data_2GM4
# 
_entry.id   2GM4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2GM4         pdb_00002gm4 10.2210/pdb2gm4/pdb 
NDB   PD0797       ?            ?                   
RCSB  RCSB037284   ?            ?                   
WWPDB D_1000037284 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1GDT 'Crystal structure of a site-specific recombinase, gamma-delta resolvase complexed with a 34 BP cleavage site' 
unspecified 
PDB 1ZR2 'Structure of a Synaptic gamma-delta Resolvase Tetramer Covalently Linked to two Cleaved DNAs'                 
unspecified 
PDB 1ZR4 'Structure of a Synaptic gamma-delta Resolvase Tetramer Covalently linked to two Cleaved DNAs'                 
unspecified 
PDB 2RSL 'Refinement of gamma delta resolvase reveals a strikingly flexible molecule'                                   
unspecified 
PDB 2GM5 'An activated, truncated gamma-delta resolvase tetramer'                                                       
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2GM4 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kamtekar, S.' 1 
'Ho, R.S.'     2 
'Li, W.'       3 
'Steitz, T.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Implications of structures of synaptic tetramers of gamma delta resolvase for the mechanism of recombination.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            103 
_citation.page_first                10642 
_citation.page_last                 10647 
_citation.year                      2006 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16807292 
_citation.pdbx_database_id_DOI      10.1073/pnas.0604062103 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kamtekar, S.'    1 ? 
primary 'Ho, R.S.'        2 ? 
primary 'Cocco, M.J.'     3 ? 
primary 'Li, W.'          4 ? 
primary 'Wenwieser, S.V.' 5 ? 
primary 'Boocock, M.R.'   6 ? 
primary 'Grindley, N.D.'  7 ? 
primary 'Steitz, T.A.'    8 ? 
# 
_cell.entry_id           2GM4 
_cell.length_a           110.138 
_cell.length_b           137.687 
_cell.length_c           83.473 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2GM4 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*CP*AP*GP*TP*GP*TP*CP*CP*GP*AP*TP*AP*AP*TP*TP*TP*AP*TP*AP*AP*A)-3'" 6445.209  4 ? ? ? ? 
2 polymer syn "5'-D(*TP*TP*AP*TP*CP*GP*GP*AP*CP*AP*CP*TP*G)-3'"                         3966.597  2 ? ? ? ? 
3 polymer man 'Transposon gamma-delta resolvase'                                        20337.457 2 ? 
'R2A, E56K, G96S, S98D, D100S, G101S, E102A, K105R, E124Q' ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Transposon Tn1000 resolvase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DC)(DA)(DG)(DT)(DG)(DT)(DC)(DC)(DG)(DA)(DT)(DA)(DA)(DT)(DT)(DT)(DA)(DT)(DA)(DA)
(DA)
;
CAGTGTCCGATAATTTATAAA X,Z,J,I ? 
2 polydeoxyribonucleotide no no '(DT)(DT)(DA)(DT)(DC)(DG)(DG)(DA)(DC)(DA)(DC)(DT)(DG)' TTATCGGACACTG Y,K     ? 
3 'polypeptide(L)'        no no 
;MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLI
KEFDAQGVSIRFIDDSIDTSSAMGRMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLG
ASHISKTMNIARSTVYKVINESN
;
;MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLI
KEFDAQGVSIRFIDDSIDTSSAMGRMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLG
ASHISKTMNIARSTVYKVINESN
;
A,B     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DA  n 
1 3   DG  n 
1 4   DT  n 
1 5   DG  n 
1 6   DT  n 
1 7   DC  n 
1 8   DC  n 
1 9   DG  n 
1 10  DA  n 
1 11  DT  n 
1 12  DA  n 
1 13  DA  n 
1 14  DT  n 
1 15  DT  n 
1 16  DT  n 
1 17  DA  n 
1 18  DT  n 
1 19  DA  n 
1 20  DA  n 
1 21  DA  n 
2 1   DT  n 
2 2   DT  n 
2 3   DA  n 
2 4   DT  n 
2 5   DC  n 
2 6   DG  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DC  n 
2 12  DT  n 
2 13  DG  n 
3 1   MET n 
3 2   ALA n 
3 3   LEU n 
3 4   PHE n 
3 5   GLY n 
3 6   TYR n 
3 7   ALA n 
3 8   ARG n 
3 9   VAL n 
3 10  SER n 
3 11  THR n 
3 12  SER n 
3 13  GLN n 
3 14  GLN n 
3 15  SER n 
3 16  LEU n 
3 17  ASP n 
3 18  ILE n 
3 19  GLN n 
3 20  VAL n 
3 21  ARG n 
3 22  ALA n 
3 23  LEU n 
3 24  LYS n 
3 25  ASP n 
3 26  ALA n 
3 27  GLY n 
3 28  VAL n 
3 29  LYS n 
3 30  ALA n 
3 31  ASN n 
3 32  ARG n 
3 33  ILE n 
3 34  PHE n 
3 35  THR n 
3 36  ASP n 
3 37  LYS n 
3 38  ALA n 
3 39  SER n 
3 40  GLY n 
3 41  SER n 
3 42  SER n 
3 43  SER n 
3 44  ASP n 
3 45  ARG n 
3 46  LYS n 
3 47  GLY n 
3 48  LEU n 
3 49  ASP n 
3 50  LEU n 
3 51  LEU n 
3 52  ARG n 
3 53  MET n 
3 54  LYS n 
3 55  VAL n 
3 56  LYS n 
3 57  GLU n 
3 58  GLY n 
3 59  ASP n 
3 60  VAL n 
3 61  ILE n 
3 62  LEU n 
3 63  VAL n 
3 64  LYS n 
3 65  LYS n 
3 66  LEU n 
3 67  ASP n 
3 68  ARG n 
3 69  LEU n 
3 70  GLY n 
3 71  ARG n 
3 72  ASP n 
3 73  THR n 
3 74  ALA n 
3 75  ASP n 
3 76  MET n 
3 77  ILE n 
3 78  GLN n 
3 79  LEU n 
3 80  ILE n 
3 81  LYS n 
3 82  GLU n 
3 83  PHE n 
3 84  ASP n 
3 85  ALA n 
3 86  GLN n 
3 87  GLY n 
3 88  VAL n 
3 89  SER n 
3 90  ILE n 
3 91  ARG n 
3 92  PHE n 
3 93  ILE n 
3 94  ASP n 
3 95  ASP n 
3 96  SER n 
3 97  ILE n 
3 98  ASP n 
3 99  THR n 
3 100 SER n 
3 101 SER n 
3 102 ALA n 
3 103 MET n 
3 104 GLY n 
3 105 ARG n 
3 106 MET n 
3 107 VAL n 
3 108 VAL n 
3 109 THR n 
3 110 ILE n 
3 111 LEU n 
3 112 SER n 
3 113 ALA n 
3 114 VAL n 
3 115 ALA n 
3 116 GLN n 
3 117 ALA n 
3 118 GLU n 
3 119 ARG n 
3 120 GLN n 
3 121 ARG n 
3 122 ILE n 
3 123 LEU n 
3 124 GLN n 
3 125 ARG n 
3 126 THR n 
3 127 ASN n 
3 128 GLU n 
3 129 GLY n 
3 130 ARG n 
3 131 GLN n 
3 132 GLU n 
3 133 ALA n 
3 134 MET n 
3 135 ALA n 
3 136 LYS n 
3 137 GLY n 
3 138 VAL n 
3 139 VAL n 
3 140 PHE n 
3 141 GLY n 
3 142 ARG n 
3 143 LYS n 
3 144 ARG n 
3 145 LYS n 
3 146 ILE n 
3 147 ASP n 
3 148 ARG n 
3 149 ASP n 
3 150 ALA n 
3 151 VAL n 
3 152 LEU n 
3 153 ASN n 
3 154 MET n 
3 155 TRP n 
3 156 GLN n 
3 157 GLN n 
3 158 GLY n 
3 159 LEU n 
3 160 GLY n 
3 161 ALA n 
3 162 SER n 
3 163 HIS n 
3 164 ILE n 
3 165 SER n 
3 166 LYS n 
3 167 THR n 
3 168 MET n 
3 169 ASN n 
3 170 ILE n 
3 171 ALA n 
3 172 ARG n 
3 173 SER n 
3 174 THR n 
3 175 VAL n 
3 176 TYR n 
3 177 LYS n 
3 178 VAL n 
3 179 ILE n 
3 180 ASN n 
3 181 GLU n 
3 182 SER n 
3 183 ASN n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 tnpR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21DE3 Star pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET25b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP TNR1_ECOLI P03012 3 1 ? ? 
2 PDB 2GM4       2GM4   1 ? ? ? 
3 PDB 2GM4       2GM4   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2GM4 A 1 ? 183 ? P03012 1  ? 183 ? 1  183 
2 1 2GM4 B 1 ? 183 ? P03012 1  ? 183 ? 1  183 
3 2 2GM4 X 1 ? 21  ? 2GM4   2  ? 22  ? 2  22  
4 2 2GM4 Z 1 ? 21  ? 2GM4   2  ? 22  ? 2  22  
5 3 2GM4 Y 1 ? 13  ? 2GM4   23 ? 35  ? 23 35  
6 2 2GM4 J 1 ? 21  ? 2GM4   2  ? 22  ? 2  22  
7 2 2GM4 I 1 ? 21  ? 2GM4   2  ? 22  ? 2  22  
8 3 2GM4 K 1 ? 13  ? 2GM4   23 ? 35  ? 23 35  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2GM4 ALA A 2   ? UNP P03012 ARG 2   'engineered mutation' 2   1  
1 2GM4 LYS A 56  ? UNP P03012 GLU 56  'engineered mutation' 56  2  
1 2GM4 SER A 96  ? UNP P03012 GLY 96  'engineered mutation' 96  3  
1 2GM4 ASP A 98  ? UNP P03012 SER 98  'engineered mutation' 98  4  
1 2GM4 SER A 100 ? UNP P03012 ASP 100 'engineered mutation' 100 5  
1 2GM4 SER A 101 ? UNP P03012 GLY 101 'engineered mutation' 101 6  
1 2GM4 ALA A 102 ? UNP P03012 GLU 102 'engineered mutation' 102 7  
1 2GM4 ARG A 105 ? UNP P03012 LYS 105 'engineered mutation' 105 8  
1 2GM4 GLN A 124 ? UNP P03012 GLU 124 'engineered mutation' 124 9  
2 2GM4 ALA B 2   ? UNP P03012 ARG 2   'engineered mutation' 2   10 
2 2GM4 LYS B 56  ? UNP P03012 GLU 56  'engineered mutation' 56  11 
2 2GM4 SER B 96  ? UNP P03012 GLY 96  'engineered mutation' 96  12 
2 2GM4 ASP B 98  ? UNP P03012 SER 98  'engineered mutation' 98  13 
2 2GM4 SER B 100 ? UNP P03012 ASP 100 'engineered mutation' 100 14 
2 2GM4 SER B 101 ? UNP P03012 GLY 101 'engineered mutation' 101 15 
2 2GM4 ALA B 102 ? UNP P03012 GLU 102 'engineered mutation' 102 16 
2 2GM4 ARG B 105 ? UNP P03012 LYS 105 'engineered mutation' 105 17 
2 2GM4 GLN B 124 ? UNP P03012 GLU 124 'engineered mutation' 124 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2GM4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.19 
_exptl_crystal.density_percent_sol   70.63 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PROTEIN: DNA stock in 300 mM NaCl, 15 mM Tris-HCl, 0.05-0.15 M Mg Formate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2003-07-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.05 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.05 
# 
_reflns.entry_id                     2GM4 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.5 
_reflns.number_obs                   16189 
_reflns.number_all                   16189 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            0.091 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.5 
_reflns_shell.d_res_low              3.63 
_reflns_shell.percent_possible_all   84.3 
_reflns_shell.Rmerge_I_obs           0.759 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.2 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1380 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2GM4 
_refine.ls_number_reflns_obs                     15177 
_refine.ls_number_reflns_all                     15177 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            3.50 
_refine.ls_percent_reflns_obs                    96.97 
_refine.ls_R_factor_obs                          0.28213 
_refine.ls_R_factor_all                          0.28213 
_refine.ls_R_factor_R_work                       0.28003 
_refine.ls_R_factor_R_free                       0.32265 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  802 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.942 
_refine.correlation_coeff_Fo_to_Fc_free          0.917 
_refine.B_iso_mean                               173.333 
_refine.aniso_B[1][1]                            -5.23 
_refine.aniso_B[2][2]                            -11.97 
_refine.aniso_B[3][3]                            17.19 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1ZR4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.606 
_refine.overall_SU_ML                            0.691 
_refine.overall_SU_B                             102.080 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2788 
_refine_hist.pdbx_number_atoms_nucleic_acid   1344 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4132 
_refine_hist.d_res_high                       3.50 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.008  0.022  ? 4309 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.157  2.359  ? 6059 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 5.582  5.000  ? 353  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 37.146 23.281 ? 128  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 21.044 15.000 ? 571  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 13.706 15.000 ? 34   'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.068  0.200  ? 696  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.004  0.020  ? 2721 'X-RAY DIFFRACTION' ? 
r_nbd_refined          0.227  0.200  ? 1773 'X-RAY DIFFRACTION' ? 
r_nbtor_refined        0.298  0.200  ? 2677 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined  0.173  0.200  ? 130  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined 0.234  0.200  ? 33   'X-RAY DIFFRACTION' ? 
r_mcbond_it            2.002  2.000  ? 1819 'X-RAY DIFFRACTION' ? 
r_mcangle_it           3.760  4.000  ? 2816 'X-RAY DIFFRACTION' ? 
r_scbond_it            2.758  4.000  ? 3255 'X-RAY DIFFRACTION' ? 
r_scangle_it           4.246  6.000  ? 3243 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
1 A 12  0.03 0.05  'tight positional'  ? ? ? ? ? 4  'X-RAY DIFFRACTION' 1  
1 A 10  0.24 0.50  'medium positional' ? ? ? ? ? 4  'X-RAY DIFFRACTION' 2  
1 A 398 0.52 5.00  'loose positional'  ? ? ? ? ? 1  'X-RAY DIFFRACTION' 3  
1 A 99  0.44 5.00  'loose positional'  ? ? ? ? ? 2  'X-RAY DIFFRACTION' 4  
1 A 183 0.39 5.00  'loose positional'  ? ? ? ? ? 3  'X-RAY DIFFRACTION' 5  
1 A 32  0.44 5.00  'loose positional'  ? ? ? ? ? 5  'X-RAY DIFFRACTION' 6  
1 A 338 0.81 5.00  'loose positional'  ? ? ? ? ? 6  'X-RAY DIFFRACTION' 7  
1 A 298 0.53 5.00  'loose positional'  ? ? ? ? ? 7  'X-RAY DIFFRACTION' 8  
1 X 349 0.51 5.00  'loose positional'  ? ? ? ? ? 8  'X-RAY DIFFRACTION' 9  
1 Y 221 0.34 5.00  'loose positional'  ? ? ? ? ? 9  'X-RAY DIFFRACTION' 10 
1 I 63  0.27 5.00  'loose positional'  ? ? ? ? ? 10 'X-RAY DIFFRACTION' 11 
1 A 12  0.06 0.50  'tight thermal'     ? ? ? ? ? 4  'X-RAY DIFFRACTION' 12 
1 A 10  0.72 2.00  'medium thermal'    ? ? ? ? ? 4  'X-RAY DIFFRACTION' 13 
1 A 398 1.88 10.00 'loose thermal'     ? ? ? ? ? 1  'X-RAY DIFFRACTION' 14 
1 A 99  5.59 10.00 'loose thermal'     ? ? ? ? ? 2  'X-RAY DIFFRACTION' 15 
1 A 183 4.21 10.00 'loose thermal'     ? ? ? ? ? 3  'X-RAY DIFFRACTION' 16 
1 A 32  4.59 10.00 'loose thermal'     ? ? ? ? ? 5  'X-RAY DIFFRACTION' 17 
1 A 338 3.63 10.00 'loose thermal'     ? ? ? ? ? 6  'X-RAY DIFFRACTION' 18 
1 A 298 2.33 10.00 'loose thermal'     ? ? ? ? ? 7  'X-RAY DIFFRACTION' 19 
1 X 349 2.05 10.00 'loose thermal'     ? ? ? ? ? 8  'X-RAY DIFFRACTION' 20 
1 Y 221 1.53 10.00 'loose thermal'     ? ? ? ? ? 9  'X-RAY DIFFRACTION' 21 
1 I 63  2.39 10.00 'loose thermal'     ? ? ? ? ? 10 'X-RAY DIFFRACTION' 22 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.500 
_refine_ls_shell.d_res_low                        3.588 
_refine_ls_shell.number_reflns_R_work             947 
_refine_ls_shell.R_factor_R_work                  0.445 
_refine_ls_shell.percent_reflns_obs               86.23 
_refine_ls_shell.R_factor_R_free                  0.395 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             55 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1  
2 B 1  
1 A 2  
2 B 2  
1 A 3  
2 B 3  
1 A 4  
2 B 4  
1 A 5  
2 B 5  
1 A 6  
2 B 6  
1 A 7  
2 B 7  
1 X 8  
2 J 8  
1 Y 9  
2 K 9  
1 I 10 
2 Z 10 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 2   A 56  1 6 G ALA 2   ? G LYS 56  ? 1  ? 
1 B 2   B 56  2 6 H ALA 2   ? H LYS 56  ? 1  ? 
1 A 58  A 70  1 6 G GLY 58  ? G GLY 70  ? 2  ? 
1 B 58  B 70  2 6 H GLY 58  ? H GLY 70  ? 2  ? 
1 A 72  A 94  1 6 G ASP 72  ? G ASP 94  ? 3  ? 
1 B 72  B 94  2 6 H ASP 72  ? H ASP 94  ? 3  ? 
1 A 95  A 97  1 2 G ASP 95  ? G ILE 97  ? 4  ? 
1 B 95  B 97  2 2 H ASP 95  ? H ILE 97  ? 4  ? 
1 A 98  A 102 1 6 G ASP 98  ? G ALA 102 ? 5  ? 
1 B 98  B 102 2 6 H ASP 98  ? H ALA 102 ? 5  ? 
1 A 103 A 145 1 6 G MET 103 ? G LYS 145 ? 6  ? 
1 B 103 B 145 2 6 H MET 103 ? H LYS 145 ? 6  ? 
1 A 146 A 183 1 6 G ILE 146 ? G ASN 183 ? 7  ? 
1 B 146 B 183 2 6 H ILE 146 ? H ASN 183 ? 7  ? 
1 X 3   X 19  1 6 A DA  2   ? A DT  18  ? 8  ? 
1 J 3   J 19  2 6 D DA  2   ? D DT  18  ? 8  ? 
1 Y 23  Y 33  1 6 C DT  1   ? C DC  11  ? 9  ? 
1 K 23  K 33  2 6 F DT  1   ? F DC  11  ? 9  ? 
1 I 20  I 22  1 6 E DA  19  ? E DA  21  ? 10 ? 
1 Z 20  Z 22  2 6 B DA  19  ? B DA  21  ? 10 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  'A B' 
2  'A B' 
3  'A B' 
4  'A B' 
5  'A B' 
6  'A B' 
7  'A B' 
8  'X J' 
9  'Y K' 
10 'I Z' 
# 
_struct.entry_id                  2GM4 
_struct.title                     'An activated, tetrameric gamma-delta resolvase: Hin chimaera bound to cleaved DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GM4 
_struct_keywords.pdbx_keywords   'RECOMBINATION, DNA' 
_struct_keywords.text            'Gamma delta resolvase, Protein DNA complex, site specific recombination, RECOMBINATION, DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 1 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a tetramer assembled using a crystallographic 2 fold axis: -x -y z' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER G 15  ? GLY G 27  ? SER A 15  GLY A 27  1 ? 13 
HELX_P HELX_P2  2  LYS G 29  ? ASN G 31  ? LYS A 29  ASN A 31  5 ? 3  
HELX_P HELX_P3  3  ARG G 45  ? VAL G 55  ? ARG A 45  VAL A 55  1 ? 11 
HELX_P HELX_P4  4  ASP G 72  ? GLY G 87  ? ASP A 72  GLY A 87  1 ? 16 
HELX_P HELX_P5  5  ALA G 102 ? ALA G 135 ? ALA A 102 ALA A 135 1 ? 34 
HELX_P HELX_P6  6  ASP G 147 ? GLN G 157 ? ASP A 147 GLN A 157 1 ? 11 
HELX_P HELX_P7  7  GLY G 160 ? MET G 168 ? GLY A 160 MET A 168 1 ? 9  
HELX_P HELX_P8  8  ALA G 171 ? GLU G 181 ? ALA A 171 GLU A 181 1 ? 11 
HELX_P HELX_P9  9  SER H 15  ? ASP H 25  ? SER B 15  ASP B 25  1 ? 11 
HELX_P HELX_P10 10 LYS H 29  ? ASN H 31  ? LYS B 29  ASN B 31  5 ? 3  
HELX_P HELX_P11 11 ARG H 45  ? MET H 53  ? ARG B 45  MET B 53  1 ? 9  
HELX_P HELX_P12 12 ASP H 72  ? GLY H 87  ? ASP B 72  GLY B 87  1 ? 16 
HELX_P HELX_P13 13 SER H 101 ? ALA H 135 ? SER B 101 ALA B 135 1 ? 35 
HELX_P HELX_P14 14 ASP H 147 ? GLN H 156 ? ASP B 147 GLN B 156 1 ? 10 
HELX_P HELX_P15 15 GLY H 160 ? MET H 168 ? GLY B 160 MET B 168 1 ? 9  
HELX_P HELX_P16 16 ALA H 171 ? ASN H 180 ? ALA B 171 ASN B 180 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale one ? B DA 19 P  ? ? ? 1_555 G SER 10 OG ? ? Z DA 20 A SER 10 1_555 ? ? ? ? ? ? ?               1.621 ? ? 
covale2  covale one ? E DA 19 P  ? ? ? 1_555 H SER 10 OG ? ? I DA 20 B SER 10 1_555 ? ? ? ? ? ? ?               1.616 ? ? 
hydrog1  hydrog ?   ? A DA 2  N1 ? ? ? 1_555 C DT  12 N3 ? ? X DA 3  Y DT  34 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? ? 
hydrog2  hydrog ?   ? A DG 3  N1 ? ? ? 1_555 C DC  11 N3 ? ? X DG 4  Y DC  33 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? ? 
hydrog3  hydrog ?   ? A DT 4  N3 ? ? ? 1_555 C DA  10 N1 ? ? X DT 5  Y DA  32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog4  hydrog ?   ? A DT 4  O4 ? ? ? 1_555 C DA  10 N6 ? ? X DT 5  Y DA  32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog5  hydrog ?   ? A DG 5  N1 ? ? ? 1_555 C DC  9  N3 ? ? X DG 6  Y DC  31 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? ? 
hydrog6  hydrog ?   ? A DT 6  N3 ? ? ? 1_555 C DA  8  N1 ? ? X DT 7  Y DA  30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog7  hydrog ?   ? A DT 6  O4 ? ? ? 1_555 C DA  8  N6 ? ? X DT 7  Y DA  30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog8  hydrog ?   ? A DC 7  N3 ? ? ? 1_555 C DG  7  N1 ? ? X DC 8  Y DG  29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog9  hydrog ?   ? A DC 7  N4 ? ? ? 1_555 C DG  7  O6 ? ? X DC 8  Y DG  29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog10 hydrog ?   ? A DC 7  O2 ? ? ? 1_555 C DG  7  N2 ? ? X DC 8  Y DG  29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog11 hydrog ?   ? A DC 8  N3 ? ? ? 1_555 C DG  6  N1 ? ? X DC 9  Y DG  28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog12 hydrog ?   ? A DC 8  N4 ? ? ? 1_555 C DG  6  O6 ? ? X DC 9  Y DG  28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog13 hydrog ?   ? A DC 8  O2 ? ? ? 1_555 C DG  6  N2 ? ? X DC 9  Y DG  28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog14 hydrog ?   ? A DG 9  N1 ? ? ? 1_555 C DC  5  O2 ? ? X DG 10 Y DC  27 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? ? 
hydrog15 hydrog ?   ? A DA 10 N1 ? ? ? 1_555 C DT  4  N3 ? ? X DA 11 Y DT  26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog16 hydrog ?   ? A DA 10 N6 ? ? ? 1_555 C DT  4  O4 ? ? X DA 11 Y DT  26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog17 hydrog ?   ? A DT 11 N3 ? ? ? 1_555 C DA  3  N1 ? ? X DT 12 Y DA  25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog18 hydrog ?   ? A DT 11 O4 ? ? ? 1_555 C DA  3  N6 ? ? X DT 12 Y DA  25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog19 hydrog ?   ? A DA 12 N1 ? ? ? 1_555 C DT  2  N3 ? ? X DA 13 Y DT  24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog20 hydrog ?   ? A DA 12 N6 ? ? ? 1_555 C DT  2  O4 ? ? X DA 13 Y DT  24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog21 hydrog ?   ? A DA 13 N1 ? ? ? 1_555 C DT  1  N3 ? ? X DA 14 Y DT  23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog22 hydrog ?   ? A DA 13 N6 ? ? ? 1_555 C DT  1  O4 ? ? X DA 14 Y DT  23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog23 hydrog ?   ? A DT 15 N3 ? ? ? 1_555 B DA  20 N1 ? ? X DT 16 Z DA  21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog24 hydrog ?   ? A DT 15 O4 ? ? ? 1_555 B DA  20 N6 ? ? X DT 16 Z DA  21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog25 hydrog ?   ? A DT 16 N3 ? ? ? 1_555 B DA  19 N1 ? ? X DT 17 Z DA  20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog26 hydrog ?   ? A DT 16 O4 ? ? ? 1_555 B DA  19 N6 ? ? X DT 17 Z DA  20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog27 hydrog ?   ? D DG 3  N2 ? ? ? 1_555 F DT  12 O2 ? ? J DG 4  K DT  34 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? ? 
hydrog28 hydrog ?   ? D DG 5  N1 ? ? ? 1_555 F DC  9  N3 ? ? J DG 6  K DC  31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog29 hydrog ?   ? D DG 5  N2 ? ? ? 1_555 F DC  9  O2 ? ? J DG 6  K DC  31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog30 hydrog ?   ? D DG 5  O6 ? ? ? 1_555 F DC  9  N4 ? ? J DG 6  K DC  31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog31 hydrog ?   ? D DT 6  N3 ? ? ? 1_555 F DA  8  N1 ? ? J DT 7  K DA  30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog32 hydrog ?   ? D DT 6  O4 ? ? ? 1_555 F DA  8  N6 ? ? J DT 7  K DA  30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog33 hydrog ?   ? D DC 7  O2 ? ? ? 1_555 F DG  7  N2 ? ? J DC 8  K DG  29 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? ? 
hydrog34 hydrog ?   ? D DC 8  N4 ? ? ? 1_555 F DG  6  O6 ? ? J DC 9  K DG  28 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? ? 
hydrog35 hydrog ?   ? D DG 9  N1 ? ? ? 1_555 F DC  5  N3 ? ? J DG 10 K DC  27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog36 hydrog ?   ? D DG 9  N2 ? ? ? 1_555 F DC  5  O2 ? ? J DG 10 K DC  27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog37 hydrog ?   ? D DG 9  O6 ? ? ? 1_555 F DC  5  N4 ? ? J DG 10 K DC  27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog38 hydrog ?   ? D DA 10 N1 ? ? ? 1_555 F DT  4  N3 ? ? J DA 11 K DT  26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog39 hydrog ?   ? D DA 10 N6 ? ? ? 1_555 F DT  4  O4 ? ? J DA 11 K DT  26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog40 hydrog ?   ? D DT 11 N3 ? ? ? 1_555 F DA  3  N1 ? ? J DT 12 K DA  25 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? ? 
hydrog41 hydrog ?   ? D DA 12 N1 ? ? ? 1_555 F DT  2  N3 ? ? J DA 13 K DT  24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog42 hydrog ?   ? D DA 12 N6 ? ? ? 1_555 F DT  2  O4 ? ? J DA 13 K DT  24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog43 hydrog ?   ? D DA 13 N1 ? ? ? 1_555 F DT  1  N3 ? ? J DA 14 K DT  23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog44 hydrog ?   ? D DA 13 N6 ? ? ? 1_555 F DT  1  O4 ? ? J DA 14 K DT  23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog45 hydrog ?   ? D DT 14 N3 ? ? ? 1_555 E DA  21 N1 ? ? J DT 15 I DA  22 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? ? 
hydrog46 hydrog ?   ? D DT 15 N3 ? ? ? 1_555 E DA  20 N1 ? ? J DT 16 I DA  21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog47 hydrog ?   ? D DT 15 O4 ? ? ? 1_555 E DA  20 N6 ? ? J DT 16 I DA  21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog48 hydrog ?   ? D DT 16 N3 ? ? ? 1_555 E DA  19 N1 ? ? J DT 17 I DA  20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog49 hydrog ?   ? D DT 16 O4 ? ? ? 1_555 E DA  19 N6 ? ? J DT 17 I DA  20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY G 5  ? VAL G 9  ? GLY A 5  VAL A 9  
A 2 ILE G 33 ? LYS G 37 ? ILE A 33 LYS A 37 
B 1 VAL G 60 ? VAL G 63 ? VAL A 60 VAL A 63 
B 2 SER G 89 ? PHE G 92 ? SER A 89 PHE A 92 
C 1 ILE H 33 ? LYS H 37 ? ILE B 33 LYS B 37 
C 2 LEU H 3  ? VAL H 9  ? LEU B 3  VAL B 9  
C 3 VAL H 60 ? VAL H 63 ? VAL B 60 VAL B 63 
C 4 SER H 89 ? PHE H 92 ? SER B 89 PHE B 92 
C 5 ILE H 97 ? ASP H 98 ? ILE B 97 ASP B 98 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY G 5  ? N GLY A 5  O PHE G 34 ? O PHE A 34 
B 1 2 N ILE G 61 ? N ILE A 61 O SER G 89 ? O SER A 89 
C 1 2 O PHE H 34 ? O PHE B 34 N ALA H 7  ? N ALA B 7  
C 2 3 N PHE H 4  ? N PHE B 4  O VAL H 60 ? O VAL B 60 
C 3 4 N ILE H 61 ? N ILE B 61 O ARG H 91 ? O ARG B 91 
C 4 5 N PHE H 92 ? N PHE B 92 O ILE H 97 ? O ILE B 97 
# 
_database_PDB_matrix.entry_id          2GM4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2GM4 
_atom_sites.fract_transf_matrix[1][1]   0.009080 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007263 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011980 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    O "O5'" . DC  A 1 1   ? 53.861  107.837 5.220   1.00 181.63 ? 2   DC  X "O5'" 1 
ATOM 2    C "C5'" . DC  A 1 1   ? 54.198  108.964 4.408   1.00 181.85 ? 2   DC  X "C5'" 1 
ATOM 3    C "C4'" . DC  A 1 1   ? 53.235  109.144 3.245   1.00 181.28 ? 2   DC  X "C4'" 1 
ATOM 4    O "O4'" . DC  A 1 1   ? 53.851  109.979 2.226   1.00 181.95 ? 2   DC  X "O4'" 1 
ATOM 5    C "C3'" . DC  A 1 1   ? 52.859  107.869 2.505   1.00 180.28 ? 2   DC  X "C3'" 1 
ATOM 6    O "O3'" . DC  A 1 1   ? 51.771  107.218 3.137   1.00 176.67 ? 2   DC  X "O3'" 1 
ATOM 7    C "C2'" . DC  A 1 1   ? 52.474  108.422 1.142   1.00 181.98 ? 2   DC  X "C2'" 1 
ATOM 8    C "C1'" . DC  A 1 1   ? 53.585  109.448 0.936   1.00 182.91 ? 2   DC  X "C1'" 1 
ATOM 9    N N1    . DC  A 1 1   ? 54.855  108.893 0.309   1.00 184.06 ? 2   DC  X N1    1 
ATOM 10   C C2    . DC  A 1 1   ? 54.841  108.316 -0.978  1.00 184.22 ? 2   DC  X C2    1 
ATOM 11   O O2    . DC  A 1 1   ? 53.791  108.253 -1.631  1.00 184.31 ? 2   DC  X O2    1 
ATOM 12   N N3    . DC  A 1 1   ? 56.004  107.836 -1.496  1.00 184.04 ? 2   DC  X N3    1 
ATOM 13   C C4    . DC  A 1 1   ? 57.143  107.906 -0.804  1.00 183.92 ? 2   DC  X C4    1 
ATOM 14   N N4    . DC  A 1 1   ? 58.252  107.421 -1.370  1.00 183.61 ? 2   DC  X N4    1 
ATOM 15   C C5    . DC  A 1 1   ? 57.187  108.480 0.500   1.00 184.62 ? 2   DC  X C5    1 
ATOM 16   C C6    . DC  A 1 1   ? 56.036  108.951 1.002   1.00 185.04 ? 2   DC  X C6    1 
ATOM 17   P P     . DA  A 1 2   ? 51.859  105.651 3.438   1.00 173.85 ? 3   DA  X P     1 
ATOM 18   O OP1   . DA  A 1 2   ? 50.721  105.325 4.325   1.00 174.79 ? 3   DA  X OP1   1 
ATOM 19   O OP2   . DA  A 1 2   ? 53.241  105.347 3.871   1.00 173.58 ? 3   DA  X OP2   1 
ATOM 20   O "O5'" . DA  A 1 2   ? 51.606  104.980 2.004   1.00 176.33 ? 3   DA  X "O5'" 1 
ATOM 21   C "C5'" . DA  A 1 2   ? 50.741  103.848 1.848   1.00 180.87 ? 3   DA  X "C5'" 1 
ATOM 22   C "C4'" . DA  A 1 2   ? 51.521  102.551 1.693   1.00 184.29 ? 3   DA  X "C4'" 1 
ATOM 23   O "O4'" . DA  A 1 2   ? 52.759  102.824 0.988   1.00 186.24 ? 3   DA  X "O4'" 1 
ATOM 24   C "C3'" . DA  A 1 2   ? 51.888  101.864 3.011   1.00 185.43 ? 3   DA  X "C3'" 1 
ATOM 25   O "O3'" . DA  A 1 2   ? 51.268  100.550 3.117   1.00 183.84 ? 3   DA  X "O3'" 1 
ATOM 26   C "C2'" . DA  A 1 2   ? 53.420  101.885 3.057   1.00 187.02 ? 3   DA  X "C2'" 1 
ATOM 27   C "C1'" . DA  A 1 2   ? 53.829  102.141 1.606   1.00 188.76 ? 3   DA  X "C1'" 1 
ATOM 28   N N9    . DA  A 1 2   ? 55.049  102.935 1.441   1.00 189.66 ? 3   DA  X N9    1 
ATOM 29   C C8    . DA  A 1 2   ? 55.672  103.708 2.385   1.00 189.99 ? 3   DA  X C8    1 
ATOM 30   N N7    . DA  A 1 2   ? 56.755  104.309 1.956   1.00 189.95 ? 3   DA  X N7    1 
ATOM 31   C C5    . DA  A 1 2   ? 56.851  103.903 0.637   1.00 189.43 ? 3   DA  X C5    1 
ATOM 32   C C6    . DA  A 1 2   ? 57.786  104.193 -0.376  1.00 188.96 ? 3   DA  X C6    1 
ATOM 33   N N6    . DA  A 1 2   ? 58.834  104.993 -0.177  1.00 189.23 ? 3   DA  X N6    1 
ATOM 34   N N1    . DA  A 1 2   ? 57.605  103.630 -1.592  1.00 189.08 ? 3   DA  X N1    1 
ATOM 35   C C2    . DA  A 1 2   ? 56.548  102.827 -1.779  1.00 189.10 ? 3   DA  X C2    1 
ATOM 36   N N3    . DA  A 1 2   ? 55.602  102.480 -0.903  1.00 188.96 ? 3   DA  X N3    1 
ATOM 37   C C4    . DA  A 1 2   ? 55.810  103.056 0.298   1.00 189.47 ? 3   DA  X C4    1 
ATOM 38   P P     . DG  A 1 3   ? 51.955  99.138  2.767   1.00 182.64 ? 4   DG  X P     1 
ATOM 39   O OP1   . DG  A 1 3   ? 50.927  98.089  2.946   1.00 183.24 ? 4   DG  X OP1   1 
ATOM 40   O OP2   . DG  A 1 3   ? 53.213  99.025  3.537   1.00 182.00 ? 4   DG  X OP2   1 
ATOM 41   O "O5'" . DG  A 1 3   ? 52.303  99.260  1.204   1.00 183.52 ? 4   DG  X "O5'" 1 
ATOM 42   C "C5'" . DG  A 1 3   ? 51.421  98.800  0.170   1.00 182.89 ? 4   DG  X "C5'" 1 
ATOM 43   C "C4'" . DG  A 1 3   ? 52.188  98.121  -0.961  1.00 182.42 ? 4   DG  X "C4'" 1 
ATOM 44   O "O4'" . DG  A 1 3   ? 53.450  98.800  -1.197  1.00 182.24 ? 4   DG  X "O4'" 1 
ATOM 45   C "C3'" . DG  A 1 3   ? 52.538  96.649  -0.739  1.00 182.40 ? 4   DG  X "C3'" 1 
ATOM 46   O "O3'" . DG  A 1 3   ? 52.377  95.916  -1.963  1.00 183.07 ? 4   DG  X "O3'" 1 
ATOM 47   C "C2'" . DG  A 1 3   ? 53.991  96.691  -0.269  1.00 181.40 ? 4   DG  X "C2'" 1 
ATOM 48   C "C1'" . DG  A 1 3   ? 54.544  97.930  -0.963  1.00 180.99 ? 4   DG  X "C1'" 1 
ATOM 49   N N9    . DG  A 1 3   ? 55.538  98.633  -0.152  1.00 181.23 ? 4   DG  X N9    1 
ATOM 50   C C8    . DG  A 1 3   ? 55.503  98.820  1.213   1.00 180.78 ? 4   DG  X C8    1 
ATOM 51   N N7    . DG  A 1 3   ? 56.522  99.482  1.682   1.00 180.69 ? 4   DG  X N7    1 
ATOM 52   C C5    . DG  A 1 3   ? 57.287  99.758  0.557   1.00 181.29 ? 4   DG  X C5    1 
ATOM 53   C C6    . DG  A 1 3   ? 58.515  100.457 0.448   1.00 181.19 ? 4   DG  X C6    1 
ATOM 54   O O6    . DG  A 1 3   ? 59.171  100.978 1.362   1.00 180.33 ? 4   DG  X O6    1 
ATOM 55   N N1    . DG  A 1 3   ? 58.966  100.521 -0.875  1.00 180.88 ? 4   DG  X N1    1 
ATOM 56   C C2    . DG  A 1 3   ? 58.308  99.972  -1.956  1.00 180.18 ? 4   DG  X C2    1 
ATOM 57   N N2    . DG  A 1 3   ? 58.890  100.130 -3.153  1.00 179.56 ? 4   DG  X N2    1 
ATOM 58   N N3    . DG  A 1 3   ? 57.154  99.316  -1.865  1.00 180.62 ? 4   DG  X N3    1 
ATOM 59   C C4    . DG  A 1 3   ? 56.699  99.243  -0.584  1.00 181.68 ? 4   DG  X C4    1 
ATOM 60   P P     . DT  A 1 4   ? 52.872  94.399  -2.162  1.00 183.87 ? 5   DT  X P     1 
ATOM 61   O OP1   . DT  A 1 4   ? 51.985  93.776  -3.170  1.00 183.23 ? 5   DT  X OP1   1 
ATOM 62   O OP2   . DT  A 1 4   ? 53.030  93.739  -0.843  1.00 183.51 ? 5   DT  X OP2   1 
ATOM 63   O "O5'" . DT  A 1 4   ? 54.314  94.607  -2.828  1.00 183.01 ? 5   DT  X "O5'" 1 
ATOM 64   C "C5'" . DT  A 1 4   ? 54.440  95.147  -4.145  1.00 181.12 ? 5   DT  X "C5'" 1 
ATOM 65   C "C4'" . DT  A 1 4   ? 55.879  95.091  -4.631  1.00 180.47 ? 5   DT  X "C4'" 1 
ATOM 66   O "O4'" . DT  A 1 4   ? 56.683  96.001  -3.837  1.00 181.19 ? 5   DT  X "O4'" 1 
ATOM 67   C "C3'" . DT  A 1 4   ? 56.557  93.722  -4.545  1.00 178.88 ? 5   DT  X "C3'" 1 
ATOM 68   O "O3'" . DT  A 1 4   ? 57.177  93.394  -5.788  1.00 176.53 ? 5   DT  X "O3'" 1 
ATOM 69   C "C2'" . DT  A 1 4   ? 57.592  93.903  -3.440  1.00 179.76 ? 5   DT  X "C2'" 1 
ATOM 70   C "C1'" . DT  A 1 4   ? 57.923  95.380  -3.585  1.00 183.73 ? 5   DT  X "C1'" 1 
ATOM 71   N N1    . DT  A 1 4   ? 58.560  95.981  -2.371  1.00 185.76 ? 5   DT  X N1    1 
ATOM 72   C C2    . DT  A 1 4   ? 59.746  96.687  -2.501  1.00 187.00 ? 5   DT  X C2    1 
ATOM 73   O O2    . DT  A 1 4   ? 60.322  96.864  -3.563  1.00 187.09 ? 5   DT  X O2    1 
ATOM 74   N N3    . DT  A 1 4   ? 60.243  97.190  -1.319  1.00 187.19 ? 5   DT  X N3    1 
ATOM 75   C C4    . DT  A 1 4   ? 59.689  97.062  -0.052  1.00 186.09 ? 5   DT  X C4    1 
ATOM 76   O O4    . DT  A 1 4   ? 60.218  97.555  0.941   1.00 185.65 ? 5   DT  X O4    1 
ATOM 77   C C5    . DT  A 1 4   ? 58.452  96.311  0.010   1.00 186.75 ? 5   DT  X C5    1 
ATOM 78   C C7    . DT  A 1 4   ? 57.746  96.094  1.317   1.00 186.57 ? 5   DT  X C7    1 
ATOM 79   C C6    . DT  A 1 4   ? 57.956  95.815  -1.134  1.00 186.43 ? 5   DT  X C6    1 
ATOM 80   P P     . DG  A 1 5   ? 57.893  91.982  -6.038  1.00 175.42 ? 6   DG  X P     1 
ATOM 81   O OP1   . DG  A 1 5   ? 57.730  91.658  -7.473  1.00 175.61 ? 6   DG  X OP1   1 
ATOM 82   O OP2   . DG  A 1 5   ? 57.418  91.013  -5.021  1.00 174.50 ? 6   DG  X OP2   1 
ATOM 83   O "O5'" . DG  A 1 5   ? 59.434  92.317  -5.763  1.00 176.84 ? 6   DG  X "O5'" 1 
ATOM 84   C "C5'" . DG  A 1 5   ? 60.301  92.758  -6.810  1.00 181.40 ? 6   DG  X "C5'" 1 
ATOM 85   C "C4'" . DG  A 1 5   ? 61.686  93.097  -6.277  1.00 186.76 ? 6   DG  X "C4'" 1 
ATOM 86   O "O4'" . DG  A 1 5   ? 61.562  93.855  -5.042  1.00 189.42 ? 6   DG  X "O4'" 1 
ATOM 87   C "C3'" . DG  A 1 5   ? 62.595  91.902  -5.965  1.00 187.83 ? 6   DG  X "C3'" 1 
ATOM 88   O "O3'" . DG  A 1 5   ? 63.864  92.045  -6.642  1.00 186.91 ? 6   DG  X "O3'" 1 
ATOM 89   C "C2'" . DG  A 1 5   ? 62.718  91.936  -4.442  1.00 188.43 ? 6   DG  X "C2'" 1 
ATOM 90   C "C1'" . DG  A 1 5   ? 62.572  93.422  -4.154  1.00 190.54 ? 6   DG  X "C1'" 1 
ATOM 91   N N9    . DG  A 1 5   ? 62.208  93.736  -2.770  1.00 191.26 ? 6   DG  X N9    1 
ATOM 92   C C8    . DG  A 1 5   ? 61.089  93.325  -2.082  1.00 191.05 ? 6   DG  X C8    1 
ATOM 93   N N7    . DG  A 1 5   ? 61.034  93.764  -0.854  1.00 190.84 ? 6   DG  X N7    1 
ATOM 94   C C5    . DG  A 1 5   ? 62.192  94.517  -0.712  1.00 191.37 ? 6   DG  X C5    1 
ATOM 95   C C6    . DG  A 1 5   ? 62.681  95.243  0.406   1.00 190.82 ? 6   DG  X C6    1 
ATOM 96   O O6    . DG  A 1 5   ? 62.164  95.362  1.525   1.00 190.58 ? 6   DG  X O6    1 
ATOM 97   N N1    . DG  A 1 5   ? 63.899  95.872  0.130   1.00 191.04 ? 6   DG  X N1    1 
ATOM 98   C C2    . DG  A 1 5   ? 64.561  95.805  -1.078  1.00 191.20 ? 6   DG  X C2    1 
ATOM 99   N N2    . DG  A 1 5   ? 65.720  96.472  -1.168  1.00 191.04 ? 6   DG  X N2    1 
ATOM 100  N N3    . DG  A 1 5   ? 64.112  95.129  -2.130  1.00 191.99 ? 6   DG  X N3    1 
ATOM 101  C C4    . DG  A 1 5   ? 62.927  94.510  -1.881  1.00 192.02 ? 6   DG  X C4    1 
ATOM 102  P P     . DT  A 1 6   ? 65.195  91.230  -6.254  1.00 184.41 ? 7   DT  X P     1 
ATOM 103  O OP1   . DT  A 1 6   ? 66.097  91.250  -7.429  1.00 184.70 ? 7   DT  X OP1   1 
ATOM 104  O OP2   . DT  A 1 6   ? 64.821  89.924  -5.663  1.00 184.17 ? 7   DT  X OP2   1 
ATOM 105  O "O5'" . DT  A 1 6   ? 65.842  92.169  -5.132  1.00 183.02 ? 7   DT  X "O5'" 1 
ATOM 106  C "C5'" . DT  A 1 6   ? 66.431  93.416  -5.499  1.00 181.92 ? 7   DT  X "C5'" 1 
ATOM 107  C "C4'" . DT  A 1 6   ? 67.784  93.631  -4.831  1.00 181.77 ? 7   DT  X "C4'" 1 
ATOM 108  O "O4'" . DT  A 1 6   ? 67.593  94.098  -3.472  1.00 181.26 ? 7   DT  X "O4'" 1 
ATOM 109  C "C3'" . DT  A 1 6   ? 68.711  92.422  -4.728  1.00 180.64 ? 7   DT  X "C3'" 1 
ATOM 110  O "O3'" . DT  A 1 6   ? 70.053  92.860  -4.937  1.00 180.88 ? 7   DT  X "O3'" 1 
ATOM 111  C "C2'" . DT  A 1 6   ? 68.473  91.902  -3.310  1.00 178.87 ? 7   DT  X "C2'" 1 
ATOM 112  C "C1'" . DT  A 1 6   ? 68.123  93.174  -2.544  1.00 179.96 ? 7   DT  X "C1'" 1 
ATOM 113  N N1    . DT  A 1 6   ? 67.089  92.996  -1.488  1.00 179.93 ? 7   DT  X N1    1 
ATOM 114  C C2    . DT  A 1 6   ? 67.181  93.729  -0.318  1.00 180.27 ? 7   DT  X C2    1 
ATOM 115  O O2    . DT  A 1 6   ? 68.074  94.524  -0.076  1.00 179.79 ? 7   DT  X O2    1 
ATOM 116  N N3    . DT  A 1 6   ? 66.168  93.489  0.580   1.00 180.80 ? 7   DT  X N3    1 
ATOM 117  C C4    . DT  A 1 6   ? 65.099  92.620  0.429   1.00 180.32 ? 7   DT  X C4    1 
ATOM 118  O O4    . DT  A 1 6   ? 64.249  92.482  1.305   1.00 180.46 ? 7   DT  X O4    1 
ATOM 119  C C5    . DT  A 1 6   ? 65.065  91.888  -0.817  1.00 180.02 ? 7   DT  X C5    1 
ATOM 120  C C7    . DT  A 1 6   ? 63.964  90.910  -1.106  1.00 180.52 ? 7   DT  X C7    1 
ATOM 121  C C6    . DT  A 1 6   ? 66.044  92.114  -1.704  1.00 179.75 ? 7   DT  X C6    1 
ATOM 122  P P     . DC  A 1 7   ? 71.315  91.901  -4.711  1.00 181.18 ? 8   DC  X P     1 
ATOM 123  O OP1   . DC  A 1 7   ? 72.475  92.486  -5.422  1.00 182.52 ? 8   DC  X OP1   1 
ATOM 124  O OP2   . DC  A 1 7   ? 70.899  90.514  -5.019  1.00 180.43 ? 8   DC  X OP2   1 
ATOM 125  O "O5'" . DC  A 1 7   ? 71.599  92.051  -3.144  1.00 181.97 ? 8   DC  X "O5'" 1 
ATOM 126  C "C5'" . DC  A 1 7   ? 71.949  93.318  -2.591  1.00 181.79 ? 8   DC  X "C5'" 1 
ATOM 127  C "C4'" . DC  A 1 7   ? 72.071  93.225  -1.082  1.00 182.24 ? 8   DC  X "C4'" 1 
ATOM 128  O "O4'" . DC  A 1 7   ? 70.757  93.053  -0.494  1.00 182.46 ? 8   DC  X "O4'" 1 
ATOM 129  C "C3'" . DC  A 1 7   ? 72.918  92.057  -0.578  1.00 182.06 ? 8   DC  X "C3'" 1 
ATOM 130  O "O3'" . DC  A 1 7   ? 74.041  92.554  0.144   1.00 184.27 ? 8   DC  X "O3'" 1 
ATOM 131  C "C2'" . DC  A 1 7   ? 71.968  91.261  0.317   1.00 182.32 ? 8   DC  X "C2'" 1 
ATOM 132  C "C1'" . DC  A 1 7   ? 70.937  92.318  0.696   1.00 182.23 ? 8   DC  X "C1'" 1 
ATOM 133  N N1    . DC  A 1 7   ? 69.621  91.783  1.204   1.00 181.85 ? 8   DC  X N1    1 
ATOM 134  C C2    . DC  A 1 7   ? 69.111  92.216  2.446   1.00 181.24 ? 8   DC  X C2    1 
ATOM 135  O O2    . DC  A 1 7   ? 69.734  93.040  3.131   1.00 181.92 ? 8   DC  X O2    1 
ATOM 136  N N3    . DC  A 1 7   ? 67.925  91.716  2.882   1.00 180.26 ? 8   DC  X N3    1 
ATOM 137  C C4    . DC  A 1 7   ? 67.259  90.826  2.142   1.00 181.14 ? 8   DC  X C4    1 
ATOM 138  N N4    . DC  A 1 7   ? 66.096  90.369  2.615   1.00 181.64 ? 8   DC  X N4    1 
ATOM 139  C C5    . DC  A 1 7   ? 67.755  90.372  0.881   1.00 181.71 ? 8   DC  X C5    1 
ATOM 140  C C6    . DC  A 1 7   ? 68.925  90.870  0.457   1.00 181.43 ? 8   DC  X C6    1 
ATOM 141  P P     . DC  A 1 8   ? 75.373  91.680  0.330   1.00 186.77 ? 9   DC  X P     1 
ATOM 142  O OP1   . DC  A 1 8   ? 76.414  92.596  0.854   1.00 186.54 ? 9   DC  X OP1   1 
ATOM 143  O OP2   . DC  A 1 8   ? 75.629  90.921  -0.917  1.00 186.17 ? 9   DC  X OP2   1 
ATOM 144  O "O5'" . DC  A 1 8   ? 74.963  90.638  1.478   1.00 188.07 ? 9   DC  X "O5'" 1 
ATOM 145  C "C5'" . DC  A 1 8   ? 75.804  90.399  2.605   1.00 190.92 ? 9   DC  X "C5'" 1 
ATOM 146  C "C4'" . DC  A 1 8   ? 75.396  91.238  3.808   1.00 192.20 ? 9   DC  X "C4'" 1 
ATOM 147  O "O4'" . DC  A 1 8   ? 74.022  91.705  3.657   1.00 190.97 ? 9   DC  X "O4'" 1 
ATOM 148  C "C3'" . DC  A 1 8   ? 75.376  90.477  5.130   1.00 192.89 ? 9   DC  X "C3'" 1 
ATOM 149  O "O3'" . DC  A 1 8   ? 76.711  90.220  5.665   1.00 189.28 ? 9   DC  X "O3'" 1 
ATOM 150  C "C2'" . DC  A 1 8   ? 74.430  91.360  5.945   1.00 192.95 ? 9   DC  X "C2'" 1 
ATOM 151  C "C1'" . DC  A 1 8   ? 73.350  91.665  4.908   1.00 190.94 ? 9   DC  X "C1'" 1 
ATOM 152  N N1    . DC  A 1 8   ? 72.200  90.661  4.906   1.00 190.68 ? 9   DC  X N1    1 
ATOM 153  C C2    . DC  A 1 8   ? 71.195  90.726  5.897   1.00 190.35 ? 9   DC  X C2    1 
ATOM 154  O O2    . DC  A 1 8   ? 71.234  91.601  6.772   1.00 191.78 ? 9   DC  X O2    1 
ATOM 155  N N3    . DC  A 1 8   ? 70.183  89.818  5.880   1.00 188.35 ? 9   DC  X N3    1 
ATOM 156  C C4    . DC  A 1 8   ? 70.142  88.877  4.935   1.00 189.27 ? 9   DC  X C4    1 
ATOM 157  N N4    . DC  A 1 8   ? 69.126  88.013  4.964   1.00 190.30 ? 9   DC  X N4    1 
ATOM 158  C C5    . DC  A 1 8   ? 71.144  88.782  3.921   1.00 189.93 ? 9   DC  X C5    1 
ATOM 159  C C6    . DC  A 1 8   ? 72.138  89.681  3.946   1.00 189.87 ? 9   DC  X C6    1 
ATOM 160  P P     . DG  A 1 9   ? 77.503  91.033  6.807   1.00 186.21 ? 10  DG  X P     1 
ATOM 161  O OP1   . DG  A 1 9   ? 78.429  91.971  6.136   1.00 188.08 ? 10  DG  X OP1   1 
ATOM 162  O OP2   . DG  A 1 9   ? 78.056  90.022  7.732   1.00 187.78 ? 10  DG  X OP2   1 
ATOM 163  O "O5'" . DG  A 1 9   ? 76.403  91.909  7.569   1.00 186.39 ? 10  DG  X "O5'" 1 
ATOM 164  C "C5'" . DG  A 1 9   ? 76.604  92.377  8.894   1.00 186.01 ? 10  DG  X "C5'" 1 
ATOM 165  C "C4'" . DG  A 1 9   ? 75.711  91.633  9.876   1.00 185.53 ? 10  DG  X "C4'" 1 
ATOM 166  O "O4'" . DG  A 1 9   ? 74.619  90.955  9.196   1.00 184.51 ? 10  DG  X "O4'" 1 
ATOM 167  C "C3'" . DG  A 1 9   ? 76.418  90.552  10.690  1.00 185.35 ? 10  DG  X "C3'" 1 
ATOM 168  O "O3'" . DG  A 1 9   ? 75.987  90.629  12.045  1.00 183.63 ? 10  DG  X "O3'" 1 
ATOM 169  C "C2'" . DG  A 1 9   ? 75.936  89.265  10.029  1.00 185.62 ? 10  DG  X "C2'" 1 
ATOM 170  C "C1'" . DG  A 1 9   ? 74.493  89.680  9.789   1.00 185.89 ? 10  DG  X "C1'" 1 
ATOM 171  N N9    . DG  A 1 9   ? 73.695  88.763  8.971   1.00 186.62 ? 10  DG  X N9    1 
ATOM 172  C C8    . DG  A 1 9   ? 74.036  88.150  7.786   1.00 186.64 ? 10  DG  X C8    1 
ATOM 173  N N7    . DG  A 1 9   ? 73.096  87.380  7.306   1.00 186.16 ? 10  DG  X N7    1 
ATOM 174  C C5    . DG  A 1 9   ? 72.065  87.487  8.233   1.00 186.35 ? 10  DG  X C5    1 
ATOM 175  C C6    . DG  A 1 9   ? 70.782  86.882  8.256   1.00 186.21 ? 10  DG  X C6    1 
ATOM 176  O O6    . DG  A 1 9   ? 70.293  86.102  7.428   1.00 186.34 ? 10  DG  X O6    1 
ATOM 177  N N1    . DG  A 1 9   ? 70.042  87.255  9.381   1.00 186.17 ? 10  DG  X N1    1 
ATOM 178  C C2    . DG  A 1 9   ? 70.487  88.112  10.365  1.00 186.05 ? 10  DG  X C2    1 
ATOM 179  N N2    . DG  A 1 9   ? 69.642  88.363  11.376  1.00 185.96 ? 10  DG  X N2    1 
ATOM 180  N N3    . DG  A 1 9   ? 71.685  88.686  10.354  1.00 186.08 ? 10  DG  X N3    1 
ATOM 181  C C4    . DG  A 1 9   ? 72.419  88.332  9.264   1.00 186.66 ? 10  DG  X C4    1 
ATOM 182  P P     . DA  A 1 10  ? 76.847  89.935  13.196  1.00 181.16 ? 11  DA  X P     1 
ATOM 183  O OP1   . DA  A 1 10  ? 78.138  90.653  13.233  1.00 184.00 ? 11  DA  X OP1   1 
ATOM 184  O OP2   . DA  A 1 10  ? 76.830  88.474  12.968  1.00 179.25 ? 11  DA  X OP2   1 
ATOM 185  O "O5'" . DA  A 1 10  ? 76.046  90.231  14.555  1.00 182.98 ? 11  DA  X "O5'" 1 
ATOM 186  C "C5'" . DA  A 1 10  ? 74.660  90.582  14.576  1.00 185.17 ? 11  DA  X "C5'" 1 
ATOM 187  C "C4'" . DA  A 1 10  ? 73.729  89.394  14.803  1.00 188.41 ? 11  DA  X "C4'" 1 
ATOM 188  O "O4'" . DA  A 1 10  ? 73.419  88.767  13.529  1.00 189.81 ? 11  DA  X "O4'" 1 
ATOM 189  C "C3'" . DA  A 1 10  ? 74.213  88.268  15.727  1.00 189.52 ? 11  DA  X "C3'" 1 
ATOM 190  O "O3'" . DA  A 1 10  ? 73.230  88.015  16.748  1.00 190.85 ? 11  DA  X "O3'" 1 
ATOM 191  C "C2'" . DA  A 1 10  ? 74.378  87.079  14.779  1.00 189.80 ? 11  DA  X "C2'" 1 
ATOM 192  C "C1'" . DA  A 1 10  ? 73.292  87.380  13.756  1.00 189.80 ? 11  DA  X "C1'" 1 
ATOM 193  N N9    . DA  A 1 10  ? 73.427  86.646  12.498  1.00 189.99 ? 11  DA  X N9    1 
ATOM 194  C C8    . DA  A 1 10  ? 74.510  86.617  11.662  1.00 190.05 ? 11  DA  X C8    1 
ATOM 195  N N7    . DA  A 1 10  ? 74.350  85.867  10.598  1.00 189.42 ? 11  DA  X N7    1 
ATOM 196  C C5    . DA  A 1 10  ? 73.071  85.363  10.747  1.00 189.59 ? 11  DA  X C5    1 
ATOM 197  C C6    . DA  A 1 10  ? 72.296  84.497  9.950   1.00 189.70 ? 11  DA  X C6    1 
ATOM 198  N N6    . DA  A 1 10  ? 72.739  83.977  8.803   1.00 190.18 ? 11  DA  X N6    1 
ATOM 199  N N1    . DA  A 1 10  ? 71.051  84.187  10.380  1.00 189.94 ? 11  DA  X N1    1 
ATOM 200  C C2    . DA  A 1 10  ? 70.611  84.717  11.532  1.00 189.88 ? 11  DA  X C2    1 
ATOM 201  N N3    . DA  A 1 10  ? 71.249  85.542  12.366  1.00 189.78 ? 11  DA  X N3    1 
ATOM 202  C C4    . DA  A 1 10  ? 72.485  85.831  11.913  1.00 189.73 ? 11  DA  X C4    1 
ATOM 203  P P     . DT  A 1 11  ? 73.283  86.767  17.762  1.00 191.74 ? 12  DT  X P     1 
ATOM 204  O OP1   . DT  A 1 11  ? 72.735  87.235  19.055  1.00 190.82 ? 12  DT  X OP1   1 
ATOM 205  O OP2   . DT  A 1 11  ? 74.632  86.157  17.732  1.00 191.14 ? 12  DT  X OP2   1 
ATOM 206  O "O5'" . DT  A 1 11  ? 72.264  85.725  17.093  1.00 192.43 ? 12  DT  X "O5'" 1 
ATOM 207  C "C5'" . DT  A 1 11  ? 70.926  85.581  17.574  1.00 192.77 ? 12  DT  X "C5'" 1 
ATOM 208  C "C4'" . DT  A 1 11  ? 70.304  84.273  17.112  1.00 192.68 ? 12  DT  X "C4'" 1 
ATOM 209  O "O4'" . DT  A 1 11  ? 70.588  84.077  15.703  1.00 191.97 ? 12  DT  X "O4'" 1 
ATOM 210  C "C3'" . DT  A 1 11  ? 70.789  83.022  17.851  1.00 192.38 ? 12  DT  X "C3'" 1 
ATOM 211  O "O3'" . DT  A 1 11  ? 69.686  82.446  18.600  1.00 193.31 ? 12  DT  X "O3'" 1 
ATOM 212  C "C2'" . DT  A 1 11  ? 71.377  82.132  16.752  1.00 191.27 ? 12  DT  X "C2'" 1 
ATOM 213  C "C1'" . DT  A 1 11  ? 70.775  82.698  15.468  1.00 190.14 ? 12  DT  X "C1'" 1 
ATOM 214  N N1    . DT  A 1 11  ? 71.636  82.502  14.248  1.00 189.43 ? 12  DT  X N1    1 
ATOM 215  C C2    . DT  A 1 11  ? 71.128  81.819  13.155  1.00 188.84 ? 12  DT  X C2    1 
ATOM 216  O O2    . DT  A 1 11  ? 70.001  81.355  13.105  1.00 188.66 ? 12  DT  X O2    1 
ATOM 217  N N3    . DT  A 1 11  ? 72.002  81.697  12.099  1.00 187.81 ? 12  DT  X N3    1 
ATOM 218  C C4    . DT  A 1 11  ? 73.302  82.171  12.020  1.00 188.14 ? 12  DT  X C4    1 
ATOM 219  O O4    . DT  A 1 11  ? 73.993  82.003  11.018  1.00 187.45 ? 12  DT  X O4    1 
ATOM 220  C C5    . DT  A 1 11  ? 73.771  82.873  13.194  1.00 188.94 ? 12  DT  X C5    1 
ATOM 221  C C7    . DT  A 1 11  ? 75.160  83.441  13.249  1.00 189.52 ? 12  DT  X C7    1 
ATOM 222  C C6    . DT  A 1 11  ? 72.929  83.001  14.232  1.00 189.55 ? 12  DT  X C6    1 
ATOM 223  P P     . DA  A 1 12  ? 69.347  80.879  18.760  1.00 193.17 ? 13  DA  X P     1 
ATOM 224  O OP1   . DA  A 1 12  ? 68.311  80.763  19.814  1.00 192.45 ? 13  DA  X OP1   1 
ATOM 225  O OP2   . DA  A 1 12  ? 70.605  80.111  18.912  1.00 190.89 ? 13  DA  X OP2   1 
ATOM 226  O "O5'" . DA  A 1 12  ? 68.675  80.536  17.345  1.00 191.27 ? 13  DA  X "O5'" 1 
ATOM 227  C "C5'" . DA  A 1 12  ? 67.422  79.861  17.246  1.00 187.62 ? 13  DA  X "C5'" 1 
ATOM 228  C "C4'" . DA  A 1 12  ? 67.530  78.659  16.323  1.00 185.03 ? 13  DA  X "C4'" 1 
ATOM 229  O "O4'" . DA  A 1 12  ? 68.463  78.940  15.240  1.00 183.52 ? 13  DA  X "O4'" 1 
ATOM 230  C "C3'" . DA  A 1 12  ? 68.010  77.369  16.991  1.00 184.00 ? 13  DA  X "C3'" 1 
ATOM 231  O "O3'" . DA  A 1 12  ? 67.140  76.291  16.599  1.00 184.75 ? 13  DA  X "O3'" 1 
ATOM 232  C "C2'" . DA  A 1 12  ? 69.444  77.236  16.475  1.00 182.30 ? 13  DA  X "C2'" 1 
ATOM 233  C "C1'" . DA  A 1 12  ? 69.317  77.826  15.075  1.00 180.69 ? 13  DA  X "C1'" 1 
ATOM 234  N N9    . DA  A 1 12  ? 70.586  78.237  14.467  1.00 179.99 ? 13  DA  X N9    1 
ATOM 235  C C8    . DA  A 1 12  ? 71.577  78.986  15.043  1.00 179.52 ? 13  DA  X C8    1 
ATOM 236  N N7    . DA  A 1 12  ? 72.611  79.200  14.263  1.00 179.41 ? 13  DA  X N7    1 
ATOM 237  C C5    . DA  A 1 12  ? 72.280  78.546  13.090  1.00 178.75 ? 13  DA  X C5    1 
ATOM 238  C C6    . DA  A 1 12  ? 72.958  78.394  11.861  1.00 178.42 ? 13  DA  X C6    1 
ATOM 239  N N6    . DA  A 1 12  ? 74.161  78.920  11.623  1.00 180.20 ? 13  DA  X N6    1 
ATOM 240  N N1    . DA  A 1 12  ? 72.360  77.679  10.885  1.00 177.71 ? 13  DA  X N1    1 
ATOM 241  C C2    . DA  A 1 12  ? 71.152  77.153  11.129  1.00 178.81 ? 13  DA  X C2    1 
ATOM 242  N N3    . DA  A 1 12  ? 70.415  77.228  12.241  1.00 178.74 ? 13  DA  X N3    1 
ATOM 243  C C4    . DA  A 1 12  ? 71.037  77.945  13.196  1.00 178.99 ? 13  DA  X C4    1 
ATOM 244  P P     . DA  A 1 13  ? 67.418  74.725  16.852  1.00 185.86 ? 14  DA  X P     1 
ATOM 245  O OP1   . DA  A 1 13  ? 66.614  74.300  18.019  1.00 185.99 ? 14  DA  X OP1   1 
ATOM 246  O OP2   . DA  A 1 13  ? 68.870  74.445  16.839  1.00 185.05 ? 14  DA  X OP2   1 
ATOM 247  O "O5'" . DA  A 1 13  ? 66.773  74.049  15.552  1.00 186.12 ? 14  DA  X "O5'" 1 
ATOM 248  C "C5'" . DA  A 1 13  ? 66.778  74.711  14.281  1.00 185.50 ? 14  DA  X "C5'" 1 
ATOM 249  C "C4'" . DA  A 1 13  ? 67.546  73.958  13.198  1.00 185.70 ? 14  DA  X "C4'" 1 
ATOM 250  O "O4'" . DA  A 1 13  ? 68.830  74.594  12.955  1.00 186.52 ? 14  DA  X "O4'" 1 
ATOM 251  C "C3'" . DA  A 1 13  ? 67.873  72.485  13.438  1.00 185.31 ? 14  DA  X "C3'" 1 
ATOM 252  O "O3'" . DA  A 1 13  ? 67.742  71.799  12.200  1.00 185.90 ? 14  DA  X "O3'" 1 
ATOM 253  C "C2'" . DA  A 1 13  ? 69.332  72.521  13.886  1.00 184.16 ? 14  DA  X "C2'" 1 
ATOM 254  C "C1'" . DA  A 1 13  ? 69.845  73.605  12.946  1.00 185.21 ? 14  DA  X "C1'" 1 
ATOM 255  N N9    . DA  A 1 13  ? 71.109  74.250  13.302  1.00 185.29 ? 14  DA  X N9    1 
ATOM 256  C C8    . DA  A 1 13  ? 71.446  74.817  14.502  1.00 184.90 ? 14  DA  X C8    1 
ATOM 257  N N7    . DA  A 1 13  ? 72.651  75.335  14.526  1.00 184.18 ? 14  DA  X N7    1 
ATOM 258  C C5    . DA  A 1 13  ? 73.134  75.104  13.251  1.00 184.08 ? 14  DA  X C5    1 
ATOM 259  C C6    . DA  A 1 13  ? 74.363  75.411  12.630  1.00 184.31 ? 14  DA  X C6    1 
ATOM 260  N N6    . DA  A 1 13  ? 75.354  76.050  13.259  1.00 185.32 ? 14  DA  X N6    1 
ATOM 261  N N1    . DA  A 1 13  ? 74.533  75.039  11.340  1.00 184.40 ? 14  DA  X N1    1 
ATOM 262  C C2    . DA  A 1 13  ? 73.535  74.400  10.713  1.00 184.31 ? 14  DA  X C2    1 
ATOM 263  N N3    . DA  A 1 13  ? 72.340  74.052  11.195  1.00 184.71 ? 14  DA  X N3    1 
ATOM 264  C C4    . DA  A 1 13  ? 72.199  74.434  12.480  1.00 184.61 ? 14  DA  X C4    1 
ATOM 265  P P     . DT  A 1 14  ? 67.253  70.281  12.113  1.00 187.82 ? 15  DT  X P     1 
ATOM 266  O OP1   . DT  A 1 14  ? 65.984  70.282  11.351  1.00 187.32 ? 15  DT  X OP1   1 
ATOM 267  O OP2   . DT  A 1 14  ? 67.309  69.672  13.465  1.00 187.34 ? 15  DT  X OP2   1 
ATOM 268  O "O5'" . DT  A 1 14  ? 68.374  69.615  11.188  1.00 186.02 ? 15  DT  X "O5'" 1 
ATOM 269  C "C5'" . DT  A 1 14  ? 69.617  69.234  11.757  1.00 184.44 ? 15  DT  X "C5'" 1 
ATOM 270  C "C4'" . DT  A 1 14  ? 70.707  69.197  10.702  1.00 184.10 ? 15  DT  X "C4'" 1 
ATOM 271  O "O4'" . DT  A 1 14  ? 71.438  70.451  10.761  1.00 184.65 ? 15  DT  X "O4'" 1 
ATOM 272  C "C3'" . DT  A 1 14  ? 71.704  68.057  10.906  1.00 183.00 ? 15  DT  X "C3'" 1 
ATOM 273  O "O3'" . DT  A 1 14  ? 71.555  67.041  9.897   1.00 179.65 ? 15  DT  X "O3'" 1 
ATOM 274  C "C2'" . DT  A 1 14  ? 73.085  68.711  10.836  1.00 184.55 ? 15  DT  X "C2'" 1 
ATOM 275  C "C1'" . DT  A 1 14  ? 72.837  70.218  10.763  1.00 185.01 ? 15  DT  X "C1'" 1 
ATOM 276  N N1    . DT  A 1 14  ? 73.503  70.966  11.889  1.00 184.55 ? 15  DT  X N1    1 
ATOM 277  C C2    . DT  A 1 14  ? 74.754  71.518  11.679  1.00 184.05 ? 15  DT  X C2    1 
ATOM 278  O O2    . DT  A 1 14  ? 75.355  71.450  10.622  1.00 184.27 ? 15  DT  X O2    1 
ATOM 279  N N3    . DT  A 1 14  ? 75.284  72.176  12.764  1.00 183.78 ? 15  DT  X N3    1 
ATOM 280  C C4    . DT  A 1 14  ? 74.709  72.327  14.015  1.00 184.47 ? 15  DT  X C4    1 
ATOM 281  O O4    . DT  A 1 14  ? 75.280  72.939  14.914  1.00 184.47 ? 15  DT  X O4    1 
ATOM 282  C C5    . DT  A 1 14  ? 73.402  71.722  14.171  1.00 184.75 ? 15  DT  X C5    1 
ATOM 283  C C7    . DT  A 1 14  ? 72.664  71.807  15.476  1.00 185.13 ? 15  DT  X C7    1 
ATOM 284  C C6    . DT  A 1 14  ? 72.873  71.077  13.119  1.00 185.06 ? 15  DT  X C6    1 
ATOM 285  P P     . DT  A 1 15  ? 72.155  65.561  10.089  1.00 177.67 ? 16  DT  X P     1 
ATOM 286  O OP1   . DT  A 1 15  ? 71.417  64.653  9.181   1.00 177.87 ? 16  DT  X OP1   1 
ATOM 287  O OP2   . DT  A 1 15  ? 72.194  65.254  11.537  1.00 176.77 ? 16  DT  X OP2   1 
ATOM 288  O "O5'" . DT  A 1 15  ? 73.664  65.700  9.564   1.00 175.95 ? 16  DT  X "O5'" 1 
ATOM 289  C "C5'" . DT  A 1 15  ? 73.990  65.573  8.176   1.00 174.50 ? 16  DT  X "C5'" 1 
ATOM 290  C "C4'" . DT  A 1 15  ? 75.401  66.056  7.871   1.00 173.92 ? 16  DT  X "C4'" 1 
ATOM 291  O "O4'" . DT  A 1 15  ? 75.612  67.364  8.461   1.00 175.32 ? 16  DT  X "O4'" 1 
ATOM 292  C "C3'" . DT  A 1 15  ? 76.531  65.178  8.398   1.00 171.69 ? 16  DT  X "C3'" 1 
ATOM 293  O "O3'" . DT  A 1 15  ? 76.889  64.217  7.406   1.00 168.03 ? 16  DT  X "O3'" 1 
ATOM 294  C "C2'" . DT  A 1 15  ? 77.666  66.170  8.646   1.00 173.50 ? 16  DT  X "C2'" 1 
ATOM 295  C "C1'" . DT  A 1 15  ? 76.956  67.499  8.886   1.00 176.32 ? 16  DT  X "C1'" 1 
ATOM 296  N N1    . DT  A 1 15  ? 76.982  67.987  10.314  1.00 177.71 ? 16  DT  X N1    1 
ATOM 297  C C2    . DT  A 1 15  ? 77.817  69.039  10.651  1.00 178.31 ? 16  DT  X C2    1 
ATOM 298  O O2    . DT  A 1 15  ? 78.550  69.599  9.854   1.00 178.42 ? 16  DT  X O2    1 
ATOM 299  N N3    . DT  A 1 15  ? 77.763  69.415  11.975  1.00 178.86 ? 16  DT  X N3    1 
ATOM 300  C C4    . DT  A 1 15  ? 76.976  68.863  12.978  1.00 178.48 ? 16  DT  X C4    1 
ATOM 301  O O4    . DT  A 1 15  ? 77.012  69.280  14.135  1.00 177.84 ? 16  DT  X O4    1 
ATOM 302  C C5    . DT  A 1 15  ? 76.128  67.765  12.560  1.00 178.73 ? 16  DT  X C5    1 
ATOM 303  C C7    . DT  A 1 15  ? 75.222  67.068  13.536  1.00 178.01 ? 16  DT  X C7    1 
ATOM 304  C C6    . DT  A 1 15  ? 76.173  67.390  11.271  1.00 178.44 ? 16  DT  X C6    1 
ATOM 305  P P     . DT  A 1 16  ? 77.725  62.899  7.766   1.00 167.36 ? 17  DT  X P     1 
ATOM 306  O OP1   . DT  A 1 16  ? 77.724  62.030  6.569   1.00 168.65 ? 17  DT  X OP1   1 
ATOM 307  O OP2   . DT  A 1 16  ? 77.223  62.356  9.051   1.00 167.00 ? 17  DT  X OP2   1 
ATOM 308  O "O5'" . DT  A 1 16  ? 79.205  63.465  8.000   1.00 166.26 ? 17  DT  X "O5'" 1 
ATOM 309  C "C5'" . DT  A 1 16  ? 80.061  63.807  6.907   1.00 164.74 ? 17  DT  X "C5'" 1 
ATOM 310  C "C4'" . DT  A 1 16  ? 81.464  64.141  7.397   1.00 165.34 ? 17  DT  X "C4'" 1 
ATOM 311  O "O4'" . DT  A 1 16  ? 81.390  65.287  8.282   1.00 164.92 ? 17  DT  X "O4'" 1 
ATOM 312  C "C3'" . DT  A 1 16  ? 82.173  63.029  8.169   1.00 164.73 ? 17  DT  X "C3'" 1 
ATOM 313  O "O3'" . DT  A 1 16  ? 83.464  62.764  7.638   1.00 163.34 ? 17  DT  X "O3'" 1 
ATOM 314  C "C2'" . DT  A 1 16  ? 82.283  63.533  9.601   1.00 165.21 ? 17  DT  X "C2'" 1 
ATOM 315  C "C1'" . DT  A 1 16  ? 82.087  65.039  9.485   1.00 167.84 ? 17  DT  X "C1'" 1 
ATOM 316  N N1    . DT  A 1 16  ? 81.290  65.595  10.624  1.00 169.10 ? 17  DT  X N1    1 
ATOM 317  C C2    . DT  A 1 16  ? 81.700  66.752  11.267  1.00 171.16 ? 17  DT  X C2    1 
ATOM 318  O O2    . DT  A 1 16  ? 82.697  67.391  10.967  1.00 171.81 ? 17  DT  X O2    1 
ATOM 319  N N3    . DT  A 1 16  ? 80.877  67.145  12.299  1.00 172.15 ? 17  DT  X N3    1 
ATOM 320  C C4    . DT  A 1 16  ? 79.721  66.520  12.745  1.00 170.17 ? 17  DT  X C4    1 
ATOM 321  O O4    . DT  A 1 16  ? 79.061  66.959  13.682  1.00 169.63 ? 17  DT  X O4    1 
ATOM 322  C C5    . DT  A 1 16  ? 79.354  65.319  12.032  1.00 170.88 ? 17  DT  X C5    1 
ATOM 323  C C7    . DT  A 1 16  ? 78.126  64.540  12.411  1.00 171.39 ? 17  DT  X C7    1 
ATOM 324  C C6    . DT  A 1 16  ? 80.146  64.925  11.025  1.00 170.24 ? 17  DT  X C6    1 
ATOM 325  P P     . DA  A 1 17  ? 84.128  61.321  7.842   1.00 165.93 ? 18  DA  X P     1 
ATOM 326  O OP1   . DA  A 1 17  ? 84.509  60.820  6.501   1.00 165.15 ? 18  DA  X OP1   1 
ATOM 327  O OP2   . DA  A 1 17  ? 83.242  60.493  8.695   1.00 165.20 ? 18  DA  X OP2   1 
ATOM 328  O "O5'" . DA  A 1 17  ? 85.460  61.678  8.661   1.00 171.35 ? 18  DA  X "O5'" 1 
ATOM 329  C "C5'" . DA  A 1 17  ? 85.711  61.145  9.961   1.00 175.80 ? 18  DA  X "C5'" 1 
ATOM 330  C "C4'" . DA  A 1 17  ? 86.105  62.248  10.925  1.00 179.12 ? 18  DA  X "C4'" 1 
ATOM 331  O "O4'" . DA  A 1 17  ? 84.961  63.077  11.233  1.00 179.75 ? 18  DA  X "O4'" 1 
ATOM 332  C "C3'" . DA  A 1 17  ? 86.565  61.756  12.284  1.00 182.40 ? 18  DA  X "C3'" 1 
ATOM 333  O "O3'" . DA  A 1 17  ? 87.956  61.461  12.232  1.00 188.44 ? 18  DA  X "O3'" 1 
ATOM 334  C "C2'" . DA  A 1 17  ? 86.279  62.947  13.198  1.00 181.15 ? 18  DA  X "C2'" 1 
ATOM 335  C "C1'" . DA  A 1 17  ? 85.181  63.727  12.473  1.00 180.18 ? 18  DA  X "C1'" 1 
ATOM 336  N N9    . DA  A 1 17  ? 83.924  63.814  13.228  1.00 180.69 ? 18  DA  X N9    1 
ATOM 337  C C8    . DA  A 1 17  ? 82.792  63.065  13.041  1.00 180.21 ? 18  DA  X C8    1 
ATOM 338  N N7    . DA  A 1 17  ? 81.812  63.354  13.865  1.00 180.14 ? 18  DA  X N7    1 
ATOM 339  C C5    . DA  A 1 17  ? 82.332  64.364  14.657  1.00 180.21 ? 18  DA  X C5    1 
ATOM 340  C C6    . DA  A 1 17  ? 81.792  65.109  15.732  1.00 179.73 ? 18  DA  X C6    1 
ATOM 341  N N6    . DA  A 1 17  ? 80.554  64.926  16.197  1.00 180.40 ? 18  DA  X N6    1 
ATOM 342  N N1    . DA  A 1 17  ? 82.572  66.050  16.314  1.00 179.24 ? 18  DA  X N1    1 
ATOM 343  C C2    . DA  A 1 17  ? 83.815  66.232  15.846  1.00 179.55 ? 18  DA  X C2    1 
ATOM 344  N N3    . DA  A 1 17  ? 84.429  65.595  14.844  1.00 180.56 ? 18  DA  X N3    1 
ATOM 345  C C4    . DA  A 1 17  ? 83.632  64.663  14.281  1.00 180.64 ? 18  DA  X C4    1 
ATOM 346  P P     . DT  A 1 18  ? 88.516  59.960  12.275  1.00 192.42 ? 19  DT  X P     1 
ATOM 347  O OP1   . DT  A 1 18  ? 89.666  59.904  11.345  1.00 191.42 ? 19  DT  X OP1   1 
ATOM 348  O OP2   . DT  A 1 18  ? 87.395  59.002  12.100  1.00 190.99 ? 19  DT  X OP2   1 
ATOM 349  O "O5'" . DT  A 1 18  ? 89.076  59.855  13.775  1.00 194.33 ? 19  DT  X "O5'" 1 
ATOM 350  C "C5'" . DT  A 1 18  ? 88.200  59.766  14.904  1.00 198.16 ? 19  DT  X "C5'" 1 
ATOM 351  C "C4'" . DT  A 1 18  ? 88.602  60.735  16.006  1.00 200.11 ? 19  DT  X "C4'" 1 
ATOM 352  O "O4'" . DT  A 1 18  ? 87.647  61.825  16.045  1.00 200.47 ? 19  DT  X "O4'" 1 
ATOM 353  C "C3'" . DT  A 1 18  ? 88.602  60.144  17.412  1.00 201.10 ? 19  DT  X "C3'" 1 
ATOM 354  O "O3'" . DT  A 1 18  ? 89.893  59.637  17.734  1.00 201.97 ? 19  DT  X "O3'" 1 
ATOM 355  C "C2'" . DT  A 1 18  ? 88.221  61.327  18.302  1.00 200.80 ? 19  DT  X "C2'" 1 
ATOM 356  C "C1'" . DT  A 1 18  ? 87.360  62.196  17.382  1.00 200.84 ? 19  DT  X "C1'" 1 
ATOM 357  N N1    . DT  A 1 18  ? 85.861  62.120  17.615  1.00 201.29 ? 19  DT  X N1    1 
ATOM 358  C C2    . DT  A 1 18  ? 85.169  63.258  18.003  1.00 201.35 ? 19  DT  X C2    1 
ATOM 359  O O2    . DT  A 1 18  ? 85.690  64.347  18.179  1.00 201.75 ? 19  DT  X O2    1 
ATOM 360  N N3    . DT  A 1 18  ? 83.815  63.081  18.183  1.00 200.20 ? 19  DT  X N3    1 
ATOM 361  C C4    . DT  A 1 18  ? 83.092  61.911  18.020  1.00 200.12 ? 19  DT  X C4    1 
ATOM 362  O O4    . DT  A 1 18  ? 81.878  61.872  18.212  1.00 199.91 ? 19  DT  X O4    1 
ATOM 363  C C5    . DT  A 1 18  ? 83.869  60.758  17.614  1.00 200.83 ? 19  DT  X C5    1 
ATOM 364  C C7    . DT  A 1 18  ? 83.223  59.420  17.398  1.00 201.18 ? 19  DT  X C7    1 
ATOM 365  C C6    . DT  A 1 18  ? 85.189  60.919  17.433  1.00 201.15 ? 19  DT  X C6    1 
ATOM 366  P P     . DA  B 1 19  ? 86.860  72.622  23.151  1.00 145.18 ? 20  DA  Z P     1 
ATOM 367  O OP1   . DA  B 1 19  ? 87.733  71.687  23.888  1.00 145.48 ? 20  DA  Z OP1   1 
ATOM 368  O OP2   . DA  B 1 19  ? 87.292  74.028  22.970  1.00 142.93 ? 20  DA  Z OP2   1 
ATOM 369  O "O5'" . DA  B 1 19  ? 86.670  72.002  21.702  1.00 146.31 ? 20  DA  Z "O5'" 1 
ATOM 370  C "C5'" . DA  B 1 19  ? 85.801  72.608  20.779  1.00 144.34 ? 20  DA  Z "C5'" 1 
ATOM 371  C "C4'" . DA  B 1 19  ? 86.459  72.519  19.426  1.00 146.04 ? 20  DA  Z "C4'" 1 
ATOM 372  O "O4'" . DA  B 1 19  ? 85.906  71.383  18.720  1.00 146.84 ? 20  DA  Z "O4'" 1 
ATOM 373  C "C3'" . DA  B 1 19  ? 86.279  73.745  18.546  1.00 146.39 ? 20  DA  Z "C3'" 1 
ATOM 374  O "O3'" . DA  B 1 19  ? 87.521  73.974  17.851  1.00 144.57 ? 20  DA  Z "O3'" 1 
ATOM 375  C "C2'" . DA  B 1 19  ? 85.091  73.344  17.671  1.00 149.32 ? 20  DA  Z "C2'" 1 
ATOM 376  C "C1'" . DA  B 1 19  ? 85.229  71.825  17.563  1.00 153.04 ? 20  DA  Z "C1'" 1 
ATOM 377  N N9    . DA  B 1 19  ? 83.955  71.117  17.507  1.00 155.57 ? 20  DA  Z N9    1 
ATOM 378  C C8    . DA  B 1 19  ? 83.043  71.013  18.520  1.00 157.27 ? 20  DA  Z C8    1 
ATOM 379  N N7    . DA  B 1 19  ? 81.977  70.317  18.206  1.00 159.70 ? 20  DA  Z N7    1 
ATOM 380  C C5    . DA  B 1 19  ? 82.205  69.935  16.895  1.00 157.94 ? 20  DA  Z C5    1 
ATOM 381  C C6    . DA  B 1 19  ? 81.445  69.171  15.987  1.00 155.68 ? 20  DA  Z C6    1 
ATOM 382  N N6    . DA  B 1 19  ? 80.256  68.647  16.298  1.00 156.10 ? 20  DA  Z N6    1 
ATOM 383  N N1    . DA  B 1 19  ? 81.956  68.966  14.751  1.00 154.87 ? 20  DA  Z N1    1 
ATOM 384  C C2    . DA  B 1 19  ? 83.152  69.490  14.449  1.00 155.39 ? 20  DA  Z C2    1 
ATOM 385  N N3    . DA  B 1 19  ? 83.954  70.230  15.218  1.00 156.68 ? 20  DA  Z N3    1 
ATOM 386  C C4    . DA  B 1 19  ? 83.423  70.418  16.443  1.00 157.35 ? 20  DA  Z C4    1 
ATOM 387  P P     . DA  B 1 20  ? 87.649  74.745  16.452  1.00 140.17 ? 21  DA  Z P     1 
ATOM 388  O OP1   . DA  B 1 20  ? 89.059  74.665  15.997  1.00 133.24 ? 21  DA  Z OP1   1 
ATOM 389  O OP2   . DA  B 1 20  ? 86.986  76.063  16.592  1.00 137.94 ? 21  DA  Z OP2   1 
ATOM 390  O "O5'" . DA  B 1 20  ? 86.765  73.820  15.500  1.00 141.14 ? 21  DA  Z "O5'" 1 
ATOM 391  C "C5'" . DA  B 1 20  ? 87.329  72.843  14.645  1.00 147.58 ? 21  DA  Z "C5'" 1 
ATOM 392  C "C4'" . DA  B 1 20  ? 86.596  72.900  13.317  1.00 153.87 ? 21  DA  Z "C4'" 1 
ATOM 393  O "O4'" . DA  B 1 20  ? 85.257  72.366  13.474  1.00 157.73 ? 21  DA  Z "O4'" 1 
ATOM 394  C "C3'" . DA  B 1 20  ? 86.416  74.303  12.749  1.00 151.70 ? 21  DA  Z "C3'" 1 
ATOM 395  O "O3'" . DA  B 1 20  ? 86.573  74.253  11.356  1.00 154.31 ? 21  DA  Z "O3'" 1 
ATOM 396  C "C2'" . DA  B 1 20  ? 84.983  74.667  13.119  1.00 152.94 ? 21  DA  Z "C2'" 1 
ATOM 397  C "C1'" . DA  B 1 20  ? 84.317  73.304  12.994  1.00 158.11 ? 21  DA  Z "C1'" 1 
ATOM 398  N N9    . DA  B 1 20  ? 83.076  73.152  13.748  1.00 158.93 ? 21  DA  Z N9    1 
ATOM 399  C C8    . DA  B 1 20  ? 82.693  73.796  14.895  1.00 159.90 ? 21  DA  Z C8    1 
ATOM 400  N N7    . DA  B 1 20  ? 81.509  73.443  15.335  1.00 159.03 ? 21  DA  Z N7    1 
ATOM 401  C C5    . DA  B 1 20  ? 81.090  72.503  14.411  1.00 158.71 ? 21  DA  Z C5    1 
ATOM 402  C C6    . DA  B 1 20  ? 79.911  71.739  14.300  1.00 159.81 ? 21  DA  Z C6    1 
ATOM 403  N N6    . DA  B 1 20  ? 78.904  71.819  15.175  1.00 160.06 ? 21  DA  Z N6    1 
ATOM 404  N N1    . DA  B 1 20  ? 79.810  70.892  13.250  1.00 160.09 ? 21  DA  Z N1    1 
ATOM 405  C C2    . DA  B 1 20  ? 80.820  70.812  12.371  1.00 159.51 ? 21  DA  Z C2    1 
ATOM 406  N N3    . DA  B 1 20  ? 81.973  71.479  12.371  1.00 158.22 ? 21  DA  Z N3    1 
ATOM 407  C C4    . DA  B 1 20  ? 82.042  72.313  13.425  1.00 157.93 ? 21  DA  Z C4    1 
ATOM 408  P P     . DA  B 1 21  ? 87.121  75.544  10.604  1.00 162.83 ? 22  DA  Z P     1 
ATOM 409  O OP1   . DA  B 1 21  ? 88.543  75.279  10.296  1.00 162.16 ? 22  DA  Z OP1   1 
ATOM 410  O OP2   . DA  B 1 21  ? 86.771  76.736  11.409  1.00 163.94 ? 22  DA  Z OP2   1 
ATOM 411  O "O5'" . DA  B 1 21  ? 86.259  75.575  9.247   1.00 164.46 ? 22  DA  Z "O5'" 1 
ATOM 412  C "C5'" . DA  B 1 21  ? 86.317  74.510  8.294   1.00 168.25 ? 22  DA  Z "C5'" 1 
ATOM 413  C "C4'" . DA  B 1 21  ? 84.940  73.948  7.968   1.00 173.72 ? 22  DA  Z "C4'" 1 
ATOM 414  O "O4'" . DA  B 1 21  ? 84.148  73.836  9.175   1.00 174.95 ? 22  DA  Z "O4'" 1 
ATOM 415  C "C3'" . DA  B 1 21  ? 84.092  74.770  6.995   1.00 176.07 ? 22  DA  Z "C3'" 1 
ATOM 416  O "O3'" . DA  B 1 21  ? 84.095  74.185  5.687   1.00 175.83 ? 22  DA  Z "O3'" 1 
ATOM 417  C "C2'" . DA  B 1 21  ? 82.685  74.749  7.595   1.00 176.23 ? 22  DA  Z "C2'" 1 
ATOM 418  C "C1'" . DA  B 1 21  ? 82.788  73.819  8.798   1.00 176.33 ? 22  DA  Z "C1'" 1 
ATOM 419  N N9    . DA  B 1 21  ? 81.969  74.261  9.923   1.00 176.57 ? 22  DA  Z N9    1 
ATOM 420  C C8    . DA  B 1 21  ? 82.259  75.280  10.788  1.00 178.35 ? 22  DA  Z C8    1 
ATOM 421  N N7    . DA  B 1 21  ? 81.348  75.472  11.712  1.00 179.84 ? 22  DA  Z N7    1 
ATOM 422  C C5    . DA  B 1 21  ? 80.387  74.516  11.434  1.00 177.86 ? 22  DA  Z C5    1 
ATOM 423  C C6    . DA  B 1 21  ? 79.159  74.197  12.055  1.00 177.63 ? 22  DA  Z C6    1 
ATOM 424  N N6    . DA  B 1 21  ? 78.686  74.845  13.126  1.00 178.05 ? 22  DA  Z N6    1 
ATOM 425  N N1    . DA  B 1 21  ? 78.434  73.184  11.533  1.00 176.80 ? 22  DA  Z N1    1 
ATOM 426  C C2    . DA  B 1 21  ? 78.912  72.543  10.457  1.00 177.31 ? 22  DA  Z C2    1 
ATOM 427  N N3    . DA  B 1 21  ? 80.052  72.746  9.791   1.00 176.45 ? 22  DA  Z N3    1 
ATOM 428  C C4    . DA  B 1 21  ? 80.753  73.759  10.332  1.00 176.28 ? 22  DA  Z C4    1 
ATOM 429  O "O5'" . DT  C 2 1   ? 81.431  76.127  3.254   1.00 176.98 ? 23  DT  Y "O5'" 1 
ATOM 430  C "C5'" . DT  C 2 1   ? 81.186  75.636  4.569   1.00 174.53 ? 23  DT  Y "C5'" 1 
ATOM 431  C "C4'" . DT  C 2 1   ? 80.026  74.655  4.592   1.00 172.74 ? 23  DT  Y "C4'" 1 
ATOM 432  O "O4'" . DT  C 2 1   ? 79.846  74.153  5.940   1.00 169.33 ? 23  DT  Y "O4'" 1 
ATOM 433  C "C3'" . DT  C 2 1   ? 78.681  75.250  4.205   1.00 173.26 ? 23  DT  Y "C3'" 1 
ATOM 434  O "O3'" . DT  C 2 1   ? 78.502  75.159  2.785   1.00 176.52 ? 23  DT  Y "O3'" 1 
ATOM 435  C "C2'" . DT  C 2 1   ? 77.704  74.365  4.972   1.00 171.33 ? 23  DT  Y "C2'" 1 
ATOM 436  C "C1'" . DT  C 2 1   ? 78.468  74.019  6.241   1.00 166.81 ? 23  DT  Y "C1'" 1 
ATOM 437  N N1    . DT  C 2 1   ? 78.094  74.853  7.441   1.00 165.23 ? 23  DT  Y N1    1 
ATOM 438  C C2    . DT  C 2 1   ? 76.868  74.671  8.064   1.00 164.48 ? 23  DT  Y C2    1 
ATOM 439  O O2    . DT  C 2 1   ? 76.027  73.868  7.710   1.00 165.52 ? 23  DT  Y O2    1 
ATOM 440  N N3    . DT  C 2 1   ? 76.645  75.481  9.150   1.00 165.18 ? 23  DT  Y N3    1 
ATOM 441  C C4    . DT  C 2 1   ? 77.499  76.436  9.676   1.00 166.83 ? 23  DT  Y C4    1 
ATOM 442  O O4    . DT  C 2 1   ? 77.201  77.109  10.659  1.00 166.29 ? 23  DT  Y O4    1 
ATOM 443  C C5    . DT  C 2 1   ? 78.761  76.580  8.986   1.00 167.59 ? 23  DT  Y C5    1 
ATOM 444  C C7    . DT  C 2 1   ? 79.774  77.585  9.456   1.00 167.73 ? 23  DT  Y C7    1 
ATOM 445  C C6    . DT  C 2 1   ? 78.991  75.793  7.920   1.00 167.26 ? 23  DT  Y C6    1 
ATOM 446  P P     . DT  C 2 2   ? 77.114  75.534  2.066   1.00 179.61 ? 24  DT  Y P     1 
ATOM 447  O OP1   . DT  C 2 2   ? 77.389  75.692  0.618   1.00 180.29 ? 24  DT  Y OP1   1 
ATOM 448  O OP2   . DT  C 2 2   ? 76.475  76.645  2.814   1.00 177.67 ? 24  DT  Y OP2   1 
ATOM 449  O "O5'" . DT  C 2 2   ? 76.258  74.193  2.254   1.00 175.69 ? 24  DT  Y "O5'" 1 
ATOM 450  C "C5'" . DT  C 2 2   ? 74.929  74.112  1.762   1.00 174.21 ? 24  DT  Y "C5'" 1 
ATOM 451  C "C4'" . DT  C 2 2   ? 73.878  74.382  2.831   1.00 172.35 ? 24  DT  Y "C4'" 1 
ATOM 452  O "O4'" . DT  C 2 2   ? 74.463  74.847  4.081   1.00 169.64 ? 24  DT  Y "O4'" 1 
ATOM 453  C "C3'" . DT  C 2 2   ? 72.824  75.425  2.437   1.00 172.09 ? 24  DT  Y "C3'" 1 
ATOM 454  O "O3'" . DT  C 2 2   ? 71.524  74.810  2.357   1.00 169.76 ? 24  DT  Y "O3'" 1 
ATOM 455  C "C2'" . DT  C 2 2   ? 72.909  76.458  3.561   1.00 172.06 ? 24  DT  Y "C2'" 1 
ATOM 456  C "C1'" . DT  C 2 2   ? 73.448  75.604  4.701   1.00 170.85 ? 24  DT  Y "C1'" 1 
ATOM 457  N N1    . DT  C 2 2   ? 73.917  76.386  5.900   1.00 171.04 ? 24  DT  Y N1    1 
ATOM 458  C C2    . DT  C 2 2   ? 73.145  76.342  7.050   1.00 172.07 ? 24  DT  Y C2    1 
ATOM 459  O O2    . DT  C 2 2   ? 72.114  75.696  7.149   1.00 172.74 ? 24  DT  Y O2    1 
ATOM 460  N N3    . DT  C 2 2   ? 73.624  77.084  8.102   1.00 169.93 ? 24  DT  Y N3    1 
ATOM 461  C C4    . DT  C 2 2   ? 74.770  77.855  8.117   1.00 169.66 ? 24  DT  Y C4    1 
ATOM 462  O O4    . DT  C 2 2   ? 75.103  78.482  9.115   1.00 169.93 ? 24  DT  Y O4    1 
ATOM 463  C C5    . DT  C 2 2   ? 75.531  77.863  6.887   1.00 171.27 ? 24  DT  Y C5    1 
ATOM 464  C C7    . DT  C 2 2   ? 76.796  78.665  6.782   1.00 172.96 ? 24  DT  Y C7    1 
ATOM 465  C C6    . DT  C 2 2   ? 75.075  77.143  5.848   1.00 170.65 ? 24  DT  Y C6    1 
ATOM 466  P P     . DA  C 2 3   ? 70.236  75.529  1.722   1.00 165.53 ? 25  DA  Y P     1 
ATOM 467  O OP1   . DA  C 2 3   ? 69.825  74.735  0.543   1.00 165.09 ? 25  DA  Y OP1   1 
ATOM 468  O OP2   . DA  C 2 3   ? 70.511  76.978  1.583   1.00 164.48 ? 25  DA  Y OP2   1 
ATOM 469  O "O5'" . DA  C 2 3   ? 69.119  75.343  2.854   1.00 166.53 ? 25  DA  Y "O5'" 1 
ATOM 470  C "C5'" . DA  C 2 3   ? 69.405  75.729  4.195   1.00 170.53 ? 25  DA  Y "C5'" 1 
ATOM 471  C "C4'" . DA  C 2 3   ? 68.172  75.813  5.086   1.00 173.69 ? 25  DA  Y "C4'" 1 
ATOM 472  O "O4'" . DA  C 2 3   ? 68.558  76.322  6.390   1.00 176.17 ? 25  DA  Y "O4'" 1 
ATOM 473  C "C3'" . DA  C 2 3   ? 67.050  76.744  4.645   1.00 174.53 ? 25  DA  Y "C3'" 1 
ATOM 474  O "O3'" . DA  C 2 3   ? 65.822  76.300  5.224   1.00 173.09 ? 25  DA  Y "O3'" 1 
ATOM 475  C "C2'" . DA  C 2 3   ? 67.485  78.088  5.222   1.00 176.80 ? 25  DA  Y "C2'" 1 
ATOM 476  C "C1'" . DA  C 2 3   ? 68.203  77.688  6.512   1.00 180.24 ? 25  DA  Y "C1'" 1 
ATOM 477  N N9    . DA  C 2 3   ? 69.428  78.441  6.784   1.00 181.71 ? 25  DA  Y N9    1 
ATOM 478  C C8    . DA  C 2 3   ? 70.490  78.628  5.940   1.00 183.11 ? 25  DA  Y C8    1 
ATOM 479  N N7    . DA  C 2 3   ? 71.462  79.346  6.451   1.00 183.58 ? 25  DA  Y N7    1 
ATOM 480  C C5    . DA  C 2 3   ? 71.010  79.650  7.723   1.00 183.02 ? 25  DA  Y C5    1 
ATOM 481  C C6    . DA  C 2 3   ? 71.579  80.390  8.784   1.00 182.91 ? 25  DA  Y C6    1 
ATOM 482  N N6    . DA  C 2 3   ? 72.779  80.974  8.711   1.00 183.10 ? 25  DA  Y N6    1 
ATOM 483  N N1    . DA  C 2 3   ? 70.866  80.506  9.928   1.00 182.86 ? 25  DA  Y N1    1 
ATOM 484  C C2    . DA  C 2 3   ? 69.663  79.918  10.004  1.00 183.01 ? 25  DA  Y C2    1 
ATOM 485  N N3    . DA  C 2 3   ? 69.026  79.199  9.074   1.00 182.70 ? 25  DA  Y N3    1 
ATOM 486  C C4    . DA  C 2 3   ? 69.758  79.099  7.948   1.00 182.40 ? 25  DA  Y C4    1 
ATOM 487  P P     . DT  C 2 4   ? 64.384  76.734  4.664   1.00 171.40 ? 26  DT  Y P     1 
ATOM 488  O OP1   . DT  C 2 4   ? 63.633  75.490  4.396   1.00 172.53 ? 26  DT  Y OP1   1 
ATOM 489  O OP2   . DT  C 2 4   ? 64.561  77.722  3.573   1.00 170.50 ? 26  DT  Y OP2   1 
ATOM 490  O "O5'" . DT  C 2 4   ? 63.715  77.422  5.949   1.00 172.73 ? 26  DT  Y "O5'" 1 
ATOM 491  C "C5'" . DT  C 2 4   ? 63.578  78.838  6.050   1.00 177.12 ? 26  DT  Y "C5'" 1 
ATOM 492  C "C4'" . DT  C 2 4   ? 63.925  79.334  7.444   1.00 179.87 ? 26  DT  Y "C4'" 1 
ATOM 493  O "O4'" . DT  C 2 4   ? 65.343  79.632  7.512   1.00 183.22 ? 26  DT  Y "O4'" 1 
ATOM 494  C "C3'" . DT  C 2 4   ? 63.194  80.603  7.881   1.00 179.45 ? 26  DT  Y "C3'" 1 
ATOM 495  O "O3'" . DT  C 2 4   ? 62.538  80.375  9.126   1.00 177.59 ? 26  DT  Y "O3'" 1 
ATOM 496  C "C2'" . DT  C 2 4   ? 64.294  81.656  8.012   1.00 181.29 ? 26  DT  Y "C2'" 1 
ATOM 497  C "C1'" . DT  C 2 4   ? 65.534  80.809  8.275   1.00 184.48 ? 26  DT  Y "C1'" 1 
ATOM 498  N N1    . DT  C 2 4   ? 66.860  81.456  7.921   1.00 185.64 ? 26  DT  Y N1    1 
ATOM 499  C C2    . DT  C 2 4   ? 67.560  82.168  8.885   1.00 185.23 ? 26  DT  Y C2    1 
ATOM 500  O O2    . DT  C 2 4   ? 67.180  82.324  10.035  1.00 184.52 ? 26  DT  Y O2    1 
ATOM 501  N N3    . DT  C 2 4   ? 68.753  82.701  8.449   1.00 185.72 ? 26  DT  Y N3    1 
ATOM 502  C C4    . DT  C 2 4   ? 69.311  82.603  7.182   1.00 184.96 ? 26  DT  Y C4    1 
ATOM 503  O O4    . DT  C 2 4   ? 70.389  83.122  6.900   1.00 184.80 ? 26  DT  Y O4    1 
ATOM 504  C C5    . DT  C 2 4   ? 68.535  81.849  6.225   1.00 184.90 ? 26  DT  Y C5    1 
ATOM 505  C C7    . DT  C 2 4   ? 69.027  81.667  4.817   1.00 184.16 ? 26  DT  Y C7    1 
ATOM 506  C C6    . DT  C 2 4   ? 67.368  81.324  6.636   1.00 186.06 ? 26  DT  Y C6    1 
ATOM 507  P P     . DC  C 2 5   ? 61.167  81.115  9.491   1.00 176.81 ? 27  DC  Y P     1 
ATOM 508  O OP1   . DC  C 2 5   ? 60.497  80.303  10.537  1.00 176.09 ? 27  DC  Y OP1   1 
ATOM 509  O OP2   . DC  C 2 5   ? 60.447  81.416  8.234   1.00 172.93 ? 27  DC  Y OP2   1 
ATOM 510  O "O5'" . DC  C 2 5   ? 61.678  82.489  10.139  1.00 176.89 ? 27  DC  Y "O5'" 1 
ATOM 511  C "C5'" . DC  C 2 5   ? 61.863  82.604  11.551  1.00 179.23 ? 27  DC  Y "C5'" 1 
ATOM 512  C "C4'" . DC  C 2 5   ? 63.010  83.534  11.915  1.00 180.95 ? 27  DC  Y "C4'" 1 
ATOM 513  O "O4'" . DC  C 2 5   ? 64.072  83.460  10.936  1.00 181.69 ? 27  DC  Y "O4'" 1 
ATOM 514  C "C3'" . DC  C 2 5   ? 62.676  85.016  11.950  1.00 181.39 ? 27  DC  Y "C3'" 1 
ATOM 515  O "O3'" . DC  C 2 5   ? 62.042  85.352  13.182  1.00 183.63 ? 27  DC  Y "O3'" 1 
ATOM 516  C "C2'" . DC  C 2 5   ? 64.061  85.647  11.852  1.00 180.59 ? 27  DC  Y "C2'" 1 
ATOM 517  C "C1'" . DC  C 2 5   ? 64.891  84.603  11.108  1.00 182.55 ? 27  DC  Y "C1'" 1 
ATOM 518  N N1    . DC  C 2 5   ? 65.419  85.068  9.777   1.00 183.28 ? 27  DC  Y N1    1 
ATOM 519  C C2    . DC  C 2 5   ? 66.667  85.716  9.691   1.00 184.51 ? 27  DC  Y C2    1 
ATOM 520  O O2    . DC  C 2 5   ? 67.337  85.911  10.715  1.00 184.99 ? 27  DC  Y O2    1 
ATOM 521  N N3    . DC  C 2 5   ? 67.114  86.120  8.470   1.00 185.01 ? 27  DC  Y N3    1 
ATOM 522  C C4    . DC  C 2 5   ? 66.378  85.902  7.374   1.00 184.37 ? 27  DC  Y C4    1 
ATOM 523  N N4    . DC  C 2 5   ? 66.859  86.316  6.198   1.00 184.07 ? 27  DC  Y N4    1 
ATOM 524  C C5    . DC  C 2 5   ? 65.111  85.246  7.437   1.00 184.40 ? 27  DC  Y C5    1 
ATOM 525  C C6    . DC  C 2 5   ? 64.680  84.857  8.644   1.00 183.47 ? 27  DC  Y C6    1 
ATOM 526  P P     . DG  C 2 6   ? 60.951  86.523  13.285  1.00 186.08 ? 28  DG  Y P     1 
ATOM 527  O OP1   . DG  C 2 6   ? 59.764  85.957  13.960  1.00 187.11 ? 28  DG  Y OP1   1 
ATOM 528  O OP2   . DG  C 2 6   ? 60.786  87.160  11.958  1.00 186.72 ? 28  DG  Y OP2   1 
ATOM 529  O "O5'" . DG  C 2 6   ? 61.650  87.542  14.307  1.00 188.26 ? 28  DG  Y "O5'" 1 
ATOM 530  C "C5'" . DG  C 2 6   ? 61.756  88.933  14.015  1.00 191.05 ? 28  DG  Y "C5'" 1 
ATOM 531  C "C4'" . DG  C 2 6   ? 63.206  89.317  13.783  1.00 192.61 ? 28  DG  Y "C4'" 1 
ATOM 532  O "O4'" . DG  C 2 6   ? 63.734  88.584  12.654  1.00 193.24 ? 28  DG  Y "O4'" 1 
ATOM 533  C "C3'" . DG  C 2 6   ? 63.436  90.766  13.394  1.00 192.42 ? 28  DG  Y "C3'" 1 
ATOM 534  O "O3'" . DG  C 2 6   ? 63.541  91.564  14.565  1.00 192.40 ? 28  DG  Y "O3'" 1 
ATOM 535  C "C2'" . DG  C 2 6   ? 64.766  90.707  12.647  1.00 192.23 ? 28  DG  Y "C2'" 1 
ATOM 536  C "C1'" . DG  C 2 6   ? 64.872  89.265  12.161  1.00 192.25 ? 28  DG  Y "C1'" 1 
ATOM 537  N N9    . DG  C 2 6   ? 64.959  89.096  10.704  1.00 191.93 ? 28  DG  Y N9    1 
ATOM 538  C C8    . DG  C 2 6   ? 64.014  88.528  9.881   1.00 192.09 ? 28  DG  Y C8    1 
ATOM 539  N N7    . DG  C 2 6   ? 64.353  88.494  8.623   1.00 191.71 ? 28  DG  Y N7    1 
ATOM 540  C C5    . DG  C 2 6   ? 65.611  89.076  8.600   1.00 191.52 ? 28  DG  Y C5    1 
ATOM 541  C C6    . DG  C 2 6   ? 66.481  89.313  7.507   1.00 191.38 ? 28  DG  Y C6    1 
ATOM 542  O O6    . DG  C 2 6   ? 66.295  89.046  6.314   1.00 192.09 ? 28  DG  Y O6    1 
ATOM 543  N N1    . DG  C 2 6   ? 67.669  89.927  7.898   1.00 191.44 ? 28  DG  Y N1    1 
ATOM 544  C C2    . DG  C 2 6   ? 67.975  90.268  9.196   1.00 192.29 ? 28  DG  Y C2    1 
ATOM 545  N N2    . DG  C 2 6   ? 69.166  90.853  9.384   1.00 192.52 ? 28  DG  Y N2    1 
ATOM 546  N N3    . DG  C 2 6   ? 67.168  90.050  10.233  1.00 192.57 ? 28  DG  Y N3    1 
ATOM 547  C C4    . DG  C 2 6   ? 66.002  89.451  9.870   1.00 191.81 ? 28  DG  Y C4    1 
ATOM 548  P P     . DG  C 2 7   ? 62.651  92.880  14.751  1.00 192.91 ? 29  DG  Y P     1 
ATOM 549  O OP1   . DG  C 2 7   ? 62.525  93.102  16.209  1.00 192.85 ? 29  DG  Y OP1   1 
ATOM 550  O OP2   . DG  C 2 7   ? 61.423  92.752  13.930  1.00 192.53 ? 29  DG  Y OP2   1 
ATOM 551  O "O5'" . DG  C 2 7   ? 63.593  94.040  14.164  1.00 193.76 ? 29  DG  Y "O5'" 1 
ATOM 552  C "C5'" . DG  C 2 7   ? 63.550  94.449  12.790  1.00 192.68 ? 29  DG  Y "C5'" 1 
ATOM 553  C "C4'" . DG  C 2 7   ? 64.945  94.440  12.184  1.00 191.76 ? 29  DG  Y "C4'" 1 
ATOM 554  O "O4'" . DG  C 2 7   ? 65.161  93.186  11.496  1.00 191.83 ? 29  DG  Y "O4'" 1 
ATOM 555  C "C3'" . DG  C 2 7   ? 65.218  95.519  11.149  1.00 190.57 ? 29  DG  Y "C3'" 1 
ATOM 556  O "O3'" . DG  C 2 7   ? 65.751  96.661  11.822  1.00 189.01 ? 29  DG  Y "O3'" 1 
ATOM 557  C "C2'" . DG  C 2 7   ? 66.241  94.858  10.225  1.00 191.68 ? 29  DG  Y "C2'" 1 
ATOM 558  C "C1'" . DG  C 2 7   ? 65.936  93.367  10.328  1.00 192.62 ? 29  DG  Y "C1'" 1 
ATOM 559  N N9    . DG  C 2 7   ? 65.200  92.825  9.182   1.00 193.32 ? 29  DG  Y N9    1 
ATOM 560  C C8    . DG  C 2 7   ? 63.880  92.433  9.162   1.00 193.66 ? 29  DG  Y C8    1 
ATOM 561  N N7    . DG  C 2 7   ? 63.477  91.985  8.006   1.00 193.97 ? 29  DG  Y N7    1 
ATOM 562  C C5    . DG  C 2 7   ? 64.601  92.083  7.196   1.00 193.77 ? 29  DG  Y C5    1 
ATOM 563  C C6    . DG  C 2 7   ? 64.770  91.742  5.829   1.00 193.55 ? 29  DG  Y C6    1 
ATOM 564  O O6    . DG  C 2 7   ? 63.928  91.273  5.047   1.00 193.06 ? 29  DG  Y O6    1 
ATOM 565  N N1    . DG  C 2 7   ? 66.070  91.993  5.384   1.00 193.22 ? 29  DG  Y N1    1 
ATOM 566  C C2    . DG  C 2 7   ? 67.079  92.513  6.166   1.00 192.80 ? 29  DG  Y C2    1 
ATOM 567  N N2    . DG  C 2 7   ? 68.266  92.689  5.570   1.00 192.88 ? 29  DG  Y N2    1 
ATOM 568  N N3    . DG  C 2 7   ? 66.933  92.835  7.449   1.00 192.50 ? 29  DG  Y N3    1 
ATOM 569  C C4    . DG  C 2 7   ? 65.673  92.597  7.903   1.00 193.37 ? 29  DG  Y C4    1 
ATOM 570  P P     . DA  C 2 8   ? 66.348  97.934  11.050  1.00 188.96 ? 30  DA  Y P     1 
ATOM 571  O OP1   . DA  C 2 8   ? 66.453  99.029  12.039  1.00 190.54 ? 30  DA  Y OP1   1 
ATOM 572  O OP2   . DA  C 2 8   ? 65.562  98.151  9.815   1.00 188.53 ? 30  DA  Y OP2   1 
ATOM 573  O "O5'" . DA  C 2 8   ? 67.833  97.461  10.669  1.00 187.66 ? 30  DA  Y "O5'" 1 
ATOM 574  C "C5'" . DA  C 2 8   ? 68.848  98.402  10.327  1.00 188.45 ? 30  DA  Y "C5'" 1 
ATOM 575  C "C4'" . DA  C 2 8   ? 69.170  98.387  8.840   1.00 190.01 ? 30  DA  Y "C4'" 1 
ATOM 576  O "O4'" . DA  C 2 8   ? 68.474  97.309  8.158   1.00 192.00 ? 30  DA  Y "O4'" 1 
ATOM 577  C "C3'" . DA  C 2 8   ? 68.785  99.661  8.091   1.00 190.99 ? 30  DA  Y "C3'" 1 
ATOM 578  O "O3'" . DA  C 2 8   ? 69.828  100.023 7.197   1.00 191.57 ? 30  DA  Y "O3'" 1 
ATOM 579  C "C2'" . DA  C 2 8   ? 67.554  99.241  7.300   1.00 192.18 ? 30  DA  Y "C2'" 1 
ATOM 580  C "C1'" . DA  C 2 8   ? 67.973  97.822  6.941   1.00 194.28 ? 30  DA  Y "C1'" 1 
ATOM 581  N N9    . DA  C 2 8   ? 66.897  96.982  6.415   1.00 195.21 ? 30  DA  Y N9    1 
ATOM 582  C C8    . DA  C 2 8   ? 65.689  96.709  6.998   1.00 195.49 ? 30  DA  Y C8    1 
ATOM 583  N N7    . DA  C 2 8   ? 64.916  95.922  6.288   1.00 194.75 ? 30  DA  Y N7    1 
ATOM 584  C C5    . DA  C 2 8   ? 65.669  95.660  5.157   1.00 195.62 ? 30  DA  Y C5    1 
ATOM 585  C C6    . DA  C 2 8   ? 65.415  94.885  4.004   1.00 196.11 ? 30  DA  Y C6    1 
ATOM 586  N N6    . DA  C 2 8   ? 64.276  94.210  3.817   1.00 196.24 ? 30  DA  Y N6    1 
ATOM 587  N N1    . DA  C 2 8   ? 66.379  94.829  3.052   1.00 196.02 ? 30  DA  Y N1    1 
ATOM 588  C C2    . DA  C 2 8   ? 67.522  95.506  3.242   1.00 195.89 ? 30  DA  Y C2    1 
ATOM 589  N N3    . DA  C 2 8   ? 67.870  96.269  4.282   1.00 196.77 ? 30  DA  Y N3    1 
ATOM 590  C C4    . DA  C 2 8   ? 66.894  96.306  5.214   1.00 195.84 ? 30  DA  Y C4    1 
ATOM 591  P P     . DC  C 2 9   ? 70.773  101.288 7.458   1.00 193.27 ? 31  DC  Y P     1 
ATOM 592  O OP1   . DC  C 2 9   ? 72.011  101.040 6.687   1.00 193.18 ? 31  DC  Y OP1   1 
ATOM 593  O OP2   . DC  C 2 9   ? 70.859  101.503 8.920   1.00 193.51 ? 31  DC  Y OP2   1 
ATOM 594  O "O5'" . DC  C 2 9   ? 70.031  102.549 6.786   1.00 192.44 ? 31  DC  Y "O5'" 1 
ATOM 595  C "C5'" . DC  C 2 9   ? 68.890  102.452 5.923   1.00 190.94 ? 31  DC  Y "C5'" 1 
ATOM 596  C "C4'" . DC  C 2 9   ? 69.244  101.875 4.561   1.00 190.37 ? 31  DC  Y "C4'" 1 
ATOM 597  O "O4'" . DC  C 2 9   ? 68.577  100.594 4.395   1.00 190.25 ? 31  DC  Y "O4'" 1 
ATOM 598  C "C3'" . DC  C 2 9   ? 68.840  102.744 3.372   1.00 189.96 ? 31  DC  Y "C3'" 1 
ATOM 599  O "O3'" . DC  C 2 9   ? 69.924  102.856 2.447   1.00 189.48 ? 31  DC  Y "O3'" 1 
ATOM 600  C "C2'" . DC  C 2 9   ? 67.657  101.997 2.763   1.00 190.33 ? 31  DC  Y "C2'" 1 
ATOM 601  C "C1'" . DC  C 2 9   ? 67.947  100.546 3.131   1.00 190.36 ? 31  DC  Y "C1'" 1 
ATOM 602  N N1    . DC  C 2 9   ? 66.702  99.693  3.172   1.00 190.81 ? 31  DC  Y N1    1 
ATOM 603  C C2    . DC  C 2 9   ? 66.546  98.627  2.264   1.00 190.73 ? 31  DC  Y C2    1 
ATOM 604  O O2    . DC  C 2 9   ? 67.439  98.377  1.440   1.00 190.35 ? 31  DC  Y O2    1 
ATOM 605  N N3    . DC  C 2 9   ? 65.407  97.880  2.319   1.00 190.42 ? 31  DC  Y N3    1 
ATOM 606  C C4    . DC  C 2 9   ? 64.453  98.159  3.216   1.00 189.78 ? 31  DC  Y C4    1 
ATOM 607  N N4    . DC  C 2 9   ? 63.356  97.393  3.226   1.00 189.49 ? 31  DC  Y N4    1 
ATOM 608  C C5    . DC  C 2 9   ? 64.587  99.239  4.143   1.00 189.97 ? 31  DC  Y C5    1 
ATOM 609  C C6    . DC  C 2 9   ? 65.711  99.968  4.082   1.00 190.80 ? 31  DC  Y C6    1 
ATOM 610  P P     . DA  C 2 10  ? 69.951  103.970 1.291   1.00 189.21 ? 32  DA  Y P     1 
ATOM 611  O OP1   . DA  C 2 10  ? 71.047  104.910 1.613   1.00 190.19 ? 32  DA  Y OP1   1 
ATOM 612  O OP2   . DA  C 2 10  ? 68.588  104.508 1.077   1.00 188.35 ? 32  DA  Y OP2   1 
ATOM 613  O "O5'" . DA  C 2 10  ? 70.388  103.137 -0.007  1.00 187.57 ? 32  DA  Y "O5'" 1 
ATOM 614  C "C5'" . DA  C 2 10  ? 69.826  101.852 -0.288  1.00 184.41 ? 32  DA  Y "C5'" 1 
ATOM 615  C "C4'" . DA  C 2 10  ? 68.889  101.847 -1.491  1.00 182.46 ? 32  DA  Y "C4'" 1 
ATOM 616  O "O4'" . DA  C 2 10  ? 67.648  101.191 -1.119  1.00 181.06 ? 32  DA  Y "O4'" 1 
ATOM 617  C "C3'" . DA  C 2 10  ? 68.494  103.199 -2.088  1.00 181.82 ? 32  DA  Y "C3'" 1 
ATOM 618  O "O3'" . DA  C 2 10  ? 68.636  103.153 -3.507  1.00 182.94 ? 32  DA  Y "O3'" 1 
ATOM 619  C "C2'" . DA  C 2 10  ? 67.034  103.380 -1.675  1.00 179.75 ? 32  DA  Y "C2'" 1 
ATOM 620  C "C1'" . DA  C 2 10  ? 66.548  101.938 -1.595  1.00 177.42 ? 32  DA  Y "C1'" 1 
ATOM 621  N N9    . DA  C 2 10  ? 65.419  101.705 -0.692  1.00 176.67 ? 32  DA  Y N9    1 
ATOM 622  C C8    . DA  C 2 10  ? 65.061  102.440 0.408   1.00 175.51 ? 32  DA  Y C8    1 
ATOM 623  N N7    . DA  C 2 10  ? 63.999  101.986 1.031   1.00 175.42 ? 32  DA  Y N7    1 
ATOM 624  C C5    . DA  C 2 10  ? 63.634  100.871 0.294   1.00 175.81 ? 32  DA  Y C5    1 
ATOM 625  C C6    . DA  C 2 10  ? 62.581  99.937  0.431   1.00 175.44 ? 32  DA  Y C6    1 
ATOM 626  N N6    . DA  C 2 10  ? 61.674  99.997  1.410   1.00 175.34 ? 32  DA  Y N6    1 
ATOM 627  N N1    . DA  C 2 10  ? 62.497  98.938  -0.479  1.00 175.23 ? 32  DA  Y N1    1 
ATOM 628  C C2    . DA  C 2 10  ? 63.406  98.879  -1.463  1.00 175.03 ? 32  DA  Y C2    1 
ATOM 629  N N3    . DA  C 2 10  ? 64.438  99.694  -1.692  1.00 175.12 ? 32  DA  Y N3    1 
ATOM 630  C C4    . DA  C 2 10  ? 64.499  100.680 -0.773  1.00 176.13 ? 32  DA  Y C4    1 
ATOM 631  P P     . DC  C 2 11  ? 68.947  104.467 -4.372  1.00 184.24 ? 33  DC  Y P     1 
ATOM 632  O OP1   . DC  C 2 11  ? 70.342  104.372 -4.859  1.00 185.03 ? 33  DC  Y OP1   1 
ATOM 633  O OP2   . DC  C 2 11  ? 68.514  105.671 -3.622  1.00 183.66 ? 33  DC  Y OP2   1 
ATOM 634  O "O5'" . DC  C 2 11  ? 67.976  104.265 -5.623  1.00 182.60 ? 33  DC  Y "O5'" 1 
ATOM 635  C "C5'" . DC  C 2 11  ? 66.581  104.323 -5.406  1.00 181.71 ? 33  DC  Y "C5'" 1 
ATOM 636  C "C4'" . DC  C 2 11  ? 65.876  103.126 -6.013  1.00 180.96 ? 33  DC  Y "C4'" 1 
ATOM 637  O "O4'" . DC  C 2 11  ? 65.209  102.372 -4.967  1.00 180.80 ? 33  DC  Y "O4'" 1 
ATOM 638  C "C3'" . DC  C 2 11  ? 64.795  103.533 -7.003  1.00 180.99 ? 33  DC  Y "C3'" 1 
ATOM 639  O "O3'" . DC  C 2 11  ? 64.676  102.611 -8.078  1.00 181.33 ? 33  DC  Y "O3'" 1 
ATOM 640  C "C2'" . DC  C 2 11  ? 63.540  103.535 -6.145  1.00 180.41 ? 33  DC  Y "C2'" 1 
ATOM 641  C "C1'" . DC  C 2 11  ? 63.803  102.437 -5.127  1.00 181.30 ? 33  DC  Y "C1'" 1 
ATOM 642  N N1    . DC  C 2 11  ? 63.136  102.738 -3.818  1.00 182.21 ? 33  DC  Y N1    1 
ATOM 643  C C2    . DC  C 2 11  ? 62.005  102.007 -3.401  1.00 182.50 ? 33  DC  Y C2    1 
ATOM 644  O O2    . DC  C 2 11  ? 61.552  101.094 -4.106  1.00 181.79 ? 33  DC  Y O2    1 
ATOM 645  N N3    . DC  C 2 11  ? 61.429  102.323 -2.209  1.00 182.64 ? 33  DC  Y N3    1 
ATOM 646  C C4    . DC  C 2 11  ? 61.929  103.312 -1.456  1.00 182.11 ? 33  DC  Y C4    1 
ATOM 647  N N4    . DC  C 2 11  ? 61.333  103.583 -0.293  1.00 181.95 ? 33  DC  Y N4    1 
ATOM 648  C C5    . DC  C 2 11  ? 63.070  104.069 -1.861  1.00 182.01 ? 33  DC  Y C5    1 
ATOM 649  C C6    . DC  C 2 11  ? 63.630  103.751 -3.035  1.00 182.74 ? 33  DC  Y C6    1 
ATOM 650  P P     . DT  C 2 12  ? 64.072  103.089 -9.485  1.00 182.73 ? 34  DT  Y P     1 
ATOM 651  O OP1   . DT  C 2 12  ? 65.195  103.179 -10.445 1.00 183.69 ? 34  DT  Y OP1   1 
ATOM 652  O OP2   . DT  C 2 12  ? 63.219  104.284 -9.279  1.00 184.70 ? 34  DT  Y OP2   1 
ATOM 653  O "O5'" . DT  C 2 12  ? 63.158  101.839 -9.892  1.00 177.83 ? 34  DT  Y "O5'" 1 
ATOM 654  C "C5'" . DT  C 2 12  ? 61.789  102.018 -10.232 1.00 171.81 ? 34  DT  Y "C5'" 1 
ATOM 655  C "C4'" . DT  C 2 12  ? 60.903  101.611 -9.073  1.00 168.53 ? 34  DT  Y "C4'" 1 
ATOM 656  O "O4'" . DT  C 2 12  ? 61.225  102.371 -7.888  1.00 168.09 ? 34  DT  Y "O4'" 1 
ATOM 657  C "C3'" . DT  C 2 12  ? 59.432  101.917 -9.260  1.00 166.77 ? 34  DT  Y "C3'" 1 
ATOM 658  O "O3'" . DT  C 2 12  ? 58.831  100.904 -10.046 1.00 166.80 ? 34  DT  Y "O3'" 1 
ATOM 659  C "C2'" . DT  C 2 12  ? 58.917  101.882 -7.824  1.00 166.91 ? 34  DT  Y "C2'" 1 
ATOM 660  C "C1'" . DT  C 2 12  ? 60.145  102.216 -6.982  1.00 169.74 ? 34  DT  Y "C1'" 1 
ATOM 661  N N1    . DT  C 2 12  ? 60.009  103.418 -6.063  1.00 170.51 ? 34  DT  Y N1    1 
ATOM 662  C C2    . DT  C 2 12  ? 59.218  103.342 -4.924  1.00 171.71 ? 34  DT  Y C2    1 
ATOM 663  O O2    . DT  C 2 12  ? 58.586  102.354 -4.588  1.00 172.41 ? 34  DT  Y O2    1 
ATOM 664  N N3    . DT  C 2 12  ? 59.185  104.490 -4.166  1.00 171.91 ? 34  DT  Y N3    1 
ATOM 665  C C4    . DT  C 2 12  ? 59.844  105.684 -4.411  1.00 171.08 ? 34  DT  Y C4    1 
ATOM 666  O O4    . DT  C 2 12  ? 59.735  106.653 -3.663  1.00 170.65 ? 34  DT  Y O4    1 
ATOM 667  C C5    . DT  C 2 12  ? 60.649  105.702 -5.611  1.00 171.85 ? 34  DT  Y C5    1 
ATOM 668  C C7    . DT  C 2 12  ? 61.419  106.931 -6.002  1.00 171.51 ? 34  DT  Y C7    1 
ATOM 669  C C6    . DT  C 2 12  ? 60.686  104.589 -6.361  1.00 171.79 ? 34  DT  Y C6    1 
ATOM 670  P P     . DG  C 2 13  ? 58.158  101.229 -11.462 1.00 168.96 ? 35  DG  Y P     1 
ATOM 671  O OP1   . DG  C 2 13  ? 58.771  100.317 -12.452 1.00 169.93 ? 35  DG  Y OP1   1 
ATOM 672  O OP2   . DG  C 2 13  ? 58.212  102.690 -11.707 1.00 169.77 ? 35  DG  Y OP2   1 
ATOM 673  O "O5'" . DG  C 2 13  ? 56.642  100.747 -11.236 1.00 167.93 ? 35  DG  Y "O5'" 1 
ATOM 674  C "C5'" . DG  C 2 13  ? 55.554  101.665 -11.075 1.00 165.77 ? 35  DG  Y "C5'" 1 
ATOM 675  C "C4'" . DG  C 2 13  ? 55.163  101.832 -9.614  1.00 163.81 ? 35  DG  Y "C4'" 1 
ATOM 676  O "O4'" . DG  C 2 13  ? 56.271  102.424 -8.896  1.00 162.54 ? 35  DG  Y "O4'" 1 
ATOM 677  C "C3'" . DG  C 2 13  ? 53.980  102.762 -9.371  1.00 163.24 ? 35  DG  Y "C3'" 1 
ATOM 678  O "O3'" . DG  C 2 13  ? 52.778  102.002 -9.272  1.00 162.65 ? 35  DG  Y "O3'" 1 
ATOM 679  C "C2'" . DG  C 2 13  ? 54.309  103.463 -8.051  1.00 161.93 ? 35  DG  Y "C2'" 1 
ATOM 680  C "C1'" . DG  C 2 13  ? 55.822  103.315 -7.892  1.00 157.63 ? 35  DG  Y "C1'" 1 
ATOM 681  N N9    . DG  C 2 13  ? 56.592  104.569 -7.966  1.00 156.20 ? 35  DG  Y N9    1 
ATOM 682  C C8    . DG  C 2 13  ? 57.238  105.104 -9.060  1.00 155.11 ? 35  DG  Y C8    1 
ATOM 683  N N7    . DG  C 2 13  ? 57.847  106.234 -8.822  1.00 153.65 ? 35  DG  Y N7    1 
ATOM 684  C C5    . DG  C 2 13  ? 57.595  106.472 -7.480  1.00 153.65 ? 35  DG  Y C5    1 
ATOM 685  C C6    . DG  C 2 13  ? 57.998  107.551 -6.653  1.00 154.32 ? 35  DG  Y C6    1 
ATOM 686  O O6    . DG  C 2 13  ? 58.682  108.535 -6.966  1.00 154.87 ? 35  DG  Y O6    1 
ATOM 687  N N1    . DG  C 2 13  ? 57.529  107.411 -5.344  1.00 154.98 ? 35  DG  Y N1    1 
ATOM 688  C C2    . DG  C 2 13  ? 56.761  106.354 -4.899  1.00 154.81 ? 35  DG  Y C2    1 
ATOM 689  N N2    . DG  C 2 13  ? 56.395  106.368 -3.611  1.00 154.71 ? 35  DG  Y N2    1 
ATOM 690  N N3    . DG  C 2 13  ? 56.381  105.338 -5.663  1.00 154.53 ? 35  DG  Y N3    1 
ATOM 691  C C4    . DG  C 2 13  ? 56.828  105.459 -6.939  1.00 154.54 ? 35  DG  Y C4    1 
ATOM 692  P P     . DA  D 1 2   ? 113.177 137.881 30.351  1.00 176.48 ? 3   DA  J P     1 
ATOM 693  O OP1   . DA  D 1 2   ? 112.341 136.755 29.875  1.00 175.80 ? 3   DA  J OP1   1 
ATOM 694  O OP2   . DA  D 1 2   ? 112.707 138.721 31.476  1.00 175.25 ? 3   DA  J OP2   1 
ATOM 695  O "O5'" . DA  D 1 2   ? 114.637 137.328 30.709  1.00 178.88 ? 3   DA  J "O5'" 1 
ATOM 696  C "C5'" . DA  D 1 2   ? 115.743 138.221 30.814  1.00 181.68 ? 3   DA  J "C5'" 1 
ATOM 697  C "C4'" . DA  D 1 2   ? 116.293 138.272 32.233  1.00 184.94 ? 3   DA  J "C4'" 1 
ATOM 698  O "O4'" . DA  D 1 2   ? 115.226 138.066 33.199  1.00 187.52 ? 3   DA  J "O4'" 1 
ATOM 699  C "C3'" . DA  D 1 2   ? 117.381 137.249 32.559  1.00 186.42 ? 3   DA  J "C3'" 1 
ATOM 700  O "O3'" . DA  D 1 2   ? 118.492 137.934 33.170  1.00 186.48 ? 3   DA  J "O3'" 1 
ATOM 701  C "C2'" . DA  D 1 2   ? 116.677 136.261 33.490  1.00 187.96 ? 3   DA  J "C2'" 1 
ATOM 702  C "C1'" . DA  D 1 2   ? 115.638 137.137 34.183  1.00 191.24 ? 3   DA  J "C1'" 1 
ATOM 703  N N9    . DA  D 1 2   ? 114.458 136.423 34.688  1.00 192.71 ? 3   DA  J N9    1 
ATOM 704  C C8    . DA  D 1 2   ? 113.860 135.322 34.137  1.00 193.11 ? 3   DA  J C8    1 
ATOM 705  N N7    . DA  D 1 2   ? 112.812 134.889 34.798  1.00 193.41 ? 3   DA  J N7    1 
ATOM 706  C C5    . DA  D 1 2   ? 112.700 135.770 35.860  1.00 193.76 ? 3   DA  J C5    1 
ATOM 707  C C6    . DA  D 1 2   ? 111.783 135.863 36.934  1.00 193.36 ? 3   DA  J C6    1 
ATOM 708  N N6    . DA  D 1 2   ? 110.765 135.014 37.110  1.00 193.46 ? 3   DA  J N6    1 
ATOM 709  N N1    . DA  D 1 2   ? 111.947 136.865 37.829  1.00 193.20 ? 3   DA  J N1    1 
ATOM 710  C C2    . DA  D 1 2   ? 112.967 137.718 37.656  1.00 193.65 ? 3   DA  J C2    1 
ATOM 711  N N3    . DA  D 1 2   ? 113.890 137.731 36.688  1.00 194.82 ? 3   DA  J N3    1 
ATOM 712  C C4    . DA  D 1 2   ? 113.706 136.724 35.809  1.00 194.04 ? 3   DA  J C4    1 
ATOM 713  P P     . DG  D 1 3   ? 119.729 137.221 33.911  1.00 184.88 ? 4   DG  J P     1 
ATOM 714  O OP1   . DG  D 1 3   ? 120.879 138.154 33.853  1.00 183.16 ? 4   DG  J OP1   1 
ATOM 715  O OP2   . DG  D 1 3   ? 119.883 135.835 33.412  1.00 183.31 ? 4   DG  J OP2   1 
ATOM 716  O "O5'" . DG  D 1 3   ? 119.219 137.185 35.426  1.00 183.72 ? 4   DG  J "O5'" 1 
ATOM 717  C "C5'" . DG  D 1 3   ? 120.074 136.734 36.462  1.00 181.99 ? 4   DG  J "C5'" 1 
ATOM 718  C "C4'" . DG  D 1 3   ? 119.575 135.428 37.057  1.00 180.79 ? 4   DG  J "C4'" 1 
ATOM 719  O "O4'" . DG  D 1 3   ? 118.198 135.157 36.675  1.00 180.21 ? 4   DG  J "O4'" 1 
ATOM 720  C "C3'" . DG  D 1 3   ? 120.375 134.189 36.650  1.00 179.70 ? 4   DG  J "C3'" 1 
ATOM 721  O "O3'" . DG  D 1 3   ? 120.778 133.492 37.815  1.00 178.06 ? 4   DG  J "O3'" 1 
ATOM 722  C "C2'" . DG  D 1 3   ? 119.363 133.353 35.875  1.00 179.82 ? 4   DG  J "C2'" 1 
ATOM 723  C "C1'" . DG  D 1 3   ? 118.107 133.751 36.640  1.00 179.28 ? 4   DG  J "C1'" 1 
ATOM 724  N N9    . DG  D 1 3   ? 116.829 133.285 36.096  1.00 178.97 ? 4   DG  J N9    1 
ATOM 725  C C8    . DG  D 1 3   ? 116.461 133.139 34.779  1.00 178.75 ? 4   DG  J C8    1 
ATOM 726  N N7    . DG  D 1 3   ? 115.250 132.686 34.620  1.00 177.73 ? 4   DG  J N7    1 
ATOM 727  C C5    . DG  D 1 3   ? 114.784 132.518 35.915  1.00 177.73 ? 4   DG  J C5    1 
ATOM 728  C C6    . DG  D 1 3   ? 113.531 132.053 36.380  1.00 178.45 ? 4   DG  J C6    1 
ATOM 729  O O6    . DG  D 1 3   ? 112.559 131.690 35.706  1.00 179.08 ? 4   DG  J O6    1 
ATOM 730  N N1    . DG  D 1 3   ? 113.464 132.031 37.774  1.00 178.45 ? 4   DG  J N1    1 
ATOM 731  C C2    . DG  D 1 3   ? 114.486 132.413 38.613  1.00 177.90 ? 4   DG  J C2    1 
ATOM 732  N N2    . DG  D 1 3   ? 114.250 132.326 39.928  1.00 178.16 ? 4   DG  J N2    1 
ATOM 733  N N3    . DG  D 1 3   ? 115.664 132.850 38.189  1.00 177.45 ? 4   DG  J N3    1 
ATOM 734  C C4    . DG  D 1 3   ? 115.743 132.877 36.835  1.00 177.74 ? 4   DG  J C4    1 
ATOM 735  P P     . DT  D 1 4   ? 122.229 133.683 38.451  1.00 177.02 ? 5   DT  J P     1 
ATOM 736  O OP1   . DT  D 1 4   ? 122.447 135.116 38.761  1.00 174.92 ? 5   DT  J OP1   1 
ATOM 737  O OP2   . DT  D 1 4   ? 123.188 132.943 37.600  1.00 177.96 ? 5   DT  J OP2   1 
ATOM 738  O "O5'" . DT  D 1 4   ? 122.063 132.908 39.835  1.00 177.09 ? 5   DT  J "O5'" 1 
ATOM 739  C "C5'" . DT  D 1 4   ? 121.096 133.345 40.780  1.00 175.07 ? 5   DT  J "C5'" 1 
ATOM 740  C "C4'" . DT  D 1 4   ? 120.142 132.226 41.151  1.00 174.05 ? 5   DT  J "C4'" 1 
ATOM 741  O "O4'" . DT  D 1 4   ? 119.158 132.030 40.104  1.00 175.93 ? 5   DT  J "O4'" 1 
ATOM 742  C "C3'" . DT  D 1 4   ? 120.772 130.852 41.384  1.00 172.84 ? 5   DT  J "C3'" 1 
ATOM 743  O "O3'" . DT  D 1 4   ? 120.473 130.436 42.710  1.00 171.53 ? 5   DT  J "O3'" 1 
ATOM 744  C "C2'" . DT  D 1 4   ? 120.078 129.970 40.349  1.00 174.42 ? 5   DT  J "C2'" 1 
ATOM 745  C "C1'" . DT  D 1 4   ? 118.746 130.695 40.263  1.00 178.25 ? 5   DT  J "C1'" 1 
ATOM 746  N N1    . DT  D 1 4   ? 117.826 130.244 39.170  1.00 179.34 ? 5   DT  J N1    1 
ATOM 747  C C2    . DT  D 1 4   ? 116.558 129.802 39.509  1.00 181.08 ? 5   DT  J C2    1 
ATOM 748  O O2    . DT  D 1 4   ? 116.131 129.760 40.651  1.00 181.65 ? 5   DT  J O2    1 
ATOM 749  N N3    . DT  D 1 4   ? 115.785 129.403 38.446  1.00 182.55 ? 5   DT  J N3    1 
ATOM 750  C C4    . DT  D 1 4   ? 116.141 129.398 37.107  1.00 181.86 ? 5   DT  J C4    1 
ATOM 751  O O4    . DT  D 1 4   ? 115.365 129.018 36.233  1.00 181.27 ? 5   DT  J O4    1 
ATOM 752  C C5    . DT  D 1 4   ? 117.479 129.869 36.821  1.00 182.21 ? 5   DT  J C5    1 
ATOM 753  C C7    . DT  D 1 4   ? 117.989 129.911 35.410  1.00 181.71 ? 5   DT  J C7    1 
ATOM 754  C C6    . DT  D 1 4   ? 118.246 130.263 37.851  1.00 180.85 ? 5   DT  J C6    1 
ATOM 755  P P     . DG  D 1 5   ? 121.056 129.088 43.345  1.00 171.09 ? 6   DG  J P     1 
ATOM 756  O OP1   . DG  D 1 5   ? 122.173 129.456 44.240  1.00 171.63 ? 6   DG  J OP1   1 
ATOM 757  O OP2   . DG  D 1 5   ? 121.284 128.100 42.271  1.00 169.85 ? 6   DG  J OP2   1 
ATOM 758  O "O5'" . DG  D 1 5   ? 119.836 128.601 44.258  1.00 174.57 ? 6   DG  J "O5'" 1 
ATOM 759  C "C5'" . DG  D 1 5   ? 119.819 127.280 44.781  1.00 181.45 ? 6   DG  J "C5'" 1 
ATOM 760  C "C4'" . DG  D 1 5   ? 118.761 126.416 44.112  1.00 186.02 ? 6   DG  J "C4'" 1 
ATOM 761  O "O4'" . DG  D 1 5   ? 118.362 126.948 42.824  1.00 187.95 ? 6   DG  J "O4'" 1 
ATOM 762  C "C3'" . DG  D 1 5   ? 119.199 124.984 43.810  1.00 186.74 ? 6   DG  J "C3'" 1 
ATOM 763  O "O3'" . DG  D 1 5   ? 118.695 124.101 44.804  1.00 187.31 ? 6   DG  J "O3'" 1 
ATOM 764  C "C2'" . DG  D 1 5   ? 118.590 124.675 42.442  1.00 186.74 ? 6   DG  J "C2'" 1 
ATOM 765  C "C1'" . DG  D 1 5   ? 117.699 125.879 42.187  1.00 189.88 ? 6   DG  J "C1'" 1 
ATOM 766  N N9    . DG  D 1 5   ? 117.512 126.109 40.757  1.00 190.70 ? 6   DG  J N9    1 
ATOM 767  C C8    . DG  D 1 5   ? 118.316 126.824 39.901  1.00 191.33 ? 6   DG  J C8    1 
ATOM 768  N N7    . DG  D 1 5   ? 117.884 126.836 38.670  1.00 190.79 ? 6   DG  J N7    1 
ATOM 769  C C5    . DG  D 1 5   ? 116.725 126.074 38.710  1.00 190.10 ? 6   DG  J C5    1 
ATOM 770  C C6    . DG  D 1 5   ? 115.821 125.731 37.677  1.00 190.61 ? 6   DG  J C6    1 
ATOM 771  O O6    . DG  D 1 5   ? 115.879 126.052 36.482  1.00 191.15 ? 6   DG  J O6    1 
ATOM 772  N N1    . DG  D 1 5   ? 114.767 124.938 38.140  1.00 191.64 ? 6   DG  J N1    1 
ATOM 773  C C2    . DG  D 1 5   ? 114.609 124.526 39.447  1.00 191.46 ? 6   DG  J C2    1 
ATOM 774  N N2    . DG  D 1 5   ? 113.534 123.769 39.718  1.00 190.63 ? 6   DG  J N2    1 
ATOM 775  N N3    . DG  D 1 5   ? 115.453 124.844 40.423  1.00 191.63 ? 6   DG  J N3    1 
ATOM 776  C C4    . DG  D 1 5   ? 116.484 125.616 39.987  1.00 190.56 ? 6   DG  J C4    1 
ATOM 777  P P     . DT  D 1 6   ? 118.971 122.523 44.745  1.00 187.95 ? 7   DT  J P     1 
ATOM 778  O OP1   . DT  D 1 6   ? 119.010 122.038 46.142  1.00 189.78 ? 7   DT  J OP1   1 
ATOM 779  O OP2   . DT  D 1 6   ? 120.120 122.258 43.850  1.00 186.79 ? 7   DT  J OP2   1 
ATOM 780  O "O5'" . DT  D 1 6   ? 117.652 121.957 44.042  1.00 184.43 ? 7   DT  J "O5'" 1 
ATOM 781  C "C5'" . DT  D 1 6   ? 116.394 122.088 44.694  1.00 183.52 ? 7   DT  J "C5'" 1 
ATOM 782  C "C4'" . DT  D 1 6   ? 115.300 121.401 43.898  1.00 183.02 ? 7   DT  J "C4'" 1 
ATOM 783  O "O4'" . DT  D 1 6   ? 115.280 121.946 42.551  1.00 183.31 ? 7   DT  J "O4'" 1 
ATOM 784  C "C3'" . DT  D 1 6   ? 115.468 119.888 43.766  1.00 182.23 ? 7   DT  J "C3'" 1 
ATOM 785  O "O3'" . DT  D 1 6   ? 114.260 119.214 44.132  1.00 178.90 ? 7   DT  J "O3'" 1 
ATOM 786  C "C2'" . DT  D 1 6   ? 115.810 119.692 42.290  1.00 183.06 ? 7   DT  J "C2'" 1 
ATOM 787  C "C1'" . DT  D 1 6   ? 115.114 120.882 41.639  1.00 181.08 ? 7   DT  J "C1'" 1 
ATOM 788  N N1    . DT  D 1 6   ? 115.652 121.249 40.282  1.00 179.69 ? 7   DT  J N1    1 
ATOM 789  C C2    . DT  D 1 6   ? 114.852 121.046 39.171  1.00 179.78 ? 7   DT  J C2    1 
ATOM 790  O O2    . DT  D 1 6   ? 113.722 120.590 39.223  1.00 179.53 ? 7   DT  J O2    1 
ATOM 791  N N3    . DT  D 1 6   ? 115.425 121.406 37.976  1.00 179.36 ? 7   DT  J N3    1 
ATOM 792  C C4    . DT  D 1 6   ? 116.689 121.934 37.779  1.00 177.91 ? 7   DT  J C4    1 
ATOM 793  O O4    . DT  D 1 6   ? 117.106 122.221 36.662  1.00 178.31 ? 7   DT  J O4    1 
ATOM 794  C C5    . DT  D 1 6   ? 117.473 122.118 38.975  1.00 177.88 ? 7   DT  J C5    1 
ATOM 795  C C7    . DT  D 1 6   ? 118.860 122.681 38.888  1.00 180.19 ? 7   DT  J C7    1 
ATOM 796  C C6    . DT  D 1 6   ? 116.929 121.772 40.153  1.00 177.92 ? 7   DT  J C6    1 
ATOM 797  P P     . DC  D 1 7   ? 114.229 117.656 44.521  1.00 176.57 ? 8   DC  J P     1 
ATOM 798  O OP1   . DC  D 1 7   ? 113.963 117.557 45.973  1.00 176.84 ? 8   DC  J OP1   1 
ATOM 799  O OP2   . DC  D 1 7   ? 115.401 116.970 43.936  1.00 176.04 ? 8   DC  J OP2   1 
ATOM 800  O "O5'" . DC  D 1 7   ? 112.937 117.118 43.750  1.00 179.80 ? 8   DC  J "O5'" 1 
ATOM 801  C "C5'" . DC  D 1 7   ? 112.318 117.906 42.737  1.00 182.14 ? 8   DC  J "C5'" 1 
ATOM 802  C "C4'" . DC  D 1 7   ? 112.481 117.332 41.336  1.00 183.42 ? 8   DC  J "C4'" 1 
ATOM 803  O "O4'" . DC  D 1 7   ? 113.528 118.029 40.614  1.00 181.76 ? 8   DC  J "O4'" 1 
ATOM 804  C "C3'" . DC  D 1 7   ? 112.816 115.841 41.196  1.00 183.87 ? 8   DC  J "C3'" 1 
ATOM 805  O "O3'" . DC  D 1 7   ? 111.720 115.194 40.541  1.00 185.03 ? 8   DC  J "O3'" 1 
ATOM 806  C "C2'" . DC  D 1 7   ? 114.078 115.835 40.330  1.00 183.31 ? 8   DC  J "C2'" 1 
ATOM 807  C "C1'" . DC  D 1 7   ? 113.850 117.138 39.574  1.00 183.28 ? 8   DC  J "C1'" 1 
ATOM 808  N N1    . DC  D 1 7   ? 114.970 117.654 38.721  1.00 182.92 ? 8   DC  J N1    1 
ATOM 809  C C2    . DC  D 1 7   ? 114.762 117.820 37.339  1.00 182.66 ? 8   DC  J C2    1 
ATOM 810  O O2    . DC  D 1 7   ? 113.670 117.536 36.837  1.00 185.48 ? 8   DC  J O2    1 
ATOM 811  N N3    . DC  D 1 7   ? 115.774 118.289 36.567  1.00 182.68 ? 8   DC  J N3    1 
ATOM 812  C C4    . DC  D 1 7   ? 116.948 118.589 37.123  1.00 184.67 ? 8   DC  J C4    1 
ATOM 813  N N4    . DC  D 1 7   ? 117.914 119.049 36.325  1.00 184.79 ? 8   DC  J N4    1 
ATOM 814  C C5    . DC  D 1 7   ? 117.182 118.433 38.524  1.00 186.22 ? 8   DC  J C5    1 
ATOM 815  C C6    . DC  D 1 7   ? 116.178 117.964 39.278  1.00 184.36 ? 8   DC  J C6    1 
ATOM 816  P P     . DC  D 1 8   ? 111.511 113.606 40.547  1.00 185.61 ? 9   DC  J P     1 
ATOM 817  O OP1   . DC  D 1 8   ? 110.134 113.353 40.063  1.00 184.17 ? 9   DC  J OP1   1 
ATOM 818  O OP2   . DC  D 1 8   ? 111.922 113.084 41.870  1.00 185.32 ? 9   DC  J OP2   1 
ATOM 819  O "O5'" . DC  D 1 8   ? 112.558 113.101 39.442  1.00 187.80 ? 9   DC  J "O5'" 1 
ATOM 820  C "C5'" . DC  D 1 8   ? 112.231 112.076 38.501  1.00 190.21 ? 9   DC  J "C5'" 1 
ATOM 821  C "C4'" . DC  D 1 8   ? 111.758 112.669 37.185  1.00 190.77 ? 9   DC  J "C4'" 1 
ATOM 822  O "O4'" . DC  D 1 8   ? 112.355 113.973 36.987  1.00 192.08 ? 9   DC  J "O4'" 1 
ATOM 823  C "C3'" . DC  D 1 8   ? 112.135 111.868 35.951  1.00 190.87 ? 9   DC  J "C3'" 1 
ATOM 824  O "O3'" . DC  D 1 8   ? 111.122 110.894 35.711  1.00 189.85 ? 9   DC  J "O3'" 1 
ATOM 825  C "C2'" . DC  D 1 8   ? 112.168 112.938 34.864  1.00 191.22 ? 9   DC  J "C2'" 1 
ATOM 826  C "C1'" . DC  D 1 8   ? 112.592 114.197 35.609  1.00 191.38 ? 9   DC  J "C1'" 1 
ATOM 827  N N1    . DC  D 1 8   ? 114.029 114.608 35.386  1.00 191.81 ? 9   DC  J N1    1 
ATOM 828  C C2    . DC  D 1 8   ? 114.426 115.131 34.138  1.00 191.97 ? 9   DC  J C2    1 
ATOM 829  O O2    . DC  D 1 8   ? 113.600 115.245 33.220  1.00 193.40 ? 9   DC  J O2    1 
ATOM 830  N N3    . DC  D 1 8   ? 115.722 115.504 33.964  1.00 189.42 ? 9   DC  J N3    1 
ATOM 831  C C4    . DC  D 1 8   ? 116.596 115.377 34.965  1.00 189.83 ? 9   DC  J C4    1 
ATOM 832  N N4    . DC  D 1 8   ? 117.854 115.760 34.736  1.00 191.18 ? 9   DC  J N4    1 
ATOM 833  C C5    . DC  D 1 8   ? 116.218 114.852 36.239  1.00 189.96 ? 9   DC  J C5    1 
ATOM 834  C C6    . DC  D 1 8   ? 114.941 114.486 36.402  1.00 189.86 ? 9   DC  J C6    1 
ATOM 835  P P     . DG  D 1 9   ? 111.051 110.033 34.361  1.00 189.20 ? 10  DG  J P     1 
ATOM 836  O OP1   . DG  D 1 9   ? 109.993 109.019 34.559  1.00 190.23 ? 10  DG  J OP1   1 
ATOM 837  O OP2   . DG  D 1 9   ? 112.423 109.596 34.012  1.00 188.57 ? 10  DG  J OP2   1 
ATOM 838  O "O5'" . DG  D 1 9   ? 110.518 111.078 33.268  1.00 187.13 ? 10  DG  J "O5'" 1 
ATOM 839  C "C5'" . DG  D 1 9   ? 110.216 110.657 31.941  1.00 186.81 ? 10  DG  J "C5'" 1 
ATOM 840  C "C4'" . DG  D 1 9   ? 111.294 111.064 30.947  1.00 186.66 ? 10  DG  J "C4'" 1 
ATOM 841  O "O4'" . DG  D 1 9   ? 112.382 111.756 31.616  1.00 187.61 ? 10  DG  J "O4'" 1 
ATOM 842  C "C3'" . DG  D 1 9   ? 111.943 109.906 30.189  1.00 186.45 ? 10  DG  J "C3'" 1 
ATOM 843  O "O3'" . DG  D 1 9   ? 111.989 110.209 28.790  1.00 185.39 ? 10  DG  J "O3'" 1 
ATOM 844  C "C2'" . DG  D 1 9   ? 113.343 109.820 30.797  1.00 186.04 ? 10  DG  J "C2'" 1 
ATOM 845  C "C1'" . DG  D 1 9   ? 113.592 111.300 31.048  1.00 188.01 ? 10  DG  J "C1'" 1 
ATOM 846  N N9    . DG  D 1 9   ? 114.718 111.626 31.924  1.00 188.76 ? 10  DG  J N9    1 
ATOM 847  C C8    . DG  D 1 9   ? 114.841 111.390 33.274  1.00 188.56 ? 10  DG  J C8    1 
ATOM 848  N N7    . DG  D 1 9   ? 115.966 111.807 33.783  1.00 186.45 ? 10  DG  J N7    1 
ATOM 849  C C5    . DG  D 1 9   ? 116.634 112.356 32.699  1.00 186.85 ? 10  DG  J C5    1 
ATOM 850  C C6    . DG  D 1 9   ? 117.907 112.967 32.628  1.00 188.06 ? 10  DG  J C6    1 
ATOM 851  O O6    . DG  D 1 9   ? 118.716 113.142 33.547  1.00 190.26 ? 10  DG  J O6    1 
ATOM 852  N N1    . DG  D 1 9   ? 118.220 113.397 31.338  1.00 188.12 ? 10  DG  J N1    1 
ATOM 853  C C2    . DG  D 1 9   ? 117.399 113.248 30.244  1.00 188.20 ? 10  DG  J C2    1 
ATOM 854  N N2    . DG  D 1 9   ? 117.863 113.725 29.080  1.00 188.47 ? 10  DG  J N2    1 
ATOM 855  N N3    . DG  D 1 9   ? 116.199 112.678 30.295  1.00 188.70 ? 10  DG  J N3    1 
ATOM 856  C C4    . DG  D 1 9   ? 115.882 112.256 31.548  1.00 188.03 ? 10  DG  J C4    1 
ATOM 857  P P     . DA  D 1 10  ? 112.029 109.043 27.693  1.00 184.83 ? 11  DA  J P     1 
ATOM 858  O OP1   . DA  D 1 10  ? 110.734 109.069 26.977  1.00 184.73 ? 11  DA  J OP1   1 
ATOM 859  O OP2   . DA  D 1 10  ? 112.472 107.796 28.361  1.00 185.04 ? 11  DA  J OP2   1 
ATOM 860  O "O5'" . DA  D 1 10  ? 113.190 109.493 26.685  1.00 182.30 ? 11  DA  J "O5'" 1 
ATOM 861  C "C5'" . DA  D 1 10  ? 113.146 110.710 25.942  1.00 182.20 ? 11  DA  J "C5'" 1 
ATOM 862  C "C4'" . DA  D 1 10  ? 114.541 111.105 25.473  1.00 184.87 ? 11  DA  J "C4'" 1 
ATOM 863  O "O4'" . DA  D 1 10  ? 115.389 111.390 26.621  1.00 186.85 ? 11  DA  J "O4'" 1 
ATOM 864  C "C3'" . DA  D 1 10  ? 115.289 110.070 24.633  1.00 185.45 ? 11  DA  J "C3'" 1 
ATOM 865  O "O3'" . DA  D 1 10  ? 115.921 110.717 23.523  1.00 188.24 ? 11  DA  J "O3'" 1 
ATOM 866  C "C2'" . DA  D 1 10  ? 116.305 109.484 25.612  1.00 186.92 ? 11  DA  J "C2'" 1 
ATOM 867  C "C1'" . DA  D 1 10  ? 116.598 110.659 26.540  1.00 185.73 ? 11  DA  J "C1'" 1 
ATOM 868  N N9    . DA  D 1 10  ? 116.998 110.232 27.882  1.00 185.07 ? 11  DA  J N9    1 
ATOM 869  C C8    . DA  D 1 10  ? 116.280 109.441 28.737  1.00 186.51 ? 11  DA  J C8    1 
ATOM 870  N N7    . DA  D 1 10  ? 116.870 109.199 29.882  1.00 186.11 ? 11  DA  J N7    1 
ATOM 871  C C5    . DA  D 1 10  ? 118.068 109.878 29.776  1.00 186.00 ? 11  DA  J C5    1 
ATOM 872  C C6    . DA  D 1 10  ? 119.155 110.022 30.665  1.00 185.67 ? 11  DA  J C6    1 
ATOM 873  N N6    . DA  D 1 10  ? 119.190 109.459 31.876  1.00 185.80 ? 11  DA  J N6    1 
ATOM 874  N N1    . DA  D 1 10  ? 120.208 110.767 30.262  1.00 185.39 ? 11  DA  J N1    1 
ATOM 875  C C2    . DA  D 1 10  ? 120.166 111.333 29.046  1.00 186.29 ? 11  DA  J C2    1 
ATOM 876  N N3    . DA  D 1 10  ? 119.200 111.267 28.124  1.00 187.27 ? 11  DA  J N3    1 
ATOM 877  C C4    . DA  D 1 10  ? 118.167 110.517 28.550  1.00 185.70 ? 11  DA  J C4    1 
ATOM 878  P P     . DT  D 1 11  ? 116.933 109.966 22.528  1.00 190.75 ? 12  DT  J P     1 
ATOM 879  O OP1   . DT  D 1 11  ? 116.974 110.758 21.277  1.00 191.53 ? 12  DT  J OP1   1 
ATOM 880  O OP2   . DT  D 1 11  ? 116.571 108.531 22.468  1.00 188.33 ? 12  DT  J OP2   1 
ATOM 881  O "O5'" . DT  D 1 11  ? 118.353 110.121 23.261  1.00 192.17 ? 12  DT  J "O5'" 1 
ATOM 882  C "C5'" . DT  D 1 11  ? 119.254 111.182 22.919  1.00 193.35 ? 12  DT  J "C5'" 1 
ATOM 883  C "C4'" . DT  D 1 11  ? 120.686 110.886 23.347  1.00 193.88 ? 12  DT  J "C4'" 1 
ATOM 884  O "O4'" . DT  D 1 11  ? 120.727 110.595 24.767  1.00 194.38 ? 12  DT  J "O4'" 1 
ATOM 885  C "C3'" . DT  D 1 11  ? 121.372 109.714 22.642  1.00 194.58 ? 12  DT  J "C3'" 1 
ATOM 886  O "O3'" . DT  D 1 11  ? 122.624 110.167 22.105  1.00 193.83 ? 12  DT  J "O3'" 1 
ATOM 887  C "C2'" . DT  D 1 11  ? 121.520 108.654 23.737  1.00 192.58 ? 12  DT  J "C2'" 1 
ATOM 888  C "C1'" . DT  D 1 11  ? 121.591 109.503 25.001  1.00 191.14 ? 12  DT  J "C1'" 1 
ATOM 889  N N1    . DT  D 1 11  ? 121.154 108.815 26.266  1.00 190.36 ? 12  DT  J N1    1 
ATOM 890  C C2    . DT  D 1 11  ? 121.878 108.998 27.434  1.00 189.35 ? 12  DT  J C2    1 
ATOM 891  O O2    . DT  D 1 11  ? 122.877 109.695 27.519  1.00 188.39 ? 12  DT  J O2    1 
ATOM 892  N N3    . DT  D 1 11  ? 121.382 108.325 28.527  1.00 188.67 ? 12  DT  J N3    1 
ATOM 893  C C4    . DT  D 1 11  ? 120.263 107.507 28.575  1.00 188.50 ? 12  DT  J C4    1 
ATOM 894  O O4    . DT  D 1 11  ? 119.905 106.951 29.609  1.00 187.94 ? 12  DT  J O4    1 
ATOM 895  C C5    . DT  D 1 11  ? 119.555 107.361 27.323  1.00 188.53 ? 12  DT  J C5    1 
ATOM 896  C C7    . DT  D 1 11  ? 118.328 106.502 27.236  1.00 190.35 ? 12  DT  J C7    1 
ATOM 897  C C6    . DT  D 1 11  ? 120.024 108.013 26.249  1.00 188.92 ? 12  DT  J C6    1 
ATOM 898  P P     . DA  D 1 12  ? 123.762 109.189 21.529  1.00 194.69 ? 13  DA  J P     1 
ATOM 899  O OP1   . DA  D 1 12  ? 124.577 109.993 20.590  1.00 193.44 ? 13  DA  J OP1   1 
ATOM 900  O OP2   . DA  D 1 12  ? 123.161 107.908 21.076  1.00 191.48 ? 13  DA  J OP2   1 
ATOM 901  O "O5'" . DA  D 1 12  ? 124.656 108.924 22.829  1.00 191.55 ? 13  DA  J "O5'" 1 
ATOM 902  C "C5'" . DA  D 1 12  ? 125.117 110.025 23.611  1.00 186.13 ? 13  DA  J "C5'" 1 
ATOM 903  C "C4'" . DA  D 1 12  ? 126.306 109.660 24.487  1.00 182.32 ? 13  DA  J "C4'" 1 
ATOM 904  O "O4'" . DA  D 1 12  ? 125.840 109.235 25.792  1.00 181.12 ? 13  DA  J "O4'" 1 
ATOM 905  C "C3'" . DA  D 1 12  ? 127.224 108.561 23.967  1.00 179.66 ? 13  DA  J "C3'" 1 
ATOM 906  O "O3'" . DA  D 1 12  ? 128.563 108.984 24.144  1.00 180.17 ? 13  DA  J "O3'" 1 
ATOM 907  C "C2'" . DA  D 1 12  ? 126.888 107.342 24.824  1.00 179.66 ? 13  DA  J "C2'" 1 
ATOM 908  C "C1'" . DA  D 1 12  ? 126.318 107.943 26.105  1.00 180.54 ? 13  DA  J "C1'" 1 
ATOM 909  N N9    . DA  D 1 12  ? 125.198 107.187 26.669  1.00 181.59 ? 13  DA  J N9    1 
ATOM 910  C C8    . DA  D 1 12  ? 124.087 106.747 26.001  1.00 180.84 ? 13  DA  J C8    1 
ATOM 911  N N7    . DA  D 1 12  ? 123.234 106.096 26.754  1.00 180.94 ? 13  DA  J N7    1 
ATOM 912  C C5    . DA  D 1 12  ? 123.821 106.109 28.007  1.00 180.03 ? 13  DA  J C5    1 
ATOM 913  C C6    . DA  D 1 12  ? 123.416 105.584 29.252  1.00 179.82 ? 13  DA  J C6    1 
ATOM 914  N N6    . DA  D 1 12  ? 122.271 104.917 29.419  1.00 182.18 ? 13  DA  J N6    1 
ATOM 915  N N1    . DA  D 1 12  ? 124.229 105.764 30.315  1.00 178.27 ? 13  DA  J N1    1 
ATOM 916  C C2    . DA  D 1 12  ? 125.370 106.435 30.139  1.00 179.34 ? 13  DA  J C2    1 
ATOM 917  N N3    . DA  D 1 12  ? 125.857 106.974 29.020  1.00 180.98 ? 13  DA  J N3    1 
ATOM 918  C C4    . DA  D 1 12  ? 125.031 106.778 27.977  1.00 181.04 ? 13  DA  J C4    1 
ATOM 919  P P     . DA  D 1 13  ? 129.801 108.131 23.602  1.00 182.18 ? 14  DA  J P     1 
ATOM 920  O OP1   . DA  D 1 13  ? 130.884 109.085 23.270  1.00 182.55 ? 14  DA  J OP1   1 
ATOM 921  O OP2   . DA  D 1 13  ? 129.322 107.176 22.575  1.00 181.05 ? 14  DA  J OP2   1 
ATOM 922  O "O5'" . DA  D 1 13  ? 130.236 107.313 24.906  1.00 182.42 ? 14  DA  J "O5'" 1 
ATOM 923  C "C5'" . DA  D 1 13  ? 130.622 107.995 26.095  1.00 181.03 ? 14  DA  J "C5'" 1 
ATOM 924  C "C4'" . DA  D 1 13  ? 130.483 107.091 27.307  1.00 181.08 ? 14  DA  J "C4'" 1 
ATOM 925  O "O4'" . DA  D 1 13  ? 129.137 106.558 27.383  1.00 181.54 ? 14  DA  J "O4'" 1 
ATOM 926  C "C3'" . DA  D 1 13  ? 131.407 105.875 27.328  1.00 180.91 ? 14  DA  J "C3'" 1 
ATOM 927  O "O3'" . DA  D 1 13  ? 132.076 105.835 28.577  1.00 181.84 ? 14  DA  J "O3'" 1 
ATOM 928  C "C2'" . DA  D 1 13  ? 130.461 104.684 27.170  1.00 180.78 ? 14  DA  J "C2'" 1 
ATOM 929  C "C1'" . DA  D 1 13  ? 129.246 105.246 27.896  1.00 178.87 ? 14  DA  J "C1'" 1 
ATOM 930  N N9    . DA  D 1 13  ? 127.976 104.535 27.738  1.00 176.98 ? 14  DA  J N9    1 
ATOM 931  C C8    . DA  D 1 13  ? 127.294 104.289 26.579  1.00 176.21 ? 14  DA  J C8    1 
ATOM 932  N N7    . DA  D 1 13  ? 126.172 103.636 26.756  1.00 175.54 ? 14  DA  J N7    1 
ATOM 933  C C5    . DA  D 1 13  ? 126.112 103.443 28.124  1.00 175.10 ? 14  DA  J C5    1 
ATOM 934  C C6    . DA  D 1 13  ? 125.168 102.812 28.957  1.00 176.25 ? 14  DA  J C6    1 
ATOM 935  N N6    . DA  D 1 13  ? 124.060 102.243 28.482  1.00 178.06 ? 14  DA  J N6    1 
ATOM 936  N N1    . DA  D 1 13  ? 125.395 102.788 30.290  1.00 175.37 ? 14  DA  J N1    1 
ATOM 937  C C2    . DA  D 1 13  ? 126.510 103.362 30.754  1.00 175.93 ? 14  DA  J C2    1 
ATOM 938  N N3    . DA  D 1 13  ? 127.470 103.981 30.067  1.00 175.58 ? 14  DA  J N3    1 
ATOM 939  C C4    . DA  D 1 13  ? 127.214 103.989 28.747  1.00 174.96 ? 14  DA  J C4    1 
ATOM 940  P P     . DT  D 1 14  ? 133.597 105.360 28.664  1.00 185.61 ? 15  DT  J P     1 
ATOM 941  O OP1   . DT  D 1 14  ? 134.386 106.489 29.209  1.00 185.24 ? 15  DT  J OP1   1 
ATOM 942  O OP2   . DT  D 1 14  ? 133.980 104.757 27.365  1.00 186.23 ? 15  DT  J OP2   1 
ATOM 943  O "O5'" . DT  D 1 14  ? 133.534 104.224 29.791  1.00 186.30 ? 15  DT  J "O5'" 1 
ATOM 944  C "C5'" . DT  D 1 14  ? 133.158 102.886 29.471  1.00 184.37 ? 15  DT  J "C5'" 1 
ATOM 945  C "C4'" . DT  D 1 14  ? 132.161 102.364 30.486  1.00 182.43 ? 15  DT  J "C4'" 1 
ATOM 946  O "O4'" . DT  D 1 14  ? 130.822 102.607 29.994  1.00 184.04 ? 15  DT  J "O4'" 1 
ATOM 947  C "C3'" . DT  D 1 14  ? 132.209 100.866 30.737  1.00 180.60 ? 15  DT  J "C3'" 1 
ATOM 948  O "O3'" . DT  D 1 14  ? 133.150 100.555 31.760  1.00 175.64 ? 15  DT  J "O3'" 1 
ATOM 949  C "C2'" . DT  D 1 14  ? 130.790 100.567 31.207  1.00 183.23 ? 15  DT  J "C2'" 1 
ATOM 950  C "C1'" . DT  D 1 14  ? 129.937 101.636 30.525  1.00 182.62 ? 15  DT  J "C1'" 1 
ATOM 951  N N1    . DT  D 1 14  ? 129.022 101.088 29.454  1.00 181.32 ? 15  DT  J N1    1 
ATOM 952  C C2    . DT  D 1 14  ? 127.844 100.456 29.820  1.00 181.49 ? 15  DT  J C2    1 
ATOM 953  O O2    . DT  D 1 14  ? 127.472 100.307 30.970  1.00 182.28 ? 15  DT  J O2    1 
ATOM 954  N N3    . DT  D 1 14  ? 127.087 99.993  28.772  1.00 181.92 ? 15  DT  J N3    1 
ATOM 955  C C4    . DT  D 1 14  ? 127.379 100.091 27.422  1.00 182.11 ? 15  DT  J C4    1 
ATOM 956  O O4    . DT  D 1 14  ? 126.628 99.638  26.563  1.00 181.14 ? 15  DT  J O4    1 
ATOM 957  C C5    . DT  D 1 14  ? 128.622 100.756 27.103  1.00 181.97 ? 15  DT  J C5    1 
ATOM 958  C C7    . DT  D 1 14  ? 129.051 100.923 25.673  1.00 181.84 ? 15  DT  J C7    1 
ATOM 959  C C6    . DT  D 1 14  ? 129.372 101.215 28.120  1.00 181.48 ? 15  DT  J C6    1 
ATOM 960  P P     . DT  D 1 15  ? 134.319 99.493  31.500  1.00 171.96 ? 16  DT  J P     1 
ATOM 961  O OP1   . DT  D 1 15  ? 135.490 99.959  32.282  1.00 172.70 ? 16  DT  J OP1   1 
ATOM 962  O OP2   . DT  D 1 15  ? 134.426 99.273  30.039  1.00 169.73 ? 16  DT  J OP2   1 
ATOM 963  O "O5'" . DT  D 1 15  ? 133.783 98.132  32.149  1.00 167.14 ? 16  DT  J "O5'" 1 
ATOM 964  C "C5'" . DT  D 1 15  ? 133.534 98.028  33.544  1.00 166.57 ? 16  DT  J "C5'" 1 
ATOM 965  C "C4'" . DT  D 1 15  ? 132.285 97.202  33.803  1.00 166.53 ? 16  DT  J "C4'" 1 
ATOM 966  O "O4'" . DT  D 1 15  ? 131.212 97.661  32.951  1.00 166.49 ? 16  DT  J "O4'" 1 
ATOM 967  C "C3'" . DT  D 1 15  ? 132.429 95.716  33.508  1.00 164.98 ? 16  DT  J "C3'" 1 
ATOM 968  O "O3'" . DT  D 1 15  ? 132.679 95.018  34.719  1.00 162.39 ? 16  DT  J "O3'" 1 
ATOM 969  C "C2'" . DT  D 1 15  ? 131.089 95.294  32.911  1.00 164.88 ? 16  DT  J "C2'" 1 
ATOM 970  C "C1'" . DT  D 1 15  ? 130.327 96.594  32.684  1.00 166.11 ? 16  DT  J "C1'" 1 
ATOM 971  N N1    . DT  D 1 15  ? 129.807 96.740  31.290  1.00 165.65 ? 16  DT  J N1    1 
ATOM 972  C C2    . DT  D 1 15  ? 128.477 96.482  31.022  1.00 166.88 ? 16  DT  J C2    1 
ATOM 973  O O2    . DT  D 1 15  ? 127.665 96.130  31.859  1.00 168.00 ? 16  DT  J O2    1 
ATOM 974  N N3    . DT  D 1 15  ? 128.120 96.654  29.708  1.00 167.27 ? 16  DT  J N3    1 
ATOM 975  C C4    . DT  D 1 15  ? 128.933 97.047  28.658  1.00 167.39 ? 16  DT  J C4    1 
ATOM 976  O O4    . DT  D 1 15  ? 128.513 97.170  27.512  1.00 168.10 ? 16  DT  J O4    1 
ATOM 977  C C5    . DT  D 1 15  ? 130.308 97.298  29.005  1.00 168.13 ? 16  DT  J C5    1 
ATOM 978  C C7    . DT  D 1 15  ? 131.291 97.731  27.956  1.00 169.54 ? 16  DT  J C7    1 
ATOM 979  C C6    . DT  D 1 15  ? 130.672 97.133  30.285  1.00 167.79 ? 16  DT  J C6    1 
ATOM 980  P P     . DT  D 1 16  ? 133.425 93.604  34.703  1.00 160.01 ? 17  DT  J P     1 
ATOM 981  O OP1   . DT  D 1 16  ? 133.910 93.336  36.076  1.00 160.73 ? 17  DT  J OP1   1 
ATOM 982  O OP2   . DT  D 1 16  ? 134.389 93.599  33.578  1.00 161.22 ? 17  DT  J OP2   1 
ATOM 983  O "O5'" . DT  D 1 16  ? 132.233 92.589  34.368  1.00 158.87 ? 17  DT  J "O5'" 1 
ATOM 984  C "C5'" . DT  D 1 16  ? 131.270 92.229  35.361  1.00 158.98 ? 17  DT  J "C5'" 1 
ATOM 985  C "C4'" . DT  D 1 16  ? 130.229 91.258  34.824  1.00 158.12 ? 17  DT  J "C4'" 1 
ATOM 986  O "O4'" . DT  D 1 16  ? 129.358 91.968  33.913  1.00 158.02 ? 17  DT  J "O4'" 1 
ATOM 987  C "C3'" . DT  D 1 16  ? 130.785 90.062  34.061  1.00 158.96 ? 17  DT  J "C3'" 1 
ATOM 988  O "O3'" . DT  D 1 16  ? 130.771 88.901  34.884  1.00 158.53 ? 17  DT  J "O3'" 1 
ATOM 989  C "C2'" . DT  D 1 16  ? 129.854 89.890  32.866  1.00 161.17 ? 17  DT  J "C2'" 1 
ATOM 990  C "C1'" . DT  D 1 16  ? 129.048 91.184  32.781  1.00 162.00 ? 17  DT  J "C1'" 1 
ATOM 991  N N1    . DT  D 1 16  ? 129.312 91.991  31.540  1.00 162.57 ? 17  DT  J N1    1 
ATOM 992  C C2    . DT  D 1 16  ? 128.255 92.537  30.833  1.00 162.09 ? 17  DT  J C2    1 
ATOM 993  O O2    . DT  D 1 16  ? 127.085 92.412  31.149  1.00 161.93 ? 17  DT  J O2    1 
ATOM 994  N N3    . DT  D 1 16  ? 128.626 93.253  29.719  1.00 162.58 ? 17  DT  J N3    1 
ATOM 995  C C4    . DT  D 1 16  ? 129.912 93.474  29.247  1.00 163.39 ? 17  DT  J C4    1 
ATOM 996  O O4    . DT  D 1 16  ? 130.126 94.133  28.234  1.00 162.89 ? 17  DT  J O4    1 
ATOM 997  C C5    . DT  D 1 16  ? 130.971 92.874  30.031  1.00 164.77 ? 17  DT  J C5    1 
ATOM 998  C C7    . DT  D 1 16  ? 132.416 93.027  29.645  1.00 164.74 ? 17  DT  J C7    1 
ATOM 999  C C6    . DT  D 1 16  ? 130.620 92.175  31.119  1.00 164.96 ? 17  DT  J C6    1 
ATOM 1000 P P     . DA  D 1 17  ? 131.672 87.637  34.500  1.00 158.76 ? 18  DA  J P     1 
ATOM 1001 O OP1   . DA  D 1 17  ? 131.698 86.737  35.675  1.00 159.21 ? 18  DA  J OP1   1 
ATOM 1002 O OP2   . DA  D 1 17  ? 132.947 88.128  33.927  1.00 157.51 ? 18  DA  J OP2   1 
ATOM 1003 O "O5'" . DA  D 1 17  ? 130.818 86.937  33.337  1.00 164.60 ? 18  DA  J "O5'" 1 
ATOM 1004 C "C5'" . DA  D 1 17  ? 129.599 86.245  33.632  1.00 173.32 ? 18  DA  J "C5'" 1 
ATOM 1005 C "C4'" . DA  D 1 17  ? 128.745 85.967  32.398  1.00 178.64 ? 18  DA  J "C4'" 1 
ATOM 1006 O "O4'" . DA  D 1 17  ? 128.368 87.200  31.732  1.00 178.58 ? 18  DA  J "O4'" 1 
ATOM 1007 C "C3'" . DA  D 1 17  ? 129.386 85.133  31.298  1.00 181.62 ? 18  DA  J "C3'" 1 
ATOM 1008 O "O3'" . DA  D 1 17  ? 129.324 83.744  31.624  1.00 188.67 ? 18  DA  J "O3'" 1 
ATOM 1009 C "C2'" . DA  D 1 17  ? 128.488 85.480  30.113  1.00 178.45 ? 18  DA  J "C2'" 1 
ATOM 1010 C "C1'" . DA  D 1 17  ? 128.154 86.952  30.354  1.00 178.42 ? 18  DA  J "C1'" 1 
ATOM 1011 N N9    . DA  D 1 17  ? 128.965 87.896  29.579  1.00 179.11 ? 18  DA  J N9    1 
ATOM 1012 C C8    . DA  D 1 17  ? 130.254 88.279  29.839  1.00 179.48 ? 18  DA  J C8    1 
ATOM 1013 N N7    . DA  D 1 17  ? 130.744 89.145  28.984  1.00 179.74 ? 18  DA  J N7    1 
ATOM 1014 C C5    . DA  D 1 17  ? 129.705 89.349  28.094  1.00 179.25 ? 18  DA  J C5    1 
ATOM 1015 C C6    . DA  D 1 17  ? 129.586 90.160  26.943  1.00 178.49 ? 18  DA  J C6    1 
ATOM 1016 N N6    . DA  D 1 17  ? 130.574 90.940  26.496  1.00 179.38 ? 18  DA  J N6    1 
ATOM 1017 N N1    . DA  D 1 17  ? 128.416 90.140  26.268  1.00 178.28 ? 18  DA  J N1    1 
ATOM 1018 C C2    . DA  D 1 17  ? 127.428 89.356  26.722  1.00 179.25 ? 18  DA  J C2    1 
ATOM 1019 N N3    . DA  D 1 17  ? 127.422 88.551  27.790  1.00 180.24 ? 18  DA  J N3    1 
ATOM 1020 C C4    . DA  D 1 17  ? 128.600 88.590  28.443  1.00 179.62 ? 18  DA  J C4    1 
ATOM 1021 P P     . DT  D 1 18  ? 130.574 82.935  32.234  1.00 195.31 ? 19  DT  J P     1 
ATOM 1022 O OP1   . DT  D 1 18  ? 130.428 82.921  33.709  1.00 195.05 ? 19  DT  J OP1   1 
ATOM 1023 O OP2   . DT  D 1 18  ? 131.833 83.451  31.646  1.00 194.87 ? 19  DT  J OP2   1 
ATOM 1024 O "O5'" . DT  D 1 18  ? 130.309 81.453  31.673  1.00 197.07 ? 19  DT  J "O5'" 1 
ATOM 1025 C "C5'" . DT  D 1 18  ? 130.715 81.060  30.355  1.00 198.90 ? 19  DT  J "C5'" 1 
ATOM 1026 C "C4'" . DT  D 1 18  ? 129.540 80.932  29.397  1.00 199.18 ? 19  DT  J "C4'" 1 
ATOM 1027 O "O4'" . DT  D 1 18  ? 128.977 82.245  29.151  1.00 200.20 ? 19  DT  J "O4'" 1 
ATOM 1028 C "C3'" . DT  D 1 18  ? 129.905 80.372  28.027  1.00 199.14 ? 19  DT  J "C3'" 1 
ATOM 1029 O "O3'" . DT  D 1 18  ? 129.656 78.971  27.999  1.00 196.89 ? 19  DT  J "O3'" 1 
ATOM 1030 C "C2'" . DT  D 1 18  ? 129.002 81.119  27.044  1.00 200.32 ? 19  DT  J "C2'" 1 
ATOM 1031 C "C1'" . DT  D 1 18  ? 128.548 82.369  27.805  1.00 200.39 ? 19  DT  J "C1'" 1 
ATOM 1032 N N1    . DT  D 1 18  ? 129.022 83.698  27.228  1.00 200.61 ? 19  DT  J N1    1 
ATOM 1033 C C2    . DT  D 1 18  ? 128.181 84.433  26.400  1.00 199.36 ? 19  DT  J C2    1 
ATOM 1034 O O2    . DT  D 1 18  ? 127.055 84.086  26.082  1.00 198.84 ? 19  DT  J O2    1 
ATOM 1035 N N3    . DT  D 1 18  ? 128.713 85.617  25.940  1.00 198.09 ? 19  DT  J N3    1 
ATOM 1036 C C4    . DT  D 1 18  ? 129.969 86.137  26.212  1.00 198.87 ? 19  DT  J C4    1 
ATOM 1037 O O4    . DT  D 1 18  ? 130.334 87.211  25.739  1.00 199.36 ? 19  DT  J O4    1 
ATOM 1038 C C5    . DT  D 1 18  ? 130.799 85.328  27.082  1.00 198.56 ? 19  DT  J C5    1 
ATOM 1039 C C7    . DT  D 1 18  ? 132.184 85.769  27.461  1.00 198.58 ? 19  DT  J C7    1 
ATOM 1040 C C6    . DT  D 1 18  ? 130.293 84.169  27.536  1.00 199.45 ? 19  DT  J C6    1 
ATOM 1041 P P     . DA  E 1 19  ? 119.978 90.247  19.779  1.00 158.12 ? 20  DA  I P     1 
ATOM 1042 O OP1   . DA  E 1 19  ? 121.161 89.747  19.049  1.00 159.51 ? 20  DA  I OP1   1 
ATOM 1043 O OP2   . DA  E 1 19  ? 118.667 89.606  19.517  1.00 152.41 ? 20  DA  I OP2   1 
ATOM 1044 O "O5'" . DA  E 1 19  ? 120.265 90.083  21.343  1.00 155.44 ? 20  DA  I "O5'" 1 
ATOM 1045 C "C5'" . DA  E 1 19  ? 119.539 90.879  22.265  1.00 151.23 ? 20  DA  I "C5'" 1 
ATOM 1046 C "C4'" . DA  E 1 19  ? 120.220 90.921  23.615  1.00 146.58 ? 20  DA  I "C4'" 1 
ATOM 1047 O "O4'" . DA  E 1 19  ? 121.542 91.495  23.546  1.00 144.21 ? 20  DA  I "O4'" 1 
ATOM 1048 C "C3'" . DA  E 1 19  ? 119.492 91.761  24.657  1.00 144.82 ? 20  DA  I "C3'" 1 
ATOM 1049 O "O3'" . DA  E 1 19  ? 118.871 90.872  25.550  1.00 144.07 ? 20  DA  I "O3'" 1 
ATOM 1050 C "C2'" . DA  E 1 19  ? 120.591 92.552  25.358  1.00 144.03 ? 20  DA  I "C2'" 1 
ATOM 1051 C "C1'" . DA  E 1 19  ? 121.823 91.786  24.899  1.00 148.18 ? 20  DA  I "C1'" 1 
ATOM 1052 N N9    . DA  E 1 19  ? 123.085 92.508  25.053  1.00 149.76 ? 20  DA  I N9    1 
ATOM 1053 C C8    . DA  E 1 19  ? 123.690 93.344  24.153  1.00 152.22 ? 20  DA  I C8    1 
ATOM 1054 N N7    . DA  E 1 19  ? 124.827 93.855  24.565  1.00 151.69 ? 20  DA  I N7    1 
ATOM 1055 C C5    . DA  E 1 19  ? 124.977 93.313  25.827  1.00 150.48 ? 20  DA  I C5    1 
ATOM 1056 C C6    . DA  E 1 19  ? 125.986 93.458  26.795  1.00 150.34 ? 20  DA  I C6    1 
ATOM 1057 N N6    . DA  E 1 19  ? 127.061 94.229  26.608  1.00 149.65 ? 20  DA  I N6    1 
ATOM 1058 N N1    . DA  E 1 19  ? 125.841 92.780  27.957  1.00 151.23 ? 20  DA  I N1    1 
ATOM 1059 C C2    . DA  E 1 19  ? 124.755 92.009  28.130  1.00 150.63 ? 20  DA  I C2    1 
ATOM 1060 N N3    . DA  E 1 19  ? 123.741 91.794  27.290  1.00 147.97 ? 20  DA  I N3    1 
ATOM 1061 C C4    . DA  E 1 19  ? 123.915 92.481  26.147  1.00 149.00 ? 20  DA  I C4    1 
ATOM 1062 P P     . DA  E 1 20  ? 117.559 91.289  26.353  1.00 143.85 ? 21  DA  I P     1 
ATOM 1063 O OP1   . DA  E 1 20  ? 116.716 90.072  26.428  1.00 136.09 ? 21  DA  I OP1   1 
ATOM 1064 O OP2   . DA  E 1 20  ? 117.008 92.548  25.795  1.00 143.55 ? 21  DA  I OP2   1 
ATOM 1065 O "O5'" . DA  E 1 20  ? 118.147 91.642  27.798  1.00 143.73 ? 21  DA  I "O5'" 1 
ATOM 1066 C "C5'" . DA  E 1 20  ? 119.130 90.834  28.425  1.00 145.13 ? 21  DA  I "C5'" 1 
ATOM 1067 C "C4'" . DA  E 1 20  ? 119.727 91.561  29.612  1.00 148.04 ? 21  DA  I "C4'" 1 
ATOM 1068 O "O4'" . DA  E 1 20  ? 120.900 92.268  29.155  1.00 151.85 ? 21  DA  I "O4'" 1 
ATOM 1069 C "C3'" . DA  E 1 20  ? 118.823 92.601  30.272  1.00 153.07 ? 21  DA  I "C3'" 1 
ATOM 1070 O "O3'" . DA  E 1 20  ? 118.732 92.361  31.673  1.00 160.77 ? 21  DA  I "O3'" 1 
ATOM 1071 C "C2'" . DA  E 1 20  ? 119.497 93.939  29.977  1.00 154.18 ? 21  DA  I "C2'" 1 
ATOM 1072 C "C1'" . DA  E 1 20  ? 120.950 93.526  29.794  1.00 157.33 ? 21  DA  I "C1'" 1 
ATOM 1073 N N9    . DA  E 1 20  ? 121.746 94.433  28.967  1.00 158.02 ? 21  DA  I N9    1 
ATOM 1074 C C8    . DA  E 1 20  ? 121.373 95.059  27.806  1.00 159.65 ? 21  DA  I C8    1 
ATOM 1075 N N7    . DA  E 1 20  ? 122.299 95.818  27.273  1.00 156.41 ? 21  DA  I N7    1 
ATOM 1076 C C5    . DA  E 1 20  ? 123.357 95.675  28.145  1.00 156.32 ? 21  DA  I C5    1 
ATOM 1077 C C6    . DA  E 1 20  ? 124.649 96.228  28.148  1.00 158.75 ? 21  DA  I C6    1 
ATOM 1078 N N6    . DA  E 1 20  ? 125.081 97.061  27.196  1.00 159.32 ? 21  DA  I N6    1 
ATOM 1079 N N1    . DA  E 1 20  ? 125.471 95.891  29.169  1.00 159.79 ? 21  DA  I N1    1 
ATOM 1080 C C2    . DA  E 1 20  ? 125.025 95.056  30.121  1.00 159.21 ? 21  DA  I C2    1 
ATOM 1081 N N3    . DA  E 1 20  ? 123.829 94.475  30.222  1.00 157.40 ? 21  DA  I N3    1 
ATOM 1082 C C4    . DA  E 1 20  ? 123.038 94.830  29.195  1.00 156.00 ? 21  DA  I C4    1 
ATOM 1083 P P     . DA  E 1 21  ? 117.673 93.139  32.592  1.00 167.73 ? 22  DA  I P     1 
ATOM 1084 O OP1   . DA  E 1 21  ? 117.046 92.148  33.497  1.00 166.09 ? 22  DA  I OP1   1 
ATOM 1085 O OP2   . DA  E 1 21  ? 116.808 93.991  31.746  1.00 169.27 ? 22  DA  I OP2   1 
ATOM 1086 O "O5'" . DA  E 1 21  ? 118.621 94.078  33.467  1.00 164.57 ? 22  DA  I "O5'" 1 
ATOM 1087 C "C5'" . DA  E 1 21  ? 119.561 93.460  34.323  1.00 168.59 ? 22  DA  I "C5'" 1 
ATOM 1088 C "C4'" . DA  E 1 21  ? 120.812 94.304  34.418  1.00 172.67 ? 22  DA  I "C4'" 1 
ATOM 1089 O "O4'" . DA  E 1 21  ? 121.153 94.805  33.102  1.00 173.48 ? 22  DA  I "O4'" 1 
ATOM 1090 C "C3'" . DA  E 1 21  ? 120.684 95.523  35.334  1.00 173.46 ? 22  DA  I "C3'" 1 
ATOM 1091 O "O3'" . DA  E 1 21  ? 121.727 95.513  36.312  1.00 169.83 ? 22  DA  I "O3'" 1 
ATOM 1092 C "C2'" . DA  E 1 21  ? 120.807 96.706  34.377  1.00 174.84 ? 22  DA  I "C2'" 1 
ATOM 1093 C "C1'" . DA  E 1 21  ? 121.695 96.090  33.304  1.00 177.56 ? 22  DA  I "C1'" 1 
ATOM 1094 N N9    . DA  E 1 21  ? 121.750 96.815  32.040  1.00 178.98 ? 22  DA  I N9    1 
ATOM 1095 C C8    . DA  E 1 21  ? 120.751 96.948  31.117  1.00 181.01 ? 22  DA  I C8    1 
ATOM 1096 N N7    . DA  E 1 21  ? 121.089 97.659  30.069  1.00 181.24 ? 22  DA  I N7    1 
ATOM 1097 C C5    . DA  E 1 21  ? 122.400 98.018  30.326  1.00 178.61 ? 22  DA  I C5    1 
ATOM 1098 C C6    . DA  E 1 21  ? 123.332 98.780  29.597  1.00 179.05 ? 22  DA  I C6    1 
ATOM 1099 N N6    . DA  E 1 21  ? 123.045 99.324  28.411  1.00 180.40 ? 22  DA  I N6    1 
ATOM 1100 N N1    . DA  E 1 21  ? 124.567 98.952  30.125  1.00 178.85 ? 22  DA  I N1    1 
ATOM 1101 C C2    . DA  E 1 21  ? 124.841 98.395  31.313  1.00 179.10 ? 22  DA  I C2    1 
ATOM 1102 N N3    . DA  E 1 21  ? 124.043 97.659  32.091  1.00 178.86 ? 22  DA  I N3    1 
ATOM 1103 C C4    . DA  E 1 21  ? 122.827 97.505  31.536  1.00 177.88 ? 22  DA  I C4    1 
ATOM 1104 O "O5'" . DT  F 2 1   ? 120.483 100.068 38.227  1.00 181.96 ? 23  DT  K "O5'" 1 
ATOM 1105 C "C5'" . DT  F 2 1   ? 121.049 99.025  37.427  1.00 179.53 ? 23  DT  K "C5'" 1 
ATOM 1106 C "C4'" . DT  F 2 1   ? 122.572 99.029  37.461  1.00 174.27 ? 23  DT  K "C4'" 1 
ATOM 1107 O "O4'" . DT  F 2 1   ? 123.084 98.489  36.213  1.00 172.81 ? 23  DT  K "O4'" 1 
ATOM 1108 C "C3'" . DT  F 2 1   ? 123.219 100.398 37.604  1.00 171.55 ? 23  DT  K "C3'" 1 
ATOM 1109 O "O3'" . DT  F 2 1   ? 123.436 100.655 38.979  1.00 174.84 ? 23  DT  K "O3'" 1 
ATOM 1110 C "C2'" . DT  F 2 1   ? 124.525 100.228 36.840  1.00 169.05 ? 23  DT  K "C2'" 1 
ATOM 1111 C "C1'" . DT  F 2 1   ? 124.100 99.324  35.687  1.00 168.15 ? 23  DT  K "C1'" 1 
ATOM 1112 N N1    . DT  F 2 1   ? 123.616 100.054 34.446  1.00 166.56 ? 23  DT  K N1    1 
ATOM 1113 C C2    . DT  F 2 1   ? 124.514 100.766 33.672  1.00 164.87 ? 23  DT  K C2    1 
ATOM 1114 O O2    . DT  F 2 1   ? 125.697 100.849 33.921  1.00 169.18 ? 23  DT  K O2    1 
ATOM 1115 N N3    . DT  F 2 1   ? 123.986 101.389 32.572  1.00 162.49 ? 23  DT  K N3    1 
ATOM 1116 C C4    . DT  F 2 1   ? 122.666 101.370 32.167  1.00 166.75 ? 23  DT  K C4    1 
ATOM 1117 O O4    . DT  F 2 1   ? 122.289 101.960 31.162  1.00 168.80 ? 23  DT  K O4    1 
ATOM 1118 C C5    . DT  F 2 1   ? 121.769 100.611 33.005  1.00 167.60 ? 23  DT  K C5    1 
ATOM 1119 C C7    . DT  F 2 1   ? 120.308 100.514 32.674  1.00 167.76 ? 23  DT  K C7    1 
ATOM 1120 C C6    . DT  F 2 1   ? 122.281 100.002 34.083  1.00 167.79 ? 23  DT  K C6    1 
ATOM 1121 P P     . DT  F 2 2   ? 123.787 102.126 39.505  1.00 178.23 ? 24  DT  K P     1 
ATOM 1122 O OP1   . DT  F 2 2   ? 123.356 102.220 40.917  1.00 179.90 ? 24  DT  K OP1   1 
ATOM 1123 O OP2   . DT  F 2 2   ? 123.295 103.121 38.524  1.00 176.67 ? 24  DT  K OP2   1 
ATOM 1124 O "O5'" . DT  F 2 2   ? 125.383 102.105 39.487  1.00 175.49 ? 24  DT  K "O5'" 1 
ATOM 1125 C "C5'" . DT  F 2 2   ? 126.101 103.254 39.903  1.00 174.69 ? 24  DT  K "C5'" 1 
ATOM 1126 C "C4'" . DT  F 2 2   ? 126.593 104.077 38.722  1.00 172.55 ? 24  DT  K "C4'" 1 
ATOM 1127 O "O4'" . DT  F 2 2   ? 125.916 103.706 37.486  1.00 169.82 ? 24  DT  K "O4'" 1 
ATOM 1128 C "C3'" . DT  F 2 2   ? 126.412 105.591 38.881  1.00 169.25 ? 24  DT  K "C3'" 1 
ATOM 1129 O "O3'" . DT  F 2 2   ? 127.680 106.235 38.800  1.00 163.76 ? 24  DT  K "O3'" 1 
ATOM 1130 C "C2'" . DT  F 2 2   ? 125.510 105.954 37.707  1.00 171.65 ? 24  DT  K "C2'" 1 
ATOM 1131 C "C1'" . DT  F 2 2   ? 125.919 104.880 36.713  1.00 170.43 ? 24  DT  K "C1'" 1 
ATOM 1132 N N1    . DT  F 2 2   ? 125.025 104.800 35.529  1.00 170.16 ? 24  DT  K N1    1 
ATOM 1133 C C2    . DT  F 2 2   ? 125.587 105.035 34.289  1.00 172.14 ? 24  DT  K C2    1 
ATOM 1134 O O2    . DT  F 2 2   ? 126.774 105.283 34.126  1.00 171.56 ? 24  DT  K O2    1 
ATOM 1135 N N3    . DT  F 2 2   ? 124.701 104.957 33.240  1.00 171.78 ? 24  DT  K N3    1 
ATOM 1136 C C4    . DT  F 2 2   ? 123.349 104.681 33.318  1.00 170.16 ? 24  DT  K C4    1 
ATOM 1137 O O4    . DT  F 2 2   ? 122.652 104.635 32.315  1.00 171.52 ? 24  DT  K O4    1 
ATOM 1138 C C5    . DT  F 2 2   ? 122.823 104.455 34.646  1.00 170.66 ? 24  DT  K C5    1 
ATOM 1139 C C7    . DT  F 2 2   ? 121.368 104.146 34.855  1.00 171.15 ? 24  DT  K C7    1 
ATOM 1140 C C6    . DT  F 2 2   ? 123.676 104.526 35.677  1.00 169.18 ? 24  DT  K C6    1 
ATOM 1141 P P     . DA  F 2 3   ? 127.874 107.807 38.567  1.00 164.39 ? 25  DA  K P     1 
ATOM 1142 O OP1   . DA  F 2 3   ? 128.781 108.293 39.632  1.00 164.76 ? 25  DA  K OP1   1 
ATOM 1143 O OP2   . DA  F 2 3   ? 126.568 108.475 38.332  1.00 152.81 ? 25  DA  K OP2   1 
ATOM 1144 O "O5'" . DA  F 2 3   ? 128.753 107.811 37.236  1.00 166.66 ? 25  DA  K "O5'" 1 
ATOM 1145 C "C5'" . DA  F 2 3   ? 128.140 107.862 35.962  1.00 170.41 ? 25  DA  K "C5'" 1 
ATOM 1146 C "C4'" . DA  F 2 3   ? 128.712 109.008 35.145  1.00 171.80 ? 25  DA  K "C4'" 1 
ATOM 1147 O "O4'" . DA  F 2 3   ? 127.934 109.212 33.943  1.00 172.02 ? 25  DA  K "O4'" 1 
ATOM 1148 C "C3'" . DA  F 2 3   ? 128.729 110.377 35.807  1.00 172.92 ? 25  DA  K "C3'" 1 
ATOM 1149 O "O3'" . DA  F 2 3   ? 129.841 111.091 35.256  1.00 174.76 ? 25  DA  K "O3'" 1 
ATOM 1150 C "C2'" . DA  F 2 3   ? 127.363 110.959 35.439  1.00 174.52 ? 25  DA  K "C2'" 1 
ATOM 1151 C "C1'" . DA  F 2 3   ? 126.986 110.235 34.149  1.00 176.23 ? 25  DA  K "C1'" 1 
ATOM 1152 N N9    . DA  F 2 3   ? 125.691 109.573 34.213  1.00 178.01 ? 25  DA  K N9    1 
ATOM 1153 C C8    . DA  F 2 3   ? 125.080 109.073 35.330  1.00 179.49 ? 25  DA  K C8    1 
ATOM 1154 N N7    . DA  F 2 3   ? 123.916 108.519 35.098  1.00 182.44 ? 25  DA  K N7    1 
ATOM 1155 C C5    . DA  F 2 3   ? 123.754 108.659 33.732  1.00 180.72 ? 25  DA  K C5    1 
ATOM 1156 C C6    . DA  F 2 3   ? 122.716 108.271 32.866  1.00 178.61 ? 25  DA  K C6    1 
ATOM 1157 N N6    . DA  F 2 3   ? 121.620 107.643 33.296  1.00 178.24 ? 25  DA  K N6    1 
ATOM 1158 N N1    . DA  F 2 3   ? 122.854 108.558 31.551  1.00 179.06 ? 25  DA  K N1    1 
ATOM 1159 C C2    . DA  F 2 3   ? 123.963 109.190 31.137  1.00 179.12 ? 25  DA  K C2    1 
ATOM 1160 N N3    . DA  F 2 3   ? 125.007 109.604 31.860  1.00 179.04 ? 25  DA  K N3    1 
ATOM 1161 C C4    . DA  F 2 3   ? 124.840 109.305 33.163  1.00 180.00 ? 25  DA  K C4    1 
ATOM 1162 P P     . DT  F 2 4   ? 130.020 112.683 35.292  1.00 174.14 ? 26  DT  K P     1 
ATOM 1163 O OP1   . DT  F 2 4   ? 131.465 112.995 35.438  1.00 171.60 ? 26  DT  K OP1   1 
ATOM 1164 O OP2   . DT  F 2 4   ? 129.047 113.242 36.259  1.00 173.37 ? 26  DT  K OP2   1 
ATOM 1165 O "O5'" . DT  F 2 4   ? 129.584 113.072 33.803  1.00 175.31 ? 26  DT  K "O5'" 1 
ATOM 1166 C "C5'" . DT  F 2 4   ? 128.385 113.792 33.580  1.00 175.99 ? 26  DT  K "C5'" 1 
ATOM 1167 C "C4'" . DT  F 2 4   ? 128.011 113.804 32.116  1.00 175.25 ? 26  DT  K "C4'" 1 
ATOM 1168 O "O4'" . DT  F 2 4   ? 126.997 112.794 31.896  1.00 177.88 ? 26  DT  K "O4'" 1 
ATOM 1169 C "C3'" . DT  F 2 4   ? 127.430 115.141 31.686  1.00 173.63 ? 26  DT  K "C3'" 1 
ATOM 1170 O "O3'" . DT  F 2 4   ? 128.031 115.628 30.502  1.00 169.19 ? 26  DT  K "O3'" 1 
ATOM 1171 C "C2'" . DT  F 2 4   ? 125.951 114.874 31.465  1.00 178.31 ? 26  DT  K "C2'" 1 
ATOM 1172 C "C1'" . DT  F 2 4   ? 125.848 113.367 31.305  1.00 182.86 ? 26  DT  K "C1'" 1 
ATOM 1173 N N1    . DT  F 2 4   ? 124.600 112.832 31.946  1.00 184.92 ? 26  DT  K N1    1 
ATOM 1174 C C2    . DT  F 2 4   ? 123.547 112.443 31.139  1.00 185.28 ? 26  DT  K C2    1 
ATOM 1175 O O2    . DT  F 2 4   ? 123.578 112.491 29.922  1.00 185.83 ? 26  DT  K O2    1 
ATOM 1176 N N3    . DT  F 2 4   ? 122.445 111.973 31.815  1.00 185.90 ? 26  DT  K N3    1 
ATOM 1177 C C4    . DT  F 2 4   ? 122.287 111.863 33.187  1.00 185.20 ? 26  DT  K C4    1 
ATOM 1178 O O4    . DT  F 2 4   ? 121.255 111.428 33.690  1.00 184.61 ? 26  DT  K O4    1 
ATOM 1179 C C5    . DT  F 2 4   ? 123.421 112.295 33.974  1.00 186.46 ? 26  DT  K C5    1 
ATOM 1180 C C7    . DT  F 2 4   ? 123.377 112.228 35.472  1.00 186.07 ? 26  DT  K C7    1 
ATOM 1181 C C6    . DT  F 2 4   ? 124.504 112.756 33.327  1.00 186.72 ? 26  DT  K C6    1 
ATOM 1182 P P     . DC  F 2 5   ? 127.845 117.175 30.156  1.00 166.87 ? 27  DC  K P     1 
ATOM 1183 O OP1   . DC  F 2 5   ? 128.908 117.551 29.194  1.00 166.99 ? 27  DC  K OP1   1 
ATOM 1184 O OP2   . DC  F 2 5   ? 127.718 117.907 31.436  1.00 164.30 ? 27  DC  K OP2   1 
ATOM 1185 O "O5'" . DC  F 2 5   ? 126.418 117.209 29.427  1.00 165.11 ? 27  DC  K "O5'" 1 
ATOM 1186 C "C5'" . DC  F 2 5   ? 126.292 117.330 28.017  1.00 168.96 ? 27  DC  K "C5'" 1 
ATOM 1187 C "C4'" . DC  F 2 5   ? 125.046 116.619 27.517  1.00 174.96 ? 27  DC  K "C4'" 1 
ATOM 1188 O "O4'" . DC  F 2 5   ? 124.556 115.697 28.520  1.00 176.57 ? 27  DC  K "O4'" 1 
ATOM 1189 C "C3'" . DC  F 2 5   ? 123.848 117.511 27.231  1.00 178.18 ? 27  DC  K "C3'" 1 
ATOM 1190 O "O3'" . DC  F 2 5   ? 123.947 118.080 25.928  1.00 183.77 ? 27  DC  K "O3'" 1 
ATOM 1191 C "C2'" . DC  F 2 5   ? 122.693 116.519 27.304  1.00 176.49 ? 27  DC  K "C2'" 1 
ATOM 1192 C "C1'" . DC  F 2 5   ? 123.161 115.509 28.348  1.00 178.17 ? 27  DC  K "C1'" 1 
ATOM 1193 N N1    . DC  F 2 5   ? 122.457 115.596 29.683  1.00 179.23 ? 27  DC  K N1    1 
ATOM 1194 C C2    . DC  F 2 5   ? 121.147 115.108 29.855  1.00 179.84 ? 27  DC  K C2    1 
ATOM 1195 O O2    . DC  F 2 5   ? 120.541 114.600 28.903  1.00 180.89 ? 27  DC  K O2    1 
ATOM 1196 N N3    . DC  F 2 5   ? 120.564 115.208 31.082  1.00 180.60 ? 27  DC  K N3    1 
ATOM 1197 C C4    . DC  F 2 5   ? 121.225 115.757 32.107  1.00 180.36 ? 27  DC  K C4    1 
ATOM 1198 N N4    . DC  F 2 5   ? 120.614 115.834 33.293  1.00 179.99 ? 27  DC  K N4    1 
ATOM 1199 C C5    . DC  F 2 5   ? 122.551 116.257 31.959  1.00 182.17 ? 27  DC  K C5    1 
ATOM 1200 C C6    . DC  F 2 5   ? 123.112 116.156 30.746  1.00 182.66 ? 27  DC  K C6    1 
ATOM 1201 P P     . DG  F 2 6   ? 123.456 119.577 25.626  1.00 189.38 ? 28  DG  K P     1 
ATOM 1202 O OP1   . DG  F 2 6   ? 124.574 120.287 24.961  1.00 190.12 ? 28  DG  K OP1   1 
ATOM 1203 O OP2   . DG  F 2 6   ? 122.871 120.156 26.859  1.00 190.08 ? 28  DG  K OP2   1 
ATOM 1204 O "O5'" . DG  F 2 6   ? 122.304 119.345 24.534  1.00 190.77 ? 28  DG  K "O5'" 1 
ATOM 1205 C "C5'" . DG  F 2 6   ? 121.033 119.994 24.638  1.00 192.45 ? 28  DG  K "C5'" 1 
ATOM 1206 C "C4'" . DG  F 2 6   ? 119.951 119.002 25.025  1.00 193.43 ? 28  DG  K "C4'" 1 
ATOM 1207 O "O4'" . DG  F 2 6   ? 120.384 118.234 26.171  1.00 194.60 ? 28  DG  K "O4'" 1 
ATOM 1208 C "C3'" . DG  F 2 6   ? 118.645 119.607 25.505  1.00 193.24 ? 28  DG  K "C3'" 1 
ATOM 1209 O "O3'" . DG  F 2 6   ? 117.851 119.997 24.403  1.00 193.39 ? 28  DG  K "O3'" 1 
ATOM 1210 C "C2'" . DG  F 2 6   ? 118.025 118.430 26.247  1.00 194.09 ? 28  DG  K "C2'" 1 
ATOM 1211 C "C1'" . DG  F 2 6   ? 119.250 117.810 26.911  1.00 193.38 ? 28  DG  K "C1'" 1 
ATOM 1212 N N9    . DG  F 2 6   ? 119.436 118.133 28.332  1.00 193.02 ? 28  DG  K N9    1 
ATOM 1213 C C8    . DG  F 2 6   ? 120.416 118.928 28.882  1.00 191.59 ? 28  DG  K C8    1 
ATOM 1214 N N7    . DG  F 2 6   ? 120.346 119.027 30.179  1.00 190.80 ? 28  DG  K N7    1 
ATOM 1215 C C5    . DG  F 2 6   ? 119.252 118.246 30.521  1.00 191.23 ? 28  DG  K C5    1 
ATOM 1216 C C6    . DG  F 2 6   ? 118.685 117.970 31.791  1.00 191.65 ? 28  DG  K C6    1 
ATOM 1217 O O6    . DG  F 2 6   ? 119.054 118.374 32.897  1.00 192.72 ? 28  DG  K O6    1 
ATOM 1218 N N1    . DG  F 2 6   ? 117.578 117.130 31.713  1.00 191.61 ? 28  DG  K N1    1 
ATOM 1219 C C2    . DG  F 2 6   ? 117.078 116.618 30.541  1.00 191.68 ? 28  DG  K C2    1 
ATOM 1220 N N2    . DG  F 2 6   ? 116.003 115.830 30.661  1.00 192.52 ? 28  DG  K N2    1 
ATOM 1221 N N3    . DG  F 2 6   ? 117.595 116.864 29.340  1.00 192.08 ? 28  DG  K N3    1 
ATOM 1222 C C4    . DG  F 2 6   ? 118.680 117.685 29.399  1.00 192.43 ? 28  DG  K C4    1 
ATOM 1223 P P     . DG  F 2 7   ? 117.541 121.543 24.140  1.00 194.91 ? 29  DG  K P     1 
ATOM 1224 O OP1   . DG  F 2 7   ? 117.398 121.703 22.676  1.00 196.78 ? 29  DG  K OP1   1 
ATOM 1225 O OP2   . DG  F 2 7   ? 118.535 122.366 24.867  1.00 194.03 ? 29  DG  K OP2   1 
ATOM 1226 O "O5'" . DG  F 2 7   ? 116.088 121.743 24.786  1.00 195.38 ? 29  DG  K "O5'" 1 
ATOM 1227 C "C5'" . DG  F 2 7   ? 115.907 122.001 26.177  1.00 193.60 ? 29  DG  K "C5'" 1 
ATOM 1228 C "C4'" . DG  F 2 7   ? 115.106 120.880 26.811  1.00 192.98 ? 29  DG  K "C4'" 1 
ATOM 1229 O "O4'" . DG  F 2 7   ? 115.980 120.086 27.647  1.00 193.40 ? 29  DG  K "O4'" 1 
ATOM 1230 C "C3'" . DG  F 2 7   ? 113.961 121.332 27.704  1.00 191.38 ? 29  DG  K "C3'" 1 
ATOM 1231 O "O3'" . DG  F 2 7   ? 112.765 121.305 26.939  1.00 186.81 ? 29  DG  K "O3'" 1 
ATOM 1232 C "C2'" . DG  F 2 7   ? 113.928 120.283 28.812  1.00 192.60 ? 29  DG  K "C2'" 1 
ATOM 1233 C "C1'" . DG  F 2 7   ? 115.370 119.792 28.887  1.00 192.33 ? 29  DG  K "C1'" 1 
ATOM 1234 N N9    . DG  F 2 7   ? 116.175 120.408 29.942  1.00 191.87 ? 29  DG  K N9    1 
ATOM 1235 C C8    . DG  F 2 7   ? 117.138 121.374 29.774  1.00 191.93 ? 29  DG  K C8    1 
ATOM 1236 N N7    . DG  F 2 7   ? 117.711 121.744 30.882  1.00 192.47 ? 29  DG  K N7    1 
ATOM 1237 C C5    . DG  F 2 7   ? 117.090 120.972 31.853  1.00 192.19 ? 29  DG  K C5    1 
ATOM 1238 C C6    . DG  F 2 7   ? 117.303 120.936 33.254  1.00 192.28 ? 29  DG  K C6    1 
ATOM 1239 O O6    . DG  F 2 7   ? 118.102 121.610 33.920  1.00 191.60 ? 29  DG  K O6    1 
ATOM 1240 N N1    . DG  F 2 7   ? 116.466 120.014 33.886  1.00 191.92 ? 29  DG  K N1    1 
ATOM 1241 C C2    . DG  F 2 7   ? 115.544 119.223 33.240  1.00 191.54 ? 29  DG  K C2    1 
ATOM 1242 N N2    . DG  F 2 7   ? 114.833 118.393 34.013  1.00 191.54 ? 29  DG  K N2    1 
ATOM 1243 N N3    . DG  F 2 7   ? 115.338 119.245 31.926  1.00 191.34 ? 29  DG  K N3    1 
ATOM 1244 C C4    . DG  F 2 7   ? 116.141 120.141 31.294  1.00 191.74 ? 29  DG  K C4    1 
ATOM 1245 P P     . DA  F 2 8   ? 111.758 122.545 26.928  1.00 182.32 ? 30  DA  K P     1 
ATOM 1246 O OP1   . DA  F 2 8   ? 111.003 122.472 25.660  1.00 183.39 ? 30  DA  K OP1   1 
ATOM 1247 O OP2   . DA  F 2 8   ? 112.504 123.779 27.263  1.00 181.99 ? 30  DA  K OP2   1 
ATOM 1248 O "O5'" . DA  F 2 8   ? 110.757 122.203 28.130  1.00 182.79 ? 30  DA  K "O5'" 1 
ATOM 1249 C "C5'" . DA  F 2 8   ? 110.072 120.953 28.191  1.00 184.27 ? 30  DA  K "C5'" 1 
ATOM 1250 C "C4'" . DA  F 2 8   ? 109.803 120.553 29.634  1.00 186.92 ? 30  DA  K "C4'" 1 
ATOM 1251 O "O4'" . DA  F 2 8   ? 111.055 120.528 30.368  1.00 189.69 ? 30  DA  K "O4'" 1 
ATOM 1252 C "C3'" . DA  F 2 8   ? 108.866 121.481 30.405  1.00 188.14 ? 30  DA  K "C3'" 1 
ATOM 1253 O "O3'" . DA  F 2 8   ? 107.925 120.728 31.160  1.00 188.72 ? 30  DA  K "O3'" 1 
ATOM 1254 C "C2'" . DA  F 2 8   ? 109.800 122.247 31.332  1.00 190.20 ? 30  DA  K "C2'" 1 
ATOM 1255 C "C1'" . DA  F 2 8   ? 110.904 121.231 31.583  1.00 193.70 ? 30  DA  K "C1'" 1 
ATOM 1256 N N9    . DA  F 2 8   ? 112.153 121.889 31.965  1.00 195.45 ? 30  DA  K N9    1 
ATOM 1257 C C8    . DA  F 2 8   ? 112.922 122.720 31.195  1.00 195.66 ? 30  DA  K C8    1 
ATOM 1258 N N7    . DA  F 2 8   ? 113.987 123.180 31.805  1.00 195.35 ? 30  DA  K N7    1 
ATOM 1259 C C5    . DA  F 2 8   ? 113.910 122.620 33.068  1.00 195.22 ? 30  DA  K C5    1 
ATOM 1260 C C6    . DA  F 2 8   ? 114.741 122.718 34.205  1.00 195.31 ? 30  DA  K C6    1 
ATOM 1261 N N6    . DA  F 2 8   ? 115.860 123.450 34.233  1.00 195.62 ? 30  DA  K N6    1 
ATOM 1262 N N1    . DA  F 2 8   ? 114.383 122.028 35.312  1.00 195.54 ? 30  DA  K N1    1 
ATOM 1263 C C2    . DA  F 2 8   ? 113.262 121.293 35.285  1.00 195.48 ? 30  DA  K C2    1 
ATOM 1264 N N3    . DA  F 2 8   ? 112.401 121.128 34.277  1.00 196.57 ? 30  DA  K N3    1 
ATOM 1265 C C4    . DA  F 2 8   ? 112.784 121.823 33.188  1.00 195.73 ? 30  DA  K C4    1 
ATOM 1266 P P     . DC  F 2 9   ? 106.527 121.362 31.616  1.00 189.30 ? 31  DC  K P     1 
ATOM 1267 O OP1   . DC  F 2 9   ? 105.978 120.468 32.663  1.00 189.73 ? 31  DC  K OP1   1 
ATOM 1268 O OP2   . DC  F 2 9   ? 105.734 121.643 30.399  1.00 190.20 ? 31  DC  K OP2   1 
ATOM 1269 O "O5'" . DC  F 2 9   ? 106.930 122.760 32.283  1.00 188.54 ? 31  DC  K "O5'" 1 
ATOM 1270 C "C5'" . DC  F 2 9   ? 106.158 123.331 33.329  1.00 189.14 ? 31  DC  K "C5'" 1 
ATOM 1271 C "C4'" . DC  F 2 9   ? 106.682 122.905 34.690  1.00 189.13 ? 31  DC  K "C4'" 1 
ATOM 1272 O "O4'" . DC  F 2 9   ? 108.045 122.404 34.592  1.00 187.95 ? 31  DC  K "O4'" 1 
ATOM 1273 C "C3'" . DC  F 2 9   ? 106.783 124.020 35.718  1.00 189.62 ? 31  DC  K "C3'" 1 
ATOM 1274 O "O3'" . DC  F 2 9   ? 105.480 124.427 36.209  1.00 189.76 ? 31  DC  K "O3'" 1 
ATOM 1275 C "C2'" . DC  F 2 9   ? 107.737 123.379 36.724  1.00 188.81 ? 31  DC  K "C2'" 1 
ATOM 1276 C "C1'" . DC  F 2 9   ? 108.750 122.721 35.784  1.00 188.04 ? 31  DC  K "C1'" 1 
ATOM 1277 N N1    . DC  F 2 9   ? 109.962 123.589 35.495  1.00 188.27 ? 31  DC  K N1    1 
ATOM 1278 C C2    . DC  F 2 9   ? 111.029 123.651 36.417  1.00 189.17 ? 31  DC  K C2    1 
ATOM 1279 O O2    . DC  F 2 9   ? 110.987 122.990 37.464  1.00 189.28 ? 31  DC  K O2    1 
ATOM 1280 N N3    . DC  F 2 9   ? 112.103 124.442 36.136  1.00 188.36 ? 31  DC  K N3    1 
ATOM 1281 C C4    . DC  F 2 9   ? 112.146 125.153 35.004  1.00 187.82 ? 31  DC  K C4    1 
ATOM 1282 N N4    . DC  F 2 9   ? 113.222 125.913 34.776  1.00 187.08 ? 31  DC  K N4    1 
ATOM 1283 C C5    . DC  F 2 9   ? 111.079 125.110 34.055  1.00 188.34 ? 31  DC  K C5    1 
ATOM 1284 C C6    . DC  F 2 9   ? 110.026 124.328 34.340  1.00 188.15 ? 31  DC  K C6    1 
ATOM 1285 P P     . DA  F 2 10  ? 104.625 123.713 37.368  1.00 190.03 ? 32  DA  K P     1 
ATOM 1286 O OP1   . DA  F 2 10  ? 104.908 122.257 37.386  1.00 190.52 ? 32  DA  K OP1   1 
ATOM 1287 O OP2   . DA  F 2 10  ? 103.225 124.166 37.204  1.00 190.04 ? 32  DA  K OP2   1 
ATOM 1288 O "O5'" . DA  F 2 10  ? 105.219 124.388 38.692  1.00 186.62 ? 32  DA  K "O5'" 1 
ATOM 1289 C "C5'" . DA  F 2 10  ? 105.424 123.631 39.881  1.00 182.81 ? 32  DA  K "C5'" 1 
ATOM 1290 C "C4'" . DA  F 2 10  ? 106.552 124.227 40.702  1.00 180.43 ? 32  DA  K "C4'" 1 
ATOM 1291 O "O4'" . DA  F 2 10  ? 107.676 124.511 39.839  1.00 178.64 ? 32  DA  K "O4'" 1 
ATOM 1292 C "C3'" . DA  F 2 10  ? 106.210 125.542 41.390  1.00 180.57 ? 32  DA  K "C3'" 1 
ATOM 1293 O "O3'" . DA  F 2 10  ? 105.964 125.273 42.770  1.00 183.21 ? 32  DA  K "O3'" 1 
ATOM 1294 C "C2'" . DA  F 2 10  ? 107.428 126.445 41.169  1.00 178.63 ? 32  DA  K "C2'" 1 
ATOM 1295 C "C1'" . DA  F 2 10  ? 108.407 125.606 40.352  1.00 176.07 ? 32  DA  K "C1'" 1 
ATOM 1296 N N9    . DA  F 2 10  ? 109.014 126.309 39.218  1.00 175.48 ? 32  DA  K N9    1 
ATOM 1297 C C8    . DA  F 2 10  ? 108.406 126.619 38.032  1.00 175.32 ? 32  DA  K C8    1 
ATOM 1298 N N7    . DA  F 2 10  ? 109.178 127.247 37.178  1.00 175.22 ? 32  DA  K N7    1 
ATOM 1299 C C5    . DA  F 2 10  ? 110.383 127.359 37.844  1.00 173.81 ? 32  DA  K C5    1 
ATOM 1300 C C6    . DA  F 2 10  ? 111.616 127.931 37.471  1.00 173.44 ? 32  DA  K C6    1 
ATOM 1301 N N6    . DA  F 2 10  ? 111.826 128.514 36.288  1.00 173.64 ? 32  DA  K N6    1 
ATOM 1302 N N1    . DA  F 2 10  ? 112.627 127.878 38.365  1.00 174.67 ? 32  DA  K N1    1 
ATOM 1303 C C2    . DA  F 2 10  ? 112.411 127.290 39.552  1.00 175.10 ? 32  DA  K C2    1 
ATOM 1304 N N3    . DA  F 2 10  ? 111.294 126.720 40.014  1.00 174.40 ? 32  DA  K N3    1 
ATOM 1305 C C4    . DA  F 2 10  ? 110.304 126.785 39.104  1.00 174.49 ? 32  DA  K C4    1 
ATOM 1306 P P     . DC  F 2 11  ? 105.453 126.396 43.794  1.00 185.52 ? 33  DC  K P     1 
ATOM 1307 O OP1   . DC  F 2 11  ? 104.692 125.707 44.860  1.00 185.35 ? 33  DC  K OP1   1 
ATOM 1308 O OP2   . DC  F 2 11  ? 104.800 127.491 43.036  1.00 184.74 ? 33  DC  K OP2   1 
ATOM 1309 O "O5'" . DC  F 2 11  ? 106.841 126.897 44.425  1.00 184.77 ? 33  DC  K "O5'" 1 
ATOM 1310 C "C5'" . DC  F 2 11  ? 107.020 128.237 44.882  1.00 185.18 ? 33  DC  K "C5'" 1 
ATOM 1311 C "C4'" . DC  F 2 11  ? 108.479 128.650 44.790  1.00 184.90 ? 33  DC  K "C4'" 1 
ATOM 1312 O "O4'" . DC  F 2 11  ? 108.934 128.489 43.425  1.00 184.45 ? 33  DC  K "O4'" 1 
ATOM 1313 C "C3'" . DC  F 2 11  ? 108.766 130.105 45.145  1.00 184.60 ? 33  DC  K "C3'" 1 
ATOM 1314 O "O3'" . DC  F 2 11  ? 109.120 130.215 46.528  1.00 184.45 ? 33  DC  K "O3'" 1 
ATOM 1315 C "C2'" . DC  F 2 11  ? 109.938 130.491 44.240  1.00 184.02 ? 33  DC  K "C2'" 1 
ATOM 1316 C "C1'" . DC  F 2 11  ? 109.986 129.399 43.171  1.00 184.55 ? 33  DC  K "C1'" 1 
ATOM 1317 N N1    . DC  F 2 11  ? 109.875 129.938 41.773  1.00 184.69 ? 33  DC  K N1    1 
ATOM 1318 C C2    . DC  F 2 11  ? 111.040 130.201 41.033  1.00 185.81 ? 33  DC  K C2    1 
ATOM 1319 O O2    . DC  F 2 11  ? 112.153 129.984 41.531  1.00 186.94 ? 33  DC  K O2    1 
ATOM 1320 N N3    . DC  F 2 11  ? 110.920 130.692 39.771  1.00 185.88 ? 33  DC  K N3    1 
ATOM 1321 C C4    . DC  F 2 11  ? 109.711 130.920 39.249  1.00 184.89 ? 33  DC  K C4    1 
ATOM 1322 N N4    . DC  F 2 11  ? 109.648 131.404 38.005  1.00 185.45 ? 33  DC  K N4    1 
ATOM 1323 C C5    . DC  F 2 11  ? 108.514 130.663 39.982  1.00 185.02 ? 33  DC  K C5    1 
ATOM 1324 C C6    . DC  F 2 11  ? 108.643 130.180 41.225  1.00 184.49 ? 33  DC  K C6    1 
ATOM 1325 P P     . DT  F 2 12  ? 109.186 131.628 47.285  1.00 184.97 ? 34  DT  K P     1 
ATOM 1326 O OP1   . DT  F 2 12  ? 108.981 131.360 48.726  1.00 185.24 ? 34  DT  K OP1   1 
ATOM 1327 O OP2   . DT  F 2 12  ? 108.286 132.577 46.589  1.00 185.65 ? 34  DT  K OP2   1 
ATOM 1328 O "O5'" . DT  F 2 12  ? 110.711 132.086 47.076  1.00 183.83 ? 34  DT  K "O5'" 1 
ATOM 1329 C "C5'" . DT  F 2 12  ? 111.189 133.360 47.532  1.00 181.50 ? 34  DT  K "C5'" 1 
ATOM 1330 C "C4'" . DT  F 2 12  ? 112.376 133.827 46.703  1.00 179.81 ? 34  DT  K "C4'" 1 
ATOM 1331 O "O4'" . DT  F 2 12  ? 112.133 133.470 45.321  1.00 179.45 ? 34  DT  K "O4'" 1 
ATOM 1332 C "C3'" . DT  F 2 12  ? 112.626 135.332 46.709  1.00 179.72 ? 34  DT  K "C3'" 1 
ATOM 1333 O "O3'" . DT  F 2 12  ? 113.607 135.666 47.687  1.00 177.12 ? 34  DT  K "O3'" 1 
ATOM 1334 C "C2'" . DT  F 2 12  ? 113.128 135.642 45.298  1.00 180.80 ? 34  DT  K "C2'" 1 
ATOM 1335 C "C1'" . DT  F 2 12  ? 112.688 134.438 44.455  1.00 182.19 ? 34  DT  K "C1'" 1 
ATOM 1336 N N1    . DT  F 2 12  ? 111.694 134.734 43.344  1.00 183.38 ? 34  DT  K N1    1 
ATOM 1337 C C2    . DT  F 2 12  ? 111.963 134.291 42.059  1.00 183.07 ? 34  DT  K C2    1 
ATOM 1338 O O2    . DT  F 2 12  ? 112.964 133.668 41.754  1.00 182.87 ? 34  DT  K O2    1 
ATOM 1339 N N3    . DT  F 2 12  ? 111.004 134.608 41.122  1.00 183.63 ? 34  DT  K N3    1 
ATOM 1340 C C4    . DT  F 2 12  ? 109.824 135.308 41.329  1.00 183.77 ? 34  DT  K C4    1 
ATOM 1341 O O4    . DT  F 2 12  ? 109.035 135.537 40.413  1.00 183.10 ? 34  DT  K O4    1 
ATOM 1342 C C5    . DT  F 2 12  ? 109.596 135.745 42.691  1.00 183.98 ? 34  DT  K C5    1 
ATOM 1343 C C7    . DT  F 2 12  ? 108.356 136.514 43.055  1.00 182.07 ? 34  DT  K C7    1 
ATOM 1344 C C6    . DT  F 2 12  ? 110.527 135.438 43.614  1.00 184.87 ? 34  DT  K C6    1 
ATOM 1345 N N     . MET G 3 1   ? 100.671 80.983  46.432  1.00 157.24 ? 1   MET A N     1 
ATOM 1346 C CA    . MET G 3 1   ? 100.099 79.847  47.212  1.00 159.68 ? 1   MET A CA    1 
ATOM 1347 C C     . MET G 3 1   ? 98.563  79.782  47.186  1.00 160.52 ? 1   MET A C     1 
ATOM 1348 O O     . MET G 3 1   ? 98.002  78.692  46.918  1.00 160.59 ? 1   MET A O     1 
ATOM 1349 C CB    . MET G 3 1   ? 100.644 79.817  48.665  1.00 162.11 ? 1   MET A CB    1 
ATOM 1350 C CG    . MET G 3 1   ? 100.677 81.166  49.438  1.00 163.62 ? 1   MET A CG    1 
ATOM 1351 S SD    . MET G 3 1   ? 99.224  81.558  50.486  1.00 162.27 ? 1   MET A SD    1 
ATOM 1352 C CE    . MET G 3 1   ? 99.876  82.993  51.408  1.00 160.34 ? 1   MET A CE    1 
ATOM 1353 N N     . ALA G 3 2   ? 97.904  80.942  47.436  1.00 161.21 ? 2   ALA A N     1 
ATOM 1354 C CA    . ALA G 3 2   ? 96.446  81.018  47.665  1.00 161.51 ? 2   ALA A CA    1 
ATOM 1355 C C     . ALA G 3 2   ? 95.629  80.501  46.487  1.00 164.55 ? 2   ALA A C     1 
ATOM 1356 O O     . ALA G 3 2   ? 95.095  81.294  45.714  1.00 166.79 ? 2   ALA A O     1 
ATOM 1357 C CB    . ALA G 3 2   ? 96.043  82.455  48.003  1.00 160.89 ? 2   ALA A CB    1 
ATOM 1358 N N     . LEU G 3 3   ? 95.505  79.172  46.396  1.00 167.79 ? 3   LEU A N     1 
ATOM 1359 C CA    . LEU G 3 3   ? 95.149  78.449  45.149  1.00 168.04 ? 3   LEU A CA    1 
ATOM 1360 C C     . LEU G 3 3   ? 93.841  78.845  44.463  1.00 167.95 ? 3   LEU A C     1 
ATOM 1361 O O     . LEU G 3 3   ? 92.828  79.085  45.126  1.00 171.86 ? 3   LEU A O     1 
ATOM 1362 C CB    . LEU G 3 3   ? 95.148  76.933  45.375  1.00 167.58 ? 3   LEU A CB    1 
ATOM 1363 C CG    . LEU G 3 3   ? 96.475  76.199  45.564  1.00 170.11 ? 3   LEU A CG    1 
ATOM 1364 C CD1   . LEU G 3 3   ? 96.788  75.987  47.045  1.00 173.39 ? 3   LEU A CD1   1 
ATOM 1365 C CD2   . LEU G 3 3   ? 96.415  74.862  44.854  1.00 173.00 ? 3   LEU A CD2   1 
ATOM 1366 N N     . PHE G 3 4   ? 93.880  78.897  43.132  1.00 164.78 ? 4   PHE A N     1 
ATOM 1367 C CA    . PHE G 3 4   ? 92.686  79.100  42.312  1.00 166.35 ? 4   PHE A CA    1 
ATOM 1368 C C     . PHE G 3 4   ? 92.383  77.871  41.461  1.00 170.42 ? 4   PHE A C     1 
ATOM 1369 O O     . PHE G 3 4   ? 93.160  76.908  41.440  1.00 169.96 ? 4   PHE A O     1 
ATOM 1370 C CB    . PHE G 3 4   ? 92.839  80.320  41.404  1.00 164.87 ? 4   PHE A CB    1 
ATOM 1371 C CG    . PHE G 3 4   ? 92.748  81.623  42.125  1.00 165.35 ? 4   PHE A CG    1 
ATOM 1372 C CD1   . PHE G 3 4   ? 93.862  82.444  42.243  1.00 166.58 ? 4   PHE A CD1   1 
ATOM 1373 C CD2   . PHE G 3 4   ? 91.549  82.033  42.694  1.00 167.88 ? 4   PHE A CD2   1 
ATOM 1374 C CE1   . PHE G 3 4   ? 93.781  83.662  42.916  1.00 169.27 ? 4   PHE A CE1   1 
ATOM 1375 C CE2   . PHE G 3 4   ? 91.458  83.245  43.377  1.00 168.80 ? 4   PHE A CE2   1 
ATOM 1376 C CZ    . PHE G 3 4   ? 92.577  84.062  43.486  1.00 168.37 ? 4   PHE A CZ    1 
ATOM 1377 N N     . GLY G 3 5   ? 91.250  77.910  40.761  1.00 174.16 ? 5   GLY A N     1 
ATOM 1378 C CA    . GLY G 3 5   ? 90.858  76.813  39.873  1.00 176.87 ? 5   GLY A CA    1 
ATOM 1379 C C     . GLY G 3 5   ? 90.151  77.263  38.608  1.00 177.23 ? 5   GLY A C     1 
ATOM 1380 O O     . GLY G 3 5   ? 89.278  78.147  38.650  1.00 175.57 ? 5   GLY A O     1 
ATOM 1381 N N     . TYR G 3 6   ? 90.521  76.648  37.483  1.00 175.85 ? 6   TYR A N     1 
ATOM 1382 C CA    . TYR G 3 6   ? 89.910  76.993  36.198  1.00 176.58 ? 6   TYR A CA    1 
ATOM 1383 C C     . TYR G 3 6   ? 89.650  75.814  35.256  1.00 177.92 ? 6   TYR A C     1 
ATOM 1384 O O     . TYR G 3 6   ? 90.550  75.024  34.965  1.00 181.74 ? 6   TYR A O     1 
ATOM 1385 C CB    . TYR G 3 6   ? 90.742  78.048  35.470  1.00 174.25 ? 6   TYR A CB    1 
ATOM 1386 C CG    . TYR G 3 6   ? 90.256  78.297  34.069  1.00 170.14 ? 6   TYR A CG    1 
ATOM 1387 C CD1   . TYR G 3 6   ? 89.081  79.001  33.840  1.00 166.27 ? 6   TYR A CD1   1 
ATOM 1388 C CD2   . TYR G 3 6   ? 90.957  77.804  32.970  1.00 174.25 ? 6   TYR A CD2   1 
ATOM 1389 C CE1   . TYR G 3 6   ? 88.621  79.223  32.557  1.00 169.54 ? 6   TYR A CE1   1 
ATOM 1390 C CE2   . TYR G 3 6   ? 90.503  78.022  31.674  1.00 174.12 ? 6   TYR A CE2   1 
ATOM 1391 C CZ    . TYR G 3 6   ? 89.333  78.732  31.478  1.00 171.58 ? 6   TYR A CZ    1 
ATOM 1392 O OH    . TYR G 3 6   ? 88.876  78.956  30.201  1.00 172.96 ? 6   TYR A OH    1 
ATOM 1393 N N     . ALA G 3 7   ? 88.422  75.734  34.747  1.00 176.34 ? 7   ALA A N     1 
ATOM 1394 C CA    . ALA G 3 7   ? 88.048  74.707  33.769  1.00 174.63 ? 7   ALA A CA    1 
ATOM 1395 C C     . ALA G 3 7   ? 87.110  75.248  32.674  1.00 172.64 ? 7   ALA A C     1 
ATOM 1396 O O     . ALA G 3 7   ? 86.598  76.368  32.772  1.00 173.12 ? 7   ALA A O     1 
ATOM 1397 C CB    . ALA G 3 7   ? 87.434  73.504  34.476  1.00 173.93 ? 7   ALA A CB    1 
ATOM 1398 N N     . ARG G 3 8   ? 86.892  74.447  31.635  1.00 169.90 ? 8   ARG A N     1 
ATOM 1399 C CA    . ARG G 3 8   ? 86.092  74.872  30.488  1.00 169.12 ? 8   ARG A CA    1 
ATOM 1400 C C     . ARG G 3 8   ? 85.460  73.681  29.775  1.00 168.08 ? 8   ARG A C     1 
ATOM 1401 O O     . ARG G 3 8   ? 85.862  72.538  29.989  1.00 170.07 ? 8   ARG A O     1 
ATOM 1402 C CB    . ARG G 3 8   ? 86.973  75.655  29.506  1.00 171.66 ? 8   ARG A CB    1 
ATOM 1403 C CG    . ARG G 3 8   ? 86.232  76.241  28.297  1.00 172.41 ? 8   ARG A CG    1 
ATOM 1404 C CD    . ARG G 3 8   ? 87.192  76.776  27.258  1.00 166.74 ? 8   ARG A CD    1 
ATOM 1405 N NE    . ARG G 3 8   ? 88.100  75.731  26.810  1.00 158.29 ? 8   ARG A NE    1 
ATOM 1406 C CZ    . ARG G 3 8   ? 89.304  75.958  26.304  1.00 161.19 ? 8   ARG A CZ    1 
ATOM 1407 N NH1   . ARG G 3 8   ? 89.754  77.202  26.179  1.00 164.73 ? 8   ARG A NH1   1 
ATOM 1408 N NH2   . ARG G 3 8   ? 90.061  74.939  25.929  1.00 162.23 ? 8   ARG A NH2   1 
ATOM 1409 N N     . VAL G 3 9   ? 84.469  73.956  28.931  1.00 164.16 ? 9   VAL A N     1 
ATOM 1410 C CA    . VAL G 3 9   ? 83.897  72.945  28.055  1.00 162.97 ? 9   VAL A CA    1 
ATOM 1411 C C     . VAL G 3 9   ? 83.569  73.574  26.695  1.00 162.30 ? 9   VAL A C     1 
ATOM 1412 O O     . VAL G 3 9   ? 83.506  74.798  26.579  1.00 162.51 ? 9   VAL A O     1 
ATOM 1413 C CB    . VAL G 3 9   ? 82.662  72.278  28.705  1.00 162.64 ? 9   VAL A CB    1 
ATOM 1414 C CG1   . VAL G 3 9   ? 81.385  73.063  28.404  1.00 166.07 ? 9   VAL A CG1   1 
ATOM 1415 C CG2   . VAL G 3 9   ? 82.539  70.826  28.258  1.00 164.07 ? 9   VAL A CG2   1 
ATOM 1416 N N     . SER G 3 10  ? 83.375  72.745  25.671  1.00 161.49 ? 10  SER A N     1 
ATOM 1417 C CA    . SER G 3 10  ? 83.074  73.257  24.333  1.00 160.89 ? 10  SER A CA    1 
ATOM 1418 C C     . SER G 3 10  ? 82.102  72.422  23.479  1.00 163.62 ? 10  SER A C     1 
ATOM 1419 O O     . SER G 3 10  ? 81.506  72.940  22.531  1.00 163.41 ? 10  SER A O     1 
ATOM 1420 C CB    . SER G 3 10  ? 84.370  73.561  23.569  1.00 158.88 ? 10  SER A CB    1 
ATOM 1421 O OG    . SER G 3 10  ? 85.398  72.621  23.852  1.00 151.37 ? 10  SER A OG    1 
ATOM 1422 N N     . THR G 3 11  ? 81.933  71.146  23.820  1.00 166.26 ? 11  THR A N     1 
ATOM 1423 C CA    . THR G 3 11  ? 81.072  70.242  23.049  1.00 168.31 ? 11  THR A CA    1 
ATOM 1424 C C     . THR G 3 11  ? 79.680  70.141  23.668  1.00 170.02 ? 11  THR A C     1 
ATOM 1425 O O     . THR G 3 11  ? 79.420  70.719  24.727  1.00 169.53 ? 11  THR A O     1 
ATOM 1426 C CB    . THR G 3 11  ? 81.675  68.815  22.955  1.00 168.82 ? 11  THR A CB    1 
ATOM 1427 O OG1   . THR G 3 11  ? 83.085  68.857  23.205  1.00 173.01 ? 11  THR A OG1   1 
ATOM 1428 C CG2   . THR G 3 11  ? 81.413  68.196  21.579  1.00 168.01 ? 11  THR A CG2   1 
ATOM 1429 N N     . SER G 3 12  ? 78.794  69.408  22.992  1.00 173.02 ? 12  SER A N     1 
ATOM 1430 C CA    . SER G 3 12  ? 77.476  69.054  23.523  1.00 175.59 ? 12  SER A CA    1 
ATOM 1431 C C     . SER G 3 12  ? 77.609  68.184  24.773  1.00 177.67 ? 12  SER A C     1 
ATOM 1432 O O     . SER G 3 12  ? 76.710  68.149  25.616  1.00 177.68 ? 12  SER A O     1 
ATOM 1433 C CB    . SER G 3 12  ? 76.648  68.327  22.460  1.00 175.60 ? 12  SER A CB    1 
ATOM 1434 O OG    . SER G 3 12  ? 77.300  67.148  22.018  1.00 175.64 ? 12  SER A OG    1 
ATOM 1435 N N     . GLN G 3 13  ? 78.735  67.480  24.873  1.00 180.02 ? 13  GLN A N     1 
ATOM 1436 C CA    . GLN G 3 13  ? 79.104  66.761  26.084  1.00 182.22 ? 13  GLN A CA    1 
ATOM 1437 C C     . GLN G 3 13  ? 79.716  67.757  27.071  1.00 182.93 ? 13  GLN A C     1 
ATOM 1438 O O     . GLN G 3 13  ? 80.916  68.055  27.009  1.00 182.32 ? 13  GLN A O     1 
ATOM 1439 C CB    . GLN G 3 13  ? 80.089  65.632  25.759  1.00 182.42 ? 13  GLN A CB    1 
ATOM 1440 C CG    . GLN G 3 13  ? 80.231  64.577  26.853  1.00 183.42 ? 13  GLN A CG    1 
ATOM 1441 C CD    . GLN G 3 13  ? 81.303  63.544  26.543  1.00 183.23 ? 13  GLN A CD    1 
ATOM 1442 O OE1   . GLN G 3 13  ? 82.466  63.885  26.314  1.00 185.35 ? 13  GLN A OE1   1 
ATOM 1443 N NE2   . GLN G 3 13  ? 80.917  62.271  26.548  1.00 182.58 ? 13  GLN A NE2   1 
ATOM 1444 N N     . GLN G 3 14  ? 78.878  68.281  27.967  1.00 184.04 ? 14  GLN A N     1 
ATOM 1445 C CA    . GLN G 3 14  ? 79.324  69.216  29.003  1.00 184.33 ? 14  GLN A CA    1 
ATOM 1446 C C     . GLN G 3 14  ? 80.053  68.479  30.125  1.00 183.99 ? 14  GLN A C     1 
ATOM 1447 O O     . GLN G 3 14  ? 79.579  68.419  31.267  1.00 183.91 ? 14  GLN A O     1 
ATOM 1448 C CB    . GLN G 3 14  ? 78.157  70.042  29.561  1.00 184.45 ? 14  GLN A CB    1 
ATOM 1449 C CG    . GLN G 3 14  ? 77.644  71.129  28.626  1.00 185.39 ? 14  GLN A CG    1 
ATOM 1450 C CD    . GLN G 3 14  ? 76.555  70.637  27.685  1.00 186.96 ? 14  GLN A CD    1 
ATOM 1451 O OE1   . GLN G 3 14  ? 75.578  70.016  28.110  1.00 185.72 ? 14  GLN A OE1   1 
ATOM 1452 N NE2   . GLN G 3 14  ? 76.714  70.927  26.399  1.00 187.93 ? 14  GLN A NE2   1 
ATOM 1453 N N     . SER G 3 15  ? 81.213  67.923  29.779  1.00 182.99 ? 15  SER A N     1 
ATOM 1454 C CA    . SER G 3 15  ? 82.054  67.181  30.713  1.00 182.21 ? 15  SER A CA    1 
ATOM 1455 C C     . SER G 3 15  ? 82.679  68.115  31.752  1.00 180.94 ? 15  SER A C     1 
ATOM 1456 O O     . SER G 3 15  ? 83.822  67.925  32.182  1.00 181.81 ? 15  SER A O     1 
ATOM 1457 C CB    . SER G 3 15  ? 83.133  66.400  29.949  1.00 182.77 ? 15  SER A CB    1 
ATOM 1458 O OG    . SER G 3 15  ? 83.814  67.226  29.017  1.00 183.51 ? 15  SER A OG    1 
ATOM 1459 N N     . LEU G 3 16  ? 81.907  69.119  32.157  1.00 178.03 ? 16  LEU A N     1 
ATOM 1460 C CA    . LEU G 3 16  ? 82.369  70.130  33.087  1.00 175.68 ? 16  LEU A CA    1 
ATOM 1461 C C     . LEU G 3 16  ? 82.376  69.600  34.511  1.00 175.79 ? 16  LEU A C     1 
ATOM 1462 O O     . LEU G 3 16  ? 83.303  69.871  35.277  1.00 175.17 ? 16  LEU A O     1 
ATOM 1463 C CB    . LEU G 3 16  ? 81.482  71.366  33.000  1.00 174.44 ? 16  LEU A CB    1 
ATOM 1464 C CG    . LEU G 3 16  ? 82.129  72.653  33.506  1.00 172.31 ? 16  LEU A CG    1 
ATOM 1465 C CD1   . LEU G 3 16  ? 82.949  73.296  32.399  1.00 172.93 ? 16  LEU A CD1   1 
ATOM 1466 C CD2   . LEU G 3 16  ? 81.072  73.612  34.014  1.00 174.11 ? 16  LEU A CD2   1 
ATOM 1467 N N     . ASP G 3 17  ? 81.336  68.842  34.853  1.00 176.18 ? 17  ASP A N     1 
ATOM 1468 C CA    . ASP G 3 17  ? 81.182  68.271  36.189  1.00 176.90 ? 17  ASP A CA    1 
ATOM 1469 C C     . ASP G 3 17  ? 82.457  67.545  36.615  1.00 175.84 ? 17  ASP A C     1 
ATOM 1470 O O     . ASP G 3 17  ? 82.894  67.664  37.760  1.00 176.54 ? 17  ASP A O     1 
ATOM 1471 C CB    . ASP G 3 17  ? 79.980  67.320  36.231  1.00 178.39 ? 17  ASP A CB    1 
ATOM 1472 C CG    . ASP G 3 17  ? 78.743  67.896  35.544  1.00 182.76 ? 17  ASP A CG    1 
ATOM 1473 O OD1   . ASP G 3 17  ? 78.857  68.360  34.387  1.00 185.04 ? 17  ASP A OD1   1 
ATOM 1474 O OD2   . ASP G 3 17  ? 77.652  67.868  36.156  1.00 185.18 ? 17  ASP A OD2   1 
ATOM 1475 N N     . ILE G 3 18  ? 83.055  66.823  35.668  1.00 173.77 ? 18  ILE A N     1 
ATOM 1476 C CA    . ILE G 3 18  ? 84.300  66.079  35.876  1.00 172.20 ? 18  ILE A CA    1 
ATOM 1477 C C     . ILE G 3 18  ? 85.484  67.016  36.116  1.00 169.58 ? 18  ILE A C     1 
ATOM 1478 O O     . ILE G 3 18  ? 86.292  66.794  37.022  1.00 167.07 ? 18  ILE A O     1 
ATOM 1479 C CB    . ILE G 3 18  ? 84.600  65.156  34.662  1.00 173.14 ? 18  ILE A CB    1 
ATOM 1480 C CG1   . ILE G 3 18  ? 83.402  64.242  34.374  1.00 176.81 ? 18  ILE A CG1   1 
ATOM 1481 C CG2   . ILE G 3 18  ? 85.872  64.336  34.893  1.00 171.33 ? 18  ILE A CG2   1 
ATOM 1482 C CD1   . ILE G 3 18  ? 83.354  63.697  32.954  1.00 180.54 ? 18  ILE A CD1   1 
ATOM 1483 N N     . GLN G 3 19  ? 85.571  68.057  35.293  1.00 169.37 ? 19  GLN A N     1 
ATOM 1484 C CA    . GLN G 3 19  ? 86.634  69.055  35.382  1.00 170.28 ? 19  GLN A CA    1 
ATOM 1485 C C     . GLN G 3 19  ? 86.778  69.573  36.800  1.00 169.39 ? 19  GLN A C     1 
ATOM 1486 O O     . GLN G 3 19  ? 87.854  69.496  37.394  1.00 170.79 ? 19  GLN A O     1 
ATOM 1487 C CB    . GLN G 3 19  ? 86.322  70.228  34.459  1.00 171.66 ? 19  GLN A CB    1 
ATOM 1488 C CG    . GLN G 3 19  ? 86.447  69.919  32.990  1.00 174.39 ? 19  GLN A CG    1 
ATOM 1489 C CD    . GLN G 3 19  ? 87.849  70.132  32.480  1.00 174.47 ? 19  GLN A CD    1 
ATOM 1490 O OE1   . GLN G 3 19  ? 88.456  71.181  32.717  1.00 172.54 ? 19  GLN A OE1   1 
ATOM 1491 N NE2   . GLN G 3 19  ? 88.374  69.140  31.767  1.00 172.60 ? 19  GLN A NE2   1 
ATOM 1492 N N     . VAL G 3 20  ? 85.672  70.092  37.324  1.00 166.46 ? 20  VAL A N     1 
ATOM 1493 C CA    . VAL G 3 20  ? 85.585  70.620  38.678  1.00 163.03 ? 20  VAL A CA    1 
ATOM 1494 C C     . VAL G 3 20  ? 85.913  69.551  39.707  1.00 160.38 ? 20  VAL A C     1 
ATOM 1495 O O     . VAL G 3 20  ? 86.721  69.772  40.610  1.00 156.65 ? 20  VAL A O     1 
ATOM 1496 C CB    . VAL G 3 20  ? 84.165  71.151  38.942  1.00 163.12 ? 20  VAL A CB    1 
ATOM 1497 C CG1   . VAL G 3 20  ? 83.924  71.381  40.433  1.00 164.01 ? 20  VAL A CG1   1 
ATOM 1498 C CG2   . VAL G 3 20  ? 83.922  72.418  38.135  1.00 162.05 ? 20  VAL A CG2   1 
ATOM 1499 N N     . ARG G 3 21  ? 85.290  68.389  39.545  1.00 161.37 ? 21  ARG A N     1 
ATOM 1500 C CA    . ARG G 3 21  ? 85.357  67.328  40.539  1.00 164.75 ? 21  ARG A CA    1 
ATOM 1501 C C     . ARG G 3 21  ? 86.723  67.179  41.200  1.00 164.30 ? 21  ARG A C     1 
ATOM 1502 O O     . ARG G 3 21  ? 86.806  67.086  42.422  1.00 167.54 ? 21  ARG A O     1 
ATOM 1503 C CB    . ARG G 3 21  ? 84.861  65.994  39.965  1.00 167.24 ? 21  ARG A CB    1 
ATOM 1504 C CG    . ARG G 3 21  ? 83.398  65.696  40.302  1.00 171.14 ? 21  ARG A CG    1 
ATOM 1505 C CD    . ARG G 3 21  ? 82.775  64.695  39.337  1.00 174.67 ? 21  ARG A CD    1 
ATOM 1506 N NE    . ARG G 3 21  ? 81.367  64.442  39.649  1.00 178.38 ? 21  ARG A NE    1 
ATOM 1507 C CZ    . ARG G 3 21  ? 80.521  63.781  38.860  1.00 180.25 ? 21  ARG A CZ    1 
ATOM 1508 N NH1   . ARG G 3 21  ? 80.924  63.299  37.690  1.00 181.15 ? 21  ARG A NH1   1 
ATOM 1509 N NH2   . ARG G 3 21  ? 79.261  63.602  39.241  1.00 180.10 ? 21  ARG A NH2   1 
ATOM 1510 N N     . ALA G 3 22  ? 87.790  67.185  40.414  1.00 161.91 ? 22  ALA A N     1 
ATOM 1511 C CA    . ALA G 3 22  ? 89.112  67.035  41.000  1.00 161.09 ? 22  ALA A CA    1 
ATOM 1512 C C     . ALA G 3 22  ? 89.740  68.364  41.425  1.00 158.27 ? 22  ALA A C     1 
ATOM 1513 O O     . ALA G 3 22  ? 90.591  68.386  42.315  1.00 157.05 ? 22  ALA A O     1 
ATOM 1514 C CB    . ALA G 3 22  ? 90.035  66.259  40.068  1.00 164.20 ? 22  ALA A CB    1 
ATOM 1515 N N     . LEU G 3 23  ? 89.323  69.470  40.808  1.00 156.53 ? 23  LEU A N     1 
ATOM 1516 C CA    . LEU G 3 23  ? 89.901  70.772  41.151  1.00 156.17 ? 23  LEU A CA    1 
ATOM 1517 C C     . LEU G 3 23  ? 89.710  71.033  42.629  1.00 155.99 ? 23  LEU A C     1 
ATOM 1518 O O     . LEU G 3 23  ? 90.529  71.702  43.254  1.00 156.11 ? 23  LEU A O     1 
ATOM 1519 C CB    . LEU G 3 23  ? 89.319  71.920  40.310  1.00 155.57 ? 23  LEU A CB    1 
ATOM 1520 C CG    . LEU G 3 23  ? 89.725  72.087  38.827  1.00 160.22 ? 23  LEU A CG    1 
ATOM 1521 C CD1   . LEU G 3 23  ? 89.269  73.453  38.312  1.00 158.05 ? 23  LEU A CD1   1 
ATOM 1522 C CD2   . LEU G 3 23  ? 91.246  71.889  38.534  1.00 153.62 ? 23  LEU A CD2   1 
ATOM 1523 N N     . LYS G 3 24  ? 88.624  70.479  43.169  1.00 158.02 ? 24  LYS A N     1 
ATOM 1524 C CA    . LYS G 3 24  ? 88.347  70.472  44.607  1.00 159.80 ? 24  LYS A CA    1 
ATOM 1525 C C     . LYS G 3 24  ? 89.268  69.486  45.319  1.00 161.41 ? 24  LYS A C     1 
ATOM 1526 O O     . LYS G 3 24  ? 90.013  69.861  46.223  1.00 162.67 ? 24  LYS A O     1 
ATOM 1527 C CB    . LYS G 3 24  ? 86.895  70.070  44.891  1.00 159.15 ? 24  LYS A CB    1 
ATOM 1528 C CG    . LYS G 3 24  ? 85.821  71.002  44.360  1.00 159.95 ? 24  LYS A CG    1 
ATOM 1529 C CD    . LYS G 3 24  ? 84.446  70.386  44.594  1.00 162.73 ? 24  LYS A CD    1 
ATOM 1530 C CE    . LYS G 3 24  ? 83.321  71.348  44.253  1.00 164.65 ? 24  LYS A CE    1 
ATOM 1531 N NZ    . LYS G 3 24  ? 82.000  70.848  44.750  1.00 166.49 ? 24  LYS A NZ    1 
ATOM 1532 N N     . ASP G 3 25  ? 89.207  68.225  44.898  1.00 161.95 ? 25  ASP A N     1 
ATOM 1533 C CA    . ASP G 3 25  ? 90.005  67.150  45.482  1.00 162.43 ? 25  ASP A CA    1 
ATOM 1534 C C     . ASP G 3 25  ? 91.507  67.446  45.443  1.00 162.35 ? 25  ASP A C     1 
ATOM 1535 O O     . ASP G 3 25  ? 92.297  66.740  46.072  1.00 165.03 ? 25  ASP A O     1 
ATOM 1536 C CB    . ASP G 3 25  ? 89.700  65.823  44.776  1.00 164.38 ? 25  ASP A CB    1 
ATOM 1537 C CG    . ASP G 3 25  ? 88.212  65.483  44.768  1.00 167.76 ? 25  ASP A CG    1 
ATOM 1538 O OD1   . ASP G 3 25  ? 87.825  64.568  44.006  1.00 171.52 ? 25  ASP A OD1   1 
ATOM 1539 O OD2   . ASP G 3 25  ? 87.432  66.124  45.511  1.00 167.02 ? 25  ASP A OD2   1 
ATOM 1540 N N     . ALA G 3 26  ? 91.892  68.483  44.700  1.00 160.62 ? 26  ALA A N     1 
ATOM 1541 C CA    . ALA G 3 26  ? 93.264  68.977  44.700  1.00 158.42 ? 26  ALA A CA    1 
ATOM 1542 C C     . ALA G 3 26  ? 93.498  69.828  45.946  1.00 156.27 ? 26  ALA A C     1 
ATOM 1543 O O     . ALA G 3 26  ? 94.479  69.629  46.668  1.00 154.75 ? 26  ALA A O     1 
ATOM 1544 C CB    . ALA G 3 26  ? 93.550  69.780  43.430  1.00 157.37 ? 26  ALA A CB    1 
ATOM 1545 N N     . GLY G 3 27  ? 92.588  70.770  46.195  1.00 156.32 ? 27  GLY A N     1 
ATOM 1546 C CA    . GLY G 3 27  ? 92.673  71.650  47.361  1.00 158.45 ? 27  GLY A CA    1 
ATOM 1547 C C     . GLY G 3 27  ? 91.842  72.921  47.264  1.00 160.04 ? 27  GLY A C     1 
ATOM 1548 O O     . GLY G 3 27  ? 91.543  73.550  48.291  1.00 161.02 ? 27  GLY A O     1 
ATOM 1549 N N     . VAL G 3 28  ? 91.461  73.292  46.037  1.00 158.57 ? 28  VAL A N     1 
ATOM 1550 C CA    . VAL G 3 28  ? 90.764  74.556  45.779  1.00 158.09 ? 28  VAL A CA    1 
ATOM 1551 C C     . VAL G 3 28  ? 89.255  74.400  45.748  1.00 159.53 ? 28  VAL A C     1 
ATOM 1552 O O     . VAL G 3 28  ? 88.733  73.457  45.158  1.00 157.36 ? 28  VAL A O     1 
ATOM 1553 C CB    . VAL G 3 28  ? 91.180  75.195  44.450  1.00 157.67 ? 28  VAL A CB    1 
ATOM 1554 C CG1   . VAL G 3 28  ? 90.892  76.690  44.488  1.00 154.65 ? 28  VAL A CG1   1 
ATOM 1555 C CG2   . VAL G 3 28  ? 92.654  74.929  44.156  1.00 162.44 ? 28  VAL A CG2   1 
ATOM 1556 N N     . LYS G 3 29  ? 88.567  75.358  46.365  1.00 163.49 ? 29  LYS A N     1 
ATOM 1557 C CA    . LYS G 3 29  ? 87.112  75.345  46.454  1.00 165.94 ? 29  LYS A CA    1 
ATOM 1558 C C     . LYS G 3 29  ? 86.456  76.211  45.371  1.00 167.50 ? 29  LYS A C     1 
ATOM 1559 O O     . LYS G 3 29  ? 87.082  77.133  44.828  1.00 167.73 ? 29  LYS A O     1 
ATOM 1560 C CB    . LYS G 3 29  ? 86.673  75.791  47.851  1.00 165.68 ? 29  LYS A CB    1 
ATOM 1561 C CG    . LYS G 3 29  ? 87.276  74.960  48.971  1.00 166.35 ? 29  LYS A CG    1 
ATOM 1562 C CD    . LYS G 3 29  ? 86.726  75.384  50.319  1.00 172.27 ? 29  LYS A CD    1 
ATOM 1563 C CE    . LYS G 3 29  ? 87.198  74.456  51.432  1.00 173.60 ? 29  LYS A CE    1 
ATOM 1564 N NZ    . LYS G 3 29  ? 86.511  74.751  52.726  1.00 175.50 ? 29  LYS A NZ    1 
ATOM 1565 N N     . ALA G 3 30  ? 85.194  75.896  45.065  1.00 168.70 ? 30  ALA A N     1 
ATOM 1566 C CA    . ALA G 3 30  ? 84.392  76.621  44.070  1.00 168.99 ? 30  ALA A CA    1 
ATOM 1567 C C     . ALA G 3 30  ? 84.415  78.124  44.306  1.00 168.94 ? 30  ALA A C     1 
ATOM 1568 O O     . ALA G 3 30  ? 84.461  78.910  43.355  1.00 168.29 ? 30  ALA A O     1 
ATOM 1569 C CB    . ALA G 3 30  ? 82.967  76.117  44.084  1.00 169.51 ? 30  ALA A CB    1 
ATOM 1570 N N     . ASN G 3 31  ? 84.371  78.500  45.585  1.00 168.70 ? 31  ASN A N     1 
ATOM 1571 C CA    . ASN G 3 31  ? 84.597  79.864  46.045  1.00 167.78 ? 31  ASN A CA    1 
ATOM 1572 C C     . ASN G 3 31  ? 85.647  80.592  45.195  1.00 168.06 ? 31  ASN A C     1 
ATOM 1573 O O     . ASN G 3 31  ? 85.628  81.822  45.082  1.00 168.41 ? 31  ASN A O     1 
ATOM 1574 C CB    . ASN G 3 31  ? 85.009  79.822  47.522  1.00 166.89 ? 31  ASN A CB    1 
ATOM 1575 C CG    . ASN G 3 31  ? 85.253  81.196  48.112  1.00 167.23 ? 31  ASN A CG    1 
ATOM 1576 O OD1   . ASN G 3 31  ? 84.571  82.165  47.778  1.00 169.46 ? 31  ASN A OD1   1 
ATOM 1577 N ND2   . ASN G 3 31  ? 86.231  81.285  49.005  1.00 166.11 ? 31  ASN A ND2   1 
ATOM 1578 N N     . ARG G 3 32  ? 86.547  79.813  44.591  1.00 167.17 ? 32  ARG A N     1 
ATOM 1579 C CA    . ARG G 3 32  ? 87.585  80.327  43.707  1.00 167.66 ? 32  ARG A CA    1 
ATOM 1580 C C     . ARG G 3 32  ? 87.797  79.413  42.487  1.00 170.48 ? 32  ARG A C     1 
ATOM 1581 O O     . ARG G 3 32  ? 88.943  79.124  42.110  1.00 170.95 ? 32  ARG A O     1 
ATOM 1582 C CB    . ARG G 3 32  ? 88.910  80.490  44.468  1.00 168.10 ? 32  ARG A CB    1 
ATOM 1583 C CG    . ARG G 3 32  ? 88.838  81.268  45.779  1.00 168.41 ? 32  ARG A CG    1 
ATOM 1584 C CD    . ARG G 3 32  ? 90.221  81.472  46.390  1.00 166.74 ? 32  ARG A CD    1 
ATOM 1585 N NE    . ARG G 3 32  ? 90.172  81.570  47.851  1.00 164.34 ? 32  ARG A NE    1 
ATOM 1586 C CZ    . ARG G 3 32  ? 90.060  82.702  48.546  1.00 157.12 ? 32  ARG A CZ    1 
ATOM 1587 N NH1   . ARG G 3 32  ? 89.978  83.879  47.932  1.00 152.82 ? 32  ARG A NH1   1 
ATOM 1588 N NH2   . ARG G 3 32  ? 90.031  82.652  49.871  1.00 152.85 ? 32  ARG A NH2   1 
ATOM 1589 N N     . ILE G 3 33  ? 86.704  78.957  41.871  1.00 172.47 ? 33  ILE A N     1 
ATOM 1590 C CA    . ILE G 3 33  ? 86.785  78.149  40.634  1.00 173.63 ? 33  ILE A CA    1 
ATOM 1591 C C     . ILE G 3 33  ? 86.017  78.761  39.453  1.00 175.13 ? 33  ILE A C     1 
ATOM 1592 O O     . ILE G 3 33  ? 84.812  79.014  39.536  1.00 176.54 ? 33  ILE A O     1 
ATOM 1593 C CB    . ILE G 3 33  ? 86.372  76.682  40.863  1.00 171.44 ? 33  ILE A CB    1 
ATOM 1594 C CG1   . ILE G 3 33  ? 87.506  75.941  41.574  1.00 174.14 ? 33  ILE A CG1   1 
ATOM 1595 C CG2   . ILE G 3 33  ? 86.037  76.001  39.542  1.00 167.79 ? 33  ILE A CG2   1 
ATOM 1596 C CD1   . ILE G 3 33  ? 87.208  74.490  41.909  1.00 175.64 ? 33  ILE A CD1   1 
ATOM 1597 N N     . PHE G 3 34  ? 86.725  78.971  38.349  1.00 175.25 ? 34  PHE A N     1 
ATOM 1598 C CA    . PHE G 3 34  ? 86.205  79.774  37.248  1.00 177.29 ? 34  PHE A CA    1 
ATOM 1599 C C     . PHE G 3 34  ? 85.840  78.938  36.029  1.00 176.46 ? 34  PHE A C     1 
ATOM 1600 O O     . PHE G 3 34  ? 86.387  77.851  35.833  1.00 177.62 ? 34  PHE A O     1 
ATOM 1601 C CB    . PHE G 3 34  ? 87.209  80.877  36.905  1.00 179.85 ? 34  PHE A CB    1 
ATOM 1602 C CG    . PHE G 3 34  ? 87.317  81.926  37.971  1.00 183.47 ? 34  PHE A CG    1 
ATOM 1603 C CD1   . PHE G 3 34  ? 87.872  81.627  39.211  1.00 186.41 ? 34  PHE A CD1   1 
ATOM 1604 C CD2   . PHE G 3 34  ? 86.835  83.206  37.750  1.00 187.54 ? 34  PHE A CD2   1 
ATOM 1605 C CE1   . PHE G 3 34  ? 87.949  82.590  40.212  1.00 186.82 ? 34  PHE A CE1   1 
ATOM 1606 C CE2   . PHE G 3 34  ? 86.915  84.178  38.743  1.00 187.30 ? 34  PHE A CE2   1 
ATOM 1607 C CZ    . PHE G 3 34  ? 87.475  83.868  39.975  1.00 184.42 ? 34  PHE A CZ    1 
ATOM 1608 N N     . THR G 3 35  ? 84.912  79.446  35.218  1.00 174.00 ? 35  THR A N     1 
ATOM 1609 C CA    . THR G 3 35  ? 84.335  78.657  34.135  1.00 172.59 ? 35  THR A CA    1 
ATOM 1610 C C     . THR G 3 35  ? 83.786  79.448  32.953  1.00 174.02 ? 35  THR A C     1 
ATOM 1611 O O     . THR G 3 35  ? 82.935  80.336  33.110  1.00 174.27 ? 35  THR A O     1 
ATOM 1612 C CB    . THR G 3 35  ? 83.242  77.726  34.681  1.00 172.19 ? 35  THR A CB    1 
ATOM 1613 O OG1   . THR G 3 35  ? 83.872  76.580  35.259  1.00 174.83 ? 35  THR A OG1   1 
ATOM 1614 C CG2   . THR G 3 35  ? 82.283  77.271  33.579  1.00 172.47 ? 35  THR A CG2   1 
ATOM 1615 N N     . ASP G 3 36  ? 84.287  79.098  31.769  1.00 173.67 ? 36  ASP A N     1 
ATOM 1616 C CA    . ASP G 3 36  ? 83.706  79.528  30.501  1.00 172.08 ? 36  ASP A CA    1 
ATOM 1617 C C     . ASP G 3 36  ? 83.048  78.320  29.854  1.00 172.46 ? 36  ASP A C     1 
ATOM 1618 O O     . ASP G 3 36  ? 83.668  77.260  29.750  1.00 173.91 ? 36  ASP A O     1 
ATOM 1619 C CB    . ASP G 3 36  ? 84.788  80.056  29.564  1.00 168.99 ? 36  ASP A CB    1 
ATOM 1620 C CG    . ASP G 3 36  ? 85.733  81.005  30.247  1.00 164.16 ? 36  ASP A CG    1 
ATOM 1621 O OD1   . ASP G 3 36  ? 85.378  82.188  30.422  1.00 166.51 ? 36  ASP A OD1   1 
ATOM 1622 O OD2   . ASP G 3 36  ? 86.838  80.564  30.601  1.00 157.52 ? 36  ASP A OD2   1 
ATOM 1623 N N     . LYS G 3 37  ? 81.796  78.466  29.435  1.00 170.28 ? 37  LYS A N     1 
ATOM 1624 C CA    . LYS G 3 37  ? 81.139  77.411  28.674  1.00 170.48 ? 37  LYS A CA    1 
ATOM 1625 C C     . LYS G 3 37  ? 81.121  77.850  27.215  1.00 172.29 ? 37  LYS A C     1 
ATOM 1626 O O     . LYS G 3 37  ? 80.137  78.422  26.747  1.00 174.17 ? 37  LYS A O     1 
ATOM 1627 C CB    . LYS G 3 37  ? 79.719  77.159  29.186  1.00 170.17 ? 37  LYS A CB    1 
ATOM 1628 C CG    . LYS G 3 37  ? 79.551  77.187  30.699  1.00 169.31 ? 37  LYS A CG    1 
ATOM 1629 C CD    . LYS G 3 37  ? 78.073  77.098  31.064  1.00 171.65 ? 37  LYS A CD    1 
ATOM 1630 C CE    . LYS G 3 37  ? 77.779  77.728  32.419  1.00 173.33 ? 37  LYS A CE    1 
ATOM 1631 N NZ    . LYS G 3 37  ? 76.315  77.804  32.686  1.00 171.64 ? 37  LYS A NZ    1 
ATOM 1632 N N     . ALA G 3 38  ? 82.219  77.580  26.508  1.00 174.22 ? 38  ALA A N     1 
ATOM 1633 C CA    . ALA G 3 38  ? 82.473  78.118  25.157  1.00 175.91 ? 38  ALA A CA    1 
ATOM 1634 C C     . ALA G 3 38  ? 81.299  78.007  24.165  1.00 177.25 ? 38  ALA A C     1 
ATOM 1635 O O     . ALA G 3 38  ? 81.201  77.047  23.393  1.00 177.46 ? 38  ALA A O     1 
ATOM 1636 C CB    . ALA G 3 38  ? 83.764  77.518  24.565  1.00 174.54 ? 38  ALA A CB    1 
ATOM 1637 N N     . SER G 3 39  ? 80.418  79.005  24.200  1.00 178.24 ? 39  SER A N     1 
ATOM 1638 C CA    . SER G 3 39  ? 79.219  79.034  23.364  1.00 178.87 ? 39  SER A CA    1 
ATOM 1639 C C     . SER G 3 39  ? 79.540  79.523  21.955  1.00 179.97 ? 39  SER A C     1 
ATOM 1640 O O     . SER G 3 39  ? 80.254  78.856  21.202  1.00 181.07 ? 39  SER A O     1 
ATOM 1641 C CB    . SER G 3 39  ? 78.152  79.928  24.001  1.00 178.30 ? 39  SER A CB    1 
ATOM 1642 O OG    . SER G 3 39  ? 76.994  80.003  23.189  1.00 177.60 ? 39  SER A OG    1 
ATOM 1643 N N     . ASP G 3 44  ? 84.890  85.236  23.736  1.00 195.13 ? 44  ASP A N     1 
ATOM 1644 C CA    . ASP G 3 44  ? 83.812  85.003  24.694  1.00 196.60 ? 44  ASP A CA    1 
ATOM 1645 C C     . ASP G 3 44  ? 84.295  84.317  25.976  1.00 197.07 ? 44  ASP A C     1 
ATOM 1646 O O     . ASP G 3 44  ? 83.488  83.973  26.847  1.00 197.83 ? 44  ASP A O     1 
ATOM 1647 C CB    . ASP G 3 44  ? 82.681  84.194  24.046  1.00 197.24 ? 44  ASP A CB    1 
ATOM 1648 C CG    . ASP G 3 44  ? 81.886  85.005  23.035  1.00 202.21 ? 44  ASP A CG    1 
ATOM 1649 O OD1   . ASP G 3 44  ? 82.509  85.688  22.193  1.00 206.20 ? 44  ASP A OD1   1 
ATOM 1650 O OD2   . ASP G 3 44  ? 80.635  84.957  23.077  1.00 203.70 ? 44  ASP A OD2   1 
ATOM 1651 N N     . ARG G 3 45  ? 85.610  84.131  26.087  1.00 196.08 ? 45  ARG A N     1 
ATOM 1652 C CA    . ARG G 3 45  ? 86.224  83.482  27.251  1.00 195.77 ? 45  ARG A CA    1 
ATOM 1653 C C     . ARG G 3 45  ? 86.255  84.409  28.478  1.00 193.88 ? 45  ARG A C     1 
ATOM 1654 O O     . ARG G 3 45  ? 87.320  84.781  28.979  1.00 193.49 ? 45  ARG A O     1 
ATOM 1655 C CB    . ARG G 3 45  ? 87.624  82.945  26.901  1.00 196.50 ? 45  ARG A CB    1 
ATOM 1656 C CG    . ARG G 3 45  ? 88.511  83.911  26.103  1.00 199.64 ? 45  ARG A CG    1 
ATOM 1657 C CD    . ARG G 3 45  ? 89.910  83.344  25.862  1.00 198.10 ? 45  ARG A CD    1 
ATOM 1658 N NE    . ARG G 3 45  ? 90.820  84.348  25.307  1.00 202.08 ? 45  ARG A NE    1 
ATOM 1659 C CZ    . ARG G 3 45  ? 92.146  84.220  25.223  1.00 205.72 ? 45  ARG A CZ    1 
ATOM 1660 N NH1   . ARG G 3 45  ? 92.760  83.122  25.659  1.00 204.42 ? 45  ARG A NH1   1 
ATOM 1661 N NH2   . ARG G 3 45  ? 92.867  85.205  24.700  1.00 208.13 ? 45  ARG A NH2   1 
ATOM 1662 N N     . LYS G 3 46  ? 85.066  84.751  28.968  1.00 192.56 ? 46  LYS A N     1 
ATOM 1663 C CA    . LYS G 3 46  ? 84.904  85.783  29.990  1.00 190.99 ? 46  LYS A CA    1 
ATOM 1664 C C     . LYS G 3 46  ? 85.429  85.374  31.363  1.00 190.32 ? 46  LYS A C     1 
ATOM 1665 O O     . LYS G 3 46  ? 86.371  85.984  31.871  1.00 190.84 ? 46  LYS A O     1 
ATOM 1666 C CB    . LYS G 3 46  ? 83.448  86.255  30.056  1.00 189.89 ? 46  LYS A CB    1 
ATOM 1667 C CG    . LYS G 3 46  ? 83.025  87.063  28.834  1.00 189.99 ? 46  LYS A CG    1 
ATOM 1668 C CD    . LYS G 3 46  ? 81.514  87.242  28.758  1.00 192.48 ? 46  LYS A CD    1 
ATOM 1669 C CE    . LYS G 3 46  ? 81.112  88.057  27.527  1.00 192.32 ? 46  LYS A CE    1 
ATOM 1670 N NZ    . LYS G 3 46  ? 79.633  88.238  27.401  1.00 188.84 ? 46  LYS A NZ    1 
ATOM 1671 N N     . GLY G 3 47  ? 84.842  84.332  31.947  1.00 189.29 ? 47  GLY A N     1 
ATOM 1672 C CA    . GLY G 3 47  ? 85.283  83.810  33.245  1.00 189.25 ? 47  GLY A CA    1 
ATOM 1673 C C     . GLY G 3 47  ? 86.786  83.594  33.374  1.00 188.82 ? 47  GLY A C     1 
ATOM 1674 O O     . GLY G 3 47  ? 87.300  83.374  34.475  1.00 188.90 ? 47  GLY A O     1 
ATOM 1675 N N     . LEU G 3 48  ? 87.493  83.647  32.249  1.00 187.65 ? 48  LEU A N     1 
ATOM 1676 C CA    . LEU G 3 48  ? 88.943  83.583  32.269  1.00 186.81 ? 48  LEU A CA    1 
ATOM 1677 C C     . LEU G 3 48  ? 89.518  84.966  32.522  1.00 184.85 ? 48  LEU A C     1 
ATOM 1678 O O     . LEU G 3 48  ? 90.317  85.154  33.440  1.00 183.75 ? 48  LEU A O     1 
ATOM 1679 C CB    . LEU G 3 48  ? 89.487  83.022  30.958  1.00 187.50 ? 48  LEU A CB    1 
ATOM 1680 C CG    . LEU G 3 48  ? 91.015  82.991  30.887  1.00 190.79 ? 48  LEU A CG    1 
ATOM 1681 C CD1   . LEU G 3 48  ? 91.586  81.896  31.791  1.00 189.69 ? 48  LEU A CD1   1 
ATOM 1682 C CD2   . LEU G 3 48  ? 91.485  82.819  29.452  1.00 194.58 ? 48  LEU A CD2   1 
ATOM 1683 N N     . ASP G 3 49  ? 89.105  85.925  31.697  1.00 183.71 ? 49  ASP A N     1 
ATOM 1684 C CA    . ASP G 3 49  ? 89.532  87.308  31.844  1.00 184.56 ? 49  ASP A CA    1 
ATOM 1685 C C     . ASP G 3 49  ? 89.381  87.749  33.291  1.00 184.28 ? 49  ASP A C     1 
ATOM 1686 O O     . ASP G 3 49  ? 90.251  88.431  33.834  1.00 186.22 ? 49  ASP A O     1 
ATOM 1687 C CB    . ASP G 3 49  ? 88.718  88.231  30.930  1.00 185.24 ? 49  ASP A CB    1 
ATOM 1688 C CG    . ASP G 3 49  ? 88.959  87.960  29.456  1.00 187.65 ? 49  ASP A CG    1 
ATOM 1689 O OD1   . ASP G 3 49  ? 90.140  87.900  29.041  1.00 192.34 ? 49  ASP A OD1   1 
ATOM 1690 O OD2   . ASP G 3 49  ? 87.964  87.816  28.708  1.00 188.02 ? 49  ASP A OD2   1 
ATOM 1691 N N     . LEU G 3 50  ? 88.280  87.334  33.914  1.00 181.92 ? 50  LEU A N     1 
ATOM 1692 C CA    . LEU G 3 50  ? 87.976  87.730  35.280  1.00 179.29 ? 50  LEU A CA    1 
ATOM 1693 C C     . LEU G 3 50  ? 88.931  87.072  36.257  1.00 175.96 ? 50  LEU A C     1 
ATOM 1694 O O     . LEU G 3 50  ? 89.372  87.698  37.224  1.00 174.67 ? 50  LEU A O     1 
ATOM 1695 C CB    . LEU G 3 50  ? 86.532  87.387  35.637  1.00 180.14 ? 50  LEU A CB    1 
ATOM 1696 C CG    . LEU G 3 50  ? 85.885  88.341  36.641  1.00 183.75 ? 50  LEU A CG    1 
ATOM 1697 C CD1   . LEU G 3 50  ? 85.513  89.665  35.971  1.00 185.71 ? 50  LEU A CD1   1 
ATOM 1698 C CD2   . LEU G 3 50  ? 84.662  87.695  37.272  1.00 187.52 ? 50  LEU A CD2   1 
ATOM 1699 N N     . LEU G 3 51  ? 89.253  85.809  35.996  1.00 174.11 ? 51  LEU A N     1 
ATOM 1700 C CA    . LEU G 3 51  ? 90.231  85.110  36.807  1.00 171.37 ? 51  LEU A CA    1 
ATOM 1701 C C     . LEU G 3 51  ? 91.563  85.832  36.660  1.00 170.34 ? 51  LEU A C     1 
ATOM 1702 O O     . LEU G 3 51  ? 92.238  86.119  37.648  1.00 170.10 ? 51  LEU A O     1 
ATOM 1703 C CB    . LEU G 3 51  ? 90.340  83.640  36.402  1.00 168.55 ? 51  LEU A CB    1 
ATOM 1704 C CG    . LEU G 3 51  ? 91.371  82.863  37.225  1.00 171.54 ? 51  LEU A CG    1 
ATOM 1705 C CD1   . LEU G 3 51  ? 90.982  82.829  38.695  1.00 169.19 ? 51  LEU A CD1   1 
ATOM 1706 C CD2   . LEU G 3 51  ? 91.597  81.454  36.691  1.00 173.11 ? 51  LEU A CD2   1 
ATOM 1707 N N     . ARG G 3 52  ? 91.894  86.163  35.417  1.00 170.14 ? 52  ARG A N     1 
ATOM 1708 C CA    . ARG G 3 52  ? 93.107  86.896  35.075  1.00 171.12 ? 52  ARG A CA    1 
ATOM 1709 C C     . ARG G 3 52  ? 93.314  88.128  35.952  1.00 170.32 ? 52  ARG A C     1 
ATOM 1710 O O     . ARG G 3 52  ? 94.445  88.508  36.237  1.00 171.08 ? 52  ARG A O     1 
ATOM 1711 C CB    . ARG G 3 52  ? 93.031  87.323  33.611  1.00 172.27 ? 52  ARG A CB    1 
ATOM 1712 C CG    . ARG G 3 52  ? 94.413  87.258  32.850  1.00 168.94 ? 52  ARG A CG    1 
ATOM 1713 C CD    . ARG G 3 52  ? 94.029  86.881  31.402  1.00 170.20 ? 52  ARG A CD    1 
ATOM 1714 N NE    . ARG G 3 52  ? 94.891  87.567  30.441  1.00 172.82 ? 52  ARG A NE    1 
ATOM 1715 C CZ    . ARG G 3 52  ? 94.520  87.879  29.198  1.00 177.66 ? 52  ARG A CZ    1 
ATOM 1716 N NH1   . ARG G 3 52  ? 93.292  87.576  28.762  1.00 177.30 ? 52  ARG A NH1   1 
ATOM 1717 N NH2   . ARG G 3 52  ? 95.375  88.504  28.390  1.00 181.10 ? 52  ARG A NH2   1 
ATOM 1718 N N     . MET G 3 53  ? 92.224  88.746  36.385  1.00 169.98 ? 53  MET A N     1 
ATOM 1719 C CA    . MET G 3 53  ? 92.328  89.996  37.119  1.00 173.18 ? 53  MET A CA    1 
ATOM 1720 C C     . MET G 3 53  ? 92.093  89.846  38.617  1.00 171.99 ? 53  MET A C     1 
ATOM 1721 O O     . MET G 3 53  ? 92.353  90.776  39.385  1.00 172.04 ? 53  MET A O     1 
ATOM 1722 C CB    . MET G 3 53  ? 91.397  91.046  36.516  1.00 174.08 ? 53  MET A CB    1 
ATOM 1723 C CG    . MET G 3 53  ? 91.674  91.329  35.044  1.00 176.41 ? 53  MET A CG    1 
ATOM 1724 S SD    . MET G 3 53  ? 90.483  92.464  34.311  1.00 177.92 ? 53  MET A SD    1 
ATOM 1725 C CE    . MET G 3 53  ? 88.965  91.510  34.401  1.00 179.36 ? 53  MET A CE    1 
ATOM 1726 N N     . LYS G 3 54  ? 91.608  88.678  39.033  1.00 171.35 ? 54  LYS A N     1 
ATOM 1727 C CA    . LYS G 3 54  ? 91.445  88.408  40.457  1.00 172.46 ? 54  LYS A CA    1 
ATOM 1728 C C     . LYS G 3 54  ? 92.774  87.973  41.075  1.00 172.28 ? 54  LYS A C     1 
ATOM 1729 O O     . LYS G 3 54  ? 93.010  88.196  42.265  1.00 174.69 ? 54  LYS A O     1 
ATOM 1730 C CB    . LYS G 3 54  ? 90.343  87.369  40.724  1.00 173.15 ? 54  LYS A CB    1 
ATOM 1731 C CG    . LYS G 3 54  ? 89.697  87.485  42.127  1.00 175.26 ? 54  LYS A CG    1 
ATOM 1732 C CD    . LYS G 3 54  ? 88.737  86.324  42.459  1.00 172.95 ? 54  LYS A CD    1 
ATOM 1733 C CE    . LYS G 3 54  ? 88.096  86.508  43.847  1.00 171.69 ? 54  LYS A CE    1 
ATOM 1734 N NZ    . LYS G 3 54  ? 87.196  85.381  44.247  1.00 166.37 ? 54  LYS A NZ    1 
ATOM 1735 N N     . VAL G 3 55  ? 93.643  87.372  40.264  1.00 169.65 ? 55  VAL A N     1 
ATOM 1736 C CA    . VAL G 3 55  ? 94.935  86.887  40.753  1.00 169.14 ? 55  VAL A CA    1 
ATOM 1737 C C     . VAL G 3 55  ? 95.936  88.014  40.984  1.00 168.43 ? 55  VAL A C     1 
ATOM 1738 O O     . VAL G 3 55  ? 95.878  89.053  40.322  1.00 169.83 ? 55  VAL A O     1 
ATOM 1739 C CB    . VAL G 3 55  ? 95.560  85.814  39.826  1.00 170.25 ? 55  VAL A CB    1 
ATOM 1740 C CG1   . VAL G 3 55  ? 94.582  84.688  39.589  1.00 174.40 ? 55  VAL A CG1   1 
ATOM 1741 C CG2   . VAL G 3 55  ? 96.007  86.414  38.497  1.00 172.66 ? 55  VAL A CG2   1 
ATOM 1742 N N     . LYS G 3 56  ? 96.842  87.796  41.936  1.00 167.03 ? 56  LYS A N     1 
ATOM 1743 C CA    . LYS G 3 56  ? 97.887  88.761  42.295  1.00 165.04 ? 56  LYS A CA    1 
ATOM 1744 C C     . LYS G 3 56  ? 99.216  88.030  42.544  1.00 163.33 ? 56  LYS A C     1 
ATOM 1745 O O     . LYS G 3 56  ? 99.300  86.817  42.342  1.00 163.28 ? 56  LYS A O     1 
ATOM 1746 C CB    . LYS G 3 56  ? 97.458  89.591  43.518  1.00 164.95 ? 56  LYS A CB    1 
ATOM 1747 C CG    . LYS G 3 56  ? 96.257  90.509  43.266  1.00 163.50 ? 56  LYS A CG    1 
ATOM 1748 C CD    . LYS G 3 56  ? 95.917  91.367  44.472  1.00 164.46 ? 56  LYS A CD    1 
ATOM 1749 C CE    . LYS G 3 56  ? 94.838  92.387  44.124  1.00 164.93 ? 56  LYS A CE    1 
ATOM 1750 N NZ    . LYS G 3 56  ? 94.708  93.469  45.146  1.00 161.70 ? 56  LYS A NZ    1 
ATOM 1751 N N     . GLU G 3 57  ? 100.248 88.762  42.969  1.00 161.40 ? 57  GLU A N     1 
ATOM 1752 C CA    . GLU G 3 57  ? 101.563 88.172  43.259  1.00 159.27 ? 57  GLU A CA    1 
ATOM 1753 C C     . GLU G 3 57  ? 101.475 86.935  44.143  1.00 155.71 ? 57  GLU A C     1 
ATOM 1754 O O     . GLU G 3 57  ? 100.707 86.902  45.105  1.00 156.54 ? 57  GLU A O     1 
ATOM 1755 C CB    . GLU G 3 57  ? 102.499 89.192  43.919  1.00 160.97 ? 57  GLU A CB    1 
ATOM 1756 C CG    . GLU G 3 57  ? 103.545 89.789  42.984  1.00 164.34 ? 57  GLU A CG    1 
ATOM 1757 C CD    . GLU G 3 57  ? 104.853 90.118  43.689  1.00 165.70 ? 57  GLU A CD    1 
ATOM 1758 O OE1   . GLU G 3 57  ? 104.829 90.844  44.709  1.00 166.17 ? 57  GLU A OE1   1 
ATOM 1759 O OE2   . GLU G 3 57  ? 105.910 89.653  43.212  1.00 165.96 ? 57  GLU A OE2   1 
ATOM 1760 N N     . GLY G 3 58  ? 102.266 85.923  43.803  1.00 151.83 ? 58  GLY A N     1 
ATOM 1761 C CA    . GLY G 3 58  ? 102.342 84.698  44.588  1.00 149.50 ? 58  GLY A CA    1 
ATOM 1762 C C     . GLY G 3 58  ? 101.030 83.952  44.751  1.00 148.25 ? 58  GLY A C     1 
ATOM 1763 O O     . GLY G 3 58  ? 100.758 83.401  45.815  1.00 147.62 ? 58  GLY A O     1 
ATOM 1764 N N     . ASP G 3 59  ? 100.208 83.950  43.704  1.00 147.98 ? 59  ASP A N     1 
ATOM 1765 C CA    . ASP G 3 59  ? 99.022  83.096  43.663  1.00 146.21 ? 59  ASP A CA    1 
ATOM 1766 C C     . ASP G 3 59  ? 99.378  81.801  42.964  1.00 140.37 ? 59  ASP A C     1 
ATOM 1767 O O     . ASP G 3 59  ? 100.470 81.686  42.402  1.00 138.26 ? 59  ASP A O     1 
ATOM 1768 C CB    . ASP G 3 59  ? 97.861  83.788  42.945  1.00 149.01 ? 59  ASP A CB    1 
ATOM 1769 C CG    . ASP G 3 59  ? 97.148  84.806  43.826  1.00 158.96 ? 59  ASP A CG    1 
ATOM 1770 O OD1   . ASP G 3 59  ? 97.328  84.778  45.068  1.00 162.28 ? 59  ASP A OD1   1 
ATOM 1771 O OD2   . ASP G 3 59  ? 96.396  85.636  43.273  1.00 163.50 ? 59  ASP A OD2   1 
ATOM 1772 N N     . VAL G 3 60  ? 98.473  80.826  43.024  1.00 136.39 ? 60  VAL A N     1 
ATOM 1773 C CA    . VAL G 3 60  ? 98.633  79.568  42.290  1.00 135.45 ? 60  VAL A CA    1 
ATOM 1774 C C     . VAL G 3 60  ? 97.288  79.086  41.772  1.00 138.74 ? 60  VAL A C     1 
ATOM 1775 O O     . VAL G 3 60  ? 96.304  79.086  42.529  1.00 139.34 ? 60  VAL A O     1 
ATOM 1776 C CB    . VAL G 3 60  ? 99.297  78.456  43.142  1.00 134.57 ? 60  VAL A CB    1 
ATOM 1777 C CG1   . VAL G 3 60  ? 98.918  77.064  42.623  1.00 125.04 ? 60  VAL A CG1   1 
ATOM 1778 C CG2   . VAL G 3 60  ? 100.827 78.622  43.166  1.00 133.02 ? 60  VAL A CG2   1 
ATOM 1779 N N     . ILE G 3 61  ? 97.256  78.698  40.487  1.00 138.15 ? 61  ILE A N     1 
ATOM 1780 C CA    . ILE G 3 61  ? 96.047  78.161  39.839  1.00 136.88 ? 61  ILE A CA    1 
ATOM 1781 C C     . ILE G 3 61  ? 96.139  76.657  39.578  1.00 143.11 ? 61  ILE A C     1 
ATOM 1782 O O     . ILE G 3 61  ? 97.142  76.035  39.899  1.00 146.76 ? 61  ILE A O     1 
ATOM 1783 C CB    . ILE G 3 61  ? 95.751  78.832  38.506  1.00 131.73 ? 61  ILE A CB    1 
ATOM 1784 C CG1   . ILE G 3 61  ? 96.178  80.302  38.519  1.00 127.32 ? 61  ILE A CG1   1 
ATOM 1785 C CG2   . ILE G 3 61  ? 94.260  78.637  38.153  1.00 132.92 ? 61  ILE A CG2   1 
ATOM 1786 C CD1   . ILE G 3 61  ? 95.015  81.300  38.435  1.00 122.15 ? 61  ILE A CD1   1 
ATOM 1787 N N     . LEU G 3 62  ? 95.081  76.091  38.994  1.00 148.84 ? 62  LEU A N     1 
ATOM 1788 C CA    . LEU G 3 62  ? 94.999  74.665  38.653  1.00 150.96 ? 62  LEU A CA    1 
ATOM 1789 C C     . LEU G 3 62  ? 94.019  74.431  37.510  1.00 153.27 ? 62  LEU A C     1 
ATOM 1790 O O     . LEU G 3 62  ? 92.843  74.853  37.575  1.00 151.87 ? 62  LEU A O     1 
ATOM 1791 C CB    . LEU G 3 62  ? 94.547  73.858  39.859  1.00 148.65 ? 62  LEU A CB    1 
ATOM 1792 C CG    . LEU G 3 62  ? 95.531  72.971  40.598  1.00 149.55 ? 62  LEU A CG    1 
ATOM 1793 C CD1   . LEU G 3 62  ? 96.967  73.349  40.358  1.00 146.37 ? 62  LEU A CD1   1 
ATOM 1794 C CD2   . LEU G 3 62  ? 95.187  72.959  42.099  1.00 157.88 ? 62  LEU A CD2   1 
ATOM 1795 N N     . VAL G 3 63  ? 94.524  73.777  36.461  1.00 154.45 ? 63  VAL A N     1 
ATOM 1796 C CA    . VAL G 3 63  ? 93.724  73.414  35.286  1.00 151.25 ? 63  VAL A CA    1 
ATOM 1797 C C     . VAL G 3 63  ? 93.848  71.920  35.030  1.00 148.83 ? 63  VAL A C     1 
ATOM 1798 O O     . VAL G 3 63  ? 94.968  71.368  35.084  1.00 146.45 ? 63  VAL A O     1 
ATOM 1799 C CB    . VAL G 3 63  ? 94.141  74.199  34.030  1.00 148.60 ? 63  VAL A CB    1 
ATOM 1800 C CG1   . VAL G 3 63  ? 93.469  73.607  32.824  1.00 153.34 ? 63  VAL A CG1   1 
ATOM 1801 C CG2   . VAL G 3 63  ? 93.762  75.678  34.158  1.00 143.83 ? 63  VAL A CG2   1 
ATOM 1802 N N     . LYS G 3 64  ? 92.713  71.268  34.750  1.00 148.34 ? 64  LYS A N     1 
ATOM 1803 C CA    . LYS G 3 64  ? 92.685  69.796  34.681  1.00 151.48 ? 64  LYS A CA    1 
ATOM 1804 C C     . LYS G 3 64  ? 93.836  69.235  33.880  1.00 150.90 ? 64  LYS A C     1 
ATOM 1805 O O     . LYS G 3 64  ? 94.713  68.579  34.451  1.00 148.93 ? 64  LYS A O     1 
ATOM 1806 C CB    . LYS G 3 64  ? 91.379  69.252  34.105  1.00 154.39 ? 64  LYS A CB    1 
ATOM 1807 C CG    . LYS G 3 64  ? 91.279  67.732  34.249  1.00 157.52 ? 64  LYS A CG    1 
ATOM 1808 C CD    . LYS G 3 64  ? 90.487  67.090  33.132  1.00 159.80 ? 64  LYS A CD    1 
ATOM 1809 C CE    . LYS G 3 64  ? 90.360  65.597  33.359  1.00 162.74 ? 64  LYS A CE    1 
ATOM 1810 N NZ    . LYS G 3 64  ? 89.873  64.915  32.131  1.00 169.41 ? 64  LYS A NZ    1 
ATOM 1811 N N     . LYS G 3 65  ? 93.802  69.502  32.566  1.00 151.23 ? 65  LYS A N     1 
ATOM 1812 C CA    . LYS G 3 65  ? 94.857  69.123  31.624  1.00 149.52 ? 65  LYS A CA    1 
ATOM 1813 C C     . LYS G 3 65  ? 95.281  70.297  30.758  1.00 142.75 ? 65  LYS A C     1 
ATOM 1814 O O     . LYS G 3 65  ? 94.708  71.393  30.854  1.00 131.60 ? 65  LYS A O     1 
ATOM 1815 C CB    . LYS G 3 65  ? 94.402  67.959  30.739  1.00 151.90 ? 65  LYS A CB    1 
ATOM 1816 C CG    . LYS G 3 65  ? 93.003  68.130  30.141  1.00 159.32 ? 65  LYS A CG    1 
ATOM 1817 C CD    . LYS G 3 65  ? 92.410  66.790  29.654  1.00 156.82 ? 65  LYS A CD    1 
ATOM 1818 C CE    . LYS G 3 65  ? 90.918  66.932  29.309  1.00 160.21 ? 65  LYS A CE    1 
ATOM 1819 N NZ    . LYS G 3 65  ? 90.274  65.622  28.999  1.00 163.68 ? 65  LYS A NZ    1 
ATOM 1820 N N     . LEU G 3 66  ? 96.272  70.027  29.897  1.00 148.00 ? 66  LEU A N     1 
ATOM 1821 C CA    . LEU G 3 66  ? 96.873  71.001  28.932  1.00 147.51 ? 66  LEU A CA    1 
ATOM 1822 C C     . LEU G 3 66  ? 95.983  71.712  27.897  1.00 144.75 ? 66  LEU A C     1 
ATOM 1823 O O     . LEU G 3 66  ? 96.230  72.869  27.554  1.00 141.05 ? 66  LEU A O     1 
ATOM 1824 C CB    . LEU G 3 66  ? 98.055  70.387  28.181  1.00 140.15 ? 66  LEU A CB    1 
ATOM 1825 C CG    . LEU G 3 66  ? 99.270  71.298  28.365  1.00 130.70 ? 66  LEU A CG    1 
ATOM 1826 C CD1   . LEU G 3 66  ? 100.467 70.776  27.586  1.00 129.73 ? 66  LEU A CD1   1 
ATOM 1827 C CD2   . LEU G 3 66  ? 98.958  72.769  28.030  1.00 95.73  ? 66  LEU A CD2   1 
ATOM 1828 N N     . ASP G 3 67  ? 94.980  71.017  27.385  1.00 147.72 ? 67  ASP A N     1 
ATOM 1829 C CA    . ASP G 3 67  ? 94.041  71.641  26.468  1.00 155.67 ? 67  ASP A CA    1 
ATOM 1830 C C     . ASP G 3 67  ? 93.138  72.643  27.162  1.00 155.02 ? 67  ASP A C     1 
ATOM 1831 O O     . ASP G 3 67  ? 92.647  73.578  26.526  1.00 158.36 ? 67  ASP A O     1 
ATOM 1832 C CB    . ASP G 3 67  ? 93.178  70.583  25.786  1.00 161.74 ? 67  ASP A CB    1 
ATOM 1833 C CG    . ASP G 3 67  ? 92.528  69.645  26.776  1.00 171.52 ? 67  ASP A CG    1 
ATOM 1834 O OD1   . ASP G 3 67  ? 92.972  68.474  26.852  1.00 180.58 ? 67  ASP A OD1   1 
ATOM 1835 O OD2   . ASP G 3 67  ? 91.597  70.083  27.487  1.00 170.42 ? 67  ASP A OD2   1 
ATOM 1836 N N     . ARG G 3 68  ? 92.927  72.452  28.460  1.00 152.12 ? 68  ARG A N     1 
ATOM 1837 C CA    . ARG G 3 68  ? 91.840  73.135  29.141  1.00 152.06 ? 68  ARG A CA    1 
ATOM 1838 C C     . ARG G 3 68  ? 92.070  74.602  29.416  1.00 148.69 ? 68  ARG A C     1 
ATOM 1839 O O     . ARG G 3 68  ? 91.114  75.359  29.612  1.00 145.39 ? 68  ARG A O     1 
ATOM 1840 C CB    . ARG G 3 68  ? 91.424  72.390  30.403  1.00 156.19 ? 68  ARG A CB    1 
ATOM 1841 C CG    . ARG G 3 68  ? 90.361  71.346  30.146  1.00 162.16 ? 68  ARG A CG    1 
ATOM 1842 C CD    . ARG G 3 68  ? 89.148  71.960  29.475  1.00 166.71 ? 68  ARG A CD    1 
ATOM 1843 N NE    . ARG G 3 68  ? 88.627  71.086  28.427  1.00 176.30 ? 68  ARG A NE    1 
ATOM 1844 C CZ    . ARG G 3 68  ? 89.015  71.106  27.153  1.00 178.17 ? 68  ARG A CZ    1 
ATOM 1845 N NH1   . ARG G 3 68  ? 89.946  71.956  26.733  1.00 173.36 ? 68  ARG A NH1   1 
ATOM 1846 N NH2   . ARG G 3 68  ? 88.473  70.259  26.289  1.00 184.51 ? 68  ARG A NH2   1 
ATOM 1847 N N     . LEU G 3 69  ? 93.331  75.007  29.418  1.00 149.93 ? 69  LEU A N     1 
ATOM 1848 C CA    . LEU G 3 69  ? 93.654  76.418  29.542  1.00 154.52 ? 69  LEU A CA    1 
ATOM 1849 C C     . LEU G 3 69  ? 93.314  77.118  28.227  1.00 159.74 ? 69  LEU A C     1 
ATOM 1850 O O     . LEU G 3 69  ? 92.363  77.893  28.147  1.00 159.68 ? 69  LEU A O     1 
ATOM 1851 C CB    . LEU G 3 69  ? 95.136  76.594  29.909  1.00 153.13 ? 69  LEU A CB    1 
ATOM 1852 C CG    . LEU G 3 69  ? 95.736  77.989  30.131  1.00 151.34 ? 69  LEU A CG    1 
ATOM 1853 C CD1   . LEU G 3 69  ? 94.726  79.048  30.583  1.00 148.11 ? 69  LEU A CD1   1 
ATOM 1854 C CD2   . LEU G 3 69  ? 96.865  77.872  31.138  1.00 156.38 ? 69  LEU A CD2   1 
ATOM 1855 N N     . GLY G 3 70  ? 94.096  76.817  27.198  1.00 164.64 ? 70  GLY A N     1 
ATOM 1856 C CA    . GLY G 3 70  ? 93.929  77.416  25.890  1.00 164.99 ? 70  GLY A CA    1 
ATOM 1857 C C     . GLY G 3 70  ? 93.965  76.359  24.807  1.00 165.37 ? 70  GLY A C     1 
ATOM 1858 O O     . GLY G 3 70  ? 94.640  75.316  24.933  1.00 159.49 ? 70  GLY A O     1 
ATOM 1859 N N     . ARG G 3 71  ? 93.226  76.646  23.738  1.00 165.54 ? 71  ARG A N     1 
ATOM 1860 C CA    . ARG G 3 71  ? 93.136  75.770  22.587  1.00 162.49 ? 71  ARG A CA    1 
ATOM 1861 C C     . ARG G 3 71  ? 94.318  76.022  21.647  1.00 159.92 ? 71  ARG A C     1 
ATOM 1862 O O     . ARG G 3 71  ? 94.910  75.084  21.101  1.00 158.85 ? 71  ARG A O     1 
ATOM 1863 C CB    . ARG G 3 71  ? 91.804  76.014  21.871  1.00 162.41 ? 71  ARG A CB    1 
ATOM 1864 C CG    . ARG G 3 71  ? 91.489  75.064  20.720  1.00 171.68 ? 71  ARG A CG    1 
ATOM 1865 C CD    . ARG G 3 71  ? 91.140  73.667  21.205  1.00 178.62 ? 71  ARG A CD    1 
ATOM 1866 N NE    . ARG G 3 71  ? 90.633  72.829  20.120  1.00 185.08 ? 71  ARG A NE    1 
ATOM 1867 C CZ    . ARG G 3 71  ? 90.289  71.550  20.252  1.00 189.19 ? 71  ARG A CZ    1 
ATOM 1868 N NH1   . ARG G 3 71  ? 90.398  70.942  21.431  1.00 190.97 ? 71  ARG A NH1   1 
ATOM 1869 N NH2   . ARG G 3 71  ? 89.836  70.875  19.201  1.00 190.12 ? 71  ARG A NH2   1 
ATOM 1870 N N     . ASP G 3 72  ? 94.669  77.295  21.487  1.00 156.49 ? 72  ASP A N     1 
ATOM 1871 C CA    . ASP G 3 72  ? 95.604  77.720  20.449  1.00 152.95 ? 72  ASP A CA    1 
ATOM 1872 C C     . ASP G 3 72  ? 96.972  77.996  21.040  1.00 150.07 ? 72  ASP A C     1 
ATOM 1873 O O     . ASP G 3 72  ? 97.154  78.979  21.766  1.00 149.31 ? 72  ASP A O     1 
ATOM 1874 C CB    . ASP G 3 72  ? 95.047  78.965  19.742  1.00 152.83 ? 72  ASP A CB    1 
ATOM 1875 C CG    . ASP G 3 72  ? 95.957  79.495  18.655  1.00 149.12 ? 72  ASP A CG    1 
ATOM 1876 O OD1   . ASP G 3 72  ? 97.173  79.204  18.670  1.00 148.16 ? 72  ASP A OD1   1 
ATOM 1877 O OD2   . ASP G 3 72  ? 95.438  80.223  17.784  1.00 149.37 ? 72  ASP A OD2   1 
ATOM 1878 N N     . THR G 3 73  ? 97.936  77.142  20.696  1.00 148.87 ? 73  THR A N     1 
ATOM 1879 C CA    . THR G 3 73  ? 99.260  77.181  21.330  1.00 149.82 ? 73  THR A CA    1 
ATOM 1880 C C     . THR G 3 73  ? 99.774  78.610  21.446  1.00 150.09 ? 73  THR A C     1 
ATOM 1881 O O     . THR G 3 73  ? 100.298 79.001  22.486  1.00 153.14 ? 73  THR A O     1 
ATOM 1882 C CB    . THR G 3 73  ? 100.310 76.263  20.625  1.00 148.34 ? 73  THR A CB    1 
ATOM 1883 O OG1   . THR G 3 73  ? 99.858  74.902  20.641  1.00 143.00 ? 73  THR A OG1   1 
ATOM 1884 C CG2   . THR G 3 73  ? 101.659 76.320  21.345  1.00 145.80 ? 73  THR A CG2   1 
ATOM 1885 N N     . ALA G 3 74  ? 99.568  79.392  20.393  1.00 148.25 ? 74  ALA A N     1 
ATOM 1886 C CA    . ALA G 3 74  ? 100.069 80.755  20.334  1.00 149.47 ? 74  ALA A CA    1 
ATOM 1887 C C     . ALA G 3 74  ? 99.806  81.551  21.604  1.00 148.19 ? 74  ALA A C     1 
ATOM 1888 O O     . ALA G 3 74  ? 100.736 82.109  22.177  1.00 148.18 ? 74  ALA A O     1 
ATOM 1889 C CB    . ALA G 3 74  ? 99.508  81.481  19.114  1.00 153.72 ? 74  ALA A CB    1 
ATOM 1890 N N     . ASP G 3 75  ? 98.558  81.601  22.055  1.00 148.63 ? 75  ASP A N     1 
ATOM 1891 C CA    . ASP G 3 75  ? 98.264  82.409  23.236  1.00 155.38 ? 75  ASP A CA    1 
ATOM 1892 C C     . ASP G 3 75  ? 98.231  81.629  24.555  1.00 157.59 ? 75  ASP A C     1 
ATOM 1893 O O     . ASP G 3 75  ? 98.267  82.218  25.639  1.00 156.29 ? 75  ASP A O     1 
ATOM 1894 C CB    . ASP G 3 75  ? 97.015  83.269  23.034  1.00 157.87 ? 75  ASP A CB    1 
ATOM 1895 C CG    . ASP G 3 75  ? 95.839  82.474  22.555  1.00 165.86 ? 75  ASP A CG    1 
ATOM 1896 O OD1   . ASP G 3 75  ? 95.378  81.584  23.307  1.00 176.31 ? 75  ASP A OD1   1 
ATOM 1897 O OD2   . ASP G 3 75  ? 95.372  82.752  21.430  1.00 172.56 ? 75  ASP A OD2   1 
ATOM 1898 N N     . MET G 3 76  ? 98.194  80.302  24.458  1.00 160.18 ? 76  MET A N     1 
ATOM 1899 C CA    . MET G 3 76  ? 98.451  79.454  25.612  1.00 161.49 ? 76  MET A CA    1 
ATOM 1900 C C     . MET G 3 76  ? 99.694  79.991  26.308  1.00 159.33 ? 76  MET A C     1 
ATOM 1901 O O     . MET G 3 76  ? 99.789  79.981  27.533  1.00 158.48 ? 76  MET A O     1 
ATOM 1902 C CB    . MET G 3 76  ? 98.692  78.000  25.190  1.00 163.21 ? 76  MET A CB    1 
ATOM 1903 C CG    . MET G 3 76  ? 98.043  76.959  26.131  1.00 172.24 ? 76  MET A CG    1 
ATOM 1904 S SD    . MET G 3 76  ? 98.508  76.983  27.898  1.00 158.30 ? 76  MET A SD    1 
ATOM 1905 C CE    . MET G 3 76  ? 99.456  75.498  28.021  1.00 139.48 ? 76  MET A CE    1 
ATOM 1906 N N     . ILE G 3 77  ? 100.638 80.474  25.509  1.00 157.82 ? 77  ILE A N     1 
ATOM 1907 C CA    . ILE G 3 77  ? 101.858 81.052  26.034  1.00 160.80 ? 77  ILE A CA    1 
ATOM 1908 C C     . ILE G 3 77  ? 101.572 82.419  26.615  1.00 161.41 ? 77  ILE A C     1 
ATOM 1909 O O     . ILE G 3 77  ? 101.948 82.710  27.751  1.00 160.84 ? 77  ILE A O     1 
ATOM 1910 C CB    . ILE G 3 77  ? 102.934 81.238  24.949  1.00 162.12 ? 77  ILE A CB    1 
ATOM 1911 C CG1   . ILE G 3 77  ? 102.777 80.223  23.809  1.00 167.27 ? 77  ILE A CG1   1 
ATOM 1912 C CG2   . ILE G 3 77  ? 104.328 81.211  25.578  1.00 166.67 ? 77  ILE A CG2   1 
ATOM 1913 C CD1   . ILE G 3 77  ? 102.721 78.754  24.230  1.00 175.61 ? 77  ILE A CD1   1 
ATOM 1914 N N     . GLN G 3 78  ? 100.907 83.259  25.828  1.00 161.52 ? 78  GLN A N     1 
ATOM 1915 C CA    . GLN G 3 78  ? 100.669 84.627  26.242  1.00 162.35 ? 78  GLN A CA    1 
ATOM 1916 C C     . GLN G 3 78  ? 100.178 84.645  27.678  1.00 164.65 ? 78  GLN A C     1 
ATOM 1917 O O     . GLN G 3 78  ? 100.704 85.390  28.499  1.00 166.84 ? 78  GLN A O     1 
ATOM 1918 C CB    . GLN G 3 78  ? 99.688  85.335  25.309  1.00 160.25 ? 78  GLN A CB    1 
ATOM 1919 C CG    . GLN G 3 78  ? 99.969  86.819  25.174  1.00 162.46 ? 78  GLN A CG    1 
ATOM 1920 C CD    . GLN G 3 78  ? 101.322 87.119  24.521  1.00 167.89 ? 78  GLN A CD    1 
ATOM 1921 O OE1   . GLN G 3 78  ? 102.083 86.211  24.181  1.00 167.28 ? 78  GLN A OE1   1 
ATOM 1922 N NE2   . GLN G 3 78  ? 101.619 88.404  24.340  1.00 171.78 ? 78  GLN A NE2   1 
ATOM 1923 N N     . LEU G 3 79  ? 99.203  83.788  27.977  1.00 165.31 ? 79  LEU A N     1 
ATOM 1924 C CA    . LEU G 3 79  ? 98.659  83.661  29.323  1.00 168.59 ? 79  LEU A CA    1 
ATOM 1925 C C     . LEU G 3 79  ? 99.783  83.397  30.307  1.00 168.38 ? 79  LEU A C     1 
ATOM 1926 O O     . LEU G 3 79  ? 100.043 84.213  31.187  1.00 169.83 ? 79  LEU A O     1 
ATOM 1927 C CB    . LEU G 3 79  ? 97.628  82.533  29.388  1.00 172.00 ? 79  LEU A CB    1 
ATOM 1928 C CG    . LEU G 3 79  ? 96.495  82.593  28.358  1.00 186.19 ? 79  LEU A CG    1 
ATOM 1929 C CD1   . LEU G 3 79  ? 95.879  81.210  28.152  1.00 193.47 ? 79  LEU A CD1   1 
ATOM 1930 C CD2   . LEU G 3 79  ? 95.423  83.642  28.716  1.00 187.71 ? 79  LEU A CD2   1 
ATOM 1931 N N     . ILE G 3 80  ? 100.458 82.265  30.125  1.00 166.62 ? 80  ILE A N     1 
ATOM 1932 C CA    . ILE G 3 80  ? 101.603 81.869  30.942  1.00 164.56 ? 80  ILE A CA    1 
ATOM 1933 C C     . ILE G 3 80  ? 102.608 83.015  31.106  1.00 165.36 ? 80  ILE A C     1 
ATOM 1934 O O     . ILE G 3 80  ? 103.011 83.332  32.227  1.00 166.25 ? 80  ILE A O     1 
ATOM 1935 C CB    . ILE G 3 80  ? 102.292 80.621  30.340  1.00 163.69 ? 80  ILE A CB    1 
ATOM 1936 C CG1   . ILE G 3 80  ? 101.299 79.461  30.281  1.00 165.43 ? 80  ILE A CG1   1 
ATOM 1937 C CG2   . ILE G 3 80  ? 103.534 80.227  31.135  1.00 158.09 ? 80  ILE A CG2   1 
ATOM 1938 C CD1   . ILE G 3 80  ? 101.758 78.289  29.447  1.00 172.38 ? 80  ILE A CD1   1 
ATOM 1939 N N     . LYS G 3 81  ? 102.997 83.640  29.995  1.00 164.34 ? 81  LYS A N     1 
ATOM 1940 C CA    . LYS G 3 81  ? 103.944 84.752  30.034  1.00 163.07 ? 81  LYS A CA    1 
ATOM 1941 C C     . LYS G 3 81  ? 103.407 85.853  30.946  1.00 163.60 ? 81  LYS A C     1 
ATOM 1942 O O     . LYS G 3 81  ? 104.030 86.194  31.955  1.00 162.37 ? 81  LYS A O     1 
ATOM 1943 C CB    . LYS G 3 81  ? 104.231 85.280  28.624  1.00 161.18 ? 81  LYS A CB    1 
ATOM 1944 C CG    . LYS G 3 81  ? 105.284 86.376  28.572  1.00 155.50 ? 81  LYS A CG    1 
ATOM 1945 C CD    . LYS G 3 81  ? 105.812 86.561  27.167  1.00 153.06 ? 81  LYS A CD    1 
ATOM 1946 C CE    . LYS G 3 81  ? 106.403 87.945  26.971  1.00 154.03 ? 81  LYS A CE    1 
ATOM 1947 N NZ    . LYS G 3 81  ? 105.348 88.974  26.759  1.00 153.98 ? 81  LYS A NZ    1 
ATOM 1948 N N     . GLU G 3 82  ? 102.230 86.372  30.595  1.00 165.59 ? 82  GLU A N     1 
ATOM 1949 C CA    . GLU G 3 82  ? 101.529 87.378  31.394  1.00 167.08 ? 82  GLU A CA    1 
ATOM 1950 C C     . GLU G 3 82  ? 101.336 86.893  32.826  1.00 164.72 ? 82  GLU A C     1 
ATOM 1951 O O     . GLU G 3 82  ? 101.356 87.682  33.771  1.00 166.06 ? 82  GLU A O     1 
ATOM 1952 C CB    . GLU G 3 82  ? 100.174 87.730  30.759  1.00 167.24 ? 82  GLU A CB    1 
ATOM 1953 C CG    . GLU G 3 82  ? 100.276 88.624  29.512  1.00 170.45 ? 82  GLU A CG    1 
ATOM 1954 C CD    . GLU G 3 82  ? 98.980  88.704  28.704  1.00 170.09 ? 82  GLU A CD    1 
ATOM 1955 O OE1   . GLU G 3 82  ? 98.265  87.682  28.602  1.00 174.72 ? 82  GLU A OE1   1 
ATOM 1956 O OE2   . GLU G 3 82  ? 98.686  89.791  28.154  1.00 171.67 ? 82  GLU A OE2   1 
ATOM 1957 N N     . PHE G 3 83  ? 101.172 85.584  32.971  1.00 161.48 ? 83  PHE A N     1 
ATOM 1958 C CA    . PHE G 3 83  ? 100.942 84.961  34.267  1.00 161.28 ? 83  PHE A CA    1 
ATOM 1959 C C     . PHE G 3 83  ? 102.206 84.921  35.127  1.00 161.73 ? 83  PHE A C     1 
ATOM 1960 O O     . PHE G 3 83  ? 102.179 85.291  36.308  1.00 159.98 ? 83  PHE A O     1 
ATOM 1961 C CB    . PHE G 3 83  ? 100.348 83.554  34.075  1.00 158.38 ? 83  PHE A CB    1 
ATOM 1962 C CG    . PHE G 3 83  ? 98.835  83.514  34.098  1.00 149.78 ? 83  PHE A CG    1 
ATOM 1963 C CD1   . PHE G 3 83  ? 98.172  82.318  34.311  1.00 139.95 ? 83  PHE A CD1   1 
ATOM 1964 C CD2   . PHE G 3 83  ? 98.080  84.669  33.943  1.00 149.58 ? 83  PHE A CD2   1 
ATOM 1965 C CE1   . PHE G 3 83  ? 96.798  82.258  34.347  1.00 129.46 ? 83  PHE A CE1   1 
ATOM 1966 C CE2   . PHE G 3 83  ? 96.698  84.617  33.983  1.00 145.86 ? 83  PHE A CE2   1 
ATOM 1967 C CZ    . PHE G 3 83  ? 96.060  83.408  34.183  1.00 140.90 ? 83  PHE A CZ    1 
ATOM 1968 N N     . ASP G 3 84  ? 103.310 84.486  34.525  1.00 162.71 ? 84  ASP A N     1 
ATOM 1969 C CA    . ASP G 3 84  ? 104.584 84.439  35.220  1.00 164.53 ? 84  ASP A CA    1 
ATOM 1970 C C     . ASP G 3 84  ? 105.057 85.844  35.557  1.00 166.25 ? 84  ASP A C     1 
ATOM 1971 O O     . ASP G 3 84  ? 105.777 86.043  36.536  1.00 167.68 ? 84  ASP A O     1 
ATOM 1972 C CB    . ASP G 3 84  ? 105.637 83.717  34.388  1.00 164.92 ? 84  ASP A CB    1 
ATOM 1973 C CG    . ASP G 3 84  ? 106.980 83.645  35.091  1.00 169.70 ? 84  ASP A CG    1 
ATOM 1974 O OD1   . ASP G 3 84  ? 107.781 84.598  34.958  1.00 168.65 ? 84  ASP A OD1   1 
ATOM 1975 O OD2   . ASP G 3 84  ? 107.236 82.633  35.778  1.00 175.63 ? 84  ASP A OD2   1 
ATOM 1976 N N     . ALA G 3 85  ? 104.648 86.813  34.743  1.00 167.26 ? 85  ALA A N     1 
ATOM 1977 C CA    . ALA G 3 85  ? 104.972 88.213  34.990  1.00 168.98 ? 85  ALA A CA    1 
ATOM 1978 C C     . ALA G 3 85  ? 104.401 88.683  36.328  1.00 169.44 ? 85  ALA A C     1 
ATOM 1979 O O     . ALA G 3 85  ? 105.060 89.422  37.072  1.00 169.17 ? 85  ALA A O     1 
ATOM 1980 C CB    . ALA G 3 85  ? 104.462 89.080  33.853  1.00 170.05 ? 85  ALA A CB    1 
ATOM 1981 N N     . GLN G 3 86  ? 103.181 88.237  36.628  1.00 169.31 ? 86  GLN A N     1 
ATOM 1982 C CA    . GLN G 3 86  ? 102.497 88.595  37.870  1.00 168.77 ? 86  GLN A CA    1 
ATOM 1983 C C     . GLN G 3 86  ? 103.011 87.787  39.052  1.00 166.05 ? 86  GLN A C     1 
ATOM 1984 O O     . GLN G 3 86  ? 103.019 88.266  40.185  1.00 165.76 ? 86  GLN A O     1 
ATOM 1985 C CB    . GLN G 3 86  ? 100.983 88.417  37.729  1.00 169.89 ? 86  GLN A CB    1 
ATOM 1986 C CG    . GLN G 3 86  ? 100.325 89.430  36.794  1.00 174.81 ? 86  GLN A CG    1 
ATOM 1987 C CD    . GLN G 3 86  ? 98.874  89.713  37.145  1.00 177.15 ? 86  GLN A CD    1 
ATOM 1988 O OE1   . GLN G 3 86  ? 98.155  88.836  37.627  1.00 177.04 ? 86  GLN A OE1   1 
ATOM 1989 N NE2   . GLN G 3 86  ? 98.435  90.949  36.902  1.00 178.79 ? 86  GLN A NE2   1 
ATOM 1990 N N     . GLY G 3 87  ? 103.441 86.562  38.777  1.00 163.37 ? 87  GLY A N     1 
ATOM 1991 C CA    . GLY G 3 87  ? 103.934 85.668  39.811  1.00 161.00 ? 87  GLY A CA    1 
ATOM 1992 C C     . GLY G 3 87  ? 102.924 84.585  40.110  1.00 158.95 ? 87  GLY A C     1 
ATOM 1993 O O     . GLY G 3 87  ? 102.913 84.014  41.199  1.00 159.90 ? 87  GLY A O     1 
ATOM 1994 N N     . VAL G 3 88  ? 102.068 84.302  39.138  1.00 156.98 ? 88  VAL A N     1 
ATOM 1995 C CA    . VAL G 3 88  ? 101.072 83.257  39.312  1.00 156.95 ? 88  VAL A CA    1 
ATOM 1996 C C     . VAL G 3 88  ? 101.422 82.017  38.504  1.00 153.35 ? 88  VAL A C     1 
ATOM 1997 O O     . VAL G 3 88  ? 101.864 82.112  37.360  1.00 155.55 ? 88  VAL A O     1 
ATOM 1998 C CB    . VAL G 3 88  ? 99.636  83.743  38.994  1.00 159.84 ? 88  VAL A CB    1 
ATOM 1999 C CG1   . VAL G 3 88  ? 99.308  84.992  39.802  1.00 163.59 ? 88  VAL A CG1   1 
ATOM 2000 C CG2   . VAL G 3 88  ? 99.449  84.004  37.508  1.00 158.65 ? 88  VAL A CG2   1 
ATOM 2001 N N     . SER G 3 89  ? 101.222 80.860  39.121  1.00 146.94 ? 89  SER A N     1 
ATOM 2002 C CA    . SER G 3 89  ? 101.539 79.587  38.512  1.00 142.05 ? 89  SER A CA    1 
ATOM 2003 C C     . SER G 3 89  ? 100.277 78.733  38.327  1.00 146.79 ? 89  SER A C     1 
ATOM 2004 O O     . SER G 3 89  ? 99.451  78.643  39.236  1.00 144.33 ? 89  SER A O     1 
ATOM 2005 C CB    . SER G 3 89  ? 102.597 78.871  39.349  1.00 135.74 ? 89  SER A CB    1 
ATOM 2006 O OG    . SER G 3 89  ? 102.541 77.455  39.172  1.00 126.51 ? 89  SER A OG    1 
ATOM 2007 N N     . ILE G 3 90  ? 100.132 78.146  37.129  1.00 153.23 ? 90  ILE A N     1 
ATOM 2008 C CA    . ILE G 3 90  ? 99.051  77.196  36.794  1.00 157.28 ? 90  ILE A CA    1 
ATOM 2009 C C     . ILE G 3 90  ? 99.613  75.814  36.538  1.00 156.47 ? 90  ILE A C     1 
ATOM 2010 O O     . ILE G 3 90  ? 100.536 75.648  35.737  1.00 158.93 ? 90  ILE A O     1 
ATOM 2011 C CB    . ILE G 3 90  ? 98.272  77.554  35.501  1.00 161.30 ? 90  ILE A CB    1 
ATOM 2012 C CG1   . ILE G 3 90  ? 98.469  79.011  35.087  1.00 162.25 ? 90  ILE A CG1   1 
ATOM 2013 C CG2   . ILE G 3 90  ? 96.800  77.168  35.628  1.00 165.32 ? 90  ILE A CG2   1 
ATOM 2014 C CD1   . ILE G 3 90  ? 99.539  79.179  34.027  1.00 163.39 ? 90  ILE A CD1   1 
ATOM 2015 N N     . ARG G 3 91  ? 99.024  74.820  37.190  1.00 155.24 ? 91  ARG A N     1 
ATOM 2016 C CA    . ARG G 3 91  ? 99.500  73.437  37.109  1.00 154.34 ? 91  ARG A CA    1 
ATOM 2017 C C     . ARG G 3 91  ? 98.581  72.624  36.181  1.00 146.16 ? 91  ARG A C     1 
ATOM 2018 O O     . ARG G 3 91  ? 97.394  72.963  36.008  1.00 142.31 ? 91  ARG A O     1 
ATOM 2019 C CB    . ARG G 3 91  ? 99.625  72.850  38.537  1.00 157.55 ? 91  ARG A CB    1 
ATOM 2020 C CG    . ARG G 3 91  ? 99.427  71.339  38.701  1.00 166.50 ? 91  ARG A CG    1 
ATOM 2021 C CD    . ARG G 3 91  ? 100.724 70.623  39.024  1.00 179.02 ? 91  ARG A CD    1 
ATOM 2022 N NE    . ARG G 3 91  ? 100.513 69.193  39.248  1.00 190.01 ? 91  ARG A NE    1 
ATOM 2023 C CZ    . ARG G 3 91  ? 101.479 68.317  39.529  1.00 198.75 ? 91  ARG A CZ    1 
ATOM 2024 N NH1   . ARG G 3 91  ? 102.747 68.712  39.623  1.00 201.00 ? 91  ARG A NH1   1 
ATOM 2025 N NH2   . ARG G 3 91  ? 101.181 67.036  39.715  1.00 203.76 ? 91  ARG A NH2   1 
ATOM 2026 N N     . PHE G 3 92  ? 99.145  71.597  35.548  1.00 139.78 ? 92  PHE A N     1 
ATOM 2027 C CA    . PHE G 3 92  ? 98.374  70.763  34.623  1.00 142.50 ? 92  PHE A CA    1 
ATOM 2028 C C     . PHE G 3 92  ? 98.163  69.389  35.240  1.00 147.86 ? 92  PHE A C     1 
ATOM 2029 O O     . PHE G 3 92  ? 98.872  68.428  34.913  1.00 152.45 ? 92  PHE A O     1 
ATOM 2030 C CB    . PHE G 3 92  ? 98.933  70.812  33.136  1.00 140.54 ? 92  PHE A CB    1 
ATOM 2031 C CG    . PHE G 3 92  ? 98.685  72.143  32.496  1.00 117.77 ? 92  PHE A CG    1 
ATOM 2032 C CD1   . PHE G 3 92  ? 99.620  73.181  32.627  1.00 107.96 ? 92  PHE A CD1   1 
ATOM 2033 C CD2   . PHE G 3 92  ? 97.431  72.422  31.950  1.00 106.32 ? 92  PHE A CD2   1 
ATOM 2034 C CE1   . PHE G 3 92  ? 99.320  74.482  32.191  1.00 112.92 ? 92  PHE A CE1   1 
ATOM 2035 C CE2   . PHE G 3 92  ? 97.106  73.718  31.511  1.00 120.21 ? 92  PHE A CE2   1 
ATOM 2036 C CZ    . PHE G 3 92  ? 98.062  74.753  31.627  1.00 124.81 ? 92  PHE A CZ    1 
ATOM 2037 N N     . ILE G 3 93  ? 97.176  69.324  36.141  1.00 147.25 ? 93  ILE A N     1 
ATOM 2038 C CA    . ILE G 3 93  ? 96.948  68.160  37.031  1.00 149.49 ? 93  ILE A CA    1 
ATOM 2039 C C     . ILE G 3 93  ? 97.134  66.782  36.384  1.00 149.23 ? 93  ILE A C     1 
ATOM 2040 O O     . ILE G 3 93  ? 97.628  65.852  37.023  1.00 144.11 ? 93  ILE A O     1 
ATOM 2041 C CB    . ILE G 3 93  ? 95.554  68.221  37.703  1.00 149.66 ? 93  ILE A CB    1 
ATOM 2042 C CG1   . ILE G 3 93  ? 95.565  69.183  38.888  1.00 148.21 ? 93  ILE A CG1   1 
ATOM 2043 C CG2   . ILE G 3 93  ? 95.109  66.855  38.192  1.00 158.22 ? 93  ILE A CG2   1 
ATOM 2044 C CD1   . ILE G 3 93  ? 94.752  70.424  38.650  1.00 150.94 ? 93  ILE A CD1   1 
ATOM 2045 N N     . ASP G 3 94  ? 96.721  66.670  35.124  1.00 154.65 ? 94  ASP A N     1 
ATOM 2046 C CA    . ASP G 3 94  ? 96.843  65.439  34.351  1.00 159.52 ? 94  ASP A CA    1 
ATOM 2047 C C     . ASP G 3 94  ? 98.246  65.253  33.799  1.00 160.98 ? 94  ASP A C     1 
ATOM 2048 O O     . ASP G 3 94  ? 98.728  64.117  33.664  1.00 155.53 ? 94  ASP A O     1 
ATOM 2049 C CB    . ASP G 3 94  ? 95.836  65.444  33.203  1.00 161.26 ? 94  ASP A CB    1 
ATOM 2050 C CG    . ASP G 3 94  ? 94.413  65.232  33.679  1.00 164.69 ? 94  ASP A CG    1 
ATOM 2051 O OD1   . ASP G 3 94  ? 93.580  66.144  33.492  1.00 157.03 ? 94  ASP A OD1   1 
ATOM 2052 O OD2   . ASP G 3 94  ? 94.131  64.153  34.248  1.00 172.15 ? 94  ASP A OD2   1 
ATOM 2053 N N     . ASP G 3 95  ? 98.889  66.377  33.493  1.00 169.20 ? 95  ASP A N     1 
ATOM 2054 C CA    . ASP G 3 95  ? 100.204 66.386  32.868  1.00 173.40 ? 95  ASP A CA    1 
ATOM 2055 C C     . ASP G 3 95  ? 101.331 66.502  33.893  1.00 175.20 ? 95  ASP A C     1 
ATOM 2056 O O     . ASP G 3 95  ? 102.431 65.977  33.682  1.00 175.45 ? 95  ASP A O     1 
ATOM 2057 C CB    . ASP G 3 95  ? 100.281 67.526  31.854  1.00 171.91 ? 95  ASP A CB    1 
ATOM 2058 C CG    . ASP G 3 95  ? 99.286  67.365  30.721  1.00 170.69 ? 95  ASP A CG    1 
ATOM 2059 O OD1   . ASP G 3 95  ? 99.520  66.491  29.847  1.00 165.79 ? 95  ASP A OD1   1 
ATOM 2060 O OD2   . ASP G 3 95  ? 98.274  68.111  30.716  1.00 166.56 ? 95  ASP A OD2   1 
ATOM 2061 N N     . SER G 3 96  ? 101.037 67.187  34.998  1.00 175.51 ? 96  SER A N     1 
ATOM 2062 C CA    . SER G 3 96  ? 101.961 67.381  36.124  1.00 174.71 ? 96  SER A CA    1 
ATOM 2063 C C     . SER G 3 96  ? 103.142 68.290  35.782  1.00 174.18 ? 96  SER A C     1 
ATOM 2064 O O     . SER G 3 96  ? 104.300 67.917  35.989  1.00 175.07 ? 96  SER A O     1 
ATOM 2065 C CB    . SER G 3 96  ? 102.442 66.034  36.695  1.00 172.85 ? 96  SER A CB    1 
ATOM 2066 O OG    . SER G 3 96  ? 103.374 65.412  35.828  1.00 166.21 ? 96  SER A OG    1 
ATOM 2067 N N     . ILE G 3 97  ? 102.843 69.479  35.259  1.00 173.04 ? 97  ILE A N     1 
ATOM 2068 C CA    . ILE G 3 97  ? 103.884 70.462  34.945  1.00 173.72 ? 97  ILE A CA    1 
ATOM 2069 C C     . ILE G 3 97  ? 103.554 71.836  35.546  1.00 173.57 ? 97  ILE A C     1 
ATOM 2070 O O     . ILE G 3 97  ? 102.392 72.260  35.579  1.00 173.62 ? 97  ILE A O     1 
ATOM 2071 C CB    . ILE G 3 97  ? 104.192 70.590  33.397  1.00 174.23 ? 97  ILE A CB    1 
ATOM 2072 C CG1   . ILE G 3 97  ? 103.563 69.466  32.576  1.00 173.28 ? 97  ILE A CG1   1 
ATOM 2073 C CG2   . ILE G 3 97  ? 105.702 70.680  33.115  1.00 173.06 ? 97  ILE A CG2   1 
ATOM 2074 C CD1   . ILE G 3 97  ? 102.272 69.867  31.947  1.00 176.91 ? 97  ILE A CD1   1 
ATOM 2075 N N     . ASP G 3 98  ? 104.603 72.518  36.006  1.00 170.82 ? 98  ASP A N     1 
ATOM 2076 C CA    . ASP G 3 98  ? 104.511 73.805  36.701  1.00 168.83 ? 98  ASP A CA    1 
ATOM 2077 C C     . ASP G 3 98  ? 104.901 75.013  35.843  1.00 162.84 ? 98  ASP A C     1 
ATOM 2078 O O     . ASP G 3 98  ? 106.075 75.175  35.510  1.00 167.84 ? 98  ASP A O     1 
ATOM 2079 C CB    . ASP G 3 98  ? 105.435 73.784  37.933  1.00 172.40 ? 98  ASP A CB    1 
ATOM 2080 C CG    . ASP G 3 98  ? 104.717 73.370  39.218  1.00 183.88 ? 98  ASP A CG    1 
ATOM 2081 O OD1   . ASP G 3 98  ? 103.696 74.009  39.580  1.00 189.55 ? 98  ASP A OD1   1 
ATOM 2082 O OD2   . ASP G 3 98  ? 105.195 72.419  39.882  1.00 182.87 ? 98  ASP A OD2   1 
ATOM 2083 N N     . THR G 3 99  ? 103.934 75.868  35.511  1.00 151.02 ? 99  THR A N     1 
ATOM 2084 C CA    . THR G 3 99  ? 104.214 77.218  34.989  1.00 143.13 ? 99  THR A CA    1 
ATOM 2085 C C     . THR G 3 99  ? 105.387 77.924  35.680  1.00 144.22 ? 99  THR A C     1 
ATOM 2086 O O     . THR G 3 99  ? 105.986 78.850  35.119  1.00 139.98 ? 99  THR A O     1 
ATOM 2087 C CB    . THR G 3 99  ? 103.013 78.131  35.247  1.00 140.67 ? 99  THR A CB    1 
ATOM 2088 O OG1   . THR G 3 99  ? 101.839 77.584  34.638  1.00 140.85 ? 99  THR A OG1   1 
ATOM 2089 C CG2   . THR G 3 99  ? 103.264 79.552  34.748  1.00 137.47 ? 99  THR A CG2   1 
ATOM 2090 N N     . SER G 3 100 ? 105.693 77.480  36.905  1.00 149.62 ? 100 SER A N     1 
ATOM 2091 C CA    . SER G 3 100 ? 106.512 78.245  37.865  1.00 151.44 ? 100 SER A CA    1 
ATOM 2092 C C     . SER G 3 100 ? 108.019 78.198  37.640  1.00 147.90 ? 100 SER A C     1 
ATOM 2093 O O     . SER G 3 100 ? 108.691 79.221  37.783  1.00 146.35 ? 100 SER A O     1 
ATOM 2094 C CB    . SER G 3 100 ? 106.155 77.898  39.327  1.00 153.09 ? 100 SER A CB    1 
ATOM 2095 O OG    . SER G 3 100 ? 106.374 76.531  39.635  1.00 157.40 ? 100 SER A OG    1 
ATOM 2096 N N     . SER G 3 101 ? 108.548 77.028  37.295  1.00 147.62 ? 101 SER A N     1 
ATOM 2097 C CA    . SER G 3 101 ? 109.964 76.920  36.932  1.00 150.14 ? 101 SER A CA    1 
ATOM 2098 C C     . SER G 3 101 ? 110.222 77.637  35.608  1.00 152.21 ? 101 SER A C     1 
ATOM 2099 O O     . SER G 3 101 ? 109.432 78.487  35.187  1.00 155.78 ? 101 SER A O     1 
ATOM 2100 C CB    . SER G 3 101 ? 110.424 75.448  36.853  1.00 149.94 ? 101 SER A CB    1 
ATOM 2101 O OG    . SER G 3 101 ? 109.397 74.566  36.415  1.00 144.58 ? 101 SER A OG    1 
ATOM 2102 N N     . ALA G 3 102 ? 111.343 77.324  34.974  1.00 150.43 ? 102 ALA A N     1 
ATOM 2103 C CA    . ALA G 3 102 ? 111.485 77.595  33.563  1.00 149.24 ? 102 ALA A CA    1 
ATOM 2104 C C     . ALA G 3 102 ? 111.032 76.304  32.922  1.00 147.95 ? 102 ALA A C     1 
ATOM 2105 O O     . ALA G 3 102 ? 109.892 76.204  32.456  1.00 143.47 ? 102 ALA A O     1 
ATOM 2106 C CB    . ALA G 3 102 ? 112.915 77.899  33.211  1.00 152.17 ? 102 ALA A CB    1 
ATOM 2107 N N     . MET G 3 103 ? 111.921 75.307  32.966  1.00 150.54 ? 103 MET A N     1 
ATOM 2108 C CA    . MET G 3 103 ? 111.680 73.956  32.442  1.00 153.29 ? 103 MET A CA    1 
ATOM 2109 C C     . MET G 3 103 ? 110.213 73.577  32.428  1.00 151.09 ? 103 MET A C     1 
ATOM 2110 O O     . MET G 3 103 ? 109.741 72.949  31.492  1.00 152.84 ? 103 MET A O     1 
ATOM 2111 C CB    . MET G 3 103 ? 112.443 72.921  33.264  1.00 155.99 ? 103 MET A CB    1 
ATOM 2112 C CG    . MET G 3 103 ? 113.937 73.060  33.182  1.00 168.59 ? 103 MET A CG    1 
ATOM 2113 S SD    . MET G 3 103 ? 114.555 72.572  31.566  1.00 184.05 ? 103 MET A SD    1 
ATOM 2114 C CE    . MET G 3 103 ? 114.244 70.804  31.603  1.00 184.71 ? 103 MET A CE    1 
ATOM 2115 N N     . GLY G 3 104 ? 109.503 73.956  33.483  1.00 146.81 ? 104 GLY A N     1 
ATOM 2116 C CA    . GLY G 3 104 ? 108.082 73.742  33.551  1.00 141.60 ? 104 GLY A CA    1 
ATOM 2117 C C     . GLY G 3 104 ? 107.441 74.377  32.352  1.00 139.63 ? 104 GLY A C     1 
ATOM 2118 O O     . GLY G 3 104 ? 107.104 73.665  31.399  1.00 143.33 ? 104 GLY A O     1 
ATOM 2119 N N     . ARG G 3 105 ? 107.306 75.711  32.377  1.00 137.54 ? 105 ARG A N     1 
ATOM 2120 C CA    . ARG G 3 105 ? 106.601 76.422  31.289  1.00 142.29 ? 105 ARG A CA    1 
ATOM 2121 C C     . ARG G 3 105 ? 107.179 76.085  29.922  1.00 142.24 ? 105 ARG A C     1 
ATOM 2122 O O     . ARG G 3 105 ? 106.446 75.765  28.983  1.00 144.22 ? 105 ARG A O     1 
ATOM 2123 C CB    . ARG G 3 105 ? 106.592 77.934  31.498  1.00 142.83 ? 105 ARG A CB    1 
ATOM 2124 C CG    . ARG G 3 105 ? 107.621 78.407  32.465  1.00 146.95 ? 105 ARG A CG    1 
ATOM 2125 C CD    . ARG G 3 105 ? 108.544 79.385  31.830  1.00 154.79 ? 105 ARG A CD    1 
ATOM 2126 N NE    . ARG G 3 105 ? 109.276 80.097  32.859  1.00 161.55 ? 105 ARG A NE    1 
ATOM 2127 C CZ    . ARG G 3 105 ? 108.968 81.319  33.257  1.00 168.77 ? 105 ARG A CZ    1 
ATOM 2128 N NH1   . ARG G 3 105 ? 107.957 81.957  32.683  1.00 172.50 ? 105 ARG A NH1   1 
ATOM 2129 N NH2   . ARG G 3 105 ? 109.677 81.905  34.212  1.00 177.57 ? 105 ARG A NH2   1 
ATOM 2130 N N     . MET G 3 106 ? 108.498 76.160  29.825  1.00 139.85 ? 106 MET A N     1 
ATOM 2131 C CA    . MET G 3 106 ? 109.193 75.630  28.682  1.00 136.35 ? 106 MET A CA    1 
ATOM 2132 C C     . MET G 3 106 ? 108.502 74.314  28.258  1.00 134.18 ? 106 MET A C     1 
ATOM 2133 O O     . MET G 3 106 ? 107.893 74.260  27.183  1.00 140.50 ? 106 MET A O     1 
ATOM 2134 C CB    . MET G 3 106 ? 110.663 75.467  29.042  1.00 136.64 ? 106 MET A CB    1 
ATOM 2135 C CG    . MET G 3 106 ? 111.548 74.972  27.945  1.00 142.90 ? 106 MET A CG    1 
ATOM 2136 S SD    . MET G 3 106 ? 111.938 73.259  28.286  1.00 158.48 ? 106 MET A SD    1 
ATOM 2137 C CE    . MET G 3 106 ? 113.611 73.121  27.660  1.00 144.94 ? 106 MET A CE    1 
ATOM 2138 N N     . VAL G 3 107 ? 108.514 73.286  29.105  1.00 126.59 ? 107 VAL A N     1 
ATOM 2139 C CA    . VAL G 3 107 ? 107.876 72.004  28.720  1.00 122.94 ? 107 VAL A CA    1 
ATOM 2140 C C     . VAL G 3 107 ? 106.338 72.036  28.694  1.00 119.81 ? 107 VAL A C     1 
ATOM 2141 O O     . VAL G 3 107 ? 105.713 71.099  28.214  1.00 119.49 ? 107 VAL A O     1 
ATOM 2142 C CB    . VAL G 3 107 ? 108.413 70.761  29.519  1.00 122.79 ? 107 VAL A CB    1 
ATOM 2143 C CG1   . VAL G 3 107 ? 107.655 69.484  29.169  1.00 112.56 ? 107 VAL A CG1   1 
ATOM 2144 C CG2   . VAL G 3 107 ? 109.868 70.545  29.225  1.00 118.05 ? 107 VAL A CG2   1 
ATOM 2145 N N     . VAL G 3 108 ? 105.715 73.095  29.187  1.00 120.19 ? 108 VAL A N     1 
ATOM 2146 C CA    . VAL G 3 108 ? 104.277 73.243  28.919  1.00 127.56 ? 108 VAL A CA    1 
ATOM 2147 C C     . VAL G 3 108 ? 104.140 73.583  27.403  1.00 127.07 ? 108 VAL A C     1 
ATOM 2148 O O     . VAL G 3 108 ? 103.643 72.781  26.579  1.00 121.36 ? 108 VAL A O     1 
ATOM 2149 C CB    . VAL G 3 108 ? 103.565 74.269  29.926  1.00 128.18 ? 108 VAL A CB    1 
ATOM 2150 C CG1   . VAL G 3 108 ? 102.114 74.560  29.564  1.00 109.49 ? 108 VAL A CG1   1 
ATOM 2151 C CG2   . VAL G 3 108 ? 103.613 73.735  31.343  1.00 131.21 ? 108 VAL A CG2   1 
ATOM 2152 N N     . THR G 3 109 ? 104.653 74.754  27.053  1.00 126.58 ? 109 THR A N     1 
ATOM 2153 C CA    . THR G 3 109 ? 104.685 75.218  25.695  1.00 133.29 ? 109 THR A CA    1 
ATOM 2154 C C     . THR G 3 109 ? 105.269 74.174  24.734  1.00 139.89 ? 109 THR A C     1 
ATOM 2155 O O     . THR G 3 109 ? 104.883 74.122  23.553  1.00 147.58 ? 109 THR A O     1 
ATOM 2156 C CB    . THR G 3 109 ? 105.521 76.481  25.610  1.00 134.84 ? 109 THR A CB    1 
ATOM 2157 O OG1   . THR G 3 109 ? 106.848 76.199  26.087  1.00 138.22 ? 109 THR A OG1   1 
ATOM 2158 C CG2   . THR G 3 109 ? 104.902 77.561  26.474  1.00 138.23 ? 109 THR A CG2   1 
ATOM 2159 N N     . ILE G 3 110 ? 106.196 73.353  25.217  1.00 135.21 ? 110 ILE A N     1 
ATOM 2160 C CA    . ILE G 3 110 ? 106.652 72.240  24.406  1.00 135.54 ? 110 ILE A CA    1 
ATOM 2161 C C     . ILE G 3 110 ? 105.465 71.369  24.015  1.00 141.59 ? 110 ILE A C     1 
ATOM 2162 O O     . ILE G 3 110 ? 105.120 71.266  22.832  1.00 143.62 ? 110 ILE A O     1 
ATOM 2163 C CB    . ILE G 3 110 ? 107.691 71.408  25.127  1.00 131.92 ? 110 ILE A CB    1 
ATOM 2164 C CG1   . ILE G 3 110 ? 109.034 72.132  25.054  1.00 140.35 ? 110 ILE A CG1   1 
ATOM 2165 C CG2   . ILE G 3 110 ? 107.774 70.015  24.516  1.00 126.01 ? 110 ILE A CG2   1 
ATOM 2166 C CD1   . ILE G 3 110 ? 110.205 71.360  25.631  1.00 148.06 ? 110 ILE A CD1   1 
ATOM 2167 N N     . LEU G 3 111 ? 104.821 70.791  25.024  1.00 146.65 ? 111 LEU A N     1 
ATOM 2168 C CA    . LEU G 3 111 ? 103.738 69.843  24.819  1.00 151.44 ? 111 LEU A CA    1 
ATOM 2169 C C     . LEU G 3 111 ? 102.570 70.384  24.000  1.00 155.12 ? 111 LEU A C     1 
ATOM 2170 O O     . LEU G 3 111 ? 101.941 69.621  23.270  1.00 157.73 ? 111 LEU A O     1 
ATOM 2171 C CB    . LEU G 3 111 ? 103.213 69.342  26.158  1.00 151.19 ? 111 LEU A CB    1 
ATOM 2172 C CG    . LEU G 3 111 ? 104.190 68.699  27.132  1.00 152.47 ? 111 LEU A CG    1 
ATOM 2173 C CD1   . LEU G 3 111 ? 103.608 68.754  28.525  1.00 155.66 ? 111 LEU A CD1   1 
ATOM 2174 C CD2   . LEU G 3 111 ? 104.504 67.273  26.739  1.00 155.33 ? 111 LEU A CD2   1 
ATOM 2175 N N     . SER G 3 112 ? 102.268 71.677  24.123  1.00 156.46 ? 112 SER A N     1 
ATOM 2176 C CA    . SER G 3 112 ? 101.116 72.232  23.408  1.00 160.37 ? 112 SER A CA    1 
ATOM 2177 C C     . SER G 3 112 ? 101.336 72.162  21.904  1.00 161.92 ? 112 SER A C     1 
ATOM 2178 O O     . SER G 3 112 ? 100.515 71.595  21.185  1.00 165.38 ? 112 SER A O     1 
ATOM 2179 C CB    . SER G 3 112 ? 100.801 73.671  23.817  1.00 161.72 ? 112 SER A CB    1 
ATOM 2180 O OG    . SER G 3 112 ? 101.094 73.905  25.177  1.00 169.77 ? 112 SER A OG    1 
ATOM 2181 N N     . ALA G 3 113 ? 102.445 72.711  21.422  1.00 159.10 ? 113 ALA A N     1 
ATOM 2182 C CA    . ALA G 3 113 ? 102.669 72.727  19.979  1.00 161.01 ? 113 ALA A CA    1 
ATOM 2183 C C     . ALA G 3 113 ? 102.741 71.323  19.404  1.00 156.09 ? 113 ALA A C     1 
ATOM 2184 O O     . ALA G 3 113 ? 102.386 71.098  18.248  1.00 160.00 ? 113 ALA A O     1 
ATOM 2185 C CB    . ALA G 3 113 ? 103.909 73.501  19.629  1.00 166.67 ? 113 ALA A CB    1 
ATOM 2186 N N     . VAL G 3 114 ? 103.184 70.380  20.221  1.00 148.97 ? 114 VAL A N     1 
ATOM 2187 C CA    . VAL G 3 114 ? 103.272 69.000  19.775  1.00 148.35 ? 114 VAL A CA    1 
ATOM 2188 C C     . VAL G 3 114 ? 101.902 68.337  19.771  1.00 149.14 ? 114 VAL A C     1 
ATOM 2189 O O     . VAL G 3 114 ? 101.714 67.287  19.153  1.00 147.75 ? 114 VAL A O     1 
ATOM 2190 C CB    . VAL G 3 114 ? 104.211 68.169  20.660  1.00 146.82 ? 114 VAL A CB    1 
ATOM 2191 C CG1   . VAL G 3 114 ? 104.644 66.909  19.895  1.00 143.20 ? 114 VAL A CG1   1 
ATOM 2192 C CG2   . VAL G 3 114 ? 105.439 69.007  21.085  1.00 145.01 ? 114 VAL A CG2   1 
ATOM 2193 N N     . ALA G 3 115 ? 100.957 68.954  20.473  1.00 151.32 ? 115 ALA A N     1 
ATOM 2194 C CA    . ALA G 3 115 ? 99.613  68.404  20.606  1.00 155.74 ? 115 ALA A CA    1 
ATOM 2195 C C     . ALA G 3 115 ? 98.663  69.042  19.603  1.00 156.70 ? 115 ALA A C     1 
ATOM 2196 O O     . ALA G 3 115 ? 97.650  68.446  19.219  1.00 156.72 ? 115 ALA A O     1 
ATOM 2197 C CB    . ALA G 3 115 ? 99.094  68.590  22.032  1.00 157.92 ? 115 ALA A CB    1 
ATOM 2198 N N     . GLN G 3 116 ? 98.988  70.260  19.189  1.00 156.52 ? 116 GLN A N     1 
ATOM 2199 C CA    . GLN G 3 116 ? 98.197  70.933  18.183  1.00 157.93 ? 116 GLN A CA    1 
ATOM 2200 C C     . GLN G 3 116 ? 98.527  70.333  16.827  1.00 162.44 ? 116 GLN A C     1 
ATOM 2201 O O     . GLN G 3 116 ? 97.650  70.151  15.982  1.00 164.63 ? 116 GLN A O     1 
ATOM 2202 C CB    . GLN G 3 116 ? 98.477  72.422  18.190  1.00 154.85 ? 116 GLN A CB    1 
ATOM 2203 C CG    . GLN G 3 116 ? 97.403  73.214  17.500  1.00 153.37 ? 116 GLN A CG    1 
ATOM 2204 C CD    . GLN G 3 116 ? 97.714  74.685  17.457  1.00 159.07 ? 116 GLN A CD    1 
ATOM 2205 O OE1   . GLN G 3 116 ? 96.805  75.512  17.485  1.00 163.65 ? 116 GLN A OE1   1 
ATOM 2206 N NE2   . GLN G 3 116 ? 99.007  75.026  17.395  1.00 162.77 ? 116 GLN A NE2   1 
ATOM 2207 N N     . ALA G 3 117 ? 99.798  70.007  16.635  1.00 163.31 ? 117 ALA A N     1 
ATOM 2208 C CA    . ALA G 3 117 ? 100.231 69.316  15.444  1.00 168.03 ? 117 ALA A CA    1 
ATOM 2209 C C     . ALA G 3 117 ? 99.398  68.046  15.195  1.00 172.19 ? 117 ALA A C     1 
ATOM 2210 O O     . ALA G 3 117 ? 99.345  67.527  14.067  1.00 173.98 ? 117 ALA A O     1 
ATOM 2211 C CB    . ALA G 3 117 ? 101.688 68.987  15.567  1.00 170.38 ? 117 ALA A CB    1 
ATOM 2212 N N     . GLU G 3 118 ? 98.751  67.556  16.253  1.00 174.02 ? 118 GLU A N     1 
ATOM 2213 C CA    . GLU G 3 118 ? 97.820  66.434  16.150  1.00 176.91 ? 118 GLU A CA    1 
ATOM 2214 C C     . GLU G 3 118 ? 96.475  66.940  15.649  1.00 176.77 ? 118 GLU A C     1 
ATOM 2215 O O     . GLU G 3 118 ? 95.896  66.367  14.731  1.00 178.44 ? 118 GLU A O     1 
ATOM 2216 C CB    . GLU G 3 118 ? 97.637  65.739  17.505  1.00 178.23 ? 118 GLU A CB    1 
ATOM 2217 C CG    . GLU G 3 118 ? 97.222  64.266  17.430  1.00 180.86 ? 118 GLU A CG    1 
ATOM 2218 C CD    . GLU G 3 118 ? 98.395  63.308  17.624  1.00 188.98 ? 118 GLU A CD    1 
ATOM 2219 O OE1   . GLU G 3 118 ? 99.504  63.593  17.116  1.00 194.67 ? 118 GLU A OE1   1 
ATOM 2220 O OE2   . GLU G 3 118 ? 98.209  62.263  18.288  1.00 190.40 ? 118 GLU A OE2   1 
ATOM 2221 N N     . ARG G 3 119 ? 95.985  68.016  16.256  1.00 175.50 ? 119 ARG A N     1 
ATOM 2222 C CA    . ARG G 3 119 ? 94.696  68.586  15.885  1.00 175.82 ? 119 ARG A CA    1 
ATOM 2223 C C     . ARG G 3 119 ? 94.761  69.133  14.467  1.00 170.88 ? 119 ARG A C     1 
ATOM 2224 O O     . ARG G 3 119 ? 93.868  68.893  13.657  1.00 169.70 ? 119 ARG A O     1 
ATOM 2225 C CB    . ARG G 3 119 ? 94.291  69.703  16.854  1.00 180.71 ? 119 ARG A CB    1 
ATOM 2226 C CG    . ARG G 3 119 ? 94.500  69.399  18.339  1.00 190.19 ? 119 ARG A CG    1 
ATOM 2227 C CD    . ARG G 3 119 ? 94.549  70.697  19.141  1.00 200.92 ? 119 ARG A CD    1 
ATOM 2228 N NE    . ARG G 3 119 ? 95.072  70.510  20.495  1.00 210.18 ? 119 ARG A NE    1 
ATOM 2229 C CZ    . ARG G 3 119 ? 95.601  71.478  21.242  1.00 213.66 ? 119 ARG A CZ    1 
ATOM 2230 N NH1   . ARG G 3 119 ? 95.695  72.716  20.769  1.00 213.69 ? 119 ARG A NH1   1 
ATOM 2231 N NH2   . ARG G 3 119 ? 96.049  71.207  22.465  1.00 213.86 ? 119 ARG A NH2   1 
ATOM 2232 N N     . GLN G 3 120 ? 95.836  69.858  14.175  1.00 168.35 ? 120 GLN A N     1 
ATOM 2233 C CA    . GLN G 3 120 ? 96.019  70.480  12.868  1.00 168.50 ? 120 GLN A CA    1 
ATOM 2234 C C     . GLN G 3 120 ? 95.982  69.454  11.731  1.00 168.72 ? 120 GLN A C     1 
ATOM 2235 O O     . GLN G 3 120 ? 95.381  69.707  10.685  1.00 167.98 ? 120 GLN A O     1 
ATOM 2236 C CB    . GLN G 3 120 ? 97.304  71.319  12.835  1.00 168.83 ? 120 GLN A CB    1 
ATOM 2237 C CG    . GLN G 3 120 ? 97.090  72.808  13.170  1.00 165.95 ? 120 GLN A CG    1 
ATOM 2238 C CD    . GLN G 3 120 ? 98.386  73.633  13.177  1.00 166.61 ? 120 GLN A CD    1 
ATOM 2239 O OE1   . GLN G 3 120 ? 99.485  73.111  13.451  1.00 162.29 ? 120 GLN A OE1   1 
ATOM 2240 N NE2   . GLN G 3 120 ? 98.252  74.936  12.889  1.00 158.92 ? 120 GLN A NE2   1 
ATOM 2241 N N     . ARG G 3 121 ? 96.612  68.300  11.950  1.00 167.89 ? 121 ARG A N     1 
ATOM 2242 C CA    . ARG G 3 121 ? 96.509  67.172  11.025  1.00 166.12 ? 121 ARG A CA    1 
ATOM 2243 C C     . ARG G 3 121 ? 95.084  66.608  11.013  1.00 163.38 ? 121 ARG A C     1 
ATOM 2244 O O     . ARG G 3 121 ? 94.521  66.385  9.945   1.00 163.72 ? 121 ARG A O     1 
ATOM 2245 C CB    . ARG G 3 121 ? 97.554  66.091  11.356  1.00 167.96 ? 121 ARG A CB    1 
ATOM 2246 C CG    . ARG G 3 121 ? 97.373  64.741  10.631  1.00 171.73 ? 121 ARG A CG    1 
ATOM 2247 C CD    . ARG G 3 121 ? 96.889  63.632  11.576  1.00 176.55 ? 121 ARG A CD    1 
ATOM 2248 N NE    . ARG G 3 121 ? 97.946  63.190  12.495  1.00 178.35 ? 121 ARG A NE    1 
ATOM 2249 C CZ    . ARG G 3 121 ? 97.774  62.356  13.520  1.00 173.98 ? 121 ARG A CZ    1 
ATOM 2250 N NH1   . ARG G 3 121 ? 96.578  61.850  13.797  1.00 173.66 ? 121 ARG A NH1   1 
ATOM 2251 N NH2   . ARG G 3 121 ? 98.810  62.024  14.276  1.00 172.71 ? 121 ARG A NH2   1 
ATOM 2252 N N     . ILE G 3 122 ? 94.502  66.400  12.194  1.00 161.86 ? 122 ILE A N     1 
ATOM 2253 C CA    . ILE G 3 122 ? 93.148  65.849  12.316  1.00 161.89 ? 122 ILE A CA    1 
ATOM 2254 C C     . ILE G 3 122 ? 92.171  66.595  11.418  1.00 162.64 ? 122 ILE A C     1 
ATOM 2255 O O     . ILE G 3 122 ? 91.439  65.983  10.634  1.00 161.80 ? 122 ILE A O     1 
ATOM 2256 C CB    . ILE G 3 122 ? 92.646  65.859  13.789  1.00 161.45 ? 122 ILE A CB    1 
ATOM 2257 C CG1   . ILE G 3 122 ? 93.085  64.578  14.502  1.00 161.71 ? 122 ILE A CG1   1 
ATOM 2258 C CG2   . ILE G 3 122 ? 91.117  66.000  13.866  1.00 160.04 ? 122 ILE A CG2   1 
ATOM 2259 C CD1   . ILE G 3 122 ? 92.797  64.567  15.993  1.00 163.30 ? 122 ILE A CD1   1 
ATOM 2260 N N     . LEU G 3 123 ? 92.190  67.919  11.520  1.00 163.66 ? 123 LEU A N     1 
ATOM 2261 C CA    . LEU G 3 123 ? 91.256  68.757  10.787  1.00 164.63 ? 123 LEU A CA    1 
ATOM 2262 C C     . LEU G 3 123 ? 91.421  68.648  9.277   1.00 164.30 ? 123 LEU A C     1 
ATOM 2263 O O     . LEU G 3 123 ? 90.439  68.741  8.542   1.00 165.56 ? 123 LEU A O     1 
ATOM 2264 C CB    . LEU G 3 123 ? 91.352  70.208  11.254  1.00 164.70 ? 123 LEU A CB    1 
ATOM 2265 C CG    . LEU G 3 123 ? 90.362  70.593  12.359  1.00 165.50 ? 123 LEU A CG    1 
ATOM 2266 C CD1   . LEU G 3 123 ? 90.674  69.938  13.713  1.00 165.46 ? 123 LEU A CD1   1 
ATOM 2267 C CD2   . LEU G 3 123 ? 90.322  72.099  12.489  1.00 168.24 ? 123 LEU A CD2   1 
ATOM 2268 N N     . GLN G 3 124 ? 92.655  68.442  8.824   1.00 163.18 ? 124 GLN A N     1 
ATOM 2269 C CA    . GLN G 3 124 ? 92.922  68.247  7.405   1.00 163.80 ? 124 GLN A CA    1 
ATOM 2270 C C     . GLN G 3 124 ? 92.343  66.915  6.939   1.00 166.01 ? 124 GLN A C     1 
ATOM 2271 O O     . GLN G 3 124 ? 91.777  66.837  5.848   1.00 167.08 ? 124 GLN A O     1 
ATOM 2272 C CB    . GLN G 3 124 ? 94.418  68.310  7.115   1.00 163.19 ? 124 GLN A CB    1 
ATOM 2273 C CG    . GLN G 3 124 ? 94.760  68.509  5.649   1.00 166.31 ? 124 GLN A CG    1 
ATOM 2274 C CD    . GLN G 3 124 ? 96.087  67.870  5.257   1.00 174.88 ? 124 GLN A CD    1 
ATOM 2275 O OE1   . GLN G 3 124 ? 96.970  67.666  6.096   1.00 175.44 ? 124 GLN A OE1   1 
ATOM 2276 N NE2   . GLN G 3 124 ? 96.232  67.550  3.970   1.00 179.85 ? 124 GLN A NE2   1 
ATOM 2277 N N     . ARG G 3 125 ? 92.472  65.881  7.772   1.00 167.65 ? 125 ARG A N     1 
ATOM 2278 C CA    . ARG G 3 125 ? 91.916  64.561  7.460   1.00 170.50 ? 125 ARG A CA    1 
ATOM 2279 C C     . ARG G 3 125 ? 90.391  64.558  7.594   1.00 170.02 ? 125 ARG A C     1 
ATOM 2280 O O     . ARG G 3 125 ? 89.697  63.838  6.868   1.00 169.91 ? 125 ARG A O     1 
ATOM 2281 C CB    . ARG G 3 125 ? 92.538  63.471  8.339   1.00 170.08 ? 125 ARG A CB    1 
ATOM 2282 C CG    . ARG G 3 125 ? 92.659  62.115  7.644   1.00 173.25 ? 125 ARG A CG    1 
ATOM 2283 C CD    . ARG G 3 125 ? 93.389  61.092  8.506   1.00 174.24 ? 125 ARG A CD    1 
ATOM 2284 N NE    . ARG G 3 125 ? 94.275  60.225  7.720   1.00 180.06 ? 125 ARG A NE    1 
ATOM 2285 C CZ    . ARG G 3 125 ? 94.022  58.959  7.389   1.00 180.17 ? 125 ARG A CZ    1 
ATOM 2286 N NH1   . ARG G 3 125 ? 92.893  58.369  7.767   1.00 181.35 ? 125 ARG A NH1   1 
ATOM 2287 N NH2   . ARG G 3 125 ? 94.908  58.277  6.675   1.00 180.63 ? 125 ARG A NH2   1 
ATOM 2288 N N     . THR G 3 126 ? 89.887  65.368  8.525   1.00 168.88 ? 126 THR A N     1 
ATOM 2289 C CA    . THR G 3 126 ? 88.453  65.578  8.701   1.00 167.73 ? 126 THR A CA    1 
ATOM 2290 C C     . THR G 3 126 ? 87.866  66.226  7.446   1.00 168.16 ? 126 THR A C     1 
ATOM 2291 O O     . THR G 3 126 ? 86.849  65.770  6.926   1.00 167.57 ? 126 THR A O     1 
ATOM 2292 C CB    . THR G 3 126 ? 88.163  66.454  9.943   1.00 166.71 ? 126 THR A CB    1 
ATOM 2293 O OG1   . THR G 3 126 ? 88.866  65.926  11.071  1.00 164.37 ? 126 THR A OG1   1 
ATOM 2294 C CG2   . THR G 3 126 ? 86.676  66.488  10.262  1.00 165.75 ? 126 THR A CG2   1 
ATOM 2295 N N     . ASN G 3 127 ? 88.526  67.277  6.962   1.00 169.31 ? 127 ASN A N     1 
ATOM 2296 C CA    . ASN G 3 127 ? 88.086  67.995  5.770   1.00 171.43 ? 127 ASN A CA    1 
ATOM 2297 C C     . ASN G 3 127 ? 88.290  67.208  4.477   1.00 173.39 ? 127 ASN A C     1 
ATOM 2298 O O     . ASN G 3 127 ? 87.422  67.225  3.599   1.00 174.12 ? 127 ASN A O     1 
ATOM 2299 C CB    . ASN G 3 127 ? 88.753  69.371  5.684   1.00 171.58 ? 127 ASN A CB    1 
ATOM 2300 C CG    . ASN G 3 127 ? 88.132  70.381  6.637   1.00 173.82 ? 127 ASN A CG    1 
ATOM 2301 O OD1   . ASN G 3 127 ? 87.952  70.110  7.827   1.00 174.54 ? 127 ASN A OD1   1 
ATOM 2302 N ND2   . ASN G 3 127 ? 87.803  71.558  6.114   1.00 175.23 ? 127 ASN A ND2   1 
ATOM 2303 N N     . GLU G 3 128 ? 89.429  66.522  4.365   1.00 174.36 ? 128 GLU A N     1 
ATOM 2304 C CA    . GLU G 3 128 ? 89.682  65.610  3.242   1.00 175.32 ? 128 GLU A CA    1 
ATOM 2305 C C     . GLU G 3 128 ? 88.595  64.541  3.150   1.00 175.84 ? 128 GLU A C     1 
ATOM 2306 O O     . GLU G 3 128 ? 88.240  64.100  2.057   1.00 175.36 ? 128 GLU A O     1 
ATOM 2307 C CB    . GLU G 3 128 ? 91.049  64.933  3.377   1.00 175.42 ? 128 GLU A CB    1 
ATOM 2308 C CG    . GLU G 3 128 ? 92.211  65.706  2.758   1.00 175.81 ? 128 GLU A CG    1 
ATOM 2309 C CD    . GLU G 3 128 ? 93.548  64.980  2.887   1.00 174.86 ? 128 GLU A CD    1 
ATOM 2310 O OE1   . GLU G 3 128 ? 93.553  63.745  3.091   1.00 174.54 ? 128 GLU A OE1   1 
ATOM 2311 O OE2   . GLU G 3 128 ? 94.600  65.648  2.777   1.00 170.70 ? 128 GLU A OE2   1 
ATOM 2312 N N     . GLY G 3 129 ? 88.080  64.138  4.311   1.00 176.79 ? 129 GLY A N     1 
ATOM 2313 C CA    . GLY G 3 129 ? 87.006  63.152  4.409   1.00 176.13 ? 129 GLY A CA    1 
ATOM 2314 C C     . GLY G 3 129 ? 85.621  63.731  4.196   1.00 175.15 ? 129 GLY A C     1 
ATOM 2315 O O     . GLY G 3 129 ? 84.652  62.985  4.046   1.00 174.98 ? 129 GLY A O     1 
ATOM 2316 N N     . ARG G 3 130 ? 85.525  65.060  4.198   1.00 174.91 ? 130 ARG A N     1 
ATOM 2317 C CA    . ARG G 3 130 ? 84.278  65.752  3.872   1.00 174.99 ? 130 ARG A CA    1 
ATOM 2318 C C     . ARG G 3 130 ? 84.227  66.101  2.386   1.00 175.54 ? 130 ARG A C     1 
ATOM 2319 O O     . ARG G 3 130 ? 83.148  66.183  1.800   1.00 174.52 ? 130 ARG A O     1 
ATOM 2320 C CB    . ARG G 3 130 ? 84.098  67.014  4.720   1.00 174.61 ? 130 ARG A CB    1 
ATOM 2321 C CG    . ARG G 3 130 ? 83.975  66.760  6.221   1.00 172.94 ? 130 ARG A CG    1 
ATOM 2322 C CD    . ARG G 3 130 ? 83.067  67.775  6.914   1.00 172.54 ? 130 ARG A CD    1 
ATOM 2323 N NE    . ARG G 3 130 ? 83.330  69.154  6.506   1.00 172.35 ? 130 ARG A NE    1 
ATOM 2324 C CZ    . ARG G 3 130 ? 82.674  70.219  6.962   1.00 171.45 ? 130 ARG A CZ    1 
ATOM 2325 N NH1   . ARG G 3 130 ? 81.705  70.088  7.861   1.00 169.57 ? 130 ARG A NH1   1 
ATOM 2326 N NH2   . ARG G 3 130 ? 82.993  71.425  6.517   1.00 171.82 ? 130 ARG A NH2   1 
ATOM 2327 N N     . GLN G 3 131 ? 85.402  66.303  1.789   1.00 177.39 ? 131 GLN A N     1 
ATOM 2328 C CA    . GLN G 3 131 ? 85.522  66.573  0.354   1.00 178.90 ? 131 GLN A CA    1 
ATOM 2329 C C     . GLN G 3 131 ? 85.352  65.304  -0.489  1.00 178.91 ? 131 GLN A C     1 
ATOM 2330 O O     . GLN G 3 131 ? 85.023  65.384  -1.672  1.00 179.23 ? 131 GLN A O     1 
ATOM 2331 C CB    . GLN G 3 131 ? 86.862  67.250  0.030   1.00 180.00 ? 131 GLN A CB    1 
ATOM 2332 C CG    . GLN G 3 131 ? 87.100  68.601  0.716   1.00 183.04 ? 131 GLN A CG    1 
ATOM 2333 C CD    . GLN G 3 131 ? 86.265  69.731  0.137   1.00 184.98 ? 131 GLN A CD    1 
ATOM 2334 O OE1   . GLN G 3 131 ? 86.740  70.499  -0.700  1.00 185.59 ? 131 GLN A OE1   1 
ATOM 2335 N NE2   . GLN G 3 131 ? 85.016  69.840  0.582   1.00 185.04 ? 131 GLN A NE2   1 
ATOM 2336 N N     . GLU G 3 132 ? 85.590  64.144  0.123   1.00 179.47 ? 132 GLU A N     1 
ATOM 2337 C CA    . GLU G 3 132 ? 85.326  62.850  -0.519  1.00 179.57 ? 132 GLU A CA    1 
ATOM 2338 C C     . GLU G 3 132 ? 83.932  62.323  -0.145  1.00 180.60 ? 132 GLU A C     1 
ATOM 2339 O O     . GLU G 3 132 ? 83.550  61.215  -0.530  1.00 180.74 ? 132 GLU A O     1 
ATOM 2340 C CB    . GLU G 3 132 ? 86.433  61.823  -0.200  1.00 179.91 ? 132 GLU A CB    1 
ATOM 2341 C CG    . GLU G 3 132 ? 86.489  61.328  1.254   1.00 179.74 ? 132 GLU A CG    1 
ATOM 2342 C CD    . GLU G 3 132 ? 87.692  60.433  1.547   1.00 177.86 ? 132 GLU A CD    1 
ATOM 2343 O OE1   . GLU G 3 132 ? 88.837  60.836  1.248   1.00 174.38 ? 132 GLU A OE1   1 
ATOM 2344 O OE2   . GLU G 3 132 ? 87.490  59.328  2.094   1.00 173.74 ? 132 GLU A OE2   1 
ATOM 2345 N N     . ALA G 3 133 ? 83.185  63.134  0.606   1.00 181.33 ? 133 ALA A N     1 
ATOM 2346 C CA    . ALA G 3 133 ? 81.801  62.832  0.976   1.00 182.18 ? 133 ALA A CA    1 
ATOM 2347 C C     . ALA G 3 133 ? 80.821  63.743  0.231   1.00 182.98 ? 133 ALA A C     1 
ATOM 2348 O O     . ALA G 3 133 ? 79.778  63.286  -0.242  1.00 183.05 ? 133 ALA A O     1 
ATOM 2349 C CB    . ALA G 3 133 ? 81.612  62.954  2.481   1.00 181.84 ? 133 ALA A CB    1 
ATOM 2350 N N     . MET G 3 134 ? 81.163  65.029  0.140   1.00 183.58 ? 134 MET A N     1 
ATOM 2351 C CA    . MET G 3 134 ? 80.405  66.002  -0.652  1.00 183.30 ? 134 MET A CA    1 
ATOM 2352 C C     . MET G 3 134 ? 80.370  65.609  -2.130  1.00 182.80 ? 134 MET A C     1 
ATOM 2353 O O     . MET G 3 134 ? 79.317  65.667  -2.770  1.00 182.87 ? 134 MET A O     1 
ATOM 2354 C CB    . MET G 3 134 ? 81.007  67.407  -0.503  1.00 183.60 ? 134 MET A CB    1 
ATOM 2355 C CG    . MET G 3 134 ? 80.260  68.358  0.435   1.00 183.84 ? 134 MET A CG    1 
ATOM 2356 S SD    . MET G 3 134 ? 80.330  67.961  2.195   1.00 183.93 ? 134 MET A SD    1 
ATOM 2357 C CE    . MET G 3 134 ? 79.605  69.436  2.909   1.00 182.49 ? 134 MET A CE    1 
ATOM 2358 N N     . ALA G 3 135 ? 81.526  65.204  -2.656  1.00 182.33 ? 135 ALA A N     1 
ATOM 2359 C CA    . ALA G 3 135 ? 81.667  64.800  -4.055  1.00 182.22 ? 135 ALA A CA    1 
ATOM 2360 C C     . ALA G 3 135 ? 81.036  63.438  -4.342  1.00 182.43 ? 135 ALA A C     1 
ATOM 2361 O O     . ALA G 3 135 ? 80.598  63.179  -5.465  1.00 182.32 ? 135 ALA A O     1 
ATOM 2362 C CB    . ALA G 3 135 ? 83.136  64.802  -4.459  1.00 181.73 ? 135 ALA A CB    1 
ATOM 2363 N N     . LYS G 3 136 ? 80.995  62.580  -3.323  1.00 182.66 ? 136 LYS A N     1 
ATOM 2364 C CA    . LYS G 3 136 ? 80.430  61.231  -3.438  1.00 182.74 ? 136 LYS A CA    1 
ATOM 2365 C C     . LYS G 3 136 ? 78.917  61.260  -3.678  1.00 182.72 ? 136 LYS A C     1 
ATOM 2366 O O     . LYS G 3 136 ? 78.378  60.404  -4.383  1.00 183.12 ? 136 LYS A O     1 
ATOM 2367 C CB    . LYS G 3 136 ? 80.752  60.411  -2.184  1.00 182.91 ? 136 LYS A CB    1 
ATOM 2368 C CG    . LYS G 3 136 ? 80.724  58.898  -2.379  1.00 182.47 ? 136 LYS A CG    1 
ATOM 2369 C CD    . LYS G 3 136 ? 80.875  58.173  -1.046  1.00 182.43 ? 136 LYS A CD    1 
ATOM 2370 C CE    . LYS G 3 136 ? 81.104  56.681  -1.233  1.00 181.52 ? 136 LYS A CE    1 
ATOM 2371 N NZ    . LYS G 3 136 ? 82.493  56.374  -1.676  1.00 180.58 ? 136 LYS A NZ    1 
ATOM 2372 N N     . GLY G 3 137 ? 78.243  62.246  -3.086  1.00 182.38 ? 137 GLY A N     1 
ATOM 2373 C CA    . GLY G 3 137 ? 76.802  62.419  -3.255  1.00 182.15 ? 137 GLY A CA    1 
ATOM 2374 C C     . GLY G 3 137 ? 76.030  62.344  -1.951  1.00 181.84 ? 137 GLY A C     1 
ATOM 2375 O O     . GLY G 3 137 ? 75.073  61.575  -1.834  1.00 182.11 ? 137 GLY A O     1 
ATOM 2376 N N     . VAL G 3 138 ? 76.450  63.147  -0.974  1.00 181.10 ? 138 VAL A N     1 
ATOM 2377 C CA    . VAL G 3 138 ? 75.803  63.204  0.340   1.00 180.34 ? 138 VAL A CA    1 
ATOM 2378 C C     . VAL G 3 138 ? 75.142  64.569  0.540   1.00 180.14 ? 138 VAL A C     1 
ATOM 2379 O O     . VAL G 3 138 ? 75.688  65.589  0.125   1.00 179.46 ? 138 VAL A O     1 
ATOM 2380 C CB    . VAL G 3 138 ? 76.816  62.923  1.489   1.00 179.91 ? 138 VAL A CB    1 
ATOM 2381 C CG1   . VAL G 3 138 ? 76.150  63.032  2.860   1.00 178.79 ? 138 VAL A CG1   1 
ATOM 2382 C CG2   . VAL G 3 138 ? 77.448  61.546  1.325   1.00 180.01 ? 138 VAL A CG2   1 
ATOM 2383 N N     . VAL G 3 139 ? 73.963  64.574  1.163   1.00 180.54 ? 139 VAL A N     1 
ATOM 2384 C CA    . VAL G 3 139 ? 73.246  65.814  1.491   1.00 180.82 ? 139 VAL A CA    1 
ATOM 2385 C C     . VAL G 3 139 ? 73.959  66.595  2.601   1.00 181.09 ? 139 VAL A C     1 
ATOM 2386 O O     . VAL G 3 139 ? 74.428  66.006  3.579   1.00 181.16 ? 139 VAL A O     1 
ATOM 2387 C CB    . VAL G 3 139 ? 71.753  65.556  1.867   1.00 180.81 ? 139 VAL A CB    1 
ATOM 2388 C CG1   . VAL G 3 139 ? 70.934  65.223  0.626   1.00 180.35 ? 139 VAL A CG1   1 
ATOM 2389 C CG2   . VAL G 3 139 ? 71.616  64.450  2.919   1.00 181.19 ? 139 VAL A CG2   1 
ATOM 2390 N N     . PHE G 3 140 ? 74.036  67.917  2.440   1.00 181.48 ? 140 PHE A N     1 
ATOM 2391 C CA    . PHE G 3 140 ? 74.823  68.778  3.338   1.00 181.83 ? 140 PHE A CA    1 
ATOM 2392 C C     . PHE G 3 140 ? 73.957  69.692  4.211   1.00 181.07 ? 140 PHE A C     1 
ATOM 2393 O O     . PHE G 3 140 ? 72.781  69.917  3.912   1.00 181.70 ? 140 PHE A O     1 
ATOM 2394 C CB    . PHE G 3 140 ? 75.814  69.652  2.546   1.00 182.61 ? 140 PHE A CB    1 
ATOM 2395 C CG    . PHE G 3 140 ? 75.862  69.360  1.065   1.00 184.10 ? 140 PHE A CG    1 
ATOM 2396 C CD1   . PHE G 3 140 ? 74.996  70.010  0.186   1.00 184.43 ? 140 PHE A CD1   1 
ATOM 2397 C CD2   . PHE G 3 140 ? 76.786  68.458  0.547   1.00 184.68 ? 140 PHE A CD2   1 
ATOM 2398 C CE1   . PHE G 3 140 ? 75.039  69.752  -1.185  1.00 184.17 ? 140 PHE A CE1   1 
ATOM 2399 C CE2   . PHE G 3 140 ? 76.838  68.195  -0.825  1.00 184.19 ? 140 PHE A CE2   1 
ATOM 2400 C CZ    . PHE G 3 140 ? 75.961  68.842  -1.690  1.00 183.73 ? 140 PHE A CZ    1 
ATOM 2401 N N     . GLY G 3 141 ? 74.557  70.208  5.285   1.00 179.52 ? 141 GLY A N     1 
ATOM 2402 C CA    . GLY G 3 141 ? 73.960  71.259  6.118   1.00 178.46 ? 141 GLY A CA    1 
ATOM 2403 C C     . GLY G 3 141 ? 72.624  70.940  6.761   1.00 177.97 ? 141 GLY A C     1 
ATOM 2404 O O     . GLY G 3 141 ? 72.496  69.961  7.496   1.00 177.63 ? 141 GLY A O     1 
ATOM 2405 N N     . ARG G 3 142 ? 71.630  71.782  6.483   1.00 178.26 ? 142 ARG A N     1 
ATOM 2406 C CA    . ARG G 3 142 ? 70.280  71.609  7.017   1.00 178.76 ? 142 ARG A CA    1 
ATOM 2407 C C     . ARG G 3 142 ? 69.275  71.331  5.897   1.00 179.13 ? 142 ARG A C     1 
ATOM 2408 O O     . ARG G 3 142 ? 69.438  71.812  4.773   1.00 178.88 ? 142 ARG A O     1 
ATOM 2409 C CB    . ARG G 3 142 ? 69.857  72.848  7.806   1.00 178.57 ? 142 ARG A CB    1 
ATOM 2410 C CG    . ARG G 3 142 ? 69.014  72.540  9.028   1.00 178.54 ? 142 ARG A CG    1 
ATOM 2411 C CD    . ARG G 3 142 ? 68.268  73.767  9.508   1.00 177.88 ? 142 ARG A CD    1 
ATOM 2412 N NE    . ARG G 3 142 ? 66.968  73.898  8.856   1.00 179.69 ? 142 ARG A NE    1 
ATOM 2413 C CZ    . ARG G 3 142 ? 66.053  74.810  9.173   1.00 180.60 ? 142 ARG A CZ    1 
ATOM 2414 N NH1   . ARG G 3 142 ? 66.286  75.689  10.141  1.00 179.80 ? 142 ARG A NH1   1 
ATOM 2415 N NH2   . ARG G 3 142 ? 64.900  74.842  8.519   1.00 181.40 ? 142 ARG A NH2   1 
ATOM 2416 N N     . LYS G 3 143 ? 68.237  70.561  6.217   1.00 179.76 ? 143 LYS A N     1 
ATOM 2417 C CA    . LYS G 3 143 ? 67.231  70.146  5.235   1.00 180.46 ? 143 LYS A CA    1 
ATOM 2418 C C     . LYS G 3 143 ? 66.100  71.166  5.085   1.00 180.32 ? 143 LYS A C     1 
ATOM 2419 O O     . LYS G 3 143 ? 65.771  71.890  6.029   1.00 180.08 ? 143 LYS A O     1 
ATOM 2420 C CB    . LYS G 3 143 ? 66.657  68.771  5.612   1.00 181.09 ? 143 LYS A CB    1 
ATOM 2421 C CG    . LYS G 3 143 ? 65.789  68.114  4.533   1.00 181.52 ? 143 LYS A CG    1 
ATOM 2422 C CD    . LYS G 3 143 ? 65.087  66.867  5.051   1.00 180.35 ? 143 LYS A CD    1 
ATOM 2423 C CE    . LYS G 3 143 ? 64.232  66.228  3.969   1.00 178.38 ? 143 LYS A CE    1 
ATOM 2424 N NZ    . LYS G 3 143 ? 63.620  64.955  4.433   1.00 177.86 ? 143 LYS A NZ    1 
ATOM 2425 N N     . ARG G 3 144 ? 65.521  71.216  3.886   1.00 180.23 ? 144 ARG A N     1 
ATOM 2426 C CA    . ARG G 3 144 ? 64.291  71.955  3.634   1.00 180.98 ? 144 ARG A CA    1 
ATOM 2427 C C     . ARG G 3 144 ? 63.229  71.507  4.637   1.00 182.16 ? 144 ARG A C     1 
ATOM 2428 O O     . ARG G 3 144 ? 63.014  70.307  4.825   1.00 182.32 ? 144 ARG A O     1 
ATOM 2429 C CB    . ARG G 3 144 ? 63.804  71.697  2.203   1.00 181.31 ? 144 ARG A CB    1 
ATOM 2430 C CG    . ARG G 3 144 ? 62.510  72.429  1.824   1.00 182.31 ? 144 ARG A CG    1 
ATOM 2431 C CD    . ARG G 3 144 ? 61.697  71.678  0.766   1.00 179.85 ? 144 ARG A CD    1 
ATOM 2432 N NE    . ARG G 3 144 ? 62.267  71.794  -0.576  1.00 178.92 ? 144 ARG A NE    1 
ATOM 2433 C CZ    . ARG G 3 144 ? 61.660  71.402  -1.694  1.00 178.31 ? 144 ARG A CZ    1 
ATOM 2434 N NH1   . ARG G 3 144 ? 60.448  70.862  -1.649  1.00 178.28 ? 144 ARG A NH1   1 
ATOM 2435 N NH2   . ARG G 3 144 ? 62.266  71.553  -2.863  1.00 178.48 ? 144 ARG A NH2   1 
ATOM 2436 N N     . LYS G 3 145 ? 62.582  72.472  5.285   1.00 183.71 ? 145 LYS A N     1 
ATOM 2437 C CA    . LYS G 3 145 ? 61.529  72.185  6.263   1.00 185.34 ? 145 LYS A CA    1 
ATOM 2438 C C     . LYS G 3 145 ? 60.142  72.636  5.801   1.00 186.47 ? 145 LYS A C     1 
ATOM 2439 O O     . LYS G 3 145 ? 59.133  72.026  6.159   1.00 186.18 ? 145 LYS A O     1 
ATOM 2440 C CB    . LYS G 3 145 ? 61.865  72.820  7.617   1.00 185.39 ? 145 LYS A CB    1 
ATOM 2441 C CG    . LYS G 3 145 ? 62.806  71.992  8.491   1.00 186.12 ? 145 LYS A CG    1 
ATOM 2442 C CD    . LYS G 3 145 ? 62.062  70.861  9.202   1.00 186.39 ? 145 LYS A CD    1 
ATOM 2443 C CE    . LYS G 3 145 ? 62.988  70.051  10.095  1.00 185.14 ? 145 LYS A CE    1 
ATOM 2444 N NZ    . LYS G 3 145 ? 62.267  68.954  10.799  1.00 184.11 ? 145 LYS A NZ    1 
ATOM 2445 N N     . ILE G 3 146 ? 60.108  73.702  5.006   1.00 188.59 ? 146 ILE A N     1 
ATOM 2446 C CA    . ILE G 3 146 ? 58.857  74.309  4.543   1.00 189.77 ? 146 ILE A CA    1 
ATOM 2447 C C     . ILE G 3 146 ? 58.659  74.084  3.039   1.00 190.86 ? 146 ILE A C     1 
ATOM 2448 O O     . ILE G 3 146 ? 59.512  74.464  2.230   1.00 190.92 ? 146 ILE A O     1 
ATOM 2449 C CB    . ILE G 3 146 ? 58.811  75.826  4.882   1.00 189.08 ? 146 ILE A CB    1 
ATOM 2450 C CG1   . ILE G 3 146 ? 59.002  76.040  6.389   1.00 188.65 ? 146 ILE A CG1   1 
ATOM 2451 C CG2   . ILE G 3 146 ? 57.499  76.451  4.412   1.00 188.36 ? 146 ILE A CG2   1 
ATOM 2452 C CD1   . ILE G 3 146 ? 59.700  77.332  6.757   1.00 187.86 ? 146 ILE A CD1   1 
ATOM 2453 N N     . ASP G 3 147 ? 57.530  73.465  2.686   1.00 191.63 ? 147 ASP A N     1 
ATOM 2454 C CA    . ASP G 3 147 ? 57.198  73.121  1.296   1.00 191.66 ? 147 ASP A CA    1 
ATOM 2455 C C     . ASP G 3 147 ? 57.360  74.295  0.324   1.00 191.13 ? 147 ASP A C     1 
ATOM 2456 O O     . ASP G 3 147 ? 56.589  75.260  0.359   1.00 189.85 ? 147 ASP A O     1 
ATOM 2457 C CB    . ASP G 3 147 ? 55.776  72.539  1.199   1.00 191.81 ? 147 ASP A CB    1 
ATOM 2458 C CG    . ASP G 3 147 ? 55.728  71.033  1.453   1.00 191.16 ? 147 ASP A CG    1 
ATOM 2459 O OD1   . ASP G 3 147 ? 56.372  70.554  2.411   1.00 191.44 ? 147 ASP A OD1   1 
ATOM 2460 O OD2   . ASP G 3 147 ? 55.027  70.328  0.695   1.00 189.17 ? 147 ASP A OD2   1 
ATOM 2461 N N     . ARG G 3 148 ? 58.377  74.195  -0.532  1.00 191.43 ? 148 ARG A N     1 
ATOM 2462 C CA    . ARG G 3 148 ? 58.650  75.199  -1.564  1.00 191.50 ? 148 ARG A CA    1 
ATOM 2463 C C     . ARG G 3 148 ? 57.650  75.090  -2.718  1.00 191.78 ? 148 ARG A C     1 
ATOM 2464 O O     . ARG G 3 148 ? 57.495  76.029  -3.505  1.00 191.81 ? 148 ARG A O     1 
ATOM 2465 C CB    . ARG G 3 148 ? 60.086  75.070  -2.096  1.00 191.58 ? 148 ARG A CB    1 
ATOM 2466 C CG    . ARG G 3 148 ? 61.172  74.972  -1.022  1.00 192.78 ? 148 ARG A CG    1 
ATOM 2467 C CD    . ARG G 3 148 ? 62.519  75.488  -1.530  1.00 194.82 ? 148 ARG A CD    1 
ATOM 2468 N NE    . ARG G 3 148 ? 63.659  74.816  -0.902  1.00 195.42 ? 148 ARG A NE    1 
ATOM 2469 C CZ    . ARG G 3 148 ? 64.883  75.333  -0.794  1.00 195.15 ? 148 ARG A CZ    1 
ATOM 2470 N NH1   . ARG G 3 148 ? 65.145  76.552  -1.252  1.00 192.67 ? 148 ARG A NH1   1 
ATOM 2471 N NH2   . ARG G 3 148 ? 65.849  74.632  -0.211  1.00 195.47 ? 148 ARG A NH2   1 
ATOM 2472 N N     . ASP G 3 149 ? 56.984  73.936  -2.807  1.00 191.89 ? 149 ASP A N     1 
ATOM 2473 C CA    . ASP G 3 149 ? 55.909  73.697  -3.776  1.00 191.11 ? 149 ASP A CA    1 
ATOM 2474 C C     . ASP G 3 149 ? 54.667  74.511  -3.420  1.00 190.49 ? 149 ASP A C     1 
ATOM 2475 O O     . ASP G 3 149 ? 53.892  74.895  -4.299  1.00 190.92 ? 149 ASP A O     1 
ATOM 2476 C CB    . ASP G 3 149 ? 55.537  72.208  -3.824  1.00 190.85 ? 149 ASP A CB    1 
ATOM 2477 C CG    . ASP G 3 149 ? 56.750  71.290  -3.819  1.00 190.85 ? 149 ASP A CG    1 
ATOM 2478 O OD1   . ASP G 3 149 ? 57.825  71.693  -4.319  1.00 190.66 ? 149 ASP A OD1   1 
ATOM 2479 O OD2   . ASP G 3 149 ? 56.621  70.153  -3.315  1.00 191.04 ? 149 ASP A OD2   1 
ATOM 2480 N N     . ALA G 3 150 ? 54.486  74.756  -2.122  1.00 189.26 ? 150 ALA A N     1 
ATOM 2481 C CA    . ALA G 3 150 ? 53.376  75.555  -1.606  1.00 187.78 ? 150 ALA A CA    1 
ATOM 2482 C C     . ALA G 3 150 ? 53.595  77.049  -1.844  1.00 186.26 ? 150 ALA A C     1 
ATOM 2483 O O     . ALA G 3 150 ? 52.633  77.812  -1.976  1.00 186.42 ? 150 ALA A O     1 
ATOM 2484 C CB    . ALA G 3 150 ? 53.171  75.278  -0.121  1.00 187.83 ? 150 ALA A CB    1 
ATOM 2485 N N     . VAL G 3 151 ? 54.862  77.453  -1.899  1.00 184.07 ? 151 VAL A N     1 
ATOM 2486 C CA    . VAL G 3 151 ? 55.235  78.854  -2.098  1.00 182.24 ? 151 VAL A CA    1 
ATOM 2487 C C     . VAL G 3 151 ? 55.218  79.240  -3.579  1.00 181.73 ? 151 VAL A C     1 
ATOM 2488 O O     . VAL G 3 151 ? 54.748  80.325  -3.934  1.00 182.29 ? 151 VAL A O     1 
ATOM 2489 C CB    . VAL G 3 151 ? 56.627  79.165  -1.498  1.00 181.72 ? 151 VAL A CB    1 
ATOM 2490 C CG1   . VAL G 3 151 ? 56.868  80.668  -1.448  1.00 180.58 ? 151 VAL A CG1   1 
ATOM 2491 C CG2   . VAL G 3 151 ? 56.759  78.569  -0.106  1.00 182.86 ? 151 VAL A CG2   1 
ATOM 2492 N N     . LEU G 3 152 ? 55.725  78.349  -4.433  1.00 180.55 ? 152 LEU A N     1 
ATOM 2493 C CA    . LEU G 3 152 ? 55.822  78.595  -5.878  1.00 179.30 ? 152 LEU A CA    1 
ATOM 2494 C C     . LEU G 3 152 ? 54.444  78.695  -6.550  1.00 177.92 ? 152 LEU A C     1 
ATOM 2495 O O     . LEU G 3 152 ? 54.270  79.450  -7.510  1.00 177.52 ? 152 LEU A O     1 
ATOM 2496 C CB    . LEU G 3 152 ? 56.683  77.515  -6.550  1.00 179.33 ? 152 LEU A CB    1 
ATOM 2497 C CG    . LEU G 3 152 ? 57.730  77.942  -7.590  1.00 178.69 ? 152 LEU A CG    1 
ATOM 2498 C CD1   . LEU G 3 152 ? 58.806  76.871  -7.731  1.00 177.72 ? 152 LEU A CD1   1 
ATOM 2499 C CD2   . LEU G 3 152 ? 57.112  78.273  -8.952  1.00 178.19 ? 152 LEU A CD2   1 
ATOM 2500 N N     . ASN G 3 153 ? 53.478  77.931  -6.039  1.00 176.41 ? 153 ASN A N     1 
ATOM 2501 C CA    . ASN G 3 153 ? 52.080  78.023  -6.471  1.00 175.28 ? 153 ASN A CA    1 
ATOM 2502 C C     . ASN G 3 153 ? 51.431  79.337  -6.049  1.00 175.68 ? 153 ASN A C     1 
ATOM 2503 O O     . ASN G 3 153 ? 50.512  79.830  -6.708  1.00 175.80 ? 153 ASN A O     1 
ATOM 2504 C CB    . ASN G 3 153 ? 51.268  76.851  -5.912  1.00 174.33 ? 153 ASN A CB    1 
ATOM 2505 C CG    . ASN G 3 153 ? 51.306  75.630  -6.809  1.00 173.01 ? 153 ASN A CG    1 
ATOM 2506 O OD1   . ASN G 3 153 ? 50.920  75.689  -7.977  1.00 173.20 ? 153 ASN A OD1   1 
ATOM 2507 N ND2   . ASN G 3 153 ? 51.757  74.508  -6.260  1.00 171.66 ? 153 ASN A ND2   1 
ATOM 2508 N N     . MET G 3 154 ? 51.925  79.892  -4.945  1.00 176.21 ? 154 MET A N     1 
ATOM 2509 C CA    . MET G 3 154 ? 51.390  81.119  -4.366  1.00 176.96 ? 154 MET A CA    1 
ATOM 2510 C C     . MET G 3 154 ? 52.085  82.366  -4.929  1.00 177.74 ? 154 MET A C     1 
ATOM 2511 O O     . MET G 3 154 ? 51.796  83.488  -4.507  1.00 178.00 ? 154 MET A O     1 
ATOM 2512 C CB    . MET G 3 154 ? 51.516  81.061  -2.839  1.00 177.01 ? 154 MET A CB    1 
ATOM 2513 C CG    . MET G 3 154 ? 50.291  81.558  -2.086  1.00 176.77 ? 154 MET A CG    1 
ATOM 2514 S SD    . MET G 3 154 ? 50.120  80.802  -0.452  1.00 176.77 ? 154 MET A SD    1 
ATOM 2515 C CE    . MET G 3 154 ? 49.533  79.159  -0.872  1.00 175.05 ? 154 MET A CE    1 
ATOM 2516 N N     . TRP G 3 155 ? 52.996  82.159  -5.882  1.00 178.43 ? 155 TRP A N     1 
ATOM 2517 C CA    . TRP G 3 155 ? 53.678  83.256  -6.578  1.00 179.07 ? 155 TRP A CA    1 
ATOM 2518 C C     . TRP G 3 155 ? 53.334  83.292  -8.073  1.00 178.70 ? 155 TRP A C     1 
ATOM 2519 O O     . TRP G 3 155 ? 53.226  84.372  -8.663  1.00 178.61 ? 155 TRP A O     1 
ATOM 2520 C CB    . TRP G 3 155 ? 55.196  83.186  -6.373  1.00 179.67 ? 155 TRP A CB    1 
ATOM 2521 C CG    . TRP G 3 155 ? 55.931  84.389  -6.911  1.00 180.46 ? 155 TRP A CG    1 
ATOM 2522 C CD1   . TRP G 3 155 ? 56.080  85.601  -6.299  1.00 180.72 ? 155 TRP A CD1   1 
ATOM 2523 C CD2   . TRP G 3 155 ? 56.609  84.491  -8.173  1.00 181.01 ? 155 TRP A CD2   1 
ATOM 2524 N NE1   . TRP G 3 155 ? 56.809  86.451  -7.098  1.00 180.78 ? 155 TRP A NE1   1 
ATOM 2525 C CE2   . TRP G 3 155 ? 57.146  85.796  -8.253  1.00 181.18 ? 155 TRP A CE2   1 
ATOM 2526 C CE3   . TRP G 3 155 ? 56.815  83.607  -9.242  1.00 181.11 ? 155 TRP A CE3   1 
ATOM 2527 C CZ2   . TRP G 3 155 ? 57.878  86.240  -9.362  1.00 181.08 ? 155 TRP A CZ2   1 
ATOM 2528 C CZ3   . TRP G 3 155 ? 57.543  84.050  -10.346 1.00 180.77 ? 155 TRP A CZ3   1 
ATOM 2529 C CH2   . TRP G 3 155 ? 58.065  85.356  -10.394 1.00 180.80 ? 155 TRP A CH2   1 
ATOM 2530 N N     . GLN G 3 156 ? 53.174  82.111  -8.676  1.00 178.04 ? 156 GLN A N     1 
ATOM 2531 C CA    . GLN G 3 156 ? 52.649  81.988  -10.041 1.00 176.85 ? 156 GLN A CA    1 
ATOM 2532 C C     . GLN G 3 156 ? 51.232  82.540  -10.094 1.00 176.37 ? 156 GLN A C     1 
ATOM 2533 O O     . GLN G 3 156 ? 50.749  82.941  -11.154 1.00 176.50 ? 156 GLN A O     1 
ATOM 2534 C CB    . GLN G 3 156 ? 52.646  80.529  -10.506 1.00 176.85 ? 156 GLN A CB    1 
ATOM 2535 C CG    . GLN G 3 156 ? 53.922  80.080  -11.206 1.00 176.49 ? 156 GLN A CG    1 
ATOM 2536 C CD    . GLN G 3 156 ? 53.772  78.734  -11.904 1.00 176.11 ? 156 GLN A CD    1 
ATOM 2537 O OE1   . GLN G 3 156 ? 52.709  78.408  -12.437 1.00 174.17 ? 156 GLN A OE1   1 
ATOM 2538 N NE2   . GLN G 3 156 ? 54.844  77.950  -11.910 1.00 175.36 ? 156 GLN A NE2   1 
ATOM 2539 N N     . GLN G 3 157 ? 50.581  82.547  -8.932  1.00 176.06 ? 157 GLN A N     1 
ATOM 2540 C CA    . GLN G 3 157 ? 49.298  83.205  -8.728  1.00 176.51 ? 157 GLN A CA    1 
ATOM 2541 C C     . GLN G 3 157 ? 49.406  84.703  -9.022  1.00 178.32 ? 157 GLN A C     1 
ATOM 2542 O O     . GLN G 3 157 ? 48.423  85.343  -9.410  1.00 178.73 ? 157 GLN A O     1 
ATOM 2543 C CB    . GLN G 3 157 ? 48.844  83.000  -7.280  1.00 175.30 ? 157 GLN A CB    1 
ATOM 2544 C CG    . GLN G 3 157 ? 47.341  83.095  -7.060  1.00 171.84 ? 157 GLN A CG    1 
ATOM 2545 C CD    . GLN G 3 157 ? 46.621  81.795  -7.365  1.00 169.59 ? 157 GLN A CD    1 
ATOM 2546 O OE1   . GLN G 3 157 ? 47.044  80.720  -6.935  1.00 167.24 ? 157 GLN A OE1   1 
ATOM 2547 N NE2   . GLN G 3 157 ? 45.522  81.887  -8.106  1.00 169.70 ? 157 GLN A NE2   1 
ATOM 2548 N N     . GLY G 3 158 ? 50.610  85.246  -8.844  1.00 179.64 ? 158 GLY A N     1 
ATOM 2549 C CA    . GLY G 3 158 ? 50.853  86.682  -8.962  1.00 181.11 ? 158 GLY A CA    1 
ATOM 2550 C C     . GLY G 3 158 ? 50.484  87.380  -7.669  1.00 181.90 ? 158 GLY A C     1 
ATOM 2551 O O     . GLY G 3 158 ? 50.207  88.582  -7.655  1.00 182.82 ? 158 GLY A O     1 
ATOM 2552 N N     . LEU G 3 159 ? 50.482  86.610  -6.583  1.00 181.50 ? 159 LEU A N     1 
ATOM 2553 C CA    . LEU G 3 159 ? 50.067  87.089  -5.273  1.00 181.30 ? 159 LEU A CA    1 
ATOM 2554 C C     . LEU G 3 159 ? 51.164  87.950  -4.660  1.00 181.67 ? 159 LEU A C     1 
ATOM 2555 O O     . LEU G 3 159 ? 52.353  87.705  -4.888  1.00 181.18 ? 159 LEU A O     1 
ATOM 2556 C CB    . LEU G 3 159 ? 49.742  85.897  -4.368  1.00 180.89 ? 159 LEU A CB    1 
ATOM 2557 C CG    . LEU G 3 159 ? 48.692  86.036  -3.262  1.00 180.33 ? 159 LEU A CG    1 
ATOM 2558 C CD1   . LEU G 3 159 ? 47.875  84.760  -3.153  1.00 180.37 ? 159 LEU A CD1   1 
ATOM 2559 C CD2   . LEU G 3 159 ? 49.329  86.377  -1.927  1.00 179.17 ? 159 LEU A CD2   1 
ATOM 2560 N N     . GLY G 3 160 ? 50.755  88.966  -3.902  1.00 182.55 ? 160 GLY A N     1 
ATOM 2561 C CA    . GLY G 3 160 ? 51.687  89.846  -3.200  1.00 183.53 ? 160 GLY A CA    1 
ATOM 2562 C C     . GLY G 3 160 ? 52.564  89.060  -2.246  1.00 184.18 ? 160 GLY A C     1 
ATOM 2563 O O     . GLY G 3 160 ? 52.063  88.280  -1.433  1.00 184.75 ? 160 GLY A O     1 
ATOM 2564 N N     . ALA G 3 161 ? 53.875  89.263  -2.351  1.00 183.79 ? 161 ALA A N     1 
ATOM 2565 C CA    . ALA G 3 161 ? 54.849  88.489  -1.582  1.00 183.71 ? 161 ALA A CA    1 
ATOM 2566 C C     . ALA G 3 161 ? 54.697  88.648  -0.066  1.00 183.49 ? 161 ALA A C     1 
ATOM 2567 O O     . ALA G 3 161 ? 54.881  87.687  0.685   1.00 182.99 ? 161 ALA A O     1 
ATOM 2568 C CB    . ALA G 3 161 ? 56.258  88.840  -2.021  1.00 184.20 ? 161 ALA A CB    1 
ATOM 2569 N N     . SER G 3 162 ? 54.354  89.861  0.366   1.00 183.74 ? 162 SER A N     1 
ATOM 2570 C CA    . SER G 3 162 ? 54.186  90.186  1.785   1.00 183.77 ? 162 SER A CA    1 
ATOM 2571 C C     . SER G 3 162 ? 53.012  89.441  2.421   1.00 182.79 ? 162 SER A C     1 
ATOM 2572 O O     . SER G 3 162 ? 53.072  89.058  3.592   1.00 182.42 ? 162 SER A O     1 
ATOM 2573 C CB    . SER G 3 162 ? 54.012  91.697  1.966   1.00 184.43 ? 162 SER A CB    1 
ATOM 2574 O OG    . SER G 3 162 ? 53.961  92.051  3.338   1.00 186.40 ? 162 SER A OG    1 
ATOM 2575 N N     . HIS G 3 163 ? 51.953  89.244  1.637   1.00 182.02 ? 163 HIS A N     1 
ATOM 2576 C CA    . HIS G 3 163 ? 50.740  88.553  2.078   1.00 180.92 ? 163 HIS A CA    1 
ATOM 2577 C C     . HIS G 3 163 ? 51.031  87.099  2.473   1.00 179.54 ? 163 HIS A C     1 
ATOM 2578 O O     . HIS G 3 163 ? 50.474  86.592  3.450   1.00 179.69 ? 163 HIS A O     1 
ATOM 2579 C CB    . HIS G 3 163 ? 49.683  88.602  0.965   1.00 180.88 ? 163 HIS A CB    1 
ATOM 2580 C CG    . HIS G 3 163 ? 48.268  88.604  1.459   1.00 180.99 ? 163 HIS A CG    1 
ATOM 2581 N ND1   . HIS G 3 163 ? 47.464  89.724  1.406   1.00 181.64 ? 163 HIS A ND1   1 
ATOM 2582 C CD2   . HIS G 3 163 ? 47.508  87.622  1.999   1.00 180.92 ? 163 HIS A CD2   1 
ATOM 2583 C CE1   . HIS G 3 163 ? 46.274  89.433  1.899   1.00 181.13 ? 163 HIS A CE1   1 
ATOM 2584 N NE2   . HIS G 3 163 ? 46.274  88.165  2.267   1.00 181.52 ? 163 HIS A NE2   1 
ATOM 2585 N N     . ILE G 3 164 ? 51.923  86.453  1.721   1.00 177.47 ? 164 ILE A N     1 
ATOM 2586 C CA    . ILE G 3 164 ? 52.237  85.030  1.891   1.00 175.43 ? 164 ILE A CA    1 
ATOM 2587 C C     . ILE G 3 164 ? 52.899  84.724  3.238   1.00 174.73 ? 164 ILE A C     1 
ATOM 2588 O O     . ILE G 3 164 ? 52.717  83.637  3.793   1.00 174.08 ? 164 ILE A O     1 
ATOM 2589 C CB    . ILE G 3 164 ? 53.131  84.497  0.734   1.00 175.16 ? 164 ILE A CB    1 
ATOM 2590 C CG1   . ILE G 3 164 ? 52.675  85.063  -0.617  1.00 174.60 ? 164 ILE A CG1   1 
ATOM 2591 C CG2   . ILE G 3 164 ? 53.120  82.969  0.702   1.00 174.58 ? 164 ILE A CG2   1 
ATOM 2592 C CD1   . ILE G 3 164 ? 53.674  84.876  -1.752  1.00 174.92 ? 164 ILE A CD1   1 
ATOM 2593 N N     . SER G 3 165 ? 53.650  85.690  3.762   1.00 174.77 ? 165 SER A N     1 
ATOM 2594 C CA    . SER G 3 165 ? 54.397  85.513  5.012   1.00 175.52 ? 165 SER A CA    1 
ATOM 2595 C C     . SER G 3 165 ? 53.511  85.397  6.260   1.00 174.71 ? 165 SER A C     1 
ATOM 2596 O O     . SER G 3 165 ? 54.017  85.176  7.367   1.00 174.93 ? 165 SER A O     1 
ATOM 2597 C CB    . SER G 3 165 ? 55.429  86.632  5.185   1.00 176.31 ? 165 SER A CB    1 
ATOM 2598 O OG    . SER G 3 165 ? 54.815  87.908  5.164   1.00 178.68 ? 165 SER A OG    1 
ATOM 2599 N N     . LYS G 3 166 ? 52.199  85.543  6.079   1.00 173.06 ? 166 LYS A N     1 
ATOM 2600 C CA    . LYS G 3 166 ? 51.241  85.333  7.166   1.00 171.97 ? 166 LYS A CA    1 
ATOM 2601 C C     . LYS G 3 166 ? 50.125  84.348  6.812   1.00 171.19 ? 166 LYS A C     1 
ATOM 2602 O O     . LYS G 3 166 ? 49.409  83.877  7.700   1.00 170.66 ? 166 LYS A O     1 
ATOM 2603 C CB    . LYS G 3 166 ? 50.684  86.664  7.685   1.00 171.90 ? 166 LYS A CB    1 
ATOM 2604 C CG    . LYS G 3 166 ? 51.627  87.365  8.657   1.00 172.37 ? 166 LYS A CG    1 
ATOM 2605 C CD    . LYS G 3 166 ? 51.013  88.617  9.262   1.00 172.13 ? 166 LYS A CD    1 
ATOM 2606 C CE    . LYS G 3 166 ? 51.980  89.273  10.239  1.00 170.83 ? 166 LYS A CE    1 
ATOM 2607 N NZ    . LYS G 3 166 ? 51.432  90.537  10.803  1.00 170.36 ? 166 LYS A NZ    1 
ATOM 2608 N N     . THR G 3 167 ? 49.984  84.036  5.522   1.00 171.03 ? 167 THR A N     1 
ATOM 2609 C CA    . THR G 3 167 ? 49.169  82.898  5.088   1.00 171.18 ? 167 THR A CA    1 
ATOM 2610 C C     . THR G 3 167 ? 49.926  81.631  5.490   1.00 171.71 ? 167 THR A C     1 
ATOM 2611 O O     . THR G 3 167 ? 49.364  80.740  6.127   1.00 172.69 ? 167 THR A O     1 
ATOM 2612 C CB    . THR G 3 167 ? 48.866  82.922  3.564   1.00 171.13 ? 167 THR A CB    1 
ATOM 2613 O OG1   . THR G 3 167 ? 48.060  84.064  3.251   1.00 171.86 ? 167 THR A OG1   1 
ATOM 2614 C CG2   . THR G 3 167 ? 48.118  81.660  3.127   1.00 170.74 ? 167 THR A CG2   1 
ATOM 2615 N N     . MET G 3 168 ? 51.203  81.568  5.114   1.00 171.64 ? 168 MET A N     1 
ATOM 2616 C CA    . MET G 3 168 ? 52.147  80.618  5.697   1.00 171.31 ? 168 MET A CA    1 
ATOM 2617 C C     . MET G 3 168 ? 52.989  81.405  6.695   1.00 171.48 ? 168 MET A C     1 
ATOM 2618 O O     . MET G 3 168 ? 53.801  82.240  6.293   1.00 172.33 ? 168 MET A O     1 
ATOM 2619 C CB    . MET G 3 168 ? 53.033  79.982  4.619   1.00 170.89 ? 168 MET A CB    1 
ATOM 2620 C CG    . MET G 3 168 ? 52.358  78.870  3.820   1.00 170.90 ? 168 MET A CG    1 
ATOM 2621 S SD    . MET G 3 168 ? 53.429  78.097  2.586   1.00 170.83 ? 168 MET A SD    1 
ATOM 2622 C CE    . MET G 3 168 ? 53.467  79.359  1.316   1.00 168.45 ? 168 MET A CE    1 
ATOM 2623 N N     . ASN G 3 169 ? 52.780  81.155  7.989   1.00 171.02 ? 169 ASN A N     1 
ATOM 2624 C CA    . ASN G 3 169 ? 53.409  81.955  9.049   1.00 170.86 ? 169 ASN A CA    1 
ATOM 2625 C C     . ASN G 3 169 ? 54.923  81.747  9.144   1.00 170.99 ? 169 ASN A C     1 
ATOM 2626 O O     . ASN G 3 169 ? 55.430  81.092  10.059  1.00 170.71 ? 169 ASN A O     1 
ATOM 2627 C CB    . ASN G 3 169 ? 52.722  81.725  10.404  1.00 170.36 ? 169 ASN A CB    1 
ATOM 2628 C CG    . ASN G 3 169 ? 52.976  82.857  11.395  1.00 168.81 ? 169 ASN A CG    1 
ATOM 2629 O OD1   . ASN G 3 169 ? 53.360  83.967  11.016  1.00 166.76 ? 169 ASN A OD1   1 
ATOM 2630 N ND2   . ASN G 3 169 ? 52.750  82.579  12.674  1.00 167.74 ? 169 ASN A ND2   1 
ATOM 2631 N N     . ILE G 3 170 ? 55.627  82.327  8.174   1.00 171.45 ? 170 ILE A N     1 
ATOM 2632 C CA    . ILE G 3 170 ? 57.070  82.175  8.020   1.00 171.91 ? 170 ILE A CA    1 
ATOM 2633 C C     . ILE G 3 170 ? 57.723  83.547  7.868   1.00 172.82 ? 170 ILE A C     1 
ATOM 2634 O O     . ILE G 3 170 ? 57.045  84.576  7.948   1.00 172.92 ? 170 ILE A O     1 
ATOM 2635 C CB    . ILE G 3 170 ? 57.424  81.296  6.782   1.00 171.92 ? 170 ILE A CB    1 
ATOM 2636 C CG1   . ILE G 3 170 ? 56.919  81.946  5.481   1.00 171.95 ? 170 ILE A CG1   1 
ATOM 2637 C CG2   . ILE G 3 170 ? 56.883  79.872  6.954   1.00 171.24 ? 170 ILE A CG2   1 
ATOM 2638 C CD1   . ILE G 3 170 ? 57.617  81.469  4.214   1.00 171.64 ? 170 ILE A CD1   1 
ATOM 2639 N N     . ALA G 3 171 ? 59.036  83.551  7.645   1.00 173.67 ? 171 ALA A N     1 
ATOM 2640 C CA    . ALA G 3 171 ? 59.778  84.776  7.357   1.00 174.26 ? 171 ALA A CA    1 
ATOM 2641 C C     . ALA G 3 171 ? 59.478  85.291  5.949   1.00 174.26 ? 171 ALA A C     1 
ATOM 2642 O O     . ALA G 3 171 ? 59.342  84.507  5.004   1.00 173.73 ? 171 ALA A O     1 
ATOM 2643 C CB    . ALA G 3 171 ? 61.267  84.546  7.529   1.00 174.26 ? 171 ALA A CB    1 
ATOM 2644 N N     . ARG G 3 172 ? 59.378  86.612  5.824   1.00 174.52 ? 172 ARG A N     1 
ATOM 2645 C CA    . ARG G 3 172 ? 59.092  87.262  4.545   1.00 174.95 ? 172 ARG A CA    1 
ATOM 2646 C C     . ARG G 3 172 ? 60.295  87.252  3.597   1.00 174.62 ? 172 ARG A C     1 
ATOM 2647 O O     . ARG G 3 172 ? 60.134  87.166  2.378   1.00 173.98 ? 172 ARG A O     1 
ATOM 2648 C CB    . ARG G 3 172 ? 58.576  88.690  4.768   1.00 175.33 ? 172 ARG A CB    1 
ATOM 2649 C CG    . ARG G 3 172 ? 59.509  89.617  5.555   1.00 175.49 ? 172 ARG A CG    1 
ATOM 2650 C CD    . ARG G 3 172 ? 58.799  90.902  5.982   1.00 175.86 ? 172 ARG A CD    1 
ATOM 2651 N NE    . ARG G 3 172 ? 58.250  91.651  4.849   1.00 176.72 ? 172 ARG A NE    1 
ATOM 2652 C CZ    . ARG G 3 172 ? 58.846  92.686  4.260   1.00 176.31 ? 172 ARG A CZ    1 
ATOM 2653 N NH1   . ARG G 3 172 ? 60.026  93.123  4.687   1.00 176.58 ? 172 ARG A NH1   1 
ATOM 2654 N NH2   . ARG G 3 172 ? 58.257  93.289  3.238   1.00 174.86 ? 172 ARG A NH2   1 
ATOM 2655 N N     . SER G 3 173 ? 61.491  87.336  4.171   1.00 174.79 ? 173 SER A N     1 
ATOM 2656 C CA    . SER G 3 173 ? 62.737  87.361  3.411   1.00 174.91 ? 173 SER A CA    1 
ATOM 2657 C C     . SER G 3 173 ? 62.999  86.044  2.669   1.00 174.24 ? 173 SER A C     1 
ATOM 2658 O O     . SER G 3 173 ? 63.480  86.052  1.531   1.00 172.98 ? 173 SER A O     1 
ATOM 2659 C CB    . SER G 3 173 ? 63.903  87.698  4.346   1.00 175.39 ? 173 SER A CB    1 
ATOM 2660 O OG    . SER G 3 173 ? 65.132  87.905  3.602   1.00 178.17 ? 173 SER A OG    1 
ATOM 2661 N N     . THR G 3 174 ? 62.676  84.923  3.314   1.00 174.29 ? 174 THR A N     1 
ATOM 2662 C CA    . THR G 3 174 ? 62.861  83.599  2.715   1.00 175.32 ? 174 THR A CA    1 
ATOM 2663 C C     . THR G 3 174 ? 61.972  83.392  1.497   1.00 176.08 ? 174 THR A C     1 
ATOM 2664 O O     . THR G 3 174 ? 62.414  82.824  0.498   1.00 176.34 ? 174 THR A O     1 
ATOM 2665 C CB    . THR G 3 174 ? 62.612  82.463  3.721   1.00 175.49 ? 174 THR A CB    1 
ATOM 2666 O OG1   . THR G 3 174 ? 61.515  82.809  4.577   1.00 176.48 ? 174 THR A OG1   1 
ATOM 2667 C CG2   . THR G 3 174 ? 63.854  82.226  4.558   1.00 175.35 ? 174 THR A CG2   1 
ATOM 2668 N N     . VAL G 3 175 ? 60.729  83.863  1.590   1.00 176.73 ? 175 VAL A N     1 
ATOM 2669 C CA    . VAL G 3 175 ? 59.776  83.832  0.478   1.00 176.86 ? 175 VAL A CA    1 
ATOM 2670 C C     . VAL G 3 175 ? 60.466  84.170  -0.845  1.00 177.45 ? 175 VAL A C     1 
ATOM 2671 O O     . VAL G 3 175 ? 60.412  83.386  -1.795  1.00 177.19 ? 175 VAL A O     1 
ATOM 2672 C CB    . VAL G 3 175 ? 58.596  84.814  0.714   1.00 176.46 ? 175 VAL A CB    1 
ATOM 2673 C CG1   . VAL G 3 175 ? 57.634  84.812  -0.470  1.00 176.32 ? 175 VAL A CG1   1 
ATOM 2674 C CG2   . VAL G 3 175 ? 57.859  84.476  2.000   1.00 177.02 ? 175 VAL A CG2   1 
ATOM 2675 N N     . TYR G 3 176 ? 61.130  85.325  -0.880  1.00 178.24 ? 176 TYR A N     1 
ATOM 2676 C CA    . TYR G 3 176 ? 61.827  85.808  -2.073  1.00 179.17 ? 176 TYR A CA    1 
ATOM 2677 C C     . TYR G 3 176 ? 62.944  84.867  -2.520  1.00 178.34 ? 176 TYR A C     1 
ATOM 2678 O O     . TYR G 3 176 ? 62.880  84.291  -3.611  1.00 176.91 ? 176 TYR A O     1 
ATOM 2679 C CB    . TYR G 3 176 ? 62.393  87.214  -1.833  1.00 180.32 ? 176 TYR A CB    1 
ATOM 2680 C CG    . TYR G 3 176 ? 61.353  88.308  -1.800  1.00 180.86 ? 176 TYR A CG    1 
ATOM 2681 C CD1   . TYR G 3 176 ? 60.687  88.627  -0.618  1.00 182.43 ? 176 TYR A CD1   1 
ATOM 2682 C CD2   . TYR G 3 176 ? 61.038  89.031  -2.949  1.00 181.44 ? 176 TYR A CD2   1 
ATOM 2683 C CE1   . TYR G 3 176 ? 59.727  89.637  -0.583  1.00 182.02 ? 176 TYR A CE1   1 
ATOM 2684 C CE2   . TYR G 3 176 ? 60.081  90.043  -2.925  1.00 181.26 ? 176 TYR A CE2   1 
ATOM 2685 C CZ    . TYR G 3 176 ? 59.434  90.340  -1.738  1.00 180.94 ? 176 TYR A CZ    1 
ATOM 2686 O OH    . TYR G 3 176 ? 58.489  91.337  -1.702  1.00 182.76 ? 176 TYR A OH    1 
ATOM 2687 N N     . LYS G 3 177 ? 63.954  84.710  -1.668  1.00 178.69 ? 177 LYS A N     1 
ATOM 2688 C CA    . LYS G 3 177 ? 65.122  83.898  -1.992  1.00 181.45 ? 177 LYS A CA    1 
ATOM 2689 C C     . LYS G 3 177 ? 64.729  82.507  -2.504  1.00 183.24 ? 177 LYS A C     1 
ATOM 2690 O O     . LYS G 3 177 ? 65.422  81.935  -3.348  1.00 184.74 ? 177 LYS A O     1 
ATOM 2691 C CB    . LYS G 3 177 ? 66.057  83.787  -0.782  1.00 183.45 ? 177 LYS A CB    1 
ATOM 2692 C CG    . LYS G 3 177 ? 67.505  83.408  -1.132  1.00 184.22 ? 177 LYS A CG    1 
ATOM 2693 C CD    . LYS G 3 177 ? 68.277  82.862  0.070   1.00 179.83 ? 177 LYS A CD    1 
ATOM 2694 C CE    . LYS G 3 177 ? 67.915  81.409  0.365   1.00 179.02 ? 177 LYS A CE    1 
ATOM 2695 N NZ    . LYS G 3 177 ? 68.414  80.462  -0.676  1.00 179.05 ? 177 LYS A NZ    1 
ATOM 2696 N N     . VAL G 3 178 ? 63.615  81.977  -2.000  1.00 183.11 ? 178 VAL A N     1 
ATOM 2697 C CA    . VAL G 3 178 ? 63.088  80.683  -2.443  1.00 182.89 ? 178 VAL A CA    1 
ATOM 2698 C C     . VAL G 3 178 ? 62.812  80.673  -3.950  1.00 182.79 ? 178 VAL A C     1 
ATOM 2699 O O     . VAL G 3 178 ? 63.194  79.732  -4.652  1.00 183.23 ? 178 VAL A O     1 
ATOM 2700 C CB    . VAL G 3 178 ? 61.808  80.289  -1.653  1.00 183.01 ? 178 VAL A CB    1 
ATOM 2701 C CG1   . VAL G 3 178 ? 61.063  79.143  -2.336  1.00 184.82 ? 178 VAL A CG1   1 
ATOM 2702 C CG2   . VAL G 3 178 ? 62.159  79.913  -0.223  1.00 181.11 ? 178 VAL A CG2   1 
ATOM 2703 N N     . ILE G 3 179 ? 62.168  81.732  -4.436  1.00 181.94 ? 179 ILE A N     1 
ATOM 2704 C CA    . ILE G 3 179 ? 61.800  81.854  -5.846  1.00 182.44 ? 179 ILE A CA    1 
ATOM 2705 C C     . ILE G 3 179 ? 63.029  82.048  -6.738  1.00 182.94 ? 179 ILE A C     1 
ATOM 2706 O O     . ILE G 3 179 ? 63.003  81.723  -7.927  1.00 182.60 ? 179 ILE A O     1 
ATOM 2707 C CB    . ILE G 3 179 ? 60.803  83.015  -6.061  1.00 182.84 ? 179 ILE A CB    1 
ATOM 2708 C CG1   . ILE G 3 179 ? 59.690  82.963  -5.009  1.00 183.80 ? 179 ILE A CG1   1 
ATOM 2709 C CG2   . ILE G 3 179 ? 60.207  82.968  -7.470  1.00 184.37 ? 179 ILE A CG2   1 
ATOM 2710 C CD1   . ILE G 3 179 ? 58.992  84.291  -4.765  1.00 184.25 ? 179 ILE A CD1   1 
ATOM 2711 N N     . ASN G 3 180 ? 64.105  82.563  -6.150  1.00 184.33 ? 180 ASN A N     1 
ATOM 2712 C CA    . ASN G 3 180 ? 65.338  82.849  -6.884  1.00 186.57 ? 180 ASN A CA    1 
ATOM 2713 C C     . ASN G 3 180 ? 66.176  81.619  -7.261  1.00 188.58 ? 180 ASN A C     1 
ATOM 2714 O O     . ASN G 3 180 ? 67.025  81.704  -8.153  1.00 188.91 ? 180 ASN A O     1 
ATOM 2715 C CB    . ASN G 3 180 ? 66.202  83.845  -6.103  1.00 186.50 ? 180 ASN A CB    1 
ATOM 2716 C CG    . ASN G 3 180 ? 65.464  85.131  -5.768  1.00 187.01 ? 180 ASN A CG    1 
ATOM 2717 O OD1   . ASN G 3 180 ? 64.505  85.513  -6.442  1.00 187.11 ? 180 ASN A OD1   1 
ATOM 2718 N ND2   . ASN G 3 180 ? 65.919  85.810  -4.721  1.00 187.74 ? 180 ASN A ND2   1 
ATOM 2719 N N     . GLU G 3 181 ? 65.942  80.489  -6.590  1.00 190.56 ? 181 GLU A N     1 
ATOM 2720 C CA    . GLU G 3 181 ? 66.732  79.270  -6.820  1.00 192.57 ? 181 GLU A CA    1 
ATOM 2721 C C     . GLU G 3 181 ? 66.468  78.634  -8.188  1.00 193.35 ? 181 GLU A C     1 
ATOM 2722 O O     . GLU G 3 181 ? 67.407  78.378  -8.946  1.00 193.31 ? 181 GLU A O     1 
ATOM 2723 C CB    . GLU G 3 181 ? 66.529  78.244  -5.693  1.00 192.32 ? 181 GLU A CB    1 
ATOM 2724 C CG    . GLU G 3 181 ? 67.411  76.991  -5.830  1.00 194.59 ? 181 GLU A CG    1 
ATOM 2725 C CD    . GLU G 3 181 ? 67.438  76.111  -4.583  1.00 194.42 ? 181 GLU A CD    1 
ATOM 2726 O OE1   . GLU G 3 181 ? 67.496  76.653  -3.458  1.00 198.79 ? 181 GLU A OE1   1 
ATOM 2727 O OE2   . GLU G 3 181 ? 67.421  74.869  -4.731  1.00 193.25 ? 181 GLU A OE2   1 
ATOM 2728 N N     . SER G 3 182 ? 65.197  78.381  -8.492  1.00 194.48 ? 182 SER A N     1 
ATOM 2729 C CA    . SER G 3 182 ? 64.815  77.778  -9.768  1.00 195.70 ? 182 SER A CA    1 
ATOM 2730 C C     . SER G 3 182 ? 64.880  78.794  -10.912 1.00 196.62 ? 182 SER A C     1 
ATOM 2731 O O     . SER G 3 182 ? 63.935  79.556  -11.138 1.00 197.01 ? 182 SER A O     1 
ATOM 2732 C CB    . SER G 3 182 ? 63.424  77.139  -9.673  1.00 195.72 ? 182 SER A CB    1 
ATOM 2733 O OG    . SER G 3 182 ? 62.449  78.083  -9.262  1.00 196.31 ? 182 SER A OG    1 
ATOM 2734 N N     . ASN G 3 183 ? 66.013  78.803  -11.615 1.00 197.19 ? 183 ASN A N     1 
ATOM 2735 C CA    . ASN G 3 183 ? 66.226  79.684  -12.766 1.00 197.43 ? 183 ASN A CA    1 
ATOM 2736 C C     . ASN G 3 183 ? 65.675  79.092  -14.062 1.00 197.93 ? 183 ASN A C     1 
ATOM 2737 O O     . ASN G 3 183 ? 65.978  77.953  -14.421 1.00 198.08 ? 183 ASN A O     1 
ATOM 2738 C CB    . ASN G 3 183 ? 67.717  80.011  -12.934 1.00 196.94 ? 183 ASN A CB    1 
ATOM 2739 C CG    . ASN G 3 183 ? 68.157  81.219  -12.117 1.00 195.79 ? 183 ASN A CG    1 
ATOM 2740 O OD1   . ASN G 3 183 ? 67.523  81.590  -11.129 1.00 195.60 ? 183 ASN A OD1   1 
ATOM 2741 N ND2   . ASN G 3 183 ? 69.258  81.837  -12.532 1.00 194.43 ? 183 ASN A ND2   1 
ATOM 2742 O OXT   . ASN G 3 183 ? 64.915  79.739  -14.784 1.00 198.21 ? 183 ASN A OXT   1 
ATOM 2743 N N     . ALA H 3 2   ? 106.568 86.084  -5.379  1.00 162.33 ? 2   ALA B N     1 
ATOM 2744 C CA    . ALA H 3 2   ? 107.333 87.114  -4.620  1.00 163.45 ? 2   ALA B CA    1 
ATOM 2745 C C     . ALA H 3 2   ? 108.020 86.501  -3.401  1.00 165.55 ? 2   ALA B C     1 
ATOM 2746 O O     . ALA H 3 2   ? 107.395 85.764  -2.634  1.00 166.50 ? 2   ALA B O     1 
ATOM 2747 C CB    . ALA H 3 2   ? 106.414 88.255  -4.202  1.00 162.31 ? 2   ALA B CB    1 
ATOM 2748 N N     . LEU H 3 3   ? 109.307 86.804  -3.237  1.00 167.07 ? 3   LEU B N     1 
ATOM 2749 C CA    . LEU H 3 3   ? 110.108 86.295  -2.117  1.00 168.25 ? 3   LEU B CA    1 
ATOM 2750 C C     . LEU H 3 3   ? 110.808 87.434  -1.374  1.00 168.37 ? 3   LEU B C     1 
ATOM 2751 O O     . LEU H 3 3   ? 111.199 88.435  -1.983  1.00 168.58 ? 3   LEU B O     1 
ATOM 2752 C CB    . LEU H 3 3   ? 111.129 85.258  -2.603  1.00 168.34 ? 3   LEU B CB    1 
ATOM 2753 C CG    . LEU H 3 3   ? 110.745 83.768  -2.672  1.00 170.79 ? 3   LEU B CG    1 
ATOM 2754 C CD1   . LEU H 3 3   ? 109.666 83.452  -3.711  1.00 171.23 ? 3   LEU B CD1   1 
ATOM 2755 C CD2   . LEU H 3 3   ? 111.983 82.925  -2.943  1.00 170.43 ? 3   LEU B CD2   1 
ATOM 2756 N N     . PHE H 3 4   ? 110.963 87.273  -0.060  1.00 169.00 ? 4   PHE B N     1 
ATOM 2757 C CA    . PHE H 3 4   ? 111.425 88.363  0.806   1.00 169.91 ? 4   PHE B CA    1 
ATOM 2758 C C     . PHE H 3 4   ? 112.494 87.972  1.830   1.00 170.78 ? 4   PHE B C     1 
ATOM 2759 O O     . PHE H 3 4   ? 112.606 86.806  2.225   1.00 169.34 ? 4   PHE B O     1 
ATOM 2760 C CB    . PHE H 3 4   ? 110.239 89.005  1.534   1.00 169.93 ? 4   PHE B CB    1 
ATOM 2761 C CG    . PHE H 3 4   ? 109.239 89.645  0.619   1.00 168.59 ? 4   PHE B CG    1 
ATOM 2762 C CD1   . PHE H 3 4   ? 108.163 88.915  0.121   1.00 169.06 ? 4   PHE B CD1   1 
ATOM 2763 C CD2   . PHE H 3 4   ? 109.366 90.979  0.260   1.00 168.33 ? 4   PHE B CD2   1 
ATOM 2764 C CE1   . PHE H 3 4   ? 107.234 89.502  -0.728  1.00 171.78 ? 4   PHE B CE1   1 
ATOM 2765 C CE2   . PHE H 3 4   ? 108.441 91.580  -0.588  1.00 172.01 ? 4   PHE B CE2   1 
ATOM 2766 C CZ    . PHE H 3 4   ? 107.371 90.839  -1.083  1.00 172.74 ? 4   PHE B CZ    1 
ATOM 2767 N N     . GLY H 3 5   ? 113.259 88.974  2.263   1.00 172.37 ? 5   GLY B N     1 
ATOM 2768 C CA    . GLY H 3 5   ? 114.341 88.786  3.225   1.00 173.17 ? 5   GLY B CA    1 
ATOM 2769 C C     . GLY H 3 5   ? 114.245 89.716  4.420   1.00 173.68 ? 5   GLY B C     1 
ATOM 2770 O O     . GLY H 3 5   ? 113.903 90.896  4.278   1.00 172.80 ? 5   GLY B O     1 
ATOM 2771 N N     . TYR H 3 6   ? 114.555 89.171  5.597   1.00 173.77 ? 6   TYR B N     1 
ATOM 2772 C CA    . TYR H 3 6   ? 114.506 89.909  6.860   1.00 171.93 ? 6   TYR B CA    1 
ATOM 2773 C C     . TYR H 3 6   ? 115.727 89.619  7.736   1.00 170.01 ? 6   TYR B C     1 
ATOM 2774 O O     . TYR H 3 6   ? 116.194 88.479  7.811   1.00 169.10 ? 6   TYR B O     1 
ATOM 2775 C CB    . TYR H 3 6   ? 113.216 89.573  7.614   1.00 172.42 ? 6   TYR B CB    1 
ATOM 2776 C CG    . TYR H 3 6   ? 113.047 90.333  8.905   1.00 171.84 ? 6   TYR B CG    1 
ATOM 2777 C CD1   . TYR H 3 6   ? 112.598 91.649  8.906   1.00 172.30 ? 6   TYR B CD1   1 
ATOM 2778 C CD2   . TYR H 3 6   ? 113.337 89.734  10.128  1.00 174.92 ? 6   TYR B CD2   1 
ATOM 2779 C CE1   . TYR H 3 6   ? 112.445 92.358  10.091  1.00 176.12 ? 6   TYR B CE1   1 
ATOM 2780 C CE2   . TYR H 3 6   ? 113.188 90.431  11.323  1.00 178.62 ? 6   TYR B CE2   1 
ATOM 2781 C CZ    . TYR H 3 6   ? 112.740 91.744  11.298  1.00 177.75 ? 6   TYR B CZ    1 
ATOM 2782 O OH    . TYR H 3 6   ? 112.586 92.442  12.477  1.00 176.33 ? 6   TYR B OH    1 
ATOM 2783 N N     . ALA H 3 7   ? 116.234 90.660  8.395   1.00 169.13 ? 7   ALA B N     1 
ATOM 2784 C CA    . ALA H 3 7   ? 117.384 90.542  9.302   1.00 169.11 ? 7   ALA B CA    1 
ATOM 2785 C C     . ALA H 3 7   ? 117.330 91.541  10.468  1.00 168.77 ? 7   ALA B C     1 
ATOM 2786 O O     . ALA H 3 7   ? 116.557 92.502  10.445  1.00 168.74 ? 7   ALA B O     1 
ATOM 2787 C CB    . ALA H 3 7   ? 118.691 90.676  8.532   1.00 168.74 ? 7   ALA B CB    1 
ATOM 2788 N N     . ARG H 3 8   ? 118.158 91.304  11.481  1.00 168.16 ? 8   ARG B N     1 
ATOM 2789 C CA    . ARG H 3 8   ? 118.122 92.068  12.726  1.00 169.68 ? 8   ARG B CA    1 
ATOM 2790 C C     . ARG H 3 8   ? 119.466 92.019  13.437  1.00 168.33 ? 8   ARG B C     1 
ATOM 2791 O O     . ARG H 3 8   ? 120.331 91.216  13.089  1.00 168.98 ? 8   ARG B O     1 
ATOM 2792 C CB    . ARG H 3 8   ? 117.061 91.491  13.663  1.00 172.28 ? 8   ARG B CB    1 
ATOM 2793 C CG    . ARG H 3 8   ? 115.721 92.215  13.679  1.00 176.41 ? 8   ARG B CG    1 
ATOM 2794 C CD    . ARG H 3 8   ? 114.823 91.700  14.817  1.00 172.60 ? 8   ARG B CD    1 
ATOM 2795 N NE    . ARG H 3 8   ? 115.417 91.934  16.135  1.00 176.90 ? 8   ARG B NE    1 
ATOM 2796 C CZ    . ARG H 3 8   ? 116.067 91.016  16.851  1.00 178.78 ? 8   ARG B CZ    1 
ATOM 2797 N NH1   . ARG H 3 8   ? 116.213 89.776  16.394  1.00 177.93 ? 8   ARG B NH1   1 
ATOM 2798 N NH2   . ARG H 3 8   ? 116.575 91.339  18.033  1.00 181.11 ? 8   ARG B NH2   1 
ATOM 2799 N N     . VAL H 3 9   ? 119.625 92.867  14.450  1.00 166.89 ? 9   VAL B N     1 
ATOM 2800 C CA    . VAL H 3 9   ? 120.864 92.936  15.222  1.00 165.40 ? 9   VAL B CA    1 
ATOM 2801 C C     . VAL H 3 9   ? 120.603 93.386  16.666  1.00 165.07 ? 9   VAL B C     1 
ATOM 2802 O O     . VAL H 3 9   ? 119.550 93.954  16.963  1.00 166.59 ? 9   VAL B O     1 
ATOM 2803 C CB    . VAL H 3 9   ? 121.889 93.871  14.532  1.00 164.53 ? 9   VAL B CB    1 
ATOM 2804 C CG1   . VAL H 3 9   ? 121.505 95.341  14.711  1.00 162.63 ? 9   VAL B CG1   1 
ATOM 2805 C CG2   . VAL H 3 9   ? 123.300 93.592  15.034  1.00 166.89 ? 9   VAL B CG2   1 
ATOM 2806 N N     . SER H 3 10  ? 121.554 93.120  17.558  1.00 163.50 ? 10  SER B N     1 
ATOM 2807 C CA    . SER H 3 10  ? 121.470 93.597  18.934  1.00 163.19 ? 10  SER B CA    1 
ATOM 2808 C C     . SER H 3 10  ? 122.789 94.195  19.395  1.00 165.04 ? 10  SER B C     1 
ATOM 2809 O O     . SER H 3 10  ? 122.826 95.308  19.920  1.00 165.58 ? 10  SER B O     1 
ATOM 2810 C CB    . SER H 3 10  ? 121.077 92.466  19.877  1.00 161.95 ? 10  SER B CB    1 
ATOM 2811 O OG    . SER H 3 10  ? 119.876 91.829  19.468  1.00 161.03 ? 10  SER B OG    1 
ATOM 2812 N N     . THR H 3 11  ? 123.867 93.448  19.182  1.00 167.10 ? 11  THR B N     1 
ATOM 2813 C CA    . THR H 3 11  ? 125.191 93.793  19.697  1.00 168.94 ? 11  THR B CA    1 
ATOM 2814 C C     . THR H 3 11  ? 125.782 95.036  19.016  1.00 169.58 ? 11  THR B C     1 
ATOM 2815 O O     . THR H 3 11  ? 125.332 95.434  17.939  1.00 168.38 ? 11  THR B O     1 
ATOM 2816 C CB    . THR H 3 11  ? 126.167 92.596  19.534  1.00 169.58 ? 11  THR B CB    1 
ATOM 2817 O OG1   . THR H 3 11  ? 125.427 91.371  19.404  1.00 169.10 ? 11  THR B OG1   1 
ATOM 2818 C CG2   . THR H 3 11  ? 127.114 92.498  20.729  1.00 170.03 ? 11  THR B CG2   1 
ATOM 2819 N N     . SER H 3 12  ? 126.777 95.650  19.658  1.00 172.02 ? 12  SER B N     1 
ATOM 2820 C CA    . SER H 3 12  ? 127.600 96.680  19.018  1.00 174.63 ? 12  SER B CA    1 
ATOM 2821 C C     . SER H 3 12  ? 128.388 96.043  17.876  1.00 176.83 ? 12  SER B C     1 
ATOM 2822 O O     . SER H 3 12  ? 128.873 96.730  16.974  1.00 175.97 ? 12  SER B O     1 
ATOM 2823 C CB    . SER H 3 12  ? 128.556 97.322  20.025  1.00 174.58 ? 12  SER B CB    1 
ATOM 2824 O OG    . SER H 3 12  ? 129.550 96.404  20.448  1.00 174.82 ? 12  SER B OG    1 
ATOM 2825 N N     . GLN H 3 13  ? 128.512 94.718  17.952  1.00 180.02 ? 13  GLN B N     1 
ATOM 2826 C CA    . GLN H 3 13  ? 129.031 93.889  16.871  1.00 182.66 ? 13  GLN B CA    1 
ATOM 2827 C C     . GLN H 3 13  ? 127.925 93.667  15.835  1.00 182.95 ? 13  GLN B C     1 
ATOM 2828 O O     . GLN H 3 13  ? 127.191 92.672  15.880  1.00 181.21 ? 13  GLN B O     1 
ATOM 2829 C CB    . GLN H 3 13  ? 129.545 92.551  17.420  1.00 183.23 ? 13  GLN B CB    1 
ATOM 2830 C CG    . GLN H 3 13  ? 130.792 92.661  18.306  1.00 184.13 ? 13  GLN B CG    1 
ATOM 2831 C CD    . GLN H 3 13  ? 131.112 91.378  19.071  1.00 183.83 ? 13  GLN B CD    1 
ATOM 2832 O OE1   . GLN H 3 13  ? 131.770 91.417  20.110  1.00 184.41 ? 13  GLN B OE1   1 
ATOM 2833 N NE2   . GLN H 3 13  ? 130.647 90.239  18.560  1.00 185.14 ? 13  GLN B NE2   1 
ATOM 2834 N N     . GLN H 3 14  ? 127.818 94.621  14.910  1.00 184.56 ? 14  GLN B N     1 
ATOM 2835 C CA    . GLN H 3 14  ? 126.782 94.635  13.875  1.00 184.74 ? 14  GLN B CA    1 
ATOM 2836 C C     . GLN H 3 14  ? 127.001 93.533  12.838  1.00 184.33 ? 14  GLN B C     1 
ATOM 2837 O O     . GLN H 3 14  ? 127.458 93.801  11.720  1.00 185.69 ? 14  GLN B O     1 
ATOM 2838 C CB    . GLN H 3 14  ? 126.736 96.006  13.181  1.00 184.61 ? 14  GLN B CB    1 
ATOM 2839 C CG    . GLN H 3 14  ? 126.514 97.198  14.112  1.00 184.33 ? 14  GLN B CG    1 
ATOM 2840 C CD    . GLN H 3 14  ? 127.060 98.503  13.547  1.00 183.72 ? 14  GLN B CD    1 
ATOM 2841 O OE1   . GLN H 3 14  ? 127.333 98.615  12.350  1.00 183.60 ? 14  GLN B OE1   1 
ATOM 2842 N NE2   . GLN H 3 14  ? 127.223 99.497  14.415  1.00 182.35 ? 14  GLN B NE2   1 
ATOM 2843 N N     . SER H 3 15  ? 126.672 92.297  13.209  1.00 182.57 ? 15  SER B N     1 
ATOM 2844 C CA    . SER H 3 15  ? 126.757 91.168  12.282  1.00 182.79 ? 15  SER B CA    1 
ATOM 2845 C C     . SER H 3 15  ? 125.706 91.297  11.167  1.00 181.65 ? 15  SER B C     1 
ATOM 2846 O O     . SER H 3 15  ? 125.361 90.317  10.500  1.00 183.94 ? 15  SER B O     1 
ATOM 2847 C CB    . SER H 3 15  ? 126.640 89.823  13.031  1.00 184.65 ? 15  SER B CB    1 
ATOM 2848 O OG    . SER H 3 15  ? 125.332 89.575  13.535  1.00 184.77 ? 15  SER B OG    1 
ATOM 2849 N N     . LEU H 3 16  ? 125.224 92.522  10.965  1.00 177.82 ? 16  LEU B N     1 
ATOM 2850 C CA    . LEU H 3 16  ? 124.124 92.801  10.052  1.00 175.45 ? 16  LEU B CA    1 
ATOM 2851 C C     . LEU H 3 16  ? 124.517 92.590  8.596   1.00 175.12 ? 16  LEU B C     1 
ATOM 2852 O O     . LEU H 3 16  ? 123.773 91.966  7.836   1.00 174.30 ? 16  LEU B O     1 
ATOM 2853 C CB    . LEU H 3 16  ? 123.607 94.225  10.271  1.00 174.74 ? 16  LEU B CB    1 
ATOM 2854 C CG    . LEU H 3 16  ? 122.124 94.537  10.030  1.00 173.54 ? 16  LEU B CG    1 
ATOM 2855 C CD1   . LEU H 3 16  ? 121.753 94.481  8.555   1.00 175.70 ? 16  LEU B CD1   1 
ATOM 2856 C CD2   . LEU H 3 16  ? 121.212 93.630  10.842  1.00 173.87 ? 16  LEU B CD2   1 
ATOM 2857 N N     . ASP H 3 17  ? 125.687 93.106  8.221   1.00 175.78 ? 17  ASP B N     1 
ATOM 2858 C CA    . ASP H 3 17  ? 126.228 92.940  6.871   1.00 176.79 ? 17  ASP B CA    1 
ATOM 2859 C C     . ASP H 3 17  ? 126.290 91.468  6.465   1.00 177.16 ? 17  ASP B C     1 
ATOM 2860 O O     . ASP H 3 17  ? 126.152 91.139  5.286   1.00 178.30 ? 17  ASP B O     1 
ATOM 2861 C CB    . ASP H 3 17  ? 127.625 93.565  6.767   1.00 177.11 ? 17  ASP B CB    1 
ATOM 2862 C CG    . ASP H 3 17  ? 127.622 95.061  7.032   1.00 179.52 ? 17  ASP B CG    1 
ATOM 2863 O OD1   . ASP H 3 17  ? 128.058 95.823  6.143   1.00 180.73 ? 17  ASP B OD1   1 
ATOM 2864 O OD2   . ASP H 3 17  ? 127.187 95.478  8.127   1.00 181.38 ? 17  ASP B OD2   1 
ATOM 2865 N N     . ILE H 3 18  ? 126.482 90.596  7.454   1.00 176.24 ? 18  ILE B N     1 
ATOM 2866 C CA    . ILE H 3 18  ? 126.635 89.155  7.230   1.00 175.12 ? 18  ILE B CA    1 
ATOM 2867 C C     . ILE H 3 18  ? 125.298 88.463  6.952   1.00 174.31 ? 18  ILE B C     1 
ATOM 2868 O O     . ILE H 3 18  ? 125.199 87.651  6.030   1.00 174.04 ? 18  ILE B O     1 
ATOM 2869 C CB    . ILE H 3 18  ? 127.374 88.467  8.413   1.00 175.06 ? 18  ILE B CB    1 
ATOM 2870 C CG1   . ILE H 3 18  ? 128.679 89.210  8.733   1.00 177.80 ? 18  ILE B CG1   1 
ATOM 2871 C CG2   . ILE H 3 18  ? 127.652 86.993  8.102   1.00 173.02 ? 18  ILE B CG2   1 
ATOM 2872 C CD1   . ILE H 3 18  ? 129.221 88.968  10.133  1.00 179.90 ? 18  ILE B CD1   1 
ATOM 2873 N N     . GLN H 3 19  ? 124.278 88.784  7.747   1.00 174.02 ? 19  GLN B N     1 
ATOM 2874 C CA    . GLN H 3 19  ? 122.940 88.212  7.568   1.00 173.50 ? 19  GLN B CA    1 
ATOM 2875 C C     . GLN H 3 19  ? 122.388 88.504  6.179   1.00 171.51 ? 19  GLN B C     1 
ATOM 2876 O O     . GLN H 3 19  ? 121.830 87.620  5.524   1.00 171.39 ? 19  GLN B O     1 
ATOM 2877 C CB    . GLN H 3 19  ? 121.971 88.748  8.623   1.00 174.05 ? 19  GLN B CB    1 
ATOM 2878 C CG    . GLN H 3 19  ? 121.958 87.966  9.921   1.00 175.88 ? 19  GLN B CG    1 
ATOM 2879 C CD    . GLN H 3 19  ? 120.905 88.468  10.889  1.00 174.83 ? 19  GLN B CD    1 
ATOM 2880 O OE1   . GLN H 3 19  ? 119.702 88.296  10.672  1.00 173.96 ? 19  GLN B OE1   1 
ATOM 2881 N NE2   . GLN H 3 19  ? 121.356 89.088  11.972  1.00 176.56 ? 19  GLN B NE2   1 
ATOM 2882 N N     . VAL H 3 20  ? 122.559 89.750  5.743   1.00 168.34 ? 20  VAL B N     1 
ATOM 2883 C CA    . VAL H 3 20  ? 122.070 90.206  4.449   1.00 166.38 ? 20  VAL B CA    1 
ATOM 2884 C C     . VAL H 3 20  ? 122.746 89.441  3.319   1.00 165.12 ? 20  VAL B C     1 
ATOM 2885 O O     . VAL H 3 20  ? 122.102 89.089  2.331   1.00 164.19 ? 20  VAL B O     1 
ATOM 2886 C CB    . VAL H 3 20  ? 122.288 91.726  4.275   1.00 167.18 ? 20  VAL B CB    1 
ATOM 2887 C CG1   . VAL H 3 20  ? 121.806 92.203  2.903   1.00 168.55 ? 20  VAL B CG1   1 
ATOM 2888 C CG2   . VAL H 3 20  ? 121.573 92.486  5.378   1.00 166.87 ? 20  VAL B CG2   1 
ATOM 2889 N N     . ARG H 3 21  ? 124.039 89.176  3.481   1.00 165.19 ? 21  ARG B N     1 
ATOM 2890 C CA    . ARG H 3 21  ? 124.819 88.483  2.463   1.00 166.82 ? 21  ARG B CA    1 
ATOM 2891 C C     . ARG H 3 21  ? 124.140 87.170  2.077   1.00 165.83 ? 21  ARG B C     1 
ATOM 2892 O O     . ARG H 3 21  ? 123.820 86.950  0.908   1.00 167.33 ? 21  ARG B O     1 
ATOM 2893 C CB    . ARG H 3 21  ? 126.248 88.227  2.957   1.00 168.36 ? 21  ARG B CB    1 
ATOM 2894 C CG    . ARG H 3 21  ? 127.352 88.632  1.981   1.00 169.21 ? 21  ARG B CG    1 
ATOM 2895 C CD    . ARG H 3 21  ? 127.621 90.128  2.066   1.00 172.15 ? 21  ARG B CD    1 
ATOM 2896 N NE    . ARG H 3 21  ? 128.992 90.468  1.697   1.00 175.96 ? 21  ARG B NE    1 
ATOM 2897 C CZ    . ARG H 3 21  ? 129.592 91.615  2.007   1.00 177.31 ? 21  ARG B CZ    1 
ATOM 2898 N NH1   . ARG H 3 21  ? 128.947 92.547  2.700   1.00 177.96 ? 21  ARG B NH1   1 
ATOM 2899 N NH2   . ARG H 3 21  ? 130.846 91.830  1.626   1.00 177.01 ? 21  ARG B NH2   1 
ATOM 2900 N N     . ALA H 3 22  ? 123.899 86.319  3.070   1.00 163.63 ? 22  ALA B N     1 
ATOM 2901 C CA    . ALA H 3 22  ? 123.231 85.040  2.860   1.00 162.61 ? 22  ALA B CA    1 
ATOM 2902 C C     . ALA H 3 22  ? 121.891 85.201  2.143   1.00 161.40 ? 22  ALA B C     1 
ATOM 2903 O O     . ALA H 3 22  ? 121.539 84.384  1.291   1.00 161.34 ? 22  ALA B O     1 
ATOM 2904 C CB    . ALA H 3 22  ? 123.041 84.323  4.188   1.00 163.62 ? 22  ALA B CB    1 
ATOM 2905 N N     . LEU H 3 23  ? 121.155 86.257  2.486   1.00 160.23 ? 23  LEU B N     1 
ATOM 2906 C CA    . LEU H 3 23  ? 119.855 86.535  1.875   1.00 159.82 ? 23  LEU B CA    1 
ATOM 2907 C C     . LEU H 3 23  ? 119.967 86.702  0.363   1.00 158.64 ? 23  LEU B C     1 
ATOM 2908 O O     . LEU H 3 23  ? 119.136 86.187  -0.385  1.00 157.79 ? 23  LEU B O     1 
ATOM 2909 C CB    . LEU H 3 23  ? 119.218 87.785  2.492   1.00 161.47 ? 23  LEU B CB    1 
ATOM 2910 C CG    . LEU H 3 23  ? 118.784 87.776  3.961   1.00 163.57 ? 23  LEU B CG    1 
ATOM 2911 C CD1   . LEU H 3 23  ? 118.502 89.195  4.425   1.00 163.35 ? 23  LEU B CD1   1 
ATOM 2912 C CD2   . LEU H 3 23  ? 117.555 86.896  4.168   1.00 168.42 ? 23  LEU B CD2   1 
ATOM 2913 N N     . LYS H 3 24  ? 120.996 87.424  -0.075  1.00 158.73 ? 24  LYS B N     1 
ATOM 2914 C CA    . LYS H 3 24  ? 121.282 87.587  -1.500  1.00 159.83 ? 24  LYS B CA    1 
ATOM 2915 C C     . LYS H 3 24  ? 121.747 86.274  -2.125  1.00 160.71 ? 24  LYS B C     1 
ATOM 2916 O O     . LYS H 3 24  ? 121.445 85.993  -3.286  1.00 161.38 ? 24  LYS B O     1 
ATOM 2917 C CB    . LYS H 3 24  ? 122.325 88.686  -1.732  1.00 160.04 ? 24  LYS B CB    1 
ATOM 2918 C CG    . LYS H 3 24  ? 121.771 90.103  -1.649  1.00 160.03 ? 24  LYS B CG    1 
ATOM 2919 C CD    . LYS H 3 24  ? 122.851 91.143  -1.913  1.00 159.36 ? 24  LYS B CD    1 
ATOM 2920 C CE    . LYS H 3 24  ? 122.278 92.552  -1.887  1.00 157.67 ? 24  LYS B CE    1 
ATOM 2921 N NZ    . LYS H 3 24  ? 123.333 93.584  -2.080  1.00 159.69 ? 24  LYS B NZ    1 
ATOM 2922 N N     . ASP H 3 25  ? 122.477 85.476  -1.344  1.00 161.05 ? 25  ASP B N     1 
ATOM 2923 C CA    . ASP H 3 25  ? 122.917 84.146  -1.770  1.00 160.88 ? 25  ASP B CA    1 
ATOM 2924 C C     . ASP H 3 25  ? 121.760 83.142  -1.750  1.00 159.99 ? 25  ASP B C     1 
ATOM 2925 O O     . ASP H 3 25  ? 121.972 81.935  -1.907  1.00 160.49 ? 25  ASP B O     1 
ATOM 2926 C CB    . ASP H 3 25  ? 124.073 83.647  -0.890  1.00 161.47 ? 25  ASP B CB    1 
ATOM 2927 C CG    . ASP H 3 25  ? 125.352 84.460  -1.066  1.00 164.70 ? 25  ASP B CG    1 
ATOM 2928 O OD1   . ASP H 3 25  ? 126.336 84.154  -0.359  1.00 167.78 ? 25  ASP B OD1   1 
ATOM 2929 O OD2   . ASP H 3 25  ? 125.386 85.394  -1.902  1.00 164.88 ? 25  ASP B OD2   1 
ATOM 2930 N N     . ALA H 3 26  ? 120.543 83.652  -1.553  1.00 158.20 ? 26  ALA B N     1 
ATOM 2931 C CA    . ALA H 3 26  ? 119.329 82.839  -1.576  1.00 156.61 ? 26  ALA B CA    1 
ATOM 2932 C C     . ALA H 3 26  ? 118.399 83.241  -2.721  1.00 156.04 ? 26  ALA B C     1 
ATOM 2933 O O     . ALA H 3 26  ? 117.666 82.403  -3.249  1.00 155.75 ? 26  ALA B O     1 
ATOM 2934 C CB    . ALA H 3 26  ? 118.605 82.919  -0.243  1.00 156.17 ? 26  ALA B CB    1 
ATOM 2935 N N     . GLY H 3 27  ? 118.423 84.521  -3.093  1.00 156.05 ? 27  GLY B N     1 
ATOM 2936 C CA    . GLY H 3 27  ? 117.649 85.002  -4.239  1.00 157.59 ? 27  GLY B CA    1 
ATOM 2937 C C     . GLY H 3 27  ? 116.826 86.261  -4.022  1.00 158.59 ? 27  GLY B C     1 
ATOM 2938 O O     . GLY H 3 27  ? 116.159 86.734  -4.946  1.00 159.44 ? 27  GLY B O     1 
ATOM 2939 N N     . VAL H 3 28  ? 116.868 86.806  -2.809  1.00 159.15 ? 28  VAL B N     1 
ATOM 2940 C CA    . VAL H 3 28  ? 116.141 88.035  -2.494  1.00 161.01 ? 28  VAL B CA    1 
ATOM 2941 C C     . VAL H 3 28  ? 117.075 89.235  -2.598  1.00 162.37 ? 28  VAL B C     1 
ATOM 2942 O O     . VAL H 3 28  ? 118.192 89.207  -2.075  1.00 162.76 ? 28  VAL B O     1 
ATOM 2943 C CB    . VAL H 3 28  ? 115.505 87.999  -1.080  1.00 161.64 ? 28  VAL B CB    1 
ATOM 2944 C CG1   . VAL H 3 28  ? 114.647 89.237  -0.848  1.00 161.51 ? 28  VAL B CG1   1 
ATOM 2945 C CG2   . VAL H 3 28  ? 114.671 86.732  -0.882  1.00 162.78 ? 28  VAL B CG2   1 
ATOM 2946 N N     . LYS H 3 29  ? 116.609 90.283  -3.273  1.00 163.93 ? 29  LYS B N     1 
ATOM 2947 C CA    . LYS H 3 29  ? 117.386 91.509  -3.455  1.00 166.08 ? 29  LYS B CA    1 
ATOM 2948 C C     . LYS H 3 29  ? 117.156 92.445  -2.267  1.00 168.24 ? 29  LYS B C     1 
ATOM 2949 O O     . LYS H 3 29  ? 116.188 92.274  -1.520  1.00 168.50 ? 29  LYS B O     1 
ATOM 2950 C CB    . LYS H 3 29  ? 116.988 92.217  -4.760  1.00 165.74 ? 29  LYS B CB    1 
ATOM 2951 C CG    . LYS H 3 29  ? 116.231 91.356  -5.778  1.00 166.22 ? 29  LYS B CG    1 
ATOM 2952 C CD    . LYS H 3 29  ? 117.129 90.352  -6.494  1.00 167.91 ? 29  LYS B CD    1 
ATOM 2953 C CE    . LYS H 3 29  ? 116.302 89.368  -7.307  1.00 168.33 ? 29  LYS B CE    1 
ATOM 2954 N NZ    . LYS H 3 29  ? 117.149 88.340  -7.971  1.00 169.39 ? 29  LYS B NZ    1 
ATOM 2955 N N     . ALA H 3 30  ? 118.041 93.431  -2.098  1.00 170.15 ? 30  ALA B N     1 
ATOM 2956 C CA    . ALA H 3 30  ? 117.853 94.499  -1.102  1.00 170.92 ? 30  ALA B CA    1 
ATOM 2957 C C     . ALA H 3 30  ? 116.612 95.325  -1.442  1.00 171.58 ? 30  ALA B C     1 
ATOM 2958 O O     . ALA H 3 30  ? 116.146 96.144  -0.644  1.00 171.07 ? 30  ALA B O     1 
ATOM 2959 C CB    . ALA H 3 30  ? 119.087 95.387  -1.022  1.00 170.72 ? 30  ALA B CB    1 
ATOM 2960 N N     . ASN H 3 31  ? 116.101 95.087  -2.649  1.00 172.45 ? 31  ASN B N     1 
ATOM 2961 C CA    . ASN H 3 31  ? 114.817 95.588  -3.119  1.00 172.63 ? 31  ASN B CA    1 
ATOM 2962 C C     . ASN H 3 31  ? 113.636 94.959  -2.360  1.00 172.76 ? 31  ASN B C     1 
ATOM 2963 O O     . ASN H 3 31  ? 112.518 95.469  -2.404  1.00 173.26 ? 31  ASN B O     1 
ATOM 2964 C CB    . ASN H 3 31  ? 114.697 95.301  -4.620  1.00 172.21 ? 31  ASN B CB    1 
ATOM 2965 C CG    . ASN H 3 31  ? 113.480 95.949  -5.249  1.00 173.51 ? 31  ASN B CG    1 
ATOM 2966 O OD1   . ASN H 3 31  ? 113.407 97.172  -5.379  1.00 175.82 ? 31  ASN B OD1   1 
ATOM 2967 N ND2   . ASN H 3 31  ? 112.520 95.125  -5.658  1.00 172.01 ? 31  ASN B ND2   1 
ATOM 2968 N N     . ARG H 3 32  ? 113.890 93.847  -1.676  1.00 172.24 ? 32  ARG B N     1 
ATOM 2969 C CA    . ARG H 3 32  ? 112.864 93.151  -0.905  1.00 173.05 ? 32  ARG B CA    1 
ATOM 2970 C C     . ARG H 3 32  ? 113.431 92.654  0.432   1.00 174.27 ? 32  ARG B C     1 
ATOM 2971 O O     . ARG H 3 32  ? 113.011 91.616  0.963   1.00 174.97 ? 32  ARG B O     1 
ATOM 2972 C CB    . ARG H 3 32  ? 112.263 91.997  -1.726  1.00 173.42 ? 32  ARG B CB    1 
ATOM 2973 C CG    . ARG H 3 32  ? 111.229 92.431  -2.767  1.00 173.09 ? 32  ARG B CG    1 
ATOM 2974 C CD    . ARG H 3 32  ? 110.917 91.325  -3.781  1.00 172.93 ? 32  ARG B CD    1 
ATOM 2975 N NE    . ARG H 3 32  ? 109.898 91.735  -4.758  1.00 171.31 ? 32  ARG B NE    1 
ATOM 2976 C CZ    . ARG H 3 32  ? 110.144 92.184  -5.992  1.00 165.40 ? 32  ARG B CZ    1 
ATOM 2977 N NH1   . ARG H 3 32  ? 111.387 92.293  -6.451  1.00 160.27 ? 32  ARG B NH1   1 
ATOM 2978 N NH2   . ARG H 3 32  ? 109.132 92.524  -6.780  1.00 160.60 ? 32  ARG B NH2   1 
ATOM 2979 N N     . ILE H 3 33  ? 114.385 93.410  0.971   1.00 173.80 ? 33  ILE B N     1 
ATOM 2980 C CA    . ILE H 3 33  ? 115.018 93.076  2.247   1.00 173.73 ? 33  ILE B CA    1 
ATOM 2981 C C     . ILE H 3 33  ? 114.766 94.167  3.286   1.00 173.73 ? 33  ILE B C     1 
ATOM 2982 O O     . ILE H 3 33  ? 114.758 95.357  2.960   1.00 172.93 ? 33  ILE B O     1 
ATOM 2983 C CB    . ILE H 3 33  ? 116.529 92.785  2.073   1.00 173.52 ? 33  ILE B CB    1 
ATOM 2984 C CG1   . ILE H 3 33  ? 116.733 91.344  1.601   1.00 174.90 ? 33  ILE B CG1   1 
ATOM 2985 C CG2   . ILE H 3 33  ? 117.295 93.011  3.371   1.00 173.76 ? 33  ILE B CG2   1 
ATOM 2986 C CD1   . ILE H 3 33  ? 118.124 91.056  1.058   1.00 177.34 ? 33  ILE B CD1   1 
ATOM 2987 N N     . PHE H 3 34  ? 114.551 93.753  4.532   1.00 174.22 ? 34  PHE B N     1 
ATOM 2988 C CA    . PHE H 3 34  ? 114.199 94.684  5.601   1.00 174.96 ? 34  PHE B CA    1 
ATOM 2989 C C     . PHE H 3 34  ? 114.999 94.443  6.863   1.00 174.24 ? 34  PHE B C     1 
ATOM 2990 O O     . PHE H 3 34  ? 115.388 93.309  7.155   1.00 173.95 ? 34  PHE B O     1 
ATOM 2991 C CB    . PHE H 3 34  ? 112.705 94.600  5.887   1.00 176.61 ? 34  PHE B CB    1 
ATOM 2992 C CG    . PHE H 3 34  ? 111.872 94.676  4.657   1.00 180.08 ? 34  PHE B CG    1 
ATOM 2993 C CD1   . PHE H 3 34  ? 111.433 93.518  4.026   1.00 182.02 ? 34  PHE B CD1   1 
ATOM 2994 C CD2   . PHE H 3 34  ? 111.569 95.908  4.092   1.00 182.36 ? 34  PHE B CD2   1 
ATOM 2995 C CE1   . PHE H 3 34  ? 110.680 93.588  2.864   1.00 185.36 ? 34  PHE B CE1   1 
ATOM 2996 C CE2   . PHE H 3 34  ? 110.816 95.987  2.937   1.00 183.95 ? 34  PHE B CE2   1 
ATOM 2997 C CZ    . PHE H 3 34  ? 110.368 94.829  2.318   1.00 184.67 ? 34  PHE B CZ    1 
ATOM 2998 N N     . THR H 3 35  ? 115.241 95.516  7.613   1.00 173.82 ? 35  THR B N     1 
ATOM 2999 C CA    . THR H 3 35  ? 116.095 95.428  8.789   1.00 174.46 ? 35  THR B CA    1 
ATOM 3000 C C     . THR H 3 35  ? 115.706 96.331  9.966   1.00 174.62 ? 35  THR B C     1 
ATOM 3001 O O     . THR H 3 35  ? 115.313 97.493  9.787   1.00 174.63 ? 35  THR B O     1 
ATOM 3002 C CB    . THR H 3 35  ? 117.588 95.612  8.413   1.00 174.65 ? 35  THR B CB    1 
ATOM 3003 O OG1   . THR H 3 35  ? 118.412 95.016  9.421   1.00 177.02 ? 35  THR B OG1   1 
ATOM 3004 C CG2   . THR H 3 35  ? 117.954 97.094  8.226   1.00 175.87 ? 35  THR B CG2   1 
ATOM 3005 N N     . ASP H 3 36  ? 115.820 95.764  11.166  1.00 173.52 ? 36  ASP B N     1 
ATOM 3006 C CA    . ASP H 3 36  ? 115.624 96.484  12.416  1.00 172.16 ? 36  ASP B CA    1 
ATOM 3007 C C     . ASP H 3 36  ? 116.906 96.424  13.244  1.00 172.93 ? 36  ASP B C     1 
ATOM 3008 O O     . ASP H 3 36  ? 117.408 95.335  13.543  1.00 174.75 ? 36  ASP B O     1 
ATOM 3009 C CB    . ASP H 3 36  ? 114.464 95.868  13.201  1.00 171.24 ? 36  ASP B CB    1 
ATOM 3010 C CG    . ASP H 3 36  ? 113.109 96.248  12.640  1.00 170.14 ? 36  ASP B CG    1 
ATOM 3011 O OD1   . ASP H 3 36  ? 112.821 97.463  12.568  1.00 172.00 ? 36  ASP B OD1   1 
ATOM 3012 O OD2   . ASP H 3 36  ? 112.326 95.337  12.287  1.00 165.79 ? 36  ASP B OD2   1 
ATOM 3013 N N     . LYS H 3 37  ? 117.438 97.594  13.596  1.00 171.63 ? 37  LYS B N     1 
ATOM 3014 C CA    . LYS H 3 37  ? 118.627 97.692  14.444  1.00 171.16 ? 37  LYS B CA    1 
ATOM 3015 C C     . LYS H 3 37  ? 118.205 97.971  15.882  1.00 171.58 ? 37  LYS B C     1 
ATOM 3016 O O     . LYS H 3 37  ? 118.247 99.115  16.339  1.00 172.07 ? 37  LYS B O     1 
ATOM 3017 C CB    . LYS H 3 37  ? 119.563 98.799  13.945  1.00 171.80 ? 37  LYS B CB    1 
ATOM 3018 C CG    . LYS H 3 37  ? 120.204 98.549  12.583  1.00 173.30 ? 37  LYS B CG    1 
ATOM 3019 C CD    . LYS H 3 37  ? 121.016 99.760  12.123  1.00 171.10 ? 37  LYS B CD    1 
ATOM 3020 C CE    . LYS H 3 37  ? 121.579 99.567  10.722  1.00 168.54 ? 37  LYS B CE    1 
ATOM 3021 N NZ    . LYS H 3 37  ? 122.220 100.809 10.209  1.00 166.72 ? 37  LYS B NZ    1 
ATOM 3022 N N     . ALA H 3 38  ? 117.799 96.917  16.588  1.00 173.13 ? 38  ALA B N     1 
ATOM 3023 C CA    . ALA H 3 38  ? 117.215 97.029  17.931  1.00 174.71 ? 38  ALA B CA    1 
ATOM 3024 C C     . ALA H 3 38  ? 118.019 97.932  18.864  1.00 175.73 ? 38  ALA B C     1 
ATOM 3025 O O     . ALA H 3 38  ? 119.146 97.606  19.245  1.00 176.72 ? 38  ALA B O     1 
ATOM 3026 C CB    . ALA H 3 38  ? 117.021 95.639  18.551  1.00 174.73 ? 38  ALA B CB    1 
ATOM 3027 N N     . SER H 3 39  ? 117.429 99.074  19.213  1.00 176.40 ? 39  SER B N     1 
ATOM 3028 C CA    . SER H 3 39  ? 118.088 100.061 20.062  1.00 176.97 ? 39  SER B CA    1 
ATOM 3029 C C     . SER H 3 39  ? 117.176 100.517 21.200  1.00 177.44 ? 39  SER B C     1 
ATOM 3030 O O     . SER H 3 39  ? 116.484 99.705  21.818  1.00 177.94 ? 39  SER B O     1 
ATOM 3031 C CB    . SER H 3 39  ? 118.540 101.261 19.228  1.00 176.77 ? 39  SER B CB    1 
ATOM 3032 O OG    . SER H 3 39  ? 119.349 102.135 19.995  1.00 178.31 ? 39  SER B OG    1 
ATOM 3033 N N     . ASP H 3 44  ? 111.206 98.272  19.726  1.00 194.60 ? 44  ASP B N     1 
ATOM 3034 C CA    . ASP H 3 44  ? 111.497 99.178  18.616  1.00 195.81 ? 44  ASP B CA    1 
ATOM 3035 C C     . ASP H 3 44  ? 111.652 98.414  17.300  1.00 195.14 ? 44  ASP B C     1 
ATOM 3036 O O     . ASP H 3 44  ? 112.625 98.603  16.566  1.00 194.55 ? 44  ASP B O     1 
ATOM 3037 C CB    . ASP H 3 44  ? 112.760 100.002 18.903  1.00 197.10 ? 44  ASP B CB    1 
ATOM 3038 C CG    . ASP H 3 44  ? 112.625 100.884 20.134  1.00 199.40 ? 44  ASP B CG    1 
ATOM 3039 O OD1   . ASP H 3 44  ? 112.253 100.363 21.208  1.00 202.02 ? 44  ASP B OD1   1 
ATOM 3040 O OD2   . ASP H 3 44  ? 112.908 102.097 20.029  1.00 198.03 ? 44  ASP B OD2   1 
ATOM 3041 N N     . ARG H 3 45  ? 110.679 97.556  17.009  1.00 194.83 ? 45  ARG B N     1 
ATOM 3042 C CA    . ARG H 3 45  ? 110.713 96.710  15.818  1.00 195.02 ? 45  ARG B CA    1 
ATOM 3043 C C     . ARG H 3 45  ? 109.829 97.263  14.690  1.00 193.72 ? 45  ARG B C     1 
ATOM 3044 O O     . ARG H 3 45  ? 108.912 96.589  14.211  1.00 193.69 ? 45  ARG B O     1 
ATOM 3045 C CB    . ARG H 3 45  ? 110.326 95.274  16.183  1.00 194.57 ? 45  ARG B CB    1 
ATOM 3046 C CG    . ARG H 3 45  ? 109.050 95.154  17.014  1.00 197.46 ? 45  ARG B CG    1 
ATOM 3047 C CD    . ARG H 3 45  ? 108.804 93.715  17.435  1.00 198.21 ? 45  ARG B CD    1 
ATOM 3048 N NE    . ARG H 3 45  ? 107.413 93.476  17.816  1.00 201.98 ? 45  ARG B NE    1 
ATOM 3049 C CZ    . ARG H 3 45  ? 106.891 92.272  18.038  1.00 203.17 ? 45  ARG B CZ    1 
ATOM 3050 N NH1   . ARG H 3 45  ? 107.640 91.180  17.920  1.00 201.00 ? 45  ARG B NH1   1 
ATOM 3051 N NH2   . ARG H 3 45  ? 105.614 92.158  18.377  1.00 205.59 ? 45  ARG B NH2   1 
ATOM 3052 N N     . LYS H 3 46  ? 110.129 98.491  14.268  1.00 192.04 ? 46  LYS B N     1 
ATOM 3053 C CA    . LYS H 3 46  ? 109.345 99.201  13.252  1.00 189.69 ? 46  LYS B CA    1 
ATOM 3054 C C     . LYS H 3 46  ? 109.401 98.537  11.872  1.00 188.36 ? 46  LYS B C     1 
ATOM 3055 O O     . LYS H 3 46  ? 108.363 98.219  11.294  1.00 187.95 ? 46  LYS B O     1 
ATOM 3056 C CB    . LYS H 3 46  ? 109.795 100.662 13.148  1.00 189.32 ? 46  LYS B CB    1 
ATOM 3057 C CG    . LYS H 3 46  ? 109.580 101.486 14.408  1.00 189.08 ? 46  LYS B CG    1 
ATOM 3058 C CD    . LYS H 3 46  ? 110.124 102.894 14.230  1.00 189.01 ? 46  LYS B CD    1 
ATOM 3059 C CE    . LYS H 3 46  ? 110.001 103.710 15.506  1.00 189.07 ? 46  LYS B CE    1 
ATOM 3060 N NZ    . LYS H 3 46  ? 110.555 105.084 15.342  1.00 187.89 ? 46  LYS B NZ    1 
ATOM 3061 N N     . GLY H 3 47  ? 110.614 98.331  11.360  1.00 187.02 ? 47  GLY B N     1 
ATOM 3062 C CA    . GLY H 3 47  ? 110.830 97.750  10.033  1.00 185.99 ? 47  GLY B CA    1 
ATOM 3063 C C     . GLY H 3 47  ? 110.132 96.425  9.794   1.00 185.41 ? 47  GLY B C     1 
ATOM 3064 O O     . GLY H 3 47  ? 109.741 96.120  8.667   1.00 185.84 ? 47  GLY B O     1 
ATOM 3065 N N     . LEU H 3 48  ? 109.980 95.636  10.854  1.00 185.37 ? 48  LEU B N     1 
ATOM 3066 C CA    . LEU H 3 48  ? 109.234 94.387  10.784  1.00 185.27 ? 48  LEU B CA    1 
ATOM 3067 C C     . LEU H 3 48  ? 107.771 94.654  10.460  1.00 184.92 ? 48  LEU B C     1 
ATOM 3068 O O     . LEU H 3 48  ? 107.230 94.076  9.517   1.00 184.41 ? 48  LEU B O     1 
ATOM 3069 C CB    . LEU H 3 48  ? 109.349 93.611  12.102  1.00 186.85 ? 48  LEU B CB    1 
ATOM 3070 C CG    . LEU H 3 48  ? 108.698 92.221  12.255  1.00 187.47 ? 48  LEU B CG    1 
ATOM 3071 C CD1   . LEU H 3 48  ? 107.168 92.283  12.433  1.00 187.52 ? 48  LEU B CD1   1 
ATOM 3072 C CD2   . LEU H 3 48  ? 109.085 91.272  11.115  1.00 190.56 ? 48  LEU B CD2   1 
ATOM 3073 N N     . ASP H 3 49  ? 107.144 95.523  11.256  1.00 185.26 ? 49  ASP B N     1 
ATOM 3074 C CA    . ASP H 3 49  ? 105.749 95.926  11.058  1.00 185.31 ? 49  ASP B CA    1 
ATOM 3075 C C     . ASP H 3 49  ? 105.480 96.227  9.589   1.00 184.11 ? 49  ASP B C     1 
ATOM 3076 O O     . ASP H 3 49  ? 104.486 95.766  9.024   1.00 184.36 ? 49  ASP B O     1 
ATOM 3077 C CB    . ASP H 3 49  ? 105.407 97.161  11.907  1.00 185.99 ? 49  ASP B CB    1 
ATOM 3078 C CG    . ASP H 3 49  ? 105.167 96.829  13.371  1.00 187.75 ? 49  ASP B CG    1 
ATOM 3079 O OD1   . ASP H 3 49  ? 104.103 97.223  13.897  1.00 188.11 ? 49  ASP B OD1   1 
ATOM 3080 O OD2   . ASP H 3 49  ? 106.034 96.182  13.999  1.00 189.03 ? 49  ASP B OD2   1 
ATOM 3081 N N     . LEU H 3 50  ? 106.388 96.988  8.981   1.00 182.38 ? 50  LEU B N     1 
ATOM 3082 C CA    . LEU H 3 50  ? 106.283 97.386  7.582   1.00 180.94 ? 50  LEU B CA    1 
ATOM 3083 C C     . LEU H 3 50  ? 106.263 96.189  6.642   1.00 178.32 ? 50  LEU B C     1 
ATOM 3084 O O     . LEU H 3 50  ? 105.437 96.126  5.729   1.00 178.53 ? 50  LEU B O     1 
ATOM 3085 C CB    . LEU H 3 50  ? 107.419 98.347  7.206   1.00 182.07 ? 50  LEU B CB    1 
ATOM 3086 C CG    . LEU H 3 50  ? 107.253 99.856  7.460   1.00 185.00 ? 50  LEU B CG    1 
ATOM 3087 C CD1   . LEU H 3 50  ? 106.094 100.447 6.648   1.00 186.13 ? 50  LEU B CD1   1 
ATOM 3088 C CD2   . LEU H 3 50  ? 107.106 100.208 8.945   1.00 186.81 ? 50  LEU B CD2   1 
ATOM 3089 N N     . LEU H 3 51  ? 107.169 95.242  6.874   1.00 175.67 ? 51  LEU B N     1 
ATOM 3090 C CA    . LEU H 3 51  ? 107.195 94.009  6.102   1.00 173.33 ? 51  LEU B CA    1 
ATOM 3091 C C     . LEU H 3 51  ? 105.912 93.223  6.339   1.00 171.64 ? 51  LEU B C     1 
ATOM 3092 O O     . LEU H 3 51  ? 105.315 92.700  5.397   1.00 170.53 ? 51  LEU B O     1 
ATOM 3093 C CB    . LEU H 3 51  ? 108.425 93.172  6.459   1.00 171.73 ? 51  LEU B CB    1 
ATOM 3094 C CG    . LEU H 3 51  ? 108.508 91.746  5.904   1.00 173.31 ? 51  LEU B CG    1 
ATOM 3095 C CD1   . LEU H 3 51  ? 108.347 91.689  4.383   1.00 172.42 ? 51  LEU B CD1   1 
ATOM 3096 C CD2   . LEU H 3 51  ? 109.811 91.088  6.333   1.00 175.24 ? 51  LEU B CD2   1 
ATOM 3097 N N     . ARG H 3 52  ? 105.486 93.168  7.598   1.00 172.22 ? 52  ARG B N     1 
ATOM 3098 C CA    . ARG H 3 52  ? 104.248 92.490  7.977   1.00 173.92 ? 52  ARG B CA    1 
ATOM 3099 C C     . ARG H 3 52  ? 103.025 93.168  7.348   1.00 174.67 ? 52  ARG B C     1 
ATOM 3100 O O     . ARG H 3 52  ? 101.935 92.588  7.303   1.00 175.55 ? 52  ARG B O     1 
ATOM 3101 C CB    . ARG H 3 52  ? 104.112 92.424  9.507   1.00 174.42 ? 52  ARG B CB    1 
ATOM 3102 C CG    . ARG H 3 52  ? 103.221 91.289  10.017  1.00 173.21 ? 52  ARG B CG    1 
ATOM 3103 C CD    . ARG H 3 52  ? 103.285 91.161  11.527  1.00 173.57 ? 52  ARG B CD    1 
ATOM 3104 N NE    . ARG H 3 52  ? 102.305 92.017  12.187  1.00 177.80 ? 52  ARG B NE    1 
ATOM 3105 C CZ    . ARG H 3 52  ? 102.460 92.560  13.392  1.00 180.69 ? 52  ARG B CZ    1 
ATOM 3106 N NH1   . ARG H 3 52  ? 103.571 92.355  14.090  1.00 179.66 ? 52  ARG B NH1   1 
ATOM 3107 N NH2   . ARG H 3 52  ? 101.500 93.326  13.896  1.00 183.01 ? 52  ARG B NH2   1 
ATOM 3108 N N     . MET H 3 53  ? 103.213 94.387  6.848   1.00 174.94 ? 53  MET B N     1 
ATOM 3109 C CA    . MET H 3 53  ? 102.123 95.130  6.222   1.00 175.35 ? 53  MET B CA    1 
ATOM 3110 C C     . MET H 3 53  ? 102.186 95.126  4.692   1.00 173.10 ? 53  MET B C     1 
ATOM 3111 O O     . MET H 3 53  ? 101.297 95.670  4.035   1.00 173.29 ? 53  MET B O     1 
ATOM 3112 C CB    . MET H 3 53  ? 102.061 96.567  6.758   1.00 177.03 ? 53  MET B CB    1 
ATOM 3113 C CG    . MET H 3 53  ? 100.649 97.157  6.823   1.00 182.74 ? 53  MET B CG    1 
ATOM 3114 S SD    . MET H 3 53  ? 99.656  96.577  8.228   1.00 194.20 ? 53  MET B SD    1 
ATOM 3115 C CE    . MET H 3 53  ? 99.000  95.001  7.656   1.00 188.15 ? 53  MET B CE    1 
ATOM 3116 N N     . LYS H 3 54  ? 103.218 94.506  4.124   1.00 170.84 ? 54  LYS B N     1 
ATOM 3117 C CA    . LYS H 3 54  ? 103.390 94.544  2.673   1.00 169.67 ? 54  LYS B CA    1 
ATOM 3118 C C     . LYS H 3 54  ? 103.634 93.178  2.028   1.00 168.08 ? 54  LYS B C     1 
ATOM 3119 O O     . LYS H 3 54  ? 104.413 93.055  1.081   1.00 167.97 ? 54  LYS B O     1 
ATOM 3120 C CB    . LYS H 3 54  ? 104.475 95.557  2.288   1.00 170.44 ? 54  LYS B CB    1 
ATOM 3121 C CG    . LYS H 3 54  ? 104.117 96.369  1.052   1.00 172.96 ? 54  LYS B CG    1 
ATOM 3122 C CD    . LYS H 3 54  ? 104.655 97.790  1.131   1.00 172.08 ? 54  LYS B CD    1 
ATOM 3123 C CE    . LYS H 3 54  ? 103.705 98.788  0.468   1.00 171.77 ? 54  LYS B CE    1 
ATOM 3124 N NZ    . LYS H 3 54  ? 103.388 98.457  -0.952  1.00 170.99 ? 54  LYS B NZ    1 
ATOM 3125 N N     . VAL H 3 55  ? 102.949 92.159  2.539   1.00 167.28 ? 55  VAL B N     1 
ATOM 3126 C CA    . VAL H 3 55  ? 102.977 90.821  1.941   1.00 167.53 ? 55  VAL B CA    1 
ATOM 3127 C C     . VAL H 3 55  ? 101.586 90.191  1.894   1.00 168.29 ? 55  VAL B C     1 
ATOM 3128 O O     . VAL H 3 55  ? 100.847 90.221  2.882   1.00 169.91 ? 55  VAL B O     1 
ATOM 3129 C CB    . VAL H 3 55  ? 103.955 89.861  2.664   1.00 167.07 ? 55  VAL B CB    1 
ATOM 3130 C CG1   . VAL H 3 55  ? 105.395 90.194  2.308   1.00 167.38 ? 55  VAL B CG1   1 
ATOM 3131 C CG2   . VAL H 3 55  ? 103.738 89.877  4.182   1.00 167.07 ? 55  VAL B CG2   1 
ATOM 3132 N N     . LYS H 3 56  ? 101.243 89.623  0.739   1.00 167.16 ? 56  LYS B N     1 
ATOM 3133 C CA    . LYS H 3 56  ? 99.955  88.952  0.541   1.00 165.14 ? 56  LYS B CA    1 
ATOM 3134 C C     . LYS H 3 56  ? 100.142 87.448  0.312   1.00 163.50 ? 56  LYS B C     1 
ATOM 3135 O O     . LYS H 3 56  ? 101.256 86.930  0.432   1.00 163.12 ? 56  LYS B O     1 
ATOM 3136 C CB    . LYS H 3 56  ? 99.181  89.599  -0.616  1.00 164.94 ? 56  LYS B CB    1 
ATOM 3137 C CG    . LYS H 3 56  ? 98.683  91.008  -0.316  1.00 163.76 ? 56  LYS B CG    1 
ATOM 3138 C CD    . LYS H 3 56  ? 98.216  91.724  -1.573  1.00 162.48 ? 56  LYS B CD    1 
ATOM 3139 C CE    . LYS H 3 56  ? 97.802  93.154  -1.257  1.00 162.49 ? 56  LYS B CE    1 
ATOM 3140 N NZ    . LYS H 3 56  ? 97.516  93.948  -2.481  1.00 162.07 ? 56  LYS B NZ    1 
ATOM 3141 N N     . GLU H 3 57  ? 99.052  86.755  -0.010  1.00 161.65 ? 57  GLU B N     1 
ATOM 3142 C CA    . GLU H 3 57  ? 99.071  85.303  -0.192  1.00 159.97 ? 57  GLU B CA    1 
ATOM 3143 C C     . GLU H 3 57  ? 99.992  84.883  -1.339  1.00 158.89 ? 57  GLU B C     1 
ATOM 3144 O O     . GLU H 3 57  ? 99.950  85.467  -2.423  1.00 160.06 ? 57  GLU B O     1 
ATOM 3145 C CB    . GLU H 3 57  ? 97.650  84.780  -0.427  1.00 160.14 ? 57  GLU B CB    1 
ATOM 3146 C CG    . GLU H 3 57  ? 97.478  83.283  -0.205  1.00 157.67 ? 57  GLU B CG    1 
ATOM 3147 C CD    . GLU H 3 57  ? 96.027  82.845  -0.271  1.00 158.70 ? 57  GLU B CD    1 
ATOM 3148 O OE1   . GLU H 3 57  ? 95.267  83.389  -1.103  1.00 156.43 ? 57  GLU B OE1   1 
ATOM 3149 O OE2   . GLU H 3 57  ? 95.647  81.947  0.509   1.00 157.55 ? 57  GLU B OE2   1 
ATOM 3150 N N     . GLY H 3 58  ? 100.824 83.875  -1.084  1.00 156.61 ? 58  GLY B N     1 
ATOM 3151 C CA    . GLY H 3 58  ? 101.765 83.361  -2.081  1.00 154.02 ? 58  GLY B CA    1 
ATOM 3152 C C     . GLY H 3 58  ? 103.186 83.875  -1.919  1.00 151.97 ? 58  GLY B C     1 
ATOM 3153 O O     . GLY H 3 58  ? 104.023 83.693  -2.806  1.00 152.35 ? 58  GLY B O     1 
ATOM 3154 N N     . ASP H 3 59  ? 103.459 84.511  -0.782  1.00 149.65 ? 59  ASP B N     1 
ATOM 3155 C CA    . ASP H 3 59  ? 104.779 85.072  -0.495  1.00 147.59 ? 59  ASP B CA    1 
ATOM 3156 C C     . ASP H 3 59  ? 105.547 84.251  0.548   1.00 143.67 ? 59  ASP B C     1 
ATOM 3157 O O     . ASP H 3 59  ? 104.949 83.508  1.323   1.00 142.43 ? 59  ASP B O     1 
ATOM 3158 C CB    . ASP H 3 59  ? 104.644 86.532  -0.048  1.00 149.81 ? 59  ASP B CB    1 
ATOM 3159 C CG    . ASP H 3 59  ? 103.968 87.411  -1.097  1.00 155.44 ? 59  ASP B CG    1 
ATOM 3160 O OD1   . ASP H 3 59  ? 103.851 86.986  -2.269  1.00 157.22 ? 59  ASP B OD1   1 
ATOM 3161 O OD2   . ASP H 3 59  ? 103.553 88.536  -0.745  1.00 159.80 ? 59  ASP B OD2   1 
ATOM 3162 N N     . VAL H 3 60  ? 106.873 84.390  0.550   1.00 141.20 ? 60  VAL B N     1 
ATOM 3163 C CA    . VAL H 3 60  ? 107.758 83.623  1.435   1.00 139.63 ? 60  VAL B CA    1 
ATOM 3164 C C     . VAL H 3 60  ? 108.885 84.506  1.995   1.00 140.49 ? 60  VAL B C     1 
ATOM 3165 O O     . VAL H 3 60  ? 109.637 85.118  1.234   1.00 142.50 ? 60  VAL B O     1 
ATOM 3166 C CB    . VAL H 3 60  ? 108.372 82.398  0.697   1.00 139.21 ? 60  VAL B CB    1 
ATOM 3167 C CG1   . VAL H 3 60  ? 109.464 81.737  1.532   1.00 138.55 ? 60  VAL B CG1   1 
ATOM 3168 C CG2   . VAL H 3 60  ? 107.295 81.380  0.325   1.00 140.12 ? 60  VAL B CG2   1 
ATOM 3169 N N     . ILE H 3 61  ? 109.001 84.557  3.322   1.00 140.19 ? 61  ILE B N     1 
ATOM 3170 C CA    . ILE H 3 61  ? 110.020 85.376  3.996   1.00 139.72 ? 61  ILE B CA    1 
ATOM 3171 C C     . ILE H 3 61  ? 111.238 84.559  4.417   1.00 144.05 ? 61  ILE B C     1 
ATOM 3172 O O     . ILE H 3 61  ? 111.154 83.345  4.585   1.00 146.63 ? 61  ILE B O     1 
ATOM 3173 C CB    . ILE H 3 61  ? 109.429 86.113  5.222   1.00 135.85 ? 61  ILE B CB    1 
ATOM 3174 C CG1   . ILE H 3 61  ? 108.338 87.076  4.754   1.00 135.56 ? 61  ILE B CG1   1 
ATOM 3175 C CG2   . ILE H 3 61  ? 110.516 86.874  5.981   1.00 130.74 ? 61  ILE B CG2   1 
ATOM 3176 C CD1   . ILE H 3 61  ? 107.743 87.942  5.827   1.00 133.80 ? 61  ILE B CD1   1 
ATOM 3177 N N     . LEU H 3 62  ? 112.373 85.226  4.587   1.00 147.36 ? 62  LEU B N     1 
ATOM 3178 C CA    . LEU H 3 62  ? 113.573 84.542  5.038   1.00 151.88 ? 62  LEU B CA    1 
ATOM 3179 C C     . LEU H 3 62  ? 114.297 85.244  6.180   1.00 155.92 ? 62  LEU B C     1 
ATOM 3180 O O     . LEU H 3 62  ? 114.344 86.476  6.245   1.00 155.87 ? 62  LEU B O     1 
ATOM 3181 C CB    . LEU H 3 62  ? 114.521 84.322  3.866   1.00 151.04 ? 62  LEU B CB    1 
ATOM 3182 C CG    . LEU H 3 62  ? 114.100 83.161  2.969   1.00 154.21 ? 62  LEU B CG    1 
ATOM 3183 C CD1   . LEU H 3 62  ? 114.351 83.471  1.498   1.00 161.86 ? 62  LEU B CD1   1 
ATOM 3184 C CD2   . LEU H 3 62  ? 114.800 81.882  3.384   1.00 156.91 ? 62  LEU B CD2   1 
ATOM 3185 N N     . VAL H 3 63  ? 114.835 84.436  7.091   1.00 159.05 ? 63  VAL B N     1 
ATOM 3186 C CA    . VAL H 3 63  ? 115.745 84.907  8.136   1.00 162.11 ? 63  VAL B CA    1 
ATOM 3187 C C     . VAL H 3 63  ? 116.868 83.880  8.254   1.00 161.81 ? 63  VAL B C     1 
ATOM 3188 O O     . VAL H 3 63  ? 116.610 82.672  8.137   1.00 161.99 ? 63  VAL B O     1 
ATOM 3189 C CB    . VAL H 3 63  ? 115.060 85.036  9.532   1.00 164.35 ? 63  VAL B CB    1 
ATOM 3190 C CG1   . VAL H 3 63  ? 115.842 85.995  10.413  1.00 166.47 ? 63  VAL B CG1   1 
ATOM 3191 C CG2   . VAL H 3 63  ? 113.609 85.499  9.426   1.00 162.71 ? 63  VAL B CG2   1 
ATOM 3192 N N     . LYS H 3 64  ? 118.097 84.351  8.491   1.00 159.63 ? 64  LYS B N     1 
ATOM 3193 C CA    . LYS H 3 64  ? 119.258 83.463  8.662   1.00 159.28 ? 64  LYS B CA    1 
ATOM 3194 C C     . LYS H 3 64  ? 119.053 82.489  9.815   1.00 160.44 ? 64  LYS B C     1 
ATOM 3195 O O     . LYS H 3 64  ? 118.799 81.302  9.593   1.00 161.60 ? 64  LYS B O     1 
ATOM 3196 C CB    . LYS H 3 64  ? 120.541 84.262  8.899   1.00 159.82 ? 64  LYS B CB    1 
ATOM 3197 C CG    . LYS H 3 64  ? 121.801 83.393  8.968   1.00 162.62 ? 64  LYS B CG    1 
ATOM 3198 C CD    . LYS H 3 64  ? 122.902 84.036  9.807   1.00 165.66 ? 64  LYS B CD    1 
ATOM 3199 C CE    . LYS H 3 64  ? 124.093 83.100  9.990   1.00 162.13 ? 64  LYS B CE    1 
ATOM 3200 N NZ    . LYS H 3 64  ? 125.124 83.701  10.883  1.00 162.60 ? 64  LYS B NZ    1 
ATOM 3201 N N     . LYS H 3 65  ? 119.177 83.010  11.037  1.00 161.58 ? 65  LYS B N     1 
ATOM 3202 C CA    . LYS H 3 65  ? 118.946 82.256  12.269  1.00 161.13 ? 65  LYS B CA    1 
ATOM 3203 C C     . LYS H 3 65  ? 117.490 82.350  12.672  1.00 157.57 ? 65  LYS B C     1 
ATOM 3204 O O     . LYS H 3 65  ? 116.757 83.245  12.230  1.00 154.48 ? 65  LYS B O     1 
ATOM 3205 C CB    . LYS H 3 65  ? 119.791 82.816  13.418  1.00 162.27 ? 65  LYS B CB    1 
ATOM 3206 C CG    . LYS H 3 65  ? 121.233 82.337  13.483  1.00 166.48 ? 65  LYS B CG    1 
ATOM 3207 C CD    . LYS H 3 65  ? 122.043 83.206  14.450  1.00 165.46 ? 65  LYS B CD    1 
ATOM 3208 C CE    . LYS H 3 65  ? 123.501 82.765  14.536  1.00 171.86 ? 65  LYS B CE    1 
ATOM 3209 N NZ    . LYS H 3 65  ? 123.636 81.449  15.227  1.00 176.69 ? 65  LYS B NZ    1 
ATOM 3210 N N     . LEU H 3 66  ? 117.091 81.431  13.542  1.00 157.20 ? 66  LEU B N     1 
ATOM 3211 C CA    . LEU H 3 66  ? 115.741 81.397  14.078  1.00 157.45 ? 66  LEU B CA    1 
ATOM 3212 C C     . LEU H 3 66  ? 115.474 82.520  15.083  1.00 159.45 ? 66  LEU B C     1 
ATOM 3213 O O     . LEU H 3 66  ? 114.566 83.338  14.885  1.00 160.29 ? 66  LEU B O     1 
ATOM 3214 C CB    . LEU H 3 66  ? 115.508 80.062  14.752  1.00 155.38 ? 66  LEU B CB    1 
ATOM 3215 C CG    . LEU H 3 66  ? 114.112 79.485  14.615  1.00 153.75 ? 66  LEU B CG    1 
ATOM 3216 C CD1   . LEU H 3 66  ? 113.890 78.507  15.784  1.00 157.46 ? 66  LEU B CD1   1 
ATOM 3217 C CD2   . LEU H 3 66  ? 113.050 80.584  14.563  1.00 138.17 ? 66  LEU B CD2   1 
ATOM 3218 N N     . ASP H 3 67  ? 116.265 82.542  16.157  1.00 160.81 ? 67  ASP B N     1 
ATOM 3219 C CA    . ASP H 3 67  ? 116.192 83.579  17.191  1.00 164.14 ? 67  ASP B CA    1 
ATOM 3220 C C     . ASP H 3 67  ? 116.063 85.004  16.623  1.00 163.64 ? 67  ASP B C     1 
ATOM 3221 O O     . ASP H 3 67  ? 115.557 85.909  17.295  1.00 162.74 ? 67  ASP B O     1 
ATOM 3222 C CB    . ASP H 3 67  ? 117.414 83.477  18.125  1.00 166.86 ? 67  ASP B CB    1 
ATOM 3223 C CG    . ASP H 3 67  ? 118.641 84.253  17.608  1.00 172.67 ? 67  ASP B CG    1 
ATOM 3224 O OD1   . ASP H 3 67  ? 118.918 84.234  16.385  1.00 176.29 ? 67  ASP B OD1   1 
ATOM 3225 O OD2   . ASP H 3 67  ? 119.338 84.879  18.438  1.00 172.81 ? 67  ASP B OD2   1 
ATOM 3226 N N     . ARG H 3 68  ? 116.521 85.178  15.384  1.00 163.19 ? 68  ARG B N     1 
ATOM 3227 C CA    . ARG H 3 68  ? 116.582 86.479  14.739  1.00 164.33 ? 68  ARG B CA    1 
ATOM 3228 C C     . ARG H 3 68  ? 115.222 87.108  14.516  1.00 163.65 ? 68  ARG B C     1 
ATOM 3229 O O     . ARG H 3 68  ? 115.080 88.330  14.607  1.00 162.95 ? 68  ARG B O     1 
ATOM 3230 C CB    . ARG H 3 68  ? 117.320 86.383  13.404  1.00 166.02 ? 68  ARG B CB    1 
ATOM 3231 C CG    . ARG H 3 68  ? 118.834 86.387  13.500  1.00 173.20 ? 68  ARG B CG    1 
ATOM 3232 C CD    . ARG H 3 68  ? 119.382 87.704  14.041  1.00 178.55 ? 68  ARG B CD    1 
ATOM 3233 N NE    . ARG H 3 68  ? 119.319 87.767  15.499  1.00 185.36 ? 68  ARG B NE    1 
ATOM 3234 C CZ    . ARG H 3 68  ? 120.196 87.195  16.323  1.00 188.96 ? 68  ARG B CZ    1 
ATOM 3235 N NH1   . ARG H 3 68  ? 121.229 86.504  15.849  1.00 187.06 ? 68  ARG B NH1   1 
ATOM 3236 N NH2   . ARG H 3 68  ? 120.034 87.316  17.635  1.00 191.75 ? 68  ARG B NH2   1 
ATOM 3237 N N     . LEU H 3 69  ? 114.228 86.284  14.206  1.00 163.17 ? 69  LEU B N     1 
ATOM 3238 C CA    . LEU H 3 69  ? 112.902 86.815  13.963  1.00 167.18 ? 69  LEU B CA    1 
ATOM 3239 C C     . LEU H 3 69  ? 112.351 87.385  15.269  1.00 169.41 ? 69  LEU B C     1 
ATOM 3240 O O     . LEU H 3 69  ? 112.231 88.602  15.414  1.00 169.97 ? 69  LEU B O     1 
ATOM 3241 C CB    . LEU H 3 69  ? 111.980 85.757  13.350  1.00 168.18 ? 69  LEU B CB    1 
ATOM 3242 C CG    . LEU H 3 69  ? 110.712 86.240  12.622  1.00 171.17 ? 69  LEU B CG    1 
ATOM 3243 C CD1   . LEU H 3 69  ? 110.908 87.576  11.899  1.00 169.87 ? 69  LEU B CD1   1 
ATOM 3244 C CD2   . LEU H 3 69  ? 110.233 85.181  11.635  1.00 169.42 ? 69  LEU B CD2   1 
ATOM 3245 N N     . GLY H 3 70  ? 112.053 86.502  16.221  1.00 172.09 ? 70  GLY B N     1 
ATOM 3246 C CA    . GLY H 3 70  ? 111.653 86.901  17.572  1.00 168.57 ? 70  GLY B CA    1 
ATOM 3247 C C     . GLY H 3 70  ? 112.551 86.246  18.604  1.00 165.23 ? 70  GLY B C     1 
ATOM 3248 O O     . GLY H 3 70  ? 112.764 85.030  18.575  1.00 161.18 ? 70  GLY B O     1 
ATOM 3249 N N     . ARG H 3 71  ? 113.090 87.067  19.502  1.00 165.31 ? 71  ARG B N     1 
ATOM 3250 C CA    . ARG H 3 71  ? 113.927 86.611  20.618  1.00 165.40 ? 71  ARG B CA    1 
ATOM 3251 C C     . ARG H 3 71  ? 113.099 85.781  21.609  1.00 162.25 ? 71  ARG B C     1 
ATOM 3252 O O     . ARG H 3 71  ? 113.511 84.689  22.031  1.00 161.59 ? 71  ARG B O     1 
ATOM 3253 C CB    . ARG H 3 71  ? 114.521 87.816  21.362  1.00 167.81 ? 71  ARG B CB    1 
ATOM 3254 C CG    . ARG H 3 71  ? 114.617 89.104  20.547  1.00 175.73 ? 71  ARG B CG    1 
ATOM 3255 C CD    . ARG H 3 71  ? 114.091 90.300  21.343  1.00 182.60 ? 71  ARG B CD    1 
ATOM 3256 N NE    . ARG H 3 71  ? 114.298 91.569  20.641  1.00 190.68 ? 71  ARG B NE    1 
ATOM 3257 C CZ    . ARG H 3 71  ? 113.656 92.705  20.909  1.00 193.67 ? 71  ARG B CZ    1 
ATOM 3258 N NH1   . ARG H 3 71  ? 112.737 92.752  21.868  1.00 195.58 ? 71  ARG B NH1   1 
ATOM 3259 N NH2   . ARG H 3 71  ? 113.929 93.801  20.208  1.00 193.79 ? 71  ARG B NH2   1 
ATOM 3260 N N     . ASP H 3 72  ? 111.937 86.334  21.971  1.00 157.54 ? 72  ASP B N     1 
ATOM 3261 C CA    . ASP H 3 72  ? 110.982 85.733  22.903  1.00 152.03 ? 72  ASP B CA    1 
ATOM 3262 C C     . ASP H 3 72  ? 110.071 84.757  22.176  1.00 149.49 ? 72  ASP B C     1 
ATOM 3263 O O     . ASP H 3 72  ? 109.377 85.128  21.226  1.00 148.53 ? 72  ASP B O     1 
ATOM 3264 C CB    . ASP H 3 72  ? 110.164 86.835  23.608  1.00 150.78 ? 72  ASP B CB    1 
ATOM 3265 C CG    . ASP H 3 72  ? 108.807 86.347  24.128  1.00 144.46 ? 72  ASP B CG    1 
ATOM 3266 O OD1   . ASP H 3 72  ? 108.699 85.188  24.582  1.00 136.92 ? 72  ASP B OD1   1 
ATOM 3267 O OD2   . ASP H 3 72  ? 107.844 87.142  24.087  1.00 141.31 ? 72  ASP B OD2   1 
ATOM 3268 N N     . THR H 3 73  ? 110.070 83.514  22.650  1.00 148.46 ? 73  THR B N     1 
ATOM 3269 C CA    . THR H 3 73  ? 109.323 82.418  22.028  1.00 148.94 ? 73  THR B CA    1 
ATOM 3270 C C     . THR H 3 73  ? 107.853 82.768  21.774  1.00 148.69 ? 73  THR B C     1 
ATOM 3271 O O     . THR H 3 73  ? 107.306 82.431  20.723  1.00 146.59 ? 73  THR B O     1 
ATOM 3272 C CB    . THR H 3 73  ? 109.462 81.110  22.857  1.00 149.00 ? 73  THR B CB    1 
ATOM 3273 O OG1   . THR H 3 73  ? 110.801 80.615  22.735  1.00 148.32 ? 73  THR B OG1   1 
ATOM 3274 C CG2   . THR H 3 73  ? 108.516 80.032  22.367  1.00 151.79 ? 73  THR B CG2   1 
ATOM 3275 N N     . ALA H 3 74  ? 107.242 83.473  22.722  1.00 149.91 ? 74  ALA B N     1 
ATOM 3276 C CA    . ALA H 3 74  ? 105.814 83.787  22.670  1.00 151.32 ? 74  ALA B CA    1 
ATOM 3277 C C     . ALA H 3 74  ? 105.381 84.552  21.418  1.00 150.69 ? 74  ALA B C     1 
ATOM 3278 O O     . ALA H 3 74  ? 104.679 84.002  20.571  1.00 148.76 ? 74  ALA B O     1 
ATOM 3279 C CB    . ALA H 3 74  ? 105.387 84.526  23.925  1.00 153.48 ? 74  ALA B CB    1 
ATOM 3280 N N     . ASP H 3 75  ? 105.795 85.809  21.296  1.00 152.75 ? 75  ASP B N     1 
ATOM 3281 C CA    . ASP H 3 75  ? 105.362 86.622  20.162  1.00 158.62 ? 75  ASP B CA    1 
ATOM 3282 C C     . ASP H 3 75  ? 105.910 86.083  18.828  1.00 160.09 ? 75  ASP B C     1 
ATOM 3283 O O     . ASP H 3 75  ? 105.455 86.476  17.751  1.00 160.70 ? 75  ASP B O     1 
ATOM 3284 C CB    . ASP H 3 75  ? 105.706 88.104  20.373  1.00 160.97 ? 75  ASP B CB    1 
ATOM 3285 C CG    . ASP H 3 75  ? 107.201 88.369  20.382  1.00 170.24 ? 75  ASP B CG    1 
ATOM 3286 O OD1   . ASP H 3 75  ? 107.994 87.401  20.413  1.00 177.59 ? 75  ASP B OD1   1 
ATOM 3287 O OD2   . ASP H 3 75  ? 107.585 89.558  20.355  1.00 174.51 ? 75  ASP B OD2   1 
ATOM 3288 N N     . MET H 3 76  ? 106.874 85.171  18.916  1.00 160.50 ? 76  MET B N     1 
ATOM 3289 C CA    . MET H 3 76  ? 107.424 84.510  17.742  1.00 160.61 ? 76  MET B CA    1 
ATOM 3290 C C     . MET H 3 76  ? 106.326 83.721  17.024  1.00 158.73 ? 76  MET B C     1 
ATOM 3291 O O     . MET H 3 76  ? 106.120 83.885  15.823  1.00 158.50 ? 76  MET B O     1 
ATOM 3292 C CB    . MET H 3 76  ? 108.577 83.595  18.150  1.00 162.72 ? 76  MET B CB    1 
ATOM 3293 C CG    . MET H 3 76  ? 109.867 83.797  17.364  1.00 168.43 ? 76  MET B CG    1 
ATOM 3294 S SD    . MET H 3 76  ? 110.157 82.594  16.049  1.00 177.59 ? 76  MET B SD    1 
ATOM 3295 C CE    . MET H 3 76  ? 109.172 83.259  14.715  1.00 163.12 ? 76  MET B CE    1 
ATOM 3296 N N     . ILE H 3 77  ? 105.602 82.889  17.766  1.00 157.90 ? 77  ILE B N     1 
ATOM 3297 C CA    . ILE H 3 77  ? 104.474 82.164  17.193  1.00 158.43 ? 77  ILE B CA    1 
ATOM 3298 C C     . ILE H 3 77  ? 103.382 83.128  16.750  1.00 161.19 ? 77  ILE B C     1 
ATOM 3299 O O     . ILE H 3 77  ? 102.773 82.935  15.698  1.00 162.48 ? 77  ILE B O     1 
ATOM 3300 C CB    . ILE H 3 77  ? 103.852 81.157  18.170  1.00 157.63 ? 77  ILE B CB    1 
ATOM 3301 C CG1   . ILE H 3 77  ? 104.919 80.519  19.058  1.00 157.26 ? 77  ILE B CG1   1 
ATOM 3302 C CG2   . ILE H 3 77  ? 103.045 80.105  17.412  1.00 160.00 ? 77  ILE B CG2   1 
ATOM 3303 C CD1   . ILE H 3 77  ? 104.780 80.869  20.504  1.00 156.93 ? 77  ILE B CD1   1 
ATOM 3304 N N     . GLN H 3 78  ? 103.137 84.162  17.554  1.00 162.95 ? 78  GLN B N     1 
ATOM 3305 C CA    . GLN H 3 78  ? 102.110 85.154  17.239  1.00 163.58 ? 78  GLN B CA    1 
ATOM 3306 C C     . GLN H 3 78  ? 102.276 85.653  15.824  1.00 163.07 ? 78  GLN B C     1 
ATOM 3307 O O     . GLN H 3 78  ? 101.309 85.691  15.066  1.00 163.10 ? 78  GLN B O     1 
ATOM 3308 C CB    . GLN H 3 78  ? 102.139 86.333  18.215  1.00 164.49 ? 78  GLN B CB    1 
ATOM 3309 C CG    . GLN H 3 78  ? 101.339 86.120  19.495  1.00 167.39 ? 78  GLN B CG    1 
ATOM 3310 C CD    . GLN H 3 78  ? 99.835  86.191  19.278  1.00 169.32 ? 78  GLN B CD    1 
ATOM 3311 O OE1   . GLN H 3 78  ? 99.237  85.302  18.669  1.00 169.34 ? 78  GLN B OE1   1 
ATOM 3312 N NE2   . GLN H 3 78  ? 99.215  87.246  19.796  1.00 172.62 ? 78  GLN B NE2   1 
ATOM 3313 N N     . LEU H 3 79  ? 103.508 86.016  15.471  1.00 163.56 ? 79  LEU B N     1 
ATOM 3314 C CA    . LEU H 3 79  ? 103.816 86.436  14.113  1.00 166.33 ? 79  LEU B CA    1 
ATOM 3315 C C     . LEU H 3 79  ? 103.490 85.307  13.162  1.00 165.13 ? 79  LEU B C     1 
ATOM 3316 O O     . LEU H 3 79  ? 102.614 85.445  12.308  1.00 167.28 ? 79  LEU B O     1 
ATOM 3317 C CB    . LEU H 3 79  ? 105.286 86.829  13.961  1.00 169.32 ? 79  LEU B CB    1 
ATOM 3318 C CG    . LEU H 3 79  ? 105.823 88.075  14.672  1.00 179.26 ? 79  LEU B CG    1 
ATOM 3319 C CD1   . LEU H 3 79  ? 107.284 88.297  14.283  1.00 183.01 ? 79  LEU B CD1   1 
ATOM 3320 C CD2   . LEU H 3 79  ? 104.983 89.324  14.382  1.00 180.37 ? 79  LEU B CD2   1 
ATOM 3321 N N     . ILE H 3 80  ? 104.173 84.181  13.336  1.00 161.08 ? 80  ILE B N     1 
ATOM 3322 C CA    . ILE H 3 80  ? 103.985 83.034  12.460  1.00 159.80 ? 80  ILE B CA    1 
ATOM 3323 C C     . ILE H 3 80  ? 102.504 82.694  12.260  1.00 160.18 ? 80  ILE B C     1 
ATOM 3324 O O     . ILE H 3 80  ? 102.081 82.420  11.136  1.00 159.46 ? 80  ILE B O     1 
ATOM 3325 C CB    . ILE H 3 80  ? 104.837 81.835  12.919  1.00 160.20 ? 80  ILE B CB    1 
ATOM 3326 C CG1   . ILE H 3 80  ? 106.254 81.994  12.355  1.00 158.21 ? 80  ILE B CG1   1 
ATOM 3327 C CG2   . ILE H 3 80  ? 104.208 80.504  12.499  1.00 160.88 ? 80  ILE B CG2   1 
ATOM 3328 C CD1   . ILE H 3 80  ? 107.256 80.951  12.802  1.00 161.44 ? 80  ILE B CD1   1 
ATOM 3329 N N     . LYS H 3 81  ? 101.722 82.743  13.337  1.00 161.71 ? 81  LYS B N     1 
ATOM 3330 C CA    . LYS H 3 81  ? 100.279 82.525  13.250  1.00 163.61 ? 81  LYS B CA    1 
ATOM 3331 C C     . LYS H 3 81  ? 99.638  83.558  12.318  1.00 164.27 ? 81  LYS B C     1 
ATOM 3332 O O     . LYS H 3 81  ? 99.041  83.198  11.296  1.00 163.36 ? 81  LYS B O     1 
ATOM 3333 C CB    . LYS H 3 81  ? 99.626  82.560  14.638  1.00 163.69 ? 81  LYS B CB    1 
ATOM 3334 C CG    . LYS H 3 81  ? 98.134  82.226  14.625  1.00 164.83 ? 81  LYS B CG    1 
ATOM 3335 C CD    . LYS H 3 81  ? 97.461  82.561  15.948  1.00 164.75 ? 81  LYS B CD    1 
ATOM 3336 C CE    . LYS H 3 81  ? 95.949  82.659  15.786  1.00 166.11 ? 81  LYS B CE    1 
ATOM 3337 N NZ    . LYS H 3 81  ? 95.247  82.899  17.084  1.00 167.24 ? 81  LYS B NZ    1 
ATOM 3338 N N     . GLU H 3 82  ? 99.783  84.836  12.669  1.00 165.10 ? 82  GLU B N     1 
ATOM 3339 C CA    . GLU H 3 82  ? 99.308  85.936  11.834  1.00 166.21 ? 82  GLU B CA    1 
ATOM 3340 C C     . GLU H 3 82  ? 99.778  85.729  10.407  1.00 164.44 ? 82  GLU B C     1 
ATOM 3341 O O     . GLU H 3 82  ? 99.109  86.134  9.456   1.00 165.77 ? 82  GLU B O     1 
ATOM 3342 C CB    . GLU H 3 82  ? 99.843  87.278  12.343  1.00 166.79 ? 82  GLU B CB    1 
ATOM 3343 C CG    . GLU H 3 82  ? 99.115  87.853  13.555  1.00 170.46 ? 82  GLU B CG    1 
ATOM 3344 C CD    . GLU H 3 82  ? 99.712  89.175  14.033  1.00 169.60 ? 82  GLU B CD    1 
ATOM 3345 O OE1   . GLU H 3 82  ? 100.955 89.335  13.974  1.00 170.68 ? 82  GLU B OE1   1 
ATOM 3346 O OE2   . GLU H 3 82  ? 98.933  90.052  14.474  1.00 173.95 ? 82  GLU B OE2   1 
ATOM 3347 N N     . PHE H 3 83  ? 100.928 85.076  10.275  1.00 161.63 ? 83  PHE B N     1 
ATOM 3348 C CA    . PHE H 3 83  ? 101.582 84.906  8.988   1.00 160.90 ? 83  PHE B CA    1 
ATOM 3349 C C     . PHE H 3 83  ? 100.973 83.807  8.148   1.00 161.35 ? 83  PHE B C     1 
ATOM 3350 O O     . PHE H 3 83  ? 100.734 84.003  6.958   1.00 162.05 ? 83  PHE B O     1 
ATOM 3351 C CB    . PHE H 3 83  ? 103.077 84.665  9.178   1.00 159.71 ? 83  PHE B CB    1 
ATOM 3352 C CG    . PHE H 3 83  ? 103.901 85.916  9.140   1.00 154.25 ? 83  PHE B CG    1 
ATOM 3353 C CD1   . PHE H 3 83  ? 105.187 85.888  8.628   1.00 145.75 ? 83  PHE B CD1   1 
ATOM 3354 C CD2   . PHE H 3 83  ? 103.383 87.126  9.596   1.00 155.54 ? 83  PHE B CD2   1 
ATOM 3355 C CE1   . PHE H 3 83  ? 105.952 87.030  8.586   1.00 146.84 ? 83  PHE B CE1   1 
ATOM 3356 C CE2   . PHE H 3 83  ? 104.139 88.277  9.551   1.00 154.99 ? 83  PHE B CE2   1 
ATOM 3357 C CZ    . PHE H 3 83  ? 105.428 88.233  9.043   1.00 153.59 ? 83  PHE B CZ    1 
ATOM 3358 N N     . ASP H 3 84  ? 100.725 82.652  8.759   1.00 161.35 ? 84  ASP B N     1 
ATOM 3359 C CA    . ASP H 3 84  ? 100.136 81.541  8.032   1.00 163.26 ? 84  ASP B CA    1 
ATOM 3360 C C     . ASP H 3 84  ? 98.712  81.880  7.619   1.00 165.85 ? 84  ASP B C     1 
ATOM 3361 O O     . ASP H 3 84  ? 98.243  81.434  6.569   1.00 167.73 ? 84  ASP B O     1 
ATOM 3362 C CB    . ASP H 3 84  ? 100.152 80.262  8.859   1.00 163.35 ? 84  ASP B CB    1 
ATOM 3363 C CG    . ASP H 3 84  ? 100.053 79.024  7.998   1.00 163.69 ? 84  ASP B CG    1 
ATOM 3364 O OD1   . ASP H 3 84  ? 101.025 78.748  7.258   1.00 164.04 ? 84  ASP B OD1   1 
ATOM 3365 O OD2   . ASP H 3 84  ? 99.008  78.336  8.058   1.00 160.41 ? 84  ASP B OD2   1 
ATOM 3366 N N     . ALA H 3 85  ? 98.039  82.679  8.445   1.00 167.46 ? 85  ALA B N     1 
ATOM 3367 C CA    . ALA H 3 85  ? 96.675  83.129  8.167   1.00 169.23 ? 85  ALA B CA    1 
ATOM 3368 C C     . ALA H 3 85  ? 96.604  84.010  6.920   1.00 168.96 ? 85  ALA B C     1 
ATOM 3369 O O     . ALA H 3 85  ? 95.683  83.876  6.112   1.00 169.19 ? 85  ALA B O     1 
ATOM 3370 C CB    . ALA H 3 85  ? 96.101  83.862  9.373   1.00 170.25 ? 85  ALA B CB    1 
ATOM 3371 N N     . GLN H 3 86  ? 97.582  84.902  6.774   1.00 168.66 ? 86  GLN B N     1 
ATOM 3372 C CA    . GLN H 3 86  ? 97.672  85.785  5.613   1.00 169.67 ? 86  GLN B CA    1 
ATOM 3373 C C     . GLN H 3 86  ? 98.010  85.008  4.341   1.00 167.29 ? 86  GLN B C     1 
ATOM 3374 O O     . GLN H 3 86  ? 97.532  85.345  3.259   1.00 167.93 ? 86  GLN B O     1 
ATOM 3375 C CB    . GLN H 3 86  ? 98.706  86.895  5.853   1.00 170.56 ? 86  GLN B CB    1 
ATOM 3376 C CG    . GLN H 3 86  ? 98.232  88.008  6.794   1.00 173.81 ? 86  GLN B CG    1 
ATOM 3377 C CD    . GLN H 3 86  ? 99.318  89.030  7.120   1.00 172.92 ? 86  GLN B CD    1 
ATOM 3378 O OE1   . GLN H 3 86  ? 100.384 88.686  7.642   1.00 173.52 ? 86  GLN B OE1   1 
ATOM 3379 N NE2   . GLN H 3 86  ? 99.039  90.298  6.828   1.00 175.86 ? 86  GLN B NE2   1 
ATOM 3380 N N     . GLY H 3 87  ? 98.825  83.966  4.486   1.00 164.94 ? 87  GLY B N     1 
ATOM 3381 C CA    . GLY H 3 87  ? 99.252  83.137  3.360   1.00 162.96 ? 87  GLY B CA    1 
ATOM 3382 C C     . GLY H 3 87  ? 100.756 83.121  3.152   1.00 161.77 ? 87  GLY B C     1 
ATOM 3383 O O     . GLY H 3 87  ? 101.248 82.568  2.165   1.00 161.73 ? 87  GLY B O     1 
ATOM 3384 N N     . VAL H 3 88  ? 101.486 83.719  4.091   1.00 160.77 ? 88  VAL B N     1 
ATOM 3385 C CA    . VAL H 3 88  ? 102.946 83.818  4.010   1.00 158.99 ? 88  VAL B CA    1 
ATOM 3386 C C     . VAL H 3 88  ? 103.658 82.886  4.991   1.00 153.91 ? 88  VAL B C     1 
ATOM 3387 O O     . VAL H 3 88  ? 103.098 82.496  6.015   1.00 153.03 ? 88  VAL B O     1 
ATOM 3388 C CB    . VAL H 3 88  ? 103.439 85.272  4.216   1.00 161.96 ? 88  VAL B CB    1 
ATOM 3389 C CG1   . VAL H 3 88  ? 102.738 86.223  3.239   1.00 165.78 ? 88  VAL B CG1   1 
ATOM 3390 C CG2   . VAL H 3 88  ? 103.233 85.725  5.656   1.00 162.84 ? 88  VAL B CG2   1 
ATOM 3391 N N     . SER H 3 89  ? 104.898 82.539  4.665   1.00 150.56 ? 89  SER B N     1 
ATOM 3392 C CA    . SER H 3 89  ? 105.661 81.591  5.462   1.00 149.06 ? 89  SER B CA    1 
ATOM 3393 C C     . SER H 3 89  ? 107.162 81.877  5.432   1.00 150.25 ? 89  SER B C     1 
ATOM 3394 O O     . SER H 3 89  ? 107.724 82.197  4.387   1.00 150.35 ? 89  SER B O     1 
ATOM 3395 C CB    . SER H 3 89  ? 105.367 80.156  5.008   1.00 147.79 ? 89  SER B CB    1 
ATOM 3396 O OG    . SER H 3 89  ? 105.799 79.928  3.681   1.00 142.71 ? 89  SER B OG    1 
ATOM 3397 N N     . ILE H 3 90  ? 107.797 81.756  6.594   1.00 152.13 ? 90  ILE B N     1 
ATOM 3398 C CA    . ILE H 3 90  ? 109.216 82.044  6.756   1.00 154.54 ? 90  ILE B CA    1 
ATOM 3399 C C     . ILE H 3 90  ? 110.035 80.771  6.671   1.00 155.61 ? 90  ILE B C     1 
ATOM 3400 O O     . ILE H 3 90  ? 109.769 79.801  7.387   1.00 157.07 ? 90  ILE B O     1 
ATOM 3401 C CB    . ILE H 3 90  ? 109.524 82.711  8.127   1.00 156.32 ? 90  ILE B CB    1 
ATOM 3402 C CG1   . ILE H 3 90  ? 108.580 83.883  8.415   1.00 157.43 ? 90  ILE B CG1   1 
ATOM 3403 C CG2   . ILE H 3 90  ? 110.973 83.176  8.188   1.00 163.54 ? 90  ILE B CG2   1 
ATOM 3404 C CD1   . ILE H 3 90  ? 107.324 83.490  9.155   1.00 156.40 ? 90  ILE B CD1   1 
ATOM 3405 N N     . ARG H 3 91  ? 111.029 80.773  5.791   1.00 156.83 ? 91  ARG B N     1 
ATOM 3406 C CA    . ARG H 3 91  ? 112.049 79.736  5.819   1.00 160.28 ? 91  ARG B CA    1 
ATOM 3407 C C     . ARG H 3 91  ? 113.236 80.274  6.604   1.00 158.22 ? 91  ARG B C     1 
ATOM 3408 O O     . ARG H 3 91  ? 113.572 81.466  6.520   1.00 158.05 ? 91  ARG B O     1 
ATOM 3409 C CB    . ARG H 3 91  ? 112.477 79.320  4.410   1.00 160.41 ? 91  ARG B CB    1 
ATOM 3410 C CG    . ARG H 3 91  ? 113.306 78.039  4.371   1.00 165.62 ? 91  ARG B CG    1 
ATOM 3411 C CD    . ARG H 3 91  ? 113.968 77.816  3.013   1.00 168.01 ? 91  ARG B CD    1 
ATOM 3412 N NE    . ARG H 3 91  ? 114.466 76.443  2.871   1.00 184.18 ? 91  ARG B NE    1 
ATOM 3413 C CZ    . ARG H 3 91  ? 115.170 75.989  1.833   1.00 189.03 ? 91  ARG B CZ    1 
ATOM 3414 N NH1   . ARG H 3 91  ? 115.486 76.795  0.824   1.00 191.97 ? 91  ARG B NH1   1 
ATOM 3415 N NH2   . ARG H 3 91  ? 115.567 74.722  1.808   1.00 189.83 ? 91  ARG B NH2   1 
ATOM 3416 N N     . PHE H 3 92  ? 113.849 79.398  7.389   1.00 155.56 ? 92  PHE B N     1 
ATOM 3417 C CA    . PHE H 3 92  ? 115.049 79.758  8.121   1.00 154.73 ? 92  PHE B CA    1 
ATOM 3418 C C     . PHE H 3 92  ? 116.190 78.996  7.499   1.00 155.29 ? 92  PHE B C     1 
ATOM 3419 O O     . PHE H 3 92  ? 116.168 77.771  7.462   1.00 157.47 ? 92  PHE B O     1 
ATOM 3420 C CB    . PHE H 3 92  ? 114.894 79.448  9.615   1.00 152.63 ? 92  PHE B CB    1 
ATOM 3421 C CG    . PHE H 3 92  ? 113.853 80.292  10.292  1.00 147.02 ? 92  PHE B CG    1 
ATOM 3422 C CD1   . PHE H 3 92  ? 112.563 79.807  10.479  1.00 138.18 ? 92  PHE B CD1   1 
ATOM 3423 C CD2   . PHE H 3 92  ? 114.152 81.594  10.703  1.00 145.88 ? 92  PHE B CD2   1 
ATOM 3424 C CE1   . PHE H 3 92  ? 111.588 80.597  11.085  1.00 138.98 ? 92  PHE B CE1   1 
ATOM 3425 C CE2   . PHE H 3 92  ? 113.184 82.391  11.311  1.00 145.53 ? 92  PHE B CE2   1 
ATOM 3426 C CZ    . PHE H 3 92  ? 111.898 81.890  11.500  1.00 144.81 ? 92  PHE B CZ    1 
ATOM 3427 N N     . ILE H 3 93  ? 117.172 79.721  6.983   1.00 154.68 ? 93  ILE B N     1 
ATOM 3428 C CA    . ILE H 3 93  ? 118.223 79.090  6.198   1.00 157.90 ? 93  ILE B CA    1 
ATOM 3429 C C     . ILE H 3 93  ? 119.164 78.237  7.051   1.00 160.77 ? 93  ILE B C     1 
ATOM 3430 O O     . ILE H 3 93  ? 119.544 77.137  6.639   1.00 162.08 ? 93  ILE B O     1 
ATOM 3431 C CB    . ILE H 3 93  ? 119.005 80.110  5.349   1.00 157.59 ? 93  ILE B CB    1 
ATOM 3432 C CG1   . ILE H 3 93  ? 118.028 81.004  4.585   1.00 156.76 ? 93  ILE B CG1   1 
ATOM 3433 C CG2   . ILE H 3 93  ? 119.928 79.385  4.362   1.00 159.82 ? 93  ILE B CG2   1 
ATOM 3434 C CD1   . ILE H 3 93  ? 118.521 82.415  4.342   1.00 157.41 ? 93  ILE B CD1   1 
ATOM 3435 N N     . ASP H 3 94  ? 119.519 78.731  8.236   1.00 162.60 ? 94  ASP B N     1 
ATOM 3436 C CA    . ASP H 3 94  ? 120.431 78.005  9.120   1.00 165.97 ? 94  ASP B CA    1 
ATOM 3437 C C     . ASP H 3 94  ? 119.881 76.657  9.560   1.00 168.37 ? 94  ASP B C     1 
ATOM 3438 O O     . ASP H 3 94  ? 120.601 75.657  9.571   1.00 170.37 ? 94  ASP B O     1 
ATOM 3439 C CB    . ASP H 3 94  ? 120.803 78.843  10.345  1.00 166.95 ? 94  ASP B CB    1 
ATOM 3440 C CG    . ASP H 3 94  ? 122.086 79.628  10.145  1.00 172.14 ? 94  ASP B CG    1 
ATOM 3441 O OD1   . ASP H 3 94  ? 122.181 80.379  9.150   1.00 174.76 ? 94  ASP B OD1   1 
ATOM 3442 O OD2   . ASP H 3 94  ? 123.005 79.493  10.985  1.00 174.80 ? 94  ASP B OD2   1 
ATOM 3443 N N     . ASP H 3 95  ? 118.600 76.632  9.902   1.00 169.55 ? 95  ASP B N     1 
ATOM 3444 C CA    . ASP H 3 95  ? 117.981 75.435  10.458  1.00 173.45 ? 95  ASP B CA    1 
ATOM 3445 C C     . ASP H 3 95  ? 117.206 74.649  9.397   1.00 175.17 ? 95  ASP B C     1 
ATOM 3446 O O     . ASP H 3 95  ? 116.955 73.454  9.568   1.00 175.34 ? 95  ASP B O     1 
ATOM 3447 C CB    . ASP H 3 95  ? 117.079 75.812  11.636  1.00 172.28 ? 95  ASP B CB    1 
ATOM 3448 C CG    . ASP H 3 95  ? 117.660 76.936  12.484  1.00 170.68 ? 95  ASP B CG    1 
ATOM 3449 O OD1   . ASP H 3 95  ? 118.192 76.636  13.575  1.00 167.34 ? 95  ASP B OD1   1 
ATOM 3450 O OD2   . ASP H 3 95  ? 117.597 78.114  12.054  1.00 165.78 ? 95  ASP B OD2   1 
ATOM 3451 N N     . SER H 3 96  ? 116.858 75.336  8.305   1.00 175.44 ? 96  SER B N     1 
ATOM 3452 C CA    . SER H 3 96  ? 116.083 74.803  7.165   1.00 174.68 ? 96  SER B CA    1 
ATOM 3453 C C     . SER H 3 96  ? 114.688 74.283  7.537   1.00 174.13 ? 96  SER B C     1 
ATOM 3454 O O     . SER H 3 96  ? 114.358 73.119  7.300   1.00 175.05 ? 96  SER B O     1 
ATOM 3455 C CB    . SER H 3 96  ? 116.893 73.802  6.318   1.00 173.81 ? 96  SER B CB    1 
ATOM 3456 O OG    . SER H 3 96  ? 117.015 72.546  6.958   1.00 169.99 ? 96  SER B OG    1 
ATOM 3457 N N     . ILE H 3 97  ? 113.879 75.161  8.123   1.00 173.02 ? 97  ILE B N     1 
ATOM 3458 C CA    . ILE H 3 97  ? 112.493 74.836  8.463   1.00 173.64 ? 97  ILE B CA    1 
ATOM 3459 C C     . ILE H 3 97  ? 111.542 75.893  7.912   1.00 173.58 ? 97  ILE B C     1 
ATOM 3460 O O     . ILE H 3 97  ? 111.828 77.095  7.956   1.00 173.71 ? 97  ILE B O     1 
ATOM 3461 C CB    . ILE H 3 97  ? 112.244 74.691  9.997   1.00 173.49 ? 97  ILE B CB    1 
ATOM 3462 C CG1   . ILE H 3 97  ? 113.516 74.906  10.818  1.00 173.03 ? 97  ILE B CG1   1 
ATOM 3463 C CG2   . ILE H 3 97  ? 111.583 73.360  10.317  1.00 173.61 ? 97  ILE B CG2   1 
ATOM 3464 C CD1   . ILE H 3 97  ? 113.683 76.333  11.284  1.00 175.63 ? 97  ILE B CD1   1 
ATOM 3465 N N     . ASP H 3 98  ? 110.408 75.428  7.398   1.00 172.02 ? 98  ASP B N     1 
ATOM 3466 C CA    . ASP H 3 98  ? 109.411 76.292  6.784   1.00 170.58 ? 98  ASP B CA    1 
ATOM 3467 C C     . ASP H 3 98  ? 108.122 76.274  7.580   1.00 166.09 ? 98  ASP B C     1 
ATOM 3468 O O     . ASP H 3 98  ? 107.581 75.199  7.864   1.00 168.22 ? 98  ASP B O     1 
ATOM 3469 C CB    . ASP H 3 98  ? 109.112 75.811  5.364   1.00 173.92 ? 98  ASP B CB    1 
ATOM 3470 C CG    . ASP H 3 98  ? 110.089 76.349  4.344   1.00 180.22 ? 98  ASP B CG    1 
ATOM 3471 O OD1   . ASP H 3 98  ? 109.930 77.520  3.926   1.00 182.32 ? 98  ASP B OD1   1 
ATOM 3472 O OD2   . ASP H 3 98  ? 111.000 75.590  3.947   1.00 183.03 ? 98  ASP B OD2   1 
ATOM 3473 N N     . THR H 3 99  ? 107.617 77.459  7.917   1.00 157.68 ? 99  THR B N     1 
ATOM 3474 C CA    . THR H 3 99  ? 106.302 77.581  8.557   1.00 152.53 ? 99  THR B CA    1 
ATOM 3475 C C     . THR H 3 99  ? 105.144 77.176  7.629   1.00 153.64 ? 99  THR B C     1 
ATOM 3476 O O     . THR H 3 99  ? 103.994 77.063  8.063   1.00 153.63 ? 99  THR B O     1 
ATOM 3477 C CB    . THR H 3 99  ? 106.070 78.991  9.155   1.00 149.08 ? 99  THR B CB    1 
ATOM 3478 O OG1   . THR H 3 99  ? 104.842 79.538  8.660   1.00 148.93 ? 99  THR B OG1   1 
ATOM 3479 C CG2   . THR H 3 99  ? 107.180 79.912  8.779   1.00 138.18 ? 99  THR B CG2   1 
ATOM 3480 N N     . SER H 3 100 ? 105.473 76.932  6.361   1.00 153.75 ? 100 SER B N     1 
ATOM 3481 C CA    . SER H 3 100 ? 104.511 76.549  5.334   1.00 153.69 ? 100 SER B CA    1 
ATOM 3482 C C     . SER H 3 100 ? 103.860 75.190  5.596   1.00 155.42 ? 100 SER B C     1 
ATOM 3483 O O     . SER H 3 100 ? 103.094 74.683  4.766   1.00 156.06 ? 100 SER B O     1 
ATOM 3484 C CB    . SER H 3 100 ? 105.206 76.537  3.973   1.00 153.86 ? 100 SER B CB    1 
ATOM 3485 O OG    . SER H 3 100 ? 106.279 75.612  3.963   1.00 152.42 ? 100 SER B OG    1 
ATOM 3486 N N     . SER H 3 101 ? 104.164 74.601  6.749   1.00 156.41 ? 101 SER B N     1 
ATOM 3487 C CA    . SER H 3 101 ? 103.589 73.314  7.109   1.00 159.17 ? 101 SER B CA    1 
ATOM 3488 C C     . SER H 3 101 ? 103.083 73.270  8.547   1.00 158.78 ? 101 SER B C     1 
ATOM 3489 O O     . SER H 3 101 ? 103.142 74.260  9.276   1.00 155.25 ? 101 SER B O     1 
ATOM 3490 C CB    . SER H 3 101 ? 104.597 72.182  6.862   1.00 161.02 ? 101 SER B CB    1 
ATOM 3491 O OG    . SER H 3 101 ? 105.553 72.095  7.903   1.00 162.50 ? 101 SER B OG    1 
ATOM 3492 N N     . ALA H 3 102 ? 102.572 72.104  8.926   1.00 161.83 ? 102 ALA B N     1 
ATOM 3493 C CA    . ALA H 3 102 ? 102.165 71.825  10.287  1.00 163.62 ? 102 ALA B CA    1 
ATOM 3494 C C     . ALA H 3 102 ? 103.419 71.647  11.121  1.00 164.52 ? 102 ALA B C     1 
ATOM 3495 O O     . ALA H 3 102 ? 103.798 72.549  11.879  1.00 164.66 ? 102 ALA B O     1 
ATOM 3496 C CB    . ALA H 3 102 ? 101.313 70.564  10.332  1.00 165.07 ? 102 ALA B CB    1 
ATOM 3497 N N     . MET H 3 103 ? 104.067 70.491  10.957  1.00 163.59 ? 103 MET B N     1 
ATOM 3498 C CA    . MET H 3 103 ? 105.296 70.185  11.680  1.00 163.82 ? 103 MET B CA    1 
ATOM 3499 C C     . MET H 3 103 ? 106.236 71.378  11.672  1.00 162.03 ? 103 MET B C     1 
ATOM 3500 O O     . MET H 3 103 ? 106.611 71.868  12.729  1.00 163.27 ? 103 MET B O     1 
ATOM 3501 C CB    . MET H 3 103 ? 105.974 68.935  11.117  1.00 166.02 ? 103 MET B CB    1 
ATOM 3502 C CG    . MET H 3 103 ? 105.685 67.668  11.914  1.00 173.03 ? 103 MET B CG    1 
ATOM 3503 S SD    . MET H 3 103 ? 104.028 67.621  12.650  1.00 184.28 ? 103 MET B SD    1 
ATOM 3504 C CE    . MET H 3 103 ? 103.793 65.858  12.952  1.00 175.45 ? 103 MET B CE    1 
ATOM 3505 N N     . GLY H 3 104 ? 106.577 71.864  10.481  1.00 157.82 ? 104 GLY B N     1 
ATOM 3506 C CA    . GLY H 3 104 ? 107.351 73.086  10.346  1.00 152.58 ? 104 GLY B CA    1 
ATOM 3507 C C     . GLY H 3 104 ? 107.005 74.053  11.454  1.00 149.40 ? 104 GLY B C     1 
ATOM 3508 O O     . GLY H 3 104 ? 107.803 74.255  12.361  1.00 147.47 ? 104 GLY B O     1 
ATOM 3509 N N     . ARG H 3 105 ? 105.799 74.613  11.405  1.00 150.64 ? 105 ARG B N     1 
ATOM 3510 C CA    . ARG H 3 105 ? 105.342 75.556  12.430  1.00 153.74 ? 105 ARG B CA    1 
ATOM 3511 C C     . ARG H 3 105 ? 105.617 75.056  13.835  1.00 152.80 ? 105 ARG B C     1 
ATOM 3512 O O     . ARG H 3 105 ? 106.240 75.770  14.630  1.00 153.01 ? 105 ARG B O     1 
ATOM 3513 C CB    . ARG H 3 105 ? 103.858 75.879  12.281  1.00 156.47 ? 105 ARG B CB    1 
ATOM 3514 C CG    . ARG H 3 105 ? 103.586 77.176  11.550  1.00 161.91 ? 105 ARG B CG    1 
ATOM 3515 C CD    . ARG H 3 105 ? 102.125 77.295  11.166  1.00 166.44 ? 105 ARG B CD    1 
ATOM 3516 N NE    . ARG H 3 105 ? 101.752 76.285  10.181  1.00 173.72 ? 105 ARG B NE    1 
ATOM 3517 C CZ    . ARG H 3 105 ? 100.514 76.077  9.746   1.00 180.64 ? 105 ARG B CZ    1 
ATOM 3518 N NH1   . ARG H 3 105 ? 99.509  76.815  10.207  1.00 184.76 ? 105 ARG B NH1   1 
ATOM 3519 N NH2   . ARG H 3 105 ? 100.282 75.126  8.847   1.00 181.20 ? 105 ARG B NH2   1 
ATOM 3520 N N     . MET H 3 106 ? 105.160 73.835  14.133  1.00 149.86 ? 106 MET B N     1 
ATOM 3521 C CA    . MET H 3 106 ? 105.473 73.194  15.412  1.00 149.04 ? 106 MET B CA    1 
ATOM 3522 C C     . MET H 3 106 ? 106.977 73.247  15.662  1.00 148.30 ? 106 MET B C     1 
ATOM 3523 O O     . MET H 3 106 ? 107.433 73.750  16.695  1.00 151.52 ? 106 MET B O     1 
ATOM 3524 C CB    . MET H 3 106 ? 104.991 71.744  15.455  1.00 142.96 ? 106 MET B CB    1 
ATOM 3525 C CG    . MET H 3 106 ? 105.877 70.846  16.302  1.00 135.90 ? 106 MET B CG    1 
ATOM 3526 S SD    . MET H 3 106 ? 105.307 69.138  16.364  1.00 155.91 ? 106 MET B SD    1 
ATOM 3527 C CE    . MET H 3 106 ? 106.818 68.239  16.706  1.00 144.39 ? 106 MET B CE    1 
ATOM 3528 N N     . VAL H 3 107 ? 107.743 72.755  14.696  1.00 142.24 ? 107 VAL B N     1 
ATOM 3529 C CA    . VAL H 3 107 ? 109.168 72.593  14.887  1.00 137.29 ? 107 VAL B CA    1 
ATOM 3530 C C     . VAL H 3 107 ? 109.871 73.932  14.941  1.00 132.58 ? 107 VAL B C     1 
ATOM 3531 O O     . VAL H 3 107 ? 110.985 74.021  15.437  1.00 132.34 ? 107 VAL B O     1 
ATOM 3532 C CB    . VAL H 3 107 ? 109.776 71.639  13.853  1.00 139.64 ? 107 VAL B CB    1 
ATOM 3533 C CG1   . VAL H 3 107 ? 111.282 71.528  14.032  1.00 142.69 ? 107 VAL B CG1   1 
ATOM 3534 C CG2   . VAL H 3 107 ? 109.130 70.255  13.993  1.00 140.54 ? 107 VAL B CG2   1 
ATOM 3535 N N     . VAL H 3 108 ? 109.216 74.986  14.473  1.00 133.12 ? 108 VAL B N     1 
ATOM 3536 C CA    . VAL H 3 108 ? 109.768 76.312  14.718  1.00 138.53 ? 108 VAL B CA    1 
ATOM 3537 C C     . VAL H 3 108 ? 109.621 76.505  16.210  1.00 141.24 ? 108 VAL B C     1 
ATOM 3538 O O     . VAL H 3 108 ? 110.607 76.755  16.907  1.00 142.58 ? 108 VAL B O     1 
ATOM 3539 C CB    . VAL H 3 108 ? 109.047 77.478  13.964  1.00 139.93 ? 108 VAL B CB    1 
ATOM 3540 C CG1   . VAL H 3 108 ? 109.900 78.750  14.009  1.00 125.01 ? 108 VAL B CG1   1 
ATOM 3541 C CG2   . VAL H 3 108 ? 108.738 77.118  12.513  1.00 140.74 ? 108 VAL B CG2   1 
ATOM 3542 N N     . THR H 3 109 ? 108.392 76.329  16.695  1.00 140.87 ? 109 THR B N     1 
ATOM 3543 C CA    . THR H 3 109 ? 108.074 76.611  18.088  1.00 142.21 ? 109 THR B CA    1 
ATOM 3544 C C     . THR H 3 109 ? 108.943 75.854  19.090  1.00 141.81 ? 109 THR B C     1 
ATOM 3545 O O     . THR H 3 109 ? 109.645 76.504  19.877  1.00 141.65 ? 109 THR B O     1 
ATOM 3546 C CB    . THR H 3 109 ? 106.573 76.467  18.397  1.00 143.39 ? 109 THR B CB    1 
ATOM 3547 O OG1   . THR H 3 109 ? 106.087 75.232  17.869  1.00 146.45 ? 109 THR B OG1   1 
ATOM 3548 C CG2   . THR H 3 109 ? 105.808 77.581  17.748  1.00 144.72 ? 109 THR B CG2   1 
ATOM 3549 N N     . ILE H 3 110 ? 108.934 74.514  19.056  1.00 138.95 ? 110 ILE B N     1 
ATOM 3550 C CA    . ILE H 3 110 ? 109.733 73.757  20.041  1.00 143.70 ? 110 ILE B CA    1 
ATOM 3551 C C     . ILE H 3 110 ? 111.160 74.270  20.087  1.00 145.35 ? 110 ILE B C     1 
ATOM 3552 O O     . ILE H 3 110 ? 111.515 75.007  21.005  1.00 147.03 ? 110 ILE B O     1 
ATOM 3553 C CB    . ILE H 3 110 ? 109.700 72.217  19.902  1.00 145.13 ? 110 ILE B CB    1 
ATOM 3554 C CG1   . ILE H 3 110 ? 109.305 71.799  18.495  1.00 151.51 ? 110 ILE B CG1   1 
ATOM 3555 C CG2   . ILE H 3 110 ? 108.764 71.581  20.964  1.00 142.47 ? 110 ILE B CG2   1 
ATOM 3556 C CD1   . ILE H 3 110 ? 108.967 70.323  18.394  1.00 158.89 ? 110 ILE B CD1   1 
ATOM 3557 N N     . LEU H 3 111 ? 111.967 73.929  19.095  1.00 146.00 ? 111 LEU B N     1 
ATOM 3558 C CA    . LEU H 3 111 ? 113.225 74.644  18.894  1.00 149.18 ? 111 LEU B CA    1 
ATOM 3559 C C     . LEU H 3 111 ? 113.324 75.926  19.746  1.00 146.44 ? 111 LEU B C     1 
ATOM 3560 O O     . LEU H 3 111 ? 114.209 76.067  20.588  1.00 140.36 ? 111 LEU B O     1 
ATOM 3561 C CB    . LEU H 3 111 ? 113.377 75.016  17.406  1.00 152.07 ? 111 LEU B CB    1 
ATOM 3562 C CG    . LEU H 3 111 ? 114.253 74.227  16.421  1.00 148.85 ? 111 LEU B CG    1 
ATOM 3563 C CD1   . LEU H 3 111 ? 115.618 74.901  16.249  1.00 148.02 ? 111 LEU B CD1   1 
ATOM 3564 C CD2   . LEU H 3 111 ? 114.389 72.752  16.801  1.00 148.29 ? 111 LEU B CD2   1 
ATOM 3565 N N     . SER H 3 112 ? 112.400 76.852  19.527  1.00 148.60 ? 112 SER B N     1 
ATOM 3566 C CA    . SER H 3 112 ? 112.554 78.186  20.080  1.00 155.98 ? 112 SER B CA    1 
ATOM 3567 C C     . SER H 3 112 ? 112.283 78.248  21.571  1.00 155.82 ? 112 SER B C     1 
ATOM 3568 O O     . SER H 3 112 ? 112.890 79.062  22.268  1.00 158.00 ? 112 SER B O     1 
ATOM 3569 C CB    . SER H 3 112 ? 111.731 79.230  19.303  1.00 159.04 ? 112 SER B CB    1 
ATOM 3570 O OG    . SER H 3 112 ? 110.552 78.664  18.758  1.00 165.27 ? 112 SER B OG    1 
ATOM 3571 N N     . ALA H 3 113 ? 111.380 77.394  22.051  1.00 153.28 ? 113 ALA B N     1 
ATOM 3572 C CA    . ALA H 3 113 ? 111.120 77.264  23.492  1.00 156.08 ? 113 ALA B CA    1 
ATOM 3573 C C     . ALA H 3 113 ? 112.383 76.849  24.281  1.00 154.07 ? 113 ALA B C     1 
ATOM 3574 O O     . ALA H 3 113 ? 112.916 77.643  25.078  1.00 154.00 ? 113 ALA B O     1 
ATOM 3575 C CB    . ALA H 3 113 ? 109.987 76.278  23.738  1.00 159.26 ? 113 ALA B CB    1 
ATOM 3576 N N     . VAL H 3 114 ? 112.829 75.605  24.062  1.00 145.47 ? 114 VAL B N     1 
ATOM 3577 C CA    . VAL H 3 114 ? 114.163 75.131  24.456  1.00 136.03 ? 114 VAL B CA    1 
ATOM 3578 C C     . VAL H 3 114 ? 115.226 76.212  24.290  1.00 140.82 ? 114 VAL B C     1 
ATOM 3579 O O     . VAL H 3 114 ? 115.858 76.623  25.257  1.00 141.39 ? 114 VAL B O     1 
ATOM 3580 C CB    . VAL H 3 114 ? 114.587 73.922  23.608  1.00 129.06 ? 114 VAL B CB    1 
ATOM 3581 C CG1   . VAL H 3 114 ? 116.066 73.618  23.789  1.00 109.40 ? 114 VAL B CG1   1 
ATOM 3582 C CG2   . VAL H 3 114 ? 113.730 72.730  23.934  1.00 122.75 ? 114 VAL B CG2   1 
ATOM 3583 N N     . ALA H 3 115 ? 115.411 76.676  23.059  1.00 147.94 ? 115 ALA B N     1 
ATOM 3584 C CA    . ALA H 3 115 ? 116.356 77.750  22.767  1.00 154.85 ? 115 ALA B CA    1 
ATOM 3585 C C     . ALA H 3 115 ? 116.395 78.808  23.869  1.00 156.09 ? 115 ALA B C     1 
ATOM 3586 O O     . ALA H 3 115 ? 117.457 79.361  24.175  1.00 153.77 ? 115 ALA B O     1 
ATOM 3587 C CB    . ALA H 3 115 ? 116.013 78.396  21.435  1.00 157.93 ? 115 ALA B CB    1 
ATOM 3588 N N     . GLN H 3 116 ? 115.231 79.066  24.464  1.00 158.50 ? 116 GLN B N     1 
ATOM 3589 C CA    . GLN H 3 116 ? 115.093 80.112  25.457  1.00 162.18 ? 116 GLN B CA    1 
ATOM 3590 C C     . GLN H 3 116 ? 115.467 79.647  26.855  1.00 165.95 ? 116 GLN B C     1 
ATOM 3591 O O     . GLN H 3 116 ? 116.182 80.347  27.572  1.00 167.35 ? 116 GLN B O     1 
ATOM 3592 C CB    . GLN H 3 116 ? 113.686 80.689  25.448  1.00 160.75 ? 116 GLN B CB    1 
ATOM 3593 C CG    . GLN H 3 116 ? 113.703 82.199  25.365  1.00 164.83 ? 116 GLN B CG    1 
ATOM 3594 C CD    . GLN H 3 116 ? 112.488 82.839  25.991  1.00 167.74 ? 116 GLN B CD    1 
ATOM 3595 O OE1   . GLN H 3 116 ? 112.465 84.055  26.215  1.00 172.26 ? 116 GLN B OE1   1 
ATOM 3596 N NE2   . GLN H 3 116 ? 111.470 82.028  26.290  1.00 165.84 ? 116 GLN B NE2   1 
ATOM 3597 N N     . ALA H 3 117 ? 114.998 78.467  27.246  1.00 168.29 ? 117 ALA B N     1 
ATOM 3598 C CA    . ALA H 3 117 ? 115.394 77.898  28.530  1.00 169.76 ? 117 ALA B CA    1 
ATOM 3599 C C     . ALA H 3 117 ? 116.900 78.053  28.725  1.00 171.07 ? 117 ALA B C     1 
ATOM 3600 O O     . ALA H 3 117 ? 117.354 78.353  29.824  1.00 172.34 ? 117 ALA B O     1 
ATOM 3601 C CB    . ALA H 3 117 ? 114.985 76.448  28.627  1.00 170.11 ? 117 ALA B CB    1 
ATOM 3602 N N     . GLU H 3 118 ? 117.660 77.861  27.648  1.00 172.86 ? 118 GLU B N     1 
ATOM 3603 C CA    . GLU H 3 118 ? 119.091 78.154  27.642  1.00 176.61 ? 118 GLU B CA    1 
ATOM 3604 C C     . GLU H 3 118 ? 119.312 79.666  27.762  1.00 176.20 ? 118 GLU B C     1 
ATOM 3605 O O     . GLU H 3 118 ? 119.879 80.136  28.751  1.00 175.15 ? 118 GLU B O     1 
ATOM 3606 C CB    . GLU H 3 118 ? 119.776 77.575  26.387  1.00 178.95 ? 118 GLU B CB    1 
ATOM 3607 C CG    . GLU H 3 118 ? 120.709 76.359  26.631  1.00 186.92 ? 118 GLU B CG    1 
ATOM 3608 C CD    . GLU H 3 118 ? 120.000 74.988  26.639  1.00 196.85 ? 118 GLU B CD    1 
ATOM 3609 O OE1   . GLU H 3 118 ? 118.784 74.918  26.924  1.00 202.53 ? 118 GLU B OE1   1 
ATOM 3610 O OE2   . GLU H 3 118 ? 120.673 73.963  26.370  1.00 198.13 ? 118 GLU B OE2   1 
ATOM 3611 N N     . ARG H 3 119 ? 118.839 80.422  26.772  1.00 177.26 ? 119 ARG B N     1 
ATOM 3612 C CA    . ARG H 3 119 ? 118.955 81.881  26.793  1.00 178.85 ? 119 ARG B CA    1 
ATOM 3613 C C     . ARG H 3 119 ? 118.621 82.443  28.171  1.00 176.17 ? 119 ARG B C     1 
ATOM 3614 O O     . ARG H 3 119 ? 119.291 83.350  28.652  1.00 178.62 ? 119 ARG B O     1 
ATOM 3615 C CB    . ARG H 3 119 ? 118.058 82.537  25.725  1.00 182.91 ? 119 ARG B CB    1 
ATOM 3616 C CG    . ARG H 3 119 ? 118.805 83.124  24.516  1.00 193.37 ? 119 ARG B CG    1 
ATOM 3617 C CD    . ARG H 3 119 ? 118.048 84.319  23.890  1.00 204.56 ? 119 ARG B CD    1 
ATOM 3618 N NE    . ARG H 3 119 ? 118.934 85.217  23.129  1.00 210.36 ? 119 ARG B NE    1 
ATOM 3619 C CZ    . ARG H 3 119 ? 118.630 86.459  22.739  1.00 209.66 ? 119 ARG B CZ    1 
ATOM 3620 N NH1   . ARG H 3 119 ? 117.450 86.998  23.028  1.00 210.66 ? 119 ARG B NH1   1 
ATOM 3621 N NH2   . ARG H 3 119 ? 119.515 87.174  22.055  1.00 206.02 ? 119 ARG B NH2   1 
ATOM 3622 N N     . GLN H 3 120 ? 117.605 81.880  28.813  1.00 172.72 ? 120 GLN B N     1 
ATOM 3623 C CA    . GLN H 3 120 ? 117.083 82.435  30.051  1.00 172.92 ? 120 GLN B CA    1 
ATOM 3624 C C     . GLN H 3 120 ? 117.925 82.038  31.260  1.00 169.30 ? 120 GLN B C     1 
ATOM 3625 O O     . GLN H 3 120 ? 118.134 82.835  32.172  1.00 167.94 ? 120 GLN B O     1 
ATOM 3626 C CB    . GLN H 3 120 ? 115.625 82.018  30.238  1.00 173.70 ? 120 GLN B CB    1 
ATOM 3627 C CG    . GLN H 3 120 ? 114.736 83.119  30.803  1.00 179.13 ? 120 GLN B CG    1 
ATOM 3628 C CD    . GLN H 3 120 ? 113.241 82.827  30.666  1.00 178.24 ? 120 GLN B CD    1 
ATOM 3629 O OE1   . GLN H 3 120 ? 112.820 81.673  30.514  1.00 182.75 ? 120 GLN B OE1   1 
ATOM 3630 N NE2   . GLN H 3 120 ? 112.431 83.884  30.727  1.00 183.31 ? 120 GLN B NE2   1 
ATOM 3631 N N     . ARG H 3 121 ? 118.407 80.802  31.261  1.00 168.27 ? 121 ARG B N     1 
ATOM 3632 C CA    . ARG H 3 121 ? 119.259 80.315  32.341  1.00 167.60 ? 121 ARG B CA    1 
ATOM 3633 C C     . ARG H 3 121 ? 120.618 81.008  32.308  1.00 164.96 ? 121 ARG B C     1 
ATOM 3634 O O     . ARG H 3 121 ? 121.140 81.406  33.347  1.00 165.20 ? 121 ARG B O     1 
ATOM 3635 C CB    . ARG H 3 121 ? 119.367 78.776  32.301  1.00 169.48 ? 121 ARG B CB    1 
ATOM 3636 C CG    . ARG H 3 121 ? 120.721 78.167  32.661  1.00 172.44 ? 121 ARG B CG    1 
ATOM 3637 C CD    . ARG H 3 121 ? 121.491 77.739  31.406  1.00 176.42 ? 121 ARG B CD    1 
ATOM 3638 N NE    . ARG H 3 121 ? 121.085 76.418  30.921  1.00 177.40 ? 121 ARG B NE    1 
ATOM 3639 C CZ    . ARG H 3 121 ? 121.749 75.705  30.012  1.00 177.88 ? 121 ARG B CZ    1 
ATOM 3640 N NH1   . ARG H 3 121 ? 122.863 76.176  29.463  1.00 177.67 ? 121 ARG B NH1   1 
ATOM 3641 N NH2   . ARG H 3 121 ? 121.299 74.509  29.648  1.00 177.14 ? 121 ARG B NH2   1 
ATOM 3642 N N     . ILE H 3 122 ? 121.169 81.177  31.111  1.00 162.94 ? 122 ILE B N     1 
ATOM 3643 C CA    . ILE H 3 122 ? 122.460 81.836  30.961  1.00 162.32 ? 122 ILE B CA    1 
ATOM 3644 C C     . ILE H 3 122 ? 122.356 83.293  31.399  1.00 161.21 ? 122 ILE B C     1 
ATOM 3645 O O     . ILE H 3 122 ? 123.259 83.818  32.044  1.00 160.62 ? 122 ILE B O     1 
ATOM 3646 C CB    . ILE H 3 122 ? 123.026 81.686  29.513  1.00 163.64 ? 122 ILE B CB    1 
ATOM 3647 C CG1   . ILE H 3 122 ? 124.548 81.434  29.527  1.00 169.04 ? 122 ILE B CG1   1 
ATOM 3648 C CG2   . ILE H 3 122 ? 122.578 82.821  28.580  1.00 161.60 ? 122 ILE B CG2   1 
ATOM 3649 C CD1   . ILE H 3 122 ? 125.435 82.593  30.000  1.00 172.27 ? 122 ILE B CD1   1 
ATOM 3650 N N     . LEU H 3 123 ? 121.236 83.929  31.067  1.00 160.80 ? 123 LEU B N     1 
ATOM 3651 C CA    . LEU H 3 123 ? 120.954 85.275  31.529  1.00 160.83 ? 123 LEU B CA    1 
ATOM 3652 C C     . LEU H 3 123 ? 121.129 85.350  33.040  1.00 161.09 ? 123 LEU B C     1 
ATOM 3653 O O     . LEU H 3 123 ? 121.795 86.247  33.554  1.00 160.88 ? 123 LEU B O     1 
ATOM 3654 C CB    . LEU H 3 123 ? 119.526 85.670  31.162  1.00 160.92 ? 123 LEU B CB    1 
ATOM 3655 C CG    . LEU H 3 123 ? 119.035 86.979  31.783  1.00 162.41 ? 123 LEU B CG    1 
ATOM 3656 C CD1   . LEU H 3 123 ? 119.372 88.136  30.856  1.00 164.51 ? 123 LEU B CD1   1 
ATOM 3657 C CD2   . LEU H 3 123 ? 117.539 86.931  32.101  1.00 160.28 ? 123 LEU B CD2   1 
ATOM 3658 N N     . GLN H 3 124 ? 120.529 84.393  33.740  1.00 161.22 ? 124 GLN B N     1 
ATOM 3659 C CA    . GLN H 3 124 ? 120.594 84.348  35.187  1.00 163.39 ? 124 GLN B CA    1 
ATOM 3660 C C     . GLN H 3 124 ? 122.044 84.255  35.648  1.00 164.84 ? 124 GLN B C     1 
ATOM 3661 O O     . GLN H 3 124 ? 122.440 84.920  36.609  1.00 164.58 ? 124 GLN B O     1 
ATOM 3662 C CB    . GLN H 3 124 ? 119.788 83.164  35.701  1.00 163.85 ? 124 GLN B CB    1 
ATOM 3663 C CG    . GLN H 3 124 ? 119.243 83.341  37.098  1.00 168.50 ? 124 GLN B CG    1 
ATOM 3664 C CD    . GLN H 3 124 ? 118.289 82.230  37.490  1.00 175.26 ? 124 GLN B CD    1 
ATOM 3665 O OE1   . GLN H 3 124 ? 118.406 81.093  37.020  1.00 175.42 ? 124 GLN B OE1   1 
ATOM 3666 N NE2   . GLN H 3 124 ? 117.336 82.551  38.360  1.00 181.23 ? 124 GLN B NE2   1 
ATOM 3667 N N     . ARG H 3 125 ? 122.830 83.447  34.935  1.00 166.46 ? 125 ARG B N     1 
ATOM 3668 C CA    . ARG H 3 125 ? 124.251 83.253  35.232  1.00 168.35 ? 125 ARG B CA    1 
ATOM 3669 C C     . ARG H 3 125 ? 125.029 84.553  35.071  1.00 167.28 ? 125 ARG B C     1 
ATOM 3670 O O     . ARG H 3 125 ? 125.969 84.816  35.819  1.00 166.45 ? 125 ARG B O     1 
ATOM 3671 C CB    . ARG H 3 125 ? 124.850 82.176  34.321  1.00 170.72 ? 125 ARG B CB    1 
ATOM 3672 C CG    . ARG H 3 125 ? 126.045 81.419  34.907  1.00 173.83 ? 125 ARG B CG    1 
ATOM 3673 C CD    . ARG H 3 125 ? 125.634 80.045  35.431  1.00 177.90 ? 125 ARG B CD    1 
ATOM 3674 N NE    . ARG H 3 125 ? 125.228 79.141  34.352  1.00 182.20 ? 125 ARG B NE    1 
ATOM 3675 C CZ    . ARG H 3 125 ? 125.971 78.145  33.875  1.00 185.80 ? 125 ARG B CZ    1 
ATOM 3676 N NH1   . ARG H 3 125 ? 127.175 77.897  34.380  1.00 186.39 ? 125 ARG B NH1   1 
ATOM 3677 N NH2   . ARG H 3 125 ? 125.503 77.385  32.890  1.00 187.78 ? 125 ARG B NH2   1 
ATOM 3678 N N     . THR H 3 126 ? 124.633 85.356  34.086  1.00 167.99 ? 126 THR B N     1 
ATOM 3679 C CA    . THR H 3 126 ? 125.217 86.677  33.892  1.00 169.83 ? 126 THR B CA    1 
ATOM 3680 C C     . THR H 3 126 ? 124.937 87.531  35.124  1.00 170.64 ? 126 THR B C     1 
ATOM 3681 O O     . THR H 3 126 ? 125.840 88.182  35.644  1.00 171.58 ? 126 THR B O     1 
ATOM 3682 C CB    . THR H 3 126 ? 124.681 87.374  32.611  1.00 170.36 ? 126 THR B CB    1 
ATOM 3683 O OG1   . THR H 3 126 ? 124.932 86.548  31.469  1.00 171.35 ? 126 THR B OG1   1 
ATOM 3684 C CG2   . THR H 3 126 ? 125.352 88.730  32.396  1.00 170.29 ? 126 THR B CG2   1 
ATOM 3685 N N     . ASN H 3 127 ? 123.695 87.501  35.601  1.00 171.34 ? 127 ASN B N     1 
ATOM 3686 C CA    . ASN H 3 127 ? 123.298 88.291  36.761  1.00 172.43 ? 127 ASN B CA    1 
ATOM 3687 C C     . ASN H 3 127 ? 123.953 87.842  38.060  1.00 173.06 ? 127 ASN B C     1 
ATOM 3688 O O     . ASN H 3 127 ? 124.215 88.661  38.943  1.00 173.03 ? 127 ASN B O     1 
ATOM 3689 C CB    . ASN H 3 127 ? 121.776 88.340  36.899  1.00 173.27 ? 127 ASN B CB    1 
ATOM 3690 C CG    . ASN H 3 127 ? 121.154 89.473  36.097  1.00 177.40 ? 127 ASN B CG    1 
ATOM 3691 O OD1   . ASN H 3 127 ? 121.780 90.514  35.871  1.00 180.01 ? 127 ASN B OD1   1 
ATOM 3692 N ND2   . ASN H 3 127 ? 119.912 89.279  35.669  1.00 179.46 ? 127 ASN B ND2   1 
ATOM 3693 N N     . GLU H 3 128 ? 124.221 86.541  38.162  1.00 173.98 ? 128 GLU B N     1 
ATOM 3694 C CA    . GLU H 3 128 ? 124.990 85.990  39.278  1.00 175.67 ? 128 GLU B CA    1 
ATOM 3695 C C     . GLU H 3 128 ? 126.406 86.554  39.252  1.00 174.89 ? 128 GLU B C     1 
ATOM 3696 O O     . GLU H 3 128 ? 126.964 86.897  40.294  1.00 174.44 ? 128 GLU B O     1 
ATOM 3697 C CB    . GLU H 3 128 ? 125.031 84.460  39.208  1.00 177.42 ? 128 GLU B CB    1 
ATOM 3698 C CG    . GLU H 3 128 ? 123.684 83.780  39.458  1.00 183.47 ? 128 GLU B CG    1 
ATOM 3699 C CD    . GLU H 3 128 ? 123.600 82.372  38.870  1.00 185.94 ? 128 GLU B CD    1 
ATOM 3700 O OE1   . GLU H 3 128 ? 124.382 81.490  39.291  1.00 185.64 ? 128 GLU B OE1   1 
ATOM 3701 O OE2   . GLU H 3 128 ? 122.735 82.147  37.994  1.00 186.56 ? 128 GLU B OE2   1 
ATOM 3702 N N     . GLY H 3 129 ? 126.964 86.654  38.044  1.00 175.02 ? 129 GLY B N     1 
ATOM 3703 C CA    . GLY H 3 129 ? 128.289 87.230  37.813  1.00 175.19 ? 129 GLY B CA    1 
ATOM 3704 C C     . GLY H 3 129 ? 128.359 88.721  38.092  1.00 175.41 ? 129 GLY B C     1 
ATOM 3705 O O     . GLY H 3 129 ? 129.408 89.233  38.483  1.00 175.40 ? 129 GLY B O     1 
ATOM 3706 N N     . ARG H 3 130 ? 127.242 89.414  37.879  1.00 176.13 ? 130 ARG B N     1 
ATOM 3707 C CA    . ARG H 3 130 ? 127.112 90.827  38.231  1.00 177.00 ? 130 ARG B CA    1 
ATOM 3708 C C     . ARG H 3 130 ? 127.063 90.955  39.750  1.00 177.39 ? 130 ARG B C     1 
ATOM 3709 O O     . ARG H 3 130 ? 127.653 91.871  40.330  1.00 175.41 ? 130 ARG B O     1 
ATOM 3710 C CB    . ARG H 3 130 ? 125.834 91.428  37.624  1.00 177.86 ? 130 ARG B CB    1 
ATOM 3711 C CG    . ARG H 3 130 ? 125.685 91.298  36.101  1.00 178.06 ? 130 ARG B CG    1 
ATOM 3712 C CD    . ARG H 3 130 ? 126.378 92.422  35.336  1.00 177.87 ? 130 ARG B CD    1 
ATOM 3713 N NE    . ARG H 3 130 ? 125.708 93.712  35.505  1.00 178.53 ? 130 ARG B NE    1 
ATOM 3714 C CZ    . ARG H 3 130 ? 124.775 94.203  34.691  1.00 179.96 ? 130 ARG B CZ    1 
ATOM 3715 N NH1   . ARG H 3 130 ? 124.372 93.520  33.624  1.00 182.29 ? 130 ARG B NH1   1 
ATOM 3716 N NH2   . ARG H 3 130 ? 124.241 95.388  34.949  1.00 179.08 ? 130 ARG B NH2   1 
ATOM 3717 N N     . GLN H 3 131 ? 126.353 90.020  40.380  1.00 179.86 ? 131 GLN B N     1 
ATOM 3718 C CA    . GLN H 3 131 ? 126.195 89.982  41.831  1.00 182.57 ? 131 GLN B CA    1 
ATOM 3719 C C     . GLN H 3 131 ? 127.514 89.691  42.542  1.00 183.07 ? 131 GLN B C     1 
ATOM 3720 O O     . GLN H 3 131 ? 127.848 90.352  43.529  1.00 182.53 ? 131 GLN B O     1 
ATOM 3721 C CB    . GLN H 3 131 ? 125.130 88.951  42.232  1.00 183.79 ? 131 GLN B CB    1 
ATOM 3722 C CG    . GLN H 3 131 ? 123.682 89.397  42.004  1.00 187.23 ? 131 GLN B CG    1 
ATOM 3723 C CD    . GLN H 3 131 ? 123.143 90.293  43.113  1.00 190.95 ? 131 GLN B CD    1 
ATOM 3724 O OE1   . GLN H 3 131 ? 123.731 91.326  43.446  1.00 191.74 ? 131 GLN B OE1   1 
ATOM 3725 N NE2   . GLN H 3 131 ? 122.008 89.903  43.683  1.00 191.91 ? 131 GLN B NE2   1 
ATOM 3726 N N     . GLU H 3 132 ? 128.262 88.712  42.032  1.00 184.28 ? 132 GLU B N     1 
ATOM 3727 C CA    . GLU H 3 132 ? 129.562 88.348  42.609  1.00 185.53 ? 132 GLU B CA    1 
ATOM 3728 C C     . GLU H 3 132 ? 130.672 89.348  42.252  1.00 186.47 ? 132 GLU B C     1 
ATOM 3729 O O     . GLU H 3 132 ? 131.829 89.174  42.650  1.00 186.72 ? 132 GLU B O     1 
ATOM 3730 C CB    . GLU H 3 132 ? 129.955 86.896  42.255  1.00 185.38 ? 132 GLU B CB    1 
ATOM 3731 C CG    . GLU H 3 132 ? 130.255 86.613  40.774  1.00 185.43 ? 132 GLU B CG    1 
ATOM 3732 C CD    . GLU H 3 132 ? 130.523 85.131  40.480  1.00 185.52 ? 132 GLU B CD    1 
ATOM 3733 O OE1   . GLU H 3 132 ? 131.324 84.502  41.204  1.00 185.11 ? 132 GLU B OE1   1 
ATOM 3734 O OE2   . GLU H 3 132 ? 129.940 84.595  39.512  1.00 184.53 ? 132 GLU B OE2   1 
ATOM 3735 N N     . ALA H 3 133 ? 130.304 90.399  41.517  1.00 186.85 ? 133 ALA B N     1 
ATOM 3736 C CA    . ALA H 3 133 ? 131.229 91.471  41.149  1.00 187.21 ? 133 ALA B CA    1 
ATOM 3737 C C     . ALA H 3 133 ? 130.937 92.773  41.899  1.00 187.71 ? 133 ALA B C     1 
ATOM 3738 O O     . ALA H 3 133 ? 131.854 93.416  42.413  1.00 187.18 ? 133 ALA B O     1 
ATOM 3739 C CB    . ALA H 3 133 ? 131.210 91.703  39.644  1.00 186.91 ? 133 ALA B CB    1 
ATOM 3740 N N     . MET H 3 134 ? 129.660 93.152  41.964  1.00 188.74 ? 134 MET B N     1 
ATOM 3741 C CA    . MET H 3 134 ? 129.242 94.383  42.647  1.00 189.82 ? 134 MET B CA    1 
ATOM 3742 C C     . MET H 3 134 ? 129.476 94.304  44.162  1.00 187.64 ? 134 MET B C     1 
ATOM 3743 O O     . MET H 3 134 ? 129.606 95.332  44.833  1.00 186.56 ? 134 MET B O     1 
ATOM 3744 C CB    . MET H 3 134 ? 127.771 94.704  42.329  1.00 190.74 ? 134 MET B CB    1 
ATOM 3745 C CG    . MET H 3 134 ? 127.363 96.168  42.570  1.00 193.47 ? 134 MET B CG    1 
ATOM 3746 S SD    . MET H 3 134 ? 125.757 96.635  41.865  1.00 192.92 ? 134 MET B SD    1 
ATOM 3747 C CE    . MET H 3 134 ? 125.608 98.330  42.442  1.00 190.99 ? 134 MET B CE    1 
ATOM 3748 N N     . ALA H 3 135 ? 129.536 93.078  44.680  1.00 186.60 ? 135 ALA B N     1 
ATOM 3749 C CA    . ALA H 3 135 ? 129.778 92.825  46.100  1.00 185.50 ? 135 ALA B CA    1 
ATOM 3750 C C     . ALA H 3 135 ? 131.271 92.779  46.436  1.00 184.54 ? 135 ALA B C     1 
ATOM 3751 O O     . ALA H 3 135 ? 131.674 93.141  47.543  1.00 183.72 ? 135 ALA B O     1 
ATOM 3752 C CB    . ALA H 3 135 ? 129.095 91.532  46.529  1.00 185.34 ? 135 ALA B CB    1 
ATOM 3753 N N     . LYS H 3 136 ? 132.078 92.331  45.475  1.00 184.10 ? 136 LYS B N     1 
ATOM 3754 C CA    . LYS H 3 136 ? 133.528 92.231  45.646  1.00 183.54 ? 136 LYS B CA    1 
ATOM 3755 C C     . LYS H 3 136 ? 134.196 93.605  45.579  1.00 183.14 ? 136 LYS B C     1 
ATOM 3756 O O     . LYS H 3 136 ? 135.248 93.820  46.185  1.00 182.98 ? 136 LYS B O     1 
ATOM 3757 C CB    . LYS H 3 136 ? 134.126 91.289  44.597  1.00 183.86 ? 136 LYS B CB    1 
ATOM 3758 C CG    . LYS H 3 136 ? 135.451 90.653  45.000  1.00 183.96 ? 136 LYS B CG    1 
ATOM 3759 C CD    . LYS H 3 136 ? 135.898 89.617  43.975  1.00 183.69 ? 136 LYS B CD    1 
ATOM 3760 C CE    . LYS H 3 136 ? 137.199 88.936  44.385  1.00 182.66 ? 136 LYS B CE    1 
ATOM 3761 N NZ    . LYS H 3 136 ? 137.018 87.974  45.510  1.00 181.01 ? 136 LYS B NZ    1 
ATOM 3762 N N     . GLY H 3 137 ? 133.582 94.523  44.833  1.00 183.46 ? 137 GLY B N     1 
ATOM 3763 C CA    . GLY H 3 137 ? 134.010 95.923  44.802  1.00 183.75 ? 137 GLY B CA    1 
ATOM 3764 C C     . GLY H 3 137 ? 134.361 96.490  43.436  1.00 183.34 ? 137 GLY B C     1 
ATOM 3765 O O     . GLY H 3 137 ? 135.408 97.128  43.281  1.00 184.27 ? 137 GLY B O     1 
ATOM 3766 N N     . VAL H 3 138 ? 133.483 96.277  42.453  1.00 181.10 ? 138 VAL B N     1 
ATOM 3767 C CA    . VAL H 3 138 ? 133.713 96.765  41.086  1.00 178.62 ? 138 VAL B CA    1 
ATOM 3768 C C     . VAL H 3 138 ? 132.856 97.996  40.773  1.00 178.41 ? 138 VAL B C     1 
ATOM 3769 O O     . VAL H 3 138 ? 131.698 98.083  41.190  1.00 178.05 ? 138 VAL B O     1 
ATOM 3770 C CB    . VAL H 3 138 ? 133.477 95.662  40.019  1.00 177.22 ? 138 VAL B CB    1 
ATOM 3771 C CG1   . VAL H 3 138 ? 134.026 96.094  38.666  1.00 176.09 ? 138 VAL B CG1   1 
ATOM 3772 C CG2   . VAL H 3 138 ? 134.137 94.362  40.434  1.00 176.78 ? 138 VAL B CG2   1 
ATOM 3773 N N     . VAL H 3 139 ? 133.444 98.942  40.040  1.00 178.47 ? 139 VAL B N     1 
ATOM 3774 C CA    . VAL H 3 139 ? 132.765 100.175 39.641  1.00 178.86 ? 139 VAL B CA    1 
ATOM 3775 C C     . VAL H 3 139 ? 132.047 99.982  38.307  1.00 178.17 ? 139 VAL B C     1 
ATOM 3776 O O     . VAL H 3 139 ? 132.692 99.800  37.269  1.00 178.31 ? 139 VAL B O     1 
ATOM 3777 C CB    . VAL H 3 139 ? 133.755 101.368 39.527  1.00 179.83 ? 139 VAL B CB    1 
ATOM 3778 C CG1   . VAL H 3 139 ? 133.018 102.650 39.141  1.00 179.93 ? 139 VAL B CG1   1 
ATOM 3779 C CG2   . VAL H 3 139 ? 134.535 101.565 40.831  1.00 181.83 ? 139 VAL B CG2   1 
ATOM 3780 N N     . PHE H 3 140 ? 130.716 100.024 38.344  1.00 177.15 ? 140 PHE B N     1 
ATOM 3781 C CA    . PHE H 3 140 ? 129.893 99.858  37.142  1.00 176.81 ? 140 PHE B CA    1 
ATOM 3782 C C     . PHE H 3 140 ? 129.556 101.184 36.465  1.00 176.41 ? 140 PHE B C     1 
ATOM 3783 O O     . PHE H 3 140 ? 129.820 102.250 37.017  1.00 178.00 ? 140 PHE B O     1 
ATOM 3784 C CB    . PHE H 3 140 ? 128.603 99.102  37.468  1.00 177.27 ? 140 PHE B CB    1 
ATOM 3785 C CG    . PHE H 3 140 ? 128.734 97.610  37.383  1.00 177.62 ? 140 PHE B CG    1 
ATOM 3786 C CD1   . PHE H 3 140 ? 128.547 96.819  38.511  1.00 178.42 ? 140 PHE B CD1   1 
ATOM 3787 C CD2   . PHE H 3 140 ? 129.042 96.994  36.174  1.00 176.71 ? 140 PHE B CD2   1 
ATOM 3788 C CE1   . PHE H 3 140 ? 128.665 95.434  38.438  1.00 177.21 ? 140 PHE B CE1   1 
ATOM 3789 C CE2   . PHE H 3 140 ? 129.167 95.614  36.092  1.00 176.56 ? 140 PHE B CE2   1 
ATOM 3790 C CZ    . PHE H 3 140 ? 128.977 94.832  37.226  1.00 177.09 ? 140 PHE B CZ    1 
ATOM 3791 N N     . GLY H 3 141 ? 128.974 101.105 35.267  1.00 174.86 ? 141 GLY B N     1 
ATOM 3792 C CA    . GLY H 3 141 ? 128.557 102.290 34.510  1.00 173.96 ? 141 GLY B CA    1 
ATOM 3793 C C     . GLY H 3 141 ? 129.701 102.968 33.786  1.00 174.22 ? 141 GLY B C     1 
ATOM 3794 O O     . GLY H 3 141 ? 130.829 102.476 33.804  1.00 174.87 ? 141 GLY B O     1 
ATOM 3795 N N     . ARG H 3 142 ? 129.415 104.094 33.135  1.00 174.68 ? 142 ARG B N     1 
ATOM 3796 C CA    . ARG H 3 142 ? 130.475 104.896 32.522  1.00 176.56 ? 142 ARG B CA    1 
ATOM 3797 C C     . ARG H 3 142 ? 131.240 105.659 33.592  1.00 177.13 ? 142 ARG B C     1 
ATOM 3798 O O     . ARG H 3 142 ? 130.649 106.190 34.533  1.00 177.19 ? 142 ARG B O     1 
ATOM 3799 C CB    . ARG H 3 142 ? 129.933 105.854 31.454  1.00 176.74 ? 142 ARG B CB    1 
ATOM 3800 C CG    . ARG H 3 142 ? 128.991 106.932 31.971  1.00 178.35 ? 142 ARG B CG    1 
ATOM 3801 C CD    . ARG H 3 142 ? 128.481 107.839 30.862  1.00 177.96 ? 142 ARG B CD    1 
ATOM 3802 N NE    . ARG H 3 142 ? 129.464 108.828 30.425  1.00 182.41 ? 142 ARG B NE    1 
ATOM 3803 C CZ    . ARG H 3 142 ? 129.165 109.941 29.757  1.00 184.40 ? 142 ARG B CZ    1 
ATOM 3804 N NH1   . ARG H 3 142 ? 127.904 110.223 29.447  1.00 183.96 ? 142 ARG B NH1   1 
ATOM 3805 N NH2   . ARG H 3 142 ? 130.130 110.781 29.403  1.00 185.17 ? 142 ARG B NH2   1 
ATOM 3806 N N     . LYS H 3 143 ? 132.559 105.700 33.446  1.00 178.58 ? 143 LYS B N     1 
ATOM 3807 C CA    . LYS H 3 143 ? 133.415 106.382 34.410  1.00 180.29 ? 143 LYS B CA    1 
ATOM 3808 C C     . LYS H 3 143 ? 133.308 107.900 34.241  1.00 180.97 ? 143 LYS B C     1 
ATOM 3809 O O     . LYS H 3 143 ? 132.929 108.382 33.169  1.00 182.34 ? 143 LYS B O     1 
ATOM 3810 C CB    . LYS H 3 143 ? 134.862 105.896 34.282  1.00 180.77 ? 143 LYS B CB    1 
ATOM 3811 C CG    . LYS H 3 143 ? 135.032 104.402 34.554  1.00 182.24 ? 143 LYS B CG    1 
ATOM 3812 C CD    . LYS H 3 143 ? 136.458 104.061 34.940  1.00 185.39 ? 143 LYS B CD    1 
ATOM 3813 C CE    . LYS H 3 143 ? 136.569 102.629 35.436  1.00 187.92 ? 143 LYS B CE    1 
ATOM 3814 N NZ    . LYS H 3 143 ? 137.923 102.356 35.997  1.00 189.97 ? 143 LYS B NZ    1 
ATOM 3815 N N     . ARG H 3 144 ? 133.619 108.642 35.304  1.00 179.64 ? 144 ARG B N     1 
ATOM 3816 C CA    . ARG H 3 144 ? 133.467 110.099 35.312  1.00 178.34 ? 144 ARG B CA    1 
ATOM 3817 C C     . ARG H 3 144 ? 134.518 110.772 34.429  1.00 179.23 ? 144 ARG B C     1 
ATOM 3818 O O     . ARG H 3 144 ? 135.613 110.237 34.250  1.00 179.13 ? 144 ARG B O     1 
ATOM 3819 C CB    . ARG H 3 144 ? 133.508 110.630 36.749  1.00 176.92 ? 144 ARG B CB    1 
ATOM 3820 C CG    . ARG H 3 144 ? 132.349 110.127 37.606  1.00 177.60 ? 144 ARG B CG    1 
ATOM 3821 C CD    . ARG H 3 144 ? 132.493 110.473 39.083  1.00 178.90 ? 144 ARG B CD    1 
ATOM 3822 N NE    . ARG H 3 144 ? 131.389 109.915 39.870  1.00 182.12 ? 144 ARG B NE    1 
ATOM 3823 C CZ    . ARG H 3 144 ? 131.218 110.085 41.181  1.00 183.52 ? 144 ARG B CZ    1 
ATOM 3824 N NH1   . ARG H 3 144 ? 132.078 110.804 41.894  1.00 183.44 ? 144 ARG B NH1   1 
ATOM 3825 N NH2   . ARG H 3 144 ? 130.175 109.527 41.783  1.00 183.86 ? 144 ARG B NH2   1 
ATOM 3826 N N     . LYS H 3 145 ? 134.172 111.927 33.861  1.00 181.24 ? 145 LYS B N     1 
ATOM 3827 C CA    . LYS H 3 145 ? 135.071 112.644 32.946  1.00 184.29 ? 145 LYS B CA    1 
ATOM 3828 C C     . LYS H 3 145 ? 135.413 114.058 33.409  1.00 185.73 ? 145 LYS B C     1 
ATOM 3829 O O     . LYS H 3 145 ? 136.592 114.423 33.499  1.00 186.58 ? 145 LYS B O     1 
ATOM 3830 C CB    . LYS H 3 145 ? 134.479 112.702 31.533  1.00 183.99 ? 145 LYS B CB    1 
ATOM 3831 C CG    . LYS H 3 145 ? 134.754 111.477 30.681  1.00 186.17 ? 145 LYS B CG    1 
ATOM 3832 C CD    . LYS H 3 145 ? 134.029 111.565 29.342  1.00 186.28 ? 145 LYS B CD    1 
ATOM 3833 C CE    . LYS H 3 145 ? 134.082 110.239 28.591  1.00 188.00 ? 145 LYS B CE    1 
ATOM 3834 N NZ    . LYS H 3 145 ? 133.241 110.246 27.360  1.00 186.78 ? 145 LYS B NZ    1 
ATOM 3835 N N     . ILE H 3 146 ? 134.375 114.839 33.702  1.00 186.22 ? 146 ILE B N     1 
ATOM 3836 C CA    . ILE H 3 146 ? 134.501 116.270 33.978  1.00 187.23 ? 146 ILE B CA    1 
ATOM 3837 C C     . ILE H 3 146 ? 135.249 116.558 35.283  1.00 187.49 ? 146 ILE B C     1 
ATOM 3838 O O     . ILE H 3 146 ? 134.899 116.020 36.334  1.00 187.33 ? 146 ILE B O     1 
ATOM 3839 C CB    . ILE H 3 146 ? 133.111 116.948 33.991  1.00 187.71 ? 146 ILE B CB    1 
ATOM 3840 C CG1   . ILE H 3 146 ? 132.392 116.706 32.657  1.00 190.31 ? 146 ILE B CG1   1 
ATOM 3841 C CG2   . ILE H 3 146 ? 133.239 118.443 34.271  1.00 189.84 ? 146 ILE B CG2   1 
ATOM 3842 C CD1   . ILE H 3 146 ? 130.878 116.868 32.714  1.00 192.54 ? 146 ILE B CD1   1 
ATOM 3843 N N     . ASP H 3 147 ? 136.274 117.410 35.191  1.00 187.95 ? 147 ASP B N     1 
ATOM 3844 C CA    . ASP H 3 147 ? 137.134 117.782 36.324  1.00 187.90 ? 147 ASP B CA    1 
ATOM 3845 C C     . ASP H 3 147 ? 136.339 118.469 37.439  1.00 187.24 ? 147 ASP B C     1 
ATOM 3846 O O     . ASP H 3 147 ? 136.280 119.699 37.516  1.00 185.46 ? 147 ASP B O     1 
ATOM 3847 C CB    . ASP H 3 147 ? 138.291 118.673 35.842  1.00 188.53 ? 147 ASP B CB    1 
ATOM 3848 C CG    . ASP H 3 147 ? 139.422 118.787 36.861  1.00 190.40 ? 147 ASP B CG    1 
ATOM 3849 O OD1   . ASP H 3 147 ? 139.431 118.022 37.849  1.00 193.07 ? 147 ASP B OD1   1 
ATOM 3850 O OD2   . ASP H 3 147 ? 140.312 119.645 36.667  1.00 189.19 ? 147 ASP B OD2   1 
ATOM 3851 N N     . ARG H 3 148 ? 135.739 117.650 38.300  1.00 187.97 ? 148 ARG B N     1 
ATOM 3852 C CA    . ARG H 3 148 ? 134.807 118.112 39.331  1.00 188.10 ? 148 ARG B CA    1 
ATOM 3853 C C     . ARG H 3 148 ? 135.464 119.028 40.349  1.00 188.44 ? 148 ARG B C     1 
ATOM 3854 O O     . ARG H 3 148 ? 134.904 120.067 40.711  1.00 189.50 ? 148 ARG B O     1 
ATOM 3855 C CB    . ARG H 3 148 ? 134.161 116.924 40.042  1.00 187.10 ? 148 ARG B CB    1 
ATOM 3856 C CG    . ARG H 3 148 ? 133.339 116.052 39.126  1.00 190.06 ? 148 ARG B CG    1 
ATOM 3857 C CD    . ARG H 3 148 ? 132.458 115.112 39.911  1.00 194.11 ? 148 ARG B CD    1 
ATOM 3858 N NE    . ARG H 3 148 ? 131.536 114.381 39.043  1.00 190.71 ? 148 ARG B NE    1 
ATOM 3859 C CZ    . ARG H 3 148 ? 130.619 113.523 39.479  1.00 191.38 ? 148 ARG B CZ    1 
ATOM 3860 N NH1   . ARG H 3 148 ? 130.486 113.275 40.778  1.00 192.45 ? 148 ARG B NH1   1 
ATOM 3861 N NH2   . ARG H 3 148 ? 129.830 112.906 38.615  1.00 194.58 ? 148 ARG B NH2   1 
ATOM 3862 N N     . ASP H 3 149 ? 136.656 118.642 40.799  1.00 187.46 ? 149 ASP B N     1 
ATOM 3863 C CA    . ASP H 3 149 ? 137.414 119.435 41.759  1.00 186.66 ? 149 ASP B CA    1 
ATOM 3864 C C     . ASP H 3 149 ? 137.602 120.873 41.266  1.00 186.76 ? 149 ASP B C     1 
ATOM 3865 O O     . ASP H 3 149 ? 137.970 121.761 42.044  1.00 187.60 ? 149 ASP B O     1 
ATOM 3866 C CB    . ASP H 3 149 ? 138.764 118.769 42.055  1.00 185.43 ? 149 ASP B CB    1 
ATOM 3867 C CG    . ASP H 3 149 ? 138.616 117.463 42.838  1.00 181.64 ? 149 ASP B CG    1 
ATOM 3868 O OD1   . ASP H 3 149 ? 137.526 117.283 43.618  1.00 177.91 ? 149 ASP B OD1   1 
ATOM 3869 O OD2   . ASP H 3 149 ? 139.605 116.611 42.678  1.00 180.88 ? 149 ASP B OD2   1 
ATOM 3870 N N     . ALA H 3 150 ? 137.333 121.090 39.977  1.00 185.16 ? 150 ALA B N     1 
ATOM 3871 C CA    . ALA H 3 150 ? 137.386 122.421 39.382  1.00 183.78 ? 150 ALA B CA    1 
ATOM 3872 C C     . ALA H 3 150 ? 136.035 123.117 39.482  1.00 180.57 ? 150 ALA B C     1 
ATOM 3873 O O     . ALA H 3 150 ? 135.958 124.291 39.844  1.00 181.28 ? 150 ALA B O     1 
ATOM 3874 C CB    . ALA H 3 150 ? 137.852 122.348 37.935  1.00 185.30 ? 150 ALA B CB    1 
ATOM 3875 N N     . VAL H 3 151 ? 134.974 122.388 39.160  1.00 177.15 ? 151 VAL B N     1 
ATOM 3876 C CA    . VAL H 3 151 ? 133.619 122.902 39.312  1.00 175.81 ? 151 VAL B CA    1 
ATOM 3877 C C     . VAL H 3 151 ? 133.361 123.263 40.769  1.00 174.09 ? 151 VAL B C     1 
ATOM 3878 O O     . VAL H 3 151 ? 132.863 124.349 41.071  1.00 173.17 ? 151 VAL B O     1 
ATOM 3879 C CB    . VAL H 3 151 ? 132.573 121.876 38.837  1.00 175.98 ? 151 VAL B CB    1 
ATOM 3880 C CG1   . VAL H 3 151 ? 131.175 122.275 39.290  1.00 175.03 ? 151 VAL B CG1   1 
ATOM 3881 C CG2   . VAL H 3 151 ? 132.630 121.722 37.322  1.00 175.31 ? 151 VAL B CG2   1 
ATOM 3882 N N     . LEU H 3 152 ? 133.719 122.347 41.663  1.00 173.97 ? 152 LEU B N     1 
ATOM 3883 C CA    . LEU H 3 152 ? 133.575 122.556 43.096  1.00 174.87 ? 152 LEU B CA    1 
ATOM 3884 C C     . LEU H 3 152 ? 134.376 123.779 43.548  1.00 173.93 ? 152 LEU B C     1 
ATOM 3885 O O     . LEU H 3 152 ? 133.956 124.498 44.454  1.00 174.44 ? 152 LEU B O     1 
ATOM 3886 C CB    . LEU H 3 152 ? 134.027 121.308 43.858  1.00 176.26 ? 152 LEU B CB    1 
ATOM 3887 C CG    . LEU H 3 152 ? 133.147 120.776 45.000  1.00 178.33 ? 152 LEU B CG    1 
ATOM 3888 C CD1   . LEU H 3 152 ? 133.608 119.367 45.383  1.00 179.63 ? 152 LEU B CD1   1 
ATOM 3889 C CD2   . LEU H 3 152 ? 133.135 121.710 46.225  1.00 177.74 ? 152 LEU B CD2   1 
ATOM 3890 N N     . ASN H 3 153 ? 135.520 124.011 42.902  1.00 172.28 ? 153 ASN B N     1 
ATOM 3891 C CA    . ASN H 3 153 ? 136.334 125.205 43.143  1.00 170.14 ? 153 ASN B CA    1 
ATOM 3892 C C     . ASN H 3 153 ? 135.757 126.476 42.523  1.00 171.20 ? 153 ASN B C     1 
ATOM 3893 O O     . ASN H 3 153 ? 136.209 127.586 42.829  1.00 171.57 ? 153 ASN B O     1 
ATOM 3894 C CB    . ASN H 3 153 ? 137.765 124.988 42.650  1.00 168.09 ? 153 ASN B CB    1 
ATOM 3895 C CG    . ASN H 3 153 ? 138.676 124.427 43.723  1.00 165.98 ? 153 ASN B CG    1 
ATOM 3896 O OD1   . ASN H 3 153 ? 139.869 124.729 43.738  1.00 162.82 ? 153 ASN B OD1   1 
ATOM 3897 N ND2   . ASN H 3 153 ? 138.121 123.613 44.630  1.00 166.09 ? 153 ASN B ND2   1 
ATOM 3898 N N     . MET H 3 154 ? 134.764 126.311 41.652  1.00 172.02 ? 154 MET B N     1 
ATOM 3899 C CA    . MET H 3 154 ? 134.091 127.450 41.027  1.00 171.66 ? 154 MET B CA    1 
ATOM 3900 C C     . MET H 3 154 ? 132.772 127.837 41.711  1.00 173.17 ? 154 MET B C     1 
ATOM 3901 O O     . MET H 3 154 ? 132.202 128.887 41.410  1.00 173.75 ? 154 MET B O     1 
ATOM 3902 C CB    . MET H 3 154 ? 133.924 127.239 39.519  1.00 171.06 ? 154 MET B CB    1 
ATOM 3903 C CG    . MET H 3 154 ? 135.169 127.618 38.726  1.00 168.71 ? 154 MET B CG    1 
ATOM 3904 S SD    . MET H 3 154 ? 134.931 127.619 36.942  1.00 168.71 ? 154 MET B SD    1 
ATOM 3905 C CE    . MET H 3 154 ? 136.436 128.415 36.384  1.00 170.49 ? 154 MET B CE    1 
ATOM 3906 N N     . TRP H 3 155 ? 132.294 127.000 42.631  1.00 173.38 ? 155 TRP B N     1 
ATOM 3907 C CA    . TRP H 3 155 ? 131.279 127.449 43.584  1.00 173.64 ? 155 TRP B CA    1 
ATOM 3908 C C     . TRP H 3 155 ? 131.971 128.017 44.827  1.00 171.88 ? 155 TRP B C     1 
ATOM 3909 O O     . TRP H 3 155 ? 131.687 129.144 45.225  1.00 169.92 ? 155 TRP B O     1 
ATOM 3910 C CB    . TRP H 3 155 ? 130.291 126.341 43.974  1.00 175.20 ? 155 TRP B CB    1 
ATOM 3911 C CG    . TRP H 3 155 ? 128.905 126.862 44.348  1.00 176.31 ? 155 TRP B CG    1 
ATOM 3912 C CD1   . TRP H 3 155 ? 127.726 126.529 43.750  1.00 174.44 ? 155 TRP B CD1   1 
ATOM 3913 C CD2   . TRP H 3 155 ? 128.571 127.814 45.383  1.00 180.03 ? 155 TRP B CD2   1 
ATOM 3914 N NE1   . TRP H 3 155 ? 126.682 127.196 44.344  1.00 174.99 ? 155 TRP B NE1   1 
ATOM 3915 C CE2   . TRP H 3 155 ? 127.171 127.992 45.347  1.00 179.63 ? 155 TRP B CE2   1 
ATOM 3916 C CE3   . TRP H 3 155 ? 129.317 128.530 46.338  1.00 180.64 ? 155 TRP B CE3   1 
ATOM 3917 C CZ2   . TRP H 3 155 ? 126.499 128.860 46.227  1.00 179.96 ? 155 TRP B CZ2   1 
ATOM 3918 C CZ3   . TRP H 3 155 ? 128.648 129.396 47.212  1.00 176.43 ? 155 TRP B CZ3   1 
ATOM 3919 C CH2   . TRP H 3 155 ? 127.254 129.549 47.148  1.00 177.22 ? 155 TRP B CH2   1 
ATOM 3920 N N     . GLN H 3 156 ? 132.874 127.238 45.429  1.00 170.74 ? 156 GLN B N     1 
ATOM 3921 C CA    . GLN H 3 156 ? 133.657 127.689 46.583  1.00 169.98 ? 156 GLN B CA    1 
ATOM 3922 C C     . GLN H 3 156 ? 134.113 129.132 46.384  1.00 171.20 ? 156 GLN B C     1 
ATOM 3923 O O     . GLN H 3 156 ? 134.277 129.878 47.348  1.00 172.80 ? 156 GLN B O     1 
ATOM 3924 C CB    . GLN H 3 156 ? 134.872 126.784 46.808  1.00 169.83 ? 156 GLN B CB    1 
ATOM 3925 C CG    . GLN H 3 156 ? 134.594 125.490 47.580  1.00 168.78 ? 156 GLN B CG    1 
ATOM 3926 C CD    . GLN H 3 156 ? 135.857 124.660 47.829  1.00 169.28 ? 156 GLN B CD    1 
ATOM 3927 O OE1   . GLN H 3 156 ? 137.037 125.215 47.622  1.00 170.74 ? 156 GLN B OE1   1 
ATOM 3928 N NE2   . GLN H 3 156 ? 135.609 123.284 48.103  1.00 165.92 ? 156 GLN B NE2   1 
ATOM 3929 N N     . GLN H 3 157 ? 134.305 129.502 45.119  1.00 171.08 ? 157 GLN B N     1 
ATOM 3930 C CA    . GLN H 3 157 ? 134.603 130.867 44.695  1.00 171.27 ? 157 GLN B CA    1 
ATOM 3931 C C     . GLN H 3 157 ? 133.496 131.850 45.073  1.00 172.61 ? 157 GLN B C     1 
ATOM 3932 O O     . GLN H 3 157 ? 133.760 132.986 45.476  1.00 170.70 ? 157 GLN B O     1 
ATOM 3933 C CB    . GLN H 3 157 ? 134.755 130.881 43.178  1.00 170.43 ? 157 GLN B CB    1 
ATOM 3934 C CG    . GLN H 3 157 ? 135.299 132.173 42.613  1.00 166.53 ? 157 GLN B CG    1 
ATOM 3935 C CD    . GLN H 3 157 ? 136.716 132.032 42.124  1.00 163.77 ? 157 GLN B CD    1 
ATOM 3936 O OE1   . GLN H 3 157 ? 137.204 132.871 41.369  1.00 162.77 ? 157 GLN B OE1   1 
ATOM 3937 N NE2   . GLN H 3 157 ? 137.385 130.956 42.533  1.00 163.27 ? 157 GLN B NE2   1 
ATOM 3938 N N     . GLY H 3 158 ? 132.256 131.393 44.926  1.00 175.47 ? 158 GLY B N     1 
ATOM 3939 C CA    . GLY H 3 158 ? 131.084 132.247 45.044  1.00 178.41 ? 158 GLY B CA    1 
ATOM 3940 C C     . GLY H 3 158 ? 130.646 132.711 43.668  1.00 179.90 ? 158 GLY B C     1 
ATOM 3941 O O     . GLY H 3 158 ? 130.162 133.835 43.511  1.00 181.68 ? 158 GLY B O     1 
ATOM 3942 N N     . LEU H 3 159 ? 130.828 131.850 42.668  1.00 178.96 ? 159 LEU B N     1 
ATOM 3943 C CA    . LEU H 3 159 ? 130.461 132.178 41.295  1.00 179.32 ? 159 LEU B CA    1 
ATOM 3944 C C     . LEU H 3 159 ? 129.125 131.585 40.909  1.00 180.65 ? 159 LEU B C     1 
ATOM 3945 O O     . LEU H 3 159 ? 128.744 130.521 41.404  1.00 181.54 ? 159 LEU B O     1 
ATOM 3946 C CB    . LEU H 3 159 ? 131.525 131.701 40.308  1.00 179.12 ? 159 LEU B CB    1 
ATOM 3947 C CG    . LEU H 3 159 ? 132.561 132.708 39.810  1.00 182.60 ? 159 LEU B CG    1 
ATOM 3948 C CD1   . LEU H 3 159 ? 133.547 132.005 38.892  1.00 183.84 ? 159 LEU B CD1   1 
ATOM 3949 C CD2   . LEU H 3 159 ? 131.910 133.894 39.095  1.00 183.32 ? 159 LEU B CD2   1 
ATOM 3950 N N     . GLY H 3 160 ? 128.426 132.278 40.011  1.00 181.36 ? 160 GLY B N     1 
ATOM 3951 C CA    . GLY H 3 160 ? 127.148 131.815 39.479  1.00 180.77 ? 160 GLY B CA    1 
ATOM 3952 C C     . GLY H 3 160 ? 127.261 130.436 38.862  1.00 179.39 ? 160 GLY B C     1 
ATOM 3953 O O     . GLY H 3 160 ? 128.217 130.144 38.141  1.00 178.91 ? 160 GLY B O     1 
ATOM 3954 N N     . ALA H 3 161 ? 126.287 129.584 39.163  1.00 178.75 ? 161 ALA B N     1 
ATOM 3955 C CA    . ALA H 3 161 ? 126.263 128.223 38.640  1.00 178.45 ? 161 ALA B CA    1 
ATOM 3956 C C     . ALA H 3 161 ? 126.057 128.220 37.127  1.00 177.96 ? 161 ALA B C     1 
ATOM 3957 O O     . ALA H 3 161 ? 126.658 127.418 36.412  1.00 176.67 ? 161 ALA B O     1 
ATOM 3958 C CB    . ALA H 3 161 ? 125.190 127.417 39.331  1.00 178.44 ? 161 ALA B CB    1 
ATOM 3959 N N     . SER H 3 162 ? 125.209 129.130 36.655  1.00 179.41 ? 162 SER B N     1 
ATOM 3960 C CA    . SER H 3 162 ? 125.005 129.355 35.227  1.00 180.93 ? 162 SER B CA    1 
ATOM 3961 C C     . SER H 3 162 ? 126.317 129.761 34.561  1.00 180.62 ? 162 SER B C     1 
ATOM 3962 O O     . SER H 3 162 ? 126.680 129.228 33.509  1.00 180.62 ? 162 SER B O     1 
ATOM 3963 C CB    . SER H 3 162 ? 123.945 130.440 35.011  1.00 182.12 ? 162 SER B CB    1 
ATOM 3964 O OG    . SER H 3 162 ? 123.835 130.798 33.643  1.00 184.54 ? 162 SER B OG    1 
ATOM 3965 N N     . HIS H 3 163 ? 127.021 130.698 35.196  1.00 179.52 ? 163 HIS B N     1 
ATOM 3966 C CA    . HIS H 3 163 ? 128.324 131.175 34.735  1.00 177.85 ? 163 HIS B CA    1 
ATOM 3967 C C     . HIS H 3 163 ? 129.287 130.020 34.444  1.00 175.78 ? 163 HIS B C     1 
ATOM 3968 O O     . HIS H 3 163 ? 129.989 130.028 33.431  1.00 175.90 ? 163 HIS B O     1 
ATOM 3969 C CB    . HIS H 3 163 ? 128.925 132.126 35.775  1.00 178.28 ? 163 HIS B CB    1 
ATOM 3970 C CG    . HIS H 3 163 ? 130.263 132.677 35.396  1.00 180.42 ? 163 HIS B CG    1 
ATOM 3971 N ND1   . HIS H 3 163 ? 130.435 133.967 34.941  1.00 182.53 ? 163 HIS B ND1   1 
ATOM 3972 C CD2   . HIS H 3 163 ? 131.495 132.116 35.409  1.00 180.81 ? 163 HIS B CD2   1 
ATOM 3973 C CE1   . HIS H 3 163 ? 131.715 134.175 34.688  1.00 182.87 ? 163 HIS B CE1   1 
ATOM 3974 N NE2   . HIS H 3 163 ? 132.380 133.067 34.961  1.00 182.27 ? 163 HIS B NE2   1 
ATOM 3975 N N     . ILE H 3 164 ? 129.305 129.033 35.336  1.00 173.05 ? 164 ILE B N     1 
ATOM 3976 C CA    . ILE H 3 164 ? 130.146 127.850 35.193  1.00 170.59 ? 164 ILE B CA    1 
ATOM 3977 C C     . ILE H 3 164 ? 129.891 127.164 33.860  1.00 169.36 ? 164 ILE B C     1 
ATOM 3978 O O     . ILE H 3 164 ? 130.815 126.954 33.072  1.00 168.16 ? 164 ILE B O     1 
ATOM 3979 C CB    . ILE H 3 164 ? 129.900 126.858 36.355  1.00 170.49 ? 164 ILE B CB    1 
ATOM 3980 C CG1   . ILE H 3 164 ? 130.420 127.448 37.668  1.00 171.51 ? 164 ILE B CG1   1 
ATOM 3981 C CG2   . ILE H 3 164 ? 130.551 125.512 36.074  1.00 169.02 ? 164 ILE B CG2   1 
ATOM 3982 C CD1   . ILE H 3 164 ? 129.807 126.852 38.915  1.00 172.55 ? 164 ILE B CD1   1 
ATOM 3983 N N     . SER H 3 165 ? 128.621 126.856 33.611  1.00 169.61 ? 165 SER B N     1 
ATOM 3984 C CA    . SER H 3 165 ? 128.200 126.083 32.447  1.00 170.41 ? 165 SER B CA    1 
ATOM 3985 C C     . SER H 3 165 ? 128.502 126.749 31.106  1.00 170.71 ? 165 SER B C     1 
ATOM 3986 O O     . SER H 3 165 ? 128.463 126.094 30.062  1.00 171.53 ? 165 SER B O     1 
ATOM 3987 C CB    . SER H 3 165 ? 126.712 125.753 32.547  1.00 170.47 ? 165 SER B CB    1 
ATOM 3988 O OG    . SER H 3 165 ? 125.953 126.904 32.868  1.00 171.32 ? 165 SER B OG    1 
ATOM 3989 N N     . LYS H 3 166 ? 128.789 128.046 31.134  1.00 170.14 ? 166 LYS B N     1 
ATOM 3990 C CA    . LYS H 3 166 ? 129.237 128.750 29.937  1.00 170.38 ? 166 LYS B CA    1 
ATOM 3991 C C     . LYS H 3 166 ? 130.761 128.752 29.844  1.00 169.93 ? 166 LYS B C     1 
ATOM 3992 O O     . LYS H 3 166 ? 131.318 128.640 28.749  1.00 170.16 ? 166 LYS B O     1 
ATOM 3993 C CB    . LYS H 3 166 ? 128.690 130.180 29.894  1.00 170.96 ? 166 LYS B CB    1 
ATOM 3994 C CG    . LYS H 3 166 ? 127.322 130.317 29.230  1.00 171.30 ? 166 LYS B CG    1 
ATOM 3995 C CD    . LYS H 3 166 ? 126.967 131.785 28.993  1.00 170.35 ? 166 LYS B CD    1 
ATOM 3996 C CE    . LYS H 3 166 ? 125.659 131.935 28.227  1.00 168.47 ? 166 LYS B CE    1 
ATOM 3997 N NZ    . LYS H 3 166 ? 125.323 133.364 27.976  1.00 166.16 ? 166 LYS B NZ    1 
ATOM 3998 N N     . THR H 3 167 ? 131.424 128.875 30.995  1.00 168.97 ? 167 THR B N     1 
ATOM 3999 C CA    . THR H 3 167 ? 132.886 128.921 31.054  1.00 168.22 ? 167 THR B CA    1 
ATOM 4000 C C     . THR H 3 167 ? 133.459 127.575 30.624  1.00 167.20 ? 167 THR B C     1 
ATOM 4001 O O     . THR H 3 167 ? 134.288 127.506 29.716  1.00 167.22 ? 167 THR B O     1 
ATOM 4002 C CB    . THR H 3 167 ? 133.400 129.301 32.462  1.00 168.49 ? 167 THR B CB    1 
ATOM 4003 O OG1   . THR H 3 167 ? 132.573 130.329 33.020  1.00 167.99 ? 167 THR B OG1   1 
ATOM 4004 C CG2   . THR H 3 167 ? 134.840 129.802 32.394  1.00 169.02 ? 167 THR B CG2   1 
ATOM 4005 N N     . MET H 3 168 ? 133.009 126.514 31.285  1.00 166.65 ? 168 MET B N     1 
ATOM 4006 C CA    . MET H 3 168 ? 133.269 125.156 30.837  1.00 166.58 ? 168 MET B CA    1 
ATOM 4007 C C     . MET H 3 168 ? 132.164 124.778 29.860  1.00 166.79 ? 168 MET B C     1 
ATOM 4008 O O     . MET H 3 168 ? 130.984 124.961 30.162  1.00 168.01 ? 168 MET B O     1 
ATOM 4009 C CB    . MET H 3 168 ? 133.271 124.189 32.024  1.00 166.86 ? 168 MET B CB    1 
ATOM 4010 C CG    . MET H 3 168 ? 134.566 124.149 32.821  1.00 165.95 ? 168 MET B CG    1 
ATOM 4011 S SD    . MET H 3 168 ? 134.391 123.228 34.366  1.00 165.44 ? 168 MET B SD    1 
ATOM 4012 C CE    . MET H 3 168 ? 133.795 124.504 35.464  1.00 163.66 ? 168 MET B CE    1 
ATOM 4013 N N     . ASN H 3 169 ? 132.540 124.266 28.690  1.00 165.58 ? 169 ASN B N     1 
ATOM 4014 C CA    . ASN H 3 169 ? 131.564 123.853 27.680  1.00 164.52 ? 169 ASN B CA    1 
ATOM 4015 C C     . ASN H 3 169 ? 130.784 122.607 28.110  1.00 164.08 ? 169 ASN B C     1 
ATOM 4016 O O     . ASN H 3 169 ? 130.769 121.594 27.407  1.00 164.81 ? 169 ASN B O     1 
ATOM 4017 C CB    . ASN H 3 169 ? 132.242 123.632 26.319  1.00 164.33 ? 169 ASN B CB    1 
ATOM 4018 C CG    . ASN H 3 169 ? 132.588 124.935 25.610  1.00 163.42 ? 169 ASN B CG    1 
ATOM 4019 O OD1   . ASN H 3 169 ? 131.854 125.921 25.691  1.00 163.66 ? 169 ASN B OD1   1 
ATOM 4020 N ND2   . ASN H 3 169 ? 133.708 124.935 24.897  1.00 161.75 ? 169 ASN B ND2   1 
ATOM 4021 N N     . ILE H 3 170 ? 130.141 122.694 29.274  1.00 163.28 ? 170 ILE B N     1 
ATOM 4022 C CA    . ILE H 3 170 ? 129.391 121.574 29.850  1.00 163.15 ? 170 ILE B CA    1 
ATOM 4023 C C     . ILE H 3 170 ? 127.999 121.984 30.331  1.00 164.49 ? 170 ILE B C     1 
ATOM 4024 O O     . ILE H 3 170 ? 127.691 123.174 30.437  1.00 163.88 ? 170 ILE B O     1 
ATOM 4025 C CB    . ILE H 3 170 ? 130.149 120.894 31.019  1.00 161.87 ? 170 ILE B CB    1 
ATOM 4026 C CG1   . ILE H 3 170 ? 130.364 121.876 32.174  1.00 158.59 ? 170 ILE B CG1   1 
ATOM 4027 C CG2   . ILE H 3 170 ? 131.466 120.284 30.534  1.00 163.79 ? 170 ILE B CG2   1 
ATOM 4028 C CD1   . ILE H 3 170 ? 130.387 121.216 33.536  1.00 155.05 ? 170 ILE B CD1   1 
ATOM 4029 N N     . ALA H 3 171 ? 127.176 120.983 30.639  1.00 166.77 ? 171 ALA B N     1 
ATOM 4030 C CA    . ALA H 3 171 ? 125.773 121.187 30.996  1.00 168.41 ? 171 ALA B CA    1 
ATOM 4031 C C     . ALA H 3 171 ? 125.596 121.806 32.373  1.00 167.76 ? 171 ALA B C     1 
ATOM 4032 O O     . ALA H 3 171 ? 126.382 121.559 33.282  1.00 166.93 ? 171 ALA B O     1 
ATOM 4033 C CB    . ALA H 3 171 ? 125.008 119.875 30.906  1.00 170.72 ? 171 ALA B CB    1 
ATOM 4034 N N     . ARG H 3 172 ? 124.540 122.597 32.514  1.00 169.40 ? 172 ARG B N     1 
ATOM 4035 C CA    . ARG H 3 172 ? 124.282 123.346 33.740  1.00 171.30 ? 172 ARG B CA    1 
ATOM 4036 C C     . ARG H 3 172 ? 123.690 122.498 34.861  1.00 171.79 ? 172 ARG B C     1 
ATOM 4037 O O     . ARG H 3 172 ? 124.155 122.563 35.999  1.00 171.75 ? 172 ARG B O     1 
ATOM 4038 C CB    . ARG H 3 172 ? 123.401 124.572 33.453  1.00 171.67 ? 172 ARG B CB    1 
ATOM 4039 C CG    . ARG H 3 172 ? 122.184 124.313 32.556  1.00 173.15 ? 172 ARG B CG    1 
ATOM 4040 C CD    . ARG H 3 172 ? 121.498 125.611 32.149  1.00 171.84 ? 172 ARG B CD    1 
ATOM 4041 N NE    . ARG H 3 172 ? 121.388 126.548 33.268  1.00 174.37 ? 172 ARG B NE    1 
ATOM 4042 C CZ    . ARG H 3 172 ? 120.429 126.522 34.191  1.00 175.20 ? 172 ARG B CZ    1 
ATOM 4043 N NH1   . ARG H 3 172 ? 119.470 125.605 34.145  1.00 176.63 ? 172 ARG B NH1   1 
ATOM 4044 N NH2   . ARG H 3 172 ? 120.431 127.421 35.166  1.00 173.53 ? 172 ARG B NH2   1 
ATOM 4045 N N     . SER H 3 173 ? 122.674 121.700 34.533  1.00 171.82 ? 173 SER B N     1 
ATOM 4046 C CA    . SER H 3 173 ? 121.996 120.859 35.517  1.00 171.12 ? 173 SER B CA    1 
ATOM 4047 C C     . SER H 3 173 ? 122.965 119.925 36.213  1.00 169.96 ? 173 SER B C     1 
ATOM 4048 O O     . SER H 3 173 ? 122.765 119.565 37.375  1.00 169.48 ? 173 SER B O     1 
ATOM 4049 C CB    . SER H 3 173 ? 120.901 120.035 34.855  1.00 171.91 ? 173 SER B CB    1 
ATOM 4050 O OG    . SER H 3 173 ? 120.573 118.912 35.656  1.00 174.89 ? 173 SER B OG    1 
ATOM 4051 N N     . THR H 3 174 ? 124.001 119.527 35.482  1.00 170.02 ? 174 THR B N     1 
ATOM 4052 C CA    . THR H 3 174 ? 125.052 118.684 36.027  1.00 170.79 ? 174 THR B CA    1 
ATOM 4053 C C     . THR H 3 174 ? 125.796 119.432 37.123  1.00 170.37 ? 174 THR B C     1 
ATOM 4054 O O     . THR H 3 174 ? 126.012 118.889 38.206  1.00 169.86 ? 174 THR B O     1 
ATOM 4055 C CB    . THR H 3 174 ? 126.030 118.184 34.936  1.00 171.02 ? 174 THR B CB    1 
ATOM 4056 O OG1   . THR H 3 174 ? 126.274 119.228 33.989  1.00 171.98 ? 174 THR B OG1   1 
ATOM 4057 C CG2   . THR H 3 174 ? 125.447 116.983 34.210  1.00 167.85 ? 174 THR B CG2   1 
ATOM 4058 N N     . VAL H 3 175 ? 126.142 120.689 36.848  1.00 170.78 ? 175 VAL B N     1 
ATOM 4059 C CA    . VAL H 3 175 ? 126.869 121.528 37.803  1.00 171.41 ? 175 VAL B CA    1 
ATOM 4060 C C     . VAL H 3 175 ? 126.268 121.402 39.199  1.00 171.79 ? 175 VAL B C     1 
ATOM 4061 O O     . VAL H 3 175 ? 126.968 121.049 40.147  1.00 171.78 ? 175 VAL B O     1 
ATOM 4062 C CB    . VAL H 3 175 ? 126.904 123.024 37.376  1.00 171.42 ? 175 VAL B CB    1 
ATOM 4063 C CG1   . VAL H 3 175 ? 127.703 123.855 38.372  1.00 169.57 ? 175 VAL B CG1   1 
ATOM 4064 C CG2   . VAL H 3 175 ? 127.493 123.180 35.982  1.00 172.75 ? 175 VAL B CG2   1 
ATOM 4065 N N     . TYR H 3 176 ? 124.970 121.671 39.307  1.00 172.38 ? 176 TYR B N     1 
ATOM 4066 C CA    . TYR H 3 176 ? 124.259 121.615 40.581  1.00 175.40 ? 176 TYR B CA    1 
ATOM 4067 C C     . TYR H 3 176 ? 124.380 120.249 41.251  1.00 177.06 ? 176 TYR B C     1 
ATOM 4068 O O     . TYR H 3 176 ? 124.799 120.154 42.407  1.00 177.94 ? 176 TYR B O     1 
ATOM 4069 C CB    . TYR H 3 176 ? 122.788 121.960 40.373  1.00 177.88 ? 176 TYR B CB    1 
ATOM 4070 C CG    . TYR H 3 176 ? 122.531 123.410 40.042  1.00 179.85 ? 176 TYR B CG    1 
ATOM 4071 C CD1   . TYR H 3 176 ? 122.820 123.922 38.776  1.00 180.85 ? 176 TYR B CD1   1 
ATOM 4072 C CD2   . TYR H 3 176 ? 121.983 124.267 40.990  1.00 181.47 ? 176 TYR B CD2   1 
ATOM 4073 C CE1   . TYR H 3 176 ? 122.576 125.253 38.469  1.00 181.59 ? 176 TYR B CE1   1 
ATOM 4074 C CE2   . TYR H 3 176 ? 121.736 125.598 40.694  1.00 182.39 ? 176 TYR B CE2   1 
ATOM 4075 C CZ    . TYR H 3 176 ? 122.034 126.085 39.434  1.00 181.33 ? 176 TYR B CZ    1 
ATOM 4076 O OH    . TYR H 3 176 ? 121.791 127.406 39.142  1.00 181.43 ? 176 TYR B OH    1 
ATOM 4077 N N     . LYS H 3 177 ? 124.017 119.203 40.511  1.00 178.10 ? 177 LYS B N     1 
ATOM 4078 C CA    . LYS H 3 177 ? 124.119 117.818 40.973  1.00 179.18 ? 177 LYS B CA    1 
ATOM 4079 C C     . LYS H 3 177 ? 125.500 117.527 41.558  1.00 177.81 ? 177 LYS B C     1 
ATOM 4080 O O     . LYS H 3 177 ? 125.619 116.878 42.600  1.00 176.94 ? 177 LYS B O     1 
ATOM 4081 C CB    . LYS H 3 177 ? 123.794 116.866 39.812  1.00 180.81 ? 177 LYS B CB    1 
ATOM 4082 C CG    . LYS H 3 177 ? 124.265 115.421 39.974  1.00 184.16 ? 177 LYS B CG    1 
ATOM 4083 C CD    . LYS H 3 177 ? 123.881 114.575 38.757  1.00 180.93 ? 177 LYS B CD    1 
ATOM 4084 C CE    . LYS H 3 177 ? 124.899 113.464 38.499  1.00 180.64 ? 177 LYS B CE    1 
ATOM 4085 N NZ    . LYS H 3 177 ? 124.858 112.371 39.538  1.00 180.60 ? 177 LYS B NZ    1 
ATOM 4086 N N     . VAL H 3 178 ? 126.530 118.038 40.887  1.00 177.99 ? 178 VAL B N     1 
ATOM 4087 C CA    . VAL H 3 178 ? 127.921 117.863 41.303  1.00 178.06 ? 178 VAL B CA    1 
ATOM 4088 C C     . VAL H 3 178 ? 128.162 118.364 42.730  1.00 178.95 ? 178 VAL B C     1 
ATOM 4089 O O     . VAL H 3 178 ? 128.863 117.722 43.511  1.00 180.52 ? 178 VAL B O     1 
ATOM 4090 C CB    . VAL H 3 178 ? 128.906 118.561 40.320  1.00 176.62 ? 178 VAL B CB    1 
ATOM 4091 C CG1   . VAL H 3 178 ? 130.348 118.394 40.781  1.00 182.83 ? 178 VAL B CG1   1 
ATOM 4092 C CG2   . VAL H 3 178 ? 128.756 118.008 38.916  1.00 173.92 ? 178 VAL B CG2   1 
ATOM 4093 N N     . ILE H 3 179 ? 127.575 119.506 43.066  1.00 178.95 ? 179 ILE B N     1 
ATOM 4094 C CA    . ILE H 3 179 ? 127.797 120.117 44.370  1.00 179.89 ? 179 ILE B CA    1 
ATOM 4095 C C     . ILE H 3 179 ? 127.132 119.295 45.469  1.00 180.44 ? 179 ILE B C     1 
ATOM 4096 O O     . ILE H 3 179 ? 127.762 118.974 46.479  1.00 179.92 ? 179 ILE B O     1 
ATOM 4097 C CB    . ILE H 3 179 ? 127.319 121.577 44.392  1.00 180.06 ? 179 ILE B CB    1 
ATOM 4098 C CG1   . ILE H 3 179 ? 127.997 122.357 43.263  1.00 181.15 ? 179 ILE B CG1   1 
ATOM 4099 C CG2   . ILE H 3 179 ? 127.635 122.227 45.734  1.00 182.59 ? 179 ILE B CG2   1 
ATOM 4100 C CD1   . ILE H 3 179 ? 127.119 123.400 42.624  1.00 183.45 ? 179 ILE B CD1   1 
ATOM 4101 N N     . ASN H 3 180 ? 125.871 118.934 45.256  1.00 182.08 ? 180 ASN B N     1 
ATOM 4102 C CA    . ASN H 3 180 ? 125.173 118.042 46.172  1.00 184.81 ? 180 ASN B CA    1 
ATOM 4103 C C     . ASN H 3 180 ? 125.673 116.600 46.062  1.00 187.67 ? 180 ASN B C     1 
ATOM 4104 O O     . ASN H 3 180 ? 124.917 115.649 46.279  1.00 188.82 ? 180 ASN B O     1 
ATOM 4105 C CB    . ASN H 3 180 ? 123.654 118.123 45.968  1.00 184.44 ? 180 ASN B CB    1 
ATOM 4106 C CG    . ASN H 3 180 ? 122.978 119.069 46.950  1.00 184.02 ? 180 ASN B CG    1 
ATOM 4107 O OD1   . ASN H 3 180 ? 123.475 120.162 47.229  1.00 182.48 ? 180 ASN B OD1   1 
ATOM 4108 N ND2   . ASN H 3 180 ? 121.832 118.650 47.477  1.00 184.22 ? 180 ASN B ND2   1 
ATOM 4109 N N     . GLU H 3 181 ? 126.953 116.448 45.725  1.00 189.91 ? 181 GLU B N     1 
ATOM 4110 C CA    . GLU H 3 181 ? 127.598 115.138 45.690  1.00 192.99 ? 181 GLU B CA    1 
ATOM 4111 C C     . GLU H 3 181 ? 128.519 114.965 46.897  1.00 194.82 ? 181 GLU B C     1 
ATOM 4112 O O     . GLU H 3 181 ? 128.503 113.920 47.551  1.00 195.94 ? 181 GLU B O     1 
ATOM 4113 C CB    . GLU H 3 181 ? 128.378 114.943 44.386  1.00 193.29 ? 181 GLU B CB    1 
ATOM 4114 C CG    . GLU H 3 181 ? 128.668 113.485 44.022  1.00 192.22 ? 181 GLU B CG    1 
ATOM 4115 C CD    . GLU H 3 181 ? 127.480 112.779 43.392  1.00 189.79 ? 181 GLU B CD    1 
ATOM 4116 O OE1   . GLU H 3 181 ? 127.313 111.568 43.644  1.00 191.00 ? 181 GLU B OE1   1 
ATOM 4117 O OE2   . GLU H 3 181 ? 126.715 113.427 42.647  1.00 188.08 ? 181 GLU B OE2   1 
ATOM 4118 N N     . SER H 3 182 ? 129.315 115.991 47.186  1.00 195.50 ? 182 SER B N     1 
ATOM 4119 C CA    . SER H 3 182 ? 130.203 115.975 48.342  1.00 197.36 ? 182 SER B CA    1 
ATOM 4120 C C     . SER H 3 182 ? 129.591 116.767 49.500  1.00 197.76 ? 182 SER B C     1 
ATOM 4121 O O     . SER H 3 182 ? 129.832 117.970 49.643  1.00 197.73 ? 182 SER B O     1 
ATOM 4122 C CB    . SER H 3 182 ? 131.577 116.528 47.965  1.00 198.49 ? 182 SER B CB    1 
ATOM 4123 O OG    . SER H 3 182 ? 131.462 117.840 47.442  1.00 202.21 ? 182 SER B OG    1 
ATOM 4124 N N     . ASN H 3 183 ? 128.791 116.078 50.315  1.00 198.16 ? 183 ASN B N     1 
ATOM 4125 C CA    . ASN H 3 183 ? 128.094 116.697 51.445  1.00 198.57 ? 183 ASN B CA    1 
ATOM 4126 C C     . ASN H 3 183 ? 129.037 117.134 52.567  1.00 199.28 ? 183 ASN B C     1 
ATOM 4127 O O     . ASN H 3 183 ? 129.460 116.338 53.408  1.00 199.60 ? 183 ASN B O     1 
ATOM 4128 C CB    . ASN H 3 183 ? 127.004 115.764 51.992  1.00 197.97 ? 183 ASN B CB    1 
ATOM 4129 C CG    . ASN H 3 183 ? 125.733 115.788 51.157  1.00 196.56 ? 183 ASN B CG    1 
ATOM 4130 O OD1   . ASN H 3 183 ? 125.296 114.757 50.648  1.00 195.24 ? 183 ASN B OD1   1 
ATOM 4131 N ND2   . ASN H 3 183 ? 125.132 116.966 51.018  1.00 196.19 ? 183 ASN B ND2   1 
ATOM 4132 O OXT   . ASN H 3 183 ? 129.402 118.307 52.655  1.00 199.57 ? 183 ASN B OXT   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   2   2   DC  C   X . n 
A 1 2   DA  2   3   3   DA  A   X . n 
A 1 3   DG  3   4   4   DG  G   X . n 
A 1 4   DT  4   5   5   DT  T   X . n 
A 1 5   DG  5   6   6   DG  G   X . n 
A 1 6   DT  6   7   7   DT  T   X . n 
A 1 7   DC  7   8   8   DC  C   X . n 
A 1 8   DC  8   9   9   DC  C   X . n 
A 1 9   DG  9   10  10  DG  G   X . n 
A 1 10  DA  10  11  11  DA  A   X . n 
A 1 11  DT  11  12  12  DT  T   X . n 
A 1 12  DA  12  13  13  DA  A   X . n 
A 1 13  DA  13  14  14  DA  A   X . n 
A 1 14  DT  14  15  15  DT  T   X . n 
A 1 15  DT  15  16  16  DT  T   X . n 
A 1 16  DT  16  17  17  DT  T   X . n 
A 1 17  DA  17  18  18  DA  A   X . n 
A 1 18  DT  18  19  19  DT  T   X . n 
A 1 19  DA  19  20  ?   ?   ?   X . n 
A 1 20  DA  20  21  ?   ?   ?   X . n 
A 1 21  DA  21  22  ?   ?   ?   X . n 
B 1 1   DC  1   2   ?   ?   ?   Z . n 
B 1 2   DA  2   3   ?   ?   ?   Z . n 
B 1 3   DG  3   4   ?   ?   ?   Z . n 
B 1 4   DT  4   5   ?   ?   ?   Z . n 
B 1 5   DG  5   6   ?   ?   ?   Z . n 
B 1 6   DT  6   7   ?   ?   ?   Z . n 
B 1 7   DC  7   8   ?   ?   ?   Z . n 
B 1 8   DC  8   9   ?   ?   ?   Z . n 
B 1 9   DG  9   10  ?   ?   ?   Z . n 
B 1 10  DA  10  11  ?   ?   ?   Z . n 
B 1 11  DT  11  12  ?   ?   ?   Z . n 
B 1 12  DA  12  13  ?   ?   ?   Z . n 
B 1 13  DA  13  14  ?   ?   ?   Z . n 
B 1 14  DT  14  15  ?   ?   ?   Z . n 
B 1 15  DT  15  16  ?   ?   ?   Z . n 
B 1 16  DT  16  17  ?   ?   ?   Z . n 
B 1 17  DA  17  18  ?   ?   ?   Z . n 
B 1 18  DT  18  19  ?   ?   ?   Z . n 
B 1 19  DA  19  20  20  DA  A   Z . n 
B 1 20  DA  20  21  21  DA  A   Z . n 
B 1 21  DA  21  22  22  DA  A   Z . n 
C 2 1   DT  1   23  23  DT  T   Y . n 
C 2 2   DT  2   24  24  DT  T   Y . n 
C 2 3   DA  3   25  25  DA  A   Y . n 
C 2 4   DT  4   26  26  DT  T   Y . n 
C 2 5   DC  5   27  27  DC  C   Y . n 
C 2 6   DG  6   28  28  DG  G   Y . n 
C 2 7   DG  7   29  29  DG  G   Y . n 
C 2 8   DA  8   30  30  DA  A   Y . n 
C 2 9   DC  9   31  31  DC  C   Y . n 
C 2 10  DA  10  32  32  DA  A   Y . n 
C 2 11  DC  11  33  33  DC  C   Y . n 
C 2 12  DT  12  34  34  DT  T   Y . n 
C 2 13  DG  13  35  35  DG  G   Y . n 
D 1 1   DC  1   2   ?   ?   ?   J . n 
D 1 2   DA  2   3   3   DA  A   J . n 
D 1 3   DG  3   4   4   DG  G   J . n 
D 1 4   DT  4   5   5   DT  T   J . n 
D 1 5   DG  5   6   6   DG  G   J . n 
D 1 6   DT  6   7   7   DT  T   J . n 
D 1 7   DC  7   8   8   DC  C   J . n 
D 1 8   DC  8   9   9   DC  C   J . n 
D 1 9   DG  9   10  10  DG  G   J . n 
D 1 10  DA  10  11  11  DA  A   J . n 
D 1 11  DT  11  12  12  DT  T   J . n 
D 1 12  DA  12  13  13  DA  A   J . n 
D 1 13  DA  13  14  14  DA  A   J . n 
D 1 14  DT  14  15  15  DT  T   J . n 
D 1 15  DT  15  16  16  DT  T   J . n 
D 1 16  DT  16  17  17  DT  T   J . n 
D 1 17  DA  17  18  18  DA  A   J . n 
D 1 18  DT  18  19  19  DT  T   J . n 
D 1 19  DA  19  20  ?   ?   ?   J . n 
D 1 20  DA  20  21  ?   ?   ?   J . n 
D 1 21  DA  21  22  ?   ?   ?   J . n 
E 1 1   DC  1   2   ?   ?   ?   I . n 
E 1 2   DA  2   3   ?   ?   ?   I . n 
E 1 3   DG  3   4   ?   ?   ?   I . n 
E 1 4   DT  4   5   ?   ?   ?   I . n 
E 1 5   DG  5   6   ?   ?   ?   I . n 
E 1 6   DT  6   7   ?   ?   ?   I . n 
E 1 7   DC  7   8   ?   ?   ?   I . n 
E 1 8   DC  8   9   ?   ?   ?   I . n 
E 1 9   DG  9   10  ?   ?   ?   I . n 
E 1 10  DA  10  11  ?   ?   ?   I . n 
E 1 11  DT  11  12  ?   ?   ?   I . n 
E 1 12  DA  12  13  ?   ?   ?   I . n 
E 1 13  DA  13  14  ?   ?   ?   I . n 
E 1 14  DT  14  15  ?   ?   ?   I . n 
E 1 15  DT  15  16  ?   ?   ?   I . n 
E 1 16  DT  16  17  ?   ?   ?   I . n 
E 1 17  DA  17  18  ?   ?   ?   I . n 
E 1 18  DT  18  19  ?   ?   ?   I . n 
E 1 19  DA  19  20  20  DA  A   I . n 
E 1 20  DA  20  21  21  DA  A   I . n 
E 1 21  DA  21  22  22  DA  A   I . n 
F 2 1   DT  1   23  23  DT  T   K . n 
F 2 2   DT  2   24  24  DT  T   K . n 
F 2 3   DA  3   25  25  DA  A   K . n 
F 2 4   DT  4   26  26  DT  T   K . n 
F 2 5   DC  5   27  27  DC  C   K . n 
F 2 6   DG  6   28  28  DG  G   K . n 
F 2 7   DG  7   29  29  DG  G   K . n 
F 2 8   DA  8   30  30  DA  A   K . n 
F 2 9   DC  9   31  31  DC  C   K . n 
F 2 10  DA  10  32  32  DA  A   K . n 
F 2 11  DC  11  33  33  DC  C   K . n 
F 2 12  DT  12  34  34  DT  T   K . n 
F 2 13  DG  13  35  ?   ?   ?   K . n 
G 3 1   MET 1   1   1   MET MET A . n 
G 3 2   ALA 2   2   2   ALA ALA A . n 
G 3 3   LEU 3   3   3   LEU LEU A . n 
G 3 4   PHE 4   4   4   PHE PHE A . n 
G 3 5   GLY 5   5   5   GLY GLY A . n 
G 3 6   TYR 6   6   6   TYR TYR A . n 
G 3 7   ALA 7   7   7   ALA ALA A . n 
G 3 8   ARG 8   8   8   ARG ARG A . n 
G 3 9   VAL 9   9   9   VAL VAL A . n 
G 3 10  SER 10  10  10  SER SER A . n 
G 3 11  THR 11  11  11  THR THR A . n 
G 3 12  SER 12  12  12  SER SER A . n 
G 3 13  GLN 13  13  13  GLN GLN A . n 
G 3 14  GLN 14  14  14  GLN GLN A . n 
G 3 15  SER 15  15  15  SER SER A . n 
G 3 16  LEU 16  16  16  LEU LEU A . n 
G 3 17  ASP 17  17  17  ASP ASP A . n 
G 3 18  ILE 18  18  18  ILE ILE A . n 
G 3 19  GLN 19  19  19  GLN GLN A . n 
G 3 20  VAL 20  20  20  VAL VAL A . n 
G 3 21  ARG 21  21  21  ARG ARG A . n 
G 3 22  ALA 22  22  22  ALA ALA A . n 
G 3 23  LEU 23  23  23  LEU LEU A . n 
G 3 24  LYS 24  24  24  LYS LYS A . n 
G 3 25  ASP 25  25  25  ASP ASP A . n 
G 3 26  ALA 26  26  26  ALA ALA A . n 
G 3 27  GLY 27  27  27  GLY GLY A . n 
G 3 28  VAL 28  28  28  VAL VAL A . n 
G 3 29  LYS 29  29  29  LYS LYS A . n 
G 3 30  ALA 30  30  30  ALA ALA A . n 
G 3 31  ASN 31  31  31  ASN ASN A . n 
G 3 32  ARG 32  32  32  ARG ARG A . n 
G 3 33  ILE 33  33  33  ILE ILE A . n 
G 3 34  PHE 34  34  34  PHE PHE A . n 
G 3 35  THR 35  35  35  THR THR A . n 
G 3 36  ASP 36  36  36  ASP ASP A . n 
G 3 37  LYS 37  37  37  LYS LYS A . n 
G 3 38  ALA 38  38  38  ALA ALA A . n 
G 3 39  SER 39  39  39  SER SER A . n 
G 3 40  GLY 40  40  ?   ?   ?   A . n 
G 3 41  SER 41  41  ?   ?   ?   A . n 
G 3 42  SER 42  42  ?   ?   ?   A . n 
G 3 43  SER 43  43  ?   ?   ?   A . n 
G 3 44  ASP 44  44  44  ASP ASP A . n 
G 3 45  ARG 45  45  45  ARG ARG A . n 
G 3 46  LYS 46  46  46  LYS LYS A . n 
G 3 47  GLY 47  47  47  GLY GLY A . n 
G 3 48  LEU 48  48  48  LEU LEU A . n 
G 3 49  ASP 49  49  49  ASP ASP A . n 
G 3 50  LEU 50  50  50  LEU LEU A . n 
G 3 51  LEU 51  51  51  LEU LEU A . n 
G 3 52  ARG 52  52  52  ARG ARG A . n 
G 3 53  MET 53  53  53  MET MET A . n 
G 3 54  LYS 54  54  54  LYS LYS A . n 
G 3 55  VAL 55  55  55  VAL VAL A . n 
G 3 56  LYS 56  56  56  LYS LYS A . n 
G 3 57  GLU 57  57  57  GLU GLU A . n 
G 3 58  GLY 58  58  58  GLY GLY A . n 
G 3 59  ASP 59  59  59  ASP ASP A . n 
G 3 60  VAL 60  60  60  VAL VAL A . n 
G 3 61  ILE 61  61  61  ILE ILE A . n 
G 3 62  LEU 62  62  62  LEU LEU A . n 
G 3 63  VAL 63  63  63  VAL VAL A . n 
G 3 64  LYS 64  64  64  LYS LYS A . n 
G 3 65  LYS 65  65  65  LYS LYS A . n 
G 3 66  LEU 66  66  66  LEU LEU A . n 
G 3 67  ASP 67  67  67  ASP ASP A . n 
G 3 68  ARG 68  68  68  ARG ARG A . n 
G 3 69  LEU 69  69  69  LEU LEU A . n 
G 3 70  GLY 70  70  70  GLY GLY A . n 
G 3 71  ARG 71  71  71  ARG ARG A . n 
G 3 72  ASP 72  72  72  ASP ASP A . n 
G 3 73  THR 73  73  73  THR THR A . n 
G 3 74  ALA 74  74  74  ALA ALA A . n 
G 3 75  ASP 75  75  75  ASP ASP A . n 
G 3 76  MET 76  76  76  MET MET A . n 
G 3 77  ILE 77  77  77  ILE ILE A . n 
G 3 78  GLN 78  78  78  GLN GLN A . n 
G 3 79  LEU 79  79  79  LEU LEU A . n 
G 3 80  ILE 80  80  80  ILE ILE A . n 
G 3 81  LYS 81  81  81  LYS LYS A . n 
G 3 82  GLU 82  82  82  GLU GLU A . n 
G 3 83  PHE 83  83  83  PHE PHE A . n 
G 3 84  ASP 84  84  84  ASP ASP A . n 
G 3 85  ALA 85  85  85  ALA ALA A . n 
G 3 86  GLN 86  86  86  GLN GLN A . n 
G 3 87  GLY 87  87  87  GLY GLY A . n 
G 3 88  VAL 88  88  88  VAL VAL A . n 
G 3 89  SER 89  89  89  SER SER A . n 
G 3 90  ILE 90  90  90  ILE ILE A . n 
G 3 91  ARG 91  91  91  ARG ARG A . n 
G 3 92  PHE 92  92  92  PHE PHE A . n 
G 3 93  ILE 93  93  93  ILE ILE A . n 
G 3 94  ASP 94  94  94  ASP ASP A . n 
G 3 95  ASP 95  95  95  ASP ASP A . n 
G 3 96  SER 96  96  96  SER SER A . n 
G 3 97  ILE 97  97  97  ILE ILE A . n 
G 3 98  ASP 98  98  98  ASP ASP A . n 
G 3 99  THR 99  99  99  THR THR A . n 
G 3 100 SER 100 100 100 SER SER A . n 
G 3 101 SER 101 101 101 SER SER A . n 
G 3 102 ALA 102 102 102 ALA ALA A . n 
G 3 103 MET 103 103 103 MET MET A . n 
G 3 104 GLY 104 104 104 GLY GLY A . n 
G 3 105 ARG 105 105 105 ARG ARG A . n 
G 3 106 MET 106 106 106 MET MET A . n 
G 3 107 VAL 107 107 107 VAL VAL A . n 
G 3 108 VAL 108 108 108 VAL VAL A . n 
G 3 109 THR 109 109 109 THR THR A . n 
G 3 110 ILE 110 110 110 ILE ILE A . n 
G 3 111 LEU 111 111 111 LEU LEU A . n 
G 3 112 SER 112 112 112 SER SER A . n 
G 3 113 ALA 113 113 113 ALA ALA A . n 
G 3 114 VAL 114 114 114 VAL VAL A . n 
G 3 115 ALA 115 115 115 ALA ALA A . n 
G 3 116 GLN 116 116 116 GLN GLN A . n 
G 3 117 ALA 117 117 117 ALA ALA A . n 
G 3 118 GLU 118 118 118 GLU GLU A . n 
G 3 119 ARG 119 119 119 ARG ARG A . n 
G 3 120 GLN 120 120 120 GLN GLN A . n 
G 3 121 ARG 121 121 121 ARG ARG A . n 
G 3 122 ILE 122 122 122 ILE ILE A . n 
G 3 123 LEU 123 123 123 LEU LEU A . n 
G 3 124 GLN 124 124 124 GLN GLN A . n 
G 3 125 ARG 125 125 125 ARG ARG A . n 
G 3 126 THR 126 126 126 THR THR A . n 
G 3 127 ASN 127 127 127 ASN ASN A . n 
G 3 128 GLU 128 128 128 GLU GLU A . n 
G 3 129 GLY 129 129 129 GLY GLY A . n 
G 3 130 ARG 130 130 130 ARG ARG A . n 
G 3 131 GLN 131 131 131 GLN GLN A . n 
G 3 132 GLU 132 132 132 GLU GLU A . n 
G 3 133 ALA 133 133 133 ALA ALA A . n 
G 3 134 MET 134 134 134 MET MET A . n 
G 3 135 ALA 135 135 135 ALA ALA A . n 
G 3 136 LYS 136 136 136 LYS LYS A . n 
G 3 137 GLY 137 137 137 GLY GLY A . n 
G 3 138 VAL 138 138 138 VAL VAL A . n 
G 3 139 VAL 139 139 139 VAL VAL A . n 
G 3 140 PHE 140 140 140 PHE PHE A . n 
G 3 141 GLY 141 141 141 GLY GLY A . n 
G 3 142 ARG 142 142 142 ARG ARG A . n 
G 3 143 LYS 143 143 143 LYS LYS A . n 
G 3 144 ARG 144 144 144 ARG ARG A . n 
G 3 145 LYS 145 145 145 LYS LYS A . n 
G 3 146 ILE 146 146 146 ILE ILE A . n 
G 3 147 ASP 147 147 147 ASP ASP A . n 
G 3 148 ARG 148 148 148 ARG ARG A . n 
G 3 149 ASP 149 149 149 ASP ASP A . n 
G 3 150 ALA 150 150 150 ALA ALA A . n 
G 3 151 VAL 151 151 151 VAL VAL A . n 
G 3 152 LEU 152 152 152 LEU LEU A . n 
G 3 153 ASN 153 153 153 ASN ASN A . n 
G 3 154 MET 154 154 154 MET MET A . n 
G 3 155 TRP 155 155 155 TRP TRP A . n 
G 3 156 GLN 156 156 156 GLN GLN A . n 
G 3 157 GLN 157 157 157 GLN GLN A . n 
G 3 158 GLY 158 158 158 GLY GLY A . n 
G 3 159 LEU 159 159 159 LEU LEU A . n 
G 3 160 GLY 160 160 160 GLY GLY A . n 
G 3 161 ALA 161 161 161 ALA ALA A . n 
G 3 162 SER 162 162 162 SER SER A . n 
G 3 163 HIS 163 163 163 HIS HIS A . n 
G 3 164 ILE 164 164 164 ILE ILE A . n 
G 3 165 SER 165 165 165 SER SER A . n 
G 3 166 LYS 166 166 166 LYS LYS A . n 
G 3 167 THR 167 167 167 THR THR A . n 
G 3 168 MET 168 168 168 MET MET A . n 
G 3 169 ASN 169 169 169 ASN ASN A . n 
G 3 170 ILE 170 170 170 ILE ILE A . n 
G 3 171 ALA 171 171 171 ALA ALA A . n 
G 3 172 ARG 172 172 172 ARG ARG A . n 
G 3 173 SER 173 173 173 SER SER A . n 
G 3 174 THR 174 174 174 THR THR A . n 
G 3 175 VAL 175 175 175 VAL VAL A . n 
G 3 176 TYR 176 176 176 TYR TYR A . n 
G 3 177 LYS 177 177 177 LYS LYS A . n 
G 3 178 VAL 178 178 178 VAL VAL A . n 
G 3 179 ILE 179 179 179 ILE ILE A . n 
G 3 180 ASN 180 180 180 ASN ASN A . n 
G 3 181 GLU 181 181 181 GLU GLU A . n 
G 3 182 SER 182 182 182 SER SER A . n 
G 3 183 ASN 183 183 183 ASN ASN A . n 
H 3 1   MET 1   1   ?   ?   ?   B . n 
H 3 2   ALA 2   2   2   ALA ALA B . n 
H 3 3   LEU 3   3   3   LEU LEU B . n 
H 3 4   PHE 4   4   4   PHE PHE B . n 
H 3 5   GLY 5   5   5   GLY GLY B . n 
H 3 6   TYR 6   6   6   TYR TYR B . n 
H 3 7   ALA 7   7   7   ALA ALA B . n 
H 3 8   ARG 8   8   8   ARG ARG B . n 
H 3 9   VAL 9   9   9   VAL VAL B . n 
H 3 10  SER 10  10  10  SER SER B . n 
H 3 11  THR 11  11  11  THR THR B . n 
H 3 12  SER 12  12  12  SER SER B . n 
H 3 13  GLN 13  13  13  GLN GLN B . n 
H 3 14  GLN 14  14  14  GLN GLN B . n 
H 3 15  SER 15  15  15  SER SER B . n 
H 3 16  LEU 16  16  16  LEU LEU B . n 
H 3 17  ASP 17  17  17  ASP ASP B . n 
H 3 18  ILE 18  18  18  ILE ILE B . n 
H 3 19  GLN 19  19  19  GLN GLN B . n 
H 3 20  VAL 20  20  20  VAL VAL B . n 
H 3 21  ARG 21  21  21  ARG ARG B . n 
H 3 22  ALA 22  22  22  ALA ALA B . n 
H 3 23  LEU 23  23  23  LEU LEU B . n 
H 3 24  LYS 24  24  24  LYS LYS B . n 
H 3 25  ASP 25  25  25  ASP ASP B . n 
H 3 26  ALA 26  26  26  ALA ALA B . n 
H 3 27  GLY 27  27  27  GLY GLY B . n 
H 3 28  VAL 28  28  28  VAL VAL B . n 
H 3 29  LYS 29  29  29  LYS LYS B . n 
H 3 30  ALA 30  30  30  ALA ALA B . n 
H 3 31  ASN 31  31  31  ASN ASN B . n 
H 3 32  ARG 32  32  32  ARG ARG B . n 
H 3 33  ILE 33  33  33  ILE ILE B . n 
H 3 34  PHE 34  34  34  PHE PHE B . n 
H 3 35  THR 35  35  35  THR THR B . n 
H 3 36  ASP 36  36  36  ASP ASP B . n 
H 3 37  LYS 37  37  37  LYS LYS B . n 
H 3 38  ALA 38  38  38  ALA ALA B . n 
H 3 39  SER 39  39  39  SER SER B . n 
H 3 40  GLY 40  40  ?   ?   ?   B . n 
H 3 41  SER 41  41  ?   ?   ?   B . n 
H 3 42  SER 42  42  ?   ?   ?   B . n 
H 3 43  SER 43  43  ?   ?   ?   B . n 
H 3 44  ASP 44  44  44  ASP ASP B . n 
H 3 45  ARG 45  45  45  ARG ARG B . n 
H 3 46  LYS 46  46  46  LYS LYS B . n 
H 3 47  GLY 47  47  47  GLY GLY B . n 
H 3 48  LEU 48  48  48  LEU LEU B . n 
H 3 49  ASP 49  49  49  ASP ASP B . n 
H 3 50  LEU 50  50  50  LEU LEU B . n 
H 3 51  LEU 51  51  51  LEU LEU B . n 
H 3 52  ARG 52  52  52  ARG ARG B . n 
H 3 53  MET 53  53  53  MET MET B . n 
H 3 54  LYS 54  54  54  LYS LYS B . n 
H 3 55  VAL 55  55  55  VAL VAL B . n 
H 3 56  LYS 56  56  56  LYS LYS B . n 
H 3 57  GLU 57  57  57  GLU GLU B . n 
H 3 58  GLY 58  58  58  GLY GLY B . n 
H 3 59  ASP 59  59  59  ASP ASP B . n 
H 3 60  VAL 60  60  60  VAL VAL B . n 
H 3 61  ILE 61  61  61  ILE ILE B . n 
H 3 62  LEU 62  62  62  LEU LEU B . n 
H 3 63  VAL 63  63  63  VAL VAL B . n 
H 3 64  LYS 64  64  64  LYS LYS B . n 
H 3 65  LYS 65  65  65  LYS LYS B . n 
H 3 66  LEU 66  66  66  LEU LEU B . n 
H 3 67  ASP 67  67  67  ASP ASP B . n 
H 3 68  ARG 68  68  68  ARG ARG B . n 
H 3 69  LEU 69  69  69  LEU LEU B . n 
H 3 70  GLY 70  70  70  GLY GLY B . n 
H 3 71  ARG 71  71  71  ARG ARG B . n 
H 3 72  ASP 72  72  72  ASP ASP B . n 
H 3 73  THR 73  73  73  THR THR B . n 
H 3 74  ALA 74  74  74  ALA ALA B . n 
H 3 75  ASP 75  75  75  ASP ASP B . n 
H 3 76  MET 76  76  76  MET MET B . n 
H 3 77  ILE 77  77  77  ILE ILE B . n 
H 3 78  GLN 78  78  78  GLN GLN B . n 
H 3 79  LEU 79  79  79  LEU LEU B . n 
H 3 80  ILE 80  80  80  ILE ILE B . n 
H 3 81  LYS 81  81  81  LYS LYS B . n 
H 3 82  GLU 82  82  82  GLU GLU B . n 
H 3 83  PHE 83  83  83  PHE PHE B . n 
H 3 84  ASP 84  84  84  ASP ASP B . n 
H 3 85  ALA 85  85  85  ALA ALA B . n 
H 3 86  GLN 86  86  86  GLN GLN B . n 
H 3 87  GLY 87  87  87  GLY GLY B . n 
H 3 88  VAL 88  88  88  VAL VAL B . n 
H 3 89  SER 89  89  89  SER SER B . n 
H 3 90  ILE 90  90  90  ILE ILE B . n 
H 3 91  ARG 91  91  91  ARG ARG B . n 
H 3 92  PHE 92  92  92  PHE PHE B . n 
H 3 93  ILE 93  93  93  ILE ILE B . n 
H 3 94  ASP 94  94  94  ASP ASP B . n 
H 3 95  ASP 95  95  95  ASP ASP B . n 
H 3 96  SER 96  96  96  SER SER B . n 
H 3 97  ILE 97  97  97  ILE ILE B . n 
H 3 98  ASP 98  98  98  ASP ASP B . n 
H 3 99  THR 99  99  99  THR THR B . n 
H 3 100 SER 100 100 100 SER SER B . n 
H 3 101 SER 101 101 101 SER SER B . n 
H 3 102 ALA 102 102 102 ALA ALA B . n 
H 3 103 MET 103 103 103 MET MET B . n 
H 3 104 GLY 104 104 104 GLY GLY B . n 
H 3 105 ARG 105 105 105 ARG ARG B . n 
H 3 106 MET 106 106 106 MET MET B . n 
H 3 107 VAL 107 107 107 VAL VAL B . n 
H 3 108 VAL 108 108 108 VAL VAL B . n 
H 3 109 THR 109 109 109 THR THR B . n 
H 3 110 ILE 110 110 110 ILE ILE B . n 
H 3 111 LEU 111 111 111 LEU LEU B . n 
H 3 112 SER 112 112 112 SER SER B . n 
H 3 113 ALA 113 113 113 ALA ALA B . n 
H 3 114 VAL 114 114 114 VAL VAL B . n 
H 3 115 ALA 115 115 115 ALA ALA B . n 
H 3 116 GLN 116 116 116 GLN GLN B . n 
H 3 117 ALA 117 117 117 ALA ALA B . n 
H 3 118 GLU 118 118 118 GLU GLU B . n 
H 3 119 ARG 119 119 119 ARG ARG B . n 
H 3 120 GLN 120 120 120 GLN GLN B . n 
H 3 121 ARG 121 121 121 ARG ARG B . n 
H 3 122 ILE 122 122 122 ILE ILE B . n 
H 3 123 LEU 123 123 123 LEU LEU B . n 
H 3 124 GLN 124 124 124 GLN GLN B . n 
H 3 125 ARG 125 125 125 ARG ARG B . n 
H 3 126 THR 126 126 126 THR THR B . n 
H 3 127 ASN 127 127 127 ASN ASN B . n 
H 3 128 GLU 128 128 128 GLU GLU B . n 
H 3 129 GLY 129 129 129 GLY GLY B . n 
H 3 130 ARG 130 130 130 ARG ARG B . n 
H 3 131 GLN 131 131 131 GLN GLN B . n 
H 3 132 GLU 132 132 132 GLU GLU B . n 
H 3 133 ALA 133 133 133 ALA ALA B . n 
H 3 134 MET 134 134 134 MET MET B . n 
H 3 135 ALA 135 135 135 ALA ALA B . n 
H 3 136 LYS 136 136 136 LYS LYS B . n 
H 3 137 GLY 137 137 137 GLY GLY B . n 
H 3 138 VAL 138 138 138 VAL VAL B . n 
H 3 139 VAL 139 139 139 VAL VAL B . n 
H 3 140 PHE 140 140 140 PHE PHE B . n 
H 3 141 GLY 141 141 141 GLY GLY B . n 
H 3 142 ARG 142 142 142 ARG ARG B . n 
H 3 143 LYS 143 143 143 LYS LYS B . n 
H 3 144 ARG 144 144 144 ARG ARG B . n 
H 3 145 LYS 145 145 145 LYS LYS B . n 
H 3 146 ILE 146 146 146 ILE ILE B . n 
H 3 147 ASP 147 147 147 ASP ASP B . n 
H 3 148 ARG 148 148 148 ARG ARG B . n 
H 3 149 ASP 149 149 149 ASP ASP B . n 
H 3 150 ALA 150 150 150 ALA ALA B . n 
H 3 151 VAL 151 151 151 VAL VAL B . n 
H 3 152 LEU 152 152 152 LEU LEU B . n 
H 3 153 ASN 153 153 153 ASN ASN B . n 
H 3 154 MET 154 154 154 MET MET B . n 
H 3 155 TRP 155 155 155 TRP TRP B . n 
H 3 156 GLN 156 156 156 GLN GLN B . n 
H 3 157 GLN 157 157 157 GLN GLN B . n 
H 3 158 GLY 158 158 158 GLY GLY B . n 
H 3 159 LEU 159 159 159 LEU LEU B . n 
H 3 160 GLY 160 160 160 GLY GLY B . n 
H 3 161 ALA 161 161 161 ALA ALA B . n 
H 3 162 SER 162 162 162 SER SER B . n 
H 3 163 HIS 163 163 163 HIS HIS B . n 
H 3 164 ILE 164 164 164 ILE ILE B . n 
H 3 165 SER 165 165 165 SER SER B . n 
H 3 166 LYS 166 166 166 LYS LYS B . n 
H 3 167 THR 167 167 167 THR THR B . n 
H 3 168 MET 168 168 168 MET MET B . n 
H 3 169 ASN 169 169 169 ASN ASN B . n 
H 3 170 ILE 170 170 170 ILE ILE B . n 
H 3 171 ALA 171 171 171 ALA ALA B . n 
H 3 172 ARG 172 172 172 ARG ARG B . n 
H 3 173 SER 173 173 173 SER SER B . n 
H 3 174 THR 174 174 174 THR THR B . n 
H 3 175 VAL 175 175 175 VAL VAL B . n 
H 3 176 TYR 176 176 176 TYR TYR B . n 
H 3 177 LYS 177 177 177 LYS LYS B . n 
H 3 178 VAL 178 178 178 VAL VAL B . n 
H 3 179 ILE 179 179 179 ILE ILE B . n 
H 3 180 ASN 180 180 180 ASN ASN B . n 
H 3 181 GLU 181 181 181 GLU GLU B . n 
H 3 182 SER 182 182 182 SER SER B . n 
H 3 183 ASN 183 183 183 ASN ASN B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexadecameric 
_pdbx_struct_assembly.oligomeric_count     16 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_765 -x+2,-y+1,z -1.0000000000 0.0000000000 0.0000000000 220.2760000000 0.0000000000 -1.0000000000 
0.0000000000 137.6870000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-27 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_conn        
3 4 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_conn.pdbx_dist_value'        
4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'     
6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
7 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'     
8 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
9 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 92.5639  77.4604  34.5492 -0.8621 -0.9908 -0.8335 0.3314  0.1333  0.0260  24.9609 16.9743 18.9314 -2.1664  -5.8767 
0.0573  -0.6200 -0.1383 1.5028  1.1544  0.3289  2.0292  -0.1004 -0.2909 0.2912  'X-RAY DIFFRACTION' 
2 ? refined 90.6711  68.8924  12.6625 -0.3875 -0.1434 -0.1981 0.1388  -0.1244 -0.0508 12.6309 7.6643  0.7774  -3.8572  -1.2793 
-1.6593 0.7695  2.4481  -1.5772 -1.3954 0.3675  2.0873  0.2623  -0.7303 -1.1370 'X-RAY DIFFRACTION' 
3 ? refined 56.8954  82.3892  -1.4622 0.2071  -0.0683 1.1472  0.1750  -1.0340 0.5500  46.0657 17.9769 12.5628 4.4388   -5.2098 
5.9665  0.2106  3.8415  -0.0036 0.2791  -0.8663 0.0496  0.5679  -3.3636 0.6557  'X-RAY DIFFRACTION' 
4 ? refined 112.5819 88.0671  8.7400  -0.3895 -0.9206 -0.3030 -0.1630 0.1745  0.2684  14.2562 23.4112 14.7944 2.6218   -1.2542 
-9.7077 0.3459  0.7803  1.1283  -1.3454 -0.0841 0.0092  -0.9522 0.0461  -0.2618 'X-RAY DIFFRACTION' 
5 ? refined 120.9659 86.1612  29.7873 -0.3657 -0.7464 -0.0810 -0.1849 -0.1829 0.0139  5.3289  18.1217 4.2450  3.7594   3.1814  
7.1050  0.4987  -0.5991 0.1818  2.2467  0.3919  -2.5209 1.2214  0.6713  -0.8905 'X-RAY DIFFRACTION' 
6 ? refined 129.9271 123.3898 39.0383 -0.7389 -0.5006 0.2027  -0.3892 -0.0916 -0.3385 15.5856 83.1815 24.7439 -10.2394 17.2068 
9.6571  1.4470  0.6299  1.5202  -1.1601 -1.6516 1.3547  -1.8921 0.5303  0.2046  'X-RAY DIFFRACTION' 
7 ? refined 69.6948  85.8144  6.3144  0.2097  -0.2210 0.8662  0.0518  -0.5550 0.5627  17.6487 10.7000 10.4031 -13.2520 10.3459 
-9.2003 -0.5803 -0.9700 -1.1183 0.7827  2.1542  2.6891  -1.0963 -0.8477 -1.5739 'X-RAY DIFFRACTION' 
8 ? refined 120.0428 112.1049 33.1474 -0.6009 -0.1286 0.8066  -0.3399 -0.6234 -0.2438 0.5337  18.6614 5.7462  3.0866   0.0799  
2.6163  -0.0610 -0.0225 0.7316  -1.0736 0.1608  1.9282  -0.2030 -0.2842 -0.0998 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1 A 1   G 1   A 100 G 100 ? 'X-RAY DIFFRACTION' ? 
2  2 A 101 G 101 A 145 G 145 ? 'X-RAY DIFFRACTION' ? 
3  3 A 146 G 146 A 183 G 183 ? 'X-RAY DIFFRACTION' ? 
4  4 B 2   H 2   B 100 H 100 ? 'X-RAY DIFFRACTION' ? 
5  5 B 101 H 101 B 145 H 145 ? 'X-RAY DIFFRACTION' ? 
6  6 B 146 H 146 B 183 H 183 ? 'X-RAY DIFFRACTION' ? 
7  7 X 2   A 1   X 19  A 18  ? 'X-RAY DIFFRACTION' ? 
8  7 Z 20  B 19  Z 22  B 21  ? 'X-RAY DIFFRACTION' ? 
9  7 Y 23  C 1   Y 35  C 13  ? 'X-RAY DIFFRACTION' ? 
10 8 J 3   D 2   J 19  D 18  ? 'X-RAY DIFFRACTION' ? 
11 8 I 20  E 19  I 22  E 21  ? 'X-RAY DIFFRACTION' ? 
12 8 K 23  F 1   K 34  F 12  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
ADSC      'data collection' .        ? 2 
SCALEPACK 'data scaling'    .        ? 3 
CNS       phasing           .        ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" X DC 2  ? ? "C1'" X DC 2  ? ? N1    X DC 2  ? ? 110.76 108.30 2.46  0.30 N 
2  1 "O4'" X DG 6  ? ? "C1'" X DG 6  ? ? N9    X DG 6  ? ? 110.51 108.30 2.21  0.30 N 
3  1 "O4'" X DC 8  ? ? "C1'" X DC 8  ? ? N1    X DC 8  ? ? 110.95 108.30 2.65  0.30 N 
4  1 "O4'" X DC 9  ? ? "C1'" X DC 9  ? ? N1    X DC 9  ? ? 111.94 108.30 3.64  0.30 N 
5  1 "C3'" X DC 9  ? ? "O3'" X DC 9  ? ? P     X DG 10 ? ? 128.34 119.70 8.64  1.20 Y 
6  1 "O4'" X DG 10 ? ? "C1'" X DG 10 ? ? N9    X DG 10 ? ? 112.29 108.30 3.99  0.30 N 
7  1 "O4'" X DA 11 ? ? "C1'" X DA 11 ? ? N9    X DA 11 ? ? 110.28 108.30 1.98  0.30 N 
8  1 "O4'" X DA 13 ? ? "C1'" X DA 13 ? ? N9    X DA 13 ? ? 110.52 108.30 2.22  0.30 N 
9  1 "O4'" X DT 15 ? ? "C1'" X DT 15 ? ? N1    X DT 15 ? ? 110.82 108.30 2.52  0.30 N 
10 1 "O4'" X DA 18 ? ? "C1'" X DA 18 ? ? N9    X DA 18 ? ? 110.12 108.30 1.82  0.30 N 
11 1 "O4'" Y DT 23 ? ? "C1'" Y DT 23 ? ? N1    Y DT 23 ? ? 110.97 108.30 2.67  0.30 N 
12 1 "O4'" Y DT 24 ? ? "C1'" Y DT 24 ? ? N1    Y DT 24 ? ? 113.87 108.30 5.57  0.30 N 
13 1 "O4'" Y DT 26 ? ? "C1'" Y DT 26 ? ? N1    Y DT 26 ? ? 110.29 108.30 1.99  0.30 N 
14 1 "O4'" Y DC 27 ? ? "C1'" Y DC 27 ? ? N1    Y DC 27 ? ? 110.16 108.30 1.86  0.30 N 
15 1 "O4'" Y DA 30 ? ? "C1'" Y DA 30 ? ? N9    Y DA 30 ? ? 111.23 108.30 2.93  0.30 N 
16 1 "O4'" Y DC 31 ? ? "C1'" Y DC 31 ? ? N1    Y DC 31 ? ? 111.26 108.30 2.96  0.30 N 
17 1 "O4'" Y DC 33 ? ? "C1'" Y DC 33 ? ? N1    Y DC 33 ? ? 110.61 108.30 2.31  0.30 N 
18 1 "O4'" Y DT 34 ? ? "C1'" Y DT 34 ? ? N1    Y DT 34 ? ? 111.60 108.30 3.30  0.30 N 
19 1 "O4'" J DG 4  ? ? "C1'" J DG 4  ? ? N9    J DG 4  ? ? 112.51 108.30 4.21  0.30 N 
20 1 "O4'" J DT 5  ? ? "C1'" J DT 5  ? ? N1    J DT 5  ? ? 112.53 108.30 4.23  0.30 N 
21 1 "O4'" J DG 6  ? ? "C1'" J DG 6  ? ? N9    J DG 6  ? ? 112.53 108.30 4.23  0.30 N 
22 1 "O4'" J DT 7  ? ? "C1'" J DT 7  ? ? N1    J DT 7  ? ? 110.90 108.30 2.60  0.30 N 
23 1 "C1'" J DC 8  ? ? "O4'" J DC 8  ? ? "C4'" J DC 8  ? ? 103.23 110.10 -6.87 1.00 N 
24 1 "O4'" J DC 8  ? ? "C1'" J DC 8  ? ? N1    J DC 8  ? ? 111.94 108.30 3.64  0.30 N 
25 1 "O4'" J DC 9  ? ? "C1'" J DC 9  ? ? N1    J DC 9  ? ? 110.23 108.30 1.93  0.30 N 
26 1 "O4'" J DG 10 ? ? "C1'" J DG 10 ? ? N9    J DG 10 ? ? 110.28 108.30 1.98  0.30 N 
27 1 "O4'" J DA 14 ? ? "C1'" J DA 14 ? ? N9    J DA 14 ? ? 110.17 108.30 1.87  0.30 N 
28 1 "O4'" J DT 15 ? ? "C1'" J DT 15 ? ? N1    J DT 15 ? ? 111.16 108.30 2.86  0.30 N 
29 1 "C1'" I DA 20 ? ? "O4'" I DA 20 ? ? "C4'" I DA 20 ? ? 102.62 110.10 -7.48 1.00 N 
30 1 "O4'" I DA 20 ? ? "C1'" I DA 20 ? ? N9    I DA 20 ? ? 111.99 108.30 3.69  0.30 N 
31 1 "O4'" K DT 23 ? ? "C1'" K DT 23 ? ? N1    K DT 23 ? ? 110.99 108.30 2.69  0.30 N 
32 1 "O4'" K DT 24 ? ? "C1'" K DT 24 ? ? N1    K DT 24 ? ? 113.08 108.30 4.78  0.30 N 
33 1 "O4'" K DT 26 ? ? "C1'" K DT 26 ? ? N1    K DT 26 ? ? 110.65 108.30 2.35  0.30 N 
34 1 "O4'" K DA 30 ? ? "C1'" K DA 30 ? ? N9    K DA 30 ? ? 110.95 108.30 2.65  0.30 N 
35 1 "O4'" K DC 31 ? ? "C1'" K DC 31 ? ? N1    K DC 31 ? ? 111.34 108.30 3.04  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 2   ? ? -59.63  80.09   
2  1 SER A 10  ? ? -144.69 -19.92  
3  1 SER A 15  ? ? -69.58  36.36   
4  1 ASN A 31  ? ? -34.68  -26.34  
5  1 ARG A 32  ? ? -140.04 44.26   
6  1 ALA A 38  ? ? -47.23  86.35   
7  1 THR A 99  ? ? -39.87  -22.23  
8  1 SER A 101 ? ? -68.37  -162.09 
9  1 ALA A 102 ? ? -92.55  -76.76  
10 1 MET A 103 ? ? -26.46  -40.25  
11 1 ASP A 147 ? ? -49.83  109.88  
12 1 ASN A 169 ? ? -69.07  74.23   
13 1 SER B 10  ? ? -134.29 -49.90  
14 1 SER B 15  ? ? -68.04  20.48   
15 1 ARG B 45  ? ? -100.90 58.66   
16 1 LYS B 64  ? ? -58.53  -75.20  
17 1 SER B 100 ? ? -64.93  5.23    
18 1 ALA B 102 ? ? -73.56  -75.21  
19 1 ILE B 110 ? ? -50.28  -75.82  
20 1 LEU B 111 ? ? -11.09  -60.49  
21 1 ALA B 115 ? ? -36.87  -35.53  
22 1 LYS B 145 ? ? -121.26 -52.53  
23 1 ASP B 147 ? ? -61.44  84.54   
24 1 ASN B 169 ? ? -69.55  56.19   
25 1 ASN B 180 ? ? -72.52  30.88   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 X DA  20 ? A DA  19 
2  1 Y 1 X DA  21 ? A DA  20 
3  1 Y 1 X DA  22 ? A DA  21 
4  1 Y 1 Z DC  2  ? B DC  1  
5  1 Y 1 Z DA  3  ? B DA  2  
6  1 Y 1 Z DG  4  ? B DG  3  
7  1 Y 1 Z DT  5  ? B DT  4  
8  1 Y 1 Z DG  6  ? B DG  5  
9  1 Y 1 Z DT  7  ? B DT  6  
10 1 Y 1 Z DC  8  ? B DC  7  
11 1 Y 1 Z DC  9  ? B DC  8  
12 1 Y 1 Z DG  10 ? B DG  9  
13 1 Y 1 Z DA  11 ? B DA  10 
14 1 Y 1 Z DT  12 ? B DT  11 
15 1 Y 1 Z DA  13 ? B DA  12 
16 1 Y 1 Z DA  14 ? B DA  13 
17 1 Y 1 Z DT  15 ? B DT  14 
18 1 Y 1 Z DT  16 ? B DT  15 
19 1 Y 1 Z DT  17 ? B DT  16 
20 1 Y 1 Z DA  18 ? B DA  17 
21 1 Y 1 Z DT  19 ? B DT  18 
22 1 Y 1 J DC  2  ? D DC  1  
23 1 Y 1 J DA  20 ? D DA  19 
24 1 Y 1 J DA  21 ? D DA  20 
25 1 Y 1 J DA  22 ? D DA  21 
26 1 Y 1 I DC  2  ? E DC  1  
27 1 Y 1 I DA  3  ? E DA  2  
28 1 Y 1 I DG  4  ? E DG  3  
29 1 Y 1 I DT  5  ? E DT  4  
30 1 Y 1 I DG  6  ? E DG  5  
31 1 Y 1 I DT  7  ? E DT  6  
32 1 Y 1 I DC  8  ? E DC  7  
33 1 Y 1 I DC  9  ? E DC  8  
34 1 Y 1 I DG  10 ? E DG  9  
35 1 Y 1 I DA  11 ? E DA  10 
36 1 Y 1 I DT  12 ? E DT  11 
37 1 Y 1 I DA  13 ? E DA  12 
38 1 Y 1 I DA  14 ? E DA  13 
39 1 Y 1 I DT  15 ? E DT  14 
40 1 Y 1 I DT  16 ? E DT  15 
41 1 Y 1 I DT  17 ? E DT  16 
42 1 Y 1 I DA  18 ? E DA  17 
43 1 Y 1 I DT  19 ? E DT  18 
44 1 Y 1 K DG  35 ? F DG  13 
45 1 Y 1 A GLY 40 ? G GLY 40 
46 1 Y 1 A SER 41 ? G SER 41 
47 1 Y 1 A SER 42 ? G SER 42 
48 1 Y 1 A SER 43 ? G SER 43 
49 1 Y 1 B MET 1  ? H MET 1  
50 1 Y 1 B GLY 40 ? H GLY 40 
51 1 Y 1 B SER 41 ? H SER 41 
52 1 Y 1 B SER 42 ? H SER 42 
53 1 Y 1 B SER 43 ? H SER 43 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2GM4 'double helix'        
2GM4 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 C DT 12 1_555 -0.397 0.164  0.872  4.237   -33.063 7.120   1  X_DA3:DT34_Y  X 3  ? Y 34 ? ?  ? 
1 A DG 3  1_555 C DC 11 1_555 0.214  0.379  0.616  -2.776  -23.106 4.660   2  X_DG4:DC33_Y  X 4  ? Y 33 ? ?  1 
1 A DT 4  1_555 C DA 10 1_555 -1.087 -0.069 0.087  -14.741 -26.019 -8.473  3  X_DT5:DA32_Y  X 5  ? Y 32 ? 20 1 
1 A DG 5  1_555 C DC 9  1_555 0.534  0.296  -0.508 -18.796 -13.215 -10.982 4  X_DG6:DC31_Y  X 6  ? Y 31 ? ?  ? 
1 A DT 6  1_555 C DA 8  1_555 -0.080 -0.110 -0.056 -0.267  -9.092  2.119   5  X_DT7:DA30_Y  X 7  ? Y 30 ? 20 1 
1 A DC 7  1_555 C DG 7  1_555 -0.946 0.123  0.113  7.022   -18.335 4.392   6  X_DC8:DG29_Y  X 8  ? Y 29 ? 19 1 
1 A DC 8  1_555 C DG 6  1_555 -0.062 0.121  0.670  8.456   -30.530 -9.406  7  X_DC9:DG28_Y  X 9  ? Y 28 ? 19 1 
1 A DG 9  1_555 C DC 5  1_555 -1.142 -0.160 0.913  9.781   -36.445 -4.313  8  X_DG10:DC27_Y X 10 ? Y 27 ? ?  1 
1 A DA 10 1_555 C DT 4  1_555 0.501  0.290  0.520  -4.363  -13.987 -12.286 9  X_DA11:DT26_Y X 11 ? Y 26 ? 20 1 
1 A DT 11 1_555 C DA 3  1_555 0.061  -0.271 0.256  0.628   -5.668  -1.711  10 X_DT12:DA25_Y X 12 ? Y 25 ? 20 1 
1 A DA 12 1_555 C DT 2  1_555 0.655  0.094  -0.187 -3.048  -5.276  -13.583 11 X_DA13:DT24_Y X 13 ? Y 24 ? 20 1 
1 A DA 13 1_555 C DT 1  1_555 0.760  0.065  0.784  7.392   -18.731 -1.926  12 X_DA14:DT23_Y X 14 ? Y 23 ? 20 1 
1 A DT 15 1_555 B DA 20 1_555 -0.402 -0.081 -0.546 9.223   -25.047 11.481  13 X_DT16:DA21_Z X 16 ? Z 21 ? 20 1 
1 A DT 16 1_555 B DA 19 1_555 -0.519 0.317  -0.897 25.112  2.383   -2.411  14 X_DT17:DA20_Z X 17 ? Z 20 ? 20 1 
1 D DG 3  1_555 F DT 12 1_555 0.730  2.202  -2.120 36.260  -34.871 -49.674 15 J_DG4:DT34_K  J 4  ? K 34 ? ?  ? 
1 D DG 5  1_555 F DC 9  1_555 0.153  0.332  0.166  -12.098 -11.575 -7.281  16 J_DG6:DC31_K  J 6  ? K 31 ? 19 1 
1 D DT 6  1_555 F DA 8  1_555 -1.096 -0.154 0.669  -6.813  -15.883 -6.709  17 J_DT7:DA30_K  J 7  ? K 30 ? 20 1 
1 D DC 7  1_555 F DG 7  1_555 -1.560 -0.060 0.933  -0.435  -25.575 -4.050  18 J_DC8:DG29_K  J 8  ? K 29 ? ?  1 
1 D DC 8  1_555 F DG 6  1_555 -0.970 0.233  0.554  6.011   -32.329 -8.471  19 J_DC9:DG28_K  J 9  ? K 28 ? ?  1 
1 D DG 9  1_555 F DC 5  1_555 -0.211 -0.168 1.079  9.839   -23.604 -2.278  20 J_DG10:DC27_K J 10 ? K 27 ? 19 1 
1 D DA 10 1_555 F DT 4  1_555 0.287  0.022  0.582  -5.688  -21.304 1.174   21 J_DA11:DT26_K J 11 ? K 26 ? 20 1 
1 D DT 11 1_555 F DA 3  1_555 -0.531 0.557  0.122  0.104   -9.828  14.699  22 J_DT12:DA25_K J 12 ? K 25 ? ?  ? 
1 D DA 12 1_555 F DT 2  1_555 1.436  -0.088 -0.541 -11.213 -14.822 -7.132  23 J_DA13:DT24_K J 13 ? K 24 ? 20 1 
1 D DA 13 1_555 F DT 1  1_555 0.783  0.044  0.400  9.599   -30.131 -5.676  24 J_DA14:DT23_K J 14 ? K 23 ? 20 1 
1 D DT 14 1_555 E DA 21 1_555 0.388  0.174  0.752  0.679   -30.810 13.640  25 J_DT15:DA22_I J 15 ? I 22 ? ?  1 
1 D DT 15 1_555 E DA 20 1_555 0.011  -0.052 0.062  3.455   -22.898 10.070  26 J_DT16:DA21_I J 16 ? I 21 ? 20 1 
1 D DT 16 1_555 E DA 19 1_555 1.042  0.158  -0.911 27.268  -19.455 2.095   27 J_DT17:DA20_I J 17 ? I 20 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 C DT 12 1_555 A DG 3  1_555 C DC 11 1_555 -0.875 0.724  3.583 -4.012  -14.598 41.675 2.429  0.758  3.233 -19.752 
5.429   44.225 1  XX_DA3DG4:DC33DT34_YY   X 3  ? Y 34 ? X 4  ? Y 33 ? 
1 A DG 3  1_555 C DC 11 1_555 A DT 4  1_555 C DA 10 1_555 -0.914 -0.510 3.429 1.138   4.371   27.949 -2.087 2.141  3.274 8.975   
-2.337  28.305 2  XX_DG4DT5:DA32DC33_YY   X 4  ? Y 33 ? X 5  ? Y 32 ? 
1 A DT 4  1_555 C DA 10 1_555 A DG 5  1_555 C DC 9  1_555 -0.139 -0.185 3.643 -0.698  9.024   39.552 -1.385 0.114  3.522 13.127  
1.015   40.534 3  XX_DT5DG6:DC31DA32_YY   X 5  ? Y 32 ? X 6  ? Y 31 ? 
1 A DG 5  1_555 C DC 9  1_555 A DT 6  1_555 C DA 8  1_555 -0.252 -0.598 2.801 -4.051  -0.759  30.012 -1.013 -0.224 2.824 -1.458  
7.776   30.287 4  XX_DG6DT7:DA30DC31_YY   X 6  ? Y 31 ? X 7  ? Y 30 ? 
1 A DT 6  1_555 C DA 8  1_555 A DC 7  1_555 C DG 7  1_555 0.890  -0.852 3.005 -3.916  6.723   27.084 -3.119 -2.627 2.572 13.992  
8.150   28.160 5  XX_DT7DC8:DG29DA30_YY   X 7  ? Y 30 ? X 8  ? Y 29 ? 
1 A DC 7  1_555 C DG 7  1_555 A DC 8  1_555 C DG 6  1_555 -1.152 -0.638 3.540 -3.504  -6.619  32.782 0.109  1.351  3.695 -11.540 
6.110   33.603 6  XX_DC8DC9:DG28DG29_YY   X 8  ? Y 29 ? X 9  ? Y 28 ? 
1 A DC 8  1_555 C DG 6  1_555 A DG 9  1_555 C DC 5  1_555 -0.155 -0.366 3.142 -0.022  11.879  28.107 -2.928 0.291  2.764 23.193  
0.044   30.467 7  XX_DC9DG10:DC27DG28_YY  X 9  ? Y 28 ? X 10 ? Y 27 ? 
1 A DG 9  1_555 C DC 5  1_555 A DA 10 1_555 C DT 4  1_555 -0.312 -0.006 3.664 -2.858  -11.032 47.371 0.946  0.132  3.592 -13.503 
3.498   48.645 8  XX_DG10DA11:DT26DC27_YY X 10 ? Y 27 ? X 11 ? Y 26 ? 
1 A DA 10 1_555 C DT 4  1_555 A DT 11 1_555 C DA 3  1_555 0.132  -1.018 3.079 2.948   -1.206  30.749 -1.688 0.295  3.114 -2.267  
-5.541  30.909 9  XX_DA11DT12:DA25DT26_YY X 11 ? Y 26 ? X 12 ? Y 25 ? 
1 A DT 11 1_555 C DA 3  1_555 A DA 12 1_555 C DT 2  1_555 -0.252 -0.849 3.302 1.659   5.982   42.534 -1.746 0.507  3.148 8.194   
-2.272  42.964 10 XX_DT12DA13:DT24DA25_YY X 12 ? Y 25 ? X 13 ? Y 24 ? 
1 A DA 12 1_555 C DT 2  1_555 A DA 13 1_555 C DT 1  1_555 0.390  -0.909 2.892 -8.632  1.108   32.575 -1.725 -1.889 2.672 1.933   
15.056  33.687 11 XX_DA13DA14:DT23DT24_YY X 13 ? Y 24 ? X 14 ? Y 23 ? 
1 A DA 13 1_555 C DT 1  1_555 A DT 15 1_555 B DA 20 1_555 -0.285 -0.948 6.427 12.765  -1.850  64.122 -0.729 1.303  6.300 -1.724  
-11.897 65.271 12 XX_DA14DT16:DA21DT23_ZY X 14 ? Y 23 ? X 16 ? Z 21 ? 
1 A DT 15 1_555 B DA 20 1_555 A DT 16 1_555 B DA 19 1_555 -0.672 0.033  3.076 0.624   7.508   30.554 -1.261 1.350  2.985 13.982  
-1.161  31.448 13 XX_DT16DT17:DA20DA21_ZZ X 16 ? Z 21 ? X 17 ? Z 20 ? 
1 D DG 5  1_555 F DC 9  1_555 D DT 6  1_555 F DA 8  1_555 -0.471 -1.274 3.278 -3.188  -7.513  29.332 -0.835 0.222  3.519 -14.487 
6.147   30.422 14 JJ_DG6DT7:DA30DC31_KK   J 6  ? K 31 ? J 7  ? K 30 ? 
1 D DT 6  1_555 F DA 8  1_555 D DC 7  1_555 F DG 7  1_555 0.483  -0.616 2.994 -4.502  3.099   29.907 -1.732 -1.731 2.816 5.942   
8.633   30.391 15 JJ_DT7DC8:DG29DA30_KK   J 7  ? K 30 ? J 8  ? K 29 ? 
1 D DC 7  1_555 F DG 7  1_555 D DC 8  1_555 F DG 6  1_555 -1.142 -1.332 3.015 -3.643  -4.897  30.760 -1.568 1.445  3.293 -9.118  
6.785   31.345 16 JJ_DC8DC9:DG28DG29_KK   J 8  ? K 29 ? J 9  ? K 28 ? 
1 D DC 8  1_555 F DG 6  1_555 D DG 9  1_555 F DC 5  1_555 -0.210 -0.334 3.074 -6.244  5.541   38.086 -1.131 -0.395 2.994 8.369   
9.430   38.957 17 JJ_DC9DG10:DC27DG28_KK  J 9  ? K 28 ? J 10 ? K 27 ? 
1 D DG 9  1_555 F DC 5  1_555 D DA 10 1_555 F DT 4  1_555 -0.597 -0.107 3.760 -0.589  -13.985 45.615 1.169  0.685  3.648 -17.557 
0.740   47.604 18 JJ_DG10DA11:DT26DC27_KK J 10 ? K 27 ? J 11 ? K 26 ? 
1 D DA 10 1_555 F DT 4  1_555 D DT 11 1_555 F DA 3  1_555 0.364  -0.808 3.036 5.792   -3.359  28.098 -0.907 0.499  3.121 -6.797  
-11.720 28.869 19 JJ_DA11DT12:DA25DT26_KK J 11 ? K 26 ? J 12 ? K 25 ? 
1 D DT 11 1_555 F DA 3  1_555 D DA 12 1_555 F DT 2  1_555 -0.671 -0.306 3.598 0.420   11.502  48.514 -1.282 0.831  3.441 13.773  
-0.503  49.780 20 JJ_DT12DA13:DT24DA25_KK J 12 ? K 25 ? J 13 ? K 24 ? 
1 D DA 12 1_555 F DT 2  1_555 D DA 13 1_555 F DT 1  1_555 0.180  -0.651 2.707 -10.335 3.761   26.887 -1.967 -2.197 2.367 7.693   
21.138  29.011 21 JJ_DA13DA14:DT23DT24_KK J 13 ? K 24 ? J 14 ? K 23 ? 
1 D DA 13 1_555 F DT 1  1_555 D DT 14 1_555 E DA 21 1_555 1.197  -0.954 3.425 0.871   -7.746  30.878 -0.199 -2.009 3.584 -14.264 
-1.603  31.823 22 JJ_DA14DT15:DA22DT23_IK J 14 ? K 23 ? J 15 ? I 22 ? 
1 D DT 14 1_555 E DA 21 1_555 D DT 15 1_555 E DA 20 1_555 -0.470 0.085  2.954 6.949   8.766   32.512 -1.084 1.769  2.730 15.110  
-11.979 34.333 23 JJ_DT15DT16:DA21DA22_II J 15 ? I 22 ? J 16 ? I 21 ? 
1 D DT 15 1_555 E DA 20 1_555 D DT 16 1_555 E DA 19 1_555 -0.437 0.513  2.728 6.736   5.360   40.388 0.247  1.225  2.669 7.658   
-9.625  41.258 24 JJ_DT16DT17:DA20DA21_II J 16 ? I 21 ? J 17 ? I 20 ? 
#