data_2GNJ
# 
_entry.id   2GNJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2GNJ         pdb_00002gnj 10.2210/pdb2gnj/pdb 
RCSB  RCSB037330   ?            ?                   
WWPDB D_1000037330 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1Q8T .                                                                          unspecified 
PDB 1Q8U .                                                                          unspecified 
PDB 1Q8W .                                                                          unspecified 
PDB 2GNF 'PKA five fold mutant model of Rho-kinase with Y-27632'                    unspecified 
PDB 2GNG 'PKA five fold mutant model of Rho-kinase'                                 unspecified 
PDB 2GNH 'PKA five fold mutant model of Rho-kinase with H1152P'                     unspecified 
PDB 2GNI 'PKA five fold mutant model of Rho-kinase with inhibitor Fasudil (HA1077)' unspecified 
PDB 2GNL 'PKA three fold mutant model of Rho-kinase with inhibitor H-1152P'         unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2GNJ 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bonn, S.'             1 
'Herrero, S.'          2 
'Breitenlechner, C.B.' 3 
'Engh, R.A.'           4 
'Gassel, M.'           5 
'Bossemeyer, D.'       6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural analysis of protein kinase A mutants with Rho-kinase inhibitor specificity'                                 
J.Biol.Chem. 281 24818 24830 2006 JBCHA3 US 0021-9258 0071 ? 16699172 10.1074/jbc.M512374200    
1       'Protein kinase A in complex with Rho-kinase inhibitors Y-27632, Fasudil, and H-1152P: structural basis of selectivity' 
Structure    11  1595  1607  2003 STRUE6 UK 0969-2126 2005 ? 14656443 10.1016/j.str.2003.11.002 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bonn, S.'             1  ? 
primary 'Herrero, S.'          2  ? 
primary 'Breitenlechner, C.B.' 3  ? 
primary 'Erlbruch, A.'         4  ? 
primary 'Lehmann, W.'          5  ? 
primary 'Engh, R.A.'           6  ? 
primary 'Gassel, M.'           7  ? 
primary 'Bossemeyer, D.'       8  ? 
1       'Breitenlechner, C.B.' 9  ? 
1       'Gassel, M.'           10 ? 
1       'Hidaka, H.'           11 ? 
1       'Kinzel, V.'           12 ? 
1       'Huber, R.'            13 ? 
1       'Engh, R.A.'           14 ? 
1       'Bossemeyer, D.'       15 ? 
# 
_cell.entry_id           2GNJ 
_cell.length_a           72.690 
_cell.length_b           75.480 
_cell.length_c           79.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2GNJ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'cAMP-dependent protein kinase, alpha-catalytic subunit'          40677.441 1   2.7.11.11 'L49I, Q181K, T183A' ? 
? 
2 polymer     syn 'cAMP-dependent protein kinase inhibitor alpha'                   2226.411  1   ?         ?                    
'PKI(residues 5-24)' ? 
3 non-polymer syn '(R)-TRANS-4-(1-AMINOETHYL)-N-(4-PYRIDYL) CYCLOHEXANECARBOXAMIDE' 247.336   1   ?         ?                    ? 
? 
4 water       nat water                                                             18.015    253 ?         ?                    ? 
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PKA C-alpha'                                                              
2 'PKI-alpha, cAMP-dependent protein kinase inhibitor, muscle/brain isoform' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTIGTGSFGRVMLVKHMETGNHYAMKILDKQKVV
KLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSL
DLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTW(TPO)LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIP
KFKGPGDTSNFDDYEEEEIRV(SEP)INEKCGKEFSEF
;
;GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTIGTGSFGRVMLVKHMETGNHYAMKILDKQKVV
KLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSL
DLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA
DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKG
PGDTSNFDDYEEEEIRVSINEKCGKEFSEF
;
A ? 
2 'polypeptide(L)' no no  TTYADFIASGRTGRRNAIHD TTYADFIASGRTGRRNAIHD I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   ALA n 
1 4   ALA n 
1 5   ALA n 
1 6   ALA n 
1 7   LYS n 
1 8   LYS n 
1 9   GLY n 
1 10  SER n 
1 11  GLU n 
1 12  GLN n 
1 13  GLU n 
1 14  SER n 
1 15  VAL n 
1 16  LYS n 
1 17  GLU n 
1 18  PHE n 
1 19  LEU n 
1 20  ALA n 
1 21  LYS n 
1 22  ALA n 
1 23  LYS n 
1 24  GLU n 
1 25  ASP n 
1 26  PHE n 
1 27  LEU n 
1 28  LYS n 
1 29  LYS n 
1 30  TRP n 
1 31  GLU n 
1 32  ASN n 
1 33  PRO n 
1 34  ALA n 
1 35  GLN n 
1 36  ASN n 
1 37  THR n 
1 38  ALA n 
1 39  HIS n 
1 40  LEU n 
1 41  ASP n 
1 42  GLN n 
1 43  PHE n 
1 44  GLU n 
1 45  ARG n 
1 46  ILE n 
1 47  LYS n 
1 48  THR n 
1 49  ILE n 
1 50  GLY n 
1 51  THR n 
1 52  GLY n 
1 53  SER n 
1 54  PHE n 
1 55  GLY n 
1 56  ARG n 
1 57  VAL n 
1 58  MET n 
1 59  LEU n 
1 60  VAL n 
1 61  LYS n 
1 62  HIS n 
1 63  MET n 
1 64  GLU n 
1 65  THR n 
1 66  GLY n 
1 67  ASN n 
1 68  HIS n 
1 69  TYR n 
1 70  ALA n 
1 71  MET n 
1 72  LYS n 
1 73  ILE n 
1 74  LEU n 
1 75  ASP n 
1 76  LYS n 
1 77  GLN n 
1 78  LYS n 
1 79  VAL n 
1 80  VAL n 
1 81  LYS n 
1 82  LEU n 
1 83  LYS n 
1 84  GLN n 
1 85  ILE n 
1 86  GLU n 
1 87  HIS n 
1 88  THR n 
1 89  LEU n 
1 90  ASN n 
1 91  GLU n 
1 92  LYS n 
1 93  ARG n 
1 94  ILE n 
1 95  LEU n 
1 96  GLN n 
1 97  ALA n 
1 98  VAL n 
1 99  ASN n 
1 100 PHE n 
1 101 PRO n 
1 102 PHE n 
1 103 LEU n 
1 104 VAL n 
1 105 LYS n 
1 106 LEU n 
1 107 GLU n 
1 108 PHE n 
1 109 SER n 
1 110 PHE n 
1 111 LYS n 
1 112 ASP n 
1 113 ASN n 
1 114 SER n 
1 115 ASN n 
1 116 LEU n 
1 117 TYR n 
1 118 MET n 
1 119 VAL n 
1 120 MET n 
1 121 GLU n 
1 122 TYR n 
1 123 VAL n 
1 124 PRO n 
1 125 GLY n 
1 126 GLY n 
1 127 GLU n 
1 128 MET n 
1 129 PHE n 
1 130 SER n 
1 131 HIS n 
1 132 LEU n 
1 133 ARG n 
1 134 ARG n 
1 135 ILE n 
1 136 GLY n 
1 137 ARG n 
1 138 PHE n 
1 139 SER n 
1 140 GLU n 
1 141 PRO n 
1 142 HIS n 
1 143 ALA n 
1 144 ARG n 
1 145 PHE n 
1 146 TYR n 
1 147 ALA n 
1 148 ALA n 
1 149 GLN n 
1 150 ILE n 
1 151 VAL n 
1 152 LEU n 
1 153 THR n 
1 154 PHE n 
1 155 GLU n 
1 156 TYR n 
1 157 LEU n 
1 158 HIS n 
1 159 SER n 
1 160 LEU n 
1 161 ASP n 
1 162 LEU n 
1 163 ILE n 
1 164 TYR n 
1 165 ARG n 
1 166 ASP n 
1 167 LEU n 
1 168 LYS n 
1 169 PRO n 
1 170 GLU n 
1 171 ASN n 
1 172 LEU n 
1 173 LEU n 
1 174 ILE n 
1 175 ASP n 
1 176 GLN n 
1 177 GLN n 
1 178 GLY n 
1 179 TYR n 
1 180 ILE n 
1 181 LYS n 
1 182 VAL n 
1 183 ALA n 
1 184 ASP n 
1 185 PHE n 
1 186 GLY n 
1 187 PHE n 
1 188 ALA n 
1 189 LYS n 
1 190 ARG n 
1 191 VAL n 
1 192 LYS n 
1 193 GLY n 
1 194 ARG n 
1 195 THR n 
1 196 TRP n 
1 197 TPO n 
1 198 LEU n 
1 199 CYS n 
1 200 GLY n 
1 201 THR n 
1 202 PRO n 
1 203 GLU n 
1 204 TYR n 
1 205 LEU n 
1 206 ALA n 
1 207 PRO n 
1 208 GLU n 
1 209 ILE n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 LYS n 
1 214 GLY n 
1 215 TYR n 
1 216 ASN n 
1 217 LYS n 
1 218 ALA n 
1 219 VAL n 
1 220 ASP n 
1 221 TRP n 
1 222 TRP n 
1 223 ALA n 
1 224 LEU n 
1 225 GLY n 
1 226 VAL n 
1 227 LEU n 
1 228 ILE n 
1 229 TYR n 
1 230 GLU n 
1 231 MET n 
1 232 ALA n 
1 233 ALA n 
1 234 GLY n 
1 235 TYR n 
1 236 PRO n 
1 237 PRO n 
1 238 PHE n 
1 239 PHE n 
1 240 ALA n 
1 241 ASP n 
1 242 GLN n 
1 243 PRO n 
1 244 ILE n 
1 245 GLN n 
1 246 ILE n 
1 247 TYR n 
1 248 GLU n 
1 249 LYS n 
1 250 ILE n 
1 251 VAL n 
1 252 SER n 
1 253 GLY n 
1 254 LYS n 
1 255 VAL n 
1 256 ARG n 
1 257 PHE n 
1 258 PRO n 
1 259 SER n 
1 260 HIS n 
1 261 PHE n 
1 262 SER n 
1 263 SER n 
1 264 ASP n 
1 265 LEU n 
1 266 LYS n 
1 267 ASP n 
1 268 LEU n 
1 269 LEU n 
1 270 ARG n 
1 271 ASN n 
1 272 LEU n 
1 273 LEU n 
1 274 GLN n 
1 275 VAL n 
1 276 ASP n 
1 277 LEU n 
1 278 THR n 
1 279 LYS n 
1 280 ARG n 
1 281 PHE n 
1 282 GLY n 
1 283 ASN n 
1 284 LEU n 
1 285 LYS n 
1 286 ASN n 
1 287 GLY n 
1 288 VAL n 
1 289 ASN n 
1 290 ASP n 
1 291 ILE n 
1 292 LYS n 
1 293 ASN n 
1 294 HIS n 
1 295 LYS n 
1 296 TRP n 
1 297 PHE n 
1 298 ALA n 
1 299 THR n 
1 300 THR n 
1 301 ASP n 
1 302 TRP n 
1 303 ILE n 
1 304 ALA n 
1 305 ILE n 
1 306 TYR n 
1 307 GLN n 
1 308 ARG n 
1 309 LYS n 
1 310 VAL n 
1 311 GLU n 
1 312 ALA n 
1 313 PRO n 
1 314 PHE n 
1 315 ILE n 
1 316 PRO n 
1 317 LYS n 
1 318 PHE n 
1 319 LYS n 
1 320 GLY n 
1 321 PRO n 
1 322 GLY n 
1 323 ASP n 
1 324 THR n 
1 325 SER n 
1 326 ASN n 
1 327 PHE n 
1 328 ASP n 
1 329 ASP n 
1 330 TYR n 
1 331 GLU n 
1 332 GLU n 
1 333 GLU n 
1 334 GLU n 
1 335 ILE n 
1 336 ARG n 
1 337 VAL n 
1 338 SEP n 
1 339 ILE n 
1 340 ASN n 
1 341 GLU n 
1 342 LYS n 
1 343 CYS n 
1 344 GLY n 
1 345 LYS n 
1 346 GLU n 
1 347 PHE n 
1 348 SER n 
1 349 GLU n 
1 350 PHE n 
2 1   THR n 
2 2   THR n 
2 3   TYR n 
2 4   ALA n 
2 5   ASP n 
2 6   PHE n 
2 7   ILE n 
2 8   ALA n 
2 9   SER n 
2 10  GLY n 
2 11  ARG n 
2 12  THR n 
2 13  GLY n 
2 14  ARG n 
2 15  ARG n 
2 16  ASN n 
2 17  ALA n 
2 18  ILE n 
2 19  HIS n 
2 20  ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               cattle 
_entity_src_gen.gene_src_genus                     Bos 
_entity_src_gen.pdbx_gene_src_gene                 PRKACA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bos taurus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9913 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pT7-7 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Oryctolagus cuniculus' 
_pdbx_entity_src_syn.organism_common_name   rabbit 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9986 
_pdbx_entity_src_syn.details                
'The peptide was chemically synthesized. The sequence of the peptide is naturally found in Rabbit.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP KAPCA_BOVIN P00517 1 
;GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVV
KLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSL
DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA
DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKG
PGDTSNFDDYEEEEIRVSINEKCGKEFSEF
;
1 ? 
2 UNP IPKA_RABIT  P61926 2 TTYADFIASGRTGRRNAIHD 5 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2GNJ A 1 ? 350 ? P00517 1 ? 350 ? 1 350 
2 2 2GNJ I 1 ? 20  ? P61926 5 ? 24  ? 5 24  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2GNJ ILE A 49  ? UNP P00517 LEU 49  'engineered mutation' 49  1 
1 2GNJ LYS A 181 ? UNP P00517 GLN 181 'engineered mutation' 181 2 
1 2GNJ ALA A 183 ? UNP P00517 THR 183 'engineered mutation' 183 3 
1 2GNJ TPO A 197 ? UNP P00517 THR 197 'modified residue'    197 4 
1 2GNJ SEP A 338 ? UNP P00517 SER 338 'modified residue'    338 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                           ?                  'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                                          ?                  'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                        ?                  'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                   ?                  'C4 H7 N O4'     
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                          ?                  'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                         ?                  'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                   ?                  'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                                           ?                  'C2 H5 N O2'     
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                         ?                  'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                             ?                  'H2 O'           
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                        ?                  'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                                           ?                  'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                                            ?                  'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                        ?                  'C5 H11 N O2 S'  
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                     ?                  'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                                           ?                  'C5 H9 N O2'     
115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE                                                     PHOSPHONOSERINE    'C3 H8 N O6 P'   
185.072 
SER 'L-peptide linking' y SERINE                                                            ?                  'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                                         ?                  'C4 H9 N O3'     
119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE                                                  PHOSPHONOTHREONINE 'C4 H10 N O6 P'  
199.099 
TRP 'L-peptide linking' y TRYPTOPHAN                                                        ?                  'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                                          ?                  'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                                            ?                  'C5 H11 N O2'    
117.146 
Y27 non-polymer         . '(R)-TRANS-4-(1-AMINOETHYL)-N-(4-PYRIDYL) CYCLOHEXANECARBOXAMIDE' ?                  'C14 H21 N3 O'   
247.336 
# 
_exptl.entry_id          2GNJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_percent_sol   51.83 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'LiCl, MesBisTris, EDTA, DTT, Mega8, Methanol, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     77 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'BRUKER SMART 2000' 
_diffrn_detector.pdbx_collection_date   2004-07-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00003 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        OTHER 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW6 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00003 
# 
_reflns.entry_id                     2GNJ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             19.764 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   22878 
_reflns.number_all                   22878 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 2GNJ 
_refine.ls_number_reflns_obs                     19254 
_refine.ls_number_reflns_all                     19559 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.76 
_refine.ls_d_res_high                            2.28 
_refine.ls_percent_reflns_obs                    98.44 
_refine.ls_R_factor_obs                          0.18951 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18576 
_refine.ls_R_factor_R_free                       0.26185 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1022 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.942 
_refine.correlation_coeff_Fo_to_Fc_free          0.881 
_refine.B_iso_mean                               27.411 
_refine.aniso_B[1][1]                            1.03 
_refine.aniso_B[2][2]                            0.35 
_refine.aniso_B[3][3]                            -1.38 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      
'an unpublished structure of the binary complex of PKA C alpha wildtype enzyme with PKI(5-24)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.307 
_refine.pdbx_overall_ESU_R_Free                  0.249 
_refine.overall_SU_ML                            0.164 
_refine.overall_SU_B                             6.517 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2941 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             253 
_refine_hist.number_atoms_total               3212 
_refine_hist.d_res_high                       2.28 
_refine_hist.d_res_low                        19.76 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017 0.022 ? 3035 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002 0.020 ? 2720 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.516 1.954 ? 4093 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.861 3.000 ? 6341 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.259 5.000 ? 355  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.094 0.200 ? 427  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007 0.020 ? 3323 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.005 0.020 ? 652  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.204 0.200 ? 645  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.241 0.200 ? 3194 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.087 0.200 ? 1731 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.193 0.200 ? 192  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.217 0.200 ? 11   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.345 0.200 ? 26   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.267 0.200 ? 19   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.817 1.500 ? 1777 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.534 2.000 ? 2865 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.141 3.000 ? 1258 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.494 4.500 ? 1228 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.280 
_refine_ls_shell.d_res_low                        2.338 
_refine_ls_shell.number_reflns_R_work             1394 
_refine_ls_shell.R_factor_R_work                  0.194 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.269 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             80 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2GNJ 
_struct.title                     'PKA three fold mutant model of Rho-kinase with Y-27632' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GNJ 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            'PKA, surrogate, Rho-kinase, H1152P, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 14  ? ASN A 32  ? SER A 14  ASN A 32  1 ? 19 
HELX_P HELX_P2  2  HIS A 39  ? ASP A 41  ? HIS A 39  ASP A 41  5 ? 3  
HELX_P HELX_P3  3  LYS A 76  ? LEU A 82  ? LYS A 76  LEU A 82  1 ? 7  
HELX_P HELX_P4  4  GLN A 84  ? VAL A 98  ? GLN A 84  VAL A 98  1 ? 15 
HELX_P HELX_P5  5  GLU A 127 ? GLY A 136 ? GLU A 127 GLY A 136 1 ? 10 
HELX_P HELX_P6  6  SER A 139 ? LEU A 160 ? SER A 139 LEU A 160 1 ? 22 
HELX_P HELX_P7  7  LYS A 168 ? GLU A 170 ? LYS A 168 GLU A 170 5 ? 3  
HELX_P HELX_P8  8  THR A 201 ? LEU A 205 ? THR A 201 LEU A 205 5 ? 5  
HELX_P HELX_P9  9  ALA A 206 ? LEU A 211 ? ALA A 206 LEU A 211 1 ? 6  
HELX_P HELX_P10 10 LYS A 217 ? GLY A 234 ? LYS A 217 GLY A 234 1 ? 18 
HELX_P HELX_P11 11 GLN A 242 ? GLY A 253 ? GLN A 242 GLY A 253 1 ? 12 
HELX_P HELX_P12 12 SER A 262 ? LEU A 273 ? SER A 262 LEU A 273 1 ? 12 
HELX_P HELX_P13 13 VAL A 288 ? ASN A 293 ? VAL A 288 ASN A 293 1 ? 6  
HELX_P HELX_P14 14 ASP A 301 ? GLN A 307 ? ASP A 301 GLN A 307 1 ? 7  
HELX_P HELX_P15 15 GLY A 344 ? SER A 348 ? GLY A 344 SER A 348 5 ? 5  
HELX_P HELX_P16 16 THR B 1   ? SER B 9   ? THR I 5   SER I 13  1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A TRP 196 C ? ? ? 1_555 A TPO 197 N ? ? A TRP 196 A TPO 197 1_555 ? ? ? ? ? ? ? 1.322 ? ? 
covale2 covale both ? A TPO 197 C ? ? ? 1_555 A LEU 198 N ? ? A TPO 197 A LEU 198 1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale3 covale both ? A VAL 337 C ? ? ? 1_555 A SEP 338 N ? ? A VAL 337 A SEP 338 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale4 covale both ? A SEP 338 C ? ? ? 1_555 A ILE 339 N ? ? A SEP 338 A ILE 339 1_555 ? ? ? ? ? ? ? 1.334 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           52 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            52 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    53 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     53 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -7.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 43  ? THR A 51  ? PHE A 43  THR A 51  
A 2 ARG A 56  ? HIS A 62  ? ARG A 56  HIS A 62  
A 3 ASN A 67  ? ASP A 75  ? ASN A 67  ASP A 75  
A 4 ASN A 115 ? GLU A 121 ? ASN A 115 GLU A 121 
A 5 LEU A 106 ? LYS A 111 ? LEU A 106 LYS A 111 
B 1 LEU A 162 ? ILE A 163 ? LEU A 162 ILE A 163 
B 2 LYS A 189 ? ARG A 190 ? LYS A 189 ARG A 190 
C 1 LEU A 172 ? ILE A 174 ? LEU A 172 ILE A 174 
C 2 ILE A 180 ? VAL A 182 ? ILE A 180 VAL A 182 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 47  ? N LYS A 47  O LEU A 59  ? O LEU A 59  
A 2 3 N MET A 58  ? N MET A 58  O MET A 71  ? O MET A 71  
A 3 4 N ALA A 70  ? N ALA A 70  O MET A 120 ? O MET A 120 
A 4 5 O VAL A 119 ? O VAL A 119 N PHE A 108 ? N PHE A 108 
B 1 2 N ILE A 163 ? N ILE A 163 O LYS A 189 ? O LYS A 189 
C 1 2 N LEU A 173 ? N LEU A 173 O LYS A 181 ? O LYS A 181 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    Y27 
_struct_site.pdbx_auth_seq_id     501 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    17 
_struct_site.details              'BINDING SITE FOR RESIDUE Y27 A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 ILE A 49  ? ILE A 49  . ? 1_555 ? 
2  AC1 17 THR A 51  ? THR A 51  . ? 1_555 ? 
3  AC1 17 GLY A 52  ? GLY A 52  . ? 1_555 ? 
4  AC1 17 SER A 53  ? SER A 53  . ? 1_555 ? 
5  AC1 17 VAL A 57  ? VAL A 57  . ? 1_555 ? 
6  AC1 17 ALA A 70  ? ALA A 70  . ? 1_555 ? 
7  AC1 17 GLU A 121 ? GLU A 121 . ? 1_555 ? 
8  AC1 17 TYR A 122 ? TYR A 122 . ? 1_555 ? 
9  AC1 17 VAL A 123 ? VAL A 123 . ? 1_555 ? 
10 AC1 17 GLU A 170 ? GLU A 170 . ? 1_555 ? 
11 AC1 17 ASN A 171 ? ASN A 171 . ? 1_555 ? 
12 AC1 17 LEU A 173 ? LEU A 173 . ? 1_555 ? 
13 AC1 17 ASP A 184 ? ASP A 184 . ? 1_555 ? 
14 AC1 17 PHE A 327 ? PHE A 327 . ? 1_555 ? 
15 AC1 17 HOH D .   ? HOH A 519 . ? 1_555 ? 
16 AC1 17 HOH D .   ? HOH A 527 . ? 1_555 ? 
17 AC1 17 HOH D .   ? HOH A 548 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2GNJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2GNJ 
_atom_sites.fract_transf_matrix[1][1]   0.013757 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013249 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012516 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 14  ? -8.281  -13.278 -15.164 1.00 43.14 ? 14  SER A N   1 
ATOM   2    C CA  . SER A 1 14  ? -8.872  -12.057 -14.538 1.00 43.60 ? 14  SER A CA  1 
ATOM   3    C C   . SER A 1 14  ? -7.762  -11.111 -14.067 1.00 43.47 ? 14  SER A C   1 
ATOM   4    O O   . SER A 1 14  ? -7.983  -9.918  -13.974 1.00 43.12 ? 14  SER A O   1 
ATOM   5    C CB  . SER A 1 14  ? -9.788  -12.407 -13.363 1.00 43.47 ? 14  SER A CB  1 
ATOM   6    O OG  . SER A 1 14  ? -10.721 -11.343 -13.120 1.00 46.00 ? 14  SER A OG  1 
ATOM   7    N N   . VAL A 1 15  ? -6.608  -11.681 -13.706 1.00 43.40 ? 15  VAL A N   1 
ATOM   8    C CA  . VAL A 1 15  ? -5.396  -10.910 -13.417 1.00 43.91 ? 15  VAL A CA  1 
ATOM   9    C C   . VAL A 1 15  ? -4.884  -10.251 -14.722 1.00 43.75 ? 15  VAL A C   1 
ATOM   10   O O   . VAL A 1 15  ? -4.581  -9.065  -14.737 1.00 42.60 ? 15  VAL A O   1 
ATOM   11   C CB  . VAL A 1 15  ? -4.282  -11.798 -12.798 1.00 43.07 ? 15  VAL A CB  1 
ATOM   12   C CG1 . VAL A 1 15  ? -2.918  -11.159 -12.974 1.00 43.24 ? 15  VAL A CG1 1 
ATOM   13   C CG2 . VAL A 1 15  ? -4.568  -12.089 -11.318 1.00 43.14 ? 15  VAL A CG2 1 
ATOM   14   N N   . LYS A 1 16  ? -4.782  -11.051 -15.789 1.00 44.15 ? 16  LYS A N   1 
ATOM   15   C CA  . LYS A 1 16  ? -4.475  -10.565 -17.152 1.00 44.70 ? 16  LYS A CA  1 
ATOM   16   C C   . LYS A 1 16  ? -5.395  -9.398  -17.584 1.00 43.89 ? 16  LYS A C   1 
ATOM   17   O O   . LYS A 1 16  ? -4.925  -8.409  -18.138 1.00 43.42 ? 16  LYS A O   1 
ATOM   18   C CB  . LYS A 1 16  ? -4.582  -11.720 -18.174 1.00 45.38 ? 16  LYS A CB  1 
ATOM   19   C CG  . LYS A 1 16  ? -3.303  -11.989 -18.999 1.00 48.01 ? 16  LYS A CG  1 
ATOM   20   C CD  . LYS A 1 16  ? -2.175  -12.679 -18.179 1.00 51.22 ? 16  LYS A CD  1 
ATOM   21   C CE  . LYS A 1 16  ? -0.989  -11.712 -17.763 1.00 52.26 ? 16  LYS A CE  1 
ATOM   22   N NZ  . LYS A 1 16  ? -0.948  -11.507 -16.271 1.00 52.72 ? 16  LYS A NZ  1 
ATOM   23   N N   . GLU A 1 17  ? -6.684  -9.540  -17.282 1.00 43.23 ? 17  GLU A N   1 
ATOM   24   C CA  . GLU A 1 17  ? -7.727  -8.595  -17.640 1.00 43.44 ? 17  GLU A CA  1 
ATOM   25   C C   . GLU A 1 17  ? -7.665  -7.340  -16.754 1.00 41.50 ? 17  GLU A C   1 
ATOM   26   O O   . GLU A 1 17  ? -7.947  -6.224  -17.180 1.00 40.58 ? 17  GLU A O   1 
ATOM   27   C CB  . GLU A 1 17  ? -9.103  -9.319  -17.501 1.00 44.47 ? 17  GLU A CB  1 
ATOM   28   C CG  . GLU A 1 17  ? -10.361 -8.480  -17.760 1.00 48.79 ? 17  GLU A CG  1 
ATOM   29   C CD  . GLU A 1 17  ? -11.678 -9.236  -17.482 1.00 56.06 ? 17  GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 17  ? -11.660 -10.457 -17.154 1.00 59.83 ? 17  GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 17  ? -12.758 -8.605  -17.593 1.00 60.41 ? 17  GLU A OE2 1 
ATOM   32   N N   . PHE A 1 18  ? -7.347  -7.533  -15.487 1.00 40.01 ? 18  PHE A N   1 
ATOM   33   C CA  . PHE A 1 18  ? -7.128  -6.407  -14.606 1.00 38.66 ? 18  PHE A CA  1 
ATOM   34   C C   . PHE A 1 18  ? -5.936  -5.547  -15.127 1.00 36.54 ? 18  PHE A C   1 
ATOM   35   O O   . PHE A 1 18  ? -5.981  -4.344  -15.163 1.00 34.05 ? 18  PHE A O   1 
ATOM   36   C CB  . PHE A 1 18  ? -6.840  -6.890  -13.177 1.00 39.13 ? 18  PHE A CB  1 
ATOM   37   C CG  . PHE A 1 18  ? -6.420  -5.767  -12.267 1.00 40.53 ? 18  PHE A CG  1 
ATOM   38   C CD1 . PHE A 1 18  ? -7.360  -4.906  -11.750 1.00 43.43 ? 18  PHE A CD1 1 
ATOM   39   C CD2 . PHE A 1 18  ? -5.082  -5.529  -12.011 1.00 41.97 ? 18  PHE A CD2 1 
ATOM   40   C CE1 . PHE A 1 18  ? -6.973  -3.853  -10.940 1.00 44.81 ? 18  PHE A CE1 1 
ATOM   41   C CE2 . PHE A 1 18  ? -4.694  -4.487  -11.224 1.00 42.34 ? 18  PHE A CE2 1 
ATOM   42   C CZ  . PHE A 1 18  ? -5.637  -3.640  -10.697 1.00 45.01 ? 18  PHE A CZ  1 
ATOM   43   N N   . LEU A 1 19  ? -4.867  -6.227  -15.506 1.00 35.49 ? 19  LEU A N   1 
ATOM   44   C CA  . LEU A 1 19  ? -3.636  -5.578  -15.867 1.00 35.55 ? 19  LEU A CA  1 
ATOM   45   C C   . LEU A 1 19  ? -3.703  -4.904  -17.229 1.00 35.17 ? 19  LEU A C   1 
ATOM   46   O O   . LEU A 1 19  ? -3.041  -3.884  -17.414 1.00 34.73 ? 19  LEU A O   1 
ATOM   47   C CB  . LEU A 1 19  ? -2.476  -6.568  -15.796 1.00 35.56 ? 19  LEU A CB  1 
ATOM   48   C CG  . LEU A 1 19  ? -2.096  -7.034  -14.387 1.00 35.37 ? 19  LEU A CG  1 
ATOM   49   C CD1 . LEU A 1 19  ? -1.083  -8.209  -14.448 1.00 34.04 ? 19  LEU A CD1 1 
ATOM   50   C CD2 . LEU A 1 19  ? -1.530  -5.862  -13.594 1.00 35.70 ? 19  LEU A CD2 1 
ATOM   51   N N   . ALA A 1 20  ? -4.505  -5.442  -18.164 1.00 34.95 ? 20  ALA A N   1 
ATOM   52   C CA  . ALA A 1 20  ? -4.677  -4.811  -19.484 1.00 34.70 ? 20  ALA A CA  1 
ATOM   53   C C   . ALA A 1 20  ? -5.412  -3.482  -19.328 1.00 34.66 ? 20  ALA A C   1 
ATOM   54   O O   . ALA A 1 20  ? -5.023  -2.486  -19.938 1.00 34.46 ? 20  ALA A O   1 
ATOM   55   C CB  . ALA A 1 20  ? -5.437  -5.726  -20.482 1.00 34.50 ? 20  ALA A CB  1 
ATOM   56   N N   . LYS A 1 21  ? -6.473  -3.476  -18.528 1.00 34.38 ? 21  LYS A N   1 
ATOM   57   C CA  . LYS A 1 21  ? -7.226  -2.255  -18.292 1.00 35.12 ? 21  LYS A CA  1 
ATOM   58   C C   . LYS A 1 21  ? -6.357  -1.253  -17.530 1.00 34.02 ? 21  LYS A C   1 
ATOM   59   O O   . LYS A 1 21  ? -6.361  -0.054  -17.839 1.00 33.74 ? 21  LYS A O   1 
ATOM   60   C CB  . LYS A 1 21  ? -8.514  -2.547  -17.495 1.00 35.85 ? 21  LYS A CB  1 
ATOM   61   C CG  . LYS A 1 21  ? -9.364  -1.262  -17.092 1.00 40.24 ? 21  LYS A CG  1 
ATOM   62   C CD  . LYS A 1 21  ? -9.456  -0.180  -18.246 1.00 43.55 ? 21  LYS A CD  1 
ATOM   63   C CE  . LYS A 1 21  ? -10.871 0.383   -18.433 1.00 46.63 ? 21  LYS A CE  1 
ATOM   64   N NZ  . LYS A 1 21  ? -10.923 1.448   -19.502 1.00 48.95 ? 21  LYS A NZ  1 
ATOM   65   N N   . ALA A 1 22  ? -5.645  -1.756  -16.521 1.00 32.70 ? 22  ALA A N   1 
ATOM   66   C CA  . ALA A 1 22  ? -4.668  -0.955  -15.776 1.00 32.68 ? 22  ALA A CA  1 
ATOM   67   C C   . ALA A 1 22  ? -3.595  -0.316  -16.687 1.00 32.04 ? 22  ALA A C   1 
ATOM   68   O O   . ALA A 1 22  ? -3.277  0.855   -16.501 1.00 31.50 ? 22  ALA A O   1 
ATOM   69   C CB  . ALA A 1 22  ? -4.007  -1.789  -14.669 1.00 32.41 ? 22  ALA A CB  1 
ATOM   70   N N   . LYS A 1 23  ? -3.089  -1.059  -17.681 1.00 31.90 ? 23  LYS A N   1 
ATOM   71   C CA  . LYS A 1 23  ? -2.113  -0.526  -18.643 1.00 32.31 ? 23  LYS A CA  1 
ATOM   72   C C   . LYS A 1 23  ? -2.715  0.601   -19.478 1.00 33.28 ? 23  LYS A C   1 
ATOM   73   O O   . LYS A 1 23  ? -2.080  1.646   -19.666 1.00 33.40 ? 23  LYS A O   1 
ATOM   74   C CB  . LYS A 1 23  ? -1.529  -1.606  -19.562 1.00 32.68 ? 23  LYS A CB  1 
ATOM   75   C CG  . LYS A 1 23  ? -0.231  -1.133  -20.343 1.00 34.54 ? 23  LYS A CG  1 
ATOM   76   C CD  . LYS A 1 23  ? 0.466   -2.264  -21.152 1.00 37.58 ? 23  LYS A CD  1 
ATOM   77   C CE  . LYS A 1 23  ? 1.909   -1.892  -21.716 1.00 39.26 ? 23  LYS A CE  1 
ATOM   78   N NZ  . LYS A 1 23  ? 3.167   -2.523  -21.003 1.00 35.46 ? 23  LYS A NZ  1 
ATOM   79   N N   . GLU A 1 24  ? -3.946  0.421   -19.963 1.00 33.24 ? 24  GLU A N   1 
ATOM   80   C CA  . GLU A 1 24  ? -4.641  1.491   -20.706 1.00 33.41 ? 24  GLU A CA  1 
ATOM   81   C C   . GLU A 1 24  ? -4.773  2.780   -19.885 1.00 31.17 ? 24  GLU A C   1 
ATOM   82   O O   . GLU A 1 24  ? -4.618  3.870   -20.402 1.00 31.46 ? 24  GLU A O   1 
ATOM   83   C CB  . GLU A 1 24  ? -6.074  1.063   -21.089 1.00 34.22 ? 24  GLU A CB  1 
ATOM   84   C CG  . GLU A 1 24  ? -6.212  0.065   -22.223 1.00 39.66 ? 24  GLU A CG  1 
ATOM   85   C CD  . GLU A 1 24  ? -7.372  0.417   -23.198 1.00 47.22 ? 24  GLU A CD  1 
ATOM   86   O OE1 . GLU A 1 24  ? -7.228  0.069   -24.413 1.00 49.86 ? 24  GLU A OE1 1 
ATOM   87   O OE2 . GLU A 1 24  ? -8.406  1.052   -22.765 1.00 48.23 ? 24  GLU A OE2 1 
ATOM   88   N N   . ASP A 1 25  ? -5.123  2.637   -18.618 1.00 30.08 ? 25  ASP A N   1 
ATOM   89   C CA  . ASP A 1 25  ? -5.239  3.763   -17.690 1.00 29.24 ? 25  ASP A CA  1 
ATOM   90   C C   . ASP A 1 25  ? -3.890  4.479   -17.555 1.00 28.38 ? 25  ASP A C   1 
ATOM   91   O O   . ASP A 1 25  ? -3.824  5.708   -17.569 1.00 27.81 ? 25  ASP A O   1 
ATOM   92   C CB  . ASP A 1 25  ? -5.650  3.298   -16.280 1.00 29.26 ? 25  ASP A CB  1 
ATOM   93   C CG  . ASP A 1 25  ? -7.125  2.843   -16.163 1.00 30.90 ? 25  ASP A CG  1 
ATOM   94   O OD1 . ASP A 1 25  ? -7.906  2.959   -17.115 1.00 32.60 ? 25  ASP A OD1 1 
ATOM   95   O OD2 . ASP A 1 25  ? -7.587  2.347   -15.099 1.00 32.53 ? 25  ASP A OD2 1 
ATOM   96   N N   . PHE A 1 26  ? -2.837  3.683   -17.397 1.00 27.74 ? 26  PHE A N   1 
ATOM   97   C CA  . PHE A 1 26  ? -1.489  4.190   -17.135 1.00 28.13 ? 26  PHE A CA  1 
ATOM   98   C C   . PHE A 1 26  ? -1.025  4.950   -18.341 1.00 27.42 ? 26  PHE A C   1 
ATOM   99   O O   . PHE A 1 26  ? -0.571  6.071   -18.196 1.00 26.21 ? 26  PHE A O   1 
ATOM   100  C CB  . PHE A 1 26  ? -0.505  3.060   -16.776 1.00 27.94 ? 26  PHE A CB  1 
ATOM   101  C CG  . PHE A 1 26  ? 0.927   3.479   -16.804 1.00 29.84 ? 26  PHE A CG  1 
ATOM   102  C CD1 . PHE A 1 26  ? 1.471   4.216   -15.747 1.00 30.24 ? 26  PHE A CD1 1 
ATOM   103  C CD2 . PHE A 1 26  ? 1.734   3.176   -17.904 1.00 29.38 ? 26  PHE A CD2 1 
ATOM   104  C CE1 . PHE A 1 26  ? 2.796   4.634   -15.780 1.00 29.95 ? 26  PHE A CE1 1 
ATOM   105  C CE2 . PHE A 1 26  ? 3.057   3.617   -17.946 1.00 29.60 ? 26  PHE A CE2 1 
ATOM   106  C CZ  . PHE A 1 26  ? 3.592   4.325   -16.867 1.00 28.05 ? 26  PHE A CZ  1 
ATOM   107  N N   . LEU A 1 27  ? -1.211  4.361   -19.529 1.00 27.62 ? 27  LEU A N   1 
ATOM   108  C CA  . LEU A 1 27  ? -0.739  4.962   -20.768 1.00 28.33 ? 27  LEU A CA  1 
ATOM   109  C C   . LEU A 1 27  ? -1.281  6.356   -21.024 1.00 28.86 ? 27  LEU A C   1 
ATOM   110  O O   . LEU A 1 27  ? -0.526  7.232   -21.441 1.00 28.93 ? 27  LEU A O   1 
ATOM   111  C CB  . LEU A 1 27  ? -0.981  4.038   -21.970 1.00 28.37 ? 27  LEU A CB  1 
ATOM   112  C CG  . LEU A 1 27  ? -0.041  2.828   -21.943 1.00 29.12 ? 27  LEU A CG  1 
ATOM   113  C CD1 . LEU A 1 27  ? -0.278  1.884   -23.182 1.00 30.66 ? 27  LEU A CD1 1 
ATOM   114  C CD2 . LEU A 1 27  ? 1.433   3.228   -21.823 1.00 25.56 ? 27  LEU A CD2 1 
ATOM   115  N N   . LYS A 1 28  ? -2.558  6.589   -20.740 1.00 30.10 ? 28  LYS A N   1 
ATOM   116  C CA  . LYS A 1 28  ? -3.143  7.900   -21.013 1.00 31.55 ? 28  LYS A CA  1 
ATOM   117  C C   . LYS A 1 28  ? -2.445  8.949   -20.182 1.00 30.57 ? 28  LYS A C   1 
ATOM   118  O O   . LYS A 1 28  ? -2.209  10.053  -20.659 1.00 31.50 ? 28  LYS A O   1 
ATOM   119  C CB  . LYS A 1 28  ? -4.638  7.965   -20.664 1.00 32.64 ? 28  LYS A CB  1 
ATOM   120  C CG  . LYS A 1 28  ? -5.596  7.323   -21.683 1.00 36.87 ? 28  LYS A CG  1 
ATOM   121  C CD  . LYS A 1 28  ? -7.079  7.276   -21.135 1.00 38.90 ? 28  LYS A CD  1 
ATOM   122  C CE  . LYS A 1 28  ? -7.727  5.882   -21.359 1.00 40.45 ? 28  LYS A CE  1 
ATOM   123  N NZ  . LYS A 1 28  ? -9.226  5.886   -21.095 1.00 41.77 ? 28  LYS A NZ  1 
ATOM   124  N N   . LYS A 1 29  ? -2.189  8.622   -18.916 1.00 29.38 ? 29  LYS A N   1 
ATOM   125  C CA  . LYS A 1 29  ? -1.563  9.570   -17.979 1.00 28.72 ? 29  LYS A CA  1 
ATOM   126  C C   . LYS A 1 29  ? -0.061  9.720   -18.250 1.00 27.20 ? 29  LYS A C   1 
ATOM   127  O O   . LYS A 1 29  ? 0.499   10.797  -18.076 1.00 25.67 ? 29  LYS A O   1 
ATOM   128  C CB  . LYS A 1 29  ? -1.830  9.140   -16.524 1.00 29.05 ? 29  LYS A CB  1 
ATOM   129  C CG  . LYS A 1 29  ? -3.337  9.152   -16.176 1.00 30.43 ? 29  LYS A CG  1 
ATOM   130  C CD  . LYS A 1 29  ? -3.632  8.549   -14.802 1.00 32.39 ? 29  LYS A CD  1 
ATOM   131  C CE  . LYS A 1 29  ? -4.939  9.092   -14.216 1.00 33.85 ? 29  LYS A CE  1 
ATOM   132  N NZ  . LYS A 1 29  ? -5.238  8.466   -12.895 1.00 34.51 ? 29  LYS A NZ  1 
ATOM   133  N N   . TRP A 1 30  ? 0.571   8.632   -18.687 1.00 27.07 ? 30  TRP A N   1 
ATOM   134  C CA  . TRP A 1 30  ? 1.993   8.613   -19.033 1.00 27.31 ? 30  TRP A CA  1 
ATOM   135  C C   . TRP A 1 30  ? 2.228   9.513   -20.216 1.00 27.84 ? 30  TRP A C   1 
ATOM   136  O O   . TRP A 1 30  ? 3.148   10.343  -20.201 1.00 26.94 ? 30  TRP A O   1 
ATOM   137  C CB  . TRP A 1 30  ? 2.448   7.188   -19.336 1.00 27.02 ? 30  TRP A CB  1 
ATOM   138  C CG  . TRP A 1 30  ? 3.811   7.063   -19.932 1.00 27.39 ? 30  TRP A CG  1 
ATOM   139  C CD1 . TRP A 1 30  ? 4.128   6.837   -21.256 1.00 28.47 ? 30  TRP A CD1 1 
ATOM   140  C CD2 . TRP A 1 30  ? 5.051   7.111   -19.232 1.00 29.48 ? 30  TRP A CD2 1 
ATOM   141  N NE1 . TRP A 1 30  ? 5.492   6.746   -21.408 1.00 27.96 ? 30  TRP A NE1 1 
ATOM   142  C CE2 . TRP A 1 30  ? 6.083   6.935   -20.184 1.00 29.88 ? 30  TRP A CE2 1 
ATOM   143  C CE3 . TRP A 1 30  ? 5.402   7.346   -17.901 1.00 30.55 ? 30  TRP A CE3 1 
ATOM   144  C CZ2 . TRP A 1 30  ? 7.433   6.971   -19.836 1.00 30.42 ? 30  TRP A CZ2 1 
ATOM   145  C CZ3 . TRP A 1 30  ? 6.738   7.386   -17.562 1.00 31.74 ? 30  TRP A CZ3 1 
ATOM   146  C CH2 . TRP A 1 30  ? 7.737   7.208   -18.524 1.00 30.57 ? 30  TRP A CH2 1 
ATOM   147  N N   . GLU A 1 31  ? 1.376   9.393   -21.233 1.00 29.13 ? 31  GLU A N   1 
ATOM   148  C CA  . GLU A 1 31  ? 1.582   10.181  -22.462 1.00 31.08 ? 31  GLU A CA  1 
ATOM   149  C C   . GLU A 1 31  ? 1.109   11.620  -22.289 1.00 31.30 ? 31  GLU A C   1 
ATOM   150  O O   . GLU A 1 31  ? 1.466   12.481  -23.071 1.00 31.22 ? 31  GLU A O   1 
ATOM   151  C CB  . GLU A 1 31  ? 0.895   9.537   -23.687 1.00 32.07 ? 31  GLU A CB  1 
ATOM   152  C CG  . GLU A 1 31  ? 1.567   8.275   -24.281 1.00 34.46 ? 31  GLU A CG  1 
ATOM   153  C CD  . GLU A 1 31  ? 3.110   8.336   -24.466 1.00 39.23 ? 31  GLU A CD  1 
ATOM   154  O OE1 . GLU A 1 31  ? 3.711   9.429   -24.643 1.00 42.26 ? 31  GLU A OE1 1 
ATOM   155  O OE2 . GLU A 1 31  ? 3.754   7.249   -24.464 1.00 41.96 ? 31  GLU A OE2 1 
ATOM   156  N N   . ASN A 1 32  ? 0.290   11.884  -21.273 1.00 32.16 ? 32  ASN A N   1 
ATOM   157  C CA  . ASN A 1 32  ? -0.204  13.250  -21.048 1.00 33.14 ? 32  ASN A CA  1 
ATOM   158  C C   . ASN A 1 32  ? -0.231  13.620  -19.543 1.00 31.72 ? 32  ASN A C   1 
ATOM   159  O O   . ASN A 1 32  ? -1.280  13.700  -18.919 1.00 30.96 ? 32  ASN A O   1 
ATOM   160  C CB  . ASN A 1 32  ? -1.570  13.408  -21.708 1.00 33.98 ? 32  ASN A CB  1 
ATOM   161  C CG  . ASN A 1 32  ? -2.163  14.777  -21.484 1.00 38.19 ? 32  ASN A CG  1 
ATOM   162  O OD1 . ASN A 1 32  ? -1.561  15.809  -21.829 1.00 43.34 ? 32  ASN A OD1 1 
ATOM   163  N ND2 . ASN A 1 32  ? -3.334  14.796  -20.853 1.00 41.77 ? 32  ASN A ND2 1 
ATOM   164  N N   . PRO A 1 33  ? 0.945   13.807  -18.970 1.00 30.74 ? 33  PRO A N   1 
ATOM   165  C CA  . PRO A 1 33  ? 1.065   13.950  -17.519 1.00 30.53 ? 33  PRO A CA  1 
ATOM   166  C C   . PRO A 1 33  ? 0.296   15.103  -16.967 1.00 30.35 ? 33  PRO A C   1 
ATOM   167  O O   . PRO A 1 33  ? 0.267   16.160  -17.600 1.00 29.83 ? 33  PRO A O   1 
ATOM   168  C CB  . PRO A 1 33  ? 2.568   14.166  -17.305 1.00 29.51 ? 33  PRO A CB  1 
ATOM   169  C CG  . PRO A 1 33  ? 3.180   13.443  -18.456 1.00 30.18 ? 33  PRO A CG  1 
ATOM   170  C CD  . PRO A 1 33  ? 2.272   13.819  -19.620 1.00 31.27 ? 33  PRO A CD  1 
ATOM   171  N N   . ALA A 1 34  ? -0.313  14.896  -15.803 1.00 30.12 ? 34  ALA A N   1 
ATOM   172  C CA  . ALA A 1 34  ? -0.849  16.026  -15.050 1.00 30.85 ? 34  ALA A CA  1 
ATOM   173  C C   . ALA A 1 34  ? 0.332   16.953  -14.630 1.00 31.04 ? 34  ALA A C   1 
ATOM   174  O O   . ALA A 1 34  ? 1.447   16.493  -14.299 1.00 29.74 ? 34  ALA A O   1 
ATOM   175  C CB  . ALA A 1 34  ? -1.623  15.540  -13.855 1.00 30.42 ? 34  ALA A CB  1 
ATOM   176  N N   . GLN A 1 35  ? 0.068   18.253  -14.649 1.00 31.52 ? 35  GLN A N   1 
ATOM   177  C CA  . GLN A 1 35  ? 1.087   19.270  -14.417 1.00 31.76 ? 35  GLN A CA  1 
ATOM   178  C C   . GLN A 1 35  ? 0.498   20.538  -13.746 1.00 31.95 ? 35  GLN A C   1 
ATOM   179  O O   . GLN A 1 35  ? -0.574  20.978  -14.128 1.00 32.32 ? 35  GLN A O   1 
ATOM   180  C CB  . GLN A 1 35  ? 1.708   19.605  -15.776 1.00 32.10 ? 35  GLN A CB  1 
ATOM   181  C CG  . GLN A 1 35  ? 2.733   20.705  -15.775 1.00 33.95 ? 35  GLN A CG  1 
ATOM   182  C CD  . GLN A 1 35  ? 3.618   20.635  -16.999 1.00 35.26 ? 35  GLN A CD  1 
ATOM   183  O OE1 . GLN A 1 35  ? 3.168   20.196  -18.047 1.00 34.79 ? 35  GLN A OE1 1 
ATOM   184  N NE2 . GLN A 1 35  ? 4.867   21.083  -16.871 1.00 35.51 ? 35  GLN A NE2 1 
ATOM   185  N N   . ASN A 1 36  ? 1.197   21.085  -12.734 1.00 31.32 ? 36  ASN A N   1 
ATOM   186  C CA  . ASN A 1 36  ? 0.862   22.368  -12.110 1.00 31.14 ? 36  ASN A CA  1 
ATOM   187  C C   . ASN A 1 36  ? -0.533  22.448  -11.500 1.00 30.30 ? 36  ASN A C   1 
ATOM   188  O O   . ASN A 1 36  ? -1.272  23.381  -11.789 1.00 30.63 ? 36  ASN A O   1 
ATOM   189  C CB  . ASN A 1 36  ? 1.058   23.505  -13.125 1.00 31.35 ? 36  ASN A CB  1 
ATOM   190  C CG  . ASN A 1 36  ? 0.963   24.902  -12.501 1.00 32.33 ? 36  ASN A CG  1 
ATOM   191  O OD1 . ASN A 1 36  ? 1.537   25.171  -11.449 1.00 31.41 ? 36  ASN A OD1 1 
ATOM   192  N ND2 . ASN A 1 36  ? 0.242   25.795  -13.174 1.00 30.33 ? 36  ASN A ND2 1 
ATOM   193  N N   . THR A 1 37  ? -0.865  21.497  -10.627 1.00 28.96 ? 37  THR A N   1 
ATOM   194  C CA  . THR A 1 37  ? -2.222  21.341  -10.140 1.00 28.13 ? 37  THR A CA  1 
ATOM   195  C C   . THR A 1 37  ? -2.436  21.854  -8.730  1.00 27.02 ? 37  THR A C   1 
ATOM   196  O O   . THR A 1 37  ? -3.463  21.627  -8.142  1.00 27.38 ? 37  THR A O   1 
ATOM   197  C CB  . THR A 1 37  ? -2.629  19.845  -10.198 1.00 28.62 ? 37  THR A CB  1 
ATOM   198  O OG1 . THR A 1 37  ? -1.672  19.058  -9.485  1.00 28.38 ? 37  THR A OG1 1 
ATOM   199  C CG2 . THR A 1 37  ? -2.610  19.311  -11.648 1.00 27.28 ? 37  THR A CG2 1 
ATOM   200  N N   . ALA A 1 38  ? -1.457  22.527  -8.170  1.00 26.59 ? 38  ALA A N   1 
ATOM   201  C CA  . ALA A 1 38  ? -1.671  23.292  -6.970  1.00 25.82 ? 38  ALA A CA  1 
ATOM   202  C C   . ALA A 1 38  ? -0.554  24.327  -6.863  1.00 26.05 ? 38  ALA A C   1 
ATOM   203  O O   . ALA A 1 38  ? 0.152   24.572  -7.829  1.00 24.82 ? 38  ALA A O   1 
ATOM   204  C CB  . ALA A 1 38  ? -1.741  22.392  -5.748  1.00 25.49 ? 38  ALA A CB  1 
ATOM   205  N N   . HIS A 1 39  ? -0.448  24.951  -5.689  1.00 26.93 ? 39  HIS A N   1 
ATOM   206  C CA  . HIS A 1 39  ? 0.528   25.988  -5.401  1.00 27.62 ? 39  HIS A CA  1 
ATOM   207  C C   . HIS A 1 39  ? 0.899   25.904  -3.924  1.00 27.56 ? 39  HIS A C   1 
ATOM   208  O O   . HIS A 1 39  ? 0.094   25.519  -3.084  1.00 26.69 ? 39  HIS A O   1 
ATOM   209  C CB  . HIS A 1 39  ? -0.020  27.379  -5.787  1.00 27.76 ? 39  HIS A CB  1 
ATOM   210  C CG  . HIS A 1 39  ? 0.986   28.493  -5.676  1.00 28.87 ? 39  HIS A CG  1 
ATOM   211  N ND1 . HIS A 1 39  ? 1.307   29.318  -6.736  1.00 32.62 ? 39  HIS A ND1 1 
ATOM   212  C CD2 . HIS A 1 39  ? 1.729   28.932  -4.630  1.00 30.86 ? 39  HIS A CD2 1 
ATOM   213  C CE1 . HIS A 1 39  ? 2.202   30.212  -6.348  1.00 34.12 ? 39  HIS A CE1 1 
ATOM   214  N NE2 . HIS A 1 39  ? 2.488   29.991  -5.074  1.00 32.09 ? 39  HIS A NE2 1 
ATOM   215  N N   . LEU A 1 40  ? 2.159   26.208  -3.627  1.00 28.50 ? 40  LEU A N   1 
ATOM   216  C CA  . LEU A 1 40  ? 2.686   26.139  -2.262  1.00 29.40 ? 40  LEU A CA  1 
ATOM   217  C C   . LEU A 1 40  ? 1.810   26.853  -1.236  1.00 30.00 ? 40  LEU A C   1 
ATOM   218  O O   . LEU A 1 40  ? 1.712   26.414  -0.106  1.00 28.38 ? 40  LEU A O   1 
ATOM   219  C CB  . LEU A 1 40  ? 4.041   26.807  -2.218  1.00 29.86 ? 40  LEU A CB  1 
ATOM   220  C CG  . LEU A 1 40  ? 5.218   26.327  -1.376  1.00 31.59 ? 40  LEU A CG  1 
ATOM   221  C CD1 . LEU A 1 40  ? 5.949   27.557  -0.825  1.00 29.99 ? 40  LEU A CD1 1 
ATOM   222  C CD2 . LEU A 1 40  ? 4.895   25.281  -0.309  1.00 31.80 ? 40  LEU A CD2 1 
ATOM   223  N N   . ASP A 1 41  ? 1.232   27.985  -1.643  1.00 30.84 ? 41  ASP A N   1 
ATOM   224  C CA  . ASP A 1 41  ? 0.480   28.855  -0.748  1.00 32.52 ? 41  ASP A CA  1 
ATOM   225  C C   . ASP A 1 41  ? -0.875  28.274  -0.390  1.00 31.63 ? 41  ASP A C   1 
ATOM   226  O O   . ASP A 1 41  ? -1.518  28.760  0.501   1.00 31.34 ? 41  ASP A O   1 
ATOM   227  C CB  . ASP A 1 41  ? 0.380   30.317  -1.287  1.00 33.62 ? 41  ASP A CB  1 
ATOM   228  C CG  . ASP A 1 41  ? -0.486  30.452  -2.561  1.00 38.14 ? 41  ASP A CG  1 
ATOM   229  O OD1 . ASP A 1 41  ? -0.436  31.566  -3.194  1.00 43.30 ? 41  ASP A OD1 1 
ATOM   230  O OD2 . ASP A 1 41  ? -1.258  29.537  -3.012  1.00 43.35 ? 41  ASP A OD2 1 
ATOM   231  N N   . GLN A 1 42  ? -1.280  27.194  -1.061  1.00 31.38 ? 42  GLN A N   1 
ATOM   232  C CA  . GLN A 1 42  ? -2.469  26.447  -0.688  1.00 30.46 ? 42  GLN A CA  1 
ATOM   233  C C   . GLN A 1 42  ? -2.204  25.554  0.510   1.00 30.14 ? 42  GLN A C   1 
ATOM   234  O O   . GLN A 1 42  ? -3.113  24.874  1.001   1.00 29.33 ? 42  GLN A O   1 
ATOM   235  C CB  . GLN A 1 42  ? -2.970  25.635  -1.900  1.00 30.85 ? 42  GLN A CB  1 
ATOM   236  C CG  . GLN A 1 42  ? -3.607  26.575  -2.911  1.00 32.61 ? 42  GLN A CG  1 
ATOM   237  C CD  . GLN A 1 42  ? -3.744  26.050  -4.337  1.00 35.09 ? 42  GLN A CD  1 
ATOM   238  O OE1 . GLN A 1 42  ? -4.167  26.795  -5.209  1.00 37.47 ? 42  GLN A OE1 1 
ATOM   239  N NE2 . GLN A 1 42  ? -3.429  24.798  -4.566  1.00 31.78 ? 42  GLN A NE2 1 
ATOM   240  N N   . PHE A 1 43  ? -0.966  25.522  1.010   1.00 29.69 ? 43  PHE A N   1 
ATOM   241  C CA  . PHE A 1 43  ? -0.679  24.561  2.080   1.00 29.78 ? 43  PHE A CA  1 
ATOM   242  C C   . PHE A 1 43  ? -0.053  25.171  3.299   1.00 30.50 ? 43  PHE A C   1 
ATOM   243  O O   . PHE A 1 43  ? 0.752   26.089  3.219   1.00 31.01 ? 43  PHE A O   1 
ATOM   244  C CB  . PHE A 1 43  ? 0.208   23.424  1.573   1.00 28.83 ? 43  PHE A CB  1 
ATOM   245  C CG  . PHE A 1 43  ? -0.340  22.710  0.395   1.00 26.30 ? 43  PHE A CG  1 
ATOM   246  C CD1 . PHE A 1 43  ? -1.167  21.618  0.555   1.00 22.51 ? 43  PHE A CD1 1 
ATOM   247  C CD2 . PHE A 1 43  ? -0.025  23.123  -0.880  1.00 25.54 ? 43  PHE A CD2 1 
ATOM   248  C CE1 . PHE A 1 43  ? -1.635  20.934  -0.522  1.00 21.09 ? 43  PHE A CE1 1 
ATOM   249  C CE2 . PHE A 1 43  ? -0.540  22.453  -1.977  1.00 26.43 ? 43  PHE A CE2 1 
ATOM   250  C CZ  . PHE A 1 43  ? -1.351  21.351  -1.794  1.00 22.27 ? 43  PHE A CZ  1 
ATOM   251  N N   . GLU A 1 44  ? -0.417  24.632  4.442   1.00 31.84 ? 44  GLU A N   1 
ATOM   252  C CA  . GLU A 1 44  ? 0.258   24.980  5.697   1.00 34.18 ? 44  GLU A CA  1 
ATOM   253  C C   . GLU A 1 44  ? 1.256   23.863  6.081   1.00 33.84 ? 44  GLU A C   1 
ATOM   254  O O   . GLU A 1 44  ? 0.877   22.709  6.278   1.00 33.61 ? 44  GLU A O   1 
ATOM   255  C CB  . GLU A 1 44  ? -0.827  25.193  6.767   1.00 34.63 ? 44  GLU A CB  1 
ATOM   256  C CG  . GLU A 1 44  ? -0.394  25.361  8.220   1.00 38.85 ? 44  GLU A CG  1 
ATOM   257  C CD  . GLU A 1 44  ? -1.610  25.266  9.140   1.00 43.57 ? 44  GLU A CD  1 
ATOM   258  O OE1 . GLU A 1 44  ? -2.641  25.949  8.831   1.00 45.87 ? 44  GLU A OE1 1 
ATOM   259  O OE2 . GLU A 1 44  ? -1.550  24.495  10.124  1.00 44.15 ? 44  GLU A OE2 1 
ATOM   260  N N   . ARG A 1 45  ? 2.532   24.201  6.141   1.00 34.98 ? 45  ARG A N   1 
ATOM   261  C CA  . ARG A 1 45  ? 3.563   23.212  6.445   1.00 35.84 ? 45  ARG A CA  1 
ATOM   262  C C   . ARG A 1 45  ? 3.511   23.027  7.966   1.00 34.76 ? 45  ARG A C   1 
ATOM   263  O O   . ARG A 1 45  ? 3.362   23.998  8.703   1.00 35.58 ? 45  ARG A O   1 
ATOM   264  C CB  . ARG A 1 45  ? 4.930   23.692  5.938   1.00 36.52 ? 45  ARG A CB  1 
ATOM   265  C CG  . ARG A 1 45  ? 5.507   24.833  6.793   1.00 41.73 ? 45  ARG A CG  1 
ATOM   266  C CD  . ARG A 1 45  ? 6.985   25.155  6.570   1.00 45.80 ? 45  ARG A CD  1 
ATOM   267  N NE  . ARG A 1 45  ? 7.866   24.250  7.317   1.00 47.03 ? 45  ARG A NE  1 
ATOM   268  C CZ  . ARG A 1 45  ? 9.193   24.316  7.263   1.00 50.08 ? 45  ARG A CZ  1 
ATOM   269  N NH1 . ARG A 1 45  ? 9.778   25.260  6.508   1.00 51.04 ? 45  ARG A NH1 1 
ATOM   270  N NH2 . ARG A 1 45  ? 9.940   23.428  7.945   1.00 49.39 ? 45  ARG A NH2 1 
ATOM   271  N N   . ILE A 1 46  ? 3.559   21.786  8.422   1.00 33.10 ? 46  ILE A N   1 
ATOM   272  C CA  . ILE A 1 46  ? 3.415   21.481  9.831   1.00 31.65 ? 46  ILE A CA  1 
ATOM   273  C C   . ILE A 1 46  ? 4.726   20.929  10.340  1.00 30.56 ? 46  ILE A C   1 
ATOM   274  O O   . ILE A 1 46  ? 5.300   21.509  11.226  1.00 30.36 ? 46  ILE A O   1 
ATOM   275  C CB  . ILE A 1 46  ? 2.215   20.531  10.092  1.00 31.62 ? 46  ILE A CB  1 
ATOM   276  C CG1 . ILE A 1 46  ? 0.914   21.225  9.655   1.00 33.55 ? 46  ILE A CG1 1 
ATOM   277  C CG2 . ILE A 1 46  ? 2.102   20.193  11.602  1.00 31.16 ? 46  ILE A CG2 1 
ATOM   278  C CD1 . ILE A 1 46  ? -0.352  20.346  9.759   1.00 35.48 ? 46  ILE A CD1 1 
ATOM   279  N N   . LYS A 1 47  ? 5.237   19.854  9.736   1.00 28.87 ? 47  LYS A N   1 
ATOM   280  C CA  . LYS A 1 47  ? 6.360   19.156  10.318  1.00 28.13 ? 47  LYS A CA  1 
ATOM   281  C C   . LYS A 1 47  ? 7.048   18.227  9.308   1.00 26.80 ? 47  LYS A C   1 
ATOM   282  O O   . LYS A 1 47  ? 6.408   17.580  8.479   1.00 26.26 ? 47  LYS A O   1 
ATOM   283  C CB  . LYS A 1 47  ? 5.873   18.364  11.551  1.00 28.35 ? 47  LYS A CB  1 
ATOM   284  C CG  . LYS A 1 47  ? 6.917   17.468  12.239  1.00 29.71 ? 47  LYS A CG  1 
ATOM   285  C CD  . LYS A 1 47  ? 6.394   16.784  13.496  1.00 32.05 ? 47  LYS A CD  1 
ATOM   286  C CE  . LYS A 1 47  ? 7.417   16.708  14.669  1.00 33.77 ? 47  LYS A CE  1 
ATOM   287  N NZ  . LYS A 1 47  ? 8.743   16.196  14.214  1.00 36.39 ? 47  LYS A NZ  1 
ATOM   288  N N   . THR A 1 48  ? 8.360   18.139  9.424   1.00 25.27 ? 48  THR A N   1 
ATOM   289  C CA  . THR A 1 48  ? 9.131   17.289  8.562   1.00 25.68 ? 48  THR A CA  1 
ATOM   290  C C   . THR A 1 48  ? 9.056   15.879  9.098   1.00 25.94 ? 48  THR A C   1 
ATOM   291  O O   . THR A 1 48  ? 9.480   15.613  10.220  1.00 26.19 ? 48  THR A O   1 
ATOM   292  C CB  . THR A 1 48  ? 10.559  17.787  8.496   1.00 26.14 ? 48  THR A CB  1 
ATOM   293  O OG1 . THR A 1 48  ? 10.561  19.008  7.765   1.00 22.77 ? 48  THR A OG1 1 
ATOM   294  C CG2 . THR A 1 48  ? 11.448  16.849  7.680   1.00 26.55 ? 48  THR A CG2 1 
ATOM   295  N N   . ILE A 1 49  ? 8.455   15.005  8.306   1.00 25.79 ? 49  ILE A N   1 
ATOM   296  C CA  . ILE A 1 49  ? 8.272   13.612  8.664   1.00 26.09 ? 49  ILE A CA  1 
ATOM   297  C C   . ILE A 1 49  ? 9.206   12.622  7.937   1.00 27.25 ? 49  ILE A C   1 
ATOM   298  O O   . ILE A 1 49  ? 9.068   11.397  8.103   1.00 27.11 ? 49  ILE A O   1 
ATOM   299  C CB  . ILE A 1 49  ? 6.801   13.242  8.479   1.00 26.41 ? 49  ILE A CB  1 
ATOM   300  C CG1 . ILE A 1 49  ? 6.328   13.417  7.022   1.00 26.40 ? 49  ILE A CG1 1 
ATOM   301  C CG2 . ILE A 1 49  ? 5.940   14.066  9.462   1.00 25.59 ? 49  ILE A CG2 1 
ATOM   302  C CD1 . ILE A 1 49  ? 5.002   12.753  6.771   1.00 25.43 ? 49  ILE A CD1 1 
ATOM   303  N N   . GLY A 1 50  ? 10.194  13.129  7.192   1.00 28.28 ? 50  GLY A N   1 
ATOM   304  C CA  . GLY A 1 50  ? 11.044  12.258  6.399   1.00 30.23 ? 50  GLY A CA  1 
ATOM   305  C C   . GLY A 1 50  ? 12.080  12.971  5.531   1.00 31.89 ? 50  GLY A C   1 
ATOM   306  O O   . GLY A 1 50  ? 11.853  14.110  5.086   1.00 31.89 ? 50  GLY A O   1 
ATOM   307  N N   . THR A 1 51  ? 13.212  12.287  5.313   1.00 33.11 ? 51  THR A N   1 
ATOM   308  C CA  . THR A 1 51  ? 14.323  12.774  4.494   1.00 33.95 ? 51  THR A CA  1 
ATOM   309  C C   . THR A 1 51  ? 14.767  11.703  3.495   1.00 35.65 ? 51  THR A C   1 
ATOM   310  O O   . THR A 1 51  ? 14.754  10.512  3.788   1.00 35.52 ? 51  THR A O   1 
ATOM   311  C CB  . THR A 1 51  ? 15.552  13.115  5.363   1.00 33.77 ? 51  THR A CB  1 
ATOM   312  O OG1 . THR A 1 51  ? 15.799  12.042  6.280   1.00 32.51 ? 51  THR A OG1 1 
ATOM   313  C CG2 . THR A 1 51  ? 15.305  14.321  6.243   1.00 33.24 ? 51  THR A CG2 1 
ATOM   314  N N   . GLY A 1 52  ? 15.208  12.144  2.322   1.00 37.46 ? 52  GLY A N   1 
ATOM   315  C CA  . GLY A 1 52  ? 15.853  11.256  1.381   1.00 38.83 ? 52  GLY A CA  1 
ATOM   316  C C   . GLY A 1 52  ? 14.868  10.496  0.490   1.00 40.09 ? 52  GLY A C   1 
ATOM   317  O O   . GLY A 1 52  ? 13.625  10.662  0.628   1.00 40.97 ? 52  GLY A O   1 
ATOM   318  N N   . SER A 1 53  ? 15.404  9.700   -0.446  1.00 40.47 ? 53  SER A N   1 
ATOM   319  C CA  . SER A 1 53  ? 16.862  9.680   -0.713  1.00 41.10 ? 53  SER A CA  1 
ATOM   320  C C   . SER A 1 53  ? 17.388  11.044  -1.266  1.00 40.58 ? 53  SER A C   1 
ATOM   321  O O   . SER A 1 53  ? 18.572  11.387  -1.103  1.00 40.77 ? 53  SER A O   1 
ATOM   322  C CB  . SER A 1 53  ? 17.291  8.496   -1.609  1.00 40.90 ? 53  SER A CB  1 
ATOM   323  O OG  . SER A 1 53  ? 16.319  8.126   -2.564  1.00 41.83 ? 53  SER A OG  1 
ATOM   324  N N   . PHE A 1 54  ? 16.492  11.805  -1.900  1.00 39.79 ? 54  PHE A N   1 
ATOM   325  C CA  . PHE A 1 54  ? 16.723  13.227  -2.182  1.00 38.75 ? 54  PHE A CA  1 
ATOM   326  C C   . PHE A 1 54  ? 15.525  14.032  -1.634  1.00 37.74 ? 54  PHE A C   1 
ATOM   327  O O   . PHE A 1 54  ? 14.362  13.560  -1.652  1.00 37.02 ? 54  PHE A O   1 
ATOM   328  C CB  . PHE A 1 54  ? 16.998  13.441  -3.689  1.00 38.70 ? 54  PHE A CB  1 
ATOM   329  C CG  . PHE A 1 54  ? 18.058  12.476  -4.252  1.00 39.58 ? 54  PHE A CG  1 
ATOM   330  C CD1 . PHE A 1 54  ? 19.424  12.709  -4.049  1.00 39.38 ? 54  PHE A CD1 1 
ATOM   331  C CD2 . PHE A 1 54  ? 17.682  11.292  -4.899  1.00 38.85 ? 54  PHE A CD2 1 
ATOM   332  C CE1 . PHE A 1 54  ? 20.393  11.792  -4.522  1.00 40.38 ? 54  PHE A CE1 1 
ATOM   333  C CE2 . PHE A 1 54  ? 18.639  10.386  -5.374  1.00 38.99 ? 54  PHE A CE2 1 
ATOM   334  C CZ  . PHE A 1 54  ? 19.988  10.624  -5.190  1.00 40.02 ? 54  PHE A CZ  1 
ATOM   335  N N   . GLY A 1 55  ? 15.850  15.206  -1.090  1.00 36.33 ? 55  GLY A N   1 
ATOM   336  C CA  . GLY A 1 55  ? 14.889  16.127  -0.522  1.00 35.90 ? 55  GLY A CA  1 
ATOM   337  C C   . GLY A 1 55  ? 14.299  15.729  0.829   1.00 35.10 ? 55  GLY A C   1 
ATOM   338  O O   . GLY A 1 55  ? 14.913  15.054  1.631   1.00 35.41 ? 55  GLY A O   1 
ATOM   339  N N   . ARG A 1 56  ? 13.094  16.199  1.081   1.00 34.23 ? 56  ARG A N   1 
ATOM   340  C CA  . ARG A 1 56  ? 12.418  15.981  2.359   1.00 33.88 ? 56  ARG A CA  1 
ATOM   341  C C   . ARG A 1 56  ? 10.909  15.998  2.172   1.00 31.81 ? 56  ARG A C   1 
ATOM   342  O O   . ARG A 1 56  ? 10.399  16.488  1.182   1.00 31.72 ? 56  ARG A O   1 
ATOM   343  C CB  . ARG A 1 56  ? 12.837  17.030  3.392   1.00 34.82 ? 56  ARG A CB  1 
ATOM   344  C CG  . ARG A 1 56  ? 12.361  18.449  3.123   1.00 37.70 ? 56  ARG A CG  1 
ATOM   345  C CD  . ARG A 1 56  ? 13.387  19.537  3.534   1.00 44.07 ? 56  ARG A CD  1 
ATOM   346  N NE  . ARG A 1 56  ? 13.415  20.691  2.604   1.00 45.24 ? 56  ARG A NE  1 
ATOM   347  C CZ  . ARG A 1 56  ? 13.035  21.936  2.918   1.00 45.63 ? 56  ARG A CZ  1 
ATOM   348  N NH1 . ARG A 1 56  ? 12.584  22.245  4.142   1.00 45.79 ? 56  ARG A NH1 1 
ATOM   349  N NH2 . ARG A 1 56  ? 13.110  22.889  1.992   1.00 45.96 ? 56  ARG A NH2 1 
ATOM   350  N N   . VAL A 1 57  ? 10.217  15.438  3.137   1.00 29.98 ? 57  VAL A N   1 
ATOM   351  C CA  . VAL A 1 57  ? 8.792   15.256  3.082   1.00 28.56 ? 57  VAL A CA  1 
ATOM   352  C C   . VAL A 1 57  ? 8.231   15.851  4.347   1.00 27.74 ? 57  VAL A C   1 
ATOM   353  O O   . VAL A 1 57  ? 8.694   15.527  5.457   1.00 26.70 ? 57  VAL A O   1 
ATOM   354  C CB  . VAL A 1 57  ? 8.395   13.778  2.999   1.00 27.81 ? 57  VAL A CB  1 
ATOM   355  C CG1 . VAL A 1 57  ? 6.846   13.646  3.081   1.00 30.11 ? 57  VAL A CG1 1 
ATOM   356  C CG2 . VAL A 1 57  ? 8.883   13.181  1.735   1.00 26.96 ? 57  VAL A CG2 1 
ATOM   357  N N   . MET A 1 58  ? 7.225   16.709  4.181   1.00 27.30 ? 58  MET A N   1 
ATOM   358  C CA  . MET A 1 58  ? 6.590   17.409  5.304   1.00 27.32 ? 58  MET A CA  1 
ATOM   359  C C   . MET A 1 58  ? 5.118   17.080  5.371   1.00 25.84 ? 58  MET A C   1 
ATOM   360  O O   . MET A 1 58  ? 4.455   17.019  4.342   1.00 24.37 ? 58  MET A O   1 
ATOM   361  C CB  . MET A 1 58  ? 6.715   18.914  5.119   1.00 28.18 ? 58  MET A CB  1 
ATOM   362  C CG  . MET A 1 58  ? 8.096   19.464  5.273   1.00 31.02 ? 58  MET A CG  1 
ATOM   363  S SD  . MET A 1 58  ? 7.981   21.280  5.327   1.00 34.05 ? 58  MET A SD  1 
ATOM   364  C CE  . MET A 1 58  ? 9.663   21.731  5.041   1.00 36.80 ? 58  MET A CE  1 
ATOM   365  N N   . LEU A 1 59  ? 4.603   16.913  6.580   1.00 25.55 ? 59  LEU A N   1 
ATOM   366  C CA  . LEU A 1 59  ? 3.161   16.974  6.781   1.00 26.09 ? 59  LEU A CA  1 
ATOM   367  C C   . LEU A 1 59  ? 2.709   18.380  6.459   1.00 26.11 ? 59  LEU A C   1 
ATOM   368  O O   . LEU A 1 59  ? 3.274   19.349  6.978   1.00 25.56 ? 59  LEU A O   1 
ATOM   369  C CB  . LEU A 1 59  ? 2.768   16.668  8.221   1.00 26.80 ? 59  LEU A CB  1 
ATOM   370  C CG  . LEU A 1 59  ? 1.443   15.976  8.588   1.00 28.06 ? 59  LEU A CG  1 
ATOM   371  C CD1 . LEU A 1 59  ? 0.885   16.544  9.889   1.00 26.76 ? 59  LEU A CD1 1 
ATOM   372  C CD2 . LEU A 1 59  ? 0.391   15.934  7.477   1.00 29.73 ? 59  LEU A CD2 1 
ATOM   373  N N   . VAL A 1 60  ? 1.701   18.484  5.595   1.00 25.80 ? 60  VAL A N   1 
ATOM   374  C CA  . VAL A 1 60  ? 1.057   19.751  5.321   1.00 25.64 ? 60  VAL A CA  1 
ATOM   375  C C   . VAL A 1 60  ? -0.442  19.630  5.407   1.00 26.83 ? 60  VAL A C   1 
ATOM   376  O O   . VAL A 1 60  ? -0.941  18.534  5.446   1.00 27.08 ? 60  VAL A O   1 
ATOM   377  C CB  . VAL A 1 60  ? 1.470   20.295  3.951   1.00 25.06 ? 60  VAL A CB  1 
ATOM   378  C CG1 . VAL A 1 60  ? 3.001   20.377  3.869   1.00 24.09 ? 60  VAL A CG1 1 
ATOM   379  C CG2 . VAL A 1 60  ? 0.896   19.449  2.789   1.00 24.17 ? 60  VAL A CG2 1 
ATOM   380  N N   . LYS A 1 61  ? -1.148  20.770  5.436   1.00 28.17 ? 61  LYS A N   1 
ATOM   381  C CA  . LYS A 1 61  ? -2.605  20.834  5.497   1.00 29.34 ? 61  LYS A CA  1 
ATOM   382  C C   . LYS A 1 61  ? -3.125  21.704  4.338   1.00 29.61 ? 61  LYS A C   1 
ATOM   383  O O   . LYS A 1 61  ? -2.676  22.823  4.156   1.00 29.61 ? 61  LYS A O   1 
ATOM   384  C CB  . LYS A 1 61  ? -3.062  21.446  6.837   1.00 29.99 ? 61  LYS A CB  1 
ATOM   385  C CG  . LYS A 1 61  ? -4.537  21.130  7.226   1.00 35.24 ? 61  LYS A CG  1 
ATOM   386  C CD  . LYS A 1 61  ? -4.962  21.718  8.627   1.00 38.74 ? 61  LYS A CD  1 
ATOM   387  C CE  . LYS A 1 61  ? -5.925  22.904  8.506   1.00 41.19 ? 61  LYS A CE  1 
ATOM   388  N NZ  . LYS A 1 61  ? -6.462  23.392  9.843   1.00 44.96 ? 61  LYS A NZ  1 
ATOM   389  N N   . HIS A 1 62  ? -4.058  21.189  3.553   1.00 29.23 ? 62  HIS A N   1 
ATOM   390  C CA  . HIS A 1 62  ? -4.646  21.957  2.462   1.00 30.48 ? 62  HIS A CA  1 
ATOM   391  C C   . HIS A 1 62  ? -5.741  22.853  3.074   1.00 30.76 ? 62  HIS A C   1 
ATOM   392  O O   . HIS A 1 62  ? -6.747  22.339  3.584   1.00 29.56 ? 62  HIS A O   1 
ATOM   393  C CB  . HIS A 1 62  ? -5.257  20.956  1.497   1.00 30.39 ? 62  HIS A CB  1 
ATOM   394  C CG  . HIS A 1 62  ? -5.497  21.467  0.116   1.00 31.96 ? 62  HIS A CG  1 
ATOM   395  N ND1 . HIS A 1 62  ? -4.836  22.553  -0.416  1.00 32.76 ? 62  HIS A ND1 1 
ATOM   396  C CD2 . HIS A 1 62  ? -6.273  20.973  -0.878  1.00 33.07 ? 62  HIS A CD2 1 
ATOM   397  C CE1 . HIS A 1 62  ? -5.219  22.724  -1.666  1.00 31.77 ? 62  HIS A CE1 1 
ATOM   398  N NE2 . HIS A 1 62  ? -6.091  21.779  -1.972  1.00 33.95 ? 62  HIS A NE2 1 
ATOM   399  N N   . MET A 1 63  ? -5.544  24.165  3.049   1.00 32.16 ? 63  MET A N   1 
ATOM   400  C CA  . MET A 1 63  ? -6.525  25.114  3.638   1.00 33.28 ? 63  MET A CA  1 
ATOM   401  C C   . MET A 1 63  ? -7.920  24.882  3.091   1.00 32.76 ? 63  MET A C   1 
ATOM   402  O O   . MET A 1 63  ? -8.848  24.808  3.849   1.00 32.46 ? 63  MET A O   1 
ATOM   403  C CB  . MET A 1 63  ? -6.194  26.595  3.413   1.00 34.41 ? 63  MET A CB  1 
ATOM   404  C CG  . MET A 1 63  ? -4.793  26.980  3.033   1.00 38.65 ? 63  MET A CG  1 
ATOM   405  S SD  . MET A 1 63  ? -3.610  26.549  4.334   1.00 47.90 ? 63  MET A SD  1 
ATOM   406  C CE  . MET A 1 63  ? -2.578  28.109  4.266   1.00 47.67 ? 63  MET A CE  1 
ATOM   407  N N   . GLU A 1 64  ? -8.049  24.711  1.782   1.00 33.07 ? 64  GLU A N   1 
ATOM   408  C CA  . GLU A 1 64  ? -9.354  24.740  1.147   1.00 34.29 ? 64  GLU A CA  1 
ATOM   409  C C   . GLU A 1 64  ? -10.218 23.502  1.492   1.00 33.25 ? 64  GLU A C   1 
ATOM   410  O O   . GLU A 1 64  ? -11.425 23.609  1.530   1.00 33.33 ? 64  GLU A O   1 
ATOM   411  C CB  . GLU A 1 64  ? -9.225  24.980  -0.375  1.00 35.69 ? 64  GLU A CB  1 
ATOM   412  C CG  . GLU A 1 64  ? -8.803  23.752  -1.207  1.00 40.60 ? 64  GLU A CG  1 
ATOM   413  C CD  . GLU A 1 64  ? -8.961  23.925  -2.734  1.00 46.38 ? 64  GLU A CD  1 
ATOM   414  O OE1 . GLU A 1 64  ? -8.446  24.951  -3.291  1.00 50.50 ? 64  GLU A OE1 1 
ATOM   415  O OE2 . GLU A 1 64  ? -9.572  23.014  -3.381  1.00 47.60 ? 64  GLU A OE2 1 
ATOM   416  N N   . THR A 1 65  ? -9.607  22.359  1.772   1.00 31.40 ? 65  THR A N   1 
ATOM   417  C CA  . THR A 1 65  ? -10.350 21.178  2.208   1.00 30.28 ? 65  THR A CA  1 
ATOM   418  C C   . THR A 1 65  ? -10.169 20.802  3.679   1.00 29.23 ? 65  THR A C   1 
ATOM   419  O O   . THR A 1 65  ? -10.924 20.002  4.190   1.00 27.94 ? 65  THR A O   1 
ATOM   420  C CB  . THR A 1 65  ? -9.926  19.974  1.391   1.00 31.18 ? 65  THR A CB  1 
ATOM   421  O OG1 . THR A 1 65  ? -8.495  19.813  1.443   1.00 28.71 ? 65  THR A OG1 1 
ATOM   422  C CG2 . THR A 1 65  ? -10.261 20.165  -0.089  1.00 31.53 ? 65  THR A CG2 1 
ATOM   423  N N   . GLY A 1 66  ? -9.180  21.382  4.359   1.00 28.83 ? 66  GLY A N   1 
ATOM   424  C CA  . GLY A 1 66  ? -8.732  20.872  5.654   1.00 28.51 ? 66  GLY A CA  1 
ATOM   425  C C   . GLY A 1 66  ? -8.105  19.468  5.620   1.00 28.12 ? 66  GLY A C   1 
ATOM   426  O O   . GLY A 1 66  ? -7.950  18.811  6.650   1.00 28.34 ? 66  GLY A O   1 
ATOM   427  N N   . ASN A 1 67  ? -7.747  18.983  4.443   1.00 28.23 ? 67  ASN A N   1 
ATOM   428  C CA  . ASN A 1 67  ? -7.143  17.643  4.321   1.00 28.54 ? 67  ASN A CA  1 
ATOM   429  C C   . ASN A 1 67  ? -5.663  17.717  4.678   1.00 27.94 ? 67  ASN A C   1 
ATOM   430  O O   . ASN A 1 67  ? -4.986  18.724  4.455   1.00 27.85 ? 67  ASN A O   1 
ATOM   431  C CB  . ASN A 1 67  ? -7.280  17.092  2.901   1.00 28.90 ? 67  ASN A CB  1 
ATOM   432  C CG  . ASN A 1 67  ? -8.701  16.693  2.537   1.00 29.73 ? 67  ASN A CG  1 
ATOM   433  O OD1 . ASN A 1 67  ? -9.443  16.145  3.338   1.00 30.90 ? 67  ASN A OD1 1 
ATOM   434  N ND2 . ASN A 1 67  ? -9.057  16.922  1.290   1.00 31.92 ? 67  ASN A ND2 1 
ATOM   435  N N   . HIS A 1 68  ? -5.150  16.645  5.237   1.00 27.75 ? 68  HIS A N   1 
ATOM   436  C CA  . HIS A 1 68  ? -3.714  16.546  5.455   1.00 27.06 ? 68  HIS A CA  1 
ATOM   437  C C   . HIS A 1 68  ? -3.098  15.778  4.311   1.00 25.33 ? 68  HIS A C   1 
ATOM   438  O O   . HIS A 1 68  ? -3.683  14.803  3.833   1.00 25.51 ? 68  HIS A O   1 
ATOM   439  C CB  . HIS A 1 68  ? -3.436  15.825  6.768   1.00 27.60 ? 68  HIS A CB  1 
ATOM   440  C CG  . HIS A 1 68  ? -3.684  16.674  7.961   1.00 29.80 ? 68  HIS A CG  1 
ATOM   441  N ND1 . HIS A 1 68  ? -2.795  17.641  8.374   1.00 31.27 ? 68  HIS A ND1 1 
ATOM   442  C CD2 . HIS A 1 68  ? -4.741  16.743  8.798   1.00 30.82 ? 68  HIS A CD2 1 
ATOM   443  C CE1 . HIS A 1 68  ? -3.289  18.257  9.430   1.00 31.93 ? 68  HIS A CE1 1 
ATOM   444  N NE2 . HIS A 1 68  ? -4.470  17.733  9.705   1.00 34.22 ? 68  HIS A NE2 1 
ATOM   445  N N   . TYR A 1 69  ? -1.914  16.226  3.904   1.00 24.42 ? 69  TYR A N   1 
ATOM   446  C CA  . TYR A 1 69  ? -1.074  15.562  2.881   1.00 24.11 ? 69  TYR A CA  1 
ATOM   447  C C   . TYR A 1 69  ? 0.364   15.496  3.365   1.00 23.06 ? 69  TYR A C   1 
ATOM   448  O O   . TYR A 1 69  ? 0.695   16.083  4.414   1.00 24.14 ? 69  TYR A O   1 
ATOM   449  C CB  . TYR A 1 69  ? -1.133  16.337  1.568   1.00 24.19 ? 69  TYR A CB  1 
ATOM   450  C CG  . TYR A 1 69  ? -2.527  16.373  0.989   1.00 23.49 ? 69  TYR A CG  1 
ATOM   451  C CD1 . TYR A 1 69  ? -3.116  15.231  0.500   1.00 25.57 ? 69  TYR A CD1 1 
ATOM   452  C CD2 . TYR A 1 69  ? -3.263  17.554  0.959   1.00 23.71 ? 69  TYR A CD2 1 
ATOM   453  C CE1 . TYR A 1 69  ? -4.434  15.253  -0.038  1.00 26.65 ? 69  TYR A CE1 1 
ATOM   454  C CE2 . TYR A 1 69  ? -4.539  17.588  0.412   1.00 26.07 ? 69  TYR A CE2 1 
ATOM   455  C CZ  . TYR A 1 69  ? -5.122  16.448  -0.071  1.00 24.46 ? 69  TYR A CZ  1 
ATOM   456  O OH  . TYR A 1 69  ? -6.378  16.516  -0.570  1.00 26.73 ? 69  TYR A OH  1 
ATOM   457  N N   . ALA A 1 70  ? 1.185   14.742  2.639   1.00 21.14 ? 70  ALA A N   1 
ATOM   458  C CA  . ALA A 1 70  ? 2.645   14.725  2.799   1.00 20.39 ? 70  ALA A CA  1 
ATOM   459  C C   . ALA A 1 70  ? 3.282   15.319  1.549   1.00 20.21 ? 70  ALA A C   1 
ATOM   460  O O   . ALA A 1 70  ? 3.099   14.801  0.445   1.00 19.80 ? 70  ALA A O   1 
ATOM   461  C CB  . ALA A 1 70  ? 3.142   13.331  2.960   1.00 20.63 ? 70  ALA A CB  1 
ATOM   462  N N   . MET A 1 71  ? 4.067   16.364  1.729   1.00 19.67 ? 71  MET A N   1 
ATOM   463  C CA  . MET A 1 71  ? 4.591   17.092  0.611   1.00 20.64 ? 71  MET A CA  1 
ATOM   464  C C   . MET A 1 71  ? 6.072   16.858  0.537   1.00 20.39 ? 71  MET A C   1 
ATOM   465  O O   . MET A 1 71  ? 6.802   17.178  1.488   1.00 20.18 ? 71  MET A O   1 
ATOM   466  C CB  . MET A 1 71  ? 4.292   18.601  0.778   1.00 21.07 ? 71  MET A CB  1 
ATOM   467  C CG  . MET A 1 71  ? 4.953   19.467  -0.253  1.00 23.31 ? 71  MET A CG  1 
ATOM   468  S SD  . MET A 1 71  ? 4.803   21.249  0.148   1.00 28.55 ? 71  MET A SD  1 
ATOM   469  C CE  . MET A 1 71  ? 3.300   21.443  -0.534  1.00 28.75 ? 71  MET A CE  1 
ATOM   470  N N   . LYS A 1 72  ? 6.518   16.294  -0.585  1.00 20.08 ? 72  LYS A N   1 
ATOM   471  C CA  . LYS A 1 72  ? 7.945   16.181  -0.880  1.00 20.22 ? 72  LYS A CA  1 
ATOM   472  C C   . LYS A 1 72  ? 8.417   17.393  -1.594  1.00 20.49 ? 72  LYS A C   1 
ATOM   473  O O   . LYS A 1 72  ? 7.830   17.822  -2.567  1.00 20.75 ? 72  LYS A O   1 
ATOM   474  C CB  . LYS A 1 72  ? 8.216   14.999  -1.758  1.00 20.36 ? 72  LYS A CB  1 
ATOM   475  C CG  . LYS A 1 72  ? 9.615   14.861  -2.198  1.00 21.47 ? 72  LYS A CG  1 
ATOM   476  C CD  . LYS A 1 72  ? 9.860   13.396  -2.698  1.00 22.25 ? 72  LYS A CD  1 
ATOM   477  C CE  . LYS A 1 72  ? 11.223  13.216  -3.376  1.00 22.50 ? 72  LYS A CE  1 
ATOM   478  N NZ  . LYS A 1 72  ? 11.591  11.745  -3.540  1.00 22.66 ? 72  LYS A NZ  1 
ATOM   479  N N   . ILE A 1 73  ? 9.518   17.937  -1.125  1.00 20.80 ? 73  ILE A N   1 
ATOM   480  C CA  . ILE A 1 73  ? 10.127  19.099  -1.735  1.00 20.83 ? 73  ILE A CA  1 
ATOM   481  C C   . ILE A 1 73  ? 11.516  18.679  -2.166  1.00 20.77 ? 73  ILE A C   1 
ATOM   482  O O   . ILE A 1 73  ? 12.251  18.131  -1.388  1.00 20.17 ? 73  ILE A O   1 
ATOM   483  C CB  . ILE A 1 73  ? 10.240  20.230  -0.689  1.00 20.71 ? 73  ILE A CB  1 
ATOM   484  C CG1 . ILE A 1 73  ? 8.892   20.489  -0.033  1.00 22.41 ? 73  ILE A CG1 1 
ATOM   485  C CG2 . ILE A 1 73  ? 10.786  21.513  -1.297  1.00 20.44 ? 73  ILE A CG2 1 
ATOM   486  C CD1 . ILE A 1 73  ? 9.007   20.765  1.427   1.00 25.65 ? 73  ILE A CD1 1 
ATOM   487  N N   . LEU A 1 74  ? 11.857  18.992  -3.411  1.00 22.22 ? 74  LEU A N   1 
ATOM   488  C CA  . LEU A 1 74  ? 13.194  18.880  -3.988  1.00 21.87 ? 74  LEU A CA  1 
ATOM   489  C C   . LEU A 1 74  ? 13.707  20.254  -4.412  1.00 22.17 ? 74  LEU A C   1 
ATOM   490  O O   . LEU A 1 74  ? 13.009  21.044  -5.060  1.00 21.74 ? 74  LEU A O   1 
ATOM   491  C CB  . LEU A 1 74  ? 13.137  18.002  -5.248  1.00 22.84 ? 74  LEU A CB  1 
ATOM   492  C CG  . LEU A 1 74  ? 12.903  16.501  -5.054  1.00 24.27 ? 74  LEU A CG  1 
ATOM   493  C CD1 . LEU A 1 74  ? 12.693  15.875  -6.377  1.00 25.66 ? 74  LEU A CD1 1 
ATOM   494  C CD2 . LEU A 1 74  ? 14.111  15.836  -4.368  1.00 25.57 ? 74  LEU A CD2 1 
ATOM   495  N N   . ASP A 1 75  ? 14.939  20.546  -4.050  1.00 22.70 ? 75  ASP A N   1 
ATOM   496  C CA  . ASP A 1 75  ? 15.601  21.767  -4.476  1.00 23.02 ? 75  ASP A CA  1 
ATOM   497  C C   . ASP A 1 75  ? 16.149  21.519  -5.880  1.00 23.30 ? 75  ASP A C   1 
ATOM   498  O O   . ASP A 1 75  ? 16.946  20.628  -6.056  1.00 24.62 ? 75  ASP A O   1 
ATOM   499  C CB  . ASP A 1 75  ? 16.730  22.059  -3.485  1.00 22.61 ? 75  ASP A CB  1 
ATOM   500  C CG  . ASP A 1 75  ? 17.484  23.296  -3.825  1.00 22.43 ? 75  ASP A CG  1 
ATOM   501  O OD1 . ASP A 1 75  ? 17.841  24.064  -2.937  1.00 25.47 ? 75  ASP A OD1 1 
ATOM   502  O OD2 . ASP A 1 75  ? 17.739  23.611  -4.977  1.00 25.15 ? 75  ASP A OD2 1 
ATOM   503  N N   . LYS A 1 76  ? 15.718  22.275  -6.883  1.00 23.91 ? 76  LYS A N   1 
ATOM   504  C CA  . LYS A 1 76  ? 16.101  21.976  -8.263  1.00 24.13 ? 76  LYS A CA  1 
ATOM   505  C C   . LYS A 1 76  ? 17.619  21.994  -8.463  1.00 24.33 ? 76  LYS A C   1 
ATOM   506  O O   . LYS A 1 76  ? 18.148  21.145  -9.150  1.00 24.57 ? 76  LYS A O   1 
ATOM   507  C CB  . LYS A 1 76  ? 15.493  22.988  -9.215  1.00 25.01 ? 76  LYS A CB  1 
ATOM   508  C CG  . LYS A 1 76  ? 14.021  22.933  -9.333  1.00 24.15 ? 76  LYS A CG  1 
ATOM   509  C CD  . LYS A 1 76  ? 13.529  23.784  -10.469 1.00 26.62 ? 76  LYS A CD  1 
ATOM   510  C CE  . LYS A 1 76  ? 12.630  24.915  -10.002 1.00 27.13 ? 76  LYS A CE  1 
ATOM   511  N NZ  . LYS A 1 76  ? 12.505  26.025  -10.984 1.00 25.48 ? 76  LYS A NZ  1 
ATOM   512  N N   . GLN A 1 77  ? 18.306  22.943  -7.829  1.00 24.56 ? 77  GLN A N   1 
ATOM   513  C CA  . GLN A 1 77  ? 19.769  23.056  -7.896  1.00 24.96 ? 77  GLN A CA  1 
ATOM   514  C C   . GLN A 1 77  ? 20.494  21.872  -7.273  1.00 24.39 ? 77  GLN A C   1 
ATOM   515  O O   . GLN A 1 77  ? 21.474  21.408  -7.809  1.00 23.36 ? 77  GLN A O   1 
ATOM   516  C CB  . GLN A 1 77  ? 20.251  24.360  -7.243  1.00 25.26 ? 77  GLN A CB  1 
ATOM   517  C CG  . GLN A 1 77  ? 19.942  25.570  -8.083  1.00 26.94 ? 77  GLN A CG  1 
ATOM   518  C CD  . GLN A 1 77  ? 20.281  26.880  -7.384  1.00 30.81 ? 77  GLN A CD  1 
ATOM   519  O OE1 . GLN A 1 77  ? 20.393  26.931  -6.164  1.00 32.09 ? 77  GLN A OE1 1 
ATOM   520  N NE2 . GLN A 1 77  ? 20.447  27.932  -8.161  1.00 31.38 ? 77  GLN A NE2 1 
ATOM   521  N N   . LYS A 1 78  ? 19.996  21.385  -6.152  1.00 24.37 ? 78  LYS A N   1 
ATOM   522  C CA  . LYS A 1 78  ? 20.536  20.172  -5.562  1.00 24.70 ? 78  LYS A CA  1 
ATOM   523  C C   . LYS A 1 78  ? 20.294  18.937  -6.408  1.00 24.13 ? 78  LYS A C   1 
ATOM   524  O O   . LYS A 1 78  ? 21.143  18.049  -6.466  1.00 24.25 ? 78  LYS A O   1 
ATOM   525  C CB  . LYS A 1 78  ? 19.965  19.981  -4.172  1.00 25.25 ? 78  LYS A CB  1 
ATOM   526  C CG  . LYS A 1 78  ? 20.464  21.070  -3.216  1.00 26.70 ? 78  LYS A CG  1 
ATOM   527  C CD  . LYS A 1 78  ? 20.061  20.792  -1.800  1.00 29.28 ? 78  LYS A CD  1 
ATOM   528  C CE  . LYS A 1 78  ? 20.727  21.791  -0.872  1.00 32.01 ? 78  LYS A CE  1 
ATOM   529  N NZ  . LYS A 1 78  ? 20.357  21.387  0.469   1.00 31.54 ? 78  LYS A NZ  1 
ATOM   530  N N   . VAL A 1 79  ? 19.151  18.891  -7.085  1.00 23.70 ? 79  VAL A N   1 
ATOM   531  C CA  . VAL A 1 79  ? 18.884  17.803  -8.004  1.00 23.48 ? 79  VAL A CA  1 
ATOM   532  C C   . VAL A 1 79  ? 19.869  17.833  -9.190  1.00 23.74 ? 79  VAL A C   1 
ATOM   533  O O   . VAL A 1 79  ? 20.401  16.813  -9.594  1.00 21.72 ? 79  VAL A O   1 
ATOM   534  C CB  . VAL A 1 79  ? 17.473  17.875  -8.498  1.00 23.11 ? 79  VAL A CB  1 
ATOM   535  C CG1 . VAL A 1 79  ? 17.260  16.879  -9.659  1.00 23.60 ? 79  VAL A CG1 1 
ATOM   536  C CG2 . VAL A 1 79  ? 16.519  17.614  -7.347  1.00 21.41 ? 79  VAL A CG2 1 
ATOM   537  N N   . VAL A 1 80  ? 20.120  19.022  -9.723  1.00 24.55 ? 80  VAL A N   1 
ATOM   538  C CA  . VAL A 1 80  ? 21.054  19.149  -10.826 1.00 25.21 ? 80  VAL A CA  1 
ATOM   539  C C   . VAL A 1 80  ? 22.462  18.676  -10.364 1.00 25.93 ? 80  VAL A C   1 
ATOM   540  O O   . VAL A 1 80  ? 23.098  17.851  -11.030 1.00 25.50 ? 80  VAL A O   1 
ATOM   541  C CB  . VAL A 1 80  ? 21.053  20.590  -11.417 1.00 25.65 ? 80  VAL A CB  1 
ATOM   542  C CG1 . VAL A 1 80  ? 22.326  20.831  -12.295 1.00 26.04 ? 80  VAL A CG1 1 
ATOM   543  C CG2 . VAL A 1 80  ? 19.754  20.856  -12.219 1.00 25.12 ? 80  VAL A CG2 1 
ATOM   544  N N   . LYS A 1 81  ? 22.938  19.169  -9.221  1.00 26.07 ? 81  LYS A N   1 
ATOM   545  C CA  . LYS A 1 81  ? 24.276  18.788  -8.730  1.00 27.03 ? 81  LYS A CA  1 
ATOM   546  C C   . LYS A 1 81  ? 24.422  17.305  -8.532  1.00 25.94 ? 81  LYS A C   1 
ATOM   547  O O   . LYS A 1 81  ? 25.489  16.753  -8.737  1.00 27.31 ? 81  LYS A O   1 
ATOM   548  C CB  . LYS A 1 81  ? 24.622  19.508  -7.434  1.00 27.62 ? 81  LYS A CB  1 
ATOM   549  C CG  . LYS A 1 81  ? 24.882  20.999  -7.640  1.00 31.65 ? 81  LYS A CG  1 
ATOM   550  C CD  . LYS A 1 81  ? 25.130  21.762  -6.293  1.00 35.91 ? 81  LYS A CD  1 
ATOM   551  C CE  . LYS A 1 81  ? 26.142  22.932  -6.465  1.00 37.99 ? 81  LYS A CE  1 
ATOM   552  N NZ  . LYS A 1 81  ? 26.651  23.395  -5.117  1.00 41.14 ? 81  LYS A NZ  1 
ATOM   553  N N   . LEU A 1 82  ? 23.340  16.636  -8.178  1.00 25.50 ? 82  LEU A N   1 
ATOM   554  C CA  . LEU A 1 82  ? 23.398  15.209  -7.911  1.00 25.11 ? 82  LEU A CA  1 
ATOM   555  C C   . LEU A 1 82  ? 23.128  14.346  -9.137  1.00 24.02 ? 82  LEU A C   1 
ATOM   556  O O   . LEU A 1 82  ? 23.082  13.106  -9.044  1.00 23.08 ? 82  LEU A O   1 
ATOM   557  C CB  . LEU A 1 82  ? 22.451  14.875  -6.766  1.00 25.50 ? 82  LEU A CB  1 
ATOM   558  C CG  . LEU A 1 82  ? 22.949  15.480  -5.459  1.00 28.31 ? 82  LEU A CG  1 
ATOM   559  C CD1 . LEU A 1 82  ? 21.850  15.565  -4.361  1.00 29.43 ? 82  LEU A CD1 1 
ATOM   560  C CD2 . LEU A 1 82  ? 24.155  14.608  -5.003  1.00 30.20 ? 82  LEU A CD2 1 
ATOM   561  N N   . LYS A 1 83  ? 22.993  14.996  -10.280 1.00 23.93 ? 83  LYS A N   1 
ATOM   562  C CA  . LYS A 1 83  ? 22.737  14.326  -11.557 1.00 24.92 ? 83  LYS A CA  1 
ATOM   563  C C   . LYS A 1 83  ? 21.479  13.471  -11.438 1.00 23.91 ? 83  LYS A C   1 
ATOM   564  O O   . LYS A 1 83  ? 21.411  12.342  -11.903 1.00 23.46 ? 83  LYS A O   1 
ATOM   565  C CB  . LYS A 1 83  ? 23.970  13.493  -12.003 1.00 25.78 ? 83  LYS A CB  1 
ATOM   566  C CG  . LYS A 1 83  ? 25.307  14.351  -12.085 1.00 29.55 ? 83  LYS A CG  1 
ATOM   567  C CD  . LYS A 1 83  ? 26.589  13.510  -12.488 1.00 33.01 ? 83  LYS A CD  1 
ATOM   568  C CE  . LYS A 1 83  ? 26.619  12.094  -11.811 1.00 36.31 ? 83  LYS A CE  1 
ATOM   569  N NZ  . LYS A 1 83  ? 27.965  11.398  -11.739 1.00 37.00 ? 83  LYS A NZ  1 
ATOM   570  N N   . GLN A 1 84  ? 20.467  14.036  -10.807 1.00 24.04 ? 84  GLN A N   1 
ATOM   571  C CA  . GLN A 1 84  ? 19.206  13.355  -10.673 1.00 23.87 ? 84  GLN A CA  1 
ATOM   572  C C   . GLN A 1 84  ? 18.090  13.979  -11.490 1.00 23.19 ? 84  GLN A C   1 
ATOM   573  O O   . GLN A 1 84  ? 16.924  13.719  -11.247 1.00 23.20 ? 84  GLN A O   1 
ATOM   574  C CB  . GLN A 1 84  ? 18.867  13.279  -9.219  1.00 24.01 ? 84  GLN A CB  1 
ATOM   575  C CG  . GLN A 1 84  ? 19.905  12.534  -8.420  1.00 24.38 ? 84  GLN A CG  1 
ATOM   576  C CD  . GLN A 1 84  ? 20.047  11.090  -8.875  1.00 27.53 ? 84  GLN A CD  1 
ATOM   577  O OE1 . GLN A 1 84  ? 19.040  10.336  -8.932  1.00 27.93 ? 84  GLN A OE1 1 
ATOM   578  N NE2 . GLN A 1 84  ? 21.281  10.677  -9.145  1.00 24.57 ? 84  GLN A NE2 1 
ATOM   579  N N   . ILE A 1 85  ? 18.445  14.759  -12.494 1.00 23.03 ? 85  ILE A N   1 
ATOM   580  C CA  . ILE A 1 85  ? 17.433  15.418  -13.300 1.00 23.40 ? 85  ILE A CA  1 
ATOM   581  C C   . ILE A 1 85  ? 16.487  14.389  -13.904 1.00 22.82 ? 85  ILE A C   1 
ATOM   582  O O   . ILE A 1 85  ? 15.293  14.403  -13.652 1.00 21.51 ? 85  ILE A O   1 
ATOM   583  C CB  . ILE A 1 85  ? 18.037  16.310  -14.402 1.00 23.54 ? 85  ILE A CB  1 
ATOM   584  C CG1 . ILE A 1 85  ? 18.967  17.382  -13.805 1.00 24.91 ? 85  ILE A CG1 1 
ATOM   585  C CG2 . ILE A 1 85  ? 16.910  17.069  -15.119 1.00 24.53 ? 85  ILE A CG2 1 
ATOM   586  C CD1 . ILE A 1 85  ? 19.862  18.154  -14.882 1.00 24.82 ? 85  ILE A CD1 1 
ATOM   587  N N   . GLU A 1 86  ? 17.025  13.472  -14.690 1.00 23.58 ? 86  GLU A N   1 
ATOM   588  C CA  . GLU A 1 86  ? 16.164  12.558  -15.445 1.00 24.43 ? 86  GLU A CA  1 
ATOM   589  C C   . GLU A 1 86  ? 15.402  11.653  -14.471 1.00 23.72 ? 86  GLU A C   1 
ATOM   590  O O   . GLU A 1 86  ? 14.219  11.370  -14.682 1.00 24.38 ? 86  GLU A O   1 
ATOM   591  C CB  . GLU A 1 86  ? 16.970  11.770  -16.515 1.00 25.21 ? 86  GLU A CB  1 
ATOM   592  C CG  . GLU A 1 86  ? 16.140  10.916  -17.456 1.00 27.54 ? 86  GLU A CG  1 
ATOM   593  C CD  . GLU A 1 86  ? 15.400  11.720  -18.536 1.00 28.93 ? 86  GLU A CD  1 
ATOM   594  O OE1 . GLU A 1 86  ? 15.859  12.807  -18.934 1.00 30.42 ? 86  GLU A OE1 1 
ATOM   595  O OE2 . GLU A 1 86  ? 14.350  11.253  -18.981 1.00 29.40 ? 86  GLU A OE2 1 
ATOM   596  N N   . HIS A 1 87  ? 16.040  11.259  -13.381 1.00 21.96 ? 87  HIS A N   1 
ATOM   597  C CA  . HIS A 1 87  ? 15.389  10.392  -12.407 1.00 22.06 ? 87  HIS A CA  1 
ATOM   598  C C   . HIS A 1 87  ? 14.188  11.103  -11.729 1.00 20.98 ? 87  HIS A C   1 
ATOM   599  O O   . HIS A 1 87  ? 13.199  10.447  -11.397 1.00 21.12 ? 87  HIS A O   1 
ATOM   600  C CB  . HIS A 1 87  ? 16.380  9.908   -11.317 1.00 22.05 ? 87  HIS A CB  1 
ATOM   601  C CG  . HIS A 1 87  ? 17.329  8.849   -11.775 1.00 23.60 ? 87  HIS A CG  1 
ATOM   602  N ND1 . HIS A 1 87  ? 18.599  8.705   -11.244 1.00 24.27 ? 87  HIS A ND1 1 
ATOM   603  C CD2 . HIS A 1 87  ? 17.188  7.852   -12.682 1.00 24.55 ? 87  HIS A CD2 1 
ATOM   604  C CE1 . HIS A 1 87  ? 19.205  7.689   -11.830 1.00 23.27 ? 87  HIS A CE1 1 
ATOM   605  N NE2 . HIS A 1 87  ? 18.367  7.146   -12.697 1.00 23.13 ? 87  HIS A NE2 1 
ATOM   606  N N   . THR A 1 88  ? 14.313  12.417  -11.516 1.00 19.00 ? 88  THR A N   1 
ATOM   607  C CA  . THR A 1 88  ? 13.305  13.203  -10.862 1.00 18.36 ? 88  THR A CA  1 
ATOM   608  C C   . THR A 1 88  ? 12.113  13.367  -11.782 1.00 18.45 ? 88  THR A C   1 
ATOM   609  O O   . THR A 1 88  ? 10.998  13.338  -11.347 1.00 18.05 ? 88  THR A O   1 
ATOM   610  C CB  . THR A 1 88  ? 13.900  14.564  -10.421 1.00 18.44 ? 88  THR A CB  1 
ATOM   611  O OG1 . THR A 1 88  ? 14.880  14.347  -9.380  1.00 16.69 ? 88  THR A OG1 1 
ATOM   612  C CG2 . THR A 1 88  ? 12.844  15.445  -9.733  1.00 18.31 ? 88  THR A CG2 1 
ATOM   613  N N   . LEU A 1 89  ? 12.371  13.504  -13.074 1.00 19.30 ? 89  LEU A N   1 
ATOM   614  C CA  . LEU A 1 89  ? 11.327  13.560  -14.079 1.00 19.04 ? 89  LEU A CA  1 
ATOM   615  C C   . LEU A 1 89  ? 10.639  12.198  -14.196 1.00 18.57 ? 89  LEU A C   1 
ATOM   616  O O   . LEU A 1 89  ? 9.419   12.150  -14.286 1.00 18.40 ? 89  LEU A O   1 
ATOM   617  C CB  . LEU A 1 89  ? 11.918  13.978  -15.431 1.00 18.51 ? 89  LEU A CB  1 
ATOM   618  C CG  . LEU A 1 89  ? 12.568  15.376  -15.368 1.00 21.07 ? 89  LEU A CG  1 
ATOM   619  C CD1 . LEU A 1 89  ? 13.135  15.774  -16.690 1.00 20.12 ? 89  LEU A CD1 1 
ATOM   620  C CD2 . LEU A 1 89  ? 11.598  16.420  -14.887 1.00 22.83 ? 89  LEU A CD2 1 
ATOM   621  N N   . ASN A 1 90  ? 11.410  11.111  -14.176 1.00 17.81 ? 90  ASN A N   1 
ATOM   622  C CA  . ASN A 1 90  ? 10.841  9.761   -14.084 1.00 18.32 ? 90  ASN A CA  1 
ATOM   623  C C   . ASN A 1 90  ? 9.867   9.653   -12.919 1.00 18.85 ? 90  ASN A C   1 
ATOM   624  O O   . ASN A 1 90  ? 8.770   9.156   -13.067 1.00 18.83 ? 90  ASN A O   1 
ATOM   625  C CB  . ASN A 1 90  ? 11.920  8.703   -13.791 1.00 18.39 ? 90  ASN A CB  1 
ATOM   626  C CG  . ASN A 1 90  ? 12.848  8.421   -14.958 1.00 19.47 ? 90  ASN A CG  1 
ATOM   627  O OD1 . ASN A 1 90  ? 12.560  8.749   -16.119 1.00 21.04 ? 90  ASN A OD1 1 
ATOM   628  N ND2 . ASN A 1 90  ? 13.944  7.710   -14.657 1.00 19.36 ? 90  ASN A ND2 1 
ATOM   629  N N   . GLU A 1 91  ? 10.355  10.020  -11.729 1.00 19.75 ? 91  GLU A N   1 
ATOM   630  C CA  . GLU A 1 91  ? 9.650   9.875   -10.474 1.00 19.70 ? 91  GLU A CA  1 
ATOM   631  C C   . GLU A 1 91  ? 8.250   10.503  -10.531 1.00 20.77 ? 91  GLU A C   1 
ATOM   632  O O   . GLU A 1 91  ? 7.227   9.874   -10.188 1.00 21.25 ? 91  GLU A O   1 
ATOM   633  C CB  . GLU A 1 91  ? 10.447  10.569  -9.378  1.00 19.93 ? 91  GLU A CB  1 
ATOM   634  C CG  . GLU A 1 91  ? 9.633   10.751  -8.098  1.00 18.78 ? 91  GLU A CG  1 
ATOM   635  C CD  . GLU A 1 91  ? 10.476  11.228  -6.954  1.00 18.09 ? 91  GLU A CD  1 
ATOM   636  O OE1 . GLU A 1 91  ? 11.600  11.681  -7.191  1.00 18.84 ? 91  GLU A OE1 1 
ATOM   637  O OE2 . GLU A 1 91  ? 10.019  11.155  -5.818  1.00 18.29 ? 91  GLU A OE2 1 
ATOM   638  N N   . LYS A 1 92  ? 8.196   11.744  -10.984 1.00 20.60 ? 92  LYS A N   1 
ATOM   639  C CA  . LYS A 1 92  ? 6.942   12.475  -10.982 1.00 19.98 ? 92  LYS A CA  1 
ATOM   640  C C   . LYS A 1 92  ? 6.045   11.974  -12.159 1.00 20.69 ? 92  LYS A C   1 
ATOM   641  O O   . LYS A 1 92  ? 4.830   11.754  -11.999 1.00 20.46 ? 92  LYS A O   1 
ATOM   642  C CB  . LYS A 1 92  ? 7.215   13.977  -11.019 1.00 19.45 ? 92  LYS A CB  1 
ATOM   643  C CG  . LYS A 1 92  ? 5.920   14.846  -11.200 1.00 19.35 ? 92  LYS A CG  1 
ATOM   644  C CD  . LYS A 1 92  ? 5.774   15.266  -12.659 1.00 17.57 ? 92  LYS A CD  1 
ATOM   645  C CE  . LYS A 1 92  ? 4.422   15.821  -12.981 1.00 19.69 ? 92  LYS A CE  1 
ATOM   646  N NZ  . LYS A 1 92  ? 4.435   16.574  -14.291 1.00 16.00 ? 92  LYS A NZ  1 
ATOM   647  N N   . ARG A 1 93  ? 6.634   11.755  -13.322 1.00 20.97 ? 93  ARG A N   1 
ATOM   648  C CA  . ARG A 1 93  ? 5.866   11.284  -14.466 1.00 20.97 ? 93  ARG A CA  1 
ATOM   649  C C   . ARG A 1 93  ? 5.259   9.895   -14.175 1.00 21.61 ? 93  ARG A C   1 
ATOM   650  O O   . ARG A 1 93  ? 4.081   9.653   -14.455 1.00 20.97 ? 93  ARG A O   1 
ATOM   651  C CB  . ARG A 1 93  ? 6.764   11.233  -15.689 1.00 21.36 ? 93  ARG A CB  1 
ATOM   652  C CG  . ARG A 1 93  ? 6.032   10.760  -16.921 1.00 22.39 ? 93  ARG A CG  1 
ATOM   653  C CD  . ARG A 1 93  ? 6.847   10.853  -18.137 1.00 23.22 ? 93  ARG A CD  1 
ATOM   654  N NE  . ARG A 1 93  ? 6.087   10.502  -19.317 1.00 24.28 ? 93  ARG A NE  1 
ATOM   655  C CZ  . ARG A 1 93  ? 6.598   10.468  -20.554 1.00 24.80 ? 93  ARG A CZ  1 
ATOM   656  N NH1 . ARG A 1 93  ? 7.885   10.728  -20.764 1.00 25.30 ? 93  ARG A NH1 1 
ATOM   657  N NH2 . ARG A 1 93  ? 5.827   10.144  -21.574 1.00 23.50 ? 93  ARG A NH2 1 
ATOM   658  N N   . ILE A 1 94  ? 6.054   8.995   -13.576 1.00 21.25 ? 94  ILE A N   1 
ATOM   659  C CA  . ILE A 1 94  ? 5.536   7.677   -13.132 1.00 21.50 ? 94  ILE A CA  1 
ATOM   660  C C   . ILE A 1 94  ? 4.481   7.752   -12.042 1.00 21.16 ? 94  ILE A C   1 
ATOM   661  O O   . ILE A 1 94  ? 3.445   7.093   -12.138 1.00 21.30 ? 94  ILE A O   1 
ATOM   662  C CB  . ILE A 1 94  ? 6.696   6.752   -12.688 1.00 21.47 ? 94  ILE A CB  1 
ATOM   663  C CG1 . ILE A 1 94  ? 7.519   6.366   -13.921 1.00 21.60 ? 94  ILE A CG1 1 
ATOM   664  C CG2 . ILE A 1 94  ? 6.196   5.544   -11.946 1.00 20.59 ? 94  ILE A CG2 1 
ATOM   665  C CD1 . ILE A 1 94  ? 8.901   5.985   -13.615 1.00 22.86 ? 94  ILE A CD1 1 
ATOM   666  N N   . LEU A 1 95  ? 4.741   8.539   -11.009 1.00 21.47 ? 95  LEU A N   1 
ATOM   667  C CA  . LEU A 1 95  ? 3.863   8.565   -9.821  1.00 22.02 ? 95  LEU A CA  1 
ATOM   668  C C   . LEU A 1 95  ? 2.470   9.144   -10.144 1.00 21.60 ? 95  LEU A C   1 
ATOM   669  O O   . LEU A 1 95  ? 1.438   8.670   -9.636  1.00 21.72 ? 95  LEU A O   1 
ATOM   670  C CB  . LEU A 1 95  ? 4.504   9.349   -8.676  1.00 21.99 ? 95  LEU A CB  1 
ATOM   671  C CG  . LEU A 1 95  ? 4.445   8.842   -7.231  1.00 23.64 ? 95  LEU A CG  1 
ATOM   672  C CD1 . LEU A 1 95  ? 4.463   10.006  -6.252  1.00 24.16 ? 95  LEU A CD1 1 
ATOM   673  C CD2 . LEU A 1 95  ? 3.292   7.946   -6.964  1.00 26.20 ? 95  LEU A CD2 1 
ATOM   674  N N   . GLN A 1 96  ? 2.452   10.181  -10.968 1.00 21.50 ? 96  GLN A N   1 
ATOM   675  C CA  . GLN A 1 96  ? 1.197   10.764  -11.415 1.00 21.58 ? 96  GLN A CA  1 
ATOM   676  C C   . GLN A 1 96  ? 0.393   9.807   -12.301 1.00 22.04 ? 96  GLN A C   1 
ATOM   677  O O   . GLN A 1 96  ? -0.824  9.968   -12.427 1.00 22.56 ? 96  GLN A O   1 
ATOM   678  C CB  . GLN A 1 96  ? 1.410   12.103  -12.125 1.00 20.85 ? 96  GLN A CB  1 
ATOM   679  C CG  . GLN A 1 96  ? 2.223   12.086  -13.433 1.00 22.41 ? 96  GLN A CG  1 
ATOM   680  C CD  . GLN A 1 96  ? 1.402   11.825  -14.696 1.00 23.12 ? 96  GLN A CD  1 
ATOM   681  O OE1 . GLN A 1 96  ? 0.229   12.159  -14.735 1.00 25.47 ? 96  GLN A OE1 1 
ATOM   682  N NE2 . GLN A 1 96  ? 2.012   11.191  -15.710 1.00 18.98 ? 96  GLN A NE2 1 
ATOM   683  N N   . ALA A 1 97  ? 1.054   8.825   -12.917 1.00 22.05 ? 97  ALA A N   1 
ATOM   684  C CA  . ALA A 1 97  ? 0.377   7.921   -13.848 1.00 22.51 ? 97  ALA A CA  1 
ATOM   685  C C   . ALA A 1 97  ? -0.146  6.639   -13.233 1.00 22.70 ? 97  ALA A C   1 
ATOM   686  O O   . ALA A 1 97  ? -1.025  5.987   -13.798 1.00 22.16 ? 97  ALA A O   1 
ATOM   687  C CB  . ALA A 1 97  ? 1.294   7.612   -15.071 1.00 22.89 ? 97  ALA A CB  1 
ATOM   688  N N   . VAL A 1 98  ? 0.376   6.252   -12.077 1.00 22.99 ? 98  VAL A N   1 
ATOM   689  C CA  . VAL A 1 98  ? 0.055   4.938   -11.570 1.00 23.19 ? 98  VAL A CA  1 
ATOM   690  C C   . VAL A 1 98  ? -1.149  4.996   -10.620 1.00 24.32 ? 98  VAL A C   1 
ATOM   691  O O   . VAL A 1 98  ? -1.605  6.073   -10.210 1.00 25.10 ? 98  VAL A O   1 
ATOM   692  C CB  . VAL A 1 98  ? 1.246   4.253   -10.873 1.00 23.20 ? 98  VAL A CB  1 
ATOM   693  C CG1 . VAL A 1 98  ? 2.341   3.940   -11.843 1.00 23.07 ? 98  VAL A CG1 1 
ATOM   694  C CG2 . VAL A 1 98  ? 1.727   5.052   -9.643  1.00 22.91 ? 98  VAL A CG2 1 
ATOM   695  N N   . ASN A 1 99  ? -1.622  3.823   -10.243 1.00 25.27 ? 99  ASN A N   1 
ATOM   696  C CA  . ASN A 1 99  ? -2.837  3.695   -9.458  1.00 26.93 ? 99  ASN A CA  1 
ATOM   697  C C   . ASN A 1 99  ? -2.941  2.244   -9.019  1.00 26.33 ? 99  ASN A C   1 
ATOM   698  O O   . ASN A 1 99  ? -3.243  1.384   -9.819  1.00 26.31 ? 99  ASN A O   1 
ATOM   699  C CB  . ASN A 1 99  ? -4.064  4.098   -10.309 1.00 27.82 ? 99  ASN A CB  1 
ATOM   700  C CG  . ASN A 1 99  ? -5.395  3.746   -9.632  1.00 30.54 ? 99  ASN A CG  1 
ATOM   701  O OD1 . ASN A 1 99  ? -5.593  4.004   -8.440  1.00 32.74 ? 99  ASN A OD1 1 
ATOM   702  N ND2 . ASN A 1 99  ? -6.298  3.140   -10.393 1.00 31.61 ? 99  ASN A ND2 1 
ATOM   703  N N   . PHE A 1 100 ? -2.633  1.989   -7.757  1.00 26.73 ? 100 PHE A N   1 
ATOM   704  C CA  . PHE A 1 100 ? -2.720  0.647   -7.187  1.00 26.88 ? 100 PHE A CA  1 
ATOM   705  C C   . PHE A 1 100 ? -2.860  0.801   -5.661  1.00 26.42 ? 100 PHE A C   1 
ATOM   706  O O   . PHE A 1 100 ? -2.273  1.711   -5.088  1.00 24.68 ? 100 PHE A O   1 
ATOM   707  C CB  . PHE A 1 100 ? -1.463  -0.173  -7.583  1.00 27.83 ? 100 PHE A CB  1 
ATOM   708  C CG  . PHE A 1 100 ? -1.624  -1.674  -7.444  1.00 26.17 ? 100 PHE A CG  1 
ATOM   709  C CD1 . PHE A 1 100 ? -2.478  -2.376  -8.289  1.00 26.03 ? 100 PHE A CD1 1 
ATOM   710  C CD2 . PHE A 1 100 ? -0.913  -2.368  -6.483  1.00 26.27 ? 100 PHE A CD2 1 
ATOM   711  C CE1 . PHE A 1 100 ? -2.628  -3.768  -8.175  1.00 28.81 ? 100 PHE A CE1 1 
ATOM   712  C CE2 . PHE A 1 100 ? -1.046  -3.764  -6.357  1.00 28.23 ? 100 PHE A CE2 1 
ATOM   713  C CZ  . PHE A 1 100 ? -1.913  -4.472  -7.208  1.00 26.88 ? 100 PHE A CZ  1 
ATOM   714  N N   . PRO A 1 101 ? -3.649  -0.058  -5.007  1.00 26.70 ? 101 PRO A N   1 
ATOM   715  C CA  . PRO A 1 101 ? -3.955  0.112   -3.588  1.00 27.15 ? 101 PRO A CA  1 
ATOM   716  C C   . PRO A 1 101 ? -2.723  0.297   -2.698  1.00 27.32 ? 101 PRO A C   1 
ATOM   717  O O   . PRO A 1 101 ? -2.846  1.012   -1.697  1.00 28.81 ? 101 PRO A O   1 
ATOM   718  C CB  . PRO A 1 101 ? -4.639  -1.213  -3.236  1.00 27.13 ? 101 PRO A CB  1 
ATOM   719  C CG  . PRO A 1 101 ? -5.282  -1.631  -4.485  1.00 27.19 ? 101 PRO A CG  1 
ATOM   720  C CD  . PRO A 1 101 ? -4.321  -1.261  -5.524  1.00 27.26 ? 101 PRO A CD  1 
ATOM   721  N N   . PHE A 1 102 ? -1.589  -0.328  -3.043  1.00 25.57 ? 102 PHE A N   1 
ATOM   722  C CA  . PHE A 1 102 ? -0.410  -0.279  -2.204  1.00 25.08 ? 102 PHE A CA  1 
ATOM   723  C C   . PHE A 1 102 ? 0.687   0.690   -2.736  1.00 25.62 ? 102 PHE A C   1 
ATOM   724  O O   . PHE A 1 102 ? 1.871   0.577   -2.348  1.00 25.57 ? 102 PHE A O   1 
ATOM   725  C CB  . PHE A 1 102 ? 0.117   -1.701  -1.984  1.00 24.64 ? 102 PHE A CB  1 
ATOM   726  C CG  . PHE A 1 102 ? -0.987  -2.717  -1.723  1.00 24.34 ? 102 PHE A CG  1 
ATOM   727  C CD1 . PHE A 1 102 ? -1.924  -2.504  -0.720  1.00 25.97 ? 102 PHE A CD1 1 
ATOM   728  C CD2 . PHE A 1 102 ? -1.106  -3.852  -2.505  1.00 26.01 ? 102 PHE A CD2 1 
ATOM   729  C CE1 . PHE A 1 102 ? -2.948  -3.422  -0.492  1.00 28.91 ? 102 PHE A CE1 1 
ATOM   730  C CE2 . PHE A 1 102 ? -2.110  -4.774  -2.284  1.00 27.11 ? 102 PHE A CE2 1 
ATOM   731  C CZ  . PHE A 1 102 ? -3.034  -4.567  -1.273  1.00 26.80 ? 102 PHE A CZ  1 
ATOM   732  N N   . LEU A 1 103 ? 0.294   1.632   -3.604  1.00 24.22 ? 103 LEU A N   1 
ATOM   733  C CA  . LEU A 1 103 ? 1.182   2.699   -4.044  1.00 23.74 ? 103 LEU A CA  1 
ATOM   734  C C   . LEU A 1 103 ? 0.658   3.975   -3.468  1.00 23.41 ? 103 LEU A C   1 
ATOM   735  O O   . LEU A 1 103 ? -0.504  4.243   -3.616  1.00 23.34 ? 103 LEU A O   1 
ATOM   736  C CB  . LEU A 1 103 ? 1.188   2.845   -5.553  1.00 23.03 ? 103 LEU A CB  1 
ATOM   737  C CG  . LEU A 1 103 ? 1.759   1.696   -6.337  1.00 22.39 ? 103 LEU A CG  1 
ATOM   738  C CD1 . LEU A 1 103 ? 1.721   1.999   -7.852  1.00 21.30 ? 103 LEU A CD1 1 
ATOM   739  C CD2 . LEU A 1 103 ? 3.200   1.336   -5.865  1.00 22.52 ? 103 LEU A CD2 1 
ATOM   740  N N   . VAL A 1 104 ? 1.515   4.749   -2.806  1.00 22.97 ? 104 VAL A N   1 
ATOM   741  C CA  . VAL A 1 104 ? 1.130   6.040   -2.281  1.00 22.73 ? 104 VAL A CA  1 
ATOM   742  C C   . VAL A 1 104 ? 0.595   6.867   -3.435  1.00 23.54 ? 104 VAL A C   1 
ATOM   743  O O   . VAL A 1 104 ? 1.141   6.819   -4.551  1.00 25.15 ? 104 VAL A O   1 
ATOM   744  C CB  . VAL A 1 104 ? 2.313   6.768   -1.595  1.00 23.54 ? 104 VAL A CB  1 
ATOM   745  C CG1 . VAL A 1 104 ? 3.253   7.457   -2.638  1.00 24.04 ? 104 VAL A CG1 1 
ATOM   746  C CG2 . VAL A 1 104 ? 1.811   7.777   -0.592  1.00 23.22 ? 104 VAL A CG2 1 
ATOM   747  N N   . LYS A 1 105 ? -0.485  7.596   -3.186  1.00 23.19 ? 105 LYS A N   1 
ATOM   748  C CA  . LYS A 1 105 ? -1.113  8.439   -4.204  1.00 24.09 ? 105 LYS A CA  1 
ATOM   749  C C   . LYS A 1 105 ? -0.568  9.872   -4.288  1.00 23.32 ? 105 LYS A C   1 
ATOM   750  O O   . LYS A 1 105 ? -0.467  10.586  -3.287  1.00 22.38 ? 105 LYS A O   1 
ATOM   751  C CB  . LYS A 1 105 ? -2.636  8.483   -3.973  1.00 24.74 ? 105 LYS A CB  1 
ATOM   752  C CG  . LYS A 1 105 ? -3.464  9.010   -5.146  1.00 29.01 ? 105 LYS A CG  1 
ATOM   753  C CD  . LYS A 1 105 ? -4.944  8.615   -4.987  1.00 34.14 ? 105 LYS A CD  1 
ATOM   754  C CE  . LYS A 1 105 ? -5.874  9.379   -5.954  1.00 37.56 ? 105 LYS A CE  1 
ATOM   755  N NZ  . LYS A 1 105 ? -7.198  9.667   -5.266  1.00 40.52 ? 105 LYS A NZ  1 
ATOM   756  N N   . LEU A 1 106 ? -0.232  10.293  -5.501  1.00 23.16 ? 106 LEU A N   1 
ATOM   757  C CA  . LEU A 1 106 ? 0.124   11.658  -5.749  1.00 23.84 ? 106 LEU A CA  1 
ATOM   758  C C   . LEU A 1 106 ? -1.159  12.441  -5.993  1.00 24.42 ? 106 LEU A C   1 
ATOM   759  O O   . LEU A 1 106 ? -1.928  12.133  -6.878  1.00 26.77 ? 106 LEU A O   1 
ATOM   760  C CB  . LEU A 1 106 ? 1.064   11.782  -6.935  1.00 24.11 ? 106 LEU A CB  1 
ATOM   761  C CG  . LEU A 1 106 ? 1.618   13.204  -7.154  1.00 22.48 ? 106 LEU A CG  1 
ATOM   762  C CD1 . LEU A 1 106 ? 2.581   13.628  -6.039  1.00 21.64 ? 106 LEU A CD1 1 
ATOM   763  C CD2 . LEU A 1 106 ? 2.292   13.303  -8.508  1.00 22.90 ? 106 LEU A CD2 1 
ATOM   764  N N   . GLU A 1 107 ? -1.395  13.434  -5.168  1.00 24.30 ? 107 GLU A N   1 
ATOM   765  C CA  . GLU A 1 107 ? -2.584  14.276  -5.246  1.00 24.17 ? 107 GLU A CA  1 
ATOM   766  C C   . GLU A 1 107 ? -2.334  15.522  -6.093  1.00 23.94 ? 107 GLU A C   1 
ATOM   767  O O   . GLU A 1 107 ? -3.179  15.878  -6.899  1.00 24.72 ? 107 GLU A O   1 
ATOM   768  C CB  . GLU A 1 107 ? -3.002  14.670  -3.818  1.00 24.10 ? 107 GLU A CB  1 
ATOM   769  C CG  . GLU A 1 107 ? -3.244  13.455  -2.921  1.00 25.13 ? 107 GLU A CG  1 
ATOM   770  C CD  . GLU A 1 107 ? -4.588  12.817  -3.153  1.00 28.31 ? 107 GLU A CD  1 
ATOM   771  O OE1 . GLU A 1 107 ? -5.241  13.137  -4.173  1.00 31.07 ? 107 GLU A OE1 1 
ATOM   772  O OE2 . GLU A 1 107 ? -4.989  11.986  -2.310  1.00 32.15 ? 107 GLU A OE2 1 
ATOM   773  N N   . PHE A 1 108 ? -1.188  16.175  -5.893  1.00 23.57 ? 108 PHE A N   1 
ATOM   774  C CA  . PHE A 1 108 ? -0.783  17.376  -6.656  1.00 24.07 ? 108 PHE A CA  1 
ATOM   775  C C   . PHE A 1 108 ? 0.723   17.417  -6.883  1.00 23.11 ? 108 PHE A C   1 
ATOM   776  O O   . PHE A 1 108 ? 1.482   16.831  -6.141  1.00 22.81 ? 108 PHE A O   1 
ATOM   777  C CB  . PHE A 1 108 ? -1.164  18.673  -5.917  1.00 24.60 ? 108 PHE A CB  1 
ATOM   778  C CG  . PHE A 1 108 ? -2.540  18.646  -5.294  1.00 27.80 ? 108 PHE A CG  1 
ATOM   779  C CD1 . PHE A 1 108 ? -3.704  18.814  -6.095  1.00 29.42 ? 108 PHE A CD1 1 
ATOM   780  C CD2 . PHE A 1 108 ? -2.687  18.455  -3.912  1.00 28.88 ? 108 PHE A CD2 1 
ATOM   781  C CE1 . PHE A 1 108 ? -4.997  18.775  -5.505  1.00 31.65 ? 108 PHE A CE1 1 
ATOM   782  C CE2 . PHE A 1 108 ? -3.957  18.421  -3.311  1.00 30.06 ? 108 PHE A CE2 1 
ATOM   783  C CZ  . PHE A 1 108 ? -5.127  18.578  -4.107  1.00 30.70 ? 108 PHE A CZ  1 
ATOM   784  N N   . SER A 1 109 ? 1.133   18.094  -7.944  1.00 22.61 ? 109 SER A N   1 
ATOM   785  C CA  . SER A 1 109 ? 2.531   18.441  -8.153  1.00 22.49 ? 109 SER A CA  1 
ATOM   786  C C   . SER A 1 109 ? 2.601   19.849  -8.725  1.00 22.38 ? 109 SER A C   1 
ATOM   787  O O   . SER A 1 109 ? 1.677   20.302  -9.431  1.00 22.42 ? 109 SER A O   1 
ATOM   788  C CB  . SER A 1 109 ? 3.238   17.452  -9.076  1.00 22.24 ? 109 SER A CB  1 
ATOM   789  O OG  . SER A 1 109 ? 2.757   17.520  -10.409 1.00 22.96 ? 109 SER A OG  1 
ATOM   790  N N   . PHE A 1 110 ? 3.680   20.541  -8.393  1.00 22.04 ? 110 PHE A N   1 
ATOM   791  C CA  . PHE A 1 110 ? 3.931   21.863  -8.939  1.00 22.55 ? 110 PHE A CA  1 
ATOM   792  C C   . PHE A 1 110 ? 5.378   22.233  -8.675  1.00 23.13 ? 110 PHE A C   1 
ATOM   793  O O   . PHE A 1 110 ? 6.128   21.477  -8.053  1.00 23.59 ? 110 PHE A O   1 
ATOM   794  C CB  . PHE A 1 110 ? 2.967   22.905  -8.319  1.00 22.52 ? 110 PHE A CB  1 
ATOM   795  C CG  . PHE A 1 110 ? 2.949   22.903  -6.799  1.00 20.14 ? 110 PHE A CG  1 
ATOM   796  C CD1 . PHE A 1 110 ? 2.119   22.052  -6.105  1.00 23.61 ? 110 PHE A CD1 1 
ATOM   797  C CD2 . PHE A 1 110 ? 3.804   23.718  -6.088  1.00 20.36 ? 110 PHE A CD2 1 
ATOM   798  C CE1 . PHE A 1 110 ? 2.127   22.035  -4.712  1.00 23.49 ? 110 PHE A CE1 1 
ATOM   799  C CE2 . PHE A 1 110 ? 3.804   23.739  -4.715  1.00 19.76 ? 110 PHE A CE2 1 
ATOM   800  C CZ  . PHE A 1 110 ? 2.980   22.889  -4.019  1.00 21.92 ? 110 PHE A CZ  1 
ATOM   801  N N   . LYS A 1 111 ? 5.772   23.401  -9.154  1.00 23.77 ? 111 LYS A N   1 
ATOM   802  C CA  . LYS A 1 111 ? 7.111   23.899  -8.939  1.00 24.31 ? 111 LYS A CA  1 
ATOM   803  C C   . LYS A 1 111 ? 7.107   25.413  -8.825  1.00 24.22 ? 111 LYS A C   1 
ATOM   804  O O   . LYS A 1 111 ? 6.166   26.079  -9.188  1.00 24.22 ? 111 LYS A O   1 
ATOM   805  C CB  . LYS A 1 111 ? 8.010   23.436  -10.096 1.00 24.97 ? 111 LYS A CB  1 
ATOM   806  C CG  . LYS A 1 111 ? 7.620   24.016  -11.474 1.00 25.63 ? 111 LYS A CG  1 
ATOM   807  C CD  . LYS A 1 111 ? 8.233   23.275  -12.610 1.00 25.67 ? 111 LYS A CD  1 
ATOM   808  C CE  . LYS A 1 111 ? 7.941   24.002  -13.951 1.00 27.45 ? 111 LYS A CE  1 
ATOM   809  N NZ  . LYS A 1 111 ? 8.137   23.048  -15.067 1.00 25.49 ? 111 LYS A NZ  1 
ATOM   810  N N   . ASP A 1 112 ? 8.182   25.960  -8.295  1.00 25.50 ? 112 ASP A N   1 
ATOM   811  C CA  . ASP A 1 112 ? 8.367   27.389  -8.299  1.00 25.09 ? 112 ASP A CA  1 
ATOM   812  C C   . ASP A 1 112 ? 9.780   27.653  -8.716  1.00 26.09 ? 112 ASP A C   1 
ATOM   813  O O   . ASP A 1 112 ? 10.446  26.767  -9.291  1.00 25.88 ? 112 ASP A O   1 
ATOM   814  C CB  . ASP A 1 112 ? 7.962   27.994  -6.955  1.00 26.12 ? 112 ASP A CB  1 
ATOM   815  C CG  . ASP A 1 112 ? 8.753   27.455  -5.762  1.00 25.01 ? 112 ASP A CG  1 
ATOM   816  O OD1 . ASP A 1 112 ? 9.956   27.207  -5.924  1.00 23.44 ? 112 ASP A OD1 1 
ATOM   817  O OD2 . ASP A 1 112 ? 8.244   27.298  -4.607  1.00 24.72 ? 112 ASP A OD2 1 
ATOM   818  N N   . ASN A 1 113 ? 10.241  28.873  -8.489  1.00 25.89 ? 113 ASN A N   1 
ATOM   819  C CA  . ASN A 1 113 ? 11.531  29.260  -8.965  1.00 25.58 ? 113 ASN A CA  1 
ATOM   820  C C   . ASN A 1 113 ? 12.615  28.339  -8.447  1.00 25.46 ? 113 ASN A C   1 
ATOM   821  O O   . ASN A 1 113 ? 13.588  28.117  -9.149  1.00 24.45 ? 113 ASN A O   1 
ATOM   822  C CB  . ASN A 1 113 ? 11.862  30.698  -8.585  1.00 25.50 ? 113 ASN A CB  1 
ATOM   823  C CG  . ASN A 1 113 ? 11.013  31.736  -9.368  1.00 28.41 ? 113 ASN A CG  1 
ATOM   824  O OD1 . ASN A 1 113 ? 10.816  32.888  -8.914  1.00 31.93 ? 113 ASN A OD1 1 
ATOM   825  N ND2 . ASN A 1 113 ? 10.513  31.331  -10.518 1.00 28.65 ? 113 ASN A ND2 1 
ATOM   826  N N   . SER A 1 114 ? 12.454  27.839  -7.214  1.00 24.97 ? 114 SER A N   1 
ATOM   827  C CA  . SER A 1 114 ? 13.527  27.121  -6.535  1.00 24.74 ? 114 SER A CA  1 
ATOM   828  C C   . SER A 1 114 ? 13.339  25.609  -6.423  1.00 23.36 ? 114 SER A C   1 
ATOM   829  O O   . SER A 1 114 ? 14.305  24.857  -6.501  1.00 23.69 ? 114 SER A O   1 
ATOM   830  C CB  . SER A 1 114 ? 13.675  27.720  -5.143  1.00 25.03 ? 114 SER A CB  1 
ATOM   831  O OG  . SER A 1 114 ? 14.244  29.021  -5.232  1.00 27.06 ? 114 SER A OG  1 
ATOM   832  N N   . ASN A 1 115 ? 12.104  25.174  -6.223  1.00 22.77 ? 115 ASN A N   1 
ATOM   833  C CA  . ASN A 1 115 ? 11.824  23.817  -5.830  1.00 22.44 ? 115 ASN A CA  1 
ATOM   834  C C   . ASN A 1 115 ? 10.827  23.090  -6.722  1.00 21.93 ? 115 ASN A C   1 
ATOM   835  O O   . ASN A 1 115 ? 10.094  23.695  -7.501  1.00 21.99 ? 115 ASN A O   1 
ATOM   836  C CB  . ASN A 1 115 ? 11.298  23.791  -4.409  1.00 23.55 ? 115 ASN A CB  1 
ATOM   837  C CG  . ASN A 1 115 ? 12.188  24.555  -3.396  1.00 24.42 ? 115 ASN A CG  1 
ATOM   838  O OD1 . ASN A 1 115 ? 13.381  24.291  -3.253  1.00 25.38 ? 115 ASN A OD1 1 
ATOM   839  N ND2 . ASN A 1 115 ? 11.576  25.482  -2.678  1.00 22.92 ? 115 ASN A ND2 1 
ATOM   840  N N   . LEU A 1 116 ? 10.805  21.771  -6.567  1.00 21.90 ? 116 LEU A N   1 
ATOM   841  C CA  . LEU A 1 116 ? 9.764   20.900  -7.076  1.00 21.39 ? 116 LEU A CA  1 
ATOM   842  C C   . LEU A 1 116 ? 9.027   20.341  -5.871  1.00 21.60 ? 116 LEU A C   1 
ATOM   843  O O   . LEU A 1 116 ? 9.624   20.103  -4.816  1.00 20.56 ? 116 LEU A O   1 
ATOM   844  C CB  . LEU A 1 116 ? 10.365  19.757  -7.882  1.00 22.08 ? 116 LEU A CB  1 
ATOM   845  C CG  . LEU A 1 116 ? 11.438  20.146  -8.924  1.00 22.85 ? 116 LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 116 ? 12.212  18.923  -9.336  1.00 24.64 ? 116 LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 116 ? 10.798  20.815  -10.129 1.00 23.23 ? 116 LEU A CD2 1 
ATOM   848  N N   . TYR A 1 117 ? 7.733   20.100  -6.068  1.00 20.85 ? 117 TYR A N   1 
ATOM   849  C CA  . TYR A 1 117 ? 6.841   19.672  -5.017  1.00 20.70 ? 117 TYR A CA  1 
ATOM   850  C C   . TYR A 1 117 ? 5.964   18.561  -5.509  1.00 20.39 ? 117 TYR A C   1 
ATOM   851  O O   . TYR A 1 117 ? 5.446   18.615  -6.608  1.00 20.45 ? 117 TYR A O   1 
ATOM   852  C CB  . TYR A 1 117 ? 5.945   20.808  -4.553  1.00 21.45 ? 117 TYR A CB  1 
ATOM   853  C CG  . TYR A 1 117 ? 6.697   22.047  -4.140  1.00 20.20 ? 117 TYR A CG  1 
ATOM   854  C CD1 . TYR A 1 117 ? 7.036   22.996  -5.061  1.00 21.68 ? 117 TYR A CD1 1 
ATOM   855  C CD2 . TYR A 1 117 ? 7.051   22.268  -2.812  1.00 20.33 ? 117 TYR A CD2 1 
ATOM   856  C CE1 . TYR A 1 117 ? 7.719   24.167  -4.685  1.00 21.25 ? 117 TYR A CE1 1 
ATOM   857  C CE2 . TYR A 1 117 ? 7.703   23.431  -2.438  1.00 20.87 ? 117 TYR A CE2 1 
ATOM   858  C CZ  . TYR A 1 117 ? 8.042   24.358  -3.390  1.00 19.98 ? 117 TYR A CZ  1 
ATOM   859  O OH  . TYR A 1 117 ? 8.727   25.479  -3.043  1.00 24.36 ? 117 TYR A OH  1 
ATOM   860  N N   . MET A 1 118 ? 5.847   17.511  -4.699  1.00 20.92 ? 118 MET A N   1 
ATOM   861  C CA  . MET A 1 118 ? 4.919   16.414  -4.964  1.00 20.48 ? 118 MET A CA  1 
ATOM   862  C C   . MET A 1 118 ? 4.151   16.190  -3.689  1.00 19.87 ? 118 MET A C   1 
ATOM   863  O O   . MET A 1 118 ? 4.703   15.746  -2.681  1.00 20.34 ? 118 MET A O   1 
ATOM   864  C CB  . MET A 1 118 ? 5.691   15.146  -5.365  1.00 20.06 ? 118 MET A CB  1 
ATOM   865  C CG  . MET A 1 118 ? 6.270   15.198  -6.735  1.00 22.28 ? 118 MET A CG  1 
ATOM   866  S SD  . MET A 1 118 ? 7.354   13.818  -7.107  1.00 24.02 ? 118 MET A SD  1 
ATOM   867  C CE  . MET A 1 118 ? 8.816   14.469  -6.364  1.00 23.91 ? 118 MET A CE  1 
ATOM   868  N N   . VAL A 1 119 ? 2.861   16.468  -3.733  1.00 20.96 ? 119 VAL A N   1 
ATOM   869  C CA  . VAL A 1 119 ? 1.992   16.338  -2.553  1.00 21.01 ? 119 VAL A CA  1 
ATOM   870  C C   . VAL A 1 119 ? 1.304   15.002  -2.632  1.00 21.59 ? 119 VAL A C   1 
ATOM   871  O O   . VAL A 1 119 ? 0.496   14.775  -3.533  1.00 23.01 ? 119 VAL A O   1 
ATOM   872  C CB  . VAL A 1 119 ? 0.974   17.475  -2.496  1.00 20.98 ? 119 VAL A CB  1 
ATOM   873  C CG1 . VAL A 1 119 ? 0.147   17.387  -1.269  1.00 22.28 ? 119 VAL A CG1 1 
ATOM   874  C CG2 . VAL A 1 119 ? 1.730   18.823  -2.508  1.00 22.58 ? 119 VAL A CG2 1 
ATOM   875  N N   . MET A 1 120 ? 1.663   14.103  -1.737  1.00 20.82 ? 120 MET A N   1 
ATOM   876  C CA  . MET A 1 120 ? 1.054   12.798  -1.687  1.00 21.73 ? 120 MET A CA  1 
ATOM   877  C C   . MET A 1 120 ? 0.016   12.755  -0.607  1.00 22.26 ? 120 MET A C   1 
ATOM   878  O O   . MET A 1 120 ? -0.071  13.641  0.210   1.00 23.09 ? 120 MET A O   1 
ATOM   879  C CB  . MET A 1 120 ? 2.088   11.730  -1.332  1.00 21.70 ? 120 MET A CB  1 
ATOM   880  C CG  . MET A 1 120 ? 3.233   11.561  -2.299  1.00 23.20 ? 120 MET A CG  1 
ATOM   881  S SD  . MET A 1 120 ? 4.577   10.836  -1.341  1.00 25.38 ? 120 MET A SD  1 
ATOM   882  C CE  . MET A 1 120 ? 5.498   12.269  -0.814  1.00 27.03 ? 120 MET A CE  1 
ATOM   883  N N   . GLU A 1 121 ? -0.754  11.691  -0.603  1.00 23.97 ? 121 GLU A N   1 
ATOM   884  C CA  . GLU A 1 121 ? -1.691  11.415  0.466   1.00 25.32 ? 121 GLU A CA  1 
ATOM   885  C C   . GLU A 1 121 ? -0.862  11.230  1.724   1.00 25.32 ? 121 GLU A C   1 
ATOM   886  O O   . GLU A 1 121 ? 0.295   10.790  1.643   1.00 25.68 ? 121 GLU A O   1 
ATOM   887  C CB  . GLU A 1 121 ? -2.524  10.175  0.130   1.00 25.08 ? 121 GLU A CB  1 
ATOM   888  C CG  . GLU A 1 121 ? -1.684  8.962   -0.138  1.00 28.79 ? 121 GLU A CG  1 
ATOM   889  C CD  . GLU A 1 121 ? -2.496  7.681   -0.296  1.00 30.11 ? 121 GLU A CD  1 
ATOM   890  O OE1 . GLU A 1 121 ? -3.538  7.565   0.354   1.00 31.38 ? 121 GLU A OE1 1 
ATOM   891  O OE2 . GLU A 1 121 ? -2.042  6.786   -1.044  1.00 29.20 ? 121 GLU A OE2 1 
ATOM   892  N N   . TYR A 1 122 ? -1.423  11.584  2.876   1.00 25.65 ? 122 TYR A N   1 
ATOM   893  C CA  . TYR A 1 122 ? -0.717  11.403  4.143   1.00 26.06 ? 122 TYR A CA  1 
ATOM   894  C C   . TYR A 1 122 ? -1.032  10.039  4.738   1.00 25.97 ? 122 TYR A C   1 
ATOM   895  O O   . TYR A 1 122 ? -2.182  9.693   5.033   1.00 25.44 ? 122 TYR A O   1 
ATOM   896  C CB  . TYR A 1 122 ? -1.042  12.509  5.135   1.00 26.62 ? 122 TYR A CB  1 
ATOM   897  C CG  . TYR A 1 122 ? -0.436  12.317  6.497   1.00 26.45 ? 122 TYR A CG  1 
ATOM   898  C CD1 . TYR A 1 122 ? -1.198  12.447  7.657   1.00 27.33 ? 122 TYR A CD1 1 
ATOM   899  C CD2 . TYR A 1 122 ? 0.902   12.006  6.629   1.00 26.66 ? 122 TYR A CD2 1 
ATOM   900  C CE1 . TYR A 1 122 ? -0.595  12.261  8.936   1.00 28.20 ? 122 TYR A CE1 1 
ATOM   901  C CE2 . TYR A 1 122 ? 1.489   11.826  7.855   1.00 25.19 ? 122 TYR A CE2 1 
ATOM   902  C CZ  . TYR A 1 122 ? 0.765   11.951  8.993   1.00 26.96 ? 122 TYR A CZ  1 
ATOM   903  O OH  . TYR A 1 122 ? 1.424   11.739  10.182  1.00 31.01 ? 122 TYR A OH  1 
ATOM   904  N N   . VAL A 1 123 ? 0.031   9.266   4.928   1.00 26.34 ? 123 VAL A N   1 
ATOM   905  C CA  . VAL A 1 123 ? -0.051  7.913   5.475   1.00 26.16 ? 123 VAL A CA  1 
ATOM   906  C C   . VAL A 1 123 ? 0.458   7.994   6.919   1.00 26.73 ? 123 VAL A C   1 
ATOM   907  O O   . VAL A 1 123 ? 1.653   8.038   7.152   1.00 27.46 ? 123 VAL A O   1 
ATOM   908  C CB  . VAL A 1 123 ? 0.779   6.942   4.612   1.00 25.68 ? 123 VAL A CB  1 
ATOM   909  C CG1 . VAL A 1 123 ? 0.443   5.521   4.940   1.00 27.07 ? 123 VAL A CG1 1 
ATOM   910  C CG2 . VAL A 1 123 ? 0.525   7.177   3.152   1.00 24.61 ? 123 VAL A CG2 1 
ATOM   911  N N   . PRO A 1 124 ? -0.452  8.049   7.890   1.00 27.13 ? 124 PRO A N   1 
ATOM   912  C CA  . PRO A 1 124 ? -0.064  8.410   9.266   1.00 26.90 ? 124 PRO A CA  1 
ATOM   913  C C   . PRO A 1 124 ? 0.667   7.329   10.040  1.00 26.37 ? 124 PRO A C   1 
ATOM   914  O O   . PRO A 1 124 ? 1.297   7.631   11.027  1.00 26.08 ? 124 PRO A O   1 
ATOM   915  C CB  . PRO A 1 124 ? -1.422  8.682   9.941   1.00 26.64 ? 124 PRO A CB  1 
ATOM   916  C CG  . PRO A 1 124 ? -2.344  7.741   9.262   1.00 26.59 ? 124 PRO A CG  1 
ATOM   917  C CD  . PRO A 1 124 ? -1.912  7.779   7.776   1.00 26.95 ? 124 PRO A CD  1 
ATOM   918  N N   . GLY A 1 125 ? 0.598   6.096   9.576   1.00 26.60 ? 125 GLY A N   1 
ATOM   919  C CA  . GLY A 1 125 ? 1.061   4.954   10.342  1.00 26.72 ? 125 GLY A CA  1 
ATOM   920  C C   . GLY A 1 125 ? 2.552   4.756   10.524  1.00 26.77 ? 125 GLY A C   1 
ATOM   921  O O   . GLY A 1 125 ? 2.987   3.886   11.313  1.00 26.55 ? 125 GLY A O   1 
ATOM   922  N N   . GLY A 1 126 ? 3.345   5.553   9.828   1.00 26.67 ? 126 GLY A N   1 
ATOM   923  C CA  . GLY A 1 126 ? 4.788   5.427   9.923   1.00 26.66 ? 126 GLY A CA  1 
ATOM   924  C C   . GLY A 1 126 ? 5.368   4.553   8.814   1.00 26.77 ? 126 GLY A C   1 
ATOM   925  O O   . GLY A 1 126 ? 4.652   3.925   8.024   1.00 28.07 ? 126 GLY A O   1 
ATOM   926  N N   . GLU A 1 127 ? 6.682   4.575   8.736   1.00 26.19 ? 127 GLU A N   1 
ATOM   927  C CA  . GLU A 1 127 ? 7.469   3.670   7.931   1.00 25.69 ? 127 GLU A CA  1 
ATOM   928  C C   . GLU A 1 127 ? 7.542   2.281   8.568   1.00 24.85 ? 127 GLU A C   1 
ATOM   929  O O   . GLU A 1 127 ? 7.607   2.131   9.810   1.00 24.53 ? 127 GLU A O   1 
ATOM   930  C CB  . GLU A 1 127 ? 8.902   4.235   7.797   1.00 26.41 ? 127 GLU A CB  1 
ATOM   931  C CG  . GLU A 1 127 ? 8.990   5.542   7.027   1.00 27.52 ? 127 GLU A CG  1 
ATOM   932  C CD  . GLU A 1 127 ? 10.308  6.308   7.186   1.00 31.17 ? 127 GLU A CD  1 
ATOM   933  O OE1 . GLU A 1 127 ? 11.363  5.689   7.514   1.00 30.45 ? 127 GLU A OE1 1 
ATOM   934  O OE2 . GLU A 1 127 ? 10.289  7.552   6.942   1.00 30.90 ? 127 GLU A OE2 1 
ATOM   935  N N   . MET A 1 128 ? 7.589   1.257   7.721   1.00 23.42 ? 128 MET A N   1 
ATOM   936  C CA  . MET A 1 128 ? 7.683   -0.111  8.213   1.00 22.62 ? 128 MET A CA  1 
ATOM   937  C C   . MET A 1 128 ? 8.982   -0.268  9.012   1.00 22.82 ? 128 MET A C   1 
ATOM   938  O O   . MET A 1 128 ? 8.981   -0.900  10.043  1.00 23.18 ? 128 MET A O   1 
ATOM   939  C CB  . MET A 1 128 ? 7.642   -1.105  7.052   1.00 21.02 ? 128 MET A CB  1 
ATOM   940  C CG  . MET A 1 128 ? 7.882   -2.558  7.497   1.00 21.92 ? 128 MET A CG  1 
ATOM   941  S SD  . MET A 1 128 ? 8.254   -3.733  6.193   1.00 20.35 ? 128 MET A SD  1 
ATOM   942  C CE  . MET A 1 128 ? 6.822   -3.537  5.226   1.00 19.88 ? 128 MET A CE  1 
ATOM   943  N N   . PHE A 1 129 ? 10.069  0.302   8.488   1.00 23.59 ? 129 PHE A N   1 
ATOM   944  C CA  . PHE A 1 129 ? 11.362  0.379   9.121   1.00 24.81 ? 129 PHE A CA  1 
ATOM   945  C C   . PHE A 1 129 ? 11.252  0.696   10.605  1.00 25.44 ? 129 PHE A C   1 
ATOM   946  O O   . PHE A 1 129 ? 11.806  -0.006  11.421  1.00 24.71 ? 129 PHE A O   1 
ATOM   947  C CB  . PHE A 1 129 ? 12.212  1.462   8.455   1.00 25.32 ? 129 PHE A CB  1 
ATOM   948  C CG  . PHE A 1 129 ? 13.559  1.669   9.099   1.00 25.56 ? 129 PHE A CG  1 
ATOM   949  C CD1 . PHE A 1 129 ? 14.672  0.957   8.673   1.00 27.02 ? 129 PHE A CD1 1 
ATOM   950  C CD2 . PHE A 1 129 ? 13.717  2.591   10.108  1.00 27.00 ? 129 PHE A CD2 1 
ATOM   951  C CE1 . PHE A 1 129 ? 15.894  1.138   9.284   1.00 26.96 ? 129 PHE A CE1 1 
ATOM   952  C CE2 . PHE A 1 129 ? 14.953  2.781   10.716  1.00 26.31 ? 129 PHE A CE2 1 
ATOM   953  C CZ  . PHE A 1 129 ? 16.023  2.065   10.308  1.00 27.83 ? 129 PHE A CZ  1 
ATOM   954  N N   . SER A 1 130 ? 10.549  1.752   10.962  1.00 26.66 ? 130 SER A N   1 
ATOM   955  C CA  . SER A 1 130 ? 10.541  2.127   12.364  1.00 27.84 ? 130 SER A CA  1 
ATOM   956  C C   . SER A 1 130 ? 9.912   1.026   13.235  1.00 26.97 ? 130 SER A C   1 
ATOM   957  O O   . SER A 1 130 ? 10.464  0.704   14.275  1.00 26.47 ? 130 SER A O   1 
ATOM   958  C CB  . SER A 1 130 ? 9.883   3.501   12.568  1.00 28.44 ? 130 SER A CB  1 
ATOM   959  O OG  . SER A 1 130 ? 8.476   3.407   12.465  1.00 31.82 ? 130 SER A OG  1 
ATOM   960  N N   . HIS A 1 131 ? 8.793   0.433   12.805  1.00 27.13 ? 131 HIS A N   1 
ATOM   961  C CA  . HIS A 1 131 ? 8.124   -0.643  13.568  1.00 27.11 ? 131 HIS A CA  1 
ATOM   962  C C   . HIS A 1 131 ? 8.967   -1.922  13.592  1.00 26.43 ? 131 HIS A C   1 
ATOM   963  O O   . HIS A 1 131 ? 9.052   -2.600  14.578  1.00 26.02 ? 131 HIS A O   1 
ATOM   964  C CB  . HIS A 1 131 ? 6.722   -0.950  12.996  1.00 28.07 ? 131 HIS A CB  1 
ATOM   965  C CG  . HIS A 1 131 ? 5.854   0.263   12.849  1.00 29.47 ? 131 HIS A CG  1 
ATOM   966  N ND1 . HIS A 1 131 ? 5.274   0.908   13.928  1.00 31.09 ? 131 HIS A ND1 1 
ATOM   967  C CD2 . HIS A 1 131 ? 5.500   0.971   11.747  1.00 29.87 ? 131 HIS A CD2 1 
ATOM   968  C CE1 . HIS A 1 131 ? 4.612   1.968   13.491  1.00 34.30 ? 131 HIS A CE1 1 
ATOM   969  N NE2 . HIS A 1 131 ? 4.744   2.036   12.171  1.00 31.72 ? 131 HIS A NE2 1 
ATOM   970  N N   . LEU A 1 132 ? 9.628   -2.220  12.487  1.00 26.39 ? 132 LEU A N   1 
ATOM   971  C CA  . LEU A 1 132 ? 10.474  -3.401  12.390  1.00 25.79 ? 132 LEU A CA  1 
ATOM   972  C C   . LEU A 1 132 ? 11.664  -3.329  13.307  1.00 25.31 ? 132 LEU A C   1 
ATOM   973  O O   . LEU A 1 132 ? 11.992  -4.310  13.935  1.00 24.49 ? 132 LEU A O   1 
ATOM   974  C CB  . LEU A 1 132 ? 10.962  -3.574  10.968  1.00 25.60 ? 132 LEU A CB  1 
ATOM   975  C CG  . LEU A 1 132 ? 11.875  -4.740  10.603  1.00 25.15 ? 132 LEU A CG  1 
ATOM   976  C CD1 . LEU A 1 132 ? 11.263  -6.101  10.953  1.00 27.12 ? 132 LEU A CD1 1 
ATOM   977  C CD2 . LEU A 1 132 ? 12.129  -4.666  9.124   1.00 25.26 ? 132 LEU A CD2 1 
ATOM   978  N N   . ARG A 1 133 ? 12.327  -2.185  13.344  1.00 25.03 ? 133 ARG A N   1 
ATOM   979  C CA  . ARG A 1 133 ? 13.479  -2.003  14.221  1.00 25.64 ? 133 ARG A CA  1 
ATOM   980  C C   . ARG A 1 133 ? 13.078  -2.090  15.700  1.00 25.52 ? 133 ARG A C   1 
ATOM   981  O O   . ARG A 1 133 ? 13.773  -2.730  16.474  1.00 24.53 ? 133 ARG A O   1 
ATOM   982  C CB  . ARG A 1 133 ? 14.189  -0.676  13.969  1.00 24.98 ? 133 ARG A CB  1 
ATOM   983  C CG  . ARG A 1 133 ? 15.124  -0.603  12.736  1.00 25.89 ? 133 ARG A CG  1 
ATOM   984  C CD  . ARG A 1 133 ? 16.300  -1.553  12.709  1.00 25.29 ? 133 ARG A CD  1 
ATOM   985  N NE  . ARG A 1 133 ? 16.948  -1.535  11.401  1.00 24.76 ? 133 ARG A NE  1 
ATOM   986  C CZ  . ARG A 1 133 ? 16.576  -2.283  10.362  1.00 23.38 ? 133 ARG A CZ  1 
ATOM   987  N NH1 . ARG A 1 133 ? 15.552  -3.102  10.437  1.00 25.11 ? 133 ARG A NH1 1 
ATOM   988  N NH2 . ARG A 1 133 ? 17.197  -2.156  9.211   1.00 26.93 ? 133 ARG A NH2 1 
ATOM   989  N N   . ARG A 1 134 ? 11.952  -1.482  16.053  1.00 26.07 ? 134 ARG A N   1 
ATOM   990  C CA  . ARG A 1 134 ? 11.512  -1.377  17.443  1.00 27.87 ? 134 ARG A CA  1 
ATOM   991  C C   . ARG A 1 134 ? 11.159  -2.763  18.005  1.00 27.45 ? 134 ARG A C   1 
ATOM   992  O O   . ARG A 1 134 ? 11.777  -3.224  18.961  1.00 26.02 ? 134 ARG A O   1 
ATOM   993  C CB  . ARG A 1 134 ? 10.320  -0.408  17.577  1.00 27.98 ? 134 ARG A CB  1 
ATOM   994  C CG  . ARG A 1 134 ? 9.703   -0.355  18.982  1.00 31.46 ? 134 ARG A CG  1 
ATOM   995  C CD  . ARG A 1 134 ? 8.724   0.825   19.208  1.00 35.58 ? 134 ARG A CD  1 
ATOM   996  N NE  . ARG A 1 134 ? 7.421   0.503   18.605  1.00 43.49 ? 134 ARG A NE  1 
ATOM   997  C CZ  . ARG A 1 134 ? 6.961   0.916   17.393  1.00 46.61 ? 134 ARG A CZ  1 
ATOM   998  N NH1 . ARG A 1 134 ? 7.658   1.770   16.609  1.00 46.18 ? 134 ARG A NH1 1 
ATOM   999  N NH2 . ARG A 1 134 ? 5.767   0.476   16.975  1.00 46.78 ? 134 ARG A NH2 1 
ATOM   1000 N N   . ILE A 1 135 ? 10.188  -3.390  17.359  1.00 27.83 ? 135 ILE A N   1 
ATOM   1001 C CA  . ILE A 1 135 ? 9.700   -4.724  17.701  1.00 29.66 ? 135 ILE A CA  1 
ATOM   1002 C C   . ILE A 1 135 ? 10.762  -5.788  17.523  1.00 28.73 ? 135 ILE A C   1 
ATOM   1003 O O   . ILE A 1 135 ? 10.863  -6.696  18.310  1.00 28.95 ? 135 ILE A O   1 
ATOM   1004 C CB  . ILE A 1 135 ? 8.421   -5.081  16.824  1.00 30.89 ? 135 ILE A CB  1 
ATOM   1005 C CG1 . ILE A 1 135 ? 7.319   -3.999  16.995  1.00 34.11 ? 135 ILE A CG1 1 
ATOM   1006 C CG2 . ILE A 1 135 ? 7.884   -6.504  17.211  1.00 32.59 ? 135 ILE A CG2 1 
ATOM   1007 C CD1 . ILE A 1 135 ? 5.964   -4.148  16.113  1.00 36.12 ? 135 ILE A CD1 1 
ATOM   1008 N N   . GLY A 1 136 ? 11.589  -5.648  16.496  1.00 28.43 ? 136 GLY A N   1 
ATOM   1009 C CA  . GLY A 1 136 ? 12.771  -6.486  16.334  1.00 28.57 ? 136 GLY A CA  1 
ATOM   1010 C C   . GLY A 1 136 ? 12.698  -7.288  15.046  1.00 28.53 ? 136 GLY A C   1 
ATOM   1011 O O   . GLY A 1 136 ? 13.544  -7.197  14.149  1.00 27.06 ? 136 GLY A O   1 
ATOM   1012 N N   . ARG A 1 137 ? 11.646  -8.077  14.964  1.00 28.99 ? 137 ARG A N   1 
ATOM   1013 C CA  . ARG A 1 137 ? 11.378  -8.839  13.758  1.00 30.21 ? 137 ARG A CA  1 
ATOM   1014 C C   . ARG A 1 137 ? 9.902   -9.133  13.692  1.00 29.36 ? 137 ARG A C   1 
ATOM   1015 O O   . ARG A 1 137 ? 9.218   -9.094  14.720  1.00 30.92 ? 137 ARG A O   1 
ATOM   1016 C CB  . ARG A 1 137 ? 12.188  -10.120 13.770  1.00 30.64 ? 137 ARG A CB  1 
ATOM   1017 C CG  . ARG A 1 137 ? 11.775  -11.085 14.861  1.00 35.11 ? 137 ARG A CG  1 
ATOM   1018 C CD  . ARG A 1 137 ? 12.661  -12.319 14.960  1.00 41.14 ? 137 ARG A CD  1 
ATOM   1019 N NE  . ARG A 1 137 ? 11.953  -13.427 15.618  1.00 46.34 ? 137 ARG A NE  1 
ATOM   1020 C CZ  . ARG A 1 137 ? 12.497  -14.271 16.506  1.00 50.13 ? 137 ARG A CZ  1 
ATOM   1021 N NH1 . ARG A 1 137 ? 13.783  -14.186 16.866  1.00 50.02 ? 137 ARG A NH1 1 
ATOM   1022 N NH2 . ARG A 1 137 ? 11.736  -15.225 17.031  1.00 52.22 ? 137 ARG A NH2 1 
ATOM   1023 N N   . PHE A 1 138 ? 9.412   -9.398  12.495  1.00 28.14 ? 138 PHE A N   1 
ATOM   1024 C CA  . PHE A 1 138 ? 8.057   -9.859  12.307  1.00 28.30 ? 138 PHE A CA  1 
ATOM   1025 C C   . PHE A 1 138 ? 7.973   -11.398 12.255  1.00 28.73 ? 138 PHE A C   1 
ATOM   1026 O O   . PHE A 1 138 ? 8.919   -12.094 11.846  1.00 27.50 ? 138 PHE A O   1 
ATOM   1027 C CB  . PHE A 1 138 ? 7.477   -9.279  11.038  1.00 28.27 ? 138 PHE A CB  1 
ATOM   1028 C CG  . PHE A 1 138 ? 7.488   -7.776  10.981  1.00 26.63 ? 138 PHE A CG  1 
ATOM   1029 C CD1 . PHE A 1 138 ? 7.457   -6.993  12.149  1.00 26.26 ? 138 PHE A CD1 1 
ATOM   1030 C CD2 . PHE A 1 138 ? 7.539   -7.140  9.759   1.00 24.99 ? 138 PHE A CD2 1 
ATOM   1031 C CE1 . PHE A 1 138 ? 7.482   -5.597  12.087  1.00 23.20 ? 138 PHE A CE1 1 
ATOM   1032 C CE2 . PHE A 1 138 ? 7.529   -5.751  9.694   1.00 25.64 ? 138 PHE A CE2 1 
ATOM   1033 C CZ  . PHE A 1 138 ? 7.505   -4.984  10.879  1.00 25.39 ? 138 PHE A CZ  1 
ATOM   1034 N N   . SER A 1 139 ? 6.833   -11.908 12.715  1.00 28.84 ? 139 SER A N   1 
ATOM   1035 C CA  . SER A 1 139 ? 6.513   -13.334 12.601  1.00 28.55 ? 139 SER A CA  1 
ATOM   1036 C C   . SER A 1 139 ? 6.324   -13.627 11.147  1.00 28.89 ? 139 SER A C   1 
ATOM   1037 O O   . SER A 1 139 ? 6.050   -12.717 10.363  1.00 29.50 ? 139 SER A O   1 
ATOM   1038 C CB  . SER A 1 139 ? 5.210   -13.627 13.314  1.00 28.65 ? 139 SER A CB  1 
ATOM   1039 O OG  . SER A 1 139 ? 4.139   -12.922 12.698  1.00 28.20 ? 139 SER A OG  1 
ATOM   1040 N N   . GLU A 1 140 ? 6.429   -14.889 10.773  1.00 29.32 ? 140 GLU A N   1 
ATOM   1041 C CA  . GLU A 1 140 ? 6.289   -15.252 9.373   1.00 29.76 ? 140 GLU A CA  1 
ATOM   1042 C C   . GLU A 1 140 ? 4.932   -14.794 8.792   1.00 29.91 ? 140 GLU A C   1 
ATOM   1043 O O   . GLU A 1 140 ? 4.910   -14.217 7.707   1.00 29.77 ? 140 GLU A O   1 
ATOM   1044 C CB  . GLU A 1 140 ? 6.654   -16.735 9.113   1.00 29.63 ? 140 GLU A CB  1 
ATOM   1045 C CG  . GLU A 1 140 ? 8.115   -17.027 9.498   1.00 29.08 ? 140 GLU A CG  1 
ATOM   1046 C CD  . GLU A 1 140 ? 8.710   -18.283 8.878   1.00 26.80 ? 140 GLU A CD  1 
ATOM   1047 O OE1 . GLU A 1 140 ? 8.106   -18.824 7.969   1.00 23.24 ? 140 GLU A OE1 1 
ATOM   1048 O OE2 . GLU A 1 140 ? 9.805   -18.729 9.308   1.00 26.86 ? 140 GLU A OE2 1 
ATOM   1049 N N   . PRO A 1 141 ? 3.825   -15.001 9.504   1.00 30.09 ? 141 PRO A N   1 
ATOM   1050 C CA  . PRO A 1 141 ? 2.524   -14.542 9.004   1.00 30.14 ? 141 PRO A CA  1 
ATOM   1051 C C   . PRO A 1 141 ? 2.437   -13.026 8.756   1.00 29.37 ? 141 PRO A C   1 
ATOM   1052 O O   . PRO A 1 141 ? 1.815   -12.591 7.795   1.00 29.74 ? 141 PRO A O   1 
ATOM   1053 C CB  . PRO A 1 141 ? 1.553   -14.967 10.112  1.00 30.36 ? 141 PRO A CB  1 
ATOM   1054 C CG  . PRO A 1 141 ? 2.276   -16.158 10.770  1.00 31.69 ? 141 PRO A CG  1 
ATOM   1055 C CD  . PRO A 1 141 ? 3.703   -15.765 10.766  1.00 30.46 ? 141 PRO A CD  1 
ATOM   1056 N N   . HIS A 1 142 ? 3.040   -12.262 9.642   1.00 28.54 ? 142 HIS A N   1 
ATOM   1057 C CA  . HIS A 1 142 ? 3.103   -10.806 9.558   1.00 28.22 ? 142 HIS A CA  1 
ATOM   1058 C C   . HIS A 1 142 ? 3.907   -10.401 8.308   1.00 27.31 ? 142 HIS A C   1 
ATOM   1059 O O   . HIS A 1 142 ? 3.430   -9.616  7.489   1.00 27.12 ? 142 HIS A O   1 
ATOM   1060 C CB  . HIS A 1 142 ? 3.731   -10.294 10.861  1.00 28.33 ? 142 HIS A CB  1 
ATOM   1061 C CG  . HIS A 1 142 ? 3.658   -8.808  11.071  1.00 30.92 ? 142 HIS A CG  1 
ATOM   1062 N ND1 . HIS A 1 142 ? 3.557   -8.249  12.330  1.00 32.61 ? 142 HIS A ND1 1 
ATOM   1063 C CD2 . HIS A 1 142 ? 3.710   -7.766  10.206  1.00 31.04 ? 142 HIS A CD2 1 
ATOM   1064 C CE1 . HIS A 1 142 ? 3.523   -6.928  12.229  1.00 30.84 ? 142 HIS A CE1 1 
ATOM   1065 N NE2 . HIS A 1 142 ? 3.606   -6.611  10.951  1.00 31.53 ? 142 HIS A NE2 1 
ATOM   1066 N N   . ALA A 1 143 ? 5.109   -10.959 8.159   1.00 26.50 ? 143 ALA A N   1 
ATOM   1067 C CA  . ALA A 1 143 ? 5.969   -10.685 7.023   1.00 25.49 ? 143 ALA A CA  1 
ATOM   1068 C C   . ALA A 1 143 ? 5.310   -11.105 5.726   1.00 25.37 ? 143 ALA A C   1 
ATOM   1069 O O   . ALA A 1 143 ? 5.444   -10.398 4.733   1.00 24.70 ? 143 ALA A O   1 
ATOM   1070 C CB  . ALA A 1 143 ? 7.304   -11.396 7.184   1.00 24.96 ? 143 ALA A CB  1 
ATOM   1071 N N   . ARG A 1 144 ? 4.569   -12.229 5.734   1.00 25.26 ? 144 ARG A N   1 
ATOM   1072 C CA  . ARG A 1 144 ? 3.912   -12.727 4.509   1.00 25.36 ? 144 ARG A CA  1 
ATOM   1073 C C   . ARG A 1 144 ? 2.790   -11.818 4.082   1.00 24.60 ? 144 ARG A C   1 
ATOM   1074 O O   . ARG A 1 144 ? 2.622   -11.512 2.915   1.00 24.53 ? 144 ARG A O   1 
ATOM   1075 C CB  . ARG A 1 144 ? 3.437   -14.172 4.673   1.00 26.55 ? 144 ARG A CB  1 
ATOM   1076 C CG  . ARG A 1 144 ? 2.328   -14.679 3.712   1.00 27.27 ? 144 ARG A CG  1 
ATOM   1077 C CD  . ARG A 1 144 ? 1.573   -15.930 4.311   1.00 30.20 ? 144 ARG A CD  1 
ATOM   1078 N NE  . ARG A 1 144 ? 2.556   -16.972 4.552   1.00 30.29 ? 144 ARG A NE  1 
ATOM   1079 C CZ  . ARG A 1 144 ? 2.802   -17.594 5.706   1.00 31.34 ? 144 ARG A CZ  1 
ATOM   1080 N NH1 . ARG A 1 144 ? 2.119   -17.353 6.816   1.00 32.57 ? 144 ARG A NH1 1 
ATOM   1081 N NH2 . ARG A 1 144 ? 3.776   -18.490 5.737   1.00 31.36 ? 144 ARG A NH2 1 
ATOM   1082 N N   . PHE A 1 145 ? 2.042   -11.330 5.042   1.00 24.85 ? 145 PHE A N   1 
ATOM   1083 C CA  . PHE A 1 145 ? 1.008   -10.362 4.746   1.00 24.78 ? 145 PHE A CA  1 
ATOM   1084 C C   . PHE A 1 145 ? 1.569   -9.156  3.951   1.00 25.37 ? 145 PHE A C   1 
ATOM   1085 O O   . PHE A 1 145 ? 1.001   -8.752  2.936   1.00 25.29 ? 145 PHE A O   1 
ATOM   1086 C CB  . PHE A 1 145 ? 0.439   -9.901  6.073   1.00 24.65 ? 145 PHE A CB  1 
ATOM   1087 C CG  . PHE A 1 145 ? -0.484  -8.753  5.961   1.00 25.21 ? 145 PHE A CG  1 
ATOM   1088 C CD1 . PHE A 1 145 ? -1.726  -8.911  5.371   1.00 26.63 ? 145 PHE A CD1 1 
ATOM   1089 C CD2 . PHE A 1 145 ? -0.110  -7.506  6.426   1.00 26.05 ? 145 PHE A CD2 1 
ATOM   1090 C CE1 . PHE A 1 145 ? -2.585  -7.856  5.263   1.00 26.13 ? 145 PHE A CE1 1 
ATOM   1091 C CE2 . PHE A 1 145 ? -0.947  -6.453  6.307   1.00 26.52 ? 145 PHE A CE2 1 
ATOM   1092 C CZ  . PHE A 1 145 ? -2.213  -6.635  5.743   1.00 28.15 ? 145 PHE A CZ  1 
ATOM   1093 N N   . TYR A 1 146 ? 2.661   -8.552  4.452   1.00 25.52 ? 146 TYR A N   1 
ATOM   1094 C CA  . TYR A 1 146 ? 3.333   -7.429  3.742   1.00 24.55 ? 146 TYR A CA  1 
ATOM   1095 C C   . TYR A 1 146 ? 3.978   -7.877  2.451   1.00 23.27 ? 146 TYR A C   1 
ATOM   1096 O O   . TYR A 1 146 ? 3.987   -7.157  1.486   1.00 23.41 ? 146 TYR A O   1 
ATOM   1097 C CB  . TYR A 1 146 ? 4.438   -6.821  4.586   1.00 24.52 ? 146 TYR A CB  1 
ATOM   1098 C CG  . TYR A 1 146 ? 3.982   -6.151  5.854   1.00 26.60 ? 146 TYR A CG  1 
ATOM   1099 C CD1 . TYR A 1 146 ? 2.794   -5.425  5.915   1.00 27.10 ? 146 TYR A CD1 1 
ATOM   1100 C CD2 . TYR A 1 146 ? 4.732   -6.257  6.999   1.00 27.66 ? 146 TYR A CD2 1 
ATOM   1101 C CE1 . TYR A 1 146 ? 2.388   -4.831  7.077   1.00 27.53 ? 146 TYR A CE1 1 
ATOM   1102 C CE2 . TYR A 1 146 ? 4.352   -5.623  8.147   1.00 30.07 ? 146 TYR A CE2 1 
ATOM   1103 C CZ  . TYR A 1 146 ? 3.162   -4.927  8.187   1.00 28.69 ? 146 TYR A CZ  1 
ATOM   1104 O OH  . TYR A 1 146 ? 2.770   -4.359  9.372   1.00 28.09 ? 146 TYR A OH  1 
ATOM   1105 N N   . ALA A 1 147 ? 4.582   -9.054  2.453   1.00 22.74 ? 147 ALA A N   1 
ATOM   1106 C CA  . ALA A 1 147 ? 5.288   -9.497  1.292   1.00 22.51 ? 147 ALA A CA  1 
ATOM   1107 C C   . ALA A 1 147 ? 4.298   -9.694  0.144   1.00 23.18 ? 147 ALA A C   1 
ATOM   1108 O O   . ALA A 1 147 ? 4.577   -9.316  -0.963  1.00 24.05 ? 147 ALA A O   1 
ATOM   1109 C CB  . ALA A 1 147 ? 6.032   -10.735 1.583   1.00 22.98 ? 147 ALA A CB  1 
ATOM   1110 N N   . ALA A 1 148 ? 3.114   -10.217 0.426   1.00 23.37 ? 148 ALA A N   1 
ATOM   1111 C CA  . ALA A 1 148 ? 2.105   -10.391 -0.594  1.00 23.61 ? 148 ALA A CA  1 
ATOM   1112 C C   . ALA A 1 148 ? 1.734   -9.072  -1.246  1.00 23.74 ? 148 ALA A C   1 
ATOM   1113 O O   . ALA A 1 148 ? 1.475   -9.015  -2.431  1.00 23.88 ? 148 ALA A O   1 
ATOM   1114 C CB  . ALA A 1 148 ? 0.845   -11.074 -0.002  1.00 23.65 ? 148 ALA A CB  1 
ATOM   1115 N N   . GLN A 1 149 ? 1.686   -8.011  -0.461  1.00 23.68 ? 149 GLN A N   1 
ATOM   1116 C CA  . GLN A 1 149 ? 1.375   -6.709  -1.006  1.00 23.28 ? 149 GLN A CA  1 
ATOM   1117 C C   . GLN A 1 149 ? 2.434   -6.235  -2.012  1.00 23.40 ? 149 GLN A C   1 
ATOM   1118 O O   . GLN A 1 149 ? 2.090   -5.629  -3.058  1.00 23.37 ? 149 GLN A O   1 
ATOM   1119 C CB  . GLN A 1 149 ? 1.191   -5.711  0.116   1.00 23.03 ? 149 GLN A CB  1 
ATOM   1120 C CG  . GLN A 1 149 ? -0.127  -5.908  0.818   1.00 20.57 ? 149 GLN A CG  1 
ATOM   1121 C CD  . GLN A 1 149 ? -0.218  -5.140  2.066   1.00 22.23 ? 149 GLN A CD  1 
ATOM   1122 O OE1 . GLN A 1 149 ? -0.381  -3.934  2.012   1.00 25.70 ? 149 GLN A OE1 1 
ATOM   1123 N NE2 . GLN A 1 149 ? -0.147  -5.813  3.213   1.00 25.89 ? 149 GLN A NE2 1 
ATOM   1124 N N   . ILE A 1 150 ? 3.696   -6.532  -1.705  1.00 23.10 ? 150 ILE A N   1 
ATOM   1125 C CA  . ILE A 1 150 ? 4.789   -6.117  -2.527  1.00 23.11 ? 150 ILE A CA  1 
ATOM   1126 C C   . ILE A 1 150 ? 4.769   -6.943  -3.789  1.00 23.44 ? 150 ILE A C   1 
ATOM   1127 O O   . ILE A 1 150 ? 5.046   -6.406  -4.840  1.00 23.76 ? 150 ILE A O   1 
ATOM   1128 C CB  . ILE A 1 150 ? 6.179   -6.249  -1.809  1.00 23.54 ? 150 ILE A CB  1 
ATOM   1129 C CG1 . ILE A 1 150 ? 6.272   -5.340  -0.576  1.00 23.20 ? 150 ILE A CG1 1 
ATOM   1130 C CG2 . ILE A 1 150 ? 7.326   -5.957  -2.777  1.00 21.91 ? 150 ILE A CG2 1 
ATOM   1131 C CD1 . ILE A 1 150 ? 5.984   -3.907  -0.801  1.00 25.06 ? 150 ILE A CD1 1 
ATOM   1132 N N   . VAL A 1 151 ? 4.456   -8.232  -3.684  1.00 23.70 ? 151 VAL A N   1 
ATOM   1133 C CA  . VAL A 1 151 ? 4.408   -9.112  -4.828  1.00 23.51 ? 151 VAL A CA  1 
ATOM   1134 C C   . VAL A 1 151 ? 3.391   -8.574  -5.829  1.00 23.77 ? 151 VAL A C   1 
ATOM   1135 O O   . VAL A 1 151 ? 3.695   -8.441  -6.985  1.00 23.84 ? 151 VAL A O   1 
ATOM   1136 C CB  . VAL A 1 151 ? 3.987   -10.548 -4.452  1.00 23.79 ? 151 VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 151 ? 3.588   -11.354 -5.738  1.00 22.49 ? 151 VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 151 ? 5.074   -11.261 -3.729  1.00 23.72 ? 151 VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 152 ? 2.194   -8.244  -5.370  1.00 23.65 ? 152 LEU A N   1 
ATOM   1140 C CA  . LEU A 1 152 ? 1.156   -7.728  -6.259  1.00 24.09 ? 152 LEU A CA  1 
ATOM   1141 C C   . LEU A 1 152 ? 1.514   -6.333  -6.841  1.00 23.45 ? 152 LEU A C   1 
ATOM   1142 O O   . LEU A 1 152 ? 1.169   -6.016  -7.974  1.00 23.96 ? 152 LEU A O   1 
ATOM   1143 C CB  . LEU A 1 152 ? -0.178  -7.632  -5.497  1.00 24.20 ? 152 LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 152 ? -0.882  -8.915  -5.042  1.00 27.23 ? 152 LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 152 ? -2.159  -8.611  -4.285  1.00 27.68 ? 152 LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 152 ? -1.225  -9.774  -6.248  1.00 29.83 ? 152 LEU A CD2 1 
ATOM   1147 N N   . THR A 1 153 ? 2.192   -5.509  -6.055  1.00 23.17 ? 153 THR A N   1 
ATOM   1148 C CA  . THR A 1 153 ? 2.608   -4.177  -6.485  1.00 22.66 ? 153 THR A CA  1 
ATOM   1149 C C   . THR A 1 153 ? 3.646   -4.303  -7.557  1.00 22.03 ? 153 THR A C   1 
ATOM   1150 O O   . THR A 1 153 ? 3.589   -3.608  -8.541  1.00 21.40 ? 153 THR A O   1 
ATOM   1151 C CB  . THR A 1 153 ? 3.142   -3.399  -5.289  1.00 23.29 ? 153 THR A CB  1 
ATOM   1152 O OG1 . THR A 1 153 ? 2.111   -3.253  -4.294  1.00 22.02 ? 153 THR A OG1 1 
ATOM   1153 C CG2 . THR A 1 153 ? 3.552   -1.971  -5.666  1.00 24.32 ? 153 THR A CG2 1 
ATOM   1154 N N   . PHE A 1 154 ? 4.579   -5.230  -7.403  1.00 23.18 ? 154 PHE A N   1 
ATOM   1155 C CA  . PHE A 1 154 ? 5.583   -5.471  -8.441  1.00 23.76 ? 154 PHE A CA  1 
ATOM   1156 C C   . PHE A 1 154 ? 4.916   -6.122  -9.658  1.00 24.66 ? 154 PHE A C   1 
ATOM   1157 O O   . PHE A 1 154 ? 5.167   -5.750  -10.804 1.00 25.77 ? 154 PHE A O   1 
ATOM   1158 C CB  . PHE A 1 154 ? 6.744   -6.340  -7.901  1.00 23.84 ? 154 PHE A CB  1 
ATOM   1159 C CG  . PHE A 1 154 ? 7.765   -5.578  -7.037  1.00 24.00 ? 154 PHE A CG  1 
ATOM   1160 C CD1 . PHE A 1 154 ? 7.685   -4.204  -6.844  1.00 21.23 ? 154 PHE A CD1 1 
ATOM   1161 C CD2 . PHE A 1 154 ? 8.787   -6.268  -6.402  1.00 20.62 ? 154 PHE A CD2 1 
ATOM   1162 C CE1 . PHE A 1 154 ? 8.616   -3.538  -6.044  1.00 23.07 ? 154 PHE A CE1 1 
ATOM   1163 C CE2 . PHE A 1 154 ? 9.721   -5.598  -5.640  1.00 20.30 ? 154 PHE A CE2 1 
ATOM   1164 C CZ  . PHE A 1 154 ? 9.623   -4.228  -5.449  1.00 20.83 ? 154 PHE A CZ  1 
ATOM   1165 N N   . GLU A 1 155 ? 4.028   -7.071  -9.438  1.00 25.24 ? 155 GLU A N   1 
ATOM   1166 C CA  . GLU A 1 155 ? 3.273   -7.598  -10.580 1.00 25.74 ? 155 GLU A CA  1 
ATOM   1167 C C   . GLU A 1 155 ? 2.667   -6.428  -11.377 1.00 24.70 ? 155 GLU A C   1 
ATOM   1168 O O   . GLU A 1 155 ? 2.785   -6.380  -12.614 1.00 25.03 ? 155 GLU A O   1 
ATOM   1169 C CB  . GLU A 1 155 ? 2.178   -8.565  -10.131 1.00 26.18 ? 155 GLU A CB  1 
ATOM   1170 C CG  . GLU A 1 155 ? 1.462   -9.211  -11.307 1.00 28.58 ? 155 GLU A CG  1 
ATOM   1171 C CD  . GLU A 1 155 ? 0.390   -10.214 -10.898 1.00 31.88 ? 155 GLU A CD  1 
ATOM   1172 O OE1 . GLU A 1 155 ? -0.175  -10.162 -9.754  1.00 34.41 ? 155 GLU A OE1 1 
ATOM   1173 O OE2 . GLU A 1 155 ? 0.116   -11.060 -11.762 1.00 34.63 ? 155 GLU A OE2 1 
ATOM   1174 N N   . TYR A 1 156 ? 2.058   -5.476  -10.667 1.00 23.04 ? 156 TYR A N   1 
ATOM   1175 C CA  . TYR A 1 156 ? 1.475   -4.305  -11.310 1.00 21.19 ? 156 TYR A CA  1 
ATOM   1176 C C   . TYR A 1 156 ? 2.525   -3.422  -11.943 1.00 21.72 ? 156 TYR A C   1 
ATOM   1177 O O   . TYR A 1 156 ? 2.395   -3.072  -13.128 1.00 22.63 ? 156 TYR A O   1 
ATOM   1178 C CB  . TYR A 1 156 ? 0.656   -3.502  -10.312 1.00 20.75 ? 156 TYR A CB  1 
ATOM   1179 C CG  . TYR A 1 156 ? 0.212   -2.164  -10.777 1.00 19.09 ? 156 TYR A CG  1 
ATOM   1180 C CD1 . TYR A 1 156 ? -0.980  -2.006  -11.462 1.00 20.65 ? 156 TYR A CD1 1 
ATOM   1181 C CD2 . TYR A 1 156 ? 0.966   -1.023  -10.500 1.00 20.94 ? 156 TYR A CD2 1 
ATOM   1182 C CE1 . TYR A 1 156 ? -1.414  -0.719  -11.897 1.00 22.57 ? 156 TYR A CE1 1 
ATOM   1183 C CE2 . TYR A 1 156 ? 0.540   0.263   -10.933 1.00 23.11 ? 156 TYR A CE2 1 
ATOM   1184 C CZ  . TYR A 1 156 ? -0.654  0.401   -11.642 1.00 22.47 ? 156 TYR A CZ  1 
ATOM   1185 O OH  . TYR A 1 156 ? -1.099  1.660   -12.061 1.00 20.96 ? 156 TYR A OH  1 
ATOM   1186 N N   . LEU A 1 157 ? 3.575   -3.023  -11.220 1.00 20.80 ? 157 LEU A N   1 
ATOM   1187 C CA  . LEU A 1 157 ? 4.517   -2.083  -11.849 1.00 20.17 ? 157 LEU A CA  1 
ATOM   1188 C C   . LEU A 1 157 ? 5.204   -2.702  -13.068 1.00 20.88 ? 157 LEU A C   1 
ATOM   1189 O O   . LEU A 1 157 ? 5.346   -2.055  -14.117 1.00 20.43 ? 157 LEU A O   1 
ATOM   1190 C CB  . LEU A 1 157 ? 5.549   -1.548  -10.873 1.00 19.65 ? 157 LEU A CB  1 
ATOM   1191 C CG  . LEU A 1 157 ? 4.956   -0.744  -9.705  1.00 18.63 ? 157 LEU A CG  1 
ATOM   1192 C CD1 . LEU A 1 157 ? 5.987   -0.610  -8.617  1.00 16.12 ? 157 LEU A CD1 1 
ATOM   1193 C CD2 . LEU A 1 157 ? 4.484   0.635   -10.166 1.00 18.06 ? 157 LEU A CD2 1 
ATOM   1194 N N   . HIS A 1 158 ? 5.663   -3.941  -12.919 1.00 21.56 ? 158 HIS A N   1 
ATOM   1195 C CA  . HIS A 1 158 ? 6.394   -4.614  -13.982 1.00 22.28 ? 158 HIS A CA  1 
ATOM   1196 C C   . HIS A 1 158 ? 5.545   -4.783  -15.246 1.00 23.45 ? 158 HIS A C   1 
ATOM   1197 O O   . HIS A 1 158 ? 6.075   -4.778  -16.349 1.00 23.86 ? 158 HIS A O   1 
ATOM   1198 C CB  . HIS A 1 158 ? 6.859   -5.996  -13.532 1.00 22.50 ? 158 HIS A CB  1 
ATOM   1199 C CG  . HIS A 1 158 ? 7.890   -5.978  -12.449 1.00 24.28 ? 158 HIS A CG  1 
ATOM   1200 N ND1 . HIS A 1 158 ? 8.503   -4.818  -12.012 1.00 22.35 ? 158 HIS A ND1 1 
ATOM   1201 C CD2 . HIS A 1 158 ? 8.403   -6.977  -11.701 1.00 25.34 ? 158 HIS A CD2 1 
ATOM   1202 C CE1 . HIS A 1 158 ? 9.368   -5.117  -11.067 1.00 23.67 ? 158 HIS A CE1 1 
ATOM   1203 N NE2 . HIS A 1 158 ? 9.336   -6.421  -10.862 1.00 23.15 ? 158 HIS A NE2 1 
ATOM   1204 N N   . SER A 1 159 ? 4.230   -4.916  -15.095 1.00 23.99 ? 159 SER A N   1 
ATOM   1205 C CA  . SER A 1 159 ? 3.358   -5.090  -16.254 1.00 24.58 ? 159 SER A CA  1 
ATOM   1206 C C   . SER A 1 159 ? 3.297   -3.818  -17.062 1.00 24.62 ? 159 SER A C   1 
ATOM   1207 O O   . SER A 1 159 ? 2.896   -3.849  -18.225 1.00 24.06 ? 159 SER A O   1 
ATOM   1208 C CB  . SER A 1 159 ? 1.937   -5.455  -15.830 1.00 24.76 ? 159 SER A CB  1 
ATOM   1209 O OG  . SER A 1 159 ? 1.285   -4.346  -15.230 1.00 26.52 ? 159 SER A OG  1 
ATOM   1210 N N   . LEU A 1 160 ? 3.664   -2.705  -16.402 1.00 24.02 ? 160 LEU A N   1 
ATOM   1211 C CA  . LEU A 1 160 ? 3.733   -1.378  -16.987 1.00 23.89 ? 160 LEU A CA  1 
ATOM   1212 C C   . LEU A 1 160 ? 5.142   -1.023  -17.513 1.00 23.21 ? 160 LEU A C   1 
ATOM   1213 O O   . LEU A 1 160 ? 5.423   0.128   -17.859 1.00 23.01 ? 160 LEU A O   1 
ATOM   1214 C CB  . LEU A 1 160 ? 3.312   -0.382  -15.904 1.00 24.25 ? 160 LEU A CB  1 
ATOM   1215 C CG  . LEU A 1 160 ? 1.882   0.148   -15.828 1.00 25.82 ? 160 LEU A CG  1 
ATOM   1216 C CD1 . LEU A 1 160 ? 0.808   -0.700  -16.508 1.00 25.97 ? 160 LEU A CD1 1 
ATOM   1217 C CD2 . LEU A 1 160 ? 1.515   0.477   -14.393 1.00 25.05 ? 160 LEU A CD2 1 
ATOM   1218 N N   . ASP A 1 161 ? 6.026   -2.013  -17.535 1.00 23.13 ? 161 ASP A N   1 
ATOM   1219 C CA  . ASP A 1 161 ? 7.463   -1.856  -17.804 1.00 22.64 ? 161 ASP A CA  1 
ATOM   1220 C C   . ASP A 1 161 ? 8.247   -0.988  -16.818 1.00 23.08 ? 161 ASP A C   1 
ATOM   1221 O O   . ASP A 1 161 ? 9.301   -0.482  -17.126 1.00 23.19 ? 161 ASP A O   1 
ATOM   1222 C CB  . ASP A 1 161 ? 7.615   -1.389  -19.234 1.00 23.91 ? 161 ASP A CB  1 
ATOM   1223 C CG  . ASP A 1 161 ? 6.691   -2.146  -20.158 1.00 22.94 ? 161 ASP A CG  1 
ATOM   1224 O OD1 . ASP A 1 161 ? 6.879   -3.372  -20.253 1.00 26.76 ? 161 ASP A OD1 1 
ATOM   1225 O OD2 . ASP A 1 161 ? 5.697   -1.637  -20.718 1.00 28.39 ? 161 ASP A OD2 1 
ATOM   1226 N N   . LEU A 1 162 ? 7.718   -0.836  -15.612 1.00 23.86 ? 162 LEU A N   1 
ATOM   1227 C CA  . LEU A 1 162 ? 8.311   0.022   -14.610 1.00 24.05 ? 162 LEU A CA  1 
ATOM   1228 C C   . LEU A 1 162 ? 9.198   -0.852  -13.748 1.00 23.71 ? 162 LEU A C   1 
ATOM   1229 O O   . LEU A 1 162 ? 8.796   -1.957  -13.364 1.00 25.56 ? 162 LEU A O   1 
ATOM   1230 C CB  . LEU A 1 162 ? 7.243   0.724   -13.766 1.00 22.92 ? 162 LEU A CB  1 
ATOM   1231 C CG  . LEU A 1 162 ? 6.312   1.620   -14.572 1.00 23.08 ? 162 LEU A CG  1 
ATOM   1232 C CD1 . LEU A 1 162 ? 5.110   1.948   -13.773 1.00 22.45 ? 162 LEU A CD1 1 
ATOM   1233 C CD2 . LEU A 1 162 ? 6.997   2.907   -15.021 1.00 22.58 ? 162 LEU A CD2 1 
ATOM   1234 N N   . ILE A 1 163 ? 10.384  -0.339  -13.453 1.00 22.92 ? 163 ILE A N   1 
ATOM   1235 C CA  . ILE A 1 163 ? 11.269  -0.902  -12.451 1.00 23.35 ? 163 ILE A CA  1 
ATOM   1236 C C   . ILE A 1 163 ? 11.350  0.070   -11.293 1.00 21.90 ? 163 ILE A C   1 
ATOM   1237 O O   . ILE A 1 163 ? 11.507  1.260   -11.504 1.00 22.58 ? 163 ILE A O   1 
ATOM   1238 C CB  . ILE A 1 163 ? 12.670  -1.178  -13.035 1.00 23.25 ? 163 ILE A CB  1 
ATOM   1239 C CG1 . ILE A 1 163 ? 12.563  -2.056  -14.258 1.00 24.69 ? 163 ILE A CG1 1 
ATOM   1240 C CG2 . ILE A 1 163 ? 13.493  -1.968  -12.048 1.00 25.56 ? 163 ILE A CG2 1 
ATOM   1241 C CD1 . ILE A 1 163 ? 13.953  -2.439  -14.835 1.00 28.75 ? 163 ILE A CD1 1 
ATOM   1242 N N   . TYR A 1 164 ? 11.207  -0.435  -10.069 1.00 21.44 ? 164 TYR A N   1 
ATOM   1243 C CA  . TYR A 1 164 ? 11.050  0.415   -8.871  1.00 19.58 ? 164 TYR A CA  1 
ATOM   1244 C C   . TYR A 1 164 ? 12.386  0.823   -8.296  1.00 18.37 ? 164 TYR A C   1 
ATOM   1245 O O   . TYR A 1 164 ? 12.630  2.004   -8.065  1.00 18.09 ? 164 TYR A O   1 
ATOM   1246 C CB  . TYR A 1 164 ? 10.233  -0.315  -7.801  1.00 20.46 ? 164 TYR A CB  1 
ATOM   1247 C CG  . TYR A 1 164 ? 10.178  0.467   -6.517  1.00 20.24 ? 164 TYR A CG  1 
ATOM   1248 C CD1 . TYR A 1 164 ? 9.634   1.736   -6.498  1.00 18.98 ? 164 TYR A CD1 1 
ATOM   1249 C CD2 . TYR A 1 164 ? 10.713  -0.032  -5.352  1.00 20.18 ? 164 TYR A CD2 1 
ATOM   1250 C CE1 . TYR A 1 164 ? 9.624   2.481   -5.356  1.00 22.44 ? 164 TYR A CE1 1 
ATOM   1251 C CE2 . TYR A 1 164 ? 10.694  0.718   -4.184  1.00 21.59 ? 164 TYR A CE2 1 
ATOM   1252 C CZ  . TYR A 1 164 ? 10.141  1.964   -4.180  1.00 22.48 ? 164 TYR A CZ  1 
ATOM   1253 O OH  . TYR A 1 164 ? 10.142  2.750   -3.018  1.00 21.78 ? 164 TYR A OH  1 
ATOM   1254 N N   . ARG A 1 165 ? 13.224  -0.183  -8.038  1.00 17.94 ? 165 ARG A N   1 
ATOM   1255 C CA  . ARG A 1 165 ? 14.651  -0.078  -7.781  1.00 17.10 ? 165 ARG A CA  1 
ATOM   1256 C C   . ARG A 1 165 ? 15.065  0.477   -6.424  1.00 17.78 ? 165 ARG A C   1 
ATOM   1257 O O   . ARG A 1 165 ? 16.219  0.862   -6.237  1.00 17.93 ? 165 ARG A O   1 
ATOM   1258 C CB  . ARG A 1 165 ? 15.363  0.699   -8.879  1.00 16.76 ? 165 ARG A CB  1 
ATOM   1259 C CG  . ARG A 1 165 ? 15.206  0.106   -10.277 1.00 17.08 ? 165 ARG A CG  1 
ATOM   1260 C CD  . ARG A 1 165 ? 16.286  0.601   -11.220 1.00 18.16 ? 165 ARG A CD  1 
ATOM   1261 N NE  . ARG A 1 165 ? 16.089  2.002   -11.555 1.00 18.59 ? 165 ARG A NE  1 
ATOM   1262 C CZ  . ARG A 1 165 ? 16.821  2.704   -12.407 1.00 20.10 ? 165 ARG A CZ  1 
ATOM   1263 N NH1 . ARG A 1 165 ? 17.864  2.171   -13.032 1.00 25.18 ? 165 ARG A NH1 1 
ATOM   1264 N NH2 . ARG A 1 165 ? 16.511  3.958   -12.654 1.00 20.32 ? 165 ARG A NH2 1 
ATOM   1265 N N   . ASP A 1 166 ? 14.193  0.431   -5.434  1.00 18.92 ? 166 ASP A N   1 
ATOM   1266 C CA  . ASP A 1 166 ? 14.631  0.825   -4.088  1.00 19.39 ? 166 ASP A CA  1 
ATOM   1267 C C   . ASP A 1 166 ? 13.747  0.289   -2.995  1.00 19.25 ? 166 ASP A C   1 
ATOM   1268 O O   . ASP A 1 166 ? 13.446  0.988   -2.031  1.00 21.12 ? 166 ASP A O   1 
ATOM   1269 C CB  . ASP A 1 166 ? 14.696  2.349   -4.009  1.00 19.38 ? 166 ASP A CB  1 
ATOM   1270 C CG  . ASP A 1 166 ? 15.507  2.841   -2.816  1.00 22.18 ? 166 ASP A CG  1 
ATOM   1271 O OD1 . ASP A 1 166 ? 16.451  2.170   -2.365  1.00 21.11 ? 166 ASP A OD1 1 
ATOM   1272 O OD2 . ASP A 1 166 ? 15.205  3.896   -2.242  1.00 26.48 ? 166 ASP A OD2 1 
ATOM   1273 N N   . LEU A 1 167 ? 13.328  -0.958  -3.131  1.00 18.89 ? 167 LEU A N   1 
ATOM   1274 C CA  . LEU A 1 167 ? 12.555  -1.600  -2.104  1.00 18.41 ? 167 LEU A CA  1 
ATOM   1275 C C   . LEU A 1 167 ? 13.373  -1.709  -0.835  1.00 18.19 ? 167 LEU A C   1 
ATOM   1276 O O   . LEU A 1 167 ? 14.508  -2.159  -0.862  1.00 18.10 ? 167 LEU A O   1 
ATOM   1277 C CB  . LEU A 1 167 ? 12.119  -2.954  -2.570  1.00 18.36 ? 167 LEU A CB  1 
ATOM   1278 C CG  . LEU A 1 167 ? 11.125  -3.739  -1.705  1.00 19.99 ? 167 LEU A CG  1 
ATOM   1279 C CD1 . LEU A 1 167 ? 9.675   -3.206  -1.786  1.00 20.00 ? 167 LEU A CD1 1 
ATOM   1280 C CD2 . LEU A 1 167 ? 11.176  -5.154  -2.144  1.00 21.98 ? 167 LEU A CD2 1 
ATOM   1281 N N   . LYS A 1 168 ? 12.798  -1.237  0.261   1.00 18.64 ? 168 LYS A N   1 
ATOM   1282 C CA  . LYS A 1 168 ? 13.362  -1.396  1.614   1.00 18.20 ? 168 LYS A CA  1 
ATOM   1283 C C   . LYS A 1 168 ? 12.292  -0.935  2.603   1.00 19.42 ? 168 LYS A C   1 
ATOM   1284 O O   . LYS A 1 168 ? 11.417  -0.152  2.234   1.00 20.28 ? 168 LYS A O   1 
ATOM   1285 C CB  . LYS A 1 168 ? 14.608  -0.550  1.779   1.00 18.02 ? 168 LYS A CB  1 
ATOM   1286 C CG  . LYS A 1 168 ? 14.400  0.909   1.555   1.00 18.16 ? 168 LYS A CG  1 
ATOM   1287 C CD  . LYS A 1 168 ? 15.738  1.664   1.461   1.00 17.78 ? 168 LYS A CD  1 
ATOM   1288 C CE  . LYS A 1 168 ? 15.551  3.142   1.260   1.00 18.15 ? 168 LYS A CE  1 
ATOM   1289 N NZ  . LYS A 1 168 ? 16.825  3.821   0.876   1.00 18.28 ? 168 LYS A NZ  1 
ATOM   1290 N N   . PRO A 1 169 ? 12.366  -1.355  3.852   1.00 19.88 ? 169 PRO A N   1 
ATOM   1291 C CA  . PRO A 1 169 ? 11.336  -0.994  4.856   1.00 20.07 ? 169 PRO A CA  1 
ATOM   1292 C C   . PRO A 1 169 ? 11.095  0.508   5.053   1.00 19.82 ? 169 PRO A C   1 
ATOM   1293 O O   . PRO A 1 169 ? 9.977   0.936   5.432   1.00 19.59 ? 169 PRO A O   1 
ATOM   1294 C CB  . PRO A 1 169 ? 11.871  -1.602  6.157   1.00 20.07 ? 169 PRO A CB  1 
ATOM   1295 C CG  . PRO A 1 169 ? 12.804  -2.659  5.762   1.00 20.78 ? 169 PRO A CG  1 
ATOM   1296 C CD  . PRO A 1 169 ? 13.377  -2.281  4.381   1.00 20.05 ? 169 PRO A CD  1 
ATOM   1297 N N   . GLU A 1 170 ? 12.142  1.282   4.803   1.00 19.06 ? 170 GLU A N   1 
ATOM   1298 C CA  . GLU A 1 170 ? 12.123  2.724   4.909   1.00 18.48 ? 170 GLU A CA  1 
ATOM   1299 C C   . GLU A 1 170 ? 11.131  3.342   3.960   1.00 18.36 ? 170 GLU A C   1 
ATOM   1300 O O   . GLU A 1 170 ? 10.587  4.439   4.236   1.00 19.87 ? 170 GLU A O   1 
ATOM   1301 C CB  . GLU A 1 170 ? 13.530  3.294   4.611   1.00 17.71 ? 170 GLU A CB  1 
ATOM   1302 C CG  . GLU A 1 170 ? 14.607  3.031   5.667   1.00 17.74 ? 170 GLU A CG  1 
ATOM   1303 C CD  . GLU A 1 170 ? 15.540  1.822   5.388   1.00 18.33 ? 170 GLU A CD  1 
ATOM   1304 O OE1 . GLU A 1 170 ? 15.088  0.767   4.885   1.00 17.65 ? 170 GLU A OE1 1 
ATOM   1305 O OE2 . GLU A 1 170 ? 16.749  1.924   5.687   1.00 17.62 ? 170 GLU A OE2 1 
ATOM   1306 N N   . ASN A 1 171 ? 10.927  2.701   2.813   1.00 18.64 ? 171 ASN A N   1 
ATOM   1307 C CA  . ASN A 1 171 ? 10.028  3.235   1.771   1.00 18.90 ? 171 ASN A CA  1 
ATOM   1308 C C   . ASN A 1 171 ? 8.601   2.691   1.841   1.00 19.52 ? 171 ASN A C   1 
ATOM   1309 O O   . ASN A 1 171 ? 7.760   3.001   0.974   1.00 19.41 ? 171 ASN A O   1 
ATOM   1310 C CB  . ASN A 1 171 ? 10.594  2.964   0.352   1.00 18.54 ? 171 ASN A CB  1 
ATOM   1311 C CG  . ASN A 1 171 ? 11.897  3.755   0.054   1.00 19.71 ? 171 ASN A CG  1 
ATOM   1312 O OD1 . ASN A 1 171 ? 12.404  4.467   0.916   1.00 17.50 ? 171 ASN A OD1 1 
ATOM   1313 N ND2 . ASN A 1 171 ? 12.452  3.584   -1.163  1.00 17.20 ? 171 ASN A ND2 1 
ATOM   1314 N N   . LEU A 1 172 ? 8.319   1.847   2.824   1.00 19.70 ? 172 LEU A N   1 
ATOM   1315 C CA  . LEU A 1 172 ? 7.006   1.237   2.906   1.00 20.19 ? 172 LEU A CA  1 
ATOM   1316 C C   . LEU A 1 172 ? 6.220   1.851   4.056   1.00 20.61 ? 172 LEU A C   1 
ATOM   1317 O O   . LEU A 1 172 ? 6.544   1.603   5.217   1.00 20.07 ? 172 LEU A O   1 
ATOM   1318 C CB  . LEU A 1 172 ? 7.155   -0.279  3.095   1.00 20.47 ? 172 LEU A CB  1 
ATOM   1319 C CG  . LEU A 1 172 ? 8.121   -0.954  2.121   1.00 20.32 ? 172 LEU A CG  1 
ATOM   1320 C CD1 . LEU A 1 172 ? 8.094   -2.436  2.331   1.00 21.08 ? 172 LEU A CD1 1 
ATOM   1321 C CD2 . LEU A 1 172 ? 7.763   -0.627  0.697   1.00 19.80 ? 172 LEU A CD2 1 
ATOM   1322 N N   . LEU A 1 173 ? 5.190   2.631   3.740   1.00 20.80 ? 173 LEU A N   1 
ATOM   1323 C CA  . LEU A 1 173 ? 4.401   3.296   4.768   1.00 22.02 ? 173 LEU A CA  1 
ATOM   1324 C C   . LEU A 1 173 ? 3.252   2.389   5.201   1.00 22.05 ? 173 LEU A C   1 
ATOM   1325 O O   . LEU A 1 173 ? 2.735   1.682   4.373   1.00 20.95 ? 173 LEU A O   1 
ATOM   1326 C CB  . LEU A 1 173 ? 3.891   4.613   4.232   1.00 22.38 ? 173 LEU A CB  1 
ATOM   1327 C CG  . LEU A 1 173 ? 5.043   5.489   3.734   1.00 26.22 ? 173 LEU A CG  1 
ATOM   1328 C CD1 . LEU A 1 173 ? 4.544   6.539   2.805   1.00 28.78 ? 173 LEU A CD1 1 
ATOM   1329 C CD2 . LEU A 1 173 ? 5.758   6.100   4.919   1.00 28.62 ? 173 LEU A CD2 1 
ATOM   1330 N N   . ILE A 1 174 ? 2.874   2.414   6.485   1.00 22.53 ? 174 ILE A N   1 
ATOM   1331 C CA  . ILE A 1 174 ? 1.759   1.599   7.003   1.00 23.45 ? 174 ILE A CA  1 
ATOM   1332 C C   . ILE A 1 174 ? 0.562   2.523   7.142   1.00 24.15 ? 174 ILE A C   1 
ATOM   1333 O O   . ILE A 1 174 ? 0.647   3.583   7.768   1.00 23.68 ? 174 ILE A O   1 
ATOM   1334 C CB  . ILE A 1 174 ? 2.074   0.969   8.389   1.00 23.57 ? 174 ILE A CB  1 
ATOM   1335 C CG1 . ILE A 1 174 ? 3.428   0.251   8.427   1.00 26.54 ? 174 ILE A CG1 1 
ATOM   1336 C CG2 . ILE A 1 174 ? 0.995   -0.001  8.807   1.00 23.87 ? 174 ILE A CG2 1 
ATOM   1337 C CD1 . ILE A 1 174 ? 3.544   -0.863  7.505   1.00 26.55 ? 174 ILE A CD1 1 
ATOM   1338 N N   . ASP A 1 175 ? -0.568  2.152   6.561   1.00 24.96 ? 175 ASP A N   1 
ATOM   1339 C CA  . ASP A 1 175 ? -1.722  3.012   6.658   1.00 25.45 ? 175 ASP A CA  1 
ATOM   1340 C C   . ASP A 1 175 ? -2.581  2.679   7.878   1.00 27.53 ? 175 ASP A C   1 
ATOM   1341 O O   . ASP A 1 175 ? -2.242  1.805   8.682   1.00 27.05 ? 175 ASP A O   1 
ATOM   1342 C CB  . ASP A 1 175 ? -2.526  3.045   5.353   1.00 25.59 ? 175 ASP A CB  1 
ATOM   1343 C CG  . ASP A 1 175 ? -3.186  1.741   5.005   1.00 23.84 ? 175 ASP A CG  1 
ATOM   1344 O OD1 . ASP A 1 175 ? -3.431  0.879   5.867   1.00 24.35 ? 175 ASP A OD1 1 
ATOM   1345 O OD2 . ASP A 1 175 ? -3.462  1.494   3.815   1.00 25.10 ? 175 ASP A OD2 1 
ATOM   1346 N N   . GLN A 1 176 ? -3.696  3.380   8.002   1.00 29.06 ? 176 GLN A N   1 
ATOM   1347 C CA  . GLN A 1 176 ? -4.535  3.297   9.187   1.00 31.08 ? 176 GLN A CA  1 
ATOM   1348 C C   . GLN A 1 176 ? -5.206  1.941   9.292   1.00 31.31 ? 176 GLN A C   1 
ATOM   1349 O O   . GLN A 1 176 ? -5.670  1.569   10.380  1.00 30.61 ? 176 GLN A O   1 
ATOM   1350 C CB  . GLN A 1 176 ? -5.566  4.436   9.126   1.00 31.96 ? 176 GLN A CB  1 
ATOM   1351 C CG  . GLN A 1 176 ? -6.203  4.827   10.438  1.00 37.61 ? 176 GLN A CG  1 
ATOM   1352 C CD  . GLN A 1 176 ? -7.042  6.119   10.316  1.00 44.51 ? 176 GLN A CD  1 
ATOM   1353 O OE1 . GLN A 1 176 ? -8.208  6.143   10.755  1.00 52.07 ? 176 GLN A OE1 1 
ATOM   1354 N NE2 . GLN A 1 176 ? -6.450  7.195   9.736   1.00 46.03 ? 176 GLN A NE2 1 
ATOM   1355 N N   . GLN A 1 177 ? -5.288  1.231   8.153   1.00 32.01 ? 177 GLN A N   1 
ATOM   1356 C CA  . GLN A 1 177 ? -5.760  -0.167  8.090   1.00 32.48 ? 177 GLN A CA  1 
ATOM   1357 C C   . GLN A 1 177 ? -4.631  -1.226  8.163   1.00 31.79 ? 177 GLN A C   1 
ATOM   1358 O O   . GLN A 1 177 ? -4.898  -2.405  8.064   1.00 32.33 ? 177 GLN A O   1 
ATOM   1359 C CB  . GLN A 1 177 ? -6.645  -0.380  6.847   1.00 33.77 ? 177 GLN A CB  1 
ATOM   1360 C CG  . GLN A 1 177 ? -8.126  0.192   6.983   1.00 39.53 ? 177 GLN A CG  1 
ATOM   1361 C CD  . GLN A 1 177 ? -8.341  1.674   6.481   1.00 47.08 ? 177 GLN A CD  1 
ATOM   1362 O OE1 . GLN A 1 177 ? -7.964  2.661   7.163   1.00 49.77 ? 177 GLN A OE1 1 
ATOM   1363 N NE2 . GLN A 1 177 ? -8.999  1.810   5.314   1.00 50.99 ? 177 GLN A NE2 1 
ATOM   1364 N N   . GLY A 1 178 ? -3.377  -0.819  8.358   1.00 30.84 ? 178 GLY A N   1 
ATOM   1365 C CA  . GLY A 1 178 ? -2.275  -1.762  8.499   1.00 30.10 ? 178 GLY A CA  1 
ATOM   1366 C C   . GLY A 1 178 ? -1.655  -2.274  7.201   1.00 29.38 ? 178 GLY A C   1 
ATOM   1367 O O   . GLY A 1 178 ? -0.771  -3.128  7.226   1.00 29.58 ? 178 GLY A O   1 
ATOM   1368 N N   . TYR A 1 179 ? -2.142  -1.774  6.078   1.00 28.31 ? 179 TYR A N   1 
ATOM   1369 C CA  . TYR A 1 179 ? -1.636  -2.132  4.753   1.00 27.79 ? 179 TYR A CA  1 
ATOM   1370 C C   . TYR A 1 179 ? -0.532  -1.158  4.341   1.00 26.72 ? 179 TYR A C   1 
ATOM   1371 O O   . TYR A 1 179 ? -0.363  -0.109  4.947   1.00 26.07 ? 179 TYR A O   1 
ATOM   1372 C CB  . TYR A 1 179 ? -2.766  -2.078  3.726   1.00 27.48 ? 179 TYR A CB  1 
ATOM   1373 C CG  . TYR A 1 179 ? -3.688  -3.260  3.815   1.00 27.82 ? 179 TYR A CG  1 
ATOM   1374 C CD1 . TYR A 1 179 ? -4.637  -3.365  4.838   1.00 29.58 ? 179 TYR A CD1 1 
ATOM   1375 C CD2 . TYR A 1 179 ? -3.587  -4.308  2.895   1.00 30.28 ? 179 TYR A CD2 1 
ATOM   1376 C CE1 . TYR A 1 179 ? -5.469  -4.495  4.932   1.00 30.75 ? 179 TYR A CE1 1 
ATOM   1377 C CE2 . TYR A 1 179 ? -4.372  -5.428  2.982   1.00 30.94 ? 179 TYR A CE2 1 
ATOM   1378 C CZ  . TYR A 1 179 ? -5.324  -5.533  4.004   1.00 32.78 ? 179 TYR A CZ  1 
ATOM   1379 O OH  . TYR A 1 179 ? -6.127  -6.674  4.060   1.00 32.50 ? 179 TYR A OH  1 
ATOM   1380 N N   . ILE A 1 180 ? 0.188   -1.517  3.294   1.00 26.24 ? 180 ILE A N   1 
ATOM   1381 C CA  . ILE A 1 180 ? 1.359   -0.771  2.821   1.00 26.05 ? 180 ILE A CA  1 
ATOM   1382 C C   . ILE A 1 180 ? 1.011   0.189   1.731   1.00 25.58 ? 180 ILE A C   1 
ATOM   1383 O O   . ILE A 1 180 ? 0.147   -0.123  0.892   1.00 24.45 ? 180 ILE A O   1 
ATOM   1384 C CB  . ILE A 1 180 ? 2.409   -1.757  2.251   1.00 26.97 ? 180 ILE A CB  1 
ATOM   1385 C CG1 . ILE A 1 180 ? 3.093   -2.490  3.364   1.00 25.67 ? 180 ILE A CG1 1 
ATOM   1386 C CG2 . ILE A 1 180 ? 3.485   -1.061  1.381   1.00 27.37 ? 180 ILE A CG2 1 
ATOM   1387 C CD1 . ILE A 1 180 ? 3.686   -3.765  2.844   1.00 26.80 ? 180 ILE A CD1 1 
ATOM   1388 N N   . LYS A 1 181 ? 1.687   1.353   1.774   1.00 25.35 ? 181 LYS A N   1 
ATOM   1389 C CA  . LYS A 1 181 ? 1.889   2.234   0.636   1.00 25.23 ? 181 LYS A CA  1 
ATOM   1390 C C   . LYS A 1 181 ? 3.408   2.343   0.299   1.00 24.48 ? 181 LYS A C   1 
ATOM   1391 O O   . LYS A 1 181 ? 4.227   2.775   1.129   1.00 23.53 ? 181 LYS A O   1 
ATOM   1392 C CB  . LYS A 1 181 ? 1.392   3.648   0.971   1.00 26.42 ? 181 LYS A CB  1 
ATOM   1393 C CG  . LYS A 1 181 ? -0.059  3.761   1.409   1.00 27.63 ? 181 LYS A CG  1 
ATOM   1394 C CD  . LYS A 1 181 ? -1.009  3.729   0.285   1.00 27.04 ? 181 LYS A CD  1 
ATOM   1395 C CE  . LYS A 1 181 ? -2.464  3.911   0.761   1.00 26.02 ? 181 LYS A CE  1 
ATOM   1396 N NZ  . LYS A 1 181 ? -3.306  3.077   -0.071  1.00 24.69 ? 181 LYS A NZ  1 
ATOM   1397 N N   . VAL A 1 182 ? 3.783   1.971   -0.920  1.00 22.62 ? 182 VAL A N   1 
ATOM   1398 C CA  . VAL A 1 182 ? 5.126   2.145   -1.377  1.00 21.21 ? 182 VAL A CA  1 
ATOM   1399 C C   . VAL A 1 182 ? 5.283   3.613   -1.723  1.00 21.11 ? 182 VAL A C   1 
ATOM   1400 O O   . VAL A 1 182 ? 4.497   4.180   -2.482  1.00 21.20 ? 182 VAL A O   1 
ATOM   1401 C CB  . VAL A 1 182 ? 5.432   1.298   -2.608  1.00 20.91 ? 182 VAL A CB  1 
ATOM   1402 C CG1 . VAL A 1 182 ? 6.833   1.557   -3.108  1.00 21.66 ? 182 VAL A CG1 1 
ATOM   1403 C CG2 . VAL A 1 182 ? 5.243   -0.162  -2.331  1.00 21.01 ? 182 VAL A CG2 1 
ATOM   1404 N N   . ALA A 1 183 ? 6.307   4.239   -1.173  1.00 21.75 ? 183 ALA A N   1 
ATOM   1405 C CA  . ALA A 1 183 ? 6.632   5.652   -1.495  1.00 21.30 ? 183 ALA A CA  1 
ATOM   1406 C C   . ALA A 1 183 ? 8.056   5.766   -1.960  1.00 21.71 ? 183 ALA A C   1 
ATOM   1407 O O   . ALA A 1 183 ? 8.878   4.878   -1.715  1.00 22.88 ? 183 ALA A O   1 
ATOM   1408 C CB  . ALA A 1 183 ? 6.405   6.512   -0.294  1.00 20.15 ? 183 ALA A CB  1 
ATOM   1409 N N   . ASP A 1 184 ? 8.357   6.893   -2.579  1.00 22.71 ? 184 ASP A N   1 
ATOM   1410 C CA  . ASP A 1 184 ? 9.676   7.245   -3.081  1.00 22.91 ? 184 ASP A CA  1 
ATOM   1411 C C   . ASP A 1 184 ? 9.998   6.468   -4.367  1.00 23.44 ? 184 ASP A C   1 
ATOM   1412 O O   . ASP A 1 184 ? 10.551  5.346   -4.344  1.00 25.33 ? 184 ASP A O   1 
ATOM   1413 C CB  . ASP A 1 184 ? 10.772  7.070   -2.037  1.00 22.81 ? 184 ASP A CB  1 
ATOM   1414 C CG  . ASP A 1 184 ? 12.035  7.860   -2.376  1.00 24.85 ? 184 ASP A CG  1 
ATOM   1415 O OD1 . ASP A 1 184 ? 12.203  8.245   -3.580  1.00 25.28 ? 184 ASP A OD1 1 
ATOM   1416 O OD2 . ASP A 1 184 ? 12.912  8.125   -1.505  1.00 22.49 ? 184 ASP A OD2 1 
ATOM   1417 N N   . PHE A 1 185 ? 9.682   7.129   -5.471  1.00 22.79 ? 185 PHE A N   1 
ATOM   1418 C CA  . PHE A 1 185 ? 9.938   6.674   -6.816  1.00 23.21 ? 185 PHE A CA  1 
ATOM   1419 C C   . PHE A 1 185 ? 11.103  7.362   -7.501  1.00 21.92 ? 185 PHE A C   1 
ATOM   1420 O O   . PHE A 1 185 ? 11.168  7.430   -8.732  1.00 22.39 ? 185 PHE A O   1 
ATOM   1421 C CB  . PHE A 1 185 ? 8.653   6.830   -7.599  1.00 23.41 ? 185 PHE A CB  1 
ATOM   1422 C CG  . PHE A 1 185 ? 7.645   5.809   -7.224  1.00 25.64 ? 185 PHE A CG  1 
ATOM   1423 C CD1 . PHE A 1 185 ? 7.023   5.862   -6.010  1.00 29.28 ? 185 PHE A CD1 1 
ATOM   1424 C CD2 . PHE A 1 185 ? 7.370   4.766   -8.048  1.00 30.27 ? 185 PHE A CD2 1 
ATOM   1425 C CE1 . PHE A 1 185 ? 6.100   4.903   -5.650  1.00 31.08 ? 185 PHE A CE1 1 
ATOM   1426 C CE2 . PHE A 1 185 ? 6.458   3.790   -7.656  1.00 32.63 ? 185 PHE A CE2 1 
ATOM   1427 C CZ  . PHE A 1 185 ? 5.849   3.872   -6.461  1.00 28.23 ? 185 PHE A CZ  1 
ATOM   1428 N N   . GLY A 1 186 ? 12.030  7.820   -6.683  1.00 20.83 ? 186 GLY A N   1 
ATOM   1429 C CA  . GLY A 1 186 ? 13.194  8.552   -7.132  1.00 21.19 ? 186 GLY A CA  1 
ATOM   1430 C C   . GLY A 1 186 ? 14.058  7.789   -8.125  1.00 20.96 ? 186 GLY A C   1 
ATOM   1431 O O   . GLY A 1 186 ? 14.708  8.415   -8.918  1.00 21.07 ? 186 GLY A O   1 
ATOM   1432 N N   . PHE A 1 187 ? 14.079  6.458   -8.059  1.00 20.36 ? 187 PHE A N   1 
ATOM   1433 C CA  . PHE A 1 187 ? 14.791  5.669   -9.033  1.00 21.15 ? 187 PHE A CA  1 
ATOM   1434 C C   . PHE A 1 187 ? 13.897  4.794   -9.948  1.00 20.92 ? 187 PHE A C   1 
ATOM   1435 O O   . PHE A 1 187 ? 14.426  3.986   -10.694 1.00 19.59 ? 187 PHE A O   1 
ATOM   1436 C CB  . PHE A 1 187 ? 15.802  4.792   -8.337  1.00 21.49 ? 187 PHE A CB  1 
ATOM   1437 C CG  . PHE A 1 187 ? 16.830  5.567   -7.579  1.00 24.33 ? 187 PHE A CG  1 
ATOM   1438 C CD1 . PHE A 1 187 ? 17.751  6.347   -8.243  1.00 23.17 ? 187 PHE A CD1 1 
ATOM   1439 C CD2 . PHE A 1 187 ? 16.877  5.500   -6.199  1.00 25.68 ? 187 PHE A CD2 1 
ATOM   1440 C CE1 . PHE A 1 187 ? 18.702  7.062   -7.558  1.00 26.05 ? 187 PHE A CE1 1 
ATOM   1441 C CE2 . PHE A 1 187 ? 17.828  6.214   -5.504  1.00 29.16 ? 187 PHE A CE2 1 
ATOM   1442 C CZ  . PHE A 1 187 ? 18.741  7.011   -6.180  1.00 28.00 ? 187 PHE A CZ  1 
ATOM   1443 N N   . ALA A 1 188 ? 12.571  4.914   -9.853  1.00 19.79 ? 188 ALA A N   1 
ATOM   1444 C CA  . ALA A 1 188 ? 11.695  4.142   -10.706 1.00 19.38 ? 188 ALA A CA  1 
ATOM   1445 C C   . ALA A 1 188 ? 11.895  4.622   -12.141 1.00 19.59 ? 188 ALA A C   1 
ATOM   1446 O O   . ALA A 1 188 ? 12.182  5.778   -12.366 1.00 19.46 ? 188 ALA A O   1 
ATOM   1447 C CB  . ALA A 1 188 ? 10.275  4.277   -10.285 1.00 19.73 ? 188 ALA A CB  1 
ATOM   1448 N N   . LYS A 1 189 ? 11.795  3.697   -13.094 1.00 19.88 ? 189 LYS A N   1 
ATOM   1449 C CA  . LYS A 1 189 ? 12.081  3.946   -14.505 1.00 19.22 ? 189 LYS A CA  1 
ATOM   1450 C C   . LYS A 1 189 ? 11.189  3.074   -15.328 1.00 19.77 ? 189 LYS A C   1 
ATOM   1451 O O   . LYS A 1 189 ? 10.966  1.904   -14.982 1.00 18.30 ? 189 LYS A O   1 
ATOM   1452 C CB  . LYS A 1 189 ? 13.536  3.534   -14.805 1.00 20.32 ? 189 LYS A CB  1 
ATOM   1453 C CG  . LYS A 1 189 ? 14.108  4.080   -16.117 1.00 19.27 ? 189 LYS A CG  1 
ATOM   1454 C CD  . LYS A 1 189 ? 15.511  3.556   -16.448 1.00 21.52 ? 189 LYS A CD  1 
ATOM   1455 C CE  . LYS A 1 189 ? 16.010  4.232   -17.701 1.00 23.96 ? 189 LYS A CE  1 
ATOM   1456 N NZ  . LYS A 1 189 ? 17.461  4.165   -17.859 1.00 27.68 ? 189 LYS A NZ  1 
ATOM   1457 N N   . ARG A 1 190 ? 10.661  3.626   -16.405 1.00 19.94 ? 190 ARG A N   1 
ATOM   1458 C CA  . ARG A 1 190 ? 9.979   2.839   -17.401 1.00 21.15 ? 190 ARG A CA  1 
ATOM   1459 C C   . ARG A 1 190 ? 10.991  2.457   -18.521 1.00 23.07 ? 190 ARG A C   1 
ATOM   1460 O O   . ARG A 1 190 ? 11.503  3.301   -19.283 1.00 21.31 ? 190 ARG A O   1 
ATOM   1461 C CB  . ARG A 1 190 ? 8.825   3.620   -17.966 1.00 20.95 ? 190 ARG A CB  1 
ATOM   1462 C CG  . ARG A 1 190 ? 7.871   2.751   -18.668 1.00 22.51 ? 190 ARG A CG  1 
ATOM   1463 C CD  . ARG A 1 190 ? 6.585   3.419   -19.117 1.00 23.70 ? 190 ARG A CD  1 
ATOM   1464 N NE  . ARG A 1 190 ? 5.841   2.367   -19.761 1.00 24.36 ? 190 ARG A NE  1 
ATOM   1465 C CZ  . ARG A 1 190 ? 5.324   2.437   -20.968 1.00 24.54 ? 190 ARG A CZ  1 
ATOM   1466 N NH1 . ARG A 1 190 ? 5.372   3.560   -21.647 1.00 24.07 ? 190 ARG A NH1 1 
ATOM   1467 N NH2 . ARG A 1 190 ? 4.731   1.371   -21.475 1.00 23.76 ? 190 ARG A NH2 1 
ATOM   1468 N N   . VAL A 1 191 ? 11.296  1.171   -18.595 1.00 25.78 ? 191 VAL A N   1 
ATOM   1469 C CA  . VAL A 1 191 ? 12.299  0.668   -19.548 1.00 28.04 ? 191 VAL A CA  1 
ATOM   1470 C C   . VAL A 1 191 ? 11.882  -0.727  -19.989 1.00 29.69 ? 191 VAL A C   1 
ATOM   1471 O O   . VAL A 1 191 ? 11.547  -1.562  -19.149 1.00 28.81 ? 191 VAL A O   1 
ATOM   1472 C CB  . VAL A 1 191 ? 13.712  0.664   -18.943 1.00 28.01 ? 191 VAL A CB  1 
ATOM   1473 C CG1 . VAL A 1 191 ? 13.699  0.144   -17.533 1.00 30.20 ? 191 VAL A CG1 1 
ATOM   1474 C CG2 . VAL A 1 191 ? 14.691  -0.161  -19.804 1.00 28.60 ? 191 VAL A CG2 1 
ATOM   1475 N N   . LYS A 1 192 ? 11.859  -0.965  -21.306 1.00 31.78 ? 192 LYS A N   1 
ATOM   1476 C CA  . LYS A 1 192 ? 11.479  -2.292  -21.788 1.00 34.17 ? 192 LYS A CA  1 
ATOM   1477 C C   . LYS A 1 192 ? 12.637  -3.307  -21.765 1.00 35.21 ? 192 LYS A C   1 
ATOM   1478 O O   . LYS A 1 192 ? 12.476  -4.423  -21.241 1.00 37.75 ? 192 LYS A O   1 
ATOM   1479 C CB  . LYS A 1 192 ? 10.771  -2.222  -23.145 1.00 35.20 ? 192 LYS A CB  1 
ATOM   1480 C CG  . LYS A 1 192 ? 9.243   -2.071  -22.981 1.00 35.51 ? 192 LYS A CG  1 
ATOM   1481 C CD  . LYS A 1 192 ? 8.504   -2.097  -24.299 1.00 38.51 ? 192 LYS A CD  1 
ATOM   1482 C CE  . LYS A 1 192 ? 7.006   -1.904  -24.076 1.00 39.27 ? 192 LYS A CE  1 
ATOM   1483 N NZ  . LYS A 1 192 ? 6.723   -0.454  -24.255 1.00 41.97 ? 192 LYS A NZ  1 
ATOM   1484 N N   . GLY A 1 193 ? 13.798  -2.945  -22.272 1.00 35.43 ? 193 GLY A N   1 
ATOM   1485 C CA  . GLY A 1 193 ? 14.922  -3.868  -22.201 1.00 35.70 ? 193 GLY A CA  1 
ATOM   1486 C C   . GLY A 1 193 ? 15.711  -3.826  -20.892 1.00 35.28 ? 193 GLY A C   1 
ATOM   1487 O O   . GLY A 1 193 ? 15.164  -4.092  -19.811 1.00 36.28 ? 193 GLY A O   1 
ATOM   1488 N N   . ARG A 1 194 ? 16.995  -3.476  -20.995 1.00 33.71 ? 194 ARG A N   1 
ATOM   1489 C CA  . ARG A 1 194 ? 17.888  -3.459  -19.843 1.00 32.75 ? 194 ARG A CA  1 
ATOM   1490 C C   . ARG A 1 194 ? 18.311  -2.048  -19.551 1.00 29.10 ? 194 ARG A C   1 
ATOM   1491 O O   . ARG A 1 194 ? 18.116  -1.170  -20.345 1.00 29.01 ? 194 ARG A O   1 
ATOM   1492 C CB  . ARG A 1 194 ? 19.125  -4.334  -20.069 1.00 33.75 ? 194 ARG A CB  1 
ATOM   1493 C CG  . ARG A 1 194 ? 19.885  -3.999  -21.357 1.00 38.77 ? 194 ARG A CG  1 
ATOM   1494 C CD  . ARG A 1 194 ? 21.243  -4.664  -21.501 1.00 42.27 ? 194 ARG A CD  1 
ATOM   1495 N NE  . ARG A 1 194 ? 21.230  -5.820  -22.402 1.00 45.99 ? 194 ARG A NE  1 
ATOM   1496 C CZ  . ARG A 1 194 ? 21.731  -7.037  -22.101 1.00 49.82 ? 194 ARG A CZ  1 
ATOM   1497 N NH1 . ARG A 1 194 ? 22.261  -7.304  -20.891 1.00 51.12 ? 194 ARG A NH1 1 
ATOM   1498 N NH2 . ARG A 1 194 ? 21.657  -8.013  -23.006 1.00 48.87 ? 194 ARG A NH2 1 
ATOM   1499 N N   . THR A 1 195 ? 18.856  -1.829  -18.375 1.00 26.22 ? 195 THR A N   1 
ATOM   1500 C CA  . THR A 1 195 ? 19.311  -0.517  -17.994 1.00 24.97 ? 195 THR A CA  1 
ATOM   1501 C C   . THR A 1 195 ? 20.542  -0.705  -17.138 1.00 23.55 ? 195 THR A C   1 
ATOM   1502 O O   . THR A 1 195 ? 20.832  -1.792  -16.730 1.00 22.40 ? 195 THR A O   1 
ATOM   1503 C CB  . THR A 1 195 ? 18.180  0.254   -17.288 1.00 24.93 ? 195 THR A CB  1 
ATOM   1504 O OG1 . THR A 1 195 ? 18.516  1.650   -17.191 1.00 25.24 ? 195 THR A OG1 1 
ATOM   1505 C CG2 . THR A 1 195 ? 17.985  -0.238  -15.824 1.00 26.21 ? 195 THR A CG2 1 
ATOM   1506 N N   . TRP A 1 196 ? 21.290  0.352   -16.875 1.00 23.26 ? 196 TRP A N   1 
ATOM   1507 C CA  . TRP A 1 196 ? 22.610  0.176   -16.258 1.00 23.26 ? 196 TRP A CA  1 
ATOM   1508 C C   . TRP A 1 196 ? 22.899  1.061   -15.073 1.00 22.82 ? 196 TRP A C   1 
ATOM   1509 O O   . TRP A 1 196 ? 23.970  0.988   -14.527 1.00 23.12 ? 196 TRP A O   1 
ATOM   1510 C CB  . TRP A 1 196 ? 23.710  0.422   -17.301 1.00 23.12 ? 196 TRP A CB  1 
ATOM   1511 C CG  . TRP A 1 196 ? 23.664  -0.495  -18.508 1.00 25.61 ? 196 TRP A CG  1 
ATOM   1512 C CD1 . TRP A 1 196 ? 24.396  -1.608  -18.706 1.00 26.93 ? 196 TRP A CD1 1 
ATOM   1513 C CD2 . TRP A 1 196 ? 22.818  -0.357  -19.670 1.00 26.33 ? 196 TRP A CD2 1 
ATOM   1514 N NE1 . TRP A 1 196 ? 24.095  -2.161  -19.929 1.00 28.74 ? 196 TRP A NE1 1 
ATOM   1515 C CE2 . TRP A 1 196 ? 23.117  -1.417  -20.532 1.00 28.86 ? 196 TRP A CE2 1 
ATOM   1516 C CE3 . TRP A 1 196 ? 21.870  0.579   -20.069 1.00 28.01 ? 196 TRP A CE3 1 
ATOM   1517 C CZ2 . TRP A 1 196 ? 22.487  -1.589  -21.790 1.00 33.57 ? 196 TRP A CZ2 1 
ATOM   1518 C CZ3 . TRP A 1 196 ? 21.215  0.410   -21.309 1.00 33.86 ? 196 TRP A CZ3 1 
ATOM   1519 C CH2 . TRP A 1 196 ? 21.527  -0.672  -22.149 1.00 35.17 ? 196 TRP A CH2 1 
HETATM 1520 N N   . TPO A 1 197 ? 22.003  1.962   -14.707 1.00 22.95 ? 197 TPO A N   1 
HETATM 1521 C CA  . TPO A 1 197 ? 22.376  2.906   -13.692 1.00 23.27 ? 197 TPO A CA  1 
HETATM 1522 C CB  . TPO A 1 197 ? 21.332  3.981   -13.517 1.00 23.56 ? 197 TPO A CB  1 
HETATM 1523 C CG2 . TPO A 1 197 ? 21.811  5.066   -12.548 1.00 22.82 ? 197 TPO A CG2 1 
HETATM 1524 O OG1 . TPO A 1 197 ? 21.035  4.500   -14.814 1.00 23.02 ? 197 TPO A OG1 1 
HETATM 1525 P P   . TPO A 1 197 ? 19.523  4.384   -15.295 1.00 21.01 ? 197 TPO A P   1 
HETATM 1526 O O1P . TPO A 1 197 ? 19.454  4.922   -16.771 1.00 21.27 ? 197 TPO A O1P 1 
HETATM 1527 O O2P . TPO A 1 197 ? 19.052  2.880   -15.206 1.00 21.35 ? 197 TPO A O2P 1 
HETATM 1528 O O3P . TPO A 1 197 ? 18.645  5.280   -14.374 1.00 24.21 ? 197 TPO A O3P 1 
HETATM 1529 C C   . TPO A 1 197 ? 22.563  2.193   -12.365 1.00 23.31 ? 197 TPO A C   1 
HETATM 1530 O O   . TPO A 1 197 ? 21.761  1.341   -11.968 1.00 21.65 ? 197 TPO A O   1 
ATOM   1531 N N   . LEU A 1 198 ? 23.654  2.561   -11.708 1.00 23.21 ? 198 LEU A N   1 
ATOM   1532 C CA  . LEU A 1 198 ? 24.001  2.061   -10.384 1.00 25.12 ? 198 LEU A CA  1 
ATOM   1533 C C   . LEU A 1 198 ? 23.217  2.875   -9.364  1.00 24.14 ? 198 LEU A C   1 
ATOM   1534 O O   . LEU A 1 198 ? 23.542  3.995   -9.111  1.00 25.00 ? 198 LEU A O   1 
ATOM   1535 C CB  . LEU A 1 198 ? 25.521  2.250   -10.169 1.00 26.18 ? 198 LEU A CB  1 
ATOM   1536 C CG  . LEU A 1 198 ? 26.315  1.584   -9.029  1.00 29.19 ? 198 LEU A CG  1 
ATOM   1537 C CD1 . LEU A 1 198 ? 27.314  2.625   -8.349  1.00 32.04 ? 198 LEU A CD1 1 
ATOM   1538 C CD2 . LEU A 1 198 ? 25.459  0.876   -8.036  1.00 26.29 ? 198 LEU A CD2 1 
ATOM   1539 N N   . CYS A 1 199 ? 22.160  2.293   -8.824  1.00 23.95 ? 199 CYS A N   1 
ATOM   1540 C CA  . CYS A 1 199 ? 21.281  2.958   -7.872  1.00 23.42 ? 199 CYS A CA  1 
ATOM   1541 C C   . CYS A 1 199 ? 20.568  1.929   -7.045  1.00 22.72 ? 199 CYS A C   1 
ATOM   1542 O O   . CYS A 1 199 ? 20.543  0.749   -7.372  1.00 22.89 ? 199 CYS A O   1 
ATOM   1543 C CB  . CYS A 1 199 ? 20.273  3.870   -8.586  1.00 23.70 ? 199 CYS A CB  1 
ATOM   1544 S SG  . CYS A 1 199 ? 19.146  3.027   -9.710  1.00 23.74 ? 199 CYS A SG  1 
ATOM   1545 N N   . GLY A 1 200 ? 20.020  2.370   -5.937  1.00 22.61 ? 200 GLY A N   1 
ATOM   1546 C CA  . GLY A 1 200 ? 19.353  1.481   -5.005  1.00 23.17 ? 200 GLY A CA  1 
ATOM   1547 C C   . GLY A 1 200 ? 20.007  1.667   -3.670  1.00 23.23 ? 200 GLY A C   1 
ATOM   1548 O O   . GLY A 1 200 ? 20.751  2.623   -3.502  1.00 26.45 ? 200 GLY A O   1 
ATOM   1549 N N   . THR A 1 201 ? 19.775  0.775   -2.730  1.00 22.15 ? 201 THR A N   1 
ATOM   1550 C CA  . THR A 1 201 ? 20.386  0.879   -1.405  1.00 21.50 ? 201 THR A CA  1 
ATOM   1551 C C   . THR A 1 201 ? 21.301  -0.352  -1.198  1.00 21.39 ? 201 THR A C   1 
ATOM   1552 O O   . THR A 1 201 ? 20.948  -1.490  -1.591  1.00 21.17 ? 201 THR A O   1 
ATOM   1553 C CB  . THR A 1 201 ? 19.242  0.999   -0.352  1.00 21.69 ? 201 THR A CB  1 
ATOM   1554 O OG1 . THR A 1 201 ? 18.558  2.243   -0.548  1.00 19.28 ? 201 THR A OG1 1 
ATOM   1555 C CG2 . THR A 1 201 ? 19.754  1.073   1.090   1.00 23.34 ? 201 THR A CG2 1 
ATOM   1556 N N   . PRO A 1 202 ? 22.502  -0.136  -0.673  1.00 20.89 ? 202 PRO A N   1 
ATOM   1557 C CA  . PRO A 1 202 ? 23.543  -1.187  -0.674  1.00 21.15 ? 202 PRO A CA  1 
ATOM   1558 C C   . PRO A 1 202 ? 23.080  -2.631  -0.303  1.00 21.80 ? 202 PRO A C   1 
ATOM   1559 O O   . PRO A 1 202 ? 23.357  -3.596  -1.048  1.00 21.85 ? 202 PRO A O   1 
ATOM   1560 C CB  . PRO A 1 202 ? 24.560  -0.644  0.326   1.00 21.36 ? 202 PRO A CB  1 
ATOM   1561 C CG  . PRO A 1 202 ? 24.464  0.863   0.099   1.00 21.12 ? 202 PRO A CG  1 
ATOM   1562 C CD  . PRO A 1 202 ? 23.001  1.127   -0.090  1.00 20.59 ? 202 PRO A CD  1 
ATOM   1563 N N   . GLU A 1 203 ? 22.341  -2.748  0.800   1.00 21.55 ? 203 GLU A N   1 
ATOM   1564 C CA  . GLU A 1 203 ? 21.872  -4.020  1.326   1.00 21.52 ? 203 GLU A CA  1 
ATOM   1565 C C   . GLU A 1 203 ? 20.934  -4.762  0.378   1.00 22.19 ? 203 GLU A C   1 
ATOM   1566 O O   . GLU A 1 203 ? 20.800  -5.990  0.454   1.00 22.69 ? 203 GLU A O   1 
ATOM   1567 C CB  . GLU A 1 203 ? 21.128  -3.759  2.649   1.00 21.68 ? 203 GLU A CB  1 
ATOM   1568 C CG  . GLU A 1 203 ? 22.001  -3.549  3.884   1.00 20.73 ? 203 GLU A CG  1 
ATOM   1569 C CD  . GLU A 1 203 ? 22.522  -2.138  4.110   1.00 18.95 ? 203 GLU A CD  1 
ATOM   1570 O OE1 . GLU A 1 203 ? 22.488  -1.299  3.214   1.00 18.74 ? 203 GLU A OE1 1 
ATOM   1571 O OE2 . GLU A 1 203 ? 23.033  -1.881  5.225   1.00 20.17 ? 203 GLU A OE2 1 
ATOM   1572 N N   . TYR A 1 204 ? 20.271  -4.017  -0.516  1.00 22.13 ? 204 TYR A N   1 
ATOM   1573 C CA  . TYR A 1 204 ? 19.188  -4.538  -1.359  1.00 20.55 ? 204 TYR A CA  1 
ATOM   1574 C C   . TYR A 1 204 ? 19.589  -4.718  -2.842  1.00 21.20 ? 204 TYR A C   1 
ATOM   1575 O O   . TYR A 1 204 ? 18.791  -5.200  -3.633  1.00 20.35 ? 204 TYR A O   1 
ATOM   1576 C CB  . TYR A 1 204 ? 17.966  -3.592  -1.221  1.00 20.41 ? 204 TYR A CB  1 
ATOM   1577 C CG  . TYR A 1 204 ? 17.218  -3.841  0.067   1.00 18.99 ? 204 TYR A CG  1 
ATOM   1578 C CD1 . TYR A 1 204 ? 17.673  -3.303  1.269   1.00 19.50 ? 204 TYR A CD1 1 
ATOM   1579 C CD2 . TYR A 1 204 ? 16.108  -4.674  0.099   1.00 17.59 ? 204 TYR A CD2 1 
ATOM   1580 C CE1 . TYR A 1 204 ? 17.050  -3.591  2.460   1.00 18.63 ? 204 TYR A CE1 1 
ATOM   1581 C CE2 . TYR A 1 204 ? 15.471  -4.964  1.281   1.00 19.57 ? 204 TYR A CE2 1 
ATOM   1582 C CZ  . TYR A 1 204 ? 15.932  -4.410  2.469   1.00 17.90 ? 204 TYR A CZ  1 
ATOM   1583 O OH  . TYR A 1 204 ? 15.299  -4.701  3.670   1.00 18.40 ? 204 TYR A OH  1 
ATOM   1584 N N   . LEU A 1 205 ? 20.825  -4.353  -3.209  1.00 21.13 ? 205 LEU A N   1 
ATOM   1585 C CA  . LEU A 1 205 ? 21.269  -4.449  -4.577  1.00 21.52 ? 205 LEU A CA  1 
ATOM   1586 C C   . LEU A 1 205 ? 21.472  -5.876  -4.970  1.00 22.78 ? 205 LEU A C   1 
ATOM   1587 O O   . LEU A 1 205 ? 22.064  -6.653  -4.228  1.00 23.17 ? 205 LEU A O   1 
ATOM   1588 C CB  . LEU A 1 205 ? 22.594  -3.769  -4.794  1.00 22.07 ? 205 LEU A CB  1 
ATOM   1589 C CG  . LEU A 1 205 ? 22.694  -2.281  -4.485  1.00 22.25 ? 205 LEU A CG  1 
ATOM   1590 C CD1 . LEU A 1 205 ? 24.118  -1.810  -4.809  1.00 21.87 ? 205 LEU A CD1 1 
ATOM   1591 C CD2 . LEU A 1 205 ? 21.655  -1.540  -5.243  1.00 21.89 ? 205 LEU A CD2 1 
ATOM   1592 N N   . ALA A 1 206 ? 21.030  -6.198  -6.175  1.00 22.82 ? 206 ALA A N   1 
ATOM   1593 C CA  . ALA A 1 206 ? 21.280  -7.500  -6.741  1.00 22.33 ? 206 ALA A CA  1 
ATOM   1594 C C   . ALA A 1 206 ? 22.722  -7.505  -7.227  1.00 22.59 ? 206 ALA A C   1 
ATOM   1595 O O   . ALA A 1 206 ? 23.302  -6.448  -7.475  1.00 21.29 ? 206 ALA A O   1 
ATOM   1596 C CB  . ALA A 1 206 ? 20.314  -7.772  -7.858  1.00 22.11 ? 206 ALA A CB  1 
ATOM   1597 N N   . PRO A 1 207 ? 23.345  -8.688  -7.264  1.00 23.61 ? 207 PRO A N   1 
ATOM   1598 C CA  . PRO A 1 207 ? 24.745  -8.802  -7.689  1.00 24.10 ? 207 PRO A CA  1 
ATOM   1599 C C   . PRO A 1 207 ? 25.010  -8.206  -9.078  1.00 24.51 ? 207 PRO A C   1 
ATOM   1600 O O   . PRO A 1 207 ? 26.067  -7.623  -9.350  1.00 24.55 ? 207 PRO A O   1 
ATOM   1601 C CB  . PRO A 1 207 ? 25.004  -10.316 -7.690  1.00 25.32 ? 207 PRO A CB  1 
ATOM   1602 C CG  . PRO A 1 207 ? 23.772  -10.989 -7.178  1.00 24.27 ? 207 PRO A CG  1 
ATOM   1603 C CD  . PRO A 1 207 ? 22.795  -9.962  -6.783  1.00 23.35 ? 207 PRO A CD  1 
ATOM   1604 N N   . GLU A 1 208 ? 24.033  -8.322  -9.945  1.00 24.67 ? 208 GLU A N   1 
ATOM   1605 C CA  . GLU A 1 208 ? 24.184  -7.842  -11.307 1.00 25.43 ? 208 GLU A CA  1 
ATOM   1606 C C   . GLU A 1 208 ? 24.271  -6.316  -11.344 1.00 26.32 ? 208 GLU A C   1 
ATOM   1607 O O   . GLU A 1 208 ? 24.876  -5.767  -12.246 1.00 25.96 ? 208 GLU A O   1 
ATOM   1608 C CB  . GLU A 1 208 ? 23.070  -8.401  -12.221 1.00 25.98 ? 208 GLU A CB  1 
ATOM   1609 C CG  . GLU A 1 208 ? 21.653  -7.936  -11.920 1.00 25.62 ? 208 GLU A CG  1 
ATOM   1610 C CD  . GLU A 1 208 ? 20.859  -8.971  -11.143 1.00 26.89 ? 208 GLU A CD  1 
ATOM   1611 O OE1 . GLU A 1 208 ? 21.502  -9.693  -10.378 1.00 24.34 ? 208 GLU A OE1 1 
ATOM   1612 O OE2 . GLU A 1 208 ? 19.614  -9.066  -11.280 1.00 22.83 ? 208 GLU A OE2 1 
ATOM   1613 N N   . ILE A 1 209 ? 23.730  -5.623  -10.339 1.00 26.85 ? 209 ILE A N   1 
ATOM   1614 C CA  . ILE A 1 209 ? 23.875  -4.187  -10.276 1.00 27.05 ? 209 ILE A CA  1 
ATOM   1615 C C   . ILE A 1 209 ? 25.276  -3.843  -9.805  1.00 28.36 ? 209 ILE A C   1 
ATOM   1616 O O   . ILE A 1 209 ? 25.955  -2.989  -10.390 1.00 27.43 ? 209 ILE A O   1 
ATOM   1617 C CB  . ILE A 1 209 ? 22.826  -3.550  -9.319  1.00 27.76 ? 209 ILE A CB  1 
ATOM   1618 C CG1 . ILE A 1 209 ? 21.391  -3.829  -9.796  1.00 27.29 ? 209 ILE A CG1 1 
ATOM   1619 C CG2 . ILE A 1 209 ? 23.105  -2.050  -9.165  1.00 26.71 ? 209 ILE A CG2 1 
ATOM   1620 C CD1 . ILE A 1 209 ? 20.282  -3.338  -8.788  1.00 27.80 ? 209 ILE A CD1 1 
ATOM   1621 N N   . ILE A 1 210 ? 25.700  -4.494  -8.725  1.00 29.85 ? 210 ILE A N   1 
ATOM   1622 C CA  . ILE A 1 210 ? 27.050  -4.313  -8.182  1.00 30.93 ? 210 ILE A CA  1 
ATOM   1623 C C   . ILE A 1 210 ? 28.096  -4.612  -9.253  1.00 31.72 ? 210 ILE A C   1 
ATOM   1624 O O   . ILE A 1 210 ? 29.139  -3.982  -9.282  1.00 31.67 ? 210 ILE A O   1 
ATOM   1625 C CB  . ILE A 1 210 ? 27.298  -5.244  -6.956  1.00 30.93 ? 210 ILE A CB  1 
ATOM   1626 C CG1 . ILE A 1 210 ? 26.431  -4.847  -5.757  1.00 31.46 ? 210 ILE A CG1 1 
ATOM   1627 C CG2 . ILE A 1 210 ? 28.791  -5.200  -6.506  1.00 32.13 ? 210 ILE A CG2 1 
ATOM   1628 C CD1 . ILE A 1 210 ? 25.994  -6.026  -4.939  1.00 31.33 ? 210 ILE A CD1 1 
ATOM   1629 N N   . LEU A 1 211 ? 27.807  -5.578  -10.115 1.00 32.46 ? 211 LEU A N   1 
ATOM   1630 C CA  . LEU A 1 211 ? 28.762  -6.022  -11.139 1.00 33.77 ? 211 LEU A CA  1 
ATOM   1631 C C   . LEU A 1 211 ? 28.631  -5.276  -12.469 1.00 33.75 ? 211 LEU A C   1 
ATOM   1632 O O   . LEU A 1 211 ? 29.356  -5.578  -13.447 1.00 32.61 ? 211 LEU A O   1 
ATOM   1633 C CB  . LEU A 1 211 ? 28.649  -7.529  -11.373 1.00 33.69 ? 211 LEU A CB  1 
ATOM   1634 C CG  . LEU A 1 211 ? 29.131  -8.318  -10.158 1.00 36.47 ? 211 LEU A CG  1 
ATOM   1635 C CD1 . LEU A 1 211 ? 29.087  -9.835  -10.439 1.00 37.58 ? 211 LEU A CD1 1 
ATOM   1636 C CD2 . LEU A 1 211 ? 30.543  -7.847  -9.682  1.00 37.50 ? 211 LEU A CD2 1 
ATOM   1637 N N   . SER A 1 212 ? 27.715  -4.309  -12.500 1.00 33.88 ? 212 SER A N   1 
ATOM   1638 C CA  . SER A 1 212 ? 27.726  -3.305  -13.544 1.00 34.00 ? 212 SER A CA  1 
ATOM   1639 C C   . SER A 1 212 ? 27.308  -3.922  -14.853 1.00 34.25 ? 212 SER A C   1 
ATOM   1640 O O   . SER A 1 212 ? 27.790  -3.529  -15.894 1.00 35.14 ? 212 SER A O   1 
ATOM   1641 C CB  . SER A 1 212 ? 29.146  -2.705  -13.646 1.00 34.12 ? 212 SER A CB  1 
ATOM   1642 O OG  . SER A 1 212 ? 29.132  -1.327  -13.546 1.00 32.94 ? 212 SER A OG  1 
ATOM   1643 N N   . LYS A 1 213 ? 26.374  -4.860  -14.797 1.00 35.48 ? 213 LYS A N   1 
ATOM   1644 C CA  . LYS A 1 213 ? 26.106  -5.786  -15.898 1.00 36.59 ? 213 LYS A CA  1 
ATOM   1645 C C   . LYS A 1 213 ? 25.054  -5.363  -16.920 1.00 36.36 ? 213 LYS A C   1 
ATOM   1646 O O   . LYS A 1 213 ? 25.086  -5.839  -18.090 1.00 37.66 ? 213 LYS A O   1 
ATOM   1647 C CB  . LYS A 1 213 ? 25.684  -7.145  -15.329 1.00 37.51 ? 213 LYS A CB  1 
ATOM   1648 C CG  . LYS A 1 213 ? 26.865  -8.131  -15.097 1.00 41.51 ? 213 LYS A CG  1 
ATOM   1649 C CD  . LYS A 1 213 ? 26.460  -9.218  -14.059 1.00 45.86 ? 213 LYS A CD  1 
ATOM   1650 C CE  . LYS A 1 213 ? 27.138  -10.593 -14.269 1.00 47.49 ? 213 LYS A CE  1 
ATOM   1651 N NZ  . LYS A 1 213 ? 26.128  -11.697 -14.145 1.00 47.38 ? 213 LYS A NZ  1 
ATOM   1652 N N   . GLY A 1 214 ? 24.122  -4.502  -16.527 1.00 35.13 ? 214 GLY A N   1 
ATOM   1653 C CA  . GLY A 1 214 ? 22.943  -4.290  -17.357 1.00 34.13 ? 214 GLY A CA  1 
ATOM   1654 C C   . GLY A 1 214 ? 21.884  -5.246  -16.836 1.00 33.19 ? 214 GLY A C   1 
ATOM   1655 O O   . GLY A 1 214 ? 22.087  -6.464  -16.795 1.00 33.87 ? 214 GLY A O   1 
ATOM   1656 N N   . TYR A 1 215 ? 20.779  -4.704  -16.345 1.00 31.58 ? 215 TYR A N   1 
ATOM   1657 C CA  . TYR A 1 215 ? 19.852  -5.513  -15.546 1.00 29.43 ? 215 TYR A CA  1 
ATOM   1658 C C   . TYR A 1 215 ? 18.450  -5.131  -15.891 1.00 28.90 ? 215 TYR A C   1 
ATOM   1659 O O   . TYR A 1 215 ? 18.216  -4.234  -16.688 1.00 28.67 ? 215 TYR A O   1 
ATOM   1660 C CB  . TYR A 1 215 ? 20.134  -5.320  -14.045 1.00 29.15 ? 215 TYR A CB  1 
ATOM   1661 C CG  . TYR A 1 215 ? 20.058  -3.872  -13.580 1.00 26.92 ? 215 TYR A CG  1 
ATOM   1662 C CD1 . TYR A 1 215 ? 21.178  -3.036  -13.641 1.00 24.31 ? 215 TYR A CD1 1 
ATOM   1663 C CD2 . TYR A 1 215 ? 18.875  -3.349  -13.099 1.00 25.79 ? 215 TYR A CD2 1 
ATOM   1664 C CE1 . TYR A 1 215 ? 21.120  -1.744  -13.223 1.00 25.02 ? 215 TYR A CE1 1 
ATOM   1665 C CE2 . TYR A 1 215 ? 18.792  -2.051  -12.673 1.00 25.53 ? 215 TYR A CE2 1 
ATOM   1666 C CZ  . TYR A 1 215 ? 19.910  -1.246  -12.717 1.00 24.98 ? 215 TYR A CZ  1 
ATOM   1667 O OH  . TYR A 1 215 ? 19.795  0.069   -12.314 1.00 19.79 ? 215 TYR A OH  1 
ATOM   1668 N N   . ASN A 1 216 ? 17.505  -5.846  -15.302 1.00 28.83 ? 216 ASN A N   1 
ATOM   1669 C CA  . ASN A 1 216 ? 16.094  -5.616  -15.552 1.00 27.70 ? 216 ASN A CA  1 
ATOM   1670 C C   . ASN A 1 216 ? 15.260  -5.782  -14.277 1.00 26.87 ? 216 ASN A C   1 
ATOM   1671 O O   . ASN A 1 216 ? 15.774  -5.795  -13.174 1.00 25.41 ? 216 ASN A O   1 
ATOM   1672 C CB  . ASN A 1 216 ? 15.633  -6.565  -16.664 1.00 28.16 ? 216 ASN A CB  1 
ATOM   1673 C CG  . ASN A 1 216 ? 15.813  -8.053  -16.302 1.00 28.42 ? 216 ASN A CG  1 
ATOM   1674 O OD1 . ASN A 1 216 ? 16.132  -8.417  -15.176 1.00 27.43 ? 216 ASN A OD1 1 
ATOM   1675 N ND2 . ASN A 1 216 ? 15.629  -8.904  -17.288 1.00 31.17 ? 216 ASN A ND2 1 
ATOM   1676 N N   . LYS A 1 217 ? 13.954  -5.845  -14.445 1.00 27.24 ? 217 LYS A N   1 
ATOM   1677 C CA  . LYS A 1 217 ? 12.992  -5.935  -13.333 1.00 27.60 ? 217 LYS A CA  1 
ATOM   1678 C C   . LYS A 1 217 ? 13.302  -7.014  -12.290 1.00 26.60 ? 217 LYS A C   1 
ATOM   1679 O O   . LYS A 1 217 ? 12.746  -6.976  -11.184 1.00 25.67 ? 217 LYS A O   1 
ATOM   1680 C CB  . LYS A 1 217 ? 11.566  -6.144  -13.883 1.00 28.35 ? 217 LYS A CB  1 
ATOM   1681 C CG  . LYS A 1 217 ? 11.425  -7.257  -14.907 1.00 32.53 ? 217 LYS A CG  1 
ATOM   1682 C CD  . LYS A 1 217 ? 9.953   -7.502  -15.320 1.00 37.55 ? 217 LYS A CD  1 
ATOM   1683 C CE  . LYS A 1 217 ? 9.717   -7.389  -16.834 1.00 40.18 ? 217 LYS A CE  1 
ATOM   1684 N NZ  . LYS A 1 217 ? 8.602   -6.424  -17.147 1.00 42.37 ? 217 LYS A NZ  1 
ATOM   1685 N N   . ALA A 1 218 ? 14.180  -7.962  -12.631 1.00 25.08 ? 218 ALA A N   1 
ATOM   1686 C CA  . ALA A 1 218 ? 14.600  -9.015  -11.703 1.00 24.24 ? 218 ALA A CA  1 
ATOM   1687 C C   . ALA A 1 218 ? 15.330  -8.513  -10.457 1.00 23.85 ? 218 ALA A C   1 
ATOM   1688 O O   . ALA A 1 218 ? 15.370  -9.223  -9.441  1.00 22.79 ? 218 ALA A O   1 
ATOM   1689 C CB  . ALA A 1 218 ? 15.501  -10.036 -12.418 1.00 24.42 ? 218 ALA A CB  1 
ATOM   1690 N N   . VAL A 1 219 ? 15.968  -7.338  -10.554 1.00 22.14 ? 219 VAL A N   1 
ATOM   1691 C CA  . VAL A 1 219 ? 16.583  -6.752  -9.409  1.00 21.70 ? 219 VAL A CA  1 
ATOM   1692 C C   . VAL A 1 219 ? 15.550  -6.503  -8.300  1.00 21.26 ? 219 VAL A C   1 
ATOM   1693 O O   . VAL A 1 219 ? 15.889  -6.595  -7.125  1.00 20.24 ? 219 VAL A O   1 
ATOM   1694 C CB  . VAL A 1 219 ? 17.372  -5.425  -9.754  1.00 22.02 ? 219 VAL A CB  1 
ATOM   1695 C CG1 . VAL A 1 219 ? 18.437  -5.707  -10.818 1.00 22.34 ? 219 VAL A CG1 1 
ATOM   1696 C CG2 . VAL A 1 219 ? 16.442  -4.316  -10.161 1.00 19.48 ? 219 VAL A CG2 1 
ATOM   1697 N N   . ASP A 1 220 ? 14.314  -6.173  -8.686  1.00 21.52 ? 220 ASP A N   1 
ATOM   1698 C CA  . ASP A 1 220 ? 13.223  -5.918  -7.730  1.00 21.17 ? 220 ASP A CA  1 
ATOM   1699 C C   . ASP A 1 220 ? 12.828  -7.236  -6.991  1.00 21.63 ? 220 ASP A C   1 
ATOM   1700 O O   . ASP A 1 220 ? 12.529  -7.243  -5.784  1.00 20.73 ? 220 ASP A O   1 
ATOM   1701 C CB  . ASP A 1 220 ? 11.982  -5.376  -8.455  1.00 20.92 ? 220 ASP A CB  1 
ATOM   1702 C CG  . ASP A 1 220 ? 11.989  -3.867  -8.657  1.00 21.77 ? 220 ASP A CG  1 
ATOM   1703 O OD1 . ASP A 1 220 ? 12.761  -3.123  -7.987  1.00 20.93 ? 220 ASP A OD1 1 
ATOM   1704 O OD2 . ASP A 1 220 ? 11.237  -3.353  -9.511  1.00 17.37 ? 220 ASP A OD2 1 
ATOM   1705 N N   . TRP A 1 221 ? 12.839  -8.355  -7.707  1.00 20.27 ? 221 TRP A N   1 
ATOM   1706 C CA  . TRP A 1 221 ? 12.546  -9.634  -7.046  1.00 21.06 ? 221 TRP A CA  1 
ATOM   1707 C C   . TRP A 1 221 ? 13.653  -10.087 -6.085  1.00 20.22 ? 221 TRP A C   1 
ATOM   1708 O O   . TRP A 1 221 ? 13.365  -10.602 -5.012  1.00 20.01 ? 221 TRP A O   1 
ATOM   1709 C CB  . TRP A 1 221 ? 12.238  -10.713 -8.067  1.00 20.46 ? 221 TRP A CB  1 
ATOM   1710 C CG  . TRP A 1 221 ? 11.022  -10.421 -8.863  1.00 20.39 ? 221 TRP A CG  1 
ATOM   1711 C CD1 . TRP A 1 221 ? 10.963  -10.303 -10.211 1.00 20.54 ? 221 TRP A CD1 1 
ATOM   1712 C CD2 . TRP A 1 221 ? 9.667   -10.224 -8.382  1.00 17.74 ? 221 TRP A CD2 1 
ATOM   1713 N NE1 . TRP A 1 221 ? 9.665   -10.069 -10.607 1.00 21.21 ? 221 TRP A NE1 1 
ATOM   1714 C CE2 . TRP A 1 221 ? 8.855   -10.002 -9.510  1.00 18.46 ? 221 TRP A CE2 1 
ATOM   1715 C CE3 . TRP A 1 221 ? 9.070   -10.204 -7.117  1.00 17.46 ? 221 TRP A CE3 1 
ATOM   1716 C CZ2 . TRP A 1 221 ? 7.477   -9.760  -9.421  1.00 20.91 ? 221 TRP A CZ2 1 
ATOM   1717 C CZ3 . TRP A 1 221 ? 7.702   -10.003 -7.020  1.00 19.69 ? 221 TRP A CZ3 1 
ATOM   1718 C CH2 . TRP A 1 221 ? 6.916   -9.765  -8.164  1.00 20.65 ? 221 TRP A CH2 1 
ATOM   1719 N N   . TRP A 1 222 ? 14.904  -9.844  -6.448  1.00 20.91 ? 222 TRP A N   1 
ATOM   1720 C CA  . TRP A 1 222 ? 16.016  -10.018 -5.503  1.00 20.75 ? 222 TRP A CA  1 
ATOM   1721 C C   . TRP A 1 222 ? 15.756  -9.154  -4.259  1.00 20.47 ? 222 TRP A C   1 
ATOM   1722 O O   . TRP A 1 222 ? 15.767  -9.673  -3.158  1.00 22.05 ? 222 TRP A O   1 
ATOM   1723 C CB  . TRP A 1 222 ? 17.351  -9.621  -6.108  1.00 19.73 ? 222 TRP A CB  1 
ATOM   1724 C CG  . TRP A 1 222 ? 18.457  -9.643  -5.115  1.00 20.44 ? 222 TRP A CG  1 
ATOM   1725 C CD1 . TRP A 1 222 ? 18.755  -8.683  -4.177  1.00 19.93 ? 222 TRP A CD1 1 
ATOM   1726 C CD2 . TRP A 1 222 ? 19.431  -10.657 -4.948  1.00 21.52 ? 222 TRP A CD2 1 
ATOM   1727 N NE1 . TRP A 1 222 ? 19.860  -9.042  -3.451  1.00 16.91 ? 222 TRP A NE1 1 
ATOM   1728 C CE2 . TRP A 1 222 ? 20.303  -10.245 -3.905  1.00 22.66 ? 222 TRP A CE2 1 
ATOM   1729 C CE3 . TRP A 1 222 ? 19.661  -11.899 -5.554  1.00 22.47 ? 222 TRP A CE3 1 
ATOM   1730 C CZ2 . TRP A 1 222 ? 21.363  -11.038 -3.455  1.00 24.17 ? 222 TRP A CZ2 1 
ATOM   1731 C CZ3 . TRP A 1 222 ? 20.747  -12.660 -5.121  1.00 23.84 ? 222 TRP A CZ3 1 
ATOM   1732 C CH2 . TRP A 1 222 ? 21.570  -12.229 -4.087  1.00 21.68 ? 222 TRP A CH2 1 
ATOM   1733 N N   . ALA A 1 223 ? 15.497  -7.861  -4.447  1.00 19.82 ? 223 ALA A N   1 
ATOM   1734 C CA  . ALA A 1 223 ? 15.250  -6.923  -3.342  1.00 19.39 ? 223 ALA A CA  1 
ATOM   1735 C C   . ALA A 1 223 ? 14.062  -7.374  -2.473  1.00 19.03 ? 223 ALA A C   1 
ATOM   1736 O O   . ALA A 1 223 ? 14.092  -7.215  -1.259  1.00 18.32 ? 223 ALA A O   1 
ATOM   1737 C CB  . ALA A 1 223 ? 15.022  -5.496  -3.881  1.00 18.91 ? 223 ALA A CB  1 
ATOM   1738 N N   . LEU A 1 224 ? 13.032  -7.957  -3.086  1.00 18.90 ? 224 LEU A N   1 
ATOM   1739 C CA  . LEU A 1 224 ? 11.968  -8.607  -2.323  1.00 19.61 ? 224 LEU A CA  1 
ATOM   1740 C C   . LEU A 1 224 ? 12.544  -9.706  -1.430  1.00 20.21 ? 224 LEU A C   1 
ATOM   1741 O O   . LEU A 1 224 ? 12.161  -9.848  -0.267  1.00 20.84 ? 224 LEU A O   1 
ATOM   1742 C CB  . LEU A 1 224 ? 10.918  -9.235  -3.237  1.00 19.50 ? 224 LEU A CB  1 
ATOM   1743 C CG  . LEU A 1 224 ? 9.811   -9.946  -2.442  1.00 21.31 ? 224 LEU A CG  1 
ATOM   1744 C CD1 . LEU A 1 224 ? 8.924   -8.927  -1.702  1.00 21.18 ? 224 LEU A CD1 1 
ATOM   1745 C CD2 . LEU A 1 224 ? 8.978   -10.846 -3.333  1.00 20.60 ? 224 LEU A CD2 1 
ATOM   1746 N N   . GLY A 1 225 ? 13.452  -10.494 -1.974  1.00 19.98 ? 225 GLY A N   1 
ATOM   1747 C CA  . GLY A 1 225 ? 14.106  -11.501 -1.167  1.00 20.43 ? 225 GLY A CA  1 
ATOM   1748 C C   . GLY A 1 225 ? 14.796  -10.904 0.041   1.00 20.30 ? 225 GLY A C   1 
ATOM   1749 O O   . GLY A 1 225 ? 14.723  -11.466 1.131   1.00 20.66 ? 225 GLY A O   1 
ATOM   1750 N N   . VAL A 1 226 ? 15.442  -9.753  -0.141  1.00 19.82 ? 226 VAL A N   1 
ATOM   1751 C CA  . VAL A 1 226 ? 16.150  -9.107  0.949   1.00 19.06 ? 226 VAL A CA  1 
ATOM   1752 C C   . VAL A 1 226 ? 15.154  -8.651  1.991   1.00 19.17 ? 226 VAL A C   1 
ATOM   1753 O O   . VAL A 1 226 ? 15.387  -8.752  3.182   1.00 18.68 ? 226 VAL A O   1 
ATOM   1754 C CB  . VAL A 1 226 ? 17.041  -7.939  0.416   1.00 19.29 ? 226 VAL A CB  1 
ATOM   1755 C CG1 . VAL A 1 226 ? 17.768  -7.228  1.509   1.00 18.66 ? 226 VAL A CG1 1 
ATOM   1756 C CG2 . VAL A 1 226 ? 18.099  -8.469  -0.620  1.00 18.68 ? 226 VAL A CG2 1 
ATOM   1757 N N   . LEU A 1 227 ? 14.031  -8.117  1.538   1.00 20.16 ? 227 LEU A N   1 
ATOM   1758 C CA  . LEU A 1 227 ? 13.045  -7.543  2.424   1.00 19.87 ? 227 LEU A CA  1 
ATOM   1759 C C   . LEU A 1 227 ? 12.403  -8.604  3.288   1.00 20.74 ? 227 LEU A C   1 
ATOM   1760 O O   . LEU A 1 227 ? 12.241  -8.442  4.500   1.00 21.18 ? 227 LEU A O   1 
ATOM   1761 C CB  . LEU A 1 227 ? 11.945  -6.899  1.603   1.00 19.76 ? 227 LEU A CB  1 
ATOM   1762 C CG  . LEU A 1 227 ? 10.818  -6.202  2.344   1.00 17.87 ? 227 LEU A CG  1 
ATOM   1763 C CD1 . LEU A 1 227 ? 11.338  -4.927  2.931   1.00 17.22 ? 227 LEU A CD1 1 
ATOM   1764 C CD2 . LEU A 1 227 ? 9.639   -5.912  1.440   1.00 17.54 ? 227 LEU A CD2 1 
ATOM   1765 N N   . ILE A 1 228 ? 11.937  -9.655  2.639   1.00 21.53 ? 228 ILE A N   1 
ATOM   1766 C CA  . ILE A 1 228 ? 11.278  -10.733 3.361   1.00 21.83 ? 228 ILE A CA  1 
ATOM   1767 C C   . ILE A 1 228 ? 12.180  -11.263 4.459   1.00 21.10 ? 228 ILE A C   1 
ATOM   1768 O O   . ILE A 1 228 ? 11.748  -11.469 5.549   1.00 21.34 ? 228 ILE A O   1 
ATOM   1769 C CB  . ILE A 1 228 ? 10.900  -11.840 2.403   1.00 22.18 ? 228 ILE A CB  1 
ATOM   1770 C CG1 . ILE A 1 228 ? 9.735   -11.361 1.530   1.00 22.58 ? 228 ILE A CG1 1 
ATOM   1771 C CG2 . ILE A 1 228 ? 10.522  -13.091 3.178   1.00 22.95 ? 228 ILE A CG2 1 
ATOM   1772 C CD1 . ILE A 1 228 ? 9.462   -12.246 0.313   1.00 25.73 ? 228 ILE A CD1 1 
ATOM   1773 N N   . TYR A 1 229 ? 13.435  -11.472 4.138   1.00 20.78 ? 229 TYR A N   1 
ATOM   1774 C CA  . TYR A 1 229 ? 14.410  -11.952 5.078   1.00 21.61 ? 229 TYR A CA  1 
ATOM   1775 C C   . TYR A 1 229 ? 14.582  -10.964 6.224   1.00 22.50 ? 229 TYR A C   1 
ATOM   1776 O O   . TYR A 1 229 ? 14.656  -11.364 7.359   1.00 23.57 ? 229 TYR A O   1 
ATOM   1777 C CB  . TYR A 1 229 ? 15.746  -12.140 4.348   1.00 21.51 ? 229 TYR A CB  1 
ATOM   1778 C CG  . TYR A 1 229 ? 16.878  -12.651 5.203   1.00 21.20 ? 229 TYR A CG  1 
ATOM   1779 C CD1 . TYR A 1 229 ? 17.349  -11.912 6.270   1.00 21.76 ? 229 TYR A CD1 1 
ATOM   1780 C CD2 . TYR A 1 229 ? 17.497  -13.857 4.926   1.00 22.50 ? 229 TYR A CD2 1 
ATOM   1781 C CE1 . TYR A 1 229 ? 18.398  -12.353 7.043   1.00 21.97 ? 229 TYR A CE1 1 
ATOM   1782 C CE2 . TYR A 1 229 ? 18.553  -14.321 5.711   1.00 23.97 ? 229 TYR A CE2 1 
ATOM   1783 C CZ  . TYR A 1 229 ? 18.991  -13.558 6.780   1.00 22.95 ? 229 TYR A CZ  1 
ATOM   1784 O OH  . TYR A 1 229 ? 20.054  -13.966 7.584   1.00 21.29 ? 229 TYR A OH  1 
ATOM   1785 N N   . GLU A 1 230 ? 14.699  -9.681  5.917   1.00 22.56 ? 230 GLU A N   1 
ATOM   1786 C CA  . GLU A 1 230 ? 14.872  -8.692  6.940   1.00 23.00 ? 230 GLU A CA  1 
ATOM   1787 C C   . GLU A 1 230 ? 13.625  -8.580  7.791   1.00 23.13 ? 230 GLU A C   1 
ATOM   1788 O O   . GLU A 1 230 ? 13.735  -8.420  8.989   1.00 23.99 ? 230 GLU A O   1 
ATOM   1789 C CB  . GLU A 1 230 ? 15.278  -7.334  6.341   1.00 23.02 ? 230 GLU A CB  1 
ATOM   1790 C CG  . GLU A 1 230 ? 15.632  -6.302  7.394   1.00 23.85 ? 230 GLU A CG  1 
ATOM   1791 C CD  . GLU A 1 230 ? 15.984  -4.943  6.849   1.00 24.93 ? 230 GLU A CD  1 
ATOM   1792 O OE1 . GLU A 1 230 ? 16.682  -4.840  5.843   1.00 25.99 ? 230 GLU A OE1 1 
ATOM   1793 O OE2 . GLU A 1 230 ? 15.564  -3.953  7.444   1.00 27.13 ? 230 GLU A OE2 1 
ATOM   1794 N N   . MET A 1 231 ? 12.441  -8.659  7.200   1.00 23.18 ? 231 MET A N   1 
ATOM   1795 C CA  . MET A 1 231 ? 11.233  -8.627  8.010   1.00 23.26 ? 231 MET A CA  1 
ATOM   1796 C C   . MET A 1 231 ? 11.217  -9.822  8.954   1.00 24.06 ? 231 MET A C   1 
ATOM   1797 O O   . MET A 1 231 ? 10.948  -9.648  10.129  1.00 23.92 ? 231 MET A O   1 
ATOM   1798 C CB  . MET A 1 231 ? 9.977   -8.635  7.153   1.00 23.15 ? 231 MET A CB  1 
ATOM   1799 C CG  . MET A 1 231 ? 9.772   -7.393  6.392   1.00 22.05 ? 231 MET A CG  1 
ATOM   1800 S SD  . MET A 1 231 ? 8.221   -7.227  5.491   1.00 21.92 ? 231 MET A SD  1 
ATOM   1801 C CE  . MET A 1 231 ? 8.204   -8.694  4.378   1.00 21.97 ? 231 MET A CE  1 
ATOM   1802 N N   . ALA A 1 232 ? 11.583  -11.014 8.470   1.00 24.48 ? 232 ALA A N   1 
ATOM   1803 C CA  . ALA A 1 232 ? 11.496  -12.221 9.301   1.00 24.86 ? 232 ALA A CA  1 
ATOM   1804 C C   . ALA A 1 232 ? 12.614  -12.359 10.300  1.00 24.97 ? 232 ALA A C   1 
ATOM   1805 O O   . ALA A 1 232 ? 12.388  -12.902 11.377  1.00 25.64 ? 232 ALA A O   1 
ATOM   1806 C CB  . ALA A 1 232 ? 11.409  -13.494 8.456   1.00 24.97 ? 232 ALA A CB  1 
ATOM   1807 N N   . ALA A 1 233 ? 13.816  -11.894 9.963   1.00 24.54 ? 233 ALA A N   1 
ATOM   1808 C CA  . ALA A 1 233 ? 14.971  -12.088 10.827  1.00 24.12 ? 233 ALA A CA  1 
ATOM   1809 C C   . ALA A 1 233 ? 15.216  -10.925 11.769  1.00 24.29 ? 233 ALA A C   1 
ATOM   1810 O O   . ALA A 1 233 ? 15.755  -11.120 12.849  1.00 24.54 ? 233 ALA A O   1 
ATOM   1811 C CB  . ALA A 1 233 ? 16.203  -12.331 10.020  1.00 24.36 ? 233 ALA A CB  1 
ATOM   1812 N N   . GLY A 1 234 ? 14.864  -9.717  11.344  1.00 24.11 ? 234 GLY A N   1 
ATOM   1813 C CA  . GLY A 1 234 ? 15.174  -8.490  12.089  1.00 24.06 ? 234 GLY A CA  1 
ATOM   1814 C C   . GLY A 1 234 ? 16.423  -7.751  11.594  1.00 23.39 ? 234 GLY A C   1 
ATOM   1815 O O   . GLY A 1 234 ? 16.658  -6.599  11.975  1.00 22.89 ? 234 GLY A O   1 
ATOM   1816 N N   . TYR A 1 235 ? 17.213  -8.456  10.767  1.00 23.27 ? 235 TYR A N   1 
ATOM   1817 C CA  . TYR A 1 235 ? 18.371  -7.938  10.066  1.00 22.44 ? 235 TYR A CA  1 
ATOM   1818 C C   . TYR A 1 235 ? 18.416  -8.467  8.614   1.00 22.22 ? 235 TYR A C   1 
ATOM   1819 O O   . TYR A 1 235 ? 17.791  -9.480  8.307   1.00 20.93 ? 235 TYR A O   1 
ATOM   1820 C CB  . TYR A 1 235 ? 19.645  -8.335  10.787  1.00 23.16 ? 235 TYR A CB  1 
ATOM   1821 C CG  . TYR A 1 235 ? 19.725  -9.792  11.114  1.00 23.07 ? 235 TYR A CG  1 
ATOM   1822 C CD1 . TYR A 1 235 ? 20.169  -10.706 10.186  1.00 23.86 ? 235 TYR A CD1 1 
ATOM   1823 C CD2 . TYR A 1 235 ? 19.395  -10.246 12.365  1.00 23.92 ? 235 TYR A CD2 1 
ATOM   1824 C CE1 . TYR A 1 235 ? 20.228  -12.044 10.485  1.00 25.26 ? 235 TYR A CE1 1 
ATOM   1825 C CE2 . TYR A 1 235 ? 19.469  -11.596 12.677  1.00 25.10 ? 235 TYR A CE2 1 
ATOM   1826 C CZ  . TYR A 1 235 ? 19.867  -12.475 11.747  1.00 25.30 ? 235 TYR A CZ  1 
ATOM   1827 O OH  . TYR A 1 235 ? 19.949  -13.787 12.080  1.00 25.93 ? 235 TYR A OH  1 
ATOM   1828 N N   . PRO A 1 236 ? 19.137  -7.762  7.737   1.00 21.53 ? 236 PRO A N   1 
ATOM   1829 C CA  . PRO A 1 236 ? 19.235  -8.154  6.345   1.00 22.51 ? 236 PRO A CA  1 
ATOM   1830 C C   . PRO A 1 236 ? 20.244  -9.281  6.180   1.00 23.07 ? 236 PRO A C   1 
ATOM   1831 O O   . PRO A 1 236 ? 21.049  -9.503  7.108   1.00 22.75 ? 236 PRO A O   1 
ATOM   1832 C CB  . PRO A 1 236 ? 19.704  -6.874  5.647   1.00 22.47 ? 236 PRO A CB  1 
ATOM   1833 C CG  . PRO A 1 236 ? 20.386  -6.050  6.698   1.00 22.68 ? 236 PRO A CG  1 
ATOM   1834 C CD  . PRO A 1 236 ? 19.894  -6.530  8.011   1.00 22.22 ? 236 PRO A CD  1 
ATOM   1835 N N   . PRO A 1 237 ? 20.179  -9.966  5.039   1.00 23.54 ? 237 PRO A N   1 
ATOM   1836 C CA  . PRO A 1 237 ? 21.002  -11.151 4.759   1.00 23.77 ? 237 PRO A CA  1 
ATOM   1837 C C   . PRO A 1 237 ? 22.470  -10.845 4.572   1.00 24.18 ? 237 PRO A C   1 
ATOM   1838 O O   . PRO A 1 237 ? 23.312  -11.686 4.837   1.00 23.89 ? 237 PRO A O   1 
ATOM   1839 C CB  . PRO A 1 237 ? 20.360  -11.754 3.473   1.00 23.94 ? 237 PRO A CB  1 
ATOM   1840 C CG  . PRO A 1 237 ? 19.567  -10.616 2.805   1.00 24.34 ? 237 PRO A CG  1 
ATOM   1841 C CD  . PRO A 1 237 ? 19.222  -9.678  3.947   1.00 24.50 ? 237 PRO A CD  1 
ATOM   1842 N N   . PHE A 1 238 ? 22.761  -9.638  4.130   1.00 25.05 ? 238 PHE A N   1 
ATOM   1843 C CA  . PHE A 1 238 ? 24.110  -9.185  3.883   1.00 25.53 ? 238 PHE A CA  1 
ATOM   1844 C C   . PHE A 1 238 ? 24.242  -7.833  4.539   1.00 26.47 ? 238 PHE A C   1 
ATOM   1845 O O   . PHE A 1 238 ? 23.664  -6.846  4.050   1.00 27.48 ? 238 PHE A O   1 
ATOM   1846 C CB  . PHE A 1 238 ? 24.334  -9.016  2.387   1.00 25.70 ? 238 PHE A CB  1 
ATOM   1847 C CG  . PHE A 1 238 ? 23.836  -10.151 1.589   1.00 27.23 ? 238 PHE A CG  1 
ATOM   1848 C CD1 . PHE A 1 238 ? 24.539  -11.352 1.557   1.00 29.60 ? 238 PHE A CD1 1 
ATOM   1849 C CD2 . PHE A 1 238 ? 22.670  -10.029 0.857   1.00 28.56 ? 238 PHE A CD2 1 
ATOM   1850 C CE1 . PHE A 1 238 ? 24.058  -12.450 0.812   1.00 30.60 ? 238 PHE A CE1 1 
ATOM   1851 C CE2 . PHE A 1 238 ? 22.188  -11.093 0.112   1.00 31.01 ? 238 PHE A CE2 1 
ATOM   1852 C CZ  . PHE A 1 238 ? 22.870  -12.319 0.098   1.00 31.06 ? 238 PHE A CZ  1 
ATOM   1853 N N   . PHE A 1 239 ? 24.981  -7.775  5.643   1.00 26.92 ? 239 PHE A N   1 
ATOM   1854 C CA  . PHE A 1 239 ? 25.261  -6.504  6.304   1.00 26.97 ? 239 PHE A CA  1 
ATOM   1855 C C   . PHE A 1 239 ? 26.720  -6.385  6.786   1.00 26.89 ? 239 PHE A C   1 
ATOM   1856 O O   . PHE A 1 239 ? 27.390  -7.361  7.053   1.00 27.09 ? 239 PHE A O   1 
ATOM   1857 C CB  . PHE A 1 239 ? 24.250  -6.247  7.435   1.00 26.86 ? 239 PHE A CB  1 
ATOM   1858 C CG  . PHE A 1 239 ? 24.473  -7.093  8.681   1.00 27.70 ? 239 PHE A CG  1 
ATOM   1859 C CD1 . PHE A 1 239 ? 25.424  -6.739  9.634   1.00 28.35 ? 239 PHE A CD1 1 
ATOM   1860 C CD2 . PHE A 1 239 ? 23.695  -8.218  8.925   1.00 28.54 ? 239 PHE A CD2 1 
ATOM   1861 C CE1 . PHE A 1 239 ? 25.599  -7.528  10.813  1.00 28.53 ? 239 PHE A CE1 1 
ATOM   1862 C CE2 . PHE A 1 239 ? 23.890  -9.016  10.079  1.00 27.25 ? 239 PHE A CE2 1 
ATOM   1863 C CZ  . PHE A 1 239 ? 24.824  -8.642  11.023  1.00 27.07 ? 239 PHE A CZ  1 
ATOM   1864 N N   . ALA A 1 240 ? 27.195  -5.157  6.858   1.00 28.00 ? 240 ALA A N   1 
ATOM   1865 C CA  . ALA A 1 240 ? 28.558  -4.833  7.296   1.00 29.47 ? 240 ALA A CA  1 
ATOM   1866 C C   . ALA A 1 240 ? 28.589  -3.330  7.558   1.00 30.48 ? 240 ALA A C   1 
ATOM   1867 O O   . ALA A 1 240 ? 27.614  -2.623  7.279   1.00 31.35 ? 240 ALA A O   1 
ATOM   1868 C CB  . ALA A 1 240 ? 29.571  -5.212  6.252   1.00 29.34 ? 240 ALA A CB  1 
ATOM   1869 N N   . ASP A 1 241 ? 29.675  -2.826  8.106   1.00 31.49 ? 241 ASP A N   1 
ATOM   1870 C CA  . ASP A 1 241 ? 29.706  -1.416  8.495   1.00 32.71 ? 241 ASP A CA  1 
ATOM   1871 C C   . ASP A 1 241 ? 29.808  -0.456  7.331   1.00 32.55 ? 241 ASP A C   1 
ATOM   1872 O O   . ASP A 1 241 ? 29.466  0.697   7.468   1.00 32.90 ? 241 ASP A O   1 
ATOM   1873 C CB  . ASP A 1 241 ? 30.867  -1.158  9.446   1.00 33.46 ? 241 ASP A CB  1 
ATOM   1874 C CG  . ASP A 1 241 ? 30.718  -1.900  10.734  1.00 36.52 ? 241 ASP A CG  1 
ATOM   1875 O OD1 . ASP A 1 241 ? 29.610  -1.832  11.338  1.00 38.46 ? 241 ASP A OD1 1 
ATOM   1876 O OD2 . ASP A 1 241 ? 31.678  -2.563  11.192  1.00 41.79 ? 241 ASP A OD2 1 
ATOM   1877 N N   . GLN A 1 242 ? 30.297  -0.941  6.196   1.00 33.61 ? 242 GLN A N   1 
ATOM   1878 C CA  . GLN A 1 242 ? 30.627  -0.100  5.048   1.00 34.36 ? 242 GLN A CA  1 
ATOM   1879 C C   . GLN A 1 242 ? 30.090  -0.795  3.805   1.00 33.42 ? 242 GLN A C   1 
ATOM   1880 O O   . GLN A 1 242 ? 30.167  -2.014  3.737   1.00 32.74 ? 242 GLN A O   1 
ATOM   1881 C CB  . GLN A 1 242 ? 32.169  0.081   4.978   1.00 34.96 ? 242 GLN A CB  1 
ATOM   1882 C CG  . GLN A 1 242 ? 32.737  1.535   5.265   1.00 37.76 ? 242 GLN A CG  1 
ATOM   1883 C CD  . GLN A 1 242 ? 31.916  2.389   6.236   1.00 40.56 ? 242 GLN A CD  1 
ATOM   1884 O OE1 . GLN A 1 242 ? 31.975  2.190   7.462   1.00 43.15 ? 242 GLN A OE1 1 
ATOM   1885 N NE2 . GLN A 1 242 ? 31.151  3.347   5.691   1.00 42.05 ? 242 GLN A NE2 1 
ATOM   1886 N N   . PRO A 1 243 ? 29.501  -0.056  2.863   1.00 32.87 ? 243 PRO A N   1 
ATOM   1887 C CA  . PRO A 1 243 ? 28.897  -0.673  1.671   1.00 33.15 ? 243 PRO A CA  1 
ATOM   1888 C C   . PRO A 1 243 ? 29.785  -1.651  0.895   1.00 33.43 ? 243 PRO A C   1 
ATOM   1889 O O   . PRO A 1 243 ? 29.278  -2.719  0.530   1.00 32.99 ? 243 PRO A O   1 
ATOM   1890 C CB  . PRO A 1 243 ? 28.488  0.528   0.812   1.00 33.06 ? 243 PRO A CB  1 
ATOM   1891 C CG  . PRO A 1 243 ? 28.233  1.618   1.823   1.00 34.06 ? 243 PRO A CG  1 
ATOM   1892 C CD  . PRO A 1 243 ? 29.298  1.402   2.880   1.00 33.29 ? 243 PRO A CD  1 
ATOM   1893 N N   . ILE A 1 244 ? 31.053  -1.315  0.640   1.00 33.98 ? 244 ILE A N   1 
ATOM   1894 C CA  . ILE A 1 244 ? 31.958  -2.238  -0.077  1.00 34.10 ? 244 ILE A CA  1 
ATOM   1895 C C   . ILE A 1 244 ? 31.997  -3.619  0.585   1.00 33.36 ? 244 ILE A C   1 
ATOM   1896 O O   . ILE A 1 244 ? 31.989  -4.623  -0.107  1.00 32.57 ? 244 ILE A O   1 
ATOM   1897 C CB  . ILE A 1 244 ? 33.402  -1.677  -0.223  1.00 35.11 ? 244 ILE A CB  1 
ATOM   1898 C CG1 . ILE A 1 244 ? 34.318  -2.694  -0.931  1.00 36.34 ? 244 ILE A CG1 1 
ATOM   1899 C CG2 . ILE A 1 244 ? 34.036  -1.375  1.138   1.00 37.15 ? 244 ILE A CG2 1 
ATOM   1900 C CD1 . ILE A 1 244 ? 35.547  -2.064  -1.607  1.00 39.61 ? 244 ILE A CD1 1 
ATOM   1901 N N   . GLN A 1 245 ? 32.026  -3.666  1.914   1.00 32.61 ? 245 GLN A N   1 
ATOM   1902 C CA  . GLN A 1 245 ? 31.959  -4.938  2.631   1.00 32.63 ? 245 GLN A CA  1 
ATOM   1903 C C   . GLN A 1 245 ? 30.629  -5.678  2.384   1.00 30.86 ? 245 GLN A C   1 
ATOM   1904 O O   . GLN A 1 245 ? 30.604  -6.921  2.271   1.00 30.69 ? 245 GLN A O   1 
ATOM   1905 C CB  . GLN A 1 245 ? 32.140  -4.734  4.143   1.00 33.62 ? 245 GLN A CB  1 
ATOM   1906 C CG  . GLN A 1 245 ? 33.424  -3.996  4.630   1.00 37.65 ? 245 GLN A CG  1 
ATOM   1907 C CD  . GLN A 1 245 ? 33.298  -3.585  6.124   1.00 39.85 ? 245 GLN A CD  1 
ATOM   1908 O OE1 . GLN A 1 245 ? 33.451  -2.417  6.468   1.00 45.62 ? 245 GLN A OE1 1 
ATOM   1909 N NE2 . GLN A 1 245 ? 33.022  -4.555  6.992   1.00 42.57 ? 245 GLN A NE2 1 
ATOM   1910 N N   . ILE A 1 246 ? 29.534  -4.925  2.336   1.00 28.32 ? 246 ILE A N   1 
ATOM   1911 C CA  . ILE A 1 246 ? 28.232  -5.457  1.928   1.00 27.65 ? 246 ILE A CA  1 
ATOM   1912 C C   . ILE A 1 246 ? 28.220  -6.015  0.495   1.00 27.19 ? 246 ILE A C   1 
ATOM   1913 O O   . ILE A 1 246 ? 27.700  -7.076  0.264   1.00 25.71 ? 246 ILE A O   1 
ATOM   1914 C CB  . ILE A 1 246 ? 27.113  -4.369  2.088   1.00 26.87 ? 246 ILE A CB  1 
ATOM   1915 C CG1 . ILE A 1 246 ? 26.979  -3.967  3.550   1.00 26.25 ? 246 ILE A CG1 1 
ATOM   1916 C CG2 . ILE A 1 246 ? 25.770  -4.877  1.566   1.00 25.86 ? 246 ILE A CG2 1 
ATOM   1917 C CD1 . ILE A 1 246 ? 26.166  -2.745  3.761   1.00 27.07 ? 246 ILE A CD1 1 
ATOM   1918 N N   . TYR A 1 247 ? 28.814  -5.307  -0.453  1.00 28.01 ? 247 TYR A N   1 
ATOM   1919 C CA  . TYR A 1 247 ? 28.831  -5.778  -1.841  1.00 29.36 ? 247 TYR A CA  1 
ATOM   1920 C C   . TYR A 1 247 ? 29.600  -7.081  -1.950  1.00 30.75 ? 247 TYR A C   1 
ATOM   1921 O O   . TYR A 1 247 ? 29.154  -8.002  -2.643  1.00 29.24 ? 247 TYR A O   1 
ATOM   1922 C CB  . TYR A 1 247 ? 29.443  -4.745  -2.795  1.00 29.17 ? 247 TYR A CB  1 
ATOM   1923 C CG  . TYR A 1 247 ? 28.804  -3.384  -2.715  1.00 28.18 ? 247 TYR A CG  1 
ATOM   1924 C CD1 . TYR A 1 247 ? 27.460  -3.236  -2.367  1.00 24.68 ? 247 TYR A CD1 1 
ATOM   1925 C CD2 . TYR A 1 247 ? 29.556  -2.241  -2.961  1.00 27.56 ? 247 TYR A CD2 1 
ATOM   1926 C CE1 . TYR A 1 247 ? 26.905  -2.015  -2.275  1.00 26.64 ? 247 TYR A CE1 1 
ATOM   1927 C CE2 . TYR A 1 247 ? 29.000  -1.006  -2.861  1.00 27.91 ? 247 TYR A CE2 1 
ATOM   1928 C CZ  . TYR A 1 247 ? 27.677  -0.892  -2.523  1.00 28.63 ? 247 TYR A CZ  1 
ATOM   1929 O OH  . TYR A 1 247 ? 27.118  0.355   -2.440  1.00 29.02 ? 247 TYR A OH  1 
ATOM   1930 N N   . GLU A 1 248 ? 30.727  -7.172  -1.230  1.00 31.69 ? 248 GLU A N   1 
ATOM   1931 C CA  . GLU A 1 248 ? 31.507  -8.415  -1.201  1.00 33.42 ? 248 GLU A CA  1 
ATOM   1932 C C   . GLU A 1 248 ? 30.620  -9.584  -0.761  1.00 33.46 ? 248 GLU A C   1 
ATOM   1933 O O   . GLU A 1 248 ? 30.668  -10.658 -1.369  1.00 33.86 ? 248 GLU A O   1 
ATOM   1934 C CB  . GLU A 1 248 ? 32.744  -8.317  -0.264  1.00 34.19 ? 248 GLU A CB  1 
ATOM   1935 C CG  . GLU A 1 248 ? 33.807  -7.345  -0.750  1.00 37.38 ? 248 GLU A CG  1 
ATOM   1936 C CD  . GLU A 1 248 ? 35.104  -7.375  0.058   1.00 44.98 ? 248 GLU A CD  1 
ATOM   1937 O OE1 . GLU A 1 248 ? 35.438  -8.450  0.640   1.00 50.06 ? 248 GLU A OE1 1 
ATOM   1938 O OE2 . GLU A 1 248 ? 35.813  -6.330  0.077   1.00 45.49 ? 248 GLU A OE2 1 
ATOM   1939 N N   . LYS A 1 249 ? 29.822  -9.387  0.303   1.00 33.19 ? 249 LYS A N   1 
ATOM   1940 C CA  . LYS A 1 249 ? 28.987  -10.476 0.797   1.00 32.95 ? 249 LYS A CA  1 
ATOM   1941 C C   . LYS A 1 249 ? 27.906  -10.857 -0.201  1.00 32.38 ? 249 LYS A C   1 
ATOM   1942 O O   . LYS A 1 249 ? 27.647  -12.033 -0.369  1.00 31.90 ? 249 LYS A O   1 
ATOM   1943 C CB  . LYS A 1 249 ? 28.397  -10.184 2.170   1.00 33.46 ? 249 LYS A CB  1 
ATOM   1944 C CG  . LYS A 1 249 ? 29.442  -10.308 3.333   1.00 34.04 ? 249 LYS A CG  1 
ATOM   1945 C CD  . LYS A 1 249 ? 28.846  -9.761  4.622   1.00 35.20 ? 249 LYS A CD  1 
ATOM   1946 C CE  . LYS A 1 249 ? 29.575  -10.224 5.863   1.00 36.43 ? 249 LYS A CE  1 
ATOM   1947 N NZ  . LYS A 1 249 ? 29.873  -9.023  6.683   1.00 38.50 ? 249 LYS A NZ  1 
ATOM   1948 N N   . ILE A 1 250 ? 27.313  -9.877  -0.874  1.00 32.35 ? 250 ILE A N   1 
ATOM   1949 C CA  . ILE A 1 250 ? 26.288  -10.112 -1.902  1.00 32.81 ? 250 ILE A CA  1 
ATOM   1950 C C   . ILE A 1 250 ? 26.794  -10.973 -3.076  1.00 34.56 ? 250 ILE A C   1 
ATOM   1951 O O   . ILE A 1 250 ? 26.134  -11.953 -3.463  1.00 34.24 ? 250 ILE A O   1 
ATOM   1952 C CB  . ILE A 1 250 ? 25.713  -8.759  -2.399  1.00 32.53 ? 250 ILE A CB  1 
ATOM   1953 C CG1 . ILE A 1 250 ? 24.971  -8.057  -1.243  1.00 31.12 ? 250 ILE A CG1 1 
ATOM   1954 C CG2 . ILE A 1 250 ? 24.744  -8.968  -3.559  1.00 33.23 ? 250 ILE A CG2 1 
ATOM   1955 C CD1 . ILE A 1 250 ? 24.703  -6.603  -1.452  1.00 28.34 ? 250 ILE A CD1 1 
ATOM   1956 N N   . VAL A 1 251 ? 27.973  -10.644 -3.614  1.00 36.64 ? 251 VAL A N   1 
ATOM   1957 C CA  . VAL A 1 251 ? 28.483  -11.327 -4.795  1.00 38.87 ? 251 VAL A CA  1 
ATOM   1958 C C   . VAL A 1 251 ? 29.071  -12.717 -4.485  1.00 40.82 ? 251 VAL A C   1 
ATOM   1959 O O   . VAL A 1 251 ? 29.258  -13.521 -5.401  1.00 41.65 ? 251 VAL A O   1 
ATOM   1960 C CB  . VAL A 1 251 ? 29.516  -10.474 -5.599  1.00 39.11 ? 251 VAL A CB  1 
ATOM   1961 C CG1 . VAL A 1 251 ? 28.993  -9.070  -5.846  1.00 38.38 ? 251 VAL A CG1 1 
ATOM   1962 C CG2 . VAL A 1 251 ? 30.883  -10.439 -4.905  1.00 40.78 ? 251 VAL A CG2 1 
ATOM   1963 N N   . SER A 1 252 ? 29.368  -12.998 -3.214  1.00 42.77 ? 252 SER A N   1 
ATOM   1964 C CA  . SER A 1 252 ? 29.559  -14.383 -2.748  1.00 43.84 ? 252 SER A CA  1 
ATOM   1965 C C   . SER A 1 252 ? 28.185  -15.103 -2.708  1.00 45.27 ? 252 SER A C   1 
ATOM   1966 O O   . SER A 1 252 ? 28.083  -16.251 -3.121  1.00 45.86 ? 252 SER A O   1 
ATOM   1967 C CB  . SER A 1 252 ? 30.239  -14.420 -1.380  1.00 43.69 ? 252 SER A CB  1 
ATOM   1968 O OG  . SER A 1 252 ? 29.259  -14.729 -0.411  1.00 43.81 ? 252 SER A OG  1 
ATOM   1969 N N   . GLY A 1 253 ? 27.135  -14.423 -2.203  1.00 46.73 ? 253 GLY A N   1 
ATOM   1970 C CA  . GLY A 1 253 ? 25.745  -14.908 -2.248  1.00 46.62 ? 253 GLY A CA  1 
ATOM   1971 C C   . GLY A 1 253 ? 25.394  -16.010 -1.246  1.00 47.22 ? 253 GLY A C   1 
ATOM   1972 O O   . GLY A 1 253 ? 24.275  -16.556 -1.235  1.00 47.40 ? 253 GLY A O   1 
ATOM   1973 N N   . LYS A 1 254 ? 26.369  -16.345 -0.407  1.00 47.47 ? 254 LYS A N   1 
ATOM   1974 C CA  . LYS A 1 254 ? 26.189  -17.295 0.665   1.00 47.41 ? 254 LYS A CA  1 
ATOM   1975 C C   . LYS A 1 254 ? 25.330  -16.555 1.646   1.00 46.90 ? 254 LYS A C   1 
ATOM   1976 O O   . LYS A 1 254 ? 25.743  -15.513 2.189   1.00 47.45 ? 254 LYS A O   1 
ATOM   1977 C CB  . LYS A 1 254 ? 27.522  -17.636 1.325   1.00 47.53 ? 254 LYS A CB  1 
ATOM   1978 C CG  . LYS A 1 254 ? 28.607  -18.090 0.372   1.00 48.53 ? 254 LYS A CG  1 
ATOM   1979 C CD  . LYS A 1 254 ? 29.679  -18.910 1.097   1.00 48.12 ? 254 LYS A CD  1 
ATOM   1980 C CE  . LYS A 1 254 ? 30.755  -18.029 1.715   1.00 47.69 ? 254 LYS A CE  1 
ATOM   1981 N NZ  . LYS A 1 254 ? 31.747  -17.606 0.688   1.00 48.44 ? 254 LYS A NZ  1 
ATOM   1982 N N   . VAL A 1 255 ? 24.119  -17.041 1.840   1.00 45.57 ? 255 VAL A N   1 
ATOM   1983 C CA  . VAL A 1 255 ? 23.275  -16.433 2.827   1.00 44.77 ? 255 VAL A CA  1 
ATOM   1984 C C   . VAL A 1 255 ? 23.022  -17.498 3.901   1.00 43.94 ? 255 VAL A C   1 
ATOM   1985 O O   . VAL A 1 255 ? 22.892  -18.677 3.583   1.00 42.73 ? 255 VAL A O   1 
ATOM   1986 C CB  . VAL A 1 255 ? 22.003  -15.820 2.211   1.00 44.55 ? 255 VAL A CB  1 
ATOM   1987 C CG1 . VAL A 1 255 ? 21.370  -16.771 1.227   1.00 45.77 ? 255 VAL A CG1 1 
ATOM   1988 C CG2 . VAL A 1 255 ? 21.020  -15.413 3.305   1.00 44.42 ? 255 VAL A CG2 1 
ATOM   1989 N N   . ARG A 1 256 ? 23.035  -17.050 5.158   1.00 42.67 ? 256 ARG A N   1 
ATOM   1990 C CA  . ARG A 1 256 ? 22.736  -17.859 6.328   1.00 42.93 ? 256 ARG A CA  1 
ATOM   1991 C C   . ARG A 1 256 ? 21.347  -17.453 6.801   1.00 40.99 ? 256 ARG A C   1 
ATOM   1992 O O   . ARG A 1 256 ? 21.046  -16.280 6.907   1.00 41.41 ? 256 ARG A O   1 
ATOM   1993 C CB  . ARG A 1 256 ? 23.744  -17.550 7.456   1.00 43.80 ? 256 ARG A CB  1 
ATOM   1994 C CG  . ARG A 1 256 ? 24.973  -18.484 7.620   1.00 48.74 ? 256 ARG A CG  1 
ATOM   1995 C CD  . ARG A 1 256 ? 25.651  -18.375 9.052   1.00 53.49 ? 256 ARG A CD  1 
ATOM   1996 N NE  . ARG A 1 256 ? 24.744  -18.818 10.148  1.00 58.11 ? 256 ARG A NE  1 
ATOM   1997 C CZ  . ARG A 1 256 ? 24.653  -18.291 11.391  1.00 59.70 ? 256 ARG A CZ  1 
ATOM   1998 N NH1 . ARG A 1 256 ? 25.417  -17.283 11.776  1.00 60.54 ? 256 ARG A NH1 1 
ATOM   1999 N NH2 . ARG A 1 256 ? 23.788  -18.793 12.268  1.00 60.44 ? 256 ARG A NH2 1 
ATOM   2000 N N   . PHE A 1 257 ? 20.506  -18.413 7.120   1.00 39.69 ? 257 PHE A N   1 
ATOM   2001 C CA  . PHE A 1 257 ? 19.193  -18.125 7.643   1.00 38.43 ? 257 PHE A CA  1 
ATOM   2002 C C   . PHE A 1 257 ? 19.166  -18.408 9.151   1.00 38.21 ? 257 PHE A C   1 
ATOM   2003 O O   . PHE A 1 257 ? 19.843  -19.321 9.640   1.00 38.21 ? 257 PHE A O   1 
ATOM   2004 C CB  . PHE A 1 257 ? 18.166  -18.966 6.919   1.00 37.83 ? 257 PHE A CB  1 
ATOM   2005 C CG  . PHE A 1 257 ? 18.227  -18.855 5.416   1.00 38.65 ? 257 PHE A CG  1 
ATOM   2006 C CD1 . PHE A 1 257 ? 17.739  -17.731 4.773   1.00 38.50 ? 257 PHE A CD1 1 
ATOM   2007 C CD2 . PHE A 1 257 ? 18.735  -19.889 4.638   1.00 39.39 ? 257 PHE A CD2 1 
ATOM   2008 C CE1 . PHE A 1 257 ? 17.759  -17.625 3.402   1.00 37.44 ? 257 PHE A CE1 1 
ATOM   2009 C CE2 . PHE A 1 257 ? 18.758  -19.795 3.253   1.00 38.82 ? 257 PHE A CE2 1 
ATOM   2010 C CZ  . PHE A 1 257 ? 18.258  -18.646 2.636   1.00 39.26 ? 257 PHE A CZ  1 
ATOM   2011 N N   . PRO A 1 258 ? 18.426  -17.600 9.901   1.00 37.51 ? 258 PRO A N   1 
ATOM   2012 C CA  . PRO A 1 258 ? 18.151  -17.907 11.315  1.00 36.94 ? 258 PRO A CA  1 
ATOM   2013 C C   . PRO A 1 258 ? 17.476  -19.249 11.477  1.00 36.04 ? 258 PRO A C   1 
ATOM   2014 O O   . PRO A 1 258 ? 16.633  -19.609 10.660  1.00 35.59 ? 258 PRO A O   1 
ATOM   2015 C CB  . PRO A 1 258 ? 17.185  -16.793 11.750  1.00 36.63 ? 258 PRO A CB  1 
ATOM   2016 C CG  . PRO A 1 258 ? 17.485  -15.662 10.843  1.00 37.29 ? 258 PRO A CG  1 
ATOM   2017 C CD  . PRO A 1 258 ? 17.850  -16.306 9.494   1.00 37.52 ? 258 PRO A CD  1 
ATOM   2018 N N   . SER A 1 259 ? 17.812  -19.961 12.543  1.00 35.24 ? 259 SER A N   1 
ATOM   2019 C CA  . SER A 1 259 ? 17.300  -21.320 12.733  1.00 35.57 ? 259 SER A CA  1 
ATOM   2020 C C   . SER A 1 259 ? 15.793  -21.307 12.882  1.00 34.69 ? 259 SER A C   1 
ATOM   2021 O O   . SER A 1 259 ? 15.129  -22.319 12.639  1.00 35.18 ? 259 SER A O   1 
ATOM   2022 C CB  . SER A 1 259 ? 17.972  -22.017 13.959  1.00 36.10 ? 259 SER A CB  1 
ATOM   2023 O OG  . SER A 1 259 ? 18.104  -21.137 15.060  1.00 35.35 ? 259 SER A OG  1 
ATOM   2024 N N   . HIS A 1 260 ? 15.251  -20.161 13.302  1.00 33.78 ? 260 HIS A N   1 
ATOM   2025 C CA  . HIS A 1 260 ? 13.816  -19.994 13.392  1.00 32.84 ? 260 HIS A CA  1 
ATOM   2026 C C   . HIS A 1 260 ? 13.086  -19.892 12.058  1.00 31.87 ? 260 HIS A C   1 
ATOM   2027 O O   . HIS A 1 260 ? 11.887  -19.913 12.084  1.00 31.07 ? 260 HIS A O   1 
ATOM   2028 C CB  . HIS A 1 260 ? 13.418  -18.823 14.361  1.00 33.64 ? 260 HIS A CB  1 
ATOM   2029 C CG  . HIS A 1 260 ? 13.760  -17.432 13.885  1.00 34.16 ? 260 HIS A CG  1 
ATOM   2030 N ND1 . HIS A 1 260 ? 13.103  -16.805 12.841  1.00 37.68 ? 260 HIS A ND1 1 
ATOM   2031 C CD2 . HIS A 1 260 ? 14.618  -16.508 14.387  1.00 35.96 ? 260 HIS A CD2 1 
ATOM   2032 C CE1 . HIS A 1 260 ? 13.588  -15.582 12.687  1.00 36.16 ? 260 HIS A CE1 1 
ATOM   2033 N NE2 . HIS A 1 260 ? 14.503  -15.374 13.615  1.00 33.57 ? 260 HIS A NE2 1 
ATOM   2034 N N   . PHE A 1 261 ? 13.771  -19.764 10.908  1.00 32.08 ? 261 PHE A N   1 
ATOM   2035 C CA  . PHE A 1 261 ? 13.069  -19.632 9.603   1.00 32.09 ? 261 PHE A CA  1 
ATOM   2036 C C   . PHE A 1 261 ? 12.466  -21.000 9.231   1.00 32.59 ? 261 PHE A C   1 
ATOM   2037 O O   . PHE A 1 261 ? 13.169  -22.025 9.271   1.00 31.95 ? 261 PHE A O   1 
ATOM   2038 C CB  . PHE A 1 261 ? 14.019  -19.198 8.447   1.00 32.48 ? 261 PHE A CB  1 
ATOM   2039 C CG  . PHE A 1 261 ? 14.275  -17.696 8.331   1.00 31.38 ? 261 PHE A CG  1 
ATOM   2040 C CD1 . PHE A 1 261 ? 13.993  -16.801 9.377   1.00 30.23 ? 261 PHE A CD1 1 
ATOM   2041 C CD2 . PHE A 1 261 ? 14.830  -17.186 7.152   1.00 31.64 ? 261 PHE A CD2 1 
ATOM   2042 C CE1 . PHE A 1 261 ? 14.263  -15.428 9.242   1.00 29.76 ? 261 PHE A CE1 1 
ATOM   2043 C CE2 . PHE A 1 261 ? 15.086  -15.785 7.003   1.00 30.56 ? 261 PHE A CE2 1 
ATOM   2044 C CZ  . PHE A 1 261 ? 14.795  -14.923 8.055   1.00 28.56 ? 261 PHE A CZ  1 
ATOM   2045 N N   . SER A 1 262 ? 11.185  -21.022 8.862   1.00 32.50 ? 262 SER A N   1 
ATOM   2046 C CA  . SER A 1 262 ? 10.558  -22.244 8.409   1.00 32.51 ? 262 SER A CA  1 
ATOM   2047 C C   . SER A 1 262 ? 11.283  -22.729 7.153   1.00 33.06 ? 262 SER A C   1 
ATOM   2048 O O   . SER A 1 262 ? 12.011  -21.944 6.498   1.00 33.04 ? 262 SER A O   1 
ATOM   2049 C CB  . SER A 1 262 ? 9.080   -21.995 8.132   1.00 32.85 ? 262 SER A CB  1 
ATOM   2050 O OG  . SER A 1 262 ? 8.885   -21.355 6.870   1.00 34.20 ? 262 SER A OG  1 
ATOM   2051 N N   . SER A 1 263 ? 11.136  -24.010 6.806   1.00 32.81 ? 263 SER A N   1 
ATOM   2052 C CA  . SER A 1 263 ? 11.881  -24.546 5.657   1.00 33.09 ? 263 SER A CA  1 
ATOM   2053 C C   . SER A 1 263 ? 11.327  -23.989 4.340   1.00 31.93 ? 263 SER A C   1 
ATOM   2054 O O   . SER A 1 263 ? 12.080  -23.727 3.436   1.00 32.48 ? 263 SER A O   1 
ATOM   2055 C CB  . SER A 1 263 ? 11.910  -26.092 5.678   1.00 33.73 ? 263 SER A CB  1 
ATOM   2056 O OG  . SER A 1 263 ? 10.708  -26.620 5.142   1.00 35.59 ? 263 SER A OG  1 
ATOM   2057 N N   . ASP A 1 264 ? 10.012  -23.800 4.262   1.00 31.58 ? 264 ASP A N   1 
ATOM   2058 C CA  . ASP A 1 264 ? 9.371   -23.016 3.191   1.00 31.99 ? 264 ASP A CA  1 
ATOM   2059 C C   . ASP A 1 264 ? 9.959   -21.604 3.013   1.00 31.42 ? 264 ASP A C   1 
ATOM   2060 O O   . ASP A 1 264 ? 10.121  -21.166 1.903   1.00 31.43 ? 264 ASP A O   1 
ATOM   2061 C CB  . ASP A 1 264 ? 7.857   -22.831 3.454   1.00 32.05 ? 264 ASP A CB  1 
ATOM   2062 C CG  . ASP A 1 264 ? 7.014   -24.110 3.153   1.00 33.78 ? 264 ASP A CG  1 
ATOM   2063 O OD1 . ASP A 1 264 ? 7.525   -25.057 2.509   1.00 33.50 ? 264 ASP A OD1 1 
ATOM   2064 O OD2 . ASP A 1 264 ? 5.834   -24.225 3.560   1.00 33.44 ? 264 ASP A OD2 1 
ATOM   2065 N N   . LEU A 1 265 ? 10.235  -20.896 4.103   1.00 31.24 ? 265 LEU A N   1 
ATOM   2066 C CA  . LEU A 1 265 ? 10.680  -19.501 4.009   1.00 31.35 ? 265 LEU A CA  1 
ATOM   2067 C C   . LEU A 1 265 ? 12.006  -19.518 3.350   1.00 31.13 ? 265 LEU A C   1 
ATOM   2068 O O   . LEU A 1 265 ? 12.231  -18.798 2.362   1.00 30.74 ? 265 LEU A O   1 
ATOM   2069 C CB  . LEU A 1 265 ? 10.757  -18.801 5.366   1.00 30.94 ? 265 LEU A CB  1 
ATOM   2070 C CG  . LEU A 1 265 ? 11.308  -17.369 5.360   1.00 31.32 ? 265 LEU A CG  1 
ATOM   2071 C CD1 . LEU A 1 265 ? 10.586  -16.453 4.374   1.00 28.35 ? 265 LEU A CD1 1 
ATOM   2072 C CD2 . LEU A 1 265 ? 11.279  -16.753 6.765   1.00 30.80 ? 265 LEU A CD2 1 
ATOM   2073 N N   . LYS A 1 266 ? 12.862  -20.408 3.836   1.00 32.07 ? 266 LYS A N   1 
ATOM   2074 C CA  . LYS A 1 266 ? 14.212  -20.536 3.284   1.00 32.65 ? 266 LYS A CA  1 
ATOM   2075 C C   . LYS A 1 266 ? 14.195  -20.853 1.813   1.00 31.64 ? 266 LYS A C   1 
ATOM   2076 O O   . LYS A 1 266 ? 14.979  -20.289 1.046   1.00 31.95 ? 266 LYS A O   1 
ATOM   2077 C CB  . LYS A 1 266 ? 15.033  -21.564 4.045   1.00 33.17 ? 266 LYS A CB  1 
ATOM   2078 C CG  . LYS A 1 266 ? 15.130  -21.219 5.564   1.00 36.70 ? 266 LYS A CG  1 
ATOM   2079 C CD  . LYS A 1 266 ? 16.376  -21.825 6.298   1.00 39.80 ? 266 LYS A CD  1 
ATOM   2080 C CE  . LYS A 1 266 ? 16.597  -23.319 6.088   1.00 41.81 ? 266 LYS A CE  1 
ATOM   2081 N NZ  . LYS A 1 266 ? 16.610  -24.162 7.370   1.00 41.17 ? 266 LYS A NZ  1 
ATOM   2082 N N   . ASP A 1 267 ? 13.281  -21.719 1.408   1.00 31.08 ? 267 ASP A N   1 
ATOM   2083 C CA  . ASP A 1 267 ? 13.263  -22.170 0.028   1.00 31.17 ? 267 ASP A CA  1 
ATOM   2084 C C   . ASP A 1 267 ? 12.744  -21.047 -0.888  1.00 30.61 ? 267 ASP A C   1 
ATOM   2085 O O   . ASP A 1 267 ? 13.191  -20.922 -2.005  1.00 30.30 ? 267 ASP A O   1 
ATOM   2086 C CB  . ASP A 1 267 ? 12.388  -23.419 -0.109  1.00 31.45 ? 267 ASP A CB  1 
ATOM   2087 C CG  . ASP A 1 267 ? 12.250  -23.853 -1.529  1.00 30.90 ? 267 ASP A CG  1 
ATOM   2088 O OD1 . ASP A 1 267 ? 13.224  -24.437 -2.033  1.00 31.38 ? 267 ASP A OD1 1 
ATOM   2089 O OD2 . ASP A 1 267 ? 11.244  -23.590 -2.232  1.00 30.48 ? 267 ASP A OD2 1 
ATOM   2090 N N   . LEU A 1 268 ? 11.778  -20.263 -0.410  1.00 29.76 ? 268 LEU A N   1 
ATOM   2091 C CA  . LEU A 1 268 ? 11.368  -19.028 -1.116  1.00 29.50 ? 268 LEU A CA  1 
ATOM   2092 C C   . LEU A 1 268 ? 12.582  -18.129 -1.323  1.00 29.03 ? 268 LEU A C   1 
ATOM   2093 O O   . LEU A 1 268 ? 12.887  -17.700 -2.450  1.00 27.65 ? 268 LEU A O   1 
ATOM   2094 C CB  . LEU A 1 268 ? 10.320  -18.245 -0.316  1.00 29.50 ? 268 LEU A CB  1 
ATOM   2095 C CG  . LEU A 1 268 ? 9.312   -17.280 -0.999  1.00 30.04 ? 268 LEU A CG  1 
ATOM   2096 C CD1 . LEU A 1 268 ? 9.216   -15.995 -0.252  1.00 29.19 ? 268 LEU A CD1 1 
ATOM   2097 C CD2 . LEU A 1 268 ? 9.577   -16.993 -2.474  1.00 29.58 ? 268 LEU A CD2 1 
ATOM   2098 N N   . LEU A 1 269 ? 13.290  -17.898 -0.217  1.00 28.69 ? 269 LEU A N   1 
ATOM   2099 C CA  . LEU A 1 269 ? 14.365  -16.937 -0.181  1.00 28.85 ? 269 LEU A CA  1 
ATOM   2100 C C   . LEU A 1 269 ? 15.524  -17.364 -1.044  1.00 29.64 ? 269 LEU A C   1 
ATOM   2101 O O   . LEU A 1 269 ? 16.169  -16.517 -1.631  1.00 28.76 ? 269 LEU A O   1 
ATOM   2102 C CB  . LEU A 1 269 ? 14.815  -16.668 1.270   1.00 28.12 ? 269 LEU A CB  1 
ATOM   2103 C CG  . LEU A 1 269 ? 13.798  -15.871 2.113   1.00 28.59 ? 269 LEU A CG  1 
ATOM   2104 C CD1 . LEU A 1 269 ? 14.300  -15.630 3.558   1.00 27.60 ? 269 LEU A CD1 1 
ATOM   2105 C CD2 . LEU A 1 269 ? 13.446  -14.538 1.433   1.00 26.19 ? 269 LEU A CD2 1 
ATOM   2106 N N   . ARG A 1 270 ? 15.807  -18.674 -1.113  1.00 31.45 ? 270 ARG A N   1 
ATOM   2107 C CA  . ARG A 1 270 ? 16.929  -19.153 -1.927  1.00 32.41 ? 270 ARG A CA  1 
ATOM   2108 C C   . ARG A 1 270 ? 16.622  -18.980 -3.412  1.00 31.84 ? 270 ARG A C   1 
ATOM   2109 O O   . ARG A 1 270 ? 17.519  -18.824 -4.218  1.00 31.87 ? 270 ARG A O   1 
ATOM   2110 C CB  . ARG A 1 270 ? 17.264  -20.620 -1.622  1.00 33.31 ? 270 ARG A CB  1 
ATOM   2111 C CG  . ARG A 1 270 ? 18.245  -20.772 -0.479  1.00 35.88 ? 270 ARG A CG  1 
ATOM   2112 C CD  . ARG A 1 270 ? 18.731  -22.220 -0.245  1.00 40.24 ? 270 ARG A CD  1 
ATOM   2113 N NE  . ARG A 1 270 ? 17.715  -23.001 0.428   1.00 40.87 ? 270 ARG A NE  1 
ATOM   2114 C CZ  . ARG A 1 270 ? 17.799  -23.479 1.678   1.00 41.15 ? 270 ARG A CZ  1 
ATOM   2115 N NH1 . ARG A 1 270 ? 18.886  -23.308 2.443   1.00 38.99 ? 270 ARG A NH1 1 
ATOM   2116 N NH2 . ARG A 1 270 ? 16.769  -24.158 2.149   1.00 40.78 ? 270 ARG A NH2 1 
ATOM   2117 N N   . ASN A 1 271 ? 15.349  -19.019 -3.759  1.00 31.63 ? 271 ASN A N   1 
ATOM   2118 C CA  . ASN A 1 271 ? 14.921  -18.750 -5.132  1.00 32.07 ? 271 ASN A CA  1 
ATOM   2119 C C   . ASN A 1 271 ? 14.771  -17.252 -5.470  1.00 31.89 ? 271 ASN A C   1 
ATOM   2120 O O   . ASN A 1 271 ? 14.738  -16.895 -6.646  1.00 31.15 ? 271 ASN A O   1 
ATOM   2121 C CB  . ASN A 1 271 ? 13.607  -19.461 -5.412  1.00 32.28 ? 271 ASN A CB  1 
ATOM   2122 C CG  . ASN A 1 271 ? 13.771  -20.972 -5.427  1.00 34.12 ? 271 ASN A CG  1 
ATOM   2123 O OD1 . ASN A 1 271 ? 13.412  -21.643 -4.463  1.00 36.41 ? 271 ASN A OD1 1 
ATOM   2124 N ND2 . ASN A 1 271 ? 14.360  -21.500 -6.486  1.00 32.23 ? 271 ASN A ND2 1 
ATOM   2125 N N   . LEU A 1 272 ? 14.674  -16.396 -4.450  1.00 30.70 ? 272 LEU A N   1 
ATOM   2126 C CA  . LEU A 1 272 ? 14.653  -14.956 -4.675  1.00 30.93 ? 272 LEU A CA  1 
ATOM   2127 C C   . LEU A 1 272 ? 16.067  -14.392 -4.624  1.00 30.77 ? 272 LEU A C   1 
ATOM   2128 O O   . LEU A 1 272 ? 16.449  -13.630 -5.486  1.00 31.16 ? 272 LEU A O   1 
ATOM   2129 C CB  . LEU A 1 272 ? 13.732  -14.266 -3.664  1.00 30.49 ? 272 LEU A CB  1 
ATOM   2130 C CG  . LEU A 1 272 ? 12.237  -14.456 -3.915  1.00 28.09 ? 272 LEU A CG  1 
ATOM   2131 C CD1 . LEU A 1 272 ? 11.422  -13.826 -2.795  1.00 27.46 ? 272 LEU A CD1 1 
ATOM   2132 C CD2 . LEU A 1 272 ? 11.831  -13.874 -5.255  1.00 27.07 ? 272 LEU A CD2 1 
ATOM   2133 N N   . LEU A 1 273 ? 16.842  -14.783 -3.621  1.00 30.96 ? 273 LEU A N   1 
ATOM   2134 C CA  . LEU A 1 273 ? 18.244  -14.378 -3.490  1.00 30.94 ? 273 LEU A CA  1 
ATOM   2135 C C   . LEU A 1 273 ? 19.151  -15.295 -4.319  1.00 31.81 ? 273 LEU A C   1 
ATOM   2136 O O   . LEU A 1 273 ? 20.160  -15.833 -3.853  1.00 31.86 ? 273 LEU A O   1 
ATOM   2137 C CB  . LEU A 1 273 ? 18.641  -14.369 -2.025  1.00 31.15 ? 273 LEU A CB  1 
ATOM   2138 C CG  . LEU A 1 273 ? 17.783  -13.485 -1.104  1.00 31.03 ? 273 LEU A CG  1 
ATOM   2139 C CD1 . LEU A 1 273 ? 18.133  -13.745 0.364   1.00 31.48 ? 273 LEU A CD1 1 
ATOM   2140 C CD2 . LEU A 1 273 ? 17.963  -11.973 -1.474  1.00 29.96 ? 273 LEU A CD2 1 
ATOM   2141 N N   . GLN A 1 274 ? 18.794  -15.411 -5.591  1.00 32.80 ? 274 GLN A N   1 
ATOM   2142 C CA  . GLN A 1 274 ? 19.422  -16.312 -6.531  1.00 33.51 ? 274 GLN A CA  1 
ATOM   2143 C C   . GLN A 1 274 ? 20.265  -15.485 -7.478  1.00 33.47 ? 274 GLN A C   1 
ATOM   2144 O O   . GLN A 1 274 ? 19.727  -14.693 -8.229  1.00 32.77 ? 274 GLN A O   1 
ATOM   2145 C CB  . GLN A 1 274 ? 18.302  -17.050 -7.293  1.00 34.26 ? 274 GLN A CB  1 
ATOM   2146 C CG  . GLN A 1 274 ? 18.747  -17.955 -8.454  1.00 35.45 ? 274 GLN A CG  1 
ATOM   2147 C CD  . GLN A 1 274 ? 19.739  -19.018 -8.023  1.00 35.33 ? 274 GLN A CD  1 
ATOM   2148 O OE1 . GLN A 1 274 ? 20.949  -18.821 -8.171  1.00 36.99 ? 274 GLN A OE1 1 
ATOM   2149 N NE2 . GLN A 1 274 ? 19.239  -20.116 -7.450  1.00 32.93 ? 274 GLN A NE2 1 
ATOM   2150 N N   . VAL A 1 275 ? 21.587  -15.667 -7.448  1.00 34.38 ? 275 VAL A N   1 
ATOM   2151 C CA  . VAL A 1 275 ? 22.491  -14.961 -8.355  1.00 34.46 ? 275 VAL A CA  1 
ATOM   2152 C C   . VAL A 1 275 ? 22.166  -15.303 -9.826  1.00 34.52 ? 275 VAL A C   1 
ATOM   2153 O O   . VAL A 1 275 ? 22.278  -14.475 -10.708 1.00 34.30 ? 275 VAL A O   1 
ATOM   2154 C CB  . VAL A 1 275 ? 23.997  -15.261 -8.035  1.00 35.16 ? 275 VAL A CB  1 
ATOM   2155 C CG1 . VAL A 1 275 ? 24.924  -14.509 -9.006  1.00 35.51 ? 275 VAL A CG1 1 
ATOM   2156 C CG2 . VAL A 1 275 ? 24.360  -14.867 -6.594  1.00 36.72 ? 275 VAL A CG2 1 
ATOM   2157 N N   . ASP A 1 276 ? 21.718  -16.521 -10.074 1.00 35.36 ? 276 ASP A N   1 
ATOM   2158 C CA  . ASP A 1 276 ? 21.489  -17.017 -11.419 1.00 35.55 ? 276 ASP A CA  1 
ATOM   2159 C C   . ASP A 1 276 ? 20.120  -16.598 -11.945 1.00 35.81 ? 276 ASP A C   1 
ATOM   2160 O O   . ASP A 1 276 ? 19.093  -17.189 -11.589 1.00 35.32 ? 276 ASP A O   1 
ATOM   2161 C CB  . ASP A 1 276 ? 21.597  -18.555 -11.373 1.00 36.18 ? 276 ASP A CB  1 
ATOM   2162 C CG  . ASP A 1 276 ? 21.709  -19.209 -12.733 1.00 36.30 ? 276 ASP A CG  1 
ATOM   2163 O OD1 . ASP A 1 276 ? 21.349  -18.605 -13.778 1.00 37.97 ? 276 ASP A OD1 1 
ATOM   2164 O OD2 . ASP A 1 276 ? 22.164  -20.380 -12.823 1.00 40.18 ? 276 ASP A OD2 1 
ATOM   2165 N N   . LEU A 1 277 ? 20.121  -15.633 -12.865 1.00 36.35 ? 277 LEU A N   1 
ATOM   2166 C CA  . LEU A 1 277 ? 18.883  -15.110 -13.478 1.00 36.63 ? 277 LEU A CA  1 
ATOM   2167 C C   . LEU A 1 277 ? 17.963  -16.121 -14.156 1.00 37.41 ? 277 LEU A C   1 
ATOM   2168 O O   . LEU A 1 277 ? 16.760  -15.883 -14.252 1.00 37.45 ? 277 LEU A O   1 
ATOM   2169 C CB  . LEU A 1 277 ? 19.226  -14.001 -14.467 1.00 36.37 ? 277 LEU A CB  1 
ATOM   2170 C CG  . LEU A 1 277 ? 19.779  -12.783 -13.748 1.00 36.73 ? 277 LEU A CG  1 
ATOM   2171 C CD1 . LEU A 1 277 ? 20.574  -11.879 -14.677 1.00 36.94 ? 277 LEU A CD1 1 
ATOM   2172 C CD2 . LEU A 1 277 ? 18.623  -12.058 -13.094 1.00 38.22 ? 277 LEU A CD2 1 
ATOM   2173 N N   . THR A 1 278 ? 18.504  -17.245 -14.638 1.00 38.63 ? 278 THR A N   1 
ATOM   2174 C CA  . THR A 1 278 ? 17.653  -18.303 -15.229 1.00 38.84 ? 278 THR A CA  1 
ATOM   2175 C C   . THR A 1 278 ? 16.870  -19.082 -14.170 1.00 38.66 ? 278 THR A C   1 
ATOM   2176 O O   . THR A 1 278 ? 15.887  -19.735 -14.476 1.00 39.62 ? 278 THR A O   1 
ATOM   2177 C CB  . THR A 1 278 ? 18.501  -19.295 -16.061 1.00 39.20 ? 278 THR A CB  1 
ATOM   2178 O OG1 . THR A 1 278 ? 19.302  -20.097 -15.180 1.00 39.97 ? 278 THR A OG1 1 
ATOM   2179 C CG2 . THR A 1 278 ? 19.520  -18.534 -16.984 1.00 39.78 ? 278 THR A CG2 1 
ATOM   2180 N N   . LYS A 1 279 ? 17.329  -19.036 -12.925 1.00 38.76 ? 279 LYS A N   1 
ATOM   2181 C CA  . LYS A 1 279 ? 16.616  -19.660 -11.790 1.00 38.60 ? 279 LYS A CA  1 
ATOM   2182 C C   . LYS A 1 279 ? 15.886  -18.703 -10.811 1.00 37.26 ? 279 LYS A C   1 
ATOM   2183 O O   . LYS A 1 279 ? 15.043  -19.147 -10.035 1.00 37.72 ? 279 LYS A O   1 
ATOM   2184 C CB  . LYS A 1 279 ? 17.612  -20.532 -11.009 1.00 39.16 ? 279 LYS A CB  1 
ATOM   2185 C CG  . LYS A 1 279 ? 17.821  -21.946 -11.609 1.00 41.13 ? 279 LYS A CG  1 
ATOM   2186 C CD  . LYS A 1 279 ? 19.284  -22.256 -11.973 1.00 44.10 ? 279 LYS A CD  1 
ATOM   2187 C CE  . LYS A 1 279 ? 20.050  -23.012 -10.861 1.00 45.23 ? 279 LYS A CE  1 
ATOM   2188 N NZ  . LYS A 1 279 ? 21.425  -23.452 -11.318 1.00 46.17 ? 279 LYS A NZ  1 
ATOM   2189 N N   . ARG A 1 280 ? 16.185  -17.403 -10.839 1.00 36.23 ? 280 ARG A N   1 
ATOM   2190 C CA  . ARG A 1 280 ? 15.576  -16.462 -9.872  1.00 34.64 ? 280 ARG A CA  1 
ATOM   2191 C C   . ARG A 1 280 ? 14.095  -16.276 -10.149 1.00 34.26 ? 280 ARG A C   1 
ATOM   2192 O O   . ARG A 1 280 ? 13.723  -15.898 -11.241 1.00 33.45 ? 280 ARG A O   1 
ATOM   2193 C CB  . ARG A 1 280 ? 16.286  -15.091 -9.880  1.00 34.33 ? 280 ARG A CB  1 
ATOM   2194 C CG  . ARG A 1 280 ? 15.698  -14.091 -8.849  1.00 32.16 ? 280 ARG A CG  1 
ATOM   2195 C CD  . ARG A 1 280 ? 16.248  -12.728 -8.911  1.00 28.72 ? 280 ARG A CD  1 
ATOM   2196 N NE  . ARG A 1 280 ? 17.702  -12.783 -8.966  1.00 29.79 ? 280 ARG A NE  1 
ATOM   2197 C CZ  . ARG A 1 280 ? 18.465  -11.795 -9.347  1.00 27.03 ? 280 ARG A CZ  1 
ATOM   2198 N NH1 . ARG A 1 280 ? 17.914  -10.642 -9.654  1.00 28.55 ? 280 ARG A NH1 1 
ATOM   2199 N NH2 . ARG A 1 280 ? 19.783  -11.956 -9.424  1.00 27.83 ? 280 ARG A NH2 1 
ATOM   2200 N N   . PHE A 1 281 ? 13.262  -16.567 -9.151  1.00 34.56 ? 281 PHE A N   1 
ATOM   2201 C CA  . PHE A 1 281 ? 11.821  -16.357 -9.227  1.00 35.55 ? 281 PHE A CA  1 
ATOM   2202 C C   . PHE A 1 281 ? 11.443  -14.929 -9.589  1.00 36.25 ? 281 PHE A C   1 
ATOM   2203 O O   . PHE A 1 281 ? 12.102  -13.969 -9.183  1.00 35.23 ? 281 PHE A O   1 
ATOM   2204 C CB  . PHE A 1 281 ? 11.177  -16.700 -7.885  1.00 35.78 ? 281 PHE A CB  1 
ATOM   2205 C CG  . PHE A 1 281 ? 10.958  -18.171 -7.665  1.00 38.24 ? 281 PHE A CG  1 
ATOM   2206 C CD1 . PHE A 1 281 ? 11.619  -19.139 -8.443  1.00 38.29 ? 281 PHE A CD1 1 
ATOM   2207 C CD2 . PHE A 1 281 ? 10.078  -18.600 -6.675  1.00 40.58 ? 281 PHE A CD2 1 
ATOM   2208 C CE1 . PHE A 1 281 ? 11.385  -20.472 -8.240  1.00 39.84 ? 281 PHE A CE1 1 
ATOM   2209 C CE2 . PHE A 1 281 ? 9.847   -19.952 -6.478  1.00 41.06 ? 281 PHE A CE2 1 
ATOM   2210 C CZ  . PHE A 1 281 ? 10.498  -20.882 -7.259  1.00 41.38 ? 281 PHE A CZ  1 
ATOM   2211 N N   . GLY A 1 282 ? 10.343  -14.816 -10.318 1.00 37.67 ? 282 GLY A N   1 
ATOM   2212 C CA  . GLY A 1 282 ? 9.857   -13.560 -10.859 1.00 39.33 ? 282 GLY A CA  1 
ATOM   2213 C C   . GLY A 1 282 ? 10.327  -13.367 -12.285 1.00 40.67 ? 282 GLY A C   1 
ATOM   2214 O O   . GLY A 1 282 ? 9.610   -12.816 -13.085 1.00 41.37 ? 282 GLY A O   1 
ATOM   2215 N N   . ASN A 1 283 ? 11.537  -13.830 -12.586 1.00 42.34 ? 283 ASN A N   1 
ATOM   2216 C CA  . ASN A 1 283 ? 12.169  -13.652 -13.906 1.00 44.04 ? 283 ASN A CA  1 
ATOM   2217 C C   . ASN A 1 283 ? 11.740  -14.685 -15.011 1.00 44.79 ? 283 ASN A C   1 
ATOM   2218 O O   . ASN A 1 283 ? 11.740  -14.375 -16.213 1.00 44.26 ? 283 ASN A O   1 
ATOM   2219 C CB  . ASN A 1 283 ? 13.722  -13.679 -13.738 1.00 43.47 ? 283 ASN A CB  1 
ATOM   2220 C CG  . ASN A 1 283 ? 14.456  -12.846 -14.806 1.00 43.89 ? 283 ASN A CG  1 
ATOM   2221 O OD1 . ASN A 1 283 ? 13.940  -11.809 -15.271 1.00 46.01 ? 283 ASN A OD1 1 
ATOM   2222 N ND2 . ASN A 1 283 ? 15.665  -13.285 -15.186 1.00 38.60 ? 283 ASN A ND2 1 
ATOM   2223 N N   . LEU A 1 284 ? 11.364  -15.884 -14.557 1.00 45.99 ? 284 LEU A N   1 
ATOM   2224 C CA  . LEU A 1 284 ? 11.199  -17.087 -15.391 1.00 46.33 ? 284 LEU A CA  1 
ATOM   2225 C C   . LEU A 1 284 ? 9.939   -17.052 -16.264 1.00 46.35 ? 284 LEU A C   1 
ATOM   2226 O O   . LEU A 1 284 ? 9.176   -16.075 -16.221 1.00 46.23 ? 284 LEU A O   1 
ATOM   2227 C CB  . LEU A 1 284 ? 11.190  -18.341 -14.492 1.00 46.34 ? 284 LEU A CB  1 
ATOM   2228 C CG  . LEU A 1 284 ? 12.222  -18.340 -13.347 1.00 47.48 ? 284 LEU A CG  1 
ATOM   2229 C CD1 . LEU A 1 284 ? 12.163  -19.599 -12.471 1.00 48.89 ? 284 LEU A CD1 1 
ATOM   2230 C CD2 . LEU A 1 284 ? 13.578  -18.192 -13.941 1.00 47.82 ? 284 LEU A CD2 1 
ATOM   2231 N N   . LYS A 1 285 ? 9.740   -18.118 -17.055 1.00 46.34 ? 285 LYS A N   1 
ATOM   2232 C CA  . LYS A 1 285 ? 8.635   -18.197 -18.023 1.00 46.54 ? 285 LYS A CA  1 
ATOM   2233 C C   . LYS A 1 285 ? 7.289   -18.043 -17.325 1.00 45.79 ? 285 LYS A C   1 
ATOM   2234 O O   . LYS A 1 285 ? 6.406   -17.323 -17.814 1.00 46.06 ? 285 LYS A O   1 
ATOM   2235 C CB  . LYS A 1 285 ? 8.668   -19.494 -18.903 1.00 46.89 ? 285 LYS A CB  1 
ATOM   2236 C CG  . LYS A 1 285 ? 9.088   -20.818 -18.193 1.00 49.00 ? 285 LYS A CG  1 
ATOM   2237 C CD  . LYS A 1 285 ? 10.574  -21.281 -18.529 1.00 50.32 ? 285 LYS A CD  1 
ATOM   2238 C CE  . LYS A 1 285 ? 11.603  -21.014 -17.408 1.00 48.99 ? 285 LYS A CE  1 
ATOM   2239 N NZ  . LYS A 1 285 ? 12.504  -19.842 -17.741 1.00 47.90 ? 285 LYS A NZ  1 
ATOM   2240 N N   . ASN A 1 286 ? 7.160   -18.687 -16.166 1.00 45.04 ? 286 ASN A N   1 
ATOM   2241 C CA  . ASN A 1 286 ? 5.959   -18.586 -15.329 1.00 44.67 ? 286 ASN A CA  1 
ATOM   2242 C C   . ASN A 1 286 ? 5.783   -17.255 -14.568 1.00 43.04 ? 286 ASN A C   1 
ATOM   2243 O O   . ASN A 1 286 ? 4.779   -17.064 -13.880 1.00 42.97 ? 286 ASN A O   1 
ATOM   2244 C CB  . ASN A 1 286 ? 5.948   -19.737 -14.336 1.00 45.21 ? 286 ASN A CB  1 
ATOM   2245 C CG  . ASN A 1 286 ? 5.465   -21.012 -14.954 1.00 48.32 ? 286 ASN A CG  1 
ATOM   2246 O OD1 . ASN A 1 286 ? 6.155   -21.607 -15.789 1.00 52.10 ? 286 ASN A OD1 1 
ATOM   2247 N ND2 . ASN A 1 286 ? 4.253   -21.445 -14.563 1.00 51.70 ? 286 ASN A ND2 1 
ATOM   2248 N N   . GLY A 1 287 ? 6.762   -16.358 -14.661 1.00 40.98 ? 287 GLY A N   1 
ATOM   2249 C CA  . GLY A 1 287 ? 6.626   -15.021 -14.101 1.00 39.11 ? 287 GLY A CA  1 
ATOM   2250 C C   . GLY A 1 287 ? 6.398   -15.000 -12.594 1.00 37.23 ? 287 GLY A C   1 
ATOM   2251 O O   . GLY A 1 287 ? 7.109   -15.631 -11.848 1.00 35.78 ? 287 GLY A O   1 
ATOM   2252 N N   . VAL A 1 288 ? 5.403   -14.236 -12.167 1.00 36.07 ? 288 VAL A N   1 
ATOM   2253 C CA  . VAL A 1 288 ? 5.121   -13.995 -10.747 1.00 35.68 ? 288 VAL A CA  1 
ATOM   2254 C C   . VAL A 1 288 ? 4.397   -15.180 -10.060 1.00 36.28 ? 288 VAL A C   1 
ATOM   2255 O O   . VAL A 1 288 ? 4.396   -15.306 -8.833  1.00 34.74 ? 288 VAL A O   1 
ATOM   2256 C CB  . VAL A 1 288 ? 4.332   -12.646 -10.556 1.00 35.16 ? 288 VAL A CB  1 
ATOM   2257 C CG1 . VAL A 1 288 ? 3.038   -12.664 -11.247 1.00 33.15 ? 288 VAL A CG1 1 
ATOM   2258 C CG2 . VAL A 1 288 ? 4.138   -12.310 -9.076  1.00 35.18 ? 288 VAL A CG2 1 
ATOM   2259 N N   . ASN A 1 289 ? 3.818   -16.080 -10.855 1.00 37.06 ? 289 ASN A N   1 
ATOM   2260 C CA  . ASN A 1 289 ? 3.186   -17.275 -10.286 1.00 37.44 ? 289 ASN A CA  1 
ATOM   2261 C C   . ASN A 1 289 ? 4.151   -18.192 -9.587  1.00 36.35 ? 289 ASN A C   1 
ATOM   2262 O O   . ASN A 1 289 ? 3.774   -18.850 -8.631  1.00 36.49 ? 289 ASN A O   1 
ATOM   2263 C CB  . ASN A 1 289 ? 2.339   -17.981 -11.341 1.00 38.18 ? 289 ASN A CB  1 
ATOM   2264 C CG  . ASN A 1 289 ? 1.197   -17.111 -11.786 1.00 41.18 ? 289 ASN A CG  1 
ATOM   2265 O OD1 . ASN A 1 289 ? 1.033   -16.841 -12.980 1.00 47.70 ? 289 ASN A OD1 1 
ATOM   2266 N ND2 . ASN A 1 289 ? 0.442   -16.586 -10.816 1.00 41.10 ? 289 ASN A ND2 1 
ATOM   2267 N N   . ASP A 1 290 ? 5.421   -18.164 -9.987  1.00 36.27 ? 290 ASP A N   1 
ATOM   2268 C CA  . ASP A 1 290 ? 6.456   -18.879 -9.253  1.00 36.07 ? 290 ASP A CA  1 
ATOM   2269 C C   . ASP A 1 290 ? 6.528   -18.426 -7.789  1.00 36.14 ? 290 ASP A C   1 
ATOM   2270 O O   . ASP A 1 290 ? 6.870   -19.215 -6.897  1.00 36.80 ? 290 ASP A O   1 
ATOM   2271 C CB  . ASP A 1 290 ? 7.824   -18.696 -9.922  1.00 36.79 ? 290 ASP A CB  1 
ATOM   2272 C CG  . ASP A 1 290 ? 7.992   -19.562 -11.174 1.00 37.19 ? 290 ASP A CG  1 
ATOM   2273 O OD1 . ASP A 1 290 ? 7.283   -20.592 -11.249 1.00 36.09 ? 290 ASP A OD1 1 
ATOM   2274 O OD2 . ASP A 1 290 ? 8.797   -19.290 -12.117 1.00 35.64 ? 290 ASP A OD2 1 
ATOM   2275 N N   . ILE A 1 291 ? 6.207   -17.155 -7.542  1.00 35.11 ? 291 ILE A N   1 
ATOM   2276 C CA  . ILE A 1 291 ? 6.167   -16.630 -6.189  1.00 33.97 ? 291 ILE A CA  1 
ATOM   2277 C C   . ILE A 1 291 ? 4.836   -16.919 -5.545  1.00 33.54 ? 291 ILE A C   1 
ATOM   2278 O O   . ILE A 1 291 ? 4.761   -17.463 -4.450  1.00 32.46 ? 291 ILE A O   1 
ATOM   2279 C CB  . ILE A 1 291 ? 6.461   -15.118 -6.206  1.00 33.51 ? 291 ILE A CB  1 
ATOM   2280 C CG1 . ILE A 1 291 ? 7.926   -14.878 -6.632  1.00 34.11 ? 291 ILE A CG1 1 
ATOM   2281 C CG2 . ILE A 1 291 ? 6.168   -14.524 -4.853  1.00 33.25 ? 291 ILE A CG2 1 
ATOM   2282 C CD1 . ILE A 1 291 ? 8.252   -13.498 -7.169  1.00 34.19 ? 291 ILE A CD1 1 
ATOM   2283 N N   . LYS A 1 292 ? 3.778   -16.517 -6.227  1.00 34.00 ? 292 LYS A N   1 
ATOM   2284 C CA  . LYS A 1 292 ? 2.421   -16.638 -5.724  1.00 34.50 ? 292 LYS A CA  1 
ATOM   2285 C C   . LYS A 1 292 ? 1.980   -18.059 -5.346  1.00 35.12 ? 292 LYS A C   1 
ATOM   2286 O O   . LYS A 1 292 ? 1.189   -18.228 -4.422  1.00 35.03 ? 292 LYS A O   1 
ATOM   2287 C CB  . LYS A 1 292 ? 1.451   -16.080 -6.751  1.00 34.52 ? 292 LYS A CB  1 
ATOM   2288 C CG  . LYS A 1 292 ? 1.565   -14.587 -6.975  1.00 35.01 ? 292 LYS A CG  1 
ATOM   2289 C CD  . LYS A 1 292 ? 0.187   -13.976 -7.274  1.00 36.25 ? 292 LYS A CD  1 
ATOM   2290 C CE  . LYS A 1 292 ? 0.215   -13.013 -8.418  1.00 36.33 ? 292 LYS A CE  1 
ATOM   2291 N NZ  . LYS A 1 292 ? -1.152  -12.480 -8.681  1.00 34.28 ? 292 LYS A NZ  1 
ATOM   2292 N N   . ASN A 1 293 ? 2.477   -19.059 -6.062  1.00 36.45 ? 293 ASN A N   1 
ATOM   2293 C CA  . ASN A 1 293 ? 2.082   -20.460 -5.863  1.00 37.58 ? 293 ASN A CA  1 
ATOM   2294 C C   . ASN A 1 293 ? 3.095   -21.202 -4.992  1.00 37.97 ? 293 ASN A C   1 
ATOM   2295 O O   . ASN A 1 293 ? 2.923   -22.408 -4.755  1.00 38.13 ? 293 ASN A O   1 
ATOM   2296 C CB  . ASN A 1 293 ? 1.977   -21.212 -7.206  1.00 37.95 ? 293 ASN A CB  1 
ATOM   2297 C CG  . ASN A 1 293 ? 0.907   -20.648 -8.136  1.00 39.22 ? 293 ASN A CG  1 
ATOM   2298 O OD1 . ASN A 1 293 ? -0.165  -20.218 -7.710  1.00 40.14 ? 293 ASN A OD1 1 
ATOM   2299 N ND2 . ASN A 1 293 ? 1.209   -20.651 -9.418  1.00 42.03 ? 293 ASN A ND2 1 
ATOM   2300 N N   . HIS A 1 294 ? 4.156   -20.514 -4.549  1.00 37.50 ? 294 HIS A N   1 
ATOM   2301 C CA  . HIS A 1 294 ? 5.060   -21.067 -3.524  1.00 37.85 ? 294 HIS A CA  1 
ATOM   2302 C C   . HIS A 1 294 ? 4.265   -21.552 -2.308  1.00 38.00 ? 294 HIS A C   1 
ATOM   2303 O O   . HIS A 1 294 ? 3.184   -21.031 -2.019  1.00 37.43 ? 294 HIS A O   1 
ATOM   2304 C CB  . HIS A 1 294 ? 6.106   -20.047 -3.042  1.00 38.36 ? 294 HIS A CB  1 
ATOM   2305 C CG  . HIS A 1 294 ? 7.362   -20.690 -2.539  1.00 37.39 ? 294 HIS A CG  1 
ATOM   2306 N ND1 . HIS A 1 294 ? 7.416   -21.378 -1.350  1.00 36.77 ? 294 HIS A ND1 1 
ATOM   2307 C CD2 . HIS A 1 294 ? 8.601   -20.780 -3.080  1.00 38.39 ? 294 HIS A CD2 1 
ATOM   2308 C CE1 . HIS A 1 294 ? 8.629   -21.876 -1.183  1.00 38.46 ? 294 HIS A CE1 1 
ATOM   2309 N NE2 . HIS A 1 294 ? 9.371   -21.524 -2.217  1.00 38.37 ? 294 HIS A NE2 1 
ATOM   2310 N N   . LYS A 1 295 ? 4.815   -22.544 -1.598  1.00 38.51 ? 295 LYS A N   1 
ATOM   2311 C CA  . LYS A 1 295 ? 4.223   -23.051 -0.346  1.00 39.00 ? 295 LYS A CA  1 
ATOM   2312 C C   . LYS A 1 295 ? 4.275   -22.067 0.833   1.00 37.80 ? 295 LYS A C   1 
ATOM   2313 O O   . LYS A 1 295 ? 3.390   -22.093 1.695   1.00 38.29 ? 295 LYS A O   1 
ATOM   2314 C CB  . LYS A 1 295 ? 4.899   -24.359 0.080   1.00 40.23 ? 295 LYS A CB  1 
ATOM   2315 C CG  . LYS A 1 295 ? 4.123   -25.634 -0.285  1.00 43.58 ? 295 LYS A CG  1 
ATOM   2316 C CD  . LYS A 1 295 ? 5.006   -26.599 -1.101  1.00 47.15 ? 295 LYS A CD  1 
ATOM   2317 C CE  . LYS A 1 295 ? 5.819   -27.565 -0.207  1.00 48.68 ? 295 LYS A CE  1 
ATOM   2318 N NZ  . LYS A 1 295 ? 6.767   -28.427 -0.993  1.00 48.06 ? 295 LYS A NZ  1 
ATOM   2319 N N   . TRP A 1 296 ? 5.300   -21.220 0.905   1.00 36.20 ? 296 TRP A N   1 
ATOM   2320 C CA  . TRP A 1 296 ? 5.287   -20.160 1.917   1.00 35.05 ? 296 TRP A CA  1 
ATOM   2321 C C   . TRP A 1 296 ? 4.025   -19.303 1.765   1.00 34.63 ? 296 TRP A C   1 
ATOM   2322 O O   . TRP A 1 296 ? 3.470   -18.829 2.753   1.00 32.94 ? 296 TRP A O   1 
ATOM   2323 C CB  . TRP A 1 296 ? 6.550   -19.299 1.871   1.00 34.65 ? 296 TRP A CB  1 
ATOM   2324 C CG  . TRP A 1 296 ? 6.767   -18.504 3.088   1.00 31.53 ? 296 TRP A CG  1 
ATOM   2325 C CD1 . TRP A 1 296 ? 7.092   -18.985 4.336   1.00 34.67 ? 296 TRP A CD1 1 
ATOM   2326 C CD2 . TRP A 1 296 ? 6.690   -17.080 3.218   1.00 29.73 ? 296 TRP A CD2 1 
ATOM   2327 N NE1 . TRP A 1 296 ? 7.212   -17.945 5.232   1.00 32.56 ? 296 TRP A NE1 1 
ATOM   2328 C CE2 . TRP A 1 296 ? 6.977   -16.763 4.574   1.00 28.93 ? 296 TRP A CE2 1 
ATOM   2329 C CE3 . TRP A 1 296 ? 6.406   -16.026 2.327   1.00 27.52 ? 296 TRP A CE3 1 
ATOM   2330 C CZ2 . TRP A 1 296 ? 7.025   -15.465 5.041   1.00 25.57 ? 296 TRP A CZ2 1 
ATOM   2331 C CZ3 . TRP A 1 296 ? 6.411   -14.735 2.807   1.00 24.72 ? 296 TRP A CZ3 1 
ATOM   2332 C CH2 . TRP A 1 296 ? 6.724   -14.462 4.161   1.00 26.05 ? 296 TRP A CH2 1 
ATOM   2333 N N   . PHE A 1 297 ? 3.539   -19.175 0.534   1.00 34.39 ? 297 PHE A N   1 
ATOM   2334 C CA  . PHE A 1 297 ? 2.342   -18.371 0.270   1.00 34.45 ? 297 PHE A CA  1 
ATOM   2335 C C   . PHE A 1 297 ? 1.034   -19.175 0.160   1.00 35.35 ? 297 PHE A C   1 
ATOM   2336 O O   . PHE A 1 297 ? 0.023   -18.617 -0.233  1.00 35.55 ? 297 PHE A O   1 
ATOM   2337 C CB  . PHE A 1 297 ? 2.556   -17.542 -1.029  1.00 34.29 ? 297 PHE A CB  1 
ATOM   2338 C CG  . PHE A 1 297 ? 3.370   -16.262 -0.842  1.00 32.06 ? 297 PHE A CG  1 
ATOM   2339 C CD1 . PHE A 1 297 ? 2.949   -15.282 0.022   1.00 31.80 ? 297 PHE A CD1 1 
ATOM   2340 C CD2 . PHE A 1 297 ? 4.522   -16.034 -1.577  1.00 31.30 ? 297 PHE A CD2 1 
ATOM   2341 C CE1 . PHE A 1 297 ? 3.682   -14.089 0.176   1.00 30.67 ? 297 PHE A CE1 1 
ATOM   2342 C CE2 . PHE A 1 297 ? 5.266   -14.841 -1.434  1.00 30.43 ? 297 PHE A CE2 1 
ATOM   2343 C CZ  . PHE A 1 297 ? 4.846   -13.880 -0.568  1.00 29.72 ? 297 PHE A CZ  1 
ATOM   2344 N N   . ALA A 1 298 ? 1.037   -20.477 0.471   1.00 36.52 ? 298 ALA A N   1 
ATOM   2345 C CA  . ALA A 1 298 ? -0.177  -21.309 0.320   1.00 36.48 ? 298 ALA A CA  1 
ATOM   2346 C C   . ALA A 1 298 ? -1.400  -20.807 1.112   1.00 36.46 ? 298 ALA A C   1 
ATOM   2347 O O   . ALA A 1 298 ? -2.532  -20.987 0.669   1.00 36.94 ? 298 ALA A O   1 
ATOM   2348 C CB  . ALA A 1 298 ? 0.116   -22.777 0.678   1.00 36.85 ? 298 ALA A CB  1 
ATOM   2349 N N   . THR A 1 299 ? -1.197  -20.159 2.257   1.00 36.58 ? 299 THR A N   1 
ATOM   2350 C CA  . THR A 1 299 ? -2.341  -19.558 3.004   1.00 36.38 ? 299 THR A CA  1 
ATOM   2351 C C   . THR A 1 299 ? -2.750  -18.180 2.526   1.00 35.76 ? 299 THR A C   1 
ATOM   2352 O O   . THR A 1 299 ? -3.674  -17.582 3.086   1.00 35.69 ? 299 THR A O   1 
ATOM   2353 C CB  . THR A 1 299 ? -2.068  -19.463 4.512   1.00 36.39 ? 299 THR A CB  1 
ATOM   2354 O OG1 . THR A 1 299 ? -0.871  -18.707 4.761   1.00 37.70 ? 299 THR A OG1 1 
ATOM   2355 C CG2 . THR A 1 299 ? -1.799  -20.836 5.084   1.00 36.38 ? 299 THR A CG2 1 
ATOM   2356 N N   . THR A 1 300 ? -2.056  -17.648 1.517   1.00 35.47 ? 300 THR A N   1 
ATOM   2357 C CA  . THR A 1 300 ? -2.322  -16.285 1.090   1.00 34.19 ? 300 THR A CA  1 
ATOM   2358 C C   . THR A 1 300 ? -3.490  -16.252 0.124   1.00 34.11 ? 300 THR A C   1 
ATOM   2359 O O   . THR A 1 300 ? -3.523  -16.978 -0.843  1.00 35.50 ? 300 THR A O   1 
ATOM   2360 C CB  . THR A 1 300 ? -1.077  -15.651 0.494   1.00 34.17 ? 300 THR A CB  1 
ATOM   2361 O OG1 . THR A 1 300 ? -0.013  -15.700 1.461   1.00 32.79 ? 300 THR A OG1 1 
ATOM   2362 C CG2 . THR A 1 300 ? -1.300  -14.126 0.238   1.00 32.72 ? 300 THR A CG2 1 
ATOM   2363 N N   . ASP A 1 301 ? -4.446  -15.387 0.407   1.00 33.87 ? 301 ASP A N   1 
ATOM   2364 C CA  . ASP A 1 301 ? -5.571  -15.142 -0.451  1.00 33.45 ? 301 ASP A CA  1 
ATOM   2365 C C   . ASP A 1 301 ? -5.258  -13.850 -1.229  1.00 32.63 ? 301 ASP A C   1 
ATOM   2366 O O   . ASP A 1 301 ? -5.512  -12.751 -0.738  1.00 32.30 ? 301 ASP A O   1 
ATOM   2367 C CB  . ASP A 1 301 ? -6.834  -14.990 0.431   1.00 33.75 ? 301 ASP A CB  1 
ATOM   2368 C CG  . ASP A 1 301 ? -8.133  -15.135 -0.365  1.00 35.84 ? 301 ASP A CG  1 
ATOM   2369 O OD1 . ASP A 1 301 ? -8.078  -14.898 -1.597  1.00 37.20 ? 301 ASP A OD1 1 
ATOM   2370 O OD2 . ASP A 1 301 ? -9.231  -15.512 0.153   1.00 35.66 ? 301 ASP A OD2 1 
ATOM   2371 N N   . TRP A 1 302 ? -4.721  -14.002 -2.442  1.00 32.25 ? 302 TRP A N   1 
ATOM   2372 C CA  . TRP A 1 302 ? -4.229  -12.879 -3.255  1.00 32.23 ? 302 TRP A CA  1 
ATOM   2373 C C   . TRP A 1 302 ? -5.326  -11.885 -3.597  1.00 33.54 ? 302 TRP A C   1 
ATOM   2374 O O   . TRP A 1 302 ? -5.112  -10.656 -3.586  1.00 33.78 ? 302 TRP A O   1 
ATOM   2375 C CB  . TRP A 1 302 ? -3.531  -13.388 -4.529  1.00 31.86 ? 302 TRP A CB  1 
ATOM   2376 C CG  . TRP A 1 302 ? -2.331  -14.162 -4.195  1.00 29.54 ? 302 TRP A CG  1 
ATOM   2377 C CD1 . TRP A 1 302 ? -2.220  -15.521 -4.122  1.00 29.22 ? 302 TRP A CD1 1 
ATOM   2378 C CD2 . TRP A 1 302 ? -1.048  -13.637 -3.802  1.00 27.00 ? 302 TRP A CD2 1 
ATOM   2379 N NE1 . TRP A 1 302 ? -0.952  -15.874 -3.711  1.00 29.00 ? 302 TRP A NE1 1 
ATOM   2380 C CE2 . TRP A 1 302 ? -0.211  -14.735 -3.513  1.00 28.05 ? 302 TRP A CE2 1 
ATOM   2381 C CE3 . TRP A 1 302 ? -0.529  -12.349 -3.641  1.00 24.62 ? 302 TRP A CE3 1 
ATOM   2382 C CZ2 . TRP A 1 302 ? 1.127   -14.574 -3.105  1.00 26.83 ? 302 TRP A CZ2 1 
ATOM   2383 C CZ3 . TRP A 1 302 ? 0.789   -12.195 -3.242  1.00 22.87 ? 302 TRP A CZ3 1 
ATOM   2384 C CH2 . TRP A 1 302 ? 1.595   -13.294 -2.979  1.00 25.49 ? 302 TRP A CH2 1 
ATOM   2385 N N   . ILE A 1 303 ? -6.513  -12.400 -3.894  1.00 34.43 ? 303 ILE A N   1 
ATOM   2386 C CA  . ILE A 1 303 ? -7.630  -11.517 -4.203  1.00 35.03 ? 303 ILE A CA  1 
ATOM   2387 C C   . ILE A 1 303 ? -8.036  -10.770 -2.932  1.00 34.63 ? 303 ILE A C   1 
ATOM   2388 O O   . ILE A 1 303 ? -8.288  -9.560  -2.954  1.00 34.77 ? 303 ILE A O   1 
ATOM   2389 C CB  . ILE A 1 303 ? -8.847  -12.313 -4.807  1.00 35.76 ? 303 ILE A CB  1 
ATOM   2390 C CG1 . ILE A 1 303 ? -8.456  -13.004 -6.129  1.00 36.91 ? 303 ILE A CG1 1 
ATOM   2391 C CG2 . ILE A 1 303 ? -10.049 -11.375 -5.017  1.00 35.63 ? 303 ILE A CG2 1 
ATOM   2392 C CD1 . ILE A 1 303 ? -7.881  -12.056 -7.220  1.00 38.91 ? 303 ILE A CD1 1 
ATOM   2393 N N   . ALA A 1 304 ? -8.106  -11.486 -1.817  1.00 34.40 ? 304 ALA A N   1 
ATOM   2394 C CA  . ALA A 1 304 ? -8.441  -10.833 -0.532  1.00 34.00 ? 304 ALA A CA  1 
ATOM   2395 C C   . ALA A 1 304 ? -7.364  -9.840  -0.102  1.00 32.98 ? 304 ALA A C   1 
ATOM   2396 O O   . ALA A 1 304 ? -7.698  -8.852  0.518   1.00 32.89 ? 304 ALA A O   1 
ATOM   2397 C CB  . ALA A 1 304 ? -8.669  -11.861 0.580   1.00 34.00 ? 304 ALA A CB  1 
ATOM   2398 N N   . ILE A 1 305 ? -6.082  -10.078 -0.425  1.00 32.60 ? 305 ILE A N   1 
ATOM   2399 C CA  . ILE A 1 305 ? -5.052  -9.079  -0.088  1.00 31.64 ? 305 ILE A CA  1 
ATOM   2400 C C   . ILE A 1 305 ? -5.286  -7.822  -0.918  1.00 32.00 ? 305 ILE A C   1 
ATOM   2401 O O   . ILE A 1 305 ? -5.341  -6.758  -0.356  1.00 31.23 ? 305 ILE A O   1 
ATOM   2402 C CB  . ILE A 1 305 ? -3.605  -9.604  -0.235  1.00 31.62 ? 305 ILE A CB  1 
ATOM   2403 C CG1 . ILE A 1 305 ? -3.343  -10.760 0.742   1.00 29.36 ? 305 ILE A CG1 1 
ATOM   2404 C CG2 . ILE A 1 305 ? -2.568  -8.436  -0.050  1.00 30.34 ? 305 ILE A CG2 1 
ATOM   2405 C CD1 . ILE A 1 305 ? -3.012  -10.332 2.154   1.00 28.38 ? 305 ILE A CD1 1 
ATOM   2406 N N   . TYR A 1 306 ? -5.487  -7.971  -2.225  1.00 32.98 ? 306 TYR A N   1 
ATOM   2407 C CA  . TYR A 1 306 ? -5.764  -6.862  -3.133  1.00 34.46 ? 306 TYR A CA  1 
ATOM   2408 C C   . TYR A 1 306 ? -6.926  -5.970  -2.674  1.00 35.96 ? 306 TYR A C   1 
ATOM   2409 O O   . TYR A 1 306 ? -6.854  -4.730  -2.707  1.00 35.18 ? 306 TYR A O   1 
ATOM   2410 C CB  . TYR A 1 306 ? -6.025  -7.390  -4.575  1.00 34.76 ? 306 TYR A CB  1 
ATOM   2411 C CG  . TYR A 1 306 ? -6.473  -6.292  -5.504  1.00 36.19 ? 306 TYR A CG  1 
ATOM   2412 C CD1 . TYR A 1 306 ? -5.584  -5.316  -5.926  1.00 36.89 ? 306 TYR A CD1 1 
ATOM   2413 C CD2 . TYR A 1 306 ? -7.810  -6.190  -5.920  1.00 37.98 ? 306 TYR A CD2 1 
ATOM   2414 C CE1 . TYR A 1 306 ? -5.992  -4.282  -6.752  1.00 38.28 ? 306 TYR A CE1 1 
ATOM   2415 C CE2 . TYR A 1 306 ? -8.234  -5.148  -6.755  1.00 38.31 ? 306 TYR A CE2 1 
ATOM   2416 C CZ  . TYR A 1 306 ? -7.322  -4.187  -7.147  1.00 38.81 ? 306 TYR A CZ  1 
ATOM   2417 O OH  . TYR A 1 306 ? -7.713  -3.156  -7.954  1.00 38.38 ? 306 TYR A OH  1 
ATOM   2418 N N   . GLN A 1 307 ? -7.996  -6.617  -2.216  1.00 38.07 ? 307 GLN A N   1 
ATOM   2419 C CA  . GLN A 1 307 ? -9.254  -5.943  -1.876  1.00 39.17 ? 307 GLN A CA  1 
ATOM   2420 C C   . GLN A 1 307 ? -9.216  -5.337  -0.458  1.00 40.01 ? 307 GLN A C   1 
ATOM   2421 O O   . GLN A 1 307 ? -10.165 -4.675  -0.036  1.00 40.06 ? 307 GLN A O   1 
ATOM   2422 C CB  . GLN A 1 307 ? -10.410 -6.943  -2.012  1.00 39.92 ? 307 GLN A CB  1 
ATOM   2423 C CG  . GLN A 1 307 ? -10.712 -7.383  -3.452  1.00 42.61 ? 307 GLN A CG  1 
ATOM   2424 C CD  . GLN A 1 307 ? -11.916 -8.391  -3.573  1.00 46.59 ? 307 GLN A CD  1 
ATOM   2425 O OE1 . GLN A 1 307 ? -12.815 -8.214  -4.423  1.00 46.11 ? 307 GLN A OE1 1 
ATOM   2426 N NE2 . GLN A 1 307 ? -11.918 -9.424  -2.729  1.00 46.79 ? 307 GLN A NE2 1 
ATOM   2427 N N   . ARG A 1 308 ? -8.107  -5.555  0.251   1.00 40.10 ? 308 ARG A N   1 
ATOM   2428 C CA  . ARG A 1 308 ? -7.906  -5.090  1.614   1.00 40.96 ? 308 ARG A CA  1 
ATOM   2429 C C   . ARG A 1 308 ? -8.890  -5.759  2.623   1.00 40.93 ? 308 ARG A C   1 
ATOM   2430 O O   . ARG A 1 308 ? -9.274  -5.177  3.627   1.00 40.81 ? 308 ARG A O   1 
ATOM   2431 C CB  . ARG A 1 308 ? -7.907  -3.545  1.656   1.00 41.64 ? 308 ARG A CB  1 
ATOM   2432 C CG  . ARG A 1 308 ? -7.014  -2.884  0.553   1.00 42.95 ? 308 ARG A CG  1 
ATOM   2433 C CD  . ARG A 1 308 ? -7.123  -1.343  0.413   1.00 45.43 ? 308 ARG A CD  1 
ATOM   2434 N NE  . ARG A 1 308 ? -6.159  -0.576  1.229   1.00 46.15 ? 308 ARG A NE  1 
ATOM   2435 C CZ  . ARG A 1 308 ? -6.455  -0.038  2.427   1.00 49.54 ? 308 ARG A CZ  1 
ATOM   2436 N NH1 . ARG A 1 308 ? -7.662  -0.181  2.976   1.00 52.69 ? 308 ARG A NH1 1 
ATOM   2437 N NH2 . ARG A 1 308 ? -5.557  0.653   3.096   1.00 47.85 ? 308 ARG A NH2 1 
ATOM   2438 N N   . LYS A 1 309 ? -9.243  -7.016  2.364   1.00 41.20 ? 309 LYS A N   1 
ATOM   2439 C CA  . LYS A 1 309 ? -10.197 -7.747  3.211   1.00 42.06 ? 309 LYS A CA  1 
ATOM   2440 C C   . LYS A 1 309 ? -9.529  -8.575  4.305   1.00 41.93 ? 309 LYS A C   1 
ATOM   2441 O O   . LYS A 1 309 ? -10.171 -8.923  5.284   1.00 42.06 ? 309 LYS A O   1 
ATOM   2442 C CB  . LYS A 1 309 ? -11.119 -8.648  2.369   1.00 42.38 ? 309 LYS A CB  1 
ATOM   2443 C CG  . LYS A 1 309 ? -12.215 -7.898  1.596   1.00 43.28 ? 309 LYS A CG  1 
ATOM   2444 C CD  . LYS A 1 309 ? -12.990 -8.812  0.602   1.00 44.04 ? 309 LYS A CD  1 
ATOM   2445 C CE  . LYS A 1 309 ? -14.275 -8.101  0.081   1.00 45.39 ? 309 LYS A CE  1 
ATOM   2446 N NZ  . LYS A 1 309 ? -14.907 -8.692  -1.172  1.00 46.16 ? 309 LYS A NZ  1 
ATOM   2447 N N   . VAL A 1 310 ? -8.243  -8.881  4.151   1.00 42.10 ? 310 VAL A N   1 
ATOM   2448 C CA  . VAL A 1 310 ? -7.520  -9.632  5.172   1.00 42.15 ? 310 VAL A CA  1 
ATOM   2449 C C   . VAL A 1 310 ? -7.278  -8.739  6.381   1.00 42.55 ? 310 VAL A C   1 
ATOM   2450 O O   . VAL A 1 310 ? -7.100  -7.535  6.256   1.00 43.41 ? 310 VAL A O   1 
ATOM   2451 C CB  . VAL A 1 310 ? -6.217  -10.299 4.598   1.00 42.33 ? 310 VAL A CB  1 
ATOM   2452 C CG1 . VAL A 1 310 ? -5.377  -11.027 5.683   1.00 39.95 ? 310 VAL A CG1 1 
ATOM   2453 C CG2 . VAL A 1 310 ? -6.581  -11.281 3.486   1.00 42.62 ? 310 VAL A CG2 1 
ATOM   2454 N N   . GLU A 1 311 ? -7.334  -9.324  7.561   1.00 43.34 ? 311 GLU A N   1 
ATOM   2455 C CA  . GLU A 1 311 ? -7.172  -8.566  8.795   1.00 44.43 ? 311 GLU A CA  1 
ATOM   2456 C C   . GLU A 1 311 ? -5.669  -8.335  8.996   1.00 43.57 ? 311 GLU A C   1 
ATOM   2457 O O   . GLU A 1 311 ? -4.884  -9.275  8.987   1.00 43.04 ? 311 GLU A O   1 
ATOM   2458 C CB  . GLU A 1 311 ? -7.798  -9.318  9.989   1.00 45.28 ? 311 GLU A CB  1 
ATOM   2459 C CG  . GLU A 1 311 ? -8.318  -8.429  11.129  1.00 49.00 ? 311 GLU A CG  1 
ATOM   2460 C CD  . GLU A 1 311 ? -8.061  -9.011  12.535  1.00 54.43 ? 311 GLU A CD  1 
ATOM   2461 O OE1 . GLU A 1 311 ? -8.111  -8.231  13.534  1.00 57.07 ? 311 GLU A OE1 1 
ATOM   2462 O OE2 . GLU A 1 311 ? -7.805  -10.247 12.663  1.00 56.30 ? 311 GLU A OE2 1 
ATOM   2463 N N   . ALA A 1 312 ? -5.275  -7.074  9.143   1.00 43.33 ? 312 ALA A N   1 
ATOM   2464 C CA  . ALA A 1 312 ? -3.870  -6.739  9.292   1.00 43.02 ? 312 ALA A CA  1 
ATOM   2465 C C   . ALA A 1 312 ? -3.391  -7.238  10.649  1.00 42.82 ? 312 ALA A C   1 
ATOM   2466 O O   . ALA A 1 312 ? -4.114  -7.117  11.639  1.00 41.73 ? 312 ALA A O   1 
ATOM   2467 C CB  . ALA A 1 312 ? -3.656  -5.232  9.178   1.00 43.00 ? 312 ALA A CB  1 
ATOM   2468 N N   . PRO A 1 313 ? -2.171  -7.775  10.696  1.00 42.90 ? 313 PRO A N   1 
ATOM   2469 C CA  . PRO A 1 313 ? -1.628  -8.287  11.953  1.00 42.79 ? 313 PRO A CA  1 
ATOM   2470 C C   . PRO A 1 313 ? -1.235  -7.158  12.925  1.00 41.98 ? 313 PRO A C   1 
ATOM   2471 O O   . PRO A 1 313 ? -1.082  -7.403  14.105  1.00 41.75 ? 313 PRO A O   1 
ATOM   2472 C CB  . PRO A 1 313 ? -0.422  -9.117  11.492  1.00 43.05 ? 313 PRO A CB  1 
ATOM   2473 C CG  . PRO A 1 313 ? 0.017   -8.488  10.173  1.00 43.43 ? 313 PRO A CG  1 
ATOM   2474 C CD  . PRO A 1 313 ? -1.213  -7.917  9.574   1.00 42.84 ? 313 PRO A CD  1 
ATOM   2475 N N   . PHE A 1 314 ? -1.122  -5.938  12.424  1.00 41.89 ? 314 PHE A N   1 
ATOM   2476 C CA  . PHE A 1 314 ? -0.688  -4.797  13.213  1.00 41.94 ? 314 PHE A CA  1 
ATOM   2477 C C   . PHE A 1 314 ? -1.381  -3.562  12.677  1.00 42.81 ? 314 PHE A C   1 
ATOM   2478 O O   . PHE A 1 314 ? -1.284  -3.287  11.484  1.00 42.82 ? 314 PHE A O   1 
ATOM   2479 C CB  . PHE A 1 314 ? 0.848   -4.640  13.094  1.00 42.09 ? 314 PHE A CB  1 
ATOM   2480 C CG  . PHE A 1 314 ? 1.357   -3.309  13.538  1.00 40.78 ? 314 PHE A CG  1 
ATOM   2481 C CD1 . PHE A 1 314 ? 1.262   -2.929  14.859  1.00 42.81 ? 314 PHE A CD1 1 
ATOM   2482 C CD2 . PHE A 1 314 ? 1.913   -2.428  12.633  1.00 40.33 ? 314 PHE A CD2 1 
ATOM   2483 C CE1 . PHE A 1 314 ? 1.737   -1.666  15.276  1.00 42.96 ? 314 PHE A CE1 1 
ATOM   2484 C CE2 . PHE A 1 314 ? 2.353   -1.179  13.026  1.00 41.14 ? 314 PHE A CE2 1 
ATOM   2485 C CZ  . PHE A 1 314 ? 2.262   -0.796  14.360  1.00 42.31 ? 314 PHE A CZ  1 
ATOM   2486 N N   . ILE A 1 315 ? -2.070  -2.826  13.545  1.00 43.90 ? 315 ILE A N   1 
ATOM   2487 C CA  . ILE A 1 315 ? -2.754  -1.583  13.181  1.00 45.36 ? 315 ILE A CA  1 
ATOM   2488 C C   . ILE A 1 315 ? -2.168  -0.422  14.010  1.00 46.66 ? 315 ILE A C   1 
ATOM   2489 O O   . ILE A 1 315 ? -2.265  -0.426  15.228  1.00 46.25 ? 315 ILE A O   1 
ATOM   2490 C CB  . ILE A 1 315 ? -4.305  -1.728  13.398  1.00 45.77 ? 315 ILE A CB  1 
ATOM   2491 C CG1 . ILE A 1 315 ? -4.955  -2.433  12.190  1.00 47.06 ? 315 ILE A CG1 1 
ATOM   2492 C CG2 . ILE A 1 315 ? -4.976  -0.360  13.643  1.00 46.15 ? 315 ILE A CG2 1 
ATOM   2493 C CD1 . ILE A 1 315 ? -6.489  -2.710  12.300  1.00 48.63 ? 315 ILE A CD1 1 
ATOM   2494 N N   . PRO A 1 316 ? -1.559  0.575   13.370  1.00 48.85 ? 316 PRO A N   1 
ATOM   2495 C CA  . PRO A 1 316 ? -0.868  1.630   14.128  1.00 50.02 ? 316 PRO A CA  1 
ATOM   2496 C C   . PRO A 1 316 ? -1.817  2.517   14.940  1.00 51.28 ? 316 PRO A C   1 
ATOM   2497 O O   . PRO A 1 316 ? -3.000  2.684   14.622  1.00 50.96 ? 316 PRO A O   1 
ATOM   2498 C CB  . PRO A 1 316 ? -0.134  2.444   13.046  1.00 50.16 ? 316 PRO A CB  1 
ATOM   2499 C CG  . PRO A 1 316 ? -0.900  2.197   11.797  1.00 50.03 ? 316 PRO A CG  1 
ATOM   2500 C CD  . PRO A 1 316 ? -1.487  0.806   11.914  1.00 48.69 ? 316 PRO A CD  1 
ATOM   2501 N N   . LYS A 1 317 ? -1.270  3.056   16.023  1.00 52.95 ? 317 LYS A N   1 
ATOM   2502 C CA  . LYS A 1 317 ? -1.998  3.953   16.894  1.00 54.20 ? 317 LYS A CA  1 
ATOM   2503 C C   . LYS A 1 317 ? -2.245  5.219   16.106  1.00 54.63 ? 317 LYS A C   1 
ATOM   2504 O O   . LYS A 1 317 ? -1.376  5.691   15.377  1.00 53.74 ? 317 LYS A O   1 
ATOM   2505 C CB  . LYS A 1 317 ? -1.190  4.243   18.170  1.00 54.73 ? 317 LYS A CB  1 
ATOM   2506 C CG  . LYS A 1 317 ? -0.943  3.009   19.057  1.00 56.54 ? 317 LYS A CG  1 
ATOM   2507 C CD  . LYS A 1 317 ? 0.571   2.759   19.320  1.00 58.27 ? 317 LYS A CD  1 
ATOM   2508 C CE  . LYS A 1 317 ? 0.817   1.864   20.571  1.00 59.36 ? 317 LYS A CE  1 
ATOM   2509 N NZ  . LYS A 1 317 ? 1.411   0.497   20.237  1.00 58.75 ? 317 LYS A NZ  1 
ATOM   2510 N N   . PHE A 1 318 ? -3.457  5.733   16.237  1.00 55.94 ? 318 PHE A N   1 
ATOM   2511 C CA  . PHE A 1 318 ? -3.905  6.917   15.517  1.00 57.08 ? 318 PHE A CA  1 
ATOM   2512 C C   . PHE A 1 318 ? -4.409  7.874   16.580  1.00 56.97 ? 318 PHE A C   1 
ATOM   2513 O O   . PHE A 1 318 ? -5.459  7.622   17.168  1.00 57.32 ? 318 PHE A O   1 
ATOM   2514 C CB  . PHE A 1 318 ? -5.033  6.524   14.539  1.00 57.75 ? 318 PHE A CB  1 
ATOM   2515 C CG  . PHE A 1 318 ? -5.724  7.699   13.874  1.00 60.81 ? 318 PHE A CG  1 
ATOM   2516 C CD1 . PHE A 1 318 ? -6.951  8.175   14.369  1.00 62.77 ? 318 PHE A CD1 1 
ATOM   2517 C CD2 . PHE A 1 318 ? -5.156  8.321   12.745  1.00 63.37 ? 318 PHE A CD2 1 
ATOM   2518 C CE1 . PHE A 1 318 ? -7.604  9.271   13.765  1.00 63.94 ? 318 PHE A CE1 1 
ATOM   2519 C CE2 . PHE A 1 318 ? -5.803  9.417   12.122  1.00 64.40 ? 318 PHE A CE2 1 
ATOM   2520 C CZ  . PHE A 1 318 ? -7.030  9.891   12.638  1.00 64.64 ? 318 PHE A CZ  1 
ATOM   2521 N N   . LYS A 1 319 ? -3.661  8.938   16.861  1.00 56.80 ? 319 LYS A N   1 
ATOM   2522 C CA  . LYS A 1 319 ? -4.057  9.875   17.931  1.00 57.03 ? 319 LYS A CA  1 
ATOM   2523 C C   . LYS A 1 319 ? -4.960  11.015  17.414  1.00 56.19 ? 319 LYS A C   1 
ATOM   2524 O O   . LYS A 1 319 ? -5.606  11.709  18.212  1.00 56.78 ? 319 LYS A O   1 
ATOM   2525 C CB  . LYS A 1 319 ? -2.823  10.424  18.689  1.00 57.45 ? 319 LYS A CB  1 
ATOM   2526 C CG  . LYS A 1 319 ? -2.867  10.203  20.231  1.00 58.85 ? 319 LYS A CG  1 
ATOM   2527 C CD  . LYS A 1 319 ? -2.072  8.922   20.691  1.00 61.50 ? 319 LYS A CD  1 
ATOM   2528 C CE  . LYS A 1 319 ? -2.664  8.227   21.972  1.00 61.72 ? 319 LYS A CE  1 
ATOM   2529 N NZ  . LYS A 1 319 ? -2.616  6.714   21.961  1.00 60.71 ? 319 LYS A NZ  1 
ATOM   2530 N N   . GLY A 1 320 ? -5.015  11.174  16.088  1.00 54.75 ? 320 GLY A N   1 
ATOM   2531 C CA  . GLY A 1 320 ? -5.825  12.191  15.436  1.00 53.64 ? 320 GLY A CA  1 
ATOM   2532 C C   . GLY A 1 320 ? -5.408  12.420  13.987  1.00 52.63 ? 320 GLY A C   1 
ATOM   2533 O O   . GLY A 1 320 ? -4.406  11.858  13.538  1.00 52.41 ? 320 GLY A O   1 
ATOM   2534 N N   . PRO A 1 321 ? -6.183  13.205  13.230  1.00 51.39 ? 321 PRO A N   1 
ATOM   2535 C CA  . PRO A 1 321 ? -5.717  13.678  11.924  1.00 50.00 ? 321 PRO A CA  1 
ATOM   2536 C C   . PRO A 1 321 ? -4.575  14.648  12.151  1.00 48.46 ? 321 PRO A C   1 
ATOM   2537 O O   . PRO A 1 321 ? -4.604  15.475  13.098  1.00 48.15 ? 321 PRO A O   1 
ATOM   2538 C CB  . PRO A 1 321 ? -6.942  14.384  11.332  1.00 49.98 ? 321 PRO A CB  1 
ATOM   2539 C CG  . PRO A 1 321 ? -7.731  14.794  12.523  1.00 51.37 ? 321 PRO A CG  1 
ATOM   2540 C CD  . PRO A 1 321 ? -7.557  13.670  13.518  1.00 51.43 ? 321 PRO A CD  1 
ATOM   2541 N N   . GLY A 1 322 ? -3.555  14.516  11.314  1.00 46.23 ? 322 GLY A N   1 
ATOM   2542 C CA  . GLY A 1 322 ? -2.349  15.305  11.467  1.00 44.90 ? 322 GLY A CA  1 
ATOM   2543 C C   . GLY A 1 322 ? -1.382  14.863  12.562  1.00 43.37 ? 322 GLY A C   1 
ATOM   2544 O O   . GLY A 1 322 ? -0.396  15.553  12.849  1.00 43.22 ? 322 GLY A O   1 
ATOM   2545 N N   . ASP A 1 323 ? -1.638  13.741  13.209  1.00 41.80 ? 323 ASP A N   1 
ATOM   2546 C CA  . ASP A 1 323 ? -0.693  13.308  14.221  1.00 41.12 ? 323 ASP A CA  1 
ATOM   2547 C C   . ASP A 1 323 ? 0.546   12.699  13.530  1.00 39.52 ? 323 ASP A C   1 
ATOM   2548 O O   . ASP A 1 323 ? 0.396   11.958  12.556  1.00 39.03 ? 323 ASP A O   1 
ATOM   2549 C CB  . ASP A 1 323 ? -1.319  12.325  15.184  1.00 41.29 ? 323 ASP A CB  1 
ATOM   2550 C CG  . ASP A 1 323 ? -0.340  11.882  16.240  1.00 42.63 ? 323 ASP A CG  1 
ATOM   2551 O OD1 . ASP A 1 323 ? -0.001  12.711  17.131  1.00 43.79 ? 323 ASP A OD1 1 
ATOM   2552 O OD2 . ASP A 1 323 ? 0.163   10.742  16.194  1.00 40.95 ? 323 ASP A OD2 1 
ATOM   2553 N N   . THR A 1 324 ? 1.742   13.040  14.022  1.00 38.06 ? 324 THR A N   1 
ATOM   2554 C CA  . THR A 1 324 ? 3.013   12.626  13.405  1.00 37.87 ? 324 THR A CA  1 
ATOM   2555 C C   . THR A 1 324 ? 3.895   11.766  14.311  1.00 37.18 ? 324 THR A C   1 
ATOM   2556 O O   . THR A 1 324 ? 5.076   11.556  14.012  1.00 36.91 ? 324 THR A O   1 
ATOM   2557 C CB  . THR A 1 324 ? 3.837   13.851  12.991  1.00 37.32 ? 324 THR A CB  1 
ATOM   2558 O OG1 . THR A 1 324 ? 4.107   14.648  14.143  1.00 38.00 ? 324 THR A OG1 1 
ATOM   2559 C CG2 . THR A 1 324 ? 3.064   14.753  12.068  1.00 37.92 ? 324 THR A CG2 1 
ATOM   2560 N N   . SER A 1 325 ? 3.328   11.286  15.413  1.00 36.34 ? 325 SER A N   1 
ATOM   2561 C CA  . SER A 1 325 ? 4.100   10.631  16.477  1.00 35.46 ? 325 SER A CA  1 
ATOM   2562 C C   . SER A 1 325 ? 4.609   9.266   16.045  1.00 34.71 ? 325 SER A C   1 
ATOM   2563 O O   . SER A 1 325 ? 5.484   8.714   16.695  1.00 34.72 ? 325 SER A O   1 
ATOM   2564 C CB  . SER A 1 325 ? 3.270   10.525  17.783  1.00 35.65 ? 325 SER A CB  1 
ATOM   2565 O OG  . SER A 1 325 ? 2.242   9.534   17.701  1.00 35.12 ? 325 SER A OG  1 
ATOM   2566 N N   . ASN A 1 326 ? 4.072   8.734   14.941  1.00 33.77 ? 326 ASN A N   1 
ATOM   2567 C CA  . ASN A 1 326 ? 4.604   7.541   14.307  1.00 33.35 ? 326 ASN A CA  1 
ATOM   2568 C C   . ASN A 1 326 ? 5.816   7.790   13.412  1.00 32.51 ? 326 ASN A C   1 
ATOM   2569 O O   . ASN A 1 326 ? 6.342   6.832   12.823  1.00 32.11 ? 326 ASN A O   1 
ATOM   2570 C CB  . ASN A 1 326 ? 3.538   6.822   13.483  1.00 33.60 ? 326 ASN A CB  1 
ATOM   2571 C CG  . ASN A 1 326 ? 2.455   6.224   14.327  1.00 36.62 ? 326 ASN A CG  1 
ATOM   2572 O OD1 . ASN A 1 326 ? 2.684   5.856   15.489  1.00 39.24 ? 326 ASN A OD1 1 
ATOM   2573 N ND2 . ASN A 1 326 ? 1.246   6.115   13.757  1.00 35.69 ? 326 ASN A ND2 1 
ATOM   2574 N N   . PHE A 1 327 ? 6.246   9.040   13.286  1.00 31.37 ? 327 PHE A N   1 
ATOM   2575 C CA  . PHE A 1 327 ? 7.467   9.363   12.560  1.00 31.51 ? 327 PHE A CA  1 
ATOM   2576 C C   . PHE A 1 327 ? 8.468   9.947   13.519  1.00 32.53 ? 327 PHE A C   1 
ATOM   2577 O O   . PHE A 1 327 ? 8.107   10.470  14.559  1.00 32.60 ? 327 PHE A O   1 
ATOM   2578 C CB  . PHE A 1 327 ? 7.198   10.335  11.418  1.00 30.96 ? 327 PHE A CB  1 
ATOM   2579 C CG  . PHE A 1 327 ? 6.278   9.784   10.362  1.00 31.04 ? 327 PHE A CG  1 
ATOM   2580 C CD1 . PHE A 1 327 ? 6.789   9.142   9.247   1.00 30.65 ? 327 PHE A CD1 1 
ATOM   2581 C CD2 . PHE A 1 327 ? 4.890   9.899   10.491  1.00 30.57 ? 327 PHE A CD2 1 
ATOM   2582 C CE1 . PHE A 1 327 ? 5.939   8.632   8.287   1.00 31.03 ? 327 PHE A CE1 1 
ATOM   2583 C CE2 . PHE A 1 327 ? 4.037   9.409   9.522   1.00 27.78 ? 327 PHE A CE2 1 
ATOM   2584 C CZ  . PHE A 1 327 ? 4.556   8.771   8.427   1.00 30.39 ? 327 PHE A CZ  1 
ATOM   2585 N N   . ASP A 1 328 ? 9.746   9.825   13.184  1.00 34.07 ? 328 ASP A N   1 
ATOM   2586 C CA  . ASP A 1 328 ? 10.799  10.463  13.960  1.00 34.48 ? 328 ASP A CA  1 
ATOM   2587 C C   . ASP A 1 328 ? 10.741  11.992  13.762  1.00 35.70 ? 328 ASP A C   1 
ATOM   2588 O O   . ASP A 1 328 ? 10.008  12.521  12.899  1.00 34.26 ? 328 ASP A O   1 
ATOM   2589 C CB  . ASP A 1 328 ? 12.184  9.910   13.589  1.00 34.44 ? 328 ASP A CB  1 
ATOM   2590 C CG  . ASP A 1 328 ? 12.358  8.412   13.932  1.00 34.88 ? 328 ASP A CG  1 
ATOM   2591 O OD1 . ASP A 1 328 ? 11.613  7.786   14.723  1.00 35.53 ? 328 ASP A OD1 1 
ATOM   2592 O OD2 . ASP A 1 328 ? 13.237  7.749   13.415  1.00 36.27 ? 328 ASP A OD2 1 
ATOM   2593 N N   . ASP A 1 329 ? 11.501  12.680  14.604  1.00 36.44 ? 329 ASP A N   1 
ATOM   2594 C CA  . ASP A 1 329 ? 11.630  14.116  14.553  1.00 37.64 ? 329 ASP A CA  1 
ATOM   2595 C C   . ASP A 1 329 ? 12.831  14.433  13.689  1.00 38.02 ? 329 ASP A C   1 
ATOM   2596 O O   . ASP A 1 329 ? 13.825  13.714  13.721  1.00 39.10 ? 329 ASP A O   1 
ATOM   2597 C CB  . ASP A 1 329 ? 11.799  14.710  15.969  1.00 37.92 ? 329 ASP A CB  1 
ATOM   2598 C CG  . ASP A 1 329 ? 10.619  14.365  16.907  1.00 38.99 ? 329 ASP A CG  1 
ATOM   2599 O OD1 . ASP A 1 329 ? 9.444   14.363  16.454  1.00 40.22 ? 329 ASP A OD1 1 
ATOM   2600 O OD2 . ASP A 1 329 ? 10.779  14.070  18.117  1.00 43.48 ? 329 ASP A OD2 1 
ATOM   2601 N N   . TYR A 1 330 ? 12.704  15.496  12.898  1.00 37.94 ? 330 TYR A N   1 
ATOM   2602 C CA  . TYR A 1 330 ? 13.720  15.914  11.957  1.00 38.05 ? 330 TYR A CA  1 
ATOM   2603 C C   . TYR A 1 330 ? 14.012  17.394  12.153  1.00 39.51 ? 330 TYR A C   1 
ATOM   2604 O O   . TYR A 1 330 ? 13.135  18.145  12.566  1.00 39.49 ? 330 TYR A O   1 
ATOM   2605 C CB  . TYR A 1 330 ? 13.247  15.609  10.522  1.00 37.09 ? 330 TYR A CB  1 
ATOM   2606 C CG  . TYR A 1 330 ? 13.205  14.121  10.218  1.00 33.65 ? 330 TYR A CG  1 
ATOM   2607 C CD1 . TYR A 1 330 ? 12.074  13.374  10.475  1.00 31.77 ? 330 TYR A CD1 1 
ATOM   2608 C CD2 . TYR A 1 330 ? 14.318  13.467  9.699   1.00 32.14 ? 330 TYR A CD2 1 
ATOM   2609 C CE1 . TYR A 1 330 ? 12.047  12.027  10.224  1.00 33.28 ? 330 TYR A CE1 1 
ATOM   2610 C CE2 . TYR A 1 330 ? 14.311  12.111  9.437   1.00 30.81 ? 330 TYR A CE2 1 
ATOM   2611 C CZ  . TYR A 1 330 ? 13.180  11.398  9.698   1.00 32.64 ? 330 TYR A CZ  1 
ATOM   2612 O OH  . TYR A 1 330 ? 13.164  10.060  9.448   1.00 32.78 ? 330 TYR A OH  1 
ATOM   2613 N N   . GLU A 1 331 ? 15.265  17.782  11.915  1.00 41.96 ? 331 GLU A N   1 
ATOM   2614 C CA  . GLU A 1 331 ? 15.653  19.188  11.803  1.00 44.02 ? 331 GLU A CA  1 
ATOM   2615 C C   . GLU A 1 331 ? 14.752  19.832  10.730  1.00 44.56 ? 331 GLU A C   1 
ATOM   2616 O O   . GLU A 1 331 ? 14.594  19.255  9.640   1.00 44.25 ? 331 GLU A O   1 
ATOM   2617 C CB  . GLU A 1 331 ? 17.137  19.327  11.376  1.00 44.62 ? 331 GLU A CB  1 
ATOM   2618 C CG  . GLU A 1 331 ? 18.170  19.473  12.512  1.00 48.44 ? 331 GLU A CG  1 
ATOM   2619 C CD  . GLU A 1 331 ? 18.598  20.927  12.805  1.00 53.40 ? 331 GLU A CD  1 
ATOM   2620 O OE1 . GLU A 1 331 ? 18.997  21.660  11.845  1.00 53.92 ? 331 GLU A OE1 1 
ATOM   2621 O OE2 . GLU A 1 331 ? 18.542  21.334  14.011  1.00 56.24 ? 331 GLU A OE2 1 
ATOM   2622 N N   . GLU A 1 332 ? 14.172  20.996  11.055  1.00 45.30 ? 332 GLU A N   1 
ATOM   2623 C CA  . GLU A 1 332 ? 13.351  21.793  10.125  1.00 45.70 ? 332 GLU A CA  1 
ATOM   2624 C C   . GLU A 1 332 ? 14.190  22.830  9.364   1.00 46.89 ? 332 GLU A C   1 
ATOM   2625 O O   . GLU A 1 332 ? 14.929  23.618  9.968   1.00 46.79 ? 332 GLU A O   1 
ATOM   2626 C CB  . GLU A 1 332 ? 12.218  22.507  10.864  1.00 45.05 ? 332 GLU A CB  1 
ATOM   2627 C CG  . GLU A 1 332 ? 11.299  21.591  11.671  1.00 44.43 ? 332 GLU A CG  1 
ATOM   2628 C CD  . GLU A 1 332 ? 10.420  20.656  10.824  1.00 41.85 ? 332 GLU A CD  1 
ATOM   2629 O OE1 . GLU A 1 332 ? 10.401  20.795  9.579   1.00 36.28 ? 332 GLU A OE1 1 
ATOM   2630 O OE2 . GLU A 1 332 ? 9.736   19.775  11.427  1.00 40.83 ? 332 GLU A OE2 1 
ATOM   2631 N N   . GLU A 1 333 ? 14.070  22.786  8.037   1.00 48.20 ? 333 GLU A N   1 
ATOM   2632 C CA  . GLU A 1 333 ? 14.756  23.685  7.104   1.00 49.73 ? 333 GLU A CA  1 
ATOM   2633 C C   . GLU A 1 333 ? 13.699  24.638  6.513   1.00 49.59 ? 333 GLU A C   1 
ATOM   2634 O O   . GLU A 1 333 ? 12.563  24.229  6.269   1.00 49.13 ? 333 GLU A O   1 
ATOM   2635 C CB  . GLU A 1 333 ? 15.382  22.859  5.959   1.00 50.50 ? 333 GLU A CB  1 
ATOM   2636 C CG  . GLU A 1 333 ? 16.904  22.702  5.942   1.00 53.71 ? 333 GLU A CG  1 
ATOM   2637 C CD  . GLU A 1 333 ? 17.375  21.816  4.771   1.00 56.45 ? 333 GLU A CD  1 
ATOM   2638 O OE1 . GLU A 1 333 ? 17.154  22.192  3.590   1.00 55.68 ? 333 GLU A OE1 1 
ATOM   2639 O OE2 . GLU A 1 333 ? 17.949  20.731  5.029   1.00 56.89 ? 333 GLU A OE2 1 
ATOM   2640 N N   . GLU A 1 334 ? 14.055  25.901  6.304   1.00 49.70 ? 334 GLU A N   1 
ATOM   2641 C CA  . GLU A 1 334 ? 13.163  26.836  5.616   1.00 50.34 ? 334 GLU A CA  1 
ATOM   2642 C C   . GLU A 1 334 ? 12.904  26.397  4.166   1.00 50.09 ? 334 GLU A C   1 
ATOM   2643 O O   . GLU A 1 334 ? 13.723  25.687  3.561   1.00 50.12 ? 334 GLU A O   1 
ATOM   2644 C CB  . GLU A 1 334 ? 13.760  28.237  5.617   1.00 50.80 ? 334 GLU A CB  1 
ATOM   2645 C CG  . GLU A 1 334 ? 15.180  28.302  5.049   1.00 52.30 ? 334 GLU A CG  1 
ATOM   2646 C CD  . GLU A 1 334 ? 15.534  29.655  4.445   1.00 54.61 ? 334 GLU A CD  1 
ATOM   2647 O OE1 . GLU A 1 334 ? 16.705  29.841  4.045   1.00 55.81 ? 334 GLU A OE1 1 
ATOM   2648 O OE2 . GLU A 1 334 ? 14.650  30.533  4.353   1.00 56.77 ? 334 GLU A OE2 1 
ATOM   2649 N N   . ILE A 1 335 ? 11.761  26.800  3.619   1.00 49.95 ? 335 ILE A N   1 
ATOM   2650 C CA  . ILE A 1 335 ? 11.529  26.681  2.180   1.00 49.95 ? 335 ILE A CA  1 
ATOM   2651 C C   . ILE A 1 335 ? 11.861  28.021  1.579   1.00 50.21 ? 335 ILE A C   1 
ATOM   2652 O O   . ILE A 1 335 ? 11.049  28.949  1.612   1.00 51.12 ? 335 ILE A O   1 
ATOM   2653 C CB  . ILE A 1 335 ? 10.077  26.315  1.827   1.00 50.08 ? 335 ILE A CB  1 
ATOM   2654 C CG1 . ILE A 1 335 ? 9.528   25.212  2.739   1.00 51.00 ? 335 ILE A CG1 1 
ATOM   2655 C CG2 . ILE A 1 335 ? 9.976   25.929  0.337   1.00 49.69 ? 335 ILE A CG2 1 
ATOM   2656 C CD1 . ILE A 1 335 ? 9.538   23.848  2.143   1.00 51.79 ? 335 ILE A CD1 1 
ATOM   2657 N N   . ARG A 1 336 ? 13.063  28.138  1.036   1.00 50.50 ? 336 ARG A N   1 
ATOM   2658 C CA  . ARG A 1 336 ? 13.439  29.350  0.313   1.00 50.43 ? 336 ARG A CA  1 
ATOM   2659 C C   . ARG A 1 336 ? 12.994  29.306  -1.138  1.00 49.20 ? 336 ARG A C   1 
ATOM   2660 O O   . ARG A 1 336 ? 13.215  28.326  -1.848  1.00 49.50 ? 336 ARG A O   1 
ATOM   2661 C CB  . ARG A 1 336 ? 14.943  29.585  0.367   1.00 51.18 ? 336 ARG A CB  1 
ATOM   2662 C CG  . ARG A 1 336 ? 15.288  31.038  0.564   1.00 53.29 ? 336 ARG A CG  1 
ATOM   2663 C CD  . ARG A 1 336 ? 16.766  31.361  0.352   1.00 56.66 ? 336 ARG A CD  1 
ATOM   2664 N NE  . ARG A 1 336 ? 16.898  32.554  -0.484  1.00 59.00 ? 336 ARG A NE  1 
ATOM   2665 C CZ  . ARG A 1 336 ? 17.299  32.567  -1.758  1.00 60.83 ? 336 ARG A CZ  1 
ATOM   2666 N NH1 . ARG A 1 336 ? 17.645  31.441  -2.395  1.00 60.67 ? 336 ARG A NH1 1 
ATOM   2667 N NH2 . ARG A 1 336 ? 17.362  33.733  -2.397  1.00 61.19 ? 336 ARG A NH2 1 
ATOM   2668 N N   . VAL A 1 337 ? 12.371  30.391  -1.562  1.00 47.88 ? 337 VAL A N   1 
ATOM   2669 C CA  . VAL A 1 337 ? 11.888  30.537  -2.922  1.00 47.12 ? 337 VAL A CA  1 
ATOM   2670 C C   . VAL A 1 337 ? 12.503  31.809  -3.461  1.00 46.08 ? 337 VAL A C   1 
ATOM   2671 O O   . VAL A 1 337 ? 12.022  32.901  -3.168  1.00 46.27 ? 337 VAL A O   1 
ATOM   2672 C CB  . VAL A 1 337 ? 10.344  30.669  -3.014  1.00 47.06 ? 337 VAL A CB  1 
ATOM   2673 C CG1 . VAL A 1 337 ? 9.919   30.741  -4.496  1.00 47.21 ? 337 VAL A CG1 1 
ATOM   2674 C CG2 . VAL A 1 337 ? 9.633   29.540  -2.282  1.00 46.43 ? 337 VAL A CG2 1 
HETATM 2675 N N   . SEP A 1 338 ? 13.566  31.635  -4.241  1.00 44.67 ? 338 SEP A N   1 
HETATM 2676 C CA  . SEP A 1 338 ? 14.267  32.702  -4.955  1.00 43.73 ? 338 SEP A CA  1 
HETATM 2677 C CB  . SEP A 1 338 ? 15.372  32.059  -5.793  1.00 43.42 ? 338 SEP A CB  1 
HETATM 2678 O OG  . SEP A 1 338 ? 16.076  33.001  -6.566  1.00 44.91 ? 338 SEP A OG  1 
HETATM 2679 C C   . SEP A 1 338 ? 13.361  33.541  -5.856  1.00 42.86 ? 338 SEP A C   1 
HETATM 2680 O O   . SEP A 1 338 ? 12.328  33.062  -6.328  1.00 42.26 ? 338 SEP A O   1 
HETATM 2681 P P   . SEP A 1 338 ? 17.360  33.646  -5.833  1.00 42.42 ? 338 SEP A P   1 
HETATM 2682 O O1P . SEP A 1 338 ? 18.188  32.562  -5.008  1.00 43.46 ? 338 SEP A O1P 1 
HETATM 2683 O O2P . SEP A 1 338 ? 18.302  34.262  -6.968  1.00 44.75 ? 338 SEP A O2P 1 
HETATM 2684 O O3P . SEP A 1 338 ? 16.808  34.790  -4.855  1.00 43.90 ? 338 SEP A O3P 1 
ATOM   2685 N N   . ILE A 1 339 ? 13.757  34.791  -6.101  1.00 42.04 ? 339 ILE A N   1 
ATOM   2686 C CA  . ILE A 1 339 ? 13.022  35.663  -7.040  1.00 41.94 ? 339 ILE A CA  1 
ATOM   2687 C C   . ILE A 1 339 ? 13.344  35.347  -8.497  1.00 40.89 ? 339 ILE A C   1 
ATOM   2688 O O   . ILE A 1 339 ? 12.633  35.777  -9.407  1.00 41.04 ? 339 ILE A O   1 
ATOM   2689 C CB  . ILE A 1 339 ? 13.248  37.191  -6.745  1.00 42.33 ? 339 ILE A CB  1 
ATOM   2690 C CG1 . ILE A 1 339 ? 14.756  37.557  -6.666  1.00 44.03 ? 339 ILE A CG1 1 
ATOM   2691 C CG2 . ILE A 1 339 ? 12.493  37.584  -5.468  1.00 43.26 ? 339 ILE A CG2 1 
ATOM   2692 C CD1 . ILE A 1 339 ? 15.120  38.900  -7.324  1.00 45.13 ? 339 ILE A CD1 1 
ATOM   2693 N N   . ASN A 1 340 ? 14.422  34.596  -8.703  1.00 40.05 ? 340 ASN A N   1 
ATOM   2694 C CA  . ASN A 1 340 ? 14.863  34.160  -10.027 1.00 39.37 ? 340 ASN A CA  1 
ATOM   2695 C C   . ASN A 1 340 ? 14.629  32.664  -10.258 1.00 38.25 ? 340 ASN A C   1 
ATOM   2696 O O   . ASN A 1 340 ? 14.885  31.852  -9.366  1.00 38.00 ? 340 ASN A O   1 
ATOM   2697 C CB  . ASN A 1 340 ? 16.340  34.474  -10.169 1.00 39.47 ? 340 ASN A CB  1 
ATOM   2698 C CG  . ASN A 1 340 ? 16.639  35.934  -9.891  1.00 40.94 ? 340 ASN A CG  1 
ATOM   2699 O OD1 . ASN A 1 340 ? 16.168  36.831  -10.624 1.00 37.65 ? 340 ASN A OD1 1 
ATOM   2700 N ND2 . ASN A 1 340 ? 17.402  36.190  -8.815  1.00 39.29 ? 340 ASN A ND2 1 
ATOM   2701 N N   . GLU A 1 341 ? 14.150  32.314  -11.447 1.00 37.14 ? 341 GLU A N   1 
ATOM   2702 C CA  . GLU A 1 341 ? 13.859  30.923  -11.789 1.00 36.74 ? 341 GLU A CA  1 
ATOM   2703 C C   . GLU A 1 341 ? 15.175  30.136  -11.965 1.00 35.73 ? 341 GLU A C   1 
ATOM   2704 O O   . GLU A 1 341 ? 16.051  30.534  -12.716 1.00 36.81 ? 341 GLU A O   1 
ATOM   2705 C CB  . GLU A 1 341 ? 13.004  30.832  -13.058 1.00 37.30 ? 341 GLU A CB  1 
ATOM   2706 C CG  . GLU A 1 341 ? 12.557  29.414  -13.452 1.00 37.99 ? 341 GLU A CG  1 
ATOM   2707 C CD  . GLU A 1 341 ? 11.832  29.383  -14.780 1.00 36.90 ? 341 GLU A CD  1 
ATOM   2708 O OE1 . GLU A 1 341 ? 12.321  29.982  -15.740 1.00 41.93 ? 341 GLU A OE1 1 
ATOM   2709 O OE2 . GLU A 1 341 ? 10.769  28.779  -14.881 1.00 39.72 ? 341 GLU A OE2 1 
ATOM   2710 N N   . LYS A 1 342 ? 15.309  29.031  -11.239 1.00 33.79 ? 342 LYS A N   1 
ATOM   2711 C CA  . LYS A 1 342 ? 16.445  28.153  -11.383 1.00 32.31 ? 342 LYS A CA  1 
ATOM   2712 C C   . LYS A 1 342 ? 16.058  26.987  -12.270 1.00 31.42 ? 342 LYS A C   1 
ATOM   2713 O O   . LYS A 1 342 ? 14.981  26.425  -12.131 1.00 30.57 ? 342 LYS A O   1 
ATOM   2714 C CB  . LYS A 1 342 ? 16.893  27.638  -10.022 1.00 31.93 ? 342 LYS A CB  1 
ATOM   2715 C CG  . LYS A 1 342 ? 17.088  28.697  -8.938  1.00 32.24 ? 342 LYS A CG  1 
ATOM   2716 C CD  . LYS A 1 342 ? 18.007  29.881  -9.342  1.00 33.76 ? 342 LYS A CD  1 
ATOM   2717 C CE  . LYS A 1 342 ? 18.050  30.963  -8.259  1.00 32.34 ? 342 LYS A CE  1 
ATOM   2718 N NZ  . LYS A 1 342 ? 19.274  31.775  -8.304  1.00 35.87 ? 342 LYS A NZ  1 
ATOM   2719 N N   . CYS A 1 343 ? 16.943  26.632  -13.194 1.00 31.19 ? 343 CYS A N   1 
ATOM   2720 C CA  . CYS A 1 343 ? 16.856  25.360  -13.905 1.00 30.37 ? 343 CYS A CA  1 
ATOM   2721 C C   . CYS A 1 343 ? 15.536  25.204  -14.648 1.00 30.04 ? 343 CYS A C   1 
ATOM   2722 O O   . CYS A 1 343 ? 14.946  24.118  -14.678 1.00 30.97 ? 343 CYS A O   1 
ATOM   2723 C CB  . CYS A 1 343 ? 16.996  24.202  -12.910 1.00 30.49 ? 343 CYS A CB  1 
ATOM   2724 S SG  . CYS A 1 343 ? 18.390  24.387  -11.802 1.00 28.91 ? 343 CYS A SG  1 
ATOM   2725 N N   . GLY A 1 344 ? 15.058  26.295  -15.216 1.00 29.64 ? 344 GLY A N   1 
ATOM   2726 C CA  . GLY A 1 344 ? 13.798  26.309  -15.931 1.00 28.72 ? 344 GLY A CA  1 
ATOM   2727 C C   . GLY A 1 344 ? 13.762  25.194  -16.960 1.00 28.05 ? 344 GLY A C   1 
ATOM   2728 O O   . GLY A 1 344 ? 12.862  24.360  -16.930 1.00 27.87 ? 344 GLY A O   1 
ATOM   2729 N N   . LYS A 1 345 ? 14.763  25.135  -17.818 1.00 27.63 ? 345 LYS A N   1 
ATOM   2730 C CA  . LYS A 1 345 ? 14.667  24.244  -18.983 1.00 28.88 ? 345 LYS A CA  1 
ATOM   2731 C C   . LYS A 1 345 ? 14.792  22.766  -18.561 1.00 27.62 ? 345 LYS A C   1 
ATOM   2732 O O   . LYS A 1 345 ? 14.141  21.923  -19.114 1.00 26.08 ? 345 LYS A O   1 
ATOM   2733 C CB  . LYS A 1 345 ? 15.618  24.603  -20.147 1.00 29.37 ? 345 LYS A CB  1 
ATOM   2734 C CG  . LYS A 1 345 ? 16.595  25.826  -19.957 1.00 35.20 ? 345 LYS A CG  1 
ATOM   2735 C CD  . LYS A 1 345 ? 15.901  27.251  -19.763 1.00 38.88 ? 345 LYS A CD  1 
ATOM   2736 C CE  . LYS A 1 345 ? 16.715  28.452  -20.411 1.00 39.47 ? 345 LYS A CE  1 
ATOM   2737 N NZ  . LYS A 1 345 ? 16.684  29.711  -19.579 1.00 39.89 ? 345 LYS A NZ  1 
ATOM   2738 N N   . GLU A 1 346 ? 15.564  22.497  -17.514 1.00 27.63 ? 346 GLU A N   1 
ATOM   2739 C CA  . GLU A 1 346 ? 15.818  21.128  -17.084 1.00 27.98 ? 346 GLU A CA  1 
ATOM   2740 C C   . GLU A 1 346 ? 14.551  20.496  -16.543 1.00 27.13 ? 346 GLU A C   1 
ATOM   2741 O O   . GLU A 1 346 ? 14.348  19.310  -16.708 1.00 26.05 ? 346 GLU A O   1 
ATOM   2742 C CB  . GLU A 1 346 ? 16.931  21.082  -16.040 1.00 28.17 ? 346 GLU A CB  1 
ATOM   2743 C CG  . GLU A 1 346 ? 18.276  21.471  -16.609 1.00 29.64 ? 346 GLU A CG  1 
ATOM   2744 C CD  . GLU A 1 346 ? 18.620  22.946  -16.410 1.00 31.70 ? 346 GLU A CD  1 
ATOM   2745 O OE1 . GLU A 1 346 ? 17.735  23.803  -16.364 1.00 28.14 ? 346 GLU A OE1 1 
ATOM   2746 O OE2 . GLU A 1 346 ? 19.808  23.243  -16.322 1.00 35.74 ? 346 GLU A OE2 1 
ATOM   2747 N N   . PHE A 1 347 ? 13.678  21.313  -15.956 1.00 26.42 ? 347 PHE A N   1 
ATOM   2748 C CA  . PHE A 1 347 ? 12.500  20.788  -15.308 1.00 25.72 ? 347 PHE A CA  1 
ATOM   2749 C C   . PHE A 1 347 ? 11.226  21.237  -15.982 1.00 25.77 ? 347 PHE A C   1 
ATOM   2750 O O   . PHE A 1 347 ? 10.187  21.196  -15.356 1.00 25.13 ? 347 PHE A O   1 
ATOM   2751 C CB  . PHE A 1 347 ? 12.533  21.166  -13.816 1.00 25.61 ? 347 PHE A CB  1 
ATOM   2752 C CG  . PHE A 1 347 ? 13.687  20.566  -13.089 1.00 23.88 ? 347 PHE A CG  1 
ATOM   2753 C CD1 . PHE A 1 347 ? 13.702  19.207  -12.758 1.00 22.87 ? 347 PHE A CD1 1 
ATOM   2754 C CD2 . PHE A 1 347 ? 14.794  21.325  -12.790 1.00 24.41 ? 347 PHE A CD2 1 
ATOM   2755 C CE1 . PHE A 1 347 ? 14.843  18.630  -12.131 1.00 22.90 ? 347 PHE A CE1 1 
ATOM   2756 C CE2 . PHE A 1 347 ? 15.924  20.753  -12.164 1.00 22.19 ? 347 PHE A CE2 1 
ATOM   2757 C CZ  . PHE A 1 347 ? 15.938  19.418  -11.832 1.00 20.61 ? 347 PHE A CZ  1 
ATOM   2758 N N   . SER A 1 348 ? 11.273  21.586  -17.278 1.00 26.18 ? 348 SER A N   1 
ATOM   2759 C CA  . SER A 1 348 ? 10.096  22.222  -17.943 1.00 26.97 ? 348 SER A CA  1 
ATOM   2760 C C   . SER A 1 348 ? 8.873   21.317  -18.001 1.00 25.63 ? 348 SER A C   1 
ATOM   2761 O O   . SER A 1 348 ? 7.767   21.791  -17.882 1.00 25.77 ? 348 SER A O   1 
ATOM   2762 C CB  . SER A 1 348 ? 10.398  22.755  -19.366 1.00 28.03 ? 348 SER A CB  1 
ATOM   2763 O OG  . SER A 1 348 ? 11.403  21.966  -20.004 1.00 32.63 ? 348 SER A OG  1 
ATOM   2764 N N   . GLU A 1 349 ? 9.085   20.012  -18.116 1.00 24.67 ? 349 GLU A N   1 
ATOM   2765 C CA  . GLU A 1 349 ? 7.991   19.048  -18.148 1.00 22.89 ? 349 GLU A CA  1 
ATOM   2766 C C   . GLU A 1 349 ? 7.470   18.685  -16.748 1.00 21.18 ? 349 GLU A C   1 
ATOM   2767 O O   . GLU A 1 349 ? 6.401   18.097  -16.622 1.00 19.43 ? 349 GLU A O   1 
ATOM   2768 C CB  . GLU A 1 349 ? 8.387   17.797  -18.947 1.00 22.98 ? 349 GLU A CB  1 
ATOM   2769 C CG  . GLU A 1 349 ? 9.124   16.757  -18.140 1.00 25.73 ? 349 GLU A CG  1 
ATOM   2770 C CD  . GLU A 1 349 ? 9.277   15.402  -18.820 1.00 28.77 ? 349 GLU A CD  1 
ATOM   2771 O OE1 . GLU A 1 349 ? 9.675   15.399  -20.029 1.00 30.77 ? 349 GLU A OE1 1 
ATOM   2772 O OE2 . GLU A 1 349 ? 9.035   14.340  -18.113 1.00 27.45 ? 349 GLU A OE2 1 
ATOM   2773 N N   . PHE A 1 350 ? 8.183   19.061  -15.691 1.00 20.27 ? 350 PHE A N   1 
ATOM   2774 C CA  . PHE A 1 350 ? 7.683   18.782  -14.348 1.00 19.71 ? 350 PHE A CA  1 
ATOM   2775 C C   . PHE A 1 350 ? 6.344   19.523  -14.101 1.00 19.43 ? 350 PHE A C   1 
ATOM   2776 O O   . PHE A 1 350 ? 6.276   20.753  -14.233 1.00 20.48 ? 350 PHE A O   1 
ATOM   2777 C CB  . PHE A 1 350 ? 8.700   19.131  -13.241 1.00 19.50 ? 350 PHE A CB  1 
ATOM   2778 C CG  . PHE A 1 350 ? 8.300   18.613  -11.882 1.00 20.26 ? 350 PHE A CG  1 
ATOM   2779 C CD1 . PHE A 1 350 ? 7.299   19.247  -11.133 1.00 20.89 ? 350 PHE A CD1 1 
ATOM   2780 C CD2 . PHE A 1 350 ? 8.900   17.481  -11.357 1.00 21.29 ? 350 PHE A CD2 1 
ATOM   2781 C CE1 . PHE A 1 350 ? 6.926   18.771  -9.880  1.00 20.12 ? 350 PHE A CE1 1 
ATOM   2782 C CE2 . PHE A 1 350 ? 8.536   16.990  -10.096 1.00 21.77 ? 350 PHE A CE2 1 
ATOM   2783 C CZ  . PHE A 1 350 ? 7.559   17.639  -9.357  1.00 24.28 ? 350 PHE A CZ  1 
ATOM   2784 O OXT . PHE A 1 350 ? 5.349   18.878  -13.804 1.00 18.00 ? 350 PHE A OXT 1 
ATOM   2785 N N   . THR B 2 1   ? 25.875  -13.272 18.741  1.00 22.59 ? 5   THR I N   1 
ATOM   2786 C CA  . THR B 2 1   ? 24.817  -13.645 17.752  1.00 21.98 ? 5   THR I CA  1 
ATOM   2787 C C   . THR B 2 1   ? 24.793  -12.680 16.613  1.00 22.22 ? 5   THR I C   1 
ATOM   2788 O O   . THR B 2 1   ? 25.312  -11.586 16.710  1.00 21.79 ? 5   THR I O   1 
ATOM   2789 C CB  . THR B 2 1   ? 23.425  -13.641 18.407  1.00 22.21 ? 5   THR I CB  1 
ATOM   2790 O OG1 . THR B 2 1   ? 23.065  -12.304 18.813  1.00 19.60 ? 5   THR I OG1 1 
ATOM   2791 C CG2 . THR B 2 1   ? 23.428  -14.461 19.676  1.00 23.45 ? 5   THR I CG2 1 
ATOM   2792 N N   . THR B 2 2   ? 24.113  -13.058 15.540  1.00 23.01 ? 6   THR I N   1 
ATOM   2793 C CA  . THR B 2 2   ? 24.007  -12.197 14.367  1.00 23.43 ? 6   THR I CA  1 
ATOM   2794 C C   . THR B 2 2   ? 23.204  -10.952 14.663  1.00 23.21 ? 6   THR I C   1 
ATOM   2795 O O   . THR B 2 2   ? 23.552  -9.874  14.211  1.00 23.86 ? 6   THR I O   1 
ATOM   2796 C CB  . THR B 2 2   ? 23.349  -12.925 13.215  1.00 23.78 ? 6   THR I CB  1 
ATOM   2797 O OG1 . THR B 2 2   ? 24.006  -14.180 13.002  1.00 27.36 ? 6   THR I OG1 1 
ATOM   2798 C CG2 . THR B 2 2   ? 23.598  -12.175 11.929  1.00 24.08 ? 6   THR I CG2 1 
ATOM   2799 N N   . TYR B 2 3   ? 22.124  -11.112 15.410  1.00 23.12 ? 7   TYR I N   1 
ATOM   2800 C CA  . TYR B 2 3   ? 21.366  -9.973  15.908  1.00 23.51 ? 7   TYR I CA  1 
ATOM   2801 C C   . TYR B 2 3   ? 22.276  -8.943  16.624  1.00 22.81 ? 7   TYR I C   1 
ATOM   2802 O O   . TYR B 2 3   ? 22.283  -7.777  16.284  1.00 21.36 ? 7   TYR I O   1 
ATOM   2803 C CB  . TYR B 2 3   ? 20.209  -10.462 16.837  1.00 23.47 ? 7   TYR I CB  1 
ATOM   2804 C CG  . TYR B 2 3   ? 19.566  -9.332  17.607  1.00 24.01 ? 7   TYR I CG  1 
ATOM   2805 C CD1 . TYR B 2 3   ? 18.683  -8.432  16.990  1.00 23.54 ? 7   TYR I CD1 1 
ATOM   2806 C CD2 . TYR B 2 3   ? 19.870  -9.148  18.968  1.00 26.26 ? 7   TYR I CD2 1 
ATOM   2807 C CE1 . TYR B 2 3   ? 18.107  -7.371  17.729  1.00 24.30 ? 7   TYR I CE1 1 
ATOM   2808 C CE2 . TYR B 2 3   ? 19.332  -8.105  19.712  1.00 24.99 ? 7   TYR I CE2 1 
ATOM   2809 C CZ  . TYR B 2 3   ? 18.459  -7.221  19.108  1.00 27.07 ? 7   TYR I CZ  1 
ATOM   2810 O OH  . TYR B 2 3   ? 17.969  -6.211  19.909  1.00 27.48 ? 7   TYR I OH  1 
ATOM   2811 N N   . ALA B 2 4   ? 23.076  -9.412  17.584  1.00 23.01 ? 8   ALA I N   1 
ATOM   2812 C CA  . ALA B 2 4   ? 24.008  -8.560  18.348  1.00 22.69 ? 8   ALA I CA  1 
ATOM   2813 C C   . ALA B 2 4   ? 25.026  -7.893  17.455  1.00 22.23 ? 8   ALA I C   1 
ATOM   2814 O O   . ALA B 2 4   ? 25.404  -6.743  17.663  1.00 20.82 ? 8   ALA I O   1 
ATOM   2815 C CB  . ALA B 2 4   ? 24.731  -9.411  19.435  1.00 23.06 ? 8   ALA I CB  1 
ATOM   2816 N N   . ASP B 2 5   ? 25.486  -8.623  16.441  1.00 23.19 ? 9   ASP I N   1 
ATOM   2817 C CA  . ASP B 2 5   ? 26.454  -8.053  15.488  1.00 23.20 ? 9   ASP I CA  1 
ATOM   2818 C C   . ASP B 2 5   ? 25.805  -6.898  14.709  1.00 22.72 ? 9   ASP I C   1 
ATOM   2819 O O   . ASP B 2 5   ? 26.362  -5.824  14.589  1.00 21.98 ? 9   ASP I O   1 
ATOM   2820 C CB  . ASP B 2 5   ? 26.999  -9.138  14.561  1.00 23.77 ? 9   ASP I CB  1 
ATOM   2821 C CG  . ASP B 2 5   ? 27.880  -10.110 15.294  1.00 23.75 ? 9   ASP I CG  1 
ATOM   2822 O OD1 . ASP B 2 5   ? 28.506  -9.678  16.270  1.00 20.89 ? 9   ASP I OD1 1 
ATOM   2823 O OD2 . ASP B 2 5   ? 28.018  -11.308 14.973  1.00 30.91 ? 9   ASP I OD2 1 
ATOM   2824 N N   . PHE B 2 6   ? 24.577  -7.107  14.281  1.00 23.46 ? 10  PHE I N   1 
ATOM   2825 C CA  . PHE B 2 6   ? 23.810  -6.064  13.596  1.00 23.80 ? 10  PHE I CA  1 
ATOM   2826 C C   . PHE B 2 6   ? 23.555  -4.843  14.460  1.00 23.62 ? 10  PHE I C   1 
ATOM   2827 O O   . PHE B 2 6   ? 23.784  -3.701  14.047  1.00 23.25 ? 10  PHE I O   1 
ATOM   2828 C CB  . PHE B 2 6   ? 22.469  -6.651  13.104  1.00 23.85 ? 10  PHE I CB  1 
ATOM   2829 C CG  . PHE B 2 6   ? 21.604  -5.667  12.330  1.00 24.19 ? 10  PHE I CG  1 
ATOM   2830 C CD1 . PHE B 2 6   ? 22.057  -5.103  11.150  1.00 25.04 ? 10  PHE I CD1 1 
ATOM   2831 C CD2 . PHE B 2 6   ? 20.328  -5.331  12.791  1.00 24.79 ? 10  PHE I CD2 1 
ATOM   2832 C CE1 . PHE B 2 6   ? 21.272  -4.201  10.441  1.00 25.70 ? 10  PHE I CE1 1 
ATOM   2833 C CE2 . PHE B 2 6   ? 19.514  -4.445  12.097  1.00 25.33 ? 10  PHE I CE2 1 
ATOM   2834 C CZ  . PHE B 2 6   ? 19.982  -3.865  10.919  1.00 26.20 ? 10  PHE I CZ  1 
ATOM   2835 N N   . ILE B 2 7   ? 23.073  -5.084  15.670  1.00 24.10 ? 11  ILE I N   1 
ATOM   2836 C CA  . ILE B 2 7   ? 22.672  -4.001  16.546  1.00 24.53 ? 11  ILE I CA  1 
ATOM   2837 C C   . ILE B 2 7   ? 23.872  -3.158  16.951  1.00 23.41 ? 11  ILE I C   1 
ATOM   2838 O O   . ILE B 2 7   ? 23.745  -1.964  17.150  1.00 22.18 ? 11  ILE I O   1 
ATOM   2839 C CB  . ILE B 2 7   ? 21.894  -4.546  17.740  1.00 25.38 ? 11  ILE I CB  1 
ATOM   2840 C CG1 . ILE B 2 7   ? 20.530  -5.011  17.260  1.00 27.67 ? 11  ILE I CG1 1 
ATOM   2841 C CG2 . ILE B 2 7   ? 21.670  -3.472  18.795  1.00 26.77 ? 11  ILE I CG2 1 
ATOM   2842 C CD1 . ILE B 2 7   ? 19.615  -3.857  16.895  1.00 29.08 ? 11  ILE I CD1 1 
ATOM   2843 N N   . ALA B 2 8   ? 25.037  -3.780  17.003  1.00 23.25 ? 12  ALA I N   1 
ATOM   2844 C CA  . ALA B 2 8   ? 26.259  -3.049  17.296  1.00 23.94 ? 12  ALA I CA  1 
ATOM   2845 C C   . ALA B 2 8   ? 26.815  -2.340  16.081  1.00 24.26 ? 12  ALA I C   1 
ATOM   2846 O O   . ALA B 2 8   ? 27.692  -1.512  16.254  1.00 24.98 ? 12  ALA I O   1 
ATOM   2847 C CB  . ALA B 2 8   ? 27.294  -3.988  17.879  1.00 24.16 ? 12  ALA I CB  1 
ATOM   2848 N N   . SER B 2 9   ? 26.359  -2.697  14.866  1.00 24.52 ? 13  SER I N   1 
ATOM   2849 C CA  . SER B 2 9   ? 26.828  -2.076  13.589  1.00 24.70 ? 13  SER I CA  1 
ATOM   2850 C C   . SER B 2 9   ? 26.376  -0.629  13.366  1.00 25.16 ? 13  SER I C   1 
ATOM   2851 O O   . SER B 2 9   ? 25.475  -0.130  14.027  1.00 24.92 ? 13  SER I O   1 
ATOM   2852 C CB  . SER B 2 9   ? 26.403  -2.928  12.356  1.00 24.12 ? 13  SER I CB  1 
ATOM   2853 O OG  . SER B 2 9   ? 25.079  -2.661  11.900  1.00 22.49 ? 13  SER I OG  1 
ATOM   2854 N N   . GLY B 2 10  ? 26.983  0.022   12.375  1.00 26.49 ? 14  GLY I N   1 
ATOM   2855 C CA  . GLY B 2 10  ? 26.637  1.405   12.013  1.00 26.61 ? 14  GLY I CA  1 
ATOM   2856 C C   . GLY B 2 10  ? 25.431  1.563   11.058  1.00 26.83 ? 14  GLY I C   1 
ATOM   2857 O O   . GLY B 2 10  ? 25.103  2.685   10.619  1.00 25.68 ? 14  GLY I O   1 
ATOM   2858 N N   . ARG B 2 11  ? 24.762  0.455   10.731  1.00 26.50 ? 15  ARG I N   1 
ATOM   2859 C CA  . ARG B 2 11  ? 23.685  0.490   9.725   1.00 26.65 ? 15  ARG I CA  1 
ATOM   2860 C C   . ARG B 2 11  ? 22.359  -0.073  10.196  1.00 25.79 ? 15  ARG I C   1 
ATOM   2861 O O   . ARG B 2 11  ? 21.685  -0.842  9.458   1.00 25.40 ? 15  ARG I O   1 
ATOM   2862 C CB  . ARG B 2 11  ? 24.097  -0.258  8.477   1.00 27.14 ? 15  ARG I CB  1 
ATOM   2863 C CG  . ARG B 2 11  ? 25.365  0.190   7.810   1.00 27.82 ? 15  ARG I CG  1 
ATOM   2864 C CD  . ARG B 2 11  ? 25.395  -0.220  6.338   1.00 29.01 ? 15  ARG I CD  1 
ATOM   2865 N NE  . ARG B 2 11  ? 25.724  0.980   5.643   1.00 34.43 ? 15  ARG I NE  1 
ATOM   2866 C CZ  . ARG B 2 11  ? 25.053  1.535   4.667   1.00 34.88 ? 15  ARG I CZ  1 
ATOM   2867 N NH1 . ARG B 2 11  ? 24.012  0.959   4.070   1.00 32.82 ? 15  ARG I NH1 1 
ATOM   2868 N NH2 . ARG B 2 11  ? 25.515  2.695   4.249   1.00 38.39 ? 15  ARG I NH2 1 
ATOM   2869 N N   . THR B 2 12  ? 21.969  0.320   11.409  1.00 24.60 ? 16  THR I N   1 
ATOM   2870 C CA  . THR B 2 12  ? 20.643  -0.012  11.894  1.00 23.94 ? 16  THR I CA  1 
ATOM   2871 C C   . THR B 2 12  ? 19.705  1.153   11.764  1.00 22.94 ? 16  THR I C   1 
ATOM   2872 O O   . THR B 2 12  ? 18.545  1.000   12.071  1.00 22.17 ? 16  THR I O   1 
ATOM   2873 C CB  . THR B 2 12  ? 20.648  -0.481  13.365  1.00 23.91 ? 16  THR I CB  1 
ATOM   2874 O OG1 . THR B 2 12  ? 21.119  0.571   14.198  1.00 22.56 ? 16  THR I OG1 1 
ATOM   2875 C CG2 . THR B 2 12  ? 21.587  -1.630  13.556  1.00 23.61 ? 16  THR I CG2 1 
ATOM   2876 N N   . GLY B 2 13  ? 20.223  2.322   11.379  1.00 22.42 ? 17  GLY I N   1 
ATOM   2877 C CA  . GLY B 2 13  ? 19.393  3.495   11.126  1.00 21.94 ? 17  GLY I CA  1 
ATOM   2878 C C   . GLY B 2 13  ? 18.918  3.476   9.672   1.00 22.65 ? 17  GLY I C   1 
ATOM   2879 O O   . GLY B 2 13  ? 19.140  2.505   8.967   1.00 19.83 ? 17  GLY I O   1 
ATOM   2880 N N   . ARG B 2 14  ? 18.205  4.525   9.270   1.00 23.63 ? 18  ARG I N   1 
ATOM   2881 C CA  . ARG B 2 14  ? 17.654  4.638   7.935   1.00 25.45 ? 18  ARG I CA  1 
ATOM   2882 C C   . ARG B 2 14  ? 18.800  4.712   6.935   1.00 25.22 ? 18  ARG I C   1 
ATOM   2883 O O   . ARG B 2 14  ? 19.748  5.475   7.090   1.00 25.65 ? 18  ARG I O   1 
ATOM   2884 C CB  . ARG B 2 14  ? 16.736  5.869   7.815   1.00 26.55 ? 18  ARG I CB  1 
ATOM   2885 C CG  . ARG B 2 14  ? 15.452  5.778   8.677   1.00 29.90 ? 18  ARG I CG  1 
ATOM   2886 C CD  . ARG B 2 14  ? 14.642  7.061   8.718   1.00 36.18 ? 18  ARG I CD  1 
ATOM   2887 N NE  . ARG B 2 14  ? 13.285  6.789   9.166   1.00 39.08 ? 18  ARG I NE  1 
ATOM   2888 C CZ  . ARG B 2 14  ? 12.940  6.390   10.402  1.00 42.18 ? 18  ARG I CZ  1 
ATOM   2889 N NH1 . ARG B 2 14  ? 13.843  6.289   11.397  1.00 44.35 ? 18  ARG I NH1 1 
ATOM   2890 N NH2 . ARG B 2 14  ? 11.656  6.100   10.660  1.00 43.36 ? 18  ARG I NH2 1 
ATOM   2891 N N   . ARG B 2 15  ? 18.705  3.878   5.920   1.00 25.78 ? 19  ARG I N   1 
ATOM   2892 C CA  . ARG B 2 15  ? 19.762  3.739   4.939   1.00 26.61 ? 19  ARG I CA  1 
ATOM   2893 C C   . ARG B 2 15  ? 19.439  4.570   3.721   1.00 27.12 ? 19  ARG I C   1 
ATOM   2894 O O   . ARG B 2 15  ? 18.362  4.464   3.155   1.00 26.98 ? 19  ARG I O   1 
ATOM   2895 C CB  . ARG B 2 15  ? 19.924  2.278   4.560   1.00 25.51 ? 19  ARG I CB  1 
ATOM   2896 C CG  . ARG B 2 15  ? 20.287  1.426   5.760   1.00 24.63 ? 19  ARG I CG  1 
ATOM   2897 C CD  . ARG B 2 15  ? 19.947  -0.022  5.616   1.00 23.35 ? 19  ARG I CD  1 
ATOM   2898 N NE  . ARG B 2 15  ? 18.499  -0.218  5.599   1.00 22.04 ? 19  ARG I NE  1 
ATOM   2899 C CZ  . ARG B 2 15  ? 17.903  -1.391  5.826   1.00 22.28 ? 19  ARG I CZ  1 
ATOM   2900 N NH1 . ARG B 2 15  ? 18.622  -2.494  6.060   1.00 22.93 ? 19  ARG I NH1 1 
ATOM   2901 N NH2 . ARG B 2 15  ? 16.583  -1.472  5.803   1.00 19.82 ? 19  ARG I NH2 1 
ATOM   2902 N N   . ASN B 2 16  ? 20.397  5.397   3.354   1.00 28.54 ? 20  ASN I N   1 
ATOM   2903 C CA  . ASN B 2 16  ? 20.358  6.208   2.168   1.00 30.37 ? 20  ASN I CA  1 
ATOM   2904 C C   . ASN B 2 16  ? 20.588  5.367   0.912   1.00 30.19 ? 20  ASN I C   1 
ATOM   2905 O O   . ASN B 2 16  ? 21.348  4.404   0.913   1.00 29.22 ? 20  ASN I O   1 
ATOM   2906 C CB  . ASN B 2 16  ? 21.443  7.307   2.246   1.00 31.29 ? 20  ASN I CB  1 
ATOM   2907 C CG  . ASN B 2 16  ? 21.325  8.189   3.504   1.00 35.01 ? 20  ASN I CG  1 
ATOM   2908 O OD1 . ASN B 2 16  ? 20.299  8.825   3.748   1.00 40.06 ? 20  ASN I OD1 1 
ATOM   2909 N ND2 . ASN B 2 16  ? 22.403  8.233   4.297   1.00 40.70 ? 20  ASN I ND2 1 
ATOM   2910 N N   . ALA B 2 17  ? 19.913  5.746   -0.161  1.00 31.27 ? 21  ALA I N   1 
ATOM   2911 C CA  . ALA B 2 17  ? 20.248  5.256   -1.488  1.00 32.92 ? 21  ALA I CA  1 
ATOM   2912 C C   . ALA B 2 17  ? 21.656  5.679   -1.878  1.00 34.27 ? 21  ALA I C   1 
ATOM   2913 O O   . ALA B 2 17  ? 22.188  6.672   -1.362  1.00 33.09 ? 21  ALA I O   1 
ATOM   2914 C CB  . ALA B 2 17  ? 19.255  5.802   -2.511  1.00 33.01 ? 21  ALA I CB  1 
ATOM   2915 N N   . ILE B 2 18  ? 22.254  4.922   -2.792  1.00 36.96 ? 22  ILE I N   1 
ATOM   2916 C CA  . ILE B 2 18  ? 23.533  5.311   -3.391  1.00 39.86 ? 22  ILE I CA  1 
ATOM   2917 C C   . ILE B 2 18  ? 23.377  5.802   -4.822  1.00 42.06 ? 22  ILE I C   1 
ATOM   2918 O O   . ILE B 2 18  ? 22.298  5.771   -5.393  1.00 42.45 ? 22  ILE I O   1 
ATOM   2919 C CB  . ILE B 2 18  ? 24.606  4.201   -3.263  1.00 39.66 ? 22  ILE I CB  1 
ATOM   2920 C CG1 . ILE B 2 18  ? 24.172  2.859   -3.848  1.00 39.81 ? 22  ILE I CG1 1 
ATOM   2921 C CG2 . ILE B 2 18  ? 24.953  4.020   -1.817  1.00 42.15 ? 22  ILE I CG2 1 
ATOM   2922 C CD1 . ILE B 2 18  ? 24.416  2.743   -5.334  1.00 38.26 ? 22  ILE I CD1 1 
ATOM   2923 N N   . HIS B 2 19  ? 24.478  6.272   -5.378  1.00 46.11 ? 23  HIS I N   1 
ATOM   2924 C CA  . HIS B 2 19  ? 24.531  6.815   -6.746  1.00 48.88 ? 23  HIS I CA  1 
ATOM   2925 C C   . HIS B 2 19  ? 25.974  7.192   -7.056  1.00 50.77 ? 23  HIS I C   1 
ATOM   2926 O O   . HIS B 2 19  ? 26.750  7.531   -6.145  1.00 50.78 ? 23  HIS I O   1 
ATOM   2927 C CB  . HIS B 2 19  ? 23.681  8.100   -6.857  1.00 49.54 ? 23  HIS I CB  1 
ATOM   2928 C CG  . HIS B 2 19  ? 23.952  9.086   -5.758  1.00 51.10 ? 23  HIS I CG  1 
ATOM   2929 N ND1 . HIS B 2 19  ? 23.090  9.261   -4.695  1.00 53.49 ? 23  HIS I ND1 1 
ATOM   2930 C CD2 . HIS B 2 19  ? 25.011  9.904   -5.525  1.00 54.00 ? 23  HIS I CD2 1 
ATOM   2931 C CE1 . HIS B 2 19  ? 23.597  10.156  -3.861  1.00 54.47 ? 23  HIS I CE1 1 
ATOM   2932 N NE2 . HIS B 2 19  ? 24.768  10.557  -4.336  1.00 54.99 ? 23  HIS I NE2 1 
ATOM   2933 N N   . ASP B 2 20  ? 26.321  7.174   -8.343  1.00 53.10 ? 24  ASP I N   1 
ATOM   2934 C CA  . ASP B 2 20  ? 27.705  7.457   -8.755  1.00 54.47 ? 24  ASP I CA  1 
ATOM   2935 C C   . ASP B 2 20  ? 27.908  8.946   -9.130  1.00 54.91 ? 24  ASP I C   1 
ATOM   2936 O O   . ASP B 2 20  ? 27.626  9.863   -8.335  1.00 54.96 ? 24  ASP I O   1 
ATOM   2937 C CB  . ASP B 2 20  ? 28.198  6.472   -9.854  1.00 54.76 ? 24  ASP I CB  1 
ATOM   2938 C CG  . ASP B 2 20  ? 27.262  6.383   -11.067 1.00 57.00 ? 24  ASP I CG  1 
ATOM   2939 O OD1 . ASP B 2 20  ? 27.251  5.305   -11.724 1.00 59.58 ? 24  ASP I OD1 1 
ATOM   2940 O OD2 . ASP B 2 20  ? 26.511  7.323   -11.447 1.00 60.02 ? 24  ASP I OD2 1 
ATOM   2941 O OXT . ASP B 2 20  ? 28.384  9.283   -10.218 1.00 55.71 ? 24  ASP I OXT 1 
HETATM 2942 O O23 . Y27 C 3 .   ? 7.352   9.887   1.479   1.00 28.88 ? 501 Y27 A O23 1 
HETATM 2943 C C22 . Y27 C 3 .   ? 7.739   9.466   2.567   1.00 26.42 ? 501 Y27 A C22 1 
HETATM 2944 C C31 . Y27 C 3 .   ? 9.118   8.901   2.755   1.00 27.32 ? 501 Y27 A C31 1 
HETATM 2945 C C36 . Y27 C 3 .   ? 9.337   7.630   1.905   1.00 25.60 ? 501 Y27 A C36 1 
HETATM 2946 C C35 . Y27 C 3 .   ? 10.773  7.106   2.093   1.00 26.58 ? 501 Y27 A C35 1 
HETATM 2947 C C34 . Y27 C 3 .   ? 11.809  8.224   1.851   1.00 26.37 ? 501 Y27 A C34 1 
HETATM 2948 C C33 . Y27 C 3 .   ? 11.584  9.398   2.821   1.00 26.19 ? 501 Y27 A C33 1 
HETATM 2949 C C32 . Y27 C 3 .   ? 10.186  9.978   2.487   1.00 26.95 ? 501 Y27 A C32 1 
HETATM 2950 C C41 . Y27 C 3 .   ? 13.270  7.704   1.866   1.00 27.27 ? 501 Y27 A C41 1 
HETATM 2951 C C42 . Y27 C 3 .   ? 13.636  6.961   3.160   1.00 26.95 ? 501 Y27 A C42 1 
HETATM 2952 N N43 . Y27 C 3 .   ? 13.538  6.838   0.663   1.00 24.30 ? 501 Y27 A N43 1 
HETATM 2953 N N21 . Y27 C 3 .   ? 6.921   9.460   3.729   1.00 27.57 ? 501 Y27 A N21 1 
HETATM 2954 C C14 . Y27 C 3 .   ? 5.469   9.684   3.793   1.00 27.96 ? 501 Y27 A C14 1 
HETATM 2955 C C15 . Y27 C 3 .   ? 4.907   9.646   5.069   1.00 26.25 ? 501 Y27 A C15 1 
HETATM 2956 C C16 . Y27 C 3 .   ? 3.536   9.828   5.229   1.00 25.42 ? 501 Y27 A C16 1 
HETATM 2957 N N11 . Y27 C 3 .   ? 2.748   10.007  4.189   1.00 23.40 ? 501 Y27 A N11 1 
HETATM 2958 C C12 . Y27 C 3 .   ? 3.251   10.048  2.955   1.00 25.71 ? 501 Y27 A C12 1 
HETATM 2959 C C13 . Y27 C 3 .   ? 4.600   9.922   2.703   1.00 26.06 ? 501 Y27 A C13 1 
HETATM 2960 O O   . HOH D 4 .   ? 14.147  7.501   -11.786 1.00 14.01 ? 502 HOH A O   1 
HETATM 2961 O O   . HOH D 4 .   ? 11.418  10.753  -1.151  1.00 24.20 ? 503 HOH A O   1 
HETATM 2962 O O   . HOH D 4 .   ? 8.235   9.474   -5.237  1.00 28.61 ? 504 HOH A O   1 
HETATM 2963 O O   . HOH D 4 .   ? 10.831  6.418   -17.057 1.00 19.45 ? 505 HOH A O   1 
HETATM 2964 O O   . HOH D 4 .   ? 18.235  -0.564  -7.547  1.00 15.59 ? 506 HOH A O   1 
HETATM 2965 O O   . HOH D 4 .   ? 21.358  -7.305  2.789   1.00 24.43 ? 507 HOH A O   1 
HETATM 2966 O O   . HOH D 4 .   ? 15.752  13.096  -7.139  1.00 24.61 ? 508 HOH A O   1 
HETATM 2967 O O   . HOH D 4 .   ? 4.145   24.290  -11.590 1.00 19.66 ? 509 HOH A O   1 
HETATM 2968 O O   . HOH D 4 .   ? 8.258   14.427  -15.446 1.00 21.13 ? 510 HOH A O   1 
HETATM 2969 O O   . HOH D 4 .   ? 16.408  18.458  -2.845  1.00 27.61 ? 511 HOH A O   1 
HETATM 2970 O O   . HOH D 4 .   ? 9.312   -16.715 -12.172 1.00 29.24 ? 512 HOH A O   1 
HETATM 2971 O O   . HOH D 4 .   ? 11.421  5.788   -19.833 1.00 19.62 ? 513 HOH A O   1 
HETATM 2972 O O   . HOH D 4 .   ? 19.221  11.270  -13.312 1.00 16.54 ? 514 HOH A O   1 
HETATM 2973 O O   . HOH D 4 .   ? 12.418  4.450   -6.620  1.00 21.13 ? 515 HOH A O   1 
HETATM 2974 O O   . HOH D 4 .   ? 9.974   11.855  -18.988 1.00 19.65 ? 516 HOH A O   1 
HETATM 2975 O O   . HOH D 4 .   ? 18.149  -1.333  -3.765  1.00 18.84 ? 517 HOH A O   1 
HETATM 2976 O O   . HOH D 4 .   ? 14.212  -2.701  -5.508  1.00 20.20 ? 518 HOH A O   1 
HETATM 2977 O O   . HOH D 4 .   ? 8.366   9.243   6.306   1.00 21.52 ? 519 HOH A O   1 
HETATM 2978 O O   . HOH D 4 .   ? 19.043  -0.239  8.955   1.00 24.17 ? 520 HOH A O   1 
HETATM 2979 O O   . HOH D 4 .   ? 8.330   12.873  -23.009 1.00 26.05 ? 521 HOH A O   1 
HETATM 2980 O O   . HOH D 4 .   ? 21.396  -2.563  7.314   1.00 15.06 ? 522 HOH A O   1 
HETATM 2981 O O   . HOH D 4 .   ? 5.537   14.416  -15.968 1.00 22.51 ? 523 HOH A O   1 
HETATM 2982 O O   . HOH D 4 .   ? 1.808   9.582   12.833  1.00 29.23 ? 524 HOH A O   1 
HETATM 2983 O O   . HOH D 4 .   ? -0.409  8.616   -7.830  1.00 17.97 ? 525 HOH A O   1 
HETATM 2984 O O   . HOH D 4 .   ? 21.442  -7.456  -1.761  1.00 19.71 ? 526 HOH A O   1 
HETATM 2985 O O   . HOH D 4 .   ? 8.624   10.214  -0.981  1.00 17.60 ? 527 HOH A O   1 
HETATM 2986 O O   . HOH D 4 .   ? 8.192   5.657   10.933  1.00 30.37 ? 528 HOH A O   1 
HETATM 2987 O O   . HOH D 4 .   ? -2.070  4.642   -6.174  1.00 17.57 ? 529 HOH A O   1 
HETATM 2988 O O   . HOH D 4 .   ? 18.603  -8.269  -13.684 1.00 27.03 ? 530 HOH A O   1 
HETATM 2989 O O   . HOH D 4 .   ? 8.505   31.238  -7.740  1.00 30.81 ? 531 HOH A O   1 
HETATM 2990 O O   . HOH D 4 .   ? 7.465   23.850  10.002  1.00 61.15 ? 532 HOH A O   1 
HETATM 2991 O O   . HOH D 4 .   ? 3.641   19.809  -11.780 1.00 24.65 ? 533 HOH A O   1 
HETATM 2992 O O   . HOH D 4 .   ? 21.760  8.104   -10.100 1.00 21.78 ? 534 HOH A O   1 
HETATM 2993 O O   . HOH D 4 .   ? -4.401  5.674   6.249   1.00 28.70 ? 535 HOH A O   1 
HETATM 2994 O O   . HOH D 4 .   ? 7.603   13.689  13.136  1.00 34.37 ? 536 HOH A O   1 
HETATM 2995 O O   . HOH D 4 .   ? 3.824   27.109  -8.271  1.00 21.45 ? 537 HOH A O   1 
HETATM 2996 O O   . HOH D 4 .   ? 4.859   -9.950  13.929  1.00 27.91 ? 538 HOH A O   1 
HETATM 2997 O O   . HOH D 4 .   ? -4.815  -20.361 -4.546  1.00 62.19 ? 539 HOH A O   1 
HETATM 2998 O O   . HOH D 4 .   ? -4.434  10.616  5.917   1.00 34.42 ? 540 HOH A O   1 
HETATM 2999 O O   . HOH D 4 .   ? 11.916  18.812  -18.563 1.00 20.80 ? 541 HOH A O   1 
HETATM 3000 O O   . HOH D 4 .   ? 18.370  -5.073  -6.159  1.00 24.15 ? 542 HOH A O   1 
HETATM 3001 O O   . HOH D 4 .   ? 23.895  4.216   -16.574 1.00 29.27 ? 543 HOH A O   1 
HETATM 3002 O O   . HOH D 4 .   ? 6.264   0.747   -25.428 1.00 45.74 ? 544 HOH A O   1 
HETATM 3003 O O   . HOH D 4 .   ? 14.208  6.453   -18.903 1.00 30.69 ? 545 HOH A O   1 
HETATM 3004 O O   . HOH D 4 .   ? 23.070  -11.536 8.033   1.00 31.81 ? 546 HOH A O   1 
HETATM 3005 O O   . HOH D 4 .   ? 7.013   9.366   -2.939  1.00 18.03 ? 547 HOH A O   1 
HETATM 3006 O O   . HOH D 4 .   ? 16.484  6.656   1.022   1.00 30.16 ? 548 HOH A O   1 
HETATM 3007 O O   . HOH D 4 .   ? 27.810  -2.365  -18.293 1.00 38.15 ? 549 HOH A O   1 
HETATM 3008 O O   . HOH D 4 .   ? 14.140  8.594   -18.218 1.00 33.90 ? 550 HOH A O   1 
HETATM 3009 O O   . HOH D 4 .   ? -6.294  -0.571  -8.010  1.00 35.03 ? 551 HOH A O   1 
HETATM 3010 O O   . HOH D 4 .   ? 16.968  -2.720  -6.112  1.00 26.71 ? 552 HOH A O   1 
HETATM 3011 O O   . HOH D 4 .   ? 16.557  10.685  -7.967  1.00 23.57 ? 553 HOH A O   1 
HETATM 3012 O O   . HOH D 4 .   ? 20.896  14.963  -14.188 1.00 19.75 ? 554 HOH A O   1 
HETATM 3013 O O   . HOH D 4 .   ? 19.109  16.005  -1.455  1.00 27.98 ? 555 HOH A O   1 
HETATM 3014 O O   . HOH D 4 .   ? 14.108  -24.570 -4.487  1.00 30.65 ? 556 HOH A O   1 
HETATM 3015 O O   . HOH D 4 .   ? 14.730  -4.866  12.794  1.00 21.63 ? 557 HOH A O   1 
HETATM 3016 O O   . HOH D 4 .   ? 22.275  -17.758 -5.115  1.00 31.59 ? 558 HOH A O   1 
HETATM 3017 O O   . HOH D 4 .   ? 15.718  17.637  -18.472 1.00 18.70 ? 559 HOH A O   1 
HETATM 3018 O O   . HOH D 4 .   ? 1.171   10.249  20.497  1.00 45.68 ? 560 HOH A O   1 
HETATM 3019 O O   . HOH D 4 .   ? 3.642   7.030   -28.000 1.00 43.99 ? 561 HOH A O   1 
HETATM 3020 O O   . HOH D 4 .   ? -5.359  5.119   -3.627  1.00 34.12 ? 562 HOH A O   1 
HETATM 3021 O O   . HOH D 4 .   ? 17.430  32.228  4.523   1.00 70.26 ? 563 HOH A O   1 
HETATM 3022 O O   . HOH D 4 .   ? 13.962  12.055  -5.643  1.00 22.59 ? 564 HOH A O   1 
HETATM 3023 O O   . HOH D 4 .   ? 10.289  16.951  12.544  1.00 26.39 ? 565 HOH A O   1 
HETATM 3024 O O   . HOH D 4 .   ? -2.985  1.918   -13.921 1.00 23.19 ? 566 HOH A O   1 
HETATM 3025 O O   . HOH D 4 .   ? -6.647  -0.640  -12.127 1.00 35.12 ? 567 HOH A O   1 
HETATM 3026 O O   . HOH D 4 .   ? -12.823 26.128  1.540   1.00 46.78 ? 568 HOH A O   1 
HETATM 3027 O O   . HOH D 4 .   ? 4.594   29.725  -8.800  1.00 33.06 ? 569 HOH A O   1 
HETATM 3028 O O   . HOH D 4 .   ? 26.967  14.443  -8.559  1.00 33.62 ? 570 HOH A O   1 
HETATM 3029 O O   . HOH D 4 .   ? 14.469  -23.742 7.258   1.00 52.23 ? 571 HOH A O   1 
HETATM 3030 O O   . HOH D 4 .   ? 33.695  -9.076  -4.953  1.00 40.51 ? 572 HOH A O   1 
HETATM 3031 O O   . HOH D 4 .   ? 13.640  -6.883  20.023  1.00 37.47 ? 573 HOH A O   1 
HETATM 3032 O O   . HOH D 4 .   ? 5.150   26.724  -12.188 1.00 26.55 ? 574 HOH A O   1 
HETATM 3033 O O   . HOH D 4 .   ? 25.545  -10.547 6.752   1.00 28.43 ? 575 HOH A O   1 
HETATM 3034 O O   . HOH D 4 .   ? -5.634  23.180  -4.505  1.00 45.36 ? 576 HOH A O   1 
HETATM 3035 O O   . HOH D 4 .   ? 15.886  29.120  -15.079 1.00 28.26 ? 577 HOH A O   1 
HETATM 3036 O O   . HOH D 4 .   ? 18.786  -14.513 14.216  1.00 23.69 ? 578 HOH A O   1 
HETATM 3037 O O   . HOH D 4 .   ? 6.371   14.321  -19.000 1.00 36.74 ? 579 HOH A O   1 
HETATM 3038 O O   . HOH D 4 .   ? 29.373  23.298  -6.151  1.00 29.92 ? 580 HOH A O   1 
HETATM 3039 O O   . HOH D 4 .   ? 22.561  -15.146 -14.559 1.00 42.57 ? 581 HOH A O   1 
HETATM 3040 O O   . HOH D 4 .   ? 6.308   30.910  -6.482  1.00 32.93 ? 582 HOH A O   1 
HETATM 3041 O O   . HOH D 4 .   ? 17.969  2.516   -19.807 1.00 30.15 ? 583 HOH A O   1 
HETATM 3042 O O   . HOH D 4 .   ? 29.902  2.714   13.002  1.00 55.93 ? 584 HOH A O   1 
HETATM 3043 O O   . HOH D 4 .   ? 10.655  24.440  -15.516 1.00 26.94 ? 585 HOH A O   1 
HETATM 3044 O O   . HOH D 4 .   ? 17.004  -6.579  -22.860 1.00 46.27 ? 586 HOH A O   1 
HETATM 3045 O O   . HOH D 4 .   ? 18.010  16.429  -3.861  1.00 30.04 ? 587 HOH A O   1 
HETATM 3046 O O   . HOH D 4 .   ? -5.968  1.613   -6.595  1.00 37.27 ? 588 HOH A O   1 
HETATM 3047 O O   . HOH D 4 .   ? 19.524  28.099  -13.027 1.00 39.98 ? 589 HOH A O   1 
HETATM 3048 O O   . HOH D 4 .   ? 16.829  15.413  -18.149 1.00 28.44 ? 590 HOH A O   1 
HETATM 3049 O O   . HOH D 4 .   ? -2.922  9.843   -8.575  1.00 45.17 ? 591 HOH A O   1 
HETATM 3050 O O   . HOH D 4 .   ? 9.337   -25.529 8.662   1.00 36.57 ? 592 HOH A O   1 
HETATM 3051 O O   . HOH D 4 .   ? 28.119  2.664   6.482   1.00 36.27 ? 593 HOH A O   1 
HETATM 3052 O O   . HOH D 4 .   ? -3.587  -12.255 -7.550  1.00 33.12 ? 594 HOH A O   1 
HETATM 3053 O O   . HOH D 4 .   ? 8.676   28.649  7.684   1.00 51.82 ? 595 HOH A O   1 
HETATM 3054 O O   . HOH D 4 .   ? -10.812 -15.453 -4.340  1.00 43.34 ? 596 HOH A O   1 
HETATM 3055 O O   . HOH D 4 .   ? 23.071  -20.471 -8.580  1.00 31.67 ? 597 HOH A O   1 
HETATM 3056 O O   . HOH D 4 .   ? 17.741  15.813  0.988   1.00 42.78 ? 598 HOH A O   1 
HETATM 3057 O O   . HOH D 4 .   ? -5.859  25.580  -0.315  1.00 44.66 ? 599 HOH A O   1 
HETATM 3058 O O   . HOH D 4 .   ? 36.010  -8.565  -3.749  1.00 43.96 ? 600 HOH A O   1 
HETATM 3059 O O   . HOH D 4 .   ? 1.721   2.814   16.055  1.00 28.99 ? 601 HOH A O   1 
HETATM 3060 O O   . HOH D 4 .   ? 18.139  19.123  -19.099 1.00 39.15 ? 602 HOH A O   1 
HETATM 3061 O O   . HOH D 4 .   ? -7.986  -8.122  -21.207 1.00 54.29 ? 603 HOH A O   1 
HETATM 3062 O O   . HOH D 4 .   ? 12.741  31.925  3.090   1.00 47.01 ? 604 HOH A O   1 
HETATM 3063 O O   . HOH D 4 .   ? 1.124   -19.550 3.877   1.00 35.28 ? 605 HOH A O   1 
HETATM 3064 O O   . HOH D 4 .   ? 22.028  19.449  0.833   1.00 44.31 ? 606 HOH A O   1 
HETATM 3065 O O   . HOH D 4 .   ? 5.314   8.336   19.686  1.00 47.65 ? 607 HOH A O   1 
HETATM 3066 O O   . HOH D 4 .   ? 27.901  19.553  -10.454 1.00 46.02 ? 608 HOH A O   1 
HETATM 3067 O O   . HOH D 4 .   ? -0.396  22.378  -16.628 1.00 37.97 ? 609 HOH A O   1 
HETATM 3068 O O   . HOH D 4 .   ? 8.824   24.824  11.563  1.00 50.13 ? 610 HOH A O   1 
HETATM 3069 O O   . HOH D 4 .   ? 31.512  -14.803 -5.520  1.00 56.03 ? 611 HOH A O   1 
HETATM 3070 O O   . HOH D 4 .   ? 13.401  13.475  18.602  1.00 50.83 ? 612 HOH A O   1 
HETATM 3071 O O   . HOH D 4 .   ? 21.163  27.339  -11.101 1.00 33.73 ? 613 HOH A O   1 
HETATM 3072 O O   . HOH D 4 .   ? -0.151  6.037   -6.771  1.00 23.68 ? 614 HOH A O   1 
HETATM 3073 O O   . HOH D 4 .   ? 25.329  -0.962  -11.900 1.00 30.82 ? 615 HOH A O   1 
HETATM 3074 O O   . HOH D 4 .   ? 1.192   -10.901 13.433  1.00 48.85 ? 616 HOH A O   1 
HETATM 3075 O O   . HOH D 4 .   ? 23.440  17.952  -13.682 1.00 36.34 ? 617 HOH A O   1 
HETATM 3076 O O   . HOH D 4 .   ? -12.089 16.858  3.351   1.00 64.64 ? 618 HOH A O   1 
HETATM 3077 O O   . HOH D 4 .   ? 18.095  14.670  -6.222  1.00 35.79 ? 619 HOH A O   1 
HETATM 3078 O O   . HOH D 4 .   ? 24.413  -4.851  -21.096 1.00 52.71 ? 620 HOH A O   1 
HETATM 3079 O O   . HOH D 4 .   ? 22.957  23.377  -9.573  1.00 31.98 ? 621 HOH A O   1 
HETATM 3080 O O   . HOH D 4 .   ? 33.007  -12.029 -2.312  1.00 39.25 ? 622 HOH A O   1 
HETATM 3081 O O   . HOH D 4 .   ? 32.628  1.314   1.499   1.00 50.96 ? 623 HOH A O   1 
HETATM 3082 O O   . HOH D 4 .   ? 12.016  11.313  -17.468 1.00 27.29 ? 624 HOH A O   1 
HETATM 3083 O O   . HOH D 4 .   ? 9.096   -4.727  -19.161 1.00 38.12 ? 625 HOH A O   1 
HETATM 3084 O O   . HOH D 4 .   ? 31.104  -3.685  -17.081 1.00 48.71 ? 626 HOH A O   1 
HETATM 3085 O O   . HOH D 4 .   ? 8.964   -2.229  21.933  1.00 31.49 ? 627 HOH A O   1 
HETATM 3086 O O   . HOH D 4 .   ? -0.499  -0.664  17.664  1.00 52.97 ? 628 HOH A O   1 
HETATM 3087 O O   . HOH D 4 .   ? 6.257   7.313   -24.145 1.00 30.26 ? 629 HOH A O   1 
HETATM 3088 O O   . HOH D 4 .   ? 15.961  -25.948 4.463   1.00 42.35 ? 630 HOH A O   1 
HETATM 3089 O O   . HOH D 4 .   ? 3.235   1.427   17.885  1.00 54.58 ? 631 HOH A O   1 
HETATM 3090 O O   . HOH D 4 .   ? 28.841  2.169   9.897   1.00 44.82 ? 632 HOH A O   1 
HETATM 3091 O O   . HOH D 4 .   ? -5.026  12.614  -23.023 1.00 50.98 ? 633 HOH A O   1 
HETATM 3092 O O   . HOH D 4 .   ? 1.508   15.744  -11.505 1.00 27.67 ? 634 HOH A O   1 
HETATM 3093 O O   . HOH D 4 .   ? 6.096   13.919  -21.496 1.00 33.89 ? 635 HOH A O   1 
HETATM 3094 O O   . HOH D 4 .   ? 11.147  32.049  0.431   1.00 38.79 ? 636 HOH A O   1 
HETATM 3095 O O   . HOH D 4 .   ? -0.739  14.626  -10.127 1.00 36.68 ? 637 HOH A O   1 
HETATM 3096 O O   . HOH D 4 .   ? -13.527 22.350  0.539   1.00 33.47 ? 638 HOH A O   1 
HETATM 3097 O O   . HOH D 4 .   ? 4.343   24.044  -15.961 1.00 35.28 ? 639 HOH A O   1 
HETATM 3098 O O   . HOH D 4 .   ? 5.904   3.684   -25.106 1.00 42.99 ? 640 HOH A O   1 
HETATM 3099 O O   . HOH D 4 .   ? 12.716  8.309   6.173   1.00 60.04 ? 641 HOH A O   1 
HETATM 3100 O O   . HOH D 4 .   ? 10.834  9.034   8.723   1.00 27.32 ? 642 HOH A O   1 
HETATM 3101 O O   . HOH D 4 .   ? 4.235   27.034  -5.753  1.00 29.21 ? 643 HOH A O   1 
HETATM 3102 O O   . HOH D 4 .   ? 6.066   28.787  -4.425  1.00 30.78 ? 644 HOH A O   1 
HETATM 3103 O O   . HOH D 4 .   ? 12.319  13.106  0.322   1.00 26.20 ? 645 HOH A O   1 
HETATM 3104 O O   . HOH D 4 .   ? -2.587  0.510   1.515   1.00 19.69 ? 646 HOH A O   1 
HETATM 3105 O O   . HOH D 4 .   ? 8.267   -9.388  -13.075 1.00 29.44 ? 647 HOH A O   1 
HETATM 3106 O O   . HOH D 4 .   ? -3.271  4.361   -13.882 1.00 18.36 ? 648 HOH A O   1 
HETATM 3107 O O   . HOH D 4 .   ? 14.388  9.145   6.573   1.00 48.97 ? 649 HOH A O   1 
HETATM 3108 O O   . HOH D 4 .   ? -2.708  8.207   -11.393 1.00 24.39 ? 650 HOH A O   1 
HETATM 3109 O O   . HOH D 4 .   ? 1.436   26.369  -9.105  1.00 24.71 ? 651 HOH A O   1 
HETATM 3110 O O   . HOH D 4 .   ? 6.126   26.347  3.463   1.00 44.92 ? 652 HOH A O   1 
HETATM 3111 O O   . HOH D 4 .   ? 16.071  -3.639  15.908  1.00 21.48 ? 653 HOH A O   1 
HETATM 3112 O O   . HOH D 4 .   ? 9.024   29.224  -11.320 1.00 40.59 ? 654 HOH A O   1 
HETATM 3113 O O   . HOH D 4 .   ? -5.660  11.694  0.435   1.00 35.76 ? 655 HOH A O   1 
HETATM 3114 O O   . HOH D 4 .   ? 7.432   5.433   -25.611 1.00 27.85 ? 656 HOH A O   1 
HETATM 3115 O O   . HOH D 4 .   ? 16.851  28.546  -5.588  1.00 30.63 ? 657 HOH A O   1 
HETATM 3116 O O   . HOH D 4 .   ? 19.864  9.445   -14.913 1.00 27.04 ? 658 HOH A O   1 
HETATM 3117 O O   . HOH D 4 .   ? -2.646  16.317  -9.409  1.00 33.28 ? 659 HOH A O   1 
HETATM 3118 O O   . HOH D 4 .   ? 27.935  4.219   -0.730  1.00 35.68 ? 660 HOH A O   1 
HETATM 3119 O O   . HOH D 4 .   ? 27.030  26.629  -6.556  1.00 43.03 ? 661 HOH A O   1 
HETATM 3120 O O   . HOH D 4 .   ? 18.638  25.946  -17.159 1.00 36.40 ? 662 HOH A O   1 
HETATM 3121 O O   . HOH D 4 .   ? 22.113  4.180   -20.316 1.00 29.88 ? 663 HOH A O   1 
HETATM 3122 O O   . HOH D 4 .   ? 3.849   0.465   -24.235 1.00 30.81 ? 664 HOH A O   1 
HETATM 3123 O O   . HOH D 4 .   ? -0.908  -14.253 -11.360 1.00 42.78 ? 665 HOH A O   1 
HETATM 3124 O O   . HOH D 4 .   ? 7.801   -24.476 6.329   1.00 42.28 ? 666 HOH A O   1 
HETATM 3125 O O   . HOH D 4 .   ? 17.055  15.169  10.757  1.00 50.85 ? 667 HOH A O   1 
HETATM 3126 O O   . HOH D 4 .   ? 21.513  -21.295 6.778   1.00 33.23 ? 668 HOH A O   1 
HETATM 3127 O O   . HOH D 4 .   ? -13.092 18.954  2.776   1.00 42.37 ? 669 HOH A O   1 
HETATM 3128 O O   . HOH D 4 .   ? -1.255  25.215  -15.544 1.00 35.81 ? 670 HOH A O   1 
HETATM 3129 O O   . HOH D 4 .   ? 16.453  -13.508 14.047  1.00 32.55 ? 671 HOH A O   1 
HETATM 3130 O O   . HOH D 4 .   ? 25.100  -16.271 -12.549 1.00 41.47 ? 672 HOH A O   1 
HETATM 3131 O O   . HOH D 4 .   ? 6.581   -16.933 12.925  1.00 35.98 ? 673 HOH A O   1 
HETATM 3132 O O   . HOH D 4 .   ? 17.479  21.124  0.950   1.00 47.03 ? 674 HOH A O   1 
HETATM 3133 O O   . HOH D 4 .   ? -12.868 2.738   -20.828 1.00 48.48 ? 675 HOH A O   1 
HETATM 3134 O O   . HOH D 4 .   ? 26.061  -11.183 -10.973 1.00 38.20 ? 676 HOH A O   1 
HETATM 3135 O O   . HOH D 4 .   ? 13.557  -11.996 -11.138 1.00 37.57 ? 677 HOH A O   1 
HETATM 3136 O O   . HOH D 4 .   ? 15.868  -8.142  15.513  1.00 44.50 ? 678 HOH A O   1 
HETATM 3137 O O   . HOH D 4 .   ? -6.043  28.141  0.390   1.00 36.05 ? 679 HOH A O   1 
HETATM 3138 O O   . HOH D 4 .   ? -4.301  -13.997 3.108   1.00 38.36 ? 680 HOH A O   1 
HETATM 3139 O O   . HOH D 4 .   ? 14.425  5.924   -4.054  1.00 46.90 ? 681 HOH A O   1 
HETATM 3140 O O   . HOH D 4 .   ? 21.699  17.096  -17.713 1.00 37.30 ? 682 HOH A O   1 
HETATM 3141 O O   . HOH D 4 .   ? -2.965  20.256  11.590  1.00 41.32 ? 683 HOH A O   1 
HETATM 3142 O O   . HOH D 4 .   ? 3.413   27.166  5.897   1.00 44.52 ? 684 HOH A O   1 
HETATM 3143 O O   . HOH D 4 .   ? 2.407   -0.938  18.622  1.00 61.88 ? 685 HOH A O   1 
HETATM 3144 O O   . HOH D 4 .   ? 19.782  13.610  -15.810 1.00 21.25 ? 686 HOH A O   1 
HETATM 3145 O O   . HOH D 4 .   ? 21.483  3.273   -17.875 1.00 30.63 ? 687 HOH A O   1 
HETATM 3146 O O   . HOH D 4 .   ? 10.603  -17.342 11.390  1.00 30.72 ? 688 HOH A O   1 
HETATM 3147 O O   . HOH D 4 .   ? 4.682   -1.006  -27.382 1.00 56.03 ? 689 HOH A O   1 
HETATM 3148 O O   . HOH D 4 .   ? -2.676  25.216  -10.269 1.00 40.42 ? 690 HOH A O   1 
HETATM 3149 O O   . HOH D 4 .   ? -6.318  9.426   4.333   1.00 40.93 ? 691 HOH A O   1 
HETATM 3150 O O   . HOH D 4 .   ? 15.067  -18.439 17.691  1.00 36.18 ? 692 HOH A O   1 
HETATM 3151 O O   . HOH D 4 .   ? 32.291  -11.611 -8.828  1.00 39.68 ? 693 HOH A O   1 
HETATM 3152 O O   . HOH D 4 .   ? 23.291  -14.105 8.366   1.00 34.91 ? 694 HOH A O   1 
HETATM 3153 O O   . HOH D 4 .   ? 9.236   -20.792 -14.817 1.00 55.59 ? 695 HOH A O   1 
HETATM 3154 O O   . HOH D 4 .   ? 0.351   -3.901  18.486  1.00 46.82 ? 696 HOH A O   1 
HETATM 3155 O O   . HOH D 4 .   ? 19.752  25.601  -19.745 1.00 43.39 ? 697 HOH A O   1 
HETATM 3156 O O   . HOH D 4 .   ? 6.688   -24.093 -3.192  1.00 35.32 ? 698 HOH A O   1 
HETATM 3157 O O   . HOH D 4 .   ? 6.379   -8.282  -16.496 1.00 38.95 ? 699 HOH A O   1 
HETATM 3158 O O   . HOH D 4 .   ? -8.328  -2.149  4.915   1.00 68.83 ? 700 HOH A O   1 
HETATM 3159 O O   . HOH D 4 .   ? 15.314  26.181  -2.205  1.00 41.15 ? 701 HOH A O   1 
HETATM 3160 O O   . HOH D 4 .   ? 9.104   6.342   14.827  1.00 39.51 ? 702 HOH A O   1 
HETATM 3161 O O   . HOH D 4 .   ? 25.289  22.662  -10.408 1.00 37.08 ? 703 HOH A O   1 
HETATM 3162 O O   . HOH D 4 .   ? 1.536   7.132   17.787  1.00 44.78 ? 704 HOH A O   1 
HETATM 3163 O O   . HOH D 4 .   ? -5.956  17.673  13.237  1.00 50.42 ? 705 HOH A O   1 
HETATM 3164 O O   . HOH D 4 .   ? 28.791  20.872  -8.006  1.00 50.65 ? 706 HOH A O   1 
HETATM 3165 O O   . HOH D 4 .   ? 10.890  -11.418 -16.400 1.00 51.58 ? 707 HOH A O   1 
HETATM 3166 O O   . HOH D 4 .   ? 15.554  11.643  12.432  1.00 44.13 ? 708 HOH A O   1 
HETATM 3167 O O   . HOH D 4 .   ? 4.398   -20.849 -11.899 1.00 48.52 ? 709 HOH A O   1 
HETATM 3168 O O   . HOH D 4 .   ? -0.453  -15.244 -16.898 1.00 55.28 ? 710 HOH A O   1 
HETATM 3169 O O   . HOH D 4 .   ? 6.232   29.786  -11.165 1.00 57.95 ? 711 HOH A O   1 
HETATM 3170 O O   . HOH D 4 .   ? 7.129   4.353   14.731  1.00 35.20 ? 712 HOH A O   1 
HETATM 3171 O O   . HOH D 4 .   ? 27.775  -0.169  -11.866 1.00 44.32 ? 713 HOH A O   1 
HETATM 3172 O O   . HOH D 4 .   ? -5.536  1.706   -12.888 1.00 44.11 ? 714 HOH A O   1 
HETATM 3173 O O   . HOH D 4 .   ? 3.992   2.875   -24.579 1.00 39.94 ? 715 HOH A O   1 
HETATM 3174 O O   . HOH D 4 .   ? 31.473  -7.033  -13.783 1.00 34.89 ? 716 HOH A O   1 
HETATM 3175 O O   . HOH D 4 .   ? 11.790  -23.955 -7.987  1.00 51.53 ? 717 HOH A O   1 
HETATM 3176 O O   . HOH D 4 .   ? 17.770  13.772  2.115   1.00 42.19 ? 718 HOH A O   1 
HETATM 3177 O O   . HOH D 4 .   ? 14.177  10.010  -3.630  1.00 37.02 ? 719 HOH A O   1 
HETATM 3178 O O   . HOH D 4 .   ? 16.606  6.852   -15.974 1.00 32.09 ? 720 HOH A O   1 
HETATM 3179 O O   . HOH D 4 .   ? 16.431  -0.708  -1.563  1.00 21.37 ? 721 HOH A O   1 
HETATM 3180 O O   . HOH D 4 .   ? 0.310   -3.850  9.667   1.00 30.09 ? 722 HOH A O   1 
HETATM 3181 O O   . HOH D 4 .   ? -4.122  12.804  2.477   1.00 22.24 ? 723 HOH A O   1 
HETATM 3182 O O   . HOH D 4 .   ? 4.361   22.783  -13.591 1.00 25.24 ? 724 HOH A O   1 
HETATM 3183 O O   . HOH D 4 .   ? 19.824  13.616  -0.885  1.00 41.88 ? 725 HOH A O   1 
HETATM 3184 O O   . HOH D 4 .   ? 12.173  2.457   15.436  1.00 25.06 ? 726 HOH A O   1 
HETATM 3185 O O   . HOH D 4 .   ? 28.374  2.374   -2.717  1.00 49.48 ? 727 HOH A O   1 
HETATM 3186 O O   . HOH D 4 .   ? 19.793  25.646  -3.974  1.00 34.55 ? 728 HOH A O   1 
HETATM 3187 O O   . HOH D 4 .   ? 16.845  25.706  -6.271  1.00 37.03 ? 729 HOH A O   1 
HETATM 3188 O O   . HOH D 4 .   ? 14.088  19.940  -0.104  1.00 36.81 ? 730 HOH A O   1 
HETATM 3189 O O   . HOH D 4 .   ? 14.229  23.084  -0.970  1.00 31.71 ? 731 HOH A O   1 
HETATM 3190 O O   . HOH D 4 .   ? 24.780  -3.142  6.481   1.00 41.33 ? 732 HOH A O   1 
HETATM 3191 O O   . HOH E 4 .   ? 23.572  1.589   13.401  1.00 25.65 ? 25  HOH I O   1 
HETATM 3192 O O   . HOH E 4 .   ? 19.952  -13.646 18.715  1.00 39.95 ? 26  HOH I O   1 
HETATM 3193 O O   . HOH E 4 .   ? 17.676  6.610   11.317  1.00 37.48 ? 27  HOH I O   1 
HETATM 3194 O O   . HOH E 4 .   ? 17.198  1.394   14.346  1.00 26.21 ? 28  HOH I O   1 
HETATM 3195 O O   . HOH E 4 .   ? 21.779  -0.110  16.867  1.00 23.54 ? 29  HOH I O   1 
HETATM 3196 O O   . HOH E 4 .   ? 22.679  3.761   10.916  1.00 23.72 ? 30  HOH I O   1 
HETATM 3197 O O   . HOH E 4 .   ? 22.573  -15.801 15.759  1.00 27.92 ? 31  HOH I O   1 
HETATM 3198 O O   . HOH E 4 .   ? 16.759  5.149   13.305  1.00 54.06 ? 32  HOH I O   1 
HETATM 3199 O O   . HOH E 4 .   ? 16.598  -4.457  18.659  1.00 31.94 ? 33  HOH I O   1 
HETATM 3200 O O   . HOH E 4 .   ? 23.421  3.873   7.014   1.00 42.45 ? 34  HOH I O   1 
HETATM 3201 O O   . HOH E 4 .   ? 24.574  8.724   2.248   1.00 45.73 ? 35  HOH I O   1 
HETATM 3202 O O   . HOH E 4 .   ? 23.044  5.018   4.637   1.00 33.97 ? 36  HOH I O   1 
HETATM 3203 O O   . HOH E 4 .   ? 18.156  -15.747 18.496  1.00 44.41 ? 37  HOH I O   1 
HETATM 3204 O O   . HOH E 4 .   ? 19.779  8.600   0.260   1.00 49.25 ? 38  HOH I O   1 
HETATM 3205 O O   . HOH E 4 .   ? 24.516  7.134   -0.108  1.00 42.25 ? 39  HOH I O   1 
HETATM 3206 O O   . HOH E 4 .   ? 15.772  -13.597 19.881  1.00 39.49 ? 40  HOH I O   1 
HETATM 3207 O O   . HOH E 4 .   ? 25.254  -3.439  9.284   1.00 44.33 ? 41  HOH I O   1 
HETATM 3208 O O   . HOH E 4 .   ? 25.894  4.403   1.008   1.00 49.11 ? 42  HOH I O   1 
HETATM 3209 O O   . HOH E 4 .   ? 26.584  9.669   -0.226  1.00 50.44 ? 43  HOH I O   1 
HETATM 3210 O O   . HOH E 4 .   ? 16.818  -10.795 19.357  1.00 54.87 ? 44  HOH I O   1 
HETATM 3211 O O   . HOH E 4 .   ? 23.536  3.793   2.054   1.00 22.29 ? 45  HOH I O   1 
HETATM 3212 O O   . HOH E 4 .   ? 10.207  8.011   10.904  1.00 37.33 ? 46  HOH I O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   ?   ?   ?   A . n 
A 1 2   ASN 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   ALA 5   5   ?   ?   ?   A . n 
A 1 6   ALA 6   6   ?   ?   ?   A . n 
A 1 7   LYS 7   7   ?   ?   ?   A . n 
A 1 8   LYS 8   8   ?   ?   ?   A . n 
A 1 9   GLY 9   9   ?   ?   ?   A . n 
A 1 10  SER 10  10  ?   ?   ?   A . n 
A 1 11  GLU 11  11  ?   ?   ?   A . n 
A 1 12  GLN 12  12  ?   ?   ?   A . n 
A 1 13  GLU 13  13  ?   ?   ?   A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  TRP 30  30  30  TRP TRP A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  HIS 39  39  39  HIS HIS A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  PHE 54  54  54  PHE PHE A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  MET 58  58  58  MET MET A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  HIS 62  62  62  HIS HIS A . n 
A 1 63  MET 63  63  63  MET MET A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  HIS 68  68  68  HIS HIS A . n 
A 1 69  TYR 69  69  69  TYR TYR A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  MET 71  71  71  MET MET A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 PHE 100 100 100 PHE PHE A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 MET 118 118 118 MET MET A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 MET 120 120 120 MET MET A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 MET 128 128 128 MET MET A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 HIS 131 131 131 HIS HIS A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 PHE 138 138 138 PHE PHE A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 HIS 142 142 142 HIS HIS A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 PHE 154 154 154 PHE PHE A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 TYR 156 156 156 TYR TYR A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 GLN 177 177 177 GLN GLN A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 LYS 189 189 189 LYS LYS A . n 
A 1 190 ARG 190 190 190 ARG ARG A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 TRP 196 196 196 TRP TRP A . n 
A 1 197 TPO 197 197 197 TPO TPO A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 CYS 199 199 199 CYS CYS A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 PRO 207 207 207 PRO PRO A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 ILE 209 209 209 ILE ILE A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 LYS 213 213 213 LYS LYS A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 TYR 215 215 215 TYR TYR A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 LYS 217 217 217 LYS LYS A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 TRP 221 221 221 TRP TRP A . n 
A 1 222 TRP 222 222 222 TRP TRP A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 ALA 233 233 233 ALA ALA A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 TYR 235 235 235 TYR TYR A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 PHE 238 238 238 PHE PHE A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 ALA 240 240 240 ALA ALA A . n 
A 1 241 ASP 241 241 241 ASP ASP A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 GLN 245 245 245 GLN GLN A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 TYR 247 247 247 TYR TYR A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 LYS 254 254 254 LYS LYS A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 PHE 257 257 257 PHE PHE A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 SER 259 259 259 SER SER A . n 
A 1 260 HIS 260 260 260 HIS HIS A . n 
A 1 261 PHE 261 261 261 PHE PHE A . n 
A 1 262 SER 262 262 262 SER SER A . n 
A 1 263 SER 263 263 263 SER SER A . n 
A 1 264 ASP 264 264 264 ASP ASP A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 LYS 266 266 266 LYS LYS A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ARG 270 270 270 ARG ARG A . n 
A 1 271 ASN 271 271 271 ASN ASN A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 GLN 274 274 274 GLN GLN A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 LEU 277 277 277 LEU LEU A . n 
A 1 278 THR 278 278 278 THR THR A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 ARG 280 280 280 ARG ARG A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 ASN 283 283 283 ASN ASN A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 LYS 285 285 285 LYS LYS A . n 
A 1 286 ASN 286 286 286 ASN ASN A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 ASN 289 289 289 ASN ASN A . n 
A 1 290 ASP 290 290 290 ASP ASP A . n 
A 1 291 ILE 291 291 291 ILE ILE A . n 
A 1 292 LYS 292 292 292 LYS LYS A . n 
A 1 293 ASN 293 293 293 ASN ASN A . n 
A 1 294 HIS 294 294 294 HIS HIS A . n 
A 1 295 LYS 295 295 295 LYS LYS A . n 
A 1 296 TRP 296 296 296 TRP TRP A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 TRP 302 302 302 TRP TRP A . n 
A 1 303 ILE 303 303 303 ILE ILE A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 TYR 306 306 306 TYR TYR A . n 
A 1 307 GLN 307 307 307 GLN GLN A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 LYS 309 309 309 LYS LYS A . n 
A 1 310 VAL 310 310 310 VAL VAL A . n 
A 1 311 GLU 311 311 311 GLU GLU A . n 
A 1 312 ALA 312 312 312 ALA ALA A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 ILE 315 315 315 ILE ILE A . n 
A 1 316 PRO 316 316 316 PRO PRO A . n 
A 1 317 LYS 317 317 317 LYS LYS A . n 
A 1 318 PHE 318 318 318 PHE PHE A . n 
A 1 319 LYS 319 319 319 LYS LYS A . n 
A 1 320 GLY 320 320 320 GLY GLY A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 THR 324 324 324 THR THR A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 ASN 326 326 326 ASN ASN A . n 
A 1 327 PHE 327 327 327 PHE PHE A . n 
A 1 328 ASP 328 328 328 ASP ASP A . n 
A 1 329 ASP 329 329 329 ASP ASP A . n 
A 1 330 TYR 330 330 330 TYR TYR A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 GLU 332 332 332 GLU GLU A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 ILE 335 335 335 ILE ILE A . n 
A 1 336 ARG 336 336 336 ARG ARG A . n 
A 1 337 VAL 337 337 337 VAL VAL A . n 
A 1 338 SEP 338 338 338 SEP SEP A . n 
A 1 339 ILE 339 339 339 ILE ILE A . n 
A 1 340 ASN 340 340 340 ASN ASN A . n 
A 1 341 GLU 341 341 341 GLU GLU A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 CYS 343 343 343 CYS CYS A . n 
A 1 344 GLY 344 344 344 GLY GLY A . n 
A 1 345 LYS 345 345 345 LYS LYS A . n 
A 1 346 GLU 346 346 346 GLU GLU A . n 
A 1 347 PHE 347 347 347 PHE PHE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 GLU 349 349 349 GLU GLU A . n 
A 1 350 PHE 350 350 350 PHE PHE A . n 
B 2 1   THR 1   5   5   THR THR I . n 
B 2 2   THR 2   6   6   THR THR I . n 
B 2 3   TYR 3   7   7   TYR TYR I . n 
B 2 4   ALA 4   8   8   ALA ALA I . n 
B 2 5   ASP 5   9   9   ASP ASP I . n 
B 2 6   PHE 6   10  10  PHE PHE I . n 
B 2 7   ILE 7   11  11  ILE ILE I . n 
B 2 8   ALA 8   12  12  ALA ALA I . n 
B 2 9   SER 9   13  13  SER SER I . n 
B 2 10  GLY 10  14  14  GLY GLY I . n 
B 2 11  ARG 11  15  15  ARG ARG I . n 
B 2 12  THR 12  16  16  THR THR I . n 
B 2 13  GLY 13  17  17  GLY GLY I . n 
B 2 14  ARG 14  18  18  ARG ARG I . n 
B 2 15  ARG 15  19  19  ARG ARG I . n 
B 2 16  ASN 16  20  20  ASN ASN I . n 
B 2 17  ALA 17  21  21  ALA ALA I . n 
B 2 18  ILE 18  22  22  ILE ILE I . n 
B 2 19  HIS 19  23  23  HIS HIS I . n 
B 2 20  ASP 20  24  24  ASP ASP I . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 Y27 1   501 1   Y27 Y27 A . 
D 4 HOH 1   502 1   HOH HOH A . 
D 4 HOH 2   503 2   HOH HOH A . 
D 4 HOH 3   504 3   HOH HOH A . 
D 4 HOH 4   505 4   HOH HOH A . 
D 4 HOH 5   506 5   HOH HOH A . 
D 4 HOH 6   507 6   HOH HOH A . 
D 4 HOH 7   508 7   HOH HOH A . 
D 4 HOH 8   509 8   HOH HOH A . 
D 4 HOH 9   510 9   HOH HOH A . 
D 4 HOH 10  511 10  HOH HOH A . 
D 4 HOH 11  512 11  HOH HOH A . 
D 4 HOH 12  513 12  HOH HOH A . 
D 4 HOH 13  514 13  HOH HOH A . 
D 4 HOH 14  515 14  HOH HOH A . 
D 4 HOH 15  516 15  HOH HOH A . 
D 4 HOH 16  517 16  HOH HOH A . 
D 4 HOH 17  518 18  HOH HOH A . 
D 4 HOH 18  519 19  HOH HOH A . 
D 4 HOH 19  520 20  HOH HOH A . 
D 4 HOH 20  521 21  HOH HOH A . 
D 4 HOH 21  522 22  HOH HOH A . 
D 4 HOH 22  523 23  HOH HOH A . 
D 4 HOH 23  524 24  HOH HOH A . 
D 4 HOH 24  525 25  HOH HOH A . 
D 4 HOH 25  526 26  HOH HOH A . 
D 4 HOH 26  527 27  HOH HOH A . 
D 4 HOH 27  528 28  HOH HOH A . 
D 4 HOH 28  529 29  HOH HOH A . 
D 4 HOH 29  530 30  HOH HOH A . 
D 4 HOH 30  531 32  HOH HOH A . 
D 4 HOH 31  532 33  HOH HOH A . 
D 4 HOH 32  533 35  HOH HOH A . 
D 4 HOH 33  534 37  HOH HOH A . 
D 4 HOH 34  535 38  HOH HOH A . 
D 4 HOH 35  536 39  HOH HOH A . 
D 4 HOH 36  537 40  HOH HOH A . 
D 4 HOH 37  538 41  HOH HOH A . 
D 4 HOH 38  539 42  HOH HOH A . 
D 4 HOH 39  540 43  HOH HOH A . 
D 4 HOH 40  541 46  HOH HOH A . 
D 4 HOH 41  542 47  HOH HOH A . 
D 4 HOH 42  543 48  HOH HOH A . 
D 4 HOH 43  544 49  HOH HOH A . 
D 4 HOH 44  545 50  HOH HOH A . 
D 4 HOH 45  546 51  HOH HOH A . 
D 4 HOH 46  547 52  HOH HOH A . 
D 4 HOH 47  548 53  HOH HOH A . 
D 4 HOH 48  549 54  HOH HOH A . 
D 4 HOH 49  550 55  HOH HOH A . 
D 4 HOH 50  551 56  HOH HOH A . 
D 4 HOH 51  552 57  HOH HOH A . 
D 4 HOH 52  553 58  HOH HOH A . 
D 4 HOH 53  554 59  HOH HOH A . 
D 4 HOH 54  555 60  HOH HOH A . 
D 4 HOH 55  556 61  HOH HOH A . 
D 4 HOH 56  557 62  HOH HOH A . 
D 4 HOH 57  558 63  HOH HOH A . 
D 4 HOH 58  559 64  HOH HOH A . 
D 4 HOH 59  560 65  HOH HOH A . 
D 4 HOH 60  561 66  HOH HOH A . 
D 4 HOH 61  562 67  HOH HOH A . 
D 4 HOH 62  563 68  HOH HOH A . 
D 4 HOH 63  564 69  HOH HOH A . 
D 4 HOH 64  565 70  HOH HOH A . 
D 4 HOH 65  566 71  HOH HOH A . 
D 4 HOH 66  567 72  HOH HOH A . 
D 4 HOH 67  568 73  HOH HOH A . 
D 4 HOH 68  569 74  HOH HOH A . 
D 4 HOH 69  570 75  HOH HOH A . 
D 4 HOH 70  571 76  HOH HOH A . 
D 4 HOH 71  572 77  HOH HOH A . 
D 4 HOH 72  573 78  HOH HOH A . 
D 4 HOH 73  574 80  HOH HOH A . 
D 4 HOH 74  575 81  HOH HOH A . 
D 4 HOH 75  576 82  HOH HOH A . 
D 4 HOH 76  577 83  HOH HOH A . 
D 4 HOH 77  578 84  HOH HOH A . 
D 4 HOH 78  579 85  HOH HOH A . 
D 4 HOH 79  580 87  HOH HOH A . 
D 4 HOH 80  581 88  HOH HOH A . 
D 4 HOH 81  582 89  HOH HOH A . 
D 4 HOH 82  583 90  HOH HOH A . 
D 4 HOH 83  584 91  HOH HOH A . 
D 4 HOH 84  585 92  HOH HOH A . 
D 4 HOH 85  586 94  HOH HOH A . 
D 4 HOH 86  587 95  HOH HOH A . 
D 4 HOH 87  588 96  HOH HOH A . 
D 4 HOH 88  589 97  HOH HOH A . 
D 4 HOH 89  590 98  HOH HOH A . 
D 4 HOH 90  591 99  HOH HOH A . 
D 4 HOH 91  592 100 HOH HOH A . 
D 4 HOH 92  593 101 HOH HOH A . 
D 4 HOH 93  594 102 HOH HOH A . 
D 4 HOH 94  595 103 HOH HOH A . 
D 4 HOH 95  596 104 HOH HOH A . 
D 4 HOH 96  597 105 HOH HOH A . 
D 4 HOH 97  598 106 HOH HOH A . 
D 4 HOH 98  599 107 HOH HOH A . 
D 4 HOH 99  600 108 HOH HOH A . 
D 4 HOH 100 601 109 HOH HOH A . 
D 4 HOH 101 602 111 HOH HOH A . 
D 4 HOH 102 603 112 HOH HOH A . 
D 4 HOH 103 604 113 HOH HOH A . 
D 4 HOH 104 605 114 HOH HOH A . 
D 4 HOH 105 606 115 HOH HOH A . 
D 4 HOH 106 607 117 HOH HOH A . 
D 4 HOH 107 608 118 HOH HOH A . 
D 4 HOH 108 609 119 HOH HOH A . 
D 4 HOH 109 610 121 HOH HOH A . 
D 4 HOH 110 611 122 HOH HOH A . 
D 4 HOH 111 612 123 HOH HOH A . 
D 4 HOH 112 613 124 HOH HOH A . 
D 4 HOH 113 614 125 HOH HOH A . 
D 4 HOH 114 615 126 HOH HOH A . 
D 4 HOH 115 616 128 HOH HOH A . 
D 4 HOH 116 617 129 HOH HOH A . 
D 4 HOH 117 618 130 HOH HOH A . 
D 4 HOH 118 619 133 HOH HOH A . 
D 4 HOH 119 620 134 HOH HOH A . 
D 4 HOH 120 621 135 HOH HOH A . 
D 4 HOH 121 622 136 HOH HOH A . 
D 4 HOH 122 623 137 HOH HOH A . 
D 4 HOH 123 624 138 HOH HOH A . 
D 4 HOH 124 625 139 HOH HOH A . 
D 4 HOH 125 626 140 HOH HOH A . 
D 4 HOH 126 627 141 HOH HOH A . 
D 4 HOH 127 628 142 HOH HOH A . 
D 4 HOH 128 629 143 HOH HOH A . 
D 4 HOH 129 630 144 HOH HOH A . 
D 4 HOH 130 631 145 HOH HOH A . 
D 4 HOH 131 632 147 HOH HOH A . 
D 4 HOH 132 633 148 HOH HOH A . 
D 4 HOH 133 634 150 HOH HOH A . 
D 4 HOH 134 635 151 HOH HOH A . 
D 4 HOH 135 636 152 HOH HOH A . 
D 4 HOH 136 637 153 HOH HOH A . 
D 4 HOH 137 638 154 HOH HOH A . 
D 4 HOH 138 639 155 HOH HOH A . 
D 4 HOH 139 640 156 HOH HOH A . 
D 4 HOH 140 641 157 HOH HOH A . 
D 4 HOH 141 642 158 HOH HOH A . 
D 4 HOH 142 643 159 HOH HOH A . 
D 4 HOH 143 644 160 HOH HOH A . 
D 4 HOH 144 645 161 HOH HOH A . 
D 4 HOH 145 646 162 HOH HOH A . 
D 4 HOH 146 647 163 HOH HOH A . 
D 4 HOH 147 648 165 HOH HOH A . 
D 4 HOH 148 649 167 HOH HOH A . 
D 4 HOH 149 650 168 HOH HOH A . 
D 4 HOH 150 651 170 HOH HOH A . 
D 4 HOH 151 652 171 HOH HOH A . 
D 4 HOH 152 653 172 HOH HOH A . 
D 4 HOH 153 654 174 HOH HOH A . 
D 4 HOH 154 655 175 HOH HOH A . 
D 4 HOH 155 656 176 HOH HOH A . 
D 4 HOH 156 657 177 HOH HOH A . 
D 4 HOH 157 658 178 HOH HOH A . 
D 4 HOH 158 659 179 HOH HOH A . 
D 4 HOH 159 660 180 HOH HOH A . 
D 4 HOH 160 661 181 HOH HOH A . 
D 4 HOH 161 662 183 HOH HOH A . 
D 4 HOH 162 663 185 HOH HOH A . 
D 4 HOH 163 664 186 HOH HOH A . 
D 4 HOH 164 665 187 HOH HOH A . 
D 4 HOH 165 666 188 HOH HOH A . 
D 4 HOH 166 667 190 HOH HOH A . 
D 4 HOH 167 668 191 HOH HOH A . 
D 4 HOH 168 669 192 HOH HOH A . 
D 4 HOH 169 670 193 HOH HOH A . 
D 4 HOH 170 671 195 HOH HOH A . 
D 4 HOH 171 672 197 HOH HOH A . 
D 4 HOH 172 673 198 HOH HOH A . 
D 4 HOH 173 674 199 HOH HOH A . 
D 4 HOH 174 675 200 HOH HOH A . 
D 4 HOH 175 676 202 HOH HOH A . 
D 4 HOH 176 677 203 HOH HOH A . 
D 4 HOH 177 678 204 HOH HOH A . 
D 4 HOH 178 679 205 HOH HOH A . 
D 4 HOH 179 680 206 HOH HOH A . 
D 4 HOH 180 681 207 HOH HOH A . 
D 4 HOH 181 682 208 HOH HOH A . 
D 4 HOH 182 683 209 HOH HOH A . 
D 4 HOH 183 684 210 HOH HOH A . 
D 4 HOH 184 685 211 HOH HOH A . 
D 4 HOH 185 686 212 HOH HOH A . 
D 4 HOH 186 687 214 HOH HOH A . 
D 4 HOH 187 688 215 HOH HOH A . 
D 4 HOH 188 689 216 HOH HOH A . 
D 4 HOH 189 690 217 HOH HOH A . 
D 4 HOH 190 691 219 HOH HOH A . 
D 4 HOH 191 692 221 HOH HOH A . 
D 4 HOH 192 693 223 HOH HOH A . 
D 4 HOH 193 694 224 HOH HOH A . 
D 4 HOH 194 695 225 HOH HOH A . 
D 4 HOH 195 696 226 HOH HOH A . 
D 4 HOH 196 697 227 HOH HOH A . 
D 4 HOH 197 698 229 HOH HOH A . 
D 4 HOH 198 699 230 HOH HOH A . 
D 4 HOH 199 700 231 HOH HOH A . 
D 4 HOH 200 701 232 HOH HOH A . 
D 4 HOH 201 702 233 HOH HOH A . 
D 4 HOH 202 703 235 HOH HOH A . 
D 4 HOH 203 704 236 HOH HOH A . 
D 4 HOH 204 705 237 HOH HOH A . 
D 4 HOH 205 706 238 HOH HOH A . 
D 4 HOH 206 707 239 HOH HOH A . 
D 4 HOH 207 708 240 HOH HOH A . 
D 4 HOH 208 709 242 HOH HOH A . 
D 4 HOH 209 710 243 HOH HOH A . 
D 4 HOH 210 711 244 HOH HOH A . 
D 4 HOH 211 712 245 HOH HOH A . 
D 4 HOH 212 713 246 HOH HOH A . 
D 4 HOH 213 714 247 HOH HOH A . 
D 4 HOH 214 715 248 HOH HOH A . 
D 4 HOH 215 716 249 HOH HOH A . 
D 4 HOH 216 717 250 HOH HOH A . 
D 4 HOH 217 718 251 HOH HOH A . 
D 4 HOH 218 719 252 HOH HOH A . 
D 4 HOH 219 720 254 HOH HOH A . 
D 4 HOH 220 721 255 HOH HOH A . 
D 4 HOH 221 722 266 HOH HOH A . 
D 4 HOH 222 723 267 HOH HOH A . 
D 4 HOH 223 724 268 HOH HOH A . 
D 4 HOH 224 725 269 HOH HOH A . 
D 4 HOH 225 726 270 HOH HOH A . 
D 4 HOH 226 727 272 HOH HOH A . 
D 4 HOH 227 728 273 HOH HOH A . 
D 4 HOH 228 729 274 HOH HOH A . 
D 4 HOH 229 730 275 HOH HOH A . 
D 4 HOH 230 731 276 HOH HOH A . 
D 4 HOH 231 732 277 HOH HOH A . 
E 4 HOH 1   25  17  HOH HOH I . 
E 4 HOH 2   26  34  HOH HOH I . 
E 4 HOH 3   27  36  HOH HOH I . 
E 4 HOH 4   28  44  HOH HOH I . 
E 4 HOH 5   29  45  HOH HOH I . 
E 4 HOH 6   30  79  HOH HOH I . 
E 4 HOH 7   31  86  HOH HOH I . 
E 4 HOH 8   32  110 HOH HOH I . 
E 4 HOH 9   33  131 HOH HOH I . 
E 4 HOH 10  34  132 HOH HOH I . 
E 4 HOH 11  35  146 HOH HOH I . 
E 4 HOH 12  36  164 HOH HOH I . 
E 4 HOH 13  37  173 HOH HOH I . 
E 4 HOH 14  38  189 HOH HOH I . 
E 4 HOH 15  39  201 HOH HOH I . 
E 4 HOH 16  40  213 HOH HOH I . 
E 4 HOH 17  41  220 HOH HOH I . 
E 4 HOH 18  42  228 HOH HOH I . 
E 4 HOH 19  43  234 HOH HOH I . 
E 4 HOH 20  44  241 HOH HOH I . 
E 4 HOH 21  45  253 HOH HOH I . 
E 4 HOH 22  46  271 HOH HOH I . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A TPO 197 A TPO 197 ? THR PHOSPHOTHREONINE 
2 A SEP 338 A SEP 338 ? SER PHOSPHOSERINE    
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2780  ? 
1 MORE         -11   ? 
1 'SSA (A^2)'  15960 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-05-23 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-07-24 
5 'Structure model' 1 4 2021-11-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' 'Source and taxonomy'       
6 5 'Structure model' 'Database references'       
7 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source       
2 4 'Structure model' pdbx_entity_src_syn 
3 4 'Structure model' struct_conn         
4 5 'Structure model' database_2          
5 5 'Structure model' struct_ref_seq_dif  
6 5 'Structure model' struct_site         
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline'  
2  4 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
3  4 'Structure model' '_diffrn_source.type'                       
4  4 'Structure model' '_pdbx_entity_src_syn.ncbi_taxonomy_id'     
5  4 'Structure model' '_pdbx_entity_src_syn.organism_common_name' 
6  4 'Structure model' '_pdbx_entity_src_syn.organism_scientific'  
7  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'       
8  5 'Structure model' '_database_2.pdbx_DOI'                      
9  5 'Structure model' '_database_2.pdbx_database_accession'       
10 5 'Structure model' '_struct_ref_seq_dif.details'               
11 5 'Structure model' '_struct_site.pdbx_auth_asym_id'            
12 5 'Structure model' '_struct_site.pdbx_auth_comp_id'            
13 5 'Structure model' '_struct_site.pdbx_auth_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.1.24    ? 1 ? ? ? ? 
MOSFLM 'data reduction' .         ? 2 ? ? ? ? 
CCP4   'data scaling'   '(SCALA)' ? 3 ? ? ? ? 
AMoRE  phasing          .         ? 4 ? ? ? ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NZ A LYS 192 ? ? O A HOH 544 ? ? 1.74 
2 1 O  A HOH 641 ? ? O A HOH 649 ? ? 1.91 
3 1 O  A HOH 640 ? ? O A HOH 715 ? ? 2.14 
4 1 NZ A LYS 266 ? ? O A HOH 571 ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 41  ? ? CG A ASP 41  ? ? OD2 A ASP 41  ? ? 124.47 118.30 6.17  0.90 N 
2 1 CB A ASP 161 ? ? CG A ASP 161 ? ? OD2 A ASP 161 ? ? 123.84 118.30 5.54  0.90 N 
3 1 CB A ASP 290 ? ? CG A ASP 290 ? ? OD2 A ASP 290 ? ? 123.76 118.30 5.46  0.90 N 
4 1 CB A ASP 328 ? ? CG A ASP 328 ? ? OD1 A ASP 328 ? ? 123.82 118.30 5.52  0.90 N 
5 1 CB I ASP 9   ? ? CG I ASP 9   ? ? OD2 I ASP 9   ? ? 124.08 118.30 5.78  0.90 N 
6 1 NE I ARG 15  ? ? CZ I ARG 15  ? ? NH1 I ARG 15  ? ? 123.52 120.30 3.22  0.50 N 
7 1 NE I ARG 15  ? ? CZ I ARG 15  ? ? NH2 I ARG 15  ? ? 115.51 120.30 -4.79 0.50 N 
8 1 CB I ASP 24  ? ? CG I ASP 24  ? ? OD2 I ASP 24  ? ? 123.91 118.30 5.61  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 99  ? ? -170.65 103.91 
2 1 ASP A 166 ? ? -159.70 41.21  
3 1 ASP A 184 ? ? 75.11   93.42  
4 1 SER A 212 ? ? 71.08   36.05  
5 1 LYS A 217 ? ? -49.60  -16.04 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1  ? A GLY 1  
2  1 Y 1 A ASN 2  ? A ASN 2  
3  1 Y 1 A ALA 3  ? A ALA 3  
4  1 Y 1 A ALA 4  ? A ALA 4  
5  1 Y 1 A ALA 5  ? A ALA 5  
6  1 Y 1 A ALA 6  ? A ALA 6  
7  1 Y 1 A LYS 7  ? A LYS 7  
8  1 Y 1 A LYS 8  ? A LYS 8  
9  1 Y 1 A GLY 9  ? A GLY 9  
10 1 Y 1 A SER 10 ? A SER 10 
11 1 Y 1 A GLU 11 ? A GLU 11 
12 1 Y 1 A GLN 12 ? A GLN 12 
13 1 Y 1 A GLU 13 ? A GLU 13 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '(R)-TRANS-4-(1-AMINOETHYL)-N-(4-PYRIDYL) CYCLOHEXANECARBOXAMIDE' Y27 
4 water                                                             HOH 
#