.983  -4.603  11.390  1.00 25.07 ? 55  ASN B C   1 
ATOM   1770 O O   . ASN B 1 16  ? 45.813  -3.777  10.498  1.00 24.70 ? 55  ASN B O   1 
ATOM   1771 C CB  . ASN B 1 16  ? 46.688  -6.265  9.584   1.00 25.94 ? 55  ASN B CB  1 
ATOM   1772 C CG  . ASN B 1 16  ? 48.002  -5.710  9.106   1.00 30.01 ? 55  ASN B CG  1 
ATOM   1773 O OD1 . ASN B 1 16  ? 48.948  -5.576  9.867   1.00 36.77 ? 55  ASN B OD1 1 
ATOM   1774 N ND2 . ASN B 1 16  ? 48.071  -5.382  7.814   1.00 33.69 ? 55  ASN B ND2 1 
ATOM   1775 N N   . VAL B 1 17  ? 45.791  -4.320  12.668  1.00 25.69 ? 56  VAL B N   1 
ATOM   1776 C CA  . VAL B 1 17  ? 45.173  -3.079  13.137  1.00 26.18 ? 56  VAL B CA  1 
ATOM   1777 C C   . VAL B 1 17  ? 46.049  -2.500  14.272  1.00 26.99 ? 56  VAL B C   1 
ATOM   1778 O O   . VAL B 1 17  ? 46.498  -3.234  15.160  1.00 27.29 ? 56  VAL B O   1 
ATOM   1779 C CB  . VAL B 1 17  ? 43.710  -3.281  13.664  1.00 26.17 ? 56  VAL B CB  1 
ATOM   1780 C CG1 . VAL B 1 17  ? 43.110  -1.975  14.088  1.00 27.83 ? 56  VAL B CG1 1 
ATOM   1781 C CG2 . VAL B 1 17  ? 42.775  -3.880  12.611  1.00 26.23 ? 56  VAL B CG2 1 
ATOM   1782 N N   . GLN B 1 18  ? 46.314  -1.203  14.196  1.00 26.66 ? 57  GLN B N   1 
ATOM   1783 C CA  . GLN B 1 18  ? 47.011  -0.454  15.237  1.00 27.76 ? 57  GLN B CA  1 
ATOM   1784 C C   . GLN B 1 18  ? 46.018  0.531   15.838  1.00 25.72 ? 57  GLN B C   1 
ATOM   1785 O O   . GLN B 1 18  ? 45.370  1.260   15.104  1.00 25.96 ? 57  GLN B O   1 
ATOM   1786 C CB  . GLN B 1 18  ? 48.216  0.286   14.628  1.00 28.64 ? 57  GLN B CB  1 
ATOM   1787 C CG  . GLN B 1 18  ? 48.614  1.541   15.397  1.00 34.25 ? 57  GLN B CG  1 
ATOM   1788 C CD  . GLN B 1 18  ? 49.858  2.260   14.875  1.00 39.52 ? 57  GLN B CD  1 
ATOM   1789 O OE1 . GLN B 1 18  ? 50.826  2.402   15.609  1.00 43.45 ? 57  GLN B OE1 1 
ATOM   1790 N NE2 . GLN B 1 18  ? 49.819  2.754   13.626  1.00 42.68 ? 57  GLN B NE2 1 
ATOM   1791 N N   . PHE B 1 19  ? 45.914  0.554   17.164  1.00 25.17 ? 58  PHE B N   1 
ATOM   1792 C CA  . PHE B 1 19  ? 45.036  1.466   17.877  1.00 24.89 ? 58  PHE B CA  1 
ATOM   1793 C C   . PHE B 1 19  ? 45.809  2.724   18.309  1.00 24.73 ? 58  PHE B C   1 
ATOM   1794 O O   . PHE B 1 19  ? 46.872  2.609   18.856  1.00 24.40 ? 58  PHE B O   1 
ATOM   1795 C CB  . PHE B 1 19  ? 44.412  0.747   19.082  1.00 26.12 ? 58  PHE B CB  1 
ATOM   1796 C CG  . PHE B 1 19  ? 43.328  -0.224  18.675  1.00 27.51 ? 58  PHE B CG  1 
ATOM   1797 C CD1 . PHE B 1 19  ? 43.653  -1.468  18.150  1.00 28.98 ? 58  PHE B CD1 1 
ATOM   1798 C CD2 . PHE B 1 19  ? 41.999  0.147   18.754  1.00 30.45 ? 58  PHE B CD2 1 
ATOM   1799 C CE1 . PHE B 1 19  ? 42.647  -2.368  17.717  1.00 28.20 ? 58  PHE B CE1 1 
ATOM   1800 C CE2 . PHE B 1 19  ? 40.976  -0.736  18.336  1.00 32.89 ? 58  PHE B CE2 1 
ATOM   1801 C CZ  . PHE B 1 19  ? 41.322  -2.003  17.817  1.00 29.69 ? 58  PHE B CZ  1 
ATOM   1802 N N   . ILE B 1 20  ? 45.298  3.914   18.026  1.00 23.68 ? 59  ILE B N   1 
ATOM   1803 C CA  . ILE B 1 20  ? 46.024  5.126   18.411  1.00 24.91 ? 59  ILE B CA  1 
ATOM   1804 C C   . ILE B 1 20  ? 45.086  6.054   19.201  1.00 26.42 ? 59  ILE B C   1 
ATOM   1805 O O   . ILE B 1 20  ? 43.832  5.945   19.094  1.00 24.20 ? 59  ILE B O   1 
ATOM   1806 C CB  . ILE B 1 20  ? 46.625  5.877   17.160  1.00 24.19 ? 59  ILE B CB  1 
ATOM   1807 C CG1 . ILE B 1 20  ? 45.521  6.363   16.205  1.00 23.43 ? 59  ILE B CG1 1 
ATOM   1808 C CG2 . ILE B 1 20  ? 47.613  5.006   16.431  1.00 24.83 ? 59  ILE B CG2 1 
ATOM   1809 C CD1 . ILE B 1 20  ? 46.012  7.334   15.110  1.00 26.05 ? 59  ILE B CD1 1 
ATOM   1810 N N   . ASN B 1 21  ? 45.684  6.975   19.965  1.00 27.91 ? 60  ASN B N   1 
ATOM   1811 C CA  . ASN B 1 21  ? 44.925  7.994   20.707  1.00 30.80 ? 60  ASN B CA  1 
ATOM   1812 C C   . ASN B 1 21  ? 43.906  7.378   21.653  1.00 34.04 ? 60  ASN B C   1 
ATOM   1813 O O   . ASN B 1 21  ? 42.762  7.851   21.731  1.00 34.31 ? 60  ASN B O   1 
ATOM   1814 C CB  . ASN B 1 21  ? 44.213  8.962   19.731  1.00 29.92 ? 60  ASN B CB  1 
ATOM   1815 C CG  . ASN B 1 21  ? 45.201  9.698   18.799  1.00 28.18 ? 60  ASN B CG  1 
ATOM   1816 O OD1 . ASN B 1 21  ? 46.330  9.948   19.181  1.00 28.81 ? 60  ASN B OD1 1 
ATOM   1817 N ND2 . ASN B 1 21  ? 44.782  10.012  17.592  1.00 22.50 ? 60  ASN B ND2 1 
ATOM   1818 N N   . VAL B 1 22  ? 44.285  6.293   22.328  1.00 37.70 ? 61  VAL B N   1 
ATOM   1819 C CA  . VAL B 1 22  ? 43.372  5.650   23.279  1.00 41.79 ? 61  VAL B CA  1 
ATOM   1820 C C   . VAL B 1 22  ? 43.367  6.416   24.601  1.00 45.33 ? 61  VAL B C   1 
ATOM   1821 O O   . VAL B 1 22  ? 42.434  6.293   25.401  1.00 45.68 ? 61  VAL B O   1 
ATOM   1822 C CB  . VAL B 1 22  ? 43.664  4.145   23.485  1.00 41.74 ? 61  VAL B CB  1 
ATOM   1823 C CG1 . VAL B 1 22  ? 44.948  3.924   24.255  1.00 42.39 ? 61  VAL B CG1 1 
ATOM   1824 C CG2 . VAL B 1 22  ? 42.507  3.496   24.225  1.00 42.99 ? 61  VAL B CG2 1 
ATOM   1825 N N   . GLY B 1 23  ? 44.422  7.208   24.798  1.00 48.81 ? 62  GLY B N   1 
ATOM   1826 C CA  . GLY B 1 23  ? 44.573  8.115   25.929  1.00 53.53 ? 62  GLY B CA  1 
ATOM   1827 C C   . GLY B 1 23  ? 44.868  7.443   27.255  1.00 56.36 ? 62  GLY B C   1 
ATOM   1828 O O   . GLY B 1 23  ? 45.039  6.230   27.326  1.00 56.70 ? 62  GLY B O   1 
ATOM   1829 N N   . GLU B 1 24  ? 44.965  8.264   28.299  1.00 59.72 ? 63  GLU B N   1 
ATOM   1830 C CA  . GLU B 1 24  ? 44.887  7.804   29.691  1.00 62.52 ? 63  GLU B CA  1 
ATOM   1831 C C   . GLU B 1 24  ? 43.411  7.615   30.042  1.00 63.79 ? 63  GLU B C   1 
ATOM   1832 O O   . GLU B 1 24  ? 43.049  7.635   31.223  1.00 64.08 ? 63  GLU B O   1 
ATOM   1833 C CB  . GLU B 1 24  ? 45.542  8.812   30.664  1.00 62.81 ? 63  GLU B CB  1 
ATOM   1834 C CG  . GLU B 1 24  ? 45.730  10.282  30.159  1.00 65.75 ? 63  GLU B CG  1 
ATOM   1835 C CD  . GLU B 1 24  ? 44.433  11.130  30.126  1.00 69.48 ? 63  GLU B CD  1 
ATOM   1836 O OE1 . GLU B 1 24  ? 44.271  12.035  30.990  1.00 69.76 ? 63  GLU B OE1 1 
ATOM   1837 O OE2 . GLU B 1 24  ? 43.584  10.906  29.225  1.00 70.73 ? 63  GLU B OE2 1 
ATOM   1838 N N   . LYS B 1 25  ? 42.581  7.441   29.000  1.00 65.25 ? 64  LYS B N   1 
ATOM   1839 C CA  . LYS B 1 25  ? 41.108  7.441   29.087  1.00 66.42 ? 64  LYS B CA  1 
ATOM   1840 C C   . LYS B 1 25  ? 40.573  6.915   30.427  1.00 67.09 ? 64  LYS B C   1 
ATOM   1841 O O   . LYS B 1 25  ? 40.846  5.754   30.793  1.00 67.26 ? 64  LYS B O   1 
ATOM   1842 C CB  . LYS B 1 25  ? 40.503  6.651   27.919  1.00 66.28 ? 64  LYS B CB  1 
ATOM   1843 N N   . ARG B 1 26  ? 39.833  7.780   31.149  1.00 67.56 ? 189 ARG B N   1 
ATOM   1844 C CA  . ARG B 1 26  ? 39.253  7.465   32.483  1.00 67.28 ? 189 ARG B CA  1 
ATOM   1845 C C   . ARG B 1 26  ? 39.083  5.952   32.715  1.00 66.76 ? 189 ARG B C   1 
ATOM   1846 O O   . ARG B 1 26  ? 39.639  5.397   33.673  1.00 67.09 ? 189 ARG B O   1 
ATOM   1847 C CB  . ARG B 1 26  ? 37.920  8.217   32.702  1.00 67.41 ? 189 ARG B CB  1 
ATOM   1848 N N   . ASN B 1 27  ? 38.335  5.302   31.822  1.00 65.74 ? 190 ASN B N   1 
ATOM   1849 C CA  . ASN B 1 27  ? 38.305  3.838   31.743  1.00 64.73 ? 190 ASN B CA  1 
ATOM   1850 C C   . ASN B 1 27  ? 39.022  3.321   30.473  1.00 63.73 ? 190 ASN B C   1 
ATOM   1851 O O   . ASN B 1 27  ? 38.810  3.849   29.359  1.00 64.12 ? 190 ASN B O   1 
ATOM   1852 C CB  . ASN B 1 27  ? 36.858  3.321   31.797  1.00 64.71 ? 190 ASN B CB  1 
ATOM   1853 N N   . GLU B 1 28  ? 39.898  2.326   30.662  1.00 61.66 ? 191 GLU B N   1 
ATOM   1854 C CA  . GLU B 1 28  ? 40.313  1.418   29.579  1.00 59.27 ? 191 GLU B CA  1 
ATOM   1855 C C   . GLU B 1 28  ? 39.152  0.434   29.346  1.00 57.34 ? 191 GLU B C   1 
ATOM   1856 O O   . GLU B 1 28  ? 39.164  -0.388  28.427  1.00 56.88 ? 191 GLU B O   1 
ATOM   1857 C CB  . GLU B 1 28  ? 41.609  0.670   29.957  1.00 59.82 ? 191 GLU B CB  1 
ATOM   1858 N N   . THR B 1 29  ? 38.147  0.581   30.207  1.00 54.84 ? 192 THR B N   1 
ATOM   1859 C CA  . THR B 1 29  ? 36.923  -0.201  30.237  1.00 52.40 ? 192 THR B CA  1 
ATOM   1860 C C   . THR B 1 29  ? 35.832  0.394   29.306  1.00 50.08 ? 192 THR B C   1 
ATOM   1861 O O   . THR B 1 29  ? 34.844  -0.283  29.004  1.00 49.85 ? 192 THR B O   1 
ATOM   1862 C CB  . THR B 1 29  ? 36.457  -0.317  31.716  1.00 52.88 ? 192 THR B CB  1 
ATOM   1863 O OG1 . THR B 1 29  ? 37.523  -0.901  32.486  1.00 53.66 ? 192 THR B OG1 1 
ATOM   1864 C CG2 . THR B 1 29  ? 35.218  -1.186  31.868  1.00 54.39 ? 192 THR B CG2 1 
ATOM   1865 N N   . LEU B 1 30  ? 36.042  1.637   28.849  1.00 46.88 ? 193 LEU B N   1 
ATOM   1866 C CA  . LEU B 1 30  ? 35.263  2.285   27.744  1.00 43.51 ? 193 LEU B CA  1 
ATOM   1867 C C   . LEU B 1 30  ? 34.958  1.375   26.549  1.00 40.06 ? 193 LEU B C   1 
ATOM   1868 O O   . LEU B 1 30  ? 35.846  0.852   25.874  1.00 41.23 ? 193 LEU B O   1 
ATOM   1869 C CB  . LEU B 1 30  ? 35.960  3.563   27.214  1.00 44.17 ? 193 LEU B CB  1 
ATOM   1870 C CG  . LEU B 1 30  ? 35.649  3.944   25.746  1.00 44.87 ? 193 LEU B CG  1 
ATOM   1871 C CD1 . LEU B 1 30  ? 34.233  4.470   25.599  1.00 43.91 ? 193 LEU B CD1 1 
ATOM   1872 C CD2 . LEU B 1 30  ? 36.725  4.908   25.097  1.00 45.24 ? 193 LEU B CD2 1 
ATOM   1873 N N   . VAL B 1 31  ? 33.681  1.203   26.280  1.00 34.37 ? 194 VAL B N   1 
ATOM   1874 C CA  . VAL B 1 31  ? 33.281  0.227   25.325  1.00 29.10 ? 194 VAL B CA  1 
ATOM   1875 C C   . VAL B 1 31  ? 32.238  0.846   24.447  1.00 24.94 ? 194 VAL B C   1 
ATOM   1876 O O   . VAL B 1 31  ? 32.253  0.601   23.271  1.00 24.13 ? 194 VAL B O   1 
ATOM   1877 C CB  . VAL B 1 31  ? 32.835  -1.086  26.050  1.00 29.66 ? 194 VAL B CB  1 
ATOM   1878 C CG1 . VAL B 1 31  ? 31.799  -1.816  25.288  1.00 28.07 ? 194 VAL B CG1 1 
ATOM   1879 C CG2 . VAL B 1 31  ? 34.080  -2.001  26.324  1.00 29.90 ? 194 VAL B CG2 1 
ATOM   1880 N N   . PHE B 1 32  ? 31.362  1.687   25.002  1.00 20.84 ? 195 PHE B N   1 
ATOM   1881 C CA  . PHE B 1 32  ? 30.236  2.229   24.221  1.00 19.11 ? 195 PHE B CA  1 
ATOM   1882 C C   . PHE B 1 32  ? 30.365  3.713   23.881  1.00 18.38 ? 195 PHE B C   1 
ATOM   1883 O O   . PHE B 1 32  ? 30.843  4.466   24.723  1.00 17.78 ? 195 PHE B O   1 
ATOM   1884 C CB  . PHE B 1 32  ? 28.941  2.026   24.990  1.00 18.54 ? 195 PHE B CB  1 
ATOM   1885 C CG  . PHE B 1 32  ? 28.507  0.586   25.081  1.00 16.82 ? 195 PHE B CG  1 
ATOM   1886 C CD1 . PHE B 1 32  ? 28.713  -0.122  26.238  1.00 15.00 ? 195 PHE B CD1 1 
ATOM   1887 C CD2 . PHE B 1 32  ? 27.886  -0.053  23.992  1.00 15.01 ? 195 PHE B CD2 1 
ATOM   1888 C CE1 . PHE B 1 32  ? 28.334  -1.456  26.336  1.00 15.46 ? 195 PHE B CE1 1 
ATOM   1889 C CE2 . PHE B 1 32  ? 27.480  -1.405  24.101  1.00 16.05 ? 195 PHE B CE2 1 
ATOM   1890 C CZ  . PHE B 1 32  ? 27.703  -2.070  25.280  1.00 15.76 ? 195 PHE B CZ  1 
ATOM   1891 N N   . SER B 1 33  ? 29.875  4.137   22.697  1.00 17.00 ? 196 SER B N   1 
ATOM   1892 C CA  . SER B 1 33  ? 29.850  5.559   22.374  1.00 16.84 ? 196 SER B CA  1 
ATOM   1893 C C   . SER B 1 33  ? 28.982  6.326   23.379  1.00 16.64 ? 196 SER B C   1 
ATOM   1894 O O   . SER B 1 33  ? 27.973  5.819   23.891  1.00 15.38 ? 196 SER B O   1 
ATOM   1895 C CB  . SER B 1 33  ? 29.363  5.828   20.966  1.00 15.10 ? 196 SER B CB  1 
ATOM   1896 O OG  . SER B 1 33  ? 28.094  5.203   20.717  1.00 19.45 ? 196 SER B OG  1 
ATOM   1897 N N   . HIS B 1 34  ? 29.393  7.538   23.672  1.00 17.57 ? 197 HIS B N   1 
ATOM   1898 C CA  . HIS B 1 34  ? 28.660  8.368   24.637  1.00 18.31 ? 197 HIS B CA  1 
ATOM   1899 C C   . HIS B 1 34  ? 27.207  8.601   24.222  1.00 18.51 ? 197 HIS B C   1 
ATOM   1900 O O   . HIS B 1 34  ? 26.321  8.626   25.102  1.00 19.20 ? 197 HIS B O   1 
ATOM   1901 C CB  . HIS B 1 34  ? 29.409  9.677   24.905  1.00 19.49 ? 197 HIS B CB  1 
ATOM   1902 C CG  . HIS B 1 34  ? 28.726  10.579  25.896  1.00 21.74 ? 197 HIS B CG  1 
ATOM   1903 N ND1 . HIS B 1 34  ? 28.759  10.353  27.257  1.00 26.46 ? 197 HIS B ND1 1 
ATOM   1904 C CD2 . HIS B 1 34  ? 28.001  11.710  25.719  1.00 26.54 ? 197 HIS B CD2 1 
ATOM   1905 C CE1 . HIS B 1 34  ? 28.104  11.324  27.878  1.00 28.84 ? 197 HIS B CE1 1 
ATOM   1906 N NE2 . HIS B 1 34  ? 27.631  12.157  26.966  1.00 28.91 ? 197 HIS B NE2 1 
ATOM   1907 N N   . ASN B 1 35  ? 26.961  8.724   22.910  1.00 18.26 ? 198 ASN B N   1 
ATOM   1908 C CA  . ASN B 1 35  ? 25.657  8.924   22.342  1.00 17.32 ? 198 ASN B CA  1 
ATOM   1909 C C   . ASN B 1 35  ? 25.283  7.771   21.400  1.00 18.55 ? 198 ASN B C   1 
ATOM   1910 O O   . ASN B 1 35  ? 26.157  7.130   20.799  1.00 19.15 ? 198 ASN B O   1 
ATOM   1911 C CB  . ASN B 1 35  ? 25.614  10.238  21.509  1.00 17.97 ? 198 ASN B CB  1 
ATOM   1912 C CG  . ASN B 1 35  ? 25.810  11.498  22.339  1.00 19.84 ? 198 ASN B CG  1 
ATOM   1913 O OD1 . ASN B 1 35  ? 26.878  12.104  22.285  1.00 21.36 ? 198 ASN B OD1 1 
ATOM   1914 N ND2 . ASN B 1 35  ? 24.807  11.878  23.152  1.00 20.64 ? 198 ASN B ND2 1 
ATOM   1915 N N   . ALA B 1 36  ? 23.975  7.566   21.228  1.00 18.01 ? 199 ALA B N   1 
ATOM   1916 C CA  . ALA B 1 36  ? 23.403  6.723   20.192  1.00 17.61 ? 199 ALA B CA  1 
ATOM   1917 C C   . ALA B 1 36  ? 22.906  7.690   19.135  1.00 17.13 ? 199 ALA B C   1 
ATOM   1918 O O   . ALA B 1 36  ? 22.780  8.884   19.422  1.00 17.70 ? 199 ALA B O   1 
ATOM   1919 C CB  . ALA B 1 36  ? 22.248  5.873   20.748  1.00 18.03 ? 199 ALA B CB  1 
ATOM   1920 N N   . VAL B 1 37  ? 22.600  7.201   17.942  1.00 16.63 ? 200 VAL B N   1 
ATOM   1921 C CA  . VAL B 1 37  ? 22.106  8.094   16.877  1.00 17.25 ? 200 VAL B CA  1 
ATOM   1922 C C   . VAL B 1 37  ? 20.883  7.478   16.253  1.00 17.08 ? 200 VAL B C   1 
ATOM   1923 O O   . VAL B 1 37  ? 20.677  6.312   16.364  1.00 17.27 ? 200 VAL B O   1 
ATOM   1924 C CB  . VAL B 1 37  ? 23.163  8.383   15.792  1.00 15.86 ? 200 VAL B CB  1 
ATOM   1925 C CG1 . VAL B 1 37  ? 24.424  8.919   16.418  1.00 14.95 ? 200 VAL B CG1 1 
ATOM   1926 C CG2 . VAL B 1 37  ? 23.468  7.125   14.981  1.00 17.43 ? 200 VAL B CG2 1 
ATOM   1927 N N   . ILE B 1 38  ? 20.048  8.284   15.626  1.00 17.63 ? 201 ILE B N   1 
ATOM   1928 C CA  . ILE B 1 38  ? 19.026  7.751   14.776  1.00 17.38 ? 201 ILE B CA  1 
ATOM   1929 C C   . ILE B 1 38  ? 19.291  8.304   13.386  1.00 18.83 ? 201 ILE B C   1 
ATOM   1930 O O   . ILE B 1 38  ? 19.410  9.522   13.200  1.00 19.50 ? 201 ILE B O   1 
ATOM   1931 C CB  . ILE B 1 38  ? 17.614  8.112   15.296  1.00 17.94 ? 201 ILE B CB  1 
ATOM   1932 C CG1 . ILE B 1 38  ? 17.276  7.186   16.474  1.00 17.19 ? 201 ILE B CG1 1 
ATOM   1933 C CG2 . ILE B 1 38  ? 16.575  7.991   14.157  1.00 17.05 ? 201 ILE B CG2 1 
ATOM   1934 C CD1 . ILE B 1 38  ? 15.950  7.469   17.177  1.00 18.85 ? 201 ILE B CD1 1 
ATOM   1935 N N   . ALA B 1 39  ? 19.363  7.423   12.399  1.00 19.05 ? 202 ALA B N   1 
ATOM   1936 C CA  . ALA B 1 39  ? 19.576  7.898   11.038  1.00 20.51 ? 202 ALA B CA  1 
ATOM   1937 C C   . ALA B 1 39  ? 19.074  6.868   10.048  1.00 21.07 ? 202 ALA B C   1 
ATOM   1938 O O   . ALA B 1 39  ? 18.845  5.686   10.393  1.00 18.64 ? 202 ALA B O   1 
ATOM   1939 C CB  . ALA B 1 39  ? 21.090  8.181   10.796  1.00 20.27 ? 202 ALA B CB  1 
ATOM   1940 N N   . MET B 1 40  ? 18.946  7.328   8.798   1.00 21.85 ? 203 MET B N   1 
ATOM   1941 C CA  . MET B 1 40  ? 18.610  6.455   7.658   1.00 23.32 ? 203 MET B CA  1 
ATOM   1942 C C   . MET B 1 40  ? 19.823  5.636   7.223   1.00 24.60 ? 203 MET B C   1 
ATOM   1943 O O   . MET B 1 40  ? 20.923  6.176   7.060   1.00 22.71 ? 203 MET B O   1 
ATOM   1944 C CB  . MET B 1 40  ? 18.149  7.263   6.439   1.00 23.15 ? 203 MET B CB  1 
ATOM   1945 C CG  . MET B 1 40  ? 16.823  8.047   6.627   1.00 23.44 ? 203 MET B CG  1 
ATOM   1946 S SD  . MET B 1 40  ? 15.433  7.010   7.040   1.00 28.86 ? 203 MET B SD  1 
ATOM   1947 C CE  . MET B 1 40  ? 15.166  6.252   5.436   1.00 25.83 ? 203 MET B CE  1 
ATOM   1948 N N   . ARG B 1 41  ? 19.588  4.351   6.991   1.00 24.52 ? 204 ARG B N   1 
ATOM   1949 C CA  . ARG B 1 41  ? 20.592  3.501   6.389   1.00 26.80 ? 204 ARG B CA  1 
ATOM   1950 C C   . ARG B 1 41  ? 19.901  2.526   5.433   1.00 27.41 ? 204 ARG B C   1 
ATOM   1951 O O   . ARG B 1 41  ? 19.041  1.751   5.828   1.00 27.90 ? 204 ARG B O   1 
ATOM   1952 C CB  . ARG B 1 41  ? 21.401  2.804   7.456   1.00 27.00 ? 204 ARG B CB  1 
ATOM   1953 C CG  . ARG B 1 41  ? 22.574  2.085   6.925   1.00 30.94 ? 204 ARG B CG  1 
ATOM   1954 C CD  . ARG B 1 41  ? 23.354  1.551   8.043   1.00 31.87 ? 204 ARG B CD  1 
ATOM   1955 N NE  . ARG B 1 41  ? 24.398  2.414   8.555   1.00 31.10 ? 204 ARG B NE  1 
ATOM   1956 C CZ  . ARG B 1 41  ? 25.443  1.906   9.201   1.00 29.64 ? 204 ARG B CZ  1 
ATOM   1957 N NH1 . ARG B 1 41  ? 25.510  0.593   9.363   1.00 27.88 ? 204 ARG B NH1 1 
ATOM   1958 N NH2 . ARG B 1 41  ? 26.402  2.675   9.672   1.00 30.01 ? 204 ARG B NH2 1 
ATOM   1959 N N   . ASP B 1 42  ? 20.257  2.611   4.160   1.00 27.97 ? 205 ASP B N   1 
ATOM   1960 C CA  . ASP B 1 42  ? 19.618  1.833   3.105   1.00 29.24 ? 205 ASP B CA  1 
ATOM   1961 C C   . ASP B 1 42  ? 18.072  1.850   3.153   1.00 29.18 ? 205 ASP B C   1 
ATOM   1962 O O   . ASP B 1 42  ? 17.429  0.815   3.153   1.00 30.17 ? 205 ASP B O   1 
ATOM   1963 C CB  . ASP B 1 42  ? 20.249  0.444   3.021   1.00 30.02 ? 205 ASP B CB  1 
ATOM   1964 C CG  . ASP B 1 42  ? 21.721  0.525   2.578   1.00 32.24 ? 205 ASP B CG  1 
ATOM   1965 O OD1 . ASP B 1 42  ? 22.040  1.095   1.460   1.00 30.68 ? 205 ASP B OD1 1 
ATOM   1966 O OD2 . ASP B 1 42  ? 22.531  0.085   3.399   1.00 30.41 ? 205 ASP B OD2 1 
ATOM   1967 N N   . GLY B 1 43  ? 17.515  3.054   3.189   1.00 28.64 ? 206 GLY B N   1 
ATOM   1968 C CA  . GLY B 1 43  ? 16.084  3.285   3.162   1.00 28.34 ? 206 GLY B CA  1 
ATOM   1969 C C   . GLY B 1 43  ? 15.339  2.862   4.430   1.00 28.00 ? 206 GLY B C   1 
ATOM   1970 O O   . GLY B 1 43  ? 14.118  2.823   4.426   1.00 27.07 ? 206 GLY B O   1 
ATOM   1971 N N   . LYS B 1 44  ? 16.069  2.542   5.498   1.00 26.63 ? 207 LYS B N   1 
ATOM   1972 C CA  . LYS B 1 44  ? 15.450  2.216   6.800   1.00 26.31 ? 207 LYS B CA  1 
ATOM   1973 C C   . LYS B 1 44  ? 15.870  3.204   7.883   1.00 24.45 ? 207 LYS B C   1 
ATOM   1974 O O   . LYS B 1 44  ? 17.026  3.596   7.947   1.00 24.32 ? 207 LYS B O   1 
ATOM   1975 C CB  . LYS B 1 44  ? 15.811  0.787   7.199   1.00 26.71 ? 207 LYS B CB  1 
ATOM   1976 C CG  . LYS B 1 44  ? 15.161  -0.247  6.316   1.00 31.57 ? 207 LYS B CG  1 
ATOM   1977 C CD  . LYS B 1 44  ? 16.139  -1.323  5.902   1.00 37.64 ? 207 LYS B CD  1 
ATOM   1978 C CE  . LYS B 1 44  ? 15.431  -2.455  5.142   1.00 42.42 ? 207 LYS B CE  1 
ATOM   1979 N NZ  . LYS B 1 44  ? 15.059  -3.571  6.085   1.00 46.78 ? 207 LYS B NZ  1 
ATOM   1980 N N   . LEU B 1 45  ? 14.942  3.618   8.746   1.00 23.06 ? 208 LEU B N   1 
ATOM   1981 C CA  . LEU B 1 45  ? 15.306  4.475   9.878   1.00 22.50 ? 208 LEU B CA  1 
ATOM   1982 C C   . LEU B 1 45  ? 15.911  3.547   10.962  1.00 21.74 ? 208 LEU B C   1 
ATOM   1983 O O   . LEU B 1 45  ? 15.276  2.547   11.348  1.00 22.74 ? 208 LEU B O   1 
ATOM   1984 C CB  . LEU B 1 45  ? 14.061  5.211   10.411  1.00 22.59 ? 208 LEU B CB  1 
ATOM   1985 C CG  . LEU B 1 45  ? 14.350  6.354   11.361  1.00 22.43 ? 208 LEU B CG  1 
ATOM   1986 C CD1 . LEU B 1 45  ? 14.968  7.550   10.616  1.00 21.84 ? 208 LEU B CD1 1 
ATOM   1987 C CD2 . LEU B 1 45  ? 13.052  6.746   12.064  1.00 22.76 ? 208 LEU B CD2 1 
ATOM   1988 N N   . CYS B 1 46  ? 17.124  3.840   11.422  1.00 21.01 ? 209 CYS B N   1 
ATOM   1989 C CA  . CYS B 1 46  ? 17.824  2.951   12.374  1.00 20.30 ? 209 CYS B CA  1 
ATOM   1990 C C   . CYS B 1 46  ? 18.266  3.687   13.596  1.00 19.68 ? 209 CYS B C   1 
ATOM   1991 O O   . CYS B 1 46  ? 18.763  4.811   13.509  1.00 20.52 ? 209 CYS B O   1 
ATOM   1992 C CB  . CYS B 1 46  ? 19.074  2.321   11.746  1.00 19.00 ? 209 CYS B CB  1 
ATOM   1993 S SG  . CYS B 1 46  ? 18.673  1.323   10.344  1.00 23.95 ? 209 CYS B SG  1 
ATOM   1994 N N   . LEU B 1 47  ? 18.148  3.007   14.724  1.00 19.01 ? 210 LEU B N   1 
ATOM   1995 C CA  . LEU B 1 47  ? 18.837  3.357   15.950  1.00 18.32 ? 210 LEU B CA  1 
ATOM   1996 C C   . LEU B 1 47  ? 20.202  2.630   15.988  1.00 17.64 ? 210 LEU B C   1 
ATOM   1997 O O   . LEU B 1 47  ? 20.274  1.410   15.775  1.00 16.78 ? 210 LEU B O   1 
ATOM   1998 C CB  . LEU B 1 47  ? 17.972  2.991   17.159  1.00 17.97 ? 210 LEU B CB  1 
ATOM   1999 C CG  . LEU B 1 47  ? 18.648  3.168   18.516  1.00 19.61 ? 210 LEU B CG  1 
ATOM   2000 C CD1 . LEU B 1 47  ? 18.819  4.638   18.950  1.00 16.80 ? 210 LEU B CD1 1 
ATOM   2001 C CD2 . LEU B 1 47  ? 17.825  2.357   19.537  1.00 19.14 ? 210 LEU B CD2 1 
ATOM   2002 N N   . MET B 1 48  ? 21.265  3.405   16.215  1.00 16.32 ? 211 MET B N   1 
ATOM   2003 C CA  . MET B 1 48  ? 22.635  2.878   16.175  1.00 17.39 ? 211 MET B CA  1 
ATOM   2004 C C   . MET B 1 48  ? 23.451  3.345   17.330  1.00 15.76 ? 211 MET B C   1 
ATOM   2005 O O   . MET B 1 48  ? 23.206  4.401   17.878  1.00 15.92 ? 211 MET B O   1 
ATOM   2006 C CB  . MET B 1 48  ? 23.352  3.266   14.853  1.00 18.11 ? 211 MET B CB  1 
ATOM   2007 C CG  . MET B 1 48  ? 22.552  2.818   13.611  1.00 18.48 ? 211 MET B CG  1 
ATOM   2008 S SD  . MET B 1 48  ? 23.372  3.269   12.033  1.00 26.61 ? 211 MET B SD  1 
ATOM   2009 C CE  . MET B 1 48  ? 22.821  4.938   11.817  1.00 29.08 ? 211 MET B CE  1 
ATOM   2010 N N   . TRP B 1 49  ? 24.443  2.543   17.690  1.00 14.67 ? 212 TRP B N   1 
ATOM   2011 C CA  . TRP B 1 49  ? 25.400  2.924   18.712  1.00 15.10 ? 212 TRP B CA  1 
ATOM   2012 C C   . TRP B 1 49  ? 26.682  2.175   18.439  1.00 15.40 ? 212 TRP B C   1 
ATOM   2013 O O   . TRP B 1 49  ? 26.651  1.132   17.796  1.00 14.49 ? 212 TRP B O   1 
ATOM   2014 C CB  . TRP B 1 49  ? 24.874  2.575   20.126  1.00 14.67 ? 212 TRP B CB  1 
ATOM   2015 C CG  . TRP B 1 49  ? 24.480  1.114   20.387  1.00 14.57 ? 212 TRP B CG  1 
ATOM   2016 C CD1 . TRP B 1 49  ? 25.251  0.157   21.002  1.00 12.88 ? 212 TRP B CD1 1 
ATOM   2017 C CD2 . TRP B 1 49  ? 23.206  0.491   20.112  1.00 14.80 ? 212 TRP B CD2 1 
ATOM   2018 N NE1 . TRP B 1 49  ? 24.531  -1.032  21.101  1.00 15.99 ? 212 TRP B NE1 1 
ATOM   2019 C CE2 . TRP B 1 49  ? 23.279  -0.835  20.560  1.00 13.64 ? 212 TRP B CE2 1 
ATOM   2020 C CE3 . TRP B 1 49  ? 22.010  0.932   19.509  1.00 16.75 ? 212 TRP B CE3 1 
ATOM   2021 C CZ2 . TRP B 1 49  ? 22.202  -1.720  20.442  1.00 13.07 ? 212 TRP B CZ2 1 
ATOM   2022 C CZ3 . TRP B 1 49  ? 20.965  0.037   19.378  1.00 16.23 ? 212 TRP B CZ3 1 
ATOM   2023 C CH2 . TRP B 1 49  ? 21.059  -1.256  19.853  1.00 14.91 ? 212 TRP B CH2 1 
ATOM   2024 N N   . ARG B 1 50  ? 27.804  2.699   18.921  1.00 16.88 ? 213 ARG B N   1 
ATOM   2025 C CA  . ARG B 1 50  ? 29.080  2.101   18.591  1.00 17.90 ? 213 ARG B CA  1 
ATOM   2026 C C   . ARG B 1 50  ? 29.622  1.350   19.817  1.00 18.08 ? 213 ARG B C   1 
ATOM   2027 O O   . ARG B 1 50  ? 29.420  1.749   20.966  1.00 18.80 ? 213 ARG B O   1 
ATOM   2028 C CB  . ARG B 1 50  ? 30.036  3.170   17.968  1.00 17.24 ? 213 ARG B CB  1 
ATOM   2029 C CG  . ARG B 1 50  ? 31.484  2.987   18.225  1.00 19.17 ? 213 ARG B CG  1 
ATOM   2030 C CD  . ARG B 1 50  ? 32.327  4.177   17.667  1.00 22.48 ? 213 ARG B CD  1 
ATOM   2031 N NE  . ARG B 1 50  ? 32.434  4.107   16.225  1.00 21.52 ? 213 ARG B NE  1 
ATOM   2032 C CZ  . ARG B 1 50  ? 32.694  5.154   15.442  1.00 20.56 ? 213 ARG B CZ  1 
ATOM   2033 N NH1 . ARG B 1 50  ? 32.881  6.372   15.943  1.00 12.86 ? 213 ARG B NH1 1 
ATOM   2034 N NH2 . ARG B 1 50  ? 32.806  4.954   14.164  1.00 14.01 ? 213 ARG B NH2 1 
ATOM   2035 N N   . VAL B 1 51  ? 30.269  0.224   19.575  1.00 18.12 ? 214 VAL B N   1 
ATOM   2036 C CA  . VAL B 1 51  ? 30.876  -0.530  20.628  1.00 19.07 ? 214 VAL B CA  1 
ATOM   2037 C C   . VAL B 1 51  ? 32.320  -0.874  20.199  1.00 20.29 ? 214 VAL B C   1 
ATOM   2038 O O   . VAL B 1 51  ? 32.553  -1.222  19.040  1.00 19.17 ? 214 VAL B O   1 
ATOM   2039 C CB  . VAL B 1 51  ? 30.021  -1.769  20.992  1.00 21.02 ? 214 VAL B CB  1 
ATOM   2040 C CG1 . VAL B 1 51  ? 29.972  -2.806  19.871  1.00 21.20 ? 214 VAL B CG1 1 
ATOM   2041 C CG2 . VAL B 1 51  ? 30.555  -2.410  22.295  1.00 23.33 ? 214 VAL B CG2 1 
ATOM   2042 N N   . GLY B 1 52  ? 33.288  -0.723  21.089  1.00 19.77 ? 215 GLY B N   1 
ATOM   2043 C CA  . GLY B 1 52  ? 34.648  -1.181  20.786  1.00 22.78 ? 215 GLY B CA  1 
ATOM   2044 C C   . GLY B 1 52  ? 34.967  -2.385  21.646  1.00 24.96 ? 215 GLY B C   1 
ATOM   2045 O O   . GLY B 1 52  ? 34.268  -2.622  22.654  1.00 25.58 ? 215 GLY B O   1 
ATOM   2046 N N   . ASN B 1 53  ? 35.999  -3.171  21.282  1.00 26.53 ? 216 ASN B N   1 
ATOM   2047 C CA  . ASN B 1 53  ? 36.416  -4.263  22.200  1.00 27.51 ? 216 ASN B CA  1 
ATOM   2048 C C   . ASN B 1 53  ? 37.132  -3.647  23.392  1.00 28.85 ? 216 ASN B C   1 
ATOM   2049 O O   . ASN B 1 53  ? 37.643  -2.522  23.276  1.00 28.65 ? 216 ASN B O   1 
ATOM   2050 C CB  . ASN B 1 53  ? 37.305  -5.337  21.562  1.00 26.00 ? 216 ASN B CB  1 
ATOM   2051 C CG  . ASN B 1 53  ? 36.911  -6.768  22.040  1.00 27.52 ? 216 ASN B CG  1 
ATOM   2052 O OD1 . ASN B 1 53  ? 36.623  -6.984  23.216  1.00 25.92 ? 216 ASN B OD1 1 
ATOM   2053 N ND2 . ASN B 1 53  ? 36.836  -7.721  21.104  1.00 26.49 ? 216 ASN B ND2 1 
ATOM   2054 N N   . LEU B 1 54  ? 37.142  -4.378  24.521  1.00 30.03 ? 217 LEU B N   1 
ATOM   2055 C CA  . LEU B 1 54  ? 37.864  -3.981  25.724  1.00 31.38 ? 217 LEU B CA  1 
ATOM   2056 C C   . LEU B 1 54  ? 39.342  -3.987  25.419  1.00 33.01 ? 217 LEU B C   1 
ATOM   2057 O O   . LEU B 1 54  ? 39.823  -4.950  24.828  1.00 33.36 ? 217 LEU B O   1 
ATOM   2058 C CB  . LEU B 1 54  ? 37.528  -4.939  26.879  1.00 31.18 ? 217 LEU B CB  1 
ATOM   2059 C CG  . LEU B 1 54  ? 36.147  -4.662  27.440  1.00 33.08 ? 217 LEU B CG  1 
ATOM   2060 C CD1 . LEU B 1 54  ? 35.624  -5.746  28.344  1.00 34.42 ? 217 LEU B CD1 1 
ATOM   2061 C CD2 . LEU B 1 54  ? 36.236  -3.297  28.182  1.00 34.89 ? 217 LEU B CD2 1 
ATOM   2062 N N   . GLN B 1 55  ? 40.075  -2.931  25.785  1.00 34.39 ? 218 GLN B N   1 
ATOM   2063 C CA  . GLN B 1 55  ? 41.498  -2.858  25.404  1.00 36.49 ? 218 GLN B CA  1 
ATOM   2064 C C   . GLN B 1 55  ? 42.327  -3.965  26.061  1.00 35.88 ? 218 GLN B C   1 
ATOM   2065 O O   . GLN B 1 55  ? 43.219  -4.551  25.438  1.00 35.77 ? 218 GLN B O   1 
ATOM   2066 C CB  . GLN B 1 55  ? 42.106  -1.493  25.728  1.00 36.60 ? 218 GLN B CB  1 
ATOM   2067 C CG  . GLN B 1 55  ? 42.134  -0.557  24.527  1.00 43.03 ? 218 GLN B CG  1 
ATOM   2068 C CD  . GLN B 1 55  ? 40.928  0.401   24.464  1.00 49.45 ? 218 GLN B CD  1 
ATOM   2069 O OE1 . GLN B 1 55  ? 40.647  1.148   25.420  1.00 52.06 ? 218 GLN B OE1 1 
ATOM   2070 N NE2 . GLN B 1 55  ? 40.238  0.408   23.320  1.00 51.61 ? 218 GLN B NE2 1 
ATOM   2071 N N   . LYS B 1 56  ? 41.999  -4.260  27.314  1.00 35.76 ? 219 LYS B N   1 
ATOM   2072 C CA  . LYS B 1 56  ? 42.833  -5.153  28.126  1.00 36.53 ? 219 LYS B CA  1 
ATOM   2073 C C   . LYS B 1 56  ? 42.204  -6.534  28.419  1.00 35.43 ? 219 LYS B C   1 
ATOM   2074 O O   . LYS B 1 56  ? 42.806  -7.362  29.127  1.00 35.83 ? 219 LYS B O   1 
ATOM   2075 C CB  . LYS B 1 56  ? 43.289  -4.428  29.412  1.00 37.34 ? 219 LYS B CB  1 
ATOM   2076 C CG  . LYS B 1 56  ? 44.110  -3.132  29.135  1.00 41.53 ? 219 LYS B CG  1 
ATOM   2077 C CD  . LYS B 1 56  ? 44.608  -2.479  30.450  1.00 48.30 ? 219 LYS B CD  1 
ATOM   2078 C CE  . LYS B 1 56  ? 45.286  -1.109  30.217  1.00 52.15 ? 219 LYS B CE  1 
ATOM   2079 N NZ  . LYS B 1 56  ? 45.333  -0.288  31.488  1.00 54.19 ? 219 LYS B NZ  1 
ATOM   2080 N N   . SER B 1 57  ? 41.028  -6.784  27.848  1.00 33.71 ? 220 SER B N   1 
ATOM   2081 C CA  . SER B 1 57  ? 40.280  -8.038  28.001  1.00 32.92 ? 220 SER B CA  1 
ATOM   2082 C C   . SER B 1 57  ? 39.584  -8.402  26.681  1.00 31.49 ? 220 SER B C   1 
ATOM   2083 O O   . SER B 1 57  ? 38.355  -8.410  26.628  1.00 32.19 ? 220 SER B O   1 
ATOM   2084 C CB  . SER B 1 57  ? 39.162  -7.840  29.021  1.00 33.26 ? 220 SER B CB  1 
ATOM   2085 O OG  . SER B 1 57  ? 39.673  -7.590  30.305  1.00 35.83 ? 220 SER B OG  1 
ATOM   2086 N N   . HIS B 1 58  ? 40.347  -8.658  25.621  1.00 29.40 ? 221 HIS B N   1 
ATOM   2087 C CA  . HIS B 1 58  ? 39.789  -8.860  24.296  1.00 27.75 ? 221 HIS B CA  1 
ATOM   2088 C C   . HIS B 1 58  ? 38.720  -9.978  24.262  1.00 26.73 ? 221 HIS B C   1 
ATOM   2089 O O   . HIS B 1 58  ? 39.036  -11.158 24.483  1.00 24.68 ? 221 HIS B O   1 
ATOM   2090 C CB  . HIS B 1 58  ? 40.888  -9.201  23.269  1.00 28.09 ? 221 HIS B CB  1 
ATOM   2091 C CG  . HIS B 1 58  ? 40.362  -9.314  21.877  1.00 27.81 ? 221 HIS B CG  1 
ATOM   2092 N ND1 . HIS B 1 58  ? 40.032  -8.209  21.115  1.00 30.10 ? 221 HIS B ND1 1 
ATOM   2093 C CD2 . HIS B 1 58  ? 40.084  -10.397 21.110  1.00 28.66 ? 221 HIS B CD2 1 
ATOM   2094 C CE1 . HIS B 1 58  ? 39.558  -8.609  19.941  1.00 32.02 ? 221 HIS B CE1 1 
ATOM   2095 N NE2 . HIS B 1 58  ? 39.589  -9.931  19.910  1.00 29.81 ? 221 HIS B NE2 1 
ATOM   2096 N N   . LEU B 1 59  ? 37.492  -9.597  23.889  1.00 24.45 ? 222 LEU B N   1 
ATOM   2097 C CA  . LEU B 1 59  ? 36.334  -10.492 23.988  1.00 22.22 ? 222 LEU B CA  1 
ATOM   2098 C C   . LEU B 1 59  ? 36.083  -11.227 22.696  1.00 20.61 ? 222 LEU B C   1 
ATOM   2099 O O   . LEU B 1 59  ? 36.071  -10.633 21.610  1.00 20.65 ? 222 LEU B O   1 
ATOM   2100 C CB  . LEU B 1 59  ? 35.098  -9.689  24.381  1.00 22.97 ? 222 LEU B CB  1 
ATOM   2101 C CG  . LEU B 1 59  ? 34.555  -9.661  25.820  1.00 23.71 ? 222 LEU B CG  1 
ATOM   2102 C CD1 . LEU B 1 59  ? 35.467  -10.035 26.968  1.00 23.83 ? 222 LEU B CD1 1 
ATOM   2103 C CD2 . LEU B 1 59  ? 33.800  -8.368  26.113  1.00 23.82 ? 222 LEU B CD2 1 
ATOM   2104 N N   . VAL B 1 60  ? 35.888  -12.527 22.825  1.00 18.30 ? 223 VAL B N   1 
ATOM   2105 C CA  . VAL B 1 60  ? 35.505  -13.425 21.729  1.00 16.52 ? 223 VAL B CA  1 
ATOM   2106 C C   . VAL B 1 60  ? 34.203  -14.155 22.089  1.00 16.96 ? 223 VAL B C   1 
ATOM   2107 O O   . VAL B 1 60  ? 33.690  -13.969 23.197  1.00 16.46 ? 223 VAL B O   1 
ATOM   2108 C CB  . VAL B 1 60  ? 36.664  -14.451 21.399  1.00 17.85 ? 223 VAL B CB  1 
ATOM   2109 C CG1 . VAL B 1 60  ? 37.905  -13.700 20.988  1.00 15.65 ? 223 VAL B CG1 1 
ATOM   2110 C CG2 . VAL B 1 60  ? 36.975  -15.406 22.609  1.00 15.04 ? 223 VAL B CG2 1 
ATOM   2111 N N   . GLU B 1 61  ? 33.627  -14.914 21.138  1.00 16.91 ? 224 GLU B N   1 
ATOM   2112 C CA  . GLU B 1 61  ? 32.246  -15.386 21.294  1.00 18.33 ? 224 GLU B CA  1 
ATOM   2113 C C   . GLU B 1 61  ? 31.331  -14.193 21.722  1.00 17.74 ? 224 GLU B C   1 
ATOM   2114 O O   . GLU B 1 61  ? 30.473  -14.343 22.596  1.00 14.82 ? 224 GLU B O   1 
ATOM   2115 C CB  . GLU B 1 61  ? 32.217  -16.554 22.303  1.00 18.50 ? 224 GLU B CB  1 
ATOM   2116 C CG  . GLU B 1 61  ? 32.781  -17.820 21.607  1.00 22.12 ? 224 GLU B CG  1 
ATOM   2117 C CD  . GLU B 1 61  ? 32.608  -19.101 22.360  1.00 26.86 ? 224 GLU B CD  1 
ATOM   2118 O OE1 . GLU B 1 61  ? 32.518  -19.065 23.613  1.00 28.25 ? 224 GLU B OE1 1 
ATOM   2119 O OE2 . GLU B 1 61  ? 32.637  -20.173 21.679  1.00 30.14 ? 224 GLU B OE2 1 
ATOM   2120 N N   . ALA B 1 62  ? 31.570  -13.007 21.128  1.00 17.09 ? 225 ALA B N   1 
ATOM   2121 C CA  . ALA B 1 62  ? 30.945  -11.757 21.628  1.00 15.51 ? 225 ALA B CA  1 
ATOM   2122 C C   . ALA B 1 62  ? 29.602  -11.571 21.002  1.00 15.66 ? 225 ALA B C   1 
ATOM   2123 O O   . ALA B 1 62  ? 29.395  -11.918 19.827  1.00 13.19 ? 225 ALA B O   1 
ATOM   2124 C CB  . ALA B 1 62  ? 31.840  -10.510 21.348  1.00 15.99 ? 225 ALA B CB  1 
ATOM   2125 N N   . HIS B 1 63  ? 28.660  -11.000 21.768  1.00 13.87 ? 226 HIS B N   1 
ATOM   2126 C CA  . HIS B 1 63  ? 27.375  -10.729 21.186  1.00 13.75 ? 226 HIS B CA  1 
ATOM   2127 C C   . HIS B 1 63  ? 26.717  -9.556  21.947  1.00 13.21 ? 226 HIS B C   1 
ATOM   2128 O O   . HIS B 1 63  ? 27.133  -9.211  23.042  1.00 13.44 ? 226 HIS B O   1 
ATOM   2129 C CB  . HIS B 1 63  ? 26.520  -12.011 21.199  1.00 13.84 ? 226 HIS B CB  1 
ATOM   2130 C CG  . HIS B 1 63  ? 26.367  -12.579 22.569  1.00 17.67 ? 226 HIS B CG  1 
ATOM   2131 N ND1 . HIS B 1 63  ? 25.272  -12.301 23.355  1.00 21.33 ? 226 HIS B ND1 1 
ATOM   2132 C CD2 . HIS B 1 63  ? 27.210  -13.315 23.342  1.00 19.31 ? 226 HIS B CD2 1 
ATOM   2133 C CE1 . HIS B 1 63  ? 25.414  -12.894 24.532  1.00 17.09 ? 226 HIS B CE1 1 
ATOM   2134 N NE2 . HIS B 1 63  ? 26.586  -13.505 24.555  1.00 18.32 ? 226 HIS B NE2 1 
ATOM   2135 N N   . VAL B 1 64  ? 25.725  -8.928  21.330  1.00 12.28 ? 227 VAL B N   1 
ATOM   2136 C CA  . VAL B 1 64  ? 25.188  -7.697  21.862  1.00 12.42 ? 227 VAL B CA  1 
ATOM   2137 C C   . VAL B 1 64  ? 23.704  -7.815  22.163  1.00 12.79 ? 227 VAL B C   1 
ATOM   2138 O O   . VAL B 1 64  ? 23.010  -8.604  21.576  1.00 11.00 ? 227 VAL B O   1 
ATOM   2139 C CB  . VAL B 1 64  ? 25.443  -6.465  20.919  1.00 12.20 ? 227 VAL B CB  1 
ATOM   2140 C CG1 . VAL B 1 64  ? 26.959  -5.992  20.987  1.00 12.68 ? 227 VAL B CG1 1 
ATOM   2141 C CG2 . VAL B 1 64  ? 24.955  -6.699  19.471  1.00 12.43 ? 227 VAL B CG2 1 
ATOM   2142 N N   . ARG B 1 65  ? 23.216  -6.969  23.058  1.00 13.86 ? 228 ARG B N   1 
ATOM   2143 C CA  . ARG B 1 65  ? 21.770  -6.889  23.290  1.00 14.43 ? 228 ARG B CA  1 
ATOM   2144 C C   . ARG B 1 65  ? 21.453  -5.482  23.653  1.00 14.67 ? 228 ARG B C   1 
ATOM   2145 O O   . ARG B 1 65  ? 22.366  -4.691  24.014  1.00 14.36 ? 228 ARG B O   1 
ATOM   2146 C CB  . ARG B 1 65  ? 21.408  -7.737  24.514  1.00 15.37 ? 228 ARG B CB  1 
ATOM   2147 C CG  . ARG B 1 65  ? 21.528  -9.236  24.298  1.00 19.15 ? 228 ARG B CG  1 
ATOM   2148 C CD  . ARG B 1 65  ? 21.256  -9.890  25.671  1.00 25.53 ? 228 ARG B CD  1 
ATOM   2149 N NE  . ARG B 1 65  ? 19.846  -9.716  26.050  1.00 24.47 ? 228 ARG B NE  1 
ATOM   2150 C CZ  . ARG B 1 65  ? 19.324  -10.186 27.195  1.00 26.00 ? 228 ARG B CZ  1 
ATOM   2151 N NH1 . ARG B 1 65  ? 20.097  -10.837 28.055  1.00 17.00 ? 228 ARG B NH1 1 
ATOM   2152 N NH2 . ARG B 1 65  ? 18.024  -10.034 27.466  1.00 23.26 ? 228 ARG B NH2 1 
ATOM   2153 N N   . ALA B 1 66  ? 20.162  -5.162  23.567  1.00 14.82 ? 229 ALA B N   1 
ATOM   2154 C CA  . ALA B 1 66  ? 19.671  -3.877  24.007  1.00 14.42 ? 229 ALA B CA  1 
ATOM   2155 C C   . ALA B 1 66  ? 18.273  -4.052  24.556  1.00 15.02 ? 229 ALA B C   1 
ATOM   2156 O O   . ALA B 1 66  ? 17.483  -4.887  24.015  1.00 16.32 ? 229 ALA B O   1 
ATOM   2157 C CB  . ALA B 1 66  ? 19.669  -2.827  22.804  1.00 13.31 ? 229 ALA B CB  1 
ATOM   2158 N N   . GLN B 1 67  ? 17.918  -3.219  25.546  1.00 15.59 ? 230 GLN B N   1 
ATOM   2159 C CA  . GLN B 1 67  ? 16.538  -3.207  26.047  1.00 16.86 ? 230 GLN B CA  1 
ATOM   2160 C C   . GLN B 1 67  ? 16.037  -1.797  26.270  1.00 16.82 ? 230 GLN B C   1 
ATOM   2161 O O   . GLN B 1 67  ? 16.758  -0.967  26.744  1.00 16.89 ? 230 GLN B O   1 
ATOM   2162 C CB  . GLN B 1 67  ? 16.429  -3.917  27.391  1.00 16.56 ? 230 GLN B CB  1 
ATOM   2163 C CG  . GLN B 1 67  ? 17.055  -5.289  27.457  1.00 18.33 ? 230 GLN B CG  1 
ATOM   2164 C CD  . GLN B 1 67  ? 16.839  -5.893  28.818  1.00 18.61 ? 230 GLN B CD  1 
ATOM   2165 O OE1 . GLN B 1 67  ? 17.105  -5.261  29.848  1.00 18.49 ? 230 GLN B OE1 1 
ATOM   2166 N NE2 . GLN B 1 67  ? 16.290  -7.085  28.835  1.00 16.95 ? 230 GLN B NE2 1 
ATOM   2167 N N   . LEU B 1 68  ? 14.794  -1.531  25.927  1.00 16.93 ? 231 LEU B N   1 
ATOM   2168 C CA  . LEU B 1 68  ? 14.157  -0.328  26.425  1.00 18.66 ? 231 LEU B CA  1 
ATOM   2169 C C   . LEU B 1 68  ? 13.539  -0.505  27.844  1.00 18.77 ? 231 LEU B C   1 
ATOM   2170 O O   . LEU B 1 68  ? 12.800  -1.474  28.097  1.00 19.15 ? 231 LEU B O   1 
ATOM   2171 C CB  . LEU B 1 68  ? 13.136  0.144   25.398  1.00 19.35 ? 231 LEU B CB  1 
ATOM   2172 C CG  . LEU B 1 68  ? 12.528  1.503   25.766  1.00 21.71 ? 231 LEU B CG  1 
ATOM   2173 C CD1 . LEU B 1 68  ? 12.548  2.413   24.610  1.00 26.98 ? 231 LEU B CD1 1 
ATOM   2174 C CD2 . LEU B 1 68  ? 11.153  1.282   26.239  1.00 23.61 ? 231 LEU B CD2 1 
ATOM   2175 N N   . LEU B 1 69  ? 13.899  0.390   28.766  1.00 20.39 ? 232 LEU B N   1 
ATOM   2176 C CA  . LEU B 1 69  ? 13.474  0.358   30.163  1.00 21.72 ? 232 LEU B CA  1 
ATOM   2177 C C   . LEU B 1 69  ? 12.396  1.423   30.362  1.00 23.37 ? 232 LEU B C   1 
ATOM   2178 O O   . LEU B 1 69  ? 12.561  2.609   29.993  1.00 23.12 ? 232 LEU B O   1 
ATOM   2179 C CB  . LEU B 1 69  ? 14.632  0.666   31.110  1.00 23.27 ? 232 LEU B CB  1 
ATOM   2180 C CG  . LEU B 1 69  ? 15.938  -0.133  31.020  1.00 24.17 ? 232 LEU B CG  1 
ATOM   2181 C CD1 . LEU B 1 69  ? 16.816  0.145   32.233  1.00 26.01 ? 232 LEU B CD1 1 
ATOM   2182 C CD2 . LEU B 1 69  ? 15.683  -1.625  30.914  1.00 22.88 ? 232 LEU B CD2 1 
ATOM   2183 N N   . LYS B 1 70  ? 11.258  0.987   30.884  1.00 23.79 ? 233 LYS B N   1 
ATOM   2184 C CA  . LYS B 1 70  ? 10.219  1.924   31.299  1.00 24.13 ? 233 LYS B CA  1 
ATOM   2185 C C   . LYS B 1 70  ? 9.290   1.195   32.260  1.00 24.20 ? 233 LYS B C   1 
ATOM   2186 O O   . LYS B 1 70  ? 9.324   -0.035  32.334  1.00 25.19 ? 233 LYS B O   1 
ATOM   2187 C CB  . LYS B 1 70  ? 9.444   2.430   30.084  1.00 23.52 ? 233 LYS B CB  1 
ATOM   2188 C CG  . LYS B 1 70  ? 8.760   1.348   29.321  1.00 25.78 ? 233 LYS B CG  1 
ATOM   2189 C CD  . LYS B 1 70  ? 7.572   1.922   28.579  1.00 36.18 ? 233 LYS B CD  1 
ATOM   2190 C CE  . LYS B 1 70  ? 6.866   0.862   27.782  1.00 38.23 ? 233 LYS B CE  1 
ATOM   2191 N NZ  . LYS B 1 70  ? 5.550   1.435   27.356  1.00 43.11 ? 233 LYS B NZ  1 
ATOM   2192 N N   . SER B 1 71  ? 8.448   1.959   32.959  1.00 23.56 ? 234 SER B N   1 
ATOM   2193 C CA  . SER B 1 71  ? 7.322   1.399   33.717  1.00 23.82 ? 234 SER B CA  1 
ATOM   2194 C C   . SER B 1 71  ? 6.083   1.290   32.818  1.00 24.44 ? 234 SER B C   1 
ATOM   2195 O O   . SER B 1 71  ? 5.975   1.932   31.745  1.00 24.30 ? 234 SER B O   1 
ATOM   2196 C CB  . SER B 1 71  ? 6.998   2.278   34.923  1.00 23.92 ? 234 SER B CB  1 
ATOM   2197 O OG  . SER B 1 71  ? 6.583   3.552   34.459  1.00 25.82 ? 234 SER B OG  1 
ATOM   2198 N N   . ARG B 1 72  ? 5.152   0.434   33.218  1.00 24.08 ? 235 ARG B N   1 
ATOM   2199 C CA  . ARG B 1 72  ? 3.892   0.352   32.494  1.00 23.27 ? 235 ARG B CA  1 
ATOM   2200 C C   . ARG B 1 72  ? 2.792   -0.208  33.365  1.00 22.78 ? 235 ARG B C   1 
ATOM   2201 O O   . ARG B 1 72  ? 3.050   -0.822  34.402  1.00 23.30 ? 235 ARG B O   1 
ATOM   2202 C CB  . ARG B 1 72  ? 4.029   -0.468  31.212  1.00 24.19 ? 235 ARG B CB  1 
ATOM   2203 C CG  . ARG B 1 72  ? 4.134   -1.931  31.388  1.00 25.23 ? 235 ARG B CG  1 
ATOM   2204 C CD  . ARG B 1 72  ? 4.122   -2.626  29.978  1.00 28.85 ? 235 ARG B CD  1 
ATOM   2205 N NE  . ARG B 1 72  ? 4.043   -4.064  30.168  1.00 27.42 ? 235 ARG B NE  1 
ATOM   2206 C CZ  . ARG B 1 72  ? 2.932   -4.778  30.050  1.00 28.25 ? 235 ARG B CZ  1 
ATOM   2207 N NH1 . ARG B 1 72  ? 1.791   -4.198  29.698  1.00 25.57 ? 235 ARG B NH1 1 
ATOM   2208 N NH2 . ARG B 1 72  ? 2.966   -6.090  30.264  1.00 29.44 ? 235 ARG B NH2 1 
ATOM   2209 N N   . ILE B 1 73  ? 1.563   0.027   32.943  1.00 22.79 ? 236 ILE B N   1 
ATOM   2210 C CA  . ILE B 1 73  ? 0.383   -0.426  33.683  1.00 22.66 ? 236 ILE B CA  1 
ATOM   2211 C C   . ILE B 1 73  ? -0.244  -1.405  32.737  1.00 21.98 ? 236 ILE B C   1 
ATOM   2212 O O   . ILE B 1 73  ? -0.469  -1.059  31.581  1.00 23.53 ? 236 ILE B O   1 
ATOM   2213 C CB  . ILE B 1 73  ? -0.661  0.749   33.933  1.00 22.74 ? 236 ILE B CB  1 
ATOM   2214 C CG1 . ILE B 1 73  ? 0.017   1.988   34.529  1.00 23.62 ? 236 ILE B CG1 1 
ATOM   2215 C CG2 . ILE B 1 73  ? -1.957  0.266   34.788  1.00 21.33 ? 236 ILE B CG2 1 
ATOM   2216 C CD1 . ILE B 1 73  ? 0.901   1.724   35.778  1.00 25.55 ? 236 ILE B CD1 1 
ATOM   2217 N N   . THR B 1 74  ? -0.553  -2.609  33.193  1.00 21.55 ? 237 THR B N   1 
ATOM   2218 C CA  . THR B 1 74  ? -1.237  -3.549  32.337  1.00 20.13 ? 237 THR B CA  1 
ATOM   2219 C C   . THR B 1 74  ? -2.719  -3.168  32.191  1.00 20.94 ? 237 THR B C   1 
ATOM   2220 O O   . THR B 1 74  ? -3.253  -2.376  32.993  1.00 21.22 ? 237 THR B O   1 
ATOM   2221 C CB  . THR B 1 74  ? -1.166  -4.958  32.864  1.00 20.50 ? 237 THR B CB  1 
ATOM   2222 O OG1 . THR B 1 74  ? -2.031  -5.050  34.014  1.00 18.45 ? 237 THR B OG1 1 
ATOM   2223 C CG2 . THR B 1 74  ? 0.264   -5.306  33.262  1.00 18.44 ? 237 THR B CG2 1 
ATOM   2224 N N   . SER B 1 75  ? -3.405  -3.757  31.206  1.00 20.28 ? 238 SER B N   1 
ATOM   2225 C CA  . SER B 1 75  ? -4.832  -3.496  31.106  1.00 22.79 ? 238 SER B CA  1 
ATOM   2226 C C   . SER B 1 75  ? -5.642  -3.927  32.345  1.00 22.26 ? 238 SER B C   1 
ATOM   2227 O O   . SER B 1 75  ? -6.754  -3.422  32.542  1.00 20.68 ? 238 SER B O   1 
ATOM   2228 C CB  . SER B 1 75  ? -5.438  -4.090  29.848  1.00 23.18 ? 238 SER B CB  1 
ATOM   2229 O OG  . SER B 1 75  ? -5.491  -5.494  29.973  1.00 28.41 ? 238 SER B OG  1 
ATOM   2230 N N   . GLU B 1 76  ? -5.093  -4.825  33.176  1.00 21.08 ? 239 GLU B N   1 
ATOM   2231 C CA  . GLU B 1 76  ? -5.791  -5.264  34.394  1.00 21.98 ? 239 GLU B CA  1 
ATOM   2232 C C   . GLU B 1 76  ? -5.525  -4.276  35.527  1.00 21.39 ? 239 GLU B C   1 
ATOM   2233 O O   . GLU B 1 76  ? -5.937  -4.502  36.643  1.00 21.98 ? 239 GLU B O   1 
ATOM   2234 C CB  . GLU B 1 76  ? -5.340  -6.690  34.811  1.00 21.59 ? 239 GLU B CB  1 
ATOM   2235 C CG  . GLU B 1 76  ? -5.741  -7.782  33.834  1.00 23.82 ? 239 GLU B CG  1 
ATOM   2236 C CD  . GLU B 1 76  ? -4.838  -7.863  32.557  1.00 27.53 ? 239 GLU B CD  1 
ATOM   2237 O OE1 . GLU B 1 76  ? -3.767  -7.192  32.494  1.00 25.78 ? 239 GLU B OE1 1 
ATOM   2238 O OE2 . GLU B 1 76  ? -5.227  -8.597  31.608  1.00 26.33 ? 239 GLU B OE2 1 
ATOM   2239 N N   . GLY B 1 77  ? -4.750  -3.231  35.262  1.00 20.88 ? 240 GLY B N   1 
ATOM   2240 C CA  . GLY B 1 77  ? -4.428  -2.259  36.287  1.00 20.65 ? 240 GLY B CA  1 
ATOM   2241 C C   . GLY B 1 77  ? -3.176  -2.545  37.085  1.00 21.29 ? 240 GLY B C   1 
ATOM   2242 O O   . GLY B 1 77  ? -2.905  -1.844  38.079  1.00 22.41 ? 240 GLY B O   1 
ATOM   2243 N N   . GLU B 1 78  ? -2.394  -3.558  36.695  1.00 20.10 ? 241 GLU B N   1 
ATOM   2244 C CA  . GLU B 1 78  ? -1.142  -3.854  37.421  1.00 19.63 ? 241 GLU B CA  1 
ATOM   2245 C C   . GLU B 1 78  ? -0.039  -2.842  37.072  1.00 19.85 ? 241 GLU B C   1 
ATOM   2246 O O   . GLU B 1 78  ? 0.202   -2.570  35.891  1.00 19.51 ? 241 GLU B O   1 
ATOM   2247 C CB  . GLU B 1 78  ? -0.644  -5.278  37.090  1.00 20.69 ? 241 GLU B CB  1 
ATOM   2248 C CG  . GLU B 1 78  ? 0.511   -5.703  38.002  1.00 19.73 ? 241 GLU B CG  1 
ATOM   2249 C CD  . GLU B 1 78  ? 1.116   -7.062  37.671  1.00 24.74 ? 241 GLU B CD  1 
ATOM   2250 O OE1 . GLU B 1 78  ? 0.694   -7.678  36.661  1.00 20.60 ? 241 GLU B OE1 1 
ATOM   2251 O OE2 . GLU B 1 78  ? 2.043   -7.486  38.438  1.00 27.28 ? 241 GLU B OE2 1 
ATOM   2252 N N   . TYR B 1 79  ? 0.627   -2.297  38.083  1.00 19.62 ? 242 TYR B N   1 
ATOM   2253 C CA  . TYR B 1 79  ? 1.742   -1.380  37.872  1.00 19.43 ? 242 TYR B CA  1 
ATOM   2254 C C   . TYR B 1 79  ? 3.016   -2.232  37.821  1.00 20.21 ? 242 TYR B C   1 
ATOM   2255 O O   . TYR B 1 79  ? 3.286   -2.977  38.763  1.00 17.73 ? 242 TYR B O   1 
ATOM   2256 C CB  . TYR B 1 79  ? 1.824   -0.403  39.041  1.00 19.85 ? 242 TYR B CB  1 
ATOM   2257 C CG  . TYR B 1 79  ? 3.159   0.288   39.259  1.00 18.81 ? 242 TYR B CG  1 
ATOM   2258 C CD1 . TYR B 1 79  ? 3.706   1.146   38.299  1.00 18.19 ? 242 TYR B CD1 1 
ATOM   2259 C CD2 . TYR B 1 79  ? 3.836   0.106   40.441  1.00 16.74 ? 242 TYR B CD2 1 
ATOM   2260 C CE1 . TYR B 1 79  ? 4.937   1.737   38.518  1.00 20.81 ? 242 TYR B CE1 1 
ATOM   2261 C CE2 . TYR B 1 79  ? 5.052   0.683   40.670  1.00 20.93 ? 242 TYR B CE2 1 
ATOM   2262 C CZ  . TYR B 1 79  ? 5.605   1.510   39.710  1.00 20.65 ? 242 TYR B CZ  1 
ATOM   2263 O OH  . TYR B 1 79  ? 6.844   2.105   39.981  1.00 20.75 ? 242 TYR B OH  1 
ATOM   2264 N N   . ILE B 1 80  ? 3.745   -2.116  36.706  1.00 20.04 ? 243 ILE B N   1 
ATOM   2265 C CA  . ILE B 1 80  ? 5.050   -2.759  36.506  1.00 21.07 ? 243 ILE B CA  1 
ATOM   2266 C C   . ILE B 1 80  ? 6.147   -1.680  36.622  1.00 20.19 ? 243 ILE B C   1 
ATOM   2267 O O   . ILE B 1 80  ? 6.254   -0.785  35.760  1.00 20.47 ? 243 ILE B O   1 
ATOM   2268 C CB  . ILE B 1 80  ? 5.039   -3.463  35.113  1.00 20.84 ? 243 ILE B CB  1 
ATOM   2269 C CG1 . ILE B 1 80  ? 4.018   -4.608  35.145  1.00 21.23 ? 243 ILE B CG1 1 
ATOM   2270 C CG2 . ILE B 1 80  ? 6.383   -4.045  34.739  1.00 20.65 ? 243 ILE B CG2 1 
ATOM   2271 C CD1 . ILE B 1 80  ? 3.741   -5.226  33.801  1.00 22.37 ? 243 ILE B CD1 1 
ATOM   2272 N N   . PRO B 1 81  ? 6.911   -1.693  37.712  1.00 19.52 ? 244 PRO B N   1 
ATOM   2273 C CA  . PRO B 1 81  ? 7.904   -0.657  37.871  1.00 19.78 ? 244 PRO B CA  1 
ATOM   2274 C C   . PRO B 1 81  ? 8.946   -0.665  36.748  1.00 20.68 ? 244 PRO B C   1 
ATOM   2275 O O   . PRO B 1 81  ? 9.406   0.401   36.331  1.00 20.69 ? 244 PRO B O   1 
ATOM   2276 C CB  . PRO B 1 81  ? 8.533   -1.008  39.212  1.00 19.30 ? 244 PRO B CB  1 
ATOM   2277 C CG  . PRO B 1 81  ? 7.492   -1.737  39.885  1.00 19.36 ? 244 PRO B CG  1 
ATOM   2278 C CD  . PRO B 1 81  ? 6.861   -2.554  38.893  1.00 19.42 ? 244 PRO B CD  1 
ATOM   2279 N N   . LEU B 1 82  ? 9.332   -1.849  36.280  1.00 20.80 ? 245 LEU B N   1 
ATOM   2280 C CA  . LEU B 1 82  ? 10.412  -1.929  35.296  1.00 23.30 ? 245 LEU B CA  1 
ATOM   2281 C C   . LEU B 1 82  ? 10.125  -3.015  34.300  1.00 23.36 ? 245 LEU B C   1 
ATOM   2282 O O   . LEU B 1 82  ? 10.201  -4.172  34.630  1.00 24.04 ? 245 LEU B O   1 
ATOM   2283 C CB  . LEU B 1 82  ? 11.761  -2.204  35.973  1.00 22.67 ? 245 LEU B CB  1 
ATOM   2284 C CG  . LEU B 1 82  ? 12.972  -2.359  35.057  1.00 25.35 ? 245 LEU B CG  1 
ATOM   2285 C CD1 . LEU B 1 82  ? 13.107  -1.092  34.224  1.00 29.06 ? 245 LEU B CD1 1 
ATOM   2286 C CD2 . LEU B 1 82  ? 14.254  -2.636  35.856  1.00 22.98 ? 245 LEU B CD2 1 
ATOM   2287 N N   . ASP B 1 83  ? 9.749   -2.605  33.098  1.00 24.52 ? 246 ASP B N   1 
ATOM   2288 C CA  . ASP B 1 83  ? 9.489   -3.487  31.991  1.00 25.82 ? 246 ASP B CA  1 
ATOM   2289 C C   . ASP B 1 83  ? 10.774  -3.345  31.153  1.00 25.03 ? 246 ASP B C   1 
ATOM   2290 O O   . ASP B 1 83  ? 11.255  -2.227  30.930  1.00 24.79 ? 246 ASP B O   1 
ATOM   2291 C CB  . ASP B 1 83  ? 8.241   -2.964  31.245  1.00 26.70 ? 246 ASP B CB  1 
ATOM   2292 C CG  . ASP B 1 83  ? 7.600   -4.004  30.314  1.00 32.63 ? 246 ASP B CG  1 
ATOM   2293 O OD1 . ASP B 1 83  ? 7.934   -5.197  30.411  1.00 38.18 ? 246 ASP B OD1 1 
ATOM   2294 O OD2 . ASP B 1 83  ? 6.723   -3.626  29.495  1.00 38.00 ? 246 ASP B OD2 1 
ATOM   2295 N N   . GLN B 1 84  ? 11.350  -4.480  30.775  1.00 23.69 ? 247 GLN B N   1 
ATOM   2296 C CA  . GLN B 1 84  ? 12.635  -4.547  30.113  1.00 23.52 ? 247 GLN B CA  1 
ATOM   2297 C C   . GLN B 1 84  ? 12.357  -5.200  28.799  1.00 23.83 ? 247 GLN B C   1 
ATOM   2298 O O   . GLN B 1 84  ? 12.220  -6.411  28.729  1.00 23.22 ? 247 GLN B O   1 
ATOM   2299 C CB  . GLN B 1 84  ? 13.641  -5.384  30.934  1.00 21.88 ? 247 GLN B CB  1 
ATOM   2300 C CG  . GLN B 1 84  ? 14.137  -4.717  32.220  1.00 22.21 ? 247 GLN B CG  1 
ATOM   2301 C CD  . GLN B 1 84  ? 15.005  -5.642  33.069  1.00 23.32 ? 247 GLN B CD  1 
ATOM   2302 O OE1 . GLN B 1 84  ? 14.588  -6.116  34.108  1.00 23.70 ? 247 GLN B OE1 1 
ATOM   2303 N NE2 . GLN B 1 84  ? 16.203  -5.917  32.604  1.00 19.51 ? 247 GLN B NE2 1 
ATOM   2304 N N   . ILE B 1 85  ? 12.234  -4.384  27.764  1.00 24.56 ? 248 ILE B N   1 
ATOM   2305 C CA  . ILE B 1 85  ? 11.756  -4.835  26.472  1.00 26.38 ? 248 ILE B CA  1 
ATOM   2306 C C   . ILE B 1 85  ? 12.961  -4.942  25.551  1.00 25.68 ? 248 ILE B C   1 
ATOM   2307 O O   . ILE B 1 85  ? 13.613  -3.947  25.228  1.00 22.69 ? 248 ILE B O   1 
ATOM   2308 C CB  . ILE B 1 85  ? 10.687  -3.869  25.887  1.00 27.28 ? 248 ILE B CB  1 
ATOM   2309 C CG1 . ILE B 1 85  ? 9.396   -3.904  26.737  1.00 32.04 ? 248 ILE B CG1 1 
ATOM   2310 C CG2 . ILE B 1 85  ? 10.319  -4.241  24.462  1.00 29.84 ? 248 ILE B CG2 1 
ATOM   2311 C CD1 . ILE B 1 85  ? 8.867   -5.327  27.046  1.00 32.60 ? 248 ILE B CD1 1 
ATOM   2312 N N   . ASP B 1 86  ? 13.234  -6.167  25.124  1.00 26.35 ? 249 ASP B N   1 
ATOM   2313 C CA  . ASP B 1 86  ? 14.408  -6.413  24.323  1.00 26.88 ? 249 ASP B CA  1 
ATOM   2314 C C   . ASP B 1 86  ? 14.212  -5.736  22.959  1.00 24.71 ? 249 ASP B C   1 
ATOM   2315 O O   . ASP B 1 86  ? 13.145  -5.781  22.430  1.00 24.70 ? 249 ASP B O   1 
ATOM   2316 C CB  . ASP B 1 86  ? 14.694  -7.923  24.268  1.00 28.09 ? 249 ASP B CB  1 
ATOM   2317 C CG  . ASP B 1 86  ? 14.962  -8.525  25.698  1.00 34.40 ? 249 ASP B CG  1 
ATOM   2318 O OD1 . ASP B 1 86  ? 16.109  -8.323  26.227  1.00 34.07 ? 249 ASP B OD1 1 
ATOM   2319 O OD2 . ASP B 1 86  ? 14.018  -9.181  26.291  1.00 38.20 ? 249 ASP B OD2 1 
ATOM   2320 N N   . ILE B 1 87  ? 15.257  -5.116  22.434  1.00 22.99 ? 250 ILE B N   1 
ATOM   2321 C CA  . ILE B 1 87  ? 15.298  -4.381  21.147  1.00 24.08 ? 250 ILE B CA  1 
ATOM   2322 C C   . ILE B 1 87  ? 16.066  -5.252  20.095  1.00 22.75 ? 250 ILE B C   1 
ATOM   2323 O O   . ILE B 1 87  ? 17.202  -5.679  20.360  1.00 21.12 ? 250 ILE B O   1 
ATOM   2324 C CB  . ILE B 1 87  ? 16.099  -3.017  21.433  1.00 25.56 ? 250 ILE B CB  1 
ATOM   2325 C CG1 . ILE B 1 87  ? 15.221  -2.002  22.183  1.00 28.41 ? 250 ILE B CG1 1 
ATOM   2326 C CG2 . ILE B 1 87  ? 16.705  -2.378  20.220  1.00 27.81 ? 250 ILE B CG2 1 
ATOM   2327 C CD1 . ILE B 1 87  ? 13.771  -2.154  21.806  1.00 32.82 ? 250 ILE B CD1 1 
ATOM   2328 N N   . ASN B 1 88  ? 15.465  -5.539  18.942  1.00 21.94 ? 251 ASN B N   1 
ATOM   2329 C CA  . ASN B 1 88  ? 16.059  -6.498  17.989  1.00 21.94 ? 251 ASN B CA  1 
ATOM   2330 C C   . ASN B 1 88  ? 17.400  -5.961  17.424  1.00 20.71 ? 251 ASN B C   1 
ATOM   2331 O O   . ASN B 1 88  ? 17.402  -4.941  16.735  1.00 20.53 ? 251 ASN B O   1 
ATOM   2332 C CB  . ASN B 1 88  ? 15.071  -6.830  16.853  1.00 21.87 ? 251 ASN B CB  1 
ATOM   2333 C CG  . ASN B 1 88  ? 15.603  -7.896  15.846  1.00 26.59 ? 251 ASN B CG  1 
ATOM   2334 O OD1 . ASN B 1 88  ? 16.609  -8.575  16.076  1.00 28.80 ? 251 ASN B OD1 1 
ATOM   2335 N ND2 . ASN B 1 88  ? 14.921  -8.010  14.708  1.00 29.82 ? 251 ASN B ND2 1 
ATOM   2336 N N   . VAL B 1 89  ? 18.502  -6.656  17.725  1.00 17.74 ? 252 VAL B N   1 
ATOM   2337 C CA  . VAL B 1 89  ? 19.795  -6.436  17.042  1.00 16.96 ? 252 VAL B CA  1 
ATOM   2338 C C   . VAL B 1 89  ? 20.344  -7.710  16.350  1.00 16.33 ? 252 VAL B C   1 
ATOM   2339 O O   . VAL B 1 89  ? 21.549  -7.853  16.164  1.00 16.06 ? 252 VAL B O   1 
ATOM   2340 C CB  . VAL B 1 89  ? 20.869  -5.808  17.973  1.00 16.06 ? 252 VAL B CB  1 
ATOM   2341 C CG1 . VAL B 1 89  ? 20.437  -4.403  18.371  1.00 15.10 ? 252 VAL B CG1 1 
ATOM   2342 C CG2 . VAL B 1 89  ? 21.049  -6.632  19.234  1.00 16.11 ? 252 VAL B CG2 1 
ATOM   2343 N N   . GLY B 1 90  ? 19.450  -8.627  16.000  1.00 14.73 ? 253 GLY B N   1 
ATOM   2344 C CA  . GLY B 1 90  ? 19.798  -9.701  15.070  1.00 15.18 ? 253 GLY B CA  1 
ATOM   2345 C C   . GLY B 1 90  ? 19.872  -11.037 15.744  1.00 15.45 ? 253 GLY B C   1 
ATOM   2346 O O   . GLY B 1 90  ? 20.333  -11.962 15.149  1.00 16.43 ? 253 GLY B O   1 
ATOM   2347 N N   . PHE B 1 91  ? 19.403  -11.163 16.979  1.00 14.02 ? 254 PHE B N   1 
ATOM   2348 C CA  . PHE B 1 91  ? 19.356  -12.504 17.614  1.00 15.68 ? 254 PHE B CA  1 
ATOM   2349 C C   . PHE B 1 91  ? 18.857  -13.652 16.729  1.00 15.81 ? 254 PHE B C   1 
ATOM   2350 O O   . PHE B 1 91  ? 19.447  -14.736 16.666  1.00 14.86 ? 254 PHE B O   1 
ATOM   2351 C CB  . PHE B 1 91  ? 18.483  -12.515 18.860  1.00 16.48 ? 254 PHE B CB  1 
ATOM   2352 C CG  . PHE B 1 91  ? 18.442  -13.871 19.566  1.00 15.86 ? 254 PHE B CG  1 
ATOM   2353 C CD1 . PHE B 1 91  ? 19.519  -14.328 20.275  1.00 15.77 ? 254 PHE B CD1 1 
ATOM   2354 C CD2 . PHE B 1 91  ? 17.311  -14.681 19.466  1.00 18.57 ? 254 PHE B CD2 1 
ATOM   2355 C CE1 . PHE B 1 91  ? 19.476  -15.557 20.947  1.00 16.67 ? 254 PHE B CE1 1 
ATOM   2356 C CE2 . PHE B 1 91  ? 17.294  -15.932 20.097  1.00 16.90 ? 254 PHE B CE2 1 
ATOM   2357 C CZ  . PHE B 1 91  ? 18.373  -16.336 20.843  1.00 16.77 ? 254 PHE B CZ  1 
ATOM   2358 N N   . ASP B 1 92  ? 17.739  -13.425 16.071  1.00 18.23 ? 255 ASP B N   1 
ATOM   2359 C CA  . ASP B 1 92  ? 17.098  -14.526 15.375  1.00 19.78 ? 255 ASP B CA  1 
ATOM   2360 C C   . ASP B 1 92  ? 17.891  -15.052 14.180  1.00 20.24 ? 255 ASP B C   1 
ATOM   2361 O O   . ASP B 1 92  ? 17.784  -16.229 13.872  1.00 18.75 ? 255 ASP B O   1 
ATOM   2362 C CB  . ASP B 1 92  ? 15.599  -14.262 15.116  1.00 21.73 ? 255 ASP B CB  1 
ATOM   2363 C CG  . ASP B 1 92  ? 14.782  -14.275 16.470  1.00 29.21 ? 255 ASP B CG  1 
ATOM   2364 O OD1 . ASP B 1 92  ? 14.543  -13.174 17.049  1.00 37.05 ? 255 ASP B OD1 1 
ATOM   2365 O OD2 . ASP B 1 92  ? 14.465  -15.390 17.033  1.00 30.93 ? 255 ASP B OD2 1 
ATOM   2366 N N   . SER B 1 93  ? 18.711  -14.211 13.546  1.00 19.37 ? 256 SER B N   1 
ATOM   2367 C CA  . SER B 1 93  ? 19.496  -14.715 12.434  1.00 19.26 ? 256 SER B CA  1 
ATOM   2368 C C   . SER B 1 93  ? 20.950  -14.928 12.846  1.00 19.44 ? 256 SER B C   1 
ATOM   2369 O O   . SER B 1 93  ? 21.772  -15.424 12.054  1.00 20.50 ? 256 SER B O   1 
ATOM   2370 C CB  . SER B 1 93  ? 19.419  -13.739 11.247  1.00 20.26 ? 256 SER B CB  1 
ATOM   2371 O OG  . SER B 1 93  ? 20.025  -12.514 11.587  1.00 18.38 ? 256 SER B OG  1 
ATOM   2372 N N   . GLY B 1 94  ? 21.303  -14.544 14.070  1.00 18.86 ? 257 GLY B N   1 
ATOM   2373 C CA  . GLY B 1 94  ? 22.668  -14.773 14.560  1.00 18.49 ? 257 GLY B CA  1 
ATOM   2374 C C   . GLY B 1 94  ? 23.606  -13.585 14.318  1.00 18.44 ? 257 GLY B C   1 
ATOM   2375 O O   . GLY B 1 94  ? 24.795  -13.658 14.586  1.00 17.61 ? 257 GLY B O   1 
ATOM   2376 N N   . ILE B 1 95  ? 23.075  -12.467 13.848  1.00 18.16 ? 258 ILE B N   1 
ATOM   2377 C CA  . ILE B 1 95  ? 23.946  -11.325 13.554  1.00 18.15 ? 258 ILE B CA  1 
ATOM   2378 C C   . ILE B 1 95  ? 24.138  -10.405 14.773  1.00 18.34 ? 258 ILE B C   1 
ATOM   2379 O O   . ILE B 1 95  ? 24.804  -9.379  14.684  1.00 18.44 ? 258 ILE B O   1 
ATOM   2380 C CB  . ILE B 1 95  ? 23.526  -10.556 12.261  1.00 19.37 ? 258 ILE B CB  1 
ATOM   2381 C CG1 . ILE B 1 95  ? 22.148  -9.900  12.396  1.00 20.75 ? 258 ILE B CG1 1 
ATOM   2382 C CG2 . ILE B 1 95  ? 23.622  -11.491 11.002  1.00 20.55 ? 258 ILE B CG2 1 
ATOM   2383 C CD1 . ILE B 1 95  ? 21.661  -9.202  11.073  1.00 24.60 ? 258 ILE B CD1 1 
ATOM   2384 N N   . ASP B 1 96  ? 23.523  -10.770 15.903  1.00 16.80 ? 259 ASP B N   1 
ATOM   2385 C CA  . ASP B 1 96  ? 23.838  -10.161 17.196  1.00 17.47 ? 259 ASP B CA  1 
ATOM   2386 C C   . ASP B 1 96  ? 25.256  -10.638 17.636  1.00 15.99 ? 259 ASP B C   1 
ATOM   2387 O O   . ASP B 1 96  ? 25.871  -10.063 18.498  1.00 16.03 ? 259 ASP B O   1 
ATOM   2388 C CB  . ASP B 1 96  ? 22.773  -10.590 18.214  1.00 17.06 ? 259 ASP B CB  1 
ATOM   2389 C CG  . ASP B 1 96  ? 22.845  -12.090 18.495  1.00 21.76 ? 259 ASP B CG  1 
ATOM   2390 O OD1 . ASP B 1 96  ? 22.951  -12.880 17.525  1.00 21.59 ? 259 ASP B OD1 1 
ATOM   2391 O OD2 . ASP B 1 96  ? 22.902  -12.486 19.669  1.00 24.15 ? 259 ASP B OD2 1 
ATOM   2392 N N   . ARG B 1 97  ? 25.796  -11.655 16.970  1.00 16.24 ? 260 ARG B N   1 
ATOM   2393 C CA  . ARG B 1 97  ? 27.117  -12.196 17.292  1.00 17.23 ? 260 ARG B CA  1 
ATOM   2394 C C   . ARG B 1 97  ? 28.149  -11.404 16.499  1.00 18.19 ? 260 ARG B C   1 
ATOM   2395 O O   . ARG B 1 97  ? 28.075  -11.347 15.266  1.00 20.16 ? 260 ARG B O   1 
ATOM   2396 C CB  . ARG B 1 97  ? 27.203  -13.670 16.865  1.00 17.38 ? 260 ARG B CB  1 
ATOM   2397 C CG  . ARG B 1 97  ? 26.098  -14.600 17.454  1.00 15.82 ? 260 ARG B CG  1 
ATOM   2398 C CD  . ARG B 1 97  ? 26.359  -16.056 17.045  1.00 12.95 ? 260 ARG B CD  1 
ATOM   2399 N NE  . ARG B 1 97  ? 26.342  -16.209 15.585  1.00 15.62 ? 260 ARG B NE  1 
ATOM   2400 C CZ  . ARG B 1 97  ? 26.976  -17.180 14.919  1.00 17.82 ? 260 ARG B CZ  1 
ATOM   2401 N NH1 . ARG B 1 97  ? 26.922  -17.201 13.607  1.00 16.74 ? 260 ARG B NH1 1 
ATOM   2402 N NH2 . ARG B 1 97  ? 27.681  -18.117 15.572  1.00 16.32 ? 260 ARG B NH2 1 
ATOM   2403 N N   . ILE B 1 98  ? 29.105  -10.799 17.164  1.00 17.57 ? 261 ILE B N   1 
ATOM   2404 C CA  . ILE B 1 98  ? 30.011  -9.880  16.455  1.00 18.49 ? 261 ILE B CA  1 
ATOM   2405 C C   . ILE B 1 98  ? 31.445  -10.370 16.568  1.00 19.30 ? 261 ILE B C   1 
ATOM   2406 O O   . ILE B 1 98  ? 31.829  -10.982 17.568  1.00 20.58 ? 261 ILE B O   1 
ATOM   2407 C CB  . ILE B 1 98  ? 29.836  -8.383  16.902  1.00 18.16 ? 261 ILE B CB  1 
ATOM   2408 C CG1 . ILE B 1 98  ? 30.228  -8.180  18.389  1.00 19.68 ? 261 ILE B CG1 1 
ATOM   2409 C CG2 . ILE B 1 98  ? 28.361  -7.867  16.593  1.00 19.07 ? 261 ILE B CG2 1 
ATOM   2410 C CD1 . ILE B 1 98  ? 30.043  -6.755  18.850  1.00 17.57 ? 261 ILE B CD1 1 
ATOM   2411 N N   . PHE B 1 99  ? 32.200  -10.158 15.497  1.00 19.64 ? 262 PHE B N   1 
ATOM   2412 C CA  . PHE B 1 99  ? 33.625  -10.388 15.470  1.00 19.09 ? 262 PHE B CA  1 
ATOM   2413 C C   . PHE B 1 99  ? 34.229  -8.996  15.643  1.00 18.86 ? 262 PHE B C   1 
ATOM   2414 O O   . PHE B 1 99  ? 34.343  -8.242  14.686  1.00 17.51 ? 262 PHE B O   1 
ATOM   2415 C CB  . PHE B 1 99  ? 34.027  -11.109 14.142  1.00 19.00 ? 262 PHE B CB  1 
ATOM   2416 C CG  . PHE B 1 99  ? 35.534  -11.124 13.857  1.00 19.93 ? 262 PHE B CG  1 
ATOM   2417 C CD1 . PHE B 1 99  ? 36.426  -11.588 14.785  1.00 21.47 ? 262 PHE B CD1 1 
ATOM   2418 C CD2 . PHE B 1 99  ? 36.035  -10.680 12.624  1.00 22.89 ? 262 PHE B CD2 1 
ATOM   2419 C CE1 . PHE B 1 99  ? 37.788  -11.603 14.525  1.00 21.76 ? 262 PHE B CE1 1 
ATOM   2420 C CE2 . PHE B 1 99  ? 37.411  -10.697 12.348  1.00 18.73 ? 262 PHE B CE2 1 
ATOM   2421 C CZ  . PHE B 1 99  ? 38.286  -11.166 13.300  1.00 20.80 ? 262 PHE B CZ  1 
ATOM   2422 N N   . LEU B 1 100 ? 34.628  -8.685  16.879  1.00 18.81 ? 263 LEU B N   1 
ATOM   2423 C CA  . LEU B 1 100 ? 34.852  -7.333  17.320  1.00 18.96 ? 263 LEU B CA  1 
ATOM   2424 C C   . LEU B 1 100 ? 36.337  -7.023  17.318  1.00 19.02 ? 263 LEU B C   1 
ATOM   2425 O O   . LEU B 1 100 ? 37.045  -7.418  18.207  1.00 18.78 ? 263 LEU B O   1 
ATOM   2426 C CB  . LEU B 1 100 ? 34.234  -7.141  18.717  1.00 19.20 ? 263 LEU B CB  1 
ATOM   2427 C CG  . LEU B 1 100 ? 34.226  -5.725  19.306  1.00 22.21 ? 263 LEU B CG  1 
ATOM   2428 C CD1 . LEU B 1 100 ? 33.637  -4.684  18.350  1.00 17.33 ? 263 LEU B CD1 1 
ATOM   2429 C CD2 . LEU B 1 100 ? 33.425  -5.739  20.654  1.00 21.22 ? 263 LEU B CD2 1 
ATOM   2430 N N   . VAL B 1 101 ? 36.825  -6.375  16.276  1.00 19.11 ? 264 VAL B N   1 
ATOM   2431 C CA  . VAL B 1 101 ? 38.259  -6.044  16.226  1.00 19.41 ? 264 VAL B CA  1 
ATOM   2432 C C   . VAL B 1 101 ? 38.328  -4.509  16.355  1.00 20.26 ? 264 VAL B C   1 
ATOM   2433 O O   . VAL B 1 101 ? 38.545  -3.982  17.446  1.00 21.29 ? 264 VAL B O   1 
ATOM   2434 C CB  . VAL B 1 101 ? 38.907  -6.627  14.933  1.00 19.80 ? 264 VAL B CB  1 
ATOM   2435 C CG1 . VAL B 1 101 ? 40.339  -6.159  14.767  1.00 19.80 ? 264 VAL B CG1 1 
ATOM   2436 C CG2 . VAL B 1 101 ? 38.844  -8.176  14.962  1.00 17.56 ? 264 VAL B CG2 1 
ATOM   2437 N N   . SER B 1 102 ? 38.024  -3.806  15.271  1.00 20.22 ? 265 SER B N   1 
ATOM   2438 C CA  . SER B 1 102 ? 37.733  -2.377  15.318  1.00 21.17 ? 265 SER B CA  1 
ATOM   2439 C C   . SER B 1 102 ? 36.264  -2.049  15.697  1.00 20.33 ? 265 SER B C   1 
ATOM   2440 O O   . SER B 1 102 ? 35.362  -2.871  15.520  1.00 19.40 ? 265 SER B O   1 
ATOM   2441 C CB  . SER B 1 102 ? 38.097  -1.730  13.990  1.00 20.32 ? 265 SER B CB  1 
ATOM   2442 O OG  . SER B 1 102 ? 37.340  -2.346  12.991  1.00 26.26 ? 265 SER B OG  1 
ATOM   2443 N N   . PRO B 1 103 ? 36.044  -0.854  16.261  1.00 20.38 ? 266 PRO B N   1 
ATOM   2444 C CA  . PRO B 1 103 ? 34.727  -0.510  16.801  1.00 19.84 ? 266 PRO B CA  1 
ATOM   2445 C C   . PRO B 1 103 ? 33.611  -0.740  15.789  1.00 19.02 ? 266 PRO B C   1 
ATOM   2446 O O   . PRO B 1 103 ? 33.734  -0.383  14.627  1.00 18.29 ? 266 PRO B O   1 
ATOM   2447 C CB  . PRO B 1 103 ? 34.875  0.969   17.156  1.00 19.40 ? 266 PRO B CB  1 
ATOM   2448 C CG  . PRO B 1 103 ? 36.322  1.068   17.540  1.00 20.08 ? 266 PRO B CG  1 
ATOM   2449 C CD  . PRO B 1 103 ? 37.026  0.216   16.501  1.00 20.40 ? 266 PRO B CD  1 
ATOM   2450 N N   . ILE B 1 104 ? 32.566  -1.422  16.227  1.00 15.93 ? 267 ILE B N   1 
ATOM   2451 C CA  . ILE B 1 104 ? 31.457  -1.762  15.368  1.00 16.91 ? 267 ILE B CA  1 
ATOM   2452 C C   . ILE B 1 104 ? 30.242  -0.879  15.666  1.00 17.08 ? 267 ILE B C   1 
ATOM   2453 O O   . ILE B 1 104 ? 29.956  -0.630  16.808  1.00 19.80 ? 267 ILE B O   1 
ATOM   2454 C CB  . ILE B 1 104 ? 31.110  -3.246  15.566  1.00 16.60 ? 267 ILE B CB  1 
ATOM   2455 C CG1 . ILE B 1 104 ? 32.244  -4.116  14.979  1.00 16.22 ? 267 ILE B CG1 1 
ATOM   2456 C CG2 . ILE B 1 104 ? 29.855  -3.631  14.832  1.00 18.49 ? 267 ILE B CG2 1 
ATOM   2457 C CD1 . ILE B 1 104 ? 31.986  -5.624  15.175  1.00 14.87 ? 267 ILE B CD1 1 
ATOM   2458 N N   . THR B 1 105 ? 29.533  -0.424  14.644  1.00 17.28 ? 268 THR B N   1 
ATOM   2459 C CA  . THR B 1 105 ? 28.268  0.307   14.830  1.00 16.50 ? 268 THR B CA  1 
ATOM   2460 C C   . THR B 1 105 ? 27.112  -0.701  14.824  1.00 17.11 ? 268 THR B C   1 
ATOM   2461 O O   . THR B 1 105 ? 26.832  -1.338  13.798  1.00 16.75 ? 268 THR B O   1 
ATOM   2462 C CB  . THR B 1 105 ? 28.102  1.360   13.709  1.00 17.20 ? 268 THR B CB  1 
ATOM   2463 O OG1 . THR B 1 105 ? 29.185  2.279   13.841  1.00 18.37 ? 268 THR B OG1 1 
ATOM   2464 C CG2 . THR B 1 105 ? 26.781  2.149   13.852  1.00 14.43 ? 268 THR B CG2 1 
ATOM   2465 N N   . ILE B 1 106 ? 26.510  -0.908  15.992  1.00 14.97 ? 269 ILE B N   1 
ATOM   2466 C CA  . ILE B 1 106 ? 25.405  -1.831  16.111  1.00 15.36 ? 269 ILE B CA  1 
ATOM   2467 C C   . ILE B 1 106 ? 24.130  -1.157  15.574  1.00 15.70 ? 269 ILE B C   1 
ATOM   2468 O O   . ILE B 1 106 ? 23.932  0.020   15.787  1.00 16.54 ? 269 ILE B O   1 
ATOM   2469 C CB  . ILE B 1 106 ? 25.212  -2.236  17.615  1.00 14.80 ? 269 ILE B CB  1 
ATOM   2470 C CG1 . ILE B 1 106 ? 26.528  -2.771  18.203  1.00 14.48 ? 269 ILE B CG1 1 
ATOM   2471 C CG2 . ILE B 1 106 ? 24.021  -3.204  17.795  1.00 10.71 ? 269 ILE B CG2 1 
ATOM   2472 C CD1 . ILE B 1 106 ? 27.117  -4.009  17.420  1.00 15.55 ? 269 ILE B CD1 1 
ATOM   2473 N N   . VAL B 1 107 ? 23.279  -1.910  14.886  1.00 17.10 ? 270 VAL B N   1 
ATOM   2474 C CA  . VAL B 1 107 ? 22.145  -1.337  14.160  1.00 17.19 ? 270 VAL B CA  1 
ATOM   2475 C C   . VAL B 1 107 ? 20.824  -2.032  14.589  1.00 18.32 ? 270 VAL B C   1 
ATOM   2476 O O   . VAL B 1 107 ? 20.692  -3.232  14.494  1.00 17.37 ? 270 VAL B O   1 
ATOM   2477 C CB  . VAL B 1 107 ? 22.376  -1.454  12.611  1.00 17.98 ? 270 VAL B CB  1 
ATOM   2478 C CG1 . VAL B 1 107 ? 21.197  -0.939  11.858  1.00 19.01 ? 270 VAL B CG1 1 
ATOM   2479 C CG2 . VAL B 1 107 ? 23.684  -0.670  12.189  1.00 15.80 ? 270 VAL B CG2 1 
ATOM   2480 N N   . HIS B 1 108 ? 19.904  -1.256  15.152  1.00 18.79 ? 271 HIS B N   1 
ATOM   2481 C CA  . HIS B 1 108 ? 18.550  -1.714  15.384  1.00 19.90 ? 271 HIS B CA  1 
ATOM   2482 C C   . HIS B 1 108 ? 17.724  -1.041  14.304  1.00 20.07 ? 271 HIS B C   1 
ATOM   2483 O O   . HIS B 1 108 ? 17.555  0.169   14.338  1.00 20.33 ? 271 HIS B O   1 
ATOM   2484 C CB  . HIS B 1 108 ? 18.041  -1.257  16.771  1.00 18.85 ? 271 HIS B CB  1 
ATOM   2485 C CG  . HIS B 1 108 ? 16.550  -1.390  16.941  1.00 20.91 ? 271 HIS B CG  1 
ATOM   2486 N ND1 . HIS B 1 108 ? 15.918  -2.614  17.001  1.00 19.15 ? 271 HIS B ND1 1 
ATOM   2487 C CD2 . HIS B 1 108 ? 15.571  -0.454  17.099  1.00 21.47 ? 271 HIS B CD2 1 
ATOM   2488 C CE1 . HIS B 1 108 ? 14.618  -2.430  17.192  1.00 22.01 ? 271 HIS B CE1 1 
ATOM   2489 N NE2 . HIS B 1 108 ? 14.385  -1.126  17.267  1.00 16.85 ? 271 HIS B NE2 1 
ATOM   2490 N N   . GLU B 1 109 ? 17.195  -1.810  13.368  1.00 21.40 ? 272 GLU B N   1 
ATOM   2491 C CA  . GLU B 1 109 ? 16.272  -1.264  12.358  1.00 24.06 ? 272 GLU B CA  1 
ATOM   2492 C C   . GLU B 1 109 ? 14.922  -0.971  12.994  1.00 23.90 ? 272 GLU B C   1 
ATOM   2493 O O   . GLU B 1 109 ? 14.311  -1.837  13.613  1.00 23.98 ? 272 GLU B O   1 
ATOM   2494 C CB  . GLU B 1 109 ? 16.099  -2.238  11.190  1.00 23.02 ? 272 GLU B CB  1 
ATOM   2495 C CG  . GLU B 1 109 ? 15.126  -1.672  10.126  1.00 30.83 ? 272 GLU B CG  1 
ATOM   2496 C CD  . GLU B 1 109 ? 14.521  -2.741  9.194   1.00 36.99 ? 272 GLU B CD  1 
ATOM   2497 O OE1 . GLU B 1 109 ? 15.032  -3.887  9.198   1.00 38.51 ? 272 GLU B OE1 1 
ATOM   2498 O OE2 . GLU B 1 109 ? 13.536  -2.422  8.448   1.00 41.20 ? 272 GLU B OE2 1 
ATOM   2499 N N   . ILE B 1 110 ? 14.452  0.258   12.864  1.00 25.63 ? 273 ILE B N   1 
ATOM   2500 C CA  . ILE B 1 110 ? 13.186  0.618   13.504  1.00 25.94 ? 273 ILE B CA  1 
ATOM   2501 C C   . ILE B 1 110 ? 12.063  0.166   12.547  1.00 27.73 ? 273 ILE B C   1 
ATOM   2502 O O   . ILE B 1 110 ? 11.611  0.923   11.658  1.00 28.99 ? 273 ILE B O   1 
ATOM   2503 C CB  . ILE B 1 110 ? 13.102  2.130   13.842  1.00 25.22 ? 273 ILE B CB  1 
ATOM   2504 C CG1 . ILE B 1 110 ? 14.292  2.532   14.725  1.00 23.34 ? 273 ILE B CG1 1 
ATOM   2505 C CG2 . ILE B 1 110 ? 11.806  2.425   14.576  1.00 25.85 ? 273 ILE B CG2 1 
ATOM   2506 C CD1 . ILE B 1 110 ? 14.459  4.051   14.984  1.00 21.88 ? 273 ILE B CD1 1 
ATOM   2507 N N   . ASP B 1 111 ? 11.669  -1.091  12.667  1.00 28.15 ? 274 ASP B N   1 
ATOM   2508 C CA  . ASP B 1 111 ? 10.543  -1.574  11.874  1.00 29.96 ? 274 ASP B CA  1 
ATOM   2509 C C   . ASP B 1 111 ? 9.249   -1.669  12.695  1.00 30.52 ? 274 ASP B C   1 
ATOM   2510 O O   . ASP B 1 111 ? 9.135   -1.077  13.788  1.00 29.57 ? 274 ASP B O   1 
ATOM   2511 C CB  . ASP B 1 111 ? 10.875  -2.887  11.188  1.00 29.11 ? 274 ASP B CB  1 
ATOM   2512 C CG  . ASP B 1 111 ? 11.119  -4.005  12.164  1.00 31.48 ? 274 ASP B CG  1 
ATOM   2513 O OD1 . ASP B 1 111 ? 10.690  -3.917  13.350  1.00 29.37 ? 274 ASP B OD1 1 
ATOM   2514 O OD2 . ASP B 1 111 ? 11.724  -4.999  11.723  1.00 33.07 ? 274 ASP B OD2 1 
ATOM   2515 N N   . GLU B 1 112 ? 8.274   -2.384  12.146  1.00 32.38 ? 275 GLU B N   1 
ATOM   2516 C CA  . GLU B 1 112 ? 6.910   -2.414  12.711  1.00 34.34 ? 275 GLU B CA  1 
ATOM   2517 C C   . GLU B 1 112 ? 6.917   -3.035  14.087  1.00 33.72 ? 275 GLU B C   1 
ATOM   2518 O O   . GLU B 1 112 ? 6.073   -2.713  14.906  1.00 34.46 ? 275 GLU B O   1 
ATOM   2519 C CB  . GLU B 1 112 ? 5.912   -3.107  11.765  1.00 35.00 ? 275 GLU B CB  1 
ATOM   2520 C CG  . GLU B 1 112 ? 6.294   -4.539  11.334  1.00 39.85 ? 275 GLU B CG  1 
ATOM   2521 C CD  . GLU B 1 112 ? 7.330   -4.647  10.185  1.00 45.82 ? 275 GLU B CD  1 
ATOM   2522 O OE1 . GLU B 1 112 ? 7.849   -3.607  9.670   1.00 47.82 ? 275 GLU B OE1 1 
ATOM   2523 O OE2 . GLU B 1 112 ? 7.616   -5.814  9.787   1.00 48.95 ? 275 GLU B OE2 1 
ATOM   2524 N N   . ASP B 1 113 ? 7.936   -3.853  14.355  1.00 33.27 ? 276 ASP B N   1 
ATOM   2525 C CA  . ASP B 1 113 ? 8.072   -4.587  15.615  1.00 33.30 ? 276 ASP B CA  1 
ATOM   2526 C C   . ASP B 1 113 ? 8.993   -3.891  16.642  1.00 32.02 ? 276 ASP B C   1 
ATOM   2527 O O   . ASP B 1 113 ? 9.123   -4.337  17.790  1.00 31.62 ? 276 ASP B O   1 
ATOM   2528 C CB  . ASP B 1 113 ? 8.563   -6.007  15.328  1.00 33.86 ? 276 ASP B CB  1 
ATOM   2529 C CG  . ASP B 1 113 ? 7.518   -6.859  14.566  1.00 37.39 ? 276 ASP B CG  1 
ATOM   2530 O OD1 . ASP B 1 113 ? 6.374   -7.016  15.068  1.00 39.92 ? 276 ASP B OD1 1 
ATOM   2531 O OD2 . ASP B 1 113 ? 7.855   -7.379  13.475  1.00 39.69 ? 276 ASP B OD2 1 
ATOM   2532 N N   . SER B 1 114 ? 9.617   -2.783  16.242  1.00 30.23 ? 277 SER B N   1 
ATOM   2533 C CA  . SER B 1 114 ? 10.414  -2.017  17.185  1.00 28.38 ? 277 SER B CA  1 
ATOM   2534 C C   . SER B 1 114 ? 9.512   -1.201  18.111  1.00 28.82 ? 277 SER B C   1 
ATOM   2535 O O   . SER B 1 114 ? 8.507   -0.700  17.672  1.00 29.04 ? 277 SER B O   1 
ATOM   2536 C CB  . SER B 1 114 ? 11.342  -1.059  16.444  1.00 27.71 ? 277 SER B CB  1 
ATOM   2537 O OG  . SER B 1 114 ? 11.973  -0.218  17.385  1.00 23.27 ? 277 SER B OG  1 
ATOM   2538 N N   . PRO B 1 115 ? 9.895   -1.041  19.386  1.00 29.60 ? 278 PRO B N   1 
ATOM   2539 C CA  . PRO B 1 115 ? 9.220   -0.076  20.285  1.00 30.51 ? 278 PRO B CA  1 
ATOM   2540 C C   . PRO B 1 115 ? 9.364   1.392   19.869  1.00 30.62 ? 278 PRO B C   1 
ATOM   2541 O O   . PRO B 1 115 ? 8.638   2.256   20.365  1.00 30.87 ? 278 PRO B O   1 
ATOM   2542 C CB  . PRO B 1 115 ? 9.892   -0.300  21.650  1.00 30.37 ? 278 PRO B CB  1 
ATOM   2543 C CG  . PRO B 1 115 ? 10.696  -1.568  21.503  1.00 29.68 ? 278 PRO B CG  1 
ATOM   2544 C CD  . PRO B 1 115 ? 10.972  -1.794  20.067  1.00 29.39 ? 278 PRO B CD  1 
ATOM   2545 N N   . LEU B 1 116 ? 10.277  1.677   18.943  1.00 29.44 ? 279 LEU B N   1 
ATOM   2546 C CA  . LEU B 1 116 ? 10.449  3.035   18.499  1.00 28.90 ? 279 LEU B CA  1 
ATOM   2547 C C   . LEU B 1 116 ? 9.657   3.377   17.238  1.00 29.18 ? 279 LEU B C   1 
ATOM   2548 O O   . LEU B 1 116 ? 9.761   4.495   16.759  1.00 29.32 ? 279 LEU B O   1 
ATOM   2549 C CB  . LEU B 1 116 ? 11.939  3.317   18.275  1.00 29.03 ? 279 LEU B CB  1 
ATOM   2550 C CG  . LEU B 1 116 ? 12.851  3.056   19.492  1.00 30.29 ? 279 LEU B CG  1 
ATOM   2551 C CD1 . LEU B 1 116 ? 14.304  3.250   19.111  1.00 31.78 ? 279 LEU B CD1 1 
ATOM   2552 C CD2 . LEU B 1 116 ? 12.508  3.991   20.646  1.00 33.59 ? 279 LEU B CD2 1 
ATOM   2553 N N   . TYR B 1 117 ? 8.877   2.431   16.711  1.00 29.04 ? 280 TYR B N   1 
ATOM   2554 C CA  . TYR B 1 117 ? 8.287   2.549   15.371  1.00 30.89 ? 280 TYR B CA  1 
ATOM   2555 C C   . TYR B 1 117 ? 7.452   3.829   15.163  1.00 30.88 ? 280 TYR B C   1 
ATOM   2556 O O   . TYR B 1 117 ? 7.433   4.405   14.101  1.00 30.01 ? 280 TYR B O   1 
ATOM   2557 C CB  . TYR B 1 117 ? 7.429   1.328   15.137  1.00 31.19 ? 280 TYR B CB  1 
ATOM   2558 C CG  . TYR B 1 117 ? 6.874   1.204   13.763  1.00 33.84 ? 280 TYR B CG  1 
ATOM   2559 C CD1 . TYR B 1 117 ? 7.705   1.269   12.639  1.00 37.59 ? 280 TYR B CD1 1 
ATOM   2560 C CD2 . TYR B 1 117 ? 5.495   1.000   13.570  1.00 37.55 ? 280 TYR B CD2 1 
ATOM   2561 C CE1 . TYR B 1 117 ? 7.189   1.147   11.363  1.00 36.47 ? 280 TYR B CE1 1 
ATOM   2562 C CE2 . TYR B 1 117 ? 4.970   0.876   12.299  1.00 36.29 ? 280 TYR B CE2 1 
ATOM   2563 C CZ  . TYR B 1 117 ? 5.807   0.950   11.206  1.00 39.02 ? 280 TYR B CZ  1 
ATOM   2564 O OH  . TYR B 1 117 ? 5.266   0.816   9.941   1.00 39.81 ? 280 TYR B OH  1 
ATOM   2565 N N   . ASP B 1 118 ? 6.805   4.277   16.224  1.00 32.76 ? 281 ASP B N   1 
ATOM   2566 C CA  . ASP B 1 118 ? 5.911   5.418   16.184  1.00 34.30 ? 281 ASP B CA  1 
ATOM   2567 C C   . ASP B 1 118 ? 6.508   6.750   16.644  1.00 34.38 ? 281 ASP B C   1 
ATOM   2568 O O   . ASP B 1 118 ? 5.803   7.773   16.680  1.00 34.94 ? 281 ASP B O   1 
ATOM   2569 C CB  . ASP B 1 118 ? 4.662   5.081   16.986  1.00 35.22 ? 281 ASP B CB  1 
ATOM   2570 C CG  . ASP B 1 118 ? 3.509   4.766   16.092  1.00 41.20 ? 281 ASP B CG  1 
ATOM   2571 O OD1 . ASP B 1 118 ? 2.874   5.764   15.624  1.00 45.41 ? 281 ASP B OD1 1 
ATOM   2572 O OD2 . ASP B 1 118 ? 3.277   3.547   15.817  1.00 44.60 ? 281 ASP B OD2 1 
ATOM   2573 N N   . LEU B 1 119 ? 7.802   6.754   16.943  1.00 33.37 ? 282 LEU B N   1 
ATOM   2574 C CA  . LEU B 1 119 ? 8.452   7.936   17.478  1.00 33.09 ? 282 LEU B CA  1 
ATOM   2575 C C   . LEU B 1 119 ? 9.151   8.813   16.430  1.00 32.44 ? 282 LEU B C   1 
ATOM   2576 O O   . LEU B 1 119 ? 10.026  8.366   15.696  1.00 31.91 ? 282 LEU B O   1 
ATOM   2577 C CB  . LEU B 1 119 ? 9.373   7.554   18.625  1.00 33.41 ? 282 LEU B CB  1 
ATOM   2578 C CG  . LEU B 1 119 ? 8.655   6.852   19.810  1.00 37.81 ? 282 LEU B CG  1 
ATOM   2579 C CD1 . LEU B 1 119 ? 9.613   6.616   20.987  1.00 39.38 ? 282 LEU B CD1 1 
ATOM   2580 C CD2 . LEU B 1 119 ? 7.332   7.509   20.326  1.00 37.94 ? 282 LEU B CD2 1 
ATOM   2581 N N   . SER B 1 120 ? 8.711   10.065  16.341  1.00 31.75 ? 283 SER B N   1 
ATOM   2582 C CA  . SER B 1 120 ? 9.363   11.068  15.522  1.00 30.49 ? 283 SER B CA  1 
ATOM   2583 C C   . SER B 1 120 ? 10.445  11.758  16.336  1.00 30.62 ? 283 SER B C   1 
ATOM   2584 O O   . SER B 1 120 ? 10.550  11.519  17.531  1.00 30.52 ? 283 SER B O   1 
ATOM   2585 C CB  . SER B 1 120 ? 8.325   12.097  15.085  1.00 31.23 ? 283 SER B CB  1 
ATOM   2586 O OG  . SER B 1 120 ? 7.935   12.892  16.187  1.00 30.34 ? 283 SER B OG  1 
ATOM   2587 N N   . LYS B 1 121 ? 11.232  12.624  15.701  1.00 30.97 ? 284 LYS B N   1 
ATOM   2588 C CA  . LYS B 1 121 ? 12.233  13.401  16.398  1.00 32.61 ? 284 LYS B CA  1 
ATOM   2589 C C   . LYS B 1 121 ? 11.638  14.181  17.594  1.00 34.18 ? 284 LYS B C   1 
ATOM   2590 O O   . LYS B 1 121 ? 12.229  14.243  18.686  1.00 34.76 ? 284 LYS B O   1 
ATOM   2591 C CB  . LYS B 1 121 ? 12.941  14.359  15.446  1.00 32.36 ? 284 LYS B CB  1 
ATOM   2592 C CG  . LYS B 1 121 ? 13.891  15.275  16.187  1.00 34.26 ? 284 LYS B CG  1 
ATOM   2593 C CD  . LYS B 1 121 ? 14.735  16.120  15.293  1.00 35.73 ? 284 LYS B CD  1 
ATOM   2594 C CE  . LYS B 1 121 ? 15.789  16.826  16.122  1.00 38.05 ? 284 LYS B CE  1 
ATOM   2595 N NZ  . LYS B 1 121 ? 15.216  17.390  17.368  1.00 42.84 ? 284 LYS B NZ  1 
ATOM   2596 N N   . GLN B 1 122 ? 10.470  14.772  17.394  1.00 35.65 ? 285 GLN B N   1 
ATOM   2597 C CA  . GLN B 1 122 ? 9.822   15.524  18.477  1.00 37.56 ? 285 GLN B CA  1 
ATOM   2598 C C   . GLN B 1 122 ? 9.289   14.619  19.600  1.00 37.40 ? 285 GLN B C   1 
ATOM   2599 O O   . GLN B 1 122 ? 9.295   15.006  20.764  1.00 37.83 ? 285 GLN B O   1 
ATOM   2600 C CB  . GLN B 1 122 ? 8.740   16.446  17.900  1.00 37.76 ? 285 GLN B CB  1 
ATOM   2601 C CG  . GLN B 1 122 ? 7.432   16.515  18.664  1.00 40.80 ? 285 GLN B CG  1 
ATOM   2602 C CD  . GLN B 1 122 ? 6.487   17.532  18.043  1.00 44.82 ? 285 GLN B CD  1 
ATOM   2603 O OE1 . GLN B 1 122 ? 5.326   17.228  17.738  1.00 45.63 ? 285 GLN B OE1 1 
ATOM   2604 N NE2 . GLN B 1 122 ? 6.993   18.750  17.833  1.00 44.82 ? 285 GLN B NE2 1 
ATOM   2605 N N   . ASP B 1 123 ? 8.832   13.427  19.243  1.00 38.02 ? 286 ASP B N   1 
ATOM   2606 C CA  . ASP B 1 123 ? 8.480   12.409  20.229  1.00 39.13 ? 286 ASP B CA  1 
ATOM   2607 C C   . ASP B 1 123 ? 9.695   12.011  21.073  1.00 39.60 ? 286 ASP B C   1 
ATOM   2608 O O   . ASP B 1 123 ? 9.557   11.826  22.279  1.00 40.37 ? 286 ASP B O   1 
ATOM   2609 C CB  . ASP B 1 123 ? 7.889   11.158  19.567  1.00 38.82 ? 286 ASP B CB  1 
ATOM   2610 C CG  . ASP B 1 123 ? 6.525   11.394  18.979  1.00 40.82 ? 286 ASP B CG  1 
ATOM   2611 O OD1 . ASP B 1 123 ? 5.747   12.195  19.560  1.00 42.87 ? 286 ASP B OD1 1 
ATOM   2612 O OD2 . ASP B 1 123 ? 6.221   10.760  17.943  1.00 42.45 ? 286 ASP B OD2 1 
ATOM   2613 N N   . ILE B 1 124 ? 10.868  11.858  20.456  1.00 39.49 ? 287 ILE B N   1 
ATOM   2614 C CA  . ILE B 1 124 ? 12.059  11.513  21.232  1.00 40.09 ? 287 ILE B CA  1 
ATOM   2615 C C   . ILE B 1 124 ? 12.469  12.684  22.135  1.00 40.59 ? 287 ILE B C   1 
ATOM   2616 O O   . ILE B 1 124 ? 13.007  12.475  23.225  1.00 40.50 ? 287 ILE B O   1 
ATOM   2617 C CB  . ILE B 1 124 ? 13.272  11.023  20.346  1.00 39.52 ? 287 ILE B CB  1 
ATOM   2618 C CG1 . ILE B 1 124 ? 12.894  9.811   19.466  1.00 39.91 ? 287 ILE B CG1 1 
ATOM   2619 C CG2 . ILE B 1 124 ? 14.500  10.718  21.196  1.00 38.78 ? 287 ILE B CG2 1 
ATOM   2620 C CD1 . ILE B 1 124 ? 12.681  8.492   20.145  1.00 38.98 ? 287 ILE B CD1 1 
ATOM   2621 N N   . ASP B 1 125 ? 12.206  13.912  21.690  1.00 41.42 ? 288 ASP B N   1 
ATOM   2622 C CA  . ASP B 1 125 ? 12.507  15.106  22.500  1.00 41.97 ? 288 ASP B CA  1 
ATOM   2623 C C   . ASP B 1 125 ? 11.654  15.230  23.769  1.00 41.31 ? 288 ASP B C   1 
ATOM   2624 O O   . ASP B 1 125 ? 12.094  15.795  24.763  1.00 41.58 ? 288 ASP B O   1 
ATOM   2625 C CB  . ASP B 1 125 ? 12.384  16.370  21.659  1.00 42.60 ? 288 ASP B CB  1 
ATOM   2626 C CG  . ASP B 1 125 ? 13.507  16.502  20.653  1.00 45.95 ? 288 ASP B CG  1 
ATOM   2627 O OD1 . ASP B 1 125 ? 14.636  16.028  20.958  1.00 48.36 ? 288 ASP B OD1 1 
ATOM   2628 O OD2 . ASP B 1 125 ? 13.262  17.076  19.560  1.00 49.06 ? 288 ASP B OD2 1 
ATOM   2629 N N   . ASN B 1 126 ? 10.440  14.704  23.719  1.00 41.17 ? 289 ASN B N   1 
ATOM   2630 C CA  . ASN B 1 126 ? 9.497   14.777  24.844  1.00 40.49 ? 289 ASN B CA  1 
ATOM   2631 C C   . ASN B 1 126 ? 9.539   13.523  25.689  1.00 39.73 ? 289 ASN B C   1 
ATOM   2632 O O   . ASN B 1 126 ? 8.697   13.351  26.578  1.00 39.59 ? 289 ASN B O   1 
ATOM   2633 C CB  . ASN B 1 126 ? 8.071   14.912  24.332  1.00 40.82 ? 289 ASN B CB  1 
ATOM   2634 C CG  . ASN B 1 126 ? 7.825   16.221  23.618  1.00 42.25 ? 289 ASN B CG  1 
ATOM   2635 O OD1 . ASN B 1 126 ? 8.561   17.206  23.813  1.00 42.23 ? 289 ASN B OD1 1 
ATOM   2636 N ND2 . ASN B 1 126 ? 6.789   16.238  22.764  1.00 41.02 ? 289 ASN B ND2 1 
ATOM   2637 N N   . ALA B 1 127 ? 10.467  12.619  25.362  1.00 37.45 ? 290 ALA B N   1 
ATOM   2638 C CA  . ALA B 1 127 ? 10.509  11.306  25.997  1.00 35.88 ? 290 ALA B CA  1 
ATOM   2639 C C   . ALA B 1 127 ? 11.482  11.283  27.165  1.00 34.05 ? 290 ALA B C   1 
ATOM   2640 O O   . ALA B 1 127 ? 12.374  12.117  27.267  1.00 33.01 ? 290 ALA B O   1 
ATOM   2641 C CB  . ALA B 1 127 ? 10.852  10.195  24.967  1.00 35.55 ? 290 ALA B CB  1 
ATOM   2642 N N   . ASP B 1 128 ? 11.294  10.314  28.047  1.00 33.57 ? 291 ASP B N   1 
ATOM   2643 C CA  . ASP B 1 128 ? 12.183  10.121  29.179  1.00 32.97 ? 291 ASP B CA  1 
ATOM   2644 C C   . ASP B 1 128 ? 12.707  8.659   29.277  1.00 31.59 ? 291 ASP B C   1 
ATOM   2645 O O   . ASP B 1 128 ? 13.361  8.302   30.280  1.00 31.16 ? 291 ASP B O   1 
ATOM   2646 C CB  . ASP B 1 128 ? 11.430  10.481  30.462  1.00 34.57 ? 291 ASP B CB  1 
ATOM   2647 C CG  . ASP B 1 128 ? 10.131  9.675   30.622  1.00 37.83 ? 291 ASP B CG  1 
ATOM   2648 O OD1 . ASP B 1 128 ? 9.861   8.780   29.785  1.00 41.26 ? 291 ASP B OD1 1 
ATOM   2649 O OD2 . ASP B 1 128 ? 9.376   9.930   31.582  1.00 44.64 ? 291 ASP B OD2 1 
ATOM   2650 N N   . PHE B 1 129 ? 12.409  7.818   28.282  1.00 29.36 ? 292 PHE B N   1 
ATOM   2651 C CA  . PHE B 1 129 ? 12.845  6.392   28.358  1.00 27.72 ? 292 PHE B CA  1 
ATOM   2652 C C   . PHE B 1 129 ? 14.358  6.230   28.383  1.00 25.09 ? 292 PHE B C   1 
ATOM   2653 O O   . PHE B 1 129 ? 15.095  7.153   28.087  1.00 24.03 ? 292 PHE B O   1 
ATOM   2654 C CB  . PHE B 1 129 ? 12.249  5.518   27.253  1.00 26.78 ? 292 PHE B CB  1 
ATOM   2655 C CG  . PHE B 1 129 ? 12.667  5.926   25.838  1.00 30.30 ? 292 PHE B CG  1 
ATOM   2656 C CD1 . PHE B 1 129 ? 13.927  5.539   25.305  1.00 29.14 ? 292 PHE B CD1 1 
ATOM   2657 C CD2 . PHE B 1 129 ? 11.796  6.678   25.024  1.00 30.60 ? 292 PHE B CD2 1 
ATOM   2658 C CE1 . PHE B 1 129 ? 14.315  5.923   23.999  1.00 26.06 ? 292 PHE B CE1 1 
ATOM   2659 C CE2 . PHE B 1 129 ? 12.188  7.071   23.700  1.00 30.73 ? 292 PHE B CE2 1 
ATOM   2660 C CZ  . PHE B 1 129 ? 13.448  6.682   23.196  1.00 29.37 ? 292 PHE B CZ  1 
ATOM   2661 N N   . GLU B 1 130 ? 14.799  5.017   28.676  1.00 24.22 ? 293 GLU B N   1 
ATOM   2662 C CA  . GLU B 1 130 ? 16.220  4.709   28.764  1.00 21.66 ? 293 GLU B CA  1 
ATOM   2663 C C   . GLU B 1 130 ? 16.480  3.440   27.945  1.00 21.28 ? 293 GLU B C   1 
ATOM   2664 O O   . GLU B 1 130 ? 15.707  2.464   28.015  1.00 20.72 ? 293 GLU B O   1 
ATOM   2665 C CB  . GLU B 1 130 ? 16.553  4.448   30.238  1.00 22.85 ? 293 GLU B CB  1 
ATOM   2666 C CG  . GLU B 1 130 ? 18.001  4.011   30.493  1.00 20.74 ? 293 GLU B CG  1 
ATOM   2667 C CD  . GLU B 1 130 ? 18.379  4.026   31.929  1.00 24.81 ? 293 GLU B CD  1 
ATOM   2668 O OE1 . GLU B 1 130 ? 19.531  3.628   32.251  1.00 22.12 ? 293 GLU B OE1 1 
ATOM   2669 O OE2 . GLU B 1 130 ? 17.519  4.409   32.764  1.00 23.76 ? 293 GLU B OE2 1 
ATOM   2670 N N   . ILE B 1 131 ? 17.550  3.413   27.179  1.00 18.76 ? 294 ILE B N   1 
ATOM   2671 C CA  . ILE B 1 131 ? 17.873  2.189   26.415  1.00 17.80 ? 294 ILE B CA  1 
ATOM   2672 C C   . ILE B 1 131 ? 19.185  1.660   26.983  1.00 17.40 ? 294 ILE B C   1 
ATOM   2673 O O   . ILE B 1 131 ? 20.185  2.384   26.976  1.00 17.00 ? 294 ILE B O   1 
ATOM   2674 C CB  . ILE B 1 131 ? 17.907  2.396   24.875  1.00 17.75 ? 294 ILE B CB  1 
ATOM   2675 C CG1 . ILE B 1 131 ? 16.474  2.675   24.386  1.00 19.80 ? 294 ILE B CG1 1 
ATOM   2676 C CG2 . ILE B 1 131 ? 18.551  1.096   24.112  1.00 17.50 ? 294 ILE B CG2 1 
ATOM   2677 C CD1 . ILE B 1 131 ? 16.347  3.029   22.956  1.00 19.41 ? 294 ILE B CD1 1 
ATOM   2678 N N   . VAL B 1 132 ? 19.147  0.476   27.604  1.00 16.02 ? 295 VAL B N   1 
ATOM   2679 C CA  . VAL B 1 132 ? 20.384  -0.197  28.109  1.00 16.23 ? 295 VAL B CA  1 
ATOM   2680 C C   . VAL B 1 132 ? 21.004  -0.966  26.967  1.00 14.97 ? 295 VAL B C   1 
ATOM   2681 O O   . VAL B 1 132 ? 20.281  -1.589  26.194  1.00 16.08 ? 295 VAL B O   1 
ATOM   2682 C CB  . VAL B 1 132 ? 20.102  -1.208  29.299  1.00 16.19 ? 295 VAL B CB  1 
ATOM   2683 C CG1 . VAL B 1 132 ? 21.457  -1.895  29.771  1.00 17.27 ? 295 VAL B CG1 1 
ATOM   2684 C CG2 . VAL B 1 132 ? 19.582  -0.368  30.443  1.00 20.20 ? 295 VAL B CG2 1 
ATOM   2685 N N   . VAL B 1 133 ? 22.318  -0.885  26.839  1.00 15.13 ? 296 VAL B N   1 
ATOM   2686 C CA  . VAL B 1 133 ? 23.038  -1.585  25.784  1.00 14.70 ? 296 VAL B CA  1 
ATOM   2687 C C   . VAL B 1 133 ? 24.044  -2.507  26.472  1.00 15.60 ? 296 VAL B C   1 
ATOM   2688 O O   . VAL B 1 133 ? 24.617  -2.149  27.489  1.00 14.44 ? 296 VAL B O   1 
ATOM   2689 C CB  . VAL B 1 133 ? 23.750  -0.638  24.811  1.00 15.93 ? 296 VAL B CB  1 
ATOM   2690 C CG1 . VAL B 1 133 ? 22.727  0.056   23.897  1.00 14.58 ? 296 VAL B CG1 1 
ATOM   2691 C CG2 . VAL B 1 133 ? 24.620  0.336   25.550  1.00 11.64 ? 296 VAL B CG2 1 
ATOM   2692 N N   . ILE B 1 134 ? 24.185  -3.723  25.936  1.00 15.17 ? 297 ILE B N   1 
ATOM   2693 C CA  . ILE B 1 134 ? 25.017  -4.742  26.547  1.00 15.67 ? 297 ILE B CA  1 
ATOM   2694 C C   . ILE B 1 134 ? 25.904  -5.424  25.509  1.00 14.46 ? 297 ILE B C   1 
ATOM   2695 O O   . ILE B 1 134 ? 25.465  -5.668  24.386  1.00 12.75 ? 297 ILE B O   1 
ATOM   2696 C CB  . ILE B 1 134 ? 24.103  -5.826  27.291  1.00 15.87 ? 297 ILE B CB  1 
ATOM   2697 C CG1 . ILE B 1 134 ? 23.321  -5.171  28.452  1.00 18.56 ? 297 ILE B CG1 1 
ATOM   2698 C CG2 . ILE B 1 134 ? 24.934  -6.961  27.859  1.00 18.04 ? 297 ILE B CG2 1 
ATOM   2699 C CD1 . ILE B 1 134 ? 22.024  -5.982  28.766  1.00 19.58 ? 297 ILE B CD1 1 
ATOM   2700 N N   . LEU B 1 135 ? 27.148  -5.669  25.926  1.00 15.12 ? 298 LEU B N   1 
ATOM   2701 C CA  . LEU B 1 135 ? 28.131  -6.470  25.211  1.00 16.04 ? 298 LEU B CA  1 
ATOM   2702 C C   . LEU B 1 135 ? 28.586  -7.559  26.178  1.00 16.30 ? 298 LEU B C   1 
ATOM   2703 O O   . LEU B 1 135 ? 29.032  -7.259  27.281  1.00 17.50 ? 298 LEU B O   1 
ATOM   2704 C CB  . LEU B 1 135 ? 29.365  -5.613  24.831  1.00 15.17 ? 298 LEU B CB  1 
ATOM   2705 C CG  . LEU B 1 135 ? 30.538  -6.360  24.160  1.00 18.79 ? 298 LEU B CG  1 
ATOM   2706 C CD1 . LEU B 1 135 ? 30.144  -6.819  22.761  1.00 15.79 ? 298 LEU B CD1 1 
ATOM   2707 C CD2 . LEU B 1 135 ? 31.805  -5.509  24.115  1.00 20.47 ? 298 LEU B CD2 1 
ATOM   2708 N N   . GLU B 1 136 ? 28.514  -8.824  25.746  1.00 17.31 ? 299 GLU B N   1 
ATOM   2709 C CA  . GLU B 1 136 ? 29.005  -9.971  26.555  1.00 17.50 ? 299 GLU B CA  1 
ATOM   2710 C C   . GLU B 1 136 ? 29.914  -10.833 25.693  1.00 17.90 ? 299 GLU B C   1 
ATOM   2711 O O   . GLU B 1 136 ? 29.766  -10.827 24.471  1.00 16.19 ? 299 GLU B O   1 
ATOM   2712 C CB  . GLU B 1 136 ? 27.820  -10.840 27.056  1.00 17.71 ? 299 GLU B CB  1 
ATOM   2713 C CG  . GLU B 1 136 ? 26.919  -10.066 28.028  1.00 18.58 ? 299 GLU B CG  1 
ATOM   2714 C CD  . GLU B 1 136 ? 25.660  -10.810 28.351  1.00 22.25 ? 299 GLU B CD  1 
ATOM   2715 O OE1 . GLU B 1 136 ? 24.955  -11.181 27.392  1.00 23.63 ? 299 GLU B OE1 1 
ATOM   2716 O OE2 . GLU B 1 136 ? 25.364  -10.989 29.573  1.00 22.98 ? 299 GLU B OE2 1 
ATOM   2717 N N   . GLY B 1 137 ? 30.893  -11.493 26.322  1.00 17.28 ? 300 GLY B N   1 
ATOM   2718 C CA  . GLY B 1 137 ? 31.740  -12.436 25.590  1.00 17.49 ? 300 GLY B CA  1 
ATOM   2719 C C   . GLY B 1 137 ? 32.658  -13.061 26.589  1.00 17.66 ? 300 GLY B C   1 
ATOM   2720 O O   . GLY B 1 137 ? 32.516  -12.810 27.804  1.00 17.69 ? 300 GLY B O   1 
ATOM   2721 N N   . MET B 1 138 ? 33.585  -13.865 26.082  1.00 17.03 ? 301 MET B N   1 
ATOM   2722 C CA  . MET B 1 138 ? 34.569  -14.571 26.863  1.00 16.83 ? 301 MET B CA  1 
ATOM   2723 C C   . MET B 1 138 ? 35.884  -13.882 26.597  1.00 17.06 ? 301 MET B C   1 
ATOM   2724 O O   . MET B 1 138 ? 36.142  -13.490 25.459  1.00 17.42 ? 301 MET B O   1 
ATOM   2725 C CB  . MET B 1 138 ? 34.642  -16.038 26.394  1.00 18.76 ? 301 MET B CB  1 
ATOM   2726 C CG  . MET B 1 138 ? 33.303  -16.806 26.523  1.00 18.64 ? 301 MET B CG  1 
ATOM   2727 S SD  . MET B 1 138 ? 32.735  -16.820 28.229  1.00 21.82 ? 301 MET B SD  1 
ATOM   2728 C CE  . MET B 1 138 ? 34.018  -17.784 29.041  1.00 18.26 ? 301 MET B CE  1 
ATOM   2729 N N   . VAL B 1 139 ? 36.719  -13.738 27.615  1.00 16.70 ? 302 VAL B N   1 
ATOM   2730 C CA  . VAL B 1 139 ? 38.060  -13.147 27.450  1.00 17.22 ? 302 VAL B CA  1 
ATOM   2731 C C   . VAL B 1 139 ? 38.929  -14.185 26.711  1.00 17.39 ? 302 VAL B C   1 
ATOM   2732 O O   . VAL B 1 139 ? 39.133  -15.298 27.168  1.00 14.81 ? 302 VAL B O   1 
ATOM   2733 C CB  . VAL B 1 139 ? 38.656  -12.661 28.818  1.00 17.26 ? 302 VAL B CB  1 
ATOM   2734 C CG1 . VAL B 1 139 ? 40.027  -11.990 28.670  1.00 18.48 ? 302 VAL B CG1 1 
ATOM   2735 C CG2 . VAL B 1 139 ? 37.674  -11.652 29.467  1.00 16.61 ? 302 VAL B CG2 1 
ATOM   2736 N N   . GLU B 1 140 ? 39.408  -13.807 25.541  1.00 17.54 ? 303 GLU B N   1 
ATOM   2737 C CA  . GLU B 1 140 ? 40.191  -14.699 24.708  1.00 18.08 ? 303 GLU B CA  1 
ATOM   2738 C C   . GLU B 1 140 ? 41.359  -15.322 25.448  1.00 19.20 ? 303 GLU B C   1 
ATOM   2739 O O   . GLU B 1 140 ? 42.054  -14.638 26.221  1.00 19.74 ? 303 GLU B O   1 
ATOM   2740 C CB  . GLU B 1 140 ? 40.721  -13.923 23.479  1.00 18.83 ? 303 GLU B CB  1 
ATOM   2741 C CG  . GLU B 1 140 ? 41.238  -14.897 22.421  1.00 22.53 ? 303 GLU B CG  1 
ATOM   2742 C CD  . GLU B 1 140 ? 41.907  -14.197 21.267  1.00 25.07 ? 303 GLU B CD  1 
ATOM   2743 O OE1 . GLU B 1 140 ? 42.198  -12.984 21.372  1.00 26.37 ? 303 GLU B OE1 1 
ATOM   2744 O OE2 . GLU B 1 140 ? 42.122  -14.881 20.256  1.00 27.62 ? 303 GLU B OE2 1 
ATOM   2745 N N   . ALA B 1 141 ? 41.575  -16.619 25.219  1.00 19.38 ? 304 ALA B N   1 
ATOM   2746 C CA  . ALA B 1 141 ? 42.645  -17.382 25.877  1.00 20.48 ? 304 ALA B CA  1 
ATOM   2747 C C   . ALA B 1 141 ? 42.433  -17.601 27.413  1.00 21.19 ? 304 ALA B C   1 
ATOM   2748 O O   . ALA B 1 141 ? 43.385  -17.880 28.174  1.00 20.31 ? 304 ALA B O   1 
ATOM   2749 C CB  . ALA B 1 141 ? 44.051  -16.759 25.556  1.00 21.63 ? 304 ALA B CB  1 
ATOM   2750 N N   . THR B 1 142 ? 41.183  -17.502 27.864  1.00 20.35 ? 305 THR B N   1 
ATOM   2751 C CA  . THR B 1 142 ? 40.910  -17.689 29.281  1.00 19.39 ? 305 THR B CA  1 
ATOM   2752 C C   . THR B 1 142 ? 39.556  -18.300 29.397  1.00 19.93 ? 305 THR B C   1 
ATOM   2753 O O   . THR B 1 142 ? 38.847  -18.374 28.413  1.00 19.32 ? 305 THR B O   1 
ATOM   2754 C CB  . THR B 1 142 ? 40.845  -16.381 30.135  1.00 20.08 ? 305 THR B CB  1 
ATOM   2755 O OG1 . THR B 1 142 ? 39.553  -15.781 29.980  1.00 19.28 ? 305 THR B OG1 1 
ATOM   2756 C CG2 . THR B 1 142 ? 41.924  -15.355 29.765  1.00 19.37 ? 305 THR B CG2 1 
ATOM   2757 N N   . ALA B 1 143 ? 39.174  -18.642 30.636  1.00 18.57 ? 306 ALA B N   1 
ATOM   2758 C CA  . ALA B 1 143 ? 37.841  -19.129 30.904  1.00 18.93 ? 306 ALA B CA  1 
ATOM   2759 C C   . ALA B 1 143 ? 36.957  -18.031 31.532  1.00 19.26 ? 306 ALA B C   1 
ATOM   2760 O O   . ALA B 1 143 ? 35.895  -18.340 32.083  1.00 18.33 ? 306 ALA B O   1 
ATOM   2761 C CB  . ALA B 1 143 ? 37.911  -20.355 31.834  1.00 18.43 ? 306 ALA B CB  1 
ATOM   2762 N N   . MET B 1 144 ? 37.382  -16.769 31.415  1.00 17.69 ? 307 MET B N   1 
ATOM   2763 C CA  . MET B 1 144 ? 36.735  -15.660 32.121  1.00 18.24 ? 307 MET B CA  1 
ATOM   2764 C C   . MET B 1 144 ? 35.714  -15.052 31.194  1.00 18.80 ? 307 MET B C   1 
ATOM   2765 O O   . MET B 1 144 ? 35.884  -15.140 29.971  1.00 18.41 ? 307 MET B O   1 
ATOM   2766 C CB  . MET B 1 144 ? 37.806  -14.624 32.544  1.00 18.36 ? 307 MET B CB  1 
ATOM   2767 C CG  . MET B 1 144 ? 38.865  -15.224 33.493  1.00 19.71 ? 307 MET B CG  1 
ATOM   2768 S SD  . MET B 1 144 ? 38.139  -15.674 35.093  1.00 21.73 ? 307 MET B SD  1 
ATOM   2769 C CE  . MET B 1 144 ? 38.200  -17.479 35.039  1.00 23.67 ? 307 MET B CE  1 
ATOM   2770 N N   . THR B 1 145 ? 34.647  -14.490 31.764  1.00 18.74 ? 308 THR B N   1 
ATOM   2771 C CA  . THR B 1 145 ? 33.574  -13.879 31.021  1.00 20.57 ? 308 THR B CA  1 
ATOM   2772 C C   . THR B 1 145 ? 33.414  -12.417 31.405  1.00 21.38 ? 308 THR B C   1 
ATOM   2773 O O   . THR B 1 145 ? 33.877  -12.032 32.471  1.00 22.64 ? 308 THR B O   1 
ATOM   2774 C CB  . THR B 1 145 ? 32.240  -14.655 31.197  1.00 21.40 ? 308 THR B CB  1 
ATOM   2775 O OG1 . THR B 1 145 ? 31.368  -14.265 30.159  1.00 24.74 ? 308 THR B OG1 1 
ATOM   2776 C CG2 . THR B 1 145 ? 31.561  -14.386 32.561  1.00 18.94 ? 308 THR B CG2 1 
ATOM   2777 N N   . LYS B 1 146 ? 32.791  -11.611 30.524  1.00 21.32 ? 309 LYS B N   1 
ATOM   2778 C CA  . LYS B 1 146 ? 32.533  -10.189 30.742  1.00 20.83 ? 309 LYS B CA  1 
ATOM   2779 C C   . LYS B 1 146 ? 31.160  -9.780  30.213  1.00 19.49 ? 309 LYS B C   1 
ATOM   2780 O O   . LYS B 1 146 ? 30.676  -10.315 29.191  1.00 18.15 ? 309 LYS B O   1 
ATOM   2781 C CB  . LYS B 1 146 ? 33.633  -9.319  30.088  1.00 21.28 ? 309 LYS B CB  1 
ATOM   2782 C CG  . LYS B 1 146 ? 34.962  -9.424  30.825  1.00 27.42 ? 309 LYS B CG  1 
ATOM   2783 C CD  . LYS B 1 146 ? 35.772  -8.137  30.783  1.00 33.50 ? 309 LYS B CD  1 
ATOM   2784 C CE  . LYS B 1 146 ? 36.999  -8.210  31.697  1.00 37.35 ? 309 LYS B CE  1 
ATOM   2785 N NZ  . LYS B 1 146 ? 36.654  -7.956  33.126  1.00 39.28 ? 309 LYS B NZ  1 
ATOM   2786 N N   . GLN B 1 147 ? 30.535  -8.856  30.931  1.00 18.50 ? 310 GLN B N   1 
ATOM   2787 C CA  . GLN B 1 147 ? 29.299  -8.163  30.530  1.00 18.62 ? 310 GLN B CA  1 
ATOM   2788 C C   . GLN B 1 147 ? 29.575  -6.673  30.728  1.00 19.15 ? 310 GLN B C   1 
ATOM   2789 O O   . GLN B 1 147 ? 29.814  -6.273  31.854  1.00 18.97 ? 310 GLN B O   1 
ATOM   2790 C CB  . GLN B 1 147 ? 28.110  -8.559  31.421  1.00 17.65 ? 310 GLN B CB  1 
ATOM   2791 C CG  . GLN B 1 147 ? 26.794  -7.846  31.058  1.00 17.94 ? 310 GLN B CG  1 
ATOM   2792 C CD  . GLN B 1 147 ? 25.710  -8.196  32.022  1.00 21.36 ? 310 GLN B CD  1 
ATOM   2793 O OE1 . GLN B 1 147 ? 25.578  -7.586  33.088  1.00 21.60 ? 310 GLN B OE1 1 
ATOM   2794 N NE2 . GLN B 1 147 ? 24.946  -9.212  31.682  1.00 18.86 ? 310 GLN B NE2 1 
ATOM   2795 N N   . CYS B 1 148 ? 29.565  -5.881  29.636  1.00 18.13 ? 311 CYS B N   1 
ATOM   2796 C CA  . CYS B 1 148 ? 29.865  -4.446  29.661  1.00 18.37 ? 311 CYS B CA  1 
ATOM   2797 C C   . CYS B 1 148 ? 28.534  -3.798  29.424  1.00 16.55 ? 311 CYS B C   1 
ATOM   2798 O O   . CYS B 1 148 ? 27.793  -4.265  28.577  1.00 14.32 ? 311 CYS B O   1 
ATOM   2799 C CB  . CYS B 1 148 ? 30.787  -4.067  28.520  1.00 17.75 ? 311 CYS B CB  1 
ATOM   2800 S SG  . CYS B 1 148 ? 32.345  -4.965  28.588  1.00 28.40 ? 311 CYS B SG  1 
ATOM   2801 N N   . ARG B 1 149 ? 28.192  -2.784  30.214  1.00 14.84 ? 312 ARG B N   1 
ATOM   2802 C CA  . ARG B 1 149 ? 26.885  -2.160  30.047  1.00 15.79 ? 312 ARG B CA  1 
ATOM   2803 C C   . ARG B 1 149 ? 27.034  -0.669  29.881  1.00 16.23 ? 312 ARG B C   1 
ATOM   2804 O O   . ARG B 1 149 ? 28.007  -0.051  30.351  1.00 15.65 ? 312 ARG B O   1 
ATOM   2805 C CB  . ARG B 1 149 ? 25.934  -2.406  31.251  1.00 17.50 ? 312 ARG B CB  1 
ATOM   2806 C CG  . ARG B 1 149 ? 25.613  -3.842  31.516  1.00 19.62 ? 312 ARG B CG  1 
ATOM   2807 C CD  . ARG B 1 149 ? 26.539  -4.337  32.618  1.00 24.01 ? 312 ARG B CD  1 
ATOM   2808 N NE  . ARG B 1 149 ? 26.208  -3.642  33.849  1.00 26.79 ? 312 ARG B NE  1 
ATOM   2809 C CZ  . ARG B 1 149 ? 25.511  -4.167  34.853  1.00 32.22 ? 312 ARG B CZ  1 
ATOM   2810 N NH1 . ARG B 1 149 ? 25.085  -5.451  34.839  1.00 28.79 ? 312 ARG B NH1 1 
ATOM   2811 N NH2 . ARG B 1 149 ? 25.265  -3.401  35.902  1.00 29.79 ? 312 ARG B NH2 1 
ATOM   2812 N N   . SER B 1 150 ? 26.036  -0.088  29.231  1.00 16.33 ? 313 SER B N   1 
ATOM   2813 C CA  . SER B 1 150 ? 25.892  1.350   29.253  1.00 16.53 ? 313 SER B CA  1 
ATOM   2814 C C   . SER B 1 150 ? 24.440  1.645   29.009  1.00 15.99 ? 313 SER B C   1 
ATOM   2815 O O   . SER B 1 150 ? 23.590  0.745   28.959  1.00 15.66 ? 313 SER B O   1 
ATOM   2816 C CB  . SER B 1 150 ? 26.797  2.043   28.206  1.00 15.96 ? 313 SER B CB  1 
ATOM   2817 O OG  . SER B 1 150 ? 26.805  3.441   28.473  1.00 20.62 ? 313 SER B OG  1 
ATOM   2818 N N   . SER B 1 151 ? 24.140  2.910   28.838  1.00 15.83 ? 314 SER B N   1 
ATOM   2819 C CA  . SER B 1 151 ? 22.779  3.349   28.792  1.00 16.78 ? 314 SER B CA  1 
ATOM   2820 C C   . SER B 1 151 ? 22.661  4.665   27.997  1.00 16.53 ? 314 SER B C   1 
ATOM   2821 O O   . SER B 1 151 ? 23.570  5.502   28.022  1.00 17.40 ? 314 SER B O   1 
ATOM   2822 C CB  . SER B 1 151 ? 22.298  3.539   30.269  1.00 17.29 ? 314 SER B CB  1 
ATOM   2823 O OG  . SER B 1 151 ? 21.275  4.486   30.375  1.00 18.86 ? 314 SER B OG  1 
ATOM   2824 N N   . TYR B 1 152 ? 21.569  4.804   27.255  1.00 16.14 ? 315 TYR B N   1 
ATOM   2825 C CA  . TYR B 1 152 ? 21.232  6.039   26.584  1.00 17.26 ? 315 TYR B CA  1 
ATOM   2826 C C   . TYR B 1 152 ? 19.832  6.484   27.070  1.00 17.60 ? 315 TYR B C   1 
ATOM   2827 O O   . TYR B 1 152 ? 18.830  5.820   26.790  1.00 17.58 ? 315 TYR B O   1 
ATOM   2828 C CB  . TYR B 1 152 ? 21.231  5.855   25.065  1.00 16.34 ? 315 TYR B CB  1 
ATOM   2829 C CG  . TYR B 1 152 ? 22.572  5.302   24.559  1.00 16.47 ? 315 TYR B CG  1 
ATOM   2830 C CD1 . TYR B 1 152 ? 23.686  6.122   24.476  1.00 17.60 ? 315 TYR B CD1 1 
ATOM   2831 C CD2 . TYR B 1 152 ? 22.703  3.959   24.149  1.00 18.27 ? 315 TYR B CD2 1 
ATOM   2832 C CE1 . TYR B 1 152 ? 24.921  5.641   24.006  1.00 16.22 ? 315 TYR B CE1 1 
ATOM   2833 C CE2 . TYR B 1 152 ? 23.943  3.459   23.683  1.00 16.11 ? 315 TYR B CE2 1 
ATOM   2834 C CZ  . TYR B 1 152 ? 25.049  4.310   23.633  1.00 15.78 ? 315 TYR B CZ  1 
ATOM   2835 O OH  . TYR B 1 152 ? 26.259  3.820   23.185  1.00 15.57 ? 315 TYR B OH  1 
ATOM   2836 N N   . LEU B 1 153 ? 19.777  7.634   27.729  1.00 18.60 ? 316 LEU B N   1 
ATOM   2837 C CA  . LEU B 1 153 ? 18.486  8.320   27.896  1.00 20.12 ? 316 LEU B CA  1 
ATOM   2838 C C   . LEU B 1 153 ? 18.015  8.829   26.543  1.00 21.12 ? 316 LEU B C   1 
ATOM   2839 O O   . LEU B 1 153 ? 18.845  9.037   25.642  1.00 21.05 ? 316 LEU B O   1 
ATOM   2840 C CB  . LEU B 1 153 ? 18.587  9.461   28.923  1.00 20.44 ? 316 LEU B CB  1 
ATOM   2841 C CG  . LEU B 1 153 ? 19.028  8.990   30.309  1.00 21.93 ? 316 LEU B CG  1 
ATOM   2842 C CD1 . LEU B 1 153 ? 19.164  10.193  31.245  1.00 24.67 ? 316 LEU B CD1 1 
ATOM   2843 C CD2 . LEU B 1 153 ? 18.067  7.897   30.891  1.00 20.90 ? 316 LEU B CD2 1 
ATOM   2844 N N   . ALA B 1 154 ? 16.692  8.996   26.384  1.00 21.77 ? 317 ALA B N   1 
ATOM   2845 C CA  . ALA B 1 154 ? 16.131  9.538   25.163  1.00 23.01 ? 317 ALA B CA  1 
ATOM   2846 C C   . ALA B 1 154 ? 16.855  10.787  24.663  1.00 24.18 ? 317 ALA B C   1 
ATOM   2847 O O   . ALA B 1 154 ? 17.119  10.941  23.464  1.00 24.17 ? 317 ALA B O   1 
ATOM   2848 C CB  . ALA B 1 154 ? 14.614  9.808   25.335  1.00 23.33 ? 317 ALA B CB  1 
ATOM   2849 N N   . ASN B 1 155 ? 17.200  11.677  25.588  1.00 25.82 ? 318 ASN B N   1 
ATOM   2850 C CA  . ASN B 1 155 ? 17.953  12.884  25.247  1.00 26.84 ? 318 ASN B CA  1 
ATOM   2851 C C   . ASN B 1 155 ? 19.427  12.679  24.910  1.00 26.30 ? 318 ASN B C   1 
ATOM   2852 O O   . ASN B 1 155 ? 20.113  13.640  24.621  1.00 25.79 ? 318 ASN B O   1 
ATOM   2853 C CB  . ASN B 1 155 ? 17.804  13.976  26.333  1.00 27.33 ? 318 ASN B CB  1 
ATOM   2854 C CG  . ASN B 1 155 ? 18.322  13.545  27.717  1.00 31.35 ? 318 ASN B CG  1 
ATOM   2855 O OD1 . ASN B 1 155 ? 17.661  13.832  28.718  1.00 41.19 ? 318 ASN B OD1 1 
ATOM   2856 N ND2 . ASN B 1 155 ? 19.501  12.923  27.799  1.00 28.65 ? 318 ASN B ND2 1 
ATOM   2857 N N   . GLU B 1 156 ? 19.918  11.441  24.981  1.00 24.72 ? 319 GLU B N   1 
ATOM   2858 C CA  . GLU B 1 156 ? 21.301  11.152  24.597  1.00 24.08 ? 319 GLU B CA  1 
ATOM   2859 C C   . GLU B 1 156 ? 21.353  10.495  23.223  1.00 23.52 ? 319 GLU B C   1 
ATOM   2860 O O   . GLU B 1 156 ? 22.436  10.091  22.757  1.00 24.33 ? 319 GLU B O   1 
ATOM   2861 C CB  . GLU B 1 156 ? 21.974  10.264  25.649  1.00 23.60 ? 319 GLU B CB  1 
ATOM   2862 C CG  . GLU B 1 156 ? 22.000  10.959  27.013  1.00 23.76 ? 319 GLU B CG  1 
ATOM   2863 C CD  . GLU B 1 156 ? 22.382  10.067  28.201  1.00 24.24 ? 319 GLU B CD  1 
ATOM   2864 O OE1 . GLU B 1 156 ? 22.361  8.819   28.095  1.00 20.38 ? 319 GLU B OE1 1 
ATOM   2865 O OE2 . GLU B 1 156 ? 22.710  10.639  29.270  1.00 23.21 ? 319 GLU B OE2 1 
ATOM   2866 N N   . ILE B 1 157 ? 20.183  10.371  22.603  1.00 21.43 ? 320 ILE B N   1 
ATOM   2867 C CA  . ILE B 1 157 ? 20.069  9.828   21.262  1.00 20.77 ? 320 ILE B CA  1 
ATOM   2868 C C   . ILE B 1 157 ? 20.021  11.006  20.299  1.00 21.00 ? 320 ILE B C   1 
ATOM   2869 O O   . ILE B 1 157 ? 19.117  11.843  20.387  1.00 20.09 ? 320 ILE B O   1 
ATOM   2870 C CB  . ILE B 1 157 ? 18.818  8.988   21.124  1.00 20.21 ? 320 ILE B CB  1 
ATOM   2871 C CG1 . ILE B 1 157 ? 18.770  7.875   22.213  1.00 20.77 ? 320 ILE B CG1 1 
ATOM   2872 C CG2 . ILE B 1 157 ? 18.640  8.466   19.705  1.00 19.79 ? 320 ILE B CG2 1 
ATOM   2873 C CD1 . ILE B 1 157 ? 17.421  7.077   22.122  1.00 21.69 ? 320 ILE B CD1 1 
ATOM   2874 N N   . LEU B 1 158 ? 20.988  11.072  19.387  1.00 20.35 ? 321 LEU B N   1 
ATOM   2875 C CA  . LEU B 1 158 ? 21.059  12.200  18.444  1.00 19.94 ? 321 LEU B CA  1 
ATOM   2876 C C   . LEU B 1 158 ? 20.377  11.905  17.135  1.00 21.19 ? 321 LEU B C   1 
ATOM   2877 O O   . LEU B 1 158 ? 20.874  11.125  16.316  1.00 19.94 ? 321 LEU B O   1 
ATOM   2878 C CB  . LEU B 1 158 ? 22.490  12.643  18.208  1.00 19.66 ? 321 LEU B CB  1 
ATOM   2879 C CG  . LEU B 1 158 ? 23.311  12.834  19.478  1.00 20.27 ? 321 LEU B CG  1 
ATOM   2880 C CD1 . LEU B 1 158 ? 24.752  12.783  19.125  1.00 21.30 ? 321 LEU B CD1 1 
ATOM   2881 C CD2 . LEU B 1 158 ? 22.964  14.175  20.269  1.00 26.64 ? 321 LEU B CD2 1 
ATOM   2882 N N   . TRP B 1 159 ? 19.229  12.544  16.934  1.00 21.76 ? 322 TRP B N   1 
ATOM   2883 C CA  . TRP B 1 159 ? 18.412  12.312  15.738  1.00 22.87 ? 322 TRP B CA  1 
ATOM   2884 C C   . TRP B 1 159 ? 19.111  13.018  14.555  1.00 22.73 ? 322 TRP B C   1 
ATOM   2885 O O   . TRP B 1 159 ? 19.469  14.206  14.632  1.00 23.57 ? 322 TRP B O   1 
ATOM   2886 C CB  . TRP B 1 159 ? 16.966  12.848  15.919  1.00 23.33 ? 322 TRP B CB  1 
ATOM   2887 C CG  . TRP B 1 159 ? 16.037  12.469  14.771  1.00 23.27 ? 322 TRP B CG  1 
ATOM   2888 C CD1 . TRP B 1 159 ? 16.080  12.964  13.490  1.00 22.32 ? 322 TRP B CD1 1 
ATOM   2889 C CD2 . TRP B 1 159 ? 14.968  11.509  14.785  1.00 23.33 ? 322 TRP B CD2 1 
ATOM   2890 N NE1 . TRP B 1 159 ? 15.111  12.351  12.712  1.00 23.02 ? 322 TRP B NE1 1 
ATOM   2891 C CE2 . TRP B 1 159 ? 14.423  11.462  13.485  1.00 22.04 ? 322 TRP B CE2 1 
ATOM   2892 C CE3 . TRP B 1 159 ? 14.424  10.675  15.770  1.00 25.72 ? 322 TRP B CE3 1 
ATOM   2893 C CZ2 . TRP B 1 159 ? 13.354  10.631  13.148  1.00 24.40 ? 322 TRP B CZ2 1 
ATOM   2894 C CZ3 . TRP B 1 159 ? 13.364  9.860   15.440  1.00 24.11 ? 322 TRP B CZ3 1 
ATOM   2895 C CH2 . TRP B 1 159 ? 12.844  9.828   14.136  1.00 27.12 ? 322 TRP B CH2 1 
ATOM   2896 N N   . GLY B 1 160 ? 19.277  12.287  13.469  1.00 22.27 ? 323 GLY B N   1 
ATOM   2897 C CA  . GLY B 1 160 ? 19.925  12.828  12.301  1.00 22.66 ? 323 GLY B CA  1 
ATOM   2898 C C   . GLY B 1 160 ? 21.426  12.892  12.391  1.00 23.47 ? 323 GLY B C   1 
ATOM   2899 O O   . GLY B 1 160 ? 22.023  13.748  11.713  1.00 25.51 ? 323 GLY B O   1 
ATOM   2900 N N   . HIS B 1 161 ? 22.060  12.005  13.189  1.00 22.11 ? 324 HIS B N   1 
ATOM   2901 C CA  . HIS B 1 161 ? 23.512  11.969  13.273  1.00 21.63 ? 324 HIS B CA  1 
ATOM   2902 C C   . HIS B 1 161 ? 24.098  10.651  12.796  1.00 21.06 ? 324 HIS B C   1 
ATOM   2903 O O   . HIS B 1 161 ? 23.432  9.630   12.846  1.00 20.78 ? 324 HIS B O   1 
ATOM   2904 C CB  . HIS B 1 161 ? 24.044  12.236  14.672  1.00 21.90 ? 324 HIS B CB  1 
ATOM   2905 C CG  . HIS B 1 161 ? 23.955  13.667  15.102  1.00 23.23 ? 324 HIS B CG  1 
ATOM   2906 N ND1 . HIS B 1 161 ? 25.019  14.336  15.667  1.00 23.56 ? 324 HIS B ND1 1 
ATOM   2907 C CD2 . HIS B 1 161 ? 22.913  14.532  15.110  1.00 21.02 ? 324 HIS B CD2 1 
ATOM   2908 C CE1 . HIS B 1 161 ? 24.640  15.568  15.977  1.00 27.46 ? 324 HIS B CE1 1 
ATOM   2909 N NE2 . HIS B 1 161 ? 23.369  15.711  15.641  1.00 25.46 ? 324 HIS B NE2 1 
ATOM   2910 N N   . ARG B 1 162 ? 25.361  10.678  12.372  1.00 21.13 ? 325 ARG B N   1 
ATOM   2911 C CA  . ARG B 1 162 ? 26.094  9.433   12.031  1.00 22.12 ? 325 ARG B CA  1 
ATOM   2912 C C   . ARG B 1 162 ? 27.427  9.485   12.709  1.00 21.45 ? 325 ARG B C   1 
ATOM   2913 O O   . ARG B 1 162 ? 27.891  10.581  13.004  1.00 21.40 ? 325 ARG B O   1 
ATOM   2914 C CB  . ARG B 1 162 ? 26.216  9.259   10.503  1.00 23.19 ? 325 ARG B CB  1 
ATOM   2915 C CG  . ARG B 1 162 ? 24.864  9.001   9.885   1.00 25.73 ? 325 ARG B CG  1 
ATOM   2916 C CD  . ARG B 1 162 ? 24.873  8.483   8.438   1.00 31.35 ? 325 ARG B CD  1 
ATOM   2917 N NE  . ARG B 1 162 ? 25.734  9.235   7.525   1.00 28.49 ? 325 ARG B NE  1 
ATOM   2918 C CZ  . ARG B 1 162 ? 25.390  9.720   6.320   1.00 29.42 ? 325 ARG B CZ  1 
ATOM   2919 N NH1 . ARG B 1 162 ? 24.180  9.549   5.783   1.00 27.45 ? 325 ARG B NH1 1 
ATOM   2920 N NH2 . ARG B 1 162 ? 26.322  10.337  5.602   1.00 27.27 ? 325 ARG B NH2 1 
ATOM   2921 N N   . TYR B 1 163 ? 28.042  8.333   13.008  1.00 20.45 ? 326 TYR B N   1 
ATOM   2922 C CA  . TYR B 1 163 ? 29.391  8.327   13.637  1.00 19.18 ? 326 TYR B CA  1 
ATOM   2923 C C   . TYR B 1 163 ? 30.484  8.760   12.649  1.00 19.75 ? 326 TYR B C   1 
ATOM   2924 O O   . TYR B 1 163 ? 30.442  8.391   11.488  1.00 20.71 ? 326 TYR B O   1 
ATOM   2925 C CB  . TYR B 1 163 ? 29.767  6.940   14.201  1.00 18.77 ? 326 TYR B CB  1 
ATOM   2926 C CG  . TYR B 1 163 ? 28.877  6.608   15.367  1.00 18.48 ? 326 TYR B CG  1 
ATOM   2927 C CD1 . TYR B 1 163 ? 27.765  5.779   15.204  1.00 15.98 ? 326 TYR B CD1 1 
ATOM   2928 C CD2 . TYR B 1 163 ? 29.059  7.263   16.597  1.00 17.75 ? 326 TYR B CD2 1 
ATOM   2929 C CE1 . TYR B 1 163 ? 26.891  5.524   16.283  1.00 18.22 ? 326 TYR B CE1 1 
ATOM   2930 C CE2 . TYR B 1 163 ? 28.182  7.045   17.664  1.00 21.83 ? 326 TYR B CE2 1 
ATOM   2931 C CZ  . TYR B 1 163 ? 27.116  6.182   17.499  1.00 18.69 ? 326 TYR B CZ  1 
ATOM   2932 O OH  . TYR B 1 163 ? 26.289  6.004   18.567  1.00 18.92 ? 326 TYR B OH  1 
ATOM   2933 N N   . GLU B 1 164 ? 31.459  9.508   13.123  1.00 18.99 ? 327 GLU B N   1 
ATOM   2934 C CA  . GLU B 1 164 ? 32.722  9.620   12.416  1.00 21.00 ? 327 GLU B CA  1 
ATOM   2935 C C   . GLU B 1 164 ? 33.436  8.242   12.297  1.00 20.66 ? 327 GLU B C   1 
ATOM   2936 O O   . GLU B 1 164 ? 33.500  7.509   13.281  1.00 20.34 ? 327 GLU B O   1 
ATOM   2937 C CB  . GLU B 1 164 ? 33.629  10.581  13.145  1.00 20.27 ? 327 GLU B CB  1 
ATOM   2938 C CG  . GLU B 1 164 ? 33.138  12.026  13.059  1.00 23.44 ? 327 GLU B CG  1 
ATOM   2939 C CD  . GLU B 1 164 ? 33.864  12.792  11.995  1.00 31.12 ? 327 GLU B CD  1 
ATOM   2940 O OE1 . GLU B 1 164 ? 33.841  14.041  12.088  1.00 30.67 ? 327 GLU B OE1 1 
ATOM   2941 O OE2 . GLU B 1 164 ? 34.466  12.146  11.072  1.00 33.28 ? 327 GLU B OE2 1 
ATOM   2942 N N   . PRO B 1 165 ? 33.966  7.908   11.088  1.00 20.51 ? 328 PRO B N   1 
ATOM   2943 C CA  . PRO B 1 165 ? 34.825  6.734   10.860  1.00 20.12 ? 328 PRO B CA  1 
ATOM   2944 C C   . PRO B 1 165 ? 35.941  6.730   11.878  1.00 18.86 ? 328 PRO B C   1 
ATOM   2945 O O   . PRO B 1 165 ? 36.506  7.770   12.137  1.00 17.97 ? 328 PRO B O   1 
ATOM   2946 C CB  . PRO B 1 165 ? 35.456  7.021   9.491   1.00 20.24 ? 328 PRO B CB  1 
ATOM   2947 C CG  . PRO B 1 165 ? 34.452  7.843   8.785   1.00 21.12 ? 328 PRO B CG  1 
ATOM   2948 C CD  . PRO B 1 165 ? 33.743  8.674   9.830   1.00 20.85 ? 328 PRO B CD  1 
ATOM   2949 N N   . VAL B 1 166 ? 36.260  5.574   12.455  1.00 19.08 ? 329 VAL B N   1 
ATOM   2950 C CA  . VAL B 1 166 ? 37.483  5.451   13.245  1.00 18.20 ? 329 VAL B CA  1 
ATOM   2951 C C   . VAL B 1 166 ? 38.531  4.597   12.511  1.00 18.78 ? 329 VAL B C   1 
ATOM   2952 O O   . VAL B 1 166 ? 39.686  4.586   12.891  1.00 19.28 ? 329 VAL B O   1 
ATOM   2953 C CB  . VAL B 1 166 ? 37.207  4.846   14.660  1.00 20.30 ? 329 VAL B CB  1 
ATOM   2954 C CG1 . VAL B 1 166 ? 36.401  5.825   15.491  1.00 19.26 ? 329 VAL B CG1 1 
ATOM   2955 C CG2 . VAL B 1 166 ? 36.476  3.474   14.566  1.00 16.69 ? 329 VAL B CG2 1 
ATOM   2956 N N   . LEU B 1 167 ? 38.137  3.888   11.461  1.00 18.64 ? 330 LEU B N   1 
ATOM   2957 C CA  . LEU B 1 167 ? 39.038  2.883   10.876  1.00 19.27 ? 330 LEU B CA  1 
ATOM   2958 C C   . LEU B 1 167 ? 39.660  3.450   9.593   1.00 19.34 ? 330 LEU B C   1 
ATOM   2959 O O   . LEU B 1 167 ? 38.909  3.851   8.709   1.00 19.75 ? 330 LEU B O   1 
ATOM   2960 C CB  . LEU B 1 167 ? 38.285  1.564   10.573  1.00 17.16 ? 330 LEU B CB  1 
ATOM   2961 C CG  . LEU B 1 167 ? 39.098  0.430   9.924   1.00 18.32 ? 330 LEU B CG  1 
ATOM   2962 C CD1 . LEU B 1 167 ? 40.194  -0.107  10.902  1.00 19.03 ? 330 LEU B CD1 1 
ATOM   2963 C CD2 . LEU B 1 167 ? 38.192  -0.704  9.374   1.00 18.12 ? 330 LEU B CD2 1 
ATOM   2964 N N   . PHE B 1 168 ? 40.997  3.452   9.506   1.00 19.24 ? 331 PHE B N   1 
ATOM   2965 C CA  . PHE B 1 168 ? 41.718  4.144   8.407   1.00 21.73 ? 331 PHE B CA  1 
ATOM   2966 C C   . PHE B 1 168 ? 42.766  3.243   7.788   1.00 23.36 ? 331 PHE B C   1 
ATOM   2967 O O   . PHE B 1 168 ? 43.443  2.522   8.507   1.00 21.70 ? 331 PHE B O   1 
ATOM   2968 C CB  . PHE B 1 168 ? 42.385  5.439   8.883   1.00 20.94 ? 331 PHE B CB  1 
ATOM   2969 C CG  . PHE B 1 168 ? 41.382  6.512   9.161   1.00 20.55 ? 331 PHE B CG  1 
ATOM   2970 C CD1 . PHE B 1 168 ? 40.812  6.617   10.434  1.00 17.71 ? 331 PHE B CD1 1 
ATOM   2971 C CD2 . PHE B 1 168 ? 40.913  7.328   8.125   1.00 21.61 ? 331 PHE B CD2 1 
ATOM   2972 C CE1 . PHE B 1 168 ? 39.809  7.562   10.694  1.00 18.05 ? 331 PHE B CE1 1 
ATOM   2973 C CE2 . PHE B 1 168 ? 39.909  8.275   8.379   1.00 23.72 ? 331 PHE B CE2 1 
ATOM   2974 C CZ  . PHE B 1 168 ? 39.358  8.369   9.674   1.00 18.92 ? 331 PHE B CZ  1 
ATOM   2975 N N   . GLU B 1 169 ? 42.873  3.291   6.463   1.00 24.31 ? 332 GLU B N   1 
ATOM   2976 C CA  . GLU B 1 169 ? 43.891  2.508   5.759   1.00 26.87 ? 332 GLU B CA  1 
ATOM   2977 C C   . GLU B 1 169 ? 45.261  3.187   5.733   1.00 28.47 ? 332 GLU B C   1 
ATOM   2978 O O   . GLU B 1 169 ? 45.378  4.312   5.272   1.00 28.17 ? 332 GLU B O   1 
ATOM   2979 C CB  . GLU B 1 169 ? 43.420  2.273   4.332   1.00 26.85 ? 332 GLU B CB  1 
ATOM   2980 C CG  . GLU B 1 169 ? 44.370  1.444   3.443   1.00 30.43 ? 332 GLU B CG  1 
ATOM   2981 C CD  . GLU B 1 169 ? 43.913  1.451   1.977   1.00 30.90 ? 332 GLU B CD  1 
ATOM   2982 O OE1 . GLU B 1 169 ? 42.931  2.156   1.679   1.00 30.35 ? 332 GLU B OE1 1 
ATOM   2983 O OE2 . GLU B 1 169 ? 44.524  0.764   1.129   1.00 34.10 ? 332 GLU B OE2 1 
ATOM   2984 N N   . GLU B 1 170 ? 46.294  2.512   6.244   1.00 29.83 ? 333 GLU B N   1 
ATOM   2985 C CA  . GLU B 1 170 ? 47.679  2.852   5.915   1.00 31.32 ? 333 GLU B CA  1 
ATOM   2986 C C   . GLU B 1 170 ? 48.183  1.826   4.895   1.00 32.54 ? 333 GLU B C   1 
ATOM   2987 O O   . GLU B 1 170 ? 47.456  0.883   4.524   1.00 32.80 ? 333 GLU B O   1 
ATOM   2988 C CB  . GLU B 1 170 ? 48.567  2.826   7.167   1.00 31.56 ? 333 GLU B CB  1 
ATOM   2989 C CG  . GLU B 1 170 ? 48.235  3.882   8.216   1.00 34.33 ? 333 GLU B CG  1 
ATOM   2990 C CD  . GLU B 1 170 ? 48.410  5.301   7.705   1.00 40.26 ? 333 GLU B CD  1 
ATOM   2991 O OE1 . GLU B 1 170 ? 49.323  5.518   6.875   1.00 43.63 ? 333 GLU B OE1 1 
ATOM   2992 O OE2 . GLU B 1 170 ? 47.638  6.198   8.127   1.00 42.76 ? 333 GLU B OE2 1 
ATOM   2993 N N   . LYS B 1 171 ? 49.423  1.983   4.436   1.00 33.88 ? 334 LYS B N   1 
ATOM   2994 C CA  . LYS B 1 171 ? 49.980  1.052   3.439   1.00 35.20 ? 334 LYS B CA  1 
ATOM   2995 C C   . LYS B 1 171 ? 50.006  -0.429  3.895   1.00 34.50 ? 334 LYS B C   1 
ATOM   2996 O O   . LYS B 1 171 ? 49.525  -1.302  3.190   1.00 34.58 ? 334 LYS B O   1 
ATOM   2997 C CB  . LYS B 1 171 ? 51.380  1.509   2.962   1.00 36.32 ? 334 LYS B CB  1 
ATOM   2998 C CG  . LYS B 1 171 ? 51.835  0.797   1.661   1.00 39.13 ? 334 LYS B CG  1 
ATOM   2999 C CD  . LYS B 1 171 ? 53.207  1.319   1.168   1.00 42.86 ? 334 LYS B CD  1 
ATOM   3000 C CE  . LYS B 1 171 ? 53.832  0.354   0.129   1.00 45.58 ? 334 LYS B CE  1 
ATOM   3001 N NZ  . LYS B 1 171 ? 55.264  0.721   -0.202  1.00 46.76 ? 334 LYS B NZ  1 
ATOM   3002 N N   . HIS B 1 172 ? 50.567  -0.701  5.067   1.00 34.45 ? 335 HIS B N   1 
ATOM   3003 C CA  . HIS B 1 172 ? 50.745  -2.093  5.496   1.00 34.25 ? 335 HIS B CA  1 
ATOM   3004 C C   . HIS B 1 172 ? 49.833  -2.520  6.644   1.00 33.06 ? 335 HIS B C   1 
ATOM   3005 O O   . HIS B 1 172 ? 50.033  -3.597  7.207   1.00 32.85 ? 335 HIS B O   1 
ATOM   3006 C CB  . HIS B 1 172 ? 52.201  -2.343  5.914   1.00 34.80 ? 335 HIS B CB  1 
ATOM   3007 C CG  . HIS B 1 172 ? 53.198  -1.946  4.873   1.00 36.40 ? 335 HIS B CG  1 
ATOM   3008 N ND1 . HIS B 1 172 ? 53.397  -2.674  3.717   1.00 42.09 ? 335 HIS B ND1 1 
ATOM   3009 C CD2 . HIS B 1 172 ? 54.041  -0.891  4.804   1.00 38.71 ? 335 HIS B CD2 1 
ATOM   3010 C CE1 . HIS B 1 172 ? 54.329  -2.089  2.984   1.00 42.06 ? 335 HIS B CE1 1 
ATOM   3011 N NE2 . HIS B 1 172 ? 54.736  -1.005  3.624   1.00 41.05 ? 335 HIS B NE2 1 
ATOM   3012 N N   . TYR B 1 173 ? 48.899  -1.658  7.046   1.00 30.70 ? 336 TYR B N   1 
ATOM   3013 C CA  . TYR B 1 173 ? 48.015  -1.980  8.172   1.00 28.36 ? 336 TYR B CA  1 
ATOM   3014 C C   . TYR B 1 173 ? 46.881  -0.974  8.258   1.00 27.26 ? 336 TYR B C   1 
ATOM   3015 O O   . TYR B 1 173 ? 46.784  -0.060  7.424   1.00 26.55 ? 336 TYR B O   1 
ATOM   3016 C CB  . TYR B 1 173 ? 48.788  -2.023  9.475   1.00 27.74 ? 336 TYR B CB  1 
ATOM   3017 C CG  . TYR B 1 173 ? 49.283  -0.662  9.936   1.00 27.22 ? 336 TYR B CG  1 
ATOM   3018 C CD1 . TYR B 1 173 ? 48.521  0.119   10.796  1.00 26.33 ? 336 TYR B CD1 1 
ATOM   3019 C CD2 . TYR B 1 173 ? 50.507  -0.139  9.471   1.00 27.64 ? 336 TYR B CD2 1 
ATOM   3020 C CE1 . TYR B 1 173 ? 48.966  1.376   11.203  1.00 28.10 ? 336 TYR B CE1 1 
ATOM   3021 C CE2 . TYR B 1 173 ? 50.951  1.125   9.898   1.00 27.91 ? 336 TYR B CE2 1 
ATOM   3022 C CZ  . TYR B 1 173 ? 50.168  1.845   10.742  1.00 26.55 ? 336 TYR B CZ  1 
ATOM   3023 O OH  . TYR B 1 173 ? 50.588  3.090   11.185  1.00 28.59 ? 336 TYR B OH  1 
ATOM   3024 N N   . TYR B 1 174 ? 46.014  -1.163  9.248   1.00 25.26 ? 337 TYR B N   1 
ATOM   3025 C CA  . TYR B 1 174 ? 44.861  -0.288  9.442   1.00 24.81 ? 337 TYR B CA  1 
ATOM   3026 C C   . TYR B 1 174 ? 45.039  0.349   10.795  1.00 24.70 ? 337 TYR B C   1 
ATOM   3027 O O   . TYR B 1 174 ? 45.591  -0.279  11.709  1.00 25.09 ? 337 TYR B O   1 
ATOM   3028 C CB  . TYR B 1 174 ? 43.546  -1.097  9.363   1.00 24.03 ? 337 TYR B CB  1 
ATOM   3029 C CG  . TYR B 1 174 ? 43.307  -1.638  7.988   1.00 23.50 ? 337 TYR B CG  1 
ATOM   3030 C CD1 . TYR B 1 174 ? 43.797  -2.918  7.608   1.00 23.01 ? 337 TYR B CD1 1 
ATOM   3031 C CD2 . TYR B 1 174 ? 42.648  -0.861  7.017   1.00 23.05 ? 337 TYR B CD2 1 
ATOM   3032 C CE1 . TYR B 1 174 ? 43.602  -3.380  6.353   1.00 23.64 ? 337 TYR B CE1 1 
ATOM   3033 C CE2 . TYR B 1 174 ? 42.472  -1.317  5.747   1.00 20.95 ? 337 TYR B CE2 1 
ATOM   3034 C CZ  . TYR B 1 174 ? 42.948  -2.576  5.414   1.00 26.06 ? 337 TYR B CZ  1 
ATOM   3035 O OH  . TYR B 1 174 ? 42.751  -3.036  4.132   1.00 27.14 ? 337 TYR B OH  1 
ATOM   3036 N N   . LYS B 1 175 ? 44.670  1.610   10.924  1.00 24.30 ? 338 LYS B N   1 
ATOM   3037 C CA  . LYS B 1 175 ? 44.686  2.195   12.236  1.00 25.79 ? 338 LYS B CA  1 
ATOM   3038 C C   . LYS B 1 175 ? 43.274  2.551   12.677  1.00 24.15 ? 338 LYS B C   1 
ATOM   3039 O O   . LYS B 1 175 ? 42.433  2.901   11.857  1.00 24.27 ? 338 LYS B O   1 
ATOM   3040 C CB  . LYS B 1 175 ? 45.637  3.393   12.327  1.00 26.94 ? 338 LYS B CB  1 
ATOM   3041 C CG  . LYS B 1 175 ? 45.372  4.448   11.306  1.00 33.23 ? 338 LYS B CG  1 
ATOM   3042 C CD  . LYS B 1 175 ? 46.389  5.598   11.463  1.00 38.76 ? 338 LYS B CD  1 
ATOM   3043 C CE  . LYS B 1 175 ? 45.794  6.881   10.894  1.00 41.02 ? 338 LYS B CE  1 
ATOM   3044 N NZ  . LYS B 1 175 ? 46.838  7.712   10.222  1.00 42.11 ? 338 LYS B NZ  1 
ATOM   3045 N N   . VAL B 1 176 ? 43.050  2.432   13.982  1.00 23.44 ? 339 VAL B N   1 
ATOM   3046 C CA  . VAL B 1 176 ? 41.795  2.780   14.619  1.00 23.12 ? 339 VAL B CA  1 
ATOM   3047 C C   . VAL B 1 176 ? 42.105  4.028   15.438  1.00 22.48 ? 339 VAL B C   1 
ATOM   3048 O O   . VAL B 1 176 ? 42.871  3.971   16.393  1.00 22.35 ? 339 VAL B O   1 
ATOM   3049 C CB  . VAL B 1 176 ? 41.251  1.663   15.570  1.00 22.54 ? 339 VAL B CB  1 
ATOM   3050 C CG1 . VAL B 1 176 ? 40.077  2.210   16.375  1.00 21.62 ? 339 VAL B CG1 1 
ATOM   3051 C CG2 . VAL B 1 176 ? 40.760  0.479   14.764  1.00 22.76 ? 339 VAL B CG2 1 
ATOM   3052 N N   . ASP B 1 177 ? 41.533  5.154   15.046  1.00 21.57 ? 340 ASP B N   1 
ATOM   3053 C CA  . ASP B 1 177 ? 41.842  6.395   15.723  1.00 21.89 ? 340 ASP B CA  1 
ATOM   3054 C C   . ASP B 1 177 ? 40.768  6.602   16.765  1.00 21.66 ? 340 ASP B C   1 
ATOM   3055 O O   . ASP B 1 177 ? 39.663  7.017   16.448  1.00 20.72 ? 340 ASP B O   1 
ATOM   3056 C CB  . ASP B 1 177 ? 41.904  7.556   14.736  1.00 22.21 ? 340 ASP B CB  1 
ATOM   3057 C CG  . ASP B 1 177 ? 42.256  8.890   15.396  1.00 26.38 ? 340 ASP B CG  1 
ATOM   3058 O OD1 . ASP B 1 177 ? 42.361  9.012   16.651  1.00 25.74 ? 340 ASP B OD1 1 
ATOM   3059 O OD2 . ASP B 1 177 ? 42.387  9.850   14.624  1.00 31.09 ? 340 ASP B OD2 1 
ATOM   3060 N N   . TYR B 1 178 ? 41.105  6.292   18.018  1.00 20.83 ? 341 TYR B N   1 
ATOM   3061 C CA  . TYR B 1 178 ? 40.124  6.376   19.093  1.00 22.21 ? 341 TYR B CA  1 
ATOM   3062 C C   . TYR B 1 178 ? 39.692  7.810   19.444  1.00 21.92 ? 341 TYR B C   1 
ATOM   3063 O O   . TYR B 1 178 ? 38.670  7.997   20.127  1.00 20.85 ? 341 TYR B O   1 
ATOM   3064 C CB  . TYR B 1 178 ? 40.567  5.595   20.331  1.00 22.23 ? 341 TYR B CB  1 
ATOM   3065 C CG  . TYR B 1 178 ? 39.823  4.292   20.491  1.00 29.50 ? 341 TYR B CG  1 
ATOM   3066 C CD1 . TYR B 1 178 ? 40.135  3.176   19.709  1.00 34.88 ? 341 TYR B CD1 1 
ATOM   3067 C CD2 . TYR B 1 178 ? 38.785  4.174   21.411  1.00 34.53 ? 341 TYR B CD2 1 
ATOM   3068 C CE1 . TYR B 1 178 ? 39.424  1.955   19.839  1.00 35.37 ? 341 TYR B CE1 1 
ATOM   3069 C CE2 . TYR B 1 178 ? 38.083  2.956   21.560  1.00 39.79 ? 341 TYR B CE2 1 
ATOM   3070 C CZ  . TYR B 1 178 ? 38.418  1.850   20.759  1.00 39.48 ? 341 TYR B CZ  1 
ATOM   3071 O OH  . TYR B 1 178 ? 37.734  0.642   20.904  1.00 42.40 ? 341 TYR B OH  1 
ATOM   3072 N N   . SER B 1 179 ? 40.435  8.806   18.945  1.00 21.03 ? 342 SER B N   1 
ATOM   3073 C CA  . SER B 1 179 ? 40.028  10.216  19.076  1.00 21.54 ? 342 SER B CA  1 
ATOM   3074 C C   . SER B 1 179 ? 38.687  10.501  18.398  1.00 21.86 ? 342 SER B C   1 
ATOM   3075 O O   . SER B 1 179 ? 37.970  11.438  18.763  1.00 22.36 ? 342 SER B O   1 
ATOM   3076 C CB  . SER B 1 179 ? 41.161  11.179  18.635  1.00 21.28 ? 342 SER B CB  1 
ATOM   3077 O OG  . SER B 1 179 ? 41.047  11.482  17.261  1.00 24.35 ? 342 SER B OG  1 
ATOM   3078 N N   . ARG B 1 180 ? 38.286  9.641   17.463  1.00 21.62 ? 343 ARG B N   1 
ATOM   3079 C CA  . ARG B 1 180 ? 37.024  9.841   16.767  1.00 20.72 ? 343 ARG B CA  1 
ATOM   3080 C C   . ARG B 1 180 ? 35.918  8.967   17.257  1.00 20.17 ? 343 ARG B C   1 
ATOM   3081 O O   . ARG B 1 180 ? 34.799  9.076   16.783  1.00 19.84 ? 343 ARG B O   1 
ATOM   3082 C CB  . ARG B 1 180 ? 37.251  9.595   15.304  1.00 22.32 ? 343 ARG B CB  1 
ATOM   3083 C CG  . ARG B 1 180 ? 37.850  10.857  14.664  1.00 25.73 ? 343 ARG B CG  1 
ATOM   3084 C CD  . ARG B 1 180 ? 38.976  10.446  13.886  1.00 30.50 ? 343 ARG B CD  1 
ATOM   3085 N NE  . ARG B 1 180 ? 39.837  11.570  13.483  1.00 33.51 ? 343 ARG B NE  1 
ATOM   3086 C CZ  . ARG B 1 180 ? 39.995  11.942  12.225  1.00 30.85 ? 343 ARG B CZ  1 
ATOM   3087 N NH1 . ARG B 1 180 ? 39.298  11.336  11.266  1.00 22.07 ? 343 ARG B NH1 1 
ATOM   3088 N NH2 . ARG B 1 180 ? 40.847  12.916  11.945  1.00 32.41 ? 343 ARG B NH2 1 
ATOM   3089 N N   . PHE B 1 181 ? 36.225  8.103   18.219  1.00 19.87 ? 344 PHE B N   1 
ATOM   3090 C CA  . PHE B 1 181 ? 35.232  7.148   18.739  1.00 19.08 ? 344 PHE B CA  1 
ATOM   3091 C C   . PHE B 1 181 ? 33.848  7.733   19.083  1.00 18.26 ? 344 PHE B C   1 
ATOM   3092 O O   . PHE B 1 181 ? 32.844  7.183   18.709  1.00 18.28 ? 344 PHE B O   1 
ATOM   3093 C CB  . PHE B 1 181 ? 35.803  6.469   19.963  1.00 19.44 ? 344 PHE B CB  1 
ATOM   3094 C CG  . PHE B 1 181 ? 34.978  5.264   20.436  1.00 19.65 ? 344 PHE B CG  1 
ATOM   3095 C CD1 . PHE B 1 181 ? 35.192  3.985   19.880  1.00 18.62 ? 344 PHE B CD1 1 
ATOM   3096 C CD2 . PHE B 1 181 ? 34.010  5.421   21.401  1.00 17.04 ? 344 PHE B CD2 1 
ATOM   3097 C CE1 . PHE B 1 181 ? 34.416  2.852   20.332  1.00 20.27 ? 344 PHE B CE1 1 
ATOM   3098 C CE2 . PHE B 1 181 ? 33.246  4.321   21.873  1.00 16.28 ? 344 PHE B CE2 1 
ATOM   3099 C CZ  . PHE B 1 181 ? 33.451  3.034   21.327  1.00 21.28 ? 344 PHE B CZ  1 
ATOM   3100 N N   . HIS B 1 182 ? 33.802  8.803   19.868  1.00 17.71 ? 345 HIS B N   1 
ATOM   3101 C CA  . HIS B 1 182 ? 32.536  9.400   20.292  1.00 18.66 ? 345 HIS B CA  1 
ATOM   3102 C C   . HIS B 1 182 ? 31.986  10.457  19.347  1.00 20.11 ? 345 HIS B C   1 
ATOM   3103 O O   . HIS B 1 182 ? 30.885  11.030  19.589  1.00 19.40 ? 345 HIS B O   1 
ATOM   3104 C CB  . HIS B 1 182 ? 32.717  10.059  21.673  1.00 18.47 ? 345 HIS B CB  1 
ATOM   3105 C CG  . HIS B 1 182 ? 33.095  9.096   22.737  1.00 18.46 ? 345 HIS B CG  1 
ATOM   3106 N ND1 . HIS B 1 182 ? 32.191  8.189   23.264  1.00 16.45 ? 345 HIS B ND1 1 
ATOM   3107 C CD2 . HIS B 1 182 ? 34.269  8.886   23.374  1.00 17.17 ? 345 HIS B CD2 1 
ATOM   3108 C CE1 . HIS B 1 182 ? 32.796  7.480   24.190  1.00 19.39 ? 345 HIS B CE1 1 
ATOM   3109 N NE2 . HIS B 1 182 ? 34.053  7.883   24.272  1.00 19.27 ? 345 HIS B NE2 1 
ATOM   3110 N N   . LYS B 1 183 ? 32.715  10.714  18.250  1.00 19.79 ? 346 LYS B N   1 
ATOM   3111 C CA  . LYS B 1 183 ? 32.367  11.862  17.424  1.00 20.54 ? 346 LYS B CA  1 
ATOM   3112 C C   . LYS B 1 183 ? 31.297  11.526  16.402  1.00 20.82 ? 346 LYS B C   1 
ATOM   3113 O O   . LYS B 1 183 ? 31.225  10.387  15.907  1.00 18.79 ? 346 LYS B O   1 
ATOM   3114 C CB  . LYS B 1 183 ? 33.653  12.450  16.799  1.00 20.51 ? 346 LYS B CB  1 
ATOM   3115 C CG  . LYS B 1 183 ? 34.505  13.089  17.857  1.00 21.16 ? 346 LYS B CG  1 
ATOM   3116 C CD  . LYS B 1 183 ? 35.686  13.756  17.231  1.00 27.51 ? 346 LYS B CD  1 
ATOM   3117 C CE  . LYS B 1 183 ? 36.427  14.590  18.285  1.00 28.78 ? 346 LYS B CE  1 
ATOM   3118 N NZ  . LYS B 1 183 ? 37.779  14.947  17.780  1.00 32.75 ? 346 LYS B NZ  1 
ATOM   3119 N N   . THR B 1 184 ? 30.447  12.510  16.097  1.00 20.80 ? 347 THR B N   1 
ATOM   3120 C CA  . THR B 1 184 ? 29.415  12.330  15.118  1.00 23.42 ? 347 THR B CA  1 
ATOM   3121 C C   . THR B 1 184 ? 29.389  13.495  14.125  1.00 25.39 ? 347 THR B C   1 
ATOM   3122 O O   . THR B 1 184 ? 29.989  14.551  14.362  1.00 26.52 ? 347 THR B O   1 
ATOM   3123 C CB  . THR B 1 184 ? 28.004  12.169  15.792  1.00 24.03 ? 347 THR B CB  1 
ATOM   3124 O OG1 . THR B 1 184 ? 27.617  13.404  16.441  1.00 25.32 ? 347 THR B OG1 1 
ATOM   3125 C CG2 . THR B 1 184 ? 28.020  11.012  16.854  1.00 20.97 ? 347 THR B CG2 1 
ATOM   3126 N N   . TYR B 1 185 ? 28.727  13.284  13.008  1.00 26.98 ? 348 TYR B N   1 
ATOM   3127 C CA  . TYR B 1 185 ? 28.371  14.396  12.177  1.00 28.79 ? 348 TYR B CA  1 
ATOM   3128 C C   . TYR B 1 185 ? 26.868  14.440  11.974  1.00 29.43 ? 348 TYR B C   1 
ATOM   3129 O O   . TYR B 1 185 ? 26.143  13.479  12.296  1.00 28.01 ? 348 TYR B O   1 
ATOM   3130 C CB  . TYR B 1 185 ? 29.190  14.452  10.894  1.00 30.06 ? 348 TYR B CB  1 
ATOM   3131 C CG  . TYR B 1 185 ? 29.073  13.272  10.004  1.00 29.76 ? 348 TYR B CG  1 
ATOM   3132 C CD1 . TYR B 1 185 ? 27.970  13.120  9.214   1.00 31.70 ? 348 TYR B CD1 1 
ATOM   3133 C CD2 . TYR B 1 185 ? 30.105  12.329  9.915   1.00 31.81 ? 348 TYR B CD2 1 
ATOM   3134 C CE1 . TYR B 1 185 ? 27.841  12.041  8.365   1.00 33.35 ? 348 TYR B CE1 1 
ATOM   3135 C CE2 . TYR B 1 185 ? 30.011  11.238  9.080   1.00 28.02 ? 348 TYR B CE2 1 
ATOM   3136 C CZ  . TYR B 1 185 ? 28.866  11.093  8.293   1.00 32.32 ? 348 TYR B CZ  1 
ATOM   3137 O OH  . TYR B 1 185 ? 28.669  10.022  7.427   1.00 31.40 ? 348 TYR B OH  1 
ATOM   3138 N N   . GLU B 1 186 ? 26.395  15.587  11.511  1.00 29.38 ? 349 GLU B N   1 
ATOM   3139 C CA  . GLU B 1 186 ? 24.976  15.806  11.360  1.00 30.96 ? 349 GLU B CA  1 
ATOM   3140 C C   . GLU B 1 186 ? 24.577  15.641  9.903   1.00 30.14 ? 349 GLU B C   1 
ATOM   3141 O O   . GLU B 1 186 ? 25.247  16.124  8.973   1.00 31.41 ? 349 GLU B O   1 
ATOM   3142 C CB  . GLU B 1 186 ? 24.556  17.175  11.955  1.00 30.92 ? 349 GLU B CB  1 
ATOM   3143 C CG  . GLU B 1 186 ? 23.104  17.701  11.607  1.00 38.50 ? 349 GLU B CG  1 
ATOM   3144 C CD  . GLU B 1 186 ? 21.943  16.807  12.131  1.00 46.75 ? 349 GLU B CD  1 
ATOM   3145 O OE1 . GLU B 1 186 ? 22.168  16.082  13.125  1.00 53.11 ? 349 GLU B OE1 1 
ATOM   3146 O OE2 . GLU B 1 186 ? 20.804  16.820  11.571  1.00 49.58 ? 349 GLU B OE2 1 
ATOM   3147 N N   . VAL B 1 187 ? 23.476  14.946  9.709   1.00 28.59 ? 350 VAL B N   1 
ATOM   3148 C CA  . VAL B 1 187 ? 22.900  14.738  8.410   1.00 29.12 ? 350 VAL B CA  1 
ATOM   3149 C C   . VAL B 1 187 ? 21.576  15.528  8.316   1.00 29.04 ? 350 VAL B C   1 
ATOM   3150 O O   . VAL B 1 187 ? 20.527  14.976  8.653   1.00 28.32 ? 350 VAL B O   1 
ATOM   3151 C CB  . VAL B 1 187 ? 22.627  13.256  8.209   1.00 28.97 ? 350 VAL B CB  1 
ATOM   3152 C CG1 . VAL B 1 187 ? 21.943  13.011  6.867   1.00 29.28 ? 350 VAL B CG1 1 
ATOM   3153 C CG2 . VAL B 1 187 ? 23.961  12.473  8.373   1.00 30.58 ? 350 VAL B CG2 1 
ATOM   3154 N N   . PRO B 1 188 ? 21.632  16.828  7.907   1.00 29.75 ? 351 PRO B N   1 
ATOM   3155 C CA  . PRO B 1 188 ? 20.385  17.664  7.818   1.00 30.84 ? 351 PRO B CA  1 
ATOM   3156 C C   . PRO B 1 188 ? 19.266  17.037  6.993   1.00 31.49 ? 351 PRO B C   1 
ATOM   3157 O O   . PRO B 1 188 ? 18.111  17.339  7.207   1.00 31.72 ? 351 PRO B O   1 
ATOM   3158 C CB  . PRO B 1 188 ? 20.877  18.977  7.172   1.00 31.52 ? 351 PRO B CB  1 
ATOM   3159 C CG  . PRO B 1 188 ? 22.373  19.083  7.634   1.00 30.45 ? 351 PRO B CG  1 
ATOM   3160 C CD  . PRO B 1 188 ? 22.850  17.624  7.607   1.00 28.92 ? 351 PRO B CD  1 
ATOM   3161 N N   . ASN B 1 189 ? 19.652  16.131  6.100   1.00 33.08 ? 352 ASN B N   1 
ATOM   3162 C CA  . ASN B 1 189 ? 18.796  15.402  5.157   1.00 35.21 ? 352 ASN B CA  1 
ATOM   3163 C C   . ASN B 1 189 ? 17.887  14.367  5.843   1.00 35.29 ? 352 ASN B C   1 
ATOM   3164 O O   . ASN B 1 189 ? 16.979  13.821  5.210   1.00 35.83 ? 352 ASN B O   1 
ATOM   3165 C CB  . ASN B 1 189 ? 19.711  14.672  4.138   1.00 36.24 ? 352 ASN B CB  1 
ATOM   3166 C CG  . ASN B 1 189 ? 18.974  14.254  2.867   1.00 39.86 ? 352 ASN B CG  1 
ATOM   3167 O OD1 . ASN B 1 189 ? 18.083  14.970  2.415   1.00 45.87 ? 352 ASN B OD1 1 
ATOM   3168 N ND2 . ASN B 1 189 ? 19.344  13.091  2.282   1.00 40.24 ? 352 ASN B ND2 1 
ATOM   3169 N N   . THR B 1 190 ? 18.129  14.097  7.132   1.00 34.28 ? 353 THR B N   1 
ATOM   3170 C CA  . THR B 1 190 ? 17.374  13.054  7.827   1.00 32.99 ? 353 THR B CA  1 
ATOM   3171 C C   . THR B 1 190 ? 15.922  13.439  8.011   1.00 33.17 ? 353 THR B C   1 
ATOM   3172 O O   . THR B 1 190 ? 15.638  14.509  8.547   1.00 33.18 ? 353 THR B O   1 
ATOM   3173 C CB  . THR B 1 190 ? 17.996  12.708  9.166   1.00 32.77 ? 353 THR B CB  1 
ATOM   3174 O OG1 . THR B 1 190 ? 19.369  12.342  8.972   1.00 30.21 ? 353 THR B OG1 1 
ATOM   3175 C CG2 . THR B 1 190 ? 17.236  11.545  9.829   1.00 31.29 ? 353 THR B CG2 1 
ATOM   3176 N N   . PRO B 1 191 ? 14.998  12.552  7.596   1.00 33.61 ? 354 PRO B N   1 
ATOM   3177 C CA  . PRO B 1 191 ? 13.573  12.814  7.796   1.00 34.24 ? 354 PRO B CA  1 
ATOM   3178 C C   . PRO B 1 191 ? 13.311  12.981  9.281   1.00 34.61 ? 354 PRO B C   1 
ATOM   3179 O O   . PRO B 1 191 ? 13.959  12.324  10.069  1.00 34.27 ? 354 PRO B O   1 
ATOM   3180 C CB  . PRO B 1 191 ? 12.893  11.528  7.323   1.00 33.96 ? 354 PRO B CB  1 
ATOM   3181 C CG  . PRO B 1 191 ? 13.909  10.834  6.455   1.00 34.10 ? 354 PRO B CG  1 
ATOM   3182 C CD  . PRO B 1 191 ? 15.246  11.239  6.958   1.00 32.99 ? 354 PRO B CD  1 
ATOM   3183 N N   . LEU B 1 192 ? 12.380  13.868  9.641   1.00 34.70 ? 355 LEU B N   1 
ATOM   3184 C CA  . LEU B 1 192 ? 12.054  14.155  11.037  1.00 34.98 ? 355 LEU B CA  1 
ATOM   3185 C C   . LEU B 1 192 ? 10.833  13.378  11.553  1.00 34.72 ? 355 LEU B C   1 
ATOM   3186 O O   . LEU B 1 192 ? 10.497  13.440  12.716  1.00 36.01 ? 355 LEU B O   1 
ATOM   3187 C CB  . LEU B 1 192 ? 11.872  15.674  11.248  1.00 35.18 ? 355 LEU B CB  1 
ATOM   3188 C CG  . LEU B 1 192 ? 13.065  16.586  10.939  1.00 35.94 ? 355 LEU B CG  1 
ATOM   3189 C CD1 . LEU B 1 192 ? 12.809  17.959  11.473  1.00 36.39 ? 355 LEU B CD1 1 
ATOM   3190 C CD2 . LEU B 1 192 ? 14.359  16.047  11.554  1.00 37.30 ? 355 LEU B CD2 1 
ATOM   3191 N N   . CYS B 1 193 ? 10.175  12.625  10.694  1.00 34.67 ? 356 CYS B N   1 
ATOM   3192 C CA  . CYS B 1 193 ? 9.015   11.864  11.131  1.00 35.30 ? 356 CYS B CA  1 
ATOM   3193 C C   . CYS B 1 193 ? 9.371   10.457  11.663  1.00 34.90 ? 356 CYS B C   1 
ATOM   3194 O O   . CYS B 1 193 ? 10.516  10.041  11.593  1.00 34.72 ? 356 CYS B O   1 
ATOM   3195 C CB  . CYS B 1 193 ? 8.044   11.743  9.961   1.00 34.94 ? 356 CYS B CB  1 
ATOM   3196 S SG  . CYS B 1 193 ? 8.816   10.979  8.525   1.00 37.72 ? 356 CYS B SG  1 
ATOM   3197 N N   . SER B 1 194 ? 8.372   9.723   12.152  1.00 34.68 ? 357 SER B N   1 
ATOM   3198 C CA  . SER B 1 194 ? 8.562   8.362   12.655  1.00 34.56 ? 357 SER B CA  1 
ATOM   3199 C C   . SER B 1 194 ? 8.817   7.387   11.516  1.00 34.30 ? 357 SER B C   1 
ATOM   3200 O O   . SER B 1 194 ? 8.520   7.685   10.365  1.00 34.47 ? 357 SER B O   1 
ATOM   3201 C CB  . SER B 1 194 ? 7.338   7.911   13.436  1.00 33.90 ? 357 SER B CB  1 
ATOM   3202 O OG  . SER B 1 194 ? 6.242   7.741   12.545  1.00 37.18 ? 357 SER B OG  1 
ATOM   3203 N N   . ALA B 1 195 ? 9.380   6.223   11.845  1.00 34.45 ? 358 ALA B N   1 
ATOM   3204 C CA  . ALA B 1 195 ? 9.486   5.133   10.910  1.00 34.56 ? 358 ALA B CA  1 
ATOM   3205 C C   . ALA B 1 195 ? 8.115   4.635   10.436  1.00 35.84 ? 358 ALA B C   1 
ATOM   3206 O O   . ALA B 1 195 ? 8.016   4.103   9.345   1.00 35.02 ? 358 ALA B O   1 
ATOM   3207 C CB  . ALA B 1 195 ? 10.293  4.002   11.503  1.00 33.82 ? 358 ALA B CB  1 
ATOM   3208 N N   . ARG B 1 196 ? 7.069   4.792   11.246  1.00 37.85 ? 359 ARG B N   1 
ATOM   3209 C CA  . ARG B 1 196 ? 5.707   4.442   10.805  1.00 40.81 ? 359 ARG B CA  1 
ATOM   3210 C C   . ARG B 1 196 ? 5.260   5.311   9.623   1.00 41.53 ? 359 ARG B C   1 
ATOM   3211 O O   . ARG B 1 196 ? 4.803   4.799   8.615   1.00 41.73 ? 359 ARG B O   1 
ATOM   3212 C CB  . ARG B 1 196 ? 4.693   4.532   11.947  1.00 41.32 ? 359 ARG B CB  1 
ATOM   3213 C CG  . ARG B 1 196 ? 3.281   4.186   11.514  1.00 44.69 ? 359 ARG B CG  1 
ATOM   3214 C CD  . ARG B 1 196 ? 2.261   4.377   12.646  1.00 51.18 ? 359 ARG B CD  1 
ATOM   3215 N NE  . ARG B 1 196 ? 2.191   3.250   13.592  1.00 53.92 ? 359 ARG B NE  1 
ATOM   3216 C CZ  . ARG B 1 196 ? 1.872   1.988   13.272  1.00 55.86 ? 359 ARG B CZ  1 
ATOM   3217 N NH1 . ARG B 1 196 ? 1.627   1.645   12.010  1.00 55.19 ? 359 ARG B NH1 1 
ATOM   3218 N NH2 . ARG B 1 196 ? 1.824   1.051   14.220  1.00 56.08 ? 359 ARG B NH2 1 
ATOM   3219 N N   . ASP B 1 197 ? 5.453   6.616   9.753   1.00 43.27 ? 360 ASP B N   1 
ATOM   3220 C CA  . ASP B 1 197 ? 5.098   7.584   8.719   1.00 44.86 ? 360 ASP B CA  1 
ATOM   3221 C C   . ASP B 1 197 ? 5.936   7.438   7.455   1.00 46.33 ? 360 ASP B C   1 
ATOM   3222 O O   . ASP B 1 197 ? 5.417   7.651   6.349   1.00 46.55 ? 360 ASP B O   1 
ATOM   3223 C CB  . ASP B 1 197 ? 5.214   9.010   9.252   1.00 44.91 ? 360 ASP B CB  1 
ATOM   3224 C CG  . ASP B 1 197 ? 4.122   9.353   10.266  1.00 46.25 ? 360 ASP B CG  1 
ATOM   3225 O OD1 . ASP B 1 197 ? 4.264   10.396  10.937  1.00 46.06 ? 360 ASP B OD1 1 
ATOM   3226 O OD2 . ASP B 1 197 ? 3.135   8.585   10.405  1.00 47.09 ? 360 ASP B OD2 1 
ATOM   3227 N N   . LEU B 1 198 ? 7.222   7.095   7.612   1.00 47.42 ? 361 LEU B N   1 
ATOM   3228 C CA  . LEU B 1 198 ? 8.105   6.826   6.478   1.00 48.58 ? 361 LEU B CA  1 
ATOM   3229 C C   . LEU B 1 198 ? 7.643   5.607   5.716   1.00 49.92 ? 361 LEU B C   1 
ATOM   3230 O O   . LEU B 1 198 ? 7.782   5.532   4.502   1.00 49.83 ? 361 LEU B O   1 
ATOM   3231 C CB  . LEU B 1 198 ? 9.530   6.563   6.941   1.00 47.80 ? 361 LEU B CB  1 
ATOM   3232 C CG  . LEU B 1 198 ? 10.426  7.760   7.223   1.00 47.87 ? 361 LEU B CG  1 
ATOM   3233 C CD1 . LEU B 1 198 ? 11.827  7.239   7.518   1.00 46.90 ? 361 LEU B CD1 1 
ATOM   3234 C CD2 . LEU B 1 198 ? 10.453  8.741   6.049   1.00 46.55 ? 361 LEU B CD2 1 
ATOM   3235 N N   . ALA B 1 199 ? 7.129   4.631   6.448   1.00 52.06 ? 362 ALA B N   1 
ATOM   3236 C CA  . ALA B 1 199 ? 6.597   3.423   5.841   1.00 54.59 ? 362 ALA B CA  1 
ATOM   3237 C C   . ALA B 1 199 ? 5.245   3.733   5.169   1.00 56.59 ? 362 ALA B C   1 
ATOM   3238 O O   . ALA B 1 199 ? 5.022   3.341   4.018   1.00 57.15 ? 362 ALA B O   1 
ATOM   3239 C CB  . ALA B 1 199 ? 6.460   2.319   6.877   1.00 53.98 ? 362 ALA B CB  1 
ATOM   3240 N N   . GLU B 1 200 ? 4.355   4.451   5.867   1.00 58.81 ? 363 GLU B N   1 
ATOM   3241 C CA  . GLU B 1 200 ? 3.050   4.815   5.286   1.00 60.71 ? 363 GLU B CA  1 
ATOM   3242 C C   . GLU B 1 200 ? 3.164   5.995   4.307   1.00 62.33 ? 363 GLU B C   1 
ATOM   3243 O O   . GLU B 1 200 ? 2.360   6.931   4.348   1.00 62.66 ? 363 GLU B O   1 
ATOM   3244 C CB  . GLU B 1 200 ? 1.996   5.065   6.371   1.00 60.47 ? 363 GLU B CB  1 
ATOM   3245 C CG  . GLU B 1 200 ? 1.937   3.958   7.422   1.00 60.63 ? 363 GLU B CG  1 
ATOM   3246 C CD  . GLU B 1 200 ? 0.934   4.224   8.544   1.00 61.14 ? 363 GLU B CD  1 
ATOM   3247 O OE1 . GLU B 1 200 ? 0.553   3.242   9.224   1.00 59.94 ? 363 GLU B OE1 1 
ATOM   3248 O OE2 . GLU B 1 200 ? 0.527   5.396   8.754   1.00 60.18 ? 363 GLU B OE2 1 
ATOM   3249 N N   . LYS B 1 201 ? 4.197   5.943   3.458   1.00 64.30 ? 364 LYS B N   1 
ATOM   3250 C CA  . LYS B 1 201 ? 4.296   6.723   2.203   1.00 66.13 ? 364 LYS B CA  1 
ATOM   3251 C C   . LYS B 1 201 ? 5.305   6.044   1.258   1.00 67.35 ? 364 LYS B C   1 
ATOM   3252 O O   . LYS B 1 201 ? 6.381   6.581   0.966   1.00 67.59 ? 364 LYS B O   1 
ATOM   3253 C CB  . LYS B 1 201 ? 4.596   8.222   2.432   1.00 65.97 ? 364 LYS B CB  1 
ATOM   3254 C CG  . LYS B 1 201 ? 5.937   8.571   3.086   1.00 66.54 ? 364 LYS B CG  1 
ATOM   3255 C CD  . LYS B 1 201 ? 6.069   10.077  3.307   1.00 66.86 ? 364 LYS B CD  1 
ATOM   3256 C CE  . LYS B 1 201 ? 7.009   10.387  4.461   1.00 67.24 ? 364 LYS B CE  1 
ATOM   3257 N NZ  . LYS B 1 201 ? 6.583   11.580  5.263   1.00 66.54 ? 364 LYS B NZ  1 
ATOM   3258 N N   . LYS B 1 202 ? 4.939   4.846   0.797   1.00 68.87 ? 365 LYS B N   1 
ATOM   3259 C CA  . LYS B 1 202 ? 5.802   4.025   -0.070  1.00 70.00 ? 365 LYS B CA  1 
ATOM   3260 C C   . LYS B 1 202 ? 5.030   3.349   -1.211  1.00 70.38 ? 365 LYS B C   1 
ATOM   3261 O O   . LYS B 1 202 ? 4.368   2.324   -1.015  1.00 70.83 ? 365 LYS B O   1 
ATOM   3262 C CB  . LYS B 1 202 ? 6.579   2.981   0.758   1.00 70.33 ? 365 LYS B CB  1 
ATOM   3263 C CG  . LYS B 1 202 ? 7.772   3.561   1.506   1.00 71.17 ? 365 LYS B CG  1 
ATOM   3264 C CD  . LYS B 1 202 ? 8.698   4.265   0.514   1.00 72.62 ? 365 LYS B CD  1 
ATOM   3265 C CE  . LYS B 1 202 ? 9.341   5.513   1.100   1.00 72.88 ? 365 LYS B CE  1 
ATOM   3266 N NZ  . LYS B 1 202 ? 9.865   6.359   -0.007  1.00 72.84 ? 365 LYS B NZ  1 
ATOM   3267 N N   . SER C 1 2   ? 7.002   8.233   31.959  1.00 44.47 ? 41  SER C N   1 
ATOM   3268 C CA  . SER C 1 2   ? 6.997   6.814   32.506  1.00 44.05 ? 41  SER C CA  1 
ATOM   3269 C C   . SER C 1 2   ? 8.396   6.204   32.731  1.00 43.52 ? 41  SER C C   1 
ATOM   3270 O O   . SER C 1 2   ? 8.605   4.984   32.547  1.00 43.70 ? 41  SER C O   1 
ATOM   3271 C CB  . SER C 1 2   ? 6.168   5.874   31.610  1.00 44.27 ? 41  SER C CB  1 
ATOM   3272 O OG  . SER C 1 2   ? 6.894   5.482   30.455  1.00 44.02 ? 41  SER C OG  1 
ATOM   3273 N N   . HIS C 1 3   ? 9.350   7.054   33.100  1.00 41.93 ? 42  HIS C N   1 
ATOM   3274 C CA  . HIS C 1 3   ? 10.649  6.615   33.583  1.00 41.19 ? 42  HIS C CA  1 
ATOM   3275 C C   . HIS C 1 3   ? 10.822  7.487   34.815  1.00 40.70 ? 42  HIS C C   1 
ATOM   3276 O O   . HIS C 1 3   ? 10.229  8.563   34.877  1.00 40.97 ? 42  HIS C O   1 
ATOM   3277 C CB  . HIS C 1 3   ? 11.753  6.869   32.526  1.00 40.55 ? 42  HIS C CB  1 
ATOM   3278 C CG  . HIS C 1 3   ? 13.100  6.282   32.864  1.00 40.31 ? 42  HIS C CG  1 
ATOM   3279 N ND1 . HIS C 1 3   ? 14.020  6.925   33.672  1.00 38.70 ? 42  HIS C ND1 1 
ATOM   3280 C CD2 . HIS C 1 3   ? 13.698  5.130   32.466  1.00 39.26 ? 42  HIS C CD2 1 
ATOM   3281 C CE1 . HIS C 1 3   ? 15.118  6.191   33.766  1.00 37.19 ? 42  HIS C CE1 1 
ATOM   3282 N NE2 . HIS C 1 3   ? 14.942  5.089   33.064  1.00 37.23 ? 42  HIS C NE2 1 
ATOM   3283 N N   . GLY C 1 4   ? 11.572  7.010   35.804  1.00 39.84 ? 43  GLY C N   1 
ATOM   3284 C CA  . GLY C 1 4   ? 11.906  7.795   36.981  1.00 39.70 ? 43  GLY C CA  1 
ATOM   3285 C C   . GLY C 1 4   ? 12.862  8.938   36.637  1.00 39.77 ? 43  GLY C C   1 
ATOM   3286 O O   . GLY C 1 4   ? 13.362  9.039   35.505  1.00 38.80 ? 43  GLY C O   1 
ATOM   3287 N N   . ARG C 1 5   ? 13.095  9.815   37.620  1.00 39.26 ? 44  ARG C N   1 
ATOM   3288 C CA  . ARG C 1 5   ? 13.999  10.947  37.447  1.00 38.62 ? 44  ARG C CA  1 
ATOM   3289 C C   . ARG C 1 5   ? 15.408  10.496  37.060  1.00 37.04 ? 44  ARG C C   1 
ATOM   3290 O O   . ARG C 1 5   ? 15.982  11.040  36.134  1.00 37.48 ? 44  ARG C O   1 
ATOM   3291 C CB  . ARG C 1 5   ? 14.063  11.787  38.721  1.00 39.93 ? 44  ARG C CB  1 
ATOM   3292 C CG  . ARG C 1 5   ? 14.301  13.278  38.473  1.00 43.18 ? 44  ARG C CG  1 
ATOM   3293 C CD  . ARG C 1 5   ? 14.575  13.996  39.805  1.00 48.51 ? 44  ARG C CD  1 
ATOM   3294 N NE  . ARG C 1 5   ? 15.845  13.527  40.366  1.00 52.87 ? 44  ARG C NE  1 
ATOM   3295 C CZ  . ARG C 1 5   ? 17.022  14.135  40.203  1.00 53.49 ? 44  ARG C CZ  1 
ATOM   3296 N NH1 . ARG C 1 5   ? 17.101  15.272  39.525  1.00 52.39 ? 44  ARG C NH1 1 
ATOM   3297 N NH2 . ARG C 1 5   ? 18.124  13.602  40.729  1.00 53.78 ? 44  ARG C NH2 1 
ATOM   3298 N N   . SER C 1 6   ? 15.961  9.522   37.784  1.00 34.99 ? 45  SER C N   1 
ATOM   3299 C CA  . SER C 1 6   ? 17.340  9.088   37.584  1.00 33.36 ? 45  SER C CA  1 
ATOM   3300 C C   . SER C 1 6   ? 17.457  7.993   36.513  1.00 30.88 ? 45  SER C C   1 
ATOM   3301 O O   . SER C 1 6   ? 16.494  7.273   36.231  1.00 30.11 ? 45  SER C O   1 
ATOM   3302 C CB  . SER C 1 6   ? 17.919  8.563   38.887  1.00 33.05 ? 45  SER C CB  1 
ATOM   3303 O OG  . SER C 1 6   ? 18.090  9.633   39.792  1.00 38.93 ? 45  SER C OG  1 
ATOM   3304 N N   . ARG C 1 7   ? 18.646  7.853   35.953  1.00 27.53 ? 46  ARG C N   1 
ATOM   3305 C CA  . ARG C 1 7   ? 18.913  6.717   35.094  1.00 25.62 ? 46  ARG C CA  1 
ATOM   3306 C C   . ARG C 1 7   ? 18.995  5.427   35.923  1.00 24.63 ? 46  ARG C C   1 
ATOM   3307 O O   . ARG C 1 7   ? 19.380  5.461   37.077  1.00 23.71 ? 46  ARG C O   1 
ATOM   3308 C CB  . ARG C 1 7   ? 20.196  6.940   34.307  1.00 24.61 ? 46  ARG C CB  1 
ATOM   3309 C CG  . ARG C 1 7   ? 21.449  7.068   35.088  1.00 23.45 ? 46  ARG C CG  1 
ATOM   3310 C CD  . ARG C 1 7   ? 22.464  7.753   34.188  1.00 22.89 ? 46  ARG C CD  1 
ATOM   3311 N NE  . ARG C 1 7   ? 22.403  7.146   32.841  1.00 19.71 ? 46  ARG C NE  1 
ATOM   3312 C CZ  . ARG C 1 7   ? 22.532  7.811   31.700  1.00 20.57 ? 46  ARG C CZ  1 
ATOM   3313 N NH1 . ARG C 1 7   ? 22.794  9.114   31.724  1.00 18.14 ? 46  ARG C NH1 1 
ATOM   3314 N NH2 . ARG C 1 7   ? 22.418  7.178   30.516  1.00 17.29 ? 46  ARG C NH2 1 
ATOM   3315 N N   . PHE C 1 8   ? 18.647  4.294   35.313  1.00 23.75 ? 47  PHE C N   1 
ATOM   3316 C CA  . PHE C 1 8   ? 18.752  2.992   35.984  1.00 21.97 ? 47  PHE C CA  1 
ATOM   3317 C C   . PHE C 1 8   ? 20.181  2.432   35.884  1.00 21.38 ? 47  PHE C C   1 
ATOM   3318 O O   . PHE C 1 8   ? 20.690  1.758   36.806  1.00 19.91 ? 47  PHE C O   1 
ATOM   3319 C CB  . PHE C 1 8   ? 17.749  2.054   35.327  1.00 21.64 ? 47  PHE C CB  1 
ATOM   3320 C CG  . PHE C 1 8   ? 17.484  0.832   36.107  1.00 23.89 ? 47  PHE C CG  1 
ATOM   3321 C CD1 . PHE C 1 8   ? 16.718  0.899   37.273  1.00 23.05 ? 47  PHE C CD1 1 
ATOM   3322 C CD2 . PHE C 1 8   ? 17.956  -0.424  35.658  1.00 26.32 ? 47  PHE C CD2 1 
ATOM   3323 C CE1 . PHE C 1 8   ? 16.478  -0.258  38.032  1.00 25.35 ? 47  PHE C CE1 1 
ATOM   3324 C CE2 . PHE C 1 8   ? 17.709  -1.583  36.405  1.00 26.28 ? 47  PHE C CE2 1 
ATOM   3325 C CZ  . PHE C 1 8   ? 16.990  -1.493  37.593  1.00 27.32 ? 47  PHE C CZ  1 
ATOM   3326 N N   . VAL C 1 9   ? 20.834  2.711   34.750  1.00 20.11 ? 48  VAL C N   1 
ATOM   3327 C CA  . VAL C 1 9   ? 22.181  2.249   34.495  1.00 18.43 ? 48  VAL C CA  1 
ATOM   3328 C C   . VAL C 1 9   ? 22.998  3.488   34.145  1.00 18.37 ? 48  VAL C C   1 
ATOM   3329 O O   . VAL C 1 9   ? 22.587  4.245   33.292  1.00 17.21 ? 48  VAL C O   1 
ATOM   3330 C CB  . VAL C 1 9   ? 22.211  1.226   33.281  1.00 18.30 ? 48  VAL C CB  1 
ATOM   3331 C CG1 . VAL C 1 9   ? 23.629  0.856   32.922  1.00 16.92 ? 48  VAL C CG1 1 
ATOM   3332 C CG2 . VAL C 1 9   ? 21.408  -0.051  33.589  1.00 19.38 ? 48  VAL C CG2 1 
ATOM   3333 N N   . LYS C 1 10  ? 24.107  3.698   34.831  1.00 18.09 ? 49  LYS C N   1 
ATOM   3334 C CA  . LYS C 1 10  ? 24.982  4.812   34.569  1.00 21.33 ? 49  LYS C CA  1 
ATOM   3335 C C   . LYS C 1 10  ? 25.823  4.593   33.307  1.00 22.36 ? 49  LYS C C   1 
ATOM   3336 O O   . LYS C 1 10  ? 25.998  3.456   32.844  1.00 21.15 ? 49  LYS C O   1 
ATOM   3337 C CB  . LYS C 1 10  ? 25.931  5.035   35.768  1.00 21.34 ? 49  LYS C CB  1 
ATOM   3338 C CG  . LYS C 1 10  ? 25.215  5.295   37.057  1.00 26.72 ? 49  LYS C CG  1 
ATOM   3339 C CD  . LYS C 1 10  ? 26.064  6.111   37.974  1.00 32.84 ? 49  LYS C CD  1 
ATOM   3340 C CE  . LYS C 1 10  ? 25.734  5.743   39.411  1.00 40.49 ? 49  LYS C CE  1 
ATOM   3341 N NZ  . LYS C 1 10  ? 26.436  4.474   39.816  1.00 42.00 ? 49  LYS C NZ  1 
ATOM   3342 N N   . LYS C 1 11  ? 26.389  5.683   32.783  1.00 23.87 ? 50  LYS C N   1 
ATOM   3343 C CA  . LYS C 1 11  ? 27.156  5.575   31.535  1.00 25.38 ? 50  LYS C CA  1 
ATOM   3344 C C   . LYS C 1 11  ? 28.325  4.636   31.696  1.00 25.72 ? 50  LYS C C   1 
ATOM   3345 O O   . LYS C 1 11  ? 28.731  4.004   30.725  1.00 28.00 ? 50  LYS C O   1 
ATOM   3346 C CB  . LYS C 1 11  ? 27.667  6.928   31.002  1.00 24.12 ? 50  LYS C CB  1 
ATOM   3347 C CG  . LYS C 1 11  ? 26.619  8.021   30.833  1.00 26.96 ? 50  LYS C CG  1 
ATOM   3348 C CD  . LYS C 1 11  ? 25.650  7.684   29.754  1.00 26.33 ? 50  LYS C CD  1 
ATOM   3349 C CE  . LYS C 1 11  ? 26.070  8.230   28.412  1.00 24.20 ? 50  LYS C CE  1 
ATOM   3350 N NZ  . LYS C 1 11  ? 25.190  7.548   27.422  1.00 17.66 ? 50  LYS C NZ  1 
ATOM   3351 N N   . ASP C 1 12  ? 28.881  4.560   32.898  1.00 26.07 ? 51  ASP C N   1 
ATOM   3352 C CA  . ASP C 1 12  ? 29.983  3.629   33.162  1.00 26.74 ? 51  ASP C CA  1 
ATOM   3353 C C   . ASP C 1 12  ? 29.516  2.165   33.390  1.00 26.41 ? 51  ASP C C   1 
ATOM   3354 O O   . ASP C 1 12  ? 30.320  1.342   33.791  1.00 25.67 ? 51  ASP C O   1 
ATOM   3355 C CB  . ASP C 1 12  ? 30.809  4.099   34.381  1.00 26.27 ? 51  ASP C CB  1 
ATOM   3356 C CG  . ASP C 1 12  ? 30.057  3.961   35.710  1.00 29.50 ? 51  ASP C CG  1 
ATOM   3357 O OD1 . ASP C 1 12  ? 28.917  3.422   35.767  1.00 31.81 ? 51  ASP C OD1 1 
ATOM   3358 O OD2 . ASP C 1 12  ? 30.598  4.383   36.745  1.00 32.58 ? 51  ASP C OD2 1 
ATOM   3359 N N   . GLY C 1 13  ? 28.231  1.863   33.190  1.00 25.46 ? 52  GLY C N   1 
ATOM   3360 C CA  . GLY C 1 13  ? 27.740  0.499   33.369  1.00 26.47 ? 52  GLY C CA  1 
ATOM   3361 C C   . GLY C 1 13  ? 27.255  0.095   34.758  1.00 26.48 ? 52  GLY C C   1 
ATOM   3362 O O   . GLY C 1 13  ? 26.529  -0.895  34.917  1.00 25.92 ? 52  GLY C O   1 
ATOM   3363 N N   . HIS C 1 14  ? 27.662  0.825   35.776  1.00 26.28 ? 53  HIS C N   1 
ATOM   3364 C CA  . HIS C 1 14  ? 27.146  0.561   37.118  1.00 27.39 ? 53  HIS C CA  1 
ATOM   3365 C C   . HIS C 1 14  ? 25.647  0.860   37.201  1.00 25.98 ? 53  HIS C C   1 
ATOM   3366 O O   . HIS C 1 14  ? 25.163  1.817   36.601  1.00 24.72 ? 53  HIS C O   1 
ATOM   3367 C CB  . HIS C 1 14  ? 27.921  1.372   38.143  1.00 28.44 ? 53  HIS C CB  1 
ATOM   3368 C CG  . HIS C 1 14  ? 29.343  0.950   38.264  1.00 33.10 ? 53  HIS C CG  1 
ATOM   3369 N ND1 . HIS C 1 14  ? 29.730  -0.145  39.006  1.00 37.20 ? 53  HIS C ND1 1 
ATOM   3370 C CD2 . HIS C 1 14  ? 30.473  1.453   37.715  1.00 38.34 ? 53  HIS C CD2 1 
ATOM   3371 C CE1 . HIS C 1 14  ? 31.041  -0.287  38.923  1.00 41.79 ? 53  HIS C CE1 1 
ATOM   3372 N NE2 . HIS C 1 14  ? 31.517  0.670   38.143  1.00 40.79 ? 53  HIS C NE2 1 
ATOM   3373 N N   . CYS C 1 15  ? 24.911  0.032   37.930  1.00 25.68 ? 54  CYS C N   1 
ATOM   3374 C CA  . CYS C 1 15  ? 23.479  0.257   38.028  1.00 26.72 ? 54  CYS C CA  1 
ATOM   3375 C C   . CYS C 1 15  ? 23.257  1.279   39.122  1.00 25.45 ? 54  CYS C C   1 
ATOM   3376 O O   . CYS C 1 15  ? 23.969  1.307   40.083  1.00 26.08 ? 54  CYS C O   1 
ATOM   3377 C CB  . CYS C 1 15  ? 22.725  -1.035  38.322  1.00 26.85 ? 54  CYS C CB  1 
ATOM   3378 S SG  . CYS C 1 15  ? 22.838  -1.599  40.049  1.00 36.35 ? 54  CYS C SG  1 
ATOM   3379 N N   . ASN C 1 16  ? 22.255  2.109   38.967  1.00 25.30 ? 55  ASN C N   1 
ATOM   3380 C CA  . ASN C 1 16  ? 21.954  3.153   39.943  1.00 25.23 ? 55  ASN C CA  1 
ATOM   3381 C C   . ASN C 1 16  ? 20.872  2.691   40.957  1.00 25.04 ? 55  ASN C C   1 
ATOM   3382 O O   . ASN C 1 16  ? 19.808  3.325   41.081  1.00 24.15 ? 55  ASN C O   1 
ATOM   3383 C CB  . ASN C 1 16  ? 21.429  4.367   39.169  1.00 25.18 ? 55  ASN C CB  1 
ATOM   3384 C CG  . ASN C 1 16  ? 21.391  5.623   40.021  1.00 26.51 ? 55  ASN C CG  1 
ATOM   3385 O OD1 . ASN C 1 16  ? 22.094  5.722   41.020  1.00 27.04 ? 55  ASN C OD1 1 
ATOM   3386 N ND2 . ASN C 1 16  ? 20.563  6.582   39.631  1.00 25.10 ? 55  ASN C ND2 1 
ATOM   3387 N N   . VAL C 1 17  ? 21.165  1.611   41.668  1.00 24.87 ? 56  VAL C N   1 
ATOM   3388 C CA  . VAL C 1 17  ? 20.191  0.897   42.491  1.00 26.01 ? 56  VAL C CA  1 
ATOM   3389 C C   . VAL C 1 17  ? 20.815  0.578   43.829  1.00 26.77 ? 56  VAL C C   1 
ATOM   3390 O O   . VAL C 1 17  ? 21.981  0.141   43.884  1.00 25.42 ? 56  VAL C O   1 
ATOM   3391 C CB  . VAL C 1 17  ? 19.743  -0.431  41.832  1.00 27.21 ? 56  VAL C CB  1 
ATOM   3392 C CG1 . VAL C 1 17  ? 18.591  -1.068  42.613  1.00 26.25 ? 56  VAL C CG1 1 
ATOM   3393 C CG2 . VAL C 1 17  ? 19.301  -0.227  40.376  1.00 25.36 ? 56  VAL C CG2 1 
ATOM   3394 N N   . GLN C 1 18  ? 20.082  0.826   44.925  1.00 26.41 ? 57  GLN C N   1 
ATOM   3395 C CA  . GLN C 1 18  ? 20.571  0.337   46.217  1.00 27.10 ? 57  GLN C CA  1 
ATOM   3396 C C   . GLN C 1 18  ? 19.652  -0.755  46.736  1.00 25.83 ? 57  GLN C C   1 
ATOM   3397 O O   . GLN C 1 18  ? 18.429  -0.618  46.663  1.00 25.63 ? 57  GLN C O   1 
ATOM   3398 C CB  . GLN C 1 18  ? 20.772  1.459   47.249  1.00 27.44 ? 57  GLN C CB  1 
ATOM   3399 C CG  . GLN C 1 18  ? 21.444  2.810   46.754  1.00 34.58 ? 57  GLN C CG  1 
ATOM   3400 C CD  . GLN C 1 18  ? 22.776  2.727   45.952  1.00 41.82 ? 57  GLN C CD  1 
ATOM   3401 O OE1 . GLN C 1 18  ? 23.646  1.868   46.216  1.00 44.86 ? 57  GLN C OE1 1 
ATOM   3402 N NE2 . GLN C 1 18  ? 22.963  3.688   44.999  1.00 43.54 ? 57  GLN C NE2 1 
ATOM   3403 N N   . PHE C 1 19  ? 20.235  -1.849  47.212  1.00 25.48 ? 58  PHE C N   1 
ATOM   3404 C CA  . PHE C 1 19  ? 19.468  -2.973  47.764  1.00 26.28 ? 58  PHE C CA  1 
ATOM   3405 C C   . PHE C 1 19  ? 19.271  -2.798  49.273  1.00 26.32 ? 58  PHE C C   1 
ATOM   3406 O O   . PHE C 1 19  ? 20.235  -2.591  49.990  1.00 25.73 ? 58  PHE C O   1 
ATOM   3407 C CB  . PHE C 1 19  ? 20.157  -4.326  47.523  1.00 26.31 ? 58  PHE C CB  1 
ATOM   3408 C CG  . PHE C 1 19  ? 20.227  -4.740  46.072  1.00 28.29 ? 58  PHE C CG  1 
ATOM   3409 C CD1 . PHE C 1 19  ? 19.578  -4.018  45.082  1.00 31.25 ? 58  PHE C CD1 1 
ATOM   3410 C CD2 . PHE C 1 19  ? 20.932  -5.871  45.699  1.00 31.23 ? 58  PHE C CD2 1 
ATOM   3411 C CE1 . PHE C 1 19  ? 19.636  -4.422  43.736  1.00 34.50 ? 58  PHE C CE1 1 
ATOM   3412 C CE2 . PHE C 1 19  ? 20.981  -6.278  44.360  1.00 30.00 ? 58  PHE C CE2 1 
ATOM   3413 C CZ  . PHE C 1 19  ? 20.334  -5.559  43.386  1.00 30.70 ? 58  PHE C CZ  1 
ATOM   3414 N N   . ILE C 1 20  ? 18.039  -2.880  49.754  1.00 26.02 ? 59  ILE C N   1 
ATOM   3415 C CA  . ILE C 1 20  ? 17.836  -2.711  51.201  1.00 27.13 ? 59  ILE C CA  1 
ATOM   3416 C C   . ILE C 1 20  ? 17.127  -3.959  51.732  1.00 28.46 ? 59  ILE C C   1 
ATOM   3417 O O   . ILE C 1 20  ? 16.511  -4.690  50.960  1.00 28.58 ? 59  ILE C O   1 
ATOM   3418 C CB  . ILE C 1 20  ? 17.081  -1.363  51.596  1.00 25.62 ? 59  ILE C CB  1 
ATOM   3419 C CG1 . ILE C 1 20  ? 15.628  -1.353  51.112  1.00 24.80 ? 59  ILE C CG1 1 
ATOM   3420 C CG2 . ILE C 1 20  ? 17.829  -0.125  51.053  1.00 26.82 ? 59  ILE C CG2 1 
ATOM   3421 C CD1 . ILE C 1 20  ? 14.780  -0.246  51.715  1.00 26.57 ? 59  ILE C CD1 1 
ATOM   3422 N N   . ASN C 1 21  ? 17.252  -4.211  53.037  1.00 30.68 ? 60  ASN C N   1 
ATOM   3423 C CA  . ASN C 1 21  ? 16.574  -5.309  53.704  1.00 32.44 ? 60  ASN C CA  1 
ATOM   3424 C C   . ASN C 1 21  ? 16.905  -6.675  53.104  1.00 34.73 ? 60  ASN C C   1 
ATOM   3425 O O   . ASN C 1 21  ? 16.044  -7.534  52.965  1.00 34.22 ? 60  ASN C O   1 
ATOM   3426 C CB  . ASN C 1 21  ? 15.073  -5.037  53.719  1.00 32.66 ? 60  ASN C CB  1 
ATOM   3427 C CG  . ASN C 1 21  ? 14.734  -3.858  54.591  1.00 31.70 ? 60  ASN C CG  1 
ATOM   3428 O OD1 . ASN C 1 21  ? 15.398  -3.646  55.593  1.00 37.42 ? 60  ASN C OD1 1 
ATOM   3429 N ND2 . ASN C 1 21  ? 13.758  -3.068  54.205  1.00 27.41 ? 60  ASN C ND2 1 
ATOM   3430 N N   . VAL C 1 22  ? 18.182  -6.853  52.779  1.00 37.10 ? 61  VAL C N   1 
ATOM   3431 C CA  . VAL C 1 22  ? 18.673  -8.050  52.114  1.00 40.09 ? 61  VAL C CA  1 
ATOM   3432 C C   . VAL C 1 22  ? 18.866  -9.176  53.128  1.00 42.57 ? 61  VAL C C   1 
ATOM   3433 O O   . VAL C 1 22  ? 18.879  -10.355 52.757  1.00 43.66 ? 61  VAL C O   1 
ATOM   3434 C CB  . VAL C 1 22  ? 19.982  -7.706  51.332  1.00 39.68 ? 61  VAL C CB  1 
ATOM   3435 C CG1 . VAL C 1 22  ? 20.968  -8.855  51.308  1.00 41.57 ? 61  VAL C CG1 1 
ATOM   3436 C CG2 . VAL C 1 22  ? 19.647  -7.222  49.930  1.00 38.91 ? 61  VAL C CG2 1 
ATOM   3437 N N   . GLY C 1 23  ? 18.992  -8.814  54.405  1.00 44.46 ? 62  GLY C N   1 
ATOM   3438 C CA  . GLY C 1 23  ? 19.256  -9.787  55.466  1.00 46.99 ? 62  GLY C CA  1 
ATOM   3439 C C   . GLY C 1 23  ? 20.725  -10.187 55.529  1.00 48.50 ? 62  GLY C C   1 
ATOM   3440 O O   . GLY C 1 23  ? 21.616  -9.432  55.090  1.00 48.46 ? 62  GLY C O   1 
ATOM   3441 N N   . GLU C 1 24  ? 20.986  -11.381 56.061  1.00 49.90 ? 63  GLU C N   1 
ATOM   3442 C CA  . GLU C 1 24  ? 22.373  -11.814 56.296  1.00 50.98 ? 63  GLU C CA  1 
ATOM   3443 C C   . GLU C 1 24  ? 23.053  -12.186 54.976  1.00 51.13 ? 63  GLU C C   1 
ATOM   3444 O O   . GLU C 1 24  ? 22.511  -12.985 54.204  1.00 51.15 ? 63  GLU C O   1 
ATOM   3445 C CB  . GLU C 1 24  ? 22.433  -12.984 57.326  1.00 51.09 ? 63  GLU C CB  1 
ATOM   3446 N N   . LYS C 1 25  ? 24.216  -11.572 54.725  1.00 51.66 ? 64  LYS C N   1 
ATOM   3447 C CA  . LYS C 1 25  ? 25.032  -11.819 53.517  1.00 52.08 ? 64  LYS C CA  1 
ATOM   3448 C C   . LYS C 1 25  ? 25.242  -13.314 53.197  1.00 52.30 ? 64  LYS C C   1 
ATOM   3449 O O   . LYS C 1 25  ? 26.175  -13.949 53.714  1.00 52.36 ? 64  LYS C O   1 
ATOM   3450 C CB  . LYS C 1 25  ? 26.383  -11.087 53.622  1.00 52.52 ? 64  LYS C CB  1 
ATOM   3451 N N   . ARG C 1 26  ? 24.375  -13.860 52.336  1.00 51.91 ? 189 ARG C N   1 
ATOM   3452 C CA  . ARG C 1 26  ? 24.359  -15.309 52.033  1.00 51.50 ? 189 ARG C CA  1 
ATOM   3453 C C   . ARG C 1 26  ? 25.465  -15.737 51.041  1.00 51.09 ? 189 ARG C C   1 
ATOM   3454 O O   . ARG C 1 26  ? 26.023  -14.902 50.301  1.00 51.02 ? 189 ARG C O   1 
ATOM   3455 C CB  . ARG C 1 26  ? 22.968  -15.746 51.531  1.00 51.48 ? 189 ARG C CB  1 
ATOM   3456 N N   . ASN C 1 27  ? 25.784  -17.037 51.035  1.00 49.90 ? 190 ASN C N   1 
ATOM   3457 C CA  . ASN C 1 27  ? 26.753  -17.577 50.078  1.00 48.60 ? 190 ASN C CA  1 
ATOM   3458 C C   . ASN C 1 27  ? 26.123  -17.776 48.680  1.00 47.19 ? 190 ASN C C   1 
ATOM   3459 O O   . ASN C 1 27  ? 26.803  -17.588 47.653  1.00 47.11 ? 190 ASN C O   1 
ATOM   3460 C CB  . ASN C 1 27  ? 27.428  -18.883 50.618  1.00 49.57 ? 190 ASN C CB  1 
ATOM   3461 N N   . GLU C 1 28  ? 24.835  -18.141 48.642  1.00 44.59 ? 191 GLU C N   1 
ATOM   3462 C CA  . GLU C 1 28  ? 24.069  -18.108 47.387  1.00 41.92 ? 191 GLU C CA  1 
ATOM   3463 C C   . GLU C 1 28  ? 23.240  -16.829 47.325  1.00 39.42 ? 191 GLU C C   1 
ATOM   3464 O O   . GLU C 1 28  ? 22.377  -16.628 48.178  1.00 39.27 ? 191 GLU C O   1 
ATOM   3465 C CB  . GLU C 1 28  ? 23.166  -19.331 47.239  1.00 42.83 ? 191 GLU C CB  1 
ATOM   3466 C CG  . GLU C 1 28  ? 22.614  -19.470 45.819  1.00 45.34 ? 191 GLU C CG  1 
ATOM   3467 C CD  . GLU C 1 28  ? 23.700  -19.219 44.736  1.00 48.99 ? 191 GLU C CD  1 
ATOM   3468 O OE1 . GLU C 1 28  ? 24.730  -19.947 44.747  1.00 53.51 ? 191 GLU C OE1 1 
ATOM   3469 O OE2 . GLU C 1 28  ? 23.535  -18.305 43.884  1.00 45.54 ? 191 GLU C OE2 1 
ATOM   3470 N N   . THR C 1 29  ? 23.514  -15.958 46.352  1.00 35.10 ? 192 THR C N   1 
ATOM   3471 C CA  . THR C 1 29  ? 22.799  -14.694 46.306  1.00 33.17 ? 192 THR C CA  1 
ATOM   3472 C C   . THR C 1 29  ? 21.691  -14.699 45.272  1.00 29.89 ? 192 THR C C   1 
ATOM   3473 O O   . THR C 1 29  ? 20.886  -13.770 45.215  1.00 29.20 ? 192 THR C O   1 
ATOM   3474 C CB  . THR C 1 29  ? 23.727  -13.431 46.159  1.00 33.75 ? 192 THR C CB  1 
ATOM   3475 O OG1 . THR C 1 29  ? 24.346  -13.423 44.862  1.00 34.90 ? 192 THR C OG1 1 
ATOM   3476 C CG2 . THR C 1 29  ? 24.798  -13.414 47.283  1.00 34.67 ? 192 THR C CG2 1 
ATOM   3477 N N   . LEU C 1 30  ? 21.615  -15.755 44.473  1.00 26.40 ? 193 LEU C N   1 
ATOM   3478 C CA  . LEU C 1 30  ? 20.467  -15.894 43.571  1.00 23.78 ? 193 LEU C CA  1 
ATOM   3479 C C   . LEU C 1 30  ? 19.277  -16.528 44.308  1.00 22.41 ? 193 LEU C C   1 
ATOM   3480 O O   . LEU C 1 30  ? 19.416  -17.528 44.971  1.00 21.20 ? 193 LEU C O   1 
ATOM   3481 C CB  . LEU C 1 30  ? 20.816  -16.719 42.309  1.00 23.00 ? 193 LEU C CB  1 
ATOM   3482 C CG  . LEU C 1 30  ? 21.920  -16.243 41.376  1.00 21.23 ? 193 LEU C CG  1 
ATOM   3483 C CD1 . LEU C 1 30  ? 22.013  -17.206 40.111  1.00 22.44 ? 193 LEU C CD1 1 
ATOM   3484 C CD2 . LEU C 1 30  ? 21.577  -14.846 40.921  1.00 20.42 ? 193 LEU C CD2 1 
ATOM   3485 N N   . VAL C 1 31  ? 18.092  -15.967 44.157  1.00 21.67 ? 194 VAL C N   1 
ATOM   3486 C CA  . VAL C 1 31  ? 16.951  -16.437 44.977  1.00 20.92 ? 194 VAL C CA  1 
ATOM   3487 C C   . VAL C 1 31  ? 15.639  -16.426 44.163  1.00 18.87 ? 194 VAL C C   1 
ATOM   3488 O O   . VAL C 1 31  ? 15.451  -15.546 43.341  1.00 19.32 ? 194 VAL C O   1 
ATOM   3489 C CB  . VAL C 1 31  ? 16.821  -15.543 46.275  1.00 20.63 ? 194 VAL C CB  1 
ATOM   3490 C CG1 . VAL C 1 31  ? 16.666  -14.087 45.928  1.00 20.57 ? 194 VAL C CG1 1 
ATOM   3491 C CG2 . VAL C 1 31  ? 15.655  -15.988 47.163  1.00 24.76 ? 194 VAL C CG2 1 
ATOM   3492 N N   . PHE C 1 32  ? 14.761  -17.412 44.390  1.00 17.39 ? 195 PHE C N   1 
ATOM   3493 C CA  . PHE C 1 32  ? 13.427  -17.460 43.778  1.00 15.69 ? 195 PHE C CA  1 
ATOM   3494 C C   . PHE C 1 32  ? 12.378  -17.170 44.812  1.00 16.10 ? 195 PHE C C   1 
ATOM   3495 O O   . PHE C 1 32  ? 12.617  -17.403 45.997  1.00 17.05 ? 195 PHE C O   1 
ATOM   3496 C CB  . PHE C 1 32  ? 13.146  -18.841 43.249  1.00 15.31 ? 195 PHE C CB  1 
ATOM   3497 C CG  . PHE C 1 32  ? 13.782  -19.123 41.939  1.00 14.60 ? 195 PHE C CG  1 
ATOM   3498 C CD1 . PHE C 1 32  ? 14.940  -19.897 41.876  1.00 17.02 ? 195 PHE C CD1 1 
ATOM   3499 C CD2 . PHE C 1 32  ? 13.212  -18.649 40.757  1.00 14.83 ? 195 PHE C CD2 1 
ATOM   3500 C CE1 . PHE C 1 32  ? 15.527  -20.193 40.655  1.00 15.84 ? 195 PHE C CE1 1 
ATOM   3501 C CE2 . PHE C 1 32  ? 13.826  -18.950 39.496  1.00 18.26 ? 195 PHE C CE2 1 
ATOM   3502 C CZ  . PHE C 1 32  ? 14.989  -19.693 39.487  1.00 14.28 ? 195 PHE C CZ  1 
ATOM   3503 N N   . SER C 1 33  ? 11.244  -16.625 44.381  1.00 16.07 ? 196 SER C N   1 
ATOM   3504 C CA  . SER C 1 33  ? 10.134  -16.340 45.309  1.00 17.59 ? 196 SER C CA  1 
ATOM   3505 C C   . SER C 1 33  ? 9.588   -17.647 45.893  1.00 17.40 ? 196 SER C C   1 
ATOM   3506 O O   . SER C 1 33  ? 9.669   -18.683 45.234  1.00 18.18 ? 196 SER C O   1 
ATOM   3507 C CB  . SER C 1 33  ? 9.015   -15.572 44.599  1.00 16.72 ? 196 SER C CB  1 
ATOM   3508 O OG  . SER C 1 33  ? 8.558   -16.245 43.443  1.00 18.68 ? 196 SER C OG  1 
ATOM   3509 N N   . HIS C 1 34  ? 9.082   -17.608 47.133  1.00 18.27 ? 197 HIS C N   1 
ATOM   3510 C CA  . HIS C 1 34  ? 8.582   -18.810 47.790  1.00 18.86 ? 197 HIS C CA  1 
ATOM   3511 C C   . HIS C 1 34  ? 7.414   -19.374 47.008  1.00 18.01 ? 197 HIS C C   1 
ATOM   3512 O O   . HIS C 1 34  ? 7.297   -20.594 46.879  1.00 19.67 ? 197 HIS C O   1 
ATOM   3513 C CB  . HIS C 1 34  ? 8.215   -18.525 49.268  1.00 20.39 ? 197 HIS C CB  1 
ATOM   3514 C CG  . HIS C 1 34  ? 7.729   -19.729 50.017  1.00 25.31 ? 197 HIS C CG  1 
ATOM   3515 N ND1 . HIS C 1 34  ? 8.586   -20.649 50.595  1.00 30.02 ? 197 HIS C ND1 1 
ATOM   3516 C CD2 . HIS C 1 34  ? 6.472   -20.156 50.298  1.00 32.61 ? 197 HIS C CD2 1 
ATOM   3517 C CE1 . HIS C 1 34  ? 7.874   -21.595 51.188  1.00 32.44 ? 197 HIS C CE1 1 
ATOM   3518 N NE2 . HIS C 1 34  ? 6.590   -21.314 51.030  1.00 33.22 ? 197 HIS C NE2 1 
ATOM   3519 N N   . ASN C 1 35  ? 6.570   -18.500 46.458  1.00 17.01 ? 198 ASN C N   1 
ATOM   3520 C CA  . ASN C 1 35  ? 5.433   -18.919 45.668  1.00 17.65 ? 198 ASN C CA  1 
ATOM   3521 C C   . ASN C 1 35  ? 5.509   -18.468 44.190  1.00 17.71 ? 198 ASN C C   1 
ATOM   3522 O O   . ASN C 1 35  ? 6.146   -17.477 43.865  1.00 17.53 ? 198 ASN C O   1 
ATOM   3523 C CB  . ASN C 1 35  ? 4.143   -18.316 46.247  1.00 16.43 ? 198 ASN C CB  1 
ATOM   3524 C CG  . ASN C 1 35  ? 3.857   -18.772 47.677  1.00 21.19 ? 198 ASN C CG  1 
ATOM   3525 O OD1 . ASN C 1 35  ? 4.120   -18.035 48.617  1.00 24.07 ? 198 ASN C OD1 1 
ATOM   3526 N ND2 . ASN C 1 35  ? 3.338   -20.000 47.840  1.00 18.17 ? 198 ASN C ND2 1 
ATOM   3527 N N   . ALA C 1 36  ? 4.791   -19.189 43.341  1.00 16.90 ? 199 ALA C N   1 
ATOM   3528 C CA  . ALA C 1 36  ? 4.532   -18.794 41.975  1.00 17.24 ? 199 ALA C CA  1 
ATOM   3529 C C   . ALA C 1 36  ? 3.104   -18.307 41.976  1.00 16.99 ? 199 ALA C C   1 
ATOM   3530 O O   . ALA C 1 36  ? 2.350   -18.571 42.930  1.00 19.76 ? 199 ALA C O   1 
ATOM   3531 C CB  . ALA C 1 36  ? 4.688   -19.980 41.034  1.00 15.13 ? 199 ALA C CB  1 
ATOM   3532 N N   . VAL C 1 37  ? 2.689   -17.603 40.937  1.00 17.32 ? 200 VAL C N   1 
ATOM   3533 C CA  . VAL C 1 37  ? 1.308   -17.076 40.916  1.00 17.63 ? 200 VAL C CA  1 
ATOM   3534 C C   . VAL C 1 37  ? 0.675   -17.365 39.577  1.00 18.35 ? 200 VAL C C   1 
ATOM   3535 O O   . VAL C 1 37  ? 1.367   -17.581 38.592  1.00 19.06 ? 200 VAL C O   1 
ATOM   3536 C CB  . VAL C 1 37  ? 1.253   -15.514 41.296  1.00 17.38 ? 200 VAL C CB  1 
ATOM   3537 C CG1 . VAL C 1 37  ? 1.907   -15.239 42.655  1.00 15.89 ? 200 VAL C CG1 1 
ATOM   3538 C CG2 . VAL C 1 37  ? 1.963   -14.671 40.245  1.00 18.27 ? 200 VAL C CG2 1 
ATOM   3539 N N   . ILE C 1 38  ? -0.648  -17.355 39.517  1.00 17.78 ? 201 ILE C N   1 
ATOM   3540 C CA  . ILE C 1 38  ? -1.282  -17.384 38.261  1.00 17.85 ? 201 ILE C CA  1 
ATOM   3541 C C   . ILE C 1 38  ? -2.188  -16.158 38.257  1.00 19.13 ? 201 ILE C C   1 
ATOM   3542 O O   . ILE C 1 38  ? -2.949  -15.951 39.207  1.00 20.06 ? 201 ILE C O   1 
ATOM   3543 C CB  . ILE C 1 38  ? -2.052  -18.684 38.058  1.00 19.05 ? 201 ILE C CB  1 
ATOM   3544 C CG1 . ILE C 1 38  ? -1.077  -19.811 37.719  1.00 17.46 ? 201 ILE C CG1 1 
ATOM   3545 C CG2 . ILE C 1 38  ? -3.036  -18.552 36.909  1.00 15.86 ? 201 ILE C CG2 1 
ATOM   3546 C CD1 . ILE C 1 38  ? -1.764  -21.158 37.486  1.00 21.53 ? 201 ILE C CD1 1 
ATOM   3547 N N   . ALA C 1 39  ? -2.092  -15.339 37.217  1.00 18.51 ? 202 ALA C N   1 
ATOM   3548 C CA  . ALA C 1 39  ? -2.907  -14.138 37.156  1.00 19.33 ? 202 ALA C CA  1 
ATOM   3549 C C   . ALA C 1 39  ? -3.056  -13.685 35.723  1.00 19.76 ? 202 ALA C C   1 
ATOM   3550 O O   . ALA C 1 39  ? -2.346  -14.179 34.827  1.00 19.58 ? 202 ALA C O   1 
ATOM   3551 C CB  . ALA C 1 39  ? -2.256  -13.047 38.028  1.00 19.69 ? 202 ALA C CB  1 
ATOM   3552 N N   . MET C 1 40  ? -3.972  -12.743 35.482  1.00 20.98 ? 203 MET C N   1 
ATOM   3553 C CA  . MET C 1 40  ? -4.119  -12.138 34.145  1.00 21.36 ? 203 MET C CA  1 
ATOM   3554 C C   . MET C 1 40  ? -3.065  -11.057 33.886  1.00 21.49 ? 203 MET C C   1 
ATOM   3555 O O   . MET C 1 40  ? -2.811  -10.217 34.742  1.00 20.15 ? 203 MET C O   1 
ATOM   3556 C CB  . MET C 1 40  ? -5.510  -11.488 33.952  1.00 21.93 ? 203 MET C CB  1 
ATOM   3557 C CG  . MET C 1 40  ? -6.722  -12.451 33.900  1.00 21.18 ? 203 MET C CG  1 
ATOM   3558 S SD  . MET C 1 40  ? -6.534  -13.755 32.670  1.00 27.32 ? 203 MET C SD  1 
ATOM   3559 C CE  . MET C 1 40  ? -6.929  -12.802 31.219  1.00 25.26 ? 203 MET C CE  1 
ATOM   3560 N N   . ARG C 1 41  ? -2.505  -11.066 32.689  1.00 22.58 ? 204 ARG C N   1 
ATOM   3561 C CA  . ARG C 1 41  ? -1.609  -9.987  32.274  1.00 25.98 ? 204 ARG C CA  1 
ATOM   3562 C C   . ARG C 1 41  ? -1.821  -9.677  30.816  1.00 26.39 ? 204 ARG C C   1 
ATOM   3563 O O   . ARG C 1 41  ? -1.654  -10.557 29.964  1.00 26.60 ? 204 ARG C O   1 
ATOM   3564 C CB  . ARG C 1 41  ? -0.158  -10.352 32.552  1.00 26.42 ? 204 ARG C CB  1 
ATOM   3565 C CG  . ARG C 1 41  ? 0.539   -9.194  33.145  1.00 31.10 ? 204 ARG C CG  1 
ATOM   3566 C CD  . ARG C 1 41  ? 1.941   -9.435  33.252  1.00 28.78 ? 204 ARG C CD  1 
ATOM   3567 N NE  . ARG C 1 41  ? 2.347   -9.054  34.583  1.00 29.85 ? 204 ARG C NE  1 
ATOM   3568 C CZ  . ARG C 1 41  ? 3.595   -9.024  34.967  1.00 27.91 ? 204 ARG C CZ  1 
ATOM   3569 N NH1 . ARG C 1 41  ? 4.534   -9.315  34.084  1.00 28.94 ? 204 ARG C NH1 1 
ATOM   3570 N NH2 . ARG C 1 41  ? 3.883   -8.670  36.198  1.00 29.04 ? 204 ARG C NH2 1 
ATOM   3571 N N   . ASP C 1 42  ? -2.242  -8.443  30.512  1.00 27.86 ? 205 ASP C N   1 
ATOM   3572 C CA  . ASP C 1 42  ? -2.469  -8.033  29.105  1.00 29.17 ? 205 ASP C CA  1 
ATOM   3573 C C   . ASP C 1 42  ? -3.448  -8.974  28.380  1.00 28.63 ? 205 ASP C C   1 
ATOM   3574 O O   . ASP C 1 42  ? -3.228  -9.332  27.208  1.00 28.95 ? 205 ASP C O   1 
ATOM   3575 C CB  . ASP C 1 42  ? -1.137  -7.971  28.324  1.00 29.88 ? 205 ASP C CB  1 
ATOM   3576 C CG  . ASP C 1 42  ? -0.071  -7.113  29.028  1.00 34.42 ? 205 ASP C CG  1 
ATOM   3577 O OD1 . ASP C 1 42  ? -0.388  -5.938  29.360  1.00 35.12 ? 205 ASP C OD1 1 
ATOM   3578 O OD2 . ASP C 1 42  ? 1.089   -7.604  29.231  1.00 37.16 ? 205 ASP C OD2 1 
ATOM   3579 N N   . GLY C 1 43  ? -4.503  -9.398  29.071  1.00 27.74 ? 206 GLY C N   1 
ATOM   3580 C CA  . GLY C 1 43  ? -5.528  -10.268 28.457  1.00 26.96 ? 206 GLY C CA  1 
ATOM   3581 C C   . GLY C 1 43  ? -5.194  -11.760 28.456  1.00 27.10 ? 206 GLY C C   1 
ATOM   3582 O O   . GLY C 1 43  ? -6.005  -12.575 28.030  1.00 27.03 ? 206 GLY C O   1 
ATOM   3583 N N   . LYS C 1 44  ? -4.013  -12.130 28.957  1.00 26.49 ? 207 LYS C N   1 
ATOM   3584 C CA  . LYS C 1 44  ? -3.574  -13.545 28.956  1.00 25.78 ? 207 LYS C CA  1 
ATOM   3585 C C   . LYS C 1 44  ? -3.395  -14.122 30.364  1.00 23.45 ? 207 LYS C C   1 
ATOM   3586 O O   . LYS C 1 44  ? -2.887  -13.463 31.257  1.00 21.81 ? 207 LYS C O   1 
ATOM   3587 C CB  . LYS C 1 44  ? -2.272  -13.690 28.152  1.00 26.49 ? 207 LYS C CB  1 
ATOM   3588 C CG  . LYS C 1 44  ? -2.348  -12.994 26.800  1.00 31.49 ? 207 LYS C CG  1 
ATOM   3589 C CD  . LYS C 1 44  ? -1.152  -13.300 25.958  1.00 38.93 ? 207 LYS C CD  1 
ATOM   3590 C CE  . LYS C 1 44  ? -1.243  -12.659 24.584  1.00 41.27 ? 207 LYS C CE  1 
ATOM   3591 N NZ  . LYS C 1 44  ? -0.399  -11.444 24.608  1.00 47.14 ? 207 LYS C NZ  1 
ATOM   3592 N N   . LEU C 1 45  ? -3.841  -15.357 30.557  1.00 21.45 ? 208 LEU C N   1 
ATOM   3593 C CA  . LEU C 1 45  ? -3.656  -16.043 31.821  1.00 20.93 ? 208 LEU C CA  1 
ATOM   3594 C C   . LEU C 1 45  ? -2.196  -16.582 31.898  1.00 20.21 ? 208 LEU C C   1 
ATOM   3595 O O   . LEU C 1 45  ? -1.750  -17.323 31.028  1.00 21.22 ? 208 LEU C O   1 
ATOM   3596 C CB  . LEU C 1 45  ? -4.688  -17.154 31.990  1.00 20.00 ? 208 LEU C CB  1 
ATOM   3597 C CG  . LEU C 1 45  ? -4.759  -17.732 33.402  1.00 21.08 ? 208 LEU C CG  1 
ATOM   3598 C CD1 . LEU C 1 45  ? -5.376  -16.740 34.386  1.00 22.73 ? 208 LEU C CD1 1 
ATOM   3599 C CD2 . LEU C 1 45  ? -5.551  -19.065 33.397  1.00 24.10 ? 208 LEU C CD2 1 
ATOM   3600 N N   . CYS C 1 46  ? -1.434  -16.158 32.896  1.00 19.96 ? 209 CYS C N   1 
ATOM   3601 C CA  . CYS C 1 46  ? 0.002   -16.492 32.945  1.00 18.26 ? 209 CYS C CA  1 
ATOM   3602 C C   . CYS C 1 46  ? 0.331   -17.099 34.287  1.00 18.14 ? 209 CYS C C   1 
ATOM   3603 O O   . CYS C 1 46  ? -0.246  -16.668 35.316  1.00 18.46 ? 209 CYS C O   1 
ATOM   3604 C CB  . CYS C 1 46  ? 0.877   -15.216 32.762  1.00 18.55 ? 209 CYS C CB  1 
ATOM   3605 S SG  . CYS C 1 46  ? 0.593   -14.323 31.247  1.00 23.56 ? 209 CYS C SG  1 
ATOM   3606 N N   . LEU C 1 47  ? 1.274   -18.059 34.281  1.00 16.15 ? 210 LEU C N   1 
ATOM   3607 C CA  . LEU C 1 47  ? 2.001   -18.518 35.455  1.00 16.21 ? 210 LEU C CA  1 
ATOM   3608 C C   . LEU C 1 47  ? 3.257   -17.646 35.566  1.00 16.12 ? 210 LEU C C   1 
ATOM   3609 O O   . LEU C 1 47  ? 3.990   -17.497 34.570  1.00 14.54 ? 210 LEU C O   1 
ATOM   3610 C CB  . LEU C 1 47  ? 2.458   -19.970 35.217  1.00 15.75 ? 210 LEU C CB  1 
ATOM   3611 C CG  . LEU C 1 47  ? 3.268   -20.682 36.292  1.00 16.88 ? 210 LEU C CG  1 
ATOM   3612 C CD1 . LEU C 1 47  ? 2.483   -20.838 37.613  1.00 14.47 ? 210 LEU C CD1 1 
ATOM   3613 C CD2 . LEU C 1 47  ? 3.719   -22.040 35.778  1.00 16.60 ? 210 LEU C CD2 1 
ATOM   3614 N N   . MET C 1 48  ? 3.521   -17.093 36.756  1.00 15.67 ? 211 MET C N   1 
ATOM   3615 C CA  . MET C 1 48  ? 4.742   -16.217 36.970  1.00 15.75 ? 211 MET C CA  1 
ATOM   3616 C C   . MET C 1 48  ? 5.453   -16.589 38.220  1.00 14.88 ? 211 MET C C   1 
ATOM   3617 O O   . MET C 1 48  ? 4.850   -17.162 39.118  1.00 15.78 ? 211 MET C O   1 
ATOM   3618 C CB  . MET C 1 48  ? 4.376   -14.706 37.039  1.00 15.20 ? 211 MET C CB  1 
ATOM   3619 C CG  . MET C 1 48  ? 3.404   -14.322 35.871  1.00 19.65 ? 211 MET C CG  1 
ATOM   3620 S SD  . MET C 1 48  ? 2.849   -12.629 35.852  1.00 23.83 ? 211 MET C SD  1 
ATOM   3621 C CE  . MET C 1 48  ? 1.090   -12.920 35.629  1.00 25.42 ? 211 MET C CE  1 
ATOM   3622 N N   . TRP C 1 49  ? 6.741   -16.273 38.286  1.00 14.10 ? 212 TRP C N   1 
ATOM   3623 C CA  . TRP C 1 49  ? 7.524   -16.518 39.486  1.00 14.10 ? 212 TRP C CA  1 
ATOM   3624 C C   . TRP C 1 49  ? 8.595   -15.446 39.464  1.00 15.94 ? 212 TRP C C   1 
ATOM   3625 O O   . TRP C 1 49  ? 8.920   -14.907 38.391  1.00 17.24 ? 212 TRP C O   1 
ATOM   3626 C CB  . TRP C 1 49  ? 8.131   -17.940 39.538  1.00 14.62 ? 212 TRP C CB  1 
ATOM   3627 C CG  . TRP C 1 49  ? 8.940   -18.381 38.375  1.00 12.51 ? 212 TRP C CG  1 
ATOM   3628 C CD1 . TRP C 1 49  ? 10.324  -18.292 38.224  1.00 14.71 ? 212 TRP C CD1 1 
ATOM   3629 C CD2 . TRP C 1 49  ? 8.437   -18.967 37.171  1.00 15.76 ? 212 TRP C CD2 1 
ATOM   3630 N NE1 . TRP C 1 49  ? 10.688  -18.811 36.992  1.00 13.07 ? 212 TRP C NE1 1 
ATOM   3631 C CE2 . TRP C 1 49  ? 9.550   -19.214 36.323  1.00 15.63 ? 212 TRP C CE2 1 
ATOM   3632 C CE3 . TRP C 1 49  ? 7.142   -19.289 36.711  1.00 14.53 ? 212 TRP C CE3 1 
ATOM   3633 C CZ2 . TRP C 1 49  ? 9.413   -19.834 35.074  1.00 15.24 ? 212 TRP C CZ2 1 
ATOM   3634 C CZ3 . TRP C 1 49  ? 6.999   -19.873 35.432  1.00 17.07 ? 212 TRP C CZ3 1 
ATOM   3635 C CH2 . TRP C 1 49  ? 8.136   -20.130 34.622  1.00 15.76 ? 212 TRP C CH2 1 
ATOM   3636 N N   . ARG C 1 50  ? 9.127   -15.103 40.608  1.00 16.73 ? 213 ARG C N   1 
ATOM   3637 C CA  . ARG C 1 50  ? 10.104  -14.004 40.655  1.00 18.16 ? 213 ARG C CA  1 
ATOM   3638 C C   . ARG C 1 50  ? 11.493  -14.575 40.950  1.00 17.22 ? 213 ARG C C   1 
ATOM   3639 O O   . ARG C 1 50  ? 11.638  -15.527 41.727  1.00 15.90 ? 213 ARG C O   1 
ATOM   3640 C CB  . ARG C 1 50  ? 9.643   -12.990 41.722  1.00 18.14 ? 213 ARG C CB  1 
ATOM   3641 C CG  . ARG C 1 50  ? 10.556  -11.833 42.043  1.00 22.41 ? 213 ARG C CG  1 
ATOM   3642 C CD  . ARG C 1 50  ? 9.916   -10.967 43.197  1.00 23.16 ? 213 ARG C CD  1 
ATOM   3643 N NE  . ARG C 1 50  ? 9.304   -9.764  42.670  1.00 22.29 ? 213 ARG C NE  1 
ATOM   3644 C CZ  . ARG C 1 50  ? 8.497   -8.954  43.361  1.00 24.89 ? 213 ARG C CZ  1 
ATOM   3645 N NH1 . ARG C 1 50  ? 8.140   -9.215  44.638  1.00 19.31 ? 213 ARG C NH1 1 
ATOM   3646 N NH2 . ARG C 1 50  ? 8.039   -7.873  42.755  1.00 21.44 ? 213 ARG C NH2 1 
ATOM   3647 N N   . VAL C 1 51  ? 12.508  -13.934 40.376  1.00 16.44 ? 214 VAL C N   1 
ATOM   3648 C CA  . VAL C 1 51  ? 13.883  -14.264 40.684  1.00 17.00 ? 214 VAL C CA  1 
ATOM   3649 C C   . VAL C 1 51  ? 14.715  -12.999 40.978  1.00 16.61 ? 214 VAL C C   1 
ATOM   3650 O O   . VAL C 1 51  ? 14.428  -11.956 40.457  1.00 16.16 ? 214 VAL C O   1 
ATOM   3651 C CB  . VAL C 1 51  ? 14.455  -15.179 39.535  1.00 17.75 ? 214 VAL C CB  1 
ATOM   3652 C CG1 . VAL C 1 51  ? 14.634  -14.361 38.194  1.00 18.99 ? 214 VAL C CG1 1 
ATOM   3653 C CG2 . VAL C 1 51  ? 15.735  -15.842 39.996  1.00 19.40 ? 214 VAL C CG2 1 
ATOM   3654 N N   . GLY C 1 52  ? 15.730  -13.089 41.827  1.00 16.84 ? 215 GLY C N   1 
ATOM   3655 C CA  . GLY C 1 52  ? 16.549  -11.935 42.116  1.00 18.29 ? 215 GLY C CA  1 
ATOM   3656 C C   . GLY C 1 52  ? 17.956  -12.304 42.452  1.00 20.30 ? 215 GLY C C   1 
ATOM   3657 O O   . GLY C 1 52  ? 18.278  -13.482 42.651  1.00 20.79 ? 215 GLY C O   1 
ATOM   3658 N N   . ASN C 1 53  ? 18.814  -11.291 42.423  1.00 21.97 ? 216 ASN C N   1 
ATOM   3659 C CA  . ASN C 1 53  ? 20.202  -11.418 42.832  1.00 23.75 ? 216 ASN C CA  1 
ATOM   3660 C C   . ASN C 1 53  ? 20.323  -10.480 44.024  1.00 26.54 ? 216 ASN C C   1 
ATOM   3661 O O   . ASN C 1 53  ? 20.131  -9.260  43.878  1.00 27.01 ? 216 ASN C O   1 
ATOM   3662 C CB  . ASN C 1 53  ? 21.148  -10.966 41.708  1.00 23.63 ? 216 ASN C CB  1 
ATOM   3663 C CG  . ASN C 1 53  ? 22.635  -11.275 42.026  1.00 22.69 ? 216 ASN C CG  1 
ATOM   3664 O OD1 . ASN C 1 53  ? 22.980  -11.778 43.104  1.00 23.05 ? 216 ASN C OD1 1 
ATOM   3665 N ND2 . ASN C 1 53  ? 23.486  -11.023 41.067  1.00 20.78 ? 216 ASN C ND2 1 
ATOM   3666 N N   . LEU C 1 54  ? 20.553  -11.056 45.204  1.00 28.74 ? 217 LEU C N   1 
ATOM   3667 C CA  . LEU C 1 54  ? 20.685  -10.317 46.478  1.00 31.20 ? 217 LEU C CA  1 
ATOM   3668 C C   . LEU C 1 54  ? 21.908  -9.361  46.490  1.00 32.73 ? 217 LEU C C   1 
ATOM   3669 O O   . LEU C 1 54  ? 22.025  -8.485  47.362  1.00 33.09 ? 217 LEU C O   1 
ATOM   3670 C CB  . LEU C 1 54  ? 20.791  -11.306 47.638  1.00 30.87 ? 217 LEU C CB  1 
ATOM   3671 C CG  . LEU C 1 54  ? 19.500  -12.106 47.916  1.00 32.81 ? 217 LEU C CG  1 
ATOM   3672 C CD1 . LEU C 1 54  ? 19.737  -13.185 48.969  1.00 32.93 ? 217 LEU C CD1 1 
ATOM   3673 C CD2 . LEU C 1 54  ? 18.341  -11.196 48.352  1.00 33.48 ? 217 LEU C CD2 1 
ATOM   3674 N N   . GLN C 1 55  ? 22.809  -9.512  45.522  1.00 34.13 ? 218 GLN C N   1 
ATOM   3675 C CA  . GLN C 1 55  ? 23.929  -8.572  45.443  1.00 36.17 ? 218 GLN C CA  1 
ATOM   3676 C C   . GLN C 1 55  ? 24.169  -8.031  44.059  1.00 35.71 ? 218 GLN C C   1 
ATOM   3677 O O   . GLN C 1 55  ? 23.530  -8.470  43.092  1.00 35.72 ? 218 GLN C O   1 
ATOM   3678 C CB  . GLN C 1 55  ? 25.183  -9.090  46.143  1.00 37.09 ? 218 GLN C CB  1 
ATOM   3679 C CG  . GLN C 1 55  ? 25.838  -10.349 45.626  1.00 41.60 ? 218 GLN C CG  1 
ATOM   3680 C CD  . GLN C 1 55  ? 27.092  -10.677 46.439  1.00 48.15 ? 218 GLN C CD  1 
ATOM   3681 O OE1 . GLN C 1 55  ? 27.028  -11.002 47.644  1.00 52.07 ? 218 GLN C OE1 1 
ATOM   3682 N NE2 . GLN C 1 55  ? 28.239  -10.585 45.789  1.00 50.76 ? 218 GLN C NE2 1 
ATOM   3683 N N   . LYS C 1 56  ? 25.046  -7.042  43.952  1.00 35.38 ? 219 LYS C N   1 
ATOM   3684 C CA  . LYS C 1 56  ? 25.142  -6.320  42.699  1.00 35.70 ? 219 LYS C CA  1 
ATOM   3685 C C   . LYS C 1 56  ? 26.184  -6.879  41.730  1.00 35.15 ? 219 LYS C C   1 
ATOM   3686 O O   . LYS C 1 56  ? 26.952  -6.115  41.113  1.00 37.10 ? 219 LYS C O   1 
ATOM   3687 C CB  . LYS C 1 56  ? 25.272  -4.807  42.932  1.00 36.11 ? 219 LYS C CB  1 
ATOM   3688 C CG  . LYS C 1 56  ? 23.906  -4.125  43.007  1.00 37.57 ? 219 LYS C CG  1 
ATOM   3689 C CD  . LYS C 1 56  ? 23.907  -2.946  43.953  1.00 39.13 ? 219 LYS C CD  1 
ATOM   3690 C CE  . LYS C 1 56  ? 24.416  -1.723  43.252  1.00 41.31 ? 219 LYS C CE  1 
ATOM   3691 N NZ  . LYS C 1 56  ? 24.121  -0.564  44.119  1.00 42.82 ? 219 LYS C NZ  1 
ATOM   3692 N N   . SER C 1 57  ? 26.185  -8.196  41.556  1.00 32.99 ? 220 SER C N   1 
ATOM   3693 C CA  . SER C 1 57  ? 27.145  -8.852  40.657  1.00 30.86 ? 220 SER C CA  1 
ATOM   3694 C C   . SER C 1 57  ? 26.596  -8.952  39.241  1.00 29.48 ? 220 SER C C   1 
ATOM   3695 O O   . SER C 1 57  ? 25.396  -8.780  39.025  1.00 29.30 ? 220 SER C O   1 
ATOM   3696 C CB  . SER C 1 57  ? 27.473  -10.236 41.192  1.00 30.57 ? 220 SER C CB  1 
ATOM   3697 O OG  . SER C 1 57  ? 26.311  -11.042 41.113  1.00 31.51 ? 220 SER C OG  1 
ATOM   3698 N N   . HIS C 1 58  ? 27.473  -9.222  38.275  1.00 27.62 ? 221 HIS C N   1 
ATOM   3699 C CA  . HIS C 1 58  ? 27.051  -9.404  36.879  1.00 27.13 ? 221 HIS C CA  1 
ATOM   3700 C C   . HIS C 1 58  ? 26.787  -10.879 36.579  1.00 24.97 ? 221 HIS C C   1 
ATOM   3701 O O   . HIS C 1 58  ? 27.747  -11.653 36.493  1.00 23.44 ? 221 HIS C O   1 
ATOM   3702 C CB  . HIS C 1 58  ? 28.146  -8.930  35.893  1.00 26.74 ? 221 HIS C CB  1 
ATOM   3703 C CG  . HIS C 1 58  ? 28.406  -7.459  35.911  1.00 30.01 ? 221 HIS C CG  1 
ATOM   3704 N ND1 . HIS C 1 58  ? 29.278  -6.861  35.015  1.00 31.74 ? 221 HIS C ND1 1 
ATOM   3705 C CD2 . HIS C 1 58  ? 27.914  -6.459  36.696  1.00 31.82 ? 221 HIS C CD2 1 
ATOM   3706 C CE1 . HIS C 1 58  ? 29.300  -5.554  35.240  1.00 34.94 ? 221 HIS C CE1 1 
ATOM   3707 N NE2 . HIS C 1 58  ? 28.494  -5.286  36.261  1.00 33.37 ? 221 HIS C NE2 1 
ATOM   3708 N N   . LEU C 1 59  ? 25.517  -11.248 36.345  1.00 23.69 ? 222 LEU C N   1 
ATOM   3709 C CA  . LEU C 1 59  ? 25.201  -12.608 35.925  1.00 21.77 ? 222 LEU C CA  1 
ATOM   3710 C C   . LEU C 1 59  ? 25.231  -12.586 34.404  1.00 21.42 ? 222 LEU C C   1 
ATOM   3711 O O   . LEU C 1 59  ? 24.283  -12.135 33.757  1.00 20.70 ? 222 LEU C O   1 
ATOM   3712 C CB  . LEU C 1 59  ? 23.831  -13.081 36.453  1.00 21.51 ? 222 LEU C CB  1 
ATOM   3713 C CG  . LEU C 1 59  ? 23.458  -14.577 36.325  1.00 22.77 ? 222 LEU C CG  1 
ATOM   3714 C CD1 . LEU C 1 59  ? 24.515  -15.515 37.021  1.00 16.06 ? 222 LEU C CD1 1 
ATOM   3715 C CD2 . LEU C 1 59  ? 22.024  -14.905 36.872  1.00 16.85 ? 222 LEU C CD2 1 
ATOM   3716 N N   . VAL C 1 60  ? 26.325  -13.068 33.840  1.00 20.24 ? 223 VAL C N   1 
ATOM   3717 C CA  . VAL C 1 60  ? 26.582  -12.936 32.406  1.00 19.94 ? 223 VAL C CA  1 
ATOM   3718 C C   . VAL C 1 60  ? 25.860  -14.059 31.676  1.00 19.72 ? 223 VAL C C   1 
ATOM   3719 O O   . VAL C 1 60  ? 25.836  -15.216 32.158  1.00 19.01 ? 223 VAL C O   1 
ATOM   3720 C CB  . VAL C 1 60  ? 28.105  -12.956 32.080  1.00 20.84 ? 223 VAL C CB  1 
ATOM   3721 C CG1 . VAL C 1 60  ? 28.356  -12.773 30.606  1.00 22.02 ? 223 VAL C CG1 1 
ATOM   3722 C CG2 . VAL C 1 60  ? 28.839  -11.892 32.840  1.00 18.94 ? 223 VAL C CG2 1 
ATOM   3723 N N   . GLU C 1 61  ? 25.248  -13.706 30.552  1.00 16.77 ? 224 GLU C N   1 
ATOM   3724 C CA  . GLU C 1 61  ? 24.526  -14.673 29.729  1.00 18.88 ? 224 GLU C CA  1 
ATOM   3725 C C   . GLU C 1 61  ? 23.503  -15.476 30.567  1.00 18.05 ? 224 GLU C C   1 
ATOM   3726 O O   . GLU C 1 61  ? 23.428  -16.704 30.513  1.00 17.16 ? 224 GLU C O   1 
ATOM   3727 C CB  . GLU C 1 61  ? 25.500  -15.554 28.944  1.00 18.86 ? 224 GLU C CB  1 
ATOM   3728 C CG  . GLU C 1 61  ? 26.113  -14.755 27.761  1.00 22.65 ? 224 GLU C CG  1 
ATOM   3729 C CD  . GLU C 1 61  ? 27.370  -15.408 27.139  1.00 29.59 ? 224 GLU C CD  1 
ATOM   3730 O OE1 . GLU C 1 61  ? 27.980  -16.299 27.769  1.00 28.15 ? 224 GLU C OE1 1 
ATOM   3731 O OE2 . GLU C 1 61  ? 27.783  -14.966 26.033  1.00 32.27 ? 224 GLU C OE2 1 
ATOM   3732 N N   . ALA C 1 62  ? 22.722  -14.724 31.337  1.00 16.65 ? 225 ALA C N   1 
ATOM   3733 C CA  . ALA C 1 62  ? 21.718  -15.300 32.230  1.00 16.13 ? 225 ALA C CA  1 
ATOM   3734 C C   . ALA C 1 62  ? 20.507  -15.678 31.402  1.00 16.09 ? 225 ALA C C   1 
ATOM   3735 O O   . ALA C 1 62  ? 20.098  -14.933 30.491  1.00 15.35 ? 225 ALA C O   1 
ATOM   3736 C CB  . ALA C 1 62  ? 21.332  -14.275 33.311  1.00 16.19 ? 225 ALA C CB  1 
ATOM   3737 N N   . HIS C 1 63  ? 19.918  -16.837 31.720  1.00 15.04 ? 226 HIS C N   1 
ATOM   3738 C CA  . HIS C 1 63  ? 18.706  -17.238 31.083  1.00 15.16 ? 226 HIS C CA  1 
ATOM   3739 C C   . HIS C 1 63  ? 17.946  -18.201 32.033  1.00 14.50 ? 226 HIS C C   1 
ATOM   3740 O O   . HIS C 1 63  ? 18.525  -18.795 32.922  1.00 15.89 ? 226 HIS C O   1 
ATOM   3741 C CB  . HIS C 1 63  ? 19.029  -17.927 29.747  1.00 16.19 ? 226 HIS C CB  1 
ATOM   3742 C CG  . HIS C 1 63  ? 19.938  -19.106 29.912  1.00 19.36 ? 226 HIS C CG  1 
ATOM   3743 N ND1 . HIS C 1 63  ? 19.535  -20.401 29.671  1.00 22.68 ? 226 HIS C ND1 1 
ATOM   3744 C CD2 . HIS C 1 63  ? 21.207  -19.186 30.385  1.00 22.81 ? 226 HIS C CD2 1 
ATOM   3745 C CE1 . HIS C 1 63  ? 20.538  -21.223 29.944  1.00 18.23 ? 226 HIS C CE1 1 
ATOM   3746 N NE2 . HIS C 1 63  ? 21.561  -20.508 30.374  1.00 20.31 ? 226 HIS C NE2 1 
ATOM   3747 N N   . VAL C 1 64  ? 16.646  -18.309 31.810  1.00 14.88 ? 227 VAL C N   1 
ATOM   3748 C CA  . VAL C 1 64  ? 15.743  -19.058 32.683  1.00 15.09 ? 227 VAL C CA  1 
ATOM   3749 C C   . VAL C 1 64  ? 15.089  -20.227 31.954  1.00 14.65 ? 227 VAL C C   1 
ATOM   3750 O O   . VAL C 1 64  ? 14.918  -20.179 30.765  1.00 14.67 ? 227 VAL C O   1 
ATOM   3751 C CB  . VAL C 1 64  ? 14.647  -18.122 33.297  1.00 14.44 ? 227 VAL C CB  1 
ATOM   3752 C CG1 . VAL C 1 64  ? 15.297  -17.142 34.262  1.00 13.25 ? 227 VAL C CG1 1 
ATOM   3753 C CG2 . VAL C 1 64  ? 13.855  -17.368 32.232  1.00 16.48 ? 227 VAL C CG2 1 
ATOM   3754 N N   . ARG C 1 65  ? 14.741  -21.290 32.695  1.00 15.08 ? 228 ARG C N   1 
ATOM   3755 C CA  . ARG C 1 65  ? 13.932  -22.371 32.165  1.00 14.78 ? 228 ARG C CA  1 
ATOM   3756 C C   . ARG C 1 65  ? 12.994  -22.827 33.256  1.00 15.63 ? 228 ARG C C   1 
ATOM   3757 O O   . ARG C 1 65  ? 13.187  -22.524 34.443  1.00 15.35 ? 228 ARG C O   1 
ATOM   3758 C CB  . ARG C 1 65  ? 14.790  -23.589 31.777  1.00 14.71 ? 228 ARG C CB  1 
ATOM   3759 C CG  . ARG C 1 65  ? 15.829  -23.355 30.741  1.00 16.88 ? 228 ARG C CG  1 
ATOM   3760 C CD  . ARG C 1 65  ? 16.873  -24.519 30.837  1.00 19.64 ? 228 ARG C CD  1 
ATOM   3761 N NE  . ARG C 1 65  ? 16.184  -25.754 30.430  1.00 19.53 ? 228 ARG C NE  1 
ATOM   3762 C CZ  . ARG C 1 65  ? 16.790  -26.910 30.196  1.00 22.75 ? 228 ARG C CZ  1 
ATOM   3763 N NH1 . ARG C 1 65  ? 18.096  -26.983 30.375  1.00 19.38 ? 228 ARG C NH1 1 
ATOM   3764 N NH2 . ARG C 1 65  ? 16.084  -27.994 29.782  1.00 20.80 ? 228 ARG C NH2 1 
ATOM   3765 N N   . ALA C 1 66  ? 11.988  -23.590 32.855  1.00 16.02 ? 229 ALA C N   1 
ATOM   3766 C CA  . ALA C 1 66  ? 11.078  -24.187 33.814  1.00 16.26 ? 229 ALA C CA  1 
ATOM   3767 C C   . ALA C 1 66  ? 10.625  -25.500 33.210  1.00 16.05 ? 229 ALA C C   1 
ATOM   3768 O O   . ALA C 1 66  ? 10.552  -25.602 31.981  1.00 15.76 ? 229 ALA C O   1 
ATOM   3769 C CB  . ALA C 1 66  ? 9.875   -23.227 34.098  1.00 17.35 ? 229 ALA C CB  1 
ATOM   3770 N N   . GLN C 1 67  ? 10.424  -26.528 34.048  1.00 15.63 ? 230 GLN C N   1 
ATOM   3771 C CA  . GLN C 1 67  ? 9.953   -27.817 33.553  1.00 15.94 ? 230 GLN C CA  1 
ATOM   3772 C C   . GLN C 1 67  ? 8.858   -28.342 34.469  1.00 16.48 ? 230 GLN C C   1 
ATOM   3773 O O   . GLN C 1 67  ? 8.985   -28.233 35.664  1.00 15.69 ? 230 GLN C O   1 
ATOM   3774 C CB  . GLN C 1 67  ? 11.073  -28.877 33.567  1.00 16.44 ? 230 GLN C CB  1 
ATOM   3775 C CG  . GLN C 1 67  ? 12.272  -28.597 32.677  1.00 16.98 ? 230 GLN C CG  1 
ATOM   3776 C CD  . GLN C 1 67  ? 13.296  -29.737 32.712  1.00 19.53 ? 230 GLN C CD  1 
ATOM   3777 O OE1 . GLN C 1 67  ? 13.917  -30.054 31.696  1.00 25.15 ? 230 GLN C OE1 1 
ATOM   3778 N NE2 . GLN C 1 67  ? 13.440  -30.370 33.845  1.00 16.12 ? 230 GLN C NE2 1 
ATOM   3779 N N   . LEU C 1 68  ? 7.800   -28.898 33.888  1.00 17.00 ? 231 LEU C N   1 
ATOM   3780 C CA  . LEU C 1 68  ? 6.861   -29.713 34.633  1.00 19.63 ? 231 LEU C CA  1 
ATOM   3781 C C   . LEU C 1 68  ? 7.429   -31.137 34.801  1.00 20.53 ? 231 LEU C C   1 
ATOM   3782 O O   . LEU C 1 68  ? 7.838   -31.779 33.810  1.00 19.57 ? 231 LEU C O   1 
ATOM   3783 C CB  . LEU C 1 68  ? 5.509   -29.734 33.897  1.00 20.28 ? 231 LEU C CB  1 
ATOM   3784 C CG  . LEU C 1 68  ? 4.348   -29.760 34.891  1.00 26.44 ? 231 LEU C CG  1 
ATOM   3785 C CD1 . LEU C 1 68  ? 3.042   -29.196 34.281  1.00 30.46 ? 231 LEU C CD1 1 
ATOM   3786 C CD2 . LEU C 1 68  ? 4.149   -31.165 35.342  1.00 28.18 ? 231 LEU C CD2 1 
ATOM   3787 N N   . LEU C 1 69  ? 7.460   -31.617 36.043  1.00 20.67 ? 232 LEU C N   1 
ATOM   3788 C CA  . LEU C 1 69  ? 7.971   -32.933 36.387  1.00 22.88 ? 232 LEU C CA  1 
ATOM   3789 C C   . LEU C 1 69  ? 6.817   -33.866 36.723  1.00 23.83 ? 232 LEU C C   1 
ATOM   3790 O O   . LEU C 1 69  ? 5.992   -33.548 37.585  1.00 24.10 ? 232 LEU C O   1 
ATOM   3791 C CB  . LEU C 1 69  ? 8.872   -32.872 37.618  1.00 21.30 ? 232 LEU C CB  1 
ATOM   3792 C CG  . LEU C 1 69  ? 10.119  -31.994 37.595  1.00 24.67 ? 232 LEU C CG  1 
ATOM   3793 C CD1 . LEU C 1 69  ? 10.909  -32.230 38.855  1.00 24.59 ? 232 LEU C CD1 1 
ATOM   3794 C CD2 . LEU C 1 69  ? 10.974  -32.221 36.365  1.00 24.66 ? 232 LEU C CD2 1 
ATOM   3795 N N   . LYS C 1 70  ? 6.766   -34.998 36.027  1.00 24.27 ? 233 LYS C N   1 
ATOM   3796 C CA  . LYS C 1 70  ? 5.723   -36.003 36.245  1.00 24.01 ? 233 LYS C CA  1 
ATOM   3797 C C   . LYS C 1 70  ? 6.130   -37.342 35.670  1.00 23.86 ? 233 LYS C C   1 
ATOM   3798 O O   . LYS C 1 70  ? 7.017   -37.432 34.804  1.00 23.47 ? 233 LYS C O   1 
ATOM   3799 C CB  . LYS C 1 70  ? 4.399   -35.564 35.634  1.00 24.54 ? 233 LYS C CB  1 
ATOM   3800 C CG  . LYS C 1 70  ? 4.459   -35.281 34.132  1.00 26.90 ? 233 LYS C CG  1 
ATOM   3801 C CD  . LYS C 1 70  ? 3.168   -34.701 33.696  1.00 34.71 ? 233 LYS C CD  1 
ATOM   3802 C CE  . LYS C 1 70  ? 2.700   -35.318 32.402  1.00 41.09 ? 233 LYS C CE  1 
ATOM   3803 N NZ  . LYS C 1 70  ? 1.196   -35.280 32.328  1.00 46.47 ? 233 LYS C NZ  1 
ATOM   3804 N N   . SER C 1 71  ? 5.454   -38.394 36.133  1.00 23.32 ? 234 SER C N   1 
ATOM   3805 C CA  . SER C 1 71  ? 5.646   -39.703 35.538  1.00 23.81 ? 234 SER C CA  1 
ATOM   3806 C C   . SER C 1 71  ? 4.664   -39.814 34.401  1.00 23.50 ? 234 SER C C   1 
ATOM   3807 O O   . SER C 1 71  ? 3.663   -39.073 34.327  1.00 24.45 ? 234 SER C O   1 
ATOM   3808 C CB  . SER C 1 71  ? 5.445   -40.818 36.582  1.00 23.37 ? 234 SER C CB  1 
ATOM   3809 O OG  . SER C 1 71  ? 4.115   -40.715 37.044  1.00 23.52 ? 234 SER C OG  1 
ATOM   3810 N N   . ARG C 1 72  ? 4.934   -40.728 33.483  1.00 24.22 ? 235 ARG C N   1 
ATOM   3811 C CA  . ARG C 1 72  ? 4.063   -40.882 32.326  1.00 23.19 ? 235 ARG C CA  1 
ATOM   3812 C C   . ARG C 1 72  ? 4.071   -42.323 31.836  1.00 22.21 ? 235 ARG C C   1 
ATOM   3813 O O   . ARG C 1 72  ? 5.097   -43.002 31.943  1.00 20.99 ? 235 ARG C O   1 
ATOM   3814 C CB  . ARG C 1 72  ? 4.595   -39.989 31.184  1.00 25.27 ? 235 ARG C CB  1 
ATOM   3815 C CG  . ARG C 1 72  ? 3.547   -39.678 30.141  1.00 25.52 ? 235 ARG C CG  1 
ATOM   3816 C CD  . ARG C 1 72  ? 3.981   -38.613 29.096  1.00 29.46 ? 235 ARG C CD  1 
ATOM   3817 N NE  . ARG C 1 72  ? 5.190   -38.921 28.313  1.00 31.54 ? 235 ARG C NE  1 
ATOM   3818 C CZ  . ARG C 1 72  ? 5.223   -39.634 27.186  1.00 31.05 ? 235 ARG C CZ  1 
ATOM   3819 N NH1 . ARG C 1 72  ? 4.113   -40.178 26.686  1.00 28.46 ? 235 ARG C NH1 1 
ATOM   3820 N NH2 . ARG C 1 72  ? 6.386   -39.811 26.551  1.00 33.07 ? 235 ARG C NH2 1 
ATOM   3821 N N   . ILE C 1 73  ? 2.947   -42.755 31.271  1.00 21.01 ? 236 ILE C N   1 
ATOM   3822 C CA  . ILE C 1 73  ? 2.847   -44.047 30.565  1.00 21.77 ? 236 ILE C CA  1 
ATOM   3823 C C   . ILE C 1 73  ? 2.628   -43.780 29.088  1.00 20.85 ? 236 ILE C C   1 
ATOM   3824 O O   . ILE C 1 73  ? 1.692   -43.095 28.742  1.00 22.29 ? 236 ILE C O   1 
ATOM   3825 C CB  . ILE C 1 73  ? 1.634   -44.951 31.103  1.00 21.50 ? 236 ILE C CB  1 
ATOM   3826 C CG1 . ILE C 1 73  ? 1.655   -45.042 32.636  1.00 19.66 ? 236 ILE C CG1 1 
ATOM   3827 C CG2 . ILE C 1 73  ? 1.598   -46.336 30.373  1.00 21.80 ? 236 ILE C CG2 1 
ATOM   3828 C CD1 . ILE C 1 73  ? 3.017   -45.464 33.354  1.00 19.09 ? 236 ILE C CD1 1 
ATOM   3829 N N   . THR C 1 74  ? 3.476   -44.320 28.209  1.00 21.02 ? 237 THR C N   1 
ATOM   3830 C CA  . THR C 1 74  ? 3.267   -44.163 26.780  1.00 21.36 ? 237 THR C CA  1 
ATOM   3831 C C   . THR C 1 74  ? 2.151   -45.094 26.295  1.00 22.69 ? 237 THR C C   1 
ATOM   3832 O O   . THR C 1 74  ? 1.791   -46.074 26.992  1.00 23.60 ? 237 THR C O   1 
ATOM   3833 C CB  . THR C 1 74  ? 4.538   -44.498 25.943  1.00 20.57 ? 237 THR C CB  1 
ATOM   3834 O OG1 . THR C 1 74  ? 4.735   -45.924 25.914  1.00 19.36 ? 237 THR C OG1 1 
ATOM   3835 C CG2 . THR C 1 74  ? 5.786   -43.837 26.568  1.00 17.80 ? 237 THR C CG2 1 
ATOM   3836 N N   . SER C 1 75  ? 1.658   -44.823 25.093  1.00 23.30 ? 238 SER C N   1 
ATOM   3837 C CA  . SER C 1 75  ? 0.661   -45.679 24.429  1.00 25.63 ? 238 SER C CA  1 
ATOM   3838 C C   . SER C 1 75  ? 1.090   -47.140 24.274  1.00 25.21 ? 238 SER C C   1 
ATOM   3839 O O   . SER C 1 75  ? 0.241   -48.023 24.210  1.00 23.86 ? 238 SER C O   1 
ATOM   3840 C CB  . SER C 1 75  ? 0.268   -45.102 23.072  1.00 27.13 ? 238 SER C CB  1 
ATOM   3841 O OG  . SER C 1 75  ? 1.400   -45.158 22.200  1.00 32.02 ? 238 SER C OG  1 
ATOM   3842 N N   . GLU C 1 76  ? 2.406   -47.387 24.223  1.00 24.74 ? 239 GLU C N   1 
ATOM   3843 C CA  . GLU C 1 76  ? 2.947   -48.754 24.148  1.00 24.29 ? 239 GLU C CA  1 
ATOM   3844 C C   . GLU C 1 76  ? 3.025   -49.415 25.514  1.00 23.49 ? 239 GLU C C   1 
ATOM   3845 O O   . GLU C 1 76  ? 3.507   -50.539 25.613  1.00 21.91 ? 239 GLU C O   1 
ATOM   3846 C CB  . GLU C 1 76  ? 4.367   -48.768 23.542  1.00 24.80 ? 239 GLU C CB  1 
ATOM   3847 C CG  . GLU C 1 76  ? 4.455   -48.294 22.088  1.00 26.31 ? 239 GLU C CG  1 
ATOM   3848 C CD  . GLU C 1 76  ? 4.415   -46.763 21.885  1.00 28.27 ? 239 GLU C CD  1 
ATOM   3849 O OE1 . GLU C 1 76  ? 4.506   -45.995 22.863  1.00 27.83 ? 239 GLU C OE1 1 
ATOM   3850 O OE2 . GLU C 1 76  ? 4.296   -46.310 20.717  1.00 30.59 ? 239 GLU C OE2 1 
ATOM   3851 N N   . GLY C 1 77  ? 2.617   -48.699 26.568  1.00 22.31 ? 240 GLY C N   1 
ATOM   3852 C CA  . GLY C 1 77  ? 2.673   -49.258 27.916  1.00 21.40 ? 240 GLY C CA  1 
ATOM   3853 C C   . GLY C 1 77  ? 3.990   -49.042 28.613  1.00 20.85 ? 240 GLY C C   1 
ATOM   3854 O O   . GLY C 1 77  ? 4.220   -49.614 29.660  1.00 20.52 ? 240 GLY C O   1 
ATOM   3855 N N   . GLU C 1 78  ? 4.876   -48.193 28.059  1.00 20.00 ? 241 GLU C N   1 
ATOM   3856 C CA  . GLU C 1 78  ? 6.133   -47.932 28.731  1.00 19.76 ? 241 GLU C CA  1 
ATOM   3857 C C   . GLU C 1 78  ? 5.951   -46.943 29.887  1.00 19.52 ? 241 GLU C C   1 
ATOM   3858 O O   . GLU C 1 78  ? 5.389   -45.885 29.709  1.00 20.10 ? 241 GLU C O   1 
ATOM   3859 C CB  . GLU C 1 78  ? 7.209   -47.397 27.758  1.00 20.56 ? 241 GLU C CB  1 
ATOM   3860 C CG  . GLU C 1 78  ? 8.516   -47.144 28.479  1.00 21.40 ? 241 GLU C CG  1 
ATOM   3861 C CD  . GLU C 1 78  ? 9.608   -46.500 27.614  1.00 24.06 ? 241 GLU C CD  1 
ATOM   3862 O OE1 . GLU C 1 78  ? 10.789  -46.491 28.077  1.00 24.52 ? 241 GLU C OE1 1 
ATOM   3863 O OE2 . GLU C 1 78  ? 9.274   -45.954 26.534  1.00 18.98 ? 241 GLU C OE2 1 
ATOM   3864 N N   . TYR C 1 79  ? 6.478   -47.290 31.054  1.00 20.57 ? 242 TYR C N   1 
ATOM   3865 C CA  . TYR C 1 79  ? 6.421   -46.453 32.244  1.00 20.58 ? 242 TYR C CA  1 
ATOM   3866 C C   . TYR C 1 79  ? 7.678   -45.572 32.291  1.00 21.18 ? 242 TYR C C   1 
ATOM   3867 O O   . TYR C 1 79  ? 8.809   -46.094 32.275  1.00 19.47 ? 242 TYR C O   1 
ATOM   3868 C CB  . TYR C 1 79  ? 6.365   -47.361 33.495  1.00 20.15 ? 242 TYR C CB  1 
ATOM   3869 C CG  . TYR C 1 79  ? 6.793   -46.703 34.763  1.00 18.99 ? 242 TYR C CG  1 
ATOM   3870 C CD1 . TYR C 1 79  ? 6.099   -45.596 35.266  1.00 19.94 ? 242 TYR C CD1 1 
ATOM   3871 C CD2 . TYR C 1 79  ? 7.896   -47.159 35.466  1.00 21.33 ? 242 TYR C CD2 1 
ATOM   3872 C CE1 . TYR C 1 79  ? 6.518   -44.937 36.396  1.00 22.71 ? 242 TYR C CE1 1 
ATOM   3873 C CE2 . TYR C 1 79  ? 8.311   -46.521 36.603  1.00 19.95 ? 242 TYR C CE2 1 
ATOM   3874 C CZ  . TYR C 1 79  ? 7.609   -45.422 37.082  1.00 22.27 ? 242 TYR C CZ  1 
ATOM   3875 O OH  . TYR C 1 79  ? 8.017   -44.785 38.245  1.00 24.13 ? 242 TYR C OH  1 
ATOM   3876 N N   . ILE C 1 80  ? 7.452   -44.253 32.395  1.00 21.04 ? 243 ILE C N   1 
ATOM   3877 C CA  . ILE C 1 80  ? 8.518   -43.238 32.451  1.00 19.95 ? 243 ILE C CA  1 
ATOM   3878 C C   . ILE C 1 80  ? 8.449   -42.602 33.800  1.00 19.60 ? 243 ILE C C   1 
ATOM   3879 O O   . ILE C 1 80  ? 7.454   -41.961 34.103  1.00 19.86 ? 243 ILE C O   1 
ATOM   3880 C CB  . ILE C 1 80  ? 8.340   -42.176 31.309  1.00 21.97 ? 243 ILE C CB  1 
ATOM   3881 C CG1 . ILE C 1 80  ? 8.330   -42.883 29.932  1.00 19.94 ? 243 ILE C CG1 1 
ATOM   3882 C CG2 . ILE C 1 80  ? 9.469   -41.064 31.377  1.00 21.23 ? 243 ILE C CG2 1 
ATOM   3883 C CD1 . ILE C 1 80  ? 8.099   -41.969 28.743  1.00 24.44 ? 243 ILE C CD1 1 
ATOM   3884 N N   . PRO C 1 81  ? 9.430   -42.888 34.682  1.00 19.01 ? 244 PRO C N   1 
ATOM   3885 C CA  . PRO C 1 81  ? 9.384   -42.406 36.045  1.00 18.75 ? 244 PRO C CA  1 
ATOM   3886 C C   . PRO C 1 81  ? 9.421   -40.895 36.113  1.00 19.72 ? 244 PRO C C   1 
ATOM   3887 O O   . PRO C 1 81  ? 8.796   -40.294 36.990  1.00 19.37 ? 244 PRO C O   1 
ATOM   3888 C CB  . PRO C 1 81  ? 10.679  -42.949 36.628  1.00 19.04 ? 244 PRO C CB  1 
ATOM   3889 C CG  . PRO C 1 81  ? 10.950  -44.180 35.863  1.00 19.42 ? 244 PRO C CG  1 
ATOM   3890 C CD  . PRO C 1 81  ? 10.582  -43.790 34.483  1.00 19.12 ? 244 PRO C CD  1 
ATOM   3891 N N   . LEU C 1 82  ? 10.221  -40.285 35.248  1.00 19.56 ? 245 LEU C N   1 
ATOM   3892 C CA  . LEU C 1 82  ? 10.377  -38.846 35.249  1.00 21.13 ? 245 LEU C CA  1 
ATOM   3893 C C   . LEU C 1 82  ? 10.426  -38.289 33.839  1.00 21.48 ? 245 LEU C C   1 
ATOM   3894 O O   . LEU C 1 82  ? 11.415  -38.445 33.107  1.00 22.30 ? 245 LEU C O   1 
ATOM   3895 C CB  . LEU C 1 82  ? 11.616  -38.441 36.047  1.00 20.72 ? 245 LEU C CB  1 
ATOM   3896 C CG  . LEU C 1 82  ? 11.825  -36.938 36.164  1.00 22.69 ? 245 LEU C CG  1 
ATOM   3897 C CD1 . LEU C 1 82  ? 10.775  -36.257 36.982  1.00 21.57 ? 245 LEU C CD1 1 
ATOM   3898 C CD2 . LEU C 1 82  ? 13.145  -36.780 36.790  1.00 21.79 ? 245 LEU C CD2 1 
ATOM   3899 N N   . ASP C 1 83  ? 9.310   -37.701 33.443  1.00 21.77 ? 246 ASP C N   1 
ATOM   3900 C CA  . ASP C 1 83  ? 9.230   -36.974 32.217  1.00 22.66 ? 246 ASP C CA  1 
ATOM   3901 C C   . ASP C 1 83  ? 9.435   -35.476 32.582  1.00 22.85 ? 246 ASP C C   1 
ATOM   3902 O O   . ASP C 1 83  ? 8.708   -34.931 33.433  1.00 21.34 ? 246 ASP C O   1 
ATOM   3903 C CB  . ASP C 1 83  ? 7.854   -37.191 31.632  1.00 24.03 ? 246 ASP C CB  1 
ATOM   3904 C CG  . ASP C 1 83  ? 7.764   -36.780 30.195  1.00 28.97 ? 246 ASP C CG  1 
ATOM   3905 O OD1 . ASP C 1 83  ? 8.832   -36.479 29.607  1.00 34.75 ? 246 ASP C OD1 1 
ATOM   3906 O OD2 . ASP C 1 83  ? 6.637   -36.783 29.643  1.00 31.52 ? 246 ASP C OD2 1 
ATOM   3907 N N   . GLN C 1 84  ? 10.418  -34.837 31.955  1.00 21.73 ? 247 GLN C N   1 
ATOM   3908 C CA  . GLN C 1 84  ? 10.776  -33.471 32.296  1.00 22.43 ? 247 GLN C CA  1 
ATOM   3909 C C   . GLN C 1 84  ? 10.334  -32.651 31.128  1.00 24.09 ? 247 GLN C C   1 
ATOM   3910 O O   . GLN C 1 84  ? 11.018  -32.624 30.109  1.00 24.44 ? 247 GLN C O   1 
ATOM   3911 C CB  . GLN C 1 84  ? 12.290  -33.335 32.508  1.00 22.01 ? 247 GLN C CB  1 
ATOM   3912 C CG  . GLN C 1 84  ? 12.780  -34.128 33.636  1.00 20.17 ? 247 GLN C CG  1 
ATOM   3913 C CD  . GLN C 1 84  ? 14.281  -34.024 33.861  1.00 23.03 ? 247 GLN C CD  1 
ATOM   3914 O OE1 . GLN C 1 84  ? 14.837  -32.918 33.975  1.00 22.02 ? 247 GLN C OE1 1 
ATOM   3915 N NE2 . GLN C 1 84  ? 14.944  -35.169 33.955  1.00 16.44 ? 247 GLN C NE2 1 
ATOM   3916 N N   . ILE C 1 85  ? 9.199   -31.964 31.274  1.00 23.61 ? 248 ILE C N   1 
ATOM   3917 C CA  . ILE C 1 85  ? 8.553   -31.262 30.152  1.00 24.63 ? 248 ILE C CA  1 
ATOM   3918 C C   . ILE C 1 85  ? 8.870   -29.775 30.235  1.00 23.85 ? 248 ILE C C   1 
ATOM   3919 O O   . ILE C 1 85  ? 8.415   -29.112 31.174  1.00 22.25 ? 248 ILE C O   1 
ATOM   3920 C CB  . ILE C 1 85  ? 7.016   -31.506 30.165  1.00 24.94 ? 248 ILE C CB  1 
ATOM   3921 C CG1 . ILE C 1 85  ? 6.692   -33.026 30.116  1.00 27.20 ? 248 ILE C CG1 1 
ATOM   3922 C CG2 . ILE C 1 85  ? 6.323   -30.801 28.991  1.00 26.27 ? 248 ILE C CG2 1 
ATOM   3923 C CD1 . ILE C 1 85  ? 5.352   -33.399 30.814  1.00 28.60 ? 248 ILE C CD1 1 
ATOM   3924 N N   . ASP C 1 86  ? 9.667   -29.250 29.295  1.00 23.38 ? 249 ASP C N   1 
ATOM   3925 C CA  . ASP C 1 86  ? 9.983   -27.820 29.311  1.00 24.78 ? 249 ASP C CA  1 
ATOM   3926 C C   . ASP C 1 86  ? 8.749   -26.992 29.035  1.00 24.24 ? 249 ASP C C   1 
ATOM   3927 O O   . ASP C 1 86  ? 7.927   -27.356 28.254  1.00 25.73 ? 249 ASP C O   1 
ATOM   3928 C CB  . ASP C 1 86  ? 11.170  -27.381 28.422  1.00 26.13 ? 249 ASP C CB  1 
ATOM   3929 C CG  . ASP C 1 86  ? 12.486  -27.278 29.220  1.00 29.88 ? 249 ASP C CG  1 
ATOM   3930 O OD1 . ASP C 1 86  ? 13.042  -26.152 29.566  1.00 29.60 ? 249 ASP C OD1 1 
ATOM   3931 O OD2 . ASP C 1 86  ? 12.977  -28.387 29.480  1.00 32.71 ? 249 ASP C OD2 1 
ATOM   3932 N N   . ILE C 1 87  ? 8.647   -25.912 29.763  1.00 22.85 ? 250 ILE C N   1 
ATOM   3933 C CA  . ILE C 1 87  ? 7.596   -24.945 29.720  1.00 24.38 ? 250 ILE C CA  1 
ATOM   3934 C C   . ILE C 1 87  ? 8.163   -23.656 29.086  1.00 23.10 ? 250 ILE C C   1 
ATOM   3935 O O   . ILE C 1 87  ? 9.289   -23.194 29.422  1.00 23.21 ? 250 ILE C O   1 
ATOM   3936 C CB  . ILE C 1 87  ? 7.186   -24.738 31.206  1.00 24.59 ? 250 ILE C CB  1 
ATOM   3937 C CG1 . ILE C 1 87  ? 6.143   -25.780 31.596  1.00 28.74 ? 250 ILE C CG1 1 
ATOM   3938 C CG2 . ILE C 1 87  ? 6.796   -23.356 31.573  1.00 26.94 ? 250 ILE C CG2 1 
ATOM   3939 C CD1 . ILE C 1 87  ? 6.015   -25.861 33.101  1.00 31.40 ? 250 ILE C CD1 1 
ATOM   3940 N N   . ASN C 1 88  ? 7.386   -23.090 28.179  1.00 21.15 ? 251 ASN C N   1 
ATOM   3941 C CA  . ASN C 1 88  ? 7.838   -21.962 27.365  1.00 20.76 ? 251 ASN C CA  1 
ATOM   3942 C C   . ASN C 1 88  ? 8.008   -20.669 28.172  1.00 19.74 ? 251 ASN C C   1 
ATOM   3943 O O   . ASN C 1 88  ? 7.033   -20.099 28.679  1.00 20.84 ? 251 ASN C O   1 
ATOM   3944 C CB  . ASN C 1 88  ? 6.894   -21.796 26.177  1.00 20.81 ? 251 ASN C CB  1 
ATOM   3945 C CG  . ASN C 1 88  ? 7.420   -20.826 25.129  1.00 24.94 ? 251 ASN C CG  1 
ATOM   3946 O OD1 . ASN C 1 88  ? 8.468   -20.216 25.286  1.00 25.54 ? 251 ASN C OD1 1 
ATOM   3947 N ND2 . ASN C 1 88  ? 6.691   -20.712 24.039  1.00 29.53 ? 251 ASN C ND2 1 
ATOM   3948 N N   . VAL C 1 89  ? 9.256   -20.201 28.286  1.00 18.06 ? 252 VAL C N   1 
ATOM   3949 C CA  . VAL C 1 89  ? 9.540   -18.878 28.852  1.00 18.00 ? 252 VAL C CA  1 
ATOM   3950 C C   . VAL C 1 89  ? 10.350  -18.025 27.838  1.00 17.68 ? 252 VAL C C   1 
ATOM   3951 O O   . VAL C 1 89  ? 11.115  -17.143 28.195  1.00 18.94 ? 252 VAL C O   1 
ATOM   3952 C CB  . VAL C 1 89  ? 10.278  -18.996 30.209  1.00 17.30 ? 252 VAL C CB  1 
ATOM   3953 C CG1 . VAL C 1 89  ? 9.295   -19.581 31.324  1.00 17.56 ? 252 VAL C CG1 1 
ATOM   3954 C CG2 . VAL C 1 89  ? 11.534  -19.878 30.086  1.00 16.51 ? 252 VAL C CG2 1 
ATOM   3955 N N   . GLY C 1 90  ? 10.218  -18.345 26.575  1.00 18.09 ? 253 GLY C N   1 
ATOM   3956 C CA  . GLY C 1 90  ? 10.747  -17.469 25.558  1.00 18.19 ? 253 GLY C CA  1 
ATOM   3957 C C   . GLY C 1 90  ? 11.991  -17.925 24.809  1.00 18.36 ? 253 GLY C C   1 
ATOM   3958 O O   . GLY C 1 90  ? 12.584  -17.122 24.049  1.00 17.09 ? 253 GLY C O   1 
ATOM   3959 N N   . PHE C 1 91  ? 12.376  -19.190 24.964  1.00 18.07 ? 254 PHE C N   1 
ATOM   3960 C CA  . PHE C 1 91  ? 13.567  -19.682 24.239  1.00 19.08 ? 254 PHE C CA  1 
ATOM   3961 C C   . PHE C 1 91  ? 13.607  -19.328 22.754  1.00 19.69 ? 254 PHE C C   1 
ATOM   3962 O O   . PHE C 1 91  ? 14.607  -18.818 22.223  1.00 18.22 ? 254 PHE C O   1 
ATOM   3963 C CB  . PHE C 1 91  ? 13.749  -21.185 24.402  1.00 19.63 ? 254 PHE C CB  1 
ATOM   3964 C CG  . PHE C 1 91  ? 14.971  -21.725 23.681  1.00 19.05 ? 254 PHE C CG  1 
ATOM   3965 C CD1 . PHE C 1 91  ? 16.244  -21.505 24.193  1.00 17.51 ? 254 PHE C CD1 1 
ATOM   3966 C CD2 . PHE C 1 91  ? 14.832  -22.451 22.511  1.00 19.14 ? 254 PHE C CD2 1 
ATOM   3967 C CE1 . PHE C 1 91  ? 17.367  -21.997 23.533  1.00 18.99 ? 254 PHE C CE1 1 
ATOM   3968 C CE2 . PHE C 1 91  ? 15.947  -22.931 21.843  1.00 18.01 ? 254 PHE C CE2 1 
ATOM   3969 C CZ  . PHE C 1 91  ? 17.206  -22.724 22.376  1.00 15.46 ? 254 PHE C CZ  1 
ATOM   3970 N N   . ASP C 1 92  ? 12.511  -19.584 22.069  1.00 20.88 ? 255 ASP C N   1 
ATOM   3971 C CA  . ASP C 1 92  ? 12.581  -19.491 20.629  1.00 23.03 ? 255 ASP C CA  1 
ATOM   3972 C C   . ASP C 1 92  ? 12.749  -18.045 20.136  1.00 21.54 ? 255 ASP C C   1 
ATOM   3973 O O   . ASP C 1 92  ? 13.290  -17.834 19.063  1.00 19.13 ? 255 ASP C O   1 
ATOM   3974 C CB  . ASP C 1 92  ? 11.515  -20.371 19.892  1.00 25.53 ? 255 ASP C CB  1 
ATOM   3975 C CG  . ASP C 1 92  ? 11.963  -21.934 19.826  1.00 31.00 ? 255 ASP C CG  1 
ATOM   3976 O OD1 . ASP C 1 92  ? 12.864  -22.407 19.024  1.00 25.93 ? 255 ASP C OD1 1 
ATOM   3977 O OD2 . ASP C 1 92  ? 11.379  -22.707 20.636  1.00 38.70 ? 255 ASP C OD2 1 
ATOM   3978 N N   . SER C 1 93  ? 12.357  -17.048 20.932  1.00 20.26 ? 256 SER C N   1 
ATOM   3979 C CA  . SER C 1 93  ? 12.572  -15.652 20.499  1.00 19.67 ? 256 SER C CA  1 
ATOM   3980 C C   . SER C 1 93  ? 13.745  -15.005 21.203  1.00 19.37 ? 256 SER C C   1 
ATOM   3981 O O   . SER C 1 93  ? 14.105  -13.868 20.891  1.00 20.50 ? 256 SER C O   1 
ATOM   3982 C CB  . SER C 1 93  ? 11.291  -14.774 20.646  1.00 20.53 ? 256 SER C CB  1 
ATOM   3983 O OG  . SER C 1 93  ? 10.934  -14.651 22.017  1.00 20.83 ? 256 SER C OG  1 
ATOM   3984 N N   . GLY C 1 94  ? 14.384  -15.697 22.145  1.00 17.10 ? 257 GLY C N   1 
ATOM   3985 C CA  . GLY C 1 94  ? 15.506  -15.122 22.849  1.00 15.88 ? 257 GLY C CA  1 
ATOM   3986 C C   . GLY C 1 94  ? 15.156  -14.375 24.152  1.00 16.99 ? 257 GLY C C   1 
ATOM   3987 O O   . GLY C 1 94  ? 16.024  -13.872 24.838  1.00 15.42 ? 257 GLY C O   1 
ATOM   3988 N N   . ILE C 1 95  ? 13.881  -14.318 24.500  1.00 17.09 ? 258 ILE C N   1 
ATOM   3989 C CA  . ILE C 1 95  ? 13.469  -13.553 25.690  1.00 18.40 ? 258 ILE C CA  1 
ATOM   3990 C C   . ILE C 1 95  ? 13.485  -14.374 26.984  1.00 18.19 ? 258 ILE C C   1 
ATOM   3991 O O   . ILE C 1 95  ? 13.151  -13.845 28.045  1.00 18.17 ? 258 ILE C O   1 
ATOM   3992 C CB  . ILE C 1 95  ? 12.076  -12.835 25.459  1.00 18.90 ? 258 ILE C CB  1 
ATOM   3993 C CG1 . ILE C 1 95  ? 10.964  -13.845 25.236  1.00 21.54 ? 258 ILE C CG1 1 
ATOM   3994 C CG2 . ILE C 1 95  ? 12.150  -11.825 24.243  1.00 17.45 ? 258 ILE C CG2 1 
ATOM   3995 C CD1 . ILE C 1 95  ? 9.688   -13.433 25.868  1.00 28.64 ? 258 ILE C CD1 1 
ATOM   3996 N N   . ASP C 1 96  ? 13.916  -15.653 26.905  1.00 18.12 ? 259 ASP C N   1 
ATOM   3997 C CA  . ASP C 1 96  ? 14.360  -16.442 28.100  1.00 17.98 ? 259 ASP C CA  1 
ATOM   3998 C C   . ASP C 1 96  ? 15.706  -15.870 28.638  1.00 16.68 ? 259 ASP C C   1 
ATOM   3999 O O   . ASP C 1 96  ? 16.141  -16.184 29.745  1.00 16.38 ? 259 ASP C O   1 
ATOM   4000 C CB  . ASP C 1 96  ? 14.562  -17.955 27.728  1.00 16.70 ? 259 ASP C CB  1 
ATOM   4001 C CG  . ASP C 1 96  ? 15.737  -18.145 26.725  1.00 21.62 ? 259 ASP C CG  1 
ATOM   4002 O OD1 . ASP C 1 96  ? 15.696  -17.441 25.700  1.00 20.75 ? 259 ASP C OD1 1 
ATOM   4003 O OD2 . ASP C 1 96  ? 16.726  -18.918 26.978  1.00 23.68 ? 259 ASP C OD2 1 
ATOM   4004 N N   . ARG C 1 97  ? 16.376  -15.031 27.838  1.00 15.86 ? 260 ARG C N   1 
ATOM   4005 C CA  . ARG C 1 97  ? 17.661  -14.483 28.233  1.00 15.66 ? 260 ARG C CA  1 
ATOM   4006 C C   . ARG C 1 97  ? 17.334  -13.224 29.014  1.00 16.50 ? 260 ARG C C   1 
ATOM   4007 O O   . ARG C 1 97  ? 16.540  -12.380 28.522  1.00 17.75 ? 260 ARG C O   1 
ATOM   4008 C CB  . ARG C 1 97  ? 18.468  -14.061 27.003  1.00 14.87 ? 260 ARG C CB  1 
ATOM   4009 C CG  . ARG C 1 97  ? 18.730  -15.229 25.980  1.00 14.82 ? 260 ARG C CG  1 
ATOM   4010 C CD  . ARG C 1 97  ? 19.627  -14.716 24.818  1.00 13.67 ? 260 ARG C CD  1 
ATOM   4011 N NE  . ARG C 1 97  ? 18.970  -13.582 24.140  1.00 18.68 ? 260 ARG C NE  1 
ATOM   4012 C CZ  . ARG C 1 97  ? 19.600  -12.704 23.365  1.00 17.68 ? 260 ARG C CZ  1 
ATOM   4013 N NH1 . ARG C 1 97  ? 18.909  -11.694 22.805  1.00 16.25 ? 260 ARG C NH1 1 
ATOM   4014 N NH2 . ARG C 1 97  ? 20.922  -12.827 23.180  1.00 14.46 ? 260 ARG C NH2 1 
ATOM   4015 N N   . ILE C 1 98  ? 17.914  -13.054 30.181  1.00 15.77 ? 261 ILE C N   1 
ATOM   4016 C CA  . ILE C 1 98  ? 17.503  -11.877 30.990  1.00 17.08 ? 261 ILE C CA  1 
ATOM   4017 C C   . ILE C 1 98  ? 18.678  -11.001 31.341  1.00 16.91 ? 261 ILE C C   1 
ATOM   4018 O O   . ILE C 1 98  ? 19.819  -11.437 31.290  1.00 16.93 ? 261 ILE C O   1 
ATOM   4019 C CB  . ILE C 1 98  ? 16.707  -12.237 32.304  1.00 16.95 ? 261 ILE C CB  1 
ATOM   4020 C CG1 . ILE C 1 98  ? 17.580  -13.071 33.257  1.00 18.28 ? 261 ILE C CG1 1 
ATOM   4021 C CG2 . ILE C 1 98  ? 15.374  -12.986 31.972  1.00 16.45 ? 261 ILE C CG2 1 
ATOM   4022 C CD1 . ILE C 1 98  ? 16.906  -13.285 34.668  1.00 19.73 ? 261 ILE C CD1 1 
ATOM   4023 N N   . PHE C 1 99  ? 18.378  -9.748  31.659  1.00 17.53 ? 262 PHE C N   1 
ATOM   4024 C CA  . PHE C 1 99  ? 19.397  -8.839  32.174  1.00 17.14 ? 262 PHE C CA  1 
ATOM   4025 C C   . PHE C 1 99  ? 18.978  -8.493  33.605  1.00 18.76 ? 262 PHE C C   1 
ATOM   4026 O O   . PHE C 1 99  ? 18.054  -7.676  33.809  1.00 18.79 ? 262 PHE C O   1 
ATOM   4027 C CB  . PHE C 1 99  ? 19.511  -7.601  31.272  1.00 16.40 ? 262 PHE C CB  1 
ATOM   4028 C CG  . PHE C 1 99  ? 20.389  -6.515  31.849  1.00 17.76 ? 262 PHE C CG  1 
ATOM   4029 C CD1 . PHE C 1 99  ? 21.654  -6.811  32.322  1.00 19.69 ? 262 PHE C CD1 1 
ATOM   4030 C CD2 . PHE C 1 99  ? 19.923  -5.209  31.961  1.00 19.73 ? 262 PHE C CD2 1 
ATOM   4031 C CE1 . PHE C 1 99  ? 22.444  -5.809  32.867  1.00 19.14 ? 262 PHE C CE1 1 
ATOM   4032 C CE2 . PHE C 1 99  ? 20.721  -4.196  32.518  1.00 17.81 ? 262 PHE C CE2 1 
ATOM   4033 C CZ  . PHE C 1 99  ? 21.957  -4.502  32.975  1.00 17.58 ? 262 PHE C CZ  1 
ATOM   4034 N N   . LEU C 1 100 ? 19.648  -9.126  34.568  1.00 18.50 ? 263 LEU C N   1 
ATOM   4035 C CA  . LEU C 1 100 ? 19.176  -9.215  35.937  1.00 19.18 ? 263 LEU C CA  1 
ATOM   4036 C C   . LEU C 1 100 ? 19.841  -8.134  36.780  1.00 19.59 ? 263 LEU C C   1 
ATOM   4037 O O   . LEU C 1 100 ? 21.029  -8.224  37.071  1.00 18.34 ? 263 LEU C O   1 
ATOM   4038 C CB  . LEU C 1 100 ? 19.443  -10.619 36.533  1.00 19.15 ? 263 LEU C CB  1 
ATOM   4039 C CG  . LEU C 1 100 ? 18.963  -10.876 37.990  1.00 20.91 ? 263 LEU C CG  1 
ATOM   4040 C CD1 . LEU C 1 100 ? 17.475  -10.546 38.217  1.00 19.88 ? 263 LEU C CD1 1 
ATOM   4041 C CD2 . LEU C 1 100 ? 19.311  -12.350 38.477  1.00 20.19 ? 263 LEU C CD2 1 
ATOM   4042 N N   . VAL C 1 101 ? 19.072  -7.111  37.132  1.00 18.38 ? 264 VAL C N   1 
ATOM   4043 C CA  . VAL C 1 101 ? 19.562  -6.106  38.064  1.00 21.38 ? 264 VAL C CA  1 
ATOM   4044 C C   . VAL C 1 101 ? 18.684  -6.197  39.307  1.00 20.56 ? 264 VAL C C   1 
ATOM   4045 O O   . VAL C 1 101 ? 19.068  -6.789  40.329  1.00 21.06 ? 264 VAL C O   1 
ATOM   4046 C CB  . VAL C 1 101 ? 19.545  -4.681  37.421  1.00 21.05 ? 264 VAL C CB  1 
ATOM   4047 C CG1 . VAL C 1 101 ? 19.983  -3.638  38.412  1.00 23.05 ? 264 VAL C CG1 1 
ATOM   4048 C CG2 . VAL C 1 101 ? 20.409  -4.672  36.142  1.00 24.38 ? 264 VAL C CG2 1 
ATOM   4049 N N   . SER C 1 102 ? 17.484  -5.661  39.181  1.00 20.72 ? 265 SER C N   1 
ATOM   4050 C CA  . SER C 1 102 ? 16.476  -5.784  40.220  1.00 21.31 ? 265 SER C CA  1 
ATOM   4051 C C   . SER C 1 102 ? 15.548  -6.975  39.892  1.00 19.97 ? 265 SER C C   1 
ATOM   4052 O O   . SER C 1 102 ? 15.562  -7.459  38.736  1.00 20.78 ? 265 SER C O   1 
ATOM   4053 C CB  . SER C 1 102 ? 15.725  -4.483  40.320  1.00 22.43 ? 265 SER C CB  1 
ATOM   4054 O OG  . SER C 1 102 ? 15.087  -4.256  39.106  1.00 24.45 ? 265 SER C OG  1 
ATOM   4055 N N   . PRO C 1 103 ? 14.840  -7.527  40.917  1.00 18.79 ? 266 PRO C N   1 
ATOM   4056 C CA  . PRO C 1 103 ? 14.129  -8.780  40.757  1.00 17.50 ? 266 PRO C CA  1 
ATOM   4057 C C   . PRO C 1 103 ? 13.218  -8.773  39.557  1.00 17.85 ? 266 PRO C C   1 
ATOM   4058 O O   . PRO C 1 103 ? 12.496  -7.798  39.341  1.00 16.59 ? 266 PRO C O   1 
ATOM   4059 C CB  . PRO C 1 103 ? 13.308  -8.864  42.052  1.00 17.70 ? 266 PRO C CB  1 
ATOM   4060 C CG  . PRO C 1 103 ? 14.240  -8.320  43.060  1.00 16.96 ? 266 PRO C CG  1 
ATOM   4061 C CD  . PRO C 1 103 ? 14.761  -7.070  42.320  1.00 18.28 ? 266 PRO C CD  1 
ATOM   4062 N N   . ILE C 1 104 ? 13.270  -9.850  38.780  1.00 15.59 ? 267 ILE C N   1 
ATOM   4063 C CA  . ILE C 1 104 ? 12.470  -9.969  37.592  1.00 16.70 ? 267 ILE C CA  1 
ATOM   4064 C C   . ILE C 1 104 ? 11.323  -10.993 37.771  1.00 16.47 ? 267 ILE C C   1 
ATOM   4065 O O   . ILE C 1 104 ? 11.525  -12.082 38.289  1.00 18.27 ? 267 ILE C O   1 
ATOM   4066 C CB  . ILE C 1 104 ? 13.365  -10.395 36.419  1.00 15.98 ? 267 ILE C CB  1 
ATOM   4067 C CG1 . ILE C 1 104 ? 14.400  -9.284  36.176  1.00 17.89 ? 267 ILE C CG1 1 
ATOM   4068 C CG2 . ILE C 1 104 ? 12.518  -10.754 35.155  1.00 15.74 ? 267 ILE C CG2 1 
ATOM   4069 C CD1 . ILE C 1 104 ? 15.273  -9.538  34.970  1.00 16.27 ? 267 ILE C CD1 1 
ATOM   4070 N N   . THR C 1 105 ? 10.134  -10.649 37.317  1.00 16.71 ? 268 THR C N   1 
ATOM   4071 C CA  . THR C 1 105 ? 9.029   -11.606 37.292  1.00 16.14 ? 268 THR C CA  1 
ATOM   4072 C C   . THR C 1 105 ? 9.055   -12.353 35.957  1.00 16.62 ? 268 THR C C   1 
ATOM   4073 O O   . THR C 1 105 ? 8.831   -11.761 34.883  1.00 16.17 ? 268 THR C O   1 
ATOM   4074 C CB  . THR C 1 105 ? 7.682   -10.916 37.480  1.00 16.38 ? 268 THR C CB  1 
ATOM   4075 O OG1 . THR C 1 105 ? 7.703   -10.264 38.764  1.00 16.31 ? 268 THR C OG1 1 
ATOM   4076 C CG2 . THR C 1 105 ? 6.541   -11.965 37.486  1.00 15.12 ? 268 THR C CG2 1 
ATOM   4077 N N   . ILE C 1 106 ? 9.349   -13.647 36.025  1.00 15.94 ? 269 ILE C N   1 
ATOM   4078 C CA  . ILE C 1 106 ? 9.402   -14.522 34.841  1.00 16.30 ? 269 ILE C CA  1 
ATOM   4079 C C   . ILE C 1 106 ? 7.984   -14.954 34.492  1.00 17.32 ? 269 ILE C C   1 
ATOM   4080 O O   . ILE C 1 106 ? 7.169   -15.245 35.359  1.00 17.98 ? 269 ILE C O   1 
ATOM   4081 C CB  . ILE C 1 106 ? 10.312  -15.794 35.063  1.00 15.06 ? 269 ILE C CB  1 
ATOM   4082 C CG1 . ILE C 1 106 ? 11.702  -15.404 35.562  1.00 15.95 ? 269 ILE C CG1 1 
ATOM   4083 C CG2 . ILE C 1 106 ? 10.318  -16.691 33.818  1.00 14.43 ? 269 ILE C CG2 1 
ATOM   4084 C CD1 . ILE C 1 106 ? 12.532  -14.483 34.512  1.00 18.57 ? 269 ILE C CD1 1 
ATOM   4085 N N   . VAL C 1 107 ? 7.662   -14.933 33.213  1.00 18.18 ? 270 VAL C N   1 
ATOM   4086 C CA  . VAL C 1 107 ? 6.289   -15.105 32.758  1.00 19.45 ? 270 VAL C CA  1 
ATOM   4087 C C   . VAL C 1 107 ? 6.129   -16.283 31.769  1.00 19.64 ? 270 VAL C C   1 
ATOM   4088 O O   . VAL C 1 107 ? 6.759   -16.301 30.700  1.00 19.43 ? 270 VAL C O   1 
ATOM   4089 C CB  . VAL C 1 107 ? 5.768   -13.792 32.072  1.00 19.24 ? 270 VAL C CB  1 
ATOM   4090 C CG1 . VAL C 1 107 ? 4.351   -13.994 31.586  1.00 21.81 ? 270 VAL C CG1 1 
ATOM   4091 C CG2 . VAL C 1 107 ? 5.833   -12.597 33.033  1.00 20.50 ? 270 VAL C CG2 1 
ATOM   4092 N N   . HIS C 1 108 ? 5.304   -17.261 32.137  1.00 18.62 ? 271 HIS C N   1 
ATOM   4093 C CA  . HIS C 1 108 ? 4.863   -18.299 31.205  1.00 18.74 ? 271 HIS C CA  1 
ATOM   4094 C C   . HIS C 1 108 ? 3.419   -18.029 30.781  1.00 19.34 ? 271 HIS C C   1 
ATOM   4095 O O   . HIS C 1 108 ? 2.504   -18.148 31.596  1.00 19.20 ? 271 HIS C O   1 
ATOM   4096 C CB  . HIS C 1 108 ? 4.960   -19.677 31.877  1.00 18.80 ? 271 HIS C CB  1 
ATOM   4097 C CG  . HIS C 1 108 ? 4.288   -20.781 31.105  1.00 19.76 ? 271 HIS C CG  1 
ATOM   4098 N ND1 . HIS C 1 108 ? 4.701   -21.170 29.847  1.00 16.48 ? 271 HIS C ND1 1 
ATOM   4099 C CD2 . HIS C 1 108 ? 3.224   -21.561 31.410  1.00 19.19 ? 271 HIS C CD2 1 
ATOM   4100 C CE1 . HIS C 1 108 ? 3.937   -22.163 29.424  1.00 19.16 ? 271 HIS C CE1 1 
ATOM   4101 N NE2 . HIS C 1 108 ? 3.024   -22.407 30.344  1.00 17.82 ? 271 HIS C NE2 1 
ATOM   4102 N N   . GLU C 1 109 ? 3.202   -17.706 29.512  1.00 19.90 ? 272 GLU C N   1 
ATOM   4103 C CA  . GLU C 1 109 ? 1.831   -17.489 29.023  1.00 21.90 ? 272 GLU C CA  1 
ATOM   4104 C C   . GLU C 1 109 ? 1.129   -18.809 28.884  1.00 21.52 ? 272 GLU C C   1 
ATOM   4105 O O   . GLU C 1 109 ? 1.638   -19.701 28.233  1.00 22.15 ? 272 GLU C O   1 
ATOM   4106 C CB  . GLU C 1 109 ? 1.861   -16.768 27.675  1.00 21.92 ? 272 GLU C CB  1 
ATOM   4107 C CG  . GLU C 1 109 ? 0.476   -16.663 27.023  1.00 25.90 ? 272 GLU C CG  1 
ATOM   4108 C CD  . GLU C 1 109 ? 0.528   -16.037 25.612  1.00 34.67 ? 272 GLU C CD  1 
ATOM   4109 O OE1 . GLU C 1 109 ? -0.534  -16.044 24.903  1.00 34.92 ? 272 GLU C OE1 1 
ATOM   4110 O OE2 . GLU C 1 109 ? 1.626   -15.540 25.219  1.00 36.22 ? 272 GLU C OE2 1 
ATOM   4111 N N   . ILE C 1 110 ? -0.053  -18.963 29.483  1.00 23.27 ? 273 ILE C N   1 
ATOM   4112 C CA  . ILE C 1 110 ? -0.729  -20.253 29.421  1.00 22.47 ? 273 ILE C CA  1 
ATOM   4113 C C   . ILE C 1 110 ? -1.564  -20.249 28.148  1.00 23.80 ? 273 ILE C C   1 
ATOM   4114 O O   . ILE C 1 110 ? -2.714  -19.771 28.122  1.00 23.94 ? 273 ILE C O   1 
ATOM   4115 C CB  . ILE C 1 110 ? -1.547  -20.547 30.710  1.00 23.11 ? 273 ILE C CB  1 
ATOM   4116 C CG1 . ILE C 1 110 ? -0.609  -20.538 31.936  1.00 21.24 ? 273 ILE C CG1 1 
ATOM   4117 C CG2 . ILE C 1 110 ? -2.342  -21.915 30.569  1.00 22.51 ? 273 ILE C CG2 1 
ATOM   4118 C CD1 . ILE C 1 110 ? -1.350  -20.463 33.303  1.00 23.07 ? 273 ILE C CD1 1 
ATOM   4119 N N   . ASP C 1 111 ? -0.949  -20.705 27.072  1.00 24.31 ? 274 ASP C N   1 
ATOM   4120 C CA  . ASP C 1 111 ? -1.620  -20.768 25.786  1.00 26.03 ? 274 ASP C CA  1 
ATOM   4121 C C   . ASP C 1 111 ? -1.914  -22.209 25.369  1.00 26.80 ? 274 ASP C C   1 
ATOM   4122 O O   . ASP C 1 111 ? -1.700  -23.139 26.163  1.00 27.03 ? 274 ASP C O   1 
ATOM   4123 C CB  . ASP C 1 111 ? -0.823  -20.012 24.744  1.00 25.94 ? 274 ASP C CB  1 
ATOM   4124 C CG  . ASP C 1 111 ? 0.474   -20.688 24.372  1.00 27.75 ? 274 ASP C CG  1 
ATOM   4125 O OD1 . ASP C 1 111 ? 0.848   -21.749 24.960  1.00 29.47 ? 274 ASP C OD1 1 
ATOM   4126 O OD2 . ASP C 1 111 ? 1.128   -20.136 23.455  1.00 28.42 ? 274 ASP C OD2 1 
ATOM   4127 N N   . GLU C 1 112 ? -2.399  -22.420 24.148  1.00 28.29 ? 275 GLU C N   1 
ATOM   4128 C CA  . GLU C 1 112 ? -2.786  -23.795 23.755  1.00 30.28 ? 275 GLU C CA  1 
ATOM   4129 C C   . GLU C 1 112 ? -1.652  -24.809 23.850  1.00 29.86 ? 275 GLU C C   1 
ATOM   4130 O O   . GLU C 1 112 ? -1.922  -25.982 24.065  1.00 29.24 ? 275 GLU C O   1 
ATOM   4131 C CB  . GLU C 1 112 ? -3.577  -23.890 22.435  1.00 31.32 ? 275 GLU C CB  1 
ATOM   4132 C CG  . GLU C 1 112 ? -2.907  -23.357 21.157  1.00 38.22 ? 275 GLU C CG  1 
ATOM   4133 C CD  . GLU C 1 112 ? -2.366  -21.926 21.272  1.00 47.58 ? 275 GLU C CD  1 
ATOM   4134 O OE1 . GLU C 1 112 ? -1.259  -21.691 20.681  1.00 50.91 ? 275 GLU C OE1 1 
ATOM   4135 O OE2 . GLU C 1 112 ? -3.027  -21.051 21.946  1.00 48.40 ? 275 GLU C OE2 1 
ATOM   4136 N N   . ASP C 1 113 ? -0.393  -24.357 23.775  1.00 29.01 ? 276 ASP C N   1 
ATOM   4137 C CA  . ASP C 1 113 ? 0.764   -25.264 23.890  1.00 28.50 ? 276 ASP C CA  1 
ATOM   4138 C C   . ASP C 1 113 ? 1.252   -25.489 25.324  1.00 27.58 ? 276 ASP C C   1 
ATOM   4139 O O   . ASP C 1 113 ? 2.150   -26.330 25.588  1.00 28.11 ? 276 ASP C O   1 
ATOM   4140 C CB  . ASP C 1 113 ? 1.946   -24.759 23.042  1.00 29.39 ? 276 ASP C CB  1 
ATOM   4141 C CG  . ASP C 1 113 ? 1.603   -24.603 21.563  1.00 33.48 ? 276 ASP C CG  1 
ATOM   4142 O OD1 . ASP C 1 113 ? 0.829   -25.404 20.999  1.00 37.37 ? 276 ASP C OD1 1 
ATOM   4143 O OD2 . ASP C 1 113 ? 2.131   -23.654 20.945  1.00 40.02 ? 276 ASP C OD2 1 
ATOM   4144 N N   . SER C 1 114 ? 0.680   -24.750 26.277  1.00 25.88 ? 277 SER C N   1 
ATOM   4145 C CA  . SER C 1 114 ? 1.090   -24.913 27.631  1.00 23.48 ? 277 SER C CA  1 
ATOM   4146 C C   . SER C 1 114 ? 0.482   -26.174 28.248  1.00 24.69 ? 277 SER C C   1 
ATOM   4147 O O   . SER C 1 114 ? -0.714  -26.446 28.062  1.00 24.17 ? 277 SER C O   1 
ATOM   4148 C CB  . SER C 1 114 ? 0.714   -23.687 28.476  1.00 23.13 ? 277 SER C CB  1 
ATOM   4149 O OG  . SER C 1 114 ? 0.841   -24.017 29.866  1.00 21.47 ? 277 SER C OG  1 
ATOM   4150 N N   . PRO C 1 115 ? 1.285   -26.900 29.055  1.00 24.63 ? 278 PRO C N   1 
ATOM   4151 C CA  . PRO C 1 115 ? 0.822   -28.013 29.879  1.00 24.92 ? 278 PRO C CA  1 
ATOM   4152 C C   . PRO C 1 115 ? -0.306  -27.598 30.798  1.00 25.46 ? 278 PRO C C   1 
ATOM   4153 O O   . PRO C 1 115 ? -1.026  -28.448 31.292  1.00 26.16 ? 278 PRO C O   1 
ATOM   4154 C CB  . PRO C 1 115 ? 2.051   -28.353 30.747  1.00 26.24 ? 278 PRO C CB  1 
ATOM   4155 C CG  . PRO C 1 115 ? 3.209   -27.845 30.007  1.00 24.16 ? 278 PRO C CG  1 
ATOM   4156 C CD  . PRO C 1 115 ? 2.731   -26.653 29.223  1.00 24.35 ? 278 PRO C CD  1 
ATOM   4157 N N   . LEU C 1 116 ? -0.462  -26.304 31.048  1.00 25.13 ? 279 LEU C N   1 
ATOM   4158 C CA  . LEU C 1 116 ? -1.472  -25.858 31.996  1.00 25.10 ? 279 LEU C CA  1 
ATOM   4159 C C   . LEU C 1 116 ? -2.769  -25.357 31.340  1.00 24.78 ? 279 LEU C C   1 
ATOM   4160 O O   . LEU C 1 116 ? -3.691  -24.946 32.043  1.00 23.40 ? 279 LEU C O   1 
ATOM   4161 C CB  . LEU C 1 116 ? -0.898  -24.762 32.892  1.00 26.07 ? 279 LEU C CB  1 
ATOM   4162 C CG  . LEU C 1 116 ? 0.450   -24.962 33.628  1.00 28.38 ? 279 LEU C CG  1 
ATOM   4163 C CD1 . LEU C 1 116 ? 0.610   -23.809 34.570  1.00 30.44 ? 279 LEU C CD1 1 
ATOM   4164 C CD2 . LEU C 1 116 ? 0.418   -26.270 34.438  1.00 33.75 ? 279 LEU C CD2 1 
ATOM   4165 N N   . TYR C 1 117 ? -2.809  -25.342 30.007  1.00 24.43 ? 280 TYR C N   1 
ATOM   4166 C CA  . TYR C 1 117 ? -3.947  -24.798 29.248  1.00 25.65 ? 280 TYR C CA  1 
ATOM   4167 C C   . TYR C 1 117 ? -5.331  -25.202 29.793  1.00 26.86 ? 280 TYR C C   1 
ATOM   4168 O O   . TYR C 1 117 ? -6.233  -24.370 29.882  1.00 26.27 ? 280 TYR C O   1 
ATOM   4169 C CB  . TYR C 1 117 ? -3.808  -25.207 27.810  1.00 25.56 ? 280 TYR C CB  1 
ATOM   4170 C CG  . TYR C 1 117 ? -4.719  -24.496 26.847  1.00 28.01 ? 280 TYR C CG  1 
ATOM   4171 C CD1 . TYR C 1 117 ? -4.809  -23.097 26.851  1.00 29.82 ? 280 TYR C CD1 1 
ATOM   4172 C CD2 . TYR C 1 117 ? -5.454  -25.218 25.881  1.00 29.19 ? 280 TYR C CD2 1 
ATOM   4173 C CE1 . TYR C 1 117 ? -5.594  -22.415 25.948  1.00 28.51 ? 280 TYR C CE1 1 
ATOM   4174 C CE2 . TYR C 1 117 ? -6.273  -24.536 24.947  1.00 28.68 ? 280 TYR C CE2 1 
ATOM   4175 C CZ  . TYR C 1 117 ? -6.334  -23.139 25.004  1.00 32.07 ? 280 TYR C CZ  1 
ATOM   4176 O OH  . TYR C 1 117 ? -7.100  -22.423 24.113  1.00 30.95 ? 280 TYR C OH  1 
ATOM   4177 N N   . ASP C 1 118 ? -5.473  -26.449 30.238  1.00 28.10 ? 281 ASP C N   1 
ATOM   4178 C CA  . ASP C 1 118 ? -6.775  -26.914 30.651  1.00 30.31 ? 281 ASP C CA  1 
ATOM   4179 C C   . ASP C 1 118 ? -7.036  -26.846 32.155  1.00 30.17 ? 281 ASP C C   1 
ATOM   4180 O O   . ASP C 1 118 ? -8.056  -27.339 32.610  1.00 29.86 ? 281 ASP C O   1 
ATOM   4181 C CB  . ASP C 1 118 ? -7.052  -28.313 30.091  1.00 31.56 ? 281 ASP C CB  1 
ATOM   4182 C CG  . ASP C 1 118 ? -8.516  -28.488 29.690  1.00 38.33 ? 281 ASP C CG  1 
ATOM   4183 O OD1 . ASP C 1 118 ? -8.923  -27.969 28.617  1.00 43.09 ? 281 ASP C OD1 1 
ATOM   4184 O OD2 . ASP C 1 118 ? -9.277  -29.110 30.473  1.00 46.09 ? 281 ASP C OD2 1 
ATOM   4185 N N   . LEU C 1 119 ? -6.149  -26.210 32.926  1.00 29.36 ? 282 LEU C N   1 
ATOM   4186 C CA  . LEU C 1 119 ? -6.293  -26.206 34.373  1.00 29.22 ? 282 LEU C CA  1 
ATOM   4187 C C   . LEU C 1 119 ? -6.951  -24.933 34.929  1.00 28.49 ? 282 LEU C C   1 
ATOM   4188 O O   . LEU C 1 119 ? -6.485  -23.831 34.691  1.00 27.13 ? 282 LEU C O   1 
ATOM   4189 C CB  . LEU C 1 119 ? -4.947  -26.487 35.055  1.00 30.14 ? 282 LEU C CB  1 
ATOM   4190 C CG  . LEU C 1 119 ? -4.159  -27.726 34.540  1.00 31.86 ? 282 LEU C CG  1 
ATOM   4191 C CD1 . LEU C 1 119 ? -2.980  -27.942 35.469  1.00 33.75 ? 282 LEU C CD1 1 
ATOM   4192 C CD2 . LEU C 1 119 ? -4.971  -29.054 34.401  1.00 33.03 ? 282 LEU C CD2 1 
ATOM   4193 N N   . SER C 1 120 ? -8.054  -25.131 35.653  1.00 27.06 ? 283 SER C N   1 
ATOM   4194 C CA  . SER C 1 120 ? -8.802  -24.098 36.356  1.00 25.13 ? 283 SER C CA  1 
ATOM   4195 C C   . SER C 1 120 ? -8.238  -24.020 37.757  1.00 25.00 ? 283 SER C C   1 
ATOM   4196 O O   . SER C 1 120 ? -7.390  -24.825 38.099  1.00 23.46 ? 283 SER C O   1 
ATOM   4197 C CB  . SER C 1 120 ? -10.281 -24.508 36.402  1.00 25.22 ? 283 SER C CB  1 
ATOM   4198 O OG  . SER C 1 120 ? -10.458 -25.597 37.285  1.00 25.93 ? 283 SER C OG  1 
ATOM   4199 N N   . LYS C 1 121 ? -8.684  -23.047 38.565  1.00 25.78 ? 284 LYS C N   1 
ATOM   4200 C CA  . LYS C 1 121 ? -8.231  -22.919 39.949  1.00 27.75 ? 284 LYS C CA  1 
ATOM   4201 C C   . LYS C 1 121 ? -8.529  -24.191 40.769  1.00 28.80 ? 284 LYS C C   1 
ATOM   4202 O O   . LYS C 1 121 ? -7.694  -24.639 41.578  1.00 27.18 ? 284 LYS C O   1 
ATOM   4203 C CB  . LYS C 1 121 ? -8.836  -21.668 40.623  1.00 27.58 ? 284 LYS C CB  1 
ATOM   4204 C CG  . LYS C 1 121 ? -8.699  -21.658 42.148  1.00 30.27 ? 284 LYS C CG  1 
ATOM   4205 C CD  . LYS C 1 121 ? -8.815  -20.253 42.787  1.00 33.64 ? 284 LYS C CD  1 
ATOM   4206 C CE  . LYS C 1 121 ? -8.471  -20.318 44.264  1.00 36.14 ? 284 LYS C CE  1 
ATOM   4207 N NZ  . LYS C 1 121 ? -8.942  -21.580 44.936  1.00 38.63 ? 284 LYS C NZ  1 
ATOM   4208 N N   . GLN C 1 122 ? -9.725  -24.749 40.560  1.00 30.77 ? 285 GLN C N   1 
ATOM   4209 C CA  . GLN C 1 122 ? -10.121 -26.006 41.220  1.00 33.74 ? 285 GLN C CA  1 
ATOM   4210 C C   . GLN C 1 122 ? -9.173  -27.160 40.864  1.00 34.31 ? 285 GLN C C   1 
ATOM   4211 O O   . GLN C 1 122 ? -8.755  -27.899 41.750  1.00 35.26 ? 285 GLN C O   1 
ATOM   4212 C CB  . GLN C 1 122 ? -11.575 -26.376 40.868  1.00 34.25 ? 285 GLN C CB  1 
ATOM   4213 C CG  . GLN C 1 122 ? -12.189 -27.444 41.783  1.00 37.95 ? 285 GLN C CG  1 
ATOM   4214 C CD  . GLN C 1 122 ? -13.708 -27.502 41.642  1.00 42.49 ? 285 GLN C CD  1 
ATOM   4215 O OE1 . GLN C 1 122 ? -14.248 -28.415 41.019  1.00 46.06 ? 285 GLN C OE1 1 
ATOM   4216 N NE2 . GLN C 1 122 ? -14.397 -26.498 42.188  1.00 44.21 ? 285 GLN C NE2 1 
ATOM   4217 N N   . ASP C 1 123 ? -8.829  -27.295 39.578  1.00 34.73 ? 286 ASP C N   1 
ATOM   4218 C CA  . ASP C 1 123 ? -7.906  -28.313 39.088  1.00 35.29 ? 286 ASP C CA  1 
ATOM   4219 C C   . ASP C 1 123 ? -6.583  -28.172 39.822  1.00 35.92 ? 286 ASP C C   1 
ATOM   4220 O O   . ASP C 1 123 ? -6.105  -29.129 40.444  1.00 36.19 ? 286 ASP C O   1 
ATOM   4221 C CB  . ASP C 1 123 ? -7.670  -28.172 37.563  1.00 35.56 ? 286 ASP C CB  1 
ATOM   4222 C CG  . ASP C 1 123 ? -8.886  -28.612 36.721  1.00 37.30 ? 286 ASP C CG  1 
ATOM   4223 O OD1 . ASP C 1 123 ? -9.236  -27.962 35.697  1.00 37.02 ? 286 ASP C OD1 1 
ATOM   4224 O OD2 . ASP C 1 123 ? -9.489  -29.631 37.082  1.00 40.07 ? 286 ASP C OD2 1 
ATOM   4225 N N   . ILE C 1 124 ? -6.000  -26.967 39.775  1.00 36.03 ? 287 ILE C N   1 
ATOM   4226 C CA  . ILE C 1 124 ? -4.738  -26.714 40.483  1.00 36.15 ? 287 ILE C CA  1 
ATOM   4227 C C   . ILE C 1 124 ? -4.846  -27.055 41.987  1.00 35.98 ? 287 ILE C C   1 
ATOM   4228 O O   . ILE C 1 124 ? -3.958  -27.684 42.522  1.00 34.78 ? 287 ILE C O   1 
ATOM   4229 C CB  . ILE C 1 124 ? -4.205  -25.275 40.280  1.00 35.15 ? 287 ILE C CB  1 
ATOM   4230 C CG1 . ILE C 1 124 ? -4.140  -24.908 38.792  1.00 36.89 ? 287 ILE C CG1 1 
ATOM   4231 C CG2 . ILE C 1 124 ? -2.797  -25.147 40.844  1.00 36.38 ? 287 ILE C CG2 1 
ATOM   4232 C CD1 . ILE C 1 124 ? -2.788  -25.143 38.106  1.00 37.94 ? 287 ILE C CD1 1 
ATOM   4233 N N   . ASP C 1 125 ? -5.932  -26.634 42.642  1.00 37.17 ? 288 ASP C N   1 
ATOM   4234 C CA  . ASP C 1 125 ? -6.190  -26.956 44.068  1.00 38.43 ? 288 ASP C CA  1 
ATOM   4235 C C   . ASP C 1 125 ? -6.103  -28.463 44.345  1.00 39.00 ? 288 ASP C C   1 
ATOM   4236 O O   . ASP C 1 125 ? -5.709  -28.886 45.418  1.00 39.03 ? 288 ASP C O   1 
ATOM   4237 C CB  . ASP C 1 125 ? -7.577  -26.469 44.508  1.00 38.88 ? 288 ASP C CB  1 
ATOM   4238 C CG  . ASP C 1 125 ? -7.619  -24.966 44.846  1.00 41.70 ? 288 ASP C CG  1 
ATOM   4239 O OD1 . ASP C 1 125 ? -6.549  -24.327 44.985  1.00 46.26 ? 288 ASP C OD1 1 
ATOM   4240 O OD2 . ASP C 1 125 ? -8.740  -24.414 44.989  1.00 44.61 ? 288 ASP C OD2 1 
ATOM   4241 N N   . ASN C 1 126 ? -6.458  -29.264 43.349  1.00 38.79 ? 289 ASN C N   1 
ATOM   4242 C CA  . ASN C 1 126 ? -6.499  -30.706 43.472  1.00 39.14 ? 289 ASN C CA  1 
ATOM   4243 C C   . ASN C 1 126 ? -5.272  -31.426 42.970  1.00 37.69 ? 289 ASN C C   1 
ATOM   4244 O O   . ASN C 1 126 ? -5.257  -32.635 42.992  1.00 37.27 ? 289 ASN C O   1 
ATOM   4245 C CB  . ASN C 1 126 ? -7.611  -31.238 42.567  1.00 39.89 ? 289 ASN C CB  1 
ATOM   4246 C CG  . ASN C 1 126 ? -8.960  -31.256 43.222  1.00 41.48 ? 289 ASN C CG  1 
ATOM   4247 O OD1 . ASN C 1 126 ? -9.869  -31.889 42.682  1.00 44.80 ? 289 ASN C OD1 1 
ATOM   4248 N ND2 . ASN C 1 126 ? -9.125  -30.550 44.364  1.00 43.22 ? 289 ASN C ND2 1 
ATOM   4249 N N   . ALA C 1 127 ? -4.290  -30.707 42.431  1.00 36.80 ? 290 ALA C N   1 
ATOM   4250 C CA  . ALA C 1 127 ? -3.270  -31.366 41.607  1.00 35.12 ? 290 ALA C CA  1 
ATOM   4251 C C   . ALA C 1 127 ? -2.022  -31.652 42.418  1.00 33.88 ? 290 ALA C C   1 
ATOM   4252 O O   . ALA C 1 127 ? -1.886  -31.145 43.541  1.00 33.39 ? 290 ALA C O   1 
ATOM   4253 C CB  . ALA C 1 127 ? -2.971  -30.560 40.350  1.00 35.94 ? 290 ALA C CB  1 
ATOM   4254 N N   . ASP C 1 128 ? -1.130  -32.493 41.879  1.00 32.78 ? 291 ASP C N   1 
ATOM   4255 C CA  . ASP C 1 128 ? 0.053   -32.890 42.643  1.00 32.50 ? 291 ASP C CA  1 
ATOM   4256 C C   . ASP C 1 128 ? 1.378   -32.672 41.903  1.00 31.15 ? 291 ASP C C   1 
ATOM   4257 O O   . ASP C 1 128 ? 2.442   -33.180 42.331  1.00 31.99 ? 291 ASP C O   1 
ATOM   4258 C CB  . ASP C 1 128 ? -0.072  -34.341 43.206  1.00 33.62 ? 291 ASP C CB  1 
ATOM   4259 C CG  . ASP C 1 128 ? 0.063   -35.417 42.135  1.00 38.86 ? 291 ASP C CG  1 
ATOM   4260 O OD1 . ASP C 1 128 ? -0.199  -35.151 40.932  1.00 44.38 ? 291 ASP C OD1 1 
ATOM   4261 O OD2 . ASP C 1 128 ? 0.429   -36.559 42.496  1.00 44.73 ? 291 ASP C OD2 1 
ATOM   4262 N N   . PHE C 1 129 ? 1.328   -31.900 40.822  1.00 27.64 ? 292 PHE C N   1 
ATOM   4263 C CA  . PHE C 1 129 ? 2.474   -31.797 39.923  1.00 25.77 ? 292 PHE C CA  1 
ATOM   4264 C C   . PHE C 1 129 ? 3.530   -30.894 40.544  1.00 22.81 ? 292 PHE C C   1 
ATOM   4265 O O   . PHE C 1 129 ? 3.274   -30.262 41.559  1.00 21.19 ? 292 PHE C O   1 
ATOM   4266 C CB  . PHE C 1 129 ? 2.053   -31.299 38.535  1.00 25.55 ? 292 PHE C CB  1 
ATOM   4267 C CG  . PHE C 1 129 ? 1.423   -29.931 38.538  1.00 28.90 ? 292 PHE C CG  1 
ATOM   4268 C CD1 . PHE C 1 129 ? 2.223   -28.774 38.575  1.00 26.60 ? 292 PHE C CD1 1 
ATOM   4269 C CD2 . PHE C 1 129 ? 0.038   -29.790 38.421  1.00 29.22 ? 292 PHE C CD2 1 
ATOM   4270 C CE1 . PHE C 1 129 ? 1.649   -27.493 38.574  1.00 29.62 ? 292 PHE C CE1 1 
ATOM   4271 C CE2 . PHE C 1 129 ? -0.556  -28.514 38.397  1.00 31.71 ? 292 PHE C CE2 1 
ATOM   4272 C CZ  . PHE C 1 129 ? 0.254   -27.354 38.470  1.00 31.39 ? 292 PHE C CZ  1 
ATOM   4273 N N   . GLU C 1 130 ? 4.716   -30.870 39.929  1.00 21.56 ? 293 GLU C N   1 
ATOM   4274 C CA  . GLU C 1 130 ? 5.824   -30.072 40.411  1.00 18.74 ? 293 GLU C CA  1 
ATOM   4275 C C   . GLU C 1 130 ? 6.467   -29.337 39.231  1.00 18.52 ? 293 GLU C C   1 
ATOM   4276 O O   . GLU C 1 130 ? 6.734   -29.944 38.163  1.00 18.22 ? 293 GLU C O   1 
ATOM   4277 C CB  . GLU C 1 130 ? 6.855   -30.945 41.134  1.00 19.27 ? 293 GLU C CB  1 
ATOM   4278 C CG  . GLU C 1 130 ? 8.159   -30.172 41.613  1.00 16.94 ? 293 GLU C CG  1 
ATOM   4279 C CD  . GLU C 1 130 ? 9.117   -31.056 42.390  1.00 18.87 ? 293 GLU C CD  1 
ATOM   4280 O OE1 . GLU C 1 130 ? 10.133  -30.553 42.926  1.00 22.82 ? 293 GLU C OE1 1 
ATOM   4281 O OE2 . GLU C 1 130 ? 8.864   -32.281 42.532  1.00 21.94 ? 293 GLU C OE2 1 
ATOM   4282 N N   . ILE C 1 131 ? 6.655   -28.029 39.398  1.00 17.12 ? 294 ILE C N   1 
ATOM   4283 C CA  . ILE C 1 131 ? 7.353   -27.214 38.389  1.00 17.67 ? 294 ILE C CA  1 
ATOM   4284 C C   . ILE C 1 131 ? 8.727   -26.828 38.922  1.00 17.35 ? 294 ILE C C   1 
ATOM   4285 O O   . ILE C 1 131 ? 8.821   -26.158 39.940  1.00 18.53 ? 294 ILE C O   1 
ATOM   4286 C CB  . ILE C 1 131 ? 6.512   -26.013 37.959  1.00 18.37 ? 294 ILE C CB  1 
ATOM   4287 C CG1 . ILE C 1 131 ? 5.214   -26.520 37.275  1.00 17.18 ? 294 ILE C CG1 1 
ATOM   4288 C CG2 . ILE C 1 131 ? 7.336   -25.064 36.996  1.00 15.58 ? 294 ILE C CG2 1 
ATOM   4289 C CD1 . ILE C 1 131 ? 4.239   -25.451 36.835  1.00 17.80 ? 294 ILE C CD1 1 
ATOM   4290 N N   . VAL C 1 132 ? 9.797   -27.264 38.276  1.00 16.12 ? 295 VAL C N   1 
ATOM   4291 C CA  . VAL C 1 132 ? 11.124  -26.823 38.704  1.00 17.20 ? 295 VAL C CA  1 
ATOM   4292 C C   . VAL C 1 132 ? 11.459  -25.589 37.864  1.00 16.87 ? 295 VAL C C   1 
ATOM   4293 O O   . VAL C 1 132 ? 11.109  -25.560 36.679  1.00 17.15 ? 295 VAL C O   1 
ATOM   4294 C CB  . VAL C 1 132 ? 12.216  -27.941 38.475  1.00 19.50 ? 295 VAL C CB  1 
ATOM   4295 C CG1 . VAL C 1 132 ? 13.651  -27.440 38.845  1.00 19.27 ? 295 VAL C CG1 1 
ATOM   4296 C CG2 . VAL C 1 132 ? 11.890  -29.176 39.314  1.00 21.95 ? 295 VAL C CG2 1 
ATOM   4297 N N   . VAL C 1 133 ? 12.090  -24.578 38.473  1.00 16.28 ? 296 VAL C N   1 
ATOM   4298 C CA  . VAL C 1 133 ? 12.460  -23.361 37.774  1.00 16.51 ? 296 VAL C CA  1 
ATOM   4299 C C   . VAL C 1 133 ? 13.946  -23.208 37.952  1.00 16.91 ? 296 VAL C C   1 
ATOM   4300 O O   . VAL C 1 133 ? 14.484  -23.596 38.982  1.00 17.29 ? 296 VAL C O   1 
ATOM   4301 C CB  . VAL C 1 133 ? 11.721  -22.102 38.326  1.00 17.26 ? 296 VAL C CB  1 
ATOM   4302 C CG1 . VAL C 1 133 ? 10.199  -22.135 37.936  1.00 13.52 ? 296 VAL C CG1 1 
ATOM   4303 C CG2 . VAL C 1 133 ? 11.912  -21.998 39.822  1.00 16.16 ? 296 VAL C CG2 1 
ATOM   4304 N N   . ILE C 1 134 ? 14.617  -22.656 36.941  1.00 16.99 ? 297 ILE C N   1 
ATOM   4305 C CA  . ILE C 1 134 ? 16.065  -22.600 36.961  1.00 17.59 ? 297 ILE C CA  1 
ATOM   4306 C C   . ILE C 1 134 ? 16.522  -21.271 36.400  1.00 16.29 ? 297 ILE C C   1 
ATOM   4307 O O   . ILE C 1 134 ? 15.883  -20.740 35.511  1.00 15.07 ? 297 ILE C O   1 
ATOM   4308 C CB  . ILE C 1 134 ? 16.626  -23.744 36.041  1.00 18.33 ? 297 ILE C CB  1 
ATOM   4309 C CG1 . ILE C 1 134 ? 16.401  -25.119 36.672  1.00 20.51 ? 297 ILE C CG1 1 
ATOM   4310 C CG2 . ILE C 1 134 ? 18.075  -23.568 35.752  1.00 19.75 ? 297 ILE C CG2 1 
ATOM   4311 C CD1 . ILE C 1 134 ? 16.466  -26.253 35.567  1.00 24.51 ? 297 ILE C CD1 1 
ATOM   4312 N N   . LEU C 1 135 ? 17.650  -20.781 36.918  1.00 15.06 ? 298 LEU C N   1 
ATOM   4313 C CA  . LEU C 1 135 ? 18.301  -19.574 36.402  1.00 15.49 ? 298 LEU C CA  1 
ATOM   4314 C C   . LEU C 1 135 ? 19.738  -19.967 36.336  1.00 15.89 ? 298 LEU C C   1 
ATOM   4315 O O   . LEU C 1 135 ? 20.294  -20.408 37.355  1.00 16.68 ? 298 LEU C O   1 
ATOM   4316 C CB  . LEU C 1 135 ? 18.145  -18.391 37.372  1.00 13.23 ? 298 LEU C CB  1 
ATOM   4317 C CG  . LEU C 1 135 ? 19.021  -17.147 37.038  1.00 17.28 ? 298 LEU C CG  1 
ATOM   4318 C CD1 . LEU C 1 135 ? 18.699  -16.569 35.645  1.00 10.17 ? 298 LEU C CD1 1 
ATOM   4319 C CD2 . LEU C 1 135 ? 18.818  -16.106 38.138  1.00 19.39 ? 298 LEU C CD2 1 
ATOM   4320 N N   . GLU C 1 136 ? 20.315  -19.855 35.129  1.00 16.87 ? 299 GLU C N   1 
ATOM   4321 C CA  . GLU C 1 136 ? 21.697  -20.190 34.848  1.00 17.36 ? 299 GLU C CA  1 
ATOM   4322 C C   . GLU C 1 136 ? 22.405  -18.944 34.304  1.00 18.35 ? 299 GLU C C   1 
ATOM   4323 O O   . GLU C 1 136 ? 21.787  -18.082 33.696  1.00 17.85 ? 299 GLU C O   1 
ATOM   4324 C CB  . GLU C 1 136 ? 21.799  -21.364 33.825  1.00 17.90 ? 299 GLU C CB  1 
ATOM   4325 C CG  . GLU C 1 136 ? 21.298  -22.703 34.427  1.00 18.52 ? 299 GLU C CG  1 
ATOM   4326 C CD  . GLU C 1 136 ? 21.174  -23.850 33.413  1.00 21.02 ? 299 GLU C CD  1 
ATOM   4327 O OE1 . GLU C 1 136 ? 20.436  -23.705 32.428  1.00 22.40 ? 299 GLU C OE1 1 
ATOM   4328 O OE2 . GLU C 1 136 ? 21.728  -24.944 33.674  1.00 22.14 ? 299 GLU C OE2 1 
ATOM   4329 N N   . GLY C 1 137 ? 23.697  -18.857 34.552  1.00 18.59 ? 300 GLY C N   1 
ATOM   4330 C CA  . GLY C 1 137 ? 24.554  -17.891 33.848  1.00 18.82 ? 300 GLY C CA  1 
ATOM   4331 C C   . GLY C 1 137 ? 25.882  -18.028 34.548  1.00 19.58 ? 300 GLY C C   1 
ATOM   4332 O O   . GLY C 1 137 ? 26.058  -18.960 35.337  1.00 19.23 ? 300 GLY C O   1 
ATOM   4333 N N   . MET C 1 138 ? 26.791  -17.081 34.318  1.00 18.94 ? 301 MET C N   1 
ATOM   4334 C CA  . MET C 1 138 ? 28.104  -17.107 34.942  1.00 19.37 ? 301 MET C CA  1 
ATOM   4335 C C   . MET C 1 138 ? 28.373  -15.781 35.631  1.00 19.52 ? 301 MET C C   1 
ATOM   4336 O O   . MET C 1 138 ? 28.255  -14.737 35.005  1.00 18.35 ? 301 MET C O   1 
ATOM   4337 C CB  . MET C 1 138 ? 29.199  -17.300 33.885  1.00 19.09 ? 301 MET C CB  1 
ATOM   4338 C CG  . MET C 1 138 ? 30.588  -17.432 34.472  1.00 21.45 ? 301 MET C CG  1 
ATOM   4339 S SD  . MET C 1 138 ? 31.771  -18.181 33.290  1.00 26.60 ? 301 MET C SD  1 
ATOM   4340 C CE  . MET C 1 138 ? 33.306  -17.590 33.993  1.00 27.25 ? 301 MET C CE  1 
ATOM   4341 N N   . VAL C 1 139 ? 28.761  -15.811 36.902  1.00 20.25 ? 302 VAL C N   1 
ATOM   4342 C CA  . VAL C 1 139 ? 29.037  -14.534 37.580  1.00 20.69 ? 302 VAL C CA  1 
ATOM   4343 C C   . VAL C 1 139 ? 30.417  -13.981 37.153  1.00 21.01 ? 302 VAL C C   1 
ATOM   4344 O O   . VAL C 1 139 ? 31.409  -14.689 37.206  1.00 21.14 ? 302 VAL C O   1 
ATOM   4345 C CB  . VAL C 1 139 ? 28.818  -14.634 39.095  1.00 20.67 ? 302 VAL C CB  1 
ATOM   4346 C CG1 . VAL C 1 139 ? 29.257  -13.344 39.796  1.00 22.79 ? 302 VAL C CG1 1 
ATOM   4347 C CG2 . VAL C 1 139 ? 27.307  -14.934 39.386  1.00 22.58 ? 302 VAL C CG2 1 
ATOM   4348 N N   . GLU C 1 140 ? 30.440  -12.749 36.658  1.00 20.94 ? 303 GLU C N   1 
ATOM   4349 C CA  . GLU C 1 140 ? 31.638  -12.191 36.040  1.00 22.55 ? 303 GLU C CA  1 
ATOM   4350 C C   . GLU C 1 140 ? 32.866  -12.187 36.984  1.00 22.66 ? 303 GLU C C   1 
ATOM   4351 O O   . GLU C 1 140 ? 33.901  -12.772 36.658  1.00 22.01 ? 303 GLU C O   1 
ATOM   4352 C CB  . GLU C 1 140 ? 31.360  -10.783 35.491  1.00 23.03 ? 303 GLU C CB  1 
ATOM   4353 C CG  . GLU C 1 140 ? 32.612  -10.107 34.941  1.00 25.15 ? 303 GLU C CG  1 
ATOM   4354 C CD  . GLU C 1 140 ? 32.310  -8.744  34.301  1.00 25.56 ? 303 GLU C CD  1 
ATOM   4355 O OE1 . GLU C 1 140 ? 31.177  -8.521  33.867  1.00 27.11 ? 303 GLU C OE1 1 
ATOM   4356 O OE2 . GLU C 1 140 ? 33.228  -7.915  34.217  1.00 24.60 ? 303 GLU C OE2 1 
ATOM   4357 N N   . ALA C 1 141 ? 32.719  -11.557 38.151  1.00 23.00 ? 304 ALA C N   1 
ATOM   4358 C CA  . ALA C 1 141 ? 33.865  -11.271 39.037  1.00 23.61 ? 304 ALA C CA  1 
ATOM   4359 C C   . ALA C 1 141 ? 34.410  -12.534 39.689  1.00 23.76 ? 304 ALA C C   1 
ATOM   4360 O O   . ALA C 1 141 ? 35.578  -12.600 39.993  1.00 24.82 ? 304 ALA C O   1 
ATOM   4361 C CB  . ALA C 1 141 ? 33.505  -10.233 40.121  1.00 23.27 ? 304 ALA C CB  1 
ATOM   4362 N N   . THR C 1 142 ? 33.554  -13.526 39.913  1.00 23.00 ? 305 THR C N   1 
ATOM   4363 C CA  . THR C 1 142 ? 33.954  -14.674 40.675  1.00 22.09 ? 305 THR C CA  1 
ATOM   4364 C C   . THR C 1 142 ? 34.219  -15.860 39.733  1.00 22.36 ? 305 THR C C   1 
ATOM   4365 O O   . THR C 1 142 ? 34.653  -16.898 40.221  1.00 21.21 ? 305 THR C O   1 
ATOM   4366 C CB  . THR C 1 142 ? 32.866  -15.091 41.676  1.00 21.83 ? 305 THR C CB  1 
ATOM   4367 O OG1 . THR C 1 142 ? 31.715  -15.560 40.939  1.00 23.84 ? 305 THR C OG1 1 
ATOM   4368 C CG2 . THR C 1 142 ? 32.442  -13.877 42.602  1.00 20.82 ? 305 THR C CG2 1 
ATOM   4369 N N   . ALA C 1 143 ? 33.913  -15.700 38.433  1.00 22.21 ? 306 ALA C N   1 
ATOM   4370 C CA  . ALA C 1 143 ? 34.018  -16.793 37.426  1.00 21.93 ? 306 ALA C CA  1 
ATOM   4371 C C   . ALA C 1 143 ? 33.305  -18.111 37.826  1.00 21.90 ? 306 ALA C C   1 
ATOM   4372 O O   . ALA C 1 143 ? 33.902  -19.199 37.765  1.00 22.88 ? 306 ALA C O   1 
ATOM   4373 C CB  . ALA C 1 143 ? 35.475  -17.086 37.150  1.00 21.88 ? 306 ALA C CB  1 
ATOM   4374 N N   . MET C 1 144 ? 32.076  -18.020 38.289  1.00 21.97 ? 307 MET C N   1 
ATOM   4375 C CA  . MET C 1 144 ? 31.349  -19.175 38.814  1.00 21.86 ? 307 MET C CA  1 
ATOM   4376 C C   . MET C 1 144 ? 30.081  -19.355 37.994  1.00 21.27 ? 307 MET C C   1 
ATOM   4377 O O   . MET C 1 144 ? 29.224  -18.442 37.957  1.00 19.69 ? 307 MET C O   1 
ATOM   4378 C CB  . MET C 1 144 ? 30.997  -18.989 40.301  1.00 22.52 ? 307 MET C CB  1 
ATOM   4379 C CG  . MET C 1 144 ? 32.214  -19.139 41.248  1.00 26.67 ? 307 MET C CG  1 
ATOM   4380 S SD  . MET C 1 144 ? 31.832  -18.899 43.006  1.00 38.03 ? 307 MET C SD  1 
ATOM   4381 C CE  . MET C 1 144 ? 30.340  -19.824 43.085  1.00 34.35 ? 307 MET C CE  1 
ATOM   4382 N N   . THR C 1 145 ? 29.992  -20.490 37.293  1.00 20.44 ? 308 THR C N   1 
ATOM   4383 C CA  . THR C 1 145 ? 28.796  -20.823 36.572  1.00 21.98 ? 308 THR C CA  1 
ATOM   4384 C C   . THR C 1 145 ? 27.754  -21.207 37.627  1.00 21.15 ? 308 THR C C   1 
ATOM   4385 O O   . THR C 1 145 ? 28.054  -21.925 38.577  1.00 22.81 ? 308 THR C O   1 
ATOM   4386 C CB  . THR C 1 145 ? 29.046  -21.962 35.515  1.00 22.44 ? 308 THR C CB  1 
ATOM   4387 O OG1 . THR C 1 145 ? 29.501  -23.133 36.205  1.00 26.81 ? 308 THR C OG1 1 
ATOM   4388 C CG2 . THR C 1 145 ? 30.116  -21.557 34.550  1.00 21.31 ? 308 THR C CG2 1 
ATOM   4389 N N   . LYS C 1 146 ? 26.540  -20.698 37.473  1.00 20.49 ? 309 LYS C N   1 
ATOM   4390 C CA  . LYS C 1 146 ? 25.493  -20.846 38.473  1.00 20.01 ? 309 LYS C CA  1 
ATOM   4391 C C   . LYS C 1 146 ? 24.323  -21.573 37.869  1.00 19.78 ? 309 LYS C C   1 
ATOM   4392 O O   . LYS C 1 146 ? 24.014  -21.402 36.689  1.00 17.78 ? 309 LYS C O   1 
ATOM   4393 C CB  . LYS C 1 146 ? 25.021  -19.450 38.915  1.00 21.82 ? 309 LYS C CB  1 
ATOM   4394 C CG  . LYS C 1 146 ? 25.992  -18.769 39.887  1.00 23.78 ? 309 LYS C CG  1 
ATOM   4395 C CD  . LYS C 1 146 ? 25.851  -19.377 41.290  1.00 32.51 ? 309 LYS C CD  1 
ATOM   4396 C CE  . LYS C 1 146 ? 26.390  -18.459 42.372  1.00 35.11 ? 309 LYS C CE  1 
ATOM   4397 N NZ  . LYS C 1 146 ? 27.713  -17.914 42.005  1.00 35.66 ? 309 LYS C NZ  1 
ATOM   4398 N N   . GLN C 1 147 ? 23.691  -22.427 38.656  1.00 17.65 ? 310 GLN C N   1 
ATOM   4399 C CA  . GLN C 1 147 ? 22.397  -22.952 38.269  1.00 18.43 ? 310 GLN C CA  1 
ATOM   4400 C C   . GLN C 1 147 ? 21.528  -22.862 39.539  1.00 18.73 ? 310 GLN C C   1 
ATOM   4401 O O   . GLN C 1 147 ? 21.567  -23.731 40.388  1.00 20.01 ? 310 GLN C O   1 
ATOM   4402 C CB  . GLN C 1 147 ? 22.510  -24.398 37.706  1.00 17.47 ? 310 GLN C CB  1 
ATOM   4403 C CG  . GLN C 1 147 ? 21.167  -25.005 37.276  1.00 19.00 ? 310 GLN C CG  1 
ATOM   4404 C CD  . GLN C 1 147 ? 21.265  -26.483 37.043  1.00 19.94 ? 310 GLN C CD  1 
ATOM   4405 O OE1 . GLN C 1 147 ? 21.243  -27.263 37.977  1.00 23.05 ? 310 GLN C OE1 1 
ATOM   4406 N NE2 . GLN C 1 147 ? 21.446  -26.871 35.793  1.00 16.41 ? 310 GLN C NE2 1 
ATOM   4407 N N   . CYS C 1 148 ? 20.792  -21.769 39.672  1.00 17.18 ? 311 CYS C N   1 
ATOM   4408 C CA  . CYS C 1 148 ? 19.974  -21.584 40.826  1.00 17.96 ? 311 CYS C CA  1 
ATOM   4409 C C   . CYS C 1 148 ? 18.710  -22.393 40.548  1.00 17.15 ? 311 CYS C C   1 
ATOM   4410 O O   . CYS C 1 148 ? 18.144  -22.264 39.493  1.00 15.72 ? 311 CYS C O   1 
ATOM   4411 C CB  . CYS C 1 148 ? 19.671  -20.095 40.978  1.00 19.18 ? 311 CYS C CB  1 
ATOM   4412 S SG  . CYS C 1 148 ? 18.540  -19.743 42.361  1.00 24.60 ? 311 CYS C SG  1 
ATOM   4413 N N   . ARG C 1 149 ? 18.304  -23.254 41.474  1.00 15.91 ? 312 ARG C N   1 
ATOM   4414 C CA  . ARG C 1 149 ? 17.132  -24.131 41.250  1.00 17.21 ? 312 ARG C CA  1 
ATOM   4415 C C   . ARG C 1 149 ? 16.100  -23.898 42.337  1.00 16.56 ? 312 ARG C C   1 
ATOM   4416 O O   . ARG C 1 149 ? 16.464  -23.724 43.500  1.00 16.79 ? 312 ARG C O   1 
ATOM   4417 C CB  . ARG C 1 149 ? 17.520  -25.623 41.356  1.00 16.40 ? 312 ARG C CB  1 
ATOM   4418 C CG  . ARG C 1 149 ? 18.371  -26.156 40.231  1.00 17.12 ? 312 ARG C CG  1 
ATOM   4419 C CD  . ARG C 1 149 ? 18.980  -27.500 40.585  1.00 18.59 ? 312 ARG C CD  1 
ATOM   4420 N NE  . ARG C 1 149 ? 19.773  -27.487 41.813  1.00 18.92 ? 312 ARG C NE  1 
ATOM   4421 C CZ  . ARG C 1 149 ? 21.051  -27.149 41.907  1.00 22.57 ? 312 ARG C CZ  1 
ATOM   4422 N NH1 . ARG C 1 149 ? 21.780  -26.784 40.849  1.00 18.62 ? 312 ARG C NH1 1 
ATOM   4423 N NH2 . ARG C 1 149 ? 21.624  -27.198 43.082  1.00 23.15 ? 312 ARG C NH2 1 
ATOM   4424 N N   . SER C 1 150 ? 14.825  -23.950 41.962  1.00 16.36 ? 313 SER C N   1 
ATOM   4425 C CA  . SER C 1 150 ? 13.764  -24.042 42.958  1.00 16.50 ? 313 SER C CA  1 
ATOM   4426 C C   . SER C 1 150 ? 12.626  -24.865 42.372  1.00 16.07 ? 313 SER C C   1 
ATOM   4427 O O   . SER C 1 150 ? 12.747  -25.428 41.270  1.00 16.68 ? 313 SER C O   1 
ATOM   4428 C CB  . SER C 1 150 ? 13.325  -22.654 43.507  1.00 14.90 ? 313 SER C CB  1 
ATOM   4429 O OG  . SER C 1 150 ? 12.584  -22.819 44.722  1.00 18.83 ? 313 SER C OG  1 
ATOM   4430 N N   . SER C 1 151 ? 11.520  -24.936 43.091  1.00 16.69 ? 314 SER C N   1 
ATOM   4431 C CA  . SER C 1 151 ? 10.461  -25.841 42.740  1.00 17.27 ? 314 SER C CA  1 
ATOM   4432 C C   . SER C 1 151 ? 9.180   -25.250 43.294  1.00 17.67 ? 314 SER C C   1 
ATOM   4433 O O   . SER C 1 151 ? 9.207   -24.703 44.405  1.00 18.73 ? 314 SER C O   1 
ATOM   4434 C CB  . SER C 1 151 ? 10.764  -27.167 43.467  1.00 18.31 ? 314 SER C CB  1 
ATOM   4435 O OG  . SER C 1 151 ? 9.634   -28.003 43.526  1.00 20.64 ? 314 SER C OG  1 
ATOM   4436 N N   . TYR C 1 152 ? 8.097   -25.345 42.523  1.00 16.39 ? 315 TYR C N   1 
ATOM   4437 C CA  . TYR C 1 152 ? 6.764   -25.078 43.010  1.00 16.73 ? 315 TYR C CA  1 
ATOM   4438 C C   . TYR C 1 152 ? 5.907   -26.313 42.782  1.00 16.62 ? 315 TYR C C   1 
ATOM   4439 O O   . TYR C 1 152 ? 5.698   -26.740 41.637  1.00 17.02 ? 315 TYR C O   1 
ATOM   4440 C CB  . TYR C 1 152 ? 6.140   -23.876 42.302  1.00 15.39 ? 315 TYR C CB  1 
ATOM   4441 C CG  . TYR C 1 152 ? 7.035   -22.666 42.354  1.00 14.82 ? 315 TYR C CG  1 
ATOM   4442 C CD1 . TYR C 1 152 ? 7.775   -22.269 41.244  1.00 16.76 ? 315 TYR C CD1 1 
ATOM   4443 C CD2 . TYR C 1 152 ? 7.135   -21.904 43.521  1.00 14.27 ? 315 TYR C CD2 1 
ATOM   4444 C CE1 . TYR C 1 152 ? 8.597   -21.105 41.296  1.00 13.67 ? 315 TYR C CE1 1 
ATOM   4445 C CE2 . TYR C 1 152 ? 7.976   -20.792 43.597  1.00 15.18 ? 315 TYR C CE2 1 
ATOM   4446 C CZ  . TYR C 1 152 ? 8.736   -20.423 42.469  1.00 13.48 ? 315 TYR C CZ  1 
ATOM   4447 O OH  . TYR C 1 152 ? 9.562   -19.313 42.523  1.00 19.03 ? 315 TYR C OH  1 
ATOM   4448 N N   . LEU C 1 153 ? 5.413   -26.870 43.872  1.00 16.28 ? 316 LEU C N   1 
ATOM   4449 C CA  . LEU C 1 153 ? 4.320   -27.826 43.789  1.00 17.98 ? 316 LEU C CA  1 
ATOM   4450 C C   . LEU C 1 153 ? 3.030   -27.104 43.449  1.00 19.80 ? 316 LEU C C   1 
ATOM   4451 O O   . LEU C 1 153 ? 2.937   -25.895 43.688  1.00 19.15 ? 316 LEU C O   1 
ATOM   4452 C CB  . LEU C 1 153 ? 4.133   -28.546 45.134  1.00 17.39 ? 316 LEU C CB  1 
ATOM   4453 C CG  . LEU C 1 153 ? 5.358   -29.238 45.714  1.00 18.44 ? 316 LEU C CG  1 
ATOM   4454 C CD1 . LEU C 1 153 ? 4.957   -29.877 47.049  1.00 22.41 ? 316 LEU C CD1 1 
ATOM   4455 C CD2 . LEU C 1 153 ? 5.892   -30.310 44.710  1.00 21.44 ? 316 LEU C CD2 1 
ATOM   4456 N N   . ALA C 1 154 ? 2.010   -27.842 42.977  1.00 20.46 ? 317 ALA C N   1 
ATOM   4457 C CA  . ALA C 1 154 ? 0.744   -27.193 42.580  1.00 21.51 ? 317 ALA C CA  1 
ATOM   4458 C C   . ALA C 1 154 ? 0.160   -26.387 43.707  1.00 22.84 ? 317 ALA C C   1 
ATOM   4459 O O   . ALA C 1 154 ? -0.321  -25.286 43.477  1.00 23.62 ? 317 ALA C O   1 
ATOM   4460 C CB  . ALA C 1 154 ? -0.278  -28.211 42.027  1.00 20.66 ? 317 ALA C CB  1 
ATOM   4461 N N   . ASN C 1 155 ? 0.249   -26.898 44.936  1.00 24.43 ? 318 ASN C N   1 
ATOM   4462 C CA  . ASN C 1 155 ? -0.207  -26.178 46.124  1.00 24.71 ? 318 ASN C CA  1 
ATOM   4463 C C   . ASN C 1 155 ? 0.622   -24.942 46.545  1.00 25.78 ? 318 ASN C C   1 
ATOM   4464 O O   . ASN C 1 155 ? 0.210   -24.207 47.469  1.00 25.88 ? 318 ASN C O   1 
ATOM   4465 C CB  . ASN C 1 155 ? -0.481  -27.136 47.310  1.00 25.39 ? 318 ASN C CB  1 
ATOM   4466 C CG  . ASN C 1 155 ? 0.789   -27.676 47.983  1.00 28.67 ? 318 ASN C CG  1 
ATOM   4467 O OD1 . ASN C 1 155 ? 1.876   -27.094 47.914  1.00 29.55 ? 318 ASN C OD1 1 
ATOM   4468 N ND2 . ASN C 1 155 ? 0.633   -28.802 48.694  1.00 32.04 ? 318 ASN C ND2 1 
ATOM   4469 N N   . GLU C 1 156 ? 1.737   -24.668 45.846  1.00 23.48 ? 319 GLU C N   1 
ATOM   4470 C CA  . GLU C 1 156 ? 2.520   -23.466 46.112  1.00 22.67 ? 319 GLU C CA  1 
ATOM   4471 C C   . GLU C 1 156 ? 2.298   -22.372 45.038  1.00 21.69 ? 319 GLU C C   1 
ATOM   4472 O O   . GLU C 1 156 ? 2.942   -21.319 45.046  1.00 23.02 ? 319 GLU C O   1 
ATOM   4473 C CB  . GLU C 1 156 ? 4.025   -23.819 46.290  1.00 21.86 ? 319 GLU C CB  1 
ATOM   4474 C CG  . GLU C 1 156 ? 4.204   -24.945 47.313  1.00 21.11 ? 319 GLU C CG  1 
ATOM   4475 C CD  . GLU C 1 156 ? 5.599   -25.551 47.333  1.00 22.33 ? 319 GLU C CD  1 
ATOM   4476 O OE1 . GLU C 1 156 ? 6.370   -25.374 46.371  1.00 21.27 ? 319 GLU C OE1 1 
ATOM   4477 O OE2 . GLU C 1 156 ? 5.931   -26.248 48.311  1.00 24.37 ? 319 GLU C OE2 1 
ATOM   4478 N N   . ILE C 1 157 ? 1.374   -22.617 44.135  1.00 20.57 ? 320 ILE C N   1 
ATOM   4479 C CA  . ILE C 1 157 ? 1.026   -21.656 43.096  1.00 21.02 ? 320 ILE C CA  1 
ATOM   4480 C C   . ILE C 1 157 ? -0.267  -21.000 43.580  1.00 21.63 ? 320 ILE C C   1 
ATOM   4481 O O   . ILE C 1 157 ? -1.219  -21.703 43.967  1.00 20.51 ? 320 ILE C O   1 
ATOM   4482 C CB  . ILE C 1 157 ? 0.786   -22.350 41.748  1.00 21.69 ? 320 ILE C CB  1 
ATOM   4483 C CG1 . ILE C 1 157 ? 2.059   -23.053 41.254  1.00 21.35 ? 320 ILE C CG1 1 
ATOM   4484 C CG2 . ILE C 1 157 ? 0.270   -21.371 40.684  1.00 20.69 ? 320 ILE C CG2 1 
ATOM   4485 C CD1 . ILE C 1 157 ? 1.753   -24.064 40.163  1.00 21.62 ? 320 ILE C CD1 1 
ATOM   4486 N N   . LEU C 1 158 ? -0.244  -19.668 43.603  1.00 20.93 ? 321 LEU C N   1 
ATOM   4487 C CA  . LEU C 1 158 ? -1.287  -18.829 44.190  1.00 21.02 ? 321 LEU C CA  1 
ATOM   4488 C C   . LEU C 1 158 ? -2.096  -18.256 43.068  1.00 19.98 ? 321 LEU C C   1 
ATOM   4489 O O   . LEU C 1 158 ? -1.676  -17.326 42.373  1.00 20.87 ? 321 LEU C O   1 
ATOM   4490 C CB  . LEU C 1 158 ? -0.643  -17.738 45.103  1.00 20.51 ? 321 LEU C CB  1 
ATOM   4491 C CG  . LEU C 1 158 ? 0.155   -18.289 46.300  1.00 22.87 ? 321 LEU C CG  1 
ATOM   4492 C CD1 . LEU C 1 158 ? 0.926   -17.227 47.102  1.00 22.01 ? 321 LEU C CD1 1 
ATOM   4493 C CD2 . LEU C 1 158 ? -0.741  -19.150 47.286  1.00 24.78 ? 321 LEU C CD2 1 
ATOM   4494 N N   . TRP C 1 159 ? -3.261  -18.845 42.838  1.00 19.46 ? 322 TRP C N   1 
ATOM   4495 C CA  . TRP C 1 159 ? -4.125  -18.448 41.730  1.00 19.18 ? 322 TRP C CA  1 
ATOM   4496 C C   . TRP C 1 159 ? -4.710  -17.092 42.109  1.00 20.44 ? 322 TRP C C   1 
ATOM   4497 O O   . TRP C 1 159 ? -5.119  -16.898 43.238  1.00 20.34 ? 322 TRP C O   1 
ATOM   4498 C CB  . TRP C 1 159 ? -5.232  -19.496 41.523  1.00 19.41 ? 322 TRP C CB  1 
ATOM   4499 C CG  . TRP C 1 159 ? -6.079  -19.218 40.324  1.00 19.76 ? 322 TRP C CG  1 
ATOM   4500 C CD1 . TRP C 1 159 ? -6.973  -18.196 40.177  1.00 20.72 ? 322 TRP C CD1 1 
ATOM   4501 C CD2 . TRP C 1 159 ? -6.091  -19.941 39.087  1.00 20.68 ? 322 TRP C CD2 1 
ATOM   4502 N NE1 . TRP C 1 159 ? -7.547  -18.246 38.938  1.00 20.76 ? 322 TRP C NE1 1 
ATOM   4503 C CE2 . TRP C 1 159 ? -7.021  -19.297 38.243  1.00 21.74 ? 322 TRP C CE2 1 
ATOM   4504 C CE3 . TRP C 1 159 ? -5.420  -21.074 38.618  1.00 21.76 ? 322 TRP C CE3 1 
ATOM   4505 C CZ2 . TRP C 1 159 ? -7.301  -19.744 36.965  1.00 21.78 ? 322 TRP C CZ2 1 
ATOM   4506 C CZ3 . TRP C 1 159 ? -5.692  -21.529 37.338  1.00 23.26 ? 322 TRP C CZ3 1 
ATOM   4507 C CH2 . TRP C 1 159 ? -6.630  -20.860 36.519  1.00 23.39 ? 322 TRP C CH2 1 
ATOM   4508 N N   . GLY C 1 160 ? -4.679  -16.126 41.205  1.00 21.98 ? 323 GLY C N   1 
ATOM   4509 C CA  . GLY C 1 160 ? -5.197  -14.807 41.504  1.00 22.85 ? 323 GLY C CA  1 
ATOM   4510 C C   . GLY C 1 160 ? -4.357  -13.848 42.323  1.00 23.62 ? 323 GLY C C   1 
ATOM   4511 O O   . GLY C 1 160 ? -4.901  -12.849 42.814  1.00 25.60 ? 323 GLY C O   1 
ATOM   4512 N N   . HIS C 1 161 ? -3.044  -14.104 42.442  1.00 22.12 ? 324 HIS C N   1 
ATOM   4513 C CA  . HIS C 1 161 ? -2.115  -13.242 43.158  1.00 21.09 ? 324 HIS C CA  1 
ATOM   4514 C C   . HIS C 1 161 ? -1.114  -12.530 42.211  1.00 21.17 ? 324 HIS C C   1 
ATOM   4515 O O   . HIS C 1 161 ? -0.852  -13.031 41.108  1.00 19.90 ? 324 HIS C O   1 
ATOM   4516 C CB  . HIS C 1 161 ? -1.328  -14.055 44.167  1.00 20.78 ? 324 HIS C CB  1 
ATOM   4517 C CG  . HIS C 1 161 ? -2.108  -14.436 45.388  1.00 21.87 ? 324 HIS C CG  1 
ATOM   4518 N ND1 . HIS C 1 161 ? -1.653  -14.178 46.666  1.00 25.42 ? 324 HIS C ND1 1 
ATOM   4519 C CD2 . HIS C 1 161 ? -3.282  -15.094 45.530  1.00 23.49 ? 324 HIS C CD2 1 
ATOM   4520 C CE1 . HIS C 1 161 ? -2.518  -14.670 47.545  1.00 25.07 ? 324 HIS C CE1 1 
ATOM   4521 N NE2 . HIS C 1 161 ? -3.525  -15.205 46.881  1.00 21.42 ? 324 HIS C NE2 1 
ATOM   4522 N N   . ARG C 1 162 ? -0.575  -11.391 42.661  1.00 19.49 ? 325 ARG C N   1 
ATOM   4523 C CA  . ARG C 1 162 ? 0.490   -10.674 41.944  1.00 21.14 ? 325 ARG C CA  1 
ATOM   4524 C C   . ARG C 1 162 ? 1.553   -10.369 42.956  1.00 20.37 ? 325 ARG C C   1 
ATOM   4525 O O   . ARG C 1 162 ? 1.276   -10.382 44.138  1.00 19.55 ? 325 ARG C O   1 
ATOM   4526 C CB  . ARG C 1 162 ? -0.032  -9.405  41.198  1.00 21.07 ? 325 ARG C CB  1 
ATOM   4527 C CG  . ARG C 1 162 ? -1.146  -9.759  40.186  1.00 21.92 ? 325 ARG C CG  1 
ATOM   4528 C CD  . ARG C 1 162 ? -1.596  -8.654  39.175  1.00 26.62 ? 325 ARG C CD  1 
ATOM   4529 N NE  . ARG C 1 162 ? -2.060  -7.433  39.802  1.00 23.52 ? 325 ARG C NE  1 
ATOM   4530 C CZ  . ARG C 1 162 ? -3.090  -6.656  39.389  1.00 25.46 ? 325 ARG C CZ  1 
ATOM   4531 N NH1 . ARG C 1 162 ? -3.864  -6.944  38.340  1.00 22.26 ? 325 ARG C NH1 1 
ATOM   4532 N NH2 . ARG C 1 162 ? -3.357  -5.568  40.070  1.00 21.77 ? 325 ARG C NH2 1 
ATOM   4533 N N   . TYR C 1 163 ? 2.773   -10.126 42.518  1.00 19.72 ? 326 TYR C N   1 
ATOM   4534 C CA  . TYR C 1 163 ? 3.845   -9.807  43.444  1.00 19.21 ? 326 TYR C CA  1 
ATOM   4535 C C   . TYR C 1 163 ? 3.740   -8.354  43.876  1.00 20.31 ? 326 TYR C C   1 
ATOM   4536 O O   . TYR C 1 163 ? 3.356   -7.525  43.069  1.00 21.79 ? 326 TYR C O   1 
ATOM   4537 C CB  . TYR C 1 163 ? 5.212   -10.060 42.782  1.00 19.36 ? 326 TYR C CB  1 
ATOM   4538 C CG  . TYR C 1 163 ? 5.401   -11.532 42.562  1.00 17.36 ? 326 TYR C CG  1 
ATOM   4539 C CD1 . TYR C 1 163 ? 5.312   -12.103 41.281  1.00 17.17 ? 326 TYR C CD1 1 
ATOM   4540 C CD2 . TYR C 1 163 ? 5.600   -12.364 43.655  1.00 17.08 ? 326 TYR C CD2 1 
ATOM   4541 C CE1 . TYR C 1 163 ? 5.420   -13.494 41.089  1.00 13.98 ? 326 TYR C CE1 1 
ATOM   4542 C CE2 . TYR C 1 163 ? 5.712   -13.722 43.495  1.00 18.07 ? 326 TYR C CE2 1 
ATOM   4543 C CZ  . TYR C 1 163 ? 5.646   -14.275 42.236  1.00 13.10 ? 326 TYR C CZ  1 
ATOM   4544 O OH  . TYR C 1 163 ? 5.726   -15.621 42.175  1.00 16.35 ? 326 TYR C OH  1 
ATOM   4545 N N   . GLU C 1 164 ? 4.098   -8.063  45.133  1.00 21.11 ? 327 GLU C N   1 
ATOM   4546 C CA  . GLU C 1 164 ? 4.324   -6.701  45.607  1.00 21.73 ? 327 GLU C CA  1 
ATOM   4547 C C   . GLU C 1 164 ? 5.556   -6.120  44.864  1.00 21.96 ? 327 GLU C C   1 
ATOM   4548 O O   . GLU C 1 164 ? 6.574   -6.805  44.742  1.00 21.34 ? 327 GLU C O   1 
ATOM   4549 C CB  . GLU C 1 164 ? 4.622   -6.702  47.108  1.00 21.95 ? 327 GLU C CB  1 
ATOM   4550 C CG  . GLU C 1 164 ? 3.360   -6.894  47.984  1.00 26.38 ? 327 GLU C CG  1 
ATOM   4551 C CD  . GLU C 1 164 ? 2.569   -5.608  48.153  1.00 31.47 ? 327 GLU C CD  1 
ATOM   4552 O OE1 . GLU C 1 164 ? 1.558   -5.667  48.857  1.00 34.74 ? 327 GLU C OE1 1 
ATOM   4553 O OE2 . GLU C 1 164 ? 2.953   -4.523  47.616  1.00 34.88 ? 327 GLU C OE2 1 
ATOM   4554 N N   . PRO C 1 165 ? 5.455   -4.867  44.384  1.00 20.90 ? 328 PRO C N   1 
ATOM   4555 C CA  . PRO C 1 165 ? 6.607   -4.119  43.897  1.00 20.63 ? 328 PRO C CA  1 
ATOM   4556 C C   . PRO C 1 165 ? 7.756   -4.129  44.880  1.00 19.35 ? 328 PRO C C   1 
ATOM   4557 O O   . PRO C 1 165 ? 7.563   -3.880  46.069  1.00 19.09 ? 328 PRO C O   1 
ATOM   4558 C CB  . PRO C 1 165 ? 6.074   -2.705  43.794  1.00 20.93 ? 328 PRO C CB  1 
ATOM   4559 C CG  . PRO C 1 165 ? 4.623   -2.901  43.430  1.00 23.71 ? 328 PRO C CG  1 
ATOM   4560 C CD  . PRO C 1 165 ? 4.186   -4.128  44.211  1.00 20.56 ? 328 PRO C CD  1 
ATOM   4561 N N   . VAL C 1 166 ? 8.945   -4.432  44.395  1.00 17.76 ? 329 VAL C N   1 
ATOM   4562 C CA  . VAL C 1 166 ? 10.162  -4.252  45.191  1.00 16.56 ? 329 VAL C CA  1 
ATOM   4563 C C   . VAL C 1 166 ? 10.970  -3.046  44.785  1.00 17.88 ? 329 VAL C C   1 
ATOM   4564 O O   . VAL C 1 166 ? 11.823  -2.593  45.544  1.00 20.72 ? 329 VAL C O   1 
ATOM   4565 C CB  . VAL C 1 166 ? 11.063  -5.504  45.188  1.00 16.47 ? 329 VAL C CB  1 
ATOM   4566 C CG1 . VAL C 1 166 ? 10.346  -6.665  45.851  1.00 13.89 ? 329 VAL C CG1 1 
ATOM   4567 C CG2 . VAL C 1 166 ? 11.585  -5.829  43.753  1.00 16.29 ? 329 VAL C CG2 1 
ATOM   4568 N N   . LEU C 1 167 ? 10.695  -2.478  43.619  1.00 18.75 ? 330 LEU C N   1 
ATOM   4569 C CA  . LEU C 1 167 ? 11.600  -1.440  43.082  1.00 19.22 ? 330 LEU C CA  1 
ATOM   4570 C C   . LEU C 1 167 ? 10.916  -0.066  43.175  1.00 20.64 ? 330 LEU C C   1 
ATOM   4571 O O   . LEU C 1 167 ? 9.828   0.085   42.622  1.00 19.36 ? 330 LEU C O   1 
ATOM   4572 C CB  . LEU C 1 167 ? 11.976  -1.723  41.603  1.00 19.20 ? 330 LEU C CB  1 
ATOM   4573 C CG  . LEU C 1 167 ? 12.804  -0.638  40.858  1.00 18.42 ? 330 LEU C CG  1 
ATOM   4574 C CD1 . LEU C 1 167 ? 14.251  -0.616  41.321  1.00 16.91 ? 330 LEU C CD1 1 
ATOM   4575 C CD2 . LEU C 1 167 ? 12.694  -0.966  39.339  1.00 21.25 ? 330 LEU C CD2 1 
ATOM   4576 N N   . PHE C 1 168 ? 11.594  0.877   43.850  1.00 20.27 ? 331 PHE C N   1 
ATOM   4577 C CA  . PHE C 1 168 ? 11.112  2.235   44.174  1.00 23.51 ? 331 PHE C CA  1 
ATOM   4578 C C   . PHE C 1 168 ? 12.099  3.318   43.774  1.00 24.95 ? 331 PHE C C   1 
ATOM   4579 O O   . PHE C 1 168 ? 13.312  3.167   43.923  1.00 24.30 ? 331 PHE C O   1 
ATOM   4580 C CB  . PHE C 1 168 ? 10.796  2.362   45.697  1.00 23.09 ? 331 PHE C CB  1 
ATOM   4581 C CG  . PHE C 1 168 ? 9.641   1.483   46.106  1.00 24.22 ? 331 PHE C CG  1 
ATOM   4582 C CD1 . PHE C 1 168 ? 8.330   1.966   46.036  1.00 22.96 ? 331 PHE C CD1 1 
ATOM   4583 C CD2 . PHE C 1 168 ? 9.853   0.149   46.424  1.00 23.43 ? 331 PHE C CD2 1 
ATOM   4584 C CE1 . PHE C 1 168 ? 7.268   1.152   46.326  1.00 22.45 ? 331 PHE C CE1 1 
ATOM   4585 C CE2 . PHE C 1 168 ? 8.795   -0.684  46.713  1.00 25.81 ? 331 PHE C CE2 1 
ATOM   4586 C CZ  . PHE C 1 168 ? 7.502   -0.186  46.680  1.00 23.45 ? 331 PHE C CZ  1 
ATOM   4587 N N   . GLU C 1 169 ? 11.544  4.433   43.335  1.00 27.57 ? 332 GLU C N   1 
ATOM   4588 C CA  . GLU C 1 169 ? 12.344  5.566   42.912  1.00 30.04 ? 332 GLU C CA  1 
ATOM   4589 C C   . GLU C 1 169 ? 12.657  6.480   44.102  1.00 31.17 ? 332 GLU C C   1 
ATOM   4590 O O   . GLU C 1 169 ? 11.756  6.907   44.839  1.00 31.01 ? 332 GLU C O   1 
ATOM   4591 C CB  . GLU C 1 169 ? 11.559  6.328   41.857  1.00 29.89 ? 332 GLU C CB  1 
ATOM   4592 C CG  . GLU C 1 169 ? 12.243  7.563   41.321  1.00 35.77 ? 332 GLU C CG  1 
ATOM   4593 C CD  . GLU C 1 169 ? 11.310  8.414   40.452  1.00 41.37 ? 332 GLU C CD  1 
ATOM   4594 O OE1 . GLU C 1 169 ? 10.136  8.020   40.228  1.00 42.07 ? 332 GLU C OE1 1 
ATOM   4595 O OE2 . GLU C 1 169 ? 11.762  9.470   39.977  1.00 43.19 ? 332 GLU C OE2 1 
ATOM   4596 N N   . GLU C 1 170 ? 13.937  6.762   44.305  1.00 31.75 ? 333 GLU C N   1 
ATOM   4597 C CA  . GLU C 1 170 ? 14.335  7.929   45.089  1.00 33.33 ? 333 GLU C CA  1 
ATOM   4598 C C   . GLU C 1 170 ? 14.697  9.084   44.132  1.00 33.93 ? 333 GLU C C   1 
ATOM   4599 O O   . GLU C 1 170 ? 14.652  8.944   42.891  1.00 33.40 ? 333 GLU C O   1 
ATOM   4600 C CB  . GLU C 1 170 ? 15.476  7.587   46.043  1.00 33.30 ? 333 GLU C CB  1 
ATOM   4601 C CG  . GLU C 1 170 ? 15.139  6.424   46.953  1.00 36.65 ? 333 GLU C CG  1 
ATOM   4602 C CD  . GLU C 1 170 ? 14.067  6.746   47.996  1.00 45.37 ? 333 GLU C CD  1 
ATOM   4603 O OE1 . GLU C 1 170 ? 14.385  7.454   48.970  1.00 47.60 ? 333 GLU C OE1 1 
ATOM   4604 O OE2 . GLU C 1 170 ? 12.908  6.275   47.856  1.00 49.29 ? 333 GLU C OE2 1 
ATOM   4605 N N   . LYS C 1 171 ? 15.022  10.240  44.692  1.00 35.01 ? 334 LYS C N   1 
ATOM   4606 C CA  . LYS C 1 171 ? 15.339  11.388  43.844  1.00 35.68 ? 334 LYS C CA  1 
ATOM   4607 C C   . LYS C 1 171 ? 16.532  11.072  42.929  1.00 35.11 ? 334 LYS C C   1 
ATOM   4608 O O   . LYS C 1 171 ? 16.479  11.283  41.696  1.00 35.62 ? 334 LYS C O   1 
ATOM   4609 C CB  . LYS C 1 171 ? 15.594  12.660  44.691  1.00 36.77 ? 334 LYS C CB  1 
ATOM   4610 C CG  . LYS C 1 171 ? 15.610  13.944  43.843  1.00 39.26 ? 334 LYS C CG  1 
ATOM   4611 C CD  . LYS C 1 171 ? 16.227  15.141  44.572  1.00 43.92 ? 334 LYS C CD  1 
ATOM   4612 C CE  . LYS C 1 171 ? 16.671  16.174  43.531  1.00 46.38 ? 334 LYS C CE  1 
ATOM   4613 N NZ  . LYS C 1 171 ? 16.242  17.557  43.898  1.00 50.59 ? 334 LYS C NZ  1 
ATOM   4614 N N   . HIS C 1 172 ? 17.595  10.540  43.513  1.00 34.80 ? 335 HIS C N   1 
ATOM   4615 C CA  . HIS C 1 172 ? 18.838  10.346  42.739  1.00 34.87 ? 335 HIS C CA  1 
ATOM   4616 C C   . HIS C 1 172 ? 19.144  8.914   42.296  1.00 32.81 ? 335 HIS C C   1 
ATOM   4617 O O   . HIS C 1 172 ? 20.044  8.707   41.482  1.00 32.99 ? 335 HIS C O   1 
ATOM   4618 C CB  . HIS C 1 172 ? 20.041  10.946  43.494  1.00 35.09 ? 335 HIS C CB  1 
ATOM   4619 C CG  . HIS C 1 172 ? 19.924  12.421  43.709  1.00 38.74 ? 335 HIS C CG  1 
ATOM   4620 N ND1 . HIS C 1 172 ? 19.972  13.329  42.670  1.00 41.41 ? 335 HIS C ND1 1 
ATOM   4621 C CD2 . HIS C 1 172 ? 19.732  13.149  44.838  1.00 40.60 ? 335 HIS C CD2 1 
ATOM   4622 C CE1 . HIS C 1 172 ? 19.820  14.552  43.151  1.00 41.98 ? 335 HIS C CE1 1 
ATOM   4623 N NE2 . HIS C 1 172 ? 19.670  14.470  44.461  1.00 41.20 ? 335 HIS C NE2 1 
ATOM   4624 N N   . TYR C 1 173 ? 18.408  7.942   42.842  1.00 31.15 ? 336 TYR C N   1 
ATOM   4625 C CA  . TYR C 1 173 ? 18.642  6.520   42.587  1.00 28.90 ? 336 TYR C CA  1 
ATOM   4626 C C   . TYR C 1 173 ? 17.332  5.692   42.749  1.00 28.26 ? 336 TYR C C   1 
ATOM   4627 O O   . TYR C 1 173 ? 16.245  6.252   42.925  1.00 28.03 ? 336 TYR C O   1 
ATOM   4628 C CB  . TYR C 1 173 ? 19.757  5.997   43.499  1.00 28.87 ? 336 TYR C CB  1 
ATOM   4629 C CG  . TYR C 1 173 ? 19.356  5.907   44.953  1.00 25.44 ? 336 TYR C CG  1 
ATOM   4630 C CD1 . TYR C 1 173 ? 18.770  4.770   45.449  1.00 28.58 ? 336 TYR C CD1 1 
ATOM   4631 C CD2 . TYR C 1 173 ? 19.534  6.984   45.823  1.00 28.16 ? 336 TYR C CD2 1 
ATOM   4632 C CE1 . TYR C 1 173 ? 18.337  4.686   46.789  1.00 29.83 ? 336 TYR C CE1 1 
ATOM   4633 C CE2 . TYR C 1 173 ? 19.136  6.906   47.158  1.00 28.91 ? 336 TYR C CE2 1 
ATOM   4634 C CZ  . TYR C 1 173 ? 18.557  5.748   47.605  1.00 30.47 ? 336 TYR C CZ  1 
ATOM   4635 O OH  . TYR C 1 173 ? 18.148  5.644   48.934  1.00 30.10 ? 336 TYR C OH  1 
ATOM   4636 N N   . TYR C 1 174 ? 17.461  4.371   42.670  1.00 26.27 ? 337 TYR C N   1 
ATOM   4637 C CA  . TYR C 1 174 ? 16.359  3.421   42.854  1.00 25.10 ? 337 TYR C CA  1 
ATOM   4638 C C   . TYR C 1 174 ? 16.714  2.539   44.024  1.00 24.61 ? 337 TYR C C   1 
ATOM   4639 O O   . TYR C 1 174 ? 17.901  2.283   44.272  1.00 26.01 ? 337 TYR C O   1 
ATOM   4640 C CB  . TYR C 1 174 ? 16.195  2.568   41.585  1.00 24.00 ? 337 TYR C CB  1 
ATOM   4641 C CG  . TYR C 1 174 ? 15.722  3.418   40.458  1.00 25.19 ? 337 TYR C CG  1 
ATOM   4642 C CD1 . TYR C 1 174 ? 16.632  4.000   39.563  1.00 22.60 ? 337 TYR C CD1 1 
ATOM   4643 C CD2 . TYR C 1 174 ? 14.369  3.725   40.336  1.00 22.50 ? 337 TYR C CD2 1 
ATOM   4644 C CE1 . TYR C 1 174 ? 16.191  4.848   38.549  1.00 25.30 ? 337 TYR C CE1 1 
ATOM   4645 C CE2 . TYR C 1 174 ? 13.924  4.583   39.340  1.00 23.74 ? 337 TYR C CE2 1 
ATOM   4646 C CZ  . TYR C 1 174 ? 14.838  5.123   38.436  1.00 27.22 ? 337 TYR C CZ  1 
ATOM   4647 O OH  . TYR C 1 174 ? 14.384  5.966   37.438  1.00 30.33 ? 337 TYR C OH  1 
ATOM   4648 N N   . LYS C 1 175 ? 15.736  2.120   44.801  1.00 24.16 ? 338 LYS C N   1 
ATOM   4649 C CA  . LYS C 1 175 ? 16.046  1.125   45.848  1.00 24.25 ? 338 LYS C CA  1 
ATOM   4650 C C   . LYS C 1 175 ? 15.209  -0.110  45.623  1.00 21.91 ? 338 LYS C C   1 
ATOM   4651 O O   . LYS C 1 175 ? 14.139  -0.032  45.057  1.00 21.18 ? 338 LYS C O   1 
ATOM   4652 C CB  . LYS C 1 175 ? 15.892  1.644   47.279  1.00 25.58 ? 338 LYS C CB  1 
ATOM   4653 C CG  . LYS C 1 175 ? 14.492  2.063   47.627  1.00 31.00 ? 338 LYS C CG  1 
ATOM   4654 C CD  . LYS C 1 175 ? 14.412  2.472   49.112  1.00 36.34 ? 338 LYS C CD  1 
ATOM   4655 C CE  . LYS C 1 175 ? 12.955  2.563   49.544  1.00 36.74 ? 338 LYS C CE  1 
ATOM   4656 N NZ  . LYS C 1 175 ? 12.451  3.959   49.481  1.00 38.93 ? 338 LYS C NZ  1 
ATOM   4657 N N   . VAL C 1 176 ? 15.758  -1.250  46.003  1.00 21.30 ? 339 VAL C N   1 
ATOM   4658 C CA  . VAL C 1 176 ? 15.051  -2.506  45.898  1.00 20.89 ? 339 VAL C CA  1 
ATOM   4659 C C   . VAL C 1 176 ? 14.830  -2.929  47.308  1.00 21.11 ? 339 VAL C C   1 
ATOM   4660 O O   . VAL C 1 176 ? 15.790  -3.074  48.070  1.00 21.91 ? 339 VAL C O   1 
ATOM   4661 C CB  . VAL C 1 176 ? 15.873  -3.628  45.186  1.00 19.82 ? 339 VAL C CB  1 
ATOM   4662 C CG1 . VAL C 1 176 ? 15.149  -4.940  45.337  1.00 19.38 ? 339 VAL C CG1 1 
ATOM   4663 C CG2 . VAL C 1 176 ? 16.097  -3.294  43.728  1.00 20.10 ? 339 VAL C CG2 1 
ATOM   4664 N N   . ASP C 1 177 ? 13.572  -3.110  47.661  1.00 21.78 ? 340 ASP C N   1 
ATOM   4665 C CA  . ASP C 1 177 ? 13.244  -3.474  49.045  1.00 23.20 ? 340 ASP C CA  1 
ATOM   4666 C C   . ASP C 1 177 ? 12.945  -4.967  49.089  1.00 22.67 ? 340 ASP C C   1 
ATOM   4667 O O   . ASP C 1 177 ? 11.839  -5.400  48.786  1.00 22.19 ? 340 ASP C O   1 
ATOM   4668 C CB  . ASP C 1 177 ? 12.064  -2.634  49.566  1.00 22.65 ? 340 ASP C CB  1 
ATOM   4669 C CG  . ASP C 1 177 ? 11.695  -2.965  51.000  1.00 25.80 ? 340 ASP C CG  1 
ATOM   4670 O OD1 . ASP C 1 177 ? 12.278  -3.903  51.605  1.00 26.19 ? 340 ASP C OD1 1 
ATOM   4671 O OD2 . ASP C 1 177 ? 10.835  -2.246  51.537  1.00 26.20 ? 340 ASP C OD2 1 
ATOM   4672 N N   . TYR C 1 178 ? 13.954  -5.739  49.482  1.00 23.94 ? 341 TYR C N   1 
ATOM   4673 C CA  . TYR C 1 178 ? 13.845  -7.195  49.478  1.00 23.42 ? 341 TYR C CA  1 
ATOM   4674 C C   . TYR C 1 178 ? 12.915  -7.711  50.548  1.00 24.22 ? 341 TYR C C   1 
ATOM   4675 O O   . TYR C 1 178 ? 12.554  -8.877  50.523  1.00 22.29 ? 341 TYR C O   1 
ATOM   4676 C CB  . TYR C 1 178 ? 15.237  -7.868  49.564  1.00 24.71 ? 341 TYR C CB  1 
ATOM   4677 C CG  . TYR C 1 178 ? 15.924  -7.977  48.201  1.00 27.62 ? 341 TYR C CG  1 
ATOM   4678 C CD1 . TYR C 1 178 ? 16.701  -6.939  47.715  1.00 27.69 ? 341 TYR C CD1 1 
ATOM   4679 C CD2 . TYR C 1 178 ? 15.736  -9.097  47.381  1.00 30.72 ? 341 TYR C CD2 1 
ATOM   4680 C CE1 . TYR C 1 178 ? 17.321  -7.022  46.470  1.00 31.41 ? 341 TYR C CE1 1 
ATOM   4681 C CE2 . TYR C 1 178 ? 16.350  -9.184  46.117  1.00 33.51 ? 341 TYR C CE2 1 
ATOM   4682 C CZ  . TYR C 1 178 ? 17.142  -8.135  45.677  1.00 33.46 ? 341 TYR C CZ  1 
ATOM   4683 O OH  . TYR C 1 178 ? 17.753  -8.182  44.418  1.00 39.80 ? 341 TYR C OH  1 
ATOM   4684 N N   . SER C 1 179 ? 12.490  -6.860  51.491  1.00 24.09 ? 342 SER C N   1 
ATOM   4685 C CA  . SER C 1 179 ? 11.447  -7.279  52.438  1.00 24.13 ? 342 SER C CA  1 
ATOM   4686 C C   . SER C 1 179 ? 10.116  -7.564  51.697  1.00 24.41 ? 342 SER C C   1 
ATOM   4687 O O   . SER C 1 179 ? 9.243   -8.262  52.231  1.00 25.96 ? 342 SER C O   1 
ATOM   4688 C CB  . SER C 1 179 ? 11.248  -6.221  53.562  1.00 24.08 ? 342 SER C CB  1 
ATOM   4689 O OG  . SER C 1 179 ? 10.494  -5.135  53.067  1.00 23.02 ? 342 SER C OG  1 
ATOM   4690 N N   . ARG C 1 180 ? 9.953   -7.051  50.470  1.00 22.90 ? 343 ARG C N   1 
ATOM   4691 C CA  . ARG C 1 180 ? 8.709   -7.280  49.700  1.00 21.90 ? 343 ARG C CA  1 
ATOM   4692 C C   . ARG C 1 180 ? 8.871   -8.418  48.669  1.00 21.02 ? 343 ARG C C   1 
ATOM   4693 O O   . ARG C 1 180 ? 7.934   -8.740  47.954  1.00 19.70 ? 343 ARG C O   1 
ATOM   4694 C CB  . ARG C 1 180 ? 8.269   -6.026  48.958  1.00 22.35 ? 343 ARG C CB  1 
ATOM   4695 C CG  . ARG C 1 180 ? 8.329   -4.704  49.783  1.00 26.74 ? 343 ARG C CG  1 
ATOM   4696 C CD  . ARG C 1 180 ? 6.967   -4.190  50.157  1.00 31.27 ? 343 ARG C CD  1 
ATOM   4697 N NE  . ARG C 1 180 ? 7.094   -3.052  51.062  1.00 33.34 ? 343 ARG C NE  1 
ATOM   4698 C CZ  . ARG C 1 180 ? 6.797   -1.785  50.760  1.00 32.37 ? 343 ARG C CZ  1 
ATOM   4699 N NH1 . ARG C 1 180 ? 6.308   -1.439  49.572  1.00 30.04 ? 343 ARG C NH1 1 
ATOM   4700 N NH2 . ARG C 1 180 ? 6.972   -0.859  51.684  1.00 34.49 ? 343 ARG C NH2 1 
ATOM   4701 N N   . PHE C 1 181 ? 10.057  -9.023  48.613  1.00 20.80 ? 344 PHE C N   1 
ATOM   4702 C CA  . PHE C 1 181 ? 10.409  -9.975  47.527  1.00 19.73 ? 344 PHE C CA  1 
ATOM   4703 C C   . PHE C 1 181 ? 9.426   -11.161 47.392  1.00 19.11 ? 344 PHE C C   1 
ATOM   4704 O O   . PHE C 1 181 ? 8.951   -11.491 46.303  1.00 19.11 ? 344 PHE C O   1 
ATOM   4705 C CB  . PHE C 1 181 ? 11.856  -10.435 47.703  1.00 20.36 ? 344 PHE C CB  1 
ATOM   4706 C CG  . PHE C 1 181 ? 12.299  -11.438 46.662  1.00 19.78 ? 344 PHE C CG  1 
ATOM   4707 C CD1 . PHE C 1 181 ? 12.685  -11.015 45.393  1.00 21.45 ? 344 PHE C CD1 1 
ATOM   4708 C CD2 . PHE C 1 181 ? 12.299  -12.789 46.945  1.00 16.21 ? 344 PHE C CD2 1 
ATOM   4709 C CE1 . PHE C 1 181 ? 13.086  -11.957 44.423  1.00 22.43 ? 344 PHE C CE1 1 
ATOM   4710 C CE2 . PHE C 1 181 ? 12.678  -13.738 45.974  1.00 19.01 ? 344 PHE C CE2 1 
ATOM   4711 C CZ  . PHE C 1 181 ? 13.054  -13.309 44.710  1.00 17.57 ? 344 PHE C CZ  1 
ATOM   4712 N N   . HIS C 1 182 ? 9.084   -11.769 48.514  1.00 18.95 ? 345 HIS C N   1 
ATOM   4713 C CA  . HIS C 1 182 ? 8.192   -12.910 48.528  1.00 18.99 ? 345 HIS C CA  1 
ATOM   4714 C C   . HIS C 1 182 ? 6.754   -12.532 48.665  1.00 21.17 ? 345 HIS C C   1 
ATOM   4715 O O   . HIS C 1 182 ? 5.898   -13.423 48.650  1.00 22.40 ? 345 HIS C O   1 
ATOM   4716 C CB  . HIS C 1 182 ? 8.510   -13.822 49.712  1.00 18.83 ? 345 HIS C CB  1 
ATOM   4717 C CG  . HIS C 1 182 ? 9.892   -14.382 49.672  1.00 16.66 ? 345 HIS C CG  1 
ATOM   4718 N ND1 . HIS C 1 182 ? 10.278  -15.347 48.756  1.00 15.89 ? 345 HIS C ND1 1 
ATOM   4719 C CD2 . HIS C 1 182 ? 10.992  -14.090 50.402  1.00 15.22 ? 345 HIS C CD2 1 
ATOM   4720 C CE1 . HIS C 1 182 ? 11.552  -15.657 48.957  1.00 15.53 ? 345 HIS C CE1 1 
ATOM   4721 N NE2 . HIS C 1 182 ? 12.005  -14.925 49.958  1.00 19.65 ? 345 HIS C NE2 1 
ATOM   4722 N N   . LYS C 1 183 ? 6.473   -11.246 48.830  1.00 21.56 ? 346 LYS C N   1 
ATOM   4723 C CA  . LYS C 1 183 ? 5.106   -10.835 49.196  1.00 23.64 ? 346 LYS C CA  1 
ATOM   4724 C C   . LYS C 1 183 ? 4.208   -10.741 47.989  1.00 24.22 ? 346 LYS C C   1 
ATOM   4725 O O   . LYS C 1 183 ? 4.635   -10.330 46.892  1.00 23.24 ? 346 LYS C O   1 
ATOM   4726 C CB  . LYS C 1 183 ? 5.119   -9.537  50.018  1.00 22.60 ? 346 LYS C CB  1 
ATOM   4727 C CG  . LYS C 1 183 ? 5.745   -9.749  51.418  1.00 25.86 ? 346 LYS C CG  1 
ATOM   4728 C CD  . LYS C 1 183 ? 5.714   -8.457  52.212  1.00 31.03 ? 346 LYS C CD  1 
ATOM   4729 C CE  . LYS C 1 183 ? 6.147   -8.670  53.641  1.00 35.51 ? 346 LYS C CE  1 
ATOM   4730 N NZ  . LYS C 1 183 ? 6.127   -7.345  54.363  1.00 41.30 ? 346 LYS C NZ  1 
ATOM   4731 N N   . THR C 1 184 ? 2.966   -11.163 48.178  1.00 25.07 ? 347 THR C N   1 
ATOM   4732 C CA  . THR C 1 184 ? 1.997   -11.146 47.100  1.00 28.18 ? 347 THR C CA  1 
ATOM   4733 C C   . THR C 1 184 ? 0.711   -10.502 47.586  1.00 29.81 ? 347 THR C C   1 
ATOM   4734 O O   . THR C 1 184 ? 0.494   -10.361 48.793  1.00 31.30 ? 347 THR C O   1 
ATOM   4735 C CB  . THR C 1 184 ? 1.665   -12.597 46.525  1.00 28.65 ? 347 THR C CB  1 
ATOM   4736 O OG1 . THR C 1 184 ? 1.228   -13.460 47.587  1.00 30.94 ? 347 THR C OG1 1 
ATOM   4737 C CG2 . THR C 1 184 ? 2.890   -13.239 45.871  1.00 24.73 ? 347 THR C CG2 1 
ATOM   4738 N N   . TYR C 1 185 ? -0.122  -10.077 46.655  1.00 30.29 ? 348 TYR C N   1 
ATOM   4739 C CA  . TYR C 1 185 ? -1.464  -9.693  47.018  1.00 31.41 ? 348 TYR C CA  1 
ATOM   4740 C C   . TYR C 1 185 ? -2.496  -10.348 46.099  1.00 30.61 ? 348 TYR C C   1 
ATOM   4741 O O   . TYR C 1 185 ? -2.206  -10.720 44.968  1.00 27.60 ? 348 TYR C O   1 
ATOM   4742 C CB  . TYR C 1 185 ? -1.623  -8.185  47.072  1.00 31.25 ? 348 TYR C CB  1 
ATOM   4743 C CG  . TYR C 1 185 ? -1.348  -7.478  45.787  1.00 35.12 ? 348 TYR C CG  1 
ATOM   4744 C CD1 . TYR C 1 185 ? -2.349  -7.274  44.867  1.00 35.74 ? 348 TYR C CD1 1 
ATOM   4745 C CD2 . TYR C 1 185 ? -0.076  -6.975  45.500  1.00 35.92 ? 348 TYR C CD2 1 
ATOM   4746 C CE1 . TYR C 1 185 ? -2.098  -6.617  43.701  1.00 37.18 ? 348 TYR C CE1 1 
ATOM   4747 C CE2 . TYR C 1 185 ? 0.174   -6.316  44.322  1.00 33.41 ? 348 TYR C CE2 1 
ATOM   4748 C CZ  . TYR C 1 185 ? -0.828  -6.146  43.447  1.00 33.33 ? 348 TYR C CZ  1 
ATOM   4749 O OH  . TYR C 1 185 ? -0.621  -5.523  42.262  1.00 36.12 ? 348 TYR C OH  1 
ATOM   4750 N N   . GLU C 1 186 ? -3.699  -10.493 46.645  1.00 30.10 ? 349 GLU C N   1 
ATOM   4751 C CA  . GLU C 1 186 ? -4.791  -11.156 45.992  1.00 30.36 ? 349 GLU C CA  1 
ATOM   4752 C C   . GLU C 1 186 ? -5.559  -10.200 45.070  1.00 29.02 ? 349 GLU C C   1 
ATOM   4753 O O   . GLU C 1 186 ? -5.777  -9.046  45.416  1.00 31.20 ? 349 GLU C O   1 
ATOM   4754 C CB  . GLU C 1 186 ? -5.688  -11.740 47.064  1.00 29.99 ? 349 GLU C CB  1 
ATOM   4755 C CG  . GLU C 1 186 ? -7.030  -12.114 46.561  1.00 36.03 ? 349 GLU C CG  1 
ATOM   4756 C CD  . GLU C 1 186 ? -7.194  -13.602 46.401  1.00 44.19 ? 349 GLU C CD  1 
ATOM   4757 O OE1 . GLU C 1 186 ? -6.569  -14.182 45.484  1.00 44.96 ? 349 GLU C OE1 1 
ATOM   4758 O OE2 . GLU C 1 186 ? -7.967  -14.190 47.208  1.00 48.64 ? 349 GLU C OE2 1 
ATOM   4759 N N   . VAL C 1 187 ? -5.945  -10.694 43.899  1.00 26.60 ? 350 VAL C N   1 
ATOM   4760 C CA  . VAL C 1 187 ? -6.704  -9.957  42.928  1.00 25.93 ? 350 VAL C CA  1 
ATOM   4761 C C   . VAL C 1 187 ? -8.036  -10.727 42.723  1.00 26.41 ? 350 VAL C C   1 
ATOM   4762 O O   . VAL C 1 187 ? -8.121  -11.656 41.910  1.00 26.55 ? 350 VAL C O   1 
ATOM   4763 C CB  . VAL C 1 187 ? -5.919  -9.709  41.591  1.00 26.07 ? 350 VAL C CB  1 
ATOM   4764 C CG1 . VAL C 1 187 ? -6.692  -8.793  40.698  1.00 22.97 ? 350 VAL C CG1 1 
ATOM   4765 C CG2 . VAL C 1 187 ? -4.513  -9.018  41.896  1.00 25.47 ? 350 VAL C CG2 1 
ATOM   4766 N N   . PRO C 1 188 ? -9.068  -10.353 43.499  1.00 25.91 ? 351 PRO C N   1 
ATOM   4767 C CA  . PRO C 1 188 ? -10.365 -11.051 43.462  1.00 27.47 ? 351 PRO C CA  1 
ATOM   4768 C C   . PRO C 1 188 ? -11.011 -11.096 42.076  1.00 27.87 ? 351 PRO C C   1 
ATOM   4769 O O   . PRO C 1 188 ? -11.779 -12.015 41.783  1.00 28.24 ? 351 PRO C O   1 
ATOM   4770 C CB  . PRO C 1 188 ? -11.233 -10.249 44.425  1.00 27.31 ? 351 PRO C CB  1 
ATOM   4771 C CG  . PRO C 1 188 ? -10.234 -9.573  45.380  1.00 28.56 ? 351 PRO C CG  1 
ATOM   4772 C CD  . PRO C 1 188 ? -9.032  -9.275  44.496  1.00 25.30 ? 351 PRO C CD  1 
ATOM   4773 N N   . ASN C 1 189 ? -10.653 -10.129 41.244  1.00 29.09 ? 352 ASN C N   1 
ATOM   4774 C CA  . ASN C 1 189 ? -11.140 -10.001 39.888  1.00 30.55 ? 352 ASN C CA  1 
ATOM   4775 C C   . ASN C 1 189 ? -10.616 -11.092 38.901  1.00 30.22 ? 352 ASN C C   1 
ATOM   4776 O O   . ASN C 1 189 ? -11.182 -11.269 37.799  1.00 31.31 ? 352 ASN C O   1 
ATOM   4777 C CB  . ASN C 1 189 ? -10.866 -8.557  39.379  1.00 30.77 ? 352 ASN C CB  1 
ATOM   4778 C CG  . ASN C 1 189 ? -11.522 -8.267  38.023  1.00 33.81 ? 352 ASN C CG  1 
ATOM   4779 O OD1 . ASN C 1 189 ? -12.672 -8.629  37.803  1.00 36.66 ? 352 ASN C OD1 1 
ATOM   4780 N ND2 . ASN C 1 189 ? -10.786 -7.605  37.111  1.00 35.47 ? 352 ASN C ND2 1 
ATOM   4781 N N   . THR C 1 190 ? -9.608  -11.865 39.305  1.00 29.60 ? 353 THR C N   1 
ATOM   4782 C CA  . THR C 1 190 ? -9.079  -12.970 38.449  1.00 28.03 ? 353 THR C CA  1 
ATOM   4783 C C   . THR C 1 190 ? -10.096 -14.085 38.084  1.00 28.56 ? 353 THR C C   1 
ATOM   4784 O O   . THR C 1 190 ? -10.663 -14.705 38.974  1.00 28.98 ? 353 THR C O   1 
ATOM   4785 C CB  . THR C 1 190 ? -7.868  -13.665 39.127  1.00 26.44 ? 353 THR C CB  1 
ATOM   4786 O OG1 . THR C 1 190 ? -6.926  -12.682 39.546  1.00 24.30 ? 353 THR C OG1 1 
ATOM   4787 C CG2 . THR C 1 190 ? -7.164  -14.607 38.187  1.00 26.05 ? 353 THR C CG2 1 
ATOM   4788 N N   . PRO C 1 191 ? -10.231 -14.427 36.787  1.00 29.11 ? 354 PRO C N   1 
ATOM   4789 C CA  . PRO C 1 191 ? -11.076 -15.577 36.448  1.00 28.89 ? 354 PRO C CA  1 
ATOM   4790 C C   . PRO C 1 191 ? -10.610 -16.831 37.181  1.00 29.39 ? 354 PRO C C   1 
ATOM   4791 O O   . PRO C 1 191 ? -9.401  -16.969 37.451  1.00 27.72 ? 354 PRO C O   1 
ATOM   4792 C CB  . PRO C 1 191 ? -10.839 -15.764 34.944  1.00 29.22 ? 354 PRO C CB  1 
ATOM   4793 C CG  . PRO C 1 191 ? -10.398 -14.415 34.455  1.00 29.41 ? 354 PRO C CG  1 
ATOM   4794 C CD  . PRO C 1 191 ? -9.609  -13.824 35.588  1.00 28.94 ? 354 PRO C CD  1 
ATOM   4795 N N   . LEU C 1 192 ? -11.569 -17.702 37.535  1.00 28.19 ? 355 LEU C N   1 
ATOM   4796 C CA  . LEU C 1 192 ? -11.283 -19.009 38.161  1.00 29.14 ? 355 LEU C CA  1 
ATOM   4797 C C   . LEU C 1 192 ? -11.241 -20.197 37.174  1.00 28.78 ? 355 LEU C C   1 
ATOM   4798 O O   . LEU C 1 192 ? -10.853 -21.308 37.530  1.00 28.93 ? 355 LEU C O   1 
ATOM   4799 C CB  . LEU C 1 192 ? -12.306 -19.292 39.271  1.00 29.21 ? 355 LEU C CB  1 
ATOM   4800 C CG  . LEU C 1 192 ? -12.325 -18.145 40.267  1.00 29.81 ? 355 LEU C CG  1 
ATOM   4801 C CD1 . LEU C 1 192 ? -13.462 -18.287 41.273  1.00 33.69 ? 355 LEU C CD1 1 
ATOM   4802 C CD2 . LEU C 1 192 ? -10.994 -18.000 40.981  1.00 30.82 ? 355 LEU C CD2 1 
ATOM   4803 N N   . CYS C 1 193 ? -11.642 -19.972 35.935  1.00 28.30 ? 356 CYS C N   1 
ATOM   4804 C CA  . CYS C 1 193 ? -11.671 -21.047 34.969  1.00 28.95 ? 356 CYS C CA  1 
ATOM   4805 C C   . CYS C 1 193 ? -10.321 -21.181 34.262  1.00 28.61 ? 356 CYS C C   1 
ATOM   4806 O O   . CYS C 1 193 ? -9.413  -20.387 34.515  1.00 28.80 ? 356 CYS C O   1 
ATOM   4807 C CB  . CYS C 1 193 ? -12.757 -20.736 33.950  1.00 28.46 ? 356 CYS C CB  1 
ATOM   4808 S SG  . CYS C 1 193 ? -12.431 -19.226 33.051  1.00 35.66 ? 356 CYS C SG  1 
ATOM   4809 N N   . SER C 1 194 ? -10.214 -22.136 33.337  1.00 28.45 ? 357 SER C N   1 
ATOM   4810 C CA  . SER C 1 194 ? -8.956  -22.429 32.626  1.00 28.80 ? 357 SER C CA  1 
ATOM   4811 C C   . SER C 1 194 ? -8.658  -21.422 31.520  1.00 28.81 ? 357 SER C C   1 
ATOM   4812 O O   . SER C 1 194 ? -9.569  -20.725 31.036  1.00 28.17 ? 357 SER C O   1 
ATOM   4813 C CB  . SER C 1 194 ? -8.995  -23.820 31.985  1.00 27.71 ? 357 SER C CB  1 
ATOM   4814 O OG  . SER C 1 194 ? -9.901  -23.856 30.891  1.00 30.68 ? 357 SER C OG  1 
ATOM   4815 N N   . ALA C 1 195 ? -7.394  -21.394 31.089  1.00 28.03 ? 358 ALA C N   1 
ATOM   4816 C CA  . ALA C 1 195 ? -7.014  -20.643 29.899  1.00 28.17 ? 358 ALA C CA  1 
ATOM   4817 C C   . ALA C 1 195 ? -7.861  -21.066 28.670  1.00 28.26 ? 358 ALA C C   1 
ATOM   4818 O O   . ALA C 1 195 ? -8.271  -20.210 27.877  1.00 28.31 ? 358 ALA C O   1 
ATOM   4819 C CB  . ALA C 1 195 ? -5.506  -20.793 29.610  1.00 27.10 ? 358 ALA C CB  1 
ATOM   4820 N N   . ARG C 1 196 ? -8.124  -22.360 28.533  1.00 27.70 ? 359 ARG C N   1 
ATOM   4821 C CA  . ARG C 1 196 ? -8.924  -22.867 27.438  1.00 28.76 ? 359 ARG C CA  1 
ATOM   4822 C C   . ARG C 1 196 ? -10.342 -22.277 27.453  1.00 28.50 ? 359 ARG C C   1 
ATOM   4823 O O   . ARG C 1 196 ? -10.817 -21.899 26.412  1.00 27.82 ? 359 ARG C O   1 
ATOM   4824 C CB  . ARG C 1 196 ? -8.988  -24.424 27.385  1.00 28.81 ? 359 ARG C CB  1 
ATOM   4825 C CG  . ARG C 1 196 ? -9.829  -24.916 26.149  1.00 31.71 ? 359 ARG C CG  1 
ATOM   4826 C CD  . ARG C 1 196 ? -10.154 -26.424 26.036  1.00 37.32 ? 359 ARG C CD  1 
ATOM   4827 N NE  . ARG C 1 196 ? -8.949  -27.243 25.933  1.00 45.00 ? 359 ARG C NE  1 
ATOM   4828 C CZ  . ARG C 1 196 ? -8.282  -27.553 24.806  1.00 47.87 ? 359 ARG C CZ  1 
ATOM   4829 N NH1 . ARG C 1 196 ? -8.669  -27.106 23.603  1.00 47.07 ? 359 ARG C NH1 1 
ATOM   4830 N NH2 . ARG C 1 196 ? -7.187  -28.320 24.890  1.00 47.82 ? 359 ARG C NH2 1 
ATOM   4831 N N   . ASP C 1 197 ? -10.978 -22.231 28.625  1.00 29.33 ? 360 ASP C N   1 
ATOM   4832 C CA  . ASP C 1 197 ? -12.315 -21.672 28.810  1.00 31.29 ? 360 ASP C CA  1 
ATOM   4833 C C   . ASP C 1 197 ? -12.285 -20.199 28.470  1.00 31.80 ? 360 ASP C C   1 
ATOM   4834 O O   . ASP C 1 197 ? -13.163 -19.697 27.755  1.00 31.27 ? 360 ASP C O   1 
ATOM   4835 C CB  . ASP C 1 197 ? -12.823 -21.853 30.254  1.00 30.89 ? 360 ASP C CB  1 
ATOM   4836 C CG  . ASP C 1 197 ? -13.310 -23.272 30.549  1.00 35.36 ? 360 ASP C CG  1 
ATOM   4837 O OD1 . ASP C 1 197 ? -13.643 -23.536 31.726  1.00 39.52 ? 360 ASP C OD1 1 
ATOM   4838 O OD2 . ASP C 1 197 ? -13.363 -24.134 29.636  1.00 36.57 ? 360 ASP C OD2 1 
ATOM   4839 N N   . LEU C 1 198 ? -11.262 -19.510 29.001  1.00 32.26 ? 361 LEU C N   1 
ATOM   4840 C CA  . LEU C 1 198 ? -11.022 -18.100 28.691  1.00 32.49 ? 361 LEU C CA  1 
ATOM   4841 C C   . LEU C 1 198 ? -10.951 -17.840 27.180  1.00 32.32 ? 361 LEU C C   1 
ATOM   4842 O O   . LEU C 1 198 ? -11.572 -16.897 26.696  1.00 31.65 ? 361 LEU C O   1 
ATOM   4843 C CB  . LEU C 1 198 ? -9.771  -17.552 29.405  1.00 31.00 ? 361 LEU C CB  1 
ATOM   4844 C CG  . LEU C 1 198 ? -9.977  -17.253 30.890  1.00 33.85 ? 361 LEU C CG  1 
ATOM   4845 C CD1 . LEU C 1 198 ? -8.649  -16.786 31.571  1.00 32.20 ? 361 LEU C CD1 1 
ATOM   4846 C CD2 . LEU C 1 198 ? -11.158 -16.239 31.176  1.00 32.33 ? 361 LEU C CD2 1 
ATOM   4847 N N   . ALA C 1 199 ? -10.199 -18.656 26.440  1.00 33.04 ? 362 ALA C N   1 
ATOM   4848 C CA  . ALA C 1 199 ? -10.125 -18.475 25.003  1.00 33.90 ? 362 ALA C CA  1 
ATOM   4849 C C   . ALA C 1 199 ? -11.502 -18.732 24.336  1.00 35.35 ? 362 ALA C C   1 
ATOM   4850 O O   . ALA C 1 199 ? -11.890 -18.028 23.393  1.00 34.15 ? 362 ALA C O   1 
ATOM   4851 C CB  . ALA C 1 199 ? -9.041  -19.360 24.402  1.00 34.26 ? 362 ALA C CB  1 
ATOM   4852 N N   . GLU C 1 200 ? -12.258 -19.713 24.841  1.00 36.81 ? 363 GLU C N   1 
ATOM   4853 C CA  . GLU C 1 200 ? -13.593 -19.965 24.271  1.00 39.39 ? 363 GLU C CA  1 
ATOM   4854 C C   . GLU C 1 200 ? -14.553 -18.799 24.513  1.00 41.08 ? 363 GLU C C   1 
ATOM   4855 O O   . GLU C 1 200 ? -15.211 -18.336 23.578  1.00 40.95 ? 363 GLU C O   1 
ATOM   4856 C CB  . GLU C 1 200 ? -14.186 -21.254 24.803  1.00 39.43 ? 363 GLU C CB  1 
ATOM   4857 C CG  . GLU C 1 200 ? -15.505 -21.691 24.129  1.00 43.10 ? 363 GLU C CG  1 
ATOM   4858 C CD  . GLU C 1 200 ? -16.020 -23.045 24.652  1.00 47.75 ? 363 GLU C CD  1 
ATOM   4859 O OE1 . GLU C 1 200 ? -15.429 -23.588 25.618  1.00 49.49 ? 363 GLU C OE1 1 
ATOM   4860 O OE2 . GLU C 1 200 ? -17.017 -23.571 24.095  1.00 50.29 ? 363 GLU C OE2 1 
ATOM   4861 N N   . LYS C 1 201 ? -14.624 -18.328 25.760  1.00 43.03 ? 364 LYS C N   1 
ATOM   4862 C CA  . LYS C 1 201 ? -15.464 -17.186 26.121  1.00 45.22 ? 364 LYS C CA  1 
ATOM   4863 C C   . LYS C 1 201 ? -15.110 -15.926 25.316  1.00 46.40 ? 364 LYS C C   1 
ATOM   4864 O O   . LYS C 1 201 ? -16.005 -15.142 24.970  1.00 47.08 ? 364 LYS C O   1 
ATOM   4865 C CB  . LYS C 1 201 ? -15.439 -16.935 27.637  1.00 45.64 ? 364 LYS C CB  1 
ATOM   4866 C CG  . LYS C 1 201 ? -15.944 -18.124 28.437  1.00 47.13 ? 364 LYS C CG  1 
ATOM   4867 C CD  . LYS C 1 201 ? -15.761 -17.974 29.946  1.00 49.80 ? 364 LYS C CD  1 
ATOM   4868 C CE  . LYS C 1 201 ? -16.505 -19.126 30.642  1.00 51.74 ? 364 LYS C CE  1 
ATOM   4869 N NZ  . LYS C 1 201 ? -15.991 -19.455 32.007  1.00 52.81 ? 364 LYS C NZ  1 
ATOM   4870 N N   . LYS C 1 202 ? -13.827 -15.762 24.985  1.00 47.59 ? 365 LYS C N   1 
ATOM   4871 C CA  . LYS C 1 202 ? -13.325 -14.665 24.142  1.00 49.09 ? 365 LYS C CA  1 
ATOM   4872 C C   . LYS C 1 202 ? -13.806 -14.707 22.685  1.00 50.21 ? 365 LYS C C   1 
ATOM   4873 O O   . LYS C 1 202 ? -14.144 -13.673 22.105  1.00 50.67 ? 365 LYS C O   1 
ATOM   4874 C CB  . LYS C 1 202 ? -11.802 -14.658 24.133  1.00 48.83 ? 365 LYS C CB  1 
ATOM   4875 C CG  . LYS C 1 202 ? -11.202 -13.380 23.592  1.00 50.75 ? 365 LYS C CG  1 
ATOM   4876 C CD  . LYS C 1 202 ? -10.001 -13.656 22.720  1.00 54.54 ? 365 LYS C CD  1 
ATOM   4877 C CE  . LYS C 1 202 ? -9.023  -12.488 22.746  1.00 56.35 ? 365 LYS C CE  1 
ATOM   4878 N NZ  . LYS C 1 202 ? -8.075  -12.532 21.584  1.00 58.78 ? 365 LYS C NZ  1 
ATOM   4879 N N   . TYR C 1 203 ? -13.779 -15.893 22.086  1.00 51.40 ? 366 TYR C N   1 
ATOM   4880 C CA  . TYR C 1 203 ? -14.237 -16.088 20.718  1.00 52.60 ? 366 TYR C CA  1 
ATOM   4881 C C   . TYR C 1 203 ? -15.739 -15.808 20.602  1.00 53.56 ? 366 TYR C C   1 
ATOM   4882 O O   . TYR C 1 203 ? -16.175 -15.103 19.683  1.00 53.54 ? 366 TYR C O   1 
ATOM   4883 C CB  . TYR C 1 203 ? -13.922 -17.512 20.247  1.00 52.60 ? 366 TYR C CB  1 
ATOM   4884 C CG  . TYR C 1 203 ? -14.503 -17.847 18.896  1.00 52.93 ? 366 TYR C CG  1 
ATOM   4885 C CD1 . TYR C 1 203 ? -13.776 -17.613 17.727  1.00 53.39 ? 366 TYR C CD1 1 
ATOM   4886 C CD2 . TYR C 1 203 ? -15.777 -18.396 18.787  1.00 53.66 ? 366 TYR C CD2 1 
ATOM   4887 C CE1 . TYR C 1 203 ? -14.296 -17.917 16.493  1.00 54.53 ? 366 TYR C CE1 1 
ATOM   4888 C CE2 . TYR C 1 203 ? -16.314 -18.700 17.556  1.00 55.25 ? 366 TYR C CE2 1 
ATOM   4889 C CZ  . TYR C 1 203 ? -15.571 -18.462 16.407  1.00 55.76 ? 366 TYR C CZ  1 
ATOM   4890 O OH  . TYR C 1 203 ? -16.111 -18.757 15.171  1.00 56.86 ? 366 TYR C OH  1 
ATOM   4891 N N   . ILE C 1 204 ? -16.510 -16.367 21.538  1.00 54.46 ? 367 ILE C N   1 
ATOM   4892 C CA  . ILE C 1 204 ? -17.958 -16.177 21.615  1.00 55.89 ? 367 ILE C CA  1 
ATOM   4893 C C   . ILE C 1 204 ? -18.374 -14.694 21.659  1.00 57.30 ? 367 ILE C C   1 
ATOM   4894 O O   . ILE C 1 204 ? -19.417 -14.316 21.123  1.00 57.45 ? 367 ILE C O   1 
ATOM   4895 C CB  . ILE C 1 204 ? -18.552 -16.970 22.800  1.00 55.54 ? 367 ILE C CB  1 
ATOM   4896 C CG1 . ILE C 1 204 ? -18.438 -18.476 22.514  1.00 55.13 ? 367 ILE C CG1 1 
ATOM   4897 C CG2 . ILE C 1 204 ? -20.007 -16.547 23.088  1.00 55.40 ? 367 ILE C CG2 1 
ATOM   4898 C CD1 . ILE C 1 204 ? -18.799 -19.385 23.673  1.00 54.07 ? 367 ILE C CD1 1 
ATOM   4899 N N   . LEU C 1 205 ? -17.547 -13.855 22.277  1.00 58.99 ? 368 LEU C N   1 
ATOM   4900 C CA  . LEU C 1 205 ? -17.828 -12.425 22.358  1.00 60.50 ? 368 LEU C CA  1 
ATOM   4901 C C   . LEU C 1 205 ? -17.260 -11.649 21.171  1.00 61.44 ? 368 LEU C C   1 
ATOM   4902 O O   . LEU C 1 205 ? -17.782 -10.593 20.819  1.00 61.84 ? 368 LEU C O   1 
ATOM   4903 C CB  . LEU C 1 205 ? -17.361 -11.847 23.700  1.00 60.66 ? 368 LEU C CB  1 
ATOM   4904 C CG  . LEU C 1 205 ? -17.912 -12.492 24.989  1.00 60.97 ? 368 LEU C CG  1 
ATOM   4905 C CD1 . LEU C 1 205 ? -17.706 -11.544 26.162  1.00 61.56 ? 368 LEU C CD1 1 
ATOM   4906 C CD2 . LEU C 1 205 ? -19.393 -12.948 24.907  1.00 60.64 ? 368 LEU C CD2 1 
ATOM   4907 N N   . SER C 1 206 ? -16.214 -12.193 20.549  1.00 62.71 ? 369 SER C N   1 
ATOM   4908 C CA  . SER C 1 206 ? -15.642 -11.657 19.308  1.00 63.87 ? 369 SER C CA  1 
ATOM   4909 C C   . SER C 1 206 ? -16.591 -11.857 18.106  1.00 64.72 ? 369 SER C C   1 
ATOM   4910 O O   . SER C 1 206 ? -16.259 -11.503 16.958  1.00 65.00 ? 369 SER C O   1 
ATOM   4911 C CB  . SER C 1 206 ? -14.257 -12.286 19.053  1.00 64.03 ? 369 SER C CB  1 
ATOM   4912 O OG  . SER C 1 206 ? -13.779 -12.092 17.721  1.00 64.78 ? 369 SER C OG  1 
ATOM   4913 N N   . ASN C 1 207 ? -17.771 -12.415 18.383  1.00 65.26 ? 370 ASN C N   1 
ATOM   4914 C CA  . ASN C 1 207 ? -18.819 -12.618 17.381  1.00 65.74 ? 370 ASN C CA  1 
ATOM   4915 C C   . ASN C 1 207 ? -20.203 -12.287 17.931  1.00 65.77 ? 370 ASN C C   1 
ATOM   4916 O O   . ASN C 1 207 ? -21.196 -12.347 17.207  1.00 66.04 ? 370 ASN C O   1 
ATOM   4917 C CB  . ASN C 1 207 ? -18.794 -14.062 16.871  1.00 65.79 ? 370 ASN C CB  1 
ATOM   4918 C CG  . ASN C 1 207 ? -17.484 -14.424 16.198  1.00 65.92 ? 370 ASN C CG  1 
ATOM   4919 O OD1 . ASN C 1 207 ? -16.930 -13.646 15.421  1.00 67.26 ? 370 ASN C OD1 1 
ATOM   4920 N ND2 . ASN C 1 207 ? -16.987 -15.612 16.489  1.00 66.21 ? 370 ASN C ND2 1 
ATOM   4921 N N   . SER D 1 2   ? 1.217   -38.093 37.017  1.00 37.58 ? 41  SER D N   1 
ATOM   4922 C CA  . SER D 1 2   ? 1.207   -38.137 38.513  1.00 36.86 ? 41  SER D CA  1 
ATOM   4923 C C   . SER D 1 2   ? 2.641   -37.969 39.105  1.00 35.35 ? 41  SER D C   1 
ATOM   4924 O O   . SER D 1 2   ? 3.663   -37.946 38.376  1.00 35.10 ? 41  SER D O   1 
ATOM   4925 C CB  . SER D 1 2   ? 0.421   -39.360 39.056  1.00 38.46 ? 41  SER D CB  1 
ATOM   4926 O OG  . SER D 1 2   ? -0.868  -39.005 39.593  1.00 40.11 ? 41  SER D OG  1 
ATOM   4927 N N   . HIS D 1 3   ? 2.701   -37.745 40.409  1.00 33.38 ? 42  HIS D N   1 
ATOM   4928 C CA  . HIS D 1 3   ? 3.937   -37.347 41.070  1.00 31.17 ? 42  HIS D CA  1 
ATOM   4929 C C   . HIS D 1 3   ? 4.073   -38.212 42.303  1.00 31.46 ? 42  HIS D C   1 
ATOM   4930 O O   . HIS D 1 3   ? 3.045   -38.581 42.894  1.00 31.33 ? 42  HIS D O   1 
ATOM   4931 C CB  . HIS D 1 3   ? 3.862   -35.849 41.446  1.00 30.53 ? 42  HIS D CB  1 
ATOM   4932 C CG  . HIS D 1 3   ? 5.168   -35.243 41.887  1.00 26.74 ? 42  HIS D CG  1 
ATOM   4933 N ND1 . HIS D 1 3   ? 5.701   -35.453 43.141  1.00 26.83 ? 42  HIS D ND1 1 
ATOM   4934 C CD2 . HIS D 1 3   ? 6.021   -34.392 41.257  1.00 24.51 ? 42  HIS D CD2 1 
ATOM   4935 C CE1 . HIS D 1 3   ? 6.838   -34.781 43.261  1.00 26.94 ? 42  HIS D CE1 1 
ATOM   4936 N NE2 . HIS D 1 3   ? 7.057   -34.124 42.134  1.00 22.97 ? 42  HIS D NE2 1 
ATOM   4937 N N   . GLY D 1 4   ? 5.321   -38.558 42.668  1.00 30.18 ? 43  GLY D N   1 
ATOM   4938 C CA  . GLY D 1 4   ? 5.633   -39.267 43.908  1.00 30.64 ? 43  GLY D CA  1 
ATOM   4939 C C   . GLY D 1 4   ? 5.247   -38.430 45.132  1.00 31.24 ? 43  GLY D C   1 
ATOM   4940 O O   . GLY D 1 4   ? 4.825   -37.275 44.991  1.00 30.20 ? 43  GLY D O   1 
ATOM   4941 N N   . ARG D 1 5   ? 5.372   -38.996 46.332  1.00 30.67 ? 44  ARG D N   1 
ATOM   4942 C CA  . ARG D 1 5   ? 4.944   -38.264 47.520  1.00 31.27 ? 44  ARG D CA  1 
ATOM   4943 C C   . ARG D 1 5   ? 5.866   -37.067 47.799  1.00 30.11 ? 44  ARG D C   1 
ATOM   4944 O O   . ARG D 1 5   ? 5.387   -35.958 48.104  1.00 30.58 ? 44  ARG D O   1 
ATOM   4945 C CB  . ARG D 1 5   ? 4.887   -39.212 48.719  1.00 32.89 ? 44  ARG D CB  1 
ATOM   4946 C CG  . ARG D 1 5   ? 4.550   -38.579 50.061  1.00 36.12 ? 44  ARG D CG  1 
ATOM   4947 C CD  . ARG D 1 5   ? 4.831   -39.616 51.204  1.00 41.47 ? 44  ARG D CD  1 
ATOM   4948 N NE  . ARG D 1 5   ? 4.721   -38.991 52.523  1.00 44.78 ? 44  ARG D NE  1 
ATOM   4949 C CZ  . ARG D 1 5   ? 5.612   -38.141 53.041  1.00 46.92 ? 44  ARG D CZ  1 
ATOM   4950 N NH1 . ARG D 1 5   ? 6.723   -37.822 52.376  1.00 47.55 ? 44  ARG D NH1 1 
ATOM   4951 N NH2 . ARG D 1 5   ? 5.393   -37.606 54.238  1.00 49.17 ? 44  ARG D NH2 1 
ATOM   4952 N N   . SER D 1 6   ? 7.170   -37.294 47.668  1.00 27.64 ? 45  SER D N   1 
ATOM   4953 C CA  . SER D 1 6   ? 8.213   -36.327 48.015  1.00 27.55 ? 45  SER D CA  1 
ATOM   4954 C C   . SER D 1 6   ? 8.482   -35.360 46.824  1.00 25.85 ? 45  SER D C   1 
ATOM   4955 O O   . SER D 1 6   ? 8.283   -35.747 45.688  1.00 25.04 ? 45  SER D O   1 
ATOM   4956 C CB  . SER D 1 6   ? 9.465   -37.138 48.249  1.00 26.82 ? 45  SER D CB  1 
ATOM   4957 O OG  . SER D 1 6   ? 10.323  -36.495 49.126  1.00 34.98 ? 45  SER D OG  1 
ATOM   4958 N N   . ARG D 1 7   ? 8.950   -34.140 47.083  1.00 23.72 ? 46  ARG D N   1 
ATOM   4959 C CA  . ARG D 1 7   ? 9.342   -33.237 45.992  1.00 22.55 ? 46  ARG D CA  1 
ATOM   4960 C C   . ARG D 1 7   ? 10.678  -33.698 45.435  1.00 21.05 ? 46  ARG D C   1 
ATOM   4961 O O   . ARG D 1 7   ? 11.487  -34.277 46.161  1.00 20.38 ? 46  ARG D O   1 
ATOM   4962 C CB  . ARG D 1 7   ? 9.372   -31.760 46.427  1.00 21.77 ? 46  ARG D CB  1 
ATOM   4963 C CG  . ARG D 1 7   ? 10.473  -31.309 47.402  1.00 20.62 ? 46  ARG D CG  1 
ATOM   4964 C CD  . ARG D 1 7   ? 10.046  -29.981 48.076  1.00 18.71 ? 46  ARG D CD  1 
ATOM   4965 N NE  . ARG D 1 7   ? 9.742   -28.963 47.055  1.00 18.24 ? 46  ARG D NE  1 
ATOM   4966 C CZ  . ARG D 1 7   ? 8.756   -28.070 47.135  1.00 22.59 ? 46  ARG D CZ  1 
ATOM   4967 N NH1 . ARG D 1 7   ? 7.995   -28.038 48.214  1.00 18.21 ? 46  ARG D NH1 1 
ATOM   4968 N NH2 . ARG D 1 7   ? 8.528   -27.189 46.144  1.00 19.91 ? 46  ARG D NH2 1 
ATOM   4969 N N   . PHE D 1 8   ? 10.878  -33.469 44.137  1.00 20.67 ? 47  PHE D N   1 
ATOM   4970 C CA  . PHE D 1 8   ? 12.110  -33.856 43.459  1.00 19.06 ? 47  PHE D CA  1 
ATOM   4971 C C   . PHE D 1 8   ? 13.202  -32.822 43.772  1.00 18.95 ? 47  PHE D C   1 
ATOM   4972 O O   . PHE D 1 8   ? 14.387  -33.155 44.009  1.00 18.67 ? 47  PHE D O   1 
ATOM   4973 C CB  . PHE D 1 8   ? 11.828  -34.014 41.947  1.00 19.58 ? 47  PHE D CB  1 
ATOM   4974 C CG  . PHE D 1 8   ? 12.953  -34.671 41.184  1.00 20.73 ? 47  PHE D CG  1 
ATOM   4975 C CD1 . PHE D 1 8   ? 13.193  -36.048 41.323  1.00 22.25 ? 47  PHE D CD1 1 
ATOM   4976 C CD2 . PHE D 1 8   ? 13.800  -33.894 40.337  1.00 24.14 ? 47  PHE D CD2 1 
ATOM   4977 C CE1 . PHE D 1 8   ? 14.279  -36.689 40.633  1.00 23.83 ? 47  PHE D CE1 1 
ATOM   4978 C CE2 . PHE D 1 8   ? 14.864  -34.500 39.612  1.00 26.84 ? 47  PHE D CE2 1 
ATOM   4979 C CZ  . PHE D 1 8   ? 15.111  -35.894 39.766  1.00 25.19 ? 47  PHE D CZ  1 
ATOM   4980 N N   . VAL D 1 9   ? 12.802  -31.555 43.814  1.00 17.96 ? 48  VAL D N   1 
ATOM   4981 C CA  . VAL D 1 9   ? 13.741  -30.464 44.048  1.00 17.53 ? 48  VAL D CA  1 
ATOM   4982 C C   . VAL D 1 9   ? 13.195  -29.693 45.253  1.00 18.08 ? 48  VAL D C   1 
ATOM   4983 O O   . VAL D 1 9   ? 12.029  -29.356 45.280  1.00 16.74 ? 48  VAL D O   1 
ATOM   4984 C CB  . VAL D 1 9   ? 13.871  -29.520 42.777  1.00 16.15 ? 48  VAL D CB  1 
ATOM   4985 C CG1 . VAL D 1 9   ? 14.694  -28.191 43.062  1.00 16.01 ? 48  VAL D CG1 1 
ATOM   4986 C CG2 . VAL D 1 9   ? 14.428  -30.306 41.605  1.00 18.61 ? 48  VAL D CG2 1 
ATOM   4987 N N   . LYS D 1 10  ? 14.020  -29.514 46.268  1.00 17.77 ? 49  LYS D N   1 
ATOM   4988 C CA  . LYS D 1 10  ? 13.612  -28.795 47.465  1.00 21.15 ? 49  LYS D CA  1 
ATOM   4989 C C   . LYS D 1 10  ? 13.576  -27.260 47.167  1.00 22.44 ? 49  LYS D C   1 
ATOM   4990 O O   . LYS D 1 10  ? 14.166  -26.800 46.178  1.00 20.29 ? 49  LYS D O   1 
ATOM   4991 C CB  . LYS D 1 10  ? 14.595  -29.134 48.609  1.00 22.19 ? 49  LYS D CB  1 
ATOM   4992 C CG  . LYS D 1 10  ? 14.775  -30.667 48.894  1.00 25.79 ? 49  LYS D CG  1 
ATOM   4993 C CD  . LYS D 1 10  ? 14.247  -31.114 50.243  1.00 34.07 ? 49  LYS D CD  1 
ATOM   4994 C CE  . LYS D 1 10  ? 12.800  -31.728 50.144  1.00 39.49 ? 49  LYS D CE  1 
ATOM   4995 N NZ  . LYS D 1 10  ? 11.861  -31.422 51.305  1.00 39.56 ? 49  LYS D NZ  1 
ATOM   4996 N N   . LYS D 1 11  ? 12.897  -26.482 48.010  1.00 22.77 ? 50  LYS D N   1 
ATOM   4997 C CA  . LYS D 1 11  ? 12.821  -25.021 47.810  1.00 23.97 ? 50  LYS D CA  1 
ATOM   4998 C C   . LYS D 1 11  ? 14.184  -24.355 47.722  1.00 23.28 ? 50  LYS D C   1 
ATOM   4999 O O   . LYS D 1 11  ? 14.343  -23.376 47.005  1.00 23.94 ? 50  LYS D O   1 
ATOM   5000 C CB  . LYS D 1 11  ? 12.000  -24.305 48.912  1.00 23.15 ? 50  LYS D CB  1 
ATOM   5001 C CG  . LYS D 1 11  ? 10.575  -24.788 49.063  1.00 26.88 ? 50  LYS D CG  1 
ATOM   5002 C CD  . LYS D 1 11  ? 9.856   -24.467 47.811  1.00 27.97 ? 50  LYS D CD  1 
ATOM   5003 C CE  . LYS D 1 11  ? 9.061   -23.211 47.921  1.00 24.66 ? 50  LYS D CE  1 
ATOM   5004 N NZ  . LYS D 1 11  ? 8.285   -23.126 46.648  1.00 22.55 ? 50  LYS D NZ  1 
ATOM   5005 N N   . ASP D 1 12  ? 15.146  -24.875 48.468  1.00 24.02 ? 51  ASP D N   1 
ATOM   5006 C CA  . ASP D 1 12  ? 16.511  -24.356 48.460  1.00 24.57 ? 51  ASP D CA  1 
ATOM   5007 C C   . ASP D 1 12  ? 17.337  -24.890 47.270  1.00 24.14 ? 51  ASP D C   1 
ATOM   5008 O O   . ASP D 1 12  ? 18.530  -24.654 47.238  1.00 25.49 ? 51  ASP D O   1 
ATOM   5009 C CB  . ASP D 1 12  ? 17.242  -24.707 49.788  1.00 26.08 ? 51  ASP D CB  1 
ATOM   5010 C CG  . ASP D 1 12  ? 17.487  -26.230 49.973  1.00 30.07 ? 51  ASP D CG  1 
ATOM   5011 O OD1 . ASP D 1 12  ? 17.193  -27.038 49.055  1.00 31.72 ? 51  ASP D OD1 1 
ATOM   5012 O OD2 . ASP D 1 12  ? 17.963  -26.641 51.060  1.00 35.23 ? 51  ASP D OD2 1 
ATOM   5013 N N   . GLY D 1 13  ? 16.712  -25.607 46.334  1.00 21.97 ? 52  GLY D N   1 
ATOM   5014 C CA  . GLY D 1 13  ? 17.418  -26.122 45.125  1.00 22.05 ? 52  GLY D CA  1 
ATOM   5015 C C   . GLY D 1 13  ? 18.151  -27.455 45.243  1.00 22.28 ? 52  GLY D C   1 
ATOM   5016 O O   . GLY D 1 13  ? 18.659  -28.016 44.246  1.00 19.82 ? 52  GLY D O   1 
ATOM   5017 N N   . HIS D 1 14  ? 18.206  -27.996 46.455  1.00 22.06 ? 53  HIS D N   1 
ATOM   5018 C CA  . HIS D 1 14  ? 18.837  -29.311 46.637  1.00 24.65 ? 53  HIS D CA  1 
ATOM   5019 C C   . HIS D 1 14  ? 17.940  -30.335 45.960  1.00 23.02 ? 53  HIS D C   1 
ATOM   5020 O O   . HIS D 1 14  ? 16.731  -30.301 46.129  1.00 22.57 ? 53  HIS D O   1 
ATOM   5021 C CB  . HIS D 1 14  ? 18.973  -29.655 48.130  1.00 26.10 ? 53  HIS D CB  1 
ATOM   5022 C CG  . HIS D 1 14  ? 19.535  -31.019 48.377  1.00 31.64 ? 53  HIS D CG  1 
ATOM   5023 N ND1 . HIS D 1 14  ? 20.885  -31.297 48.273  1.00 37.77 ? 53  HIS D ND1 1 
ATOM   5024 C CD2 . HIS D 1 14  ? 18.931  -32.191 48.696  1.00 35.67 ? 53  HIS D CD2 1 
ATOM   5025 C CE1 . HIS D 1 14  ? 21.085  -32.582 48.518  1.00 37.75 ? 53  HIS D CE1 1 
ATOM   5026 N NE2 . HIS D 1 14  ? 19.918  -33.144 48.777  1.00 35.54 ? 53  HIS D NE2 1 
ATOM   5027 N N   . CYS D 1 15  ? 18.522  -31.256 45.208  1.00 22.93 ? 54  CYS D N   1 
ATOM   5028 C CA  . CYS D 1 15  ? 17.720  -32.285 44.544  1.00 23.30 ? 54  CYS D CA  1 
ATOM   5029 C C   . CYS D 1 15  ? 17.484  -33.427 45.511  1.00 23.60 ? 54  CYS D C   1 
ATOM   5030 O O   . CYS D 1 15  ? 18.436  -33.933 46.107  1.00 24.21 ? 54  CYS D O   1 
ATOM   5031 C CB  . CYS D 1 15  ? 18.398  -32.750 43.250  1.00 22.32 ? 54  CYS D CB  1 
ATOM   5032 S SG  . CYS D 1 15  ? 18.446  -31.339 42.038  1.00 25.75 ? 54  CYS D SG  1 
ATOM   5033 N N   . ASN D 1 16  ? 16.237  -33.825 45.686  1.00 23.40 ? 55  ASN D N   1 
ATOM   5034 C CA  . ASN D 1 16  ? 15.887  -34.839 46.722  1.00 25.50 ? 55  ASN D CA  1 
ATOM   5035 C C   . ASN D 1 16  ? 16.171  -36.312 46.265  1.00 25.78 ? 55  ASN D C   1 
ATOM   5036 O O   . ASN D 1 16  ? 15.279  -37.150 46.195  1.00 26.05 ? 55  ASN D O   1 
ATOM   5037 C CB  . ASN D 1 16  ? 14.399  -34.644 47.094  1.00 24.94 ? 55  ASN D CB  1 
ATOM   5038 C CG  . ASN D 1 16  ? 14.027  -35.236 48.437  1.00 30.28 ? 55  ASN D CG  1 
ATOM   5039 O OD1 . ASN D 1 16  ? 14.887  -35.512 49.266  1.00 34.19 ? 55  ASN D OD1 1 
ATOM   5040 N ND2 . ASN D 1 16  ? 12.724  -35.452 48.657  1.00 29.29 ? 55  ASN D ND2 1 
ATOM   5041 N N   . VAL D 1 17  ? 17.423  -36.610 45.940  1.00 27.03 ? 56  VAL D N   1 
ATOM   5042 C CA  . VAL D 1 17  ? 17.779  -37.844 45.242  1.00 28.36 ? 56  VAL D CA  1 
ATOM   5043 C C   . VAL D 1 17  ? 19.031  -38.437 45.877  1.00 28.95 ? 56  VAL D C   1 
ATOM   5044 O O   . VAL D 1 17  ? 20.002  -37.705 46.165  1.00 28.30 ? 56  VAL D O   1 
ATOM   5045 C CB  . VAL D 1 17  ? 17.976  -37.578 43.699  1.00 28.81 ? 56  VAL D CB  1 
ATOM   5046 C CG1 . VAL D 1 17  ? 19.177  -36.633 43.451  1.00 31.07 ? 56  VAL D CG1 1 
ATOM   5047 C CG2 . VAL D 1 17  ? 18.202  -38.863 42.940  1.00 30.38 ? 56  VAL D CG2 1 
ATOM   5048 N N   . GLN D 1 18  ? 19.000  -39.751 46.099  1.00 29.75 ? 57  GLN D N   1 
ATOM   5049 C CA  . GLN D 1 18  ? 20.144  -40.516 46.642  1.00 30.57 ? 57  GLN D CA  1 
ATOM   5050 C C   . GLN D 1 18  ? 20.577  -41.540 45.605  1.00 29.50 ? 57  GLN D C   1 
ATOM   5051 O O   . GLN D 1 18  ? 19.743  -42.246 45.056  1.00 29.27 ? 57  GLN D O   1 
ATOM   5052 C CB  . GLN D 1 18  ? 19.730  -41.214 47.948  1.00 31.67 ? 57  GLN D CB  1 
ATOM   5053 C CG  . GLN D 1 18  ? 20.759  -42.190 48.539  1.00 37.50 ? 57  GLN D CG  1 
ATOM   5054 C CD  . GLN D 1 18  ? 20.158  -43.378 49.333  1.00 45.89 ? 57  GLN D CD  1 
ATOM   5055 O OE1 . GLN D 1 18  ? 18.970  -43.743 49.192  1.00 49.50 ? 57  GLN D OE1 1 
ATOM   5056 N NE2 . GLN D 1 18  ? 20.999  -44.002 50.162  1.00 47.70 ? 57  GLN D NE2 1 
ATOM   5057 N N   . PHE D 1 19  ? 21.876  -41.598 45.323  1.00 28.81 ? 58  PHE D N   1 
ATOM   5058 C CA  . PHE D 1 19  ? 22.437  -42.544 44.368  1.00 28.68 ? 58  PHE D CA  1 
ATOM   5059 C C   . PHE D 1 19  ? 22.913  -43.819 45.083  1.00 28.58 ? 58  PHE D C   1 
ATOM   5060 O O   . PHE D 1 19  ? 23.585  -43.734 46.097  1.00 28.00 ? 58  PHE D O   1 
ATOM   5061 C CB  . PHE D 1 19  ? 23.625  -41.903 43.634  1.00 29.77 ? 58  PHE D CB  1 
ATOM   5062 C CG  . PHE D 1 19  ? 23.260  -40.733 42.742  1.00 32.36 ? 58  PHE D CG  1 
ATOM   5063 C CD1 . PHE D 1 19  ? 21.946  -40.410 42.470  1.00 33.88 ? 58  PHE D CD1 1 
ATOM   5064 C CD2 . PHE D 1 19  ? 24.268  -39.985 42.129  1.00 38.51 ? 58  PHE D CD2 1 
ATOM   5065 C CE1 . PHE D 1 19  ? 21.618  -39.344 41.620  1.00 34.14 ? 58  PHE D CE1 1 
ATOM   5066 C CE2 . PHE D 1 19  ? 23.950  -38.914 41.279  1.00 38.43 ? 58  PHE D CE2 1 
ATOM   5067 C CZ  . PHE D 1 19  ? 22.600  -38.612 41.026  1.00 36.66 ? 58  PHE D CZ  1 
ATOM   5068 N N   . ILE D 1 20  ? 22.580  -44.996 44.554  1.00 28.12 ? 59  ILE D N   1 
ATOM   5069 C CA  . ILE D 1 20  ? 23.047  -46.247 45.178  1.00 28.96 ? 59  ILE D CA  1 
ATOM   5070 C C   . ILE D 1 20  ? 23.668  -47.131 44.117  1.00 28.75 ? 59  ILE D C   1 
ATOM   5071 O O   . ILE D 1 20  ? 23.440  -46.917 42.920  1.00 27.49 ? 59  ILE D O   1 
ATOM   5072 C CB  . ILE D 1 20  ? 21.910  -47.003 45.966  1.00 28.94 ? 59  ILE D CB  1 
ATOM   5073 C CG1 . ILE D 1 20  ? 20.801  -47.534 45.032  1.00 28.16 ? 59  ILE D CG1 1 
ATOM   5074 C CG2 . ILE D 1 20  ? 21.332  -46.109 47.053  1.00 28.72 ? 59  ILE D CG2 1 
ATOM   5075 C CD1 . ILE D 1 20  ? 19.849  -48.541 45.713  1.00 27.63 ? 59  ILE D CD1 1 
ATOM   5076 N N   . ASN D 1 21  ? 24.472  -48.092 44.556  1.00 29.16 ? 60  ASN D N   1 
ATOM   5077 C CA  . ASN D 1 21  ? 25.105  -49.046 43.646  1.00 30.22 ? 60  ASN D CA  1 
ATOM   5078 C C   . ASN D 1 21  ? 25.947  -48.338 42.548  1.00 32.24 ? 60  ASN D C   1 
ATOM   5079 O O   . ASN D 1 21  ? 25.999  -48.781 41.407  1.00 31.38 ? 60  ASN D O   1 
ATOM   5080 C CB  . ASN D 1 21  ? 24.043  -50.021 43.078  1.00 29.81 ? 60  ASN D CB  1 
ATOM   5081 C CG  . ASN D 1 21  ? 23.285  -50.793 44.195  1.00 29.35 ? 60  ASN D CG  1 
ATOM   5082 O OD1 . ASN D 1 21  ? 23.881  -51.115 45.203  1.00 30.98 ? 60  ASN D OD1 1 
ATOM   5083 N ND2 . ASN D 1 21  ? 21.992  -51.054 44.020  1.00 26.98 ? 60  ASN D ND2 1 
ATOM   5084 N N   . VAL D 1 22  ? 26.603  -47.235 42.902  1.00 34.30 ? 61  VAL D N   1 
ATOM   5085 C CA  . VAL D 1 22  ? 27.480  -46.568 41.928  1.00 38.24 ? 61  VAL D CA  1 
ATOM   5086 C C   . VAL D 1 22  ? 28.887  -47.186 41.840  1.00 40.23 ? 61  VAL D C   1 
ATOM   5087 O O   . VAL D 1 22  ? 29.596  -46.952 40.867  1.00 41.14 ? 61  VAL D O   1 
ATOM   5088 C CB  . VAL D 1 22  ? 27.485  -45.015 42.025  1.00 37.63 ? 61  VAL D CB  1 
ATOM   5089 C CG1 . VAL D 1 22  ? 26.547  -44.500 43.089  1.00 38.93 ? 61  VAL D CG1 1 
ATOM   5090 C CG2 . VAL D 1 22  ? 28.893  -44.446 42.157  1.00 39.86 ? 61  VAL D CG2 1 
ATOM   5091 N N   . GLY D 1 23  ? 29.275  -47.982 42.835  1.00 42.04 ? 62  GLY D N   1 
ATOM   5092 C CA  . GLY D 1 23  ? 30.545  -48.709 42.774  1.00 44.93 ? 62  GLY D CA  1 
ATOM   5093 C C   . GLY D 1 23  ? 31.763  -47.865 43.123  1.00 46.88 ? 62  GLY D C   1 
ATOM   5094 O O   . GLY D 1 23  ? 31.680  -46.928 43.920  1.00 46.91 ? 62  GLY D O   1 
ATOM   5095 N N   . GLU D 1 24  ? 32.900  -48.193 42.519  1.00 48.89 ? 63  GLU D N   1 
ATOM   5096 C CA  . GLU D 1 24  ? 34.171  -47.547 42.884  1.00 51.14 ? 63  GLU D CA  1 
ATOM   5097 C C   . GLU D 1 24  ? 34.271  -46.090 42.399  1.00 51.89 ? 63  GLU D C   1 
ATOM   5098 O O   . GLU D 1 24  ? 33.589  -45.704 41.448  1.00 52.18 ? 63  GLU D O   1 
ATOM   5099 C CB  . GLU D 1 24  ? 35.359  -48.359 42.346  1.00 51.25 ? 63  GLU D CB  1 
ATOM   5100 C CG  . GLU D 1 24  ? 35.623  -48.103 40.870  1.00 54.99 ? 63  GLU D CG  1 
ATOM   5101 C CD  . GLU D 1 24  ? 36.686  -49.005 40.268  1.00 59.55 ? 63  GLU D CD  1 
ATOM   5102 O OE1 . GLU D 1 24  ? 37.901  -48.734 40.484  1.00 60.59 ? 63  GLU D OE1 1 
ATOM   5103 O OE2 . GLU D 1 24  ? 36.291  -49.962 39.550  1.00 61.03 ? 63  GLU D OE2 1 
ATOM   5104 N N   . LYS D 1 25  ? 35.117  -45.317 43.095  1.00 52.83 ? 64  LYS D N   1 
ATOM   5105 C CA  . LYS D 1 25  ? 35.689  -44.010 42.686  1.00 53.66 ? 64  LYS D CA  1 
ATOM   5106 C C   . LYS D 1 25  ? 35.762  -43.759 41.184  1.00 53.55 ? 64  LYS D C   1 
ATOM   5107 O O   . LYS D 1 25  ? 35.217  -42.771 40.694  1.00 54.14 ? 64  LYS D O   1 
ATOM   5108 C CB  . LYS D 1 25  ? 37.112  -43.867 43.260  1.00 54.21 ? 64  LYS D CB  1 
ATOM   5109 C CG  . LYS D 1 25  ? 37.731  -45.228 43.693  1.00 55.93 ? 64  LYS D CG  1 
ATOM   5110 C CD  . LYS D 1 25  ? 39.104  -45.593 43.107  1.00 57.81 ? 64  LYS D CD  1 
ATOM   5111 C CE  . LYS D 1 25  ? 39.381  -47.091 43.344  1.00 58.35 ? 64  LYS D CE  1 
ATOM   5112 N NZ  . LYS D 1 25  ? 40.836  -47.432 43.339  1.00 58.68 ? 64  LYS D NZ  1 
ATOM   5113 N N   . ARG D 1 26  ? 36.447  -44.653 40.469  1.00 53.24 ? 189 ARG D N   1 
ATOM   5114 C CA  . ARG D 1 26  ? 36.567  -44.599 39.013  1.00 53.04 ? 189 ARG D CA  1 
ATOM   5115 C C   . ARG D 1 26  ? 35.251  -44.296 38.282  1.00 52.67 ? 189 ARG D C   1 
ATOM   5116 O O   . ARG D 1 26  ? 35.254  -43.704 37.191  1.00 53.30 ? 189 ARG D O   1 
ATOM   5117 C CB  . ARG D 1 26  ? 37.134  -45.911 38.504  1.00 53.57 ? 189 ARG D CB  1 
ATOM   5118 N N   . ASN D 1 27  ? 34.136  -44.723 38.877  1.00 51.23 ? 190 ASN D N   1 
ATOM   5119 C CA  . ASN D 1 27  ? 32.832  -44.673 38.233  1.00 49.53 ? 190 ASN D CA  1 
ATOM   5120 C C   . ASN D 1 27  ? 32.073  -43.352 38.509  1.00 48.18 ? 190 ASN D C   1 
ATOM   5121 O O   . ASN D 1 27  ? 30.964  -43.158 38.000  1.00 48.25 ? 190 ASN D O   1 
ATOM   5122 C CB  . ASN D 1 27  ? 31.992  -45.907 38.648  1.00 49.93 ? 190 ASN D CB  1 
ATOM   5123 N N   . GLU D 1 28  ? 32.667  -42.446 39.291  1.00 45.85 ? 191 GLU D N   1 
ATOM   5124 C CA  . GLU D 1 28  ? 31.999  -41.177 39.614  1.00 43.51 ? 191 GLU D CA  1 
ATOM   5125 C C   . GLU D 1 28  ? 32.298  -40.063 38.573  1.00 41.76 ? 191 GLU D C   1 
ATOM   5126 O O   . GLU D 1 28  ? 33.017  -39.085 38.854  1.00 42.34 ? 191 GLU D O   1 
ATOM   5127 C CB  . GLU D 1 28  ? 32.284  -40.732 41.066  1.00 43.42 ? 191 GLU D CB  1 
ATOM   5128 N N   . THR D 1 29  ? 31.721  -40.236 37.378  1.00 38.71 ? 192 THR D N   1 
ATOM   5129 C CA  . THR D 1 29  ? 31.883  -39.333 36.232  1.00 35.24 ? 192 THR D CA  1 
ATOM   5130 C C   . THR D 1 29  ? 30.552  -39.270 35.457  1.00 31.14 ? 192 THR D C   1 
ATOM   5131 O O   . THR D 1 29  ? 29.528  -39.830 35.870  1.00 28.95 ? 192 THR D O   1 
ATOM   5132 C CB  . THR D 1 29  ? 32.978  -39.857 35.237  1.00 35.60 ? 192 THR D CB  1 
ATOM   5133 O OG1 . THR D 1 29  ? 32.629  -41.174 34.801  1.00 38.87 ? 192 THR D OG1 1 
ATOM   5134 C CG2 . THR D 1 29  ? 34.366  -39.921 35.855  1.00 39.65 ? 192 THR D CG2 1 
ATOM   5135 N N   . LEU D 1 30  ? 30.583  -38.557 34.339  1.00 27.30 ? 193 LEU D N   1 
ATOM   5136 C CA  . LEU D 1 30  ? 29.509  -38.615 33.343  1.00 24.81 ? 193 LEU D CA  1 
ATOM   5137 C C   . LEU D 1 30  ? 29.620  -39.950 32.589  1.00 23.72 ? 193 LEU D C   1 
ATOM   5138 O O   . LEU D 1 30  ? 30.736  -40.432 32.314  1.00 23.31 ? 193 LEU D O   1 
ATOM   5139 C CB  . LEU D 1 30  ? 29.658  -37.457 32.360  1.00 24.49 ? 193 LEU D CB  1 
ATOM   5140 C CG  . LEU D 1 30  ? 29.648  -36.026 32.883  1.00 22.54 ? 193 LEU D CG  1 
ATOM   5141 C CD1 . LEU D 1 30  ? 29.897  -35.060 31.681  1.00 23.55 ? 193 LEU D CD1 1 
ATOM   5142 C CD2 . LEU D 1 30  ? 28.325  -35.724 33.623  1.00 17.99 ? 193 LEU D CD2 1 
ATOM   5143 N N   . VAL D 1 31  ? 28.491  -40.556 32.257  1.00 21.41 ? 194 VAL D N   1 
ATOM   5144 C CA  . VAL D 1 31  ? 28.506  -41.916 31.700  1.00 20.52 ? 194 VAL D CA  1 
ATOM   5145 C C   . VAL D 1 31  ? 27.330  -42.070 30.750  1.00 18.08 ? 194 VAL D C   1 
ATOM   5146 O O   . VAL D 1 31  ? 26.286  -41.519 30.972  1.00 17.64 ? 194 VAL D O   1 
ATOM   5147 C CB  . VAL D 1 31  ? 28.445  -43.012 32.836  1.00 21.33 ? 194 VAL D CB  1 
ATOM   5148 C CG1 . VAL D 1 31  ? 28.018  -44.380 32.296  1.00 22.30 ? 194 VAL D CG1 1 
ATOM   5149 C CG2 . VAL D 1 31  ? 29.816  -43.194 33.421  1.00 25.30 ? 194 VAL D CG2 1 
ATOM   5150 N N   . PHE D 1 32  ? 27.544  -42.825 29.683  1.00 18.02 ? 195 PHE D N   1 
ATOM   5151 C CA  . PHE D 1 32  ? 26.518  -43.200 28.706  1.00 16.97 ? 195 PHE D CA  1 
ATOM   5152 C C   . PHE D 1 32  ? 26.235  -44.664 28.877  1.00 16.47 ? 195 PHE D C   1 
ATOM   5153 O O   . PHE D 1 32  ? 27.136  -45.404 29.219  1.00 16.69 ? 195 PHE D O   1 
ATOM   5154 C CB  . PHE D 1 32  ? 27.078  -42.985 27.320  1.00 16.43 ? 195 PHE D CB  1 
ATOM   5155 C CG  . PHE D 1 32  ? 26.978  -41.544 26.848  1.00 17.59 ? 195 PHE D CG  1 
ATOM   5156 C CD1 . PHE D 1 32  ? 28.079  -40.707 26.886  1.00 15.26 ? 195 PHE D CD1 1 
ATOM   5157 C CD2 . PHE D 1 32  ? 25.775  -41.044 26.369  1.00 17.55 ? 195 PHE D CD2 1 
ATOM   5158 C CE1 . PHE D 1 32  ? 27.980  -39.389 26.460  1.00 17.35 ? 195 PHE D CE1 1 
ATOM   5159 C CE2 . PHE D 1 32  ? 25.675  -39.699 25.917  1.00 19.96 ? 195 PHE D CE2 1 
ATOM   5160 C CZ  . PHE D 1 32  ? 26.789  -38.884 25.999  1.00 15.15 ? 195 PHE D CZ  1 
ATOM   5161 N N   . SER D 1 33  ? 25.012  -45.112 28.600  1.00 16.19 ? 196 SER D N   1 
ATOM   5162 C CA  . SER D 1 33  ? 24.723  -46.534 28.664  1.00 16.95 ? 196 SER D CA  1 
ATOM   5163 C C   . SER D 1 33  ? 25.557  -47.311 27.628  1.00 17.48 ? 196 SER D C   1 
ATOM   5164 O O   . SER D 1 33  ? 25.905  -46.792 26.550  1.00 16.24 ? 196 SER D O   1 
ATOM   5165 C CB  . SER D 1 33  ? 23.241  -46.779 28.492  1.00 15.96 ? 196 SER D CB  1 
ATOM   5166 O OG  . SER D 1 33  ? 22.789  -46.224 27.262  1.00 21.11 ? 196 SER D OG  1 
ATOM   5167 N N   . HIS D 1 34  ? 25.928  -48.524 27.970  1.00 18.36 ? 197 HIS D N   1 
ATOM   5168 C CA  . HIS D 1 34  ? 26.702  -49.363 27.027  1.00 19.41 ? 197 HIS D CA  1 
ATOM   5169 C C   . HIS D 1 34  ? 26.020  -49.541 25.671  1.00 18.71 ? 197 HIS D C   1 
ATOM   5170 O O   . HIS D 1 34  ? 26.679  -49.551 24.637  1.00 19.64 ? 197 HIS D O   1 
ATOM   5171 C CB  . HIS D 1 34  ? 27.017  -50.706 27.679  1.00 20.59 ? 197 HIS D CB  1 
ATOM   5172 C CG  . HIS D 1 34  ? 28.044  -51.501 26.925  1.00 26.53 ? 197 HIS D CG  1 
ATOM   5173 N ND1 . HIS D 1 34  ? 27.711  -52.543 26.076  1.00 31.44 ? 197 HIS D ND1 1 
ATOM   5174 C CD2 . HIS D 1 34  ? 29.395  -51.404 26.891  1.00 25.04 ? 197 HIS D CD2 1 
ATOM   5175 C CE1 . HIS D 1 34  ? 28.813  -53.056 25.555  1.00 29.44 ? 197 HIS D CE1 1 
ATOM   5176 N NE2 . HIS D 1 34  ? 29.848  -52.383 26.032  1.00 32.92 ? 197 HIS D NE2 1 
ATOM   5177 N N   . ASN D 1 35  ? 24.701  -49.697 25.665  1.00 18.36 ? 198 ASN D N   1 
ATOM   5178 C CA  . ASN D 1 35  ? 23.926  -49.839 24.436  1.00 17.69 ? 198 ASN D CA  1 
ATOM   5179 C C   . ASN D 1 35  ? 22.993  -48.695 24.221  1.00 16.99 ? 198 ASN D C   1 
ATOM   5180 O O   . ASN D 1 35  ? 22.548  -48.060 25.187  1.00 15.98 ? 198 ASN D O   1 
ATOM   5181 C CB  . ASN D 1 35  ? 23.056  -51.114 24.493  1.00 19.03 ? 198 ASN D CB  1 
ATOM   5182 C CG  . ASN D 1 35  ? 23.889  -52.367 24.568  1.00 21.21 ? 198 ASN D CG  1 
ATOM   5183 O OD1 . ASN D 1 35  ? 24.033  -52.959 25.622  1.00 21.69 ? 198 ASN D OD1 1 
ATOM   5184 N ND2 . ASN D 1 35  ? 24.499  -52.738 23.441  1.00 21.98 ? 198 ASN D ND2 1 
ATOM   5185 N N   . ALA D 1 36  ? 22.625  -48.498 22.941  1.00 16.95 ? 199 ALA D N   1 
ATOM   5186 C CA  . ALA D 1 36  ? 21.502  -47.688 22.556  1.00 16.58 ? 199 ALA D CA  1 
ATOM   5187 C C   . ALA D 1 36  ? 20.351  -48.649 22.220  1.00 16.67 ? 199 ALA D C   1 
ATOM   5188 O O   . ALA D 1 36  ? 20.572  -49.873 22.099  1.00 17.53 ? 199 ALA D O   1 
ATOM   5189 C CB  . ALA D 1 36  ? 21.875  -46.784 21.327  1.00 15.61 ? 199 ALA D CB  1 
ATOM   5190 N N   . VAL D 1 37  ? 19.137  -48.123 22.092  1.00 16.71 ? 200 VAL D N   1 
ATOM   5191 C CA  . VAL D 1 37  ? 17.978  -48.973 21.755  1.00 18.23 ? 200 VAL D CA  1 
ATOM   5192 C C   . VAL D 1 37  ? 17.158  -48.338 20.659  1.00 18.54 ? 200 VAL D C   1 
ATOM   5193 O O   . VAL D 1 37  ? 17.261  -47.141 20.421  1.00 20.96 ? 200 VAL D O   1 
ATOM   5194 C CB  . VAL D 1 37  ? 17.103  -49.310 23.027  1.00 17.13 ? 200 VAL D CB  1 
ATOM   5195 C CG1 . VAL D 1 37  ? 17.961  -50.016 24.105  1.00 14.48 ? 200 VAL D CG1 1 
ATOM   5196 C CG2 . VAL D 1 37  ? 16.382  -48.029 23.579  1.00 17.76 ? 200 VAL D CG2 1 
ATOM   5197 N N   . ILE D 1 38  ? 16.355  -49.138 19.979  1.00 19.12 ? 201 ILE D N   1 
ATOM   5198 C CA  . ILE D 1 38  ? 15.376  -48.652 19.049  1.00 20.34 ? 201 ILE D CA  1 
ATOM   5199 C C   . ILE D 1 38  ? 14.038  -49.228 19.490  1.00 21.23 ? 201 ILE D C   1 
ATOM   5200 O O   . ILE D 1 38  ? 13.910  -50.440 19.723  1.00 21.71 ? 201 ILE D O   1 
ATOM   5201 C CB  . ILE D 1 38  ? 15.726  -48.961 17.544  1.00 21.12 ? 201 ILE D CB  1 
ATOM   5202 C CG1 . ILE D 1 38  ? 16.731  -47.932 17.025  1.00 19.64 ? 201 ILE D CG1 1 
ATOM   5203 C CG2 . ILE D 1 38  ? 14.505  -48.803 16.655  1.00 20.27 ? 201 ILE D CG2 1 
ATOM   5204 C CD1 . ILE D 1 38  ? 17.379  -48.309 15.692  1.00 23.16 ? 201 ILE D CD1 1 
ATOM   5205 N N   . ALA D 1 39  ? 13.078  -48.343 19.719  1.00 21.41 ? 202 ALA D N   1 
ATOM   5206 C CA  . ALA D 1 39  ? 11.752  -48.785 20.127  1.00 21.67 ? 202 ALA D CA  1 
ATOM   5207 C C   . ALA D 1 39  ? 10.713  -47.733 19.790  1.00 21.36 ? 202 ALA D C   1 
ATOM   5208 O O   . ALA D 1 39  ? 11.038  -46.569 19.561  1.00 19.29 ? 202 ALA D O   1 
ATOM   5209 C CB  . ALA D 1 39  ? 11.723  -49.152 21.609  1.00 20.78 ? 202 ALA D CB  1 
ATOM   5210 N N   . MET D 1 40  ? 9.450   -48.159 19.789  1.00 21.50 ? 203 MET D N   1 
ATOM   5211 C CA  . MET D 1 40  ? 8.332   -47.234 19.617  1.00 23.02 ? 203 MET D CA  1 
ATOM   5212 C C   . MET D 1 40  ? 8.064   -46.451 20.883  1.00 23.71 ? 203 MET D C   1 
ATOM   5213 O O   . MET D 1 40  ? 8.039   -46.998 21.985  1.00 22.78 ? 203 MET D O   1 
ATOM   5214 C CB  . MET D 1 40  ? 7.041   -47.933 19.194  1.00 23.29 ? 203 MET D CB  1 
ATOM   5215 C CG  . MET D 1 40  ? 7.176   -48.823 17.965  1.00 23.76 ? 203 MET D CG  1 
ATOM   5216 S SD  . MET D 1 40  ? 7.347   -47.793 16.501  1.00 28.36 ? 203 MET D SD  1 
ATOM   5217 C CE  . MET D 1 40  ? 5.709   -47.014 16.425  1.00 24.40 ? 203 MET D CE  1 
ATOM   5218 N N   . ARG D 1 41  ? 7.831   -45.168 20.709  1.00 23.78 ? 204 ARG D N   1 
ATOM   5219 C CA  . ARG D 1 41  ? 7.368   -44.384 21.845  1.00 25.83 ? 204 ARG D CA  1 
ATOM   5220 C C   . ARG D 1 41  ? 6.369   -43.404 21.297  1.00 26.29 ? 204 ARG D C   1 
ATOM   5221 O O   . ARG D 1 41  ? 6.675   -42.631 20.386  1.00 26.40 ? 204 ARG D O   1 
ATOM   5222 C CB  . ARG D 1 41  ? 8.541   -43.707 22.528  1.00 25.18 ? 204 ARG D CB  1 
ATOM   5223 C CG  . ARG D 1 41  ? 8.189   -42.843 23.736  1.00 29.38 ? 204 ARG D CG  1 
ATOM   5224 C CD  . ARG D 1 41  ? 9.468   -42.353 24.332  1.00 33.99 ? 204 ARG D CD  1 
ATOM   5225 N NE  . ARG D 1 41  ? 10.075  -43.267 25.297  1.00 31.15 ? 204 ARG D NE  1 
ATOM   5226 C CZ  . ARG D 1 41  ? 10.903  -42.832 26.241  1.00 31.86 ? 204 ARG D CZ  1 
ATOM   5227 N NH1 . ARG D 1 41  ? 11.186  -41.542 26.269  1.00 29.58 ? 204 ARG D NH1 1 
ATOM   5228 N NH2 . ARG D 1 41  ? 11.438  -43.664 27.132  1.00 29.75 ? 204 ARG D NH2 1 
ATOM   5229 N N   . ASP D 1 42  ? 5.144   -43.483 21.820  1.00 28.58 ? 205 ASP D N   1 
ATOM   5230 C CA  . ASP D 1 42  ? 4.020   -42.640 21.369  1.00 29.05 ? 205 ASP D CA  1 
ATOM   5231 C C   . ASP D 1 42  ? 3.800   -42.661 19.845  1.00 28.39 ? 205 ASP D C   1 
ATOM   5232 O O   . ASP D 1 42  ? 3.633   -41.619 19.196  1.00 28.34 ? 205 ASP D O   1 
ATOM   5233 C CB  . ASP D 1 42  ? 4.147   -41.226 21.957  1.00 29.53 ? 205 ASP D CB  1 
ATOM   5234 C CG  . ASP D 1 42  ? 4.046   -41.237 23.505  1.00 33.42 ? 205 ASP D CG  1 
ATOM   5235 O OD1 . ASP D 1 42  ? 3.073   -41.850 24.063  1.00 37.11 ? 205 ASP D OD1 1 
ATOM   5236 O OD2 . ASP D 1 42  ? 4.968   -40.684 24.146  1.00 37.96 ? 205 ASP D OD2 1 
ATOM   5237 N N   . GLY D 1 43  ? 3.809   -43.868 19.302  1.00 27.51 ? 206 GLY D N   1 
ATOM   5238 C CA  . GLY D 1 43  ? 3.558   -44.099 17.893  1.00 27.25 ? 206 GLY D CA  1 
ATOM   5239 C C   . GLY D 1 43  ? 4.699   -43.630 16.996  1.00 27.67 ? 206 GLY D C   1 
ATOM   5240 O O   . GLY D 1 43  ? 4.511   -43.468 15.794  1.00 28.46 ? 206 GLY D O   1 
ATOM   5241 N N   . LYS D 1 44  ? 5.891   -43.414 17.557  1.00 25.96 ? 207 LYS D N   1 
ATOM   5242 C CA  . LYS D 1 44  ? 7.040   -43.096 16.707  1.00 25.22 ? 207 LYS D CA  1 
ATOM   5243 C C   . LYS D 1 44  ? 8.214   -44.006 17.012  1.00 22.71 ? 207 LYS D C   1 
ATOM   5244 O O   . LYS D 1 44  ? 8.514   -44.299 18.150  1.00 22.68 ? 207 LYS D O   1 
ATOM   5245 C CB  . LYS D 1 44  ? 7.428   -41.644 16.863  1.00 26.28 ? 207 LYS D CB  1 
ATOM   5246 C CG  . LYS D 1 44  ? 6.437   -40.709 16.180  1.00 30.48 ? 207 LYS D CG  1 
ATOM   5247 C CD  . LYS D 1 44  ? 6.385   -39.402 16.880  1.00 34.42 ? 207 LYS D CD  1 
ATOM   5248 C CE  . LYS D 1 44  ? 5.074   -38.686 16.569  1.00 38.61 ? 207 LYS D CE  1 
ATOM   5249 N NZ  . LYS D 1 44  ? 4.725   -37.723 17.673  1.00 43.46 ? 207 LYS D NZ  1 
ATOM   5250 N N   . LEU D 1 45  ? 8.863   -44.484 15.981  1.00 21.11 ? 208 LEU D N   1 
ATOM   5251 C CA  . LEU D 1 45  ? 10.058  -45.293 16.171  1.00 19.52 ? 208 LEU D CA  1 
ATOM   5252 C C   . LEU D 1 45  ? 11.257  -44.381 16.532  1.00 18.54 ? 208 LEU D C   1 
ATOM   5253 O O   . LEU D 1 45  ? 11.528  -43.395 15.832  1.00 20.09 ? 208 LEU D O   1 
ATOM   5254 C CB  . LEU D 1 45  ? 10.316  -46.074 14.895  1.00 19.71 ? 208 LEU D CB  1 
ATOM   5255 C CG  . LEU D 1 45  ? 11.361  -47.172 15.025  1.00 19.93 ? 208 LEU D CG  1 
ATOM   5256 C CD1 . LEU D 1 45  ? 10.727  -48.421 15.664  1.00 19.12 ? 208 LEU D CD1 1 
ATOM   5257 C CD2 . LEU D 1 45  ? 11.921  -47.415 13.600  1.00 17.81 ? 208 LEU D CD2 1 
ATOM   5258 N N   . CYS D 1 46  ? 11.966  -44.691 17.613  1.00 18.15 ? 209 CYS D N   1 
ATOM   5259 C CA  . CYS D 1 46  ? 12.994  -43.795 18.147  1.00 18.39 ? 209 CYS D CA  1 
ATOM   5260 C C   . CYS D 1 46  ? 14.282  -44.563 18.434  1.00 18.33 ? 209 CYS D C   1 
ATOM   5261 O O   . CYS D 1 46  ? 14.237  -45.728 18.863  1.00 19.74 ? 209 CYS D O   1 
ATOM   5262 C CB  . CYS D 1 46  ? 12.528  -43.153 19.456  1.00 17.76 ? 209 CYS D CB  1 
ATOM   5263 S SG  . CYS D 1 46  ? 11.074  -42.083 19.261  1.00 25.14 ? 209 CYS D SG  1 
ATOM   5264 N N   . LEU D 1 47  ? 15.400  -43.896 18.192  1.00 17.28 ? 210 LEU D N   1 
ATOM   5265 C CA  . LEU D 1 47  ? 16.723  -44.304 18.688  1.00 18.27 ? 210 LEU D CA  1 
ATOM   5266 C C   . LEU D 1 47  ? 16.928  -43.637 20.049  1.00 17.29 ? 210 LEU D C   1 
ATOM   5267 O O   . LEU D 1 47  ? 16.732  -42.422 20.185  1.00 18.97 ? 210 LEU D O   1 
ATOM   5268 C CB  . LEU D 1 47  ? 17.785  -43.847 17.687  1.00 17.85 ? 210 LEU D CB  1 
ATOM   5269 C CG  . LEU D 1 47  ? 19.233  -44.078 18.094  1.00 19.17 ? 210 LEU D CG  1 
ATOM   5270 C CD1 . LEU D 1 47  ? 19.560  -45.588 18.023  1.00 18.71 ? 210 LEU D CD1 1 
ATOM   5271 C CD2 . LEU D 1 47  ? 20.054  -43.242 17.144  1.00 18.04 ? 210 LEU D CD2 1 
ATOM   5272 N N   . MET D 1 48  ? 17.241  -44.409 21.083  1.00 16.92 ? 211 MET D N   1 
ATOM   5273 C CA  . MET D 1 48  ? 17.408  -43.793 22.409  1.00 18.41 ? 211 MET D CA  1 
ATOM   5274 C C   . MET D 1 48  ? 18.672  -44.281 23.018  1.00 17.13 ? 211 MET D C   1 
ATOM   5275 O O   . MET D 1 48  ? 19.143  -45.332 22.673  1.00 18.41 ? 211 MET D O   1 
ATOM   5276 C CB  . MET D 1 48  ? 16.187  -44.089 23.337  1.00 18.64 ? 211 MET D CB  1 
ATOM   5277 C CG  . MET D 1 48  ? 14.890  -43.801 22.614  1.00 22.01 ? 211 MET D CG  1 
ATOM   5278 S SD  . MET D 1 48  ? 13.457  -44.055 23.671  1.00 27.77 ? 211 MET D SD  1 
ATOM   5279 C CE  . MET D 1 48  ? 12.988  -45.730 23.301  1.00 33.52 ? 211 MET D CE  1 
ATOM   5280 N N   . TRP D 1 49  ? 19.240  -43.489 23.900  1.00 17.14 ? 212 TRP D N   1 
ATOM   5281 C CA  . TRP D 1 49  ? 20.386  -43.866 24.704  1.00 16.41 ? 212 TRP D CA  1 
ATOM   5282 C C   . TRP D 1 49  ? 20.314  -43.072 26.024  1.00 17.60 ? 212 TRP D C   1 
ATOM   5283 O O   . TRP D 1 49  ? 19.619  -42.081 26.101  1.00 16.52 ? 212 TRP D O   1 
ATOM   5284 C CB  . TRP D 1 49  ? 21.698  -43.589 23.952  1.00 17.13 ? 212 TRP D CB  1 
ATOM   5285 C CG  . TRP D 1 49  ? 21.929  -42.119 23.539  1.00 15.71 ? 212 TRP D CG  1 
ATOM   5286 C CD1 . TRP D 1 49  ? 22.636  -41.153 24.236  1.00 15.57 ? 212 TRP D CD1 1 
ATOM   5287 C CD2 . TRP D 1 49  ? 21.452  -41.477 22.340  1.00 18.16 ? 212 TRP D CD2 1 
ATOM   5288 N NE1 . TRP D 1 49  ? 22.647  -39.970 23.522  1.00 15.32 ? 212 TRP D NE1 1 
ATOM   5289 C CE2 . TRP D 1 49  ? 21.909  -40.135 22.369  1.00 15.89 ? 212 TRP D CE2 1 
ATOM   5290 C CE3 . TRP D 1 49  ? 20.690  -41.908 21.249  1.00 17.46 ? 212 TRP D CE3 1 
ATOM   5291 C CZ2 . TRP D 1 49  ? 21.639  -39.233 21.343  1.00 16.01 ? 212 TRP D CZ2 1 
ATOM   5292 C CZ3 . TRP D 1 49  ? 20.423  -40.987 20.209  1.00 20.31 ? 212 TRP D CZ3 1 
ATOM   5293 C CH2 . TRP D 1 49  ? 20.907  -39.685 20.265  1.00 16.54 ? 212 TRP D CH2 1 
ATOM   5294 N N   . ARG D 1 50  ? 21.009  -43.540 27.060  1.00 17.46 ? 213 ARG D N   1 
ATOM   5295 C CA  . ARG D 1 50  ? 20.835  -42.992 28.398  1.00 17.80 ? 213 ARG D CA  1 
ATOM   5296 C C   . ARG D 1 50  ? 22.147  -42.335 28.761  1.00 17.48 ? 213 ARG D C   1 
ATOM   5297 O O   . ARG D 1 50  ? 23.212  -42.808 28.373  1.00 17.45 ? 213 ARG D O   1 
ATOM   5298 C CB  . ARG D 1 50  ? 20.425  -44.130 29.348  1.00 17.99 ? 213 ARG D CB  1 
ATOM   5299 C CG  . ARG D 1 50  ? 20.396  -43.827 30.744  1.00 19.96 ? 213 ARG D CG  1 
ATOM   5300 C CD  . ARG D 1 50  ? 20.042  -45.130 31.516  1.00 23.07 ? 213 ARG D CD  1 
ATOM   5301 N NE  . ARG D 1 50  ? 18.646  -45.091 31.899  1.00 22.89 ? 213 ARG D NE  1 
ATOM   5302 C CZ  . ARG D 1 50  ? 17.976  -46.107 32.433  1.00 20.73 ? 213 ARG D CZ  1 
ATOM   5303 N NH1 . ARG D 1 50  ? 18.544  -47.311 32.596  1.00 13.91 ? 213 ARG D NH1 1 
ATOM   5304 N NH2 . ARG D 1 50  ? 16.717  -45.911 32.748  1.00 16.74 ? 213 ARG D NH2 1 
ATOM   5305 N N   . VAL D 1 51  ? 22.046  -41.209 29.438  1.00 17.10 ? 214 VAL D N   1 
ATOM   5306 C CA  . VAL D 1 51  ? 23.189  -40.531 29.979  1.00 20.30 ? 214 VAL D CA  1 
ATOM   5307 C C   . VAL D 1 51  ? 22.966  -40.270 31.464  1.00 21.10 ? 214 VAL D C   1 
ATOM   5308 O O   . VAL D 1 51  ? 21.859  -40.010 31.888  1.00 20.87 ? 214 VAL D O   1 
ATOM   5309 C CB  . VAL D 1 51  ? 23.510  -39.218 29.183  1.00 20.17 ? 214 VAL D CB  1 
ATOM   5310 C CG1 . VAL D 1 51  ? 22.449  -38.080 29.431  1.00 20.73 ? 214 VAL D CG1 1 
ATOM   5311 C CG2 . VAL D 1 51  ? 24.922  -38.738 29.503  1.00 24.30 ? 214 VAL D CG2 1 
ATOM   5312 N N   . GLY D 1 52  ? 24.040  -40.285 32.227  1.00 22.32 ? 215 GLY D N   1 
ATOM   5313 C CA  . GLY D 1 52  ? 23.975  -39.962 33.633  1.00 24.99 ? 215 GLY D CA  1 
ATOM   5314 C C   . GLY D 1 52  ? 25.170  -39.203 34.180  1.00 26.51 ? 215 GLY D C   1 
ATOM   5315 O O   . GLY D 1 52  ? 26.225  -39.105 33.541  1.00 25.89 ? 215 GLY D O   1 
ATOM   5316 N N   . ASN D 1 53  ? 24.967  -38.618 35.357  1.00 27.42 ? 216 ASN D N   1 
ATOM   5317 C CA  . ASN D 1 53  ? 26.050  -38.002 36.120  1.00 29.62 ? 216 ASN D CA  1 
ATOM   5318 C C   . ASN D 1 53  ? 26.145  -38.755 37.432  1.00 31.84 ? 216 ASN D C   1 
ATOM   5319 O O   . ASN D 1 53  ? 25.205  -38.722 38.219  1.00 31.60 ? 216 ASN D O   1 
ATOM   5320 C CB  . ASN D 1 53  ? 25.741  -36.529 36.413  1.00 28.20 ? 216 ASN D CB  1 
ATOM   5321 C CG  . ASN D 1 53  ? 26.884  -35.829 37.145  1.00 28.55 ? 216 ASN D CG  1 
ATOM   5322 O OD1 . ASN D 1 53  ? 27.978  -36.383 37.322  1.00 28.29 ? 216 ASN D OD1 1 
ATOM   5323 N ND2 . ASN D 1 53  ? 26.631  -34.622 37.587  1.00 26.13 ? 216 ASN D ND2 1 
ATOM   5324 N N   . LEU D 1 54  ? 27.260  -39.441 37.672  1.00 35.41 ? 217 LEU D N   1 
ATOM   5325 C CA  . LEU D 1 54  ? 27.476  -40.112 38.964  1.00 39.58 ? 217 LEU D CA  1 
ATOM   5326 C C   . LEU D 1 54  ? 28.385  -39.328 39.925  1.00 41.94 ? 217 LEU D C   1 
ATOM   5327 O O   . LEU D 1 54  ? 28.660  -39.811 41.023  1.00 43.05 ? 217 LEU D O   1 
ATOM   5328 C CB  . LEU D 1 54  ? 28.059  -41.529 38.778  1.00 39.00 ? 217 LEU D CB  1 
ATOM   5329 C CG  . LEU D 1 54  ? 27.255  -42.623 38.078  1.00 41.21 ? 217 LEU D CG  1 
ATOM   5330 C CD1 . LEU D 1 54  ? 27.206  -42.406 36.591  1.00 41.85 ? 217 LEU D CD1 1 
ATOM   5331 C CD2 . LEU D 1 54  ? 27.913  -43.972 38.343  1.00 41.78 ? 217 LEU D CD2 1 
ATOM   5332 N N   . GLN D 1 55  ? 28.891  -38.165 39.509  1.00 44.51 ? 218 GLN D N   1 
ATOM   5333 C CA  . GLN D 1 55  ? 29.691  -37.322 40.406  1.00 46.49 ? 218 GLN D CA  1 
ATOM   5334 C C   . GLN D 1 55  ? 28.837  -36.614 41.436  1.00 46.88 ? 218 GLN D C   1 
ATOM   5335 O O   . GLN D 1 55  ? 27.589  -36.673 41.413  1.00 47.68 ? 218 GLN D O   1 
ATOM   5336 C CB  . GLN D 1 55  ? 30.433  -36.222 39.662  1.00 47.28 ? 218 GLN D CB  1 
ATOM   5337 C CG  . GLN D 1 55  ? 31.187  -36.595 38.405  1.00 50.97 ? 218 GLN D CG  1 
ATOM   5338 C CD  . GLN D 1 55  ? 31.977  -35.405 37.878  1.00 55.93 ? 218 GLN D CD  1 
ATOM   5339 O OE1 . GLN D 1 55  ? 32.404  -34.529 38.659  1.00 58.21 ? 218 GLN D OE1 1 
ATOM   5340 N NE2 . GLN D 1 55  ? 32.166  -35.352 36.555  1.00 55.57 ? 218 GLN D NE2 1 
ATOM   5341 N N   . LYS D 1 56  ? 29.539  -35.899 42.311  1.00 47.45 ? 219 LYS D N   1 
ATOM   5342 C CA  . LYS D 1 56  ? 28.945  -35.133 43.416  1.00 47.93 ? 219 LYS D CA  1 
ATOM   5343 C C   . LYS D 1 56  ? 28.598  -33.727 42.946  1.00 46.57 ? 219 LYS D C   1 
ATOM   5344 O O   . LYS D 1 56  ? 27.812  -33.035 43.582  1.00 47.07 ? 219 LYS D O   1 
ATOM   5345 C CB  . LYS D 1 56  ? 29.914  -35.043 44.618  1.00 49.10 ? 219 LYS D CB  1 
ATOM   5346 C CG  . LYS D 1 56  ? 30.776  -36.304 44.858  1.00 52.54 ? 219 LYS D CG  1 
ATOM   5347 C CD  . LYS D 1 56  ? 31.933  -36.034 45.836  1.00 57.07 ? 219 LYS D CD  1 
ATOM   5348 C CE  . LYS D 1 56  ? 32.930  -37.196 45.821  1.00 58.93 ? 219 LYS D CE  1 
ATOM   5349 N NZ  . LYS D 1 56  ? 33.589  -37.386 47.155  1.00 61.99 ? 219 LYS D NZ  1 
ATOM   5350 N N   . SER D 1 57  ? 29.187  -33.325 41.820  1.00 45.01 ? 220 SER D N   1 
ATOM   5351 C CA  . SER D 1 57  ? 29.015  -31.982 41.263  1.00 42.80 ? 220 SER D CA  1 
ATOM   5352 C C   . SER D 1 57  ? 27.989  -31.996 40.102  1.00 40.71 ? 220 SER D C   1 
ATOM   5353 O O   . SER D 1 57  ? 28.090  -32.879 39.234  1.00 40.20 ? 220 SER D O   1 
ATOM   5354 C CB  . SER D 1 57  ? 30.389  -31.464 40.798  1.00 43.48 ? 220 SER D CB  1 
ATOM   5355 O OG  . SER D 1 57  ? 30.394  -30.052 40.621  1.00 45.40 ? 220 SER D OG  1 
ATOM   5356 N N   . HIS D 1 58  ? 27.031  -31.035 40.110  1.00 37.14 ? 221 HIS D N   1 
ATOM   5357 C CA  . HIS D 1 58  ? 26.029  -30.831 39.051  1.00 34.24 ? 221 HIS D CA  1 
ATOM   5358 C C   . HIS D 1 58  ? 26.709  -30.381 37.722  1.00 32.55 ? 221 HIS D C   1 
ATOM   5359 O O   . HIS D 1 58  ? 27.677  -29.592 37.733  1.00 31.44 ? 221 HIS D O   1 
ATOM   5360 C CB  . HIS D 1 58  ? 25.004  -29.728 39.399  1.00 34.67 ? 221 HIS D CB  1 
ATOM   5361 C CG  . HIS D 1 58  ? 23.941  -30.119 40.393  1.00 37.78 ? 221 HIS D CG  1 
ATOM   5362 N ND1 . HIS D 1 58  ? 22.723  -30.645 40.017  1.00 38.84 ? 221 HIS D ND1 1 
ATOM   5363 C CD2 . HIS D 1 58  ? 23.898  -30.011 41.746  1.00 39.20 ? 221 HIS D CD2 1 
ATOM   5364 C CE1 . HIS D 1 58  ? 21.988  -30.870 41.093  1.00 38.85 ? 221 HIS D CE1 1 
ATOM   5365 N NE2 . HIS D 1 58  ? 22.681  -30.497 42.157  1.00 38.76 ? 221 HIS D NE2 1 
ATOM   5366 N N   . LEU D 1 59  ? 26.176  -30.858 36.587  1.00 29.66 ? 222 LEU D N   1 
ATOM   5367 C CA  . LEU D 1 59  ? 26.582  -30.352 35.273  1.00 27.48 ? 222 LEU D CA  1 
ATOM   5368 C C   . LEU D 1 59  ? 25.611  -29.274 34.805  1.00 26.68 ? 222 LEU D C   1 
ATOM   5369 O O   . LEU D 1 59  ? 24.452  -29.550 34.518  1.00 28.02 ? 222 LEU D O   1 
ATOM   5370 C CB  . LEU D 1 59  ? 26.641  -31.485 34.259  1.00 27.24 ? 222 LEU D CB  1 
ATOM   5371 C CG  . LEU D 1 59  ? 27.321  -31.181 32.936  1.00 25.31 ? 222 LEU D CG  1 
ATOM   5372 C CD1 . LEU D 1 59  ? 28.796  -30.925 33.100  1.00 22.49 ? 222 LEU D CD1 1 
ATOM   5373 C CD2 . LEU D 1 59  ? 27.059  -32.338 31.969  1.00 21.70 ? 222 LEU D CD2 1 
ATOM   5374 N N   . VAL D 1 60  ? 26.101  -28.045 34.733  1.00 24.41 ? 223 VAL D N   1 
ATOM   5375 C CA  . VAL D 1 60  ? 25.318  -26.832 34.427  1.00 24.88 ? 223 VAL D CA  1 
ATOM   5376 C C   . VAL D 1 60  ? 25.244  -26.581 32.924  1.00 22.82 ? 223 VAL D C   1 
ATOM   5377 O O   . VAL D 1 60  ? 26.169  -26.952 32.195  1.00 22.39 ? 223 VAL D O   1 
ATOM   5378 C CB  . VAL D 1 60  ? 26.029  -25.544 35.110  1.00 23.98 ? 223 VAL D CB  1 
ATOM   5379 C CG1 . VAL D 1 60  ? 25.528  -24.237 34.550  1.00 24.86 ? 223 VAL D CG1 1 
ATOM   5380 C CG2 . VAL D 1 60  ? 25.848  -25.574 36.550  1.00 26.56 ? 223 VAL D CG2 1 
ATOM   5381 N N   . GLU D 1 61  ? 24.146  -25.979 32.467  1.00 21.15 ? 224 GLU D N   1 
ATOM   5382 C CA  . GLU D 1 61  ? 23.956  -25.607 31.061  1.00 21.23 ? 224 GLU D CA  1 
ATOM   5383 C C   . GLU D 1 61  ? 24.270  -26.776 30.109  1.00 19.60 ? 224 GLU D C   1 
ATOM   5384 O O   . GLU D 1 61  ? 25.019  -26.645 29.156  1.00 18.01 ? 224 GLU D O   1 
ATOM   5385 C CB  . GLU D 1 61  ? 24.790  -24.361 30.752  1.00 23.38 ? 224 GLU D CB  1 
ATOM   5386 C CG  . GLU D 1 61  ? 23.905  -23.088 30.938  1.00 26.16 ? 224 GLU D CG  1 
ATOM   5387 C CD  . GLU D 1 61  ? 24.713  -21.872 31.080  1.00 31.11 ? 224 GLU D CD  1 
ATOM   5388 O OE1 . GLU D 1 61  ? 25.918  -22.042 31.286  1.00 39.66 ? 224 GLU D OE1 1 
ATOM   5389 O OE2 . GLU D 1 61  ? 24.169  -20.753 31.007  1.00 36.60 ? 224 GLU D OE2 1 
ATOM   5390 N N   . ALA D 1 62  ? 23.684  -27.930 30.422  1.00 17.56 ? 225 ALA D N   1 
ATOM   5391 C CA  . ALA D 1 62  ? 24.020  -29.189 29.747  1.00 16.22 ? 225 ALA D CA  1 
ATOM   5392 C C   . ALA D 1 62  ? 23.202  -29.374 28.518  1.00 16.10 ? 225 ALA D C   1 
ATOM   5393 O O   . ALA D 1 62  ? 22.028  -28.947 28.460  1.00 14.36 ? 225 ALA D O   1 
ATOM   5394 C CB  . ALA D 1 62  ? 23.818  -30.394 30.735  1.00 16.29 ? 225 ALA D CB  1 
ATOM   5395 N N   . HIS D 1 63  ? 23.801  -30.003 27.488  1.00 13.77 ? 226 HIS D N   1 
ATOM   5396 C CA  . HIS D 1 63  ? 23.056  -30.246 26.301  1.00 13.81 ? 226 HIS D CA  1 
ATOM   5397 C C   . HIS D 1 63  ? 23.759  -31.404 25.581  1.00 13.42 ? 226 HIS D C   1 
ATOM   5398 O O   . HIS D 1 63  ? 24.920  -31.724 25.864  1.00 12.65 ? 226 HIS D O   1 
ATOM   5399 C CB  . HIS D 1 63  ? 23.024  -28.979 25.424  1.00 14.25 ? 226 HIS D CB  1 
ATOM   5400 C CG  . HIS D 1 63  ? 24.387  -28.410 25.184  1.00 17.86 ? 226 HIS D CG  1 
ATOM   5401 N ND1 . HIS D 1 63  ? 25.016  -28.493 23.970  1.00 23.23 ? 226 HIS D ND1 1 
ATOM   5402 C CD2 . HIS D 1 63  ? 25.284  -27.843 26.028  1.00 19.41 ? 226 HIS D CD2 1 
ATOM   5403 C CE1 . HIS D 1 63  ? 26.224  -27.955 24.054  1.00 17.79 ? 226 HIS D CE1 1 
ATOM   5404 N NE2 . HIS D 1 63  ? 26.413  -27.563 25.292  1.00 20.39 ? 226 HIS D NE2 1 
ATOM   5405 N N   . VAL D 1 64  ? 23.042  -32.031 24.667  1.00 13.68 ? 227 VAL D N   1 
ATOM   5406 C CA  . VAL D 1 64  ? 23.500  -33.290 24.067  1.00 13.94 ? 227 VAL D CA  1 
ATOM   5407 C C   . VAL D 1 64  ? 23.563  -33.136 22.565  1.00 13.71 ? 227 VAL D C   1 
ATOM   5408 O O   . VAL D 1 64  ? 22.827  -32.353 21.987  1.00 12.94 ? 227 VAL D O   1 
ATOM   5409 C CB  . VAL D 1 64  ? 22.541  -34.502 24.425  1.00 12.43 ? 227 VAL D CB  1 
ATOM   5410 C CG1 . VAL D 1 64  ? 22.767  -34.946 25.887  1.00 15.47 ? 227 VAL D CG1 1 
ATOM   5411 C CG2 . VAL D 1 64  ? 21.011  -34.148 24.129  1.00 14.43 ? 227 VAL D CG2 1 
ATOM   5412 N N   . ARG D 1 65  ? 24.415  -33.928 21.933  1.00 14.64 ? 228 ARG D N   1 
ATOM   5413 C CA  . ARG D 1 65  ? 24.421  -34.010 20.480  1.00 15.97 ? 228 ARG D CA  1 
ATOM   5414 C C   . ARG D 1 65  ? 24.666  -35.424 20.094  1.00 15.57 ? 228 ARG D C   1 
ATOM   5415 O O   . ARG D 1 65  ? 25.111  -36.225 20.916  1.00 14.91 ? 228 ARG D O   1 
ATOM   5416 C CB  . ARG D 1 65  ? 25.564  -33.177 19.896  1.00 17.60 ? 228 ARG D CB  1 
ATOM   5417 C CG  . ARG D 1 65  ? 25.305  -31.662 19.989  1.00 22.11 ? 228 ARG D CG  1 
ATOM   5418 C CD  . ARG D 1 65  ? 26.429  -30.992 19.231  1.00 29.88 ? 228 ARG D CD  1 
ATOM   5419 N NE  . ARG D 1 65  ? 27.659  -30.963 20.016  1.00 33.00 ? 228 ARG D NE  1 
ATOM   5420 C CZ  . ARG D 1 65  ? 28.843  -30.561 19.529  1.00 37.18 ? 228 ARG D CZ  1 
ATOM   5421 N NH1 . ARG D 1 65  ? 28.949  -30.212 18.240  1.00 31.99 ? 228 ARG D NH1 1 
ATOM   5422 N NH2 . ARG D 1 65  ? 29.918  -30.504 20.328  1.00 35.76 ? 228 ARG D NH2 1 
ATOM   5423 N N   . ALA D 1 66  ? 24.432  -35.715 18.822  1.00 15.03 ? 229 ALA D N   1 
ATOM   5424 C CA  . ALA D 1 66  ? 24.837  -37.017 18.273  1.00 14.76 ? 229 ALA D CA  1 
ATOM   5425 C C   . ALA D 1 66  ? 25.104  -36.863 16.798  1.00 14.27 ? 229 ALA D C   1 
ATOM   5426 O O   . ALA D 1 66  ? 24.545  -35.953 16.140  1.00 14.88 ? 229 ALA D O   1 
ATOM   5427 C CB  . ALA D 1 66  ? 23.740  -38.136 18.534  1.00 13.77 ? 229 ALA D CB  1 
ATOM   5428 N N   . GLN D 1 67  ? 25.952  -37.751 16.271  1.00 15.29 ? 230 GLN D N   1 
ATOM   5429 C CA  . GLN D 1 67  ? 26.339  -37.694 14.864  1.00 17.02 ? 230 GLN D CA  1 
ATOM   5430 C C   . GLN D 1 67  ? 26.490  -39.122 14.373  1.00 17.06 ? 230 GLN D C   1 
ATOM   5431 O O   . GLN D 1 67  ? 27.079  -39.913 15.050  1.00 17.10 ? 230 GLN D O   1 
ATOM   5432 C CB  . GLN D 1 67  ? 27.728  -37.051 14.725  1.00 17.74 ? 230 GLN D CB  1 
ATOM   5433 C CG  . GLN D 1 67  ? 27.799  -35.638 15.035  1.00 20.56 ? 230 GLN D CG  1 
ATOM   5434 C CD  . GLN D 1 67  ? 29.180  -35.057 14.700  1.00 22.42 ? 230 GLN D CD  1 
ATOM   5435 O OE1 . GLN D 1 67  ? 30.209  -35.740 14.786  1.00 24.46 ? 230 GLN D OE1 1 
ATOM   5436 N NE2 . GLN D 1 67  ? 29.190  -33.800 14.321  1.00 21.67 ? 230 GLN D NE2 1 
ATOM   5437 N N   . LEU D 1 68  ? 26.019  -39.428 13.170  1.00 17.72 ? 231 LEU D N   1 
ATOM   5438 C CA  . LEU D 1 68  ? 26.367  -40.682 12.502  1.00 18.09 ? 231 LEU D CA  1 
ATOM   5439 C C   . LEU D 1 68  ? 27.664  -40.522 11.684  1.00 18.68 ? 231 LEU D C   1 
ATOM   5440 O O   . LEU D 1 68  ? 27.807  -39.550 10.914  1.00 19.48 ? 231 LEU D O   1 
ATOM   5441 C CB  . LEU D 1 68  ? 25.203  -41.105 11.604  1.00 19.35 ? 231 LEU D CB  1 
ATOM   5442 C CG  . LEU D 1 68  ? 25.413  -42.465 10.934  1.00 22.79 ? 231 LEU D CG  1 
ATOM   5443 C CD1 . LEU D 1 68  ? 24.219  -43.317 11.123  1.00 27.30 ? 231 LEU D CD1 1 
ATOM   5444 C CD2 . LEU D 1 68  ? 25.696  -42.221 9.486   1.00 25.51 ? 231 LEU D CD2 1 
ATOM   5445 N N   . LEU D 1 69  ? 28.622  -41.420 11.897  1.00 20.40 ? 232 LEU D N   1 
ATOM   5446 C CA  . LEU D 1 69  ? 29.910  -41.353 11.221  1.00 21.99 ? 232 LEU D CA  1 
ATOM   5447 C C   . LEU D 1 69  ? 29.934  -42.423 10.115  1.00 22.82 ? 232 LEU D C   1 
ATOM   5448 O O   . LEU D 1 69  ? 29.612  -43.588 10.358  1.00 22.34 ? 232 LEU D O   1 
ATOM   5449 C CB  . LEU D 1 69  ? 31.066  -41.599 12.190  1.00 22.12 ? 232 LEU D CB  1 
ATOM   5450 C CG  . LEU D 1 69  ? 31.147  -40.788 13.495  1.00 25.28 ? 232 LEU D CG  1 
ATOM   5451 C CD1 . LEU D 1 69  ? 32.478  -41.091 14.176  1.00 25.96 ? 232 LEU D CD1 1 
ATOM   5452 C CD2 . LEU D 1 69  ? 30.958  -39.276 13.327  1.00 22.70 ? 232 LEU D CD2 1 
ATOM   5453 N N   . LYS D 1 70  ? 30.272  -42.003 8.903   1.00 22.45 ? 233 LYS D N   1 
ATOM   5454 C CA  . LYS D 1 70  ? 30.530  -42.927 7.831   1.00 22.83 ? 233 LYS D CA  1 
ATOM   5455 C C   . LYS D 1 70  ? 31.351  -42.232 6.766   1.00 23.48 ? 233 LYS D C   1 
ATOM   5456 O O   . LYS D 1 70  ? 31.418  -40.989 6.703   1.00 23.07 ? 233 LYS D O   1 
ATOM   5457 C CB  . LYS D 1 70  ? 29.222  -43.402 7.209   1.00 23.95 ? 233 LYS D CB  1 
ATOM   5458 C CG  . LYS D 1 70  ? 28.302  -42.273 6.809   1.00 26.65 ? 233 LYS D CG  1 
ATOM   5459 C CD  . LYS D 1 70  ? 27.438  -42.747 5.699   1.00 33.49 ? 233 LYS D CD  1 
ATOM   5460 C CE  . LYS D 1 70  ? 26.369  -41.760 5.359   1.00 37.80 ? 233 LYS D CE  1 
ATOM   5461 N NZ  . LYS D 1 70  ? 25.680  -42.277 4.119   1.00 43.16 ? 233 LYS D NZ  1 
ATOM   5462 N N   . SER D 1 71  ? 31.958  -43.035 5.908   1.00 22.17 ? 234 SER D N   1 
ATOM   5463 C CA  . SER D 1 71  ? 32.463  -42.534 4.632   1.00 22.80 ? 234 SER D CA  1 
ATOM   5464 C C   . SER D 1 71  ? 31.366  -42.333 3.588   1.00 22.09 ? 234 SER D C   1 
ATOM   5465 O O   . SER D 1 71  ? 30.266  -42.898 3.694   1.00 21.61 ? 234 SER D O   1 
ATOM   5466 C CB  . SER D 1 71  ? 33.471  -43.536 4.108   1.00 22.67 ? 234 SER D CB  1 
ATOM   5467 O OG  . SER D 1 71  ? 34.559  -43.435 5.014   1.00 28.55 ? 234 SER D OG  1 
ATOM   5468 N N   . ARG D 1 72  ? 31.674  -41.526 2.577   1.00 21.19 ? 235 ARG D N   1 
ATOM   5469 C CA  . ARG D 1 72  ? 30.684  -41.129 1.599   1.00 21.65 ? 235 ARG D CA  1 
ATOM   5470 C C   . ARG D 1 72  ? 31.409  -40.773 0.302   1.00 20.42 ? 235 ARG D C   1 
ATOM   5471 O O   . ARG D 1 72  ? 32.487  -40.214 0.344   1.00 19.90 ? 235 ARG D O   1 
ATOM   5472 C CB  . ARG D 1 72  ? 29.918  -39.883 2.095   1.00 22.52 ? 235 ARG D CB  1 
ATOM   5473 C CG  . ARG D 1 72  ? 28.643  -39.628 1.288   1.00 26.06 ? 235 ARG D CG  1 
ATOM   5474 C CD  . ARG D 1 72  ? 27.648  -38.625 1.954   1.00 26.08 ? 235 ARG D CD  1 
ATOM   5475 N NE  . ARG D 1 72  ? 28.134  -37.248 1.935   1.00 29.10 ? 235 ARG D NE  1 
ATOM   5476 C CZ  . ARG D 1 72  ? 28.009  -36.436 0.886   1.00 25.91 ? 235 ARG D CZ  1 
ATOM   5477 N NH1 . ARG D 1 72  ? 27.458  -36.894 -0.229  1.00 25.32 ? 235 ARG D NH1 1 
ATOM   5478 N NH2 . ARG D 1 72  ? 28.457  -35.186 0.950   1.00 27.06 ? 235 ARG D NH2 1 
ATOM   5479 N N   . ILE D 1 73  ? 30.814  -41.132 -0.836  1.00 20.24 ? 236 ILE D N   1 
ATOM   5480 C CA  . ILE D 1 73  ? 31.253  -40.654 -2.139  1.00 20.14 ? 236 ILE D CA  1 
ATOM   5481 C C   . ILE D 1 73  ? 30.231  -39.678 -2.664  1.00 18.97 ? 236 ILE D C   1 
ATOM   5482 O O   . ILE D 1 73  ? 29.072  -40.032 -2.839  1.00 20.65 ? 236 ILE D O   1 
ATOM   5483 C CB  . ILE D 1 73  ? 31.372  -41.832 -3.193  1.00 18.87 ? 236 ILE D CB  1 
ATOM   5484 C CG1 . ILE D 1 73  ? 32.132  -43.045 -2.606  1.00 20.44 ? 236 ILE D CG1 1 
ATOM   5485 C CG2 . ILE D 1 73  ? 31.963  -41.326 -4.584  1.00 18.81 ? 236 ILE D CG2 1 
ATOM   5486 C CD1 . ILE D 1 73  ? 33.536  -42.721 -2.022  1.00 23.03 ? 236 ILE D CD1 1 
ATOM   5487 N N   . THR D 1 74  ? 30.665  -38.486 -3.032  1.00 20.19 ? 237 THR D N   1 
ATOM   5488 C CA  . THR D 1 74  ? 29.743  -37.491 -3.591  1.00 19.12 ? 237 THR D CA  1 
ATOM   5489 C C   . THR D 1 74  ? 29.415  -37.855 -5.026  1.00 20.47 ? 237 THR D C   1 
ATOM   5490 O O   . THR D 1 74  ? 30.143  -38.643 -5.634  1.00 21.03 ? 237 THR D O   1 
ATOM   5491 C CB  . THR D 1 74  ? 30.318  -36.054 -3.550  1.00 19.93 ? 237 THR D CB  1 
ATOM   5492 O OG1 . THR D 1 74  ? 31.342  -35.886 -4.563  1.00 16.39 ? 237 THR D OG1 1 
ATOM   5493 C CG2 . THR D 1 74  ? 30.871  -35.738 -2.188  1.00 19.29 ? 237 THR D CG2 1 
ATOM   5494 N N   . SER D 1 75  ? 28.347  -37.274 -5.581  1.00 20.91 ? 238 SER D N   1 
ATOM   5495 C CA  . SER D 1 75  ? 28.003  -37.502 -6.982  1.00 22.91 ? 238 SER D CA  1 
ATOM   5496 C C   . SER D 1 75  ? 29.102  -37.084 -7.985  1.00 22.08 ? 238 SER D C   1 
ATOM   5497 O O   . SER D 1 75  ? 29.136  -37.567 -9.119  1.00 20.51 ? 238 SER D O   1 
ATOM   5498 C CB  . SER D 1 75  ? 26.693  -36.773 -7.327  1.00 23.25 ? 238 SER D CB  1 
ATOM   5499 O OG  . SER D 1 75  ? 26.927  -35.401 -7.516  1.00 27.55 ? 238 SER D OG  1 
ATOM   5500 N N   . GLU D 1 76  ? 29.982  -36.180 -7.561  1.00 21.20 ? 239 GLU D N   1 
ATOM   5501 C CA  . GLU D 1 76  ? 31.144  -35.764 -8.376  1.00 21.90 ? 239 GLU D CA  1 
ATOM   5502 C C   . GLU D 1 76  ? 32.303  -36.741 -8.304  1.00 21.79 ? 239 GLU D C   1 
ATOM   5503 O O   . GLU D 1 76  ? 33.337  -36.498 -8.918  1.00 22.60 ? 239 GLU D O   1 
ATOM   5504 C CB  . GLU D 1 76  ? 31.639  -34.388 -7.897  1.00 21.10 ? 239 GLU D CB  1 
ATOM   5505 C CG  . GLU D 1 76  ? 30.656  -33.289 -8.179  1.00 23.02 ? 239 GLU D CG  1 
ATOM   5506 C CD  . GLU D 1 76  ? 29.521  -33.163 -7.128  1.00 26.57 ? 239 GLU D CD  1 
ATOM   5507 O OE1 . GLU D 1 76  ? 29.586  -33.787 -6.031  1.00 26.31 ? 239 GLU D OE1 1 
ATOM   5508 O OE2 . GLU D 1 76  ? 28.555  -32.430 -7.423  1.00 27.30 ? 239 GLU D OE2 1 
ATOM   5509 N N   . GLY D 1 77  ? 32.186  -37.787 -7.487  1.00 22.09 ? 240 GLY D N   1 
ATOM   5510 C CA  . GLY D 1 77  ? 33.272  -38.746 -7.345  1.00 21.27 ? 240 GLY D CA  1 
ATOM   5511 C C   . GLY D 1 77  ? 34.235  -38.461 -6.229  1.00 22.41 ? 240 GLY D C   1 
ATOM   5512 O O   . GLY D 1 77  ? 35.277  -39.123 -6.101  1.00 22.95 ? 240 GLY D O   1 
ATOM   5513 N N   . GLU D 1 78  ? 33.912  -37.473 -5.397  1.00 21.64 ? 241 GLU D N   1 
ATOM   5514 C CA  . GLU D 1 78  ? 34.770  -37.141 -4.281  1.00 20.53 ? 241 GLU D CA  1 
ATOM   5515 C C   . GLU D 1 78  ? 34.585  -38.105 -3.096  1.00 19.39 ? 241 GLU D C   1 
ATOM   5516 O O   . GLU D 1 78  ? 33.463  -38.356 -2.647  1.00 19.20 ? 241 GLU D O   1 
ATOM   5517 C CB  . GLU D 1 78  ? 34.534  -35.680 -3.841  1.00 22.31 ? 241 GLU D CB  1 
ATOM   5518 C CG  . GLU D 1 78  ? 35.538  -35.215 -2.759  1.00 20.98 ? 241 GLU D CG  1 
ATOM   5519 C CD  . GLU D 1 78  ? 35.222  -33.844 -2.159  1.00 23.80 ? 241 GLU D CD  1 
ATOM   5520 O OE1 . GLU D 1 78  ? 34.164  -33.256 -2.515  1.00 22.68 ? 241 GLU D OE1 1 
ATOM   5521 O OE2 . GLU D 1 78  ? 36.040  -33.361 -1.336  1.00 26.13 ? 241 GLU D OE2 1 
ATOM   5522 N N   . TYR D 1 79  ? 35.692  -38.678 -2.631  1.00 19.05 ? 242 TYR D N   1 
ATOM   5523 C CA  . TYR D 1 79  ? 35.717  -39.550 -1.467  1.00 19.24 ? 242 TYR D CA  1 
ATOM   5524 C C   . TYR D 1 79  ? 35.914  -38.679 -0.187  1.00 20.30 ? 242 TYR D C   1 
ATOM   5525 O O   . TYR D 1 79  ? 36.895  -37.913 -0.069  1.00 19.08 ? 242 TYR D O   1 
ATOM   5526 C CB  . TYR D 1 79  ? 36.856  -40.560 -1.613  1.00 19.01 ? 242 TYR D CB  1 
ATOM   5527 C CG  . TYR D 1 79  ? 37.261  -41.246 -0.341  1.00 18.79 ? 242 TYR D CG  1 
ATOM   5528 C CD1 . TYR D 1 79  ? 36.358  -42.068 0.389   1.00 18.73 ? 242 TYR D CD1 1 
ATOM   5529 C CD2 . TYR D 1 79  ? 38.551  -41.057 0.169   1.00 19.88 ? 242 TYR D CD2 1 
ATOM   5530 C CE1 . TYR D 1 79  ? 36.765  -42.642 1.587   1.00 20.28 ? 242 TYR D CE1 1 
ATOM   5531 C CE2 . TYR D 1 79  ? 38.964  -41.651 1.321   1.00 18.68 ? 242 TYR D CE2 1 
ATOM   5532 C CZ  . TYR D 1 79  ? 38.074  -42.436 2.035   1.00 19.62 ? 242 TYR D CZ  1 
ATOM   5533 O OH  . TYR D 1 79  ? 38.527  -42.996 3.201   1.00 21.32 ? 242 TYR D OH  1 
ATOM   5534 N N   . ILE D 1 80  ? 34.953  -38.811 0.736   1.00 20.35 ? 243 ILE D N   1 
ATOM   5535 C CA  . ILE D 1 80  ? 34.955  -38.143 2.029   1.00 20.85 ? 243 ILE D CA  1 
ATOM   5536 C C   . ILE D 1 80  ? 35.160  -39.244 3.071   1.00 21.23 ? 243 ILE D C   1 
ATOM   5537 O O   . ILE D 1 80  ? 34.278  -40.110 3.251   1.00 21.21 ? 243 ILE D O   1 
ATOM   5538 C CB  . ILE D 1 80  ? 33.606  -37.456 2.245   1.00 20.94 ? 243 ILE D CB  1 
ATOM   5539 C CG1 . ILE D 1 80  ? 33.408  -36.374 1.174   1.00 21.51 ? 243 ILE D CG1 1 
ATOM   5540 C CG2 . ILE D 1 80  ? 33.491  -36.889 3.655   1.00 21.08 ? 243 ILE D CG2 1 
ATOM   5541 C CD1 . ILE D 1 80  ? 31.998  -35.859 1.077   1.00 24.17 ? 243 ILE D CD1 1 
ATOM   5542 N N   . PRO D 1 81  ? 36.353  -39.285 3.676   1.00 21.42 ? 244 PRO D N   1 
ATOM   5543 C CA  . PRO D 1 81  ? 36.711  -40.289 4.642   1.00 22.00 ? 244 PRO D CA  1 
ATOM   5544 C C   . PRO D 1 81  ? 35.760  -40.291 5.808   1.00 23.19 ? 244 PRO D C   1 
ATOM   5545 O O   . PRO D 1 81  ? 35.360  -41.356 6.268   1.00 23.62 ? 244 PRO D O   1 
ATOM   5546 C CB  . PRO D 1 81  ? 38.102  -39.841 5.079   1.00 21.58 ? 244 PRO D CB  1 
ATOM   5547 C CG  . PRO D 1 81  ? 38.649  -39.186 3.896   1.00 20.87 ? 244 PRO D CG  1 
ATOM   5548 C CD  . PRO D 1 81  ? 37.516  -38.435 3.335   1.00 21.30 ? 244 PRO D CD  1 
ATOM   5549 N N   . LEU D 1 82  ? 35.405  -39.103 6.289   1.00 23.45 ? 245 LEU D N   1 
ATOM   5550 C CA  . LEU D 1 82  ? 34.564  -39.020 7.451   1.00 25.72 ? 245 LEU D CA  1 
ATOM   5551 C C   . LEU D 1 82  ? 33.492  -37.952 7.269   1.00 25.88 ? 245 LEU D C   1 
ATOM   5552 O O   . LEU D 1 82  ? 33.789  -36.770 7.261   1.00 25.98 ? 245 LEU D O   1 
ATOM   5553 C CB  . LEU D 1 82  ? 35.407  -38.770 8.705   1.00 26.40 ? 245 LEU D CB  1 
ATOM   5554 C CG  . LEU D 1 82  ? 34.617  -38.604 10.007  1.00 27.68 ? 245 LEU D CG  1 
ATOM   5555 C CD1 . LEU D 1 82  ? 33.798  -39.887 10.351  1.00 30.13 ? 245 LEU D CD1 1 
ATOM   5556 C CD2 . LEU D 1 82  ? 35.576  -38.205 11.124  1.00 26.99 ? 245 LEU D CD2 1 
ATOM   5557 N N   . ASP D 1 83  ? 32.265  -38.409 7.097   1.00 25.23 ? 246 ASP D N   1 
ATOM   5558 C CA  . ASP D 1 83  ? 31.103  -37.563 7.050   1.00 26.63 ? 246 ASP D CA  1 
ATOM   5559 C C   . ASP D 1 83  ? 30.492  -37.695 8.461   1.00 25.55 ? 246 ASP D C   1 
ATOM   5560 O O   . ASP D 1 83  ? 30.303  -38.816 8.939   1.00 24.73 ? 246 ASP D O   1 
ATOM   5561 C CB  . ASP D 1 83  ? 30.125  -38.125 6.023   1.00 27.88 ? 246 ASP D CB  1 
ATOM   5562 C CG  . ASP D 1 83  ? 29.303  -37.057 5.310   1.00 33.48 ? 246 ASP D CG  1 
ATOM   5563 O OD1 . ASP D 1 83  ? 29.658  -35.858 5.345   1.00 38.88 ? 246 ASP D OD1 1 
ATOM   5564 O OD2 . ASP D 1 83  ? 28.290  -37.435 4.670   1.00 39.10 ? 246 ASP D OD2 1 
ATOM   5565 N N   . GLN D 1 84  ? 30.217  -36.559 9.101   1.00 23.08 ? 247 GLN D N   1 
ATOM   5566 C CA  . GLN D 1 84  ? 29.730  -36.515 10.471  1.00 23.60 ? 247 GLN D CA  1 
ATOM   5567 C C   . GLN D 1 84  ? 28.377  -35.894 10.324  1.00 24.31 ? 247 GLN D C   1 
ATOM   5568 O O   . GLN D 1 84  ? 28.261  -34.682 10.211  1.00 25.73 ? 247 GLN D O   1 
ATOM   5569 C CB  . GLN D 1 84  ? 30.664  -35.660 11.341  1.00 22.61 ? 247 GLN D CB  1 
ATOM   5570 C CG  . GLN D 1 84  ? 32.039  -36.336 11.571  1.00 22.76 ? 247 GLN D CG  1 
ATOM   5571 C CD  . GLN D 1 84  ? 33.035  -35.437 12.293  1.00 23.98 ? 247 GLN D CD  1 
ATOM   5572 O OE1 . GLN D 1 84  ? 33.999  -34.971 11.690  1.00 26.43 ? 247 GLN D OE1 1 
ATOM   5573 N NE2 . GLN D 1 84  ? 32.819  -35.197 13.570  1.00 18.09 ? 247 GLN D NE2 1 
ATOM   5574 N N   . ILE D 1 85  ? 27.357  -36.746 10.261  1.00 24.17 ? 248 ILE D N   1 
ATOM   5575 C CA  . ILE D 1 85  ? 26.006  -36.327 9.970   1.00 24.42 ? 248 ILE D CA  1 
ATOM   5576 C C   . ILE D 1 85  ? 25.247  -36.147 11.267  1.00 24.22 ? 248 ILE D C   1 
ATOM   5577 O O   . ILE D 1 85  ? 25.080  -37.077 12.045  1.00 22.68 ? 248 ILE D O   1 
ATOM   5578 C CB  . ILE D 1 85  ? 25.334  -37.367 9.070   1.00 24.97 ? 248 ILE D CB  1 
ATOM   5579 C CG1 . ILE D 1 85  ? 26.172  -37.493 7.778   1.00 27.87 ? 248 ILE D CG1 1 
ATOM   5580 C CG2 . ILE D 1 85  ? 23.891  -36.942 8.722   1.00 26.99 ? 248 ILE D CG2 1 
ATOM   5581 C CD1 . ILE D 1 85  ? 26.391  -38.937 7.316   1.00 33.21 ? 248 ILE D CD1 1 
ATOM   5582 N N   . ASP D 1 86  ? 24.788  -34.934 11.497  1.00 25.73 ? 249 ASP D N   1 
ATOM   5583 C CA  . ASP D 1 86  ? 24.111  -34.614 12.754  1.00 26.07 ? 249 ASP D CA  1 
ATOM   5584 C C   . ASP D 1 86  ? 22.772  -35.348 12.914  1.00 23.63 ? 249 ASP D C   1 
ATOM   5585 O O   . ASP D 1 86  ? 22.041  -35.518 11.961  1.00 23.91 ? 249 ASP D O   1 
ATOM   5586 C CB  . ASP D 1 86  ? 24.053  -33.087 12.917  1.00 27.98 ? 249 ASP D CB  1 
ATOM   5587 C CG  . ASP D 1 86  ? 25.502  -32.465 13.141  1.00 34.90 ? 249 ASP D CG  1 
ATOM   5588 O OD1 . ASP D 1 86  ? 26.181  -32.840 14.143  1.00 38.85 ? 249 ASP D OD1 1 
ATOM   5589 O OD2 . ASP D 1 86  ? 25.985  -31.635 12.304  1.00 40.22 ? 249 ASP D OD2 1 
ATOM   5590 N N   . ILE D 1 87  ? 22.525  -35.871 14.111  1.00 21.37 ? 250 ILE D N   1 
ATOM   5591 C CA  . ILE D 1 87  ? 21.308  -36.637 14.454  1.00 20.59 ? 250 ILE D CA  1 
ATOM   5592 C C   . ILE D 1 87  ? 20.472  -35.772 15.410  1.00 19.66 ? 250 ILE D C   1 
ATOM   5593 O O   . ILE D 1 87  ? 20.954  -35.338 16.431  1.00 18.89 ? 250 ILE D O   1 
ATOM   5594 C CB  . ILE D 1 87  ? 21.704  -38.008 15.064  1.00 20.83 ? 250 ILE D CB  1 
ATOM   5595 C CG1 . ILE D 1 87  ? 21.993  -38.975 13.911  1.00 23.96 ? 250 ILE D CG1 1 
ATOM   5596 C CG2 . ILE D 1 87  ? 20.660  -38.614 15.985  1.00 21.35 ? 250 ILE D CG2 1 
ATOM   5597 C CD1 . ILE D 1 87  ? 22.774  -40.119 14.312  1.00 26.89 ? 250 ILE D CD1 1 
ATOM   5598 N N   . ASN D 1 88  ? 19.247  -35.488 15.022  1.00 18.38 ? 251 ASN D N   1 
ATOM   5599 C CA  . ASN D 1 88  ? 18.456  -34.470 15.665  1.00 19.30 ? 251 ASN D CA  1 
ATOM   5600 C C   . ASN D 1 88  ? 17.972  -34.988 17.025  1.00 17.90 ? 251 ASN D C   1 
ATOM   5601 O O   . ASN D 1 88  ? 17.241  -35.971 17.096  1.00 18.17 ? 251 ASN D O   1 
ATOM   5602 C CB  . ASN D 1 88  ? 17.281  -34.123 14.764  1.00 19.66 ? 251 ASN D CB  1 
ATOM   5603 C CG  . ASN D 1 88  ? 16.343  -33.061 15.353  1.00 25.19 ? 251 ASN D CG  1 
ATOM   5604 O OD1 . ASN D 1 88  ? 16.683  -32.343 16.277  1.00 25.19 ? 251 ASN D OD1 1 
ATOM   5605 N ND2 . ASN D 1 88  ? 15.137  -32.974 14.787  1.00 31.19 ? 251 ASN D ND2 1 
ATOM   5606 N N   . VAL D 1 89  ? 18.425  -34.324 18.086  1.00 15.70 ? 252 VAL D N   1 
ATOM   5607 C CA  . VAL D 1 89  ? 17.933  -34.581 19.445  1.00 16.15 ? 252 VAL D CA  1 
ATOM   5608 C C   . VAL D 1 89  ? 17.313  -33.312 20.071  1.00 16.02 ? 252 VAL D C   1 
ATOM   5609 O O   . VAL D 1 89  ? 17.295  -33.166 21.290  1.00 17.32 ? 252 VAL D O   1 
ATOM   5610 C CB  . VAL D 1 89  ? 19.031  -35.213 20.369  1.00 15.85 ? 252 VAL D CB  1 
ATOM   5611 C CG1 . VAL D 1 89  ? 19.332  -36.670 19.927  1.00 15.27 ? 252 VAL D CG1 1 
ATOM   5612 C CG2 . VAL D 1 89  ? 20.347  -34.353 20.368  1.00 14.90 ? 252 VAL D CG2 1 
ATOM   5613 N N   . GLY D 1 90  ? 16.785  -32.413 19.249  1.00 14.88 ? 253 GLY D N   1 
ATOM   5614 C CA  . GLY D 1 90  ? 15.975  -31.293 19.796  1.00 16.45 ? 253 GLY D CA  1 
ATOM   5615 C C   . GLY D 1 90  ? 16.594  -29.901 19.716  1.00 16.07 ? 253 GLY D C   1 
ATOM   5616 O O   . GLY D 1 90  ? 16.016  -28.933 20.241  1.00 17.20 ? 253 GLY D O   1 
ATOM   5617 N N   . PHE D 1 91  ? 17.751  -29.765 19.056  1.00 14.81 ? 254 PHE D N   1 
ATOM   5618 C CA  . PHE D 1 91  ? 18.387  -28.430 18.884  1.00 15.09 ? 254 PHE D CA  1 
ATOM   5619 C C   . PHE D 1 91  ? 17.458  -27.276 18.583  1.00 16.33 ? 254 PHE D C   1 
ATOM   5620 O O   . PHE D 1 91  ? 17.535  -26.180 19.230  1.00 16.12 ? 254 PHE D O   1 
ATOM   5621 C CB  . PHE D 1 91  ? 19.517  -28.424 17.843  1.00 16.29 ? 254 PHE D CB  1 
ATOM   5622 C CG  . PHE D 1 91  ? 20.221  -27.084 17.736  1.00 15.96 ? 254 PHE D CG  1 
ATOM   5623 C CD1 . PHE D 1 91  ? 21.110  -26.659 18.721  1.00 16.76 ? 254 PHE D CD1 1 
ATOM   5624 C CD2 . PHE D 1 91  ? 19.932  -26.230 16.699  1.00 19.72 ? 254 PHE D CD2 1 
ATOM   5625 C CE1 . PHE D 1 91  ? 21.761  -25.402 18.637  1.00 16.05 ? 254 PHE D CE1 1 
ATOM   5626 C CE2 . PHE D 1 91  ? 20.540  -24.956 16.632  1.00 16.82 ? 254 PHE D CE2 1 
ATOM   5627 C CZ  . PHE D 1 91  ? 21.478  -24.573 17.599  1.00 15.90 ? 254 PHE D CZ  1 
ATOM   5628 N N   . ASP D 1 92  ? 16.600  -27.498 17.587  1.00 17.15 ? 255 ASP D N   1 
ATOM   5629 C CA  . ASP D 1 92  ? 15.823  -26.426 17.006  1.00 20.05 ? 255 ASP D CA  1 
ATOM   5630 C C   . ASP D 1 92  ? 14.722  -25.893 17.905  1.00 20.08 ? 255 ASP D C   1 
ATOM   5631 O O   . ASP D 1 92  ? 14.238  -24.794 17.659  1.00 20.58 ? 255 ASP D O   1 
ATOM   5632 C CB  . ASP D 1 92  ? 15.225  -26.812 15.642  1.00 20.15 ? 255 ASP D CB  1 
ATOM   5633 C CG  . ASP D 1 92  ? 16.302  -26.873 14.518  1.00 27.82 ? 255 ASP D CG  1 
ATOM   5634 O OD1 . ASP D 1 92  ? 17.123  -25.913 14.322  1.00 29.25 ? 255 ASP D OD1 1 
ATOM   5635 O OD2 . ASP D 1 92  ? 16.283  -27.887 13.775  1.00 35.73 ? 255 ASP D OD2 1 
ATOM   5636 N N   . SER D 1 93  ? 14.295  -26.688 18.884  1.00 20.59 ? 256 SER D N   1 
ATOM   5637 C CA  . SER D 1 93  ? 13.280  -26.239 19.793  1.00 19.52 ? 256 SER D CA  1 
ATOM   5638 C C   . SER D 1 93  ? 13.895  -26.037 21.165  1.00 19.57 ? 256 SER D C   1 
ATOM   5639 O O   . SER D 1 93  ? 13.222  -25.539 22.076  1.00 19.97 ? 256 SER D O   1 
ATOM   5640 C CB  . SER D 1 93  ? 12.104  -27.223 19.812  1.00 20.73 ? 256 SER D CB  1 
ATOM   5641 O OG  . SER D 1 93  ? 12.510  -28.471 20.328  1.00 20.20 ? 256 SER D OG  1 
ATOM   5642 N N   . GLY D 1 94  ? 15.185  -26.356 21.309  1.00 18.83 ? 257 GLY D N   1 
ATOM   5643 C CA  . GLY D 1 94  ? 15.915  -26.223 22.565  1.00 18.28 ? 257 GLY D CA  1 
ATOM   5644 C C   . GLY D 1 94  ? 15.807  -27.400 23.536  1.00 17.99 ? 257 GLY D C   1 
ATOM   5645 O O   . GLY D 1 94  ? 16.235  -27.316 24.689  1.00 17.84 ? 257 GLY D O   1 
ATOM   5646 N N   . ILE D 1 95  ? 15.271  -28.516 23.076  1.00 17.74 ? 258 ILE D N   1 
ATOM   5647 C CA  . ILE D 1 95  ? 15.097  -29.644 24.003  1.00 18.40 ? 258 ILE D CA  1 
ATOM   5648 C C   . ILE D 1 95  ? 16.361  -30.559 24.077  1.00 17.98 ? 258 ILE D C   1 
ATOM   5649 O O   . ILE D 1 95  ? 16.382  -31.554 24.786  1.00 16.10 ? 258 ILE D O   1 
ATOM   5650 C CB  . ILE D 1 95  ? 13.743  -30.397 23.805  1.00 18.95 ? 258 ILE D CB  1 
ATOM   5651 C CG1 . ILE D 1 95  ? 13.648  -31.091 22.446  1.00 19.61 ? 258 ILE D CG1 1 
ATOM   5652 C CG2 . ILE D 1 95  ? 12.531  -29.412 24.020  1.00 19.58 ? 258 ILE D CG2 1 
ATOM   5653 C CD1 . ILE D 1 95  ? 12.415  -31.998 22.266  1.00 24.93 ? 258 ILE D CD1 1 
ATOM   5654 N N   . ASP D 1 96  ? 17.398  -30.187 23.320  1.00 17.14 ? 259 ASP D N   1 
ATOM   5655 C CA  . ASP D 1 96  ? 18.755  -30.774 23.440  1.00 17.69 ? 259 ASP D CA  1 
ATOM   5656 C C   . ASP D 1 96  ? 19.386  -30.311 24.741  1.00 16.58 ? 259 ASP D C   1 
ATOM   5657 O O   . ASP D 1 96  ? 20.348  -30.912 25.253  1.00 16.32 ? 259 ASP D O   1 
ATOM   5658 C CB  . ASP D 1 96  ? 19.613  -30.289 22.231  1.00 18.34 ? 259 ASP D CB  1 
ATOM   5659 C CG  . ASP D 1 96  ? 19.825  -28.779 22.255  1.00 22.42 ? 259 ASP D CG  1 
ATOM   5660 O OD1 . ASP D 1 96  ? 18.813  -28.039 22.340  1.00 23.82 ? 259 ASP D OD1 1 
ATOM   5661 O OD2 . ASP D 1 96  ? 20.988  -28.310 22.243  1.00 26.54 ? 259 ASP D OD2 1 
ATOM   5662 N N   . ARG D 1 97  ? 18.812  -29.248 25.319  1.00 16.43 ? 260 ARG D N   1 
ATOM   5663 C CA  . ARG D 1 97  ? 19.232  -28.743 26.626  1.00 16.27 ? 260 ARG D CA  1 
ATOM   5664 C C   . ARG D 1 97  ? 18.568  -29.558 27.713  1.00 17.12 ? 260 ARG D C   1 
ATOM   5665 O O   . ARG D 1 97  ? 17.357  -29.726 27.723  1.00 18.19 ? 260 ARG D O   1 
ATOM   5666 C CB  . ARG D 1 97  ? 18.829  -27.265 26.805  1.00 16.19 ? 260 ARG D CB  1 
ATOM   5667 C CG  . ARG D 1 97  ? 19.304  -26.360 25.614  1.00 13.72 ? 260 ARG D CG  1 
ATOM   5668 C CD  . ARG D 1 97  ? 18.854  -24.919 25.817  1.00 16.08 ? 260 ARG D CD  1 
ATOM   5669 N NE  . ARG D 1 97  ? 17.443  -24.823 26.075  1.00 17.86 ? 260 ARG D NE  1 
ATOM   5670 C CZ  . ARG D 1 97  ? 16.847  -23.844 26.752  1.00 18.22 ? 260 ARG D CZ  1 
ATOM   5671 N NH1 . ARG D 1 97  ? 15.544  -23.900 26.910  1.00 13.84 ? 260 ARG D NH1 1 
ATOM   5672 N NH2 . ARG D 1 97  ? 17.536  -22.810 27.254  1.00 12.42 ? 260 ARG D NH2 1 
ATOM   5673 N N   . ILE D 1 98  ? 19.346  -30.071 28.626  1.00 16.78 ? 261 ILE D N   1 
ATOM   5674 C CA  . ILE D 1 98  ? 18.759  -30.966 29.619  1.00 17.53 ? 261 ILE D CA  1 
ATOM   5675 C C   . ILE D 1 98  ? 19.027  -30.468 31.043  1.00 17.91 ? 261 ILE D C   1 
ATOM   5676 O O   . ILE D 1 98  ? 20.002  -29.784 31.293  1.00 20.74 ? 261 ILE D O   1 
ATOM   5677 C CB  . ILE D 1 98  ? 19.246  -32.448 29.433  1.00 17.65 ? 261 ILE D CB  1 
ATOM   5678 C CG1 . ILE D 1 98  ? 20.778  -32.570 29.668  1.00 18.34 ? 261 ILE D CG1 1 
ATOM   5679 C CG2 . ILE D 1 98  ? 18.743  -33.015 28.068  1.00 14.98 ? 261 ILE D CG2 1 
ATOM   5680 C CD1 . ILE D 1 98  ? 21.270  -34.026 29.739  1.00 17.55 ? 261 ILE D CD1 1 
ATOM   5681 N N   . PHE D 1 99  ? 18.144  -30.799 31.965  1.00 18.14 ? 262 PHE D N   1 
ATOM   5682 C CA  . PHE D 1 99  ? 18.375  -30.535 33.354  1.00 18.84 ? 262 PHE D CA  1 
ATOM   5683 C C   . PHE D 1 99  ? 18.658  -31.889 33.972  1.00 19.42 ? 262 PHE D C   1 
ATOM   5684 O O   . PHE D 1 99  ? 17.726  -32.671 34.266  1.00 18.21 ? 262 PHE D O   1 
ATOM   5685 C CB  . PHE D 1 99  ? 17.142  -29.809 33.961  1.00 18.99 ? 262 PHE D CB  1 
ATOM   5686 C CG  . PHE D 1 99  ? 17.107  -29.797 35.480  1.00 18.95 ? 262 PHE D CG  1 
ATOM   5687 C CD1 . PHE D 1 99  ? 18.151  -29.225 36.225  1.00 22.40 ? 262 PHE D CD1 1 
ATOM   5688 C CD2 . PHE D 1 99  ? 15.999  -30.298 36.160  1.00 22.75 ? 262 PHE D CD2 1 
ATOM   5689 C CE1 . PHE D 1 99  ? 18.093  -29.173 37.633  1.00 22.38 ? 262 PHE D CE1 1 
ATOM   5690 C CE2 . PHE D 1 99  ? 15.923  -30.254 37.577  1.00 21.36 ? 262 PHE D CE2 1 
ATOM   5691 C CZ  . PHE D 1 99  ? 16.993  -29.683 38.305  1.00 20.06 ? 262 PHE D CZ  1 
ATOM   5692 N N   . LEU D 1 100 ? 19.957  -32.173 34.158  1.00 19.91 ? 263 LEU D N   1 
ATOM   5693 C CA  . LEU D 1 100 ? 20.407  -33.524 34.417  1.00 21.69 ? 263 LEU D CA  1 
ATOM   5694 C C   . LEU D 1 100 ? 20.552  -33.735 35.906  1.00 22.47 ? 263 LEU D C   1 
ATOM   5695 O O   . LEU D 1 100 ? 21.475  -33.180 36.540  1.00 22.91 ? 263 LEU D O   1 
ATOM   5696 C CB  . LEU D 1 100 ? 21.720  -33.822 33.649  1.00 21.30 ? 263 LEU D CB  1 
ATOM   5697 C CG  . LEU D 1 100 ? 22.424  -35.168 33.894  1.00 23.98 ? 263 LEU D CG  1 
ATOM   5698 C CD1 . LEU D 1 100 ? 21.530  -36.350 33.545  1.00 20.93 ? 263 LEU D CD1 1 
ATOM   5699 C CD2 . LEU D 1 100 ? 23.796  -35.241 33.120  1.00 22.34 ? 263 LEU D CD2 1 
ATOM   5700 N N   . VAL D 1 101 ? 19.601  -34.466 36.481  1.00 21.33 ? 264 VAL D N   1 
ATOM   5701 C CA  . VAL D 1 101 ? 19.712  -34.862 37.870  1.00 22.65 ? 264 VAL D CA  1 
ATOM   5702 C C   . VAL D 1 101 ? 19.950  -36.378 37.931  1.00 23.45 ? 264 VAL D C   1 
ATOM   5703 O O   . VAL D 1 101 ? 21.095  -36.833 38.081  1.00 24.81 ? 264 VAL D O   1 
ATOM   5704 C CB  . VAL D 1 101 ? 18.481  -34.424 38.688  1.00 22.83 ? 264 VAL D CB  1 
ATOM   5705 C CG1 . VAL D 1 101 ? 18.674  -34.769 40.179  1.00 26.01 ? 264 VAL D CG1 1 
ATOM   5706 C CG2 . VAL D 1 101 ? 18.264  -32.944 38.509  1.00 23.10 ? 264 VAL D CG2 1 
ATOM   5707 N N   . SER D 1 102 ? 18.878  -37.134 37.782  1.00 22.38 ? 265 SER D N   1 
ATOM   5708 C CA  . SER D 1 102 ? 18.910  -38.558 37.596  1.00 22.51 ? 265 SER D CA  1 
ATOM   5709 C C   . SER D 1 102 ? 19.038  -38.897 36.072  1.00 21.48 ? 265 SER D C   1 
ATOM   5710 O O   . SER D 1 102 ? 18.763  -38.045 35.218  1.00 19.78 ? 265 SER D O   1 
ATOM   5711 C CB  . SER D 1 102 ? 17.604  -39.129 38.154  1.00 23.00 ? 265 SER D CB  1 
ATOM   5712 O OG  . SER D 1 102 ? 16.520  -38.487 37.532  1.00 26.20 ? 265 SER D OG  1 
ATOM   5713 N N   . PRO D 1 103 ? 19.509  -40.118 35.740  1.00 20.75 ? 266 PRO D N   1 
ATOM   5714 C CA  . PRO D 1 103 ? 19.830  -40.438 34.346  1.00 20.21 ? 266 PRO D CA  1 
ATOM   5715 C C   . PRO D 1 103 ? 18.665  -40.200 33.385  1.00 20.18 ? 266 PRO D C   1 
ATOM   5716 O O   . PRO D 1 103 ? 17.538  -40.507 33.715  1.00 20.94 ? 266 PRO D O   1 
ATOM   5717 C CB  . PRO D 1 103 ? 20.227  -41.913 34.396  1.00 20.27 ? 266 PRO D CB  1 
ATOM   5718 C CG  . PRO D 1 103 ? 20.817  -42.087 35.838  1.00 20.24 ? 266 PRO D CG  1 
ATOM   5719 C CD  . PRO D 1 103 ? 19.818  -41.229 36.660  1.00 19.58 ? 266 PRO D CD  1 
ATOM   5720 N N   . ILE D 1 104 ? 18.979  -39.645 32.222  1.00 17.84 ? 267 ILE D N   1 
ATOM   5721 C CA  . ILE D 1 104 ? 18.010  -39.204 31.219  1.00 17.76 ? 267 ILE D CA  1 
ATOM   5722 C C   . ILE D 1 104 ? 18.149  -40.085 29.975  1.00 18.21 ? 267 ILE D C   1 
ATOM   5723 O O   . ILE D 1 104 ? 19.275  -40.411 29.590  1.00 18.42 ? 267 ILE D O   1 
ATOM   5724 C CB  . ILE D 1 104 ? 18.222  -37.700 30.868  1.00 15.53 ? 267 ILE D CB  1 
ATOM   5725 C CG1 . ILE D 1 104 ? 17.839  -36.832 32.091  1.00 16.55 ? 267 ILE D CG1 1 
ATOM   5726 C CG2 . ILE D 1 104 ? 17.362  -37.236 29.645  1.00 15.00 ? 267 ILE D CG2 1 
ATOM   5727 C CD1 . ILE D 1 104 ? 18.055  -35.318 31.876  1.00 16.13 ? 267 ILE D CD1 1 
ATOM   5728 N N   . THR D 1 105 ? 17.017  -40.453 29.370  1.00 17.14 ? 268 THR D N   1 
ATOM   5729 C CA  . THR D 1 105 ? 17.026  -41.205 28.106  1.00 17.18 ? 268 THR D CA  1 
ATOM   5730 C C   . THR D 1 105 ? 16.833  -40.176 27.016  1.00 17.69 ? 268 THR D C   1 
ATOM   5731 O O   . THR D 1 105 ? 15.797  -39.472 26.997  1.00 17.31 ? 268 THR D O   1 
ATOM   5732 C CB  . THR D 1 105 ? 15.899  -42.267 28.134  1.00 17.49 ? 268 THR D CB  1 
ATOM   5733 O OG1 . THR D 1 105 ? 16.259  -43.177 29.160  1.00 18.65 ? 268 THR D OG1 1 
ATOM   5734 C CG2 . THR D 1 105 ? 15.807  -43.053 26.831  1.00 18.09 ? 268 THR D CG2 1 
ATOM   5735 N N   . ILE D 1 106 ? 17.866  -40.000 26.188  1.00 16.22 ? 269 ILE D N   1 
ATOM   5736 C CA  . ILE D 1 106 ? 17.843  -39.059 25.070  1.00 15.96 ? 269 ILE D CA  1 
ATOM   5737 C C   . ILE D 1 106 ? 17.093  -39.713 23.905  1.00 16.62 ? 269 ILE D C   1 
ATOM   5738 O O   . ILE D 1 106 ? 17.273  -40.891 23.647  1.00 17.28 ? 269 ILE D O   1 
ATOM   5739 C CB  . ILE D 1 106 ? 19.281  -38.704 24.648  1.00 15.69 ? 269 ILE D CB  1 
ATOM   5740 C CG1 . ILE D 1 106 ? 20.050  -38.186 25.888  1.00 16.72 ? 269 ILE D CG1 1 
ATOM   5741 C CG2 . ILE D 1 106 ? 19.301  -37.775 23.428  1.00 12.42 ? 269 ILE D CG2 1 
ATOM   5742 C CD1 . ILE D 1 106 ? 19.382  -36.896 26.574  1.00 15.46 ? 269 ILE D CD1 1 
ATOM   5743 N N   . VAL D 1 107 ? 16.282  -38.952 23.189  1.00 16.25 ? 270 VAL D N   1 
ATOM   5744 C CA  . VAL D 1 107 ? 15.415  -39.555 22.193  1.00 17.50 ? 270 VAL D CA  1 
ATOM   5745 C C   . VAL D 1 107 ? 15.653  -38.853 20.827  1.00 18.08 ? 270 VAL D C   1 
ATOM   5746 O O   . VAL D 1 107 ? 15.529  -37.633 20.705  1.00 18.00 ? 270 VAL D O   1 
ATOM   5747 C CB  . VAL D 1 107 ? 13.937  -39.448 22.659  1.00 17.38 ? 270 VAL D CB  1 
ATOM   5748 C CG1 . VAL D 1 107 ? 12.974  -39.970 21.580  1.00 19.86 ? 270 VAL D CG1 1 
ATOM   5749 C CG2 . VAL D 1 107 ? 13.722  -40.196 24.015  1.00 18.09 ? 270 VAL D CG2 1 
ATOM   5750 N N   . HIS D 1 108 ? 16.096  -39.633 19.858  1.00 18.30 ? 271 HIS D N   1 
ATOM   5751 C CA  . HIS D 1 108 ? 16.046  -39.273 18.431  1.00 18.06 ? 271 HIS D CA  1 
ATOM   5752 C C   . HIS D 1 108 ? 14.812  -39.914 17.745  1.00 19.18 ? 271 HIS D C   1 
ATOM   5753 O O   . HIS D 1 108 ? 14.798  -41.140 17.467  1.00 19.26 ? 271 HIS D O   1 
ATOM   5754 C CB  . HIS D 1 108 ? 17.363  -39.705 17.718  1.00 17.58 ? 271 HIS D CB  1 
ATOM   5755 C CG  . HIS D 1 108 ? 17.318  -39.569 16.218  1.00 18.30 ? 271 HIS D CG  1 
ATOM   5756 N ND1 . HIS D 1 108 ? 17.251  -38.352 15.584  1.00 20.15 ? 271 HIS D ND1 1 
ATOM   5757 C CD2 . HIS D 1 108 ? 17.307  -40.495 15.232  1.00 21.02 ? 271 HIS D CD2 1 
ATOM   5758 C CE1 . HIS D 1 108 ? 17.231  -38.527 14.270  1.00 17.96 ? 271 HIS D CE1 1 
ATOM   5759 N NE2 . HIS D 1 108 ? 17.223  -39.823 14.030  1.00 16.01 ? 271 HIS D NE2 1 
ATOM   5760 N N   . GLU D 1 109 ? 13.818  -39.091 17.389  1.00 19.30 ? 272 GLU D N   1 
ATOM   5761 C CA  . GLU D 1 109 ? 12.729  -39.580 16.556  1.00 21.08 ? 272 GLU D CA  1 
ATOM   5762 C C   . GLU D 1 109 ? 13.215  -39.882 15.149  1.00 20.30 ? 272 GLU D C   1 
ATOM   5763 O O   . GLU D 1 109 ? 13.830  -39.044 14.478  1.00 19.51 ? 272 GLU D O   1 
ATOM   5764 C CB  . GLU D 1 109 ? 11.587  -38.571 16.523  1.00 21.27 ? 272 GLU D CB  1 
ATOM   5765 C CG  . GLU D 1 109 ? 10.279  -39.127 15.931  1.00 26.74 ? 272 GLU D CG  1 
ATOM   5766 C CD  . GLU D 1 109 ? 9.360   -37.987 15.401  1.00 33.87 ? 272 GLU D CD  1 
ATOM   5767 O OE1 . GLU D 1 109 ? 8.561   -38.226 14.462  1.00 36.59 ? 272 GLU D OE1 1 
ATOM   5768 O OE2 . GLU D 1 109 ? 9.466   -36.843 15.913  1.00 36.11 ? 272 GLU D OE2 1 
ATOM   5769 N N   . ILE D 1 110 ? 12.989  -41.098 14.704  1.00 22.33 ? 273 ILE D N   1 
ATOM   5770 C CA  . ILE D 1 110 ? 13.412  -41.446 13.347  1.00 22.93 ? 273 ILE D CA  1 
ATOM   5771 C C   . ILE D 1 110 ? 12.304  -40.977 12.413  1.00 24.84 ? 273 ILE D C   1 
ATOM   5772 O O   . ILE D 1 110 ? 11.340  -41.677 12.137  1.00 25.37 ? 273 ILE D O   1 
ATOM   5773 C CB  . ILE D 1 110 ? 13.742  -42.936 13.206  1.00 23.85 ? 273 ILE D CB  1 
ATOM   5774 C CG1 . ILE D 1 110 ? 14.833  -43.324 14.220  1.00 22.62 ? 273 ILE D CG1 1 
ATOM   5775 C CG2 . ILE D 1 110 ? 14.157  -43.257 11.719  1.00 22.10 ? 273 ILE D CG2 1 
ATOM   5776 C CD1 . ILE D 1 110 ? 14.985  -44.803 14.435  1.00 22.56 ? 273 ILE D CD1 1 
ATOM   5777 N N   . ASP D 1 111 ? 12.404  -39.730 11.997  1.00 26.12 ? 274 ASP D N   1 
ATOM   5778 C CA  . ASP D 1 111 ? 11.416  -39.176 11.109  1.00 27.92 ? 274 ASP D CA  1 
ATOM   5779 C C   . ASP D 1 111 ? 12.035  -39.123 9.690   1.00 29.03 ? 274 ASP D C   1 
ATOM   5780 O O   . ASP D 1 111 ? 13.100  -39.698 9.455   1.00 28.09 ? 274 ASP D O   1 
ATOM   5781 C CB  . ASP D 1 111 ? 10.956  -37.806 11.635  1.00 27.27 ? 274 ASP D CB  1 
ATOM   5782 C CG  . ASP D 1 111 ? 11.995  -36.708 11.463  1.00 29.08 ? 274 ASP D CG  1 
ATOM   5783 O OD1 . ASP D 1 111 ? 13.133  -36.942 10.983  1.00 28.16 ? 274 ASP D OD1 1 
ATOM   5784 O OD2 . ASP D 1 111 ? 11.644  -35.545 11.785  1.00 34.81 ? 274 ASP D OD2 1 
ATOM   5785 N N   . GLU D 1 112 ? 11.359  -38.438 8.773   1.00 30.38 ? 275 GLU D N   1 
ATOM   5786 C CA  . GLU D 1 112 ? 11.781  -38.293 7.372   1.00 32.78 ? 275 GLU D CA  1 
ATOM   5787 C C   . GLU D 1 112 ? 13.171  -37.679 7.163   1.00 32.34 ? 275 GLU D C   1 
ATOM   5788 O O   . GLU D 1 112 ? 13.822  -37.941 6.143   1.00 32.87 ? 275 GLU D O   1 
ATOM   5789 C CB  . GLU D 1 112 ? 10.692  -37.514 6.619   1.00 33.04 ? 275 GLU D CB  1 
ATOM   5790 C CG  . GLU D 1 112 ? 11.140  -36.794 5.366   1.00 40.38 ? 275 GLU D CG  1 
ATOM   5791 C CD  . GLU D 1 112 ? 10.007  -35.979 4.707   1.00 47.61 ? 275 GLU D CD  1 
ATOM   5792 O OE1 . GLU D 1 112 ? 9.008   -35.653 5.409   1.00 48.94 ? 275 GLU D OE1 1 
ATOM   5793 O OE2 . GLU D 1 112 ? 10.125  -35.672 3.486   1.00 51.06 ? 275 GLU D OE2 1 
ATOM   5794 N N   . ASP D 1 113 ? 13.621  -36.865 8.115   1.00 31.91 ? 276 ASP D N   1 
ATOM   5795 C CA  . ASP D 1 113 ? 14.919  -36.187 8.031   1.00 31.79 ? 276 ASP D CA  1 
ATOM   5796 C C   . ASP D 1 113 ? 16.070  -36.956 8.732   1.00 30.48 ? 276 ASP D C   1 
ATOM   5797 O O   . ASP D 1 113 ? 17.245  -36.510 8.702   1.00 29.82 ? 276 ASP D O   1 
ATOM   5798 C CB  . ASP D 1 113 ? 14.809  -34.767 8.612   1.00 32.35 ? 276 ASP D CB  1 
ATOM   5799 C CG  . ASP D 1 113 ? 13.792  -33.875 7.851   1.00 36.94 ? 276 ASP D CG  1 
ATOM   5800 O OD1 . ASP D 1 113 ? 13.913  -33.732 6.612   1.00 39.05 ? 276 ASP D OD1 1 
ATOM   5801 O OD2 . ASP D 1 113 ? 12.890  -33.295 8.500   1.00 38.57 ? 276 ASP D OD2 1 
ATOM   5802 N N   . SER D 1 114 ? 15.728  -38.071 9.388   1.00 28.66 ? 277 SER D N   1 
ATOM   5803 C CA  . SER D 1 114 ? 16.704  -38.899 10.108  1.00 26.97 ? 277 SER D CA  1 
ATOM   5804 C C   . SER D 1 114 ? 17.518  -39.745 9.130   1.00 27.40 ? 277 SER D C   1 
ATOM   5805 O O   . SER D 1 114 ? 16.943  -40.303 8.207   1.00 26.72 ? 277 SER D O   1 
ATOM   5806 C CB  . SER D 1 114 ? 16.021  -39.839 11.098  1.00 26.85 ? 277 SER D CB  1 
ATOM   5807 O OG  . SER D 1 114 ? 16.990  -40.748 11.605  1.00 23.79 ? 277 SER D OG  1 
ATOM   5808 N N   . PRO D 1 115 ? 18.854  -39.846 9.339   1.00 27.05 ? 278 PRO D N   1 
ATOM   5809 C CA  . PRO D 1 115 ? 19.718  -40.769 8.576   1.00 27.42 ? 278 PRO D CA  1 
ATOM   5810 C C   . PRO D 1 115 ? 19.270  -42.236 8.684   1.00 27.42 ? 278 PRO D C   1 
ATOM   5811 O O   . PRO D 1 115 ? 19.673  -43.082 7.877   1.00 28.21 ? 278 PRO D O   1 
ATOM   5812 C CB  . PRO D 1 115 ? 21.103  -40.611 9.243   1.00 28.58 ? 278 PRO D CB  1 
ATOM   5813 C CG  . PRO D 1 115 ? 21.042  -39.323 10.019  1.00 27.41 ? 278 PRO D CG  1 
ATOM   5814 C CD  . PRO D 1 115 ? 19.599  -39.033 10.326  1.00 26.61 ? 278 PRO D CD  1 
ATOM   5815 N N   . LEU D 1 116 ? 18.426  -42.544 9.663   1.00 27.01 ? 279 LEU D N   1 
ATOM   5816 C CA  . LEU D 1 116 ? 17.992  -43.915 9.890   1.00 27.06 ? 279 LEU D CA  1 
ATOM   5817 C C   . LEU D 1 116 ? 16.575  -44.216 9.374   1.00 27.35 ? 279 LEU D C   1 
ATOM   5818 O O   . LEU D 1 116 ? 16.041  -45.310 9.618   1.00 26.78 ? 279 LEU D O   1 
ATOM   5819 C CB  . LEU D 1 116 ? 18.069  -44.220 11.380  1.00 28.05 ? 279 LEU D CB  1 
ATOM   5820 C CG  . LEU D 1 116 ? 19.404  -43.907 12.070  1.00 29.77 ? 279 LEU D CG  1 
ATOM   5821 C CD1 . LEU D 1 116 ? 19.254  -44.162 13.523  1.00 31.98 ? 279 LEU D CD1 1 
ATOM   5822 C CD2 . LEU D 1 116 ? 20.481  -44.834 11.501  1.00 32.10 ? 279 LEU D CD2 1 
ATOM   5823 N N   . TYR D 1 117 ? 15.970  -43.249 8.690   1.00 27.37 ? 280 TYR D N   1 
ATOM   5824 C CA  . TYR D 1 117 ? 14.568  -43.361 8.226   1.00 29.41 ? 280 TYR D CA  1 
ATOM   5825 C C   . TYR D 1 117 ? 14.246  -44.636 7.415   1.00 29.75 ? 280 TYR D C   1 
ATOM   5826 O O   . TYR D 1 117 ? 13.222  -45.274 7.640   1.00 29.82 ? 280 TYR D O   1 
ATOM   5827 C CB  . TYR D 1 117 ? 14.236  -42.135 7.395   1.00 29.28 ? 280 TYR D CB  1 
ATOM   5828 C CG  . TYR D 1 117 ? 12.777  -41.969 7.033   1.00 31.98 ? 280 TYR D CG  1 
ATOM   5829 C CD1 . TYR D 1 117 ? 11.773  -42.063 8.006   1.00 32.47 ? 280 TYR D CD1 1 
ATOM   5830 C CD2 . TYR D 1 117 ? 12.406  -41.696 5.721   1.00 32.90 ? 280 TYR D CD2 1 
ATOM   5831 C CE1 . TYR D 1 117 ? 10.441  -41.899 7.675   1.00 35.76 ? 280 TYR D CE1 1 
ATOM   5832 C CE2 . TYR D 1 117 ? 11.070  -41.526 5.381   1.00 35.55 ? 280 TYR D CE2 1 
ATOM   5833 C CZ  . TYR D 1 117 ? 10.100  -41.622 6.362   1.00 35.62 ? 280 TYR D CZ  1 
ATOM   5834 O OH  . TYR D 1 117 ? 8.786   -41.432 6.031   1.00 39.29 ? 280 TYR D OH  1 
ATOM   5835 N N   . ASP D 1 118 ? 15.153  -45.014 6.511   1.00 31.05 ? 281 ASP D N   1 
ATOM   5836 C CA  . ASP D 1 118 ? 14.983  -46.169 5.637   1.00 32.00 ? 281 ASP D CA  1 
ATOM   5837 C C   . ASP D 1 118 ? 15.496  -47.504 6.195   1.00 31.95 ? 281 ASP D C   1 
ATOM   5838 O O   . ASP D 1 118 ? 15.432  -48.507 5.499   1.00 32.52 ? 281 ASP D O   1 
ATOM   5839 C CB  . ASP D 1 118 ? 15.652  -45.868 4.284   1.00 33.36 ? 281 ASP D CB  1 
ATOM   5840 C CG  . ASP D 1 118 ? 15.064  -46.679 3.129   1.00 39.25 ? 281 ASP D CG  1 
ATOM   5841 O OD1 . ASP D 1 118 ? 13.879  -47.107 3.195   1.00 42.71 ? 281 ASP D OD1 1 
ATOM   5842 O OD2 . ASP D 1 118 ? 15.809  -46.888 2.129   1.00 46.86 ? 281 ASP D OD2 1 
ATOM   5843 N N   . LEU D 1 119 ? 15.971  -47.550 7.439   1.00 31.32 ? 282 LEU D N   1 
ATOM   5844 C CA  . LEU D 1 119 ? 16.587  -48.766 7.990   1.00 31.24 ? 282 LEU D CA  1 
ATOM   5845 C C   . LEU D 1 119 ? 15.676  -49.646 8.869   1.00 30.55 ? 282 LEU D C   1 
ATOM   5846 O O   . LEU D 1 119 ? 15.141  -49.173 9.873   1.00 30.14 ? 282 LEU D O   1 
ATOM   5847 C CB  . LEU D 1 119 ? 17.881  -48.431 8.770   1.00 31.80 ? 282 LEU D CB  1 
ATOM   5848 C CG  . LEU D 1 119 ? 19.092  -47.692 8.099   1.00 36.13 ? 282 LEU D CG  1 
ATOM   5849 C CD1 . LEU D 1 119 ? 20.369  -48.214 8.724   1.00 38.93 ? 282 LEU D CD1 1 
ATOM   5850 C CD2 . LEU D 1 119 ? 19.231  -47.813 6.558   1.00 37.95 ? 282 LEU D CD2 1 
ATOM   5851 N N   . SER D 1 120 ? 15.519  -50.920 8.487   1.00 29.41 ? 283 SER D N   1 
ATOM   5852 C CA  . SER D 1 120 ? 14.817  -51.952 9.274   1.00 28.71 ? 283 SER D CA  1 
ATOM   5853 C C   . SER D 1 120 ? 15.753  -52.635 10.246  1.00 29.24 ? 283 SER D C   1 
ATOM   5854 O O   . SER D 1 120 ? 16.966  -52.389 10.206  1.00 29.41 ? 283 SER D O   1 
ATOM   5855 C CB  . SER D 1 120 ? 14.281  -53.005 8.310   1.00 29.23 ? 283 SER D CB  1 
ATOM   5856 O OG  . SER D 1 120 ? 15.345  -53.830 7.887   1.00 29.64 ? 283 SER D OG  1 
ATOM   5857 N N   . LYS D 1 121 ? 15.221  -53.497 11.119  1.00 29.84 ? 284 LYS D N   1 
ATOM   5858 C CA  . LYS D 1 121 ? 16.071  -54.286 12.011  1.00 31.66 ? 284 LYS D CA  1 
ATOM   5859 C C   . LYS D 1 121 ? 17.148  -55.072 11.249  1.00 33.64 ? 284 LYS D C   1 
ATOM   5860 O O   . LYS D 1 121 ? 18.283  -55.175 11.705  1.00 33.57 ? 284 LYS D O   1 
ATOM   5861 C CB  . LYS D 1 121 ? 15.271  -55.248 12.888  1.00 31.54 ? 284 LYS D CB  1 
ATOM   5862 C CG  . LYS D 1 121 ? 16.168  -56.005 13.840  1.00 32.24 ? 284 LYS D CG  1 
ATOM   5863 C CD  . LYS D 1 121 ? 15.429  -56.982 14.699  1.00 34.54 ? 284 LYS D CD  1 
ATOM   5864 C CE  . LYS D 1 121 ? 16.423  -57.778 15.525  1.00 36.54 ? 284 LYS D CE  1 
ATOM   5865 N NZ  . LYS D 1 121 ? 17.399  -58.537 14.679  1.00 38.92 ? 284 LYS D NZ  1 
ATOM   5866 N N   . GLN D 1 122 ? 16.776  -55.633 10.099  1.00 35.63 ? 285 GLN D N   1 
ATOM   5867 C CA  . GLN D 1 122 ? 17.734  -56.371 9.246   1.00 36.98 ? 285 GLN D CA  1 
ATOM   5868 C C   . GLN D 1 122 ? 18.824  -55.446 8.703   1.00 36.82 ? 285 GLN D C   1 
ATOM   5869 O O   . GLN D 1 122 ? 19.967  -55.872 8.588   1.00 37.00 ? 285 GLN D O   1 
ATOM   5870 C CB  . GLN D 1 122 ? 17.016  -57.101 8.096   1.00 36.61 ? 285 GLN D CB  1 
ATOM   5871 C CG  . GLN D 1 122 ? 17.927  -58.052 7.280   1.00 41.27 ? 285 GLN D CG  1 
ATOM   5872 C CD  . GLN D 1 122 ? 17.123  -59.066 6.437   1.00 46.35 ? 285 GLN D CD  1 
ATOM   5873 O OE1 . GLN D 1 122 ? 16.348  -59.859 6.980   1.00 49.11 ? 285 GLN D OE1 1 
ATOM   5874 N NE2 . GLN D 1 122 ? 17.313  -59.041 5.115   1.00 47.11 ? 285 GLN D NE2 1 
ATOM   5875 N N   . ASP D 1 123 ? 18.470  -54.210 8.354   1.00 36.86 ? 286 ASP D N   1 
ATOM   5876 C CA  . ASP D 1 123 ? 19.452  -53.227 7.864   1.00 37.73 ? 286 ASP D CA  1 
ATOM   5877 C C   . ASP D 1 123 ? 20.476  -52.879 8.934   1.00 38.47 ? 286 ASP D C   1 
ATOM   5878 O O   . ASP D 1 123 ? 21.669  -52.781 8.618   1.00 38.23 ? 286 ASP D O   1 
ATOM   5879 C CB  . ASP D 1 123 ? 18.808  -51.940 7.349   1.00 37.55 ? 286 ASP D CB  1 
ATOM   5880 C CG  . ASP D 1 123 ? 17.962  -52.154 6.111   1.00 39.03 ? 286 ASP D CG  1 
ATOM   5881 O OD1 . ASP D 1 123 ? 18.376  -52.924 5.201   1.00 42.22 ? 286 ASP D OD1 1 
ATOM   5882 O OD2 . ASP D 1 123 ? 16.890  -51.528 6.022   1.00 40.27 ? 286 ASP D OD2 1 
ATOM   5883 N N   . ILE D 1 124 ? 20.023  -52.688 10.182  1.00 38.36 ? 287 ILE D N   1 
ATOM   5884 C CA  . ILE D 1 124 ? 20.945  -52.429 11.287  1.00 39.34 ? 287 ILE D CA  1 
ATOM   5885 C C   . ILE D 1 124 ? 21.849  -53.639 11.535  1.00 39.57 ? 287 ILE D C   1 
ATOM   5886 O O   . ILE D 1 124 ? 23.037  -53.483 11.819  1.00 40.33 ? 287 ILE D O   1 
ATOM   5887 C CB  . ILE D 1 124 ? 20.228  -52.086 12.634  1.00 39.04 ? 287 ILE D CB  1 
ATOM   5888 C CG1 . ILE D 1 124 ? 19.141  -51.000 12.476  1.00 40.78 ? 287 ILE D CG1 1 
ATOM   5889 C CG2 . ILE D 1 124 ? 21.267  -51.725 13.724  1.00 39.67 ? 287 ILE D CG2 1 
ATOM   5890 C CD1 . ILE D 1 124 ? 19.620  -49.588 12.182  1.00 39.40 ? 287 ILE D CD1 1 
ATOM   5891 N N   . ASP D 1 125 ? 21.284  -54.839 11.429  1.00 40.14 ? 288 ASP D N   1 
ATOM   5892 C CA  . ASP D 1 125 ? 22.038  -56.094 11.595  1.00 40.85 ? 288 ASP D CA  1 
ATOM   5893 C C   . ASP D 1 125 ? 23.224  -56.197 10.649  1.00 40.54 ? 288 ASP D C   1 
ATOM   5894 O O   . ASP D 1 125 ? 24.237  -56.795 10.977  1.00 41.13 ? 288 ASP D O   1 
ATOM   5895 C CB  . ASP D 1 125 ? 21.126  -57.289 11.329  1.00 41.53 ? 288 ASP D CB  1 
ATOM   5896 C CG  . ASP D 1 125 ? 20.173  -57.553 12.459  1.00 43.87 ? 288 ASP D CG  1 
ATOM   5897 O OD1 . ASP D 1 125 ? 20.561  -57.256 13.607  1.00 46.01 ? 288 ASP D OD1 1 
ATOM   5898 O OD2 . ASP D 1 125 ? 19.046  -58.076 12.204  1.00 45.60 ? 288 ASP D OD2 1 
ATOM   5899 N N   . ASN D 1 126 ? 23.074  -55.635 9.459   1.00 39.84 ? 289 ASN D N   1 
ATOM   5900 C CA  . ASN D 1 126 ? 24.080  -55.764 8.416   1.00 39.47 ? 289 ASN D CA  1 
ATOM   5901 C C   . ASN D 1 126 ? 25.020  -54.587 8.353   1.00 38.62 ? 289 ASN D C   1 
ATOM   5902 O O   . ASN D 1 126 ? 26.018  -54.649 7.635   1.00 39.24 ? 289 ASN D O   1 
ATOM   5903 C CB  . ASN D 1 126 ? 23.395  -55.908 7.048   1.00 39.35 ? 289 ASN D CB  1 
ATOM   5904 C CG  . ASN D 1 126 ? 22.522  -57.147 6.966   1.00 41.69 ? 289 ASN D CG  1 
ATOM   5905 O OD1 . ASN D 1 126 ? 22.670  -58.067 7.776   1.00 42.42 ? 289 ASN D OD1 1 
ATOM   5906 N ND2 . ASN D 1 126 ? 21.583  -57.164 6.008   1.00 42.40 ? 289 ASN D ND2 1 
ATOM   5907 N N   . ALA D 1 127 ? 24.663  -53.504 9.062   1.00 36.86 ? 290 ALA D N   1 
ATOM   5908 C CA  . ALA D 1 127 ? 25.319  -52.204 8.936   1.00 34.76 ? 290 ALA D CA  1 
ATOM   5909 C C   . ALA D 1 127 ? 26.584  -52.108 9.777   1.00 33.46 ? 290 ALA D C   1 
ATOM   5910 O O   . ALA D 1 127 ? 26.782  -52.871 10.752  1.00 31.47 ? 290 ALA D O   1 
ATOM   5911 C CB  . ALA D 1 127 ? 24.335  -51.060 9.293   1.00 34.97 ? 290 ALA D CB  1 
ATOM   5912 N N   . ASP D 1 128 ? 27.451  -51.166 9.413   1.00 32.85 ? 291 ASP D N   1 
ATOM   5913 C CA  . ASP D 1 128 ? 28.689  -51.009 10.193  1.00 32.76 ? 291 ASP D CA  1 
ATOM   5914 C C   . ASP D 1 128 ? 28.940  -49.567 10.686  1.00 30.80 ? 291 ASP D C   1 
ATOM   5915 O O   . ASP D 1 128 ? 30.025  -49.267 11.164  1.00 30.19 ? 291 ASP D O   1 
ATOM   5916 C CB  . ASP D 1 128 ? 29.910  -51.584 9.429   1.00 33.31 ? 291 ASP D CB  1 
ATOM   5917 C CG  . ASP D 1 128 ? 30.205  -50.829 8.132   1.00 38.19 ? 291 ASP D CG  1 
ATOM   5918 O OD1 . ASP D 1 128 ? 29.304  -50.152 7.604   1.00 40.87 ? 291 ASP D OD1 1 
ATOM   5919 O OD2 . ASP D 1 128 ? 31.348  -50.905 7.627   1.00 43.25 ? 291 ASP D OD2 1 
ATOM   5920 N N   . PHE D 1 129 ? 27.939  -48.689 10.564  1.00 29.39 ? 292 PHE D N   1 
ATOM   5921 C CA  . PHE D 1 129 ? 28.119  -47.292 10.960  1.00 27.15 ? 292 PHE D CA  1 
ATOM   5922 C C   . PHE D 1 129 ? 28.368  -47.169 12.459  1.00 25.88 ? 292 PHE D C   1 
ATOM   5923 O O   . PHE D 1 129 ? 28.183  -48.116 13.205  1.00 25.16 ? 292 PHE D O   1 
ATOM   5924 C CB  . PHE D 1 129 ? 26.934  -46.422 10.517  1.00 27.97 ? 292 PHE D CB  1 
ATOM   5925 C CG  . PHE D 1 129 ? 25.614  -46.823 11.127  1.00 27.63 ? 292 PHE D CG  1 
ATOM   5926 C CD1 . PHE D 1 129 ? 25.284  -46.459 12.427  1.00 28.31 ? 292 PHE D CD1 1 
ATOM   5927 C CD2 . PHE D 1 129 ? 24.696  -47.564 10.396  1.00 30.98 ? 292 PHE D CD2 1 
ATOM   5928 C CE1 . PHE D 1 129 ? 24.066  -46.828 12.994  1.00 26.56 ? 292 PHE D CE1 1 
ATOM   5929 C CE2 . PHE D 1 129 ? 23.475  -47.927 10.948  1.00 31.34 ? 292 PHE D CE2 1 
ATOM   5930 C CZ  . PHE D 1 129 ? 23.153  -47.545 12.260  1.00 30.37 ? 292 PHE D CZ  1 
ATOM   5931 N N   . GLU D 1 130 ? 28.768  -45.973 12.879  1.00 24.97 ? 293 GLU D N   1 
ATOM   5932 C CA  . GLU D 1 130 ? 29.009  -45.657 14.261  1.00 23.07 ? 293 GLU D CA  1 
ATOM   5933 C C   . GLU D 1 130 ? 28.254  -44.353 14.575  1.00 22.10 ? 293 GLU D C   1 
ATOM   5934 O O   . GLU D 1 130 ? 28.265  -43.399 13.809  1.00 22.62 ? 293 GLU D O   1 
ATOM   5935 C CB  . GLU D 1 130 ? 30.513  -45.477 14.464  1.00 23.15 ? 293 GLU D CB  1 
ATOM   5936 C CG  . GLU D 1 130 ? 30.936  -45.101 15.842  1.00 22.73 ? 293 GLU D CG  1 
ATOM   5937 C CD  . GLU D 1 130 ? 32.444  -45.026 15.988  1.00 26.12 ? 293 GLU D CD  1 
ATOM   5938 O OE1 . GLU D 1 130 ? 32.938  -44.707 17.091  1.00 24.96 ? 293 GLU D OE1 1 
ATOM   5939 O OE2 . GLU D 1 130 ? 33.170  -45.294 15.003  1.00 25.82 ? 293 GLU D OE2 1 
ATOM   5940 N N   . ILE D 1 131 ? 27.580  -44.321 15.701  1.00 20.32 ? 294 ILE D N   1 
ATOM   5941 C CA  . ILE D 1 131 ? 26.885  -43.109 16.091  1.00 18.98 ? 294 ILE D CA  1 
ATOM   5942 C C   . ILE D 1 131 ? 27.610  -42.582 17.306  1.00 17.97 ? 294 ILE D C   1 
ATOM   5943 O O   . ILE D 1 131 ? 27.645  -43.251 18.349  1.00 17.91 ? 294 ILE D O   1 
ATOM   5944 C CB  . ILE D 1 131 ? 25.398  -43.376 16.428  1.00 18.64 ? 294 ILE D CB  1 
ATOM   5945 C CG1 . ILE D 1 131 ? 24.640  -43.633 15.123  1.00 20.43 ? 294 ILE D CG1 1 
ATOM   5946 C CG2 . ILE D 1 131 ? 24.800  -42.140 17.193  1.00 17.13 ? 294 ILE D CG2 1 
ATOM   5947 C CD1 . ILE D 1 131 ? 23.249  -44.104 15.298  1.00 24.11 ? 294 ILE D CD1 1 
ATOM   5948 N N   . VAL D 1 132 ? 28.239  -41.422 17.179  1.00 16.77 ? 295 VAL D N   1 
ATOM   5949 C CA  . VAL D 1 132 ? 28.943  -40.824 18.333  1.00 15.94 ? 295 VAL D CA  1 
ATOM   5950 C C   . VAL D 1 132 ? 27.989  -39.987 19.187  1.00 15.61 ? 295 VAL D C   1 
ATOM   5951 O O   . VAL D 1 132 ? 27.172  -39.239 18.654  1.00 16.68 ? 295 VAL D O   1 
ATOM   5952 C CB  . VAL D 1 132 ? 30.113  -39.909 17.869  1.00 17.28 ? 295 VAL D CB  1 
ATOM   5953 C CG1 . VAL D 1 132 ? 30.823  -39.231 19.114  1.00 17.01 ? 295 VAL D CG1 1 
ATOM   5954 C CG2 . VAL D 1 132 ? 31.186  -40.777 17.208  1.00 19.58 ? 295 VAL D CG2 1 
ATOM   5955 N N   . VAL D 1 133 ? 28.074  -40.105 20.500  1.00 16.10 ? 296 VAL D N   1 
ATOM   5956 C CA  . VAL D 1 133 ? 27.146  -39.361 21.360  1.00 14.36 ? 296 VAL D CA  1 
ATOM   5957 C C   . VAL D 1 133 ? 27.924  -38.440 22.280  1.00 14.14 ? 296 VAL D C   1 
ATOM   5958 O O   . VAL D 1 133 ? 28.971  -38.798 22.773  1.00 14.17 ? 296 VAL D O   1 
ATOM   5959 C CB  . VAL D 1 133 ? 26.217  -40.298 22.158  1.00 16.37 ? 296 VAL D CB  1 
ATOM   5960 C CG1 . VAL D 1 133 ? 25.134  -40.944 21.229  1.00 13.20 ? 296 VAL D CG1 1 
ATOM   5961 C CG2 . VAL D 1 133 ? 27.000  -41.368 22.853  1.00 13.37 ? 296 VAL D CG2 1 
ATOM   5962 N N   . ILE D 1 134 ? 27.402  -37.236 22.535  1.00 13.16 ? 297 ILE D N   1 
ATOM   5963 C CA  . ILE D 1 134 ? 28.185  -36.271 23.277  1.00 12.69 ? 297 ILE D CA  1 
ATOM   5964 C C   . ILE D 1 134 ? 27.271  -35.591 24.294  1.00 13.67 ? 297 ILE D C   1 
ATOM   5965 O O   . ILE D 1 134 ? 26.096  -35.313 24.007  1.00 14.13 ? 297 ILE D O   1 
ATOM   5966 C CB  . ILE D 1 134 ? 28.803  -35.180 22.282  1.00 13.11 ? 297 ILE D CB  1 
ATOM   5967 C CG1 . ILE D 1 134 ? 29.948  -35.741 21.428  1.00 15.40 ? 297 ILE D CG1 1 
ATOM   5968 C CG2 . ILE D 1 134 ? 29.361  -33.954 23.053  1.00 13.71 ? 297 ILE D CG2 1 
ATOM   5969 C CD1 . ILE D 1 134 ? 30.275  -34.720 20.211  1.00 18.16 ? 297 ILE D CD1 1 
ATOM   5970 N N   . LEU D 1 135 ? 27.850  -35.282 25.451  1.00 13.19 ? 298 LEU D N   1 
ATOM   5971 C CA  . LEU D 1 135 ? 27.192  -34.500 26.507  1.00 12.91 ? 298 LEU D CA  1 
ATOM   5972 C C   . LEU D 1 135 ? 28.194  -33.455 26.953  1.00 13.09 ? 298 LEU D C   1 
ATOM   5973 O O   . LEU D 1 135 ? 29.331  -33.794 27.264  1.00 13.78 ? 298 LEU D O   1 
ATOM   5974 C CB  . LEU D 1 135 ? 26.812  -35.417 27.689  1.00 10.64 ? 298 LEU D CB  1 
ATOM   5975 C CG  . LEU D 1 135 ? 26.435  -34.684 29.000  1.00 17.95 ? 298 LEU D CG  1 
ATOM   5976 C CD1 . LEU D 1 135 ? 25.165  -33.920 28.789  1.00 15.42 ? 298 LEU D CD1 1 
ATOM   5977 C CD2 . LEU D 1 135 ? 26.245  -35.664 30.180  1.00 16.85 ? 298 LEU D CD2 1 
ATOM   5978 N N   . GLU D 1 136 ? 27.775  -32.190 26.961  1.00 13.24 ? 299 GLU D N   1 
ATOM   5979 C CA  . GLU D 1 136 ? 28.638  -31.074 27.295  1.00 16.40 ? 299 GLU D CA  1 
ATOM   5980 C C   . GLU D 1 136 ? 27.915  -30.196 28.317  1.00 15.88 ? 299 GLU D C   1 
ATOM   5981 O O   . GLU D 1 136 ? 26.665  -30.185 28.366  1.00 16.62 ? 299 GLU D O   1 
ATOM   5982 C CB  . GLU D 1 136 ? 28.966  -30.201 26.049  1.00 15.73 ? 299 GLU D CB  1 
ATOM   5983 C CG  . GLU D 1 136 ? 29.901  -30.931 25.025  1.00 18.93 ? 299 GLU D CG  1 
ATOM   5984 C CD  . GLU D 1 136 ? 29.989  -30.216 23.697  1.00 19.66 ? 299 GLU D CD  1 
ATOM   5985 O OE1 . GLU D 1 136 ? 28.937  -29.803 23.112  1.00 22.46 ? 299 GLU D OE1 1 
ATOM   5986 O OE2 . GLU D 1 136 ? 31.140  -30.064 23.231  1.00 22.33 ? 299 GLU D OE2 1 
ATOM   5987 N N   . GLY D 1 137 ? 28.697  -29.470 29.097  1.00 15.35 ? 300 GLY D N   1 
ATOM   5988 C CA  . GLY D 1 137 ? 28.168  -28.554 30.141  1.00 16.36 ? 300 GLY D CA  1 
ATOM   5989 C C   . GLY D 1 137 ? 29.312  -27.977 30.955  1.00 17.05 ? 300 GLY D C   1 
ATOM   5990 O O   . GLY D 1 137 ? 30.468  -28.251 30.685  1.00 18.05 ? 300 GLY D O   1 
ATOM   5991 N N   . MET D 1 138 ? 28.971  -27.162 31.941  1.00 17.62 ? 301 MET D N   1 
ATOM   5992 C CA  . MET D 1 138 ? 29.909  -26.469 32.822  1.00 17.01 ? 301 MET D CA  1 
ATOM   5993 C C   . MET D 1 138 ? 29.809  -27.075 34.191  1.00 18.12 ? 301 MET D C   1 
ATOM   5994 O O   . MET D 1 138 ? 28.743  -27.544 34.612  1.00 18.82 ? 301 MET D O   1 
ATOM   5995 C CB  . MET D 1 138 ? 29.564  -25.000 32.916  1.00 18.34 ? 301 MET D CB  1 
ATOM   5996 C CG  . MET D 1 138 ? 29.464  -24.254 31.548  1.00 19.01 ? 301 MET D CG  1 
ATOM   5997 S SD  . MET D 1 138 ? 30.984  -24.442 30.571  1.00 20.46 ? 301 MET D SD  1 
ATOM   5998 C CE  . MET D 1 138 ? 32.083  -23.326 31.472  1.00 22.58 ? 301 MET D CE  1 
ATOM   5999 N N   . VAL D 1 139 ? 30.929  -27.112 34.886  1.00 17.87 ? 302 VAL D N   1 
ATOM   6000 C CA  . VAL D 1 139 ? 30.960  -27.607 36.257  1.00 18.30 ? 302 VAL D CA  1 
ATOM   6001 C C   . VAL D 1 139 ? 30.420  -26.498 37.189  1.00 18.24 ? 302 VAL D C   1 
ATOM   6002 O O   . VAL D 1 139 ? 30.971  -25.417 37.267  1.00 17.54 ? 302 VAL D O   1 
ATOM   6003 C CB  . VAL D 1 139 ? 32.396  -28.010 36.668  1.00 17.71 ? 302 VAL D CB  1 
ATOM   6004 C CG1 . VAL D 1 139 ? 32.436  -28.430 38.118  1.00 19.32 ? 302 VAL D CG1 1 
ATOM   6005 C CG2 . VAL D 1 139 ? 32.888  -29.113 35.795  1.00 18.86 ? 302 VAL D CG2 1 
ATOM   6006 N N   . GLU D 1 140 ? 29.350  -26.802 37.905  1.00 18.87 ? 303 GLU D N   1 
ATOM   6007 C CA  . GLU D 1 140 ? 28.678  -25.809 38.730  1.00 19.46 ? 303 GLU D CA  1 
ATOM   6008 C C   . GLU D 1 140 ? 29.642  -25.136 39.683  1.00 19.00 ? 303 GLU D C   1 
ATOM   6009 O O   . GLU D 1 140 ? 30.492  -25.801 40.275  1.00 19.46 ? 303 GLU D O   1 
ATOM   6010 C CB  . GLU D 1 140 ? 27.536  -26.465 39.511  1.00 19.32 ? 303 GLU D CB  1 
ATOM   6011 C CG  . GLU D 1 140 ? 26.656  -25.439 40.252  1.00 20.61 ? 303 GLU D CG  1 
ATOM   6012 C CD  . GLU D 1 140 ? 25.562  -26.167 41.066  1.00 26.52 ? 303 GLU D CD  1 
ATOM   6013 O OE1 . GLU D 1 140 ? 25.895  -27.069 41.868  1.00 31.05 ? 303 GLU D OE1 1 
ATOM   6014 O OE2 . GLU D 1 140 ? 24.392  -25.858 40.885  1.00 27.05 ? 303 GLU D OE2 1 
ATOM   6015 N N   . ALA D 1 141 ? 29.511  -23.812 39.820  1.00 18.55 ? 304 ALA D N   1 
ATOM   6016 C CA  . ALA D 1 141 ? 30.311  -23.015 40.763  1.00 19.95 ? 304 ALA D CA  1 
ATOM   6017 C C   . ALA D 1 141 ? 31.765  -22.905 40.350  1.00 19.58 ? 304 ALA D C   1 
ATOM   6018 O O   . ALA D 1 141 ? 32.640  -22.514 41.165  1.00 20.36 ? 304 ALA D O   1 
ATOM   6019 C CB  . ALA D 1 141 ? 30.181  -23.531 42.267  1.00 19.78 ? 304 ALA D CB  1 
ATOM   6020 N N   . THR D 1 142 ? 32.051  -23.253 39.091  1.00 19.68 ? 305 THR D N   1 
ATOM   6021 C CA  . THR D 1 142 ? 33.400  -23.027 38.553  1.00 18.86 ? 305 THR D CA  1 
ATOM   6022 C C   . THR D 1 142 ? 33.301  -22.471 37.147  1.00 18.05 ? 305 THR D C   1 
ATOM   6023 O O   . THR D 1 142 ? 32.199  -22.303 36.636  1.00 19.42 ? 305 THR D O   1 
ATOM   6024 C CB  . THR D 1 142 ? 34.253  -24.314 38.478  1.00 17.91 ? 305 THR D CB  1 
ATOM   6025 O OG1 . THR D 1 142 ? 33.833  -25.040 37.340  1.00 22.13 ? 305 THR D OG1 1 
ATOM   6026 C CG2 . THR D 1 142 ? 34.109  -25.170 39.724  1.00 16.41 ? 305 THR D CG2 1 
ATOM   6027 N N   . ALA D 1 143 ? 34.444  -22.294 36.488  1.00 18.03 ? 306 ALA D N   1 
ATOM   6028 C CA  . ALA D 1 143 ? 34.475  -21.829 35.081  1.00 17.85 ? 306 ALA D CA  1 
ATOM   6029 C C   . ALA D 1 143 ? 34.878  -22.993 34.186  1.00 18.71 ? 306 ALA D C   1 
ATOM   6030 O O   . ALA D 1 143 ? 35.174  -22.793 33.013  1.00 18.32 ? 306 ALA D O   1 
ATOM   6031 C CB  . ALA D 1 143 ? 35.439  -20.680 34.920  1.00 18.41 ? 306 ALA D CB  1 
ATOM   6032 N N   . MET D 1 144 ? 34.867  -24.211 34.745  1.00 17.88 ? 307 MET D N   1 
ATOM   6033 C CA  . MET D 1 144 ? 35.349  -25.374 34.016  1.00 18.45 ? 307 MET D CA  1 
ATOM   6034 C C   . MET D 1 144 ? 34.220  -26.038 33.231  1.00 17.07 ? 307 MET D C   1 
ATOM   6035 O O   . MET D 1 144 ? 33.026  -25.949 33.590  1.00 16.40 ? 307 MET D O   1 
ATOM   6036 C CB  . MET D 1 144 ? 35.974  -26.418 34.964  1.00 18.71 ? 307 MET D CB  1 
ATOM   6037 C CG  . MET D 1 144 ? 37.248  -25.957 35.688  1.00 24.07 ? 307 MET D CG  1 
ATOM   6038 S SD  . MET D 1 144 ? 38.736  -25.551 34.675  1.00 31.13 ? 307 MET D SD  1 
ATOM   6039 C CE  . MET D 1 144 ? 38.583  -23.793 34.434  1.00 27.36 ? 307 MET D CE  1 
ATOM   6040 N N   . THR D 1 145 ? 34.632  -26.724 32.181  1.00 17.51 ? 308 THR D N   1 
ATOM   6041 C CA  . THR D 1 145 ? 33.733  -27.397 31.277  1.00 18.67 ? 308 THR D CA  1 
ATOM   6042 C C   . THR D 1 145 ? 33.963  -28.900 31.327  1.00 20.52 ? 308 THR D C   1 
ATOM   6043 O O   . THR D 1 145 ? 34.980  -29.351 31.863  1.00 19.60 ? 308 THR D O   1 
ATOM   6044 C CB  . THR D 1 145 ? 33.806  -26.810 29.802  1.00 17.85 ? 308 THR D CB  1 
ATOM   6045 O OG1 . THR D 1 145 ? 32.684  -27.253 29.040  1.00 18.87 ? 308 THR D OG1 1 
ATOM   6046 C CG2 . THR D 1 145 ? 35.108  -27.196 29.046  1.00 17.68 ? 308 THR D CG2 1 
ATOM   6047 N N   . LYS D 1 146 ? 32.981  -29.651 30.788  1.00 21.28 ? 309 LYS D N   1 
ATOM   6048 C CA  . LYS D 1 146 ? 33.075  -31.108 30.574  1.00 22.17 ? 309 LYS D CA  1 
ATOM   6049 C C   . LYS D 1 146 ? 32.521  -31.436 29.201  1.00 20.84 ? 309 LYS D C   1 
ATOM   6050 O O   . LYS D 1 146 ? 31.496  -30.852 28.762  1.00 20.73 ? 309 LYS D O   1 
ATOM   6051 C CB  . LYS D 1 146 ? 32.257  -31.905 31.620  1.00 23.11 ? 309 LYS D CB  1 
ATOM   6052 C CG  . LYS D 1 146 ? 32.535  -31.599 33.064  1.00 26.47 ? 309 LYS D CG  1 
ATOM   6053 C CD  . LYS D 1 146 ? 33.384  -32.680 33.709  1.00 36.26 ? 309 LYS D CD  1 
ATOM   6054 C CE  . LYS D 1 146 ? 34.424  -32.080 34.622  1.00 42.12 ? 309 LYS D CE  1 
ATOM   6055 N NZ  . LYS D 1 146 ? 35.063  -33.128 35.478  1.00 49.43 ? 309 LYS D NZ  1 
ATOM   6056 N N   . GLN D 1 147 ? 33.164  -32.379 28.529  1.00 19.57 ? 310 GLN D N   1 
ATOM   6057 C CA  . GLN D 1 147 ? 32.591  -33.020 27.341  1.00 19.55 ? 310 GLN D CA  1 
ATOM   6058 C C   . GLN D 1 147 ? 32.694  -34.534 27.526  1.00 20.24 ? 310 GLN D C   1 
ATOM   6059 O O   . GLN D 1 147 ? 33.807  -35.034 27.659  1.00 21.73 ? 310 GLN D O   1 
ATOM   6060 C CB  . GLN D 1 147 ? 33.356  -32.623 26.066  1.00 20.89 ? 310 GLN D CB  1 
ATOM   6061 C CG  . GLN D 1 147 ? 32.823  -33.244 24.782  1.00 17.09 ? 310 GLN D CG  1 
ATOM   6062 C CD  . GLN D 1 147 ? 33.702  -32.955 23.594  1.00 21.03 ? 310 GLN D CD  1 
ATOM   6063 O OE1 . GLN D 1 147 ? 34.675  -33.658 23.361  1.00 20.88 ? 310 GLN D OE1 1 
ATOM   6064 N NE2 . GLN D 1 147 ? 33.373  -31.922 22.838  1.00 14.72 ? 310 GLN D NE2 1 
ATOM   6065 N N   . CYS D 1 148 ? 31.564  -35.241 27.576  1.00 17.27 ? 311 CYS D N   1 
ATOM   6066 C CA  . CYS D 1 148 ? 31.558  -36.705 27.702  1.00 17.81 ? 311 CYS D CA  1 
ATOM   6067 C C   . CYS D 1 148 ? 31.258  -37.252 26.325  1.00 16.46 ? 311 CYS D C   1 
ATOM   6068 O O   . CYS D 1 148 ? 30.345  -36.770 25.693  1.00 16.53 ? 311 CYS D O   1 
ATOM   6069 C CB  . CYS D 1 148 ? 30.498  -37.191 28.700  1.00 16.89 ? 311 CYS D CB  1 
ATOM   6070 S SG  . CYS D 1 148 ? 30.580  -39.011 28.966  1.00 21.87 ? 311 CYS D SG  1 
ATOM   6071 N N   . ARG D 1 149 ? 32.061  -38.193 25.840  1.00 16.11 ? 312 ARG D N   1 
ATOM   6072 C CA  . ARG D 1 149 ? 31.901  -38.767 24.505  1.00 17.50 ? 312 ARG D CA  1 
ATOM   6073 C C   . ARG D 1 149 ? 31.736  -40.277 24.626  1.00 18.13 ? 312 ARG D C   1 
ATOM   6074 O O   . ARG D 1 149 ? 32.435  -40.919 25.421  1.00 18.74 ? 312 ARG D O   1 
ATOM   6075 C CB  . ARG D 1 149 ? 33.135  -38.500 23.619  1.00 18.18 ? 312 ARG D CB  1 
ATOM   6076 C CG  . ARG D 1 149 ? 33.477  -37.024 23.432  1.00 19.42 ? 312 ARG D CG  1 
ATOM   6077 C CD  . ARG D 1 149 ? 34.925  -36.866 22.942  1.00 20.79 ? 312 ARG D CD  1 
ATOM   6078 N NE  . ARG D 1 149 ? 35.917  -37.401 23.871  1.00 22.82 ? 312 ARG D NE  1 
ATOM   6079 C CZ  . ARG D 1 149 ? 36.441  -36.732 24.900  1.00 26.95 ? 312 ARG D CZ  1 
ATOM   6080 N NH1 . ARG D 1 149 ? 36.063  -35.492 25.179  1.00 26.58 ? 312 ARG D NH1 1 
ATOM   6081 N NH2 . ARG D 1 149 ? 37.344  -37.312 25.670  1.00 27.56 ? 312 ARG D NH2 1 
ATOM   6082 N N   . SER D 1 150 ? 30.826  -40.841 23.846  1.00 17.71 ? 313 SER D N   1 
ATOM   6083 C CA  . SER D 1 150 ? 30.825  -42.284 23.683  1.00 16.94 ? 313 SER D CA  1 
ATOM   6084 C C   . SER D 1 150 ? 30.435  -42.584 22.263  1.00 16.65 ? 313 SER D C   1 
ATOM   6085 O O   . SER D 1 150 ? 30.228  -41.668 21.419  1.00 16.47 ? 313 SER D O   1 
ATOM   6086 C CB  . SER D 1 150 ? 29.881  -42.973 24.697  1.00 17.30 ? 313 SER D CB  1 
ATOM   6087 O OG  . SER D 1 150 ? 30.183  -44.374 24.771  1.00 18.34 ? 313 SER D OG  1 
ATOM   6088 N N   . SER D 1 151 ? 30.304  -43.860 21.959  1.00 16.59 ? 314 SER D N   1 
ATOM   6089 C CA  . SER D 1 151 ? 29.711  -44.210 20.688  1.00 16.62 ? 314 SER D CA  1 
ATOM   6090 C C   . SER D 1 151 ? 29.016  -45.546 20.686  1.00 15.12 ? 314 SER D C   1 
ATOM   6091 O O   . SER D 1 151 ? 29.241  -46.403 21.559  1.00 15.37 ? 314 SER D O   1 
ATOM   6092 C CB  . SER D 1 151 ? 30.781  -44.132 19.570  1.00 18.97 ? 314 SER D CB  1 
ATOM   6093 O OG  . SER D 1 151 ? 31.498  -45.344 19.410  1.00 18.93 ? 314 SER D OG  1 
ATOM   6094 N N   . TYR D 1 152 ? 28.121  -45.699 19.721  1.00 16.32 ? 315 TYR D N   1 
ATOM   6095 C CA  . TYR D 1 152 ? 27.401  -46.947 19.496  1.00 15.78 ? 315 TYR D CA  1 
ATOM   6096 C C   . TYR D 1 152 ? 27.655  -47.371 18.037  1.00 16.75 ? 315 TYR D C   1 
ATOM   6097 O O   . TYR D 1 152 ? 27.257  -46.686 17.082  1.00 16.79 ? 315 TYR D O   1 
ATOM   6098 C CB  . TYR D 1 152 ? 25.896  -46.743 19.742  1.00 15.37 ? 315 TYR D CB  1 
ATOM   6099 C CG  . TYR D 1 152 ? 25.592  -46.223 21.116  1.00 13.71 ? 315 TYR D CG  1 
ATOM   6100 C CD1 . TYR D 1 152 ? 25.716  -47.045 22.220  1.00 14.92 ? 315 TYR D CD1 1 
ATOM   6101 C CD2 . TYR D 1 152 ? 25.212  -44.906 21.316  1.00 15.59 ? 315 TYR D CD2 1 
ATOM   6102 C CE1 . TYR D 1 152 ? 25.483  -46.558 23.496  1.00 16.90 ? 315 TYR D CE1 1 
ATOM   6103 C CE2 . TYR D 1 152 ? 24.969  -44.414 22.605  1.00 14.58 ? 315 TYR D CE2 1 
ATOM   6104 C CZ  . TYR D 1 152 ? 25.100  -45.247 23.678  1.00 14.61 ? 315 TYR D CZ  1 
ATOM   6105 O OH  . TYR D 1 152 ? 24.841  -44.763 24.933  1.00 14.64 ? 315 TYR D OH  1 
ATOM   6106 N N   . LEU D 1 153 ? 28.294  -48.515 17.880  1.00 17.88 ? 316 LEU D N   1 
ATOM   6107 C CA  . LEU D 1 153 ? 28.319  -49.207 16.581  1.00 18.79 ? 316 LEU D CA  1 
ATOM   6108 C C   . LEU D 1 153 ? 26.921  -49.707 16.280  1.00 20.13 ? 316 LEU D C   1 
ATOM   6109 O O   . LEU D 1 153 ? 26.135  -49.948 17.211  1.00 19.25 ? 316 LEU D O   1 
ATOM   6110 C CB  . LEU D 1 153 ? 29.283  -50.399 16.641  1.00 18.00 ? 316 LEU D CB  1 
ATOM   6111 C CG  . LEU D 1 153 ? 30.712  -49.992 16.999  1.00 18.25 ? 316 LEU D CG  1 
ATOM   6112 C CD1 . LEU D 1 153 ? 31.685  -51.169 17.037  1.00 20.05 ? 316 LEU D CD1 1 
ATOM   6113 C CD2 . LEU D 1 153 ? 31.230  -48.993 15.943  1.00 23.53 ? 316 LEU D CD2 1 
ATOM   6114 N N   . ALA D 1 154 ? 26.598  -49.855 14.989  1.00 21.91 ? 317 ALA D N   1 
ATOM   6115 C CA  . ALA D 1 154 ? 25.298  -50.431 14.603  1.00 23.79 ? 317 ALA D CA  1 
ATOM   6116 C C   . ALA D 1 154 ? 24.959  -51.721 15.392  1.00 24.94 ? 317 ALA D C   1 
ATOM   6117 O O   . ALA D 1 154 ? 23.791  -51.945 15.794  1.00 24.17 ? 317 ALA D O   1 
ATOM   6118 C CB  . ALA D 1 154 ? 25.234  -50.648 13.085  1.00 24.65 ? 317 ALA D CB  1 
ATOM   6119 N N   . ASN D 1 155 ? 25.987  -52.527 15.689  1.00 25.82 ? 318 ASN D N   1 
ATOM   6120 C CA  . ASN D 1 155 ? 25.768  -53.790 16.396  1.00 26.06 ? 318 ASN D CA  1 
ATOM   6121 C C   . ASN D 1 155 ? 25.588  -53.615 17.891  1.00 25.68 ? 318 ASN D C   1 
ATOM   6122 O O   . ASN D 1 155 ? 25.342  -54.574 18.591  1.00 25.41 ? 318 ASN D O   1 
ATOM   6123 C CB  . ASN D 1 155 ? 26.830  -54.867 16.063  1.00 26.27 ? 318 ASN D CB  1 
ATOM   6124 C CG  . ASN D 1 155 ? 28.243  -54.566 16.663  1.00 31.36 ? 318 ASN D CG  1 
ATOM   6125 O OD1 . ASN D 1 155 ? 28.389  -53.961 17.717  1.00 30.20 ? 318 ASN D OD1 1 
ATOM   6126 N ND2 . ASN D 1 155 ? 29.293  -55.058 15.973  1.00 36.51 ? 318 ASN D ND2 1 
ATOM   6127 N N   . GLU D 1 156 ? 25.703  -52.383 18.379  1.00 24.05 ? 319 GLU D N   1 
ATOM   6128 C CA  . GLU D 1 156 ? 25.474  -52.101 19.801  1.00 23.84 ? 319 GLU D CA  1 
ATOM   6129 C C   . GLU D 1 156 ? 24.125  -51.455 20.024  1.00 22.53 ? 319 GLU D C   1 
ATOM   6130 O O   . GLU D 1 156 ? 23.814  -51.080 21.147  1.00 23.27 ? 319 GLU D O   1 
ATOM   6131 C CB  . GLU D 1 156 ? 26.615  -51.256 20.420  1.00 24.35 ? 319 GLU D CB  1 
ATOM   6132 C CG  . GLU D 1 156 ? 27.990  -51.901 20.115  1.00 24.45 ? 319 GLU D CG  1 
ATOM   6133 C CD  . GLU D 1 156 ? 29.188  -51.043 20.460  1.00 25.09 ? 319 GLU D CD  1 
ATOM   6134 O OE1 . GLU D 1 156 ? 29.044  -49.812 20.526  1.00 21.83 ? 319 GLU D OE1 1 
ATOM   6135 O OE2 . GLU D 1 156 ? 30.299  -51.605 20.631  1.00 25.28 ? 319 GLU D OE2 1 
ATOM   6136 N N   . ILE D 1 157 ? 23.331  -51.343 18.960  1.00 20.60 ? 320 ILE D N   1 
ATOM   6137 C CA  . ILE D 1 157 ? 21.992  -50.799 19.038  1.00 20.19 ? 320 ILE D CA  1 
ATOM   6138 C C   . ILE D 1 157 ? 21.016  -51.977 19.129  1.00 21.31 ? 320 ILE D C   1 
ATOM   6139 O O   . ILE D 1 157 ? 21.033  -52.874 18.268  1.00 21.31 ? 320 ILE D O   1 
ATOM   6140 C CB  . ILE D 1 157 ? 21.643  -49.954 17.819  1.00 20.30 ? 320 ILE D CB  1 
ATOM   6141 C CG1 . ILE D 1 157 ? 22.697  -48.844 17.622  1.00 21.22 ? 320 ILE D CG1 1 
ATOM   6142 C CG2 . ILE D 1 157 ? 20.181  -49.422 17.951  1.00 16.91 ? 320 ILE D CG2 1 
ATOM   6143 C CD1 . ILE D 1 157 ? 22.439  -48.008 16.344  1.00 20.70 ? 320 ILE D CD1 1 
ATOM   6144 N N   . LEU D 1 158 ? 20.214  -51.991 20.186  1.00 20.32 ? 321 LEU D N   1 
ATOM   6145 C CA  . LEU D 1 158 ? 19.323  -53.093 20.436  1.00 20.18 ? 321 LEU D CA  1 
ATOM   6146 C C   . LEU D 1 158 ? 17.926  -52.773 19.966  1.00 20.80 ? 321 LEU D C   1 
ATOM   6147 O O   . LEU D 1 158 ? 17.191  -51.994 20.587  1.00 19.16 ? 321 LEU D O   1 
ATOM   6148 C CB  . LEU D 1 158 ? 19.339  -53.463 21.892  1.00 20.85 ? 321 LEU D CB  1 
ATOM   6149 C CG  . LEU D 1 158 ? 20.714  -53.683 22.541  1.00 20.75 ? 321 LEU D CG  1 
ATOM   6150 C CD1 . LEU D 1 158 ? 20.466  -53.848 23.992  1.00 19.95 ? 321 LEU D CD1 1 
ATOM   6151 C CD2 . LEU D 1 158 ? 21.425  -54.915 21.976  1.00 26.62 ? 321 LEU D CD2 1 
ATOM   6152 N N   . TRP D 1 159 ? 17.576  -53.361 18.835  1.00 20.90 ? 322 TRP D N   1 
ATOM   6153 C CA  . TRP D 1 159 ? 16.255  -53.182 18.243  1.00 21.83 ? 322 TRP D CA  1 
ATOM   6154 C C   . TRP D 1 159 ? 15.215  -53.853 19.135  1.00 22.38 ? 322 TRP D C   1 
ATOM   6155 O O   . TRP D 1 159 ? 15.389  -55.011 19.528  1.00 23.30 ? 322 TRP D O   1 
ATOM   6156 C CB  . TRP D 1 159 ? 16.192  -53.787 16.840  1.00 22.47 ? 322 TRP D CB  1 
ATOM   6157 C CG  . TRP D 1 159 ? 14.979  -53.320 16.074  1.00 22.20 ? 322 TRP D CG  1 
ATOM   6158 C CD1 . TRP D 1 159 ? 13.681  -53.744 16.248  1.00 20.48 ? 322 TRP D CD1 1 
ATOM   6159 C CD2 . TRP D 1 159 ? 14.945  -52.342 15.039  1.00 22.05 ? 322 TRP D CD2 1 
ATOM   6160 N NE1 . TRP D 1 159 ? 12.866  -53.096 15.390  1.00 18.37 ? 322 TRP D NE1 1 
ATOM   6161 C CE2 . TRP D 1 159 ? 13.605  -52.225 14.633  1.00 21.90 ? 322 TRP D CE2 1 
ATOM   6162 C CE3 . TRP D 1 159 ? 15.928  -51.542 14.408  1.00 23.24 ? 322 TRP D CE3 1 
ATOM   6163 C CZ2 . TRP D 1 159 ? 13.206  -51.359 13.629  1.00 23.01 ? 322 TRP D CZ2 1 
ATOM   6164 C CZ3 . TRP D 1 159 ? 15.535  -50.678 13.397  1.00 22.84 ? 322 TRP D CZ3 1 
ATOM   6165 C CH2 . TRP D 1 159 ? 14.184  -50.591 13.013  1.00 24.93 ? 322 TRP D CH2 1 
ATOM   6166 N N   . GLY D 1 160 ? 14.153  -53.115 19.458  1.00 22.36 ? 323 GLY D N   1 
ATOM   6167 C CA  . GLY D 1 160 ? 13.030  -53.607 20.268  1.00 22.44 ? 323 GLY D CA  1 
ATOM   6168 C C   . GLY D 1 160 ? 13.357  -53.781 21.741  1.00 23.00 ? 323 GLY D C   1 
ATOM   6169 O O   . GLY D 1 160 ? 12.874  -54.737 22.386  1.00 24.34 ? 323 GLY D O   1 
ATOM   6170 N N   . HIS D 1 161 ? 14.167  -52.869 22.298  1.00 21.69 ? 324 HIS D N   1 
ATOM   6171 C CA  . HIS D 1 161 ? 14.465  -52.881 23.714  1.00 21.47 ? 324 HIS D CA  1 
ATOM   6172 C C   . HIS D 1 161 ? 14.136  -51.511 24.345  1.00 20.82 ? 324 HIS D C   1 
ATOM   6173 O O   . HIS D 1 161 ? 14.112  -50.474 23.661  1.00 19.69 ? 324 HIS D O   1 
ATOM   6174 C CB  . HIS D 1 161 ? 15.919  -53.177 23.971  1.00 21.68 ? 324 HIS D CB  1 
ATOM   6175 C CG  . HIS D 1 161 ? 16.311  -54.602 23.719  1.00 24.33 ? 324 HIS D CG  1 
ATOM   6176 N ND1 . HIS D 1 161 ? 16.937  -55.369 24.677  1.00 24.23 ? 324 HIS D ND1 1 
ATOM   6177 C CD2 . HIS D 1 161 ? 16.218  -55.379 22.618  1.00 25.18 ? 324 HIS D CD2 1 
ATOM   6178 C CE1 . HIS D 1 161 ? 17.194  -56.568 24.181  1.00 26.27 ? 324 HIS D CE1 1 
ATOM   6179 N NE2 . HIS D 1 161 ? 16.780  -56.597 22.934  1.00 25.54 ? 324 HIS D NE2 1 
ATOM   6180 N N   . ARG D 1 162 ? 13.889  -51.524 25.650  1.00 21.15 ? 325 ARG D N   1 
ATOM   6181 C CA  . ARG D 1 162 ? 13.721  -50.271 26.432  1.00 21.68 ? 325 ARG D CA  1 
ATOM   6182 C C   . ARG D 1 162 ? 14.602  -50.368 27.647  1.00 20.89 ? 325 ARG D C   1 
ATOM   6183 O O   . ARG D 1 162 ? 15.008  -51.467 27.977  1.00 21.67 ? 325 ARG D O   1 
ATOM   6184 C CB  . ARG D 1 162 ? 12.250  -50.027 26.783  1.00 21.62 ? 325 ARG D CB  1 
ATOM   6185 C CG  . ARG D 1 162 ? 11.498  -49.706 25.525  1.00 23.84 ? 325 ARG D CG  1 
ATOM   6186 C CD  . ARG D 1 162 ? 10.034  -49.338 25.702  1.00 28.49 ? 325 ARG D CD  1 
ATOM   6187 N NE  . ARG D 1 162 ? 9.371   -50.159 26.716  1.00 25.77 ? 325 ARG D NE  1 
ATOM   6188 C CZ  . ARG D 1 162 ? 8.110   -50.600 26.626  1.00 26.79 ? 325 ARG D CZ  1 
ATOM   6189 N NH1 . ARG D 1 162 ? 7.345   -50.304 25.579  1.00 22.49 ? 325 ARG D NH1 1 
ATOM   6190 N NH2 . ARG D 1 162 ? 7.603   -51.329 27.622  1.00 23.58 ? 325 ARG D NH2 1 
ATOM   6191 N N   . TYR D 1 163 ? 14.934  -49.245 28.292  1.00 20.29 ? 326 TYR D N   1 
ATOM   6192 C CA  . TYR D 1 163 ? 15.821  -49.276 29.461  1.00 19.72 ? 326 TYR D CA  1 
ATOM   6193 C C   . TYR D 1 163 ? 15.038  -49.700 30.696  1.00 20.42 ? 326 TYR D C   1 
ATOM   6194 O O   . TYR D 1 163 ? 13.881  -49.316 30.835  1.00 20.87 ? 326 TYR D O   1 
ATOM   6195 C CB  . TYR D 1 163 ? 16.477  -47.907 29.726  1.00 18.46 ? 326 TYR D CB  1 
ATOM   6196 C CG  . TYR D 1 163 ? 17.477  -47.572 28.639  1.00 19.81 ? 326 TYR D CG  1 
ATOM   6197 C CD1 . TYR D 1 163 ? 17.156  -46.682 27.620  1.00 18.20 ? 326 TYR D CD1 1 
ATOM   6198 C CD2 . TYR D 1 163 ? 18.722  -48.231 28.600  1.00 17.63 ? 326 TYR D CD2 1 
ATOM   6199 C CE1 . TYR D 1 163 ? 18.063  -46.403 26.562  1.00 15.96 ? 326 TYR D CE1 1 
ATOM   6200 C CE2 . TYR D 1 163 ? 19.630  -47.975 27.561  1.00 18.87 ? 326 TYR D CE2 1 
ATOM   6201 C CZ  . TYR D 1 163 ? 19.288  -47.085 26.565  1.00 16.70 ? 326 TYR D CZ  1 
ATOM   6202 O OH  . TYR D 1 163 ? 20.197  -46.894 25.599  1.00 16.44 ? 326 TYR D OH  1 
ATOM   6203 N N   . GLU D 1 164 ? 15.668  -50.466 31.578  1.00 20.09 ? 327 GLU D N   1 
ATOM   6204 C CA  . GLU D 1 164 ? 15.146  -50.622 32.960  1.00 21.98 ? 327 GLU D CA  1 
ATOM   6205 C C   . GLU D 1 164 ? 15.087  -49.268 33.697  1.00 21.35 ? 327 GLU D C   1 
ATOM   6206 O O   . GLU D 1 164 ? 16.043  -48.501 33.646  1.00 21.59 ? 327 GLU D O   1 
ATOM   6207 C CB  . GLU D 1 164 ? 16.054  -51.545 33.778  1.00 20.84 ? 327 GLU D CB  1 
ATOM   6208 C CG  . GLU D 1 164 ? 15.932  -53.019 33.362  1.00 25.25 ? 327 GLU D CG  1 
ATOM   6209 C CD  . GLU D 1 164 ? 14.843  -53.727 34.098  1.00 29.71 ? 327 GLU D CD  1 
ATOM   6210 O OE1 . GLU D 1 164 ? 14.776  -54.965 33.919  1.00 29.76 ? 327 GLU D OE1 1 
ATOM   6211 O OE2 . GLU D 1 164 ? 14.081  -53.066 34.878  1.00 27.84 ? 327 GLU D OE2 1 
ATOM   6212 N N   . PRO D 1 165 ? 13.963  -48.981 34.388  1.00 22.11 ? 328 PRO D N   1 
ATOM   6213 C CA  . PRO D 1 165 ? 13.987  -47.801 35.276  1.00 20.94 ? 328 PRO D CA  1 
ATOM   6214 C C   . PRO D 1 165 ? 15.129  -47.821 36.298  1.00 20.55 ? 328 PRO D C   1 
ATOM   6215 O O   . PRO D 1 165 ? 15.513  -48.884 36.797  1.00 19.84 ? 328 PRO D O   1 
ATOM   6216 C CB  . PRO D 1 165 ? 12.594  -47.802 35.945  1.00 21.59 ? 328 PRO D CB  1 
ATOM   6217 C CG  . PRO D 1 165 ? 11.871  -49.040 35.480  1.00 21.94 ? 328 PRO D CG  1 
ATOM   6218 C CD  . PRO D 1 165 ? 12.623  -49.622 34.298  1.00 20.29 ? 328 PRO D CD  1 
ATOM   6219 N N   . VAL D 1 166 ? 15.706  -46.643 36.565  1.00 19.16 ? 329 VAL D N   1 
ATOM   6220 C CA  . VAL D 1 166 ? 16.663  -46.467 37.645  1.00 18.64 ? 329 VAL D CA  1 
ATOM   6221 C C   . VAL D 1 166 ? 16.098  -45.600 38.781  1.00 18.82 ? 329 VAL D C   1 
ATOM   6222 O O   . VAL D 1 166 ? 16.639  -45.582 39.876  1.00 19.83 ? 329 VAL D O   1 
ATOM   6223 C CB  . VAL D 1 166 ? 18.013  -45.816 37.154  1.00 19.42 ? 329 VAL D CB  1 
ATOM   6224 C CG1 . VAL D 1 166 ? 18.735  -46.738 36.209  1.00 20.51 ? 329 VAL D CG1 1 
ATOM   6225 C CG2 . VAL D 1 166 ? 17.764  -44.449 36.474  1.00 16.86 ? 329 VAL D CG2 1 
ATOM   6226 N N   . LEU D 1 167 ? 15.009  -44.900 38.537  1.00 18.44 ? 330 LEU D N   1 
ATOM   6227 C CA  . LEU D 1 167 ? 14.528  -43.890 39.499  1.00 19.45 ? 330 LEU D CA  1 
ATOM   6228 C C   . LEU D 1 167 ? 13.334  -44.484 40.230  1.00 19.71 ? 330 LEU D C   1 
ATOM   6229 O O   . LEU D 1 167 ? 12.331  -44.824 39.583  1.00 20.29 ? 330 LEU D O   1 
ATOM   6230 C CB  . LEU D 1 167 ? 14.096  -42.571 38.783  1.00 17.81 ? 330 LEU D CB  1 
ATOM   6231 C CG  . LEU D 1 167 ? 13.630  -41.442 39.722  1.00 17.99 ? 330 LEU D CG  1 
ATOM   6232 C CD1 . LEU D 1 167 ? 14.803  -40.933 40.588  1.00 18.10 ? 330 LEU D CD1 1 
ATOM   6233 C CD2 . LEU D 1 167 ? 12.995  -40.267 38.982  1.00 17.12 ? 330 LEU D CD2 1 
ATOM   6234 N N   . PHE D 1 168 ? 13.444  -44.557 41.554  1.00 20.37 ? 331 PHE D N   1 
ATOM   6235 C CA  . PHE D 1 168 ? 12.418  -45.149 42.418  1.00 22.51 ? 331 PHE D CA  1 
ATOM   6236 C C   . PHE D 1 168 ? 12.073  -44.220 43.568  1.00 23.65 ? 331 PHE D C   1 
ATOM   6237 O O   . PHE D 1 168 ? 12.959  -43.577 44.175  1.00 24.06 ? 331 PHE D O   1 
ATOM   6238 C CB  . PHE D 1 168 ? 12.915  -46.475 43.013  1.00 21.56 ? 331 PHE D CB  1 
ATOM   6239 C CG  . PHE D 1 168 ? 13.168  -47.519 41.973  1.00 23.50 ? 331 PHE D CG  1 
ATOM   6240 C CD1 . PHE D 1 168 ? 12.142  -48.396 41.594  1.00 24.87 ? 331 PHE D CD1 1 
ATOM   6241 C CD2 . PHE D 1 168 ? 14.405  -47.600 41.327  1.00 21.38 ? 331 PHE D CD2 1 
ATOM   6242 C CE1 . PHE D 1 168 ? 12.374  -49.334 40.592  1.00 26.43 ? 331 PHE D CE1 1 
ATOM   6243 C CE2 . PHE D 1 168 ? 14.625  -48.547 40.297  1.00 23.10 ? 331 PHE D CE2 1 
ATOM   6244 C CZ  . PHE D 1 168 ? 13.612  -49.391 39.934  1.00 21.02 ? 331 PHE D CZ  1 
ATOM   6245 N N   . GLU D 1 169 ? 10.801  -44.239 43.903  1.00 25.15 ? 332 GLU D N   1 
ATOM   6246 C CA  . GLU D 1 169 ? 10.251  -43.460 44.986  1.00 28.09 ? 332 GLU D CA  1 
ATOM   6247 C C   . GLU D 1 169 ? 10.420  -44.147 46.352  1.00 28.83 ? 332 GLU D C   1 
ATOM   6248 O O   . GLU D 1 169 ? 9.945   -45.280 46.545  1.00 28.31 ? 332 GLU D O   1 
ATOM   6249 C CB  . GLU D 1 169 ? 8.765   -43.214 44.687  1.00 27.90 ? 332 GLU D CB  1 
ATOM   6250 C CG  . GLU D 1 169 ? 8.080   -42.370 45.785  1.00 32.83 ? 332 GLU D CG  1 
ATOM   6251 C CD  . GLU D 1 169 ? 6.572   -42.305 45.660  1.00 36.53 ? 332 GLU D CD  1 
ATOM   6252 O OE1 . GLU D 1 169 ? 6.022   -42.939 44.721  1.00 37.76 ? 332 GLU D OE1 1 
ATOM   6253 O OE2 . GLU D 1 169 ? 5.943   -41.625 46.517  1.00 38.80 ? 332 GLU D OE2 1 
ATOM   6254 N N   . GLU D 1 170 ? 11.140  -43.483 47.272  1.00 29.86 ? 333 GLU D N   1 
ATOM   6255 C CA  . GLU D 1 170 ? 11.085  -43.764 48.728  1.00 31.51 ? 333 GLU D CA  1 
ATOM   6256 C C   . GLU D 1 170 ? 10.119  -42.749 49.397  1.00 31.68 ? 333 GLU D C   1 
ATOM   6257 O O   . GLU D 1 170 ? 9.639   -41.817 48.731  1.00 31.56 ? 333 GLU D O   1 
ATOM   6258 C CB  . GLU D 1 170 ? 12.492  -43.720 49.362  1.00 32.18 ? 333 GLU D CB  1 
ATOM   6259 C CG  . GLU D 1 170 ? 13.442  -44.854 48.903  1.00 34.13 ? 333 GLU D CG  1 
ATOM   6260 C CD  . GLU D 1 170 ? 12.850  -46.256 49.103  1.00 40.80 ? 333 GLU D CD  1 
ATOM   6261 O OE1 . GLU D 1 170 ? 12.134  -46.471 50.114  1.00 40.98 ? 333 GLU D OE1 1 
ATOM   6262 O OE2 . GLU D 1 170 ? 13.092  -47.144 48.245  1.00 43.15 ? 333 GLU D OE2 1 
ATOM   6263 N N   . LYS D 1 171 ? 9.790   -42.913 50.679  1.00 31.95 ? 334 LYS D N   1 
ATOM   6264 C CA  . LYS D 1 171 ? 8.819   -41.966 51.292  1.00 31.86 ? 334 LYS D CA  1 
ATOM   6265 C C   . LYS D 1 171 ? 9.250   -40.486 51.330  1.00 30.75 ? 334 LYS D C   1 
ATOM   6266 O O   . LYS D 1 171 ? 8.444   -39.593 51.038  1.00 29.81 ? 334 LYS D O   1 
ATOM   6267 C CB  . LYS D 1 171 ? 8.350   -42.415 52.699  1.00 33.67 ? 334 LYS D CB  1 
ATOM   6268 C CG  . LYS D 1 171 ? 7.189   -41.542 53.291  1.00 33.99 ? 334 LYS D CG  1 
ATOM   6269 C CD  . LYS D 1 171 ? 6.808   -42.033 54.711  1.00 39.17 ? 334 LYS D CD  1 
ATOM   6270 C CE  . LYS D 1 171 ? 5.912   -41.018 55.459  1.00 40.97 ? 334 LYS D CE  1 
ATOM   6271 N NZ  . LYS D 1 171 ? 5.741   -41.443 56.927  1.00 43.02 ? 334 LYS D NZ  1 
ATOM   6272 N N   . HIS D 1 172 ? 10.499  -40.238 51.722  1.00 30.23 ? 335 HIS D N   1 
ATOM   6273 C CA  . HIS D 1 172 ? 10.998  -38.871 51.855  1.00 30.02 ? 335 HIS D CA  1 
ATOM   6274 C C   . HIS D 1 172 ? 11.976  -38.446 50.748  1.00 29.37 ? 335 HIS D C   1 
ATOM   6275 O O   . HIS D 1 172 ? 12.433  -37.286 50.745  1.00 28.65 ? 335 HIS D O   1 
ATOM   6276 C CB  . HIS D 1 172 ? 11.657  -38.651 53.231  1.00 31.23 ? 335 HIS D CB  1 
ATOM   6277 C CG  . HIS D 1 172 ? 10.763  -39.000 54.388  1.00 32.14 ? 335 HIS D CG  1 
ATOM   6278 N ND1 . HIS D 1 172 ? 9.681   -38.226 54.756  1.00 35.58 ? 335 HIS D ND1 1 
ATOM   6279 C CD2 . HIS D 1 172 ? 10.785  -40.048 55.245  1.00 35.01 ? 335 HIS D CD2 1 
ATOM   6280 C CE1 . HIS D 1 172 ? 9.071   -38.785 55.787  1.00 35.52 ? 335 HIS D CE1 1 
ATOM   6281 N NE2 . HIS D 1 172 ? 9.730   -39.885 56.113  1.00 36.54 ? 335 HIS D NE2 1 
ATOM   6282 N N   . TYR D 1 173 ? 12.312  -39.360 49.835  1.00 26.59 ? 336 TYR D N   1 
ATOM   6283 C CA  . TYR D 1 173 ? 13.272  -39.043 48.784  1.00 25.26 ? 336 TYR D CA  1 
ATOM   6284 C C   . TYR D 1 173 ? 13.178  -40.028 47.625  1.00 24.74 ? 336 TYR D C   1 
ATOM   6285 O O   . TYR D 1 173 ? 12.313  -40.914 47.610  1.00 23.93 ? 336 TYR D O   1 
ATOM   6286 C CB  . TYR D 1 173 ? 14.699  -38.969 49.348  1.00 25.48 ? 336 TYR D CB  1 
ATOM   6287 C CG  . TYR D 1 173 ? 15.246  -40.310 49.733  1.00 23.61 ? 336 TYR D CG  1 
ATOM   6288 C CD1 . TYR D 1 173 ? 15.941  -41.090 48.807  1.00 24.76 ? 336 TYR D CD1 1 
ATOM   6289 C CD2 . TYR D 1 173 ? 15.026  -40.832 50.997  1.00 25.98 ? 336 TYR D CD2 1 
ATOM   6290 C CE1 . TYR D 1 173 ? 16.434  -42.346 49.128  1.00 24.59 ? 336 TYR D CE1 1 
ATOM   6291 C CE2 . TYR D 1 173 ? 15.548  -42.119 51.348  1.00 27.74 ? 336 TYR D CE2 1 
ATOM   6292 C CZ  . TYR D 1 173 ? 16.231  -42.834 50.394  1.00 26.56 ? 336 TYR D CZ  1 
ATOM   6293 O OH  . TYR D 1 173 ? 16.744  -44.077 50.716  1.00 27.64 ? 336 TYR D OH  1 
ATOM   6294 N N   . TYR D 1 174 ? 14.024  -39.821 46.622  1.00 23.66 ? 337 TYR D N   1 
ATOM   6295 C CA  . TYR D 1 174 ? 14.053  -40.671 45.453  1.00 23.60 ? 337 TYR D CA  1 
ATOM   6296 C C   . TYR D 1 174 ? 15.387  -41.341 45.424  1.00 24.07 ? 337 TYR D C   1 
ATOM   6297 O O   . TYR D 1 174 ? 16.386  -40.746 45.813  1.00 23.96 ? 337 TYR D O   1 
ATOM   6298 C CB  . TYR D 1 174 ? 13.814  -39.836 44.178  1.00 23.28 ? 337 TYR D CB  1 
ATOM   6299 C CG  . TYR D 1 174 ? 12.408  -39.262 44.152  1.00 20.13 ? 337 TYR D CG  1 
ATOM   6300 C CD1 . TYR D 1 174 ? 12.115  -38.000 44.697  1.00 21.24 ? 337 TYR D CD1 1 
ATOM   6301 C CD2 . TYR D 1 174 ? 11.370  -40.013 43.651  1.00 21.43 ? 337 TYR D CD2 1 
ATOM   6302 C CE1 . TYR D 1 174 ? 10.823  -37.519 44.701  1.00 20.47 ? 337 TYR D CE1 1 
ATOM   6303 C CE2 . TYR D 1 174 ? 10.076  -39.544 43.648  1.00 20.58 ? 337 TYR D CE2 1 
ATOM   6304 C CZ  . TYR D 1 174 ? 9.797   -38.310 44.174  1.00 23.60 ? 337 TYR D CZ  1 
ATOM   6305 O OH  . TYR D 1 174 ? 8.458   -37.890 44.118  1.00 26.17 ? 337 TYR D OH  1 
ATOM   6306 N N   . LYS D 1 175 ? 15.434  -42.587 44.975  1.00 24.99 ? 338 LYS D N   1 
ATOM   6307 C CA  . LYS D 1 175 ? 16.754  -43.206 44.832  1.00 26.24 ? 338 LYS D CA  1 
ATOM   6308 C C   . LYS D 1 175 ? 17.052  -43.546 43.406  1.00 24.36 ? 338 LYS D C   1 
ATOM   6309 O O   . LYS D 1 175 ? 16.169  -43.909 42.657  1.00 25.29 ? 338 LYS D O   1 
ATOM   6310 C CB  . LYS D 1 175 ? 16.952  -44.409 45.740  1.00 27.38 ? 338 LYS D CB  1 
ATOM   6311 C CG  . LYS D 1 175 ? 16.073  -45.570 45.494  1.00 32.85 ? 338 LYS D CG  1 
ATOM   6312 C CD  . LYS D 1 175 ? 16.272  -46.573 46.662  1.00 37.01 ? 338 LYS D CD  1 
ATOM   6313 C CE  . LYS D 1 175 ? 16.047  -47.996 46.205  1.00 42.00 ? 338 LYS D CE  1 
ATOM   6314 N NZ  . LYS D 1 175 ? 14.606  -48.368 46.294  1.00 44.93 ? 338 LYS D NZ  1 
ATOM   6315 N N   . VAL D 1 176 ? 18.301  -43.388 43.032  1.00 23.28 ? 339 VAL D N   1 
ATOM   6316 C CA  . VAL D 1 176 ? 18.726  -43.803 41.715  1.00 22.60 ? 339 VAL D CA  1 
ATOM   6317 C C   . VAL D 1 176 ? 19.557  -45.059 41.883  1.00 22.41 ? 339 VAL D C   1 
ATOM   6318 O O   . VAL D 1 176 ? 20.640  -45.009 42.419  1.00 21.72 ? 339 VAL D O   1 
ATOM   6319 C CB  . VAL D 1 176 ? 19.495  -42.680 40.952  1.00 21.97 ? 339 VAL D CB  1 
ATOM   6320 C CG1 . VAL D 1 176 ? 20.100  -43.220 39.655  1.00 22.12 ? 339 VAL D CG1 1 
ATOM   6321 C CG2 . VAL D 1 176 ? 18.537  -41.597 40.594  1.00 23.16 ? 339 VAL D CG2 1 
ATOM   6322 N N   . ASP D 1 177 ? 19.039  -46.184 41.400  1.00 22.62 ? 340 ASP D N   1 
ATOM   6323 C CA  . ASP D 1 177 ? 19.795  -47.441 41.455  1.00 23.03 ? 340 ASP D CA  1 
ATOM   6324 C C   . ASP D 1 177 ? 20.622  -47.648 40.202  1.00 22.95 ? 340 ASP D C   1 
ATOM   6325 O O   . ASP D 1 177 ? 20.104  -48.090 39.190  1.00 21.54 ? 340 ASP D O   1 
ATOM   6326 C CB  . ASP D 1 177 ? 18.856  -48.621 41.678  1.00 23.31 ? 340 ASP D CB  1 
ATOM   6327 C CG  . ASP D 1 177 ? 19.602  -49.952 41.870  1.00 26.99 ? 340 ASP D CG  1 
ATOM   6328 O OD1 . ASP D 1 177 ? 20.844  -50.037 41.676  1.00 25.97 ? 340 ASP D OD1 1 
ATOM   6329 O OD2 . ASP D 1 177 ? 18.915  -50.936 42.196  1.00 28.80 ? 340 ASP D OD2 1 
ATOM   6330 N N   . TYR D 1 178 ? 21.923  -47.338 40.295  1.00 23.32 ? 341 TYR D N   1 
ATOM   6331 C CA  . TYR D 1 178 ? 22.832  -47.426 39.151  1.00 24.77 ? 341 TYR D CA  1 
ATOM   6332 C C   . TYR D 1 178 ? 23.118  -48.828 38.640  1.00 23.87 ? 341 TYR D C   1 
ATOM   6333 O O   . TYR D 1 178 ? 23.622  -48.988 37.538  1.00 21.96 ? 341 TYR D O   1 
ATOM   6334 C CB  . TYR D 1 178 ? 24.136  -46.681 39.420  1.00 24.75 ? 341 TYR D CB  1 
ATOM   6335 C CG  . TYR D 1 178 ? 23.960  -45.224 39.065  1.00 31.93 ? 341 TYR D CG  1 
ATOM   6336 C CD1 . TYR D 1 178 ? 23.608  -44.291 40.052  1.00 35.60 ? 341 TYR D CD1 1 
ATOM   6337 C CD2 . TYR D 1 178 ? 24.078  -44.780 37.743  1.00 32.25 ? 341 TYR D CD2 1 
ATOM   6338 C CE1 . TYR D 1 178 ? 23.428  -42.944 39.751  1.00 39.47 ? 341 TYR D CE1 1 
ATOM   6339 C CE2 . TYR D 1 178 ? 23.856  -43.424 37.431  1.00 35.78 ? 341 TYR D CE2 1 
ATOM   6340 C CZ  . TYR D 1 178 ? 23.548  -42.528 38.440  1.00 37.25 ? 341 TYR D CZ  1 
ATOM   6341 O OH  . TYR D 1 178 ? 23.364  -41.198 38.179  1.00 43.34 ? 341 TYR D OH  1 
ATOM   6342 N N   . SER D 1 179 ? 22.754  -49.850 39.422  1.00 24.46 ? 342 SER D N   1 
ATOM   6343 C CA  . SER D 1 179 ? 22.861  -51.241 38.954  1.00 23.21 ? 342 SER D CA  1 
ATOM   6344 C C   . SER D 1 179 ? 21.924  -51.512 37.761  1.00 23.31 ? 342 SER D C   1 
ATOM   6345 O O   . SER D 1 179 ? 22.175  -52.421 37.000  1.00 23.64 ? 342 SER D O   1 
ATOM   6346 C CB  . SER D 1 179 ? 22.572  -52.210 40.107  1.00 23.34 ? 342 SER D CB  1 
ATOM   6347 O OG  . SER D 1 179 ? 21.183  -52.219 40.350  1.00 26.57 ? 342 SER D OG  1 
ATOM   6348 N N   . ARG D 1 180 ? 20.886  -50.690 37.554  1.00 21.84 ? 343 ARG D N   1 
ATOM   6349 C CA  . ARG D 1 180 ? 19.930  -50.852 36.427  1.00 21.37 ? 343 ARG D CA  1 
ATOM   6350 C C   . ARG D 1 180 ? 20.265  -49.973 35.215  1.00 21.15 ? 343 ARG D C   1 
ATOM   6351 O O   . ARG D 1 180 ? 19.586  -50.027 34.191  1.00 19.47 ? 343 ARG D O   1 
ATOM   6352 C CB  . ARG D 1 180 ? 18.512  -50.444 36.863  1.00 22.43 ? 343 ARG D CB  1 
ATOM   6353 C CG  . ARG D 1 180 ? 17.979  -51.095 38.208  1.00 24.37 ? 343 ARG D CG  1 
ATOM   6354 C CD  . ARG D 1 180 ? 17.398  -52.466 37.966  1.00 30.25 ? 343 ARG D CD  1 
ATOM   6355 N NE  . ARG D 1 180 ? 17.205  -53.191 39.230  1.00 30.09 ? 343 ARG D NE  1 
ATOM   6356 C CZ  . ARG D 1 180 ? 16.107  -53.131 39.980  1.00 28.74 ? 343 ARG D CZ  1 
ATOM   6357 N NH1 . ARG D 1 180 ? 15.062  -52.391 39.618  1.00 25.38 ? 343 ARG D NH1 1 
ATOM   6358 N NH2 . ARG D 1 180 ? 16.064  -53.837 41.108  1.00 30.67 ? 343 ARG D NH2 1 
ATOM   6359 N N   . PHE D 1 181 ? 21.300  -49.155 35.355  1.00 20.63 ? 344 PHE D N   1 
ATOM   6360 C CA  . PHE D 1 181 ? 21.622  -48.130 34.354  1.00 20.51 ? 344 PHE D CA  1 
ATOM   6361 C C   . PHE D 1 181 ? 21.770  -48.685 32.937  1.00 19.82 ? 344 PHE D C   1 
ATOM   6362 O O   . PHE D 1 181 ? 21.175  -48.193 32.010  1.00 20.41 ? 344 PHE D O   1 
ATOM   6363 C CB  . PHE D 1 181 ? 22.882  -47.395 34.786  1.00 19.52 ? 344 PHE D CB  1 
ATOM   6364 C CG  . PHE D 1 181 ? 23.303  -46.253 33.845  1.00 19.42 ? 344 PHE D CG  1 
ATOM   6365 C CD1 . PHE D 1 181 ? 22.733  -45.008 33.962  1.00 20.90 ? 344 PHE D CD1 1 
ATOM   6366 C CD2 . PHE D 1 181 ? 24.264  -46.450 32.883  1.00 19.14 ? 344 PHE D CD2 1 
ATOM   6367 C CE1 . PHE D 1 181 ? 23.133  -43.936 33.102  1.00 24.16 ? 344 PHE D CE1 1 
ATOM   6368 C CE2 . PHE D 1 181 ? 24.671  -45.380 32.015  1.00 18.45 ? 344 PHE D CE2 1 
ATOM   6369 C CZ  . PHE D 1 181 ? 24.088  -44.145 32.135  1.00 19.53 ? 344 PHE D CZ  1 
ATOM   6370 N N   . HIS D 1 182 ? 22.594  -49.704 32.791  1.00 20.65 ? 345 HIS D N   1 
ATOM   6371 C CA  . HIS D 1 182 ? 22.883  -50.309 31.498  1.00 20.07 ? 345 HIS D CA  1 
ATOM   6372 C C   . HIS D 1 182 ? 21.898  -51.410 31.136  1.00 21.13 ? 345 HIS D C   1 
ATOM   6373 O O   . HIS D 1 182 ? 21.978  -52.016 30.037  1.00 19.24 ? 345 HIS D O   1 
ATOM   6374 C CB  . HIS D 1 182 ? 24.253  -50.931 31.576  1.00 19.97 ? 345 HIS D CB  1 
ATOM   6375 C CG  . HIS D 1 182 ? 25.351  -49.937 31.753  1.00 19.03 ? 345 HIS D CG  1 
ATOM   6376 N ND1 . HIS D 1 182 ? 25.715  -49.050 30.764  1.00 16.30 ? 345 HIS D ND1 1 
ATOM   6377 C CD2 . HIS D 1 182 ? 26.209  -49.736 32.774  1.00 19.63 ? 345 HIS D CD2 1 
ATOM   6378 C CE1 . HIS D 1 182 ? 26.742  -48.328 31.175  1.00 18.11 ? 345 HIS D CE1 1 
ATOM   6379 N NE2 . HIS D 1 182 ? 27.057  -48.719 32.397  1.00 17.73 ? 345 HIS D NE2 1 
ATOM   6380 N N   . LYS D 1 183 ? 20.933  -51.656 32.021  1.00 21.42 ? 346 LYS D N   1 
ATOM   6381 C CA  . LYS D 1 183 ? 20.018  -52.774 31.770  1.00 22.34 ? 346 LYS D CA  1 
ATOM   6382 C C   . LYS D 1 183 ? 18.829  -52.452 30.890  1.00 23.06 ? 346 LYS D C   1 
ATOM   6383 O O   . LYS D 1 183 ? 18.292  -51.336 30.894  1.00 21.47 ? 346 LYS D O   1 
ATOM   6384 C CB  . LYS D 1 183 ? 19.586  -53.428 33.090  1.00 22.67 ? 346 LYS D CB  1 
ATOM   6385 C CG  . LYS D 1 183 ? 20.720  -53.989 33.823  1.00 24.31 ? 346 LYS D CG  1 
ATOM   6386 C CD  . LYS D 1 183 ? 20.249  -54.641 35.121  1.00 28.71 ? 346 LYS D CD  1 
ATOM   6387 C CE  . LYS D 1 183 ? 21.370  -55.515 35.668  1.00 28.66 ? 346 LYS D CE  1 
ATOM   6388 N NZ  . LYS D 1 183 ? 21.110  -55.776 37.129  1.00 31.00 ? 346 LYS D NZ  1 
ATOM   6389 N N   . THR D 1 184 ? 18.425  -53.444 30.095  1.00 23.78 ? 347 THR D N   1 
ATOM   6390 C CA  . THR D 1 184 ? 17.276  -53.288 29.228  1.00 25.44 ? 347 THR D CA  1 
ATOM   6391 C C   . THR D 1 184 ? 16.291  -54.462 29.336  1.00 26.66 ? 347 THR D C   1 
ATOM   6392 O O   . THR D 1 184 ? 16.634  -55.552 29.827  1.00 26.24 ? 347 THR D O   1 
ATOM   6393 C CB  . THR D 1 184 ? 17.714  -53.126 27.725  1.00 26.19 ? 347 THR D CB  1 
ATOM   6394 O OG1 . THR D 1 184 ? 18.355  -54.329 27.278  1.00 29.73 ? 347 THR D OG1 1 
ATOM   6395 C CG2 . THR D 1 184 ? 18.678  -51.943 27.528  1.00 23.41 ? 347 THR D CG2 1 
ATOM   6396 N N   . TYR D 1 185 ? 15.077  -54.259 28.848  1.00 27.78 ? 348 TYR D N   1 
ATOM   6397 C CA  . TYR D 1 185 ? 14.192  -55.396 28.623  1.00 30.00 ? 348 TYR D CA  1 
ATOM   6398 C C   . TYR D 1 185 ? 13.719  -55.449 27.169  1.00 31.16 ? 348 TYR D C   1 
ATOM   6399 O O   . TYR D 1 185 ? 13.864  -54.467 26.421  1.00 30.74 ? 348 TYR D O   1 
ATOM   6400 C CB  . TYR D 1 185 ? 13.044  -55.413 29.628  1.00 29.75 ? 348 TYR D CB  1 
ATOM   6401 C CG  . TYR D 1 185 ? 12.181  -54.207 29.640  1.00 31.32 ? 348 TYR D CG  1 
ATOM   6402 C CD1 . TYR D 1 185 ? 11.171  -54.056 28.711  1.00 35.05 ? 348 TYR D CD1 1 
ATOM   6403 C CD2 . TYR D 1 185 ? 12.333  -53.226 30.620  1.00 32.96 ? 348 TYR D CD2 1 
ATOM   6404 C CE1 . TYR D 1 185 ? 10.346  -52.936 28.718  1.00 35.60 ? 348 TYR D CE1 1 
ATOM   6405 C CE2 . TYR D 1 185 ? 11.526  -52.109 30.645  1.00 30.46 ? 348 TYR D CE2 1 
ATOM   6406 C CZ  . TYR D 1 185 ? 10.529  -51.962 29.697  1.00 36.08 ? 348 TYR D CZ  1 
ATOM   6407 O OH  . TYR D 1 185 ? 9.713   -50.836 29.675  1.00 36.29 ? 348 TYR D OH  1 
ATOM   6408 N N   . GLU D 1 186 ? 13.171  -56.586 26.759  1.00 31.88 ? 349 GLU D N   1 
ATOM   6409 C CA  . GLU D 1 186 ? 12.696  -56.739 25.379  1.00 33.75 ? 349 GLU D CA  1 
ATOM   6410 C C   . GLU D 1 186 ? 11.227  -56.393 25.176  1.00 33.37 ? 349 GLU D C   1 
ATOM   6411 O O   . GLU D 1 186 ? 10.396  -56.663 26.052  1.00 34.97 ? 349 GLU D O   1 
ATOM   6412 C CB  . GLU D 1 186 ? 12.957  -58.143 24.870  1.00 34.57 ? 349 GLU D CB  1 
ATOM   6413 C CG  . GLU D 1 186 ? 14.398  -58.377 24.543  1.00 39.74 ? 349 GLU D CG  1 
ATOM   6414 C CD  . GLU D 1 186 ? 14.650  -59.790 24.046  1.00 46.76 ? 349 GLU D CD  1 
ATOM   6415 O OE1 . GLU D 1 186 ? 13.740  -60.329 23.356  1.00 49.35 ? 349 GLU D OE1 1 
ATOM   6416 O OE2 . GLU D 1 186 ? 15.742  -60.345 24.368  1.00 48.93 ? 349 GLU D OE2 1 
ATOM   6417 N N   . VAL D 1 187 ? 10.932  -55.768 24.043  1.00 32.02 ? 350 VAL D N   1 
ATOM   6418 C CA  . VAL D 1 187 ? 9.574   -55.500 23.594  1.00 32.98 ? 350 VAL D CA  1 
ATOM   6419 C C   . VAL D 1 187 ? 9.370   -56.253 22.261  1.00 33.07 ? 350 VAL D C   1 
ATOM   6420 O O   . VAL D 1 187 ? 9.618   -55.687 21.186  1.00 32.73 ? 350 VAL D O   1 
ATOM   6421 C CB  . VAL D 1 187 ? 9.307   -53.969 23.414  1.00 32.31 ? 350 VAL D CB  1 
ATOM   6422 C CG1 . VAL D 1 187 ? 7.823   -53.708 23.142  1.00 34.29 ? 350 VAL D CG1 1 
ATOM   6423 C CG2 . VAL D 1 187 ? 9.766   -53.162 24.641  1.00 33.29 ? 350 VAL D CG2 1 
ATOM   6424 N N   . PRO D 1 188 ? 8.924   -57.534 22.327  1.00 33.90 ? 351 PRO D N   1 
ATOM   6425 C CA  . PRO D 1 188 ? 8.820   -58.456 21.163  1.00 34.35 ? 351 PRO D CA  1 
ATOM   6426 C C   . PRO D 1 188 ? 7.806   -57.959 20.140  1.00 34.36 ? 351 PRO D C   1 
ATOM   6427 O O   . PRO D 1 188 ? 7.876   -58.306 18.970  1.00 34.48 ? 351 PRO D O   1 
ATOM   6428 C CB  . PRO D 1 188 ? 8.364   -59.790 21.805  1.00 34.32 ? 351 PRO D CB  1 
ATOM   6429 C CG  . PRO D 1 188 ? 8.778   -59.661 23.284  1.00 35.13 ? 351 PRO D CG  1 
ATOM   6430 C CD  . PRO D 1 188 ? 8.478   -58.202 23.560  1.00 34.23 ? 351 PRO D CD  1 
ATOM   6431 N N   . ASN D 1 189 ? 6.915   -57.110 20.633  1.00 35.00 ? 352 ASN D N   1 
ATOM   6432 C CA  . ASN D 1 189 ? 5.885   -56.349 19.935  1.00 36.30 ? 352 ASN D CA  1 
ATOM   6433 C C   . ASN D 1 189 ? 6.421   -55.300 18.934  1.00 35.71 ? 352 ASN D C   1 
ATOM   6434 O O   . ASN D 1 189 ? 5.685   -54.811 18.064  1.00 36.10 ? 352 ASN D O   1 
ATOM   6435 C CB  . ASN D 1 189 ? 5.124   -55.612 21.067  1.00 37.60 ? 352 ASN D CB  1 
ATOM   6436 C CG  . ASN D 1 189 ? 3.714   -55.169 20.677  1.00 41.30 ? 352 ASN D CG  1 
ATOM   6437 O OD1 . ASN D 1 189 ? 2.933   -55.945 20.138  1.00 45.62 ? 352 ASN D OD1 1 
ATOM   6438 N ND2 . ASN D 1 189 ? 3.370   -53.918 21.009  1.00 44.63 ? 352 ASN D ND2 1 
ATOM   6439 N N   . THR D 1 190 ? 7.692   -54.924 19.067  1.00 34.30 ? 353 THR D N   1 
ATOM   6440 C CA  . THR D 1 190 ? 8.264   -53.842 18.255  1.00 32.97 ? 353 THR D CA  1 
ATOM   6441 C C   . THR D 1 190 ? 8.263   -54.226 16.767  1.00 33.18 ? 353 THR D C   1 
ATOM   6442 O O   . THR D 1 190 ? 8.683   -55.329 16.429  1.00 33.19 ? 353 THR D O   1 
ATOM   6443 C CB  . THR D 1 190 ? 9.717   -53.532 18.689  1.00 32.76 ? 353 THR D CB  1 
ATOM   6444 O OG1 . THR D 1 190 ? 9.782   -53.330 20.118  1.00 30.20 ? 353 THR D OG1 1 
ATOM   6445 C CG2 . THR D 1 190 ? 10.239  -52.331 17.950  1.00 31.78 ? 353 THR D CG2 1 
ATOM   6446 N N   . PRO D 1 191 ? 7.811   -53.313 15.877  1.00 32.84 ? 354 PRO D N   1 
ATOM   6447 C CA  . PRO D 1 191 ? 7.884   -53.599 14.454  1.00 33.36 ? 354 PRO D CA  1 
ATOM   6448 C C   . PRO D 1 191 ? 9.337   -53.729 14.020  1.00 33.38 ? 354 PRO D C   1 
ATOM   6449 O O   . PRO D 1 191 ? 10.234  -53.107 14.602  1.00 33.14 ? 354 PRO D O   1 
ATOM   6450 C CB  . PRO D 1 191 ? 7.271   -52.361 13.803  1.00 33.41 ? 354 PRO D CB  1 
ATOM   6451 C CG  . PRO D 1 191 ? 6.549   -51.649 14.889  1.00 33.28 ? 354 PRO D CG  1 
ATOM   6452 C CD  . PRO D 1 191 ? 7.255   -51.977 16.140  1.00 32.43 ? 354 PRO D CD  1 
ATOM   6453 N N   . LEU D 1 192 ? 9.549   -54.531 12.988  1.00 33.81 ? 355 LEU D N   1 
ATOM   6454 C CA  . LEU D 1 192 ? 10.884  -54.872 12.502  1.00 33.48 ? 355 LEU D CA  1 
ATOM   6455 C C   . LEU D 1 192 ? 11.240  -54.090 11.249  1.00 33.17 ? 355 LEU D C   1 
ATOM   6456 O O   . LEU D 1 192 ? 12.378  -54.112 10.798  1.00 33.58 ? 355 LEU D O   1 
ATOM   6457 C CB  . LEU D 1 192 ? 10.959  -56.384 12.234  1.00 34.59 ? 355 LEU D CB  1 
ATOM   6458 C CG  . LEU D 1 192 ? 10.500  -57.389 13.294  1.00 36.49 ? 355 LEU D CG  1 
ATOM   6459 C CD1 . LEU D 1 192 ? 10.698  -58.749 12.717  1.00 40.75 ? 355 LEU D CD1 1 
ATOM   6460 C CD2 . LEU D 1 192 ? 11.299  -57.247 14.593  1.00 38.03 ? 355 LEU D CD2 1 
ATOM   6461 N N   . CYS D 1 193 ? 10.269  -53.389 10.680  1.00 33.19 ? 356 CYS D N   1 
ATOM   6462 C CA  . CYS D 1 193 ? 10.493  -52.601 9.461   1.00 33.62 ? 356 CYS D CA  1 
ATOM   6463 C C   . CYS D 1 193 ? 11.045  -51.202 9.760   1.00 33.70 ? 356 CYS D C   1 
ATOM   6464 O O   . CYS D 1 193 ? 11.104  -50.792 10.914  1.00 34.09 ? 356 CYS D O   1 
ATOM   6465 C CB  . CYS D 1 193 ? 9.175   -52.477 8.676   1.00 33.61 ? 356 CYS D CB  1 
ATOM   6466 S SG  . CYS D 1 193 ? 7.769   -51.830 9.682   1.00 35.59 ? 356 CYS D SG  1 
ATOM   6467 N N   . SER D 1 194 ? 11.399  -50.451 8.721   1.00 33.97 ? 357 SER D N   1 
ATOM   6468 C CA  . SER D 1 194 ? 11.925  -49.106 8.889   1.00 33.59 ? 357 SER D CA  1 
ATOM   6469 C C   . SER D 1 194 ? 10.815  -48.144 9.315   1.00 34.06 ? 357 SER D C   1 
ATOM   6470 O O   . SER D 1 194 ? 9.624   -48.459 9.191   1.00 33.74 ? 357 SER D O   1 
ATOM   6471 C CB  . SER D 1 194 ? 12.570  -48.609 7.605   1.00 33.57 ? 357 SER D CB  1 
ATOM   6472 O OG  . SER D 1 194 ? 11.601  -48.458 6.587   1.00 32.99 ? 357 SER D OG  1 
ATOM   6473 N N   . ALA D 1 195 ? 11.213  -46.982 9.828   1.00 33.61 ? 358 ALA D N   1 
ATOM   6474 C CA  . ALA D 1 195 ? 10.285  -45.877 10.046  1.00 33.76 ? 358 ALA D CA  1 
ATOM   6475 C C   . ALA D 1 195 ? 9.572   -45.441 8.752   1.00 34.45 ? 358 ALA D C   1 
ATOM   6476 O O   . ALA D 1 195 ? 8.415   -45.044 8.806   1.00 33.60 ? 358 ALA D O   1 
ATOM   6477 C CB  . ALA D 1 195 ? 10.990  -44.711 10.668  1.00 33.09 ? 358 ALA D CB  1 
ATOM   6478 N N   . ARG D 1 196 ? 10.260  -45.480 7.605   1.00 35.37 ? 359 ARG D N   1 
ATOM   6479 C CA  . ARG D 1 196 ? 9.621   -45.164 6.302   1.00 36.57 ? 359 ARG D CA  1 
ATOM   6480 C C   . ARG D 1 196 ? 8.469   -46.110 5.975   1.00 36.67 ? 359 ARG D C   1 
ATOM   6481 O O   . ARG D 1 196 ? 7.398   -45.677 5.591   1.00 36.84 ? 359 ARG D O   1 
ATOM   6482 C CB  . ARG D 1 196 ? 10.618  -45.194 5.153   1.00 36.80 ? 359 ARG D CB  1 
ATOM   6483 C CG  . ARG D 1 196 ? 9.976   -44.723 3.810   1.00 41.80 ? 359 ARG D CG  1 
ATOM   6484 C CD  . ARG D 1 196 ? 10.799  -45.098 2.546   1.00 49.17 ? 359 ARG D CD  1 
ATOM   6485 N NE  . ARG D 1 196 ? 12.190  -44.616 2.588   1.00 55.25 ? 359 ARG D NE  1 
ATOM   6486 C CZ  . ARG D 1 196 ? 12.595  -43.375 2.283   1.00 58.23 ? 359 ARG D CZ  1 
ATOM   6487 N NH1 . ARG D 1 196 ? 11.719  -42.439 1.903   1.00 60.09 ? 359 ARG D NH1 1 
ATOM   6488 N NH2 . ARG D 1 196 ? 13.893  -43.061 2.360   1.00 58.66 ? 359 ARG D NH2 1 
ATOM   6489 N N   . ASP D 1 197 ? 8.711   -47.403 6.121   1.00 37.78 ? 360 ASP D N   1 
ATOM   6490 C CA  . ASP D 1 197 ? 7.687   -48.410 5.922   1.00 38.84 ? 360 ASP D CA  1 
ATOM   6491 C C   . ASP D 1 197 ? 6.499   -48.240 6.870   1.00 40.48 ? 360 ASP D C   1 
ATOM   6492 O O   . ASP D 1 197 ? 5.353   -48.402 6.441   1.00 40.54 ? 360 ASP D O   1 
ATOM   6493 C CB  . ASP D 1 197 ? 8.277   -49.794 6.105   1.00 38.48 ? 360 ASP D CB  1 
ATOM   6494 C CG  . ASP D 1 197 ? 9.055   -50.265 4.886   1.00 37.75 ? 360 ASP D CG  1 
ATOM   6495 O OD1 . ASP D 1 197 ? 9.611   -51.360 4.961   1.00 40.05 ? 360 ASP D OD1 1 
ATOM   6496 O OD2 . ASP D 1 197 ? 9.127   -49.544 3.871   1.00 37.30 ? 360 ASP D OD2 1 
ATOM   6497 N N   . LEU D 1 198 ? 6.772   -47.948 8.150   1.00 41.07 ? 361 LEU D N   1 
ATOM   6498 C CA  . LEU D 1 198 ? 5.712   -47.675 9.119   1.00 42.03 ? 361 LEU D CA  1 
ATOM   6499 C C   . LEU D 1 198 ? 4.908   -46.456 8.726   1.00 43.01 ? 361 LEU D C   1 
ATOM   6500 O O   . LEU D 1 198 ? 3.702   -46.401 8.980   1.00 43.25 ? 361 LEU D O   1 
ATOM   6501 C CB  . LEU D 1 198 ? 6.257   -47.454 10.533  1.00 41.17 ? 361 LEU D CB  1 
ATOM   6502 C CG  . LEU D 1 198 ? 6.835   -48.632 11.290  1.00 39.92 ? 361 LEU D CG  1 
ATOM   6503 C CD1 . LEU D 1 198 ? 7.288   -48.119 12.629  1.00 38.36 ? 361 LEU D CD1 1 
ATOM   6504 C CD2 . LEU D 1 198 ? 5.769   -49.705 11.443  1.00 38.83 ? 361 LEU D CD2 1 
ATOM   6505 N N   . ALA D 1 199 ? 5.572   -45.482 8.124   1.00 44.93 ? 362 ALA D N   1 
ATOM   6506 C CA  . ALA D 1 199 ? 4.906   -44.274 7.647   1.00 47.55 ? 362 ALA D CA  1 
ATOM   6507 C C   . ALA D 1 199 ? 3.954   -44.597 6.487   1.00 49.93 ? 362 ALA D C   1 
ATOM   6508 O O   . ALA D 1 199 ? 2.937   -43.905 6.318   1.00 50.15 ? 362 ALA D O   1 
ATOM   6509 C CB  . ALA D 1 199 ? 5.921   -43.226 7.232   1.00 46.77 ? 362 ALA D CB  1 
ATOM   6510 N N   . GLU D 1 200 ? 4.298   -45.636 5.704   1.00 52.29 ? 363 GLU D N   1 
ATOM   6511 C CA  . GLU D 1 200 ? 3.461   -46.146 4.604   1.00 54.83 ? 363 GLU D CA  1 
ATOM   6512 C C   . GLU D 1 200 ? 2.279   -46.958 5.100   1.00 56.00 ? 363 GLU D C   1 
ATOM   6513 O O   . GLU D 1 200 ? 1.147   -46.669 4.733   1.00 56.49 ? 363 GLU D O   1 
ATOM   6514 C CB  . GLU D 1 200 ? 4.281   -46.962 3.592   1.00 55.18 ? 363 GLU D CB  1 
ATOM   6515 C CG  . GLU D 1 200 ? 4.838   -46.153 2.408   1.00 57.23 ? 363 GLU D CG  1 
ATOM   6516 C CD  . GLU D 1 200 ? 5.330   -44.764 2.813   1.00 60.84 ? 363 GLU D CD  1 
ATOM   6517 O OE1 . GLU D 1 200 ? 4.472   -43.849 2.939   1.00 63.50 ? 363 GLU D OE1 1 
ATOM   6518 O OE2 . GLU D 1 200 ? 6.560   -44.585 3.007   1.00 59.64 ? 363 GLU D OE2 1 
ATOM   6519 N N   . LYS D 1 201 ? 2.542   -47.963 5.932   1.00 57.49 ? 364 LYS D N   1 
ATOM   6520 C CA  . LYS D 1 201 ? 1.494   -48.710 6.610   1.00 59.42 ? 364 LYS D CA  1 
ATOM   6521 C C   . LYS D 1 201 ? 0.485   -47.784 7.307   1.00 61.14 ? 364 LYS D C   1 
ATOM   6522 O O   . LYS D 1 201 ? -0.557  -48.240 7.773   1.00 61.82 ? 364 LYS D O   1 
ATOM   6523 C CB  . LYS D 1 201 ? 2.095   -49.676 7.636   1.00 59.11 ? 364 LYS D CB  1 
ATOM   6524 C CG  . LYS D 1 201 ? 2.845   -50.880 7.079   1.00 59.42 ? 364 LYS D CG  1 
ATOM   6525 C CD  . LYS D 1 201 ? 3.799   -51.418 8.154   1.00 60.23 ? 364 LYS D CD  1 
ATOM   6526 C CE  . LYS D 1 201 ? 4.056   -52.911 8.031   1.00 60.67 ? 364 LYS D CE  1 
ATOM   6527 N NZ  . LYS D 1 201 ? 4.912   -53.232 6.858   1.00 60.89 ? 364 LYS D NZ  1 
ATOM   6528 N N   . LYS D 1 202 ? 0.791   -46.493 7.377   1.00 63.16 ? 365 LYS D N   1 
ATOM   6529 C CA  . LYS D 1 202 ? -0.100  -45.521 8.008   1.00 65.58 ? 365 LYS D CA  1 
ATOM   6530 C C   . LYS D 1 202 ? -0.899  -44.718 6.965   1.00 67.17 ? 365 LYS D C   1 
ATOM   6531 O O   . LYS D 1 202 ? -1.795  -43.942 7.322   1.00 67.41 ? 365 LYS D O   1 
ATOM   6532 C CB  . LYS D 1 202 ? 0.688   -44.608 8.956   1.00 65.73 ? 365 LYS D CB  1 
ATOM   6533 C CG  . LYS D 1 202 ? -0.138  -43.861 9.998   1.00 66.54 ? 365 LYS D CG  1 
ATOM   6534 C CD  . LYS D 1 202 ? 0.787   -43.165 10.986  1.00 68.18 ? 365 LYS D CD  1 
ATOM   6535 C CE  . LYS D 1 202 ? 0.168   -41.889 11.533  1.00 69.76 ? 365 LYS D CE  1 
ATOM   6536 N NZ  . LYS D 1 202 ? -0.772  -42.154 12.661  1.00 70.22 ? 365 LYS D NZ  1 
ATOM   6537 N N   . TYR D 1 203 ? -0.570  -44.907 5.685   1.00 69.04 ? 366 TYR D N   1 
ATOM   6538 C CA  . TYR D 1 203 ? -1.453  -44.504 4.585   1.00 70.85 ? 366 TYR D CA  1 
ATOM   6539 C C   . TYR D 1 203 ? -2.408  -45.641 4.242   1.00 71.51 ? 366 TYR D C   1 
ATOM   6540 O O   . TYR D 1 203 ? -3.614  -45.429 4.114   1.00 71.60 ? 366 TYR D O   1 
ATOM   6541 C CB  . TYR D 1 203 ? -0.672  -44.103 3.333   1.00 71.32 ? 366 TYR D CB  1 
ATOM   6542 C CG  . TYR D 1 203 ? -0.639  -42.612 3.069   1.00 73.53 ? 366 TYR D CG  1 
ATOM   6543 C CD1 . TYR D 1 203 ? -1.785  -41.826 3.241   1.00 75.47 ? 366 TYR D CD1 1 
ATOM   6544 C CD2 . TYR D 1 203 ? 0.535   -41.986 2.624   1.00 75.28 ? 366 TYR D CD2 1 
ATOM   6545 C CE1 . TYR D 1 203 ? -1.763  -40.444 2.995   1.00 76.98 ? 366 TYR D CE1 1 
ATOM   6546 C CE2 . TYR D 1 203 ? 0.570   -40.606 2.367   1.00 76.52 ? 366 TYR D CE2 1 
ATOM   6547 C CZ  . TYR D 1 203 ? -0.583  -39.845 2.557   1.00 77.15 ? 366 TYR D CZ  1 
ATOM   6548 O OH  . TYR D 1 203 ? -0.565  -38.493 2.309   1.00 77.29 ? 366 TYR D OH  1 
ATOM   6549 N N   . ILE D 1 204 ? -1.858  -46.847 4.105   1.00 72.24 ? 367 ILE D N   1 
ATOM   6550 C CA  . ILE D 1 204 ? -2.645  -48.059 3.857   1.00 73.16 ? 367 ILE D CA  1 
ATOM   6551 C C   . ILE D 1 204 ? -3.757  -48.244 4.917   1.00 73.91 ? 367 ILE D C   1 
ATOM   6552 O O   . ILE D 1 204 ? -4.674  -49.046 4.732   1.00 73.87 ? 367 ILE D O   1 
ATOM   6553 C CB  . ILE D 1 204 ? -1.717  -49.313 3.720   1.00 73.12 ? 367 ILE D CB  1 
ATOM   6554 C CG1 . ILE D 1 204 ? -0.868  -49.202 2.437   1.00 72.82 ? 367 ILE D CG1 1 
ATOM   6555 C CG2 . ILE D 1 204 ? -2.529  -50.629 3.764   1.00 72.83 ? 367 ILE D CG2 1 
ATOM   6556 C CD1 . ILE D 1 204 ? 0.270   -50.241 2.309   1.00 73.00 ? 367 ILE D CD1 1 
ATOM   6557 N N   . LEU D 1 205 ? -3.654  -47.492 6.016   1.00 74.86 ? 368 LEU D N   1 
ATOM   6558 C CA  . LEU D 1 205 ? -4.722  -47.346 7.003   1.00 75.70 ? 368 LEU D CA  1 
ATOM   6559 C C   . LEU D 1 205 ? -5.661  -46.203 6.585   1.00 76.22 ? 368 LEU D C   1 
ATOM   6560 O O   . LEU D 1 205 ? -6.880  -46.362 6.617   1.00 76.58 ? 368 LEU D O   1 
ATOM   6561 C CB  . LEU D 1 205 ? -4.121  -47.120 8.405   1.00 75.82 ? 368 LEU D CB  1 
ATOM   6562 C CG  . LEU D 1 205 ? -4.725  -46.220 9.507   1.00 76.60 ? 368 LEU D CG  1 
ATOM   6563 C CD1 . LEU D 1 205 ? -6.038  -46.762 10.106  1.00 76.99 ? 368 LEU D CD1 1 
ATOM   6564 C CD2 . LEU D 1 205 ? -3.685  -45.988 10.618  1.00 76.55 ? 368 LEU D CD2 1 
ATOM   6565 N N   . SER D 1 206 ? -5.091  -45.070 6.174   1.00 76.61 ? 369 SER D N   1 
ATOM   6566 C CA  . SER D 1 206 ? -5.875  -43.905 5.771   1.00 76.92 ? 369 SER D CA  1 
ATOM   6567 C C   . SER D 1 206 ? -5.313  -43.257 4.506   1.00 77.19 ? 369 SER D C   1 
ATOM   6568 O O   . SER D 1 206 ? -6.061  -42.814 3.627   1.00 77.40 ? 369 SER D O   1 
ATOM   6569 C CB  . SER D 1 206 ? -5.901  -42.878 6.901   1.00 77.11 ? 369 SER D CB  1 
ATOM   6570 O OG  . SER D 1 206 ? -4.595  -42.408 7.165   1.00 76.76 ? 369 SER D OG  1 
HETATM 6571 K K   . K   E 2 .   ? 16.069  -20.519 15.693  1.00 37.31 ? 800 K   A K   1 
HETATM 6572 C C1  . MPD F 3 .   ? 35.436  -43.427 10.921  1.00 36.29 ? 803 MPD A C1  1 
HETATM 6573 C C2  . MPD F 3 .   ? 35.416  -43.929 9.486   1.00 37.13 ? 803 MPD A C2  1 
HETATM 6574 O O2  . MPD F 3 .   ? 35.373  -45.375 9.582   1.00 35.23 ? 803 MPD A O2  1 
HETATM 6575 C CM  . MPD F 3 .   ? 34.134  -43.467 8.773   1.00 34.28 ? 803 MPD A CM  1 
HETATM 6576 C C3  . MPD F 3 .   ? 36.709  -43.412 8.802   1.00 37.26 ? 803 MPD A C3  1 
HETATM 6577 C C4  . MPD F 3 .   ? 37.312  -44.188 7.599   1.00 38.49 ? 803 MPD A C4  1 
HETATM 6578 O O4  . MPD F 3 .   ? 36.484  -44.149 6.431   1.00 37.86 ? 803 MPD A O4  1 
HETATM 6579 C C5  . MPD F 3 .   ? 38.658  -43.579 7.212   1.00 32.72 ? 803 MPD A C5  1 
HETATM 6580 C C1  . MPD G 3 .   ? 39.408  -4.346  5.638   1.00 24.12 ? 802 MPD B C1  1 
HETATM 6581 C C2  . MPD G 3 .   ? 39.036  -3.170  4.751   1.00 27.09 ? 802 MPD B C2  1 
HETATM 6582 O O2  . MPD G 3 .   ? 40.043  -3.045  3.695   1.00 27.51 ? 802 MPD B O2  1 
HETATM 6583 C CM  . MPD G 3 .   ? 37.729  -3.509  4.044   1.00 25.88 ? 802 MPD B CM  1 
HETATM 6584 C C3  . MPD G 3 .   ? 38.943  -1.905  5.640   1.00 27.95 ? 802 MPD B C3  1 
HETATM 6585 C C4  . MPD G 3 .   ? 39.073  -0.532  4.909   1.00 28.67 ? 802 MPD B C4  1 
HETATM 6586 O O4  . MPD G 3 .   ? 37.969  -0.287  4.063   1.00 27.95 ? 802 MPD B O4  1 
HETATM 6587 C C5  . MPD G 3 .   ? 39.282  0.639   5.861   1.00 24.31 ? 802 MPD B C5  1 
HETATM 6588 C C1  . MPD H 3 .   ? 13.993  2.525   35.662  1.00 32.96 ? 804 MPD C C1  1 
HETATM 6589 C C2  . MPD H 3 .   ? 12.572  3.057   35.878  1.00 35.74 ? 804 MPD C C2  1 
HETATM 6590 O O2  . MPD H 3 .   ? 12.685  4.505   36.044  1.00 34.88 ? 804 MPD C O2  1 
HETATM 6591 C CM  . MPD H 3 .   ? 11.674  2.761   34.666  1.00 32.64 ? 804 MPD C CM  1 
HETATM 6592 C C3  . MPD H 3 .   ? 12.002  2.406   37.149  1.00 33.40 ? 804 MPD C C3  1 
HETATM 6593 C C4  . MPD H 3 .   ? 10.886  3.200   37.842  1.00 34.21 ? 804 MPD C C4  1 
HETATM 6594 O O4  . MPD H 3 .   ? 9.686   3.054   37.103  1.00 34.26 ? 804 MPD C O4  1 
HETATM 6595 C C5  . MPD H 3 .   ? 10.686  2.739   39.293  1.00 30.17 ? 804 MPD C C5  1 
HETATM 6596 C C1  . MPD I 3 .   ? 9.610   -36.680 40.553  1.00 23.83 ? 801 MPD D C1  1 
HETATM 6597 C C2  . MPD I 3 .   ? 8.608   -37.820 40.376  1.00 25.37 ? 801 MPD D C2  1 
HETATM 6598 O O2  . MPD I 3 .   ? 7.744   -37.866 41.540  1.00 26.69 ? 801 MPD D O2  1 
HETATM 6599 C CM  . MPD I 3 .   ? 7.604   -37.464 39.271  1.00 23.17 ? 801 MPD D CM  1 
HETATM 6600 C C3  . MPD I 3 .   ? 9.369   -39.167 40.193  1.00 23.10 ? 801 MPD D C3  1 
HETATM 6601 C C4  . MPD I 3 .   ? 8.591   -40.490 40.453  1.00 22.31 ? 801 MPD D C4  1 
HETATM 6602 O O4  . MPD I 3 .   ? 7.712   -40.757 39.384  1.00 23.74 ? 801 MPD D O4  1 
HETATM 6603 C C5  . MPD I 3 .   ? 9.467   -41.754 40.569  1.00 23.52 ? 801 MPD D C5  1 
HETATM 6604 O O   . HOH J 4 .   ? 31.355  -32.208 13.428  1.00 19.91 ? 804 HOH A O   1 
HETATM 6605 O O   . HOH J 4 .   ? 33.077  -19.016 15.637  1.00 20.03 ? 805 HOH A O   1 
HETATM 6606 O O   . HOH J 4 .   ? 29.135  -26.206 19.617  1.00 24.79 ? 806 HOH A O   1 
HETATM 6607 O O   . HOH J 4 .   ? 28.643  -29.844 11.909  1.00 34.84 ? 807 HOH A O   1 
HETATM 6608 O O   . HOH J 4 .   ? 24.031  -22.872 15.751  1.00 16.87 ? 808 HOH A O   1 
HETATM 6609 O O   . HOH J 4 .   ? 21.941  -31.291 19.030  1.00 19.90 ? 809 HOH A O   1 
HETATM 6610 O O   . HOH J 4 .   ? 40.525  -38.695 22.847  1.00 27.54 ? 810 HOH A O   1 
HETATM 6611 O O   . HOH J 4 .   ? 26.163  -23.101 3.803   1.00 26.91 ? 811 HOH A O   1 
HETATM 6612 O O   . HOH J 4 .   ? 26.381  -19.757 9.925   1.00 16.71 ? 812 HOH A O   1 
HETATM 6613 O O   . HOH J 4 .   ? 35.720  -49.292 23.206  1.00 18.52 ? 813 HOH A O   1 
HETATM 6614 O O   . HOH J 4 .   ? 20.335  -21.341 15.580  1.00 15.01 ? 814 HOH A O   1 
HETATM 6615 O O   . HOH J 4 .   ? 40.278  -36.489 5.446   1.00 12.84 ? 815 HOH A O   1 
HETATM 6616 O O   . HOH J 4 .   ? 35.344  -21.122 9.916   1.00 14.13 ? 816 HOH A O   1 
HETATM 6617 O O   . HOH J 4 .   ? 35.515  -21.069 28.835  1.00 22.45 ? 817 HOH A O   1 
HETATM 6618 O O   . HOH J 4 .   ? 41.942  -45.526 4.452   1.00 15.27 ? 818 HOH A O   1 
HETATM 6619 O O   . HOH J 4 .   ? 44.983  -19.729 6.138   1.00 14.96 ? 819 HOH A O   1 
HETATM 6620 O O   . HOH J 4 .   ? 18.468  -19.302 14.971  1.00 24.09 ? 820 HOH A O   1 
HETATM 6621 O O   . HOH J 4 .   ? 30.708  -8.977  13.156  1.00 18.65 ? 821 HOH A O   1 
HETATM 6622 O O   . HOH J 4 .   ? 24.768  -21.063 2.167   1.00 21.15 ? 822 HOH A O   1 
HETATM 6623 O O   . HOH J 4 .   ? 17.819  -22.652 15.964  1.00 22.44 ? 823 HOH A O   1 
HETATM 6624 O O   . HOH J 4 .   ? 24.585  -25.875 21.439  1.00 21.82 ? 824 HOH A O   1 
HETATM 6625 O O   . HOH J 4 .   ? 25.668  -16.642 3.240   1.00 19.36 ? 825 HOH A O   1 
HETATM 6626 O O   . HOH J 4 .   ? 21.418  -20.952 17.970  1.00 17.22 ? 826 HOH A O   1 
HETATM 6627 O O   . HOH J 4 .   ? 45.795  -24.986 1.294   1.00 18.29 ? 827 HOH A O   1 
HETATM 6628 O O   . HOH J 4 .   ? 45.687  -37.968 0.625   1.00 22.47 ? 828 HOH A O   1 
HETATM 6629 O O   . HOH J 4 .   ? 34.043  -29.634 -8.920  1.00 27.10 ? 829 HOH A O   1 
HETATM 6630 O O   . HOH J 4 .   ? 23.855  -18.610 1.805   1.00 30.91 ? 830 HOH A O   1 
HETATM 6631 O O   . HOH J 4 .   ? 25.451  -23.627 -5.440  1.00 25.70 ? 831 HOH A O   1 
HETATM 6632 O O   . HOH J 4 .   ? 27.106  -25.124 28.246  1.00 26.33 ? 832 HOH A O   1 
HETATM 6633 O O   . HOH J 4 .   ? 23.490  5.614   5.716   1.00 27.98 ? 833 HOH A O   1 
HETATM 6634 O O   . HOH J 4 .   ? 38.770  4.672   6.154   1.00 22.57 ? 834 HOH A O   1 
HETATM 6635 O O   . HOH J 4 .   ? 29.267  -17.501 9.764   1.00 14.85 ? 835 HOH A O   1 
HETATM 6636 O O   . HOH J 4 .   ? 20.494  -18.615 19.005  1.00 16.73 ? 836 HOH A O   1 
HETATM 6637 O O   . HOH J 4 .   ? 18.961  -19.957 20.798  1.00 14.93 ? 837 HOH A O   1 
HETATM 6638 O O   . HOH J 4 .   ? 19.825  -22.369 19.864  1.00 18.03 ? 838 HOH A O   1 
HETATM 6639 O O   . HOH J 4 .   ? 35.887  -33.139 29.622  1.00 23.12 ? 839 HOH A O   1 
HETATM 6640 O O   . HOH J 4 .   ? 27.066  -21.726 17.718  1.00 22.29 ? 840 HOH A O   1 
HETATM 6641 O O   . HOH J 4 .   ? 39.076  -32.265 5.954   1.00 21.05 ? 841 HOH A O   1 
HETATM 6642 O O   . HOH J 4 .   ? 29.354  -18.386 -7.619  1.00 24.51 ? 842 HOH A O   1 
HETATM 6643 O O   . HOH J 4 .   ? 33.940  -31.514 -7.144  1.00 32.52 ? 843 HOH A O   1 
HETATM 6644 O O   . HOH J 4 .   ? 32.171  -21.002 27.418  1.00 23.46 ? 844 HOH A O   1 
HETATM 6645 O O   . HOH J 4 .   ? 35.132  -33.000 6.648   1.00 22.29 ? 845 HOH A O   1 
HETATM 6646 O O   . HOH J 4 .   ? 47.734  -33.319 -4.687  1.00 23.49 ? 846 HOH A O   1 
HETATM 6647 O O   . HOH J 4 .   ? 33.755  -20.151 25.829  1.00 28.39 ? 847 HOH A O   1 
HETATM 6648 O O   . HOH J 4 .   ? 32.265  -42.487 27.806  1.00 22.35 ? 848 HOH A O   1 
HETATM 6649 O O   . HOH J 4 .   ? 35.351  -30.892 19.151  1.00 26.79 ? 849 HOH A O   1 
HETATM 6650 O O   . HOH J 4 .   ? 30.372  -27.132 6.971   1.00 24.67 ? 850 HOH A O   1 
HETATM 6651 O O   . HOH J 4 .   ? 23.914  -21.885 18.075  1.00 21.03 ? 851 HOH A O   1 
HETATM 6652 O O   . HOH J 4 .   ? 42.623  -7.560  -1.217  1.00 37.87 ? 852 HOH A O   1 
HETATM 6653 O O   . HOH J 4 .   ? 41.448  -21.656 32.868  1.00 26.39 ? 853 HOH A O   1 
HETATM 6654 O O   . HOH J 4 .   ? 44.650  -24.844 27.765  1.00 38.00 ? 854 HOH A O   1 
HETATM 6655 O O   . HOH J 4 .   ? 21.413  -24.549 8.390   1.00 27.07 ? 855 HOH A O   1 
HETATM 6656 O O   . HOH J 4 .   ? 37.621  -27.375 31.764  1.00 26.21 ? 856 HOH A O   1 
HETATM 6657 O O   . HOH J 4 .   ? 22.458  -20.947 8.845   1.00 38.53 ? 857 HOH A O   1 
HETATM 6658 O O   . HOH J 4 .   ? 34.844  -17.912 -15.397 1.00 29.39 ? 858 HOH A O   1 
HETATM 6659 O O   . HOH J 4 .   ? 36.953  -37.358 -8.444  1.00 26.87 ? 859 HOH A O   1 
HETATM 6660 O O   . HOH J 4 .   ? 30.932  -22.215 25.109  1.00 32.31 ? 860 HOH A O   1 
HETATM 6661 O O   . HOH J 4 .   ? 45.761  -21.240 10.896  1.00 23.59 ? 861 HOH A O   1 
HETATM 6662 O O   . HOH J 4 .   ? 25.403  -0.321  -0.554  1.00 27.96 ? 862 HOH A O   1 
HETATM 6663 O O   . HOH J 4 .   ? 37.585  -32.032 1.907   1.00 23.51 ? 863 HOH A O   1 
HETATM 6664 O O   . HOH J 4 .   ? 44.057  -17.127 15.582  1.00 34.42 ? 864 HOH A O   1 
HETATM 6665 O O   . HOH J 4 .   ? 36.593  -48.013 25.899  1.00 32.76 ? 865 HOH A O   1 
HETATM 6666 O O   . HOH J 4 .   ? 47.713  -13.582 -1.201  1.00 26.70 ? 866 HOH A O   1 
HETATM 6667 O O   . HOH J 4 .   ? 30.209  -22.678 28.148  1.00 31.99 ? 867 HOH A O   1 
HETATM 6668 O O   . HOH J 4 .   ? 30.466  -19.216 27.204  1.00 31.93 ? 868 HOH A O   1 
HETATM 6669 O O   . HOH J 4 .   ? 43.776  -37.714 -3.353  1.00 29.38 ? 869 HOH A O   1 
HETATM 6670 O O   . HOH J 4 .   ? 25.332  -38.302 -3.577  1.00 30.97 ? 870 HOH A O   1 
HETATM 6671 O O   . HOH J 4 .   ? 38.723  -49.532 19.973  1.00 35.51 ? 871 HOH A O   1 
HETATM 6672 O O   . HOH J 4 .   ? 37.600  -32.223 19.814  1.00 29.36 ? 872 HOH A O   1 
HETATM 6673 O O   . HOH J 4 .   ? 24.919  -30.136 14.942  1.00 28.00 ? 873 HOH A O   1 
HETATM 6674 O O   . HOH J 4 .   ? 26.941  5.925   11.611  1.00 29.98 ? 874 HOH A O   1 
HETATM 6675 O O   . HOH J 4 .   ? 32.009  -23.584 -17.465 1.00 42.19 ? 875 HOH A O   1 
HETATM 6676 O O   . HOH J 4 .   ? 31.213  7.673   7.311   1.00 31.43 ? 876 HOH A O   1 
HETATM 6677 O O   . HOH J 4 .   ? 28.182  -23.515 19.954  1.00 29.29 ? 877 HOH A O   1 
HETATM 6678 O O   . HOH J 4 .   ? 29.684  -25.846 9.517   1.00 30.84 ? 878 HOH A O   1 
HETATM 6679 O O   . HOH J 4 .   ? 42.676  -32.379 13.889  1.00 23.20 ? 879 HOH A O   1 
HETATM 6680 O O   . HOH J 4 .   ? 38.041  -37.778 -4.009  1.00 36.01 ? 880 HOH A O   1 
HETATM 6681 O O   . HOH J 4 .   ? 44.086  -33.761 21.727  1.00 63.55 ? 881 HOH A O   1 
HETATM 6682 O O   . HOH J 4 .   ? 38.247  2.241   2.666   1.00 36.54 ? 882 HOH A O   1 
HETATM 6683 O O   . HOH J 4 .   ? 50.080  -41.412 4.979   1.00 31.86 ? 883 HOH A O   1 
HETATM 6684 O O   . HOH J 4 .   ? 47.482  -22.075 8.779   1.00 29.94 ? 884 HOH A O   1 
HETATM 6685 O O   . HOH J 4 .   ? 27.475  -12.373 -5.766  1.00 29.91 ? 885 HOH A O   1 
HETATM 6686 O O   . HOH J 4 .   ? 23.746  -22.928 -8.255  1.00 27.84 ? 886 HOH A O   1 
HETATM 6687 O O   . HOH J 4 .   ? 37.587  -26.578 -14.689 1.00 34.84 ? 887 HOH A O   1 
HETATM 6688 O O   . HOH J 4 .   ? 33.704  0.261   9.963   1.00 37.35 ? 888 HOH A O   1 
HETATM 6689 O O   . HOH J 4 .   ? 31.558  -29.576 7.099   1.00 33.71 ? 889 HOH A O   1 
HETATM 6690 O O   . HOH J 4 .   ? 39.012  -34.638 -1.341  1.00 31.74 ? 890 HOH A O   1 
HETATM 6691 O O   . HOH J 4 .   ? 37.242  -45.231 4.100   1.00 35.40 ? 891 HOH A O   1 
HETATM 6692 O O   . HOH J 4 .   ? 45.318  -22.252 18.822  1.00 44.96 ? 892 HOH A O   1 
HETATM 6693 O O   . HOH J 4 .   ? 41.477  -20.320 -8.653  1.00 30.08 ? 893 HOH A O   1 
HETATM 6694 O O   . HOH J 4 .   ? 50.195  -29.960 4.028   1.00 30.10 ? 894 HOH A O   1 
HETATM 6695 O O   . HOH J 4 .   ? 32.637  -30.812 -10.980 1.00 38.10 ? 895 HOH A O   1 
HETATM 6696 O O   . HOH J 4 .   ? 51.721  -28.574 2.447   1.00 36.78 ? 896 HOH A O   1 
HETATM 6697 O O   . HOH J 4 .   ? 39.898  -47.075 4.123   1.00 34.26 ? 897 HOH A O   1 
HETATM 6698 O O   . HOH J 4 .   ? 33.057  -31.604 4.634   1.00 27.03 ? 898 HOH A O   1 
HETATM 6699 O O   . HOH J 4 .   ? 31.364  -1.818  -1.860  1.00 46.98 ? 899 HOH A O   1 
HETATM 6700 O O   . HOH J 4 .   ? 39.268  -34.444 1.708   1.00 36.69 ? 900 HOH A O   1 
HETATM 6701 O O   . HOH J 4 .   ? 48.961  -16.113 1.191   1.00 36.42 ? 901 HOH A O   1 
HETATM 6702 O O   . HOH J 4 .   ? 21.908  -18.147 3.698   1.00 31.41 ? 902 HOH A O   1 
HETATM 6703 O O   . HOH J 4 .   ? 32.110  -15.187 17.597  1.00 46.34 ? 903 HOH A O   1 
HETATM 6704 O O   . HOH J 4 .   ? 34.094  -50.378 14.047  1.00 38.07 ? 904 HOH A O   1 
HETATM 6705 O O   . HOH J 4 .   ? 29.162  0.276   -1.898  1.00 34.80 ? 905 HOH A O   1 
HETATM 6706 O O   . HOH J 4 .   ? 36.195  3.295   -0.325  1.00 50.99 ? 906 HOH A O   1 
HETATM 6707 O O   . HOH J 4 .   ? 17.040  6.863   2.545   1.00 30.34 ? 907 HOH A O   1 
HETATM 6708 O O   . HOH J 4 .   ? 18.674  6.894   -0.103  1.00 36.95 ? 908 HOH A O   1 
HETATM 6709 O O   . HOH J 4 .   ? 28.927  -18.437 20.341  1.00 36.79 ? 909 HOH A O   1 
HETATM 6710 O O   . HOH J 4 .   ? 38.062  -39.857 27.169  1.00 36.45 ? 910 HOH A O   1 
HETATM 6711 O O   . HOH J 4 .   ? 39.539  -17.977 -9.242  1.00 35.50 ? 911 HOH A O   1 
HETATM 6712 O O   . HOH J 4 .   ? 52.146  -41.009 15.875  1.00 45.42 ? 912 HOH A O   1 
HETATM 6713 O O   . HOH J 4 .   ? 32.723  -3.333  11.271  1.00 33.05 ? 913 HOH A O   1 
HETATM 6714 O O   . HOH J 4 .   ? 35.660  -9.197  -9.895  1.00 36.91 ? 914 HOH A O   1 
HETATM 6715 O O   . HOH J 4 .   ? 42.771  -11.069 -3.997  1.00 32.54 ? 915 HOH A O   1 
HETATM 6716 O O   . HOH J 4 .   ? 26.790  -31.157 0.435   1.00 42.52 ? 916 HOH A O   1 
HETATM 6717 O O   . HOH J 4 .   ? 17.572  -22.400 9.979   1.00 40.76 ? 917 HOH A O   1 
HETATM 6718 O O   . HOH J 4 .   ? 41.493  -40.667 26.314  1.00 47.14 ? 918 HOH A O   1 
HETATM 6719 O O   . HOH J 4 .   ? 34.370  2.219   -1.969  1.00 49.09 ? 919 HOH A O   1 
HETATM 6720 O O   . HOH J 4 .   ? 17.174  9.784   3.395   1.00 43.46 ? 920 HOH A O   1 
HETATM 6721 O O   . HOH J 4 .   ? 42.611  -17.936 20.756  1.00 32.33 ? 921 HOH A O   1 
HETATM 6722 O O   . HOH J 4 .   ? 47.784  -37.643 -3.523  1.00 34.47 ? 922 HOH A O   1 
HETATM 6723 O O   . HOH J 4 .   ? 17.585  -23.890 -11.059 1.00 33.78 ? 923 HOH A O   1 
HETATM 6724 O O   . HOH J 4 .   ? 26.232  2.920   -3.265  1.00 37.29 ? 924 HOH A O   1 
HETATM 6725 O O   . HOH J 4 .   ? 21.904  6.872   -3.839  1.00 30.80 ? 925 HOH A O   1 
HETATM 6726 O O   . HOH J 4 .   ? 23.272  -31.423 -2.806  1.00 49.56 ? 926 HOH A O   1 
HETATM 6727 O O   . HOH J 4 .   ? 37.851  -50.748 17.784  1.00 47.35 ? 927 HOH A O   1 
HETATM 6728 O O   . HOH J 4 .   ? 29.323  10.456  2.734   1.00 32.66 ? 928 HOH A O   1 
HETATM 6729 O O   . HOH J 4 .   ? 45.538  -18.902 11.800  1.00 32.11 ? 929 HOH A O   1 
HETATM 6730 O O   . HOH J 4 .   ? 42.109  -22.681 -10.441 1.00 37.25 ? 930 HOH A O   1 
HETATM 6731 O O   . HOH J 4 .   ? 22.190  -22.131 -6.438  1.00 43.86 ? 931 HOH A O   1 
HETATM 6732 O O   . HOH J 4 .   ? 52.901  -39.444 3.974   1.00 40.73 ? 932 HOH A O   1 
HETATM 6733 O O   . HOH J 4 .   ? 37.318  -50.377 21.922  1.00 36.17 ? 933 HOH A O   1 
HETATM 6734 O O   . HOH J 4 .   ? 43.651  -9.440  -11.622 1.00 45.23 ? 934 HOH A O   1 
HETATM 6735 O O   . HOH J 4 .   ? 30.360  -31.140 -11.715 1.00 41.87 ? 935 HOH A O   1 
HETATM 6736 O O   . HOH J 4 .   ? 43.731  -20.601 18.404  1.00 34.23 ? 936 HOH A O   1 
HETATM 6737 O O   . HOH J 4 .   ? 30.102  4.582   8.770   1.00 31.60 ? 937 HOH A O   1 
HETATM 6738 O O   . HOH J 4 .   ? 55.093  -38.448 12.462  1.00 35.29 ? 938 HOH A O   1 
HETATM 6739 O O   . HOH J 4 .   ? 29.643  -31.505 2.365   1.00 42.35 ? 939 HOH A O   1 
HETATM 6740 O O   . HOH J 4 .   ? 28.959  -21.810 21.957  1.00 37.49 ? 940 HOH A O   1 
HETATM 6741 O O   . HOH J 4 .   ? 45.878  -38.636 19.127  1.00 38.44 ? 941 HOH A O   1 
HETATM 6742 O O   . HOH J 4 .   ? 16.404  -21.364 13.207  1.00 33.71 ? 942 HOH A O   1 
HETATM 6743 O O   . HOH J 4 .   ? 41.755  -12.289 -7.208  1.00 44.54 ? 943 HOH A O   1 
HETATM 6744 O O   . HOH J 4 .   ? 41.273  -17.085 -6.777  1.00 32.09 ? 944 HOH A O   1 
HETATM 6745 O O   . HOH J 4 .   ? 36.538  -7.781  -4.782  1.00 49.17 ? 945 HOH A O   1 
HETATM 6746 O O   . HOH J 4 .   ? 27.200  -23.563 24.014  1.00 53.43 ? 946 HOH A O   1 
HETATM 6747 O O   . HOH J 4 .   ? 26.105  -10.234 8.917   1.00 38.23 ? 947 HOH A O   1 
HETATM 6748 O O   . HOH J 4 .   ? 29.538  -13.392 -13.557 1.00 52.46 ? 948 HOH A O   1 
HETATM 6749 O O   . HOH J 4 .   ? 40.772  -26.927 -11.782 1.00 52.15 ? 949 HOH A O   1 
HETATM 6750 O O   . HOH J 4 .   ? 39.582  -5.998  -11.533 1.00 46.77 ? 950 HOH A O   1 
HETATM 6751 O O   . HOH J 4 .   ? 35.343  -51.763 16.792  1.00 52.13 ? 951 HOH A O   1 
HETATM 6752 O O   . HOH J 4 .   ? 22.884  -24.797 6.283   1.00 42.29 ? 952 HOH A O   1 
HETATM 6753 O O   . HOH J 4 .   ? 42.952  -15.754 -8.617  1.00 44.91 ? 953 HOH A O   1 
HETATM 6754 O O   . HOH J 4 .   ? 24.238  -27.257 1.836   1.00 47.23 ? 954 HOH A O   1 
HETATM 6755 O O   . HOH J 4 .   ? 16.106  -24.243 11.514  1.00 46.26 ? 955 HOH A O   1 
HETATM 6756 O O   . HOH J 4 .   ? 47.779  -51.156 10.494  1.00 53.36 ? 956 HOH A O   1 
HETATM 6757 O O   . HOH J 4 .   ? 25.507  -24.932 5.561   1.00 39.99 ? 957 HOH A O   1 
HETATM 6758 O O   . HOH J 4 .   ? 48.907  -39.010 18.157  1.00 43.52 ? 958 HOH A O   1 
HETATM 6759 O O   . HOH J 4 .   ? 36.664  -32.497 -17.184 1.00 57.32 ? 959 HOH A O   1 
HETATM 6760 O O   . HOH J 4 .   ? 45.503  -27.358 27.989  1.00 39.31 ? 960 HOH A O   1 
HETATM 6761 O O   . HOH J 4 .   ? 52.430  -36.353 2.154   1.00 38.87 ? 961 HOH A O   1 
HETATM 6762 O O   . HOH J 4 .   ? 23.620  -13.131 -3.288  1.00 44.47 ? 962 HOH A O   1 
HETATM 6763 O O   . HOH J 4 .   ? 36.054  -33.947 2.971   1.00 38.25 ? 963 HOH A O   1 
HETATM 6764 O O   . HOH J 4 .   ? 23.483  -26.035 -14.018 1.00 41.90 ? 964 HOH A O   1 
HETATM 6765 O O   . HOH J 4 .   ? 38.963  -25.563 -12.750 1.00 44.55 ? 965 HOH A O   1 
HETATM 6766 O O   . HOH J 4 .   ? 21.859  -30.530 -6.093  1.00 43.82 ? 966 HOH A O   1 
HETATM 6767 O O   . HOH J 4 .   ? 20.908  -25.359 -19.967 1.00 42.88 ? 967 HOH A O   1 
HETATM 6768 O O   . HOH J 4 .   ? 30.043  -4.621  10.692  1.00 48.34 ? 968 HOH A O   1 
HETATM 6769 O O   . HOH J 4 .   ? 47.367  -23.187 28.498  1.00 46.92 ? 969 HOH A O   1 
HETATM 6770 O O   . HOH J 4 .   ? 48.326  -45.050 4.573   1.00 48.09 ? 970 HOH A O   1 
HETATM 6771 O O   . HOH J 4 .   ? 39.134  -35.793 8.158   1.00 40.87 ? 971 HOH A O   1 
HETATM 6772 O O   . HOH J 4 .   ? 34.821  -52.142 20.118  1.00 38.48 ? 972 HOH A O   1 
HETATM 6773 O O   . HOH J 4 .   ? 27.684  -26.368 6.115   1.00 36.87 ? 973 HOH A O   1 
HETATM 6774 O O   . HOH J 4 .   ? 44.074  -17.948 18.329  1.00 45.44 ? 974 HOH A O   1 
HETATM 6775 O O   . HOH J 4 .   ? 18.944  -23.714 7.937   1.00 38.35 ? 975 HOH A O   1 
HETATM 6776 O O   . HOH J 4 .   ? 17.193  3.263   -0.557  1.00 52.14 ? 976 HOH A O   1 
HETATM 6777 O O   . HOH J 4 .   ? 32.244  -20.481 29.864  1.00 32.35 ? 977 HOH A O   1 
HETATM 6778 O O   . HOH J 4 .   ? 24.392  -23.121 20.364  1.00 40.82 ? 978 HOH A O   1 
HETATM 6779 O O   . HOH J 4 .   ? 44.774  -29.304 26.500  1.00 40.50 ? 979 HOH A O   1 
HETATM 6780 O O   . HOH J 4 .   ? 56.404  -33.585 10.595  1.00 49.58 ? 980 HOH A O   1 
HETATM 6781 O O   . HOH J 4 .   ? 28.238  -47.365 1.412   1.00 48.96 ? 981 HOH A O   1 
HETATM 6782 O O   . HOH J 4 .   ? 29.231  -16.406 -14.710 1.00 38.12 ? 982 HOH A O   1 
HETATM 6783 O O   . HOH J 4 .   ? 44.421  -58.743 11.708  1.00 54.95 ? 983 HOH A O   1 
HETATM 6784 O O   . HOH J 4 .   ? 44.220  -18.313 22.629  1.00 47.77 ? 984 HOH A O   1 
HETATM 6785 O O   . HOH J 4 .   ? 19.706  -20.834 -6.724  1.00 44.63 ? 985 HOH A O   1 
HETATM 6786 O O   . HOH J 4 .   ? 45.225  -44.988 18.695  1.00 40.66 ? 986 HOH A O   1 
HETATM 6787 O O   . HOH J 4 .   ? 42.388  -35.126 21.667  1.00 49.47 ? 987 HOH A O   1 
HETATM 6788 O O   . HOH J 4 .   ? 39.905  -47.138 29.363  1.00 40.70 ? 988 HOH A O   1 
HETATM 6789 O O   . HOH J 4 .   ? 39.137  -35.051 3.970   1.00 36.87 ? 989 HOH A O   1 
HETATM 6790 O O   . HOH J 4 .   ? 27.783  -18.700 -18.075 1.00 44.42 ? 990 HOH A O   1 
HETATM 6791 O O   . HOH J 4 .   ? 42.931  -39.236 20.982  1.00 36.98 ? 991 HOH A O   1 
HETATM 6792 O O   . HOH J 4 .   ? 22.157  -24.920 -9.070  1.00 41.33 ? 992 HOH A O   1 
HETATM 6793 O O   . HOH J 4 .   ? 22.317  -29.444 14.549  1.00 41.02 ? 993 HOH A O   1 
HETATM 6794 O O   . HOH J 4 .   ? 49.177  -31.381 -3.367  1.00 55.35 ? 994 HOH A O   1 
HETATM 6795 O O   . HOH J 4 .   ? 27.264  -25.284 22.251  1.00 40.36 ? 995 HOH A O   1 
HETATM 6796 O O   . HOH K 4 .   ? 29.155  -20.251 14.874  1.00 24.34 ? 803 HOH B O   1 
HETATM 6797 O O   . HOH K 4 .   ? 23.050  -11.340 22.062  1.00 20.68 ? 804 HOH B O   1 
HETATM 6798 O O   . HOH K 4 .   ? 18.350  -9.122  18.861  1.00 19.01 ? 805 HOH B O   1 
HETATM 6799 O O   . HOH K 4 .   ? 21.938  -15.169 17.750  1.00 17.95 ? 806 HOH B O   1 
HETATM 6800 O O   . HOH K 4 .   ? 35.494  -5.178  13.982  1.00 18.61 ? 807 HOH B O   1 
HETATM 6801 O O   . HOH K 4 .   ? 28.154  -19.168 11.655  1.00 22.46 ? 808 HOH B O   1 
HETATM 6802 O O   . HOH K 4 .   ? 17.580  -4.964  14.054  1.00 21.33 ? 809 HOH B O   1 
HETATM 6803 O O   . HOH K 4 .   ? 28.878  9.967   21.122  1.00 22.01 ? 810 HOH B O   1 
HETATM 6804 O O   . HOH K 4 .   ? 24.757  -17.523 9.407   1.00 25.18 ? 811 HOH B O   1 
HETATM 6805 O O   . HOH K 4 .   ? 23.702  -14.596 20.885  1.00 20.58 ? 812 HOH B O   1 
HETATM 6806 O O   . HOH K 4 .   ? 27.232  -19.050 18.339  1.00 21.33 ? 813 HOH B O   1 
HETATM 6807 O O   . HOH K 4 .   ? 18.581  -7.341  22.145  1.00 14.52 ? 814 HOH B O   1 
HETATM 6808 O O   . HOH K 4 .   ? 37.497  -2.154  19.216  1.00 19.94 ? 815 HOH B O   1 
HETATM 6809 O O   . HOH K 4 .   ? 29.469  -14.673 19.172  1.00 26.89 ? 816 HOH B O   1 
HETATM 6810 O O   . HOH K 4 .   ? 18.742  -17.450 17.089  1.00 14.46 ? 817 HOH B O   1 
HETATM 6811 O O   . HOH K 4 .   ? 27.446  -9.663  13.103  1.00 42.98 ? 818 HOH B O   1 
HETATM 6812 O O   . HOH K 4 .   ? 51.236  -5.341  3.143   1.00 52.32 ? 819 HOH B O   1 
HETATM 6813 O O   . HOH K 4 .   ? 35.004  3.155   11.412  1.00 10.56 ? 820 HOH B O   1 
HETATM 6814 O O   . HOH K 4 .   ? 24.545  -3.542  22.508  1.00 15.03 ? 821 HOH B O   1 
HETATM 6815 O O   . HOH K 4 .   ? 35.576  -10.955 18.751  1.00 19.29 ? 822 HOH B O   1 
HETATM 6816 O O   . HOH K 4 .   ? 27.312  5.589   26.688  1.00 18.20 ? 823 HOH B O   1 
HETATM 6817 O O   . HOH K 4 .   ? 49.639  -13.148 6.444   1.00 21.28 ? 824 HOH B O   1 
HETATM 6818 O O   . HOH K 4 .   ? 16.502  -18.411 17.575  1.00 19.13 ? 825 HOH B O   1 
HETATM 6819 O O   . HOH K 4 .   ? 33.372  -12.705 18.707  1.00 20.04 ? 826 HOH B O   1 
HETATM 6820 O O   . HOH K 4 .   ? 14.459  -4.390  14.181  1.00 21.76 ? 827 HOH B O   1 
HETATM 6821 O O   . HOH K 4 .   ? 12.804  -4.737  18.511  1.00 21.17 ? 828 HOH B O   1 
HETATM 6822 O O   . HOH K 4 .   ? 24.073  -4.796  14.151  1.00 17.58 ? 829 HOH B O   1 
HETATM 6823 O O   . HOH K 4 .   ? -7.719  -9.148  31.447  1.00 27.47 ? 830 HOH B O   1 
HETATM 6824 O O   . HOH K 4 .   ? 19.808  10.047  7.653   1.00 21.45 ? 831 HOH B O   1 
HETATM 6825 O O   . HOH K 4 .   ? 7.985   1.933   42.327  1.00 20.50 ? 832 HOH B O   1 
HETATM 6826 O O   . HOH K 4 .   ? 41.210  5.070   4.884   1.00 18.00 ? 833 HOH B O   1 
HETATM 6827 O O   . HOH K 4 .   ? 18.215  14.647  18.651  1.00 30.07 ? 834 HOH B O   1 
HETATM 6828 O O   . HOH K 4 .   ? -1.747  -7.643  35.020  1.00 30.84 ? 835 HOH B O   1 
HETATM 6829 O O   . HOH K 4 .   ? 24.844  -9.408  25.092  1.00 21.13 ? 836 HOH B O   1 
HETATM 6830 O O   . HOH K 4 .   ? 21.931  8.742   7.033   1.00 19.48 ? 837 HOH B O   1 
HETATM 6831 O O   . HOH K 4 .   ? -2.704  0.968   30.588  1.00 29.02 ? 838 HOH B O   1 
HETATM 6832 O O   . HOH K 4 .   ? 32.472  15.572  13.473  1.00 27.45 ? 839 HOH B O   1 
HETATM 6833 O O   . HOH K 4 .   ? 45.332  -9.853  16.936  1.00 24.88 ? 840 HOH B O   1 
HETATM 6834 O O   . HOH K 4 .   ? 30.493  -1.049  11.945  1.00 26.19 ? 841 HOH B O   1 
HETATM 6835 O O   . HOH K 4 .   ? 2.787   -9.813  39.516  1.00 22.40 ? 842 HOH B O   1 
HETATM 6836 O O   . HOH K 4 .   ? 29.934  -2.349  32.413  1.00 21.64 ? 843 HOH B O   1 
HETATM 6837 O O   . HOH K 4 .   ? 50.620  -14.399 8.782   1.00 30.84 ? 844 HOH B O   1 
HETATM 6838 O O   . HOH K 4 .   ? 26.005  -15.786 21.268  1.00 33.20 ? 845 HOH B O   1 
HETATM 6839 O O   . HOH K 4 .   ? 23.980  -6.747  15.884  1.00 22.84 ? 846 HOH B O   1 
HETATM 6840 O O   . HOH K 4 .   ? 16.055  -9.995  19.697  1.00 22.35 ? 847 HOH B O   1 
HETATM 6841 O O   . HOH K 4 .   ? 17.136  12.973  21.674  1.00 30.10 ? 848 HOH B O   1 
HETATM 6842 O O   . HOH K 4 .   ? 10.686  6.110   14.499  1.00 20.76 ? 849 HOH B O   1 
HETATM 6843 O O   . HOH K 4 .   ? 30.375  -18.361 24.746  1.00 24.91 ? 850 HOH B O   1 
HETATM 6844 O O   . HOH K 4 .   ? 41.131  -18.884 32.494  1.00 28.89 ? 851 HOH B O   1 
HETATM 6845 O O   . HOH K 4 .   ? 36.248  -11.441 33.776  1.00 30.99 ? 852 HOH B O   1 
HETATM 6846 O O   . HOH K 4 .   ? 17.929  -11.214 12.576  1.00 28.64 ? 853 HOH B O   1 
HETATM 6847 O O   . HOH K 4 .   ? 15.633  11.841  28.186  1.00 32.57 ? 854 HOH B O   1 
HETATM 6848 O O   . HOH K 4 .   ? 38.265  -10.850 17.925  1.00 28.79 ? 855 HOH B O   1 
HETATM 6849 O O   . HOH K 4 .   ? 23.386  -6.710  36.646  1.00 24.31 ? 856 HOH B O   1 
HETATM 6850 O O   . HOH K 4 .   ? 31.809  1.995   14.407  1.00 25.71 ? 857 HOH B O   1 
HETATM 6851 O O   . HOH K 4 .   ? 24.050  -8.666  35.264  1.00 23.28 ? 858 HOH B O   1 
HETATM 6852 O O   . HOH K 4 .   ? 21.353  12.854  29.646  1.00 38.24 ? 859 HOH B O   1 
HETATM 6853 O O   . HOH K 4 .   ? 4.196   -5.746  38.700  1.00 27.30 ? 860 HOH B O   1 
HETATM 6854 O O   . HOH K 4 .   ? 22.698  -17.091 19.526  1.00 24.63 ? 861 HOH B O   1 
HETATM 6855 O O   . HOH K 4 .   ? 40.165  -5.307  19.353  1.00 26.77 ? 862 HOH B O   1 
HETATM 6856 O O   . HOH K 4 .   ? -8.248  -6.059  31.090  1.00 27.18 ? 863 HOH B O   1 
HETATM 6857 O O   . HOH K 4 .   ? 24.873  -18.509 19.711  1.00 29.75 ? 864 HOH B O   1 
HETATM 6858 O O   . HOH K 4 .   ? 36.032  10.537  20.654  1.00 27.86 ? 865 HOH B O   1 
HETATM 6859 O O   . HOH K 4 .   ? 12.085  -4.637  15.423  1.00 34.82 ? 866 HOH B O   1 
HETATM 6860 O O   . HOH K 4 .   ? 24.052  -1.561  8.356   1.00 33.76 ? 867 HOH B O   1 
HETATM 6861 O O   . HOH K 4 .   ? 31.308  2.259   28.035  1.00 27.28 ? 868 HOH B O   1 
HETATM 6862 O O   . HOH K 4 .   ? 29.063  4.046   11.998  1.00 22.71 ? 869 HOH B O   1 
HETATM 6863 O O   . HOH K 4 .   ? 47.121  4.882   22.302  1.00 44.00 ? 870 HOH B O   1 
HETATM 6864 O O   . HOH K 4 .   ? 12.489  1.904   9.307   1.00 32.17 ? 871 HOH B O   1 
HETATM 6865 O O   . HOH K 4 .   ? 39.526  -2.152  21.753  1.00 36.83 ? 872 HOH B O   1 
HETATM 6866 O O   . HOH K 4 .   ? 11.874  -6.337  34.550  1.00 34.18 ? 873 HOH B O   1 
HETATM 6867 O O   . HOH K 4 .   ? 29.929  5.853   27.140  1.00 30.69 ? 874 HOH B O   1 
HETATM 6868 O O   . HOH K 4 .   ? 32.182  -22.299 23.024  1.00 31.01 ? 875 HOH B O   1 
HETATM 6869 O O   . HOH K 4 .   ? 40.685  -5.728  22.700  1.00 28.57 ? 876 HOH B O   1 
HETATM 6870 O O   . HOH K 4 .   ? -7.719  -1.057  31.271  1.00 34.95 ? 877 HOH B O   1 
HETATM 6871 O O   . HOH K 4 .   ? 39.745  13.589  16.029  1.00 37.57 ? 878 HOH B O   1 
HETATM 6872 O O   . HOH K 4 .   ? 44.672  -7.228  0.985   1.00 34.94 ? 879 HOH B O   1 
HETATM 6873 O O   . HOH K 4 .   ? 1.520   1.819   30.576  1.00 31.02 ? 880 HOH B O   1 
HETATM 6874 O O   . HOH K 4 .   ? 0.506   -1.748  29.005  1.00 27.05 ? 881 HOH B O   1 
HETATM 6875 O O   . HOH K 4 .   ? 9.231   -4.360  37.581  1.00 35.30 ? 882 HOH B O   1 
HETATM 6876 O O   . HOH K 4 .   ? -3.056  -1.369  40.382  1.00 33.44 ? 883 HOH B O   1 
HETATM 6877 O O   . HOH K 4 .   ? 35.752  -6.247  -1.644  1.00 39.31 ? 884 HOH B O   1 
HETATM 6878 O O   . HOH K 4 .   ? 30.252  8.254   28.191  1.00 35.30 ? 885 HOH B O   1 
HETATM 6879 O O   . HOH K 4 .   ? 48.312  -7.721  3.516   1.00 36.55 ? 886 HOH B O   1 
HETATM 6880 O O   . HOH K 4 .   ? 15.941  -11.100 16.380  1.00 39.05 ? 887 HOH B O   1 
HETATM 6881 O O   . HOH K 4 .   ? 29.441  7.406   9.255   1.00 41.62 ? 888 HOH B O   1 
HETATM 6882 O O   . HOH K 4 .   ? 46.057  -1.202  3.727   1.00 42.26 ? 889 HOH B O   1 
HETATM 6883 O O   . HOH K 4 .   ? 47.600  -1.078  18.970  1.00 31.65 ? 890 HOH B O   1 
HETATM 6884 O O   . HOH K 4 .   ? 11.765  -7.607  15.369  1.00 41.85 ? 891 HOH B O   1 
HETATM 6885 O O   . HOH K 4 .   ? 36.376  -4.781  32.359  1.00 35.64 ? 892 HOH B O   1 
HETATM 6886 O O   . HOH K 4 .   ? 11.715  -8.462  25.784  1.00 40.13 ? 893 HOH B O   1 
HETATM 6887 O O   . HOH K 4 .   ? 27.434  -0.859  10.868  1.00 28.87 ? 894 HOH B O   1 
HETATM 6888 O O   . HOH K 4 .   ? -7.412  -6.348  38.000  1.00 31.78 ? 895 HOH B O   1 
HETATM 6889 O O   . HOH K 4 .   ? 24.174  -15.328 10.929  1.00 37.95 ? 896 HOH B O   1 
HETATM 6890 O O   . HOH K 4 .   ? 48.396  7.046   20.139  1.00 34.76 ? 897 HOH B O   1 
HETATM 6891 O O   . HOH K 4 .   ? 2.005   -3.574  41.347  1.00 37.28 ? 898 HOH B O   1 
HETATM 6892 O O   . HOH K 4 .   ? 10.646  -7.032  13.027  1.00 40.99 ? 899 HOH B O   1 
HETATM 6893 O O   . HOH K 4 .   ? 18.434  18.134  3.239   1.00 44.67 ? 900 HOH B O   1 
HETATM 6894 O O   . HOH K 4 .   ? 43.649  9.396   12.336  1.00 42.83 ? 901 HOH B O   1 
HETATM 6895 O O   . HOH K 4 .   ? 22.581  -12.739 26.973  1.00 30.47 ? 902 HOH B O   1 
HETATM 6896 O O   . HOH K 4 .   ? 15.457  -18.010 14.394  1.00 30.32 ? 903 HOH B O   1 
HETATM 6897 O O   . HOH K 4 .   ? 45.708  -16.645 28.861  1.00 44.43 ? 904 HOH B O   1 
HETATM 6898 O O   . HOH K 4 .   ? 16.426  15.131  22.625  1.00 37.55 ? 905 HOH B O   1 
HETATM 6899 O O   . HOH K 4 .   ? 49.713  -4.073  12.747  1.00 42.57 ? 906 HOH B O   1 
HETATM 6900 O O   . HOH K 4 .   ? 29.222  2.089   10.122  1.00 37.14 ? 907 HOH B O   1 
HETATM 6901 O O   . HOH K 4 .   ? 19.518  15.856  20.208  1.00 36.96 ? 908 HOH B O   1 
HETATM 6902 O O   . HOH K 4 .   ? 4.116   8.087   13.938  1.00 38.13 ? 909 HOH B O   1 
HETATM 6903 O O   . HOH K 4 .   ? 29.952  9.068   5.101   1.00 34.50 ? 910 HOH B O   1 
HETATM 6904 O O   . HOH K 4 .   ? 25.041  13.765  25.613  1.00 42.35 ? 911 HOH B O   1 
HETATM 6905 O O   . HOH K 4 .   ? 10.721  18.510  24.938  1.00 46.86 ? 912 HOH B O   1 
HETATM 6906 O O   . HOH K 4 .   ? 30.469  0.915   30.003  1.00 37.63 ? 913 HOH B O   1 
HETATM 6907 O O   . HOH K 4 .   ? 46.701  -18.998 14.472  1.00 41.92 ? 914 HOH B O   1 
HETATM 6908 O O   . HOH K 4 .   ? 5.620   11.388  12.615  1.00 37.26 ? 915 HOH B O   1 
HETATM 6909 O O   . HOH K 4 .   ? 20.110  10.700  5.009   1.00 38.44 ? 916 HOH B O   1 
HETATM 6910 O O   . HOH K 4 .   ? 40.855  3.730   2.613   1.00 40.57 ? 917 HOH B O   1 
HETATM 6911 O O   . HOH K 4 .   ? -0.431  -2.885  40.759  1.00 40.63 ? 918 HOH B O   1 
HETATM 6912 O O   . HOH K 4 .   ? 9.468   -1.328  27.873  1.00 56.43 ? 919 HOH B O   1 
HETATM 6913 O O   . HOH K 4 .   ? 43.456  12.231  14.809  1.00 38.00 ? 920 HOH B O   1 
HETATM 6914 O O   . HOH K 4 .   ? 17.599  13.784  31.735  1.00 46.10 ? 921 HOH B O   1 
HETATM 6915 O O   . HOH K 4 .   ? 10.736  15.405  7.642   1.00 39.37 ? 922 HOH B O   1 
HETATM 6916 O O   . HOH K 4 .   ? 43.230  -7.584  25.204  1.00 48.05 ? 923 HOH B O   1 
HETATM 6917 O O   . HOH K 4 .   ? 17.988  -2.145  3.667   1.00 57.36 ? 924 HOH B O   1 
HETATM 6918 O O   . HOH K 4 .   ? 9.631   15.205  14.358  1.00 41.90 ? 925 HOH B O   1 
HETATM 6919 O O   . HOH K 4 .   ? 7.296   16.011  27.502  1.00 48.35 ? 926 HOH B O   1 
HETATM 6920 O O   . HOH K 4 .   ? 18.994  -6.543  13.180  1.00 35.97 ? 927 HOH B O   1 
HETATM 6921 O O   . HOH K 4 .   ? 42.875  -11.128 19.190  1.00 48.51 ? 928 HOH B O   1 
HETATM 6922 O O   . HOH K 4 .   ? 29.015  -18.984 22.985  1.00 39.12 ? 929 HOH B O   1 
HETATM 6923 O O   . HOH K 4 .   ? 7.424   4.058   38.386  1.00 38.26 ? 930 HOH B O   1 
HETATM 6924 O O   . HOH K 4 .   ? 17.802  -8.308  24.734  1.00 22.01 ? 931 HOH B O   1 
HETATM 6925 O O   . HOH K 4 .   ? 42.090  -11.699 25.537  1.00 40.34 ? 932 HOH B O   1 
HETATM 6926 O O   . HOH K 4 .   ? 44.714  6.187   3.759   1.00 44.13 ? 933 HOH B O   1 
HETATM 6927 O O   . HOH K 4 .   ? 50.100  -0.747  -3.562  1.00 53.92 ? 934 HOH B O   1 
HETATM 6928 O O   . HOH K 4 .   ? 21.634  -5.402  12.976  1.00 49.39 ? 935 HOH B O   1 
HETATM 6929 O O   . HOH K 4 .   ? 31.303  0.878   10.617  1.00 46.43 ? 936 HOH B O   1 
HETATM 6930 O O   . HOH K 4 .   ? 5.452   13.989  15.922  1.00 44.25 ? 937 HOH B O   1 
HETATM 6931 O O   . HOH K 4 .   ? 14.644  13.556  25.020  1.00 48.58 ? 938 HOH B O   1 
HETATM 6932 O O   . HOH K 4 .   ? 46.965  -11.938 17.703  1.00 60.19 ? 939 HOH B O   1 
HETATM 6933 O O   . HOH K 4 .   ? 26.352  -3.788  12.737  1.00 35.47 ? 940 HOH B O   1 
HETATM 6934 O O   . HOH K 4 .   ? 43.825  8.611   6.413   1.00 42.10 ? 941 HOH B O   1 
HETATM 6935 O O   . HOH K 4 .   ? 49.460  -13.149 16.480  1.00 52.33 ? 942 HOH B O   1 
HETATM 6936 O O   . HOH K 4 .   ? 26.320  -14.643 12.259  1.00 36.85 ? 943 HOH B O   1 
HETATM 6937 O O   . HOH K 4 .   ? 14.730  9.779   32.079  1.00 37.23 ? 944 HOH B O   1 
HETATM 6938 O O   . HOH K 4 .   ? 5.915   -5.968  27.054  1.00 48.74 ? 945 HOH B O   1 
HETATM 6939 O O   . HOH K 4 .   ? 23.334  -13.755 8.575   1.00 42.76 ? 946 HOH B O   1 
HETATM 6940 O O   . HOH K 4 .   ? 4.752   10.861  15.721  1.00 50.33 ? 947 HOH B O   1 
HETATM 6941 O O   . HOH K 4 .   ? 9.717   6.527   29.110  1.00 53.92 ? 948 HOH B O   1 
HETATM 6942 O O   . HOH K 4 .   ? 51.975  1.116   6.486   1.00 41.45 ? 949 HOH B O   1 
HETATM 6943 O O   . HOH K 4 .   ? 10.685  12.996  32.334  1.00 56.84 ? 950 HOH B O   1 
HETATM 6944 O O   . HOH K 4 .   ? 46.591  -15.184 16.239  1.00 46.68 ? 951 HOH B O   1 
HETATM 6945 O O   . HOH K 4 .   ? 45.930  11.574  15.553  1.00 39.00 ? 952 HOH B O   1 
HETATM 6946 O O   . HOH K 4 .   ? 19.282  16.090  16.447  1.00 42.79 ? 953 HOH B O   1 
HETATM 6947 O O   . HOH K 4 .   ? 15.437  13.510  19.403  1.00 51.24 ? 954 HOH B O   1 
HETATM 6948 O O   . HOH K 4 .   ? 41.437  -3.652  21.361  1.00 39.05 ? 955 HOH B O   1 
HETATM 6949 O O   . HOH K 4 .   ? 3.707   3.505   34.029  1.00 41.09 ? 956 HOH B O   1 
HETATM 6950 O O   . HOH K 4 .   ? 4.140   8.425   18.957  1.00 57.66 ? 957 HOH B O   1 
HETATM 6951 O O   . HOH K 4 .   ? 5.996   -1.440  17.551  1.00 41.85 ? 958 HOH B O   1 
HETATM 6952 O O   . HOH K 4 .   ? 36.765  10.266  11.183  1.00 16.25 ? 959 HOH B O   1 
HETATM 6953 O O   . HOH K 4 .   ? 14.312  -17.498 16.812  1.00 26.31 ? 960 HOH B O   1 
HETATM 6954 O O   . HOH K 4 .   ? 24.205  19.550  13.812  1.00 47.88 ? 961 HOH B O   1 
HETATM 6955 O O   . HOH K 4 .   ? 31.050  5.502   10.599  1.00 31.17 ? 962 HOH B O   1 
HETATM 6956 O O   . HOH K 4 .   ? 37.949  -1.049  26.667  1.00 46.42 ? 963 HOH B O   1 
HETATM 6957 O O   . HOH K 4 .   ? 33.139  -1.951  30.345  1.00 54.46 ? 964 HOH B O   1 
HETATM 6958 O O   . HOH K 4 .   ? 39.943  -2.879  28.882  1.00 37.30 ? 965 HOH B O   1 
HETATM 6959 O O   . HOH K 4 .   ? 23.305  -2.292  36.624  1.00 25.49 ? 966 HOH B O   1 
HETATM 6960 O O   . HOH K 4 .   ? 39.984  -0.583  -3.704  1.00 44.53 ? 967 HOH B O   1 
HETATM 6961 O O   . HOH K 4 .   ? 3.304   10.330  4.729   1.00 54.92 ? 968 HOH B O   1 
HETATM 6962 O O   . HOH K 4 .   ? 35.081  12.977  21.944  1.00 40.46 ? 969 HOH B O   1 
HETATM 6963 O O   . HOH K 4 .   ? 10.651  -7.279  32.350  1.00 37.83 ? 970 HOH B O   1 
HETATM 6964 O O   . HOH K 4 .   ? 28.373  -15.841 21.141  1.00 48.47 ? 971 HOH B O   1 
HETATM 6965 O O   . HOH L 4 .   ? 16.418  -6.422  36.438  1.00 22.94 ? 805 HOH C O   1 
HETATM 6966 O O   . HOH L 4 .   ? 16.788  -18.183 23.546  1.00 16.53 ? 806 HOH C O   1 
HETATM 6967 O O   . HOH L 4 .   ? 22.555  -15.079 23.375  1.00 22.04 ? 807 HOH C O   1 
HETATM 6968 O O   . HOH L 4 .   ? 11.423  -21.362 26.737  1.00 14.47 ? 808 HOH C O   1 
HETATM 6969 O O   . HOH L 4 .   ? 10.766  -21.221 45.990  1.00 19.94 ? 809 HOH C O   1 
HETATM 6970 O O   . HOH L 4 .   ? 18.229  -21.926 32.696  1.00 21.36 ? 810 HOH C O   1 
HETATM 6971 O O   . HOH L 4 .   ? 20.001  -9.546  21.200  1.00 23.38 ? 811 HOH C O   1 
HETATM 6972 O O   . HOH L 4 .   ? 16.742  -20.652 28.683  1.00 19.97 ? 812 HOH C O   1 
HETATM 6973 O O   . HOH L 4 .   ? 21.573  -14.659 28.140  1.00 19.79 ? 813 HOH C O   1 
HETATM 6974 O O   . HOH L 4 .   ? 15.694  -31.924 30.957  1.00 17.35 ? 814 HOH C O   1 
HETATM 6975 O O   . HOH L 4 .   ? 5.466   -17.977 27.592  1.00 20.75 ? 815 HOH C O   1 
HETATM 6976 O O   . HOH L 4 .   ? 7.122   -46.435 24.801  1.00 22.34 ? 816 HOH C O   1 
HETATM 6977 O O   . HOH L 4 .   ? 22.694  -11.720 31.030  1.00 26.71 ? 817 HOH C O   1 
HETATM 6978 O O   . HOH L 4 .   ? 30.355  -9.603  39.030  1.00 15.19 ? 818 HOH C O   1 
HETATM 6979 O O   . HOH L 4 .   ? 9.313   -4.508  41.204  1.00 14.65 ? 819 HOH C O   1 
HETATM 6980 O O   . HOH L 4 .   ? 8.678   4.615   43.251  1.00 22.11 ? 820 HOH C O   1 
HETATM 6981 O O   . HOH L 4 .   ? 13.051  -19.793 35.821  1.00 18.04 ? 821 HOH C O   1 
HETATM 6982 O O   . HOH L 4 .   ? 4.986   -24.432 27.219  1.00 18.61 ? 822 HOH C O   1 
HETATM 6983 O O   . HOH L 4 .   ? 26.234  8.306   34.195  1.00 19.81 ? 823 HOH C O   1 
HETATM 6984 O O   . HOH L 4 .   ? 16.236  -19.613 19.962  1.00 15.53 ? 824 HOH C O   1 
HETATM 6985 O O   . HOH L 4 .   ? 11.903  -23.597 29.796  1.00 15.20 ? 825 HOH C O   1 
HETATM 6986 O O   . HOH L 4 .   ? 34.736  -14.552 34.806  1.00 21.76 ? 826 HOH C O   1 
HETATM 6987 O O   . HOH L 4 .   ? 15.684  -19.755 46.001  1.00 20.52 ? 827 HOH C O   1 
HETATM 6988 O O   . HOH L 4 .   ? 26.888  -2.288  39.596  1.00 27.97 ? 828 HOH C O   1 
HETATM 6989 O O   . HOH L 4 .   ? 5.509   -2.951  47.530  1.00 20.72 ? 829 HOH C O   1 
HETATM 6990 O O   . HOH L 4 .   ? 29.851  -15.769 24.828  1.00 27.21 ? 830 HOH C O   1 
HETATM 6991 O O   . HOH L 4 .   ? -5.188  -22.568 32.695  1.00 21.65 ? 831 HOH C O   1 
HETATM 6992 O O   . HOH L 4 .   ? 15.668  -21.694 18.454  1.00 20.08 ? 832 HOH C O   1 
HETATM 6993 O O   . HOH L 4 .   ? 15.717  -8.855  31.051  1.00 19.30 ? 833 HOH C O   1 
HETATM 6994 O O   . HOH L 4 .   ? 19.343  -18.961 23.308  1.00 19.40 ? 834 HOH C O   1 
HETATM 6995 O O   . HOH L 4 .   ? 19.260  -19.230 26.355  1.00 23.55 ? 835 HOH C O   1 
HETATM 6996 O O   . HOH L 4 .   ? 0.448   -7.443  50.370  1.00 32.96 ? 836 HOH C O   1 
HETATM 6997 O O   . HOH L 4 .   ? 29.565  -15.920 42.435  1.00 31.83 ? 837 HOH C O   1 
HETATM 6998 O O   . HOH L 4 .   ? 21.476  -17.757 26.977  1.00 23.15 ? 838 HOH C O   1 
HETATM 6999 O O   . HOH L 4 .   ? 9.950   -20.785 23.154  1.00 35.09 ? 839 HOH C O   1 
HETATM 7000 O O   . HOH L 4 .   ? -3.845  -9.390  37.241  1.00 28.90 ? 840 HOH C O   1 
HETATM 7001 O O   . HOH L 4 .   ? 6.214   -15.872 47.461  1.00 22.33 ? 841 HOH C O   1 
HETATM 7002 O O   . HOH L 4 .   ? -5.891  -11.443 37.509  1.00 24.70 ? 842 HOH C O   1 
HETATM 7003 O O   . HOH L 4 .   ? 26.421  -16.355 45.561  1.00 38.52 ? 843 HOH C O   1 
HETATM 7004 O O   . HOH L 4 .   ? 10.941  0.626   50.657  1.00 33.31 ? 844 HOH C O   1 
HETATM 7005 O O   . HOH L 4 .   ? 11.088  -45.456 30.773  1.00 21.41 ? 845 HOH C O   1 
HETATM 7006 O O   . HOH L 4 .   ? 16.383  -22.115 45.559  1.00 24.59 ? 846 HOH C O   1 
HETATM 7007 O O   . HOH L 4 .   ? 14.080  -37.768 33.508  1.00 28.00 ? 847 HOH C O   1 
HETATM 7008 O O   . HOH L 4 .   ? 9.638   -13.860 31.237  1.00 26.48 ? 848 HOH C O   1 
HETATM 7009 O O   . HOH L 4 .   ? 22.332  -10.152 33.896  1.00 25.20 ? 849 HOH C O   1 
HETATM 7010 O O   . HOH L 4 .   ? 11.647  -15.276 30.139  1.00 28.93 ? 850 HOH C O   1 
HETATM 7011 O O   . HOH L 4 .   ? 22.808  -20.522 42.562  1.00 36.13 ? 851 HOH C O   1 
HETATM 7012 O O   . HOH L 4 .   ? -1.305  -43.818 29.029  1.00 35.96 ? 852 HOH C O   1 
HETATM 7013 O O   . HOH L 4 .   ? 3.075   -47.697 19.041  1.00 34.52 ? 853 HOH C O   1 
HETATM 7014 O O   . HOH L 4 .   ? 3.309   -33.432 45.032  1.00 31.62 ? 854 HOH C O   1 
HETATM 7015 O O   . HOH L 4 .   ? -3.744  -17.462 28.217  1.00 28.94 ? 855 HOH C O   1 
HETATM 7016 O O   . HOH L 4 .   ? 5.594   -8.925  39.159  1.00 20.65 ? 856 HOH C O   1 
HETATM 7017 O O   . HOH L 4 .   ? 3.810   -20.153 26.583  1.00 26.57 ? 857 HOH C O   1 
HETATM 7018 O O   . HOH L 4 .   ? 9.405   -10.875 51.319  1.00 28.74 ? 858 HOH C O   1 
HETATM 7019 O O   . HOH L 4 .   ? -10.536 -26.704 31.080  1.00 36.64 ? 859 HOH C O   1 
HETATM 7020 O O   . HOH L 4 .   ? 9.778   -7.974  36.003  1.00 22.89 ? 860 HOH C O   1 
HETATM 7021 O O   . HOH L 4 .   ? 17.844  -8.602  41.956  1.00 25.59 ? 861 HOH C O   1 
HETATM 7022 O O   . HOH L 4 .   ? 9.796   -8.700  39.906  1.00 27.17 ? 862 HOH C O   1 
HETATM 7023 O O   . HOH L 4 .   ? 20.047  -23.944 43.412  1.00 40.41 ? 863 HOH C O   1 
HETATM 7024 O O   . HOH L 4 .   ? 3.179   -22.510 25.672  1.00 25.71 ? 864 HOH C O   1 
HETATM 7025 O O   . HOH L 4 .   ? -2.484  -47.644 24.641  1.00 24.58 ? 865 HOH C O   1 
HETATM 7026 O O   . HOH L 4 .   ? 11.255  -24.094 21.604  1.00 30.29 ? 866 HOH C O   1 
HETATM 7027 O O   . HOH L 4 .   ? 3.652   -27.521 49.655  1.00 35.07 ? 867 HOH C O   1 
HETATM 7028 O O   . HOH L 4 .   ? 36.200  -20.456 38.892  1.00 28.50 ? 868 HOH C O   1 
HETATM 7029 O O   . HOH L 4 .   ? 29.228  -16.436 30.104  1.00 30.27 ? 869 HOH C O   1 
HETATM 7030 O O   . HOH L 4 .   ? 22.782  -9.906  38.233  1.00 30.05 ? 870 HOH C O   1 
HETATM 7031 O O   . HOH L 4 .   ? 32.497  0.825   31.735  1.00 46.97 ? 871 HOH C O   1 
HETATM 7032 O O   . HOH L 4 .   ? -4.375  -20.771 44.890  1.00 29.58 ? 872 HOH C O   1 
HETATM 7033 O O   . HOH L 4 .   ? 24.412  -22.593 41.314  1.00 26.11 ? 873 HOH C O   1 
HETATM 7034 O O   . HOH L 4 .   ? 39.461  -22.325 36.693  1.00 38.72 ? 874 HOH C O   1 
HETATM 7035 O O   . HOH L 4 .   ? -7.804  -9.990  36.332  1.00 38.55 ? 875 HOH C O   1 
HETATM 7036 O O   . HOH L 4 .   ? 26.988  -22.354 41.886  1.00 37.21 ? 876 HOH C O   1 
HETATM 7037 O O   . HOH L 4 .   ? 22.789  -22.429 27.942  1.00 38.88 ? 877 HOH C O   1 
HETATM 7038 O O   . HOH L 4 .   ? 0.531   -29.801 45.242  1.00 29.58 ? 878 HOH C O   1 
HETATM 7039 O O   . HOH L 4 .   ? -6.798  -18.089 27.195  1.00 30.41 ? 879 HOH C O   1 
HETATM 7040 O O   . HOH L 4 .   ? 2.932   -21.474 22.138  1.00 37.42 ? 880 HOH C O   1 
HETATM 7041 O O   . HOH L 4 .   ? 0.357   -41.341 31.874  1.00 34.25 ? 881 HOH C O   1 
HETATM 7042 O O   . HOH L 4 .   ? 1.232   -40.697 27.663  1.00 31.79 ? 882 HOH C O   1 
HETATM 7043 O O   . HOH L 4 .   ? -3.699  -28.504 30.733  1.00 40.55 ? 883 HOH C O   1 
HETATM 7044 O O   . HOH L 4 .   ? -1.789  -2.698  27.862  1.00 39.16 ? 884 HOH C O   1 
HETATM 7045 O O   . HOH L 4 .   ? 28.719  7.152   34.648  1.00 27.98 ? 885 HOH C O   1 
HETATM 7046 O O   . HOH L 4 .   ? 11.444  -16.712 16.630  1.00 35.36 ? 886 HOH C O   1 
HETATM 7047 O O   . HOH L 4 .   ? 1.565   -3.211  50.020  1.00 33.44 ? 887 HOH C O   1 
HETATM 7048 O O   . HOH L 4 .   ? 21.821  -7.686  40.819  1.00 30.63 ? 888 HOH C O   1 
HETATM 7049 O O   . HOH L 4 .   ? 5.122   -51.577 31.091  1.00 30.06 ? 889 HOH C O   1 
HETATM 7050 O O   . HOH L 4 .   ? -7.894  -16.038 25.951  1.00 32.48 ? 890 HOH C O   1 
HETATM 7051 O O   . HOH L 4 .   ? 27.028  -18.852 28.116  1.00 28.86 ? 891 HOH C O   1 
HETATM 7052 O O   . HOH L 4 .   ? 4.719   -22.843 23.415  1.00 34.65 ? 892 HOH C O   1 
HETATM 7053 O O   . HOH L 4 .   ? 20.608  10.100  36.251  1.00 35.61 ? 893 HOH C O   1 
HETATM 7054 O O   . HOH L 4 .   ? 9.903   -1.601  54.122  1.00 32.24 ? 894 HOH C O   1 
HETATM 7055 O O   . HOH L 4 .   ? 18.990  -2.735  54.740  1.00 31.66 ? 895 HOH C O   1 
HETATM 7056 O O   . HOH L 4 .   ? 10.794  -30.981 27.097  1.00 32.78 ? 896 HOH C O   1 
HETATM 7057 O O   . HOH L 4 .   ? 12.385  -41.385 33.121  1.00 44.88 ? 897 HOH C O   1 
HETATM 7058 O O   . HOH L 4 .   ? 8.292   -15.008 29.166  1.00 34.89 ? 898 HOH C O   1 
HETATM 7059 O O   . HOH L 4 .   ? 9.460   -16.910 22.228  1.00 41.78 ? 899 HOH C O   1 
HETATM 7060 O O   . HOH L 4 .   ? 20.167  -24.916 29.873  1.00 36.06 ? 900 HOH C O   1 
HETATM 7061 O O   . HOH L 4 .   ? 13.599  -19.919 16.386  1.00 40.33 ? 901 HOH C O   1 
HETATM 7062 O O   . HOH L 4 .   ? -14.269 -17.125 37.018  1.00 40.73 ? 902 HOH C O   1 
HETATM 7063 O O   . HOH L 4 .   ? 12.051  -20.529 48.049  1.00 33.14 ? 903 HOH C O   1 
HETATM 7064 O O   . HOH L 4 .   ? 23.150  -1.706  47.612  1.00 32.10 ? 904 HOH C O   1 
HETATM 7065 O O   . HOH L 4 .   ? 26.110  0.139   41.434  1.00 47.16 ? 905 HOH C O   1 
HETATM 7066 O O   . HOH L 4 .   ? 1.010   -3.275  46.114  1.00 40.23 ? 906 HOH C O   1 
HETATM 7067 O O   . HOH L 4 .   ? 8.522   -17.084 19.523  1.00 40.98 ? 907 HOH C O   1 
HETATM 7068 O O   . HOH L 4 .   ? 16.028  -11.393 22.761  1.00 31.79 ? 908 HOH C O   1 
HETATM 7069 O O   . HOH L 4 .   ? 9.998   -48.390 32.388  1.00 39.75 ? 909 HOH C O   1 
HETATM 7070 O O   . HOH L 4 .   ? 11.697  -33.124 25.871  1.00 39.84 ? 910 HOH C O   1 
HETATM 7071 O O   . HOH L 4 .   ? 3.812   -50.122 18.307  1.00 40.69 ? 911 HOH C O   1 
HETATM 7072 O O   . HOH L 4 .   ? 7.955   6.366   41.164  1.00 36.63 ? 912 HOH C O   1 
HETATM 7073 O O   . HOH L 4 .   ? 13.015  -29.814 27.489  1.00 52.08 ? 913 HOH C O   1 
HETATM 7074 O O   . HOH L 4 .   ? 9.748   -33.882 24.222  1.00 44.34 ? 914 HOH C O   1 
HETATM 7075 O O   . HOH L 4 .   ? 7.625   -4.862  53.612  1.00 46.24 ? 915 HOH C O   1 
HETATM 7076 O O   . HOH L 4 .   ? 16.524  9.590   33.933  1.00 40.07 ? 916 HOH C O   1 
HETATM 7077 O O   . HOH L 4 .   ? -11.994 -23.183 39.365  1.00 31.77 ? 917 HOH C O   1 
HETATM 7078 O O   . HOH L 4 .   ? -8.740  -15.515 43.032  1.00 47.65 ? 918 HOH C O   1 
HETATM 7079 O O   . HOH L 4 .   ? -1.757  -27.990 26.336  1.00 38.71 ? 919 HOH C O   1 
HETATM 7080 O O   . HOH L 4 .   ? 21.509  -17.796 23.301  1.00 30.94 ? 920 HOH C O   1 
HETATM 7081 O O   . HOH L 4 .   ? 12.413  -36.350 30.197  1.00 30.83 ? 921 HOH C O   1 
HETATM 7082 O O   . HOH L 4 .   ? 12.474  -5.106  39.497  1.00 53.92 ? 922 HOH C O   1 
HETATM 7083 O O   . HOH L 4 .   ? 23.649  -6.555  39.523  1.00 37.01 ? 923 HOH C O   1 
HETATM 7084 O O   . HOH L 4 .   ? 7.788   -6.123  40.359  1.00 33.75 ? 924 HOH C O   1 
HETATM 7085 O O   . HOH L 4 .   ? -5.149  -23.010 43.097  1.00 36.04 ? 925 HOH C O   1 
HETATM 7086 O O   . HOH L 4 .   ? 1.562   -42.916 36.680  1.00 50.45 ? 926 HOH C O   1 
HETATM 7087 O O   . HOH L 4 .   ? 12.349  -10.073 21.441  1.00 34.28 ? 927 HOH C O   1 
HETATM 7088 O O   . HOH L 4 .   ? -1.934  -44.060 26.567  1.00 42.84 ? 928 HOH C O   1 
HETATM 7089 O O   . HOH L 4 .   ? 18.473  -19.283 46.768  1.00 33.99 ? 929 HOH C O   1 
HETATM 7090 O O   . HOH L 4 .   ? 14.965  -28.116 27.287  1.00 49.29 ? 930 HOH C O   1 
HETATM 7091 O O   . HOH L 4 .   ? 9.772   -11.584 32.296  1.00 44.39 ? 931 HOH C O   1 
HETATM 7092 O O   . HOH L 4 .   ? -12.253 -24.935 33.395  1.00 43.08 ? 932 HOH C O   1 
HETATM 7093 O O   . HOH L 4 .   ? -2.551  -23.865 44.296  1.00 34.17 ? 933 HOH C O   1 
HETATM 7094 O O   . HOH L 4 .   ? -14.036 -23.888 36.407  1.00 39.68 ? 934 HOH C O   1 
HETATM 7095 O O   . HOH L 4 .   ? 4.531   -9.778  31.010  1.00 41.20 ? 935 HOH C O   1 
HETATM 7096 O O   . HOH L 4 .   ? -11.193 -27.310 33.637  1.00 45.22 ? 936 HOH C O   1 
HETATM 7097 O O   . HOH L 4 .   ? 1.841   -34.607 38.192  1.00 32.30 ? 937 HOH C O   1 
HETATM 7098 O O   . HOH L 4 .   ? 10.971  -17.666 51.736  1.00 41.51 ? 938 HOH C O   1 
HETATM 7099 O O   . HOH L 4 .   ? 7.077   -16.620 23.884  1.00 44.22 ? 939 HOH C O   1 
HETATM 7100 O O   . HOH L 4 .   ? 3.309   -50.540 15.591  1.00 52.80 ? 940 HOH C O   1 
HETATM 7101 O O   . HOH L 4 .   ? -6.447  -29.173 27.336  1.00 57.33 ? 941 HOH C O   1 
HETATM 7102 O O   . HOH L 4 .   ? -10.658 -30.512 39.844  1.00 57.56 ? 942 HOH C O   1 
HETATM 7103 O O   . HOH L 4 .   ? -2.635  -28.666 49.356  1.00 44.19 ? 943 HOH C O   1 
HETATM 7104 O O   . HOH L 4 .   ? 20.203  -5.034  53.668  1.00 36.99 ? 944 HOH C O   1 
HETATM 7105 O O   . HOH L 4 .   ? 2.288   -11.718 51.059  1.00 41.96 ? 945 HOH C O   1 
HETATM 7106 O O   . HOH L 4 .   ? -2.159  -4.738  28.987  1.00 30.02 ? 946 HOH C O   1 
HETATM 7107 O O   . HOH L 4 .   ? 7.803   -9.967  30.942  1.00 35.95 ? 947 HOH C O   1 
HETATM 7108 O O   . HOH L 4 .   ? 18.570  11.638  34.037  1.00 44.16 ? 948 HOH C O   1 
HETATM 7109 O O   . HOH L 4 .   ? 1.716   -10.579 28.874  1.00 51.65 ? 949 HOH C O   1 
HETATM 7110 O O   . HOH L 4 .   ? 0.506   -43.709 20.056  1.00 49.78 ? 950 HOH C O   1 
HETATM 7111 O O   . HOH L 4 .   ? 4.095   -21.873 51.135  1.00 47.92 ? 951 HOH C O   1 
HETATM 7112 O O   . HOH L 4 .   ? -11.168 -14.304 41.673  1.00 36.21 ? 952 HOH C O   1 
HETATM 7113 O O   . HOH L 4 .   ? 9.656   3.951   49.570  1.00 42.59 ? 953 HOH C O   1 
HETATM 7114 O O   . HOH L 4 .   ? 14.214  -10.884 28.856  1.00 40.51 ? 954 HOH C O   1 
HETATM 7115 O O   . HOH L 4 .   ? 19.348  -18.054 49.045  1.00 46.64 ? 955 HOH C O   1 
HETATM 7116 O O   . HOH L 4 .   ? -6.808  -12.885 49.247  1.00 55.37 ? 956 HOH C O   1 
HETATM 7117 O O   . HOH L 4 .   ? -2.699  -36.075 44.191  1.00 64.29 ? 957 HOH C O   1 
HETATM 7118 O O   . HOH L 4 .   ? -12.421 -7.371  42.094  1.00 42.16 ? 958 HOH C O   1 
HETATM 7119 O O   . HOH L 4 .   ? 15.250  8.415   40.488  1.00 47.64 ? 959 HOH C O   1 
HETATM 7120 O O   . HOH L 4 .   ? -3.443  -30.185 46.477  1.00 46.96 ? 960 HOH C O   1 
HETATM 7121 O O   . HOH L 4 .   ? -12.698 -22.430 41.924  1.00 42.15 ? 961 HOH C O   1 
HETATM 7122 O O   . HOH L 4 .   ? -11.620 -14.603 19.334  1.00 64.78 ? 962 HOH C O   1 
HETATM 7123 O O   . HOH L 4 .   ? 13.790  -18.928 47.845  1.00 43.01 ? 963 HOH C O   1 
HETATM 7124 O O   . HOH L 4 .   ? 10.607  -18.926 17.934  1.00 53.34 ? 964 HOH C O   1 
HETATM 7125 O O   . HOH L 4 .   ? 29.039  -20.987 45.179  1.00 47.73 ? 965 HOH C O   1 
HETATM 7126 O O   . HOH L 4 .   ? 3.028   -44.072 38.619  1.00 54.38 ? 966 HOH C O   1 
HETATM 7127 O O   . HOH L 4 .   ? 0.808   -47.752 21.175  1.00 38.93 ? 967 HOH C O   1 
HETATM 7128 O O   . HOH L 4 .   ? 20.610  -20.481 44.375  1.00 67.07 ? 968 HOH C O   1 
HETATM 7129 O O   . HOH M 4 .   ? 23.309  -29.641 21.968  1.00 21.22 ? 802 HOH D O   1 
HETATM 7130 O O   . HOH M 4 .   ? 22.416  -26.254 22.908  1.00 24.06 ? 803 HOH D O   1 
HETATM 7131 O O   . HOH M 4 .   ? 10.830  -23.521 25.293  1.00 25.96 ? 804 HOH D O   1 
HETATM 7132 O O   . HOH M 4 .   ? 13.544  -22.021 28.282  1.00 22.55 ? 805 HOH D O   1 
HETATM 7133 O O   . HOH M 4 .   ? 22.798  -33.640 17.486  1.00 15.55 ? 806 HOH D O   1 
HETATM 7134 O O   . HOH M 4 .   ? 17.357  -35.795 35.460  1.00 20.50 ? 807 HOH D O   1 
HETATM 7135 O O   . HOH M 4 .   ? 18.969  -25.658 21.429  1.00 18.99 ? 808 HOH D O   1 
HETATM 7136 O O   . HOH M 4 .   ? 36.450  -34.680 13.083  1.00 22.18 ? 809 HOH D O   1 
HETATM 7137 O O   . HOH M 4 .   ? 21.689  -26.092 28.340  1.00 26.90 ? 810 HOH D O   1 
HETATM 7138 O O   . HOH M 4 .   ? 26.634  -31.549 23.383  1.00 20.07 ? 811 HOH D O   1 
HETATM 7139 O O   . HOH M 4 .   ? 28.549  -46.424 25.581  1.00 21.30 ? 812 HOH D O   1 
HETATM 7140 O O   . HOH M 4 .   ? 19.605  -31.692 17.835  1.00 13.59 ? 813 HOH D O   1 
HETATM 7141 O O   . HOH M 4 .   ? 27.974  -31.141 16.096  1.00 31.61 ? 814 HOH D O   1 
HETATM 7142 O O   . HOH M 4 .   ? 9.007   -45.977 42.472  1.00 18.45 ? 815 HOH D O   1 
HETATM 7143 O O   . HOH M 4 .   ? 14.511  -44.134 35.309  1.00 14.47 ? 816 HOH D O   1 
HETATM 7144 O O   . HOH M 4 .   ? 18.347  -36.127 12.280  1.00 23.91 ? 817 HOH D O   1 
HETATM 7145 O O   . HOH M 4 .   ? 18.577  -28.754 13.563  1.00 33.53 ? 818 HOH D O   1 
HETATM 7146 O O   . HOH M 4 .   ? 24.089  -37.443 23.387  1.00 16.86 ? 819 HOH D O   1 
HETATM 7147 O O   . HOH M 4 .   ? 34.433  -20.672 31.410  1.00 18.02 ? 820 HOH D O   1 
HETATM 7148 O O   . HOH M 4 .   ? 21.588  -27.897 32.512  1.00 19.22 ? 821 HOH D O   1 
HETATM 7149 O O   . HOH M 4 .   ? 17.687  -23.494 18.563  1.00 12.86 ? 822 HOH D O   1 
HETATM 7150 O O   . HOH M 4 .   ? 11.900  -27.744 50.559  1.00 22.45 ? 823 HOH D O   1 
HETATM 7151 O O   . HOH M 4 .   ? 20.042  -31.057 15.416  1.00 19.25 ? 824 HOH D O   1 
HETATM 7152 O O   . HOH M 4 .   ? 15.778  -36.262 24.057  1.00 22.97 ? 825 HOH D O   1 
HETATM 7153 O O   . HOH M 4 .   ? 21.471  -31.218 44.804  1.00 27.89 ? 826 HOH D O   1 
HETATM 7154 O O   . HOH M 4 .   ? 21.810  -29.804 34.480  1.00 18.46 ? 827 HOH D O   1 
HETATM 7155 O O   . HOH M 4 .   ? 19.948  -21.881 26.607  1.00 22.97 ? 828 HOH D O   1 
HETATM 7156 O O   . HOH M 4 .   ? 9.934   -45.854 39.913  1.00 20.87 ? 829 HOH D O   1 
HETATM 7157 O O   . HOH M 4 .   ? 14.473  -39.804 30.748  1.00 22.70 ? 830 HOH D O   1 
HETATM 7158 O O   . HOH M 4 .   ? 32.367  -33.344 -4.306  1.00 23.19 ? 831 HOH D O   1 
HETATM 7159 O O   . HOH M 4 .   ? 30.586  -43.296 29.234  1.00 22.89 ? 832 HOH D O   1 
HETATM 7160 O O   . HOH M 4 .   ? 40.832  -42.994 4.108   1.00 23.55 ? 833 HOH D O   1 
HETATM 7161 O O   . HOH M 4 .   ? 9.319   -42.644 13.487  1.00 24.82 ? 834 HOH D O   1 
HETATM 7162 O O   . HOH M 4 .   ? 13.674  -46.749 27.451  1.00 25.42 ? 835 HOH D O   1 
HETATM 7163 O O   . HOH M 4 .   ? 8.556   -50.905 20.777  1.00 25.42 ? 836 HOH D O   1 
HETATM 7164 O O   . HOH M 4 .   ? 17.449  -34.159 23.882  1.00 24.24 ? 837 HOH D O   1 
HETATM 7165 O O   . HOH M 4 .   ? 22.990  -50.868 27.844  1.00 22.12 ? 838 HOH D O   1 
HETATM 7166 O O   . HOH M 4 .   ? 14.443  -51.395 37.076  1.00 21.76 ? 839 HOH D O   1 
HETATM 7167 O O   . HOH M 4 .   ? 20.855  -23.813 21.880  1.00 16.22 ? 840 HOH D O   1 
HETATM 7168 O O   . HOH M 4 .   ? 13.946  -46.883 10.604  1.00 22.00 ? 841 HOH D O   1 
HETATM 7169 O O   . HOH M 4 .   ? 13.769  -56.109 9.624   1.00 27.73 ? 842 HOH D O   1 
HETATM 7170 O O   . HOH M 4 .   ? 34.391  -38.863 27.397  1.00 21.28 ? 843 HOH D O   1 
HETATM 7171 O O   . HOH M 4 .   ? 23.589  -51.642 34.734  1.00 24.32 ? 844 HOH D O   1 
HETATM 7172 O O   . HOH M 4 .   ? 37.465  -31.031 -0.665  1.00 23.98 ? 845 HOH D O   1 
HETATM 7173 O O   . HOH M 4 .   ? 14.406  -36.420 14.560  1.00 26.83 ? 846 HOH D O   1 
HETATM 7174 O O   . HOH M 4 .   ? 14.222  -44.774 29.307  1.00 20.80 ? 847 HOH D O   1 
HETATM 7175 O O   . HOH M 4 .   ? 13.860  -26.108 26.398  1.00 27.53 ? 848 HOH D O   1 
HETATM 7176 O O   . HOH M 4 .   ? 6.113   -43.124 39.641  1.00 30.71 ? 849 HOH D O   1 
HETATM 7177 O O   . HOH M 4 .   ? 8.107   -49.513 23.066  1.00 25.99 ? 850 HOH D O   1 
HETATM 7178 O O   . HOH M 4 .   ? 11.468  -53.179 34.329  1.00 28.62 ? 851 HOH D O   1 
HETATM 7179 O O   . HOH M 4 .   ? 13.892  -34.381 19.321  1.00 39.96 ? 852 HOH D O   1 
HETATM 7180 O O   . HOH M 4 .   ? 8.665   -39.789 47.442  1.00 37.12 ? 853 HOH D O   1 
HETATM 7181 O O   . HOH M 4 .   ? 27.783  -41.800 -4.727  1.00 26.30 ? 854 HOH D O   1 
HETATM 7182 O O   . HOH M 4 .   ? 14.201  -26.275 51.087  1.00 32.36 ? 855 HOH D O   1 
HETATM 7183 O O   . HOH M 4 .   ? 13.156  -29.764 18.191  1.00 32.39 ? 856 HOH D O   1 
HETATM 7184 O O   . HOH M 4 .   ? 14.513  -35.981 17.465  1.00 23.46 ? 857 HOH D O   1 
HETATM 7185 O O   . HOH M 4 .   ? 15.045  -32.214 26.915  1.00 31.93 ? 858 HOH D O   1 
HETATM 7186 O O   . HOH M 4 .   ? 10.144  -39.301 24.819  1.00 36.23 ? 859 HOH D O   1 
HETATM 7187 O O   . HOH M 4 .   ? 16.842  -42.665 31.969  1.00 29.33 ? 860 HOH D O   1 
HETATM 7188 O O   . HOH M 4 .   ? 27.962  -32.034 -9.787  1.00 32.37 ? 861 HOH D O   1 
HETATM 7189 O O   . HOH M 4 .   ? 32.582  -29.599 20.116  1.00 24.92 ? 862 HOH D O   1 
HETATM 7190 O O   . HOH M 4 .   ? 26.781  -39.287 -1.443  1.00 25.40 ? 863 HOH D O   1 
HETATM 7191 O O   . HOH M 4 .   ? 27.659  -34.949 -10.156 1.00 31.08 ? 864 HOH D O   1 
HETATM 7192 O O   . HOH M 4 .   ? 22.701  -38.989 37.010  1.00 21.96 ? 865 HOH D O   1 
HETATM 7193 O O   . HOH M 4 .   ? 22.226  -28.293 46.547  1.00 39.72 ? 866 HOH D O   1 
HETATM 7194 O O   . HOH M 4 .   ? 21.747  -30.275 37.744  1.00 30.73 ? 867 HOH D O   1 
HETATM 7195 O O   . HOH M 4 .   ? 24.102  -32.799 37.016  1.00 31.42 ? 868 HOH D O   1 
HETATM 7196 O O   . HOH M 4 .   ? 5.608   -33.810 46.431  1.00 28.77 ? 869 HOH D O   1 
HETATM 7197 O O   . HOH M 4 .   ? 25.254  -48.071 47.341  1.00 31.18 ? 870 HOH D O   1 
HETATM 7198 O O   . HOH M 4 .   ? 14.791  -23.067 15.400  1.00 27.55 ? 871 HOH D O   1 
HETATM 7199 O O   . HOH M 4 .   ? 28.728  -20.618 28.251  1.00 25.79 ? 872 HOH D O   1 
HETATM 7200 O O   . HOH M 4 .   ? 36.954  -36.518 6.156   1.00 32.62 ? 873 HOH D O   1 
HETATM 7201 O O   . HOH M 4 .   ? 25.014  -18.842 29.781  1.00 29.40 ? 874 HOH D O   1 
HETATM 7202 O O   . HOH M 4 .   ? 15.373  -35.948 12.133  1.00 30.69 ? 875 HOH D O   1 
HETATM 7203 O O   . HOH M 4 .   ? 15.422  -29.989 16.328  1.00 34.82 ? 876 HOH D O   1 
HETATM 7204 O O   . HOH M 4 .   ? 22.071  -53.911 16.172  1.00 29.88 ? 877 HOH D O   1 
HETATM 7205 O O   . HOH M 4 .   ? 12.445  -42.817 29.947  1.00 37.29 ? 878 HOH D O   1 
HETATM 7206 O O   . HOH M 4 .   ? 25.294  -32.547 9.759   1.00 32.15 ? 879 HOH D O   1 
HETATM 7207 O O   . HOH M 4 .   ? 37.761  -39.721 -6.553  1.00 31.19 ? 880 HOH D O   1 
HETATM 7208 O O   . HOH M 4 .   ? 21.353  -32.765 13.922  1.00 31.70 ? 881 HOH D O   1 
HETATM 7209 O O   . HOH M 4 .   ? 36.936  -30.873 31.001  1.00 31.73 ? 882 HOH D O   1 
HETATM 7210 O O   . HOH M 4 .   ? 5.930   -51.403 20.039  1.00 32.40 ? 883 HOH D O   1 
HETATM 7211 O O   . HOH M 4 .   ? 25.162  -32.793 16.397  1.00 34.58 ? 884 HOH D O   1 
HETATM 7212 O O   . HOH M 4 .   ? 23.333  -35.255 38.946  1.00 33.39 ? 885 HOH D O   1 
HETATM 7213 O O   . HOH M 4 .   ? 37.153  -35.337 0.929   1.00 30.54 ? 886 HOH D O   1 
HETATM 7214 O O   . HOH M 4 .   ? 28.123  -20.927 25.475  1.00 41.43 ? 887 HOH D O   1 
HETATM 7215 O O   . HOH M 4 .   ? 38.978  -37.321 -1.866  1.00 25.98 ? 888 HOH D O   1 
HETATM 7216 O O   . HOH M 4 .   ? 13.322  -46.203 31.649  1.00 32.80 ? 889 HOH D O   1 
HETATM 7217 O O   . HOH M 4 .   ? 11.676  -52.179 5.947   1.00 39.00 ? 890 HOH D O   1 
HETATM 7218 O O   . HOH M 4 .   ? 30.349  -53.931 19.287  1.00 30.42 ? 891 HOH D O   1 
HETATM 7219 O O   . HOH M 4 .   ? 19.160  -55.394 17.538  1.00 32.46 ? 892 HOH D O   1 
HETATM 7220 O O   . HOH M 4 .   ? 28.213  -52.625 13.658  1.00 28.27 ? 893 HOH D O   1 
HETATM 7221 O O   . HOH M 4 .   ? 28.578  -43.008 -0.604  1.00 32.01 ? 894 HOH D O   1 
HETATM 7222 O O   . HOH M 4 .   ? 7.318   -50.077 31.086  1.00 33.53 ? 895 HOH D O   1 
HETATM 7223 O O   . HOH M 4 .   ? 12.041  -26.538 15.920  1.00 39.96 ? 896 HOH D O   1 
HETATM 7224 O O   . HOH M 4 .   ? 6.756   -44.765 42.566  1.00 28.84 ? 897 HOH D O   1 
HETATM 7225 O O   . HOH M 4 .   ? 16.033  -56.530 32.545  1.00 37.01 ? 898 HOH D O   1 
HETATM 7226 O O   . HOH M 4 .   ? 8.656   -41.596 59.080  1.00 41.23 ? 899 HOH D O   1 
HETATM 7227 O O   . HOH M 4 .   ? 28.311  -49.690 44.920  1.00 38.82 ? 900 HOH D O   1 
HETATM 7228 O O   . HOH M 4 .   ? 19.436  -54.519 15.079  1.00 40.72 ? 901 HOH D O   1 
HETATM 7229 O O   . HOH M 4 .   ? 30.911  -27.983 41.593  1.00 41.15 ? 902 HOH D O   1 
HETATM 7230 O O   . HOH M 4 .   ? 12.120  -25.729 24.581  1.00 29.52 ? 903 HOH D O   1 
HETATM 7231 O O   . HOH M 4 .   ? 22.922  -25.022 25.594  1.00 34.75 ? 904 HOH D O   1 
HETATM 7232 O O   . HOH M 4 .   ? 13.144  -40.105 27.829  1.00 39.28 ? 905 HOH D O   1 
HETATM 7233 O O   . HOH M 4 .   ? 29.554  -46.534 28.182  1.00 34.57 ? 906 HOH D O   1 
HETATM 7234 O O   . HOH M 4 .   ? 34.234  -34.693 9.210   1.00 37.92 ? 907 HOH D O   1 
HETATM 7235 O O   . HOH M 4 .   ? 9.999   -27.225 24.211  1.00 29.26 ? 908 HOH D O   1 
HETATM 7236 O O   . HOH M 4 .   ? 25.347  -54.576 12.769  1.00 44.08 ? 909 HOH D O   1 
HETATM 7237 O O   . HOH M 4 .   ? 27.538  -28.973 41.964  1.00 33.98 ? 910 HOH D O   1 
HETATM 7238 O O   . HOH M 4 .   ? 34.242  -34.637 -10.664 1.00 34.56 ? 911 HOH D O   1 
HETATM 7239 O O   . HOH M 4 .   ? 12.273  -42.177 52.820  1.00 36.18 ? 912 HOH D O   1 
HETATM 7240 O O   . HOH M 4 .   ? 8.666   -25.140 25.557  1.00 40.97 ? 913 HOH D O   1 
HETATM 7241 O O   . HOH M 4 .   ? 27.499  -39.841 -9.915  1.00 38.71 ? 914 HOH D O   1 
HETATM 7242 O O   . HOH M 4 .   ? 14.683  -37.075 26.506  1.00 31.78 ? 915 HOH D O   1 
HETATM 7243 O O   . HOH M 4 .   ? 14.465  -51.354 4.645   1.00 45.55 ? 916 HOH D O   1 
HETATM 7244 O O   . HOH M 4 .   ? 20.156  -54.604 39.419  1.00 36.62 ? 917 HOH D O   1 
HETATM 7245 O O   . HOH M 4 .   ? 26.992  -46.062 45.655  1.00 46.07 ? 918 HOH D O   1 
HETATM 7246 O O   . HOH M 4 .   ? 7.296   -55.777 11.586  1.00 40.17 ? 919 HOH D O   1 
HETATM 7247 O O   . HOH M 4 .   ? 2.384   -35.613 48.825  1.00 46.89 ? 920 HOH D O   1 
HETATM 7248 O O   . HOH M 4 .   ? 24.684  -53.886 33.794  1.00 33.18 ? 921 HOH D O   1 
HETATM 7249 O O   . HOH M 4 .   ? 15.459  -39.295 35.067  1.00 34.67 ? 922 HOH D O   1 
HETATM 7250 O O   . HOH M 4 .   ? 3.798   -58.016 21.936  1.00 55.36 ? 923 HOH D O   1 
HETATM 7251 O O   . HOH M 4 .   ? 32.215  -50.765 12.445  1.00 49.20 ? 924 HOH D O   1 
HETATM 7252 O O   . HOH M 4 .   ? 19.085  -21.668 46.330  1.00 38.04 ? 925 HOH D O   1 
HETATM 7253 O O   . HOH M 4 .   ? 4.501   -60.140 20.794  1.00 41.09 ? 926 HOH D O   1 
HETATM 7254 O O   . HOH M 4 .   ? 19.235  -53.593 42.768  1.00 44.49 ? 927 HOH D O   1 
HETATM 7255 O O   . HOH M 4 .   ? 28.909  -51.094 30.708  1.00 41.06 ? 928 HOH D O   1 
HETATM 7256 O O   . HOH M 4 .   ? 21.351  -22.474 23.931  1.00 29.63 ? 929 HOH D O   1 
HETATM 7257 O O   . HOH M 4 .   ? 23.484  -40.139 46.922  1.00 36.32 ? 930 HOH D O   1 
HETATM 7258 O O   . HOH M 4 .   ? 10.286  -29.522 21.117  1.00 41.04 ? 931 HOH D O   1 
HETATM 7259 O O   . HOH M 4 .   ? 27.212  -22.398 28.932  1.00 31.66 ? 932 HOH D O   1 
HETATM 7260 O O   . HOH M 4 .   ? 35.579  -37.242 28.833  1.00 45.87 ? 933 HOH D O   1 
HETATM 7261 O O   . HOH M 4 .   ? 8.548   -33.098 49.908  1.00 40.30 ? 934 HOH D O   1 
HETATM 7262 O O   . HOH M 4 .   ? 11.567  -48.409 30.212  1.00 44.14 ? 935 HOH D O   1 
HETATM 7263 O O   . HOH M 4 .   ? 7.760   -36.042 51.743  1.00 41.53 ? 936 HOH D O   1 
HETATM 7264 O O   . HOH M 4 .   ? 29.063  -33.545 7.851   1.00 49.71 ? 937 HOH D O   1 
HETATM 7265 O O   . HOH M 4 .   ? 7.497   -43.527 10.593  1.00 32.44 ? 938 HOH D O   1 
HETATM 7266 O O   . HOH M 4 .   ? 18.009  -44.225 6.281   1.00 30.28 ? 939 HOH D O   1 
HETATM 7267 O O   . HOH M 4 .   ? 26.263  -57.076 5.469   1.00 46.25 ? 940 HOH D O   1 
HETATM 7268 O O   . HOH M 4 .   ? 28.145  -28.043 21.139  1.00 40.95 ? 941 HOH D O   1 
HETATM 7269 O O   . HOH M 4 .   ? 40.250  -38.784 25.401  1.00 52.40 ? 942 HOH D O   1 
HETATM 7270 O O   . HOH M 4 .   ? 19.944  -56.142 30.402  1.00 41.21 ? 943 HOH D O   1 
HETATM 7271 O O   . HOH M 4 .   ? 21.238  -34.827 9.633   1.00 35.32 ? 944 HOH D O   1 
HETATM 7272 O O   . HOH M 4 .   ? 30.865  -52.867 13.354  1.00 35.76 ? 945 HOH D O   1 
HETATM 7273 O O   . HOH M 4 .   ? 20.368  -52.753 45.551  1.00 42.42 ? 946 HOH D O   1 
HETATM 7274 O O   . HOH M 4 .   ? 12.909  -57.302 20.801  1.00 44.06 ? 947 HOH D O   1 
HETATM 7275 O O   . HOH M 4 .   ? 30.137  -31.800 37.218  1.00 39.76 ? 948 HOH D O   1 
HETATM 7276 O O   . HOH M 4 .   ? 25.448  -36.346 4.251   1.00 36.59 ? 949 HOH D O   1 
HETATM 7277 O O   . HOH M 4 .   ? 13.960  -50.863 46.132  1.00 55.39 ? 950 HOH D O   1 
HETATM 7278 O O   . HOH M 4 .   ? 11.962  -56.889 18.088  1.00 48.45 ? 951 HOH D O   1 
HETATM 7279 O O   . HOH M 4 .   ? 29.993  -34.119 36.300  1.00 37.26 ? 952 HOH D O   1 
HETATM 7280 O O   . HOH M 4 .   ? 14.146  -29.478 13.507  1.00 42.40 ? 953 HOH D O   1 
HETATM 7281 O O   . HOH M 4 .   ? 7.607   -40.216 20.780  1.00 45.56 ? 954 HOH D O   1 
HETATM 7282 O O   . HOH M 4 .   ? 12.197  -37.082 26.178  1.00 37.81 ? 955 HOH D O   1 
HETATM 7283 O O   . HOH M 4 .   ? 9.724   -57.464 17.510  1.00 43.58 ? 956 HOH D O   1 
HETATM 7284 O O   . HOH M 4 .   ? 5.433   -35.129 51.203  1.00 53.90 ? 957 HOH D O   1 
HETATM 7285 O O   . HOH M 4 .   ? 7.032   -36.868 56.410  1.00 58.64 ? 958 HOH D O   1 
HETATM 7286 O O   . HOH M 4 .   ? 38.217  -32.243 33.189  1.00 44.61 ? 959 HOH D O   1 
HETATM 7287 O O   . HOH M 4 .   ? 14.012  -23.775 52.021  1.00 43.91 ? 960 HOH D O   1 
HETATM 7288 O O   . HOH M 4 .   ? 13.053  -35.545 23.961  1.00 46.35 ? 961 HOH D O   1 
HETATM 7289 O O   . HOH M 4 .   ? 12.723  -48.916 4.298   1.00 37.43 ? 962 HOH D O   1 
HETATM 7290 O O   . HOH M 4 .   ? 29.361  -19.526 30.114  1.00 38.74 ? 963 HOH D O   1 
HETATM 7291 O O   . HOH M 4 .   ? 20.675  -25.562 46.112  1.00 41.10 ? 964 HOH D O   1 
HETATM 7292 O O   . HOH M 4 .   ? 8.792   -34.876 55.093  1.00 54.25 ? 965 HOH D O   1 
HETATM 7293 O O   . HOH M 4 .   ? 14.207  -57.634 18.172  1.00 46.58 ? 966 HOH D O   1 
HETATM 7294 O O   . HOH M 4 .   ? 12.593  -33.391 10.914  1.00 47.56 ? 967 HOH D O   1 
HETATM 7295 O O   . HOH M 4 .   ? 23.040  -30.668 45.922  1.00 45.08 ? 968 HOH D O   1 
HETATM 7296 O O   . HOH M 4 .   ? 21.843  -28.074 48.767  1.00 54.94 ? 969 HOH D O   1 
HETATM 7297 O O   . HOH M 4 .   ? 25.384  -24.198 25.936  1.00 42.39 ? 970 HOH D O   1 
HETATM 7298 O O   . HOH M 4 .   ? 27.141  -47.868 36.320  1.00 46.77 ? 971 HOH D O   1 
HETATM 7299 O O   . HOH M 4 .   ? 26.532  -54.601 22.736  1.00 49.83 ? 972 HOH D O   1 
HETATM 7300 O O   . HOH M 4 .   ? 27.588  -20.518 31.906  1.00 41.41 ? 973 HOH D O   1 
HETATM 7301 O O   . HOH M 4 .   ? 14.289  -35.473 21.730  1.00 40.40 ? 974 HOH D O   1 
HETATM 7302 O O   . HOH M 4 .   ? 19.210  -40.644 51.102  1.00 50.81 ? 975 HOH D O   1 
HETATM 7303 O O   . HOH M 4 .   ? 16.848  -23.643 14.069  1.00 21.52 ? 976 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   40  ?   ?   ?   A . n 
A 1 2   SER 2   41  41  SER SER A . n 
A 1 3   HIS 3   42  42  HIS HIS A . n 
A 1 4   GLY 4   43  43  GLY GLY A . n 
A 1 5   ARG 5   44  44  ARG ARG A . n 
A 1 6   SER 6   45  45  SER SER A . n 
A 1 7   ARG 7   46  46  ARG ARG A . n 
A 1 8   PHE 8   47  47  PHE PHE A . n 
A 1 9   VAL 9   48  48  VAL VAL A . n 
A 1 10  LYS 10  49  49  LYS LYS A . n 
A 1 11  LYS 11  50  50  LYS LYS A . n 
A 1 12  ASP 12  51  51  ASP ASP A . n 
A 1 13  GLY 13  52  52  GLY GLY A . n 
A 1 14  HIS 14  53  53  HIS HIS A . n 
A 1 15  CYS 15  54  54  CYS CYS A . n 
A 1 16  ASN 16  55  55  ASN ASN A . n 
A 1 17  VAL 17  56  56  VAL VAL A . n 
A 1 18  GLN 18  57  57  GLN GLN A . n 
A 1 19  PHE 19  58  58  PHE PHE A . n 
A 1 20  ILE 20  59  59  ILE ILE A . n 
A 1 21  ASN 21  60  60  ASN ASN A . n 
A 1 22  VAL 22  61  61  VAL VAL A . n 
A 1 23  GLY 23  62  62  GLY GLY A . n 
A 1 24  GLU 24  63  63  GLU ALA A . n 
A 1 25  LYS 25  64  64  LYS ALA A . n 
A 1 26  ARG 26  189 189 ARG ALA A . n 
A 1 27  ASN 27  190 190 ASN ALA A . n 
A 1 28  GLU 28  191 191 GLU GLU A . n 
A 1 29  THR 29  192 192 THR THR A . n 
A 1 30  LEU 30  193 193 LEU LEU A . n 
A 1 31  VAL 31  194 194 VAL VAL A . n 
A 1 32  PHE 32  195 195 PHE PHE A . n 
A 1 33  SER 33  196 196 SER SER A . n 
A 1 34  HIS 34  197 197 HIS HIS A . n 
A 1 35  ASN 35  198 198 ASN ASN A . n 
A 1 36  ALA 36  199 199 ALA ALA A . n 
A 1 37  VAL 37  200 200 VAL VAL A . n 
A 1 38  ILE 38  201 201 ILE ILE A . n 
A 1 39  ALA 39  202 202 ALA ALA A . n 
A 1 40  MET 40  203 203 MET MET A . n 
A 1 41  ARG 41  204 204 ARG ARG A . n 
A 1 42  ASP 42  205 205 ASP ASP A . n 
A 1 43  GLY 43  206 206 GLY GLY A . n 
A 1 44  LYS 44  207 207 LYS LYS A . n 
A 1 45  LEU 45  208 208 LEU LEU A . n 
A 1 46  CYS 46  209 209 CYS CYS A . n 
A 1 47  LEU 47  210 210 LEU LEU A . n 
A 1 48  MET 48  211 211 MET MET A . n 
A 1 49  TRP 49  212 212 TRP TRP A . n 
A 1 50  ARG 50  213 213 ARG ARG A . n 
A 1 51  VAL 51  214 214 VAL VAL A . n 
A 1 52  GLY 52  215 215 GLY GLY A . n 
A 1 53  ASN 53  216 216 ASN ASN A . n 
A 1 54  LEU 54  217 217 LEU LEU A . n 
A 1 55  GLN 55  218 218 GLN GLN A . n 
A 1 56  LYS 56  219 219 LYS LYS A . n 
A 1 57  SER 57  220 220 SER SER A . n 
A 1 58  HIS 58  221 221 HIS HIS A . n 
A 1 59  LEU 59  222 222 LEU LEU A . n 
A 1 60  VAL 60  223 223 VAL VAL A . n 
A 1 61  GLU 61  224 224 GLU GLU A . n 
A 1 62  ALA 62  225 225 ALA ALA A . n 
A 1 63  HIS 63  226 226 HIS HIS A . n 
A 1 64  VAL 64  227 227 VAL VAL A . n 
A 1 65  ARG 65  228 228 ARG ARG A . n 
A 1 66  ALA 66  229 229 ALA ALA A . n 
A 1 67  GLN 67  230 230 GLN GLN A . n 
A 1 68  LEU 68  231 231 LEU LEU A . n 
A 1 69  LEU 69  232 232 LEU LEU A . n 
A 1 70  LYS 70  233 233 LYS LYS A . n 
A 1 71  SER 71  234 234 SER SER A . n 
A 1 72  ARG 72  235 235 ARG ARG A . n 
A 1 73  ILE 73  236 236 ILE ILE A . n 
A 1 74  THR 74  237 237 THR THR A . n 
A 1 75  SER 75  238 238 SER SER A . n 
A 1 76  GLU 76  239 239 GLU GLU A . n 
A 1 77  GLY 77  240 240 GLY GLY A . n 
A 1 78  GLU 78  241 241 GLU GLU A . n 
A 1 79  TYR 79  242 242 TYR TYR A . n 
A 1 80  ILE 80  243 243 ILE ILE A . n 
A 1 81  PRO 81  244 244 PRO PRO A . n 
A 1 82  LEU 82  245 245 LEU LEU A . n 
A 1 83  ASP 83  246 246 ASP ASP A . n 
A 1 84  GLN 84  247 247 GLN GLN A . n 
A 1 85  ILE 85  248 248 ILE ILE A . n 
A 1 86  ASP 86  249 249 ASP ASP A . n 
A 1 87  ILE 87  250 250 ILE ILE A . n 
A 1 88  ASN 88  251 251 ASN ASN A . n 
A 1 89  VAL 89  252 252 VAL VAL A . n 
A 1 90  GLY 90  253 253 GLY GLY A . n 
A 1 91  PHE 91  254 254 PHE PHE A . n 
A 1 92  ASP 92  255 255 ASP ASP A . n 
A 1 93  SER 93  256 256 SER SER A . n 
A 1 94  GLY 94  257 257 GLY GLY A . n 
A 1 95  ILE 95  258 258 ILE ILE A . n 
A 1 96  ASP 96  259 259 ASP ASP A . n 
A 1 97  ARG 97  260 260 ARG ARG A . n 
A 1 98  ILE 98  261 261 ILE ILE A . n 
A 1 99  PHE 99  262 262 PHE PHE A . n 
A 1 100 LEU 100 263 263 LEU LEU A . n 
A 1 101 VAL 101 264 264 VAL VAL A . n 
A 1 102 SER 102 265 265 SER SER A . n 
A 1 103 PRO 103 266 266 PRO PRO A . n 
A 1 104 ILE 104 267 267 ILE ILE A . n 
A 1 105 THR 105 268 268 THR THR A . n 
A 1 106 ILE 106 269 269 ILE ILE A . n 
A 1 107 VAL 107 270 270 VAL VAL A . n 
A 1 108 HIS 108 271 271 HIS HIS A . n 
A 1 109 GLU 109 272 272 GLU GLU A . n 
A 1 110 ILE 110 273 273 ILE ILE A . n 
A 1 111 ASP 111 274 274 ASP ASP A . n 
A 1 112 GLU 112 275 275 GLU GLU A . n 
A 1 113 ASP 113 276 276 ASP ASP A . n 
A 1 114 SER 114 277 277 SER SER A . n 
A 1 115 PRO 115 278 278 PRO PRO A . n 
A 1 116 LEU 116 279 279 LEU LEU A . n 
A 1 117 TYR 117 280 280 TYR TYR A . n 
A 1 118 ASP 118 281 281 ASP ASP A . n 
A 1 119 LEU 119 282 282 LEU LEU A . n 
A 1 120 SER 120 283 283 SER SER A . n 
A 1 121 LYS 121 284 284 LYS LYS A . n 
A 1 122 GLN 122 285 285 GLN GLN A . n 
A 1 123 ASP 123 286 286 ASP ASP A . n 
A 1 124 ILE 124 287 287 ILE ILE A . n 
A 1 125 ASP 125 288 288 ASP ASP A . n 
A 1 126 ASN 126 289 289 ASN ASN A . n 
A 1 127 ALA 127 290 290 ALA ALA A . n 
A 1 128 ASP 128 291 291 ASP ASP A . n 
A 1 129 PHE 129 292 292 PHE PHE A . n 
A 1 130 GLU 130 293 293 GLU GLU A . n 
A 1 131 ILE 131 294 294 ILE ILE A . n 
A 1 132 VAL 132 295 295 VAL VAL A . n 
A 1 133 VAL 133 296 296 VAL VAL A . n 
A 1 134 ILE 134 297 297 ILE ILE A . n 
A 1 135 LEU 135 298 298 LEU LEU A . n 
A 1 136 GLU 136 299 299 GLU GLU A . n 
A 1 137 GLY 137 300 300 GLY GLY A . n 
A 1 138 MET 138 301 301 MET MET A . n 
A 1 139 VAL 139 302 302 VAL VAL A . n 
A 1 140 GLU 140 303 303 GLU GLU A . n 
A 1 141 ALA 141 304 304 ALA ALA A . n 
A 1 142 THR 142 305 305 THR THR A . n 
A 1 143 ALA 143 306 306 ALA ALA A . n 
A 1 144 MET 144 307 307 MET MET A . n 
A 1 145 THR 145 308 308 THR THR A . n 
A 1 146 LYS 146 309 309 LYS LYS A . n 
A 1 147 GLN 147 310 310 GLN GLN A . n 
A 1 148 CYS 148 311 311 CYS CYS A . n 
A 1 149 ARG 149 312 312 ARG ARG A . n 
A 1 150 SER 150 313 313 SER SER A . n 
A 1 151 SER 151 314 314 SER SER A . n 
A 1 152 TYR 152 315 315 TYR TYR A . n 
A 1 153 LEU 153 316 316 LEU LEU A . n 
A 1 154 ALA 154 317 317 ALA ALA A . n 
A 1 155 ASN 155 318 318 ASN ASN A . n 
A 1 156 GLU 156 319 319 GLU GLU A . n 
A 1 157 ILE 157 320 320 ILE ILE A . n 
A 1 158 LEU 158 321 321 LEU LEU A . n 
A 1 159 TRP 159 322 322 TRP TRP A . n 
A 1 160 GLY 160 323 323 GLY GLY A . n 
A 1 161 HIS 161 324 324 HIS HIS A . n 
A 1 162 ARG 162 325 325 ARG ARG A . n 
A 1 163 TYR 163 326 326 TYR TYR A . n 
A 1 164 GLU 164 327 327 GLU GLU A . n 
A 1 165 PRO 165 328 328 PRO PRO A . n 
A 1 166 VAL 166 329 329 VAL VAL A . n 
A 1 167 LEU 167 330 330 LEU LEU A . n 
A 1 168 PHE 168 331 331 PHE PHE A . n 
A 1 169 GLU 169 332 332 GLU GLU A . n 
A 1 170 GLU 170 333 333 GLU GLU A . n 
A 1 171 LYS 171 334 334 LYS LYS A . n 
A 1 172 HIS 172 335 335 HIS HIS A . n 
A 1 173 TYR 173 336 336 TYR TYR A . n 
A 1 174 TYR 174 337 337 TYR TYR A . n 
A 1 175 LYS 175 338 338 LYS LYS A . n 
A 1 176 VAL 176 339 339 VAL VAL A . n 
A 1 177 ASP 177 340 340 ASP ASP A . n 
A 1 178 TYR 178 341 341 TYR TYR A . n 
A 1 179 SER 179 342 342 SER SER A . n 
A 1 180 ARG 180 343 343 ARG ARG A . n 
A 1 181 PHE 181 344 344 PHE PHE A . n 
A 1 182 HIS 182 345 345 HIS HIS A . n 
A 1 183 LYS 183 346 346 LYS LYS A . n 
A 1 184 THR 184 347 347 THR THR A . n 
A 1 185 TYR 185 348 348 TYR TYR A . n 
A 1 186 GLU 186 349 349 GLU GLU A . n 
A 1 187 VAL 187 350 350 VAL VAL A . n 
A 1 188 PRO 188 351 351 PRO PRO A . n 
A 1 189 ASN 189 352 352 ASN ASN A . n 
A 1 190 THR 190 353 353 THR THR A . n 
A 1 191 PRO 191 354 354 PRO PRO A . n 
A 1 192 LEU 192 355 355 LEU LEU A . n 
A 1 193 CYS 193 356 356 CYS CYS A . n 
A 1 194 SER 194 357 357 SER SER A . n 
A 1 195 ALA 195 358 358 ALA ALA A . n 
A 1 196 ARG 196 359 359 ARG ARG A . n 
A 1 197 ASP 197 360 360 ASP ASP A . n 
A 1 198 LEU 198 361 361 LEU LEU A . n 
A 1 199 ALA 199 362 362 ALA ALA A . n 
A 1 200 GLU 200 363 363 GLU GLU A . n 
A 1 201 LYS 201 364 364 LYS LYS A . n 
A 1 202 LYS 202 365 365 LYS LYS A . n 
A 1 203 TYR 203 366 366 TYR TYR A . n 
A 1 204 ILE 204 367 367 ILE ILE A . n 
A 1 205 LEU 205 368 368 LEU LEU A . n 
A 1 206 SER 206 369 369 SER SER A . n 
A 1 207 ASN 207 370 370 ASN ASN A . n 
A 1 208 ALA 208 371 ?   ?   ?   A . n 
B 1 1   GLY 1   40  ?   ?   ?   B . n 
B 1 2   SER 2   41  41  SER SER B . n 
B 1 3   HIS 3   42  42  HIS HIS B . n 
B 1 4   GLY 4   43  43  GLY GLY B . n 
B 1 5   ARG 5   44  44  ARG ARG B . n 
B 1 6   SER 6   45  45  SER SER B . n 
B 1 7   ARG 7   46  46  ARG ARG B . n 
B 1 8   PHE 8   47  47  PHE PHE B . n 
B 1 9   VAL 9   48  48  VAL VAL B . n 
B 1 10  LYS 10  49  49  LYS LYS B . n 
B 1 11  LYS 11  50  50  LYS LYS B . n 
B 1 12  ASP 12  51  51  ASP ASP B . n 
B 1 13  GLY 13  52  52  GLY GLY B . n 
B 1 14  HIS 14  53  53  HIS HIS B . n 
B 1 15  CYS 15  54  54  CYS CYS B . n 
B 1 16  ASN 16  55  55  ASN ASN B . n 
B 1 17  VAL 17  56  56  VAL VAL B . n 
B 1 18  GLN 18  57  57  GLN GLN B . n 
B 1 19  PHE 19  58  58  PHE PHE B . n 
B 1 20  ILE 20  59  59  ILE ILE B . n 
B 1 21  ASN 21  60  60  ASN ASN B . n 
B 1 22  VAL 22  61  61  VAL VAL B . n 
B 1 23  GLY 23  62  62  GLY GLY B . n 
B 1 24  GLU 24  63  63  GLU GLU B . n 
B 1 25  LYS 25  64  64  LYS ALA B . n 
B 1 26  ARG 26  189 189 ARG ALA B . n 
B 1 27  ASN 27  190 190 ASN ALA B . n 
B 1 28  GLU 28  191 191 GLU ALA B . n 
B 1 29  THR 29  192 192 THR THR B . n 
B 1 30  LEU 30  193 193 LEU LEU B . n 
B 1 31  VAL 31  194 194 VAL VAL B . n 
B 1 32  PHE 32  195 195 PHE PHE B . n 
B 1 33  SER 33  196 196 SER SER B . n 
B 1 34  HIS 34  197 197 HIS HIS B . n 
B 1 35  ASN 35  198 198 ASN ASN B . n 
B 1 36  ALA 36  199 199 ALA ALA B . n 
B 1 37  VAL 37  200 200 VAL VAL B . n 
B 1 38  ILE 38  201 201 ILE ILE B . n 
B 1 39  ALA 39  202 202 ALA ALA B . n 
B 1 40  MET 40  203 203 MET MET B . n 
B 1 41  ARG 41  204 204 ARG ARG B . n 
B 1 42  ASP 42  205 205 ASP ASP B . n 
B 1 43  GLY 43  206 206 GLY GLY B . n 
B 1 44  LYS 44  207 207 LYS LYS B . n 
B 1 45  LEU 45  208 208 LEU LEU B . n 
B 1 46  CYS 46  209 209 CYS CYS B . n 
B 1 47  LEU 47  210 210 LEU LEU B . n 
B 1 48  MET 48  211 211 MET MET B . n 
B 1 49  TRP 49  212 212 TRP TRP B . n 
B 1 50  ARG 50  213 213 ARG ARG B . n 
B 1 51  VAL 51  214 214 VAL VAL B . n 
B 1 52  GLY 52  215 215 GLY GLY B . n 
B 1 53  ASN 53  216 216 ASN ASN B . n 
B 1 54  LEU 54  217 217 LEU LEU B . n 
B 1 55  GLN 55  218 218 GLN GLN B . n 
B 1 56  LYS 56  219 219 LYS LYS B . n 
B 1 57  SER 57  220 220 SER SER B . n 
B 1 58  HIS 58  221 221 HIS HIS B . n 
B 1 59  LEU 59  222 222 LEU LEU B . n 
B 1 60  VAL 60  223 223 VAL VAL B . n 
B 1 61  GLU 61  224 224 GLU GLU B . n 
B 1 62  ALA 62  225 225 ALA ALA B . n 
B 1 63  HIS 63  226 226 HIS HIS B . n 
B 1 64  VAL 64  227 227 VAL VAL B . n 
B 1 65  ARG 65  228 228 ARG ARG B . n 
B 1 66  ALA 66  229 229 ALA ALA B . n 
B 1 67  GLN 67  230 230 GLN GLN B . n 
B 1 68  LEU 68  231 231 LEU LEU B . n 
B 1 69  LEU 69  232 232 LEU LEU B . n 
B 1 70  LYS 70  233 233 LYS LYS B . n 
B 1 71  SER 71  234 234 SER SER B . n 
B 1 72  ARG 72  235 235 ARG ARG B . n 
B 1 73  ILE 73  236 236 ILE ILE B . n 
B 1 74  THR 74  237 237 THR THR B . n 
B 1 75  SER 75  238 238 SER SER B . n 
B 1 76  GLU 76  239 239 GLU GLU B . n 
B 1 77  GLY 77  240 240 GLY GLY B . n 
B 1 78  GLU 78  241 241 GLU GLU B . n 
B 1 79  TYR 79  242 242 TYR TYR B . n 
B 1 80  ILE 80  243 243 ILE ILE B . n 
B 1 81  PRO 81  244 244 PRO PRO B . n 
B 1 82  LEU 82  245 245 LEU LEU B . n 
B 1 83  ASP 83  246 246 ASP ASP B . n 
B 1 84  GLN 84  247 247 GLN GLN B . n 
B 1 85  ILE 85  248 248 ILE ILE B . n 
B 1 86  ASP 86  249 249 ASP ASP B . n 
B 1 87  ILE 87  250 250 ILE ILE B . n 
B 1 88  ASN 88  251 251 ASN ASN B . n 
B 1 89  VAL 89  252 252 VAL VAL B . n 
B 1 90  GLY 90  253 253 GLY GLY B . n 
B 1 91  PHE 91  254 254 PHE PHE B . n 
B 1 92  ASP 92  255 255 ASP ASP B . n 
B 1 93  SER 93  256 256 SER SER B . n 
B 1 94  GLY 94  257 257 GLY GLY B . n 
B 1 95  ILE 95  258 258 ILE ILE B . n 
B 1 96  ASP 96  259 259 ASP ASP B . n 
B 1 97  ARG 97  260 260 ARG ARG B . n 
B 1 98  ILE 98  261 261 ILE ILE B . n 
B 1 99  PHE 99  262 262 PHE PHE B . n 
B 1 100 LEU 100 263 263 LEU LEU B . n 
B 1 101 VAL 101 264 264 VAL VAL B . n 
B 1 102 SER 102 265 265 SER SER B . n 
B 1 103 PRO 103 266 266 PRO PRO B . n 
B 1 104 ILE 104 267 267 ILE ILE B . n 
B 1 105 THR 105 268 268 THR THR B . n 
B 1 106 ILE 106 269 269 ILE ILE B . n 
B 1 107 VAL 107 270 270 VAL VAL B . n 
B 1 108 HIS 108 271 271 HIS HIS B . n 
B 1 109 GLU 109 272 272 GLU GLU B . n 
B 1 110 ILE 110 273 273 ILE ILE B . n 
B 1 111 ASP 111 274 274 ASP ASP B . n 
B 1 112 GLU 112 275 275 GLU GLU B . n 
B 1 113 ASP 113 276 276 ASP ASP B . n 
B 1 114 SER 114 277 277 SER SER B . n 
B 1 115 PRO 115 278 278 PRO PRO B . n 
B 1 116 LEU 116 279 279 LEU LEU B . n 
B 1 117 TYR 117 280 280 TYR TYR B . n 
B 1 118 ASP 118 281 281 ASP ASP B . n 
B 1 119 LEU 119 282 282 LEU LEU B . n 
B 1 120 SER 120 283 283 SER SER B . n 
B 1 121 LYS 121 284 284 LYS LYS B . n 
B 1 122 GLN 122 285 285 GLN GLN B . n 
B 1 123 ASP 123 286 286 ASP ASP B . n 
B 1 124 ILE 124 287 287 ILE ILE B . n 
B 1 125 ASP 125 288 288 ASP ASP B . n 
B 1 126 ASN 126 289 289 ASN ASN B . n 
B 1 127 ALA 127 290 290 ALA ALA B . n 
B 1 128 ASP 128 291 291 ASP ASP B . n 
B 1 129 PHE 129 292 292 PHE PHE B . n 
B 1 130 GLU 130 293 293 GLU GLU B . n 
B 1 131 ILE 131 294 294 ILE ILE B . n 
B 1 132 VAL 132 295 295 VAL VAL B . n 
B 1 133 VAL 133 296 296 VAL VAL B . n 
B 1 134 ILE 134 297 297 ILE ILE B . n 
B 1 135 LEU 135 298 298 LEU LEU B . n 
B 1 136 GLU 136 299 299 GLU GLU B . n 
B 1 137 GLY 137 300 300 GLY GLY B . n 
B 1 138 MET 138 301 301 MET MET B . n 
B 1 139 VAL 139 302 302 VAL VAL B . n 
B 1 140 GLU 140 303 303 GLU GLU B . n 
B 1 141 ALA 141 304 304 ALA ALA B . n 
B 1 142 THR 142 305 305 THR THR B . n 
B 1 143 ALA 143 306 306 ALA ALA B . n 
B 1 144 MET 144 307 307 MET MET B . n 
B 1 145 THR 145 308 308 THR THR B . n 
B 1 146 LYS 146 309 309 LYS LYS B . n 
B 1 147 GLN 147 310 310 GLN GLN B . n 
B 1 148 CYS 148 311 311 CYS CYS B . n 
B 1 149 ARG 149 312 312 ARG ARG B . n 
B 1 150 SER 150 313 313 SER SER B . n 
B 1 151 SER 151 314 314 SER SER B . n 
B 1 152 TYR 152 315 315 TYR TYR B . n 
B 1 153 LEU 153 316 316 LEU LEU B . n 
B 1 154 ALA 154 317 317 ALA ALA B . n 
B 1 155 ASN 155 318 318 ASN ASN B . n 
B 1 156 GLU 156 319 319 GLU GLU B . n 
B 1 157 ILE 157 320 320 ILE ILE B . n 
B 1 158 LEU 158 321 321 LEU LEU B . n 
B 1 159 TRP 159 322 322 TRP TRP B . n 
B 1 160 GLY 160 323 323 GLY GLY B . n 
B 1 161 HIS 161 324 324 HIS HIS B . n 
B 1 162 ARG 162 325 325 ARG ARG B . n 
B 1 163 TYR 163 326 326 TYR TYR B . n 
B 1 164 GLU 164 327 327 GLU GLU B . n 
B 1 165 PRO 165 328 328 PRO PRO B . n 
B 1 166 VAL 166 329 329 VAL VAL B . n 
B 1 167 LEU 167 330 330 LEU LEU B . n 
B 1 168 PHE 168 331 331 PHE PHE B . n 
B 1 169 GLU 169 332 332 GLU GLU B . n 
B 1 170 GLU 170 333 333 GLU GLU B . n 
B 1 171 LYS 171 334 334 LYS LYS B . n 
B 1 172 HIS 172 335 335 HIS HIS B . n 
B 1 173 TYR 173 336 336 TYR TYR B . n 
B 1 174 TYR 174 337 337 TYR TYR B . n 
B 1 175 LYS 175 338 338 LYS LYS B . n 
B 1 176 VAL 176 339 339 VAL VAL B . n 
B 1 177 ASP 177 340 340 ASP ASP B . n 
B 1 178 TYR 178 341 341 TYR TYR B . n 
B 1 179 SER 179 342 342 SER SER B . n 
B 1 180 ARG 180 343 343 ARG ARG B . n 
B 1 181 PHE 181 344 344 PHE PHE B . n 
B 1 182 HIS 182 345 345 HIS HIS B . n 
B 1 183 LYS 183 346 346 LYS LYS B . n 
B 1 184 THR 184 347 347 THR THR B . n 
B 1 185 TYR 185 348 348 TYR TYR B . n 
B 1 186 GLU 186 349 349 GLU GLU B . n 
B 1 187 VAL 187 350 350 VAL VAL B . n 
B 1 188 PRO 188 351 351 PRO PRO B . n 
B 1 189 ASN 189 352 352 ASN ASN B . n 
B 1 190 THR 190 353 353 THR THR B . n 
B 1 191 PRO 191 354 354 PRO PRO B . n 
B 1 192 LEU 192 355 355 LEU LEU B . n 
B 1 193 CYS 193 356 356 CYS CYS B . n 
B 1 194 SER 194 357 357 SER SER B . n 
B 1 195 ALA 195 358 358 ALA ALA B . n 
B 1 196 ARG 196 359 359 ARG ARG B . n 
B 1 197 ASP 197 360 360 ASP ASP B . n 
B 1 198 LEU 198 361 361 LEU LEU B . n 
B 1 199 ALA 199 362 362 ALA ALA B . n 
B 1 200 GLU 200 363 363 GLU GLU B . n 
B 1 201 LYS 201 364 364 LYS LYS B . n 
B 1 202 LYS 202 365 365 LYS LYS B . n 
B 1 203 TYR 203 366 ?   ?   ?   B . n 
B 1 204 ILE 204 367 ?   ?   ?   B . n 
B 1 205 LEU 205 368 ?   ?   ?   B . n 
B 1 206 SER 206 369 ?   ?   ?   B . n 
B 1 207 ASN 207 370 ?   ?   ?   B . n 
B 1 208 ALA 208 371 ?   ?   ?   B . n 
C 1 1   GLY 1   40  ?   ?   ?   C . n 
C 1 2   SER 2   41  41  SER SER C . n 
C 1 3   HIS 3   42  42  HIS HIS C . n 
C 1 4   GLY 4   43  43  GLY GLY C . n 
C 1 5   ARG 5   44  44  ARG ARG C . n 
C 1 6   SER 6   45  45  SER SER C . n 
C 1 7   ARG 7   46  46  ARG ARG C . n 
C 1 8   PHE 8   47  47  PHE PHE C . n 
C 1 9   VAL 9   48  48  VAL VAL C . n 
C 1 10  LYS 10  49  49  LYS LYS C . n 
C 1 11  LYS 11  50  50  LYS LYS C . n 
C 1 12  ASP 12  51  51  ASP ASP C . n 
C 1 13  GLY 13  52  52  GLY GLY C . n 
C 1 14  HIS 14  53  53  HIS HIS C . n 
C 1 15  CYS 15  54  54  CYS CYS C . n 
C 1 16  ASN 16  55  55  ASN ASN C . n 
C 1 17  VAL 17  56  56  VAL VAL C . n 
C 1 18  GLN 18  57  57  GLN GLN C . n 
C 1 19  PHE 19  58  58  PHE PHE C . n 
C 1 20  ILE 20  59  59  ILE ILE C . n 
C 1 21  ASN 21  60  60  ASN ASN C . n 
C 1 22  VAL 22  61  61  VAL VAL C . n 
C 1 23  GLY 23  62  62  GLY GLY C . n 
C 1 24  GLU 24  63  63  GLU ALA C . n 
C 1 25  LYS 25  64  64  LYS ALA C . n 
C 1 26  ARG 26  189 189 ARG ALA C . n 
C 1 27  ASN 27  190 190 ASN ALA C . n 
C 1 28  GLU 28  191 191 GLU GLU C . n 
C 1 29  THR 29  192 192 THR THR C . n 
C 1 30  LEU 30  193 193 LEU LEU C . n 
C 1 31  VAL 31  194 194 VAL VAL C . n 
C 1 32  PHE 32  195 195 PHE PHE C . n 
C 1 33  SER 33  196 196 SER SER C . n 
C 1 34  HIS 34  197 197 HIS HIS C . n 
C 1 35  ASN 35  198 198 ASN ASN C . n 
C 1 36  ALA 36  199 199 ALA ALA C . n 
C 1 37  VAL 37  200 200 VAL VAL C . n 
C 1 38  ILE 38  201 201 ILE ILE C . n 
C 1 39  ALA 39  202 202 ALA ALA C . n 
C 1 40  MET 40  203 203 MET MET C . n 
C 1 41  ARG 41  204 204 ARG ARG C . n 
C 1 42  ASP 42  205 205 ASP ASP C . n 
C 1 43  GLY 43  206 206 GLY GLY C . n 
C 1 44  LYS 44  207 207 LYS LYS C . n 
C 1 45  LEU 45  208 208 LEU LEU C . n 
C 1 46  CYS 46  209 209 CYS CYS C . n 
C 1 47  LEU 47  210 210 LEU LEU C . n 
C 1 48  MET 48  211 211 MET MET C . n 
C 1 49  TRP 49  212 212 TRP TRP C . n 
C 1 50  ARG 50  213 213 ARG ARG C . n 
C 1 51  VAL 51  214 214 VAL VAL C . n 
C 1 52  GLY 52  215 215 GLY GLY C . n 
C 1 53  ASN 53  216 216 ASN ASN C . n 
C 1 54  LEU 54  217 217 LEU LEU C . n 
C 1 55  GLN 55  218 218 GLN GLN C . n 
C 1 56  LYS 56  219 219 LYS LYS C . n 
C 1 57  SER 57  220 220 SER SER C . n 
C 1 58  HIS 58  221 221 HIS HIS C . n 
C 1 59  LEU 59  222 222 LEU LEU C . n 
C 1 60  VAL 60  223 223 VAL VAL C . n 
C 1 61  GLU 61  224 224 GLU GLU C . n 
C 1 62  ALA 62  225 225 ALA ALA C . n 
C 1 63  HIS 63  226 226 HIS HIS C . n 
C 1 64  VAL 64  227 227 VAL VAL C . n 
C 1 65  ARG 65  228 228 ARG ARG C . n 
C 1 66  ALA 66  229 229 ALA ALA C . n 
C 1 67  GLN 67  230 230 GLN GLN C . n 
C 1 68  LEU 68  231 231 LEU LEU C . n 
C 1 69  LEU 69  232 232 LEU LEU C . n 
C 1 70  LYS 70  233 233 LYS LYS C . n 
C 1 71  SER 71  234 234 SER SER C . n 
C 1 72  ARG 72  235 235 ARG ARG C . n 
C 1 73  ILE 73  236 236 ILE ILE C . n 
C 1 74  THR 74  237 237 THR THR C . n 
C 1 75  SER 75  238 238 SER SER C . n 
C 1 76  GLU 76  239 239 GLU GLU C . n 
C 1 77  GLY 77  240 240 GLY GLY C . n 
C 1 78  GLU 78  241 241 GLU GLU C . n 
C 1 79  TYR 79  242 242 TYR TYR C . n 
C 1 80  ILE 80  243 243 ILE ILE C . n 
C 1 81  PRO 81  244 244 PRO PRO C . n 
C 1 82  LEU 82  245 245 LEU LEU C . n 
C 1 83  ASP 83  246 246 ASP ASP C . n 
C 1 84  GLN 84  247 247 GLN GLN C . n 
C 1 85  ILE 85  248 248 ILE ILE C . n 
C 1 86  ASP 86  249 249 ASP ASP C . n 
C 1 87  ILE 87  250 250 ILE ILE C . n 
C 1 88  ASN 88  251 251 ASN ASN C . n 
C 1 89  VAL 89  252 252 VAL VAL C . n 
C 1 90  GLY 90  253 253 GLY GLY C . n 
C 1 91  PHE 91  254 254 PHE PHE C . n 
C 1 92  ASP 92  255 255 ASP ASP C . n 
C 1 93  SER 93  256 256 SER SER C . n 
C 1 94  GLY 94  257 257 GLY GLY C . n 
C 1 95  ILE 95  258 258 ILE ILE C . n 
C 1 96  ASP 96  259 259 ASP ASP C . n 
C 1 97  ARG 97  260 260 ARG ARG C . n 
C 1 98  ILE 98  261 261 ILE ILE C . n 
C 1 99  PHE 99  262 262 PHE PHE C . n 
C 1 100 LEU 100 263 263 LEU LEU C . n 
C 1 101 VAL 101 264 264 VAL VAL C . n 
C 1 102 SER 102 265 265 SER SER C . n 
C 1 103 PRO 103 266 266 PRO PRO C . n 
C 1 104 ILE 104 267 267 ILE ILE C . n 
C 1 105 THR 105 268 268 THR THR C . n 
C 1 106 ILE 106 269 269 ILE ILE C . n 
C 1 107 VAL 107 270 270 VAL VAL C . n 
C 1 108 HIS 108 271 271 HIS HIS C . n 
C 1 109 GLU 109 272 272 GLU GLU C . n 
C 1 110 ILE 110 273 273 ILE ILE C . n 
C 1 111 ASP 111 274 274 ASP ASP C . n 
C 1 112 GLU 112 275 275 GLU GLU C . n 
C 1 113 ASP 113 276 276 ASP ASP C . n 
C 1 114 SER 114 277 277 SER SER C . n 
C 1 115 PRO 115 278 278 PRO PRO C . n 
C 1 116 LEU 116 279 279 LEU LEU C . n 
C 1 117 TYR 117 280 280 TYR TYR C . n 
C 1 118 ASP 118 281 281 ASP ASP C . n 
C 1 119 LEU 119 282 282 LEU LEU C . n 
C 1 120 SER 120 283 283 SER SER C . n 
C 1 121 LYS 121 284 284 LYS LYS C . n 
C 1 122 GLN 122 285 285 GLN GLN C . n 
C 1 123 ASP 123 286 286 ASP ASP C . n 
C 1 124 ILE 124 287 287 ILE ILE C . n 
C 1 125 ASP 125 288 288 ASP ASP C . n 
C 1 126 ASN 126 289 289 ASN ASN C . n 
C 1 127 ALA 127 290 290 ALA ALA C . n 
C 1 128 ASP 128 291 291 ASP ASP C . n 
C 1 129 PHE 129 292 292 PHE PHE C . n 
C 1 130 GLU 130 293 293 GLU GLU C . n 
C 1 131 ILE 131 294 294 ILE ILE C . n 
C 1 132 VAL 132 295 295 VAL VAL C . n 
C 1 133 VAL 133 296 296 VAL VAL C . n 
C 1 134 ILE 134 297 297 ILE ILE C . n 
C 1 135 LEU 135 298 298 LEU LEU C . n 
C 1 136 GLU 136 299 299 GLU GLU C . n 
C 1 137 GLY 137 300 300 GLY GLY C . n 
C 1 138 MET 138 301 301 MET MET C . n 
C 1 139 VAL 139 302 302 VAL VAL C . n 
C 1 140 GLU 140 303 303 GLU GLU C . n 
C 1 141 ALA 141 304 304 ALA ALA C . n 
C 1 142 THR 142 305 305 THR THR C . n 
C 1 143 ALA 143 306 306 ALA ALA C . n 
C 1 144 MET 144 307 307 MET MET C . n 
C 1 145 THR 145 308 308 THR THR C . n 
C 1 146 LYS 146 309 309 LYS LYS C . n 
C 1 147 GLN 147 310 310 GLN GLN C . n 
C 1 148 CYS 148 311 311 CYS CYS C . n 
C 1 149 ARG 149 312 312 ARG ARG C . n 
C 1 150 SER 150 313 313 SER SER C . n 
C 1 151 SER 151 314 314 SER SER C . n 
C 1 152 TYR 152 315 315 TYR TYR C . n 
C 1 153 LEU 153 316 316 LEU LEU C . n 
C 1 154 ALA 154 317 317 ALA ALA C . n 
C 1 155 ASN 155 318 318 ASN ASN C . n 
C 1 156 GLU 156 319 319 GLU GLU C . n 
C 1 157 ILE 157 320 320 ILE ILE C . n 
C 1 158 LEU 158 321 321 LEU LEU C . n 
C 1 159 TRP 159 322 322 TRP TRP C . n 
C 1 160 GLY 160 323 323 GLY GLY C . n 
C 1 161 HIS 161 324 324 HIS HIS C . n 
C 1 162 ARG 162 325 325 ARG ARG C . n 
C 1 163 TYR 163 326 326 TYR TYR C . n 
C 1 164 GLU 164 327 327 GLU GLU C . n 
C 1 165 PRO 165 328 328 PRO PRO C . n 
C 1 166 VAL 166 329 329 VAL VAL C . n 
C 1 167 LEU 167 330 330 LEU LEU C . n 
C 1 168 PHE 168 331 331 PHE PHE C . n 
C 1 169 GLU 169 332 332 GLU GLU C . n 
C 1 170 GLU 170 333 333 GLU GLU C . n 
C 1 171 LYS 171 334 334 LYS LYS C . n 
C 1 172 HIS 172 335 335 HIS HIS C . n 
C 1 173 TYR 173 336 336 TYR TYR C . n 
C 1 174 TYR 174 337 337 TYR TYR C . n 
C 1 175 LYS 175 338 338 LYS LYS C . n 
C 1 176 VAL 176 339 339 VAL VAL C . n 
C 1 177 ASP 177 340 340 ASP ASP C . n 
C 1 178 TYR 178 341 341 TYR TYR C . n 
C 1 179 SER 179 342 342 SER SER C . n 
C 1 180 ARG 180 343 343 ARG ARG C . n 
C 1 181 PHE 181 344 344 PHE PHE C . n 
C 1 182 HIS 182 345 345 HIS HIS C . n 
C 1 183 LYS 183 346 346 LYS LYS C . n 
C 1 184 THR 184 347 347 THR THR C . n 
C 1 185 TYR 185 348 348 TYR TYR C . n 
C 1 186 GLU 186 349 349 GLU GLU C . n 
C 1 187 VAL 187 350 350 VAL VAL C . n 
C 1 188 PRO 188 351 351 PRO PRO C . n 
C 1 189 ASN 189 352 352 ASN ASN C . n 
C 1 190 THR 190 353 353 THR THR C . n 
C 1 191 PRO 191 354 354 PRO PRO C . n 
C 1 192 LEU 192 355 355 LEU LEU C . n 
C 1 193 CYS 193 356 356 CYS CYS C . n 
C 1 194 SER 194 357 357 SER SER C . n 
C 1 195 ALA 195 358 358 ALA ALA C . n 
C 1 196 ARG 196 359 359 ARG ARG C . n 
C 1 197 ASP 197 360 360 ASP ASP C . n 
C 1 198 LEU 198 361 361 LEU LEU C . n 
C 1 199 ALA 199 362 362 ALA ALA C . n 
C 1 200 GLU 200 363 363 GLU GLU C . n 
C 1 201 LYS 201 364 364 LYS LYS C . n 
C 1 202 LYS 202 365 365 LYS LYS C . n 
C 1 203 TYR 203 366 366 TYR TYR C . n 
C 1 204 ILE 204 367 367 ILE ILE C . n 
C 1 205 LEU 205 368 368 LEU LEU C . n 
C 1 206 SER 206 369 369 SER SER C . n 
C 1 207 ASN 207 370 370 ASN ASN C . n 
C 1 208 ALA 208 371 ?   ?   ?   C . n 
D 1 1   GLY 1   40  ?   ?   ?   D . n 
D 1 2   SER 2   41  41  SER SER D . n 
D 1 3   HIS 3   42  42  HIS HIS D . n 
D 1 4   GLY 4   43  43  GLY GLY D . n 
D 1 5   ARG 5   44  44  ARG ARG D . n 
D 1 6   SER 6   45  45  SER SER D . n 
D 1 7   ARG 7   46  46  ARG ARG D . n 
D 1 8   PHE 8   47  47  PHE PHE D . n 
D 1 9   VAL 9   48  48  VAL VAL D . n 
D 1 10  LYS 10  49  49  LYS LYS D . n 
D 1 11  LYS 11  50  50  LYS LYS D . n 
D 1 12  ASP 12  51  51  ASP ASP D . n 
D 1 13  GLY 13  52  52  GLY GLY D . n 
D 1 14  HIS 14  53  53  HIS HIS D . n 
D 1 15  CYS 15  54  54  CYS CYS D . n 
D 1 16  ASN 16  55  55  ASN ASN D . n 
D 1 17  VAL 17  56  56  VAL VAL D . n 
D 1 18  GLN 18  57  57  GLN GLN D . n 
D 1 19  PHE 19  58  58  PHE PHE D . n 
D 1 20  ILE 20  59  59  ILE ILE D . n 
D 1 21  ASN 21  60  60  ASN ASN D . n 
D 1 22  VAL 22  61  61  VAL VAL D . n 
D 1 23  GLY 23  62  62  GLY GLY D . n 
D 1 24  GLU 24  63  63  GLU GLU D . n 
D 1 25  LYS 25  64  64  LYS LYS D . n 
D 1 26  ARG 26  189 189 ARG ALA D . n 
D 1 27  ASN 27  190 190 ASN ALA D . n 
D 1 28  GLU 28  191 191 GLU ALA D . n 
D 1 29  THR 29  192 192 THR THR D . n 
D 1 30  LEU 30  193 193 LEU LEU D . n 
D 1 31  VAL 31  194 194 VAL VAL D . n 
D 1 32  PHE 32  195 195 PHE PHE D . n 
D 1 33  SER 33  196 196 SER SER D . n 
D 1 34  HIS 34  197 197 HIS HIS D . n 
D 1 35  ASN 35  198 198 ASN ASN D . n 
D 1 36  ALA 36  199 199 ALA ALA D . n 
D 1 37  VAL 37  200 200 VAL VAL D . n 
D 1 38  ILE 38  201 201 ILE ILE D . n 
D 1 39  ALA 39  202 202 ALA ALA D . n 
D 1 40  MET 40  203 203 MET MET D . n 
D 1 41  ARG 41  204 204 ARG ARG D . n 
D 1 42  ASP 42  205 205 ASP ASP D . n 
D 1 43  GLY 43  206 206 GLY GLY D . n 
D 1 44  LYS 44  207 207 LYS LYS D . n 
D 1 45  LEU 45  208 208 LEU LEU D . n 
D 1 46  CYS 46  209 209 CYS CYS D . n 
D 1 47  LEU 47  210 210 LEU LEU D . n 
D 1 48  MET 48  211 211 MET MET D . n 
D 1 49  TRP 49  212 212 TRP TRP D . n 
D 1 50  ARG 50  213 213 ARG ARG D . n 
D 1 51  VAL 51  214 214 VAL VAL D . n 
D 1 52  GLY 52  215 215 GLY GLY D . n 
D 1 53  ASN 53  216 216 ASN ASN D . n 
D 1 54  LEU 54  217 217 LEU LEU D . n 
D 1 55  GLN 55  218 218 GLN GLN D . n 
D 1 56  LYS 56  219 219 LYS LYS D . n 
D 1 57  SER 57  220 220 SER SER D . n 
D 1 58  HIS 58  221 221 HIS HIS D . n 
D 1 59  LEU 59  222 222 LEU LEU D . n 
D 1 60  VAL 60  223 223 VAL VAL D . n 
D 1 61  GLU 61  224 224 GLU GLU D . n 
D 1 62  ALA 62  225 225 ALA ALA D . n 
D 1 63  HIS 63  226 226 HIS HIS D . n 
D 1 64  VAL 64  227 227 VAL VAL D . n 
D 1 65  ARG 65  228 228 ARG ARG D . n 
D 1 66  ALA 66  229 229 ALA ALA D . n 
D 1 67  GLN 67  230 230 GLN GLN D . n 
D 1 68  LEU 68  231 231 LEU LEU D . n 
D 1 69  LEU 69  232 232 LEU LEU D . n 
D 1 70  LYS 70  233 233 LYS LYS D . n 
D 1 71  SER 71  234 234 SER SER D . n 
D 1 72  ARG 72  235 235 ARG ARG D . n 
D 1 73  ILE 73  236 236 ILE ILE D . n 
D 1 74  THR 74  237 237 THR THR D . n 
D 1 75  SER 75  238 238 SER SER D . n 
D 1 76  GLU 76  239 239 GLU GLU D . n 
D 1 77  GLY 77  240 240 GLY GLY D . n 
D 1 78  GLU 78  241 241 GLU GLU D . n 
D 1 79  TYR 79  242 242 TYR TYR D . n 
D 1 80  ILE 80  243 243 ILE ILE D . n 
D 1 81  PRO 81  244 244 PRO PRO D . n 
D 1 82  LEU 82  245 245 LEU LEU D . n 
D 1 83  ASP 83  246 246 ASP ASP D . n 
D 1 84  GLN 84  247 247 GLN GLN D . n 
D 1 85  ILE 85  248 248 ILE ILE D . n 
D 1 86  ASP 86  249 249 ASP ASP D . n 
D 1 87  ILE 87  250 250 ILE ILE D . n 
D 1 88  ASN 88  251 251 ASN ASN D . n 
D 1 89  VAL 89  252 252 VAL VAL D . n 
D 1 90  GLY 90  253 253 GLY GLY D . n 
D 1 91  PHE 91  254 254 PHE PHE D . n 
D 1 92  ASP 92  255 255 ASP ASP D . n 
D 1 93  SER 93  256 256 SER SER D . n 
D 1 94  GLY 94  257 257 GLY GLY D . n 
D 1 95  ILE 95  258 258 ILE ILE D . n 
D 1 96  ASP 96  259 259 ASP ASP D . n 
D 1 97  ARG 97  260 260 ARG ARG D . n 
D 1 98  ILE 98  261 261 ILE ILE D . n 
D 1 99  PHE 99  262 262 PHE PHE D . n 
D 1 100 LEU 100 263 263 LEU LEU D . n 
D 1 101 VAL 101 264 264 VAL VAL D . n 
D 1 102 SER 102 265 265 SER SER D . n 
D 1 103 PRO 103 266 266 PRO PRO D . n 
D 1 104 ILE 104 267 267 ILE ILE D . n 
D 1 105 THR 105 268 268 THR THR D . n 
D 1 106 ILE 106 269 269 ILE ILE D . n 
D 1 107 VAL 107 270 270 VAL VAL D . n 
D 1 108 HIS 108 271 271 HIS HIS D . n 
D 1 109 GLU 109 272 272 GLU GLU D . n 
D 1 110 ILE 110 273 273 ILE ILE D . n 
D 1 111 ASP 111 274 274 ASP ASP D . n 
D 1 112 GLU 112 275 275 GLU GLU D . n 
D 1 113 ASP 113 276 276 ASP ASP D . n 
D 1 114 SER 114 277 277 SER SER D . n 
D 1 115 PRO 115 278 278 PRO PRO D . n 
D 1 116 LEU 116 279 279 LEU LEU D . n 
D 1 117 TYR 117 280 280 TYR TYR D . n 
D 1 118 ASP 118 281 281 ASP ASP D . n 
D 1 119 LEU 119 282 282 LEU LEU D . n 
D 1 120 SER 120 283 283 SER SER D . n 
D 1 121 LYS 121 284 284 LYS LYS D . n 
D 1 122 GLN 122 285 285 GLN GLN D . n 
D 1 123 ASP 123 286 286 ASP ASP D . n 
D 1 124 ILE 124 287 287 ILE ILE D . n 
D 1 125 ASP 125 288 288 ASP ASP D . n 
D 1 126 ASN 126 289 289 ASN ASN D . n 
D 1 127 ALA 127 290 290 ALA ALA D . n 
D 1 128 ASP 128 291 291 ASP ASP D . n 
D 1 129 PHE 129 292 292 PHE PHE D . n 
D 1 130 GLU 130 293 293 GLU GLU D . n 
D 1 131 ILE 131 294 294 ILE ILE D . n 
D 1 132 VAL 132 295 295 VAL VAL D . n 
D 1 133 VAL 133 296 296 VAL VAL D . n 
D 1 134 ILE 134 297 297 ILE ILE D . n 
D 1 135 LEU 135 298 298 LEU LEU D . n 
D 1 136 GLU 136 299 299 GLU GLU D . n 
D 1 137 GLY 137 300 300 GLY GLY D . n 
D 1 138 MET 138 301 301 MET MET D . n 
D 1 139 VAL 139 302 302 VAL VAL D . n 
D 1 140 GLU 140 303 303 GLU GLU D . n 
D 1 141 ALA 141 304 304 ALA ALA D . n 
D 1 142 THR 142 305 305 THR THR D . n 
D 1 143 ALA 143 306 306 ALA ALA D . n 
D 1 144 MET 144 307 307 MET MET D . n 
D 1 145 THR 145 308 308 THR THR D . n 
D 1 146 LYS 146 309 309 LYS LYS D . n 
D 1 147 GLN 147 310 310 GLN GLN D . n 
D 1 148 CYS 148 311 311 CYS CYS D . n 
D 1 149 ARG 149 312 312 ARG ARG D . n 
D 1 150 SER 150 313 313 SER SER D . n 
D 1 151 SER 151 314 314 SER SER D . n 
D 1 152 TYR 152 315 315 TYR TYR D . n 
D 1 153 LEU 153 316 316 LEU LEU D . n 
D 1 154 ALA 154 317 317 ALA ALA D . n 
D 1 155 ASN 155 318 318 ASN ASN D . n 
D 1 156 GLU 156 319 319 GLU GLU D . n 
D 1 157 ILE 157 320 320 ILE ILE D . n 
D 1 158 LEU 158 321 321 LEU LEU D . n 
D 1 159 TRP 159 322 322 TRP TRP D . n 
D 1 160 GLY 160 323 323 GLY GLY D . n 
D 1 161 HIS 161 324 324 HIS HIS D . n 
D 1 162 ARG 162 325 325 ARG ARG D . n 
D 1 163 TYR 163 326 326 TYR TYR D . n 
D 1 164 GLU 164 327 327 GLU GLU D . n 
D 1 165 PRO 165 328 328 PRO PRO D . n 
D 1 166 VAL 166 329 329 VAL VAL D . n 
D 1 167 LEU 167 330 330 LEU LEU D . n 
D 1 168 PHE 168 331 331 PHE PHE D . n 
D 1 169 GLU 169 332 332 GLU GLU D . n 
D 1 170 GLU 170 333 333 GLU GLU D . n 
D 1 171 LYS 171 334 334 LYS LYS D . n 
D 1 172 HIS 172 335 335 HIS HIS D . n 
D 1 173 TYR 173 336 336 TYR TYR D . n 
D 1 174 TYR 174 337 337 TYR TYR D . n 
D 1 175 LYS 175 338 338 LYS LYS D . n 
D 1 176 VAL 176 339 339 VAL VAL D . n 
D 1 177 ASP 177 340 340 ASP ASP D . n 
D 1 178 TYR 178 341 341 TYR TYR D . n 
D 1 179 SER 179 342 342 SER SER D . n 
D 1 180 ARG 180 343 343 ARG ARG D . n 
D 1 181 PHE 181 344 344 PHE PHE D . n 
D 1 182 HIS 182 345 345 HIS HIS D . n 
D 1 183 LYS 183 346 346 LYS LYS D . n 
D 1 184 THR 184 347 347 THR THR D . n 
D 1 185 TYR 185 348 348 TYR TYR D . n 
D 1 186 GLU 186 349 349 GLU GLU D . n 
D 1 187 VAL 187 350 350 VAL VAL D . n 
D 1 188 PRO 188 351 351 PRO PRO D . n 
D 1 189 ASN 189 352 352 ASN ASN D . n 
D 1 190 THR 190 353 353 THR THR D . n 
D 1 191 PRO 191 354 354 PRO PRO D . n 
D 1 192 LEU 192 355 355 LEU LEU D . n 
D 1 193 CYS 193 356 356 CYS CYS D . n 
D 1 194 SER 194 357 357 SER SER D . n 
D 1 195 ALA 195 358 358 ALA ALA D . n 
D 1 196 ARG 196 359 359 ARG ARG D . n 
D 1 197 ASP 197 360 360 ASP ASP D . n 
D 1 198 LEU 198 361 361 LEU LEU D . n 
D 1 199 ALA 199 362 362 ALA ALA D . n 
D 1 200 GLU 200 363 363 GLU GLU D . n 
D 1 201 LYS 201 364 364 LYS LYS D . n 
D 1 202 LYS 202 365 365 LYS LYS D . n 
D 1 203 TYR 203 366 366 TYR TYR D . n 
D 1 204 ILE 204 367 367 ILE ILE D . n 
D 1 205 LEU 205 368 368 LEU LEU D . n 
D 1 206 SER 206 369 369 SER SER D . n 
D 1 207 ASN 207 370 ?   ?   ?   D . n 
D 1 208 ALA 208 371 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 K   1   800 800 K   K   A . 
F 3 MPD 1   803 803 MPD MPD A . 
G 3 MPD 1   802 802 MPD MPD B . 
H 3 MPD 1   804 804 MPD MPD C . 
I 3 MPD 1   801 801 MPD MPD D . 
J 4 HOH 1   804 17  HOH HOH A . 
J 4 HOH 2   805 18  HOH HOH A . 
J 4 HOH 3   806 24  HOH HOH A . 
J 4 HOH 4   807 31  HOH HOH A . 
J 4 HOH 5   808 34  HOH HOH A . 
J 4 HOH 6   809 37  HOH HOH A . 
J 4 HOH 7   810 48  HOH HOH A . 
J 4 HOH 8   811 51  HOH HOH A . 
J 4 HOH 9   812 54  HOH HOH A . 
J 4 HOH 10  813 55  HOH HOH A . 
J 4 HOH 11  814 58  HOH HOH A . 
J 4 HOH 12  815 60  HOH HOH A . 
J 4 HOH 13  816 65  HOH HOH A . 
J 4 HOH 14  817 67  HOH HOH A . 
J 4 HOH 15  818 73  HOH HOH A . 
J 4 HOH 16  819 74  HOH HOH A . 
J 4 HOH 17  820 75  HOH HOH A . 
J 4 HOH 18  821 77  HOH HOH A . 
J 4 HOH 19  822 79  HOH HOH A . 
J 4 HOH 20  823 80  HOH HOH A . 
J 4 HOH 21  824 81  HOH HOH A . 
J 4 HOH 22  825 86  HOH HOH A . 
J 4 HOH 23  826 95  HOH HOH A . 
J 4 HOH 24  827 96  HOH HOH A . 
J 4 HOH 25  828 99  HOH HOH A . 
J 4 HOH 26  829 101 HOH HOH A . 
J 4 HOH 27  830 107 HOH HOH A . 
J 4 HOH 28  831 108 HOH HOH A . 
J 4 HOH 29  832 112 HOH HOH A . 
J 4 HOH 30  833 113 HOH HOH A . 
J 4 HOH 31  834 114 HOH HOH A . 
J 4 HOH 32  835 115 HOH HOH A . 
J 4 HOH 33  836 116 HOH HOH A . 
J 4 HOH 34  837 118 HOH HOH A . 
J 4 HOH 35  838 120 HOH HOH A . 
J 4 HOH 36  839 122 HOH HOH A . 
J 4 HOH 37  840 131 HOH HOH A . 
J 4 HOH 38  841 134 HOH HOH A . 
J 4 HOH 39  842 138 HOH HOH A . 
J 4 HOH 40  843 156 HOH HOH A . 
J 4 HOH 41  844 158 HOH HOH A . 
J 4 HOH 42  845 159 HOH HOH A . 
J 4 HOH 43  846 167 HOH HOH A . 
J 4 HOH 44  847 171 HOH HOH A . 
J 4 HOH 45  848 172 HOH HOH A . 
J 4 HOH 46  849 175 HOH HOH A . 
J 4 HOH 47  850 177 HOH HOH A . 
J 4 HOH 48  851 178 HOH HOH A . 
J 4 HOH 49  852 183 HOH HOH A . 
J 4 HOH 50  853 187 HOH HOH A . 
J 4 HOH 51  854 190 HOH HOH A . 
J 4 HOH 52  855 199 HOH HOH A . 
J 4 HOH 53  856 204 HOH HOH A . 
J 4 HOH 54  857 205 HOH HOH A . 
J 4 HOH 55  858 207 HOH HOH A . 
J 4 HOH 56  859 208 HOH HOH A . 
J 4 HOH 57  860 210 HOH HOH A . 
J 4 HOH 58  861 227 HOH HOH A . 
J 4 HOH 59  862 232 HOH HOH A . 
J 4 HOH 60  863 233 HOH HOH A . 
J 4 HOH 61  864 234 HOH HOH A . 
J 4 HOH 62  865 235 HOH HOH A . 
J 4 HOH 63  866 242 HOH HOH A . 
J 4 HOH 64  867 244 HOH HOH A . 
J 4 HOH 65  868 246 HOH HOH A . 
J 4 HOH 66  869 249 HOH HOH A . 
J 4 HOH 67  870 251 HOH HOH A . 
J 4 HOH 68  871 252 HOH HOH A . 
J 4 HOH 69  872 263 HOH HOH A . 
J 4 HOH 70  873 264 HOH HOH A . 
J 4 HOH 71  874 265 HOH HOH A . 
J 4 HOH 72  875 269 HOH HOH A . 
J 4 HOH 73  876 271 HOH HOH A . 
J 4 HOH 74  877 272 HOH HOH A . 
J 4 HOH 75  878 275 HOH HOH A . 
J 4 HOH 76  879 276 HOH HOH A . 
J 4 HOH 77  880 283 HOH HOH A . 
J 4 HOH 78  881 289 HOH HOH A . 
J 4 HOH 79  882 290 HOH HOH A . 
J 4 HOH 80  883 293 HOH HOH A . 
J 4 HOH 81  884 296 HOH HOH A . 
J 4 HOH 82  885 298 HOH HOH A . 
J 4 HOH 83  886 301 HOH HOH A . 
J 4 HOH 84  887 303 HOH HOH A . 
J 4 HOH 85  888 307 HOH HOH A . 
J 4 HOH 86  889 317 HOH HOH A . 
J 4 HOH 87  890 321 HOH HOH A . 
J 4 HOH 88  891 328 HOH HOH A . 
J 4 HOH 89  892 337 HOH HOH A . 
J 4 HOH 90  893 341 HOH HOH A . 
J 4 HOH 91  894 345 HOH HOH A . 
J 4 HOH 92  895 353 HOH HOH A . 
J 4 HOH 93  896 355 HOH HOH A . 
J 4 HOH 94  897 357 HOH HOH A . 
J 4 HOH 95  898 359 HOH HOH A . 
J 4 HOH 96  899 360 HOH HOH A . 
J 4 HOH 97  900 367 HOH HOH A . 
J 4 HOH 98  901 372 HOH HOH A . 
J 4 HOH 99  902 377 HOH HOH A . 
J 4 HOH 100 903 382 HOH HOH A . 
J 4 HOH 101 904 383 HOH HOH A . 
J 4 HOH 102 905 388 HOH HOH A . 
J 4 HOH 103 906 393 HOH HOH A . 
J 4 HOH 104 907 394 HOH HOH A . 
J 4 HOH 105 908 396 HOH HOH A . 
J 4 HOH 106 909 398 HOH HOH A . 
J 4 HOH 107 910 400 HOH HOH A . 
J 4 HOH 108 911 403 HOH HOH A . 
J 4 HOH 109 912 405 HOH HOH A . 
J 4 HOH 110 913 406 HOH HOH A . 
J 4 HOH 111 914 409 HOH HOH A . 
J 4 HOH 112 915 411 HOH HOH A . 
J 4 HOH 113 916 419 HOH HOH A . 
J 4 HOH 114 917 420 HOH HOH A . 
J 4 HOH 115 918 422 HOH HOH A . 
J 4 HOH 116 919 424 HOH HOH A . 
J 4 HOH 117 920 430 HOH HOH A . 
J 4 HOH 118 921 444 HOH HOH A . 
J 4 HOH 119 922 445 HOH HOH A . 
J 4 HOH 120 923 447 HOH HOH A . 
J 4 HOH 121 924 449 HOH HOH A . 
J 4 HOH 122 925 450 HOH HOH A . 
J 4 HOH 123 926 451 HOH HOH A . 
J 4 HOH 124 927 453 HOH HOH A . 
J 4 HOH 125 928 455 HOH HOH A . 
J 4 HOH 126 929 458 HOH HOH A . 
J 4 HOH 127 930 462 HOH HOH A . 
J 4 HOH 128 931 466 HOH HOH A . 
J 4 HOH 129 932 467 HOH HOH A . 
J 4 HOH 130 933 468 HOH HOH A . 
J 4 HOH 131 934 469 HOH HOH A . 
J 4 HOH 132 935 475 HOH HOH A . 
J 4 HOH 133 936 481 HOH HOH A . 
J 4 HOH 134 937 487 HOH HOH A . 
J 4 HOH 135 938 488 HOH HOH A . 
J 4 HOH 136 939 490 HOH HOH A . 
J 4 HOH 137 940 492 HOH HOH A . 
J 4 HOH 138 941 494 HOH HOH A . 
J 4 HOH 139 942 498 HOH HOH A . 
J 4 HOH 140 943 503 HOH HOH A . 
J 4 HOH 141 944 510 HOH HOH A . 
J 4 HOH 142 945 511 HOH HOH A . 
J 4 HOH 143 946 515 HOH HOH A . 
J 4 HOH 144 947 520 HOH HOH A . 
J 4 HOH 145 948 527 HOH HOH A . 
J 4 HOH 146 949 528 HOH HOH A . 
J 4 HOH 147 950 530 HOH HOH A . 
J 4 HOH 148 951 531 HOH HOH A . 
J 4 HOH 149 952 541 HOH HOH A . 
J 4 HOH 150 953 544 HOH HOH A . 
J 4 HOH 151 954 546 HOH HOH A . 
J 4 HOH 152 955 552 HOH HOH A . 
J 4 HOH 153 956 554 HOH HOH A . 
J 4 HOH 154 957 555 HOH HOH A . 
J 4 HOH 155 958 556 HOH HOH A . 
J 4 HOH 156 959 558 HOH HOH A . 
J 4 HOH 157 960 565 HOH HOH A . 
J 4 HOH 158 961 568 HOH HOH A . 
J 4 HOH 159 962 573 HOH HOH A . 
J 4 HOH 160 963 582 HOH HOH A . 
J 4 HOH 161 964 583 HOH HOH A . 
J 4 HOH 162 965 586 HOH HOH A . 
J 4 HOH 163 966 591 HOH HOH A . 
J 4 HOH 164 967 593 HOH HOH A . 
J 4 HOH 165 968 595 HOH HOH A . 
J 4 HOH 166 969 608 HOH HOH A . 
J 4 HOH 167 970 609 HOH HOH A . 
J 4 HOH 168 971 611 HOH HOH A . 
J 4 HOH 169 972 617 HOH HOH A . 
J 4 HOH 170 973 620 HOH HOH A . 
J 4 HOH 171 974 625 HOH HOH A . 
J 4 HOH 172 975 626 HOH HOH A . 
J 4 HOH 173 976 633 HOH HOH A . 
J 4 HOH 174 977 634 HOH HOH A . 
J 4 HOH 175 978 638 HOH HOH A . 
J 4 HOH 176 979 640 HOH HOH A . 
J 4 HOH 177 980 644 HOH HOH A . 
J 4 HOH 178 981 647 HOH HOH A . 
J 4 HOH 179 982 657 HOH HOH A . 
J 4 HOH 180 983 666 HOH HOH A . 
J 4 HOH 181 984 668 HOH HOH A . 
J 4 HOH 182 985 669 HOH HOH A . 
J 4 HOH 183 986 676 HOH HOH A . 
J 4 HOH 184 987 686 HOH HOH A . 
J 4 HOH 185 988 690 HOH HOH A . 
J 4 HOH 186 989 692 HOH HOH A . 
J 4 HOH 187 990 697 HOH HOH A . 
J 4 HOH 188 991 698 HOH HOH A . 
J 4 HOH 189 992 702 HOH HOH A . 
J 4 HOH 190 993 705 HOH HOH A . 
J 4 HOH 191 994 708 HOH HOH A . 
J 4 HOH 192 995 711 HOH HOH A . 
K 4 HOH 1   803 2   HOH HOH B . 
K 4 HOH 2   804 3   HOH HOH B . 
K 4 HOH 3   805 10  HOH HOH B . 
K 4 HOH 4   806 13  HOH HOH B . 
K 4 HOH 5   807 15  HOH HOH B . 
K 4 HOH 6   808 25  HOH HOH B . 
K 4 HOH 7   809 27  HOH HOH B . 
K 4 HOH 8   810 28  HOH HOH B . 
K 4 HOH 9   811 32  HOH HOH B . 
K 4 HOH 10  812 35  HOH HOH B . 
K 4 HOH 11  813 38  HOH HOH B . 
K 4 HOH 12  814 40  HOH HOH B . 
K 4 HOH 13  815 44  HOH HOH B . 
K 4 HOH 14  816 46  HOH HOH B . 
K 4 HOH 15  817 47  HOH HOH B . 
K 4 HOH 16  818 49  HOH HOH B . 
K 4 HOH 17  819 53  HOH HOH B . 
K 4 HOH 18  820 59  HOH HOH B . 
K 4 HOH 19  821 62  HOH HOH B . 
K 4 HOH 20  822 64  HOH HOH B . 
K 4 HOH 21  823 71  HOH HOH B . 
K 4 HOH 22  824 84  HOH HOH B . 
K 4 HOH 23  825 89  HOH HOH B . 
K 4 HOH 24  826 91  HOH HOH B . 
K 4 HOH 25  827 93  HOH HOH B . 
K 4 HOH 26  828 94  HOH HOH B . 
K 4 HOH 27  829 102 HOH HOH B . 
K 4 HOH 28  830 103 HOH HOH B . 
K 4 HOH 29  831 106 HOH HOH B . 
K 4 HOH 30  832 109 HOH HOH B . 
K 4 HOH 31  833 110 HOH HOH B . 
K 4 HOH 32  834 117 HOH HOH B . 
K 4 HOH 33  835 126 HOH HOH B . 
K 4 HOH 34  836 136 HOH HOH B . 
K 4 HOH 35  837 141 HOH HOH B . 
K 4 HOH 36  838 146 HOH HOH B . 
K 4 HOH 37  839 149 HOH HOH B . 
K 4 HOH 38  840 150 HOH HOH B . 
K 4 HOH 39  841 152 HOH HOH B . 
K 4 HOH 40  842 160 HOH HOH B . 
K 4 HOH 41  843 163 HOH HOH B . 
K 4 HOH 42  844 165 HOH HOH B . 
K 4 HOH 43  845 180 HOH HOH B . 
K 4 HOH 44  846 182 HOH HOH B . 
K 4 HOH 45  847 185 HOH HOH B . 
K 4 HOH 46  848 189 HOH HOH B . 
K 4 HOH 47  849 194 HOH HOH B . 
K 4 HOH 48  850 198 HOH HOH B . 
K 4 HOH 49  851 202 HOH HOH B . 
K 4 HOH 50  852 206 HOH HOH B . 
K 4 HOH 51  853 209 HOH HOH B . 
K 4 HOH 52  854 221 HOH HOH B . 
K 4 HOH 53  855 223 HOH HOH B . 
K 4 HOH 54  856 239 HOH HOH B . 
K 4 HOH 55  857 240 HOH HOH B . 
K 4 HOH 56  858 247 HOH HOH B . 
K 4 HOH 57  859 248 HOH HOH B . 
K 4 HOH 58  860 254 HOH HOH B . 
K 4 HOH 59  861 257 HOH HOH B . 
K 4 HOH 60  862 260 HOH HOH B . 
K 4 HOH 61  863 267 HOH HOH B . 
K 4 HOH 62  864 270 HOH HOH B . 
K 4 HOH 63  865 277 HOH HOH B . 
K 4 HOH 64  866 279 HOH HOH B . 
K 4 HOH 65  867 282 HOH HOH B . 
K 4 HOH 66  868 285 HOH HOH B . 
K 4 HOH 67  869 292 HOH HOH B . 
K 4 HOH 68  870 294 HOH HOH B . 
K 4 HOH 69  871 295 HOH HOH B . 
K 4 HOH 70  872 297 HOH HOH B . 
K 4 HOH 71  873 300 HOH HOH B . 
K 4 HOH 72  874 309 HOH HOH B . 
K 4 HOH 73  875 312 HOH HOH B . 
K 4 HOH 74  876 314 HOH HOH B . 
K 4 HOH 75  877 319 HOH HOH B . 
K 4 HOH 76  878 320 HOH HOH B . 
K 4 HOH 77  879 323 HOH HOH B . 
K 4 HOH 78  880 327 HOH HOH B . 
K 4 HOH 79  881 332 HOH HOH B . 
K 4 HOH 80  882 333 HOH HOH B . 
K 4 HOH 81  883 335 HOH HOH B . 
K 4 HOH 82  884 339 HOH HOH B . 
K 4 HOH 83  885 344 HOH HOH B . 
K 4 HOH 84  886 347 HOH HOH B . 
K 4 HOH 85  887 363 HOH HOH B . 
K 4 HOH 86  888 364 HOH HOH B . 
K 4 HOH 87  889 365 HOH HOH B . 
K 4 HOH 88  890 369 HOH HOH B . 
K 4 HOH 89  891 371 HOH HOH B . 
K 4 HOH 90  892 379 HOH HOH B . 
K 4 HOH 91  893 389 HOH HOH B . 
K 4 HOH 92  894 390 HOH HOH B . 
K 4 HOH 93  895 395 HOH HOH B . 
K 4 HOH 94  896 397 HOH HOH B . 
K 4 HOH 95  897 399 HOH HOH B . 
K 4 HOH 96  898 401 HOH HOH B . 
K 4 HOH 97  899 408 HOH HOH B . 
K 4 HOH 98  900 414 HOH HOH B . 
K 4 HOH 99  901 416 HOH HOH B . 
K 4 HOH 100 902 418 HOH HOH B . 
K 4 HOH 101 903 421 HOH HOH B . 
K 4 HOH 102 904 423 HOH HOH B . 
K 4 HOH 103 905 425 HOH HOH B . 
K 4 HOH 104 906 426 HOH HOH B . 
K 4 HOH 105 907 431 HOH HOH B . 
K 4 HOH 106 908 438 HOH HOH B . 
K 4 HOH 107 909 442 HOH HOH B . 
K 4 HOH 108 910 443 HOH HOH B . 
K 4 HOH 109 911 448 HOH HOH B . 
K 4 HOH 110 912 457 HOH HOH B . 
K 4 HOH 111 913 461 HOH HOH B . 
K 4 HOH 112 914 470 HOH HOH B . 
K 4 HOH 113 915 471 HOH HOH B . 
K 4 HOH 114 916 474 HOH HOH B . 
K 4 HOH 115 917 477 HOH HOH B . 
K 4 HOH 116 918 478 HOH HOH B . 
K 4 HOH 117 919 479 HOH HOH B . 
K 4 HOH 118 920 480 HOH HOH B . 
K 4 HOH 119 921 493 HOH HOH B . 
K 4 HOH 120 922 499 HOH HOH B . 
K 4 HOH 121 923 500 HOH HOH B . 
K 4 HOH 122 924 501 HOH HOH B . 
K 4 HOH 123 925 521 HOH HOH B . 
K 4 HOH 124 926 522 HOH HOH B . 
K 4 HOH 125 927 523 HOH HOH B . 
K 4 HOH 126 928 525 HOH HOH B . 
K 4 HOH 127 929 532 HOH HOH B . 
K 4 HOH 128 930 535 HOH HOH B . 
K 4 HOH 129 931 542 HOH HOH B . 
K 4 HOH 130 932 545 HOH HOH B . 
K 4 HOH 131 933 547 HOH HOH B . 
K 4 HOH 132 934 550 HOH HOH B . 
K 4 HOH 133 935 551 HOH HOH B . 
K 4 HOH 134 936 559 HOH HOH B . 
K 4 HOH 135 937 561 HOH HOH B . 
K 4 HOH 136 938 562 HOH HOH B . 
K 4 HOH 137 939 563 HOH HOH B . 
K 4 HOH 138 940 584 HOH HOH B . 
K 4 HOH 139 941 587 HOH HOH B . 
K 4 HOH 140 942 588 HOH HOH B . 
K 4 HOH 141 943 589 HOH HOH B . 
K 4 HOH 142 944 590 HOH HOH B . 
K 4 HOH 143 945 592 HOH HOH B . 
K 4 HOH 144 946 604 HOH HOH B . 
K 4 HOH 145 947 606 HOH HOH B . 
K 4 HOH 146 948 613 HOH HOH B . 
K 4 HOH 147 949 618 HOH HOH B . 
K 4 HOH 148 950 621 HOH HOH B . 
K 4 HOH 149 951 623 HOH HOH B . 
K 4 HOH 150 952 628 HOH HOH B . 
K 4 HOH 151 953 643 HOH HOH B . 
K 4 HOH 152 954 650 HOH HOH B . 
K 4 HOH 153 955 651 HOH HOH B . 
K 4 HOH 154 956 661 HOH HOH B . 
K 4 HOH 155 957 662 HOH HOH B . 
K 4 HOH 156 958 671 HOH HOH B . 
K 4 HOH 157 959 672 HOH HOH B . 
K 4 HOH 158 960 675 HOH HOH B . 
K 4 HOH 159 961 678 HOH HOH B . 
K 4 HOH 160 962 679 HOH HOH B . 
K 4 HOH 161 963 680 HOH HOH B . 
K 4 HOH 162 964 682 HOH HOH B . 
K 4 HOH 163 965 683 HOH HOH B . 
K 4 HOH 164 966 685 HOH HOH B . 
K 4 HOH 165 967 687 HOH HOH B . 
K 4 HOH 166 968 691 HOH HOH B . 
K 4 HOH 167 969 699 HOH HOH B . 
K 4 HOH 168 970 704 HOH HOH B . 
K 4 HOH 169 971 712 HOH HOH B . 
L 4 HOH 1   805 1   HOH HOH C . 
L 4 HOH 2   806 5   HOH HOH C . 
L 4 HOH 3   807 12  HOH HOH C . 
L 4 HOH 4   808 20  HOH HOH C . 
L 4 HOH 5   809 21  HOH HOH C . 
L 4 HOH 6   810 22  HOH HOH C . 
L 4 HOH 7   811 29  HOH HOH C . 
L 4 HOH 8   812 39  HOH HOH C . 
L 4 HOH 9   813 41  HOH HOH C . 
L 4 HOH 10  814 42  HOH HOH C . 
L 4 HOH 11  815 43  HOH HOH C . 
L 4 HOH 12  816 50  HOH HOH C . 
L 4 HOH 13  817 52  HOH HOH C . 
L 4 HOH 14  818 63  HOH HOH C . 
L 4 HOH 15  819 66  HOH HOH C . 
L 4 HOH 16  820 68  HOH HOH C . 
L 4 HOH 17  821 70  HOH HOH C . 
L 4 HOH 18  822 82  HOH HOH C . 
L 4 HOH 19  823 83  HOH HOH C . 
L 4 HOH 20  824 85  HOH HOH C . 
L 4 HOH 21  825 87  HOH HOH C . 
L 4 HOH 22  826 88  HOH HOH C . 
L 4 HOH 23  827 92  HOH HOH C . 
L 4 HOH 24  828 97  HOH HOH C . 
L 4 HOH 25  829 100 HOH HOH C . 
L 4 HOH 26  830 104 HOH HOH C . 
L 4 HOH 27  831 105 HOH HOH C . 
L 4 HOH 28  832 121 HOH HOH C . 
L 4 HOH 29  833 124 HOH HOH C . 
L 4 HOH 30  834 125 HOH HOH C . 
L 4 HOH 31  835 127 HOH HOH C . 
L 4 HOH 32  836 137 HOH HOH C . 
L 4 HOH 33  837 139 HOH HOH C . 
L 4 HOH 34  838 143 HOH HOH C . 
L 4 HOH 35  839 145 HOH HOH C . 
L 4 HOH 36  840 147 HOH HOH C . 
L 4 HOH 37  841 148 HOH HOH C . 
L 4 HOH 38  842 151 HOH HOH C . 
L 4 HOH 39  843 157 HOH HOH C . 
L 4 HOH 40  844 170 HOH HOH C . 
L 4 HOH 41  845 173 HOH HOH C . 
L 4 HOH 42  846 184 HOH HOH C . 
L 4 HOH 43  847 186 HOH HOH C . 
L 4 HOH 44  848 192 HOH HOH C . 
L 4 HOH 45  849 197 HOH HOH C . 
L 4 HOH 46  850 200 HOH HOH C . 
L 4 HOH 47  851 201 HOH HOH C . 
L 4 HOH 48  852 211 HOH HOH C . 
L 4 HOH 49  853 212 HOH HOH C . 
L 4 HOH 50  854 214 HOH HOH C . 
L 4 HOH 51  855 217 HOH HOH C . 
L 4 HOH 52  856 222 HOH HOH C . 
L 4 HOH 53  857 226 HOH HOH C . 
L 4 HOH 54  858 231 HOH HOH C . 
L 4 HOH 55  859 236 HOH HOH C . 
L 4 HOH 56  860 237 HOH HOH C . 
L 4 HOH 57  861 238 HOH HOH C . 
L 4 HOH 58  862 243 HOH HOH C . 
L 4 HOH 59  863 250 HOH HOH C . 
L 4 HOH 60  864 253 HOH HOH C . 
L 4 HOH 61  865 255 HOH HOH C . 
L 4 HOH 62  866 256 HOH HOH C . 
L 4 HOH 63  867 259 HOH HOH C . 
L 4 HOH 64  868 262 HOH HOH C . 
L 4 HOH 65  869 273 HOH HOH C . 
L 4 HOH 66  870 278 HOH HOH C . 
L 4 HOH 67  871 286 HOH HOH C . 
L 4 HOH 68  872 288 HOH HOH C . 
L 4 HOH 69  873 304 HOH HOH C . 
L 4 HOH 70  874 306 HOH HOH C . 
L 4 HOH 71  875 308 HOH HOH C . 
L 4 HOH 72  876 313 HOH HOH C . 
L 4 HOH 73  877 315 HOH HOH C . 
L 4 HOH 74  878 316 HOH HOH C . 
L 4 HOH 75  879 318 HOH HOH C . 
L 4 HOH 76  880 324 HOH HOH C . 
L 4 HOH 77  881 325 HOH HOH C . 
L 4 HOH 78  882 329 HOH HOH C . 
L 4 HOH 79  883 334 HOH HOH C . 
L 4 HOH 80  884 336 HOH HOH C . 
L 4 HOH 81  885 340 HOH HOH C . 
L 4 HOH 82  886 342 HOH HOH C . 
L 4 HOH 83  887 348 HOH HOH C . 
L 4 HOH 84  888 349 HOH HOH C . 
L 4 HOH 85  889 350 HOH HOH C . 
L 4 HOH 86  890 354 HOH HOH C . 
L 4 HOH 87  891 356 HOH HOH C . 
L 4 HOH 88  892 362 HOH HOH C . 
L 4 HOH 89  893 366 HOH HOH C . 
L 4 HOH 90  894 373 HOH HOH C . 
L 4 HOH 91  895 374 HOH HOH C . 
L 4 HOH 92  896 378 HOH HOH C . 
L 4 HOH 93  897 385 HOH HOH C . 
L 4 HOH 94  898 407 HOH HOH C . 
L 4 HOH 95  899 413 HOH HOH C . 
L 4 HOH 96  900 417 HOH HOH C . 
L 4 HOH 97  901 427 HOH HOH C . 
L 4 HOH 98  902 432 HOH HOH C . 
L 4 HOH 99  903 433 HOH HOH C . 
L 4 HOH 100 904 436 HOH HOH C . 
L 4 HOH 101 905 440 HOH HOH C . 
L 4 HOH 102 906 441 HOH HOH C . 
L 4 HOH 103 907 446 HOH HOH C . 
L 4 HOH 104 908 459 HOH HOH C . 
L 4 HOH 105 909 463 HOH HOH C . 
L 4 HOH 106 910 464 HOH HOH C . 
L 4 HOH 107 911 465 HOH HOH C . 
L 4 HOH 108 912 472 HOH HOH C . 
L 4 HOH 109 913 484 HOH HOH C . 
L 4 HOH 110 914 489 HOH HOH C . 
L 4 HOH 111 915 496 HOH HOH C . 
L 4 HOH 112 916 497 HOH HOH C . 
L 4 HOH 113 917 504 HOH HOH C . 
L 4 HOH 114 918 506 HOH HOH C . 
L 4 HOH 115 919 508 HOH HOH C . 
L 4 HOH 116 920 509 HOH HOH C . 
L 4 HOH 117 921 513 HOH HOH C . 
L 4 HOH 118 922 526 HOH HOH C . 
L 4 HOH 119 923 533 HOH HOH C . 
L 4 HOH 120 924 534 HOH HOH C . 
L 4 HOH 121 925 539 HOH HOH C . 
L 4 HOH 122 926 543 HOH HOH C . 
L 4 HOH 123 927 548 HOH HOH C . 
L 4 HOH 124 928 549 HOH HOH C . 
L 4 HOH 125 929 553 HOH HOH C . 
L 4 HOH 126 930 560 HOH HOH C . 
L 4 HOH 127 931 564 HOH HOH C . 
L 4 HOH 128 932 566 HOH HOH C . 
L 4 HOH 129 933 567 HOH HOH C . 
L 4 HOH 130 934 575 HOH HOH C . 
L 4 HOH 131 935 576 HOH HOH C . 
L 4 HOH 132 936 578 HOH HOH C . 
L 4 HOH 133 937 580 HOH HOH C . 
L 4 HOH 134 938 581 HOH HOH C . 
L 4 HOH 135 939 594 HOH HOH C . 
L 4 HOH 136 940 596 HOH HOH C . 
L 4 HOH 137 941 597 HOH HOH C . 
L 4 HOH 138 942 600 HOH HOH C . 
L 4 HOH 139 943 603 HOH HOH C . 
L 4 HOH 140 944 605 HOH HOH C . 
L 4 HOH 141 945 607 HOH HOH C . 
L 4 HOH 142 946 614 HOH HOH C . 
L 4 HOH 143 947 619 HOH HOH C . 
L 4 HOH 144 948 622 HOH HOH C . 
L 4 HOH 145 949 629 HOH HOH C . 
L 4 HOH 146 950 631 HOH HOH C . 
L 4 HOH 147 951 632 HOH HOH C . 
L 4 HOH 148 952 635 HOH HOH C . 
L 4 HOH 149 953 636 HOH HOH C . 
L 4 HOH 150 954 639 HOH HOH C . 
L 4 HOH 151 955 642 HOH HOH C . 
L 4 HOH 152 956 645 HOH HOH C . 
L 4 HOH 153 957 648 HOH HOH C . 
L 4 HOH 154 958 654 HOH HOH C . 
L 4 HOH 155 959 656 HOH HOH C . 
L 4 HOH 156 960 659 HOH HOH C . 
L 4 HOH 157 961 664 HOH HOH C . 
L 4 HOH 158 962 665 HOH HOH C . 
L 4 HOH 159 963 670 HOH HOH C . 
L 4 HOH 160 964 677 HOH HOH C . 
L 4 HOH 161 965 681 HOH HOH C . 
L 4 HOH 162 966 694 HOH HOH C . 
L 4 HOH 163 967 703 HOH HOH C . 
L 4 HOH 164 968 710 HOH HOH C . 
M 4 HOH 1   802 4   HOH HOH D . 
M 4 HOH 2   803 6   HOH HOH D . 
M 4 HOH 3   804 7   HOH HOH D . 
M 4 HOH 4   805 8   HOH HOH D . 
M 4 HOH 5   806 9   HOH HOH D . 
M 4 HOH 6   807 11  HOH HOH D . 
M 4 HOH 7   808 14  HOH HOH D . 
M 4 HOH 8   809 16  HOH HOH D . 
M 4 HOH 9   810 19  HOH HOH D . 
M 4 HOH 10  811 23  HOH HOH D . 
M 4 HOH 11  812 26  HOH HOH D . 
M 4 HOH 12  813 30  HOH HOH D . 
M 4 HOH 13  814 33  HOH HOH D . 
M 4 HOH 14  815 36  HOH HOH D . 
M 4 HOH 15  816 45  HOH HOH D . 
M 4 HOH 16  817 56  HOH HOH D . 
M 4 HOH 17  818 57  HOH HOH D . 
M 4 HOH 18  819 61  HOH HOH D . 
M 4 HOH 19  820 69  HOH HOH D . 
M 4 HOH 20  821 72  HOH HOH D . 
M 4 HOH 21  822 76  HOH HOH D . 
M 4 HOH 22  823 78  HOH HOH D . 
M 4 HOH 23  824 90  HOH HOH D . 
M 4 HOH 24  825 98  HOH HOH D . 
M 4 HOH 25  826 111 HOH HOH D . 
M 4 HOH 26  827 119 HOH HOH D . 
M 4 HOH 27  828 123 HOH HOH D . 
M 4 HOH 28  829 128 HOH HOH D . 
M 4 HOH 29  830 129 HOH HOH D . 
M 4 HOH 30  831 130 HOH HOH D . 
M 4 HOH 31  832 132 HOH HOH D . 
M 4 HOH 32  833 133 HOH HOH D . 
M 4 HOH 33  834 135 HOH HOH D . 
M 4 HOH 34  835 140 HOH HOH D . 
M 4 HOH 35  836 142 HOH HOH D . 
M 4 HOH 36  837 144 HOH HOH D . 
M 4 HOH 37  838 153 HOH HOH D . 
M 4 HOH 38  839 154 HOH HOH D . 
M 4 HOH 39  840 155 HOH HOH D . 
M 4 HOH 40  841 161 HOH HOH D . 
M 4 HOH 41  842 162 HOH HOH D . 
M 4 HOH 42  843 164 HOH HOH D . 
M 4 HOH 43  844 166 HOH HOH D . 
M 4 HOH 44  845 168 HOH HOH D . 
M 4 HOH 45  846 169 HOH HOH D . 
M 4 HOH 46  847 174 HOH HOH D . 
M 4 HOH 47  848 176 HOH HOH D . 
M 4 HOH 48  849 179 HOH HOH D . 
M 4 HOH 49  850 181 HOH HOH D . 
M 4 HOH 50  851 188 HOH HOH D . 
M 4 HOH 51  852 191 HOH HOH D . 
M 4 HOH 52  853 193 HOH HOH D . 
M 4 HOH 53  854 195 HOH HOH D . 
M 4 HOH 54  855 196 HOH HOH D . 
M 4 HOH 55  856 203 HOH HOH D . 
M 4 HOH 56  857 213 HOH HOH D . 
M 4 HOH 57  858 215 HOH HOH D . 
M 4 HOH 58  859 216 HOH HOH D . 
M 4 HOH 59  860 218 HOH HOH D . 
M 4 HOH 60  861 219 HOH HOH D . 
M 4 HOH 61  862 220 HOH HOH D . 
M 4 HOH 62  863 224 HOH HOH D . 
M 4 HOH 63  864 225 HOH HOH D . 
M 4 HOH 64  865 228 HOH HOH D . 
M 4 HOH 65  866 229 HOH HOH D . 
M 4 HOH 66  867 230 HOH HOH D . 
M 4 HOH 67  868 245 HOH HOH D . 
M 4 HOH 68  869 258 HOH HOH D . 
M 4 HOH 69  870 261 HOH HOH D . 
M 4 HOH 70  871 266 HOH HOH D . 
M 4 HOH 71  872 268 HOH HOH D . 
M 4 HOH 72  873 274 HOH HOH D . 
M 4 HOH 73  874 280 HOH HOH D . 
M 4 HOH 74  875 281 HOH HOH D . 
M 4 HOH 75  876 284 HOH HOH D . 
M 4 HOH 76  877 287 HOH HOH D . 
M 4 HOH 77  878 291 HOH HOH D . 
M 4 HOH 78  879 299 HOH HOH D . 
M 4 HOH 79  880 302 HOH HOH D . 
M 4 HOH 80  881 305 HOH HOH D . 
M 4 HOH 81  882 310 HOH HOH D . 
M 4 HOH 82  883 311 HOH HOH D . 
M 4 HOH 83  884 322 HOH HOH D . 
M 4 HOH 84  885 326 HOH HOH D . 
M 4 HOH 85  886 330 HOH HOH D . 
M 4 HOH 86  887 331 HOH HOH D . 
M 4 HOH 87  888 338 HOH HOH D . 
M 4 HOH 88  889 343 HOH HOH D . 
M 4 HOH 89  890 346 HOH HOH D . 
M 4 HOH 90  891 351 HOH HOH D . 
M 4 HOH 91  892 352 HOH HOH D . 
M 4 HOH 92  893 361 HOH HOH D . 
M 4 HOH 93  894 368 HOH HOH D . 
M 4 HOH 94  895 370 HOH HOH D . 
M 4 HOH 95  896 375 HOH HOH D . 
M 4 HOH 96  897 376 HOH HOH D . 
M 4 HOH 97  898 380 HOH HOH D . 
M 4 HOH 98  899 381 HOH HOH D . 
M 4 HOH 99  900 384 HOH HOH D . 
M 4 HOH 100 901 386 HOH HOH D . 
M 4 HOH 101 902 387 HOH HOH D . 
M 4 HOH 102 903 391 HOH HOH D . 
M 4 HOH 103 904 392 HOH HOH D . 
M 4 HOH 104 905 402 HOH HOH D . 
M 4 HOH 105 906 404 HOH HOH D . 
M 4 HOH 106 907 410 HOH HOH D . 
M 4 HOH 107 908 412 HOH HOH D . 
M 4 HOH 108 909 415 HOH HOH D . 
M 4 HOH 109 910 428 HOH HOH D . 
M 4 HOH 110 911 429 HOH HOH D . 
M 4 HOH 111 912 434 HOH HOH D . 
M 4 HOH 112 913 435 HOH HOH D . 
M 4 HOH 113 914 437 HOH HOH D . 
M 4 HOH 114 915 439 HOH HOH D . 
M 4 HOH 115 916 452 HOH HOH D . 
M 4 HOH 116 917 454 HOH HOH D . 
M 4 HOH 117 918 456 HOH HOH D . 
M 4 HOH 118 919 460 HOH HOH D . 
M 4 HOH 119 920 473 HOH HOH D . 
M 4 HOH 120 921 476 HOH HOH D . 
M 4 HOH 121 922 482 HOH HOH D . 
M 4 HOH 122 923 483 HOH HOH D . 
M 4 HOH 123 924 485 HOH HOH D . 
M 4 HOH 124 925 486 HOH HOH D . 
M 4 HOH 125 926 491 HOH HOH D . 
M 4 HOH 126 927 495 HOH HOH D . 
M 4 HOH 127 928 502 HOH HOH D . 
M 4 HOH 128 929 505 HOH HOH D . 
M 4 HOH 129 930 507 HOH HOH D . 
M 4 HOH 130 931 512 HOH HOH D . 
M 4 HOH 131 932 514 HOH HOH D . 
M 4 HOH 132 933 517 HOH HOH D . 
M 4 HOH 133 934 518 HOH HOH D . 
M 4 HOH 134 935 519 HOH HOH D . 
M 4 HOH 135 936 529 HOH HOH D . 
M 4 HOH 136 937 536 HOH HOH D . 
M 4 HOH 137 938 537 HOH HOH D . 
M 4 HOH 138 939 538 HOH HOH D . 
M 4 HOH 139 940 540 HOH HOH D . 
M 4 HOH 140 941 557 HOH HOH D . 
M 4 HOH 141 942 569 HOH HOH D . 
M 4 HOH 142 943 570 HOH HOH D . 
M 4 HOH 143 944 571 HOH HOH D . 
M 4 HOH 144 945 572 HOH HOH D . 
M 4 HOH 145 946 574 HOH HOH D . 
M 4 HOH 146 947 577 HOH HOH D . 
M 4 HOH 147 948 579 HOH HOH D . 
M 4 HOH 148 949 585 HOH HOH D . 
M 4 HOH 149 950 598 HOH HOH D . 
M 4 HOH 150 951 599 HOH HOH D . 
M 4 HOH 151 952 601 HOH HOH D . 
M 4 HOH 152 953 610 HOH HOH D . 
M 4 HOH 153 954 612 HOH HOH D . 
M 4 HOH 154 955 616 HOH HOH D . 
M 4 HOH 155 956 624 HOH HOH D . 
M 4 HOH 156 957 627 HOH HOH D . 
M 4 HOH 157 958 630 HOH HOH D . 
M 4 HOH 158 959 641 HOH HOH D . 
M 4 HOH 159 960 646 HOH HOH D . 
M 4 HOH 160 961 649 HOH HOH D . 
M 4 HOH 161 962 653 HOH HOH D . 
M 4 HOH 162 963 655 HOH HOH D . 
M 4 HOH 163 964 658 HOH HOH D . 
M 4 HOH 164 965 660 HOH HOH D . 
M 4 HOH 165 966 663 HOH HOH D . 
M 4 HOH 166 967 667 HOH HOH D . 
M 4 HOH 167 968 688 HOH HOH D . 
M 4 HOH 168 969 689 HOH HOH D . 
M 4 HOH 169 970 693 HOH HOH D . 
M 4 HOH 170 971 696 HOH HOH D . 
M 4 HOH 171 972 701 HOH HOH D . 
M 4 HOH 172 973 706 HOH HOH D . 
M 4 HOH 173 974 707 HOH HOH D . 
M 4 HOH 174 975 709 HOH HOH D . 
M 4 HOH 175 976 713 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 software_defined_assembly            PISA octameric  8 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H,I,J,K,L,M 
2 1,2 A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 15150 ? 
1 MORE         -67   ? 
1 'SSA (A^2)'  35260 ? 
2 'ABSA (A^2)' 32270 ? 
2 MORE         -156  ? 
2 'SSA (A^2)'  68540 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 76.7330225503 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 74.3907537183 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? J HOH . ? A HOH 820 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? J HOH . ? A HOH 823 ? 1_555 79.5  ? 
2  O ? J HOH . ? A HOH 820 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? J HOH . ? A HOH 942 ? 1_555 77.7  ? 
3  O ? J HOH . ? A HOH 823 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? J HOH . ? A HOH 942 ? 1_555 76.5  ? 
4  O ? J HOH . ? A HOH 820 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 825 ? 1_555 73.6  ? 
5  O ? J HOH . ? A HOH 823 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 825 ? 1_555 114.0 ? 
6  O ? J HOH . ? A HOH 942 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 825 ? 1_555 146.6 ? 
7  O ? J HOH . ? A HOH 820 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 903 ? 1_555 71.7  ? 
8  O ? J HOH . ? A HOH 823 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 903 ? 1_555 147.7 ? 
9  O ? J HOH . ? A HOH 942 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 903 ? 1_555 83.2  ? 
10 O ? K HOH . ? B HOH 825 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 903 ? 1_555 71.8  ? 
11 O ? J HOH . ? A HOH 820 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 960 ? 1_555 97.6  ? 
12 O ? J HOH . ? A HOH 823 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 960 ? 1_555 154.9 ? 
13 O ? J HOH . ? A HOH 942 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 960 ? 1_555 127.6 ? 
14 O ? K HOH . ? B HOH 825 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 960 ? 1_555 42.7  ? 
15 O ? K HOH . ? B HOH 903 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? K HOH . ? B HOH 960 ? 1_555 47.2  ? 
16 O ? J HOH . ? A HOH 820 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 832 ? 1_555 121.3 ? 
17 O ? J HOH . ? A HOH 823 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 832 ? 1_555 72.3  ? 
18 O ? J HOH . ? A HOH 942 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 832 ? 1_555 138.5 ? 
19 O ? K HOH . ? B HOH 825 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 832 ? 1_555 72.9  ? 
20 O ? K HOH . ? B HOH 903 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 832 ? 1_555 135.9 ? 
21 O ? K HOH . ? B HOH 960 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 832 ? 1_555 88.7  ? 
22 O ? J HOH . ? A HOH 820 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 901 ? 1_555 140.9 ? 
23 O ? J HOH . ? A HOH 823 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 901 ? 1_555 137.8 ? 
24 O ? J HOH . ? A HOH 942 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 901 ? 1_555 116.0 ? 
25 O ? K HOH . ? B HOH 825 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 901 ? 1_555 78.5  ? 
26 O ? K HOH . ? B HOH 903 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 901 ? 1_555 73.9  ? 
27 O ? K HOH . ? B HOH 960 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 901 ? 1_555 44.2  ? 
28 O ? L HOH . ? C HOH 832 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? L HOH . ? C HOH 901 ? 1_555 74.0  ? 
29 O ? J HOH . ? A HOH 820 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 871 ? 1_555 138.3 ? 
30 O ? J HOH . ? A HOH 823 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 871 ? 1_555 66.9  ? 
31 O ? J HOH . ? A HOH 942 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 871 ? 1_555 71.1  ? 
32 O ? K HOH . ? B HOH 825 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 871 ? 1_555 142.2 ? 
33 O ? K HOH . ? B HOH 903 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 871 ? 1_555 129.2 ? 
34 O ? K HOH . ? B HOH 960 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 871 ? 1_555 123.3 ? 
35 O ? L HOH . ? C HOH 832 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 871 ? 1_555 71.9  ? 
36 O ? L HOH . ? C HOH 901 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 871 ? 1_555 79.1  ? 
37 O ? J HOH . ? A HOH 820 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 976 ? 1_555 94.3  ? 
38 O ? J HOH . ? A HOH 823 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 976 ? 1_555 40.6  ? 
39 O ? J HOH . ? A HOH 942 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 976 ? 1_555 43.4  ? 
40 O ? K HOH . ? B HOH 825 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 976 ? 1_555 154.5 ? 
41 O ? K HOH . ? B HOH 903 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 976 ? 1_555 126.5 ? 
42 O ? K HOH . ? B HOH 960 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 976 ? 1_555 162.5 ? 
43 O ? L HOH . ? C HOH 832 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 976 ? 1_555 95.9  ? 
44 O ? L HOH . ? C HOH 901 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 976 ? 1_555 121.2 ? 
45 O ? M HOH . ? D HOH 871 ? 1_555 K ? E K . ? A K 800 ? 1_555 O ? M HOH . ? D HOH 976 ? 1_555 43.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-07-25 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-08-16 
5 'Structure model' 1 4 2017-10-18 
6 'Structure model' 1 5 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 4 'Structure model' 'Source and taxonomy'       
5 5 'Structure model' 'Refinement description'    
6 6 'Structure model' 'Database references'       
7 6 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen         
2 4 'Structure model' software               
3 5 'Structure model' software               
4 6 'Structure model' database_2             
5 6 'Structure model' pdbx_struct_conn_angle 
6 6 'Structure model' struct_conn            
7 6 'Structure model' struct_ref_seq_dif     
8 6 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_software.classification'                    
2  5 'Structure model' '_software.contact_author'                    
3  5 'Structure model' '_software.contact_author_email'              
4  5 'Structure model' '_software.date'                              
5  5 'Structure model' '_software.language'                          
6  5 'Structure model' '_software.location'                          
7  5 'Structure model' '_software.name'                              
8  5 'Structure model' '_software.type'                              
9  5 'Structure model' '_software.version'                           
10 6 'Structure model' '_database_2.pdbx_DOI'                        
11 6 'Structure model' '_database_2.pdbx_database_accession'         
12 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
13 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
14 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
15 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
16 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
17 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
18 6 'Structure model' '_pdbx_struct_conn_angle.value'               
19 6 'Structure model' '_struct_conn.pdbx_dist_value'                
20 6 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
21 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
22 6 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
23 6 'Structure model' '_struct_ref_seq_dif.details'                 
24 6 'Structure model' '_struct_site.pdbx_auth_asym_id'              
25 6 'Structure model' '_struct_site.pdbx_auth_comp_id'              
26 6 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
_pdbx_phasing_MR.entry_id                     2GIX 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           48.960 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        48.960 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .        ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .        ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
PHASER      .        ?              other   'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?          ? 3 
REFMAC      5.2.0005 ?              program 'Murshudov, G.N.'    ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 4 
PDB_EXTRACT 1.701    'Nov. 1, 2005' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
Blu-Ice     .        ?              ?       ?                    ?                           'data collection' ? ?          ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD2 C ASP 255 ? ? O C HOH 866 ? ? 1.70 
2 1 O   D HOH 826 ? ? O D HOH 968 ? ? 2.00 
3 1 OD2 B ASP 255 ? ? O B HOH 960 ? ? 2.13 
4 1 NH1 D ARG 44  ? ? O D HOH 936 ? ? 2.16 
5 1 OD1 C ASP 205 ? ? O C HOH 946 ? ? 2.17 
6 1 O   A HOH 881 ? ? O A HOH 987 ? ? 2.18 
7 1 CB  C CYS 54  ? ? O B HOH 966 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 204 ? ? CZ A ARG 204 ? ? NH1 A ARG 204 ? ? 115.91 120.30 -4.39 0.50 N 
2 1 NE A ARG 325 ? ? CZ A ARG 325 ? ? NH1 A ARG 325 ? ? 123.79 120.30 3.49  0.50 N 
3 1 CB C ASP 249 ? ? CG C ASP 249 ? ? OD1 C ASP 249 ? ? 124.01 118.30 5.71  0.90 N 
4 1 CB C ASP 249 ? ? CG C ASP 249 ? ? OD2 C ASP 249 ? ? 112.73 118.30 -5.57 0.90 N 
5 1 CB C ASP 255 ? ? CG C ASP 255 ? ? OD1 C ASP 255 ? ? 124.56 118.30 6.26  0.90 N 
6 1 NE C ARG 325 ? ? CZ C ARG 325 ? ? NH1 C ARG 325 ? ? 123.82 120.30 3.52  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 63  ? ? 143.13  142.88  
2  1 LYS A 64  ? ? 44.12   82.97   
3  1 GLU A 191 ? ? 69.03   106.79  
4  1 ASP A 274 ? ? -109.18 -168.64 
5  1 ALA A 306 ? ? 57.22   10.50   
6  1 LYS B 64  ? ? -31.01  119.40  
7  1 ARG B 189 ? ? -23.01  -57.26  
8  1 VAL B 194 ? ? -135.55 -36.79  
9  1 VAL B 264 ? ? -111.56 -76.93  
10 1 ASP B 274 ? ? -102.22 -164.82 
11 1 GLU B 363 ? ? -78.18  43.70   
12 1 LYS B 364 ? ? -158.83 66.48   
13 1 ASN C 55  ? ? -95.24  59.01   
14 1 LYS C 64  ? ? -47.50  94.00   
15 1 LYS C 219 ? ? -92.15  46.28   
16 1 VAL C 264 ? ? -115.72 -76.17  
17 1 SER C 369 ? ? -69.54  2.76    
18 1 LYS D 64  ? ? -24.50  -57.25  
19 1 VAL D 264 ? ? -110.53 -79.67  
20 1 ASP D 274 ? ? -103.93 -169.17 
21 1 LYS D 364 ? ? -50.02  -9.70   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 63  ? CG  ? A GLU 24 CG  
2  1 Y 1 A GLU 63  ? CD  ? A GLU 24 CD  
3  1 Y 1 A GLU 63  ? OE1 ? A GLU 24 OE1 
4  1 Y 1 A GLU 63  ? OE2 ? A GLU 24 OE2 
5  1 Y 1 A LYS 64  ? CG  ? A LYS 25 CG  
6  1 Y 1 A LYS 64  ? CD  ? A LYS 25 CD  
7  1 Y 1 A LYS 64  ? CE  ? A LYS 25 CE  
8  1 Y 1 A LYS 64  ? NZ  ? A LYS 25 NZ  
9  1 Y 1 A ARG 189 ? CG  ? A ARG 26 CG  
10 1 Y 1 A ARG 189 ? CD  ? A ARG 26 CD  
11 1 Y 1 A ARG 189 ? NE  ? A ARG 26 NE  
12 1 Y 1 A ARG 189 ? CZ  ? A ARG 26 CZ  
13 1 Y 1 A ARG 189 ? NH1 ? A ARG 26 NH1 
14 1 Y 1 A ARG 189 ? NH2 ? A ARG 26 NH2 
15 1 Y 1 A ASN 190 ? CG  ? A ASN 27 CG  
16 1 Y 1 A ASN 190 ? OD1 ? A ASN 27 OD1 
17 1 Y 1 A ASN 190 ? ND2 ? A ASN 27 ND2 
18 1 Y 1 B LYS 64  ? CG  ? B LYS 25 CG  
19 1 Y 1 B LYS 64  ? CD  ? B LYS 25 CD  
20 1 Y 1 B LYS 64  ? CE  ? B LYS 25 CE  
21 1 Y 1 B LYS 64  ? NZ  ? B LYS 25 NZ  
22 1 Y 1 B ARG 189 ? CG  ? B ARG 26 CG  
23 1 Y 1 B ARG 189 ? CD  ? B ARG 26 CD  
24 1 Y 1 B ARG 189 ? NE  ? B ARG 26 NE  
25 1 Y 1 B ARG 189 ? CZ  ? B ARG 26 CZ  
26 1 Y 1 B ARG 189 ? NH1 ? B ARG 26 NH1 
27 1 Y 1 B ARG 189 ? NH2 ? B ARG 26 NH2 
28 1 Y 1 B ASN 190 ? CG  ? B ASN 27 CG  
29 1 Y 1 B ASN 190 ? OD1 ? B ASN 27 OD1 
30 1 Y 1 B ASN 190 ? ND2 ? B ASN 27 ND2 
31 1 Y 1 B GLU 191 ? CG  ? B GLU 28 CG  
32 1 Y 1 B GLU 191 ? CD  ? B GLU 28 CD  
33 1 Y 1 B GLU 191 ? OE1 ? B GLU 28 OE1 
34 1 Y 1 B GLU 191 ? OE2 ? B GLU 28 OE2 
35 1 Y 1 C GLU 63  ? CG  ? C GLU 24 CG  
36 1 Y 1 C GLU 63  ? CD  ? C GLU 24 CD  
37 1 Y 1 C GLU 63  ? OE1 ? C GLU 24 OE1 
38 1 Y 1 C GLU 63  ? OE2 ? C GLU 24 OE2 
39 1 Y 1 C LYS 64  ? CG  ? C LYS 25 CG  
40 1 Y 1 C LYS 64  ? CD  ? C LYS 25 CD  
41 1 Y 1 C LYS 64  ? CE  ? C LYS 25 CE  
42 1 Y 1 C LYS 64  ? NZ  ? C LYS 25 NZ  
43 1 Y 1 C ARG 189 ? CG  ? C ARG 26 CG  
44 1 Y 1 C ARG 189 ? CD  ? C ARG 26 CD  
45 1 Y 1 C ARG 189 ? NE  ? C ARG 26 NE  
46 1 Y 1 C ARG 189 ? CZ  ? C ARG 26 CZ  
47 1 Y 1 C ARG 189 ? NH1 ? C ARG 26 NH1 
48 1 Y 1 C ARG 189 ? NH2 ? C ARG 26 NH2 
49 1 Y 1 C ASN 190 ? CG  ? C ASN 27 CG  
50 1 Y 1 C ASN 190 ? OD1 ? C ASN 27 OD1 
51 1 Y 1 C ASN 190 ? ND2 ? C ASN 27 ND2 
52 1 Y 1 D ARG 189 ? CG  ? D ARG 26 CG  
53 1 Y 1 D ARG 189 ? CD  ? D ARG 26 CD  
54 1 Y 1 D ARG 189 ? NE  ? D ARG 26 NE  
55 1 Y 1 D ARG 189 ? CZ  ? D ARG 26 CZ  
56 1 Y 1 D ARG 189 ? NH1 ? D ARG 26 NH1 
57 1 Y 1 D ARG 189 ? NH2 ? D ARG 26 NH2 
58 1 Y 1 D ASN 190 ? CG  ? D ASN 27 CG  
59 1 Y 1 D ASN 190 ? OD1 ? D ASN 27 OD1 
60 1 Y 1 D ASN 190 ? ND2 ? D ASN 27 ND2 
61 1 Y 1 D GLU 191 ? CG  ? D GLU 28 CG  
62 1 Y 1 D GLU 191 ? CD  ? D GLU 28 CD  
63 1 Y 1 D GLU 191 ? OE1 ? D GLU 28 OE1 
64 1 Y 1 D GLU 191 ? OE2 ? D GLU 28 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 40  ? A GLY 1   
2  1 Y 1 A ALA 371 ? A ALA 208 
3  1 Y 1 B GLY 40  ? B GLY 1   
4  1 Y 1 B TYR 366 ? B TYR 203 
5  1 Y 1 B ILE 367 ? B ILE 204 
6  1 Y 1 B LEU 368 ? B LEU 205 
7  1 Y 1 B SER 369 ? B SER 206 
8  1 Y 1 B ASN 370 ? B ASN 207 
9  1 Y 1 B ALA 371 ? B ALA 208 
10 1 Y 1 C GLY 40  ? C GLY 1   
11 1 Y 1 C ALA 371 ? C ALA 208 
12 1 Y 1 D GLY 40  ? D GLY 1   
13 1 Y 1 D ASN 370 ? D ASN 207 
14 1 Y 1 D ALA 371 ? D ALA 208 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'POTASSIUM ION'                 K   
3 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 
4 water                           HOH 
#