data_2GP0
# 
_entry.id   2GP0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GP0         
RCSB  RCSB037382   
WWPDB D_1000037382 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1ZC0 
_pdbx_database_related.details        'HePTP Catalytic Domain (33-449), WT' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2GP0 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-15 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Page, R.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'HePTP Catalytic Domain (residues 44-339), S225D mutant' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Page, R.'     1 
primary 'Mustelin, T.' 2 
# 
_cell.length_a           127.520 
_cell.length_b           127.520 
_cell.length_c           60.133 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.entry_id           2GP0 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.entry_id                         2GP0 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                169 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tyrosine-protein phosphatase non-receptor type 7' 35364.000 1   3.1.3.48 S225D 
'Catalytic Domain (residues 65-360)' ? 
2 non-polymer syn 'PHOSPHATE ION'                                    94.971    1   ?        ?     ? ? 
3 non-polymer syn GLYCEROL                                           92.094    1   ?        ?     ? ? 
4 water       nat water                                              18.015    297 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein-tyrosine phosphatase LC-PTP, Hematopoietic protein-tyrosine phosphatase, HEPTP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSDKIHHHHHHMNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPN
PQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTE
EETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRDVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHC
SAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSDKIHHHHHHMNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPN
PQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTE
EETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRDVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHC
SAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   ASP n 
1 5   LYS n 
1 6   ILE n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  HIS n 
1 12  HIS n 
1 13  MET n 
1 14  ASN n 
1 15  THR n 
1 16  PRO n 
1 17  ARG n 
1 18  GLU n 
1 19  VAL n 
1 20  THR n 
1 21  LEU n 
1 22  HIS n 
1 23  PHE n 
1 24  LEU n 
1 25  ARG n 
1 26  THR n 
1 27  ALA n 
1 28  GLY n 
1 29  HIS n 
1 30  PRO n 
1 31  LEU n 
1 32  THR n 
1 33  ARG n 
1 34  TRP n 
1 35  ALA n 
1 36  LEU n 
1 37  GLN n 
1 38  ARG n 
1 39  GLN n 
1 40  PRO n 
1 41  PRO n 
1 42  SER n 
1 43  PRO n 
1 44  LYS n 
1 45  GLN n 
1 46  LEU n 
1 47  GLU n 
1 48  GLU n 
1 49  GLU n 
1 50  PHE n 
1 51  LEU n 
1 52  LYS n 
1 53  ILE n 
1 54  PRO n 
1 55  SER n 
1 56  ASN n 
1 57  PHE n 
1 58  VAL n 
1 59  SER n 
1 60  PRO n 
1 61  GLU n 
1 62  ASP n 
1 63  LEU n 
1 64  ASP n 
1 65  ILE n 
1 66  PRO n 
1 67  GLY n 
1 68  HIS n 
1 69  ALA n 
1 70  SER n 
1 71  LYS n 
1 72  ASP n 
1 73  ARG n 
1 74  TYR n 
1 75  LYS n 
1 76  THR n 
1 77  ILE n 
1 78  LEU n 
1 79  PRO n 
1 80  ASN n 
1 81  PRO n 
1 82  GLN n 
1 83  SER n 
1 84  ARG n 
1 85  VAL n 
1 86  CYS n 
1 87  LEU n 
1 88  GLY n 
1 89  ARG n 
1 90  ALA n 
1 91  GLN n 
1 92  SER n 
1 93  GLN n 
1 94  GLU n 
1 95  ASP n 
1 96  GLY n 
1 97  ASP n 
1 98  TYR n 
1 99  ILE n 
1 100 ASN n 
1 101 ALA n 
1 102 ASN n 
1 103 TYR n 
1 104 ILE n 
1 105 ARG n 
1 106 GLY n 
1 107 TYR n 
1 108 ASP n 
1 109 GLY n 
1 110 LYS n 
1 111 GLU n 
1 112 LYS n 
1 113 VAL n 
1 114 TYR n 
1 115 ILE n 
1 116 ALA n 
1 117 THR n 
1 118 GLN n 
1 119 GLY n 
1 120 PRO n 
1 121 MET n 
1 122 PRO n 
1 123 ASN n 
1 124 THR n 
1 125 VAL n 
1 126 SER n 
1 127 ASP n 
1 128 PHE n 
1 129 TRP n 
1 130 GLU n 
1 131 MET n 
1 132 VAL n 
1 133 TRP n 
1 134 GLN n 
1 135 GLU n 
1 136 GLU n 
1 137 VAL n 
1 138 SER n 
1 139 LEU n 
1 140 ILE n 
1 141 VAL n 
1 142 MET n 
1 143 LEU n 
1 144 THR n 
1 145 GLN n 
1 146 LEU n 
1 147 ARG n 
1 148 GLU n 
1 149 GLY n 
1 150 LYS n 
1 151 GLU n 
1 152 LYS n 
1 153 CYS n 
1 154 VAL n 
1 155 HIS n 
1 156 TYR n 
1 157 TRP n 
1 158 PRO n 
1 159 THR n 
1 160 GLU n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 TYR n 
1 165 GLY n 
1 166 PRO n 
1 167 PHE n 
1 168 GLN n 
1 169 ILE n 
1 170 ARG n 
1 171 ILE n 
1 172 GLN n 
1 173 ASP n 
1 174 MET n 
1 175 LYS n 
1 176 GLU n 
1 177 CYS n 
1 178 PRO n 
1 179 GLU n 
1 180 TYR n 
1 181 THR n 
1 182 VAL n 
1 183 ARG n 
1 184 GLN n 
1 185 LEU n 
1 186 THR n 
1 187 ILE n 
1 188 GLN n 
1 189 TYR n 
1 190 GLN n 
1 191 GLU n 
1 192 GLU n 
1 193 ARG n 
1 194 ARG n 
1 195 ASP n 
1 196 VAL n 
1 197 LYS n 
1 198 HIS n 
1 199 ILE n 
1 200 LEU n 
1 201 PHE n 
1 202 SER n 
1 203 ALA n 
1 204 TRP n 
1 205 PRO n 
1 206 ASP n 
1 207 HIS n 
1 208 GLN n 
1 209 THR n 
1 210 PRO n 
1 211 GLU n 
1 212 SER n 
1 213 ALA n 
1 214 GLY n 
1 215 PRO n 
1 216 LEU n 
1 217 LEU n 
1 218 ARG n 
1 219 LEU n 
1 220 VAL n 
1 221 ALA n 
1 222 GLU n 
1 223 VAL n 
1 224 GLU n 
1 225 GLU n 
1 226 SER n 
1 227 PRO n 
1 228 GLU n 
1 229 THR n 
1 230 ALA n 
1 231 ALA n 
1 232 HIS n 
1 233 PRO n 
1 234 GLY n 
1 235 PRO n 
1 236 ILE n 
1 237 VAL n 
1 238 VAL n 
1 239 HIS n 
1 240 CYS n 
1 241 SER n 
1 242 ALA n 
1 243 GLY n 
1 244 ILE n 
1 245 GLY n 
1 246 ARG n 
1 247 THR n 
1 248 GLY n 
1 249 CYS n 
1 250 PHE n 
1 251 ILE n 
1 252 ALA n 
1 253 THR n 
1 254 ARG n 
1 255 ILE n 
1 256 GLY n 
1 257 CYS n 
1 258 GLN n 
1 259 GLN n 
1 260 LEU n 
1 261 LYS n 
1 262 ALA n 
1 263 ARG n 
1 264 GLY n 
1 265 GLU n 
1 266 VAL n 
1 267 ASP n 
1 268 ILE n 
1 269 LEU n 
1 270 GLY n 
1 271 ILE n 
1 272 VAL n 
1 273 CYS n 
1 274 GLN n 
1 275 LEU n 
1 276 ARG n 
1 277 LEU n 
1 278 ASP n 
1 279 ARG n 
1 280 GLY n 
1 281 GLY n 
1 282 MET n 
1 283 ILE n 
1 284 GLN n 
1 285 THR n 
1 286 ALA n 
1 287 GLU n 
1 288 GLN n 
1 289 TYR n 
1 290 GLN n 
1 291 PHE n 
1 292 LEU n 
1 293 HIS n 
1 294 HIS n 
1 295 THR n 
1 296 LEU n 
1 297 ALA n 
1 298 LEU n 
1 299 TYR n 
1 300 ALA n 
1 301 GLY n 
1 302 GLN n 
1 303 LEU n 
1 304 PRO n 
1 305 GLU n 
1 306 GLU n 
1 307 PRO n 
1 308 SER n 
1 309 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PTPN7 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTN7_HUMAN 
_struct_ref.pdbx_db_accession          P35236 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQ
EDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQD
MKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIAT
RIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
;
_struct_ref.pdbx_align_begin           65 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2GP0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 14 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 309 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P35236 
_struct_ref_seq.db_align_beg                  65 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  360 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       44 
_struct_ref_seq.pdbx_auth_seq_align_end       339 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2GP0 MET A 1   ? UNP P35236 ?   ?   'EXPRESSION TAG' 31  1  
1 2GP0 GLY A 2   ? UNP P35236 ?   ?   'EXPRESSION TAG' 32  2  
1 2GP0 SER A 3   ? UNP P35236 ?   ?   'EXPRESSION TAG' 33  3  
1 2GP0 ASP A 4   ? UNP P35236 ?   ?   'EXPRESSION TAG' 34  4  
1 2GP0 LYS A 5   ? UNP P35236 ?   ?   'EXPRESSION TAG' 35  5  
1 2GP0 ILE A 6   ? UNP P35236 ?   ?   'EXPRESSION TAG' 36  6  
1 2GP0 HIS A 7   ? UNP P35236 ?   ?   'EXPRESSION TAG' 37  7  
1 2GP0 HIS A 8   ? UNP P35236 ?   ?   'EXPRESSION TAG' 38  8  
1 2GP0 HIS A 9   ? UNP P35236 ?   ?   'EXPRESSION TAG' 39  9  
1 2GP0 HIS A 10  ? UNP P35236 ?   ?   'EXPRESSION TAG' 40  10 
1 2GP0 HIS A 11  ? UNP P35236 ?   ?   'EXPRESSION TAG' 41  11 
1 2GP0 HIS A 12  ? UNP P35236 ?   ?   'EXPRESSION TAG' 42  12 
1 2GP0 MET A 13  ? UNP P35236 ?   ?   'EXPRESSION TAG' 43  13 
1 2GP0 ASP A 195 ? UNP P35236 SER 246 ENGINEERED       225 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ?                               'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2GP0 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      4.23 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   70.91 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.7 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    'K/Na Phosphate, Ammonium Acetate, pH 6.7, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2005-04-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    Osmic 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        OTHER 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     2GP0 
_reflns.d_resolution_high            2.050 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   33843 
_reflns.pdbx_Rmerge_I_obs            0.089 
_reflns.pdbx_netI_over_sigmaI        9.900 
_reflns.pdbx_chi_squared             1.118 
_reflns.pdbx_redundancy              3.100 
_reflns.percent_possible_obs         96.300 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.number_all                   33843 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.12 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      2882 
_reflns_shell.Rmerge_I_obs           0.456 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.958 
_reflns_shell.pdbx_redundancy        1.80 
_reflns_shell.percent_possible_obs   82.50 
_reflns_shell.number_unique_all      ? 
_reflns_shell.percent_possible_all   82.5 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2GP0 
_refine.ls_d_res_high                            2.050 
_refine.ls_d_res_low                             20.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    96.320 
_refine.ls_number_reflns_obs                     33803 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.ls_R_factor_all                          0.179 
_refine.ls_R_factor_R_work                       0.178 
_refine.ls_R_factor_R_free                       0.206 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1689 
_refine.B_iso_mean                               32.403 
_refine.aniso_B[1][1]                            0.070 
_refine.aniso_B[2][2]                            0.070 
_refine.aniso_B[3][3]                            -0.100 
_refine.aniso_B[1][2]                            0.030 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.951 
_refine.pdbx_overall_ESU_R                       0.132 
_refine.pdbx_overall_ESU_R_Free                  0.125 
_refine.overall_SU_ML                            0.089 
_refine.overall_SU_B                             3.278 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     33803 
_refine.ls_R_factor_obs                          0.179 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      'PDB Entry 1ZC0' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2267 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             297 
_refine_hist.number_atoms_total               2575 
_refine_hist.d_res_high                       2.050 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         2415 0.017  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      3296 1.588  1.960  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   301  6.737  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   119  34.151 23.866 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   401  13.484 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   19   17.625 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           356  0.099  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1875 0.007  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1094 0.200  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1619 0.304  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    242  0.156  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   31   0.277  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 29   0.192  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1516 1.089  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2391 1.745  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1028 2.377  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             897  3.646  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.050 
_refine_ls_shell.d_res_low                        2.104 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               80.520 
_refine_ls_shell.number_reflns_R_work             1958 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.275 
_refine_ls_shell.R_factor_R_free                  0.297 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             101 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                2059 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2GP0 
_struct.title                     'HePTP Catalytic Domain (residues 44-339), S225D mutant' 
_struct.pdbx_descriptor           'Tyrosine-protein phosphatase non-receptor type 7, EC: 3.1.3.48' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GP0 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HePTP, Human Hemapoietic Tyrosine Phosphatase Catalytic Domain, PTPN7, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 15  ? ALA A 27  ? THR A 45  ALA A 57  1 ? 13 
HELX_P HELX_P2  2  ARG A 33  ? GLN A 39  ? ARG A 63  GLN A 69  1 ? 7  
HELX_P HELX_P3  3  SER A 42  ? ILE A 53  ? SER A 72  ILE A 83  1 ? 12 
HELX_P HELX_P4  4  SER A 59  ? LEU A 63  ? SER A 89  LEU A 93  5 ? 5  
HELX_P HELX_P5  5  GLY A 67  ? ASP A 72  ? GLY A 97  ASP A 102 5 ? 6  
HELX_P HELX_P6  6  ASN A 80  ? GLN A 82  ? ASN A 110 GLN A 112 5 ? 3  
HELX_P HELX_P7  7  GLY A 106 ? LYS A 110 ? GLY A 136 LYS A 140 5 ? 5  
HELX_P HELX_P8  8  MET A 121 ? ASN A 123 ? MET A 151 ASN A 153 5 ? 3  
HELX_P HELX_P9  9  THR A 124 ? GLU A 135 ? THR A 154 GLU A 165 1 ? 12 
HELX_P HELX_P10 10 SER A 212 ? SER A 226 ? SER A 242 SER A 256 1 ? 15 
HELX_P HELX_P11 11 ILE A 244 ? GLY A 264 ? ILE A 274 GLY A 294 1 ? 21 
HELX_P HELX_P12 12 ILE A 268 ? ARG A 279 ? ILE A 298 ARG A 309 1 ? 12 
HELX_P HELX_P13 13 THR A 285 ? LEU A 303 ? THR A 315 LEU A 333 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
B 8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PRO A 30  ? THR A 32  ? PRO A 60  THR A 62  
A 2 GLU A 265 ? ASP A 267 ? GLU A 295 ASP A 297 
B 1 ARG A 84  ? CYS A 86  ? ARG A 114 CYS A 116 
B 2 TYR A 98  ? ILE A 104 ? TYR A 128 ILE A 134 
B 3 TYR A 114 ? GLN A 118 ? TYR A 144 GLN A 148 
B 4 ILE A 236 ? CYS A 240 ? ILE A 266 CYS A 270 
B 5 LEU A 139 ? LEU A 143 ? LEU A 169 LEU A 173 
B 6 GLU A 192 ? PHE A 201 ? GLU A 222 PHE A 231 
B 7 TYR A 180 ? TYR A 189 ? TYR A 210 TYR A 219 
B 8 PHE A 167 ? GLU A 176 ? PHE A 197 GLU A 206 
B 9 GLU A 161 ? TYR A 164 ? GLU A 191 TYR A 194 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 31  ? N LEU A 61  O VAL A 266 ? O VAL A 296 
B 1 2 N VAL A 85  ? N VAL A 115 O ALA A 101 ? O ALA A 131 
B 2 3 N ILE A 104 ? N ILE A 134 O TYR A 114 ? O TYR A 144 
B 3 4 N ILE A 115 ? N ILE A 145 O VAL A 238 ? O VAL A 268 
B 4 5 O VAL A 237 ? O VAL A 267 N VAL A 141 ? N VAL A 171 
B 5 6 N MET A 142 ? N MET A 172 O ILE A 199 ? O ILE A 229 
B 6 7 O HIS A 198 ? O HIS A 228 N ARG A 183 ? N ARG A 213 
B 7 8 O VAL A 182 ? O VAL A 212 N LYS A 175 ? N LYS A 205 
B 8 9 O ILE A 169 ? O ILE A 199 N GLU A 162 ? N GLU A 192 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PO4 A 436' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 437' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ASP A 206 ? ASP A 236 . ? 1_555 ? 
2  AC1 10 CYS A 240 ? CYS A 270 . ? 1_555 ? 
3  AC1 10 SER A 241 ? SER A 271 . ? 1_555 ? 
4  AC1 10 ALA A 242 ? ALA A 272 . ? 1_555 ? 
5  AC1 10 ILE A 244 ? ILE A 274 . ? 1_555 ? 
6  AC1 10 GLY A 245 ? GLY A 275 . ? 1_555 ? 
7  AC1 10 ARG A 246 ? ARG A 276 . ? 1_555 ? 
8  AC1 10 GLN A 284 ? GLN A 314 . ? 1_555 ? 
9  AC1 10 GLU A 305 ? GLU A 335 . ? 2_655 ? 
10 AC1 10 HOH D .   ? HOH A 439 . ? 1_555 ? 
11 AC2 8  GLN A 82  ? GLN A 112 . ? 1_555 ? 
12 AC2 8  SER A 83  ? SER A 113 . ? 1_555 ? 
13 AC2 8  TYR A 103 ? TYR A 133 . ? 1_555 ? 
14 AC2 8  GLU A 111 ? GLU A 141 . ? 1_555 ? 
15 AC2 8  HOH D .   ? HOH A 447 . ? 1_555 ? 
16 AC2 8  HOH D .   ? HOH A 465 . ? 1_555 ? 
17 AC2 8  HOH D .   ? HOH A 517 . ? 1_555 ? 
18 AC2 8  HOH D .   ? HOH A 602 . ? 4_665 ? 
# 
_atom_sites.entry_id                    2GP0 
_atom_sites.fract_transf_matrix[1][1]   0.00784 
_atom_sites.fract_transf_matrix[1][2]   0.00453 
_atom_sites.fract_transf_matrix[1][3]   0.00000 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.00905 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.01663 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 14  ? 44.187 53.475 41.536  1.00 67.13 ? 44  ASN A N   1 
ATOM   2    C CA  . ASN A 1 14  ? 44.048 53.145 40.080  1.00 66.73 ? 44  ASN A CA  1 
ATOM   3    C C   . ASN A 1 14  ? 43.711 51.656 39.811  1.00 66.18 ? 44  ASN A C   1 
ATOM   4    O O   . ASN A 1 14  ? 44.533 50.768 40.064  0.50 66.03 ? 44  ASN A O   1 
ATOM   5    C CB  . ASN A 1 14  ? 45.307 53.582 39.311  1.00 66.96 ? 44  ASN A CB  1 
ATOM   6    N N   . THR A 1 15  ? 42.496 51.411 39.304  1.00 65.25 ? 45  THR A N   1 
ATOM   7    C CA  . THR A 1 15  ? 42.037 50.073 38.850  1.00 64.18 ? 45  THR A CA  1 
ATOM   8    C C   . THR A 1 15  ? 42.959 49.427 37.792  1.00 63.08 ? 45  THR A C   1 
ATOM   9    O O   . THR A 1 15  ? 43.751 50.128 37.156  1.00 63.60 ? 45  THR A O   1 
ATOM   10   C CB  . THR A 1 15  ? 40.565 50.116 38.268  1.00 64.60 ? 45  THR A CB  1 
ATOM   11   O OG1 . THR A 1 15  ? 40.519 50.844 37.023  1.00 64.08 ? 45  THR A OG1 1 
ATOM   12   C CG2 . THR A 1 15  ? 39.575 50.723 39.278  1.00 64.55 ? 45  THR A CG2 1 
ATOM   13   N N   . PRO A 1 16  ? 42.881 48.086 37.616  1.00 61.62 ? 46  PRO A N   1 
ATOM   14   C CA  . PRO A 1 16  ? 43.512 47.427 36.453  1.00 59.69 ? 46  PRO A CA  1 
ATOM   15   C C   . PRO A 1 16  ? 43.232 48.076 35.075  1.00 57.36 ? 46  PRO A C   1 
ATOM   16   O O   . PRO A 1 16  ? 44.123 48.086 34.223  1.00 56.83 ? 46  PRO A O   1 
ATOM   17   C CB  . PRO A 1 16  ? 42.935 46.003 36.494  1.00 59.96 ? 46  PRO A CB  1 
ATOM   18   C CG  . PRO A 1 16  ? 42.674 45.752 37.944  1.00 61.26 ? 46  PRO A CG  1 
ATOM   19   C CD  . PRO A 1 16  ? 42.263 47.100 38.532  1.00 61.82 ? 46  PRO A CD  1 
ATOM   20   N N   . ARG A 1 17  ? 42.024 48.599 34.852  1.00 54.75 ? 47  ARG A N   1 
ATOM   21   C CA  . ARG A 1 17  ? 41.720 49.223 33.556  1.00 52.10 ? 47  ARG A CA  1 
ATOM   22   C C   . ARG A 1 17  ? 42.416 50.562 33.366  1.00 49.62 ? 47  ARG A C   1 
ATOM   23   O O   . ARG A 1 17  ? 42.959 50.818 32.295  1.00 48.56 ? 47  ARG A O   1 
ATOM   24   C CB  . ARG A 1 17  ? 40.229 49.319 33.266  1.00 52.34 ? 47  ARG A CB  1 
ATOM   25   C CG  . ARG A 1 17  ? 39.961 49.906 31.894  1.00 54.30 ? 47  ARG A CG  1 
ATOM   26   C CD  . ARG A 1 17  ? 38.724 49.325 31.248  1.00 59.03 ? 47  ARG A CD  1 
ATOM   27   N NE  . ARG A 1 17  ? 38.408 49.997 29.983  1.00 61.07 ? 47  ARG A NE  1 
ATOM   28   C CZ  . ARG A 1 17  ? 38.956 49.681 28.806  1.00 62.10 ? 47  ARG A CZ  1 
ATOM   29   N NH1 . ARG A 1 17  ? 39.868 48.717 28.727  1.00 61.50 ? 47  ARG A NH1 1 
ATOM   30   N NH2 . ARG A 1 17  ? 38.601 50.339 27.709  1.00 62.99 ? 47  ARG A NH2 1 
ATOM   31   N N   . GLU A 1 18  ? 42.417 51.398 34.402  1.00 46.83 ? 48  GLU A N   1 
ATOM   32   C CA  . GLU A 1 18  ? 43.185 52.642 34.390  1.00 44.90 ? 48  GLU A CA  1 
ATOM   33   C C   . GLU A 1 18  ? 44.691 52.387 34.193  1.00 43.26 ? 48  GLU A C   1 
ATOM   34   O O   . GLU A 1 18  ? 45.372 53.143 33.494  1.00 42.08 ? 48  GLU A O   1 
ATOM   35   C CB  . GLU A 1 18  ? 42.967 53.446 35.674  1.00 44.60 ? 48  GLU A CB  1 
ATOM   36   C CG  . GLU A 1 18  ? 41.554 53.997 35.868  1.00 46.94 ? 48  GLU A CG  1 
ATOM   37   N N   . VAL A 1 19  ? 45.200 51.338 34.844  1.00 41.76 ? 49  VAL A N   1 
ATOM   38   C CA  . VAL A 1 19  ? 46.593 50.904 34.683  1.00 40.09 ? 49  VAL A CA  1 
ATOM   39   C C   . VAL A 1 19  ? 46.873 50.493 33.225  1.00 37.78 ? 49  VAL A C   1 
ATOM   40   O O   . VAL A 1 19  ? 47.817 50.975 32.645  1.00 37.28 ? 49  VAL A O   1 
ATOM   41   C CB  . VAL A 1 19  ? 46.980 49.772 35.690  1.00 40.66 ? 49  VAL A CB  1 
ATOM   42   C CG1 . VAL A 1 19  ? 48.315 49.119 35.317  1.00 41.23 ? 49  VAL A CG1 1 
ATOM   43   C CG2 . VAL A 1 19  ? 47.078 50.345 37.099  1.00 41.32 ? 49  VAL A CG2 1 
ATOM   44   N N   . THR A 1 20  ? 46.024 49.635 32.657  1.00 35.77 ? 50  THR A N   1 
ATOM   45   C CA  . THR A 1 20  ? 46.117 49.206 31.258  1.00 34.28 ? 50  THR A CA  1 
ATOM   46   C C   . THR A 1 20  ? 46.086 50.390 30.287  1.00 33.62 ? 50  THR A C   1 
ATOM   47   O O   . THR A 1 20  ? 46.993 50.540 29.468  1.00 32.49 ? 50  THR A O   1 
ATOM   48   C CB  . THR A 1 20  ? 45.012 48.199 30.946  1.00 34.75 ? 50  THR A CB  1 
ATOM   49   O OG1 . THR A 1 20  ? 45.263 47.008 31.692  1.00 36.41 ? 50  THR A OG1 1 
ATOM   50   C CG2 . THR A 1 20  ? 44.943 47.835 29.461  1.00 33.80 ? 50  THR A CG2 1 
ATOM   51   N N   . LEU A 1 21  ? 45.069 51.245 30.420  1.00 31.91 ? 51  LEU A N   1 
ATOM   52   C CA  . LEU A 1 21  ? 44.903 52.403 29.561  1.00 30.78 ? 51  LEU A CA  1 
ATOM   53   C C   . LEU A 1 21  ? 46.059 53.328 29.669  1.00 30.61 ? 51  LEU A C   1 
ATOM   54   O O   . LEU A 1 21  ? 46.516 53.853 28.656  1.00 29.97 ? 51  LEU A O   1 
ATOM   55   C CB  . LEU A 1 21  ? 43.573 53.135 29.809  1.00 30.53 ? 51  LEU A CB  1 
ATOM   56   C CG  . LEU A 1 21  ? 42.328 52.334 29.409  1.00 30.18 ? 51  LEU A CG  1 
ATOM   57   C CD1 . LEU A 1 21  ? 41.016 53.103 29.804  1.00 30.63 ? 51  LEU A CD1 1 
ATOM   58   C CD2 . LEU A 1 21  ? 42.290 52.015 27.912  1.00 30.12 ? 51  LEU A CD2 1 
ATOM   59   N N   . HIS A 1 22  ? 46.545 53.556 30.891  1.00 30.09 ? 52  HIS A N   1 
ATOM   60   C CA  . HIS A 1 22  ? 47.663 54.451 31.058  1.00 29.97 ? 52  HIS A CA  1 
ATOM   61   C C   . HIS A 1 22  ? 48.952 53.923 30.386  1.00 28.61 ? 52  HIS A C   1 
ATOM   62   O O   . HIS A 1 22  ? 49.671 54.689 29.751  1.00 28.45 ? 52  HIS A O   1 
ATOM   63   C CB  . HIS A 1 22  ? 47.915 54.786 32.544  1.00 30.47 ? 52  HIS A CB  1 
ATOM   64   C CG  . HIS A 1 22  ? 49.113 55.650 32.759  1.00 31.56 ? 52  HIS A CG  1 
ATOM   65   N ND1 . HIS A 1 22  ? 49.110 57.005 32.508  1.00 36.98 ? 52  HIS A ND1 1 
ATOM   66   C CD2 . HIS A 1 22  ? 50.375 55.343 33.149  1.00 35.44 ? 52  HIS A CD2 1 
ATOM   67   C CE1 . HIS A 1 22  ? 50.314 57.499 32.744  1.00 37.75 ? 52  HIS A CE1 1 
ATOM   68   N NE2 . HIS A 1 22  ? 51.100 56.510 33.135  1.00 36.75 ? 52  HIS A NE2 1 
ATOM   69   N N   . PHE A 1 23  ? 49.271 52.639 30.574  1.00 28.22 ? 53  PHE A N   1 
ATOM   70   C CA  . PHE A 1 23  ? 50.419 52.041 29.879  1.00 26.09 ? 53  PHE A CA  1 
ATOM   71   C C   . PHE A 1 23  ? 50.278 52.230 28.356  1.00 25.56 ? 53  PHE A C   1 
ATOM   72   O O   . PHE A 1 23  ? 51.186 52.743 27.699  1.00 24.71 ? 53  PHE A O   1 
ATOM   73   C CB  . PHE A 1 23  ? 50.525 50.537 30.185  1.00 27.27 ? 53  PHE A CB  1 
ATOM   74   C CG  . PHE A 1 23  ? 51.743 49.884 29.572  1.00 27.49 ? 53  PHE A CG  1 
ATOM   75   C CD1 . PHE A 1 23  ? 52.926 49.756 30.311  1.00 29.64 ? 53  PHE A CD1 1 
ATOM   76   C CD2 . PHE A 1 23  ? 51.721 49.450 28.246  1.00 29.32 ? 53  PHE A CD2 1 
ATOM   77   C CE1 . PHE A 1 23  ? 54.063 49.161 29.724  1.00 33.63 ? 53  PHE A CE1 1 
ATOM   78   C CE2 . PHE A 1 23  ? 52.835 48.846 27.650  1.00 29.64 ? 53  PHE A CE2 1 
ATOM   79   C CZ  . PHE A 1 23  ? 54.025 48.722 28.387  1.00 29.99 ? 53  PHE A CZ  1 
ATOM   80   N N   . LEU A 1 24  ? 49.143 51.798 27.802  1.00 24.55 ? 54  LEU A N   1 
ATOM   81   C CA  . LEU A 1 24  ? 48.930 51.843 26.346  1.00 24.72 ? 54  LEU A CA  1 
ATOM   82   C C   . LEU A 1 24  ? 49.007 53.256 25.751  1.00 25.61 ? 54  LEU A C   1 
ATOM   83   O O   . LEU A 1 24  ? 49.523 53.425 24.631  1.00 25.17 ? 54  LEU A O   1 
ATOM   84   C CB  . LEU A 1 24  ? 47.623 51.148 25.950  1.00 22.94 ? 54  LEU A CB  1 
ATOM   85   C CG  . LEU A 1 24  ? 47.546 49.651 26.302  1.00 22.41 ? 54  LEU A CG  1 
ATOM   86   C CD1 . LEU A 1 24  ? 46.095 49.282 26.169  1.00 19.72 ? 54  LEU A CD1 1 
ATOM   87   C CD2 . LEU A 1 24  ? 48.478 48.698 25.434  1.00 22.35 ? 54  LEU A CD2 1 
ATOM   88   N N   . ARG A 1 25  ? 48.530 54.259 26.517  1.00 26.39 ? 55  ARG A N   1 
ATOM   89   C CA  . ARG A 1 25  ? 48.521 55.631 26.039  1.00 27.47 ? 55  ARG A CA  1 
ATOM   90   C C   . ARG A 1 25  ? 49.886 56.299 26.135  1.00 27.87 ? 55  ARG A C   1 
ATOM   91   O O   . ARG A 1 25  ? 50.135 57.271 25.432  1.00 28.25 ? 55  ARG A O   1 
ATOM   92   C CB  . ARG A 1 25  ? 47.442 56.454 26.775  1.00 27.75 ? 55  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 25  ? 46.048 55.993 26.412  1.00 27.26 ? 55  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 25  ? 44.972 56.796 27.116  1.00 28.28 ? 55  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 25  ? 43.672 56.493 26.516  1.00 31.79 ? 55  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 25  ? 42.505 56.461 27.178  1.00 31.31 ? 55  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 25  ? 42.471 56.681 28.481  1.00 27.30 ? 55  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 25  ? 41.376 56.197 26.526  1.00 29.62 ? 55  ARG A NH2 1 
ATOM   99   N N   . THR A 1 26  ? 50.790 55.754 26.953  1.00 28.21 ? 56  THR A N   1 
ATOM   100  C CA  . THR A 1 26  ? 52.087 56.415 27.205  1.00 28.78 ? 56  THR A CA  1 
ATOM   101  C C   . THR A 1 26  ? 53.373 55.588 26.899  1.00 28.64 ? 56  THR A C   1 
ATOM   102  O O   . THR A 1 26  ? 54.431 56.179 26.751  1.00 28.90 ? 56  THR A O   1 
ATOM   103  C CB  . THR A 1 26  ? 52.196 56.879 28.678  1.00 28.81 ? 56  THR A CB  1 
ATOM   104  O OG1 . THR A 1 26  ? 52.190 55.708 29.502  1.00 32.33 ? 56  THR A OG1 1 
ATOM   105  C CG2 . THR A 1 26  ? 51.006 57.767 29.076  1.00 29.25 ? 56  THR A CG2 1 
ATOM   106  N N   . ALA A 1 27  ? 53.298 54.258 26.845  1.00 27.98 ? 57  ALA A N   1 
ATOM   107  C CA  . ALA A 1 27  ? 54.488 53.437 26.526  1.00 27.87 ? 57  ALA A CA  1 
ATOM   108  C C   . ALA A 1 27  ? 55.039 53.793 25.147  1.00 27.34 ? 57  ALA A C   1 
ATOM   109  O O   . ALA A 1 27  ? 54.269 54.090 24.204  1.00 27.12 ? 57  ALA A O   1 
ATOM   110  C CB  . ALA A 1 27  ? 54.174 51.940 26.593  1.00 27.09 ? 57  ALA A CB  1 
ATOM   111  N N   . GLY A 1 28  ? 56.362 53.793 25.035  1.00 26.26 ? 58  GLY A N   1 
ATOM   112  C CA  . GLY A 1 28  ? 57.004 53.974 23.737  1.00 27.12 ? 58  GLY A CA  1 
ATOM   113  C C   . GLY A 1 28  ? 58.487 53.632 23.731  1.00 27.65 ? 58  GLY A C   1 
ATOM   114  O O   . GLY A 1 28  ? 59.148 53.666 24.771  1.00 27.55 ? 58  GLY A O   1 
ATOM   115  N N   . HIS A 1 29  ? 59.021 53.268 22.566  1.00 27.82 ? 59  HIS A N   1 
ATOM   116  C CA  . HIS A 1 29  ? 60.454 52.940 22.485  1.00 28.57 ? 59  HIS A CA  1 
ATOM   117  C C   . HIS A 1 29  ? 60.964 53.355 21.085  1.00 28.23 ? 59  HIS A C   1 
ATOM   118  O O   . HIS A 1 29  ? 61.100 52.516 20.191  1.00 27.59 ? 59  HIS A O   1 
ATOM   119  C CB  . HIS A 1 29  ? 60.633 51.446 22.818  1.00 29.03 ? 59  HIS A CB  1 
ATOM   120  C CG  . HIS A 1 29  ? 62.057 50.976 22.835  1.00 33.52 ? 59  HIS A CG  1 
ATOM   121  N ND1 . HIS A 1 29  ? 62.394 49.663 23.105  1.00 33.66 ? 59  HIS A ND1 1 
ATOM   122  C CD2 . HIS A 1 29  ? 63.225 51.628 22.585  1.00 33.04 ? 59  HIS A CD2 1 
ATOM   123  C CE1 . HIS A 1 29  ? 63.711 49.541 23.063  1.00 36.16 ? 59  HIS A CE1 1 
ATOM   124  N NE2 . HIS A 1 29  ? 64.235 50.711 22.734  1.00 32.11 ? 59  HIS A NE2 1 
ATOM   125  N N   . PRO A 1 30  ? 61.201 54.672 20.884  1.00 27.93 ? 60  PRO A N   1 
ATOM   126  C CA  . PRO A 1 30  ? 61.609 55.172 19.571  1.00 28.03 ? 60  PRO A CA  1 
ATOM   127  C C   . PRO A 1 30  ? 62.946 54.533 19.133  1.00 27.30 ? 60  PRO A C   1 
ATOM   128  O O   . PRO A 1 30  ? 63.856 54.394 19.945  1.00 27.60 ? 60  PRO A O   1 
ATOM   129  C CB  . PRO A 1 30  ? 61.761 56.697 19.793  1.00 28.75 ? 60  PRO A CB  1 
ATOM   130  C CG  . PRO A 1 30  ? 61.068 56.994 21.051  1.00 28.14 ? 60  PRO A CG  1 
ATOM   131  C CD  . PRO A 1 30  ? 61.142 55.756 21.896  1.00 27.98 ? 60  PRO A CD  1 
ATOM   132  N N   . LEU A 1 31  ? 63.010 54.069 17.895  1.00 26.92 ? 61  LEU A N   1 
ATOM   133  C CA  . LEU A 1 31  ? 64.206 53.436 17.356  1.00 27.28 ? 61  LEU A CA  1 
ATOM   134  C C   . LEU A 1 31  ? 64.549 54.172 16.102  1.00 28.01 ? 61  LEU A C   1 
ATOM   135  O O   . LEU A 1 31  ? 63.757 54.170 15.149  1.00 28.43 ? 61  LEU A O   1 
ATOM   136  C CB  . LEU A 1 31  ? 63.962 51.946 16.975  1.00 26.20 ? 61  LEU A CB  1 
ATOM   137  C CG  . LEU A 1 31  ? 63.663 50.945 18.091  1.00 25.95 ? 61  LEU A CG  1 
ATOM   138  C CD1 . LEU A 1 31  ? 63.226 49.557 17.499  1.00 24.77 ? 61  LEU A CD1 1 
ATOM   139  C CD2 . LEU A 1 31  ? 64.836 50.805 19.095  1.00 24.44 ? 61  LEU A CD2 1 
ATOM   140  N N   . THR A 1 32  ? 65.734 54.785 16.068  1.00 29.80 ? 62  THR A N   1 
ATOM   141  C CA  . THR A 1 32  ? 66.179 55.431 14.833  1.00 31.42 ? 62  THR A CA  1 
ATOM   142  C C   . THR A 1 32  ? 66.334 54.368 13.769  1.00 32.37 ? 62  THR A C   1 
ATOM   143  O O   . THR A 1 32  ? 66.436 53.174 14.080  1.00 32.49 ? 62  THR A O   1 
ATOM   144  C CB  . THR A 1 32  ? 67.525 56.170 15.020  1.00 32.12 ? 62  THR A CB  1 
ATOM   145  O OG1 . THR A 1 32  ? 68.541 55.241 15.425  1.00 32.51 ? 62  THR A OG1 1 
ATOM   146  C CG2 . THR A 1 32  ? 67.378 57.253 16.099  1.00 32.18 ? 62  THR A CG2 1 
ATOM   147  N N   . ARG A 1 33  ? 66.325 54.796 12.519  1.00 33.49 ? 63  ARG A N   1 
ATOM   148  C CA  . ARG A 1 33  ? 66.653 53.942 11.398  1.00 35.36 ? 63  ARG A CA  1 
ATOM   149  C C   . ARG A 1 33  ? 67.996 53.171 11.615  1.00 35.39 ? 63  ARG A C   1 
ATOM   150  O O   . ARG A 1 33  ? 68.067 51.949 11.386  1.00 35.41 ? 63  ARG A O   1 
ATOM   151  C CB  . ARG A 1 33  ? 66.702 54.812 10.149  1.00 36.08 ? 63  ARG A CB  1 
ATOM   152  C CG  . ARG A 1 33  ? 66.681 54.049 8.885   1.00 40.36 ? 63  ARG A CG  1 
ATOM   153  C CD  . ARG A 1 33  ? 67.081 54.950 7.740   1.00 47.07 ? 63  ARG A CD  1 
ATOM   154  N NE  . ARG A 1 33  ? 67.822 54.235 6.687   1.00 48.04 ? 63  ARG A NE  1 
ATOM   155  C CZ  . ARG A 1 33  ? 67.974 54.725 5.463   1.00 50.31 ? 63  ARG A CZ  1 
ATOM   156  N NH1 . ARG A 1 33  ? 67.445 55.918 5.163   1.00 49.06 ? 63  ARG A NH1 1 
ATOM   157  N NH2 . ARG A 1 33  ? 68.635 54.029 4.539   1.00 51.20 ? 63  ARG A NH2 1 
ATOM   158  N N   . TRP A 1 34  ? 69.017 53.867 12.117  1.00 34.90 ? 64  TRP A N   1 
ATOM   159  C CA  . TRP A 1 34  ? 70.299 53.258 12.420  1.00 34.72 ? 64  TRP A CA  1 
ATOM   160  C C   . TRP A 1 34  ? 70.195 52.188 13.494  1.00 34.48 ? 64  TRP A C   1 
ATOM   161  O O   . TRP A 1 34  ? 70.711 51.080 13.315  1.00 33.81 ? 64  TRP A O   1 
ATOM   162  C CB  . TRP A 1 34  ? 71.359 54.294 12.843  1.00 36.56 ? 64  TRP A CB  1 
ATOM   163  C CG  . TRP A 1 34  ? 72.722 53.639 13.099  1.00 37.73 ? 64  TRP A CG  1 
ATOM   164  C CD1 . TRP A 1 34  ? 73.686 53.344 12.156  1.00 41.04 ? 64  TRP A CD1 1 
ATOM   165  C CD2 . TRP A 1 34  ? 73.236 53.158 14.356  1.00 40.06 ? 64  TRP A CD2 1 
ATOM   166  N NE1 . TRP A 1 34  ? 74.770 52.728 12.755  1.00 41.48 ? 64  TRP A NE1 1 
ATOM   167  C CE2 . TRP A 1 34  ? 74.524 52.598 14.099  1.00 41.25 ? 64  TRP A CE2 1 
ATOM   168  C CE3 . TRP A 1 34  ? 72.747 53.162 15.674  1.00 39.92 ? 64  TRP A CE3 1 
ATOM   169  C CZ2 . TRP A 1 34  ? 75.321 52.035 15.114  1.00 40.54 ? 64  TRP A CZ2 1 
ATOM   170  C CZ3 . TRP A 1 34  ? 73.529 52.603 16.683  1.00 40.58 ? 64  TRP A CZ3 1 
ATOM   171  C CH2 . TRP A 1 34  ? 74.805 52.044 16.399  1.00 41.02 ? 64  TRP A CH2 1 
ATOM   172  N N   . ALA A 1 35  ? 69.583 52.520 14.634  1.00 33.15 ? 65  ALA A N   1 
ATOM   173  C CA  . ALA A 1 35  ? 69.458 51.545 15.699  1.00 32.51 ? 65  ALA A CA  1 
ATOM   174  C C   . ALA A 1 35  ? 68.675 50.302 15.209  1.00 32.35 ? 65  ALA A C   1 
ATOM   175  O O   . ALA A 1 35  ? 69.078 49.186 15.440  1.00 32.47 ? 65  ALA A O   1 
ATOM   176  C CB  . ALA A 1 35  ? 68.806 52.165 16.910  1.00 32.13 ? 65  ALA A CB  1 
ATOM   177  N N   . LEU A 1 36  ? 67.574 50.513 14.510  1.00 32.12 ? 66  LEU A N   1 
ATOM   178  C CA  . LEU A 1 36  ? 66.799 49.425 13.963  1.00 32.83 ? 66  LEU A CA  1 
ATOM   179  C C   . LEU A 1 36  ? 67.638 48.493 13.063  1.00 33.40 ? 66  LEU A C   1 
ATOM   180  O O   . LEU A 1 36  ? 67.587 47.272 13.203  1.00 32.97 ? 66  LEU A O   1 
ATOM   181  C CB  . LEU A 1 36  ? 65.602 50.008 13.209  1.00 32.23 ? 66  LEU A CB  1 
ATOM   182  C CG  . LEU A 1 36  ? 64.529 49.092 12.631  1.00 31.44 ? 66  LEU A CG  1 
ATOM   183  C CD1 . LEU A 1 36  ? 63.759 48.365 13.746  1.00 28.68 ? 66  LEU A CD1 1 
ATOM   184  C CD2 . LEU A 1 36  ? 63.621 49.923 11.776  1.00 28.50 ? 66  LEU A CD2 1 
ATOM   185  N N   . GLN A 1 37  ? 68.394 49.082 12.141  1.00 34.38 ? 67  GLN A N   1 
ATOM   186  C CA  . GLN A 1 37  ? 69.238 48.316 11.235  1.00 35.68 ? 67  GLN A CA  1 
ATOM   187  C C   . GLN A 1 37  ? 70.477 47.710 11.893  1.00 36.50 ? 67  GLN A C   1 
ATOM   188  O O   . GLN A 1 37  ? 70.837 46.573 11.568  1.00 35.95 ? 67  GLN A O   1 
ATOM   189  C CB  . GLN A 1 37  ? 69.682 49.183 10.079  1.00 36.05 ? 67  GLN A CB  1 
ATOM   190  C CG  . GLN A 1 37  ? 68.667 49.338 9.012   1.00 37.11 ? 67  GLN A CG  1 
ATOM   191  C CD  . GLN A 1 37  ? 69.163 50.242 7.928   1.00 38.59 ? 67  GLN A CD  1 
ATOM   192  O OE1 . GLN A 1 37  ? 69.275 51.453 8.115   1.00 43.57 ? 67  GLN A OE1 1 
ATOM   193  N NE2 . GLN A 1 37  ? 69.446 49.673 6.781   1.00 37.54 ? 67  GLN A NE2 1 
ATOM   194  N N   . ARG A 1 38  ? 71.112 48.460 12.807  1.00 36.29 ? 68  ARG A N   1 
ATOM   195  C CA  . ARG A 1 38  ? 72.473 48.143 13.261  1.00 37.40 ? 68  ARG A CA  1 
ATOM   196  C C   . ARG A 1 38  ? 72.591 47.761 14.740  1.00 37.48 ? 68  ARG A C   1 
ATOM   197  O O   . ARG A 1 38  ? 73.461 46.983 15.117  1.00 37.45 ? 68  ARG A O   1 
ATOM   198  C CB  . ARG A 1 38  ? 73.434 49.299 12.943  1.00 37.03 ? 68  ARG A CB  1 
ATOM   199  C CG  . ARG A 1 38  ? 73.501 49.640 11.454  1.00 39.05 ? 68  ARG A CG  1 
ATOM   200  C CD  . ARG A 1 38  ? 74.098 48.480 10.679  1.00 41.73 ? 68  ARG A CD  1 
ATOM   201  N NE  . ARG A 1 38  ? 73.975 48.591 9.218   1.00 44.40 ? 68  ARG A NE  1 
ATOM   202  C CZ  . ARG A 1 38  ? 74.250 47.587 8.378   1.00 43.87 ? 68  ARG A CZ  1 
ATOM   203  N NH1 . ARG A 1 38  ? 74.658 46.407 8.859   1.00 42.12 ? 68  ARG A NH1 1 
ATOM   204  N NH2 . ARG A 1 38  ? 74.097 47.750 7.064   1.00 44.55 ? 68  ARG A NH2 1 
ATOM   205  N N   . GLN A 1 39  ? 71.726 48.316 15.576  1.00 37.31 ? 69  GLN A N   1 
ATOM   206  C CA  . GLN A 1 39  ? 71.788 48.000 16.994  1.00 37.50 ? 69  GLN A CA  1 
ATOM   207  C C   . GLN A 1 39  ? 70.400 47.827 17.633  1.00 36.35 ? 69  GLN A C   1 
ATOM   208  O O   . GLN A 1 39  ? 70.063 48.547 18.584  1.00 34.57 ? 69  GLN A O   1 
ATOM   209  C CB  . GLN A 1 39  ? 72.554 49.106 17.691  1.00 38.84 ? 69  GLN A CB  1 
ATOM   210  C CG  . GLN A 1 39  ? 73.216 48.692 18.998  1.00 45.10 ? 69  GLN A CG  1 
ATOM   211  C CD  . GLN A 1 39  ? 73.884 49.885 19.665  1.00 54.03 ? 69  GLN A CD  1 
ATOM   212  O OE1 . GLN A 1 39  ? 73.207 50.828 20.125  1.00 56.97 ? 69  GLN A OE1 1 
ATOM   213  N NE2 . GLN A 1 39  ? 75.220 49.868 19.700  1.00 56.46 ? 69  GLN A NE2 1 
ATOM   214  N N   . PRO A 1 40  ? 69.580 46.877 17.106  1.00 35.56 ? 70  PRO A N   1 
ATOM   215  C CA  . PRO A 1 40  ? 68.213 46.772 17.628  1.00 34.54 ? 70  PRO A CA  1 
ATOM   216  C C   . PRO A 1 40  ? 68.184 46.274 19.071  1.00 33.73 ? 70  PRO A C   1 
ATOM   217  O O   . PRO A 1 40  ? 69.225 45.798 19.595  1.00 33.58 ? 70  PRO A O   1 
ATOM   218  C CB  . PRO A 1 40  ? 67.559 45.734 16.694  1.00 34.19 ? 70  PRO A CB  1 
ATOM   219  C CG  . PRO A 1 40  ? 68.722 44.863 16.226  1.00 36.15 ? 70  PRO A CG  1 
ATOM   220  C CD  . PRO A 1 40  ? 69.841 45.883 16.037  1.00 35.69 ? 70  PRO A CD  1 
ATOM   221  N N   . PRO A 1 41  ? 67.010 46.376 19.732  1.00 32.05 ? 71  PRO A N   1 
ATOM   222  C CA  . PRO A 1 41  ? 66.906 45.685 21.021  1.00 30.97 ? 71  PRO A CA  1 
ATOM   223  C C   . PRO A 1 41  ? 67.162 44.175 20.831  1.00 28.76 ? 71  PRO A C   1 
ATOM   224  O O   . PRO A 1 41  ? 66.910 43.641 19.749  1.00 28.72 ? 71  PRO A O   1 
ATOM   225  C CB  . PRO A 1 41  ? 65.460 45.959 21.461  1.00 30.73 ? 71  PRO A CB  1 
ATOM   226  C CG  . PRO A 1 41  ? 65.036 47.142 20.678  1.00 30.93 ? 71  PRO A CG  1 
ATOM   227  C CD  . PRO A 1 41  ? 65.754 47.056 19.366  1.00 32.02 ? 71  PRO A CD  1 
ATOM   228  N N   . SER A 1 42  ? 67.697 43.523 21.857  1.00 27.66 ? 72  SER A N   1 
ATOM   229  C CA  . SER A 1 42  ? 68.074 42.109 21.759  1.00 26.97 ? 72  SER A CA  1 
ATOM   230  C C   . SER A 1 42  ? 66.813 41.229 21.714  1.00 25.29 ? 72  SER A C   1 
ATOM   231  O O   . SER A 1 42  ? 65.742 41.686 22.132  1.00 23.59 ? 72  SER A O   1 
ATOM   232  C CB  . SER A 1 42  ? 68.940 41.709 22.952  1.00 26.34 ? 72  SER A CB  1 
ATOM   233  O OG  . SER A 1 42  ? 68.157 41.699 24.136  1.00 30.23 ? 72  SER A OG  1 
ATOM   234  N N   . PRO A 1 43  ? 66.931 39.976 21.196  1.00 24.28 ? 73  PRO A N   1 
ATOM   235  C CA  . PRO A 1 43  ? 65.749 39.104 21.261  1.00 23.49 ? 73  PRO A CA  1 
ATOM   236  C C   . PRO A 1 43  ? 65.180 38.992 22.698  1.00 23.60 ? 73  PRO A C   1 
ATOM   237  O O   . PRO A 1 43  ? 63.964 39.087 22.854  1.00 22.43 ? 73  PRO A O   1 
ATOM   238  C CB  . PRO A 1 43  ? 66.263 37.749 20.704  1.00 21.84 ? 73  PRO A CB  1 
ATOM   239  C CG  . PRO A 1 43  ? 67.399 38.155 19.744  1.00 23.19 ? 73  PRO A CG  1 
ATOM   240  C CD  . PRO A 1 43  ? 68.076 39.320 20.492  1.00 24.56 ? 73  PRO A CD  1 
ATOM   241  N N   . LYS A 1 44  ? 66.029 38.833 23.727  1.00 25.15 ? 74  LYS A N   1 
ATOM   242  C CA  . LYS A 1 44  ? 65.536 38.828 25.122  1.00 25.77 ? 74  LYS A CA  1 
ATOM   243  C C   . LYS A 1 44  ? 64.781 40.107 25.500  1.00 26.07 ? 74  LYS A C   1 
ATOM   244  O O   . LYS A 1 44  ? 63.711 40.053 26.098  1.00 25.76 ? 74  LYS A O   1 
ATOM   245  C CB  . LYS A 1 44  ? 66.645 38.559 26.160  1.00 27.03 ? 74  LYS A CB  1 
ATOM   246  C CG  . LYS A 1 44  ? 66.104 38.208 27.620  1.00 28.69 ? 74  LYS A CG  1 
ATOM   247  C CD  . LYS A 1 44  ? 65.132 36.965 27.678  1.00 32.17 ? 74  LYS A CD  1 
ATOM   248  C CE  . LYS A 1 44  ? 64.482 36.685 29.050  1.00 31.15 ? 74  LYS A CE  1 
ATOM   249  N NZ  . LYS A 1 44  ? 65.346 36.525 30.268  1.00 32.34 ? 74  LYS A NZ  1 
ATOM   250  N N   . GLN A 1 45  ? 65.327 41.258 25.142  1.00 26.34 ? 75  GLN A N   1 
ATOM   251  C CA  . GLN A 1 45  ? 64.648 42.517 25.472  1.00 27.05 ? 75  GLN A CA  1 
ATOM   252  C C   . GLN A 1 45  ? 63.292 42.657 24.770  1.00 25.27 ? 75  GLN A C   1 
ATOM   253  O O   . GLN A 1 45  ? 62.337 43.098 25.379  1.00 24.78 ? 75  GLN A O   1 
ATOM   254  C CB  . GLN A 1 45  ? 65.546 43.714 25.125  1.00 27.08 ? 75  GLN A CB  1 
ATOM   255  C CG  . GLN A 1 45  ? 66.698 43.911 26.088  1.00 29.43 ? 75  GLN A CG  1 
ATOM   256  C CD  . GLN A 1 45  ? 67.737 44.953 25.593  1.00 31.29 ? 75  GLN A CD  1 
ATOM   257  O OE1 . GLN A 1 45  ? 67.918 45.218 24.380  1.00 33.48 ? 75  GLN A OE1 1 
ATOM   258  N NE2 . GLN A 1 45  ? 68.421 45.551 26.560  1.00 39.59 ? 75  GLN A NE2 1 
ATOM   259  N N   . LEU A 1 46  ? 63.221 42.257 23.501  1.00 24.54 ? 76  LEU A N   1 
ATOM   260  C CA  . LEU A 1 46  ? 61.958 42.261 22.742  1.00 23.29 ? 76  LEU A CA  1 
ATOM   261  C C   . LEU A 1 46  ? 60.907 41.307 23.318  1.00 23.59 ? 76  LEU A C   1 
ATOM   262  O O   . LEU A 1 46  ? 59.728 41.662 23.372  1.00 22.79 ? 76  LEU A O   1 
ATOM   263  C CB  . LEU A 1 46  ? 62.207 41.999 21.268  1.00 21.69 ? 76  LEU A CB  1 
ATOM   264  C CG  . LEU A 1 46  ? 62.995 43.073 20.515  1.00 23.33 ? 76  LEU A CG  1 
ATOM   265  C CD1 . LEU A 1 46  ? 63.119 42.681 19.014  1.00 21.44 ? 76  LEU A CD1 1 
ATOM   266  C CD2 . LEU A 1 46  ? 62.327 44.416 20.672  1.00 20.55 ? 76  LEU A CD2 1 
ATOM   267  N N   . GLU A 1 47  ? 61.329 40.115 23.776  1.00 23.15 ? 77  GLU A N   1 
ATOM   268  C CA  . GLU A 1 47  ? 60.421 39.196 24.473  1.00 23.19 ? 77  GLU A CA  1 
ATOM   269  C C   . GLU A 1 47  ? 59.845 39.813 25.755  1.00 23.95 ? 77  GLU A C   1 
ATOM   270  O O   . GLU A 1 47  ? 58.637 39.713 25.997  1.00 22.54 ? 77  GLU A O   1 
ATOM   271  C CB  . GLU A 1 47  ? 61.114 37.877 24.846  1.00 22.08 ? 77  GLU A CB  1 
ATOM   272  C CG  . GLU A 1 47  ? 61.358 36.972 23.650  1.00 22.76 ? 77  GLU A CG  1 
ATOM   273  C CD  . GLU A 1 47  ? 62.100 35.699 24.020  1.00 22.24 ? 77  GLU A CD  1 
ATOM   274  O OE1 . GLU A 1 47  ? 62.529 35.540 25.183  1.00 21.98 ? 77  GLU A OE1 1 
ATOM   275  O OE2 . GLU A 1 47  ? 62.254 34.854 23.125  1.00 23.27 ? 77  GLU A OE2 1 
ATOM   276  N N   . GLU A 1 48  ? 60.700 40.409 26.592  1.00 23.89 ? 78  GLU A N   1 
ATOM   277  C CA  . GLU A 1 48  ? 60.206 41.009 27.835  1.00 25.23 ? 78  GLU A CA  1 
ATOM   278  C C   . GLU A 1 48  ? 59.335 42.243 27.570  1.00 24.65 ? 78  GLU A C   1 
ATOM   279  O O   . GLU A 1 48  ? 58.304 42.455 28.238  1.00 24.81 ? 78  GLU A O   1 
ATOM   280  C CB  . GLU A 1 48  ? 61.378 41.315 28.776  1.00 26.41 ? 78  GLU A CB  1 
ATOM   281  C CG  . GLU A 1 48  ? 62.028 40.000 29.251  1.00 32.41 ? 78  GLU A CG  1 
ATOM   282  C CD  . GLU A 1 48  ? 63.200 40.197 30.163  1.00 40.54 ? 78  GLU A CD  1 
ATOM   283  O OE1 . GLU A 1 48  ? 64.005 41.133 29.929  1.00 46.39 ? 78  GLU A OE1 1 
ATOM   284  O OE2 . GLU A 1 48  ? 63.332 39.402 31.107  1.00 42.57 ? 78  GLU A OE2 1 
ATOM   285  N N   . GLU A 1 49  ? 59.709 43.027 26.569  1.00 24.04 ? 79  GLU A N   1 
ATOM   286  C CA  . GLU A 1 49  ? 58.907 44.203 26.193  1.00 23.69 ? 79  GLU A CA  1 
ATOM   287  C C   . GLU A 1 49  ? 57.503 43.774 25.746  1.00 24.79 ? 79  GLU A C   1 
ATOM   288  O O   . GLU A 1 49  ? 56.471 44.302 26.245  1.00 24.12 ? 79  GLU A O   1 
ATOM   289  C CB  . GLU A 1 49  ? 59.615 44.951 25.066  1.00 24.32 ? 79  GLU A CB  1 
ATOM   290  C CG  . GLU A 1 49  ? 58.888 46.209 24.606  1.00 23.43 ? 79  GLU A CG  1 
ATOM   291  C CD  . GLU A 1 49  ? 59.762 47.036 23.718  1.00 25.14 ? 79  GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 49  ? 60.650 47.719 24.245  1.00 25.06 ? 79  GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 49  ? 59.553 47.022 22.488  1.00 25.83 ? 79  GLU A OE2 1 
ATOM   294  N N   . PHE A 1 50  ? 57.466 42.798 24.833  1.00 23.48 ? 80  PHE A N   1 
ATOM   295  C CA  . PHE A 1 50  ? 56.213 42.275 24.342  1.00 23.81 ? 80  PHE A CA  1 
ATOM   296  C C   . PHE A 1 50  ? 55.265 41.768 25.455  1.00 25.29 ? 80  PHE A C   1 
ATOM   297  O O   . PHE A 1 50  ? 54.065 42.066 25.422  1.00 23.87 ? 80  PHE A O   1 
ATOM   298  C CB  . PHE A 1 50  ? 56.422 41.190 23.275  1.00 22.77 ? 80  PHE A CB  1 
ATOM   299  C CG  . PHE A 1 50  ? 55.140 40.737 22.657  1.00 23.74 ? 80  PHE A CG  1 
ATOM   300  C CD1 . PHE A 1 50  ? 54.455 41.566 21.747  1.00 22.52 ? 80  PHE A CD1 1 
ATOM   301  C CD2 . PHE A 1 50  ? 54.542 39.546 23.065  1.00 23.55 ? 80  PHE A CD2 1 
ATOM   302  C CE1 . PHE A 1 50  ? 53.224 41.174 21.196  1.00 21.65 ? 80  PHE A CE1 1 
ATOM   303  C CE2 . PHE A 1 50  ? 53.281 39.166 22.533  1.00 25.42 ? 80  PHE A CE2 1 
ATOM   304  C CZ  . PHE A 1 50  ? 52.643 39.983 21.581  1.00 22.69 ? 80  PHE A CZ  1 
ATOM   305  N N   . LEU A 1 51  ? 55.814 40.987 26.393  1.00 25.63 ? 81  LEU A N   1 
ATOM   306  C CA  . LEU A 1 51  ? 55.081 40.466 27.543  1.00 27.60 ? 81  LEU A CA  1 
ATOM   307  C C   . LEU A 1 51  ? 54.461 41.524 28.443  1.00 27.44 ? 81  LEU A C   1 
ATOM   308  O O   . LEU A 1 51  ? 53.422 41.274 29.049  1.00 27.93 ? 81  LEU A O   1 
ATOM   309  C CB  . LEU A 1 51  ? 55.960 39.518 28.395  1.00 27.86 ? 81  LEU A CB  1 
ATOM   310  C CG  . LEU A 1 51  ? 56.201 38.121 27.803  1.00 31.27 ? 81  LEU A CG  1 
ATOM   311  C CD1 . LEU A 1 51  ? 57.345 37.425 28.532  1.00 33.70 ? 81  LEU A CD1 1 
ATOM   312  C CD2 . LEU A 1 51  ? 54.938 37.263 27.839  1.00 30.54 ? 81  LEU A CD2 1 
ATOM   313  N N   . LYS A 1 52  ? 55.093 42.685 28.511  1.00 27.58 ? 82  LYS A N   1 
ATOM   314  C CA  . LYS A 1 52  ? 54.599 43.819 29.283  1.00 29.01 ? 82  LYS A CA  1 
ATOM   315  C C   . LYS A 1 52  ? 53.404 44.539 28.641  1.00 28.65 ? 82  LYS A C   1 
ATOM   316  O O   . LYS A 1 52  ? 52.676 45.247 29.341  1.00 30.13 ? 82  LYS A O   1 
ATOM   317  C CB  . LYS A 1 52  ? 55.716 44.841 29.532  1.00 29.63 ? 82  LYS A CB  1 
ATOM   318  C CG  . LYS A 1 52  ? 56.673 44.438 30.659  1.00 34.69 ? 82  LYS A CG  1 
ATOM   319  C CD  . LYS A 1 52  ? 57.982 45.227 30.555  1.00 42.66 ? 82  LYS A CD  1 
ATOM   320  C CE  . LYS A 1 52  ? 58.932 44.901 31.722  1.00 47.03 ? 82  LYS A CE  1 
ATOM   321  N NZ  . LYS A 1 52  ? 60.385 45.032 31.337  1.00 48.24 ? 82  LYS A NZ  1 
ATOM   322  N N   . ILE A 1 53  ? 53.188 44.371 27.340  1.00 27.19 ? 83  ILE A N   1 
ATOM   323  C CA  . ILE A 1 53  ? 52.056 45.037 26.678  1.00 25.15 ? 83  ILE A CA  1 
ATOM   324  C C   . ILE A 1 53  ? 50.714 44.402 27.091  1.00 25.72 ? 83  ILE A C   1 
ATOM   325  O O   . ILE A 1 53  ? 50.490 43.218 26.878  1.00 25.29 ? 83  ILE A O   1 
ATOM   326  C CB  . ILE A 1 53  ? 52.183 45.087 25.122  1.00 25.85 ? 83  ILE A CB  1 
ATOM   327  C CG1 . ILE A 1 53  ? 53.625 45.473 24.711  1.00 23.56 ? 83  ILE A CG1 1 
ATOM   328  C CG2 . ILE A 1 53  ? 51.079 46.043 24.526  1.00 22.19 ? 83  ILE A CG2 1 
ATOM   329  C CD1 . ILE A 1 53  ? 53.900 45.486 23.202  1.00 22.20 ? 83  ILE A CD1 1 
ATOM   330  N N   . PRO A 1 54  ? 49.823 45.199 27.705  1.00 25.74 ? 84  PRO A N   1 
ATOM   331  C CA  . PRO A 1 54  ? 48.517 44.709 28.090  1.00 26.12 ? 84  PRO A CA  1 
ATOM   332  C C   . PRO A 1 54  ? 47.720 44.332 26.854  1.00 25.42 ? 84  PRO A C   1 
ATOM   333  O O   . PRO A 1 54  ? 47.932 44.896 25.793  1.00 25.78 ? 84  PRO A O   1 
ATOM   334  C CB  . PRO A 1 54  ? 47.874 45.932 28.784  1.00 26.19 ? 84  PRO A CB  1 
ATOM   335  C CG  . PRO A 1 54  ? 48.927 46.788 29.146  1.00 26.86 ? 84  PRO A CG  1 
ATOM   336  C CD  . PRO A 1 54  ? 50.004 46.603 28.103  1.00 25.74 ? 84  PRO A CD  1 
ATOM   337  N N   . SER A 1 55  ? 46.832 43.364 26.983  1.00 26.00 ? 85  SER A N   1 
ATOM   338  C CA  . SER A 1 55  ? 46.058 42.869 25.849  1.00 26.98 ? 85  SER A CA  1 
ATOM   339  C C   . SER A 1 55  ? 44.953 43.853 25.433  1.00 27.47 ? 85  SER A C   1 
ATOM   340  O O   . SER A 1 55  ? 44.674 43.989 24.237  1.00 28.36 ? 85  SER A O   1 
ATOM   341  C CB  . SER A 1 55  ? 45.420 41.533 26.183  1.00 26.51 ? 85  SER A CB  1 
ATOM   342  O OG  . SER A 1 55  ? 44.358 41.749 27.123  1.00 29.51 ? 85  SER A OG  1 
ATOM   343  N N   . ASN A 1 56  ? 44.351 44.508 26.428  1.00 27.87 ? 86  ASN A N   1 
ATOM   344  C CA  . ASN A 1 56  ? 43.115 45.315 26.306  1.00 28.81 ? 86  ASN A CA  1 
ATOM   345  C C   . ASN A 1 56  ? 41.969 44.487 25.760  1.00 28.33 ? 86  ASN A C   1 
ATOM   346  O O   . ASN A 1 56  ? 41.081 45.013 25.089  1.00 28.25 ? 86  ASN A O   1 
ATOM   347  C CB  . ASN A 1 56  ? 43.340 46.593 25.467  1.00 28.82 ? 86  ASN A CB  1 
ATOM   348  C CG  . ASN A 1 56  ? 42.323 47.729 25.777  1.00 31.69 ? 86  ASN A CG  1 
ATOM   349  O OD1 . ASN A 1 56  ? 41.873 47.903 26.915  1.00 29.86 ? 86  ASN A OD1 1 
ATOM   350  N ND2 . ASN A 1 56  ? 41.998 48.519 24.761  1.00 27.83 ? 86  ASN A ND2 1 
ATOM   351  N N   . PHE A 1 57  ? 41.979 43.186 26.018  1.00 29.15 ? 87  PHE A N   1 
ATOM   352  C CA  . PHE A 1 57  ? 40.818 42.348 25.705  1.00 30.60 ? 87  PHE A CA  1 
ATOM   353  C C   . PHE A 1 57  ? 39.578 42.815 26.470  1.00 31.94 ? 87  PHE A C   1 
ATOM   354  O O   . PHE A 1 57  ? 39.687 43.335 27.579  1.00 30.98 ? 87  PHE A O   1 
ATOM   355  C CB  . PHE A 1 57  ? 41.082 40.879 25.992  1.00 31.07 ? 87  PHE A CB  1 
ATOM   356  C CG  . PHE A 1 57  ? 41.821 40.186 24.885  1.00 32.20 ? 87  PHE A CG  1 
ATOM   357  C CD1 . PHE A 1 57  ? 41.439 40.375 23.560  1.00 35.29 ? 87  PHE A CD1 1 
ATOM   358  C CD2 . PHE A 1 57  ? 42.887 39.358 25.154  1.00 32.77 ? 87  PHE A CD2 1 
ATOM   359  C CE1 . PHE A 1 57  ? 42.124 39.738 22.534  1.00 33.57 ? 87  PHE A CE1 1 
ATOM   360  C CE2 . PHE A 1 57  ? 43.582 38.721 24.121  1.00 32.34 ? 87  PHE A CE2 1 
ATOM   361  C CZ  . PHE A 1 57  ? 43.190 38.901 22.832  1.00 32.28 ? 87  PHE A CZ  1 
ATOM   362  N N   . VAL A 1 58  ? 38.402 42.667 25.860  1.00 34.15 ? 88  VAL A N   1 
ATOM   363  C CA  . VAL A 1 58  ? 37.170 43.017 26.559  1.00 35.74 ? 88  VAL A CA  1 
ATOM   364  C C   . VAL A 1 58  ? 36.535 41.735 27.061  1.00 37.05 ? 88  VAL A C   1 
ATOM   365  O O   . VAL A 1 58  ? 36.580 40.699 26.388  1.00 36.92 ? 88  VAL A O   1 
ATOM   366  C CB  . VAL A 1 58  ? 36.131 43.903 25.741  1.00 36.30 ? 88  VAL A CB  1 
ATOM   367  C CG1 . VAL A 1 58  ? 36.519 45.388 25.807  1.00 37.74 ? 88  VAL A CG1 1 
ATOM   368  C CG2 . VAL A 1 58  ? 35.923 43.408 24.331  1.00 34.73 ? 88  VAL A CG2 1 
ATOM   369  N N   . SER A 1 59  ? 36.016 41.807 28.278  1.00 38.70 ? 89  SER A N   1 
ATOM   370  C CA  A SER A 1 59  ? 35.270 40.696 28.881  0.50 40.20 ? 89  SER A CA  1 
ATOM   371  C CA  B SER A 1 59  ? 35.283 40.697 28.885  0.50 40.27 ? 89  SER A CA  1 
ATOM   372  C C   . SER A 1 59  ? 33.863 40.652 28.316  1.00 41.15 ? 89  SER A C   1 
ATOM   373  O O   . SER A 1 59  ? 33.325 41.697 27.912  1.00 40.41 ? 89  SER A O   1 
ATOM   374  C CB  A SER A 1 59  ? 35.164 40.904 30.378  0.50 40.22 ? 89  SER A CB  1 
ATOM   375  C CB  B SER A 1 59  ? 35.249 40.868 30.405  0.50 40.34 ? 89  SER A CB  1 
ATOM   376  O OG  A SER A 1 59  ? 34.444 42.094 30.629  0.50 40.63 ? 89  SER A OG  1 
ATOM   377  O OG  B SER A 1 59  ? 36.460 41.447 30.896  0.50 41.05 ? 89  SER A OG  1 
ATOM   378  N N   . PRO A 1 60  ? 33.238 39.441 28.275  1.00 43.30 ? 90  PRO A N   1 
ATOM   379  C CA  . PRO A 1 60  ? 31.864 39.409 27.766  1.00 45.04 ? 90  PRO A CA  1 
ATOM   380  C C   . PRO A 1 60  ? 30.914 40.348 28.539  1.00 46.74 ? 90  PRO A C   1 
ATOM   381  O O   . PRO A 1 60  ? 29.944 40.830 27.954  1.00 47.37 ? 90  PRO A O   1 
ATOM   382  C CB  . PRO A 1 60  ? 31.454 37.932 27.913  1.00 45.25 ? 90  PRO A CB  1 
ATOM   383  C CG  . PRO A 1 60  ? 32.728 37.161 27.909  1.00 44.29 ? 90  PRO A CG  1 
ATOM   384  C CD  . PRO A 1 60  ? 33.709 38.081 28.642  1.00 44.22 ? 90  PRO A CD  1 
ATOM   385  N N   . GLU A 1 61  ? 31.236 40.651 29.800  1.00 48.40 ? 91  GLU A N   1 
ATOM   386  C CA  A GLU A 1 61  ? 30.402 41.541 30.624  0.50 49.52 ? 91  GLU A CA  1 
ATOM   387  C CA  B GLU A 1 61  ? 30.437 41.541 30.653  0.50 49.83 ? 91  GLU A CA  1 
ATOM   388  C C   . GLU A 1 61  ? 30.449 42.991 30.151  1.00 50.16 ? 91  GLU A C   1 
ATOM   389  O O   . GLU A 1 61  ? 29.581 43.793 30.516  1.00 50.20 ? 91  GLU A O   1 
ATOM   390  C CB  A GLU A 1 61  ? 30.781 41.459 32.110  0.50 49.67 ? 91  GLU A CB  1 
ATOM   391  C CB  B GLU A 1 61  ? 30.909 41.446 32.123  0.50 49.82 ? 91  GLU A CB  1 
ATOM   392  C CG  A GLU A 1 61  ? 30.505 40.118 32.768  0.50 50.05 ? 91  GLU A CG  1 
ATOM   393  C CG  B GLU A 1 61  ? 32.300 42.055 32.407  0.50 50.75 ? 91  GLU A CG  1 
ATOM   394  C CD  A GLU A 1 61  ? 31.519 39.056 32.380  0.50 51.80 ? 91  GLU A CD  1 
ATOM   395  C CD  B GLU A 1 61  ? 33.023 41.441 33.609  0.50 50.94 ? 91  GLU A CD  1 
ATOM   396  O OE1 A GLU A 1 61  ? 32.734 39.373 32.325  0.50 51.33 ? 91  GLU A OE1 1 
ATOM   397  O OE1 B GLU A 1 61  ? 32.356 41.066 34.604  0.50 51.75 ? 91  GLU A OE1 1 
ATOM   398  O OE2 A GLU A 1 61  ? 31.096 37.903 32.129  0.50 52.01 ? 91  GLU A OE2 1 
ATOM   399  O OE2 B GLU A 1 61  ? 34.275 41.349 33.559  0.50 51.76 ? 91  GLU A OE2 1 
ATOM   400  N N   . ASP A 1 62  ? 31.440 43.317 29.312  1.00 50.92 ? 92  ASP A N   1 
ATOM   401  C CA  . ASP A 1 62  ? 31.626 44.683 28.766  1.00 51.76 ? 92  ASP A CA  1 
ATOM   402  C C   . ASP A 1 62  ? 30.834 44.953 27.492  1.00 51.24 ? 92  ASP A C   1 
ATOM   403  O O   . ASP A 1 62  ? 30.687 46.101 27.065  1.00 50.70 ? 92  ASP A O   1 
ATOM   404  C CB  . ASP A 1 62  ? 33.101 44.956 28.476  1.00 52.62 ? 92  ASP A CB  1 
ATOM   405  C CG  . ASP A 1 62  ? 33.968 44.954 29.724  1.00 55.57 ? 92  ASP A CG  1 
ATOM   406  O OD1 . ASP A 1 62  ? 33.425 45.058 30.865  1.00 58.08 ? 92  ASP A OD1 1 
ATOM   407  O OD2 . ASP A 1 62  ? 35.213 44.850 29.540  1.00 59.79 ? 92  ASP A OD2 1 
ATOM   408  N N   . LEU A 1 63  ? 30.359 43.886 26.868  1.00 51.10 ? 93  LEU A N   1 
ATOM   409  C CA  . LEU A 1 63  ? 29.453 44.013 25.752  1.00 51.60 ? 93  LEU A CA  1 
ATOM   410  C C   . LEU A 1 63  ? 28.053 43.651 26.222  1.00 52.21 ? 93  LEU A C   1 
ATOM   411  O O   . LEU A 1 63  ? 27.832 42.572 26.784  1.00 52.74 ? 93  LEU A O   1 
ATOM   412  C CB  . LEU A 1 63  ? 29.864 43.081 24.608  1.00 51.22 ? 93  LEU A CB  1 
ATOM   413  C CG  . LEU A 1 63  ? 31.039 43.428 23.700  1.00 49.98 ? 93  LEU A CG  1 
ATOM   414  C CD1 . LEU A 1 63  ? 31.105 42.391 22.592  1.00 47.79 ? 93  LEU A CD1 1 
ATOM   415  C CD2 . LEU A 1 63  ? 30.920 44.820 23.125  1.00 47.20 ? 93  LEU A CD2 1 
ATOM   416  N N   . ASP A 1 64  ? 27.103 44.547 26.006  1.00 52.54 ? 94  ASP A N   1 
ATOM   417  C CA  . ASP A 1 64  ? 25.719 44.157 26.150  1.00 53.23 ? 94  ASP A CA  1 
ATOM   418  C C   . ASP A 1 64  ? 25.073 44.116 24.761  1.00 52.96 ? 94  ASP A C   1 
ATOM   419  O O   . ASP A 1 64  ? 24.379 45.052 24.355  1.00 52.99 ? 94  ASP A O   1 
ATOM   420  C CB  . ASP A 1 64  ? 24.988 45.085 27.132  1.00 54.01 ? 94  ASP A CB  1 
ATOM   421  C CG  . ASP A 1 64  ? 23.517 44.694 27.353  1.00 56.07 ? 94  ASP A CG  1 
ATOM   422  O OD1 . ASP A 1 64  ? 23.204 43.474 27.461  1.00 57.52 ? 94  ASP A OD1 1 
ATOM   423  O OD2 . ASP A 1 64  ? 22.682 45.630 27.421  1.00 57.56 ? 94  ASP A OD2 1 
ATOM   424  N N   . ILE A 1 65  ? 25.333 43.031 24.030  1.00 52.50 ? 95  ILE A N   1 
ATOM   425  C CA  . ILE A 1 65  ? 24.784 42.846 22.688  1.00 52.28 ? 95  ILE A CA  1 
ATOM   426  C C   . ILE A 1 65  ? 24.225 41.424 22.590  1.00 53.00 ? 95  ILE A C   1 
ATOM   427  O O   . ILE A 1 65  ? 24.947 40.487 22.240  1.00 53.86 ? 95  ILE A O   1 
ATOM   428  C CB  . ILE A 1 65  ? 25.854 43.096 21.579  1.00 51.69 ? 95  ILE A CB  1 
ATOM   429  C CG1 . ILE A 1 65  ? 26.537 44.455 21.776  1.00 51.02 ? 95  ILE A CG1 1 
ATOM   430  C CG2 . ILE A 1 65  ? 25.243 42.981 20.190  1.00 50.30 ? 95  ILE A CG2 1 
ATOM   431  C CD1 . ILE A 1 65  ? 27.943 44.514 21.250  1.00 49.83 ? 95  ILE A CD1 1 
ATOM   432  N N   . PRO A 1 66  ? 22.936 41.243 22.917  1.00 52.97 ? 96  PRO A N   1 
ATOM   433  C CA  . PRO A 1 66  ? 22.438 39.860 22.978  1.00 52.73 ? 96  PRO A CA  1 
ATOM   434  C C   . PRO A 1 66  ? 22.566 39.099 21.649  1.00 51.56 ? 96  PRO A C   1 
ATOM   435  O O   . PRO A 1 66  ? 22.287 39.642 20.587  1.00 51.86 ? 96  PRO A O   1 
ATOM   436  C CB  . PRO A 1 66  ? 20.961 40.036 23.404  1.00 53.29 ? 96  PRO A CB  1 
ATOM   437  C CG  . PRO A 1 66  ? 20.958 41.394 24.159  1.00 53.58 ? 96  PRO A CG  1 
ATOM   438  C CD  . PRO A 1 66  ? 21.890 42.223 23.277  1.00 53.33 ? 96  PRO A CD  1 
ATOM   439  N N   . GLY A 1 67  ? 23.006 37.851 21.713  1.00 50.34 ? 97  GLY A N   1 
ATOM   440  C CA  . GLY A 1 67  ? 23.122 37.056 20.492  1.00 48.69 ? 97  GLY A CA  1 
ATOM   441  C C   . GLY A 1 67  ? 24.448 37.220 19.758  1.00 47.18 ? 97  GLY A C   1 
ATOM   442  O O   . GLY A 1 67  ? 24.675 36.545 18.746  1.00 48.10 ? 97  GLY A O   1 
ATOM   443  N N   . HIS A 1 68  ? 25.325 38.098 20.257  1.00 44.94 ? 98  HIS A N   1 
ATOM   444  C CA  . HIS A 1 68  ? 26.595 38.389 19.571  1.00 42.53 ? 98  HIS A CA  1 
ATOM   445  C C   . HIS A 1 68  ? 27.461 37.139 19.427  1.00 41.17 ? 98  HIS A C   1 
ATOM   446  O O   . HIS A 1 68  ? 28.102 36.958 18.398  1.00 40.32 ? 98  HIS A O   1 
ATOM   447  C CB  . HIS A 1 68  ? 27.348 39.595 20.188  1.00 42.44 ? 98  HIS A CB  1 
ATOM   448  C CG  . HIS A 1 68  ? 28.095 39.292 21.456  1.00 42.26 ? 98  HIS A CG  1 
ATOM   449  N ND1 . HIS A 1 68  ? 29.249 38.534 21.489  1.00 42.23 ? 98  HIS A ND1 1 
ATOM   450  C CD2 . HIS A 1 68  ? 27.879 39.689 22.733  1.00 42.46 ? 98  HIS A CD2 1 
ATOM   451  C CE1 . HIS A 1 68  ? 29.689 38.447 22.731  1.00 41.64 ? 98  HIS A CE1 1 
ATOM   452  N NE2 . HIS A 1 68  ? 28.881 39.147 23.505  1.00 42.31 ? 98  HIS A NE2 1 
ATOM   453  N N   . ALA A 1 69  ? 27.408 36.241 20.416  1.00 40.02 ? 99  ALA A N   1 
ATOM   454  C CA  . ALA A 1 69  ? 28.224 35.006 20.412  1.00 38.67 ? 99  ALA A CA  1 
ATOM   455  C C   . ALA A 1 69  ? 28.106 34.129 19.160  1.00 37.42 ? 99  ALA A C   1 
ATOM   456  O O   . ALA A 1 69  ? 29.095 33.494 18.744  1.00 36.75 ? 99  ALA A O   1 
ATOM   457  C CB  . ALA A 1 69  ? 27.968 34.171 21.673  1.00 39.50 ? 99  ALA A CB  1 
ATOM   458  N N   . SER A 1 70  ? 26.915 34.082 18.560  1.00 36.25 ? 100 SER A N   1 
ATOM   459  C CA  . SER A 1 70  ? 26.729 33.324 17.316  1.00 35.83 ? 100 SER A CA  1 
ATOM   460  C C   . SER A 1 70  ? 27.488 33.940 16.122  1.00 34.54 ? 100 SER A C   1 
ATOM   461  O O   . SER A 1 70  ? 27.665 33.302 15.087  1.00 34.30 ? 100 SER A O   1 
ATOM   462  C CB  . SER A 1 70  ? 25.241 33.152 16.980  1.00 36.30 ? 100 SER A CB  1 
ATOM   463  O OG  . SER A 1 70  ? 24.591 34.406 16.816  1.00 38.69 ? 100 SER A OG  1 
ATOM   464  N N   . LYS A 1 71  ? 27.913 35.181 16.282  1.00 32.96 ? 101 LYS A N   1 
ATOM   465  C CA  . LYS A 1 71  ? 28.628 35.934 15.228  1.00 33.20 ? 101 LYS A CA  1 
ATOM   466  C C   . LYS A 1 71  ? 30.118 36.110 15.547  1.00 32.53 ? 101 LYS A C   1 
ATOM   467  O O   . LYS A 1 71  ? 30.828 36.845 14.849  1.00 32.52 ? 101 LYS A O   1 
ATOM   468  C CB  . LYS A 1 71  ? 27.963 37.302 15.054  1.00 31.77 ? 101 LYS A CB  1 
ATOM   469  C CG  . LYS A 1 71  ? 26.555 37.183 14.519  1.00 35.38 ? 101 LYS A CG  1 
ATOM   470  C CD  . LYS A 1 71  ? 25.740 38.410 14.807  1.00 40.64 ? 101 LYS A CD  1 
ATOM   471  C CE  . LYS A 1 71  ? 24.270 38.193 14.374  1.00 46.64 ? 101 LYS A CE  1 
ATOM   472  N NZ  . LYS A 1 71  ? 24.162 37.981 12.876  1.00 50.92 ? 101 LYS A NZ  1 
ATOM   473  N N   . ASP A 1 72  ? 30.574 35.465 16.624  1.00 32.92 ? 102 ASP A N   1 
ATOM   474  C CA  . ASP A 1 72  ? 31.999 35.445 16.994  1.00 33.09 ? 102 ASP A CA  1 
ATOM   475  C C   . ASP A 1 72  ? 32.639 34.112 16.634  1.00 33.97 ? 102 ASP A C   1 
ATOM   476  O O   . ASP A 1 72  ? 32.065 33.036 16.916  1.00 33.96 ? 102 ASP A O   1 
ATOM   477  C CB  . ASP A 1 72  ? 32.160 35.724 18.480  1.00 33.23 ? 102 ASP A CB  1 
ATOM   478  C CG  . ASP A 1 72  ? 31.678 37.102 18.854  1.00 32.62 ? 102 ASP A CG  1 
ATOM   479  O OD1 . ASP A 1 72  ? 31.827 38.016 18.028  1.00 31.70 ? 102 ASP A OD1 1 
ATOM   480  O OD2 . ASP A 1 72  ? 31.151 37.282 19.975  1.00 33.10 ? 102 ASP A OD2 1 
ATOM   481  N N   . ARG A 1 73  ? 33.814 34.138 15.995  1.00 33.42 ? 103 ARG A N   1 
ATOM   482  C CA  . ARG A 1 73  ? 34.506 32.872 15.738  1.00 32.49 ? 103 ARG A CA  1 
ATOM   483  C C   . ARG A 1 73  ? 35.077 32.312 17.051  1.00 32.36 ? 103 ARG A C   1 
ATOM   484  O O   . ARG A 1 73  ? 35.057 31.100 17.272  1.00 31.66 ? 103 ARG A O   1 
ATOM   485  C CB  . ARG A 1 73  ? 35.575 32.990 14.642  1.00 32.38 ? 103 ARG A CB  1 
ATOM   486  C CG  . ARG A 1 73  ? 36.213 31.667 14.328  1.00 31.85 ? 103 ARG A CG  1 
ATOM   487  C CD  . ARG A 1 73  ? 37.099 31.721 13.099  1.00 33.88 ? 103 ARG A CD  1 
ATOM   488  N NE  . ARG A 1 73  ? 36.315 31.664 11.862  1.00 34.22 ? 103 ARG A NE  1 
ATOM   489  C CZ  . ARG A 1 73  ? 36.093 32.697 11.046  1.00 34.30 ? 103 ARG A CZ  1 
ATOM   490  N NH1 . ARG A 1 73  ? 36.621 33.909 11.289  1.00 28.91 ? 103 ARG A NH1 1 
ATOM   491  N NH2 . ARG A 1 73  ? 35.347 32.497 9.958   1.00 36.90 ? 103 ARG A NH2 1 
ATOM   492  N N   . TYR A 1 74  ? 35.542 33.207 17.921  1.00 32.37 ? 104 TYR A N   1 
ATOM   493  C CA  . TYR A 1 74  ? 36.182 32.854 19.196  1.00 32.54 ? 104 TYR A CA  1 
ATOM   494  C C   . TYR A 1 74  ? 35.501 33.610 20.318  1.00 33.59 ? 104 TYR A C   1 
ATOM   495  O O   . TYR A 1 74  ? 35.291 34.822 20.231  1.00 33.24 ? 104 TYR A O   1 
ATOM   496  C CB  . TYR A 1 74  ? 37.689 33.197 19.162  1.00 31.70 ? 104 TYR A CB  1 
ATOM   497  C CG  . TYR A 1 74  ? 38.411 32.502 18.008  1.00 31.83 ? 104 TYR A CG  1 
ATOM   498  C CD1 . TYR A 1 74  ? 38.715 31.121 18.054  1.00 31.36 ? 104 TYR A CD1 1 
ATOM   499  C CD2 . TYR A 1 74  ? 38.710 33.197 16.838  1.00 28.47 ? 104 TYR A CD2 1 
ATOM   500  C CE1 . TYR A 1 74  ? 39.342 30.484 16.957  1.00 31.23 ? 104 TYR A CE1 1 
ATOM   501  C CE2 . TYR A 1 74  ? 39.317 32.577 15.764  1.00 31.88 ? 104 TYR A CE2 1 
ATOM   502  C CZ  . TYR A 1 74  ? 39.648 31.227 15.828  1.00 31.91 ? 104 TYR A CZ  1 
ATOM   503  O OH  . TYR A 1 74  ? 40.254 30.668 14.719  1.00 32.43 ? 104 TYR A OH  1 
ATOM   504  N N   . LYS A 1 75  ? 35.171 32.898 21.394  1.00 35.22 ? 105 LYS A N   1 
ATOM   505  C CA  . LYS A 1 75  ? 34.432 33.487 22.522  1.00 36.25 ? 105 LYS A CA  1 
ATOM   506  C C   . LYS A 1 75  ? 35.162 34.601 23.266  1.00 35.77 ? 105 LYS A C   1 
ATOM   507  O O   . LYS A 1 75  ? 34.521 35.529 23.755  1.00 36.22 ? 105 LYS A O   1 
ATOM   508  C CB  . LYS A 1 75  ? 33.979 32.385 23.528  1.00 37.78 ? 105 LYS A CB  1 
ATOM   509  N N   . THR A 1 76  ? 36.489 34.506 23.361  1.00 35.25 ? 106 THR A N   1 
ATOM   510  C CA  . THR A 1 76  ? 37.319 35.503 24.075  1.00 35.26 ? 106 THR A CA  1 
ATOM   511  C C   . THR A 1 76  ? 37.805 36.690 23.207  1.00 33.18 ? 106 THR A C   1 
ATOM   512  O O   . THR A 1 76  ? 38.366 37.658 23.721  1.00 32.88 ? 106 THR A O   1 
ATOM   513  C CB  . THR A 1 76  ? 38.594 34.848 24.710  1.00 35.90 ? 106 THR A CB  1 
ATOM   514  O OG1 . THR A 1 76  ? 39.342 34.168 23.686  1.00 40.10 ? 106 THR A OG1 1 
ATOM   515  C CG2 . THR A 1 76  ? 38.210 33.838 25.781  1.00 38.52 ? 106 THR A CG2 1 
ATOM   516  N N   . ILE A 1 77  ? 37.621 36.603 21.898  1.00 31.24 ? 107 ILE A N   1 
ATOM   517  C CA  . ILE A 1 77  ? 38.074 37.687 21.012  1.00 29.42 ? 107 ILE A CA  1 
ATOM   518  C C   . ILE A 1 77  ? 36.871 38.487 20.502  1.00 28.91 ? 107 ILE A C   1 
ATOM   519  O O   . ILE A 1 77  ? 36.130 38.061 19.591  1.00 27.61 ? 107 ILE A O   1 
ATOM   520  C CB  . ILE A 1 77  ? 39.000 37.168 19.900  1.00 30.23 ? 107 ILE A CB  1 
ATOM   521  C CG1 . ILE A 1 77  ? 40.271 36.575 20.539  1.00 29.14 ? 107 ILE A CG1 1 
ATOM   522  C CG2 . ILE A 1 77  ? 39.381 38.297 18.918  1.00 27.02 ? 107 ILE A CG2 1 
ATOM   523  C CD1 . ILE A 1 77  ? 40.863 35.548 19.685  1.00 31.35 ? 107 ILE A CD1 1 
ATOM   524  N N   . LEU A 1 78  ? 36.713 39.644 21.136  1.00 28.32 ? 108 LEU A N   1 
ATOM   525  C CA  . LEU A 1 78  ? 35.541 40.508 21.034  1.00 28.35 ? 108 LEU A CA  1 
ATOM   526  C C   . LEU A 1 78  ? 35.909 41.909 20.632  1.00 27.58 ? 108 LEU A C   1 
ATOM   527  O O   . LEU A 1 78  ? 36.968 42.380 21.003  1.00 27.74 ? 108 LEU A O   1 
ATOM   528  C CB  . LEU A 1 78  ? 34.817 40.585 22.398  1.00 27.41 ? 108 LEU A CB  1 
ATOM   529  C CG  . LEU A 1 78  ? 34.266 39.256 22.917  1.00 28.90 ? 108 LEU A CG  1 
ATOM   530  C CD1 . LEU A 1 78  ? 33.558 39.484 24.289  1.00 28.15 ? 108 LEU A CD1 1 
ATOM   531  C CD2 . LEU A 1 78  ? 33.340 38.626 21.901  1.00 26.76 ? 108 LEU A CD2 1 
ATOM   532  N N   . PRO A 1 79  ? 35.011 42.609 19.914  1.00 27.82 ? 109 PRO A N   1 
ATOM   533  C CA  . PRO A 1 79  ? 35.370 43.974 19.555  1.00 27.17 ? 109 PRO A CA  1 
ATOM   534  C C   . PRO A 1 79  ? 35.179 44.965 20.683  1.00 27.94 ? 109 PRO A C   1 
ATOM   535  O O   . PRO A 1 79  ? 34.060 45.077 21.236  1.00 27.80 ? 109 PRO A O   1 
ATOM   536  C CB  . PRO A 1 79  ? 34.404 44.289 18.405  1.00 27.76 ? 109 PRO A CB  1 
ATOM   537  C CG  . PRO A 1 79  ? 33.180 43.482 18.719  1.00 28.14 ? 109 PRO A CG  1 
ATOM   538  C CD  . PRO A 1 79  ? 33.688 42.213 19.370  1.00 27.57 ? 109 PRO A CD  1 
ATOM   539  N N   . ASN A 1 80  ? 36.233 45.706 21.011  1.00 26.83 ? 110 ASN A N   1 
ATOM   540  C CA  . ASN A 1 80  ? 36.121 46.764 21.985  1.00 28.01 ? 110 ASN A CA  1 
ATOM   541  C C   . ASN A 1 80  ? 34.966 47.708 21.639  1.00 29.39 ? 110 ASN A C   1 
ATOM   542  O O   . ASN A 1 80  ? 34.885 48.183 20.495  1.00 29.21 ? 110 ASN A O   1 
ATOM   543  C CB  . ASN A 1 80  ? 37.434 47.539 22.112  1.00 26.86 ? 110 ASN A CB  1 
ATOM   544  C CG  . ASN A 1 80  ? 38.576 46.641 22.470  1.00 26.20 ? 110 ASN A CG  1 
ATOM   545  O OD1 . ASN A 1 80  ? 38.856 45.690 21.755  1.00 24.55 ? 110 ASN A OD1 1 
ATOM   546  N ND2 . ASN A 1 80  ? 39.204 46.892 23.616  1.00 25.52 ? 110 ASN A ND2 1 
ATOM   547  N N   . PRO A 1 81  ? 34.048 47.949 22.613  1.00 30.23 ? 111 PRO A N   1 
ATOM   548  C CA  . PRO A 1 81  ? 32.852 48.740 22.297  1.00 30.26 ? 111 PRO A CA  1 
ATOM   549  C C   . PRO A 1 81  ? 33.134 50.165 21.817  1.00 28.95 ? 111 PRO A C   1 
ATOM   550  O O   . PRO A 1 81  ? 32.397 50.685 20.995  1.00 29.20 ? 111 PRO A O   1 
ATOM   551  C CB  . PRO A 1 81  ? 32.025 48.726 23.611  1.00 30.96 ? 111 PRO A CB  1 
ATOM   552  C CG  . PRO A 1 81  ? 32.968 48.296 24.700  1.00 31.92 ? 111 PRO A CG  1 
ATOM   553  C CD  . PRO A 1 81  ? 34.053 47.467 24.020  1.00 31.22 ? 111 PRO A CD  1 
ATOM   554  N N   . GLN A 1 82  ? 34.197 50.770 22.296  1.00 28.28 ? 112 GLN A N   1 
ATOM   555  C CA  . GLN A 1 82  ? 34.566 52.133 21.925  1.00 28.70 ? 112 GLN A CA  1 
ATOM   556  C C   . GLN A 1 82  ? 34.880 52.384 20.421  1.00 27.98 ? 112 GLN A C   1 
ATOM   557  O O   . GLN A 1 82  ? 34.811 53.519 19.974  1.00 28.19 ? 112 GLN A O   1 
ATOM   558  C CB  . GLN A 1 82  ? 35.749 52.592 22.769  1.00 30.17 ? 112 GLN A CB  1 
ATOM   559  C CG  . GLN A 1 82  ? 35.568 52.507 24.328  1.00 33.92 ? 112 GLN A CG  1 
ATOM   560  C CD  . GLN A 1 82  ? 35.716 51.082 24.938  1.00 38.62 ? 112 GLN A CD  1 
ATOM   561  O OE1 . GLN A 1 82  ? 36.150 50.126 24.286  1.00 39.09 ? 112 GLN A OE1 1 
ATOM   562  N NE2 . GLN A 1 82  ? 35.336 50.956 26.200  1.00 41.06 ? 112 GLN A NE2 1 
ATOM   563  N N   . SER A 1 83  ? 35.214 51.336 19.661  1.00 26.99 ? 113 SER A N   1 
ATOM   564  C CA  . SER A 1 83  ? 35.747 51.457 18.280  1.00 25.35 ? 113 SER A CA  1 
ATOM   565  C C   . SER A 1 83  ? 35.067 50.396 17.448  1.00 24.46 ? 113 SER A C   1 
ATOM   566  O O   . SER A 1 83  ? 35.442 50.112 16.322  1.00 24.18 ? 113 SER A O   1 
ATOM   567  C CB  . SER A 1 83  ? 37.277 51.230 18.292  1.00 25.47 ? 113 SER A CB  1 
ATOM   568  O OG  . SER A 1 83  ? 37.627 49.949 18.786  1.00 24.54 ? 113 SER A OG  1 
ATOM   569  N N   . ARG A 1 84  ? 34.064 49.777 18.035  1.00 23.93 ? 114 ARG A N   1 
ATOM   570  C CA  . ARG A 1 84  ? 33.289 48.759 17.375  1.00 25.20 ? 114 ARG A CA  1 
ATOM   571  C C   . ARG A 1 84  ? 32.617 49.357 16.096  1.00 25.25 ? 114 ARG A C   1 
ATOM   572  O O   . ARG A 1 84  ? 32.084 50.481 16.132  1.00 26.18 ? 114 ARG A O   1 
ATOM   573  C CB  . ARG A 1 84  ? 32.238 48.267 18.385  1.00 25.52 ? 114 ARG A CB  1 
ATOM   574  C CG  . ARG A 1 84  ? 31.286 47.255 17.909  1.00 27.53 ? 114 ARG A CG  1 
ATOM   575  C CD  . ARG A 1 84  ? 30.477 46.669 19.062  1.00 30.34 ? 114 ARG A CD  1 
ATOM   576  N NE  . ARG A 1 84  ? 29.326 47.491 19.463  1.00 30.15 ? 114 ARG A NE  1 
ATOM   577  C CZ  . ARG A 1 84  ? 28.096 47.381 18.944  1.00 29.48 ? 114 ARG A CZ  1 
ATOM   578  N NH1 . ARG A 1 84  ? 27.825 46.514 17.965  1.00 25.96 ? 114 ARG A NH1 1 
ATOM   579  N NH2 . ARG A 1 84  ? 27.127 48.173 19.397  1.00 31.15 ? 114 ARG A NH2 1 
ATOM   580  N N   . VAL A 1 85  ? 32.633 48.604 14.995  1.00 25.74 ? 115 VAL A N   1 
ATOM   581  C CA  . VAL A 1 85  ? 31.864 48.942 13.793  1.00 25.19 ? 115 VAL A CA  1 
ATOM   582  C C   . VAL A 1 85  ? 30.401 48.520 14.014  1.00 26.41 ? 115 VAL A C   1 
ATOM   583  O O   . VAL A 1 85  ? 30.110 47.334 14.234  1.00 26.64 ? 115 VAL A O   1 
ATOM   584  C CB  . VAL A 1 85  ? 32.472 48.293 12.495  1.00 25.21 ? 115 VAL A CB  1 
ATOM   585  C CG1 . VAL A 1 85  ? 31.701 48.757 11.274  1.00 25.69 ? 115 VAL A CG1 1 
ATOM   586  C CG2 . VAL A 1 85  ? 33.976 48.639 12.357  1.00 20.86 ? 115 VAL A CG2 1 
ATOM   587  N N   . CYS A 1 86  ? 29.483 49.484 13.993  1.00 26.50 ? 116 CYS A N   1 
ATOM   588  C CA  . CYS A 1 86  ? 28.053 49.174 14.212  1.00 28.02 ? 116 CYS A CA  1 
ATOM   589  C C   . CYS A 1 86  ? 27.290 49.147 12.904  1.00 27.73 ? 116 CYS A C   1 
ATOM   590  O O   . CYS A 1 86  ? 27.419 50.071 12.105  1.00 27.80 ? 116 CYS A O   1 
ATOM   591  C CB  . CYS A 1 86  ? 27.429 50.226 15.142  1.00 28.68 ? 116 CYS A CB  1 
ATOM   592  S SG  . CYS A 1 86  ? 28.255 50.280 16.762  1.00 31.69 ? 116 CYS A SG  1 
ATOM   593  N N   . LEU A 1 87  ? 26.530 48.087 12.656  1.00 28.83 ? 117 LEU A N   1 
ATOM   594  C CA  . LEU A 1 87  ? 25.798 47.990 11.396  1.00 31.36 ? 117 LEU A CA  1 
ATOM   595  C C   . LEU A 1 87  ? 24.447 48.714 11.519  1.00 32.85 ? 117 LEU A C   1 
ATOM   596  O O   . LEU A 1 87  ? 23.621 48.321 12.315  1.00 32.81 ? 117 LEU A O   1 
ATOM   597  C CB  . LEU A 1 87  ? 25.662 46.526 10.944  1.00 30.07 ? 117 LEU A CB  1 
ATOM   598  C CG  . LEU A 1 87  ? 27.040 45.833 10.757  1.00 30.96 ? 117 LEU A CG  1 
ATOM   599  C CD1 . LEU A 1 87  ? 26.858 44.409 10.340  1.00 27.26 ? 117 LEU A CD1 1 
ATOM   600  C CD2 . LEU A 1 87  ? 27.966 46.570 9.738   1.00 27.96 ? 117 LEU A CD2 1 
ATOM   601  N N   . GLY A 1 88  ? 24.262 49.789 10.759  1.00 35.05 ? 118 GLY A N   1 
ATOM   602  C CA  . GLY A 1 88  ? 23.036 50.605 10.826  1.00 37.72 ? 118 GLY A CA  1 
ATOM   603  C C   . GLY A 1 88  ? 21.841 50.013 10.090  1.00 40.00 ? 118 GLY A C   1 
ATOM   604  O O   . GLY A 1 88  ? 20.711 50.491 10.246  1.00 40.91 ? 118 GLY A O   1 
ATOM   605  N N   . ARG A 1 89  ? 22.089 48.978 9.277   1.00 41.36 ? 119 ARG A N   1 
ATOM   606  C CA  . ARG A 1 89  ? 21.049 48.278 8.528   1.00 42.70 ? 119 ARG A CA  1 
ATOM   607  C C   . ARG A 1 89  ? 20.282 49.211 7.542   1.00 43.91 ? 119 ARG A C   1 
ATOM   608  O O   . ARG A 1 89  ? 19.114 48.963 7.227   1.00 43.81 ? 119 ARG A O   1 
ATOM   609  C CB  . ARG A 1 89  ? 20.079 47.549 9.488   1.00 42.52 ? 119 ARG A CB  1 
ATOM   610  C CG  . ARG A 1 89  ? 20.738 46.816 10.641  1.00 43.06 ? 119 ARG A CG  1 
ATOM   611  C CD  . ARG A 1 89  ? 21.710 45.754 10.158  1.00 42.62 ? 119 ARG A CD  1 
ATOM   612  N NE  . ARG A 1 89  ? 22.034 44.839 11.251  1.00 44.49 ? 119 ARG A NE  1 
ATOM   613  C CZ  . ARG A 1 89  ? 22.737 43.716 11.125  1.00 41.93 ? 119 ARG A CZ  1 
ATOM   614  N NH1 . ARG A 1 89  ? 23.219 43.354 9.948   1.00 39.47 ? 119 ARG A NH1 1 
ATOM   615  N NH2 . ARG A 1 89  ? 22.938 42.949 12.189  1.00 42.49 ? 119 ARG A NH2 1 
ATOM   616  N N   . ALA A 1 90  ? 20.938 50.274 7.068   1.00 45.43 ? 120 ALA A N   1 
ATOM   617  C CA  . ALA A 1 90  ? 20.351 51.149 6.039   1.00 47.37 ? 120 ALA A CA  1 
ATOM   618  C C   . ALA A 1 90  ? 19.766 50.368 4.846   1.00 48.66 ? 120 ALA A C   1 
ATOM   619  O O   . ALA A 1 90  ? 18.736 50.759 4.302   1.00 49.15 ? 120 ALA A O   1 
ATOM   620  C CB  . ALA A 1 90  ? 21.372 52.184 5.556   1.00 46.94 ? 120 ALA A CB  1 
ATOM   621  N N   . GLN A 1 91  ? 20.419 49.253 4.489   1.00 50.13 ? 121 GLN A N   1 
ATOM   622  C CA  . GLN A 1 91  ? 20.127 48.455 3.289   1.00 51.26 ? 121 GLN A CA  1 
ATOM   623  C C   . GLN A 1 91  ? 19.412 47.132 3.541   1.00 52.14 ? 121 GLN A C   1 
ATOM   624  O O   . GLN A 1 91  ? 19.129 46.395 2.590   1.00 52.69 ? 121 GLN A O   1 
ATOM   625  C CB  . GLN A 1 91  ? 21.432 48.143 2.553   1.00 51.24 ? 121 GLN A CB  1 
ATOM   626  C CG  . GLN A 1 91  ? 21.919 49.265 1.679   1.00 51.24 ? 121 GLN A CG  1 
ATOM   627  C CD  . GLN A 1 91  ? 22.373 50.443 2.467   1.00 49.59 ? 121 GLN A CD  1 
ATOM   628  O OE1 . GLN A 1 91  ? 23.204 50.316 3.368   1.00 51.32 ? 121 GLN A OE1 1 
ATOM   629  N NE2 . GLN A 1 91  ? 21.837 51.613 2.139   1.00 49.23 ? 121 GLN A NE2 1 
ATOM   630  N N   . SER A 1 92  ? 19.129 46.818 4.800   1.00 52.83 ? 122 SER A N   1 
ATOM   631  C CA  . SER A 1 92  ? 18.579 45.510 5.143   1.00 53.65 ? 122 SER A CA  1 
ATOM   632  C C   . SER A 1 92  ? 17.573 45.666 6.269   1.00 54.49 ? 122 SER A C   1 
ATOM   633  O O   . SER A 1 92  ? 17.375 46.781 6.773   1.00 54.78 ? 122 SER A O   1 
ATOM   634  C CB  . SER A 1 92  ? 19.705 44.501 5.510   1.00 53.52 ? 122 SER A CB  1 
ATOM   635  O OG  . SER A 1 92  ? 20.033 44.498 6.897   1.00 51.82 ? 122 SER A OG  1 
ATOM   636  N N   . GLN A 1 93  ? 16.945 44.558 6.660   1.00 55.31 ? 123 GLN A N   1 
ATOM   637  C CA  . GLN A 1 93  ? 15.984 44.564 7.774   1.00 56.40 ? 123 GLN A CA  1 
ATOM   638  C C   . GLN A 1 93  ? 16.504 43.806 9.025   1.00 56.78 ? 123 GLN A C   1 
ATOM   639  O O   . GLN A 1 93  ? 15.743 43.589 9.988   1.00 57.37 ? 123 GLN A O   1 
ATOM   640  C CB  . GLN A 1 93  ? 14.614 44.020 7.305   1.00 56.54 ? 123 GLN A CB  1 
ATOM   641  N N   . GLU A 1 94  ? 17.798 43.442 9.022   1.00 56.42 ? 124 GLU A N   1 
ATOM   642  C CA  . GLU A 1 94  ? 18.379 42.547 10.057  1.00 55.88 ? 124 GLU A CA  1 
ATOM   643  C C   . GLU A 1 94  ? 18.333 43.135 11.467  1.00 54.68 ? 124 GLU A C   1 
ATOM   644  O O   . GLU A 1 94  ? 18.429 44.356 11.634  1.00 54.35 ? 124 GLU A O   1 
ATOM   645  C CB  . GLU A 1 94  ? 19.822 42.133 9.708   1.00 55.94 ? 124 GLU A CB  1 
ATOM   646  C CG  . GLU A 1 94  ? 19.991 41.470 8.345   1.00 58.05 ? 124 GLU A CG  1 
ATOM   647  C CD  . GLU A 1 94  ? 19.421 40.062 8.289   1.00 62.46 ? 124 GLU A CD  1 
ATOM   648  O OE1 . GLU A 1 94  ? 19.331 39.400 9.351   1.00 65.24 ? 124 GLU A OE1 1 
ATOM   649  O OE2 . GLU A 1 94  ? 19.066 39.603 7.181   1.00 63.93 ? 124 GLU A OE2 1 
ATOM   650  N N   . ASP A 1 95  ? 18.190 42.255 12.465  1.00 53.63 ? 125 ASP A N   1 
ATOM   651  C CA  . ASP A 1 95  ? 18.166 42.654 13.879  1.00 52.48 ? 125 ASP A CA  1 
ATOM   652  C C   . ASP A 1 95  ? 19.552 43.090 14.379  1.00 51.17 ? 125 ASP A C   1 
ATOM   653  O O   . ASP A 1 95  ? 20.588 42.486 14.022  1.00 51.16 ? 125 ASP A O   1 
ATOM   654  C CB  . ASP A 1 95  ? 17.606 41.516 14.769  1.00 53.07 ? 125 ASP A CB  1 
ATOM   655  N N   . GLY A 1 96  ? 19.556 44.126 15.215  1.00 48.98 ? 126 GLY A N   1 
ATOM   656  C CA  . GLY A 1 96  ? 20.769 44.591 15.882  1.00 46.71 ? 126 GLY A CA  1 
ATOM   657  C C   . GLY A 1 96  ? 21.817 45.170 14.929  1.00 44.36 ? 126 GLY A C   1 
ATOM   658  O O   . GLY A 1 96  ? 21.555 45.388 13.735  1.00 45.62 ? 126 GLY A O   1 
ATOM   659  N N   . ASP A 1 97  ? 23.009 45.415 15.463  1.00 40.60 ? 127 ASP A N   1 
ATOM   660  C CA  . ASP A 1 97  ? 24.028 46.163 14.748  1.00 36.82 ? 127 ASP A CA  1 
ATOM   661  C C   . ASP A 1 97  ? 25.417 45.461 14.739  1.00 33.86 ? 127 ASP A C   1 
ATOM   662  O O   . ASP A 1 97  ? 26.425 46.125 14.524  1.00 31.61 ? 127 ASP A O   1 
ATOM   663  C CB  . ASP A 1 97  ? 24.139 47.561 15.392  1.00 36.18 ? 127 ASP A CB  1 
ATOM   664  C CG  . ASP A 1 97  ? 24.718 47.513 16.804  1.00 36.97 ? 127 ASP A CG  1 
ATOM   665  O OD1 . ASP A 1 97  ? 24.976 46.399 17.340  1.00 35.08 ? 127 ASP A OD1 1 
ATOM   666  O OD2 . ASP A 1 97  ? 24.945 48.600 17.380  1.00 38.01 ? 127 ASP A OD2 1 
ATOM   667  N N   . TYR A 1 98  ? 25.462 44.143 14.973  1.00 31.14 ? 128 TYR A N   1 
ATOM   668  C CA  . TYR A 1 98  ? 26.733 43.517 15.424  1.00 28.84 ? 128 TYR A CA  1 
ATOM   669  C C   . TYR A 1 98  ? 27.564 42.884 14.342  1.00 27.41 ? 128 TYR A C   1 
ATOM   670  O O   . TYR A 1 98  ? 27.069 42.077 13.528  1.00 27.32 ? 128 TYR A O   1 
ATOM   671  C CB  . TYR A 1 98  ? 26.520 42.483 16.551  1.00 28.26 ? 128 TYR A CB  1 
ATOM   672  C CG  . TYR A 1 98  ? 27.823 41.926 17.124  1.00 27.16 ? 128 TYR A CG  1 
ATOM   673  C CD1 . TYR A 1 98  ? 28.549 42.642 18.069  1.00 25.31 ? 128 TYR A CD1 1 
ATOM   674  C CD2 . TYR A 1 98  ? 28.314 40.681 16.710  1.00 26.50 ? 128 TYR A CD2 1 
ATOM   675  C CE1 . TYR A 1 98  ? 29.759 42.137 18.607  1.00 28.28 ? 128 TYR A CE1 1 
ATOM   676  C CE2 . TYR A 1 98  ? 29.531 40.164 17.232  1.00 29.84 ? 128 TYR A CE2 1 
ATOM   677  C CZ  . TYR A 1 98  ? 30.228 40.896 18.179  1.00 26.63 ? 128 TYR A CZ  1 
ATOM   678  O OH  . TYR A 1 98  ? 31.390 40.380 18.687  1.00 29.58 ? 128 TYR A OH  1 
ATOM   679  N N   . ILE A 1 99  ? 28.835 43.263 14.352  1.00 26.46 ? 129 ILE A N   1 
ATOM   680  C CA  . ILE A 1 99  ? 29.882 42.559 13.607  1.00 23.58 ? 129 ILE A CA  1 
ATOM   681  C C   . ILE A 1 99  ? 31.152 42.563 14.466  1.00 23.27 ? 129 ILE A C   1 
ATOM   682  O O   . ILE A 1 99  ? 31.439 43.530 15.150  1.00 22.74 ? 129 ILE A O   1 
ATOM   683  C CB  . ILE A 1 99  ? 30.101 43.128 12.146  1.00 23.96 ? 129 ILE A CB  1 
ATOM   684  C CG1 . ILE A 1 99  ? 31.125 42.256 11.356  1.00 21.71 ? 129 ILE A CG1 1 
ATOM   685  C CG2 . ILE A 1 99  ? 30.514 44.600 12.173  1.00 22.43 ? 129 ILE A CG2 1 
ATOM   686  C CD1 . ILE A 1 99  ? 31.121 42.418 9.815   1.00 22.35 ? 129 ILE A CD1 1 
ATOM   687  N N   . ASN A 1 100 ? 31.900 41.455 14.465  1.00 23.01 ? 130 ASN A N   1 
ATOM   688  C CA  . ASN A 1 100 ? 33.156 41.473 15.204  1.00 22.43 ? 130 ASN A CA  1 
ATOM   689  C C   . ASN A 1 100 ? 34.246 42.199 14.377  1.00 22.22 ? 130 ASN A C   1 
ATOM   690  O O   . ASN A 1 100 ? 34.938 41.553 13.580  1.00 22.53 ? 130 ASN A O   1 
ATOM   691  C CB  . ASN A 1 100 ? 33.576 40.036 15.565  1.00 21.31 ? 130 ASN A CB  1 
ATOM   692  C CG  . ASN A 1 100 ? 34.700 40.012 16.626  1.00 21.61 ? 130 ASN A CG  1 
ATOM   693  O OD1 . ASN A 1 100 ? 35.631 40.844 16.612  1.00 22.60 ? 130 ASN A OD1 1 
ATOM   694  N ND2 . ASN A 1 100 ? 34.599 39.087 17.537  1.00 18.50 ? 130 ASN A ND2 1 
ATOM   695  N N   . ALA A 1 101 ? 34.363 43.517 14.566  1.00 22.56 ? 131 ALA A N   1 
ATOM   696  C CA  . ALA A 1 101 ? 35.162 44.405 13.735  1.00 21.57 ? 131 ALA A CA  1 
ATOM   697  C C   . ALA A 1 101 ? 35.350 45.697 14.480  1.00 22.10 ? 131 ALA A C   1 
ATOM   698  O O   . ALA A 1 101 ? 34.429 46.172 15.178  1.00 21.84 ? 131 ALA A O   1 
ATOM   699  C CB  . ALA A 1 101 ? 34.437 44.697 12.386  1.00 22.04 ? 131 ALA A CB  1 
ATOM   700  N N   . ASN A 1 102 ? 36.543 46.275 14.350  1.00 21.09 ? 132 ASN A N   1 
ATOM   701  C CA  . ASN A 1 102 ? 36.862 47.536 14.991  1.00 20.58 ? 132 ASN A CA  1 
ATOM   702  C C   . ASN A 1 102 ? 37.482 48.468 13.980  1.00 21.67 ? 132 ASN A C   1 
ATOM   703  O O   . ASN A 1 102 ? 38.288 48.018 13.128  1.00 21.09 ? 132 ASN A O   1 
ATOM   704  C CB  . ASN A 1 102 ? 37.858 47.365 16.156  1.00 20.33 ? 132 ASN A CB  1 
ATOM   705  C CG  . ASN A 1 102 ? 37.241 46.655 17.345  1.00 20.18 ? 132 ASN A CG  1 
ATOM   706  O OD1 . ASN A 1 102 ? 37.277 45.423 17.421  1.00 24.61 ? 132 ASN A OD1 1 
ATOM   707  N ND2 . ASN A 1 102 ? 36.610 47.432 18.247  1.00 19.80 ? 132 ASN A ND2 1 
ATOM   708  N N   . TYR A 1 103 ? 37.101 49.747 14.063  1.00 21.68 ? 133 TYR A N   1 
ATOM   709  C CA  . TYR A 1 103 ? 37.900 50.810 13.450  1.00 22.67 ? 133 TYR A CA  1 
ATOM   710  C C   . TYR A 1 103 ? 39.303 50.843 14.046  1.00 22.00 ? 133 TYR A C   1 
ATOM   711  O O   . TYR A 1 103 ? 39.490 50.720 15.269  1.00 23.10 ? 133 TYR A O   1 
ATOM   712  C CB  . TYR A 1 103 ? 37.254 52.177 13.595  1.00 22.39 ? 133 TYR A CB  1 
ATOM   713  C CG  . TYR A 1 103 ? 35.830 52.288 13.040  1.00 23.88 ? 133 TYR A CG  1 
ATOM   714  C CD1 . TYR A 1 103 ? 35.592 52.330 11.654  1.00 22.67 ? 133 TYR A CD1 1 
ATOM   715  C CD2 . TYR A 1 103 ? 34.733 52.324 13.906  1.00 22.52 ? 133 TYR A CD2 1 
ATOM   716  C CE1 . TYR A 1 103 ? 34.287 52.452 11.152  1.00 24.32 ? 133 TYR A CE1 1 
ATOM   717  C CE2 . TYR A 1 103 ? 33.418 52.469 13.423  1.00 27.78 ? 133 TYR A CE2 1 
ATOM   718  C CZ  . TYR A 1 103 ? 33.201 52.543 12.043  1.00 25.28 ? 133 TYR A CZ  1 
ATOM   719  O OH  . TYR A 1 103 ? 31.905 52.653 11.570  1.00 25.92 ? 133 TYR A OH  1 
ATOM   720  N N   . ILE A 1 104 ? 40.292 51.034 13.177  1.00 21.62 ? 134 ILE A N   1 
ATOM   721  C CA  . ILE A 1 104 ? 41.671 51.095 13.598  1.00 20.89 ? 134 ILE A CA  1 
ATOM   722  C C   . ILE A 1 104 ? 42.271 52.391 13.079  1.00 21.04 ? 134 ILE A C   1 
ATOM   723  O O   . ILE A 1 104 ? 42.161 52.693 11.895  1.00 21.23 ? 134 ILE A O   1 
ATOM   724  C CB  . ILE A 1 104 ? 42.514 49.879 13.040  1.00 20.49 ? 134 ILE A CB  1 
ATOM   725  C CG1 . ILE A 1 104 ? 41.877 48.517 13.382  1.00 21.45 ? 134 ILE A CG1 1 
ATOM   726  C CG2 . ILE A 1 104 ? 43.972 49.962 13.507  1.00 19.37 ? 134 ILE A CG2 1 
ATOM   727  C CD1 . ILE A 1 104 ? 41.728 48.245 14.926  1.00 17.90 ? 134 ILE A CD1 1 
ATOM   728  N N   . ARG A 1 105 ? 42.969 53.101 13.955  1.00 20.01 ? 135 ARG A N   1 
ATOM   729  C CA  . ARG A 1 105 ? 43.636 54.327 13.588  1.00 21.42 ? 135 ARG A CA  1 
ATOM   730  C C   . ARG A 1 105 ? 44.927 54.017 12.810  1.00 22.15 ? 135 ARG A C   1 
ATOM   731  O O   . ARG A 1 105 ? 45.562 52.988 13.045  1.00 22.78 ? 135 ARG A O   1 
ATOM   732  C CB  . ARG A 1 105 ? 43.959 55.166 14.841  1.00 20.20 ? 135 ARG A CB  1 
ATOM   733  C CG  . ARG A 1 105 ? 42.735 55.795 15.551  1.00 22.63 ? 135 ARG A CG  1 
ATOM   734  C CD  . ARG A 1 105 ? 43.151 56.472 16.851  1.00 21.58 ? 135 ARG A CD  1 
ATOM   735  N NE  . ARG A 1 105 ? 43.572 55.433 17.791  1.00 22.10 ? 135 ARG A NE  1 
ATOM   736  C CZ  . ARG A 1 105 ? 44.684 55.472 18.518  1.00 21.09 ? 135 ARG A CZ  1 
ATOM   737  N NH1 . ARG A 1 105 ? 45.484 56.517 18.481  1.00 21.02 ? 135 ARG A NH1 1 
ATOM   738  N NH2 . ARG A 1 105 ? 44.972 54.456 19.312  1.00 22.03 ? 135 ARG A NH2 1 
ATOM   739  N N   . GLY A 1 106 ? 45.313 54.927 11.918  1.00 22.76 ? 136 GLY A N   1 
ATOM   740  C CA  . GLY A 1 106 ? 46.540 54.788 11.150  1.00 22.58 ? 136 GLY A CA  1 
ATOM   741  C C   . GLY A 1 106 ? 47.684 55.656 11.598  1.00 24.12 ? 136 GLY A C   1 
ATOM   742  O O   . GLY A 1 106 ? 47.845 55.987 12.791  1.00 24.26 ? 136 GLY A O   1 
ATOM   743  N N   . TYR A 1 107 ? 48.514 56.008 10.625  1.00 25.87 ? 137 TYR A N   1 
ATOM   744  C CA  . TYR A 1 107 ? 49.683 56.834 10.853  1.00 27.45 ? 137 TYR A CA  1 
ATOM   745  C C   . TYR A 1 107 ? 49.297 58.099 11.574  1.00 28.44 ? 137 TYR A C   1 
ATOM   746  O O   . TYR A 1 107 ? 48.390 58.786 11.159  1.00 28.36 ? 137 TYR A O   1 
ATOM   747  C CB  . TYR A 1 107 ? 50.338 57.221 9.515   1.00 28.12 ? 137 TYR A CB  1 
ATOM   748  C CG  . TYR A 1 107 ? 51.503 58.137 9.698   1.00 29.28 ? 137 TYR A CG  1 
ATOM   749  C CD1 . TYR A 1 107 ? 52.693 57.661 10.217  1.00 31.61 ? 137 TYR A CD1 1 
ATOM   750  C CD2 . TYR A 1 107 ? 51.405 59.504 9.382   1.00 32.59 ? 137 TYR A CD2 1 
ATOM   751  C CE1 . TYR A 1 107 ? 53.798 58.510 10.395  1.00 33.55 ? 137 TYR A CE1 1 
ATOM   752  C CE2 . TYR A 1 107 ? 52.499 60.368 9.556   1.00 32.41 ? 137 TYR A CE2 1 
ATOM   753  C CZ  . TYR A 1 107 ? 53.690 59.856 10.057  1.00 31.88 ? 137 TYR A CZ  1 
ATOM   754  O OH  . TYR A 1 107 ? 54.774 60.666 10.250  1.00 33.05 ? 137 TYR A OH  1 
ATOM   755  N N   . ASP A 1 108 ? 49.971 58.377 12.681  1.00 30.85 ? 138 ASP A N   1 
ATOM   756  C CA  . ASP A 1 108 ? 49.758 59.607 13.434  1.00 32.24 ? 138 ASP A CA  1 
ATOM   757  C C   . ASP A 1 108 ? 48.385 59.722 14.134  1.00 31.53 ? 138 ASP A C   1 
ATOM   758  O O   . ASP A 1 108 ? 47.975 60.827 14.504  1.00 31.41 ? 138 ASP A O   1 
ATOM   759  C CB  . ASP A 1 108 ? 49.984 60.809 12.505  1.00 34.11 ? 138 ASP A CB  1 
ATOM   760  C CG  . ASP A 1 108 ? 50.702 61.960 13.200  1.00 40.40 ? 138 ASP A CG  1 
ATOM   761  O OD1 . ASP A 1 108 ? 50.875 61.927 14.452  1.00 47.32 ? 138 ASP A OD1 1 
ATOM   762  O OD2 . ASP A 1 108 ? 51.107 62.899 12.475  1.00 48.40 ? 138 ASP A OD2 1 
ATOM   763  N N   . GLY A 1 109 ? 47.698 58.603 14.329  1.00 29.38 ? 139 GLY A N   1 
ATOM   764  C CA  . GLY A 1 109 ? 46.415 58.590 15.023  1.00 27.32 ? 139 GLY A CA  1 
ATOM   765  C C   . GLY A 1 109 ? 45.247 58.880 14.102  1.00 27.60 ? 139 GLY A C   1 
ATOM   766  O O   . GLY A 1 109 ? 44.097 59.085 14.554  1.00 26.73 ? 139 GLY A O   1 
ATOM   767  N N   . LYS A 1 110 ? 45.511 58.878 12.791  1.00 26.86 ? 140 LYS A N   1 
ATOM   768  C CA  . LYS A 1 110 ? 44.461 59.214 11.840  1.00 25.89 ? 140 LYS A CA  1 
ATOM   769  C C   . LYS A 1 110 ? 43.282 58.233 11.917  1.00 25.02 ? 140 LYS A C   1 
ATOM   770  O O   . LYS A 1 110 ? 43.455 57.028 11.845  1.00 24.24 ? 140 LYS A O   1 
ATOM   771  C CB  . LYS A 1 110 ? 45.023 59.332 10.427  1.00 26.82 ? 140 LYS A CB  1 
ATOM   772  C CG  . LYS A 1 110 ? 43.944 59.550 9.421   1.00 27.72 ? 140 LYS A CG  1 
ATOM   773  C CD  . LYS A 1 110 ? 44.532 59.703 8.054   1.00 36.00 ? 140 LYS A CD  1 
ATOM   774  C CE  . LYS A 1 110 ? 43.485 60.302 7.145   1.00 39.43 ? 140 LYS A CE  1 
ATOM   775  N NZ  . LYS A 1 110 ? 44.081 60.225 5.804   1.00 45.62 ? 140 LYS A NZ  1 
ATOM   776  N N   . GLU A 1 111 ? 42.062 58.748 12.055  1.00 24.59 ? 141 GLU A N   1 
ATOM   777  C CA  . GLU A 1 111 ? 40.946 57.885 12.374  1.00 23.60 ? 141 GLU A CA  1 
ATOM   778  C C   . GLU A 1 111 ? 40.424 57.059 11.222  1.00 22.93 ? 141 GLU A C   1 
ATOM   779  O O   . GLU A 1 111 ? 40.311 57.534 10.092  1.00 21.86 ? 141 GLU A O   1 
ATOM   780  C CB  . GLU A 1 111 ? 39.801 58.689 13.010  1.00 23.95 ? 141 GLU A CB  1 
ATOM   781  C CG  . GLU A 1 111 ? 40.187 59.376 14.310  1.00 25.48 ? 141 GLU A CG  1 
ATOM   782  C CD  . GLU A 1 111 ? 39.017 60.119 15.011  1.00 29.20 ? 141 GLU A CD  1 
ATOM   783  O OE1 . GLU A 1 111 ? 37.917 60.296 14.415  1.00 32.85 ? 141 GLU A OE1 1 
ATOM   784  O OE2 . GLU A 1 111 ? 39.220 60.526 16.171  1.00 34.04 ? 141 GLU A OE2 1 
ATOM   785  N N   . LYS A 1 112 ? 40.066 55.814 11.532  1.00 21.02 ? 142 LYS A N   1 
ATOM   786  C CA  . LYS A 1 112 ? 39.332 54.963 10.624  1.00 21.61 ? 142 LYS A CA  1 
ATOM   787  C C   . LYS A 1 112 ? 40.118 54.704 9.340   1.00 21.17 ? 142 LYS A C   1 
ATOM   788  O O   . LYS A 1 112 ? 39.512 54.616 8.254   1.00 21.89 ? 142 LYS A O   1 
ATOM   789  C CB  . LYS A 1 112 ? 37.918 55.539 10.294  1.00 22.06 ? 142 LYS A CB  1 
ATOM   790  C CG  . LYS A 1 112 ? 37.042 55.828 11.500  1.00 22.06 ? 142 LYS A CG  1 
ATOM   791  C CD  . LYS A 1 112 ? 35.538 55.941 11.119  1.00 23.11 ? 142 LYS A CD  1 
ATOM   792  C CE  . LYS A 1 112 ? 34.676 56.140 12.372  1.00 24.47 ? 142 LYS A CE  1 
ATOM   793  N NZ  . LYS A 1 112 ? 33.238 56.296 11.911  1.00 27.44 ? 142 LYS A NZ  1 
ATOM   794  N N   . VAL A 1 113 ? 41.442 54.582 9.458   1.00 20.08 ? 143 VAL A N   1 
ATOM   795  C CA  . VAL A 1 113 ? 42.264 54.141 8.310   1.00 19.50 ? 143 VAL A CA  1 
ATOM   796  C C   . VAL A 1 113 ? 41.982 52.698 7.953   1.00 19.11 ? 143 VAL A C   1 
ATOM   797  O O   . VAL A 1 113 ? 41.929 52.359 6.777   1.00 20.40 ? 143 VAL A O   1 
ATOM   798  C CB  . VAL A 1 113 ? 43.740 54.439 8.507   1.00 18.50 ? 143 VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 113 ? 44.574 53.967 7.312   1.00 17.33 ? 143 VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 113 ? 43.923 55.927 8.640   1.00 19.24 ? 143 VAL A CG2 1 
ATOM   801  N N   . TYR A 1 114 ? 41.760 51.851 8.963   1.00 19.84 ? 144 TYR A N   1 
ATOM   802  C CA  . TYR A 1 114 ? 41.466 50.439 8.763   1.00 19.26 ? 144 TYR A CA  1 
ATOM   803  C C   . TYR A 1 114 ? 40.229 50.026 9.536   1.00 19.57 ? 144 TYR A C   1 
ATOM   804  O O   . TYR A 1 114 ? 39.815 50.686 10.473  1.00 19.72 ? 144 TYR A O   1 
ATOM   805  C CB  . TYR A 1 114 ? 42.635 49.531 9.250   1.00 19.91 ? 144 TYR A CB  1 
ATOM   806  C CG  . TYR A 1 114 ? 44.000 49.998 8.800   1.00 20.45 ? 144 TYR A CG  1 
ATOM   807  C CD1 . TYR A 1 114 ? 44.550 49.536 7.598   1.00 21.19 ? 144 TYR A CD1 1 
ATOM   808  C CD2 . TYR A 1 114 ? 44.701 50.959 9.534   1.00 18.62 ? 144 TYR A CD2 1 
ATOM   809  C CE1 . TYR A 1 114 ? 45.807 49.994 7.159   1.00 20.93 ? 144 TYR A CE1 1 
ATOM   810  C CE2 . TYR A 1 114 ? 45.931 51.432 9.095   1.00 18.04 ? 144 TYR A CE2 1 
ATOM   811  C CZ  . TYR A 1 114 ? 46.474 50.942 7.903   1.00 20.76 ? 144 TYR A CZ  1 
ATOM   812  O OH  . TYR A 1 114 ? 47.719 51.418 7.480   1.00 23.08 ? 144 TYR A OH  1 
ATOM   813  N N   . ILE A 1 115 ? 39.695 48.878 9.146   1.00 19.87 ? 145 ILE A N   1 
ATOM   814  C CA  . ILE A 1 115 ? 38.788 48.106 9.957   1.00 19.74 ? 145 ILE A CA  1 
ATOM   815  C C   . ILE A 1 115 ? 39.470 46.762 10.105  1.00 20.48 ? 145 ILE A C   1 
ATOM   816  O O   . ILE A 1 115 ? 39.729 46.101 9.102   1.00 19.80 ? 145 ILE A O   1 
ATOM   817  C CB  . ILE A 1 115 ? 37.394 47.942 9.283   1.00 19.20 ? 145 ILE A CB  1 
ATOM   818  C CG1 . ILE A 1 115 ? 36.599 49.264 9.417   1.00 20.19 ? 145 ILE A CG1 1 
ATOM   819  C CG2 . ILE A 1 115 ? 36.656 46.760 9.881   1.00 19.47 ? 145 ILE A CG2 1 
ATOM   820  C CD1 . ILE A 1 115 ? 35.197 49.275 8.651   1.00 17.46 ? 145 ILE A CD1 1 
ATOM   821  N N   . ALA A 1 116 ? 39.780 46.370 11.351  1.00 20.37 ? 146 ALA A N   1 
ATOM   822  C CA  . ALA A 1 116 ? 40.235 44.995 11.586  1.00 20.45 ? 146 ALA A CA  1 
ATOM   823  C C   . ALA A 1 116 ? 39.050 44.091 11.935  1.00 20.38 ? 146 ALA A C   1 
ATOM   824  O O   . ALA A 1 116 ? 38.261 44.410 12.807  1.00 22.63 ? 146 ALA A O   1 
ATOM   825  C CB  . ALA A 1 116 ? 41.334 44.966 12.683  1.00 18.80 ? 146 ALA A CB  1 
ATOM   826  N N   . THR A 1 117 ? 38.931 42.951 11.292  1.00 21.23 ? 147 THR A N   1 
ATOM   827  C CA  . THR A 1 117 ? 37.802 42.116 11.553  1.00 21.57 ? 147 THR A CA  1 
ATOM   828  C C   . THR A 1 117 ? 38.248 40.667 11.362  1.00 22.35 ? 147 THR A C   1 
ATOM   829  O O   . THR A 1 117 ? 39.307 40.402 10.787  1.00 21.60 ? 147 THR A O   1 
ATOM   830  C CB  . THR A 1 117 ? 36.588 42.513 10.645  1.00 21.44 ? 147 THR A CB  1 
ATOM   831  O OG1 . THR A 1 117 ? 35.434 41.722 11.008  1.00 20.20 ? 147 THR A OG1 1 
ATOM   832  C CG2 . THR A 1 117 ? 36.895 42.287 9.154   1.00 21.43 ? 147 THR A CG2 1 
ATOM   833  N N   . GLN A 1 118 ? 37.447 39.723 11.845  1.00 23.41 ? 148 GLN A N   1 
ATOM   834  C CA  . GLN A 1 118 ? 37.664 38.316 11.547  1.00 24.52 ? 148 GLN A CA  1 
ATOM   835  C C   . GLN A 1 118 ? 37.216 37.997 10.118  1.00 25.11 ? 148 GLN A C   1 
ATOM   836  O O   . GLN A 1 118 ? 36.382 38.699 9.548   1.00 23.43 ? 148 GLN A O   1 
ATOM   837  C CB  . GLN A 1 118 ? 36.863 37.453 12.538  1.00 25.30 ? 148 GLN A CB  1 
ATOM   838  C CG  . GLN A 1 118 ? 35.312 37.619 12.387  1.00 24.55 ? 148 GLN A CG  1 
ATOM   839  C CD  . GLN A 1 118 ? 34.520 36.878 13.448  1.00 26.84 ? 148 GLN A CD  1 
ATOM   840  O OE1 . GLN A 1 118 ? 35.031 36.574 14.541  1.00 28.32 ? 148 GLN A OE1 1 
ATOM   841  N NE2 . GLN A 1 118 ? 33.268 36.594 13.142  1.00 25.03 ? 148 GLN A NE2 1 
ATOM   842  N N   . GLY A 1 119 ? 37.721 36.909 9.544   1.00 24.76 ? 149 GLY A N   1 
ATOM   843  C CA  . GLY A 1 119 ? 37.102 36.400 8.304   1.00 26.62 ? 149 GLY A CA  1 
ATOM   844  C C   . GLY A 1 119 ? 35.633 36.045 8.548   1.00 27.62 ? 149 GLY A C   1 
ATOM   845  O O   . GLY A 1 119 ? 35.301 35.445 9.594   1.00 27.75 ? 149 GLY A O   1 
ATOM   846  N N   . PRO A 1 120 ? 34.734 36.409 7.604   1.00 28.16 ? 150 PRO A N   1 
ATOM   847  C CA  . PRO A 1 120 ? 33.316 36.090 7.869   1.00 29.50 ? 150 PRO A CA  1 
ATOM   848  C C   . PRO A 1 120 ? 33.075 34.597 8.125   1.00 29.52 ? 150 PRO A C   1 
ATOM   849  O O   . PRO A 1 120 ? 33.745 33.746 7.551   1.00 29.79 ? 150 PRO A O   1 
ATOM   850  C CB  . PRO A 1 120 ? 32.576 36.541 6.586   1.00 29.61 ? 150 PRO A CB  1 
ATOM   851  C CG  . PRO A 1 120 ? 33.608 36.964 5.611   1.00 28.27 ? 150 PRO A CG  1 
ATOM   852  C CD  . PRO A 1 120 ? 34.936 37.110 6.317   1.00 27.85 ? 150 PRO A CD  1 
ATOM   853  N N   . MET A 1 121 ? 32.150 34.291 9.019   1.00 30.65 ? 151 MET A N   1 
ATOM   854  C CA  . MET A 1 121 ? 31.633 32.924 9.158   1.00 33.66 ? 151 MET A CA  1 
ATOM   855  C C   . MET A 1 121 ? 30.494 32.731 8.137   1.00 33.45 ? 151 MET A C   1 
ATOM   856  O O   . MET A 1 121 ? 30.009 33.711 7.571   1.00 33.19 ? 151 MET A O   1 
ATOM   857  C CB  . MET A 1 121 ? 31.160 32.686 10.593  1.00 33.03 ? 151 MET A CB  1 
ATOM   858  C CG  . MET A 1 121 ? 32.087 33.321 11.647  1.00 36.15 ? 151 MET A CG  1 
ATOM   859  S SD  . MET A 1 121 ? 31.380 33.263 13.312  1.00 38.36 ? 151 MET A SD  1 
ATOM   860  C CE  . MET A 1 121 ? 31.739 31.535 13.395  1.00 35.40 ? 151 MET A CE  1 
ATOM   861  N N   . PRO A 1 122 ? 30.070 31.476 7.865   1.00 34.44 ? 152 PRO A N   1 
ATOM   862  C CA  . PRO A 1 122 ? 28.945 31.403 6.889   1.00 34.53 ? 152 PRO A CA  1 
ATOM   863  C C   . PRO A 1 122 ? 27.735 32.301 7.239   1.00 34.01 ? 152 PRO A C   1 
ATOM   864  O O   . PRO A 1 122 ? 27.156 32.903 6.337   1.00 34.93 ? 152 PRO A O   1 
ATOM   865  C CB  . PRO A 1 122 ? 28.569 29.904 6.890   1.00 34.36 ? 152 PRO A CB  1 
ATOM   866  C CG  . PRO A 1 122 ? 29.866 29.208 7.200   1.00 34.92 ? 152 PRO A CG  1 
ATOM   867  C CD  . PRO A 1 122 ? 30.516 30.127 8.281   1.00 34.67 ? 152 PRO A CD  1 
ATOM   868  N N   . ASN A 1 123 ? 27.393 32.412 8.521   1.00 33.78 ? 153 ASN A N   1 
ATOM   869  C CA  . ASN A 1 123 ? 26.280 33.241 8.961   1.00 33.68 ? 153 ASN A CA  1 
ATOM   870  C C   . ASN A 1 123 ? 26.561 34.746 9.049   1.00 33.25 ? 153 ASN A C   1 
ATOM   871  O O   . ASN A 1 123 ? 25.687 35.511 9.466   1.00 33.69 ? 153 ASN A O   1 
ATOM   872  C CB  . ASN A 1 123 ? 25.720 32.737 10.312  1.00 34.12 ? 153 ASN A CB  1 
ATOM   873  C CG  . ASN A 1 123 ? 26.716 32.872 11.456  1.00 35.25 ? 153 ASN A CG  1 
ATOM   874  O OD1 . ASN A 1 123 ? 27.864 32.420 11.358  1.00 38.27 ? 153 ASN A OD1 1 
ATOM   875  N ND2 . ASN A 1 123 ? 26.274 33.456 12.555  1.00 34.36 ? 153 ASN A ND2 1 
ATOM   876  N N   . THR A 1 124 ? 27.776 35.185 8.699   1.00 32.77 ? 154 THR A N   1 
ATOM   877  C CA  . THR A 1 124 ? 28.101 36.608 8.791   1.00 30.47 ? 154 THR A CA  1 
ATOM   878  C C   . THR A 1 124 ? 28.612 37.198 7.479   1.00 30.64 ? 154 THR A C   1 
ATOM   879  O O   . THR A 1 124 ? 29.064 38.344 7.454   1.00 30.82 ? 154 THR A O   1 
ATOM   880  C CB  . THR A 1 124 ? 29.123 36.948 9.944   1.00 30.46 ? 154 THR A CB  1 
ATOM   881  O OG1 . THR A 1 124 ? 30.420 36.448 9.605   1.00 29.28 ? 154 THR A OG1 1 
ATOM   882  C CG2 . THR A 1 124 ? 28.704 36.385 11.251  1.00 26.51 ? 154 THR A CG2 1 
ATOM   883  N N   . VAL A 1 125 ? 28.549 36.427 6.402   1.00 31.14 ? 155 VAL A N   1 
ATOM   884  C CA  . VAL A 1 125 ? 28.921 36.919 5.056   1.00 31.71 ? 155 VAL A CA  1 
ATOM   885  C C   . VAL A 1 125 ? 28.129 38.183 4.640   1.00 32.55 ? 155 VAL A C   1 
ATOM   886  O O   . VAL A 1 125 ? 28.709 39.158 4.161   1.00 32.64 ? 155 VAL A O   1 
ATOM   887  C CB  . VAL A 1 125 ? 28.743 35.818 3.975   1.00 32.23 ? 155 VAL A CB  1 
ATOM   888  C CG1 . VAL A 1 125 ? 29.003 36.383 2.579   1.00 31.45 ? 155 VAL A CG1 1 
ATOM   889  C CG2 . VAL A 1 125 ? 29.654 34.594 4.266   1.00 31.71 ? 155 VAL A CG2 1 
ATOM   890  N N   . SER A 1 126 ? 26.803 38.158 4.828   1.00 32.83 ? 156 SER A N   1 
ATOM   891  C CA  . SER A 1 126 ? 25.947 39.311 4.517   1.00 32.40 ? 156 SER A CA  1 
ATOM   892  C C   . SER A 1 126 ? 26.282 40.506 5.390   1.00 30.55 ? 156 SER A C   1 
ATOM   893  O O   . SER A 1 126 ? 26.364 41.616 4.886   1.00 30.92 ? 156 SER A O   1 
ATOM   894  C CB  . SER A 1 126 ? 24.462 38.935 4.696   1.00 33.16 ? 156 SER A CB  1 
ATOM   895  O OG  . SER A 1 126 ? 24.120 37.937 3.745   1.00 37.43 ? 156 SER A OG  1 
ATOM   896  N N   . ASP A 1 127 ? 26.506 40.273 6.689   1.00 28.45 ? 157 ASP A N   1 
ATOM   897  C CA  . ASP A 1 127 ? 26.973 41.319 7.599   1.00 27.82 ? 157 ASP A CA  1 
ATOM   898  C C   . ASP A 1 127 ? 28.263 41.961 7.089   1.00 26.66 ? 157 ASP A C   1 
ATOM   899  O O   . ASP A 1 127 ? 28.396 43.200 7.089   1.00 26.24 ? 157 ASP A O   1 
ATOM   900  C CB  . ASP A 1 127 ? 27.217 40.769 9.015   1.00 28.11 ? 157 ASP A CB  1 
ATOM   901  C CG  . ASP A 1 127 ? 25.950 40.356 9.719   1.00 29.87 ? 157 ASP A CG  1 
ATOM   902  O OD1 . ASP A 1 127 ? 24.887 40.907 9.441   1.00 32.57 ? 157 ASP A OD1 1 
ATOM   903  O OD2 . ASP A 1 127 ? 26.019 39.474 10.590  1.00 31.64 ? 157 ASP A OD2 1 
ATOM   904  N N   . PHE A 1 128 ? 29.212 41.109 6.696   1.00 25.94 ? 158 PHE A N   1 
ATOM   905  C CA  . PHE A 1 128 ? 30.487 41.561 6.121   1.00 25.57 ? 158 PHE A CA  1 
ATOM   906  C C   . PHE A 1 128 ? 30.280 42.465 4.888   1.00 25.10 ? 158 PHE A C   1 
ATOM   907  O O   . PHE A 1 128 ? 30.841 43.539 4.818   1.00 24.26 ? 158 PHE A O   1 
ATOM   908  C CB  . PHE A 1 128 ? 31.418 40.373 5.793   1.00 24.59 ? 158 PHE A CB  1 
ATOM   909  C CG  . PHE A 1 128 ? 32.754 40.796 5.169   1.00 24.60 ? 158 PHE A CG  1 
ATOM   910  C CD1 . PHE A 1 128 ? 33.866 41.074 5.980   1.00 21.59 ? 158 PHE A CD1 1 
ATOM   911  C CD2 . PHE A 1 128 ? 32.884 40.923 3.771   1.00 22.83 ? 158 PHE A CD2 1 
ATOM   912  C CE1 . PHE A 1 128 ? 35.086 41.455 5.401   1.00 23.75 ? 158 PHE A CE1 1 
ATOM   913  C CE2 . PHE A 1 128 ? 34.088 41.319 3.189   1.00 23.48 ? 158 PHE A CE2 1 
ATOM   914  C CZ  . PHE A 1 128 ? 35.193 41.596 3.998   1.00 22.58 ? 158 PHE A CZ  1 
ATOM   915  N N   . TRP A 1 129 ? 29.477 42.022 3.923   1.00 26.52 ? 159 TRP A N   1 
ATOM   916  C CA  . TRP A 1 129 ? 29.185 42.871 2.756   1.00 26.52 ? 159 TRP A CA  1 
ATOM   917  C C   . TRP A 1 129 ? 28.423 44.169 3.095   1.00 26.94 ? 159 TRP A C   1 
ATOM   918  O O   . TRP A 1 129 ? 28.751 45.240 2.557   1.00 27.83 ? 159 TRP A O   1 
ATOM   919  C CB  . TRP A 1 129 ? 28.517 42.056 1.663   1.00 27.39 ? 159 TRP A CB  1 
ATOM   920  C CG  . TRP A 1 129 ? 29.508 41.110 1.011   1.00 27.21 ? 159 TRP A CG  1 
ATOM   921  C CD1 . TRP A 1 129 ? 29.422 39.762 0.961   1.00 26.82 ? 159 TRP A CD1 1 
ATOM   922  C CD2 . TRP A 1 129 ? 30.758 41.462 0.375   1.00 27.67 ? 159 TRP A CD2 1 
ATOM   923  N NE1 . TRP A 1 129 ? 30.532 39.234 0.322   1.00 27.07 ? 159 TRP A NE1 1 
ATOM   924  C CE2 . TRP A 1 129 ? 31.367 40.256 -0.045  1.00 27.93 ? 159 TRP A CE2 1 
ATOM   925  C CE3 . TRP A 1 129 ? 31.416 42.679 0.110   1.00 26.96 ? 159 TRP A CE3 1 
ATOM   926  C CZ2 . TRP A 1 129 ? 32.596 40.228 -0.756  1.00 27.83 ? 159 TRP A CZ2 1 
ATOM   927  C CZ3 . TRP A 1 129 ? 32.651 42.649 -0.590  1.00 28.06 ? 159 TRP A CZ3 1 
ATOM   928  C CH2 . TRP A 1 129 ? 33.220 41.417 -1.008  1.00 27.62 ? 159 TRP A CH2 1 
ATOM   929  N N   . GLU A 1 130 ? 27.465 44.093 4.027   1.00 27.80 ? 160 GLU A N   1 
ATOM   930  C CA  . GLU A 1 130 ? 26.816 45.293 4.575   1.00 29.32 ? 160 GLU A CA  1 
ATOM   931  C C   . GLU A 1 130 ? 27.825 46.260 5.143   1.00 27.81 ? 160 GLU A C   1 
ATOM   932  O O   . GLU A 1 130 ? 27.684 47.472 4.949   1.00 27.98 ? 160 GLU A O   1 
ATOM   933  C CB  . GLU A 1 130 ? 25.823 44.964 5.705   1.00 29.09 ? 160 GLU A CB  1 
ATOM   934  C CG  . GLU A 1 130 ? 24.520 44.313 5.272   1.00 33.46 ? 160 GLU A CG  1 
ATOM   935  C CD  . GLU A 1 130 ? 23.507 44.186 6.420   1.00 34.61 ? 160 GLU A CD  1 
ATOM   936  O OE1 . GLU A 1 130 ? 23.479 45.064 7.330   1.00 37.13 ? 160 GLU A OE1 1 
ATOM   937  O OE2 . GLU A 1 130 ? 22.747 43.181 6.394   1.00 43.78 ? 160 GLU A OE2 1 
ATOM   938  N N   . MET A 1 131 ? 28.801 45.746 5.907   1.00 25.83 ? 161 MET A N   1 
ATOM   939  C CA  . MET A 1 131 ? 29.867 46.606 6.408   1.00 24.94 ? 161 MET A CA  1 
ATOM   940  C C   . MET A 1 131 ? 30.668 47.254 5.282   1.00 24.57 ? 161 MET A C   1 
ATOM   941  O O   . MET A 1 131 ? 30.970 48.429 5.348   1.00 24.78 ? 161 MET A O   1 
ATOM   942  C CB  . MET A 1 131 ? 30.828 45.856 7.353   1.00 24.19 ? 161 MET A CB  1 
ATOM   943  C CG  . MET A 1 131 ? 31.901 46.736 7.929   1.00 23.23 ? 161 MET A CG  1 
ATOM   944  S SD  . MET A 1 131 ? 32.952 45.895 9.174   1.00 23.87 ? 161 MET A SD  1 
ATOM   945  C CE  . MET A 1 131 ? 33.816 44.667 8.161   1.00 20.79 ? 161 MET A CE  1 
ATOM   946  N N   . VAL A 1 132 ? 31.047 46.468 4.273   1.00 25.50 ? 162 VAL A N   1 
ATOM   947  C CA  . VAL A 1 132 ? 31.832 46.987 3.141   1.00 24.52 ? 162 VAL A CA  1 
ATOM   948  C C   . VAL A 1 132 ? 31.033 48.143 2.449   1.00 25.40 ? 162 VAL A C   1 
ATOM   949  O O   . VAL A 1 132 ? 31.600 49.215 2.152   1.00 25.65 ? 162 VAL A O   1 
ATOM   950  C CB  . VAL A 1 132 ? 32.173 45.826 2.159   1.00 25.19 ? 162 VAL A CB  1 
ATOM   951  C CG1 . VAL A 1 132 ? 32.493 46.368 0.796   1.00 22.94 ? 162 VAL A CG1 1 
ATOM   952  C CG2 . VAL A 1 132 ? 33.349 44.972 2.693   1.00 22.63 ? 162 VAL A CG2 1 
ATOM   953  N N   . TRP A 1 133 ? 29.731 47.936 2.231   1.00 24.80 ? 163 TRP A N   1 
ATOM   954  C CA  . TRP A 1 133 ? 28.861 49.033 1.662   1.00 26.54 ? 163 TRP A CA  1 
ATOM   955  C C   . TRP A 1 133 ? 28.767 50.276 2.559   1.00 25.84 ? 163 TRP A C   1 
ATOM   956  O O   . TRP A 1 133 ? 29.121 51.406 2.181   1.00 25.55 ? 163 TRP A O   1 
ATOM   957  C CB  . TRP A 1 133 ? 27.429 48.512 1.394   1.00 25.84 ? 163 TRP A CB  1 
ATOM   958  C CG  . TRP A 1 133 ? 26.643 49.535 0.604   1.00 28.35 ? 163 TRP A CG  1 
ATOM   959  C CD1 . TRP A 1 133 ? 25.789 50.482 1.104   1.00 27.72 ? 163 TRP A CD1 1 
ATOM   960  C CD2 . TRP A 1 133 ? 26.683 49.733 -0.825  1.00 27.78 ? 163 TRP A CD2 1 
ATOM   961  N NE1 . TRP A 1 133 ? 25.285 51.255 0.071   1.00 29.26 ? 163 TRP A NE1 1 
ATOM   962  C CE2 . TRP A 1 133 ? 25.826 50.831 -1.119  1.00 29.34 ? 163 TRP A CE2 1 
ATOM   963  C CE3 . TRP A 1 133 ? 27.387 49.119 -1.877  1.00 27.50 ? 163 TRP A CE3 1 
ATOM   964  C CZ2 . TRP A 1 133 ? 25.609 51.288 -2.432  1.00 25.78 ? 163 TRP A CZ2 1 
ATOM   965  C CZ3 . TRP A 1 133 ? 27.178 49.573 -3.181  1.00 27.99 ? 163 TRP A CZ3 1 
ATOM   966  C CH2 . TRP A 1 133 ? 26.308 50.671 -3.441  1.00 25.84 ? 163 TRP A CH2 1 
ATOM   967  N N   . GLN A 1 134 ? 28.314 50.048 3.787   1.00 26.62 ? 164 GLN A N   1 
ATOM   968  C CA  . GLN A 1 134 ? 28.142 51.123 4.757   1.00 26.54 ? 164 GLN A CA  1 
ATOM   969  C C   . GLN A 1 134 ? 29.388 51.966 4.949   1.00 26.05 ? 164 GLN A C   1 
ATOM   970  O O   . GLN A 1 134 ? 29.308 53.195 5.071   1.00 25.21 ? 164 GLN A O   1 
ATOM   971  C CB  . GLN A 1 134 ? 27.678 50.537 6.115   1.00 25.86 ? 164 GLN A CB  1 
ATOM   972  C CG  . GLN A 1 134 ? 27.775 51.538 7.271   1.00 26.50 ? 164 GLN A CG  1 
ATOM   973  C CD  . GLN A 1 134 ? 27.414 50.902 8.603   1.00 28.33 ? 164 GLN A CD  1 
ATOM   974  O OE1 . GLN A 1 134 ? 26.304 50.389 8.767   1.00 27.22 ? 164 GLN A OE1 1 
ATOM   975  N NE2 . GLN A 1 134 ? 28.379 50.869 9.535   1.00 27.84 ? 164 GLN A NE2 1 
ATOM   976  N N   . GLU A 1 135 ? 30.555 51.314 4.998   1.00 26.74 ? 165 GLU A N   1 
ATOM   977  C CA  . GLU A 1 135 ? 31.805 52.045 5.299   1.00 26.20 ? 165 GLU A CA  1 
ATOM   978  C C   . GLU A 1 135 ? 32.527 52.528 4.044   1.00 26.67 ? 165 GLU A C   1 
ATOM   979  O O   . GLU A 1 135 ? 33.588 53.152 4.119   1.00 26.89 ? 165 GLU A O   1 
ATOM   980  C CB  . GLU A 1 135 ? 32.742 51.211 6.201   1.00 26.47 ? 165 GLU A CB  1 
ATOM   981  C CG  . GLU A 1 135 ? 32.115 50.828 7.539   1.00 24.76 ? 165 GLU A CG  1 
ATOM   982  C CD  . GLU A 1 135 ? 31.872 52.014 8.461   1.00 25.31 ? 165 GLU A CD  1 
ATOM   983  O OE1 . GLU A 1 135 ? 32.674 52.955 8.535   1.00 25.23 ? 165 GLU A OE1 1 
ATOM   984  O OE2 . GLU A 1 135 ? 30.838 51.996 9.137   1.00 30.61 ? 165 GLU A OE2 1 
ATOM   985  N N   . GLU A 1 136 ? 31.953 52.227 2.884   1.00 26.60 ? 166 GLU A N   1 
ATOM   986  C CA  . GLU A 1 136 ? 32.534 52.671 1.623   1.00 27.17 ? 166 GLU A CA  1 
ATOM   987  C C   . GLU A 1 136 ? 33.938 52.092 1.467   1.00 25.80 ? 166 GLU A C   1 
ATOM   988  O O   . GLU A 1 136 ? 34.849 52.782 1.061   1.00 25.35 ? 166 GLU A O   1 
ATOM   989  C CB  . GLU A 1 136 ? 32.538 54.191 1.545   1.00 27.11 ? 166 GLU A CB  1 
ATOM   990  C CG  . GLU A 1 136 ? 31.117 54.743 1.552   1.00 31.82 ? 166 GLU A CG  1 
ATOM   991  C CD  . GLU A 1 136 ? 31.062 56.261 1.503   1.00 35.85 ? 166 GLU A CD  1 
ATOM   992  O OE1 . GLU A 1 136 ? 32.032 56.901 1.098   1.00 41.35 ? 166 GLU A OE1 1 
ATOM   993  O OE2 . GLU A 1 136 ? 30.049 56.825 1.905   1.00 37.39 ? 166 GLU A OE2 1 
ATOM   994  N N   . VAL A 1 137 ? 34.084 50.824 1.838   1.00 25.40 ? 167 VAL A N   1 
ATOM   995  C CA  . VAL A 1 137 ? 35.343 50.074 1.694   1.00 24.55 ? 167 VAL A CA  1 
ATOM   996  C C   . VAL A 1 137 ? 35.628 49.829 0.187   1.00 25.08 ? 167 VAL A C   1 
ATOM   997  O O   . VAL A 1 137 ? 34.758 49.349 -0.540  1.00 24.57 ? 167 VAL A O   1 
ATOM   998  C CB  . VAL A 1 137 ? 35.260 48.711 2.478   1.00 24.30 ? 167 VAL A CB  1 
ATOM   999  C CG1 . VAL A 1 137 ? 36.482 47.805 2.181   1.00 22.21 ? 167 VAL A CG1 1 
ATOM   1000 C CG2 . VAL A 1 137 ? 35.060 48.996 4.009   1.00 22.06 ? 167 VAL A CG2 1 
ATOM   1001 N N   . SER A 1 138 ? 36.842 50.166 -0.266  1.00 25.09 ? 168 SER A N   1 
ATOM   1002 C CA  . SER A 1 138 ? 37.252 49.864 -1.647  1.00 24.92 ? 168 SER A CA  1 
ATOM   1003 C C   . SER A 1 138 ? 38.453 48.883 -1.706  1.00 25.39 ? 168 SER A C   1 
ATOM   1004 O O   . SER A 1 138 ? 38.781 48.355 -2.779  1.00 25.18 ? 168 SER A O   1 
ATOM   1005 C CB  . SER A 1 138 ? 37.543 51.147 -2.413  1.00 24.13 ? 168 SER A CB  1 
ATOM   1006 O OG  . SER A 1 138 ? 38.560 51.879 -1.788  1.00 26.16 ? 168 SER A OG  1 
ATOM   1007 N N   . LEU A 1 139 ? 39.040 48.575 -0.543  1.00 24.87 ? 169 LEU A N   1 
ATOM   1008 C CA  . LEU A 1 139 ? 40.178 47.641 -0.453  1.00 23.95 ? 169 LEU A CA  1 
ATOM   1009 C C   . LEU A 1 139 ? 40.026 46.663 0.707   1.00 24.18 ? 169 LEU A C   1 
ATOM   1010 O O   . LEU A 1 139 ? 39.837 47.079 1.859   1.00 23.51 ? 169 LEU A O   1 
ATOM   1011 C CB  . LEU A 1 139 ? 41.516 48.423 -0.319  1.00 23.15 ? 169 LEU A CB  1 
ATOM   1012 C CG  . LEU A 1 139 ? 42.829 47.599 -0.299  1.00 24.47 ? 169 LEU A CG  1 
ATOM   1013 C CD1 . LEU A 1 139 ? 42.951 46.732 -1.577  1.00 25.62 ? 169 LEU A CD1 1 
ATOM   1014 C CD2 . LEU A 1 139 ? 44.045 48.525 -0.173  1.00 22.62 ? 169 LEU A CD2 1 
ATOM   1015 N N   . ILE A 1 140 ? 40.079 45.373 0.394   1.00 24.09 ? 170 ILE A N   1 
ATOM   1016 C CA  . ILE A 1 140 ? 40.097 44.315 1.412   1.00 24.19 ? 170 ILE A CA  1 
ATOM   1017 C C   . ILE A 1 140 ? 41.465 43.568 1.316   1.00 24.89 ? 170 ILE A C   1 
ATOM   1018 O O   . ILE A 1 140 ? 41.878 43.153 0.220   1.00 24.17 ? 170 ILE A O   1 
ATOM   1019 C CB  . ILE A 1 140 ? 38.913 43.296 1.252   1.00 23.82 ? 170 ILE A CB  1 
ATOM   1020 C CG1 . ILE A 1 140 ? 37.539 44.004 1.307   1.00 22.24 ? 170 ILE A CG1 1 
ATOM   1021 C CG2 . ILE A 1 140 ? 39.004 42.180 2.314   1.00 22.14 ? 170 ILE A CG2 1 
ATOM   1022 C CD1 . ILE A 1 140 ? 36.406 43.158 0.707   1.00 21.67 ? 170 ILE A CD1 1 
ATOM   1023 N N   . VAL A 1 141 ? 42.144 43.458 2.461   1.00 24.97 ? 171 VAL A N   1 
ATOM   1024 C CA  . VAL A 1 141 ? 43.373 42.645 2.652   1.00 24.99 ? 171 VAL A CA  1 
ATOM   1025 C C   . VAL A 1 141 ? 43.038 41.408 3.491   1.00 25.17 ? 171 VAL A C   1 
ATOM   1026 O O   . VAL A 1 141 ? 42.657 41.514 4.645   1.00 24.19 ? 171 VAL A O   1 
ATOM   1027 C CB  . VAL A 1 141 ? 44.490 43.489 3.316   1.00 25.58 ? 171 VAL A CB  1 
ATOM   1028 C CG1 . VAL A 1 141 ? 45.754 42.681 3.500   1.00 24.56 ? 171 VAL A CG1 1 
ATOM   1029 C CG2 . VAL A 1 141 ? 44.782 44.769 2.466   1.00 26.11 ? 171 VAL A CG2 1 
ATOM   1030 N N   . MET A 1 142 ? 43.127 40.243 2.864   1.00 25.10 ? 172 MET A N   1 
ATOM   1031 C CA  . MET A 1 142 ? 42.831 38.969 3.475   1.00 26.14 ? 172 MET A CA  1 
ATOM   1032 C C   . MET A 1 142 ? 44.144 38.192 3.736   1.00 25.55 ? 172 MET A C   1 
ATOM   1033 O O   . MET A 1 142 ? 44.920 37.943 2.797   1.00 25.23 ? 172 MET A O   1 
ATOM   1034 C CB  . MET A 1 142 ? 41.968 38.149 2.511   1.00 25.91 ? 172 MET A CB  1 
ATOM   1035 C CG  . MET A 1 142 ? 41.710 36.747 3.024   1.00 26.49 ? 172 MET A CG  1 
ATOM   1036 S SD  . MET A 1 142 ? 40.401 35.985 2.065   1.00 29.85 ? 172 MET A SD  1 
ATOM   1037 C CE  . MET A 1 142 ? 40.633 34.292 2.598   1.00 24.76 ? 172 MET A CE  1 
ATOM   1038 N N   . LEU A 1 143 ? 44.376 37.830 4.999   1.00 25.51 ? 173 LEU A N   1 
ATOM   1039 C CA  . LEU A 1 143 ? 45.579 37.127 5.413   1.00 25.79 ? 173 LEU A CA  1 
ATOM   1040 C C   . LEU A 1 143 ? 45.241 35.716 5.834   1.00 27.21 ? 173 LEU A C   1 
ATOM   1041 O O   . LEU A 1 143 ? 44.443 35.495 6.765   1.00 26.94 ? 173 LEU A O   1 
ATOM   1042 C CB  . LEU A 1 143 ? 46.322 37.871 6.530   1.00 25.60 ? 173 LEU A CB  1 
ATOM   1043 C CG  . LEU A 1 143 ? 46.478 39.400 6.308   1.00 24.69 ? 173 LEU A CG  1 
ATOM   1044 C CD1 . LEU A 1 143 ? 46.790 40.161 7.565   1.00 23.16 ? 173 LEU A CD1 1 
ATOM   1045 C CD2 . LEU A 1 143 ? 47.488 39.699 5.177   1.00 22.25 ? 173 LEU A CD2 1 
ATOM   1046 N N   . THR A 1 144 ? 45.885 34.755 5.175   1.00 28.10 ? 174 THR A N   1 
ATOM   1047 C CA  . THR A 1 144 ? 45.542 33.351 5.361   1.00 31.35 ? 174 THR A CA  1 
ATOM   1048 C C   . THR A 1 144 ? 46.735 32.376 5.121   1.00 33.58 ? 174 THR A C   1 
ATOM   1049 O O   . THR A 1 144 ? 47.831 32.808 4.719   1.00 31.86 ? 174 THR A O   1 
ATOM   1050 C CB  . THR A 1 144 ? 44.264 33.001 4.496   1.00 30.42 ? 174 THR A CB  1 
ATOM   1051 O OG1 . THR A 1 144 ? 43.695 31.782 4.956   1.00 33.82 ? 174 THR A OG1 1 
ATOM   1052 C CG2 . THR A 1 144 ? 44.574 32.864 3.049   1.00 30.78 ? 174 THR A CG2 1 
ATOM   1053 N N   . GLN A 1 145 ? 46.504 31.095 5.424   1.00 36.56 ? 175 GLN A N   1 
ATOM   1054 C CA  A GLN A 1 145 ? 47.409 30.038 4.916   0.50 38.55 ? 175 GLN A CA  1 
ATOM   1055 C CA  B GLN A 1 145 ? 47.355 29.920 5.145   0.50 40.14 ? 175 GLN A CA  1 
ATOM   1056 C C   . GLN A 1 145 ? 46.610 28.994 4.142   1.00 40.27 ? 175 GLN A C   1 
ATOM   1057 O O   . GLN A 1 145 ? 45.396 28.932 4.201   1.00 41.02 ? 175 GLN A O   1 
ATOM   1058 C CB  A GLN A 1 145 ? 48.307 29.426 6.017   0.50 38.77 ? 175 GLN A CB  1 
ATOM   1059 C CB  B GLN A 1 145 ? 47.572 29.205 6.507   0.50 39.50 ? 175 GLN A CB  1 
ATOM   1060 C CG  A GLN A 1 145 ? 49.149 28.157 5.614   0.50 37.63 ? 175 GLN A CG  1 
ATOM   1061 C CG  B GLN A 1 145 ? 47.917 27.687 6.501   0.50 40.83 ? 175 GLN A CG  1 
ATOM   1062 C CD  A GLN A 1 145 ? 50.223 28.414 4.552   0.50 39.02 ? 175 GLN A CD  1 
ATOM   1063 C CD  B GLN A 1 145 ? 48.030 27.072 7.910   0.50 40.72 ? 175 GLN A CD  1 
ATOM   1064 O OE1 A GLN A 1 145 ? 50.024 28.146 3.347   0.50 40.53 ? 175 GLN A OE1 1 
ATOM   1065 O OE1 B GLN A 1 145 ? 47.138 27.221 8.767   0.50 38.85 ? 175 GLN A OE1 1 
ATOM   1066 N NE2 A GLN A 1 145 ? 51.361 28.931 4.983   0.50 37.08 ? 175 GLN A NE2 1 
ATOM   1067 N NE2 B GLN A 1 145 ? 49.137 26.370 8.146   0.50 41.35 ? 175 GLN A NE2 1 
ATOM   1068 N N   . LEU A 1 146 ? 47.295 28.232 3.286   1.00 43.26 ? 176 LEU A N   1 
ATOM   1069 C CA  . LEU A 1 146 ? 46.630 27.199 2.415   1.00 45.01 ? 176 LEU A CA  1 
ATOM   1070 C C   . LEU A 1 146 ? 45.695 26.159 3.130   1.00 48.09 ? 176 LEU A C   1 
ATOM   1071 O O   . LEU A 1 146 ? 44.539 25.946 2.725   1.00 49.19 ? 176 LEU A O   1 
ATOM   1072 C CB  . LEU A 1 146 ? 47.678 26.455 1.566   1.00 45.71 ? 176 LEU A CB  1 
ATOM   1073 N N   . ARG A 1 147 ? 46.185 25.524 4.194   1.00 50.64 ? 177 ARG A N   1 
ATOM   1074 C CA  . ARG A 1 147 ? 45.440 24.436 4.883   1.00 52.37 ? 177 ARG A CA  1 
ATOM   1075 C C   . ARG A 1 147 ? 44.220 24.866 5.766   1.00 53.17 ? 177 ARG A C   1 
ATOM   1076 O O   . ARG A 1 147 ? 43.582 24.006 6.420   1.00 53.81 ? 177 ARG A O   1 
ATOM   1077 C CB  . ARG A 1 147 ? 46.419 23.553 5.699   1.00 52.74 ? 177 ARG A CB  1 
ATOM   1078 N N   . GLU A 1 148 ? 43.888 26.170 5.766   1.00 53.14 ? 178 GLU A N   1 
ATOM   1079 C CA  . GLU A 1 148 ? 42.932 26.739 6.723   0.50 52.32 ? 178 GLU A CA  1 
ATOM   1080 C C   . GLU A 1 148 ? 41.494 26.268 6.488   1.00 53.58 ? 178 GLU A C   1 
ATOM   1081 O O   . GLU A 1 148 ? 40.962 26.401 5.374   1.00 54.88 ? 178 GLU A O   1 
ATOM   1082 C CB  . GLU A 1 148 ? 43.008 28.272 6.707   0.50 51.54 ? 178 GLU A CB  1 
ATOM   1083 C CG  . GLU A 1 148 ? 43.284 28.853 8.073   0.50 46.77 ? 178 GLU A CG  1 
ATOM   1084 C CD  . GLU A 1 148 ? 43.536 30.340 8.053   1.00 42.42 ? 178 GLU A CD  1 
ATOM   1085 O OE1 A GLU A 1 148 ? 42.627 31.102 7.672   0.50 41.84 ? 178 GLU A OE1 1 
ATOM   1086 O OE1 B GLU A 1 148 ? 43.460 30.972 6.990   0.50 43.16 ? 178 GLU A OE1 1 
ATOM   1087 O OE2 A GLU A 1 148 ? 44.665 30.757 8.343   0.50 40.53 ? 178 GLU A OE2 1 
ATOM   1088 O OE2 B GLU A 1 148 ? 43.783 30.883 9.145   0.50 41.07 ? 178 GLU A OE2 1 
ATOM   1089 N N   . CYS A 1 153 ? 37.761 30.089 7.477   1.00 58.21 ? 183 CYS A N   1 
ATOM   1090 C CA  . CYS A 1 153 ? 38.016 30.963 6.325   1.00 58.14 ? 183 CYS A CA  1 
ATOM   1091 C C   . CYS A 1 153 ? 37.108 30.573 5.145   1.00 57.57 ? 183 CYS A C   1 
ATOM   1092 O O   . CYS A 1 153 ? 37.447 29.676 4.352   1.00 58.21 ? 183 CYS A O   1 
ATOM   1093 C CB  . CYS A 1 153 ? 39.524 30.987 5.926   1.00 58.04 ? 183 CYS A CB  1 
ATOM   1094 N N   . VAL A 1 154 ? 35.953 31.242 5.047   1.00 56.71 ? 184 VAL A N   1 
ATOM   1095 C CA  . VAL A 1 154 ? 34.983 31.008 3.945   1.00 55.12 ? 184 VAL A CA  1 
ATOM   1096 C C   . VAL A 1 154 ? 35.340 31.785 2.656   1.00 53.87 ? 184 VAL A C   1 
ATOM   1097 O O   . VAL A 1 154 ? 36.028 32.812 2.716   1.00 53.60 ? 184 VAL A O   1 
ATOM   1098 C CB  . VAL A 1 154 ? 33.500 31.279 4.390   1.00 55.33 ? 184 VAL A CB  1 
ATOM   1099 C CG1 . VAL A 1 154 ? 33.274 30.832 5.838   1.00 54.96 ? 184 VAL A CG1 1 
ATOM   1100 C CG2 . VAL A 1 154 ? 33.114 32.731 4.208   1.00 54.58 ? 184 VAL A CG2 1 
ATOM   1101 N N   . HIS A 1 155 ? 34.888 31.273 1.504   1.00 52.23 ? 185 HIS A N   1 
ATOM   1102 C CA  . HIS A 1 155 ? 35.049 31.955 0.200   1.00 50.58 ? 185 HIS A CA  1 
ATOM   1103 C C   . HIS A 1 155 ? 33.794 32.812 0.021   1.00 48.45 ? 185 HIS A C   1 
ATOM   1104 O O   . HIS A 1 155 ? 32.792 32.376 -0.551  1.00 49.28 ? 185 HIS A O   1 
ATOM   1105 C CB  . HIS A 1 155 ? 35.334 30.904 -0.908  1.00 51.03 ? 185 HIS A CB  1 
ATOM   1106 C CG  A HIS A 1 155 ? 34.859 31.254 -2.287  0.50 51.52 ? 185 HIS A CG  1 
ATOM   1107 C CG  B HIS A 1 155 ? 36.772 30.838 -1.330  0.50 52.01 ? 185 HIS A CG  1 
ATOM   1108 N ND1 A HIS A 1 155 ? 33.627 30.861 -2.770  0.50 52.59 ? 185 HIS A ND1 1 
ATOM   1109 N ND1 B HIS A 1 155 ? 37.156 30.769 -2.654  0.50 53.34 ? 185 HIS A ND1 1 
ATOM   1110 C CD2 A HIS A 1 155 ? 35.486 31.868 -3.320  0.50 52.03 ? 185 HIS A CD2 1 
ATOM   1111 C CD2 B HIS A 1 155 ? 37.918 30.832 -0.605  0.50 52.96 ? 185 HIS A CD2 1 
ATOM   1112 C CE1 A HIS A 1 155 ? 33.499 31.257 -4.025  0.50 52.40 ? 185 HIS A CE1 1 
ATOM   1113 C CE1 B HIS A 1 155 ? 38.475 30.717 -2.726  0.50 53.63 ? 185 HIS A CE1 1 
ATOM   1114 N NE2 A HIS A 1 155 ? 34.612 31.873 -4.383  0.50 51.52 ? 185 HIS A NE2 1 
ATOM   1115 N NE2 B HIS A 1 155 ? 38.962 30.759 -1.497  0.50 53.49 ? 185 HIS A NE2 1 
ATOM   1116 N N   . TYR A 1 156 ? 33.865 34.027 0.574   1.00 45.21 ? 186 TYR A N   1 
ATOM   1117 C CA  . TYR A 1 156 ? 32.727 34.926 0.738   1.00 41.85 ? 186 TYR A CA  1 
ATOM   1118 C C   . TYR A 1 156 ? 32.554 35.840 -0.476  1.00 41.93 ? 186 TYR A C   1 
ATOM   1119 O O   . TYR A 1 156 ? 31.682 36.705 -0.484  1.00 41.99 ? 186 TYR A O   1 
ATOM   1120 C CB  . TYR A 1 156 ? 32.896 35.766 2.020   1.00 39.66 ? 186 TYR A CB  1 
ATOM   1121 C CG  . TYR A 1 156 ? 34.150 36.637 2.034   1.00 36.42 ? 186 TYR A CG  1 
ATOM   1122 C CD1 . TYR A 1 156 ? 35.319 36.195 2.661   1.00 34.45 ? 186 TYR A CD1 1 
ATOM   1123 C CD2 . TYR A 1 156 ? 34.175 37.896 1.404   1.00 33.78 ? 186 TYR A CD2 1 
ATOM   1124 C CE1 . TYR A 1 156 ? 36.476 36.990 2.682   1.00 32.08 ? 186 TYR A CE1 1 
ATOM   1125 C CE2 . TYR A 1 156 ? 35.336 38.698 1.409   1.00 30.02 ? 186 TYR A CE2 1 
ATOM   1126 C CZ  . TYR A 1 156 ? 36.478 38.228 2.059   1.00 33.92 ? 186 TYR A CZ  1 
ATOM   1127 O OH  . TYR A 1 156 ? 37.634 38.987 2.080   1.00 32.91 ? 186 TYR A OH  1 
ATOM   1128 N N   . TRP A 1 157 ? 33.410 35.680 -1.476  1.00 41.71 ? 187 TRP A N   1 
ATOM   1129 C CA  . TRP A 1 157 ? 33.309 36.413 -2.736  1.00 42.57 ? 187 TRP A CA  1 
ATOM   1130 C C   . TRP A 1 157 ? 32.921 35.369 -3.790  1.00 43.53 ? 187 TRP A C   1 
ATOM   1131 O O   . TRP A 1 157 ? 33.081 34.175 -3.536  1.00 43.77 ? 187 TRP A O   1 
ATOM   1132 C CB  . TRP A 1 157 ? 34.636 37.102 -3.078  1.00 42.18 ? 187 TRP A CB  1 
ATOM   1133 C CG  . TRP A 1 157 ? 35.761 36.136 -3.232  1.00 41.88 ? 187 TRP A CG  1 
ATOM   1134 C CD1 . TRP A 1 157 ? 36.160 35.516 -4.387  1.00 42.28 ? 187 TRP A CD1 1 
ATOM   1135 C CD2 . TRP A 1 157 ? 36.597 35.616 -2.189  1.00 42.28 ? 187 TRP A CD2 1 
ATOM   1136 N NE1 . TRP A 1 157 ? 37.205 34.652 -4.129  1.00 41.53 ? 187 TRP A NE1 1 
ATOM   1137 C CE2 . TRP A 1 157 ? 37.500 34.704 -2.790  1.00 42.31 ? 187 TRP A CE2 1 
ATOM   1138 C CE3 . TRP A 1 157 ? 36.684 35.844 -0.800  1.00 41.62 ? 187 TRP A CE3 1 
ATOM   1139 C CZ2 . TRP A 1 157 ? 38.468 34.018 -2.052  1.00 41.18 ? 187 TRP A CZ2 1 
ATOM   1140 C CZ3 . TRP A 1 157 ? 37.639 35.162 -0.073  1.00 41.04 ? 187 TRP A CZ3 1 
ATOM   1141 C CH2 . TRP A 1 157 ? 38.517 34.252 -0.698  1.00 42.30 ? 187 TRP A CH2 1 
ATOM   1142 N N   . PRO A 1 158 ? 32.381 35.800 -4.955  1.00 44.57 ? 188 PRO A N   1 
ATOM   1143 C CA  . PRO A 1 158 ? 31.823 34.823 -5.892  1.00 45.20 ? 188 PRO A CA  1 
ATOM   1144 C C   . PRO A 1 158 ? 32.853 34.331 -6.906  1.00 46.03 ? 188 PRO A C   1 
ATOM   1145 O O   . PRO A 1 158 ? 33.921 34.942 -7.065  1.00 46.07 ? 188 PRO A O   1 
ATOM   1146 C CB  . PRO A 1 158 ? 30.732 35.634 -6.603  1.00 44.48 ? 188 PRO A CB  1 
ATOM   1147 C CG  . PRO A 1 158 ? 31.312 37.000 -6.678  1.00 44.47 ? 188 PRO A CG  1 
ATOM   1148 C CD  . PRO A 1 158 ? 32.226 37.176 -5.476  1.00 44.54 ? 188 PRO A CD  1 
ATOM   1149 N N   . THR A 1 159 ? 32.525 33.236 -7.591  1.00 47.35 ? 189 THR A N   1 
ATOM   1150 C CA  . THR A 1 159 ? 33.344 32.760 -8.716  1.00 48.59 ? 189 THR A CA  1 
ATOM   1151 C C   . THR A 1 159 ? 33.127 33.636 -9.958  1.00 48.07 ? 189 THR A C   1 
ATOM   1152 O O   . THR A 1 159 ? 34.079 33.963 -10.682 1.00 48.28 ? 189 THR A O   1 
ATOM   1153 C CB  . THR A 1 159 ? 33.077 31.238 -8.993  1.00 49.19 ? 189 THR A CB  1 
ATOM   1154 O OG1 . THR A 1 159 ? 33.501 30.481 -7.848  1.00 51.22 ? 189 THR A OG1 1 
ATOM   1155 C CG2 . THR A 1 159 ? 33.846 30.736 -10.209 1.00 50.21 ? 189 THR A CG2 1 
ATOM   1156 N N   . GLU A 1 160 ? 31.873 34.031 -10.174 1.00 47.76 ? 190 GLU A N   1 
ATOM   1157 C CA  . GLU A 1 160 ? 31.485 34.914 -11.279 1.00 47.58 ? 190 GLU A CA  1 
ATOM   1158 C C   . GLU A 1 160 ? 30.615 36.083 -10.723 1.00 46.73 ? 190 GLU A C   1 
ATOM   1159 O O   . GLU A 1 160 ? 30.987 37.261 -10.820 1.00 46.27 ? 190 GLU A O   1 
ATOM   1160 C CB  . GLU A 1 160 ? 30.745 34.094 -12.366 1.00 48.00 ? 190 GLU A CB  1 
ATOM   1161 C CG  . GLU A 1 160 ? 30.514 34.792 -13.722 1.00 49.22 ? 190 GLU A CG  1 
ATOM   1162 N N   . GLU A 1 161 ? 29.486 35.727 -10.110 1.00 45.39 ? 191 GLU A N   1 
ATOM   1163 C CA  . GLU A 1 161 ? 28.490 36.674 -9.632  1.00 44.98 ? 191 GLU A CA  1 
ATOM   1164 C C   . GLU A 1 161 ? 27.634 35.956 -8.603  1.00 44.11 ? 191 GLU A C   1 
ATOM   1165 O O   . GLU A 1 161 ? 27.222 34.825 -8.828  1.00 44.42 ? 191 GLU A O   1 
ATOM   1166 C CB  A GLU A 1 161 ? 27.602 37.212 -10.775 0.50 45.08 ? 191 GLU A CB  1 
ATOM   1167 C CB  B GLU A 1 161 ? 27.632 37.119 -10.826 0.50 45.04 ? 191 GLU A CB  1 
ATOM   1168 C CG  A GLU A 1 161 ? 26.437 38.129 -10.323 0.50 45.52 ? 191 GLU A CG  1 
ATOM   1169 C CG  B GLU A 1 161 ? 26.663 38.252 -10.581 0.50 45.39 ? 191 GLU A CG  1 
ATOM   1170 C CD  A GLU A 1 161 ? 25.085 37.419 -10.222 0.50 48.07 ? 191 GLU A CD  1 
ATOM   1171 C CD  B GLU A 1 161 ? 26.309 38.992 -11.869 0.50 46.95 ? 191 GLU A CD  1 
ATOM   1172 O OE1 A GLU A 1 161 ? 24.708 36.726 -11.196 0.50 49.65 ? 191 GLU A OE1 1 
ATOM   1173 O OE1 B GLU A 1 161 ? 26.992 38.791 -12.903 0.50 47.46 ? 191 GLU A OE1 1 
ATOM   1174 O OE2 A GLU A 1 161 ? 24.383 37.570 -9.183  0.50 47.11 ? 191 GLU A OE2 1 
ATOM   1175 O OE2 B GLU A 1 161 ? 25.354 39.787 -11.848 0.50 46.96 ? 191 GLU A OE2 1 
ATOM   1176 N N   . GLU A 1 162 ? 27.409 36.594 -7.459  1.00 43.16 ? 192 GLU A N   1 
ATOM   1177 C CA  A GLU A 1 162 ? 26.438 36.105 -6.485  0.50 43.11 ? 192 GLU A CA  1 
ATOM   1178 C CA  B GLU A 1 162 ? 26.489 36.091 -6.444  0.50 42.68 ? 192 GLU A CA  1 
ATOM   1179 C C   . GLU A 1 162 ? 25.822 37.302 -5.785  1.00 42.35 ? 192 GLU A C   1 
ATOM   1180 O O   . GLU A 1 162 ? 26.352 38.421 -5.822  1.00 41.65 ? 192 GLU A O   1 
ATOM   1181 C CB  A GLU A 1 162 ? 27.043 35.117 -5.456  0.50 43.12 ? 192 GLU A CB  1 
ATOM   1182 C CB  B GLU A 1 162 ? 27.203 35.230 -5.370  0.50 42.80 ? 192 GLU A CB  1 
ATOM   1183 C CG  A GLU A 1 162 ? 25.978 34.227 -4.756  0.50 43.88 ? 192 GLU A CG  1 
ATOM   1184 C CG  B GLU A 1 162 ? 27.972 33.961 -5.854  0.50 42.89 ? 192 GLU A CG  1 
ATOM   1185 C CD  A GLU A 1 162 ? 26.546 33.235 -3.729  0.50 44.52 ? 192 GLU A CD  1 
ATOM   1186 C CD  B GLU A 1 162 ? 27.084 32.885 -6.488  0.50 44.85 ? 192 GLU A CD  1 
ATOM   1187 O OE1 A GLU A 1 162 ? 27.305 32.319 -4.125  0.50 45.28 ? 192 GLU A OE1 1 
ATOM   1188 O OE1 B GLU A 1 162 ? 25.920 32.729 -6.055  0.50 46.52 ? 192 GLU A OE1 1 
ATOM   1189 O OE2 A GLU A 1 162 ? 26.201 33.351 -2.523  0.50 46.73 ? 192 GLU A OE2 1 
ATOM   1190 O OE2 B GLU A 1 162 ? 27.559 32.185 -7.417  0.50 44.28 ? 192 GLU A OE2 1 
ATOM   1191 N N   . THR A 1 163 ? 24.684 37.063 -5.169  1.00 42.00 ? 193 THR A N   1 
ATOM   1192 C CA  . THR A 1 163 ? 23.994 38.068 -4.418  1.00 42.04 ? 193 THR A CA  1 
ATOM   1193 C C   . THR A 1 163 ? 24.132 37.694 -2.946  1.00 40.48 ? 193 THR A C   1 
ATOM   1194 O O   . THR A 1 163 ? 23.988 36.533 -2.603  1.00 41.07 ? 193 THR A O   1 
ATOM   1195 C CB  . THR A 1 163 ? 22.532 38.112 -4.898  1.00 42.42 ? 193 THR A CB  1 
ATOM   1196 O OG1 . THR A 1 163 ? 22.451 39.001 -6.029  1.00 46.47 ? 193 THR A OG1 1 
ATOM   1197 C CG2 . THR A 1 163 ? 21.606 38.592 -3.800  1.00 43.89 ? 193 THR A CG2 1 
ATOM   1198 N N   . TYR A 1 164 ? 24.458 38.663 -2.091  1.00 39.04 ? 194 TYR A N   1 
ATOM   1199 C CA  . TYR A 1 164 ? 24.534 38.458 -0.649  1.00 37.32 ? 194 TYR A CA  1 
ATOM   1200 C C   . TYR A 1 164 ? 23.694 39.518 0.043   1.00 37.20 ? 194 TYR A C   1 
ATOM   1201 O O   . TYR A 1 164 ? 24.073 40.703 0.073   1.00 37.34 ? 194 TYR A O   1 
ATOM   1202 C CB  . TYR A 1 164 ? 25.979 38.549 -0.141  1.00 36.40 ? 194 TYR A CB  1 
ATOM   1203 C CG  . TYR A 1 164 ? 26.976 37.720 -0.910  1.00 35.62 ? 194 TYR A CG  1 
ATOM   1204 C CD1 . TYR A 1 164 ? 27.314 36.439 -0.493  1.00 34.41 ? 194 TYR A CD1 1 
ATOM   1205 C CD2 . TYR A 1 164 ? 27.592 38.224 -2.050  1.00 36.10 ? 194 TYR A CD2 1 
ATOM   1206 C CE1 . TYR A 1 164 ? 28.257 35.664 -1.208  1.00 34.71 ? 194 TYR A CE1 1 
ATOM   1207 C CE2 . TYR A 1 164 ? 28.516 37.481 -2.761  1.00 37.24 ? 194 TYR A CE2 1 
ATOM   1208 C CZ  . TYR A 1 164 ? 28.850 36.196 -2.335  1.00 35.79 ? 194 TYR A CZ  1 
ATOM   1209 O OH  . TYR A 1 164 ? 29.774 35.460 -3.059  1.00 36.73 ? 194 TYR A OH  1 
ATOM   1210 N N   . GLY A 1 165 ? 22.577 39.099 0.633   1.00 36.22 ? 195 GLY A N   1 
ATOM   1211 C CA  . GLY A 1 165 ? 21.582 40.042 1.103   1.00 35.92 ? 195 GLY A CA  1 
ATOM   1212 C C   . GLY A 1 165 ? 21.125 40.847 -0.102  1.00 36.03 ? 195 GLY A C   1 
ATOM   1213 O O   . GLY A 1 165 ? 20.842 40.274 -1.165  1.00 35.97 ? 195 GLY A O   1 
ATOM   1214 N N   . PRO A 1 166 ? 21.099 42.187 0.031   1.00 35.73 ? 196 PRO A N   1 
ATOM   1215 C CA  . PRO A 1 166 ? 20.678 43.091 -1.041  1.00 35.53 ? 196 PRO A CA  1 
ATOM   1216 C C   . PRO A 1 166 ? 21.764 43.398 -2.061  1.00 35.26 ? 196 PRO A C   1 
ATOM   1217 O O   . PRO A 1 166 ? 21.504 44.144 -3.011  1.00 35.05 ? 196 PRO A O   1 
ATOM   1218 C CB  . PRO A 1 166 ? 20.341 44.378 -0.284  1.00 35.44 ? 196 PRO A CB  1 
ATOM   1219 C CG  . PRO A 1 166 ? 21.272 44.396 0.840   1.00 35.09 ? 196 PRO A CG  1 
ATOM   1220 C CD  . PRO A 1 166 ? 21.473 42.933 1.246   1.00 35.90 ? 196 PRO A CD  1 
ATOM   1221 N N   . PHE A 1 167 ? 22.976 42.863 -1.852  1.00 34.87 ? 197 PHE A N   1 
ATOM   1222 C CA  . PHE A 1 167 ? 24.133 43.242 -2.660  1.00 34.74 ? 197 PHE A CA  1 
ATOM   1223 C C   . PHE A 1 167 ? 24.408 42.247 -3.754  1.00 35.73 ? 197 PHE A C   1 
ATOM   1224 O O   . PHE A 1 167 ? 24.373 41.054 -3.515  1.00 37.21 ? 197 PHE A O   1 
ATOM   1225 C CB  . PHE A 1 167 ? 25.395 43.477 -1.786  1.00 33.41 ? 197 PHE A CB  1 
ATOM   1226 C CG  . PHE A 1 167 ? 25.170 44.450 -0.704  1.00 31.92 ? 197 PHE A CG  1 
ATOM   1227 C CD1 . PHE A 1 167 ? 25.006 45.794 -1.001  1.00 29.46 ? 197 PHE A CD1 1 
ATOM   1228 C CD2 . PHE A 1 167 ? 25.040 44.021 0.627   1.00 30.76 ? 197 PHE A CD2 1 
ATOM   1229 C CE1 . PHE A 1 167 ? 24.740 46.708 -0.005  1.00 31.68 ? 197 PHE A CE1 1 
ATOM   1230 C CE2 . PHE A 1 167 ? 24.759 44.934 1.636   1.00 30.24 ? 197 PHE A CE2 1 
ATOM   1231 C CZ  . PHE A 1 167 ? 24.608 46.280 1.325   1.00 31.99 ? 197 PHE A CZ  1 
ATOM   1232 N N   . GLN A 1 168 ? 24.671 42.737 -4.961  1.00 36.07 ? 198 GLN A N   1 
ATOM   1233 C CA  . GLN A 1 168 ? 25.155 41.896 -6.005  1.00 37.02 ? 198 GLN A CA  1 
ATOM   1234 C C   . GLN A 1 168 ? 26.652 42.124 -6.163  1.00 36.45 ? 198 GLN A C   1 
ATOM   1235 O O   . GLN A 1 168 ? 27.090 43.251 -6.340  1.00 35.55 ? 198 GLN A O   1 
ATOM   1236 C CB  . GLN A 1 168 ? 24.451 42.167 -7.334  1.00 37.82 ? 198 GLN A CB  1 
ATOM   1237 C CG  . GLN A 1 168 ? 25.002 41.231 -8.384  1.00 42.32 ? 198 GLN A CG  1 
ATOM   1238 C CD  . GLN A 1 168 ? 24.289 41.296 -9.707  1.00 48.94 ? 198 GLN A CD  1 
ATOM   1239 O OE1 . GLN A 1 168 ? 24.425 42.271 -10.475 1.00 53.39 ? 198 GLN A OE1 1 
ATOM   1240 N NE2 . GLN A 1 168 ? 23.563 40.231 -10.023 1.00 51.29 ? 198 GLN A NE2 1 
ATOM   1241 N N   . ILE A 1 169 ? 27.427 41.040 -6.072  1.00 36.96 ? 199 ILE A N   1 
ATOM   1242 C CA  . ILE A 1 169 ? 28.885 41.104 -6.171  1.00 37.74 ? 199 ILE A CA  1 
ATOM   1243 C C   . ILE A 1 169 ? 29.329 40.387 -7.434  1.00 38.07 ? 199 ILE A C   1 
ATOM   1244 O O   . ILE A 1 169 ? 28.867 39.283 -7.710  1.00 37.36 ? 199 ILE A O   1 
ATOM   1245 C CB  . ILE A 1 169 ? 29.586 40.419 -4.941  1.00 37.61 ? 199 ILE A CB  1 
ATOM   1246 C CG1 . ILE A 1 169 ? 28.901 40.807 -3.615  1.00 38.32 ? 199 ILE A CG1 1 
ATOM   1247 C CG2 . ILE A 1 169 ? 31.127 40.640 -4.971  1.00 36.43 ? 199 ILE A CG2 1 
ATOM   1248 C CD1 . ILE A 1 169 ? 29.393 42.041 -2.984  1.00 38.54 ? 199 ILE A CD1 1 
ATOM   1249 N N   . ARG A 1 170 ? 30.226 41.017 -8.184  1.00 38.68 ? 200 ARG A N   1 
ATOM   1250 C CA  A ARG A 1 170 ? 30.752 40.427 -9.404  0.50 39.35 ? 200 ARG A CA  1 
ATOM   1251 C CA  B ARG A 1 170 ? 30.759 40.416 -9.395  0.50 39.66 ? 200 ARG A CA  1 
ATOM   1252 C C   . ARG A 1 170 ? 32.271 40.461 -9.407  1.00 40.00 ? 200 ARG A C   1 
ATOM   1253 O O   . ARG A 1 170 ? 32.880 41.391 -8.885  1.00 39.35 ? 200 ARG A O   1 
ATOM   1254 C CB  A ARG A 1 170 ? 30.232 41.170 -10.640 0.50 39.36 ? 200 ARG A CB  1 
ATOM   1255 C CB  B ARG A 1 170 ? 30.209 41.093 -10.661 0.50 39.62 ? 200 ARG A CB  1 
ATOM   1256 C CG  A ARG A 1 170 ? 28.714 41.136 -10.822 0.50 39.60 ? 200 ARG A CG  1 
ATOM   1257 C CG  B ARG A 1 170 ? 29.090 40.297 -11.337 0.50 40.59 ? 200 ARG A CG  1 
ATOM   1258 C CD  A ARG A 1 170 ? 28.298 41.972 -12.009 0.50 39.64 ? 200 ARG A CD  1 
ATOM   1259 C CD  B ARG A 1 170 ? 28.781 40.697 -12.800 0.50 40.52 ? 200 ARG A CD  1 
ATOM   1260 N NE  A ARG A 1 170 ? 26.860 41.902 -12.249 0.50 41.18 ? 200 ARG A NE  1 
ATOM   1261 N NE  B ARG A 1 170 ? 29.905 41.243 -13.564 0.50 42.60 ? 200 ARG A NE  1 
ATOM   1262 C CZ  A ARG A 1 170 ? 26.281 41.078 -13.121 0.50 42.78 ? 200 ARG A CZ  1 
ATOM   1263 C CZ  B ARG A 1 170 ? 30.982 40.569 -13.977 0.50 43.75 ? 200 ARG A CZ  1 
ATOM   1264 N NH1 A ARG A 1 170 ? 27.014 40.250 -13.856 0.50 43.61 ? 200 ARG A NH1 1 
ATOM   1265 N NH1 B ARG A 1 170 ? 31.147 39.277 -13.688 0.50 42.91 ? 200 ARG A NH1 1 
ATOM   1266 N NH2 A ARG A 1 170 ? 24.961 41.088 -13.269 0.50 43.13 ? 200 ARG A NH2 1 
ATOM   1267 N NH2 B ARG A 1 170 ? 31.920 41.213 -14.668 0.50 43.92 ? 200 ARG A NH2 1 
ATOM   1268 N N   . ILE A 1 171 ? 32.874 39.447 -10.023 1.00 41.01 ? 201 ILE A N   1 
ATOM   1269 C CA  . ILE A 1 171 ? 34.315 39.440 -10.210 1.00 42.07 ? 201 ILE A CA  1 
ATOM   1270 C C   . ILE A 1 171 ? 34.627 39.912 -11.632 1.00 42.67 ? 201 ILE A C   1 
ATOM   1271 O O   . ILE A 1 171 ? 34.187 39.308 -12.605 1.00 42.02 ? 201 ILE A O   1 
ATOM   1272 C CB  . ILE A 1 171 ? 34.958 38.058 -9.791  1.00 41.93 ? 201 ILE A CB  1 
ATOM   1273 C CG1 . ILE A 1 171 ? 36.435 38.009 -10.129 1.00 41.93 ? 201 ILE A CG1 1 
ATOM   1274 C CG2 . ILE A 1 171 ? 34.270 36.918 -10.424 1.00 43.62 ? 201 ILE A CG2 1 
ATOM   1275 C CD1 . ILE A 1 171 ? 37.206 37.159 -9.135  1.00 45.46 ? 201 ILE A CD1 1 
ATOM   1276 N N   . GLN A 1 172 ? 35.336 41.031 -11.731 1.00 44.02 ? 202 GLN A N   1 
ATOM   1277 C CA  . GLN A 1 172 ? 35.735 41.597 -13.017 1.00 45.97 ? 202 GLN A CA  1 
ATOM   1278 C C   . GLN A 1 172 ? 37.097 41.081 -13.486 1.00 47.58 ? 202 GLN A C   1 
ATOM   1279 O O   . GLN A 1 172 ? 37.324 40.936 -14.693 1.00 47.81 ? 202 GLN A O   1 
ATOM   1280 C CB  . GLN A 1 172 ? 35.733 43.124 -12.957 1.00 45.96 ? 202 GLN A CB  1 
ATOM   1281 C CG  . GLN A 1 172 ? 34.496 43.693 -12.213 1.00 46.97 ? 202 GLN A CG  1 
ATOM   1282 N N   . ASP A 1 173 ? 37.995 40.791 -12.532 1.00 48.87 ? 203 ASP A N   1 
ATOM   1283 C CA  . ASP A 1 173 ? 39.348 40.300 -12.835 1.00 49.74 ? 203 ASP A CA  1 
ATOM   1284 C C   . ASP A 1 173 ? 39.990 39.520 -11.677 1.00 49.57 ? 203 ASP A C   1 
ATOM   1285 O O   . ASP A 1 173 ? 39.624 39.703 -10.513 1.00 49.03 ? 203 ASP A O   1 
ATOM   1286 C CB  . ASP A 1 173 ? 40.261 41.454 -13.264 1.00 50.07 ? 203 ASP A CB  1 
ATOM   1287 C CG  . ASP A 1 173 ? 41.523 40.962 -13.977 1.00 54.67 ? 203 ASP A CG  1 
ATOM   1288 O OD1 . ASP A 1 173 ? 41.430 39.979 -14.763 1.00 58.20 ? 203 ASP A OD1 1 
ATOM   1289 O OD2 . ASP A 1 173 ? 42.617 41.549 -13.751 1.00 59.73 ? 203 ASP A OD2 1 
ATOM   1290 N N   . MET A 1 174 ? 40.931 38.637 -12.025 1.00 49.56 ? 204 MET A N   1 
ATOM   1291 C CA  A MET A 1 174 ? 41.709 37.867 -11.049 0.50 49.49 ? 204 MET A CA  1 
ATOM   1292 C CA  B MET A 1 174 ? 41.716 37.884 -11.047 0.50 49.28 ? 204 MET A CA  1 
ATOM   1293 C C   . MET A 1 174 ? 43.142 37.731 -11.562 1.00 49.27 ? 204 MET A C   1 
ATOM   1294 O O   . MET A 1 174 ? 43.370 37.152 -12.616 1.00 49.20 ? 204 MET A O   1 
ATOM   1295 C CB  A MET A 1 174 ? 41.059 36.496 -10.807 0.50 49.42 ? 204 MET A CB  1 
ATOM   1296 C CB  B MET A 1 174 ? 41.075 36.521 -10.761 0.50 49.15 ? 204 MET A CB  1 
ATOM   1297 C CG  A MET A 1 174 ? 41.753 35.605 -9.782  0.50 49.76 ? 204 MET A CG  1 
ATOM   1298 C CG  B MET A 1 174 ? 41.641 35.802 -9.548  0.50 49.51 ? 204 MET A CG  1 
ATOM   1299 S SD  A MET A 1 174 ? 40.875 34.039 -9.523  0.50 50.16 ? 204 MET A SD  1 
ATOM   1300 S SD  B MET A 1 174 ? 43.044 34.727 -9.899  0.50 49.25 ? 204 MET A SD  1 
ATOM   1301 C CE  A MET A 1 174 ? 42.021 33.175 -8.457  0.50 50.52 ? 204 MET A CE  1 
ATOM   1302 C CE  B MET A 1 174 ? 42.210 33.239 -10.463 0.50 51.25 ? 204 MET A CE  1 
ATOM   1303 N N   . LYS A 1 175 ? 44.094 38.277 -10.811 1.00 48.86 ? 205 LYS A N   1 
ATOM   1304 C CA  . LYS A 1 175 ? 45.495 38.278 -11.177 1.00 48.69 ? 205 LYS A CA  1 
ATOM   1305 C C   . LYS A 1 175 ? 46.372 37.652 -10.060 1.00 48.53 ? 205 LYS A C   1 
ATOM   1306 O O   . LYS A 1 175 ? 46.384 38.129 -8.930  1.00 47.08 ? 205 LYS A O   1 
ATOM   1307 C CB  . LYS A 1 175 ? 45.897 39.712 -11.495 1.00 48.84 ? 205 LYS A CB  1 
ATOM   1308 C CG  . LYS A 1 175 ? 47.364 39.988 -11.672 1.00 51.17 ? 205 LYS A CG  1 
ATOM   1309 C CD  . LYS A 1 175 ? 47.640 41.472 -11.385 1.00 55.80 ? 205 LYS A CD  1 
ATOM   1310 C CE  . LYS A 1 175 ? 49.079 41.862 -11.707 1.00 59.19 ? 205 LYS A CE  1 
ATOM   1311 N NZ  . LYS A 1 175 ? 49.397 43.230 -11.196 1.00 60.17 ? 205 LYS A NZ  1 
ATOM   1312 N N   . GLU A 1 176 ? 47.084 36.570 -10.394 1.00 48.48 ? 206 GLU A N   1 
ATOM   1313 C CA  . GLU A 1 176 ? 48.019 35.927 -9.471  1.00 48.59 ? 206 GLU A CA  1 
ATOM   1314 C C   . GLU A 1 176 ? 49.423 36.560 -9.495  1.00 48.46 ? 206 GLU A C   1 
ATOM   1315 O O   . GLU A 1 176 ? 50.092 36.582 -10.517 1.00 48.74 ? 206 GLU A O   1 
ATOM   1316 C CB  . GLU A 1 176 ? 48.091 34.415 -9.720  1.00 48.89 ? 206 GLU A CB  1 
ATOM   1317 C CG  . GLU A 1 176 ? 46.898 33.606 -9.197  1.00 49.69 ? 206 GLU A CG  1 
ATOM   1318 N N   . CYS A 1 177 ? 49.851 37.105 -8.365  1.00 47.71 ? 207 CYS A N   1 
ATOM   1319 C CA  . CYS A 1 177 ? 51.224 37.557 -8.219  1.00 47.54 ? 207 CYS A CA  1 
ATOM   1320 C C   . CYS A 1 177 ? 51.969 36.468 -7.463  1.00 46.86 ? 207 CYS A C   1 
ATOM   1321 O O   . CYS A 1 177 ? 51.330 35.524 -6.951  1.00 46.51 ? 207 CYS A O   1 
ATOM   1322 C CB  . CYS A 1 177 ? 51.304 38.924 -7.526  1.00 47.70 ? 207 CYS A CB  1 
ATOM   1323 S SG  . CYS A 1 177 ? 50.229 40.175 -8.374  1.00 50.30 ? 207 CYS A SG  1 
ATOM   1324 N N   . PRO A 1 178 ? 53.320 36.552 -7.427  1.00 46.64 ? 208 PRO A N   1 
ATOM   1325 C CA  . PRO A 1 178 ? 54.097 35.474 -6.806  1.00 45.57 ? 208 PRO A CA  1 
ATOM   1326 C C   . PRO A 1 178 ? 53.610 35.179 -5.389  1.00 44.30 ? 208 PRO A C   1 
ATOM   1327 O O   . PRO A 1 178 ? 53.571 34.015 -4.984  1.00 44.31 ? 208 PRO A O   1 
ATOM   1328 C CB  . PRO A 1 178 ? 55.525 36.038 -6.789  1.00 45.52 ? 208 PRO A CB  1 
ATOM   1329 C CG  . PRO A 1 178 ? 55.565 36.970 -7.960  1.00 47.13 ? 208 PRO A CG  1 
ATOM   1330 C CD  . PRO A 1 178 ? 54.199 37.617 -7.969  1.00 47.08 ? 208 PRO A CD  1 
ATOM   1331 N N   . GLU A 1 179 ? 53.186 36.230 -4.679  1.00 41.82 ? 209 GLU A N   1 
ATOM   1332 C CA  . GLU A 1 179 ? 52.913 36.162 -3.252  1.00 39.12 ? 209 GLU A CA  1 
ATOM   1333 C C   . GLU A 1 179 ? 51.461 36.422 -2.802  1.00 37.66 ? 209 GLU A C   1 
ATOM   1334 O O   . GLU A 1 179 ? 51.097 36.173 -1.648  1.00 36.74 ? 209 GLU A O   1 
ATOM   1335 C CB  . GLU A 1 179 ? 53.885 37.112 -2.576  1.00 39.75 ? 209 GLU A CB  1 
ATOM   1336 C CG  . GLU A 1 179 ? 55.314 36.504 -2.588  1.00 40.19 ? 209 GLU A CG  1 
ATOM   1337 C CD  . GLU A 1 179 ? 56.370 37.459 -3.056  1.00 39.82 ? 209 GLU A CD  1 
ATOM   1338 O OE1 . GLU A 1 179 ? 56.061 38.657 -3.227  1.00 37.36 ? 209 GLU A OE1 1 
ATOM   1339 O OE2 . GLU A 1 179 ? 57.527 37.002 -3.212  1.00 41.24 ? 209 GLU A OE2 1 
ATOM   1340 N N   . TYR A 1 180 ? 50.629 36.892 -3.725  1.00 35.19 ? 210 TYR A N   1 
ATOM   1341 C CA  . TYR A 1 180 ? 49.230 37.124 -3.415  1.00 33.63 ? 210 TYR A CA  1 
ATOM   1342 C C   . TYR A 1 180 ? 48.397 37.163 -4.682  1.00 32.47 ? 210 TYR A C   1 
ATOM   1343 O O   . TYR A 1 180 ? 48.935 37.302 -5.766  1.00 31.97 ? 210 TYR A O   1 
ATOM   1344 C CB  . TYR A 1 180 ? 49.077 38.431 -2.643  1.00 31.62 ? 210 TYR A CB  1 
ATOM   1345 C CG  . TYR A 1 180 ? 49.815 39.577 -3.268  1.00 31.32 ? 210 TYR A CG  1 
ATOM   1346 C CD1 . TYR A 1 180 ? 49.251 40.304 -4.330  1.00 29.52 ? 210 TYR A CD1 1 
ATOM   1347 C CD2 . TYR A 1 180 ? 51.076 39.961 -2.786  1.00 29.05 ? 210 TYR A CD2 1 
ATOM   1348 C CE1 . TYR A 1 180 ? 49.920 41.381 -4.894  1.00 29.37 ? 210 TYR A CE1 1 
ATOM   1349 C CE2 . TYR A 1 180 ? 51.760 41.025 -3.346  1.00 31.49 ? 210 TYR A CE2 1 
ATOM   1350 C CZ  . TYR A 1 180 ? 51.182 41.726 -4.407  1.00 30.11 ? 210 TYR A CZ  1 
ATOM   1351 O OH  . TYR A 1 180 ? 51.847 42.800 -4.929  1.00 30.26 ? 210 TYR A OH  1 
ATOM   1352 N N   . THR A 1 181 ? 47.086 37.034 -4.519  1.00 32.09 ? 211 THR A N   1 
ATOM   1353 C CA  . THR A 1 181 ? 46.141 37.091 -5.625  1.00 32.01 ? 211 THR A CA  1 
ATOM   1354 C C   . THR A 1 181 ? 45.323 38.371 -5.486  1.00 31.38 ? 211 THR A C   1 
ATOM   1355 O O   . THR A 1 181 ? 44.716 38.602 -4.431  1.00 30.07 ? 211 THR A O   1 
ATOM   1356 C CB  . THR A 1 181 ? 45.174 35.894 -5.557  1.00 32.95 ? 211 THR A CB  1 
ATOM   1357 O OG1 . THR A 1 181 ? 45.918 34.672 -5.588  1.00 36.36 ? 211 THR A OG1 1 
ATOM   1358 C CG2 . THR A 1 181 ? 44.193 35.901 -6.730  1.00 30.82 ? 211 THR A CG2 1 
ATOM   1359 N N   . VAL A 1 182 ? 45.314 39.191 -6.543  1.00 30.54 ? 212 VAL A N   1 
ATOM   1360 C CA  . VAL A 1 182 ? 44.503 40.407 -6.603  1.00 30.30 ? 212 VAL A CA  1 
ATOM   1361 C C   . VAL A 1 182 ? 43.196 40.116 -7.359  1.00 31.15 ? 212 VAL A C   1 
ATOM   1362 O O   . VAL A 1 182 ? 43.225 39.639 -8.479  1.00 31.06 ? 212 VAL A O   1 
ATOM   1363 C CB  . VAL A 1 182 ? 45.278 41.567 -7.228  1.00 30.14 ? 212 VAL A CB  1 
ATOM   1364 C CG1 . VAL A 1 182 ? 44.406 42.831 -7.362  1.00 28.99 ? 212 VAL A CG1 1 
ATOM   1365 C CG2 . VAL A 1 182 ? 46.529 41.857 -6.414  1.00 28.98 ? 212 VAL A CG2 1 
ATOM   1366 N N   . ARG A 1 183 ? 42.052 40.308 -6.704  1.00 31.36 ? 213 ARG A N   1 
ATOM   1367 C CA  . ARG A 1 183 ? 40.768 40.256 -7.408  1.00 31.61 ? 213 ARG A CA  1 
ATOM   1368 C C   . ARG A 1 183 ? 40.164 41.651 -7.511  1.00 32.32 ? 213 ARG A C   1 
ATOM   1369 O O   . ARG A 1 183 ? 40.211 42.449 -6.555  1.00 32.20 ? 213 ARG A O   1 
ATOM   1370 C CB  . ARG A 1 183 ? 39.788 39.285 -6.749  1.00 31.64 ? 213 ARG A CB  1 
ATOM   1371 C CG  . ARG A 1 183 ? 40.164 37.818 -6.907  1.00 32.81 ? 213 ARG A CG  1 
ATOM   1372 C CD  . ARG A 1 183 ? 39.397 36.974 -5.920  1.00 34.40 ? 213 ARG A CD  1 
ATOM   1373 N NE  . ARG A 1 183 ? 39.610 35.528 -6.081  1.00 34.94 ? 213 ARG A NE  1 
ATOM   1374 C CZ  . ARG A 1 183 ? 40.538 34.806 -5.437  1.00 35.66 ? 213 ARG A CZ  1 
ATOM   1375 N NH1 . ARG A 1 183 ? 41.394 35.368 -4.576  1.00 33.50 ? 213 ARG A NH1 1 
ATOM   1376 N NH2 . ARG A 1 183 ? 40.611 33.502 -5.655  1.00 36.16 ? 213 ARG A NH2 1 
ATOM   1377 N N   . GLN A 1 184 ? 39.618 41.961 -8.684  1.00 32.83 ? 214 GLN A N   1 
ATOM   1378 C CA  . GLN A 1 184 ? 38.817 43.171 -8.867  1.00 32.38 ? 214 GLN A CA  1 
ATOM   1379 C C   . GLN A 1 184 ? 37.347 42.783 -8.836  1.00 32.56 ? 214 GLN A C   1 
ATOM   1380 O O   . GLN A 1 184 ? 36.890 41.982 -9.654  1.00 32.23 ? 214 GLN A O   1 
ATOM   1381 C CB  . GLN A 1 184 ? 39.168 43.858 -10.170 1.00 33.08 ? 214 GLN A CB  1 
ATOM   1382 C CG  . GLN A 1 184 ? 40.517 44.538 -10.147 1.00 33.82 ? 214 GLN A CG  1 
ATOM   1383 C CD  . GLN A 1 184 ? 40.606 45.732 -9.171  1.00 38.82 ? 214 GLN A CD  1 
ATOM   1384 O OE1 . GLN A 1 184 ? 39.588 46.340 -8.761  1.00 41.37 ? 214 GLN A OE1 1 
ATOM   1385 N NE2 . GLN A 1 184 ? 41.839 46.092 -8.817  1.00 36.76 ? 214 GLN A NE2 1 
ATOM   1386 N N   . LEU A 1 185 ? 36.618 43.336 -7.864  1.00 31.45 ? 215 LEU A N   1 
ATOM   1387 C CA  . LEU A 1 185 ? 35.190 43.036 -7.678  1.00 30.42 ? 215 LEU A CA  1 
ATOM   1388 C C   . LEU A 1 185 ? 34.363 44.318 -7.867  1.00 29.06 ? 215 LEU A C   1 
ATOM   1389 O O   . LEU A 1 185 ? 34.899 45.434 -7.858  1.00 28.09 ? 215 LEU A O   1 
ATOM   1390 C CB  . LEU A 1 185 ? 34.916 42.454 -6.264  1.00 30.20 ? 215 LEU A CB  1 
ATOM   1391 C CG  . LEU A 1 185 ? 35.827 41.368 -5.650  1.00 31.51 ? 215 LEU A CG  1 
ATOM   1392 C CD1 . LEU A 1 185 ? 35.575 41.205 -4.137  1.00 30.29 ? 215 LEU A CD1 1 
ATOM   1393 C CD2 . LEU A 1 185 ? 35.663 40.030 -6.375  1.00 32.60 ? 215 LEU A CD2 1 
ATOM   1394 N N   . THR A 1 186 ? 33.056 44.140 -8.050  1.00 28.96 ? 216 THR A N   1 
ATOM   1395 C CA  . THR A 1 186 ? 32.117 45.240 -7.917  1.00 29.15 ? 216 THR A CA  1 
ATOM   1396 C C   . THR A 1 186 ? 31.034 44.805 -6.953  1.00 28.80 ? 216 THR A C   1 
ATOM   1397 O O   . THR A 1 186 ? 30.718 43.614 -6.860  1.00 29.88 ? 216 THR A O   1 
ATOM   1398 C CB  . THR A 1 186 ? 31.515 45.693 -9.273  1.00 28.66 ? 216 THR A CB  1 
ATOM   1399 O OG1 . THR A 1 186 ? 30.792 44.611 -9.883  1.00 30.76 ? 216 THR A OG1 1 
ATOM   1400 C CG2 . THR A 1 186 ? 32.591 46.191 -10.193 1.00 26.98 ? 216 THR A CG2 1 
ATOM   1401 N N   . ILE A 1 187 ? 30.506 45.765 -6.199  1.00 27.82 ? 217 ILE A N   1 
ATOM   1402 C CA  . ILE A 1 187 ? 29.355 45.536 -5.335  1.00 26.17 ? 217 ILE A CA  1 
ATOM   1403 C C   . ILE A 1 187 ? 28.263 46.536 -5.745  1.00 26.19 ? 217 ILE A C   1 
ATOM   1404 O O   . ILE A 1 187 ? 28.527 47.713 -5.905  1.00 25.45 ? 217 ILE A O   1 
ATOM   1405 C CB  . ILE A 1 187 ? 29.725 45.717 -3.815  1.00 26.35 ? 217 ILE A CB  1 
ATOM   1406 C CG1 . ILE A 1 187 ? 28.503 45.502 -2.912  1.00 25.85 ? 217 ILE A CG1 1 
ATOM   1407 C CG2 . ILE A 1 187 ? 30.425 47.075 -3.545  1.00 24.76 ? 217 ILE A CG2 1 
ATOM   1408 C CD1 . ILE A 1 187 ? 28.835 45.451 -1.370  1.00 25.33 ? 217 ILE A CD1 1 
ATOM   1409 N N   . GLN A 1 188 ? 27.036 46.069 -5.880  1.00 26.39 ? 218 GLN A N   1 
ATOM   1410 C CA  . GLN A 1 188 ? 25.983 46.940 -6.356  1.00 27.56 ? 218 GLN A CA  1 
ATOM   1411 C C   . GLN A 1 188 ? 24.809 46.842 -5.419  1.00 27.25 ? 218 GLN A C   1 
ATOM   1412 O O   . GLN A 1 188 ? 24.401 45.762 -5.045  1.00 27.56 ? 218 GLN A O   1 
ATOM   1413 C CB  . GLN A 1 188 ? 25.558 46.577 -7.794  1.00 26.75 ? 218 GLN A CB  1 
ATOM   1414 C CG  . GLN A 1 188 ? 24.290 47.350 -8.311  1.00 27.68 ? 218 GLN A CG  1 
ATOM   1415 C CD  . GLN A 1 188 ? 24.220 47.517 -9.852  1.00 30.38 ? 218 GLN A CD  1 
ATOM   1416 O OE1 . GLN A 1 188 ? 25.039 46.960 -10.616 1.00 32.02 ? 218 GLN A OE1 1 
ATOM   1417 N NE2 . GLN A 1 188 ? 23.233 48.312 -10.308 1.00 30.04 ? 218 GLN A NE2 1 
ATOM   1418 N N   . TYR A 1 189 ? 24.261 47.991 -5.068  1.00 28.13 ? 219 TYR A N   1 
ATOM   1419 C CA  . TYR A 1 189 ? 23.016 48.048 -4.343  1.00 28.92 ? 219 TYR A CA  1 
ATOM   1420 C C   . TYR A 1 189 ? 22.145 49.018 -5.134  1.00 29.08 ? 219 TYR A C   1 
ATOM   1421 O O   . TYR A 1 189 ? 22.529 50.177 -5.329  1.00 28.84 ? 219 TYR A O   1 
ATOM   1422 C CB  . TYR A 1 189 ? 23.231 48.617 -2.932  1.00 29.66 ? 219 TYR A CB  1 
ATOM   1423 C CG  . TYR A 1 189 ? 21.921 48.820 -2.246  1.00 31.15 ? 219 TYR A CG  1 
ATOM   1424 C CD1 . TYR A 1 189 ? 21.175 47.721 -1.845  1.00 33.08 ? 219 TYR A CD1 1 
ATOM   1425 C CD2 . TYR A 1 189 ? 21.396 50.099 -2.033  1.00 32.78 ? 219 TYR A CD2 1 
ATOM   1426 C CE1 . TYR A 1 189 ? 19.948 47.867 -1.245  1.00 36.08 ? 219 TYR A CE1 1 
ATOM   1427 C CE2 . TYR A 1 189 ? 20.139 50.258 -1.411  1.00 32.08 ? 219 TYR A CE2 1 
ATOM   1428 C CZ  . TYR A 1 189 ? 19.431 49.127 -1.024  1.00 34.22 ? 219 TYR A CZ  1 
ATOM   1429 O OH  . TYR A 1 189 ? 18.196 49.183 -0.397  1.00 33.86 ? 219 TYR A OH  1 
ATOM   1430 N N   . GLN A 1 190 ? 20.976 48.560 -5.554  1.00 29.65 ? 220 GLN A N   1 
ATOM   1431 C CA  . GLN A 1 190 ? 20.074 49.365 -6.392  1.00 30.93 ? 220 GLN A CA  1 
ATOM   1432 C C   . GLN A 1 190 ? 20.824 49.875 -7.613  1.00 29.75 ? 220 GLN A C   1 
ATOM   1433 O O   . GLN A 1 190 ? 21.381 49.070 -8.357  1.00 30.55 ? 220 GLN A O   1 
ATOM   1434 C CB  . GLN A 1 190 ? 19.438 50.516 -5.593  1.00 31.92 ? 220 GLN A CB  1 
ATOM   1435 C CG  . GLN A 1 190 ? 18.542 50.040 -4.456  1.00 35.30 ? 220 GLN A CG  1 
ATOM   1436 C CD  . GLN A 1 190 ? 17.187 49.624 -4.937  1.00 43.07 ? 220 GLN A CD  1 
ATOM   1437 O OE1 . GLN A 1 190 ? 16.412 50.456 -5.382  1.00 49.79 ? 220 GLN A OE1 1 
ATOM   1438 N NE2 . GLN A 1 190 ? 16.885 48.334 -4.862  1.00 47.12 ? 220 GLN A NE2 1 
ATOM   1439 N N   . GLU A 1 191 ? 20.842 51.189 -7.809  1.00 28.87 ? 221 GLU A N   1 
ATOM   1440 C CA  . GLU A 1 191 ? 21.455 51.807 -8.982  1.00 27.70 ? 221 GLU A CA  1 
ATOM   1441 C C   . GLU A 1 191 ? 22.973 52.000 -8.884  1.00 27.90 ? 221 GLU A C   1 
ATOM   1442 O O   . GLU A 1 191 ? 23.620 52.309 -9.868  1.00 27.86 ? 221 GLU A O   1 
ATOM   1443 C CB  . GLU A 1 191 ? 20.796 53.169 -9.268  1.00 27.71 ? 221 GLU A CB  1 
ATOM   1444 C CG  . GLU A 1 191 ? 21.341 54.397 -8.536  1.00 26.54 ? 221 GLU A CG  1 
ATOM   1445 C CD  . GLU A 1 191 ? 21.106 54.400 -7.003  1.00 27.81 ? 221 GLU A CD  1 
ATOM   1446 O OE1 . GLU A 1 191 ? 20.157 53.750 -6.506  1.00 24.18 ? 221 GLU A OE1 1 
ATOM   1447 O OE2 . GLU A 1 191 ? 21.881 55.106 -6.305  1.00 28.04 ? 221 GLU A OE2 1 
ATOM   1448 N N   . GLU A 1 192 ? 23.516 51.878 -7.681  1.00 27.54 ? 222 GLU A N   1 
ATOM   1449 C CA  . GLU A 1 192 ? 24.889 52.257 -7.433  1.00 28.24 ? 222 GLU A CA  1 
ATOM   1450 C C   . GLU A 1 192 ? 25.824 51.023 -7.385  1.00 27.93 ? 222 GLU A C   1 
ATOM   1451 O O   . GLU A 1 192 ? 25.571 50.071 -6.654  1.00 27.71 ? 222 GLU A O   1 
ATOM   1452 C CB  . GLU A 1 192 ? 24.965 53.041 -6.124  1.00 27.73 ? 222 GLU A CB  1 
ATOM   1453 C CG  . GLU A 1 192 ? 26.350 53.655 -5.917  1.00 28.87 ? 222 GLU A CG  1 
ATOM   1454 C CD  . GLU A 1 192 ? 26.475 54.399 -4.604  1.00 32.77 ? 222 GLU A CD  1 
ATOM   1455 O OE1 . GLU A 1 192 ? 25.427 54.743 -4.003  1.00 36.31 ? 222 GLU A OE1 1 
ATOM   1456 O OE2 . GLU A 1 192 ? 27.636 54.672 -4.185  1.00 32.78 ? 222 GLU A OE2 1 
ATOM   1457 N N   . ARG A 1 193 ? 26.887 51.066 -8.176  1.00 28.46 ? 223 ARG A N   1 
ATOM   1458 C CA  . ARG A 1 193 ? 27.845 49.973 -8.246  1.00 28.37 ? 223 ARG A CA  1 
ATOM   1459 C C   . ARG A 1 193 ? 29.212 50.547 -7.932  1.00 28.03 ? 223 ARG A C   1 
ATOM   1460 O O   . ARG A 1 193 ? 29.561 51.609 -8.428  1.00 28.10 ? 223 ARG A O   1 
ATOM   1461 C CB  . ARG A 1 193 ? 27.779 49.265 -9.617  1.00 28.47 ? 223 ARG A CB  1 
ATOM   1462 C CG  . ARG A 1 193 ? 28.690 48.036 -9.733  1.00 28.59 ? 223 ARG A CG  1 
ATOM   1463 C CD  . ARG A 1 193 ? 28.494 47.246 -11.053 1.00 28.23 ? 223 ARG A CD  1 
ATOM   1464 N NE  . ARG A 1 193 ? 28.665 48.099 -12.236 1.00 27.89 ? 223 ARG A NE  1 
ATOM   1465 C CZ  . ARG A 1 193 ? 27.662 48.514 -13.024 1.00 27.93 ? 223 ARG A CZ  1 
ATOM   1466 N NH1 . ARG A 1 193 ? 26.390 48.148 -12.784 1.00 26.53 ? 223 ARG A NH1 1 
ATOM   1467 N NH2 . ARG A 1 193 ? 27.939 49.320 -14.040 1.00 24.15 ? 223 ARG A NH2 1 
ATOM   1468 N N   . ARG A 1 194 ? 29.966 49.882 -7.047  1.00 27.42 ? 224 ARG A N   1 
ATOM   1469 C CA  . ARG A 1 194 ? 31.288 50.388 -6.616  1.00 27.60 ? 224 ARG A CA  1 
ATOM   1470 C C   . ARG A 1 194 ? 32.361 49.365 -6.879  1.00 26.78 ? 224 ARG A C   1 
ATOM   1471 O O   . ARG A 1 194 ? 32.105 48.184 -6.791  1.00 27.12 ? 224 ARG A O   1 
ATOM   1472 C CB  . ARG A 1 194 ? 31.302 50.679 -5.113  1.00 26.16 ? 224 ARG A CB  1 
ATOM   1473 C CG  . ARG A 1 194 ? 30.197 51.627 -4.647  1.00 28.91 ? 224 ARG A CG  1 
ATOM   1474 C CD  . ARG A 1 194 ? 30.204 51.754 -3.142  1.00 22.91 ? 224 ARG A CD  1 
ATOM   1475 N NE  . ARG A 1 194 ? 29.211 52.705 -2.644  1.00 25.27 ? 224 ARG A NE  1 
ATOM   1476 C CZ  . ARG A 1 194 ? 28.894 52.847 -1.357  1.00 26.38 ? 224 ARG A CZ  1 
ATOM   1477 N NH1 . ARG A 1 194 ? 29.487 52.073 -0.438  1.00 22.58 ? 224 ARG A NH1 1 
ATOM   1478 N NH2 . ARG A 1 194 ? 27.943 53.711 -0.989  1.00 22.80 ? 224 ARG A NH2 1 
ATOM   1479 N N   . ASP A 1 195 ? 33.571 49.819 -7.177  1.00 27.67 ? 225 ASP A N   1 
ATOM   1480 C CA  . ASP A 1 195 ? 34.736 48.918 -7.213  1.00 28.33 ? 225 ASP A CA  1 
ATOM   1481 C C   . ASP A 1 195 ? 35.291 48.551 -5.819  1.00 27.65 ? 225 ASP A C   1 
ATOM   1482 O O   . ASP A 1 195 ? 35.397 49.415 -4.953  1.00 26.45 ? 225 ASP A O   1 
ATOM   1483 C CB  . ASP A 1 195 ? 35.853 49.565 -7.997  1.00 29.56 ? 225 ASP A CB  1 
ATOM   1484 C CG  . ASP A 1 195 ? 35.533 49.685 -9.485  1.00 32.89 ? 225 ASP A CG  1 
ATOM   1485 O OD1 . ASP A 1 195 ? 34.589 49.039 -9.974  1.00 35.05 ? 225 ASP A OD1 1 
ATOM   1486 O OD2 . ASP A 1 195 ? 36.252 50.438 -10.141 1.00 38.82 ? 225 ASP A OD2 1 
ATOM   1487 N N   . VAL A 1 196 ? 35.638 47.278 -5.630  1.00 27.76 ? 226 VAL A N   1 
ATOM   1488 C CA  . VAL A 1 196 ? 36.398 46.841 -4.440  1.00 27.91 ? 226 VAL A CA  1 
ATOM   1489 C C   . VAL A 1 196 ? 37.592 46.038 -4.909  1.00 28.50 ? 226 VAL A C   1 
ATOM   1490 O O   . VAL A 1 196 ? 37.424 45.064 -5.641  1.00 29.63 ? 226 VAL A O   1 
ATOM   1491 C CB  . VAL A 1 196 ? 35.562 45.963 -3.476  1.00 28.92 ? 226 VAL A CB  1 
ATOM   1492 C CG1 . VAL A 1 196 ? 36.408 45.580 -2.214  1.00 27.69 ? 226 VAL A CG1 1 
ATOM   1493 C CG2 . VAL A 1 196 ? 34.276 46.675 -3.073  1.00 27.75 ? 226 VAL A CG2 1 
ATOM   1494 N N   . LYS A 1 197 ? 38.799 46.452 -4.537  1.00 27.80 ? 227 LYS A N   1 
ATOM   1495 C CA  . LYS A 1 197 ? 39.989 45.615 -4.778  1.00 27.42 ? 227 LYS A CA  1 
ATOM   1496 C C   . LYS A 1 197 ? 40.176 44.619 -3.601  1.00 26.78 ? 227 LYS A C   1 
ATOM   1497 O O   . LYS A 1 197 ? 40.091 45.004 -2.434  1.00 26.48 ? 227 LYS A O   1 
ATOM   1498 C CB  . LYS A 1 197 ? 41.214 46.506 -4.978  1.00 27.38 ? 227 LYS A CB  1 
ATOM   1499 C CG  . LYS A 1 197 ? 42.519 45.755 -5.227  1.00 28.40 ? 227 LYS A CG  1 
ATOM   1500 C CD  . LYS A 1 197 ? 43.639 46.776 -5.350  1.00 27.94 ? 227 LYS A CD  1 
ATOM   1501 C CE  . LYS A 1 197 ? 44.974 46.110 -5.649  1.00 26.83 ? 227 LYS A CE  1 
ATOM   1502 N NZ  . LYS A 1 197 ? 46.024 47.170 -5.741  1.00 28.67 ? 227 LYS A NZ  1 
ATOM   1503 N N   . HIS A 1 198 ? 40.374 43.344 -3.903  1.00 25.45 ? 228 HIS A N   1 
ATOM   1504 C CA  . HIS A 1 198 ? 40.573 42.333 -2.866  1.00 25.54 ? 228 HIS A CA  1 
ATOM   1505 C C   . HIS A 1 198 ? 41.973 41.670 -3.041  1.00 25.48 ? 228 HIS A C   1 
ATOM   1506 O O   . HIS A 1 198 ? 42.312 41.198 -4.140  1.00 25.46 ? 228 HIS A O   1 
ATOM   1507 C CB  . HIS A 1 198 ? 39.470 41.305 -3.006  1.00 25.74 ? 228 HIS A CB  1 
ATOM   1508 C CG  . HIS A 1 198 ? 39.462 40.237 -1.945  1.00 27.13 ? 228 HIS A CG  1 
ATOM   1509 N ND1 . HIS A 1 198 ? 40.216 39.087 -2.038  1.00 26.65 ? 228 HIS A ND1 1 
ATOM   1510 C CD2 . HIS A 1 198 ? 38.727 40.115 -0.811  1.00 25.06 ? 228 HIS A CD2 1 
ATOM   1511 C CE1 . HIS A 1 198 ? 39.984 38.324 -0.987  1.00 28.41 ? 228 HIS A CE1 1 
ATOM   1512 N NE2 . HIS A 1 198 ? 39.077 38.921 -0.229  1.00 26.18 ? 228 HIS A NE2 1 
ATOM   1513 N N   . ILE A 1 199 ? 42.764 41.641 -1.973  1.00 24.12 ? 229 ILE A N   1 
ATOM   1514 C CA  . ILE A 1 199 ? 44.113 41.017 -1.984  1.00 24.08 ? 229 ILE A CA  1 
ATOM   1515 C C   . ILE A 1 199 ? 44.158 39.824 -1.018  1.00 25.44 ? 229 ILE A C   1 
ATOM   1516 O O   . ILE A 1 199 ? 43.944 39.974 0.216   1.00 25.78 ? 229 ILE A O   1 
ATOM   1517 C CB  . ILE A 1 199 ? 45.231 42.011 -1.659  1.00 23.27 ? 229 ILE A CB  1 
ATOM   1518 C CG1 . ILE A 1 199 ? 45.063 43.292 -2.489  1.00 21.90 ? 229 ILE A CG1 1 
ATOM   1519 C CG2 . ILE A 1 199 ? 46.637 41.378 -1.928  1.00 22.82 ? 229 ILE A CG2 1 
ATOM   1520 C CD1 . ILE A 1 199 ? 45.964 44.456 -2.070  1.00 22.84 ? 229 ILE A CD1 1 
ATOM   1521 N N   . LEU A 1 200 ? 44.389 38.643 -1.576  1.00 24.84 ? 230 LEU A N   1 
ATOM   1522 C CA  . LEU A 1 200 ? 44.490 37.458 -0.743  1.00 26.32 ? 230 LEU A CA  1 
ATOM   1523 C C   . LEU A 1 200 ? 45.957 37.049 -0.664  1.00 26.51 ? 230 LEU A C   1 
ATOM   1524 O O   . LEU A 1 200 ? 46.568 36.692 -1.659  1.00 27.68 ? 230 LEU A O   1 
ATOM   1525 C CB  . LEU A 1 200 ? 43.589 36.346 -1.261  1.00 26.37 ? 230 LEU A CB  1 
ATOM   1526 C CG  . LEU A 1 200 ? 43.390 35.136 -0.344  1.00 27.20 ? 230 LEU A CG  1 
ATOM   1527 C CD1 . LEU A 1 200 ? 42.242 34.321 -0.910  1.00 28.28 ? 230 LEU A CD1 1 
ATOM   1528 C CD2 . LEU A 1 200 ? 44.670 34.280 -0.234  1.00 23.69 ? 230 LEU A CD2 1 
ATOM   1529 N N   . PHE A 1 201 ? 46.518 37.193 0.527   1.00 26.71 ? 231 PHE A N   1 
ATOM   1530 C CA  . PHE A 1 201 ? 47.894 36.857 0.852   1.00 26.79 ? 231 PHE A CA  1 
ATOM   1531 C C   . PHE A 1 201 ? 47.868 35.559 1.638   1.00 27.80 ? 231 PHE A C   1 
ATOM   1532 O O   . PHE A 1 201 ? 47.419 35.543 2.774   1.00 28.02 ? 231 PHE A O   1 
ATOM   1533 C CB  . PHE A 1 201 ? 48.511 37.968 1.697   1.00 25.82 ? 231 PHE A CB  1 
ATOM   1534 C CG  . PHE A 1 201 ? 49.985 37.752 2.032   1.00 26.33 ? 231 PHE A CG  1 
ATOM   1535 C CD1 . PHE A 1 201 ? 50.986 38.311 1.226   1.00 25.30 ? 231 PHE A CD1 1 
ATOM   1536 C CD2 . PHE A 1 201 ? 50.355 37.004 3.158   1.00 25.31 ? 231 PHE A CD2 1 
ATOM   1537 C CE1 . PHE A 1 201 ? 52.366 38.133 1.542   1.00 26.60 ? 231 PHE A CE1 1 
ATOM   1538 C CE2 . PHE A 1 201 ? 51.709 36.818 3.496   1.00 27.77 ? 231 PHE A CE2 1 
ATOM   1539 C CZ  . PHE A 1 201 ? 52.723 37.396 2.673   1.00 26.20 ? 231 PHE A CZ  1 
ATOM   1540 N N   . SER A 1 202 ? 48.310 34.466 1.019   1.00 28.53 ? 232 SER A N   1 
ATOM   1541 C CA  . SER A 1 202 ? 48.318 33.206 1.712   1.00 30.52 ? 232 SER A CA  1 
ATOM   1542 C C   . SER A 1 202 ? 49.731 32.899 2.322   1.00 30.75 ? 232 SER A C   1 
ATOM   1543 O O   . SER A 1 202 ? 50.526 33.805 2.532   1.00 32.99 ? 232 SER A O   1 
ATOM   1544 C CB  . SER A 1 202 ? 47.783 32.082 0.837   1.00 31.01 ? 232 SER A CB  1 
ATOM   1545 O OG  A SER A 1 202 ? 48.335 32.153 -0.471  0.50 29.81 ? 232 SER A OG  1 
ATOM   1546 O OG  B SER A 1 202 ? 48.146 30.851 1.460   0.50 32.95 ? 232 SER A OG  1 
ATOM   1547 N N   . ALA A 1 203 ? 50.044 31.673 2.666   1.00 30.65 ? 233 ALA A N   1 
ATOM   1548 C CA  . ALA A 1 203 ? 51.382 31.423 3.282   1.00 31.64 ? 233 ALA A CA  1 
ATOM   1549 C C   . ALA A 1 203 ? 51.656 32.210 4.583   1.00 30.89 ? 233 ALA A C   1 
ATOM   1550 O O   . ALA A 1 203 ? 52.807 32.531 4.900   1.00 31.49 ? 233 ALA A O   1 
ATOM   1551 C CB  . ALA A 1 203 ? 52.533 31.655 2.252   1.00 31.67 ? 233 ALA A CB  1 
ATOM   1552 N N   . TRP A 1 204 ? 50.597 32.534 5.324   1.00 28.87 ? 234 TRP A N   1 
ATOM   1553 C CA  . TRP A 1 204 ? 50.766 33.187 6.609   1.00 27.92 ? 234 TRP A CA  1 
ATOM   1554 C C   . TRP A 1 204 ? 49.965 32.408 7.643   1.00 27.45 ? 234 TRP A C   1 
ATOM   1555 O O   . TRP A 1 204 ? 48.775 32.683 7.860   1.00 27.46 ? 234 TRP A O   1 
ATOM   1556 C CB  . TRP A 1 204 ? 50.340 34.657 6.584   1.00 26.75 ? 234 TRP A CB  1 
ATOM   1557 C CG  . TRP A 1 204 ? 50.877 35.463 7.741   1.00 24.62 ? 234 TRP A CG  1 
ATOM   1558 C CD1 . TRP A 1 204 ? 51.369 34.977 8.920   1.00 22.40 ? 234 TRP A CD1 1 
ATOM   1559 C CD2 . TRP A 1 204 ? 50.965 36.895 7.833   1.00 24.27 ? 234 TRP A CD2 1 
ATOM   1560 N NE1 . TRP A 1 204 ? 51.755 35.988 9.723   1.00 21.25 ? 234 TRP A NE1 1 
ATOM   1561 C CE2 . TRP A 1 204 ? 51.535 37.187 9.087   1.00 23.31 ? 234 TRP A CE2 1 
ATOM   1562 C CE3 . TRP A 1 204 ? 50.597 37.959 6.983   1.00 26.15 ? 234 TRP A CE3 1 
ATOM   1563 C CZ2 . TRP A 1 204 ? 51.771 38.513 9.530   1.00 23.67 ? 234 TRP A CZ2 1 
ATOM   1564 C CZ3 . TRP A 1 204 ? 50.824 39.277 7.424   1.00 22.05 ? 234 TRP A CZ3 1 
ATOM   1565 C CH2 . TRP A 1 204 ? 51.416 39.532 8.684   1.00 23.65 ? 234 TRP A CH2 1 
ATOM   1566 N N   . PRO A 1 205 ? 50.607 31.398 8.257   1.00 27.37 ? 235 PRO A N   1 
ATOM   1567 C CA  . PRO A 1 205 ? 49.912 30.596 9.267   1.00 27.23 ? 235 PRO A CA  1 
ATOM   1568 C C   . PRO A 1 205 ? 49.574 31.394 10.523  1.00 26.74 ? 235 PRO A C   1 
ATOM   1569 O O   . PRO A 1 205 ? 50.328 32.294 10.954  1.00 26.96 ? 235 PRO A O   1 
ATOM   1570 C CB  . PRO A 1 205 ? 50.920 29.468 9.591   1.00 28.00 ? 235 PRO A CB  1 
ATOM   1571 C CG  . PRO A 1 205 ? 51.963 29.514 8.519   1.00 28.33 ? 235 PRO A CG  1 
ATOM   1572 C CD  . PRO A 1 205 ? 51.991 30.945 8.039   1.00 27.58 ? 235 PRO A CD  1 
ATOM   1573 N N   . ASP A 1 206 ? 48.419 31.100 11.083  1.00 25.64 ? 236 ASP A N   1 
ATOM   1574 C CA  A ASP A 1 206 ? 47.998 31.588 12.339  0.50 25.82 ? 236 ASP A CA  1 
ATOM   1575 C CA  B ASP A 1 206 ? 48.089 31.775 12.320  0.50 25.52 ? 236 ASP A CA  1 
ATOM   1576 C C   . ASP A 1 206 ? 49.091 31.406 13.409  1.00 25.57 ? 236 ASP A C   1 
ATOM   1577 O O   . ASP A 1 206 ? 49.702 30.343 13.426  1.00 25.64 ? 236 ASP A O   1 
ATOM   1578 C CB  A ASP A 1 206 ? 46.824 30.713 12.694  0.50 26.20 ? 236 ASP A CB  1 
ATOM   1579 C CB  B ASP A 1 206 ? 46.643 31.596 12.805  0.50 24.85 ? 236 ASP A CB  1 
ATOM   1580 C CG  A ASP A 1 206 ? 45.841 31.417 13.487  0.50 25.52 ? 236 ASP A CG  1 
ATOM   1581 C CG  B ASP A 1 206 ? 46.357 30.196 13.267  0.50 24.86 ? 236 ASP A CG  1 
ATOM   1582 O OD1 A ASP A 1 206 ? 46.213 32.466 14.017  0.50 25.25 ? 236 ASP A OD1 1 
ATOM   1583 O OD1 B ASP A 1 206 ? 46.528 29.909 14.473  0.50 22.33 ? 236 ASP A OD1 1 
ATOM   1584 O OD2 A ASP A 1 206 ? 44.705 30.930 13.567  0.50 27.48 ? 236 ASP A OD2 1 
ATOM   1585 O OD2 B ASP A 1 206 ? 45.998 29.383 12.405  0.50 23.32 ? 236 ASP A OD2 1 
ATOM   1586 N N   . HIS A 1 207 ? 49.270 32.375 14.291  1.00 24.98 ? 237 HIS A N   1 
ATOM   1587 C CA  . HIS A 1 207 ? 50.212 32.320 15.418  1.00 25.66 ? 237 HIS A CA  1 
ATOM   1588 C C   . HIS A 1 207 ? 51.649 32.195 14.981  1.00 25.80 ? 237 HIS A C   1 
ATOM   1589 O O   . HIS A 1 207 ? 52.502 31.929 15.790  1.00 26.88 ? 237 HIS A O   1 
ATOM   1590 C CB  . HIS A 1 207 ? 49.830 31.249 16.469  1.00 24.82 ? 237 HIS A CB  1 
ATOM   1591 C CG  A HIS A 1 207 ? 48.508 31.534 17.114  0.50 23.51 ? 237 HIS A CG  1 
ATOM   1592 C CG  B HIS A 1 207 ? 48.391 30.817 16.423  0.50 26.18 ? 237 HIS A CG  1 
ATOM   1593 N ND1 A HIS A 1 207 ? 48.383 32.311 18.240  0.50 20.66 ? 237 HIS A ND1 1 
ATOM   1594 N ND1 B HIS A 1 207 ? 47.356 31.618 16.859  0.50 24.82 ? 237 HIS A ND1 1 
ATOM   1595 C CD2 A HIS A 1 207 ? 47.248 31.216 16.737  0.50 21.36 ? 237 HIS A CD2 1 
ATOM   1596 C CD2 B HIS A 1 207 ? 47.823 29.655 16.014  0.50 25.79 ? 237 HIS A CD2 1 
ATOM   1597 C CE1 A HIS A 1 207 ? 47.107 32.415 18.566  0.50 19.72 ? 237 HIS A CE1 1 
ATOM   1598 C CE1 B HIS A 1 207 ? 46.212 30.976 16.700  0.50 27.19 ? 237 HIS A CE1 1 
ATOM   1599 N NE2 A HIS A 1 207 ? 46.396 31.763 17.664  0.50 22.03 ? 237 HIS A NE2 1 
ATOM   1600 N NE2 B HIS A 1 207 ? 46.470 29.781 16.193  0.50 27.82 ? 237 HIS A NE2 1 
ATOM   1601 N N   . GLN A 1 208 ? 51.901 32.439 13.701  1.00 26.65 ? 238 GLN A N   1 
ATOM   1602 C CA  . GLN A 1 208 ? 53.241 32.393 13.121  1.00 26.85 ? 238 GLN A CA  1 
ATOM   1603 C C   . GLN A 1 208 ? 53.539 33.670 12.290  1.00 25.19 ? 238 GLN A C   1 
ATOM   1604 O O   . GLN A 1 208 ? 52.720 34.592 12.206  1.00 24.62 ? 238 GLN A O   1 
ATOM   1605 C CB  . GLN A 1 208 ? 53.378 31.120 12.256  1.00 26.60 ? 238 GLN A CB  1 
ATOM   1606 C CG  . GLN A 1 208 ? 53.248 29.788 13.040  1.00 29.26 ? 238 GLN A CG  1 
ATOM   1607 C CD  . GLN A 1 208 ? 53.322 28.602 12.114  1.00 32.18 ? 238 GLN A CD  1 
ATOM   1608 O OE1 . GLN A 1 208 ? 54.228 28.519 11.278  1.00 39.54 ? 238 GLN A OE1 1 
ATOM   1609 N NE2 . GLN A 1 208 ? 52.345 27.676 12.221  1.00 39.31 ? 238 GLN A NE2 1 
ATOM   1610 N N   . THR A 1 209 ? 54.710 33.722 11.674  1.00 25.22 ? 239 THR A N   1 
ATOM   1611 C CA  . THR A 1 209 ? 55.103 34.874 10.853  1.00 25.92 ? 239 THR A CA  1 
ATOM   1612 C C   . THR A 1 209 ? 55.096 34.421 9.407   1.00 26.93 ? 239 THR A C   1 
ATOM   1613 O O   . THR A 1 209 ? 55.079 33.207 9.163   1.00 26.83 ? 239 THR A O   1 
ATOM   1614 C CB  . THR A 1 209 ? 56.501 35.398 11.220  1.00 26.54 ? 239 THR A CB  1 
ATOM   1615 O OG1 . THR A 1 209 ? 57.462 34.437 10.826  1.00 27.55 ? 239 THR A OG1 1 
ATOM   1616 C CG2 . THR A 1 209 ? 56.664 35.628 12.719  1.00 23.31 ? 239 THR A CG2 1 
ATOM   1617 N N   . PRO A 1 210 ? 55.101 35.382 8.426   1.00 27.35 ? 240 PRO A N   1 
ATOM   1618 C CA  . PRO A 1 210 ? 55.333 34.921 7.066   1.00 27.14 ? 240 PRO A CA  1 
ATOM   1619 C C   . PRO A 1 210 ? 56.712 34.260 6.898   1.00 27.51 ? 240 PRO A C   1 
ATOM   1620 O O   . PRO A 1 210 ? 57.555 34.284 7.815   1.00 25.91 ? 240 PRO A O   1 
ATOM   1621 C CB  . PRO A 1 210 ? 55.265 36.207 6.231   1.00 27.84 ? 240 PRO A CB  1 
ATOM   1622 C CG  . PRO A 1 210 ? 54.606 37.228 7.094   1.00 26.10 ? 240 PRO A CG  1 
ATOM   1623 C CD  . PRO A 1 210 ? 54.916 36.847 8.493   1.00 26.86 ? 240 PRO A CD  1 
ATOM   1624 N N   . GLU A 1 211 ? 56.925 33.679 5.720   1.00 28.55 ? 241 GLU A N   1 
ATOM   1625 C CA  . GLU A 1 211 ? 58.134 32.905 5.457   1.00 30.40 ? 241 GLU A CA  1 
ATOM   1626 C C   . GLU A 1 211 ? 59.360 33.854 5.522   1.00 28.87 ? 241 GLU A C   1 
ATOM   1627 O O   . GLU A 1 211 ? 60.391 33.514 6.076   1.00 30.67 ? 241 GLU A O   1 
ATOM   1628 C CB  . GLU A 1 211 ? 58.043 32.251 4.061   1.00 30.93 ? 241 GLU A CB  1 
ATOM   1629 C CG  . GLU A 1 211 ? 56.855 31.270 3.817   1.00 36.28 ? 241 GLU A CG  1 
ATOM   1630 N N   . SER A 1 212 ? 59.214 35.055 4.968   1.00 27.90 ? 242 SER A N   1 
ATOM   1631 C CA  . SER A 1 212 ? 60.245 36.088 5.094   1.00 26.24 ? 242 SER A CA  1 
ATOM   1632 C C   . SER A 1 212 ? 59.541 37.433 4.961   1.00 25.74 ? 242 SER A C   1 
ATOM   1633 O O   . SER A 1 212 ? 58.324 37.486 4.675   1.00 26.73 ? 242 SER A O   1 
ATOM   1634 C CB  . SER A 1 212 ? 61.338 35.891 4.019   1.00 25.44 ? 242 SER A CB  1 
ATOM   1635 O OG  . SER A 1 212 ? 60.768 35.932 2.728   1.00 23.62 ? 242 SER A OG  1 
ATOM   1636 N N   . ALA A 1 213 ? 60.295 38.520 5.141   1.00 24.86 ? 243 ALA A N   1 
ATOM   1637 C CA  . ALA A 1 213 ? 59.716 39.856 5.158   1.00 24.62 ? 243 ALA A CA  1 
ATOM   1638 C C   . ALA A 1 213 ? 59.412 40.394 3.755   1.00 24.68 ? 243 ALA A C   1 
ATOM   1639 O O   . ALA A 1 213 ? 58.439 41.094 3.558   1.00 23.46 ? 243 ALA A O   1 
ATOM   1640 C CB  . ALA A 1 213 ? 60.610 40.813 5.933   1.00 23.64 ? 243 ALA A CB  1 
ATOM   1641 N N   . GLY A 1 214 ? 60.244 40.055 2.780   1.00 25.23 ? 244 GLY A N   1 
ATOM   1642 C CA  . GLY A 1 214 ? 60.057 40.526 1.411   1.00 23.83 ? 244 GLY A CA  1 
ATOM   1643 C C   . GLY A 1 214 ? 58.636 40.437 0.865   1.00 23.96 ? 244 GLY A C   1 
ATOM   1644 O O   . GLY A 1 214 ? 58.103 41.444 0.397   1.00 23.43 ? 244 GLY A O   1 
ATOM   1645 N N   . PRO A 1 215 ? 58.025 39.230 0.858   1.00 23.55 ? 245 PRO A N   1 
ATOM   1646 C CA  . PRO A 1 215 ? 56.628 39.185 0.390   1.00 23.88 ? 245 PRO A CA  1 
ATOM   1647 C C   . PRO A 1 215 ? 55.662 40.094 1.187   1.00 23.30 ? 245 PRO A C   1 
ATOM   1648 O O   . PRO A 1 215 ? 54.705 40.573 0.594   1.00 22.65 ? 245 PRO A O   1 
ATOM   1649 C CB  . PRO A 1 215 ? 56.224 37.700 0.526   1.00 22.85 ? 245 PRO A CB  1 
ATOM   1650 C CG  . PRO A 1 215 ? 57.547 36.956 0.497   1.00 23.78 ? 245 PRO A CG  1 
ATOM   1651 C CD  . PRO A 1 215 ? 58.538 37.886 1.191   1.00 23.65 ? 245 PRO A CD  1 
ATOM   1652 N N   . LEU A 1 216 ? 55.928 40.338 2.477   1.00 22.10 ? 246 LEU A N   1 
ATOM   1653 C CA  . LEU A 1 216 ? 55.035 41.167 3.281   1.00 21.68 ? 246 LEU A CA  1 
ATOM   1654 C C   . LEU A 1 216 ? 55.192 42.626 2.858   1.00 22.57 ? 246 LEU A C   1 
ATOM   1655 O O   . LEU A 1 216 ? 54.183 43.378 2.707   1.00 21.94 ? 246 LEU A O   1 
ATOM   1656 C CB  . LEU A 1 216 ? 55.322 41.016 4.778   1.00 22.05 ? 246 LEU A CB  1 
ATOM   1657 C CG  . LEU A 1 216 ? 54.586 41.948 5.774   1.00 20.28 ? 246 LEU A CG  1 
ATOM   1658 C CD1 . LEU A 1 216 ? 53.078 41.837 5.542   1.00 17.75 ? 246 LEU A CD1 1 
ATOM   1659 C CD2 . LEU A 1 216 ? 54.918 41.542 7.238   1.00 18.95 ? 246 LEU A CD2 1 
ATOM   1660 N N   . LEU A 1 217 ? 56.447 43.050 2.687   1.00 22.41 ? 247 LEU A N   1 
ATOM   1661 C CA  . LEU A 1 217 ? 56.672 44.402 2.170   1.00 22.68 ? 247 LEU A CA  1 
ATOM   1662 C C   . LEU A 1 217 ? 56.089 44.647 0.772   1.00 23.56 ? 247 LEU A C   1 
ATOM   1663 O O   . LEU A 1 217 ? 55.648 45.772 0.488   1.00 23.62 ? 247 LEU A O   1 
ATOM   1664 C CB  . LEU A 1 217 ? 58.143 44.808 2.251   1.00 23.70 ? 247 LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 217 ? 58.779 44.878 3.645   1.00 23.40 ? 247 LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 217 ? 60.288 45.064 3.522   1.00 22.55 ? 247 LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 217 ? 58.117 46.016 4.483   1.00 26.66 ? 247 LEU A CD2 1 
ATOM   1668 N N   . ARG A 1 218 ? 56.090 43.628 -0.099  1.00 23.43 ? 248 ARG A N   1 
ATOM   1669 C CA  . ARG A 1 218 ? 55.414 43.731 -1.406  1.00 25.55 ? 248 ARG A CA  1 
ATOM   1670 C C   . ARG A 1 218 ? 53.890 43.780 -1.282  1.00 24.92 ? 248 ARG A C   1 
ATOM   1671 O O   . ARG A 1 218 ? 53.201 44.450 -2.075  1.00 24.66 ? 248 ARG A O   1 
ATOM   1672 C CB  . ARG A 1 218 ? 55.879 42.621 -2.381  1.00 25.41 ? 248 ARG A CB  1 
ATOM   1673 C CG  . ARG A 1 218 ? 57.376 42.871 -2.831  1.00 27.41 ? 248 ARG A CG  1 
ATOM   1674 C CD  . ARG A 1 218 ? 57.880 41.837 -3.869  1.00 28.63 ? 248 ARG A CD  1 
ATOM   1675 N NE  . ARG A 1 218 ? 58.157 40.510 -3.285  1.00 30.02 ? 248 ARG A NE  1 
ATOM   1676 C CZ  . ARG A 1 218 ? 59.309 40.155 -2.711  1.00 31.29 ? 248 ARG A CZ  1 
ATOM   1677 N NH1 . ARG A 1 218 ? 60.321 41.033 -2.595  1.00 31.35 ? 248 ARG A NH1 1 
ATOM   1678 N NH2 . ARG A 1 218 ? 59.440 38.916 -2.223  1.00 27.31 ? 248 ARG A NH2 1 
ATOM   1679 N N   . LEU A 1 219 ? 53.358 43.096 -0.276  1.00 24.36 ? 249 LEU A N   1 
ATOM   1680 C CA  . LEU A 1 219 ? 51.941 43.266 0.026   1.00 24.64 ? 249 LEU A CA  1 
ATOM   1681 C C   . LEU A 1 219 ? 51.642 44.705 0.463   1.00 24.49 ? 249 LEU A C   1 
ATOM   1682 O O   . LEU A 1 219 ? 50.684 45.323 -0.004  1.00 24.16 ? 249 LEU A O   1 
ATOM   1683 C CB  . LEU A 1 219 ? 51.476 42.234 1.074   1.00 23.82 ? 249 LEU A CB  1 
ATOM   1684 C CG  . LEU A 1 219 ? 50.048 42.436 1.595   1.00 24.46 ? 249 LEU A CG  1 
ATOM   1685 C CD1 . LEU A 1 219 ? 49.044 42.269 0.431   1.00 22.26 ? 249 LEU A CD1 1 
ATOM   1686 C CD2 . LEU A 1 219 ? 49.730 41.432 2.701   1.00 22.54 ? 249 LEU A CD2 1 
ATOM   1687 N N   . VAL A 1 220 ? 52.450 45.224 1.384   1.00 25.39 ? 250 VAL A N   1 
ATOM   1688 C CA  . VAL A 1 220 ? 52.288 46.613 1.826   1.00 25.32 ? 250 VAL A CA  1 
ATOM   1689 C C   . VAL A 1 220 ? 52.360 47.563 0.608   1.00 26.32 ? 250 VAL A C   1 
ATOM   1690 O O   . VAL A 1 220 ? 51.513 48.438 0.478   1.00 25.72 ? 250 VAL A O   1 
ATOM   1691 C CB  . VAL A 1 220 ? 53.272 46.996 2.961   1.00 25.18 ? 250 VAL A CB  1 
ATOM   1692 C CG1 . VAL A 1 220 ? 53.220 48.507 3.286   1.00 24.21 ? 250 VAL A CG1 1 
ATOM   1693 C CG2 . VAL A 1 220 ? 53.002 46.161 4.217   1.00 24.42 ? 250 VAL A CG2 1 
ATOM   1694 N N   . ALA A 1 221 ? 53.328 47.370 -0.291  1.00 26.58 ? 251 ALA A N   1 
ATOM   1695 C CA  . ALA A 1 221 ? 53.408 48.192 -1.502  1.00 27.17 ? 251 ALA A CA  1 
ATOM   1696 C C   . ALA A 1 221 ? 52.189 48.037 -2.382  1.00 27.10 ? 251 ALA A C   1 
ATOM   1697 O O   . ALA A 1 221 ? 51.671 49.030 -2.853  1.00 26.97 ? 251 ALA A O   1 
ATOM   1698 C CB  . ALA A 1 221 ? 54.709 47.909 -2.304  1.00 27.13 ? 251 ALA A CB  1 
ATOM   1699 N N   . GLU A 1 222 ? 51.715 46.810 -2.591  1.00 27.46 ? 252 GLU A N   1 
ATOM   1700 C CA  . GLU A 1 222 ? 50.466 46.575 -3.328  1.00 29.14 ? 252 GLU A CA  1 
ATOM   1701 C C   . GLU A 1 222 ? 49.291 47.446 -2.797  1.00 30.67 ? 252 GLU A C   1 
ATOM   1702 O O   . GLU A 1 222 ? 48.552 48.077 -3.572  1.00 30.25 ? 252 GLU A O   1 
ATOM   1703 C CB  . GLU A 1 222 ? 50.083 45.089 -3.314  1.00 28.77 ? 252 GLU A CB  1 
ATOM   1704 C CG  . GLU A 1 222 ? 48.820 44.760 -4.155  1.00 30.48 ? 252 GLU A CG  1 
ATOM   1705 C CD  . GLU A 1 222 ? 49.010 44.994 -5.678  1.00 35.21 ? 252 GLU A CD  1 
ATOM   1706 O OE1 . GLU A 1 222 ? 50.085 44.643 -6.222  1.00 36.60 ? 252 GLU A OE1 1 
ATOM   1707 O OE2 . GLU A 1 222 ? 48.075 45.507 -6.324  1.00 35.18 ? 252 GLU A OE2 1 
ATOM   1708 N N   . VAL A 1 223 ? 49.169 47.503 -1.469  1.00 31.63 ? 253 VAL A N   1 
ATOM   1709 C CA  . VAL A 1 223 ? 48.169 48.304 -0.788  1.00 32.09 ? 253 VAL A CA  1 
ATOM   1710 C C   . VAL A 1 223 ? 48.367 49.795 -1.082  1.00 34.46 ? 253 VAL A C   1 
ATOM   1711 O O   . VAL A 1 223 ? 47.409 50.468 -1.460  1.00 33.75 ? 253 VAL A O   1 
ATOM   1712 C CB  . VAL A 1 223 ? 48.149 47.985 0.747   1.00 31.54 ? 253 VAL A CB  1 
ATOM   1713 C CG1 . VAL A 1 223 ? 47.436 49.065 1.562   1.00 28.77 ? 253 VAL A CG1 1 
ATOM   1714 C CG2 . VAL A 1 223 ? 47.531 46.604 0.978   1.00 29.48 ? 253 VAL A CG2 1 
ATOM   1715 N N   . GLU A 1 224 ? 49.592 50.301 -0.917  1.00 36.92 ? 254 GLU A N   1 
ATOM   1716 C CA  . GLU A 1 224 ? 49.882 51.722 -1.202  1.00 40.82 ? 254 GLU A CA  1 
ATOM   1717 C C   . GLU A 1 224 ? 49.480 52.131 -2.621  1.00 42.72 ? 254 GLU A C   1 
ATOM   1718 O O   . GLU A 1 224 ? 48.973 53.230 -2.819  1.00 43.18 ? 254 GLU A O   1 
ATOM   1719 C CB  . GLU A 1 224 ? 51.355 52.084 -0.976  1.00 40.03 ? 254 GLU A CB  1 
ATOM   1720 C CG  . GLU A 1 224 ? 51.856 51.797 0.411   1.00 40.66 ? 254 GLU A CG  1 
ATOM   1721 C CD  . GLU A 1 224 ? 51.444 52.819 1.476   1.00 42.86 ? 254 GLU A CD  1 
ATOM   1722 O OE1 . GLU A 1 224 ? 50.641 53.763 1.207   1.00 38.37 ? 254 GLU A OE1 1 
ATOM   1723 O OE2 . GLU A 1 224 ? 51.960 52.665 2.616   1.00 40.75 ? 254 GLU A OE2 1 
ATOM   1724 N N   . GLU A 1 225 ? 49.663 51.222 -3.575  1.00 44.66 ? 255 GLU A N   1 
ATOM   1725 C CA  . GLU A 1 225 ? 49.518 51.525 -4.983  1.00 47.59 ? 255 GLU A CA  1 
ATOM   1726 C C   . GLU A 1 225 ? 48.069 51.538 -5.396  1.00 49.37 ? 255 GLU A C   1 
ATOM   1727 O O   . GLU A 1 225 ? 47.740 52.046 -6.465  1.00 51.29 ? 255 GLU A O   1 
ATOM   1728 C CB  . GLU A 1 225 ? 50.305 50.528 -5.850  1.00 47.32 ? 255 GLU A CB  1 
ATOM   1729 C CG  . GLU A 1 225 ? 49.482 49.321 -6.336  1.00 48.53 ? 255 GLU A CG  1 
ATOM   1730 N N   . SER A 1 226 ? 47.199 51.004 -4.549  1.00 51.27 ? 256 SER A N   1 
ATOM   1731 C CA  . SER A 1 226 ? 45.771 50.887 -4.864  1.00 52.72 ? 256 SER A CA  1 
ATOM   1732 C C   . SER A 1 226 ? 45.122 52.244 -5.190  1.00 54.64 ? 256 SER A C   1 
ATOM   1733 O O   . SER A 1 226 ? 45.475 53.259 -4.579  1.00 54.17 ? 256 SER A O   1 
ATOM   1734 C CB  . SER A 1 226 ? 45.032 50.137 -3.746  1.00 52.06 ? 256 SER A CB  1 
ATOM   1735 O OG  . SER A 1 226 ? 45.505 48.804 -3.666  1.00 49.94 ? 256 SER A OG  1 
ATOM   1736 N N   . PRO A 1 227 ? 44.180 52.265 -6.165  1.00 57.15 ? 257 PRO A N   1 
ATOM   1737 C CA  . PRO A 1 227 ? 43.656 53.560 -6.596  1.00 59.00 ? 257 PRO A CA  1 
ATOM   1738 C C   . PRO A 1 227 ? 42.792 54.159 -5.488  1.00 60.58 ? 257 PRO A C   1 
ATOM   1739 O O   . PRO A 1 227 ? 41.943 53.464 -4.891  1.00 60.50 ? 257 PRO A O   1 
ATOM   1740 C CB  . PRO A 1 227 ? 42.824 53.215 -7.841  1.00 58.89 ? 257 PRO A CB  1 
ATOM   1741 C CG  . PRO A 1 227 ? 42.385 51.802 -7.618  1.00 58.38 ? 257 PRO A CG  1 
ATOM   1742 C CD  . PRO A 1 227 ? 43.521 51.142 -6.871  1.00 57.74 ? 257 PRO A CD  1 
ATOM   1743 N N   . GLU A 1 228 ? 43.052 55.429 -5.187  1.00 62.45 ? 258 GLU A N   1 
ATOM   1744 C CA  . GLU A 1 228 ? 42.316 56.118 -4.135  1.00 64.09 ? 258 GLU A CA  1 
ATOM   1745 C C   . GLU A 1 228 ? 41.540 57.305 -4.702  1.00 64.20 ? 258 GLU A C   1 
ATOM   1746 O O   . GLU A 1 228 ? 41.969 58.461 -4.596  1.00 64.73 ? 258 GLU A O   1 
ATOM   1747 C CB  . GLU A 1 228 ? 43.237 56.529 -2.978  1.00 64.65 ? 258 GLU A CB  1 
ATOM   1748 C CG  . GLU A 1 228 ? 42.473 56.957 -1.727  1.00 66.71 ? 258 GLU A CG  1 
ATOM   1749 C CD  . GLU A 1 228 ? 41.492 55.883 -1.249  1.00 69.73 ? 258 GLU A CD  1 
ATOM   1750 O OE1 . GLU A 1 228 ? 40.378 55.764 -1.844  1.00 68.03 ? 258 GLU A OE1 1 
ATOM   1751 O OE2 . GLU A 1 228 ? 41.848 55.171 -0.261  1.00 71.45 ? 258 GLU A OE2 1 
ATOM   1752 N N   . THR A 1 229 ? 40.389 56.991 -5.294  1.00 63.86 ? 259 THR A N   1 
ATOM   1753 C CA  . THR A 1 229 ? 39.605 57.961 -6.053  1.00 63.56 ? 259 THR A CA  1 
ATOM   1754 C C   . THR A 1 229 ? 38.517 58.685 -5.218  1.00 62.66 ? 259 THR A C   1 
ATOM   1755 O O   . THR A 1 229 ? 37.911 59.644 -5.706  1.00 63.20 ? 259 THR A O   1 
ATOM   1756 C CB  . THR A 1 229 ? 38.990 57.312 -7.345  1.00 64.10 ? 259 THR A CB  1 
ATOM   1757 O OG1 . THR A 1 229 ? 37.930 56.404 -6.990  1.00 65.06 ? 259 THR A OG1 1 
ATOM   1758 C CG2 . THR A 1 229 ? 40.075 56.562 -8.181  1.00 64.36 ? 259 THR A CG2 1 
ATOM   1759 N N   . ALA A 1 230 ? 38.284 58.241 -3.976  1.00 60.92 ? 260 ALA A N   1 
ATOM   1760 C CA  . ALA A 1 230 ? 37.271 58.854 -3.104  1.00 59.05 ? 260 ALA A CA  1 
ATOM   1761 C C   . ALA A 1 230 ? 37.726 60.182 -2.476  1.00 57.67 ? 260 ALA A C   1 
ATOM   1762 O O   . ALA A 1 230 ? 38.921 60.412 -2.272  1.00 58.32 ? 260 ALA A O   1 
ATOM   1763 C CB  . ALA A 1 230 ? 36.802 57.865 -2.020  1.00 59.07 ? 260 ALA A CB  1 
ATOM   1764 N N   . ALA A 1 231 ? 36.761 61.064 -2.199  1.00 55.48 ? 261 ALA A N   1 
ATOM   1765 C CA  . ALA A 1 231 ? 37.028 62.346 -1.530  1.00 53.13 ? 261 ALA A CA  1 
ATOM   1766 C C   . ALA A 1 231 ? 37.334 62.111 -0.049  1.00 51.43 ? 261 ALA A C   1 
ATOM   1767 O O   . ALA A 1 231 ? 38.251 62.722 0.508   1.00 51.81 ? 261 ALA A O   1 
ATOM   1768 C CB  . ALA A 1 231 ? 35.846 63.295 -1.686  1.00 52.95 ? 261 ALA A CB  1 
ATOM   1769 N N   . HIS A 1 232 ? 36.553 61.226 0.576   1.00 48.35 ? 262 HIS A N   1 
ATOM   1770 C CA  . HIS A 1 232 ? 36.803 60.768 1.951   1.00 45.50 ? 262 HIS A CA  1 
ATOM   1771 C C   . HIS A 1 232 ? 36.990 59.238 1.885   1.00 42.63 ? 262 HIS A C   1 
ATOM   1772 O O   . HIS A 1 232 ? 36.004 58.483 1.932   1.00 42.53 ? 262 HIS A O   1 
ATOM   1773 C CB  . HIS A 1 232 ? 35.649 61.179 2.894   1.00 45.55 ? 262 HIS A CB  1 
ATOM   1774 N N   . PRO A 1 233 ? 38.249 58.783 1.709   1.00 39.65 ? 263 PRO A N   1 
ATOM   1775 C CA  . PRO A 1 233 ? 38.502 57.350 1.578   1.00 37.82 ? 263 PRO A CA  1 
ATOM   1776 C C   . PRO A 1 233 ? 37.942 56.570 2.779   1.00 35.47 ? 263 PRO A C   1 
ATOM   1777 O O   . PRO A 1 233 ? 38.024 57.034 3.928   1.00 35.39 ? 263 PRO A O   1 
ATOM   1778 C CB  . PRO A 1 233 ? 40.035 57.265 1.517   1.00 37.69 ? 263 PRO A CB  1 
ATOM   1779 C CG  . PRO A 1 233 ? 40.453 58.577 0.984   1.00 38.99 ? 263 PRO A CG  1 
ATOM   1780 C CD  . PRO A 1 233 ? 39.491 59.567 1.596   1.00 39.58 ? 263 PRO A CD  1 
ATOM   1781 N N   . GLY A 1 234 ? 37.325 55.435 2.489   1.00 32.45 ? 264 GLY A N   1 
ATOM   1782 C CA  . GLY A 1 234 ? 36.827 54.568 3.516   1.00 30.33 ? 264 GLY A CA  1 
ATOM   1783 C C   . GLY A 1 234 ? 37.977 53.813 4.174   1.00 27.98 ? 264 GLY A C   1 
ATOM   1784 O O   . GLY A 1 234 ? 39.136 53.885 3.720   1.00 26.38 ? 264 GLY A O   1 
ATOM   1785 N N   . PRO A 1 235 ? 37.660 53.061 5.254   1.00 26.99 ? 265 PRO A N   1 
ATOM   1786 C CA  . PRO A 1 235 ? 38.720 52.278 5.871   1.00 25.49 ? 265 PRO A CA  1 
ATOM   1787 C C   . PRO A 1 235 ? 39.129 51.120 4.957   1.00 24.22 ? 265 PRO A C   1 
ATOM   1788 O O   . PRO A 1 235 ? 38.323 50.622 4.152   1.00 22.37 ? 265 PRO A O   1 
ATOM   1789 C CB  . PRO A 1 235 ? 38.069 51.734 7.131   1.00 26.02 ? 265 PRO A CB  1 
ATOM   1790 C CG  . PRO A 1 235 ? 36.777 52.580 7.334   1.00 28.01 ? 265 PRO A CG  1 
ATOM   1791 C CD  . PRO A 1 235 ? 36.366 52.890 5.942   1.00 26.39 ? 265 PRO A CD  1 
ATOM   1792 N N   . ILE A 1 236 ? 40.389 50.716 5.082   1.00 23.62 ? 266 ILE A N   1 
ATOM   1793 C CA  . ILE A 1 236 ? 40.848 49.467 4.467   1.00 21.98 ? 266 ILE A CA  1 
ATOM   1794 C C   . ILE A 1 236 ? 40.470 48.326 5.404   1.00 21.35 ? 266 ILE A C   1 
ATOM   1795 O O   . ILE A 1 236 ? 40.834 48.343 6.574   1.00 22.00 ? 266 ILE A O   1 
ATOM   1796 C CB  . ILE A 1 236 ? 42.361 49.494 4.223   1.00 21.41 ? 266 ILE A CB  1 
ATOM   1797 C CG1 . ILE A 1 236 ? 42.737 50.622 3.251   1.00 21.58 ? 266 ILE A CG1 1 
ATOM   1798 C CG2 . ILE A 1 236 ? 42.871 48.138 3.735   1.00 20.06 ? 266 ILE A CG2 1 
ATOM   1799 C CD1 . ILE A 1 236 ? 44.293 50.995 3.339   1.00 23.02 ? 266 ILE A CD1 1 
ATOM   1800 N N   . VAL A 1 237 ? 39.725 47.351 4.899   1.00 20.74 ? 267 VAL A N   1 
ATOM   1801 C CA  . VAL A 1 237 ? 39.404 46.147 5.672   1.00 20.56 ? 267 VAL A CA  1 
ATOM   1802 C C   . VAL A 1 237 ? 40.602 45.185 5.649   1.00 21.53 ? 267 VAL A C   1 
ATOM   1803 O O   . VAL A 1 237 ? 41.163 44.866 4.562   1.00 20.31 ? 267 VAL A O   1 
ATOM   1804 C CB  . VAL A 1 237 ? 38.128 45.448 5.152   1.00 21.03 ? 267 VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 237 ? 37.928 44.079 5.815   1.00 18.22 ? 267 VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 237 ? 36.891 46.335 5.479   1.00 20.74 ? 267 VAL A CG2 1 
ATOM   1807 N N   . VAL A 1 238 ? 41.043 44.793 6.850   1.00 20.48 ? 268 VAL A N   1 
ATOM   1808 C CA  . VAL A 1 238 ? 42.124 43.799 6.993   1.00 20.31 ? 268 VAL A CA  1 
ATOM   1809 C C   . VAL A 1 238 ? 41.510 42.712 7.840   1.00 20.18 ? 268 VAL A C   1 
ATOM   1810 O O   . VAL A 1 238 ? 40.937 42.991 8.902   1.00 20.43 ? 268 VAL A O   1 
ATOM   1811 C CB  . VAL A 1 238 ? 43.391 44.382 7.692   1.00 20.42 ? 268 VAL A CB  1 
ATOM   1812 C CG1 . VAL A 1 238 ? 44.575 43.338 7.750   1.00 18.76 ? 268 VAL A CG1 1 
ATOM   1813 C CG2 . VAL A 1 238 ? 43.851 45.651 6.989   1.00 19.52 ? 268 VAL A CG2 1 
ATOM   1814 N N   . HIS A 1 239 ? 41.562 41.491 7.347   1.00 21.32 ? 269 HIS A N   1 
ATOM   1815 C CA  . HIS A 1 239 ? 41.060 40.370 8.123   1.00 22.10 ? 269 HIS A CA  1 
ATOM   1816 C C   . HIS A 1 239 ? 41.898 39.098 8.068   1.00 22.36 ? 269 HIS A C   1 
ATOM   1817 O O   . HIS A 1 239 ? 42.754 38.907 7.182   1.00 22.09 ? 269 HIS A O   1 
ATOM   1818 C CB  . HIS A 1 239 ? 39.585 40.062 7.796   1.00 22.42 ? 269 HIS A CB  1 
ATOM   1819 C CG  . HIS A 1 239 ? 39.362 39.425 6.464   1.00 23.36 ? 269 HIS A CG  1 
ATOM   1820 N ND1 . HIS A 1 239 ? 39.457 38.060 6.266   1.00 26.14 ? 269 HIS A ND1 1 
ATOM   1821 C CD2 . HIS A 1 239 ? 39.023 39.956 5.266   1.00 24.54 ? 269 HIS A CD2 1 
ATOM   1822 C CE1 . HIS A 1 239 ? 39.146 37.778 5.014   1.00 23.72 ? 269 HIS A CE1 1 
ATOM   1823 N NE2 . HIS A 1 239 ? 38.887 38.910 4.386   1.00 24.46 ? 269 HIS A NE2 1 
ATOM   1824 N N   . CYS A 1 240 ? 41.647 38.270 9.079   1.00 21.82 ? 270 CYS A N   1 
ATOM   1825 C CA  . CYS A 1 240 ? 42.229 36.942 9.197   1.00 23.40 ? 270 CYS A CA  1 
ATOM   1826 C C   . CYS A 1 240 ? 41.297 36.196 10.143  1.00 23.10 ? 270 CYS A C   1 
ATOM   1827 O O   . CYS A 1 240 ? 40.341 36.794 10.633  1.00 23.21 ? 270 CYS A O   1 
ATOM   1828 C CB  . CYS A 1 240 ? 43.670 36.972 9.759   1.00 20.70 ? 270 CYS A CB  1 
ATOM   1829 S SG  . CYS A 1 240 ? 43.861 37.705 11.356  1.00 22.33 ? 270 CYS A SG  1 
ATOM   1830 N N   . SER A 1 241 ? 41.595 34.920 10.423  1.00 23.05 ? 271 SER A N   1 
ATOM   1831 C CA  . SER A 1 241 ? 40.743 34.076 11.275  1.00 23.58 ? 271 SER A CA  1 
ATOM   1832 C C   . SER A 1 241 ? 40.171 34.713 12.533  1.00 22.70 ? 271 SER A C   1 
ATOM   1833 O O   . SER A 1 241 ? 38.968 34.694 12.724  1.00 23.00 ? 271 SER A O   1 
ATOM   1834 C CB  . SER A 1 241 ? 41.461 32.777 11.641  1.00 24.15 ? 271 SER A CB  1 
ATOM   1835 O OG  A SER A 1 241 ? 41.771 32.076 10.449  0.50 20.94 ? 271 SER A OG  1 
ATOM   1836 O OG  B SER A 1 241 ? 40.513 31.828 12.125  0.50 24.42 ? 271 SER A OG  1 
ATOM   1837 N N   . ALA A 1 242 ? 41.035 35.208 13.420  1.00 21.62 ? 272 ALA A N   1 
ATOM   1838 C CA  . ALA A 1 242 ? 40.579 35.887 14.630  1.00 20.23 ? 272 ALA A CA  1 
ATOM   1839 C C   . ALA A 1 242 ? 40.514 37.413 14.476  1.00 20.52 ? 272 ALA A C   1 
ATOM   1840 O O   . ALA A 1 242 ? 39.918 38.097 15.306  1.00 20.94 ? 272 ALA A O   1 
ATOM   1841 C CB  . ALA A 1 242 ? 41.453 35.497 15.839  1.00 20.25 ? 272 ALA A CB  1 
ATOM   1842 N N   . GLY A 1 243 ? 41.141 37.959 13.430  1.00 20.06 ? 273 GLY A N   1 
ATOM   1843 C CA  . GLY A 1 243 ? 41.200 39.398 13.253  1.00 18.42 ? 273 GLY A CA  1 
ATOM   1844 C C   . GLY A 1 243 ? 42.124 40.152 14.169  1.00 18.78 ? 273 GLY A C   1 
ATOM   1845 O O   . GLY A 1 243 ? 41.972 41.356 14.337  1.00 18.05 ? 273 GLY A O   1 
ATOM   1846 N N   . ILE A 1 244 ? 43.120 39.495 14.763  1.00 19.10 ? 274 ILE A N   1 
ATOM   1847 C CA  . ILE A 1 244 ? 44.002 40.255 15.673  1.00 20.10 ? 274 ILE A CA  1 
ATOM   1848 C C   . ILE A 1 244 ? 45.504 40.000 15.485  1.00 19.87 ? 274 ILE A C   1 
ATOM   1849 O O   . ILE A 1 244 ? 46.283 40.916 15.589  1.00 20.85 ? 274 ILE A O   1 
ATOM   1850 C CB  . ILE A 1 244 ? 43.612 40.121 17.219  1.00 20.98 ? 274 ILE A CB  1 
ATOM   1851 C CG1 . ILE A 1 244 ? 43.677 38.660 17.698  1.00 21.35 ? 274 ILE A CG1 1 
ATOM   1852 C CG2 . ILE A 1 244 ? 42.223 40.768 17.536  1.00 18.99 ? 274 ILE A CG2 1 
ATOM   1853 C CD1 . ILE A 1 244 ? 43.394 38.516 19.204  1.00 22.30 ? 274 ILE A CD1 1 
ATOM   1854 N N   . GLY A 1 245 ? 45.909 38.763 15.239  1.00 20.01 ? 275 GLY A N   1 
ATOM   1855 C CA  . GLY A 1 245 ? 47.339 38.452 15.157  1.00 20.34 ? 275 GLY A CA  1 
ATOM   1856 C C   . GLY A 1 245 ? 47.968 38.939 13.865  1.00 20.26 ? 275 GLY A C   1 
ATOM   1857 O O   . GLY A 1 245 ? 48.750 39.892 13.858  1.00 20.26 ? 275 GLY A O   1 
ATOM   1858 N N   . ARG A 1 246 ? 47.586 38.287 12.775  1.00 20.48 ? 276 ARG A N   1 
ATOM   1859 C CA  . ARG A 1 246 ? 48.063 38.609 11.446  1.00 21.35 ? 276 ARG A CA  1 
ATOM   1860 C C   . ARG A 1 246 ? 47.616 40.010 10.981  1.00 21.76 ? 276 ARG A C   1 
ATOM   1861 O O   . ARG A 1 246 ? 48.429 40.784 10.446  1.00 20.95 ? 276 ARG A O   1 
ATOM   1862 C CB  . ARG A 1 246 ? 47.671 37.493 10.481  1.00 21.30 ? 276 ARG A CB  1 
ATOM   1863 C CG  . ARG A 1 246 ? 48.456 36.208 10.786  1.00 22.32 ? 276 ARG A CG  1 
ATOM   1864 C CD  . ARG A 1 246 ? 47.912 35.003 10.069  1.00 23.21 ? 276 ARG A CD  1 
ATOM   1865 N NE  . ARG A 1 246 ? 46.641 34.564 10.669  1.00 24.53 ? 276 ARG A NE  1 
ATOM   1866 C CZ  . ARG A 1 246 ? 45.846 33.619 10.168  1.00 22.74 ? 276 ARG A CZ  1 
ATOM   1867 N NH1 . ARG A 1 246 ? 46.180 32.983 9.053   1.00 21.53 ? 276 ARG A NH1 1 
ATOM   1868 N NH2 . ARG A 1 246 ? 44.708 33.299 10.810  1.00 22.18 ? 276 ARG A NH2 1 
ATOM   1869 N N   . THR A 1 247 ? 46.357 40.357 11.276  1.00 21.74 ? 277 THR A N   1 
ATOM   1870 C CA  . THR A 1 247 ? 45.846 41.710 11.043  1.00 22.21 ? 277 THR A CA  1 
ATOM   1871 C C   . THR A 1 247 ? 46.702 42.737 11.747  1.00 21.09 ? 277 THR A C   1 
ATOM   1872 O O   . THR A 1 247 ? 47.105 43.734 11.129  1.00 21.18 ? 277 THR A O   1 
ATOM   1873 C CB  . THR A 1 247 ? 44.357 41.821 11.515  1.00 22.92 ? 277 THR A CB  1 
ATOM   1874 O OG1 . THR A 1 247 ? 43.551 41.146 10.557  1.00 25.10 ? 277 THR A OG1 1 
ATOM   1875 C CG2 . THR A 1 247 ? 43.900 43.204 11.454  1.00 26.07 ? 277 THR A CG2 1 
ATOM   1876 N N   . GLY A 1 248 ? 46.976 42.510 13.043  1.00 19.82 ? 278 GLY A N   1 
ATOM   1877 C CA  . GLY A 1 248 ? 47.794 43.447 13.815  1.00 19.35 ? 278 GLY A CA  1 
ATOM   1878 C C   . GLY A 1 248 ? 49.207 43.561 13.214  1.00 19.86 ? 278 GLY A C   1 
ATOM   1879 O O   . GLY A 1 248 ? 49.762 44.654 13.131  1.00 19.42 ? 278 GLY A O   1 
ATOM   1880 N N   . CYS A 1 249 ? 49.780 42.425 12.789  1.00 19.06 ? 279 CYS A N   1 
ATOM   1881 C CA  . CYS A 1 249 ? 51.112 42.435 12.178  1.00 19.31 ? 279 CYS A CA  1 
ATOM   1882 C C   . CYS A 1 249 ? 51.109 43.216 10.866  1.00 19.42 ? 279 CYS A C   1 
ATOM   1883 O O   . CYS A 1 249 ? 52.022 43.983 10.613  1.00 18.81 ? 279 CYS A O   1 
ATOM   1884 C CB  . CYS A 1 249 ? 51.656 41.005 11.933  1.00 18.89 ? 279 CYS A CB  1 
ATOM   1885 S SG  . CYS A 1 249 ? 51.979 40.048 13.407  1.00 21.50 ? 279 CYS A SG  1 
ATOM   1886 N N   . PHE A 1 250 ? 50.102 42.977 10.026  1.00 19.00 ? 280 PHE A N   1 
ATOM   1887 C CA  . PHE A 1 250 ? 50.044 43.667 8.789   1.00 19.73 ? 280 PHE A CA  1 
ATOM   1888 C C   . PHE A 1 250 ? 49.891 45.172 9.039   1.00 19.69 ? 280 PHE A C   1 
ATOM   1889 O O   . PHE A 1 250 ? 50.640 45.954 8.482   1.00 19.56 ? 280 PHE A O   1 
ATOM   1890 C CB  . PHE A 1 250 ? 48.904 43.175 7.880   1.00 19.97 ? 280 PHE A CB  1 
ATOM   1891 C CG  . PHE A 1 250 ? 48.723 44.079 6.679   1.00 21.29 ? 280 PHE A CG  1 
ATOM   1892 C CD1 . PHE A 1 250 ? 49.599 43.978 5.584   1.00 22.37 ? 280 PHE A CD1 1 
ATOM   1893 C CD2 . PHE A 1 250 ? 47.786 45.122 6.711   1.00 24.46 ? 280 PHE A CD2 1 
ATOM   1894 C CE1 . PHE A 1 250 ? 49.509 44.839 4.505   1.00 23.50 ? 280 PHE A CE1 1 
ATOM   1895 C CE2 . PHE A 1 250 ? 47.679 46.012 5.625   1.00 24.71 ? 280 PHE A CE2 1 
ATOM   1896 C CZ  . PHE A 1 250 ? 48.557 45.867 4.528   1.00 24.50 ? 280 PHE A CZ  1 
ATOM   1897 N N   . ILE A 1 251 ? 48.897 45.577 9.866   1.00 20.14 ? 281 ILE A N   1 
ATOM   1898 C CA  . ILE A 1 251 ? 48.696 47.016 10.105  1.00 20.00 ? 281 ILE A CA  1 
ATOM   1899 C C   . ILE A 1 251 ? 49.927 47.673 10.758  1.00 19.75 ? 281 ILE A C   1 
ATOM   1900 O O   . ILE A 1 251 ? 50.370 48.735 10.310  1.00 20.13 ? 281 ILE A O   1 
ATOM   1901 C CB  . ILE A 1 251 ? 47.387 47.328 10.850  1.00 20.07 ? 281 ILE A CB  1 
ATOM   1902 C CG1 . ILE A 1 251 ? 46.197 46.879 9.983   1.00 19.50 ? 281 ILE A CG1 1 
ATOM   1903 C CG2 . ILE A 1 251 ? 47.340 48.805 11.187  1.00 18.73 ? 281 ILE A CG2 1 
ATOM   1904 C CD1 . ILE A 1 251 ? 44.854 46.782 10.728  1.00 18.79 ? 281 ILE A CD1 1 
ATOM   1905 N N   . ALA A 1 252 ? 50.505 47.029 11.773  1.00 18.86 ? 282 ALA A N   1 
ATOM   1906 C CA  . ALA A 1 252 ? 51.726 47.547 12.400  1.00 19.18 ? 282 ALA A CA  1 
ATOM   1907 C C   . ALA A 1 252 ? 52.897 47.702 11.413  1.00 19.33 ? 282 ALA A C   1 
ATOM   1908 O O   . ALA A 1 252 ? 53.678 48.641 11.540  1.00 19.89 ? 282 ALA A O   1 
ATOM   1909 C CB  . ALA A 1 252 ? 52.161 46.676 13.592  1.00 18.97 ? 282 ALA A CB  1 
ATOM   1910 N N   . THR A 1 253 ? 53.008 46.804 10.437  1.00 19.51 ? 283 THR A N   1 
ATOM   1911 C CA  . THR A 1 253 ? 54.082 46.908 9.446   1.00 19.86 ? 283 THR A CA  1 
ATOM   1912 C C   . THR A 1 253 ? 53.838 48.162 8.543   1.00 20.45 ? 283 THR A C   1 
ATOM   1913 O O   . THR A 1 253 ? 54.735 48.965 8.301   1.00 20.01 ? 283 THR A O   1 
ATOM   1914 C CB  . THR A 1 253 ? 54.169 45.638 8.577   1.00 19.51 ? 283 THR A CB  1 
ATOM   1915 O OG1 . THR A 1 253 ? 54.435 44.501 9.422   1.00 20.72 ? 283 THR A OG1 1 
ATOM   1916 C CG2 . THR A 1 253 ? 55.310 45.786 7.480   1.00 18.34 ? 283 THR A CG2 1 
ATOM   1917 N N   . ARG A 1 254 ? 52.619 48.347 8.092   1.00 21.01 ? 284 ARG A N   1 
ATOM   1918 C CA  . ARG A 1 254 ? 52.333 49.503 7.260   1.00 21.30 ? 284 ARG A CA  1 
ATOM   1919 C C   . ARG A 1 254 ? 52.588 50.806 7.991   1.00 21.69 ? 284 ARG A C   1 
ATOM   1920 O O   . ARG A 1 254 ? 53.247 51.697 7.439   1.00 22.19 ? 284 ARG A O   1 
ATOM   1921 C CB  . ARG A 1 254 ? 50.918 49.479 6.660   1.00 21.05 ? 284 ARG A CB  1 
ATOM   1922 C CG  . ARG A 1 254 ? 50.737 50.776 5.754   1.00 23.40 ? 284 ARG A CG  1 
ATOM   1923 C CD  . ARG A 1 254 ? 49.685 50.623 4.771   1.00 25.93 ? 284 ARG A CD  1 
ATOM   1924 N NE  . ARG A 1 254 ? 49.566 51.793 3.878   1.00 26.16 ? 284 ARG A NE  1 
ATOM   1925 C CZ  . ARG A 1 254 ? 48.519 52.639 3.862   1.00 26.01 ? 284 ARG A CZ  1 
ATOM   1926 N NH1 . ARG A 1 254 ? 47.528 52.520 4.747   1.00 21.46 ? 284 ARG A NH1 1 
ATOM   1927 N NH2 . ARG A 1 254 ? 48.475 53.643 2.970   1.00 22.48 ? 284 ARG A NH2 1 
ATOM   1928 N N   . ILE A 1 255 ? 52.085 50.936 9.230   1.00 21.38 ? 285 ILE A N   1 
ATOM   1929 C CA  . ILE A 1 255 ? 52.337 52.139 10.015  1.00 20.74 ? 285 ILE A CA  1 
ATOM   1930 C C   . ILE A 1 255 ? 53.802 52.361 10.309  1.00 21.57 ? 285 ILE A C   1 
ATOM   1931 O O   . ILE A 1 255 ? 54.275 53.517 10.228  1.00 21.84 ? 285 ILE A O   1 
ATOM   1932 C CB  . ILE A 1 255 ? 51.546 52.148 11.322  1.00 20.72 ? 285 ILE A CB  1 
ATOM   1933 C CG1 . ILE A 1 255 ? 50.042 52.122 10.972  1.00 20.17 ? 285 ILE A CG1 1 
ATOM   1934 C CG2 . ILE A 1 255 ? 51.943 53.363 12.193  1.00 20.09 ? 285 ILE A CG2 1 
ATOM   1935 C CD1 . ILE A 1 255 ? 49.081 51.842 12.195  1.00 19.36 ? 285 ILE A CD1 1 
ATOM   1936 N N   . GLY A 1 256 ? 54.511 51.278 10.661  1.00 21.16 ? 286 GLY A N   1 
ATOM   1937 C CA  . GLY A 1 256 ? 55.970 51.285 10.838  1.00 20.72 ? 286 GLY A CA  1 
ATOM   1938 C C   . GLY A 1 256 ? 56.712 51.834 9.616   1.00 21.48 ? 286 GLY A C   1 
ATOM   1939 O O   . GLY A 1 256 ? 57.641 52.628 9.760   1.00 21.66 ? 286 GLY A O   1 
ATOM   1940 N N   . CYS A 1 257 ? 56.319 51.386 8.434   1.00 21.90 ? 287 CYS A N   1 
ATOM   1941 C CA  . CYS A 1 257 ? 56.954 51.817 7.186   1.00 23.62 ? 287 CYS A CA  1 
ATOM   1942 C C   . CYS A 1 257 ? 56.665 53.300 6.986   1.00 24.06 ? 287 CYS A C   1 
ATOM   1943 O O   . CYS A 1 257 ? 57.557 54.055 6.630   1.00 25.29 ? 287 CYS A O   1 
ATOM   1944 C CB  . CYS A 1 257 ? 56.425 51.029 5.976   1.00 22.24 ? 287 CYS A CB  1 
ATOM   1945 S SG  . CYS A 1 257 ? 56.954 49.291 5.957   1.00 24.49 ? 287 CYS A SG  1 
ATOM   1946 N N   . GLN A 1 258 ? 55.415 53.704 7.241   1.00 24.41 ? 288 GLN A N   1 
ATOM   1947 C CA  . GLN A 1 258 ? 55.025 55.102 7.157   1.00 24.52 ? 288 GLN A CA  1 
ATOM   1948 C C   . GLN A 1 258 ? 55.837 56.019 8.070   1.00 24.63 ? 288 GLN A C   1 
ATOM   1949 O O   . GLN A 1 258 ? 56.276 57.105 7.635   1.00 25.42 ? 288 GLN A O   1 
ATOM   1950 C CB  . GLN A 1 258 ? 53.522 55.262 7.364   1.00 24.73 ? 288 GLN A CB  1 
ATOM   1951 C CG  . GLN A 1 258 ? 52.665 54.681 6.273   1.00 22.55 ? 288 GLN A CG  1 
ATOM   1952 C CD  . GLN A 1 258 ? 51.203 54.739 6.682   1.00 26.52 ? 288 GLN A CD  1 
ATOM   1953 O OE1 . GLN A 1 258 ? 50.841 54.370 7.800   1.00 30.30 ? 288 GLN A OE1 1 
ATOM   1954 N NE2 . GLN A 1 258 ? 50.388 55.267 5.835   1.00 22.26 ? 288 GLN A NE2 1 
ATOM   1955 N N   . GLN A 1 259 ? 56.070 55.597 9.308   1.00 25.27 ? 289 GLN A N   1 
ATOM   1956 C CA  . GLN A 1 259 ? 56.929 56.355 10.224  1.00 26.42 ? 289 GLN A CA  1 
ATOM   1957 C C   . GLN A 1 259 ? 58.377 56.432 9.754   1.00 27.63 ? 289 GLN A C   1 
ATOM   1958 O O   . GLN A 1 259 ? 59.023 57.508 9.862   1.00 27.45 ? 289 GLN A O   1 
ATOM   1959 C CB  . GLN A 1 259 ? 56.912 55.772 11.642  1.00 26.90 ? 289 GLN A CB  1 
ATOM   1960 C CG  . GLN A 1 259 ? 55.543 55.865 12.318  1.00 27.72 ? 289 GLN A CG  1 
ATOM   1961 C CD  . GLN A 1 259 ? 55.590 55.506 13.794  1.00 25.95 ? 289 GLN A CD  1 
ATOM   1962 O OE1 . GLN A 1 259 ? 56.667 55.304 14.356  1.00 24.81 ? 289 GLN A OE1 1 
ATOM   1963 N NE2 . GLN A 1 259 ? 54.418 55.428 14.428  1.00 23.48 ? 289 GLN A NE2 1 
ATOM   1964 N N   . LEU A 1 260 ? 58.909 55.295 9.285   1.00 27.35 ? 290 LEU A N   1 
ATOM   1965 C CA  . LEU A 1 260 ? 60.319 55.245 8.879   1.00 28.21 ? 290 LEU A CA  1 
ATOM   1966 C C   . LEU A 1 260 ? 60.539 56.191 7.696   1.00 27.78 ? 290 LEU A C   1 
ATOM   1967 O O   . LEU A 1 260 ? 61.462 56.945 7.703   1.00 27.49 ? 290 LEU A O   1 
ATOM   1968 C CB  . LEU A 1 260 ? 60.758 53.818 8.496   1.00 27.52 ? 290 LEU A CB  1 
ATOM   1969 C CG  . LEU A 1 260 ? 61.214 52.930 9.645   1.00 28.35 ? 290 LEU A CG  1 
ATOM   1970 C CD1 . LEU A 1 260 ? 61.454 51.488 9.115   1.00 27.63 ? 290 LEU A CD1 1 
ATOM   1971 C CD2 . LEU A 1 260 ? 62.460 53.506 10.276  1.00 24.54 ? 290 LEU A CD2 1 
ATOM   1972 N N   . LYS A 1 261 ? 59.661 56.135 6.709   1.00 28.65 ? 291 LYS A N   1 
ATOM   1973 C CA  . LYS A 1 261 ? 59.726 56.989 5.537   1.00 29.76 ? 291 LYS A CA  1 
ATOM   1974 C C   . LYS A 1 261 ? 59.607 58.486 5.877   1.00 31.29 ? 291 LYS A C   1 
ATOM   1975 O O   . LYS A 1 261 ? 60.413 59.298 5.386   1.00 32.09 ? 291 LYS A O   1 
ATOM   1976 C CB  . LYS A 1 261 ? 58.625 56.619 4.555   1.00 29.09 ? 291 LYS A CB  1 
ATOM   1977 C CG  . LYS A 1 261 ? 58.821 57.279 3.219   1.00 31.09 ? 291 LYS A CG  1 
ATOM   1978 C CD  . LYS A 1 261 ? 57.850 56.838 2.185   1.00 32.81 ? 291 LYS A CD  1 
ATOM   1979 C CE  . LYS A 1 261 ? 58.161 57.619 0.909   1.00 38.04 ? 291 LYS A CE  1 
ATOM   1980 N NZ  . LYS A 1 261 ? 57.120 57.397 -0.115  1.00 41.43 ? 291 LYS A NZ  1 
ATOM   1981 N N   . ALA A 1 262 ? 58.624 58.841 6.713   1.00 30.94 ? 292 ALA A N   1 
ATOM   1982 C CA  . ALA A 1 262 ? 58.325 60.231 7.045   1.00 31.24 ? 292 ALA A CA  1 
ATOM   1983 C C   . ALA A 1 262 ? 59.293 60.806 8.068   1.00 31.81 ? 292 ALA A C   1 
ATOM   1984 O O   . ALA A 1 262 ? 59.668 61.949 7.944   1.00 32.58 ? 292 ALA A O   1 
ATOM   1985 C CB  . ALA A 1 262 ? 56.889 60.370 7.548   1.00 31.53 ? 292 ALA A CB  1 
ATOM   1986 N N   . ARG A 1 263 ? 59.739 60.024 9.054   1.00 31.75 ? 293 ARG A N   1 
ATOM   1987 C CA  . ARG A 1 263 ? 60.530 60.580 10.169  1.00 32.51 ? 293 ARG A CA  1 
ATOM   1988 C C   . ARG A 1 263 ? 61.930 59.973 10.338  1.00 31.28 ? 293 ARG A C   1 
ATOM   1989 O O   . ARG A 1 263 ? 62.710 60.422 11.197  1.00 30.85 ? 293 ARG A O   1 
ATOM   1990 C CB  . ARG A 1 263 ? 59.790 60.383 11.499  1.00 32.61 ? 293 ARG A CB  1 
ATOM   1991 C CG  . ARG A 1 263 ? 58.290 60.804 11.548  1.00 36.38 ? 293 ARG A CG  1 
ATOM   1992 C CD  . ARG A 1 263 ? 57.569 60.006 12.680  1.00 38.11 ? 293 ARG A CD  1 
ATOM   1993 N NE  . ARG A 1 263 ? 56.095 60.158 12.718  1.00 47.87 ? 293 ARG A NE  1 
ATOM   1994 C CZ  . ARG A 1 263 ? 55.314 59.727 13.722  1.00 50.15 ? 293 ARG A CZ  1 
ATOM   1995 N NH1 . ARG A 1 263 ? 55.842 59.125 14.786  1.00 51.66 ? 293 ARG A NH1 1 
ATOM   1996 N NH2 . ARG A 1 263 ? 53.998 59.903 13.676  1.00 52.13 ? 293 ARG A NH2 1 
ATOM   1997 N N   . GLY A 1 264 ? 62.239 58.917 9.586   1.00 30.99 ? 294 GLY A N   1 
ATOM   1998 C CA  . GLY A 1 264 ? 63.522 58.222 9.755   1.00 30.65 ? 294 GLY A CA  1 
ATOM   1999 C C   . GLY A 1 264 ? 63.643 57.540 11.102  1.00 31.05 ? 294 GLY A C   1 
ATOM   2000 O O   . GLY A 1 264 ? 64.741 57.230 11.562  1.00 30.26 ? 294 GLY A O   1 
ATOM   2001 N N   . GLU A 1 265 ? 62.502 57.325 11.764  1.00 30.72 ? 295 GLU A N   1 
ATOM   2002 C CA  . GLU A 1 265 ? 62.486 56.552 12.987  1.00 32.14 ? 295 GLU A CA  1 
ATOM   2003 C C   . GLU A 1 265 ? 61.147 55.840 13.147  1.00 29.96 ? 295 GLU A C   1 
ATOM   2004 O O   . GLU A 1 265 ? 60.203 56.127 12.427  1.00 29.81 ? 295 GLU A O   1 
ATOM   2005 C CB  . GLU A 1 265 ? 62.911 57.358 14.225  1.00 31.82 ? 295 GLU A CB  1 
ATOM   2006 C CG  . GLU A 1 265 ? 62.049 58.526 14.620  1.00 36.24 ? 295 GLU A CG  1 
ATOM   2007 C CD  . GLU A 1 265 ? 62.451 59.069 16.006  1.00 38.17 ? 295 GLU A CD  1 
ATOM   2008 O OE1 . GLU A 1 265 ? 63.661 59.319 16.225  1.00 45.72 ? 295 GLU A OE1 1 
ATOM   2009 O OE2 . GLU A 1 265 ? 61.566 59.213 16.895  1.00 44.34 ? 295 GLU A OE2 1 
ATOM   2010 N N   . VAL A 1 266 ? 61.104 54.861 14.032  1.00 28.12 ? 296 VAL A N   1 
ATOM   2011 C CA  . VAL A 1 266 ? 59.867 54.123 14.252  1.00 27.54 ? 296 VAL A CA  1 
ATOM   2012 C C   . VAL A 1 266 ? 59.744 53.815 15.742  1.00 26.72 ? 296 VAL A C   1 
ATOM   2013 O O   . VAL A 1 266 ? 60.752 53.522 16.427  1.00 27.62 ? 296 VAL A O   1 
ATOM   2014 C CB  . VAL A 1 266 ? 59.691 52.848 13.294  1.00 27.56 ? 296 VAL A CB  1 
ATOM   2015 C CG1 . VAL A 1 266 ? 60.827 51.862 13.505  1.00 27.19 ? 296 VAL A CG1 1 
ATOM   2016 C CG2 . VAL A 1 266 ? 58.328 52.144 13.543  1.00 26.31 ? 296 VAL A CG2 1 
ATOM   2017 N N   . ASP A 1 267 ? 58.524 53.929 16.263  1.00 24.93 ? 297 ASP A N   1 
ATOM   2018 C CA  . ASP A 1 267 ? 58.288 53.498 17.634  1.00 23.48 ? 297 ASP A CA  1 
ATOM   2019 C C   . ASP A 1 267 ? 57.336 52.305 17.595  1.00 22.23 ? 297 ASP A C   1 
ATOM   2020 O O   . ASP A 1 267 ? 56.115 52.451 17.524  1.00 22.19 ? 297 ASP A O   1 
ATOM   2021 C CB  . ASP A 1 267 ? 57.779 54.656 18.502  1.00 23.35 ? 297 ASP A CB  1 
ATOM   2022 C CG  . ASP A 1 267 ? 57.499 54.255 19.930  1.00 24.19 ? 297 ASP A CG  1 
ATOM   2023 O OD1 . ASP A 1 267 ? 57.633 53.065 20.358  1.00 24.34 ? 297 ASP A OD1 1 
ATOM   2024 O OD2 . ASP A 1 267 ? 57.139 55.172 20.678  1.00 27.23 ? 297 ASP A OD2 1 
ATOM   2025 N N   . ILE A 1 268 ? 57.916 51.109 17.664  1.00 21.90 ? 298 ILE A N   1 
ATOM   2026 C CA  . ILE A 1 268 ? 57.159 49.907 17.354  1.00 21.40 ? 298 ILE A CA  1 
ATOM   2027 C C   . ILE A 1 268 ? 56.323 49.565 18.574  1.00 20.92 ? 298 ILE A C   1 
ATOM   2028 O O   . ILE A 1 268 ? 55.167 49.180 18.429  1.00 21.03 ? 298 ILE A O   1 
ATOM   2029 C CB  . ILE A 1 268 ? 58.068 48.730 16.950  1.00 21.25 ? 298 ILE A CB  1 
ATOM   2030 C CG1 . ILE A 1 268 ? 58.731 49.017 15.607  1.00 21.67 ? 298 ILE A CG1 1 
ATOM   2031 C CG2 . ILE A 1 268 ? 57.276 47.464 16.889  1.00 18.89 ? 298 ILE A CG2 1 
ATOM   2032 C CD1 . ILE A 1 268 ? 59.904 48.066 15.230  1.00 21.43 ? 298 ILE A CD1 1 
ATOM   2033 N N   . LEU A 1 269 ? 56.908 49.709 19.760  1.00 20.34 ? 299 LEU A N   1 
ATOM   2034 C CA  . LEU A 1 269 ? 56.152 49.557 20.993  1.00 21.97 ? 299 LEU A CA  1 
ATOM   2035 C C   . LEU A 1 269 ? 54.903 50.471 21.005  1.00 21.43 ? 299 LEU A C   1 
ATOM   2036 O O   . LEU A 1 269 ? 53.778 50.016 21.306  1.00 20.22 ? 299 LEU A O   1 
ATOM   2037 C CB  . LEU A 1 269 ? 57.062 49.824 22.215  1.00 21.38 ? 299 LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 269 ? 56.423 49.839 23.609  1.00 22.05 ? 299 LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 269 ? 55.705 48.501 23.905  1.00 23.22 ? 299 LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 269 ? 57.466 50.090 24.689  1.00 23.34 ? 299 LEU A CD2 1 
ATOM   2041 N N   . GLY A 1 270 ? 55.122 51.755 20.694  1.00 22.19 ? 300 GLY A N   1 
ATOM   2042 C CA  . GLY A 1 270 ? 54.041 52.741 20.612  1.00 21.27 ? 300 GLY A CA  1 
ATOM   2043 C C   . GLY A 1 270 ? 53.006 52.314 19.605  1.00 21.30 ? 300 GLY A C   1 
ATOM   2044 O O   . GLY A 1 270 ? 51.814 52.358 19.871  1.00 23.04 ? 300 GLY A O   1 
ATOM   2045 N N   . ILE A 1 271 ? 53.439 51.871 18.438  1.00 20.62 ? 301 ILE A N   1 
ATOM   2046 C CA  . ILE A 1 271 ? 52.493 51.371 17.441  1.00 20.38 ? 301 ILE A CA  1 
ATOM   2047 C C   . ILE A 1 271 ? 51.598 50.237 17.949  1.00 20.61 ? 301 ILE A C   1 
ATOM   2048 O O   . ILE A 1 271 ? 50.389 50.242 17.710  1.00 19.44 ? 301 ILE A O   1 
ATOM   2049 C CB  . ILE A 1 271 ? 53.218 50.909 16.106  1.00 19.88 ? 301 ILE A CB  1 
ATOM   2050 C CG1 . ILE A 1 271 ? 53.723 52.127 15.329  1.00 19.98 ? 301 ILE A CG1 1 
ATOM   2051 C CG2 . ILE A 1 271 ? 52.261 50.104 15.190  1.00 19.88 ? 301 ILE A CG2 1 
ATOM   2052 C CD1 . ILE A 1 271 ? 54.830 51.765 14.256  1.00 19.91 ? 301 ILE A CD1 1 
ATOM   2053 N N   . VAL A 1 272 ? 52.202 49.225 18.580  1.00 20.44 ? 302 VAL A N   1 
ATOM   2054 C CA  . VAL A 1 272 ? 51.413 48.089 19.022  1.00 20.34 ? 302 VAL A CA  1 
ATOM   2055 C C   . VAL A 1 272 ? 50.429 48.508 20.155  1.00 20.85 ? 302 VAL A C   1 
ATOM   2056 O O   . VAL A 1 272 ? 49.279 48.056 20.209  1.00 19.95 ? 302 VAL A O   1 
ATOM   2057 C CB  . VAL A 1 272 ? 52.321 46.883 19.425  1.00 20.31 ? 302 VAL A CB  1 
ATOM   2058 C CG1 . VAL A 1 272 ? 51.453 45.740 20.003  1.00 18.69 ? 302 VAL A CG1 1 
ATOM   2059 C CG2 . VAL A 1 272 ? 53.139 46.380 18.206  1.00 18.76 ? 302 VAL A CG2 1 
ATOM   2060 N N   . CYS A 1 273 ? 50.894 49.399 21.028  1.00 20.65 ? 303 CYS A N   1 
ATOM   2061 C CA  . CYS A 1 273 ? 50.067 49.958 22.080  1.00 21.35 ? 303 CYS A CA  1 
ATOM   2062 C C   . CYS A 1 273 ? 48.839 50.684 21.535  1.00 21.67 ? 303 CYS A C   1 
ATOM   2063 O O   . CYS A 1 273 ? 47.726 50.452 22.020  1.00 21.00 ? 303 CYS A O   1 
ATOM   2064 C CB  . CYS A 1 273 ? 50.901 50.929 22.951  1.00 20.49 ? 303 CYS A CB  1 
ATOM   2065 S SG  . CYS A 1 273 ? 51.999 50.074 24.106  1.00 23.28 ? 303 CYS A SG  1 
ATOM   2066 N N   . GLN A 1 274 ? 49.027 51.555 20.531  1.00 21.81 ? 304 GLN A N   1 
ATOM   2067 C CA  . GLN A 1 274 ? 47.866 52.182 19.851  1.00 22.01 ? 304 GLN A CA  1 
ATOM   2068 C C   . GLN A 1 274 ? 46.900 51.227 19.174  1.00 22.59 ? 304 GLN A C   1 
ATOM   2069 O O   . GLN A 1 274 ? 45.689 51.466 19.188  1.00 24.72 ? 304 GLN A O   1 
ATOM   2070 C CB  . GLN A 1 274 ? 48.312 53.280 18.886  1.00 21.27 ? 304 GLN A CB  1 
ATOM   2071 C CG  . GLN A 1 274 ? 49.192 54.342 19.559  1.00 21.72 ? 304 GLN A CG  1 
ATOM   2072 C CD  . GLN A 1 274 ? 48.482 55.184 20.655  1.00 24.77 ? 304 GLN A CD  1 
ATOM   2073 O OE1 . GLN A 1 274 ? 47.285 55.416 20.607  1.00 22.04 ? 304 GLN A OE1 1 
ATOM   2074 N NE2 . GLN A 1 274 ? 49.248 55.658 21.616  1.00 28.39 ? 304 GLN A NE2 1 
ATOM   2075 N N   . LEU A 1 275 ? 47.407 50.179 18.527  1.00 22.71 ? 305 LEU A N   1 
ATOM   2076 C CA  . LEU A 1 275 ? 46.545 49.158 17.943  1.00 21.67 ? 305 LEU A CA  1 
ATOM   2077 C C   . LEU A 1 275 ? 45.696 48.421 19.006  1.00 21.74 ? 305 LEU A C   1 
ATOM   2078 O O   . LEU A 1 275 ? 44.546 48.078 18.742  1.00 21.02 ? 305 LEU A O   1 
ATOM   2079 C CB  . LEU A 1 275 ? 47.357 48.120 17.132  1.00 21.55 ? 305 LEU A CB  1 
ATOM   2080 C CG  . LEU A 1 275 ? 48.127 48.617 15.894  1.00 22.25 ? 305 LEU A CG  1 
ATOM   2081 C CD1 . LEU A 1 275 ? 48.965 47.454 15.352  1.00 20.45 ? 305 LEU A CD1 1 
ATOM   2082 C CD2 . LEU A 1 275 ? 47.040 49.102 14.883  1.00 14.28 ? 305 LEU A CD2 1 
ATOM   2083 N N   . ARG A 1 276 ? 46.285 48.120 20.163  1.00 21.12 ? 306 ARG A N   1 
ATOM   2084 C CA  . ARG A 1 276 ? 45.532 47.488 21.261  1.00 21.86 ? 306 ARG A CA  1 
ATOM   2085 C C   . ARG A 1 276 ? 44.473 48.374 21.898  1.00 20.45 ? 306 ARG A C   1 
ATOM   2086 O O   . ARG A 1 276 ? 43.477 47.849 22.386  1.00 20.96 ? 306 ARG A O   1 
ATOM   2087 C CB  . ARG A 1 276 ? 46.486 46.932 22.313  1.00 21.84 ? 306 ARG A CB  1 
ATOM   2088 C CG  . ARG A 1 276 ? 47.341 45.887 21.656  1.00 23.49 ? 306 ARG A CG  1 
ATOM   2089 C CD  . ARG A 1 276 ? 47.653 44.839 22.564  1.00 22.51 ? 306 ARG A CD  1 
ATOM   2090 N NE  . ARG A 1 276 ? 48.370 43.738 21.945  1.00 24.66 ? 306 ARG A NE  1 
ATOM   2091 C CZ  . ARG A 1 276 ? 49.145 42.915 22.646  1.00 22.22 ? 306 ARG A CZ  1 
ATOM   2092 N NH1 . ARG A 1 276 ? 49.283 43.113 23.965  1.00 20.09 ? 306 ARG A NH1 1 
ATOM   2093 N NH2 . ARG A 1 276 ? 49.790 41.941 22.034  1.00 24.64 ? 306 ARG A NH2 1 
ATOM   2094 N N   . LEU A 1 277 ? 44.686 49.693 21.891  1.00 20.18 ? 307 LEU A N   1 
ATOM   2095 C CA  . LEU A 1 277 ? 43.615 50.661 22.198  1.00 21.62 ? 307 LEU A CA  1 
ATOM   2096 C C   . LEU A 1 277 ? 42.426 50.506 21.220  1.00 22.25 ? 307 LEU A C   1 
ATOM   2097 O O   . LEU A 1 277 ? 41.254 50.504 21.648  1.00 23.01 ? 307 LEU A O   1 
ATOM   2098 C CB  . LEU A 1 277 ? 44.140 52.086 22.213  1.00 20.76 ? 307 LEU A CB  1 
ATOM   2099 C CG  . LEU A 1 277 ? 45.004 52.426 23.415  1.00 21.40 ? 307 LEU A CG  1 
ATOM   2100 C CD1 . LEU A 1 277 ? 45.719 53.743 23.255  1.00 18.99 ? 307 LEU A CD1 1 
ATOM   2101 C CD2 . LEU A 1 277 ? 44.204 52.391 24.744  1.00 20.70 ? 307 LEU A CD2 1 
ATOM   2102 N N   . ASP A 1 278 ? 42.729 50.252 19.940  1.00 22.61 ? 308 ASP A N   1 
ATOM   2103 C CA  . ASP A 1 278 ? 41.696 50.124 18.883  1.00 21.88 ? 308 ASP A CA  1 
ATOM   2104 C C   . ASP A 1 278 ? 41.020 48.788 18.849  1.00 21.24 ? 308 ASP A C   1 
ATOM   2105 O O   . ASP A 1 278 ? 39.846 48.726 18.524  1.00 20.51 ? 308 ASP A O   1 
ATOM   2106 C CB  . ASP A 1 278 ? 42.249 50.450 17.475  1.00 22.21 ? 308 ASP A CB  1 
ATOM   2107 C CG  . ASP A 1 278 ? 42.897 51.830 17.390  1.00 23.69 ? 308 ASP A CG  1 
ATOM   2108 O OD1 . ASP A 1 278 ? 42.608 52.705 18.253  1.00 25.14 ? 308 ASP A OD1 1 
ATOM   2109 O OD2 . ASP A 1 278 ? 43.715 52.034 16.457  1.00 21.68 ? 308 ASP A OD2 1 
ATOM   2110 N N   . ARG A 1 279 ? 41.748 47.714 19.166  1.00 20.71 ? 309 ARG A N   1 
ATOM   2111 C CA  . ARG A 1 279 ? 41.177 46.373 19.194  1.00 20.51 ? 309 ARG A CA  1 
ATOM   2112 C C   . ARG A 1 279 ? 42.093 45.495 20.060  1.00 21.66 ? 309 ARG A C   1 
ATOM   2113 O O   . ARG A 1 279 ? 43.308 45.431 19.835  1.00 20.87 ? 309 ARG A O   1 
ATOM   2114 C CB  . ARG A 1 279 ? 41.022 45.798 17.773  1.00 21.32 ? 309 ARG A CB  1 
ATOM   2115 C CG  . ARG A 1 279 ? 40.523 44.357 17.681  1.00 20.50 ? 309 ARG A CG  1 
ATOM   2116 C CD  . ARG A 1 279 ? 40.284 43.997 16.187  1.00 18.99 ? 309 ARG A CD  1 
ATOM   2117 N NE  . ARG A 1 279 ? 39.914 42.600 15.961  1.00 17.60 ? 309 ARG A NE  1 
ATOM   2118 C CZ  . ARG A 1 279 ? 38.686 42.078 16.063  1.00 20.38 ? 309 ARG A CZ  1 
ATOM   2119 N NH1 . ARG A 1 279 ? 37.634 42.832 16.386  1.00 19.76 ? 309 ARG A NH1 1 
ATOM   2120 N NH2 . ARG A 1 279 ? 38.504 40.779 15.786  1.00 20.32 ? 309 ARG A NH2 1 
ATOM   2121 N N   . GLY A 1 280 ? 41.517 44.871 21.093  1.00 20.86 ? 310 GLY A N   1 
ATOM   2122 C CA  . GLY A 1 280 ? 42.329 44.143 22.064  1.00 20.80 ? 310 GLY A CA  1 
ATOM   2123 C C   . GLY A 1 280 ? 43.055 42.986 21.413  1.00 20.74 ? 310 GLY A C   1 
ATOM   2124 O O   . GLY A 1 280 ? 42.553 42.341 20.509  1.00 19.88 ? 310 GLY A O   1 
ATOM   2125 N N   . GLY A 1 281 ? 44.294 42.778 21.843  1.00 22.06 ? 311 GLY A N   1 
ATOM   2126 C CA  . GLY A 1 281 ? 45.075 41.628 21.428  1.00 20.62 ? 311 GLY A CA  1 
ATOM   2127 C C   . GLY A 1 281 ? 45.832 41.685 20.100  1.00 20.35 ? 311 GLY A C   1 
ATOM   2128 O O   . GLY A 1 281 ? 46.450 40.677 19.729  1.00 19.98 ? 311 GLY A O   1 
ATOM   2129 N N   . MET A 1 282 ? 45.800 42.822 19.386  1.00 20.32 ? 312 MET A N   1 
ATOM   2130 C CA  . MET A 1 282 ? 46.515 42.975 18.086  1.00 20.40 ? 312 MET A CA  1 
ATOM   2131 C C   . MET A 1 282 ? 48.005 42.609 18.242  1.00 20.26 ? 312 MET A C   1 
ATOM   2132 O O   . MET A 1 282 ? 48.676 43.140 19.130  1.00 21.55 ? 312 MET A O   1 
ATOM   2133 C CB  . MET A 1 282 ? 46.384 44.414 17.531  1.00 20.25 ? 312 MET A CB  1 
ATOM   2134 C CG  . MET A 1 282 ? 44.928 44.876 17.230  1.00 20.66 ? 312 MET A CG  1 
ATOM   2135 S SD  . MET A 1 282 ? 44.298 44.112 15.758  1.00 25.22 ? 312 MET A SD  1 
ATOM   2136 C CE  . MET A 1 282 ? 44.778 45.338 14.535  1.00 24.32 ? 312 MET A CE  1 
ATOM   2137 N N   . ILE A 1 283 ? 48.477 41.720 17.359  1.00 20.21 ? 313 ILE A N   1 
ATOM   2138 C CA  . ILE A 1 283 ? 49.808 41.050 17.417  1.00 20.46 ? 313 ILE A CA  1 
ATOM   2139 C C   . ILE A 1 283 ? 49.832 40.040 18.562  1.00 20.05 ? 313 ILE A C   1 
ATOM   2140 O O   . ILE A 1 283 ? 49.856 40.397 19.741  1.00 19.66 ? 313 ILE A O   1 
ATOM   2141 C CB  . ILE A 1 283 ? 51.036 42.011 17.455  1.00 21.36 ? 313 ILE A CB  1 
ATOM   2142 C CG1 . ILE A 1 283 ? 50.947 43.048 16.302  1.00 21.84 ? 313 ILE A CG1 1 
ATOM   2143 C CG2 . ILE A 1 283 ? 52.354 41.176 17.454  1.00 19.29 ? 313 ILE A CG2 1 
ATOM   2144 C CD1 . ILE A 1 283 ? 52.249 43.670 15.945  1.00 23.89 ? 313 ILE A CD1 1 
ATOM   2145 N N   . GLN A 1 284 ? 49.800 38.774 18.192  1.00 20.29 ? 314 GLN A N   1 
ATOM   2146 C CA  . GLN A 1 284 ? 49.610 37.739 19.179  1.00 21.45 ? 314 GLN A CA  1 
ATOM   2147 C C   . GLN A 1 284 ? 50.876 37.226 19.916  1.00 21.78 ? 314 GLN A C   1 
ATOM   2148 O O   . GLN A 1 284 ? 50.819 36.953 21.106  1.00 22.08 ? 314 GLN A O   1 
ATOM   2149 C CB  . GLN A 1 284 ? 48.824 36.592 18.532  1.00 20.88 ? 314 GLN A CB  1 
ATOM   2150 C CG  A GLN A 1 284 ? 47.301 36.922 18.469  0.50 19.49 ? 314 GLN A CG  1 
ATOM   2151 C CG  B GLN A 1 284 ? 48.605 35.429 19.441  0.50 24.42 ? 314 GLN A CG  1 
ATOM   2152 C CD  A GLN A 1 284 ? 46.457 35.788 17.893  0.50 18.79 ? 314 GLN A CD  1 
ATOM   2153 C CD  B GLN A 1 284 ? 48.419 34.124 18.696  0.50 28.40 ? 314 GLN A CD  1 
ATOM   2154 O OE1 A GLN A 1 284 ? 46.803 35.204 16.877  0.50 18.51 ? 314 GLN A OE1 1 
ATOM   2155 O OE1 B GLN A 1 284 ? 48.199 34.105 17.484  0.50 32.23 ? 314 GLN A OE1 1 
ATOM   2156 N NE2 A GLN A 1 284 ? 45.372 35.466 18.552  0.50 16.96 ? 314 GLN A NE2 1 
ATOM   2157 N NE2 B GLN A 1 284 ? 48.504 33.022 19.425  0.50 30.14 ? 314 GLN A NE2 1 
ATOM   2158 N N   . THR A 1 285 ? 52.005 37.084 19.209  1.00 21.51 ? 315 THR A N   1 
ATOM   2159 C CA  . THR A 1 285 ? 53.145 36.402 19.795  1.00 21.04 ? 315 THR A CA  1 
ATOM   2160 C C   . THR A 1 285 ? 54.380 37.288 19.810  1.00 22.02 ? 315 THR A C   1 
ATOM   2161 O O   . THR A 1 285 ? 54.517 38.192 18.969  1.00 21.91 ? 315 THR A O   1 
ATOM   2162 C CB  . THR A 1 285 ? 53.485 35.096 19.008  1.00 21.12 ? 315 THR A CB  1 
ATOM   2163 O OG1 . THR A 1 285 ? 54.088 35.440 17.763  1.00 21.02 ? 315 THR A OG1 1 
ATOM   2164 C CG2 . THR A 1 285 ? 52.211 34.233 18.732  1.00 20.58 ? 315 THR A CG2 1 
ATOM   2165 N N   . ALA A 1 286 ? 55.310 36.997 20.731  1.00 21.45 ? 316 ALA A N   1 
ATOM   2166 C CA  . ALA A 1 286 ? 56.611 37.658 20.763  1.00 20.86 ? 316 ALA A CA  1 
ATOM   2167 C C   . ALA A 1 286 ? 57.404 37.413 19.479  1.00 20.23 ? 316 ALA A C   1 
ATOM   2168 O O   . ALA A 1 286 ? 58.085 38.296 19.008  1.00 20.51 ? 316 ALA A O   1 
ATOM   2169 C CB  . ALA A 1 286 ? 57.440 37.200 22.029  1.00 20.68 ? 316 ALA A CB  1 
ATOM   2170 N N   . GLU A 1 287 ? 57.293 36.220 18.898  1.00 19.96 ? 317 GLU A N   1 
ATOM   2171 C CA  . GLU A 1 287 ? 57.895 35.971 17.611  1.00 21.31 ? 317 GLU A CA  1 
ATOM   2172 C C   . GLU A 1 287 ? 57.416 36.925 16.496  1.00 20.73 ? 317 GLU A C   1 
ATOM   2173 O O   . GLU A 1 287 ? 58.212 37.377 15.669  1.00 19.54 ? 317 GLU A O   1 
ATOM   2174 C CB  . GLU A 1 287 ? 57.681 34.502 17.194  1.00 21.12 ? 317 GLU A CB  1 
ATOM   2175 C CG  . GLU A 1 287 ? 58.435 34.146 15.972  1.00 24.28 ? 317 GLU A CG  1 
ATOM   2176 C CD  . GLU A 1 287 ? 58.090 32.772 15.404  1.00 32.88 ? 317 GLU A CD  1 
ATOM   2177 O OE1 . GLU A 1 287 ? 57.114 32.129 15.846  1.00 30.68 ? 317 GLU A OE1 1 
ATOM   2178 O OE2 . GLU A 1 287 ? 58.775 32.360 14.445  1.00 37.60 ? 317 GLU A OE2 1 
ATOM   2179 N N   . GLN A 1 288 ? 56.100 37.158 16.445  1.00 20.39 ? 318 GLN A N   1 
ATOM   2180 C CA  . GLN A 1 288 ? 55.489 38.151 15.512  1.00 19.35 ? 318 GLN A CA  1 
ATOM   2181 C C   . GLN A 1 288 ? 56.038 39.574 15.727  1.00 18.35 ? 318 GLN A C   1 
ATOM   2182 O O   . GLN A 1 288 ? 56.302 40.286 14.774  1.00 18.37 ? 318 GLN A O   1 
ATOM   2183 C CB  . GLN A 1 288 ? 53.968 38.128 15.666  1.00 17.43 ? 318 GLN A CB  1 
ATOM   2184 C CG  . GLN A 1 288 ? 53.333 36.943 14.985  1.00 17.90 ? 318 GLN A CG  1 
ATOM   2185 C CD  . GLN A 1 288 ? 51.856 36.847 15.274  1.00 19.92 ? 318 GLN A CD  1 
ATOM   2186 O OE1 . GLN A 1 288 ? 51.343 37.559 16.156  1.00 20.58 ? 318 GLN A OE1 1 
ATOM   2187 N NE2 . GLN A 1 288 ? 51.146 36.014 14.495  1.00 18.45 ? 318 GLN A NE2 1 
ATOM   2188 N N   . TYR A 1 289 ? 56.190 39.951 16.988  1.00 19.56 ? 319 TYR A N   1 
ATOM   2189 C CA  . TYR A 1 289 ? 56.728 41.245 17.432  1.00 19.83 ? 319 TYR A CA  1 
ATOM   2190 C C   . TYR A 1 289 ? 58.198 41.451 16.999  1.00 20.95 ? 319 TYR A C   1 
ATOM   2191 O O   . TYR A 1 289 ? 58.595 42.540 16.553  1.00 20.00 ? 319 TYR A O   1 
ATOM   2192 C CB  . TYR A 1 289 ? 56.620 41.322 18.953  1.00 20.46 ? 319 TYR A CB  1 
ATOM   2193 C CG  . TYR A 1 289 ? 56.869 42.713 19.519  1.00 22.24 ? 319 TYR A CG  1 
ATOM   2194 C CD1 . TYR A 1 289 ? 56.008 43.805 19.202  1.00 22.41 ? 319 TYR A CD1 1 
ATOM   2195 C CD2 . TYR A 1 289 ? 57.925 42.933 20.394  1.00 23.70 ? 319 TYR A CD2 1 
ATOM   2196 C CE1 . TYR A 1 289 ? 56.208 45.071 19.741  1.00 21.33 ? 319 TYR A CE1 1 
ATOM   2197 C CE2 . TYR A 1 289 ? 58.158 44.205 20.914  1.00 22.98 ? 319 TYR A CE2 1 
ATOM   2198 C CZ  . TYR A 1 289 ? 57.292 45.260 20.588  1.00 23.66 ? 319 TYR A CZ  1 
ATOM   2199 O OH  . TYR A 1 289 ? 57.553 46.475 21.129  1.00 22.72 ? 319 TYR A OH  1 
ATOM   2200 N N   . GLN A 1 290 ? 58.995 40.410 17.170  1.00 21.28 ? 320 GLN A N   1 
ATOM   2201 C CA  . GLN A 1 290 ? 60.391 40.361 16.669  1.00 22.43 ? 320 GLN A CA  1 
ATOM   2202 C C   . GLN A 1 290 ? 60.481 40.421 15.168  1.00 20.81 ? 320 GLN A C   1 
ATOM   2203 O O   . GLN A 1 290 ? 61.363 41.093 14.616  1.00 21.78 ? 320 GLN A O   1 
ATOM   2204 C CB  . GLN A 1 290 ? 61.090 39.091 17.165  1.00 21.52 ? 320 GLN A CB  1 
ATOM   2205 C CG  . GLN A 1 290 ? 61.412 39.228 18.664  1.00 25.73 ? 320 GLN A CG  1 
ATOM   2206 C CD  . GLN A 1 290 ? 61.780 37.895 19.346  1.00 32.13 ? 320 GLN A CD  1 
ATOM   2207 O OE1 . GLN A 1 290 ? 61.301 36.838 18.954  1.00 36.73 ? 320 GLN A OE1 1 
ATOM   2208 N NE2 . GLN A 1 290 ? 62.609 37.961 20.372  1.00 29.70 ? 320 GLN A NE2 1 
ATOM   2209 N N   . PHE A 1 291 ? 59.560 39.728 14.508  1.00 20.35 ? 321 PHE A N   1 
ATOM   2210 C CA  . PHE A 1 291 ? 59.471 39.740 13.074  1.00 20.16 ? 321 PHE A CA  1 
ATOM   2211 C C   . PHE A 1 291 ? 59.125 41.127 12.541  1.00 20.42 ? 321 PHE A C   1 
ATOM   2212 O O   . PHE A 1 291 ? 59.589 41.503 11.452  1.00 21.00 ? 321 PHE A O   1 
ATOM   2213 C CB  . PHE A 1 291 ? 58.449 38.721 12.571  1.00 19.92 ? 321 PHE A CB  1 
ATOM   2214 C CG  . PHE A 1 291 ? 58.471 38.543 11.068  1.00 20.55 ? 321 PHE A CG  1 
ATOM   2215 C CD1 . PHE A 1 291 ? 59.388 37.651 10.471  1.00 20.71 ? 321 PHE A CD1 1 
ATOM   2216 C CD2 . PHE A 1 291 ? 57.565 39.241 10.238  1.00 20.19 ? 321 PHE A CD2 1 
ATOM   2217 C CE1 . PHE A 1 291 ? 59.413 37.470 9.104   1.00 20.84 ? 321 PHE A CE1 1 
ATOM   2218 C CE2 . PHE A 1 291 ? 57.597 39.064 8.848   1.00 19.25 ? 321 PHE A CE2 1 
ATOM   2219 C CZ  . PHE A 1 291 ? 58.519 38.169 8.285   1.00 21.21 ? 321 PHE A CZ  1 
ATOM   2220 N N   . LEU A 1 292 ? 58.290 41.877 13.277  1.00 19.84 ? 322 LEU A N   1 
ATOM   2221 C CA  . LEU A 1 292 ? 58.011 43.292 12.940  1.00 19.44 ? 322 LEU A CA  1 
ATOM   2222 C C   . LEU A 1 292 ? 59.304 44.120 12.929  1.00 19.64 ? 322 LEU A C   1 
ATOM   2223 O O   . LEU A 1 292 ? 59.506 44.948 12.020  1.00 19.67 ? 322 LEU A O   1 
ATOM   2224 C CB  . LEU A 1 292 ? 57.020 43.903 13.947  1.00 19.26 ? 322 LEU A CB  1 
ATOM   2225 C CG  A LEU A 1 292 ? 55.522 43.744 14.042  0.50 21.10 ? 322 LEU A CG  1 
ATOM   2226 C CG  B LEU A 1 292 ? 56.470 45.324 13.817  0.50 17.51 ? 322 LEU A CG  1 
ATOM   2227 C CD1 A LEU A 1 292 ? 55.080 44.804 15.059  0.50 21.58 ? 322 LEU A CD1 1 
ATOM   2228 C CD1 B LEU A 1 292 ? 55.881 45.545 12.470  0.50 11.74 ? 322 LEU A CD1 1 
ATOM   2229 C CD2 A LEU A 1 292 ? 54.811 44.005 12.715  0.50 25.61 ? 322 LEU A CD2 1 
ATOM   2230 C CD2 B LEU A 1 292 ? 55.376 45.506 14.871  0.50 17.84 ? 322 LEU A CD2 1 
ATOM   2231 N N   . HIS A 1 293 ? 60.188 43.901 13.915  1.00 20.16 ? 323 HIS A N   1 
ATOM   2232 C CA  . HIS A 1 293 ? 61.507 44.569 13.914  1.00 19.93 ? 323 HIS A CA  1 
ATOM   2233 C C   . HIS A 1 293 ? 62.369 44.193 12.711  1.00 21.17 ? 323 HIS A C   1 
ATOM   2234 O O   . HIS A 1 293 ? 62.953 45.065 12.058  1.00 21.52 ? 323 HIS A O   1 
ATOM   2235 C CB  . HIS A 1 293 ? 62.271 44.344 15.235  1.00 19.84 ? 323 HIS A CB  1 
ATOM   2236 C CG  . HIS A 1 293 ? 61.620 45.006 16.415  1.00 21.70 ? 323 HIS A CG  1 
ATOM   2237 N ND1 . HIS A 1 293 ? 60.408 44.588 16.936  1.00 21.00 ? 323 HIS A ND1 1 
ATOM   2238 C CD2 . HIS A 1 293 ? 61.998 46.077 17.154  1.00 20.70 ? 323 HIS A CD2 1 
ATOM   2239 C CE1 . HIS A 1 293 ? 60.081 45.368 17.954  1.00 21.97 ? 323 HIS A CE1 1 
ATOM   2240 N NE2 . HIS A 1 293 ? 61.032 46.276 18.110  1.00 23.59 ? 323 HIS A NE2 1 
ATOM   2241 N N   . HIS A 1 294 ? 62.440 42.896 12.422  1.00 20.76 ? 324 HIS A N   1 
ATOM   2242 C CA  . HIS A 1 294 ? 63.117 42.380 11.268  1.00 20.79 ? 324 HIS A CA  1 
ATOM   2243 C C   . HIS A 1 294 ? 62.613 43.000 9.956   1.00 21.03 ? 324 HIS A C   1 
ATOM   2244 O O   . HIS A 1 294 ? 63.418 43.425 9.120   1.00 21.16 ? 324 HIS A O   1 
ATOM   2245 C CB  . HIS A 1 294 ? 63.030 40.850 11.260  1.00 20.71 ? 324 HIS A CB  1 
ATOM   2246 C CG  . HIS A 1 294 ? 63.534 40.236 9.986   1.00 25.44 ? 324 HIS A CG  1 
ATOM   2247 N ND1 . HIS A 1 294 ? 64.857 39.887 9.796   1.00 24.98 ? 324 HIS A ND1 1 
ATOM   2248 C CD2 . HIS A 1 294 ? 62.892 39.938 8.825   1.00 25.05 ? 324 HIS A CD2 1 
ATOM   2249 C CE1 . HIS A 1 294 ? 65.002 39.376 8.584   1.00 27.43 ? 324 HIS A CE1 1 
ATOM   2250 N NE2 . HIS A 1 294 ? 63.825 39.405 7.972   1.00 26.38 ? 324 HIS A NE2 1 
ATOM   2251 N N   . THR A 1 295 ? 61.293 43.033 9.783   1.00 19.72 ? 325 THR A N   1 
ATOM   2252 C CA  . THR A 1 295 ? 60.657 43.521 8.587   1.00 19.80 ? 325 THR A CA  1 
ATOM   2253 C C   . THR A 1 295 ? 61.004 45.008 8.379   1.00 20.74 ? 325 THR A C   1 
ATOM   2254 O O   . THR A 1 295 ? 61.325 45.444 7.268   1.00 19.83 ? 325 THR A O   1 
ATOM   2255 C CB  . THR A 1 295 ? 59.114 43.353 8.684   1.00 20.08 ? 325 THR A CB  1 
ATOM   2256 O OG1 . THR A 1 295 ? 58.817 41.951 8.828   1.00 19.84 ? 325 THR A OG1 1 
ATOM   2257 C CG2 . THR A 1 295 ? 58.376 43.920 7.412   1.00 16.03 ? 325 THR A CG2 1 
ATOM   2258 N N   . LEU A 1 296 ? 60.945 45.768 9.464   1.00 21.04 ? 326 LEU A N   1 
ATOM   2259 C CA  . LEU A 1 296 ? 61.105 47.201 9.368   1.00 22.08 ? 326 LEU A CA  1 
ATOM   2260 C C   . LEU A 1 296 ? 62.578 47.546 9.141   1.00 22.22 ? 326 LEU A C   1 
ATOM   2261 O O   . LEU A 1 296 ? 62.866 48.499 8.432   1.00 21.82 ? 326 LEU A O   1 
ATOM   2262 C CB  . LEU A 1 296 ? 60.502 47.895 10.609  1.00 21.04 ? 326 LEU A CB  1 
ATOM   2263 C CG  . LEU A 1 296 ? 58.959 47.878 10.628  1.00 23.68 ? 326 LEU A CG  1 
ATOM   2264 C CD1 . LEU A 1 296 ? 58.360 48.333 11.979  1.00 19.97 ? 326 LEU A CD1 1 
ATOM   2265 C CD2 . LEU A 1 296 ? 58.295 48.624 9.467   1.00 23.11 ? 326 LEU A CD2 1 
ATOM   2266 N N   . ALA A 1 297 ? 63.495 46.780 9.762   1.00 22.38 ? 327 ALA A N   1 
ATOM   2267 C CA  . ALA A 1 297 ? 64.927 46.866 9.427   1.00 22.98 ? 327 ALA A CA  1 
ATOM   2268 C C   . ALA A 1 297 ? 65.189 46.677 7.931   1.00 24.33 ? 327 ALA A C   1 
ATOM   2269 O O   . ALA A 1 297 ? 65.960 47.465 7.340   1.00 24.53 ? 327 ALA A O   1 
ATOM   2270 C CB  . ALA A 1 297 ? 65.735 45.900 10.222  1.00 22.53 ? 327 ALA A CB  1 
ATOM   2271 N N   . LEU A 1 298 ? 64.573 45.658 7.317   1.00 24.42 ? 328 LEU A N   1 
ATOM   2272 C CA  . LEU A 1 298 ? 64.644 45.486 5.857   1.00 25.68 ? 328 LEU A CA  1 
ATOM   2273 C C   . LEU A 1 298 ? 64.076 46.683 5.061   1.00 26.03 ? 328 LEU A C   1 
ATOM   2274 O O   . LEU A 1 298 ? 64.680 47.130 4.064   1.00 26.90 ? 328 LEU A O   1 
ATOM   2275 C CB  . LEU A 1 298 ? 63.953 44.203 5.382   1.00 24.86 ? 328 LEU A CB  1 
ATOM   2276 C CG  . LEU A 1 298 ? 64.677 42.931 5.838   1.00 30.14 ? 328 LEU A CG  1 
ATOM   2277 C CD1 . LEU A 1 298 ? 63.810 41.718 5.529   1.00 32.49 ? 328 LEU A CD1 1 
ATOM   2278 C CD2 . LEU A 1 298 ? 66.029 42.782 5.156   1.00 29.81 ? 328 LEU A CD2 1 
ATOM   2279 N N   . TYR A 1 299 ? 62.921 47.192 5.480   1.00 25.34 ? 329 TYR A N   1 
ATOM   2280 C CA  . TYR A 1 299 ? 62.318 48.342 4.777   1.00 25.39 ? 329 TYR A CA  1 
ATOM   2281 C C   . TYR A 1 299 ? 63.218 49.588 4.880   1.00 25.83 ? 329 TYR A C   1 
ATOM   2282 O O   . TYR A 1 299 ? 63.346 50.363 3.920   1.00 25.66 ? 329 TYR A O   1 
ATOM   2283 C CB  . TYR A 1 299 ? 60.930 48.651 5.359   1.00 24.31 ? 329 TYR A CB  1 
ATOM   2284 C CG  . TYR A 1 299 ? 60.262 49.832 4.700   1.00 23.82 ? 329 TYR A CG  1 
ATOM   2285 C CD1 . TYR A 1 299 ? 59.652 49.693 3.454   1.00 24.26 ? 329 TYR A CD1 1 
ATOM   2286 C CD2 . TYR A 1 299 ? 60.243 51.078 5.318   1.00 21.22 ? 329 TYR A CD2 1 
ATOM   2287 C CE1 . TYR A 1 299 ? 59.024 50.774 2.837   1.00 24.92 ? 329 TYR A CE1 1 
ATOM   2288 C CE2 . TYR A 1 299 ? 59.595 52.180 4.719   1.00 23.12 ? 329 TYR A CE2 1 
ATOM   2289 C CZ  . TYR A 1 299 ? 59.015 52.022 3.497   1.00 22.80 ? 329 TYR A CZ  1 
ATOM   2290 O OH  . TYR A 1 299 ? 58.405 53.089 2.894   1.00 27.44 ? 329 TYR A OH  1 
ATOM   2291 N N   . ALA A 1 300 ? 63.845 49.760 6.038   1.00 26.12 ? 330 ALA A N   1 
ATOM   2292 C CA  . ALA A 1 300 ? 64.742 50.892 6.279   1.00 28.84 ? 330 ALA A CA  1 
ATOM   2293 C C   . ALA A 1 300 ? 65.856 51.030 5.183   1.00 29.81 ? 330 ALA A C   1 
ATOM   2294 O O   . ALA A 1 300 ? 66.196 52.145 4.733   1.00 30.82 ? 330 ALA A O   1 
ATOM   2295 C CB  . ALA A 1 300 ? 65.353 50.795 7.721   1.00 27.34 ? 330 ALA A CB  1 
ATOM   2296 N N   . GLY A 1 301 ? 66.385 49.890 4.737   1.00 31.06 ? 331 GLY A N   1 
ATOM   2297 C CA  . GLY A 1 301 ? 67.455 49.855 3.736   1.00 31.77 ? 331 GLY A CA  1 
ATOM   2298 C C   . GLY A 1 301 ? 66.971 50.192 2.349   1.00 32.78 ? 331 GLY A C   1 
ATOM   2299 O O   . GLY A 1 301 ? 67.761 50.530 1.490   1.00 32.98 ? 331 GLY A O   1 
ATOM   2300 N N   . GLN A 1 302 ? 65.668 50.129 2.117   1.00 33.87 ? 332 GLN A N   1 
ATOM   2301 C CA  . GLN A 1 302 ? 65.130 50.554 0.838   1.00 36.62 ? 332 GLN A CA  1 
ATOM   2302 C C   . GLN A 1 302 ? 64.989 52.067 0.779   1.00 35.94 ? 332 GLN A C   1 
ATOM   2303 O O   . GLN A 1 302 ? 64.775 52.617 -0.290  1.00 35.43 ? 332 GLN A O   1 
ATOM   2304 C CB  . GLN A 1 302 ? 63.755 49.945 0.549   1.00 36.55 ? 332 GLN A CB  1 
ATOM   2305 C CG  . GLN A 1 302 ? 63.664 48.432 0.602   1.00 40.93 ? 332 GLN A CG  1 
ATOM   2306 C CD  . GLN A 1 302 ? 62.204 47.961 0.599   1.00 40.96 ? 332 GLN A CD  1 
ATOM   2307 O OE1 . GLN A 1 302 ? 61.279 48.761 0.440   1.00 46.57 ? 332 GLN A OE1 1 
ATOM   2308 N NE2 . GLN A 1 302 ? 61.999 46.671 0.779   1.00 48.32 ? 332 GLN A NE2 1 
ATOM   2309 N N   . LEU A 1 303 ? 65.082 52.736 1.930   1.00 36.90 ? 333 LEU A N   1 
ATOM   2310 C CA  . LEU A 1 303 ? 64.777 54.152 1.980   1.00 37.47 ? 333 LEU A CA  1 
ATOM   2311 C C   . LEU A 1 303 ? 65.945 54.978 1.514   1.00 40.32 ? 333 LEU A C   1 
ATOM   2312 O O   . LEU A 1 303 ? 67.108 54.721 1.909   1.00 39.55 ? 333 LEU A O   1 
ATOM   2313 C CB  . LEU A 1 303 ? 64.366 54.611 3.384   1.00 36.44 ? 333 LEU A CB  1 
ATOM   2314 C CG  . LEU A 1 303 ? 63.001 54.159 3.877   1.00 34.19 ? 333 LEU A CG  1 
ATOM   2315 C CD1 . LEU A 1 303 ? 62.848 54.613 5.313   1.00 32.82 ? 333 LEU A CD1 1 
ATOM   2316 C CD2 . LEU A 1 303 ? 61.913 54.685 2.975   1.00 30.02 ? 333 LEU A CD2 1 
ATOM   2317 N N   . PRO A 1 304 ? 65.630 56.014 0.712   1.00 43.17 ? 334 PRO A N   1 
ATOM   2318 C CA  . PRO A 1 304 ? 66.641 56.955 0.317   1.00 45.61 ? 334 PRO A CA  1 
ATOM   2319 C C   . PRO A 1 304 ? 67.397 57.537 1.490   1.00 48.22 ? 334 PRO A C   1 
ATOM   2320 O O   . PRO A 1 304 ? 66.880 57.720 2.603   1.00 48.11 ? 334 PRO A O   1 
ATOM   2321 C CB  . PRO A 1 304 ? 65.868 58.082 -0.369  1.00 45.33 ? 334 PRO A CB  1 
ATOM   2322 C CG  . PRO A 1 304 ? 64.564 57.542 -0.694  1.00 44.92 ? 334 PRO A CG  1 
ATOM   2323 C CD  . PRO A 1 304 ? 64.302 56.353 0.170   1.00 43.44 ? 334 PRO A CD  1 
ATOM   2324 N N   . GLU A 1 305 ? 68.687 57.549 1.218   1.00 50.55 ? 335 GLU A N   1 
ATOM   2325 C CA  A GLU A 1 305 ? 69.628 58.502 1.863   0.50 51.79 ? 335 GLU A CA  1 
ATOM   2326 C CA  B GLU A 1 305 ? 69.636 58.577 1.562   0.50 51.09 ? 335 GLU A CA  1 
ATOM   2327 C C   . GLU A 1 305 ? 69.013 59.907 1.991   1.00 52.03 ? 335 GLU A C   1 
ATOM   2328 O O   . GLU A 1 305 ? 69.669 60.957 1.822   1.00 52.93 ? 335 GLU A O   1 
ATOM   2329 C CB  A GLU A 1 305 ? 70.932 58.565 1.023   0.50 52.21 ? 335 GLU A CB  1 
ATOM   2330 C CB  B GLU A 1 305 ? 70.493 58.758 0.291   0.50 51.07 ? 335 GLU A CB  1 
ATOM   2331 C CG  A GLU A 1 305 ? 71.246 57.234 0.346   0.50 53.22 ? 335 GLU A CG  1 
ATOM   2332 C CG  B GLU A 1 305 ? 71.040 57.409 -0.234  0.50 49.25 ? 335 GLU A CG  1 
ATOM   2333 C CD  A GLU A 1 305 ? 71.297 56.074 1.344   0.50 54.40 ? 335 GLU A CD  1 
ATOM   2334 C CD  B GLU A 1 305 ? 70.535 56.999 -1.609  0.50 46.26 ? 335 GLU A CD  1 
ATOM   2335 O OE1 A GLU A 1 305 ? 71.875 56.251 2.454   0.50 54.88 ? 335 GLU A OE1 1 
ATOM   2336 O OE1 B GLU A 1 305 ? 69.933 57.822 -2.311  0.50 47.66 ? 335 GLU A OE1 1 
ATOM   2337 O OE2 A GLU A 1 305 ? 70.737 54.996 1.015   0.50 55.78 ? 335 GLU A OE2 1 
ATOM   2338 O OE2 B GLU A 1 305 ? 70.737 55.837 -1.997  0.50 43.83 ? 335 GLU A OE2 1 
HETATM 2339 P P   . PO4 B 2 .   ? 44.836 35.476 14.022  1.00 24.11 ? 436 PO4 A P   1 
HETATM 2340 O O1  . PO4 B 2 .   ? 45.022 34.306 14.927  1.00 22.42 ? 436 PO4 A O1  1 
HETATM 2341 O O2  . PO4 B 2 .   ? 43.854 35.097 12.997  1.00 22.42 ? 436 PO4 A O2  1 
HETATM 2342 O O3  . PO4 B 2 .   ? 46.142 35.738 13.291  1.00 22.55 ? 436 PO4 A O3  1 
HETATM 2343 O O4  . PO4 B 2 .   ? 44.350 36.655 14.788  1.00 21.07 ? 436 PO4 A O4  1 
HETATM 2344 C C1  . GOL C 3 .   ? 36.641 56.504 15.570  1.00 40.76 ? 437 GOL A C1  1 
HETATM 2345 O O1  . GOL C 3 .   ? 37.977 56.783 15.913  1.00 42.28 ? 437 GOL A O1  1 
HETATM 2346 C C2  . GOL C 3 .   ? 36.124 55.156 16.094  1.00 41.98 ? 437 GOL A C2  1 
HETATM 2347 O O2  . GOL C 3 .   ? 37.118 54.420 16.786  1.00 40.34 ? 437 GOL A O2  1 
HETATM 2348 C C3  . GOL C 3 .   ? 34.876 55.393 16.961  1.00 42.07 ? 437 GOL A C3  1 
HETATM 2349 O O3  . GOL C 3 .   ? 33.905 54.403 16.718  1.00 42.88 ? 437 GOL A O3  1 
HETATM 2350 O O   . HOH D 4 .   ? 49.263 52.015 15.797  1.00 22.06 ? 438 HOH A O   1 
HETATM 2351 O O   . HOH D 4 .   ? 48.380 35.086 14.650  1.00 20.75 ? 439 HOH A O   1 
HETATM 2352 O O   . HOH D 4 .   ? 29.707 45.461 15.977  1.00 27.60 ? 440 HOH A O   1 
HETATM 2353 O O   . HOH D 4 .   ? 60.394 36.269 14.474  1.00 30.64 ? 441 HOH A O   1 
HETATM 2354 O O   . HOH D 4 .   ? 30.664 38.981 13.118  1.00 22.11 ? 442 HOH A O   1 
HETATM 2355 O O   . HOH D 4 .   ? 61.122 48.085 20.258  1.00 26.17 ? 443 HOH A O   1 
HETATM 2356 O O   . HOH D 4 .   ? 59.804 50.295 19.580  1.00 22.42 ? 444 HOH A O   1 
HETATM 2357 O O   . HOH D 4 .   ? 46.328 52.602 15.706  1.00 22.87 ? 445 HOH A O   1 
HETATM 2358 O O   . HOH D 4 .   ? 41.956 38.039 -3.998  1.00 24.76 ? 446 HOH A O   1 
HETATM 2359 O O   . HOH D 4 .   ? 39.574 55.022 14.162  1.00 22.82 ? 447 HOH A O   1 
HETATM 2360 O O   . HOH D 4 .   ? 54.330 35.125 22.685  1.00 23.74 ? 448 HOH A O   1 
HETATM 2361 O O   . HOH D 4 .   ? 38.984 50.849 1.535   1.00 24.60 ? 449 HOH A O   1 
HETATM 2362 O O   . HOH D 4 .   ? 47.467 55.155 15.482  1.00 23.74 ? 450 HOH A O   1 
HETATM 2363 O O   . HOH D 4 .   ? 62.811 44.865 27.319  1.00 34.08 ? 451 HOH A O   1 
HETATM 2364 O O   . HOH D 4 .   ? 32.225 38.320 10.918  1.00 26.52 ? 452 HOH A O   1 
HETATM 2365 O O   . HOH D 4 .   ? 48.337 53.804 8.398   1.00 23.42 ? 453 HOH A O   1 
HETATM 2366 O O   . HOH D 4 .   ? 31.479 49.791 -0.637  1.00 22.95 ? 454 HOH A O   1 
HETATM 2367 O O   . HOH D 4 .   ? 41.875 54.214 4.760   1.00 25.29 ? 455 HOH A O   1 
HETATM 2368 O O   . HOH D 4 .   ? 63.872 35.164 21.016  1.00 25.69 ? 456 HOH A O   1 
HETATM 2369 O O   . HOH D 4 .   ? 37.970 56.219 6.661   1.00 23.71 ? 457 HOH A O   1 
HETATM 2370 O O   . HOH D 4 .   ? 51.824 56.440 14.001  1.00 24.73 ? 458 HOH A O   1 
HETATM 2371 O O   . HOH D 4 .   ? 51.749 54.656 23.682  1.00 26.62 ? 459 HOH A O   1 
HETATM 2372 O O   . HOH D 4 .   ? 27.475 53.941 2.038   1.00 31.76 ? 460 HOH A O   1 
HETATM 2373 O O   . HOH D 4 .   ? 35.787 35.970 17.803  1.00 29.24 ? 461 HOH A O   1 
HETATM 2374 O O   . HOH D 4 .   ? 30.007 52.215 13.439  1.00 25.64 ? 462 HOH A O   1 
HETATM 2375 O O   . HOH D 4 .   ? 46.117 57.204 22.358  1.00 25.31 ? 463 HOH A O   1 
HETATM 2376 O O   . HOH D 4 .   ? 54.620 33.265 16.416  1.00 32.01 ? 464 HOH A O   1 
HETATM 2377 O O   . HOH D 4 .   ? 39.745 53.230 16.284  1.00 24.07 ? 465 HOH A O   1 
HETATM 2378 O O   . HOH D 4 .   ? 54.428 55.018 17.506  1.00 31.53 ? 466 HOH A O   1 
HETATM 2379 O O   . HOH D 4 .   ? 40.460 51.106 24.357  1.00 25.80 ? 467 HOH A O   1 
HETATM 2380 O O   . HOH D 4 .   ? 44.089 44.325 29.384  1.00 28.44 ? 468 HOH A O   1 
HETATM 2381 O O   . HOH D 4 .   ? 55.042 57.979 5.065   1.00 32.00 ? 469 HOH A O   1 
HETATM 2382 O O   . HOH D 4 .   ? 46.375 42.380 30.049  1.00 33.62 ? 470 HOH A O   1 
HETATM 2383 O O   . HOH D 4 .   ? 24.060 56.738 -6.221  1.00 30.24 ? 471 HOH A O   1 
HETATM 2384 O O   . HOH D 4 .   ? 56.702 31.625 12.426  1.00 29.69 ? 472 HOH A O   1 
HETATM 2385 O O   . HOH D 4 .   ? 40.226 35.141 6.829   1.00 24.60 ? 473 HOH A O   1 
HETATM 2386 O O   . HOH D 4 .   ? 36.252 33.517 6.763   1.00 43.99 ? 474 HOH A O   1 
HETATM 2387 O O   . HOH D 4 .   ? 40.084 56.739 29.882  1.00 30.06 ? 475 HOH A O   1 
HETATM 2388 O O   . HOH D 4 .   ? 69.211 56.867 11.737  1.00 36.54 ? 476 HOH A O   1 
HETATM 2389 O O   . HOH D 4 .   ? 33.867 39.820 9.552   1.00 23.21 ? 477 HOH A O   1 
HETATM 2390 O O   . HOH D 4 .   ? 51.489 41.042 24.868  1.00 38.67 ? 478 HOH A O   1 
HETATM 2391 O O   . HOH D 4 .   ? 60.366 34.705 21.316  1.00 33.48 ? 479 HOH A O   1 
HETATM 2392 O O   . HOH D 4 .   ? 41.583 61.697 12.091  1.00 30.83 ? 480 HOH A O   1 
HETATM 2393 O O   . HOH D 4 .   ? 54.172 45.080 -4.619  1.00 36.26 ? 481 HOH A O   1 
HETATM 2394 O O   . HOH D 4 .   ? 59.591 33.941 1.284   1.00 31.42 ? 482 HOH A O   1 
HETATM 2395 O O   . HOH D 4 .   ? 28.198 39.781 12.135  1.00 27.71 ? 483 HOH A O   1 
HETATM 2396 O O   . HOH D 4 .   ? 68.755 37.934 23.517  1.00 28.43 ? 484 HOH A O   1 
HETATM 2397 O O   . HOH D 4 .   ? 56.218 42.418 10.176  1.00 21.08 ? 485 HOH A O   1 
HETATM 2398 O O   . HOH D 4 .   ? 63.998 35.114 32.682  1.00 35.68 ? 486 HOH A O   1 
HETATM 2399 O O   . HOH D 4 .   ? 25.099 37.667 7.709   1.00 39.50 ? 487 HOH A O   1 
HETATM 2400 O O   . HOH D 4 .   ? 51.626 55.637 3.034   1.00 38.30 ? 488 HOH A O   1 
HETATM 2401 O O   . HOH D 4 .   ? 40.337 53.687 19.144  1.00 28.88 ? 489 HOH A O   1 
HETATM 2402 O O   . HOH D 4 .   ? 54.312 38.056 11.769  1.00 31.64 ? 490 HOH A O   1 
HETATM 2403 O O   . HOH D 4 .   ? 22.296 47.442 5.563   1.00 41.40 ? 491 HOH A O   1 
HETATM 2404 O O   . HOH D 4 .   ? 63.923 40.812 15.387  1.00 28.84 ? 492 HOH A O   1 
HETATM 2405 O O   . HOH D 4 .   ? 28.312 44.168 -8.731  1.00 26.18 ? 493 HOH A O   1 
HETATM 2406 O O   . HOH D 4 .   ? 29.912 55.177 -6.095  1.00 37.49 ? 494 HOH A O   1 
HETATM 2407 O O   . HOH D 4 .   ? 45.722 54.539 3.762   1.00 28.39 ? 495 HOH A O   1 
HETATM 2408 O O   . HOH D 4 .   ? 56.436 33.710 20.298  1.00 27.63 ? 496 HOH A O   1 
HETATM 2409 O O   . HOH D 4 .   ? 46.899 38.677 21.455  1.00 24.08 ? 497 HOH A O   1 
HETATM 2410 O O   . HOH D 4 .   ? 50.162 51.746 33.824  1.00 48.85 ? 498 HOH A O   1 
HETATM 2411 O O   . HOH D 4 .   ? 55.696 53.977 3.774   1.00 31.91 ? 499 HOH A O   1 
HETATM 2412 O O   . HOH D 4 .   ? 57.836 52.967 27.610  1.00 40.53 ? 500 HOH A O   1 
HETATM 2413 O O   . HOH D 4 .   ? 38.533 50.764 21.344  1.00 24.86 ? 501 HOH A O   1 
HETATM 2414 O O   . HOH D 4 .   ? 66.621 41.732 18.063  1.00 26.90 ? 502 HOH A O   1 
HETATM 2415 O O   . HOH D 4 .   ? 39.842 41.545 20.818  1.00 25.05 ? 503 HOH A O   1 
HETATM 2416 O O   . HOH D 4 .   ? 65.781 44.974 13.944  1.00 39.76 ? 504 HOH A O   1 
HETATM 2417 O O   . HOH D 4 .   ? 36.253 59.266 12.561  1.00 33.68 ? 505 HOH A O   1 
HETATM 2418 O O   . HOH D 4 .   ? 59.936 34.356 12.765  1.00 38.17 ? 506 HOH A O   1 
HETATM 2419 O O   . HOH D 4 .   ? 39.848 50.052 -5.034  1.00 38.78 ? 507 HOH A O   1 
HETATM 2420 O O   . HOH D 4 .   ? 29.651 32.850 -9.284  1.00 45.79 ? 508 HOH A O   1 
HETATM 2421 O O   . HOH D 4 .   ? 25.401 35.388 5.905   1.00 38.78 ? 509 HOH A O   1 
HETATM 2422 O O   . HOH D 4 .   ? 70.834 51.304 4.596   1.00 36.54 ? 510 HOH A O   1 
HETATM 2423 O O   . HOH D 4 .   ? 44.620 57.195 30.673  1.00 30.31 ? 511 HOH A O   1 
HETATM 2424 O O   . HOH D 4 .   ? 33.765 52.590 -7.418  1.00 39.81 ? 512 HOH A O   1 
HETATM 2425 O O   . HOH D 4 .   ? 54.767 55.813 21.885  1.00 25.07 ? 513 HOH A O   1 
HETATM 2426 O O   . HOH D 4 .   ? 68.278 46.824 5.191   1.00 39.38 ? 514 HOH A O   1 
HETATM 2427 O O   . HOH D 4 .   ? 56.678 48.096 1.132   1.00 30.34 ? 515 HOH A O   1 
HETATM 2428 O O   . HOH D 4 .   ? 36.922 46.441 -9.238  1.00 35.73 ? 516 HOH A O   1 
HETATM 2429 O O   . HOH D 4 .   ? 32.226 52.613 17.160  1.00 30.69 ? 517 HOH A O   1 
HETATM 2430 O O   . HOH D 4 .   ? 42.672 33.862 7.960   1.00 23.99 ? 518 HOH A O   1 
HETATM 2431 O O   . HOH D 4 .   ? 16.540 48.685 8.215   1.00 36.39 ? 519 HOH A O   1 
HETATM 2432 O O   . HOH D 4 .   ? 29.239 54.104 -8.846  1.00 39.99 ? 520 HOH A O   1 
HETATM 2433 O O   . HOH D 4 .   ? 29.803 49.834 21.315  1.00 40.36 ? 521 HOH A O   1 
HETATM 2434 O O   . HOH D 4 .   ? 67.053 54.605 18.676  1.00 36.44 ? 522 HOH A O   1 
HETATM 2435 O O   . HOH D 4 .   ? 25.434 55.460 -1.360  1.00 40.71 ? 523 HOH A O   1 
HETATM 2436 O O   . HOH D 4 .   ? 24.560 41.036 13.071  1.00 40.37 ? 524 HOH A O   1 
HETATM 2437 O O   . HOH D 4 .   ? 47.263 39.903 23.808  1.00 45.52 ? 525 HOH A O   1 
HETATM 2438 O O   . HOH D 4 .   ? 52.709 46.055 31.801  1.00 41.36 ? 526 HOH A O   1 
HETATM 2439 O O   . HOH D 4 .   ? 52.012 55.180 17.621  1.00 23.17 ? 527 HOH A O   1 
HETATM 2440 O O   . HOH D 4 .   ? 32.735 55.449 19.833  1.00 34.09 ? 528 HOH A O   1 
HETATM 2441 O O   . HOH D 4 .   ? 53.497 30.048 17.348  1.00 39.29 ? 529 HOH A O   1 
HETATM 2442 O O   . HOH D 4 .   ? 34.248 60.179 -0.459  1.00 43.54 ? 530 HOH A O   1 
HETATM 2443 O O   . HOH D 4 .   ? 33.830 50.495 -2.853  1.00 34.76 ? 531 HOH A O   1 
HETATM 2444 O O   . HOH D 4 .   ? 66.573 40.225 11.941  1.00 27.30 ? 532 HOH A O   1 
HETATM 2445 O O   . HOH D 4 .   ? 28.146 55.483 5.980   1.00 38.39 ? 533 HOH A O   1 
HETATM 2446 O O   . HOH D 4 .   ? 62.377 35.383 16.107  1.00 41.40 ? 534 HOH A O   1 
HETATM 2447 O O   . HOH D 4 .   ? 61.581 37.305 -1.290  1.00 32.38 ? 535 HOH A O   1 
HETATM 2448 O O   . HOH D 4 .   ? 38.266 40.194 23.795  1.00 32.07 ? 536 HOH A O   1 
HETATM 2449 O O   . HOH D 4 .   ? 58.193 41.277 30.639  1.00 47.69 ? 537 HOH A O   1 
HETATM 2450 O O   . HOH D 4 .   ? 73.514 51.227 8.430   1.00 53.41 ? 538 HOH A O   1 
HETATM 2451 O O   . HOH D 4 .   ? 50.382 54.416 15.844  1.00 23.34 ? 539 HOH A O   1 
HETATM 2452 O O   . HOH D 4 .   ? 47.489 56.335 7.301   1.00 16.51 ? 540 HOH A O   1 
HETATM 2453 O O   . HOH D 4 .   ? 64.800 39.702 17.609  1.00 33.89 ? 541 HOH A O   1 
HETATM 2454 O O   . HOH D 4 .   ? 42.331 56.672 5.249   1.00 27.51 ? 542 HOH A O   1 
HETATM 2455 O O   . HOH D 4 .   ? 38.618 49.361 25.216  1.00 34.54 ? 543 HOH A O   1 
HETATM 2456 O O   . HOH D 4 .   ? 38.754 53.441 21.313  1.00 28.63 ? 544 HOH A O   1 
HETATM 2457 O O   . HOH D 4 .   ? 54.296 56.271 3.317   1.00 27.64 ? 545 HOH A O   1 
HETATM 2458 O O   . HOH D 4 .   ? 45.535 36.217 21.442  1.00 36.64 ? 546 HOH A O   1 
HETATM 2459 O O   . HOH D 4 .   ? 39.961 53.386 1.165   1.00 36.02 ? 547 HOH A O   1 
HETATM 2460 O O   . HOH D 4 .   ? 55.105 57.411 18.223  1.00 37.02 ? 548 HOH A O   1 
HETATM 2461 O O   . HOH D 4 .   ? 41.114 59.615 17.694  1.00 39.84 ? 549 HOH A O   1 
HETATM 2462 O O   . HOH D 4 .   ? 37.743 34.586 4.929   1.00 41.11 ? 550 HOH A O   1 
HETATM 2463 O O   . HOH D 4 .   ? 60.596 43.590 -0.559  1.00 41.86 ? 551 HOH A O   1 
HETATM 2464 O O   . HOH D 4 .   ? 62.750 43.155 0.840   1.00 47.65 ? 552 HOH A O   1 
HETATM 2465 O O   . HOH D 4 .   ? 52.289 55.643 20.622  1.00 32.67 ? 553 HOH A O   1 
HETATM 2466 O O   . HOH D 4 .   ? 56.393 60.265 3.984   1.00 49.35 ? 554 HOH A O   1 
HETATM 2467 O O   . HOH D 4 .   ? 15.231 52.419 -6.721  1.00 26.36 ? 555 HOH A O   1 
HETATM 2468 O O   . HOH D 4 .   ? 23.971 51.362 7.433   1.00 40.07 ? 556 HOH A O   1 
HETATM 2469 O O   . HOH D 4 .   ? 26.312 44.326 -10.491 1.00 33.65 ? 557 HOH A O   1 
HETATM 2470 O O   . HOH D 4 .   ? 42.968 41.738 -10.496 1.00 42.97 ? 558 HOH A O   1 
HETATM 2471 O O   . HOH D 4 .   ? 52.136 34.680 0.372   1.00 40.28 ? 559 HOH A O   1 
HETATM 2472 O O   . HOH D 4 .   ? 64.695 44.087 29.244  1.00 45.41 ? 560 HOH A O   1 
HETATM 2473 O O   . HOH D 4 .   ? 32.573 55.471 9.388   1.00 33.09 ? 561 HOH A O   1 
HETATM 2474 O O   . HOH D 4 .   ? 70.749 47.134 6.623   1.00 51.38 ? 562 HOH A O   1 
HETATM 2475 O O   . HOH D 4 .   ? 43.156 32.925 -4.159  1.00 42.33 ? 563 HOH A O   1 
HETATM 2476 O O   . HOH D 4 .   ? 31.471 53.544 19.903  1.00 51.14 ? 564 HOH A O   1 
HETATM 2477 O O   . HOH D 4 .   ? 48.604 56.877 17.340  1.00 42.40 ? 565 HOH A O   1 
HETATM 2478 O O   . HOH D 4 .   ? 29.495 54.654 9.597   1.00 43.51 ? 566 HOH A O   1 
HETATM 2479 O O   . HOH D 4 .   ? 44.412 39.797 29.134  1.00 37.87 ? 567 HOH A O   1 
HETATM 2480 O O   . HOH D 4 .   ? 25.256 35.792 2.783   1.00 39.81 ? 568 HOH A O   1 
HETATM 2481 O O   . HOH D 4 .   ? 44.162 55.607 32.727  1.00 34.76 ? 569 HOH A O   1 
HETATM 2482 O O   . HOH D 4 .   ? 45.841 52.885 -0.581  1.00 47.25 ? 570 HOH A O   1 
HETATM 2483 O O   . HOH D 4 .   ? 43.152 31.796 15.019  1.00 43.45 ? 571 HOH A O   1 
HETATM 2484 O O   . HOH D 4 .   ? 40.587 57.835 7.405   1.00 43.62 ? 572 HOH A O   1 
HETATM 2485 O O   . HOH D 4 .   ? 27.121 52.827 -10.514 1.00 35.41 ? 573 HOH A O   1 
HETATM 2486 O O   . HOH D 4 .   ? 77.687 47.134 12.171  1.00 47.43 ? 574 HOH A O   1 
HETATM 2487 O O   . HOH D 4 .   ? 69.024 41.059 17.224  1.00 48.31 ? 575 HOH A O   1 
HETATM 2488 O O   . HOH D 4 .   ? 72.751 47.478 4.382   1.00 43.71 ? 576 HOH A O   1 
HETATM 2489 O O   . HOH D 4 .   ? 37.323 37.292 16.165  1.00 32.50 ? 577 HOH A O   1 
HETATM 2490 O O   . HOH D 4 .   ? 65.521 42.982 15.627  1.00 39.18 ? 578 HOH A O   1 
HETATM 2491 O O   . HOH D 4 .   ? 39.760 48.972 -7.467  1.00 39.94 ? 579 HOH A O   1 
HETATM 2492 O O   . HOH D 4 .   ? 54.354 51.949 2.955   1.00 41.60 ? 580 HOH A O   1 
HETATM 2493 O O   . HOH D 4 .   ? 30.413 53.636 15.437  1.00 35.88 ? 581 HOH A O   1 
HETATM 2494 O O   . HOH D 4 .   ? 58.786 48.005 -0.167  1.00 34.80 ? 582 HOH A O   1 
HETATM 2495 O O   . HOH D 4 .   ? 22.032 44.393 -6.454  1.00 44.57 ? 583 HOH A O   1 
HETATM 2496 O O   . HOH D 4 .   ? 42.616 48.581 -8.462  1.00 44.66 ? 584 HOH A O   1 
HETATM 2497 O O   . HOH D 4 .   ? 28.110 56.564 -2.443  1.00 52.59 ? 585 HOH A O   1 
HETATM 2498 O O   . HOH D 4 .   ? 69.806 41.494 26.135  1.00 47.72 ? 586 HOH A O   1 
HETATM 2499 O O   . HOH D 4 .   ? 37.644 31.787 -5.846  1.00 56.26 ? 587 HOH A O   1 
HETATM 2500 O O   . HOH D 4 .   ? 54.142 29.261 5.033   1.00 53.71 ? 588 HOH A O   1 
HETATM 2501 O O   . HOH D 4 .   ? 75.074 45.267 11.229  1.00 43.69 ? 589 HOH A O   1 
HETATM 2502 O O   . HOH D 4 .   ? 58.497 63.889 5.825   1.00 50.08 ? 590 HOH A O   1 
HETATM 2503 O O   . HOH D 4 .   ? 23.225 41.845 15.466  1.00 39.01 ? 591 HOH A O   1 
HETATM 2504 O O   . HOH D 4 .   ? 21.561 49.151 13.618  1.00 43.24 ? 592 HOH A O   1 
HETATM 2505 O O   . HOH D 4 .   ? 73.277 50.293 6.084   1.00 59.10 ? 593 HOH A O   1 
HETATM 2506 O O   . HOH D 4 .   ? 61.362 34.213 18.606  1.00 45.98 ? 594 HOH A O   1 
HETATM 2507 O O   . HOH D 4 .   ? 38.191 54.439 -0.819  1.00 42.05 ? 595 HOH A O   1 
HETATM 2508 O O   . HOH D 4 .   ? 52.259 57.565 23.515  1.00 29.95 ? 596 HOH A O   1 
HETATM 2509 O O   . HOH D 4 .   ? 54.010 53.534 30.377  1.00 59.21 ? 597 HOH A O   1 
HETATM 2510 O O   . HOH D 4 .   ? 57.005 46.298 -4.430  1.00 44.80 ? 598 HOH A O   1 
HETATM 2511 O O   . HOH D 4 .   ? 50.316 47.473 32.539  1.00 49.46 ? 599 HOH A O   1 
HETATM 2512 O O   . HOH D 4 .   ? 58.056 34.575 -2.754  1.00 42.07 ? 600 HOH A O   1 
HETATM 2513 O O   . HOH D 4 .   ? 52.075 38.834 28.849  1.00 43.58 ? 601 HOH A O   1 
HETATM 2514 O O   . HOH D 4 .   ? 23.852 53.983 -11.841 1.00 35.92 ? 602 HOH A O   1 
HETATM 2515 O O   . HOH D 4 .   ? 60.127 48.582 26.904  1.00 46.36 ? 603 HOH A O   1 
HETATM 2516 O O   . HOH D 4 .   ? 54.673 34.965 1.020   1.00 40.84 ? 604 HOH A O   1 
HETATM 2517 O O   . HOH D 4 .   ? 23.124 44.327 18.129  1.00 46.74 ? 605 HOH A O   1 
HETATM 2518 O O   . HOH D 4 .   ? 58.047 57.578 15.177  1.00 42.30 ? 606 HOH A O   1 
HETATM 2519 O O   . HOH D 4 .   ? 54.416 63.163 9.160   1.00 46.57 ? 607 HOH A O   1 
HETATM 2520 O O   . HOH D 4 .   ? 38.541 52.335 -5.912  1.00 46.44 ? 608 HOH A O   1 
HETATM 2521 O O   . HOH D 4 .   ? 45.050 57.018 5.130   1.00 41.57 ? 609 HOH A O   1 
HETATM 2522 O O   . HOH D 4 .   ? 67.268 42.815 12.785  1.00 43.91 ? 610 HOH A O   1 
HETATM 2523 O O   . HOH D 4 .   ? 34.963 56.290 7.469   1.00 48.94 ? 611 HOH A O   1 
HETATM 2524 O O   . HOH D 4 .   ? 51.627 49.462 33.960  1.00 49.44 ? 612 HOH A O   1 
HETATM 2525 O O   . HOH D 4 .   ? 55.034 57.843 24.131  1.00 38.89 ? 613 HOH A O   1 
HETATM 2526 O O   . HOH D 4 .   ? 58.908 46.283 -1.927  1.00 53.22 ? 614 HOH A O   1 
HETATM 2527 O O   . HOH D 4 .   ? 48.078 46.279 32.863  1.00 37.10 ? 615 HOH A O   1 
HETATM 2528 O O   . HOH D 4 .   ? 54.884 42.387 -6.145  1.00 53.31 ? 616 HOH A O   1 
HETATM 2529 O O   . HOH D 4 .   ? 45.329 48.412 -8.065  1.00 39.92 ? 617 HOH A O   1 
HETATM 2530 O O   . HOH D 4 .   ? 55.287 50.737 0.911   1.00 51.46 ? 618 HOH A O   1 
HETATM 2531 O O   . HOH D 4 .   ? 29.755 52.096 -12.080 1.00 45.73 ? 619 HOH A O   1 
HETATM 2532 O O   . HOH D 4 .   ? 24.028 50.774 16.701  1.00 45.08 ? 620 HOH A O   1 
HETATM 2533 O O   . HOH D 4 .   ? 30.432 33.090 -1.894  1.00 42.89 ? 621 HOH A O   1 
HETATM 2534 O O   . HOH D 4 .   ? 16.756 52.079 0.111   1.00 35.13 ? 622 HOH A O   1 
HETATM 2535 O O   . HOH D 4 .   ? 60.739 45.804 28.650  1.00 47.20 ? 623 HOH A O   1 
HETATM 2536 O O   . HOH D 4 .   ? 32.355 49.996 -10.237 1.00 39.77 ? 624 HOH A O   1 
HETATM 2537 O O   . HOH D 4 .   ? 17.743 50.797 -9.193  1.00 38.35 ? 625 HOH A O   1 
HETATM 2538 O O   . HOH D 4 .   ? 49.203 37.566 23.017  1.00 42.61 ? 626 HOH A O   1 
HETATM 2539 O O   . HOH D 4 .   ? 60.252 51.438 27.190  1.00 53.61 ? 627 HOH A O   1 
HETATM 2540 O O   . HOH D 4 .   ? 21.640 36.178 1.241   1.00 49.07 ? 628 HOH A O   1 
HETATM 2541 O O   . HOH D 4 .   ? 35.870 54.639 -0.234  1.00 40.65 ? 629 HOH A O   1 
HETATM 2542 O O   . HOH D 4 .   ? 64.439 54.591 22.616  1.00 46.70 ? 630 HOH A O   1 
HETATM 2543 O O   . HOH D 4 .   ? 43.582 54.561 2.714   1.00 34.83 ? 631 HOH A O   1 
HETATM 2544 O O   . HOH D 4 .   ? 62.532 58.784 3.201   1.00 44.53 ? 632 HOH A O   1 
HETATM 2545 O O   . HOH D 4 .   ? 56.405 33.206 -0.396  1.00 56.72 ? 633 HOH A O   1 
HETATM 2546 O O   . HOH D 4 .   ? 57.999 31.620 9.801   1.00 52.14 ? 634 HOH A O   1 
HETATM 2547 O O   . HOH D 4 .   ? 43.619 60.044 16.806  1.00 42.14 ? 635 HOH A O   1 
HETATM 2548 O O   . HOH D 4 .   ? 55.011 40.783 12.242  1.00 19.93 ? 636 HOH A O   1 
HETATM 2549 O O   . HOH D 4 .   ? 41.715 43.125 29.431  1.00 42.12 ? 637 HOH A O   1 
HETATM 2550 O O   . HOH D 4 .   ? 54.615 34.116 3.615   1.00 60.65 ? 638 HOH A O   1 
HETATM 2551 O O   . HOH D 4 .   ? 24.243 47.443 7.791   1.00 39.31 ? 639 HOH A O   1 
HETATM 2552 O O   . HOH D 4 .   ? 20.671 42.166 -5.781  1.00 46.16 ? 640 HOH A O   1 
HETATM 2553 O O   . HOH D 4 .   ? 47.798 44.604 -8.983  1.00 45.25 ? 641 HOH A O   1 
HETATM 2554 O O   . HOH D 4 .   ? 66.334 41.978 29.045  1.00 45.52 ? 642 HOH A O   1 
HETATM 2555 O O   . HOH D 4 .   ? 60.187 34.805 -1.121  1.00 40.04 ? 643 HOH A O   1 
HETATM 2556 O O   . HOH D 4 .   ? 24.792 48.146 4.778   1.00 44.10 ? 644 HOH A O   1 
HETATM 2557 O O   . HOH D 4 .   ? 49.259 34.049 -1.656  1.00 43.68 ? 645 HOH A O   1 
HETATM 2558 O O   . HOH D 4 .   ? 31.294 49.315 -12.620 1.00 53.85 ? 646 HOH A O   1 
HETATM 2559 O O   . HOH D 4 .   ? 22.624 54.873 2.691   1.00 40.41 ? 647 HOH A O   1 
HETATM 2560 O O   . HOH D 4 .   ? 36.988 55.120 19.861  1.00 41.30 ? 648 HOH A O   1 
HETATM 2561 O O   . HOH D 4 .   ? 43.075 52.137 -0.369  1.00 46.53 ? 649 HOH A O   1 
HETATM 2562 O O   . HOH D 4 .   ? 44.515 27.817 15.765  1.00 43.04 ? 650 HOH A O   1 
HETATM 2563 O O   . HOH D 4 .   ? 19.548 46.074 -5.409  1.00 47.08 ? 651 HOH A O   1 
HETATM 2564 O O   . HOH D 4 .   ? 43.643 38.265 -15.647 1.00 55.73 ? 652 HOH A O   1 
HETATM 2565 O O   . HOH D 4 .   ? 46.479 29.267 9.802   1.00 39.84 ? 653 HOH A O   1 
HETATM 2566 O O   . HOH D 4 .   ? 30.877 51.225 -14.539 1.00 47.53 ? 654 HOH A O   1 
HETATM 2567 O O   . HOH D 4 .   ? 27.254 44.526 -13.193 1.00 51.33 ? 655 HOH A O   1 
HETATM 2568 O O   . HOH D 4 .   ? 26.232 40.559 25.347  1.00 45.19 ? 656 HOH A O   1 
HETATM 2569 O O   . HOH D 4 .   ? 55.669 30.663 7.689   1.00 49.07 ? 657 HOH A O   1 
HETATM 2570 O O   . HOH D 4 .   ? 43.225 29.686 11.861  1.00 46.48 ? 658 HOH A O   1 
HETATM 2571 O O   . HOH D 4 .   ? 60.674 30.348 -0.844  1.00 50.91 ? 659 HOH A O   1 
HETATM 2572 O O   . HOH D 4 .   ? 68.160 49.745 20.048  1.00 38.92 ? 660 HOH A O   1 
HETATM 2573 O O   . HOH D 4 .   ? 33.617 55.462 5.358   1.00 34.71 ? 661 HOH A O   1 
HETATM 2574 O O   . HOH D 4 .   ? 31.755 55.983 14.210  1.00 46.33 ? 662 HOH A O   1 
HETATM 2575 O O   . HOH D 4 .   ? 26.421 52.725 12.182  1.00 48.07 ? 663 HOH A O   1 
HETATM 2576 O O   . HOH D 4 .   ? 21.410 37.326 3.664   1.00 43.30 ? 664 HOH A O   1 
HETATM 2577 O O   . HOH D 4 .   ? 68.019 52.554 20.147  1.00 40.18 ? 665 HOH A O   1 
HETATM 2578 O O   . HOH D 4 .   ? 47.273 35.892 -13.310 1.00 42.24 ? 666 HOH A O   1 
HETATM 2579 O O   . HOH D 4 .   ? 34.360 57.019 -0.243  1.00 46.23 ? 667 HOH A O   1 
HETATM 2580 O O   . HOH D 4 .   ? 57.275 57.894 19.721  1.00 45.48 ? 668 HOH A O   1 
HETATM 2581 O O   . HOH D 4 .   ? 33.285 59.368 10.992  1.00 45.25 ? 669 HOH A O   1 
HETATM 2582 O O   . HOH D 4 .   ? 63.526 44.103 31.833  1.00 59.25 ? 670 HOH A O   1 
HETATM 2583 O O   . HOH D 4 .   ? 71.411 44.292 18.900  1.00 48.42 ? 671 HOH A O   1 
HETATM 2584 O O   . HOH D 4 .   ? 41.512 51.663 -2.392  1.00 42.60 ? 672 HOH A O   1 
HETATM 2585 O O   . HOH D 4 .   ? 52.770 53.069 32.546  1.00 52.50 ? 673 HOH A O   1 
HETATM 2586 O O   . HOH D 4 .   ? 34.276 57.636 3.590   1.00 47.25 ? 674 HOH A O   1 
HETATM 2587 O O   . HOH D 4 .   ? 59.081 53.089 0.266   1.00 49.13 ? 675 HOH A O   1 
HETATM 2588 O O   . HOH D 4 .   ? 58.129 57.299 24.070  1.00 44.55 ? 676 HOH A O   1 
HETATM 2589 O O   . HOH D 4 .   ? 64.869 38.916 13.429  1.00 46.07 ? 677 HOH A O   1 
HETATM 2590 O O   . HOH D 4 .   ? 63.474 32.990 14.119  1.00 51.33 ? 678 HOH A O   1 
HETATM 2591 O O   . HOH D 4 .   ? 49.463 27.781 12.758  1.00 33.69 ? 679 HOH A O   1 
HETATM 2592 O O   . HOH D 4 .   ? 54.991 51.674 -2.063  1.00 45.72 ? 680 HOH A O   1 
HETATM 2593 O O   . HOH D 4 .   ? 36.847 59.744 9.879   1.00 48.52 ? 681 HOH A O   1 
HETATM 2594 O O   . HOH D 4 .   ? 59.310 57.888 17.358  1.00 44.07 ? 682 HOH A O   1 
HETATM 2595 O O   . HOH D 4 .   ? 70.302 56.297 9.269   1.00 58.83 ? 683 HOH A O   1 
HETATM 2596 O O   . HOH D 4 .   ? 60.342 31.257 1.702   1.00 48.13 ? 684 HOH A O   1 
HETATM 2597 O O   . HOH D 4 .   ? 39.175 30.880 9.380   1.00 53.34 ? 685 HOH A O   1 
HETATM 2598 O O   . HOH D 4 .   ? 35.053 48.583 27.714  1.00 36.50 ? 686 HOH A O   1 
HETATM 2599 O O   . HOH D 4 .   ? 32.910 29.385 15.743  1.00 54.61 ? 687 HOH A O   1 
HETATM 2600 O O   . HOH D 4 .   ? 39.711 60.069 9.177   1.00 46.86 ? 688 HOH A O   1 
HETATM 2601 O O   . HOH D 4 .   ? 38.589 33.330 8.542   1.00 42.83 ? 689 HOH A O   1 
HETATM 2602 O O   . HOH D 4 .   ? 52.768 49.057 -6.555  1.00 51.93 ? 690 HOH A O   1 
HETATM 2603 O O   . HOH D 4 .   ? 67.941 58.007 -3.143  1.00 49.82 ? 691 HOH A O   1 
HETATM 2604 O O   . HOH D 4 .   ? 25.521 35.900 22.966  1.00 56.47 ? 692 HOH A O   1 
HETATM 2605 O O   . HOH D 4 .   ? 52.193 58.643 16.049  1.00 40.51 ? 693 HOH A O   1 
HETATM 2606 O O   . HOH D 4 .   ? 54.522 39.438 -5.003  1.00 50.96 ? 694 HOH A O   1 
HETATM 2607 O O   . HOH D 4 .   ? 28.879 46.482 32.461  1.00 56.69 ? 695 HOH A O   1 
HETATM 2608 O O   . HOH D 4 .   ? 30.835 44.396 -12.525 1.00 48.91 ? 696 HOH A O   1 
HETATM 2609 O O   . HOH D 4 .   ? 52.346 59.500 5.570   1.00 46.89 ? 697 HOH A O   1 
HETATM 2610 O O   . HOH D 4 .   ? 17.201 46.557 0.782   1.00 48.07 ? 698 HOH A O   1 
HETATM 2611 O O   . HOH D 4 .   ? 22.426 44.328 -8.839  1.00 47.38 ? 699 HOH A O   1 
HETATM 2612 O O   . HOH D 4 .   ? 28.097 47.102 24.688  1.00 53.92 ? 700 HOH A O   1 
HETATM 2613 O O   . HOH D 4 .   ? 45.004 30.018 0.586   1.00 51.15 ? 701 HOH A O   1 
HETATM 2614 O O   . HOH D 4 .   ? 31.499 35.397 21.884  1.00 33.88 ? 702 HOH A O   1 
HETATM 2615 O O   . HOH D 4 .   ? 33.962 29.891 9.519   1.00 42.63 ? 703 HOH A O   1 
HETATM 2616 O O   . HOH D 4 .   ? 31.203 33.009 20.627  1.00 45.17 ? 704 HOH A O   1 
HETATM 2617 O O   . HOH D 4 .   ? 38.366 32.155 22.441  1.00 46.80 ? 705 HOH A O   1 
HETATM 2618 O O   . HOH D 4 .   ? 61.519 58.044 0.515   1.00 51.97 ? 706 HOH A O   1 
HETATM 2619 O O   . HOH D 4 .   ? 24.828 38.253 24.594  1.00 49.40 ? 707 HOH A O   1 
HETATM 2620 O O   . HOH D 4 .   ? 45.062 59.274 18.482  1.00 42.43 ? 708 HOH A O   1 
HETATM 2621 O O   . HOH D 4 .   ? 37.209 34.439 -7.601  1.00 56.53 ? 709 HOH A O   1 
HETATM 2622 O O   . HOH D 4 .   ? 41.604 36.301 24.413  1.00 50.62 ? 710 HOH A O   1 
HETATM 2623 O O   . HOH D 4 .   ? 32.570 31.217 19.489  1.00 43.26 ? 711 HOH A O   1 
HETATM 2624 O O   . HOH D 4 .   ? 45.766 52.310 -8.826  1.00 59.97 ? 712 HOH A O   1 
HETATM 2625 O O   . HOH D 4 .   ? 39.152 46.174 27.383  1.00 51.58 ? 713 HOH A O   1 
HETATM 2626 O O   . HOH D 4 .   ? 66.372 47.992 24.275  1.00 50.91 ? 714 HOH A O   1 
HETATM 2627 O O   . HOH D 4 .   ? 51.406 27.630 16.091  1.00 49.04 ? 715 HOH A O   1 
HETATM 2628 O O   . HOH D 4 .   ? 33.831 53.050 -2.728  1.00 47.22 ? 716 HOH A O   1 
HETATM 2629 O O   . HOH D 4 .   ? 39.347 47.826 36.122  1.00 62.19 ? 717 HOH A O   1 
HETATM 2630 O O   . HOH D 4 .   ? 23.166 40.504 7.166   1.00 46.81 ? 718 HOH A O   1 
HETATM 2631 O O   . HOH D 4 .   ? 66.843 60.761 -2.506  1.00 52.10 ? 719 HOH A O   1 
HETATM 2632 O O   . HOH D 4 .   ? 15.764 50.791 -1.554  1.00 52.19 ? 720 HOH A O   1 
HETATM 2633 O O   . HOH D 4 .   ? 30.210 31.384 17.510  1.00 48.46 ? 721 HOH A O   1 
HETATM 2634 O O   . HOH D 4 .   ? 70.431 55.611 18.022  1.00 50.64 ? 722 HOH A O   1 
HETATM 2635 O O   . HOH D 4 .   ? 67.369 61.275 -0.288  1.00 49.34 ? 723 HOH A O   1 
HETATM 2636 O O   . HOH D 4 .   ? 40.284 28.715 10.259  1.00 55.66 ? 724 HOH A O   1 
HETATM 2637 O O   . HOH D 4 .   ? 30.263 50.404 -16.681 1.00 51.85 ? 725 HOH A O   1 
HETATM 2638 O O   . HOH D 4 .   ? 72.460 36.528 25.994  1.00 54.63 ? 726 HOH A O   1 
HETATM 2639 O O   . HOH D 4 .   ? 19.714 41.015 -3.619  1.00 52.68 ? 727 HOH A O   1 
HETATM 2640 O O   . HOH D 4 .   ? 70.539 39.188 25.214  1.00 44.88 ? 728 HOH A O   1 
HETATM 2641 O O   . HOH D 4 .   ? 28.638 39.617 26.053  1.00 49.71 ? 729 HOH A O   1 
HETATM 2642 O O   . HOH D 4 .   ? 36.744 28.571 11.169  1.00 54.43 ? 730 HOH A O   1 
HETATM 2643 O O   . HOH D 4 .   ? 34.524 61.108 -4.002  1.00 48.52 ? 731 HOH A O   1 
HETATM 2644 O O   . HOH D 4 .   ? 20.996 39.732 12.798  1.00 46.61 ? 732 HOH A O   1 
HETATM 2645 O O   . HOH D 4 .   ? 31.972 52.394 -10.209 1.00 45.27 ? 733 HOH A O   1 
HETATM 2646 O O   . HOH D 4 .   ? 38.144 36.190 -13.339 1.00 43.62 ? 734 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   31  ?   ?   ?   A . n 
A 1 2   GLY 2   32  ?   ?   ?   A . n 
A 1 3   SER 3   33  ?   ?   ?   A . n 
A 1 4   ASP 4   34  ?   ?   ?   A . n 
A 1 5   LYS 5   35  ?   ?   ?   A . n 
A 1 6   ILE 6   36  ?   ?   ?   A . n 
A 1 7   HIS 7   37  ?   ?   ?   A . n 
A 1 8   HIS 8   38  ?   ?   ?   A . n 
A 1 9   HIS 9   39  ?   ?   ?   A . n 
A 1 10  HIS 10  40  ?   ?   ?   A . n 
A 1 11  HIS 11  41  ?   ?   ?   A . n 
A 1 12  HIS 12  42  ?   ?   ?   A . n 
A 1 13  MET 13  43  ?   ?   ?   A . n 
A 1 14  ASN 14  44  44  ASN ASN A . n 
A 1 15  THR 15  45  45  THR THR A . n 
A 1 16  PRO 16  46  46  PRO PRO A . n 
A 1 17  ARG 17  47  47  ARG ARG A . n 
A 1 18  GLU 18  48  48  GLU GLU A . n 
A 1 19  VAL 19  49  49  VAL VAL A . n 
A 1 20  THR 20  50  50  THR THR A . n 
A 1 21  LEU 21  51  51  LEU LEU A . n 
A 1 22  HIS 22  52  52  HIS HIS A . n 
A 1 23  PHE 23  53  53  PHE PHE A . n 
A 1 24  LEU 24  54  54  LEU LEU A . n 
A 1 25  ARG 25  55  55  ARG ARG A . n 
A 1 26  THR 26  56  56  THR THR A . n 
A 1 27  ALA 27  57  57  ALA ALA A . n 
A 1 28  GLY 28  58  58  GLY GLY A . n 
A 1 29  HIS 29  59  59  HIS HIS A . n 
A 1 30  PRO 30  60  60  PRO PRO A . n 
A 1 31  LEU 31  61  61  LEU LEU A . n 
A 1 32  THR 32  62  62  THR THR A . n 
A 1 33  ARG 33  63  63  ARG ARG A . n 
A 1 34  TRP 34  64  64  TRP TRP A . n 
A 1 35  ALA 35  65  65  ALA ALA A . n 
A 1 36  LEU 36  66  66  LEU LEU A . n 
A 1 37  GLN 37  67  67  GLN GLN A . n 
A 1 38  ARG 38  68  68  ARG ARG A . n 
A 1 39  GLN 39  69  69  GLN GLN A . n 
A 1 40  PRO 40  70  70  PRO PRO A . n 
A 1 41  PRO 41  71  71  PRO PRO A . n 
A 1 42  SER 42  72  72  SER SER A . n 
A 1 43  PRO 43  73  73  PRO PRO A . n 
A 1 44  LYS 44  74  74  LYS LYS A . n 
A 1 45  GLN 45  75  75  GLN GLN A . n 
A 1 46  LEU 46  76  76  LEU LEU A . n 
A 1 47  GLU 47  77  77  GLU GLU A . n 
A 1 48  GLU 48  78  78  GLU GLU A . n 
A 1 49  GLU 49  79  79  GLU GLU A . n 
A 1 50  PHE 50  80  80  PHE PHE A . n 
A 1 51  LEU 51  81  81  LEU LEU A . n 
A 1 52  LYS 52  82  82  LYS LYS A . n 
A 1 53  ILE 53  83  83  ILE ILE A . n 
A 1 54  PRO 54  84  84  PRO PRO A . n 
A 1 55  SER 55  85  85  SER SER A . n 
A 1 56  ASN 56  86  86  ASN ASN A . n 
A 1 57  PHE 57  87  87  PHE PHE A . n 
A 1 58  VAL 58  88  88  VAL VAL A . n 
A 1 59  SER 59  89  89  SER SER A . n 
A 1 60  PRO 60  90  90  PRO PRO A . n 
A 1 61  GLU 61  91  91  GLU GLU A . n 
A 1 62  ASP 62  92  92  ASP ASP A . n 
A 1 63  LEU 63  93  93  LEU LEU A . n 
A 1 64  ASP 64  94  94  ASP ASP A . n 
A 1 65  ILE 65  95  95  ILE ILE A . n 
A 1 66  PRO 66  96  96  PRO PRO A . n 
A 1 67  GLY 67  97  97  GLY GLY A . n 
A 1 68  HIS 68  98  98  HIS HIS A . n 
A 1 69  ALA 69  99  99  ALA ALA A . n 
A 1 70  SER 70  100 100 SER SER A . n 
A 1 71  LYS 71  101 101 LYS LYS A . n 
A 1 72  ASP 72  102 102 ASP ASP A . n 
A 1 73  ARG 73  103 103 ARG ARG A . n 
A 1 74  TYR 74  104 104 TYR TYR A . n 
A 1 75  LYS 75  105 105 LYS LYS A . n 
A 1 76  THR 76  106 106 THR THR A . n 
A 1 77  ILE 77  107 107 ILE ILE A . n 
A 1 78  LEU 78  108 108 LEU LEU A . n 
A 1 79  PRO 79  109 109 PRO PRO A . n 
A 1 80  ASN 80  110 110 ASN ASN A . n 
A 1 81  PRO 81  111 111 PRO PRO A . n 
A 1 82  GLN 82  112 112 GLN GLN A . n 
A 1 83  SER 83  113 113 SER SER A . n 
A 1 84  ARG 84  114 114 ARG ARG A . n 
A 1 85  VAL 85  115 115 VAL VAL A . n 
A 1 86  CYS 86  116 116 CYS CYS A . n 
A 1 87  LEU 87  117 117 LEU LEU A . n 
A 1 88  GLY 88  118 118 GLY GLY A . n 
A 1 89  ARG 89  119 119 ARG ARG A . n 
A 1 90  ALA 90  120 120 ALA ALA A . n 
A 1 91  GLN 91  121 121 GLN GLN A . n 
A 1 92  SER 92  122 122 SER SER A . n 
A 1 93  GLN 93  123 123 GLN GLN A . n 
A 1 94  GLU 94  124 124 GLU GLU A . n 
A 1 95  ASP 95  125 125 ASP ASP A . n 
A 1 96  GLY 96  126 126 GLY GLY A . n 
A 1 97  ASP 97  127 127 ASP ASP A . n 
A 1 98  TYR 98  128 128 TYR TYR A . n 
A 1 99  ILE 99  129 129 ILE ILE A . n 
A 1 100 ASN 100 130 130 ASN ASN A . n 
A 1 101 ALA 101 131 131 ALA ALA A . n 
A 1 102 ASN 102 132 132 ASN ASN A . n 
A 1 103 TYR 103 133 133 TYR TYR A . n 
A 1 104 ILE 104 134 134 ILE ILE A . n 
A 1 105 ARG 105 135 135 ARG ARG A . n 
A 1 106 GLY 106 136 136 GLY GLY A . n 
A 1 107 TYR 107 137 137 TYR TYR A . n 
A 1 108 ASP 108 138 138 ASP ASP A . n 
A 1 109 GLY 109 139 139 GLY GLY A . n 
A 1 110 LYS 110 140 140 LYS LYS A . n 
A 1 111 GLU 111 141 141 GLU GLU A . n 
A 1 112 LYS 112 142 142 LYS LYS A . n 
A 1 113 VAL 113 143 143 VAL VAL A . n 
A 1 114 TYR 114 144 144 TYR TYR A . n 
A 1 115 ILE 115 145 145 ILE ILE A . n 
A 1 116 ALA 116 146 146 ALA ALA A . n 
A 1 117 THR 117 147 147 THR THR A . n 
A 1 118 GLN 118 148 148 GLN GLN A . n 
A 1 119 GLY 119 149 149 GLY GLY A . n 
A 1 120 PRO 120 150 150 PRO PRO A . n 
A 1 121 MET 121 151 151 MET MET A . n 
A 1 122 PRO 122 152 152 PRO PRO A . n 
A 1 123 ASN 123 153 153 ASN ASN A . n 
A 1 124 THR 124 154 154 THR THR A . n 
A 1 125 VAL 125 155 155 VAL VAL A . n 
A 1 126 SER 126 156 156 SER SER A . n 
A 1 127 ASP 127 157 157 ASP ASP A . n 
A 1 128 PHE 128 158 158 PHE PHE A . n 
A 1 129 TRP 129 159 159 TRP TRP A . n 
A 1 130 GLU 130 160 160 GLU GLU A . n 
A 1 131 MET 131 161 161 MET MET A . n 
A 1 132 VAL 132 162 162 VAL VAL A . n 
A 1 133 TRP 133 163 163 TRP TRP A . n 
A 1 134 GLN 134 164 164 GLN GLN A . n 
A 1 135 GLU 135 165 165 GLU GLU A . n 
A 1 136 GLU 136 166 166 GLU GLU A . n 
A 1 137 VAL 137 167 167 VAL VAL A . n 
A 1 138 SER 138 168 168 SER SER A . n 
A 1 139 LEU 139 169 169 LEU LEU A . n 
A 1 140 ILE 140 170 170 ILE ILE A . n 
A 1 141 VAL 141 171 171 VAL VAL A . n 
A 1 142 MET 142 172 172 MET MET A . n 
A 1 143 LEU 143 173 173 LEU LEU A . n 
A 1 144 THR 144 174 174 THR THR A . n 
A 1 145 GLN 145 175 175 GLN GLN A . n 
A 1 146 LEU 146 176 176 LEU LEU A . n 
A 1 147 ARG 147 177 177 ARG ARG A . n 
A 1 148 GLU 148 178 178 GLU GLU A . n 
A 1 149 GLY 149 179 ?   ?   ?   A . n 
A 1 150 LYS 150 180 ?   ?   ?   A . n 
A 1 151 GLU 151 181 ?   ?   ?   A . n 
A 1 152 LYS 152 182 ?   ?   ?   A . n 
A 1 153 CYS 153 183 183 CYS CYS A . n 
A 1 154 VAL 154 184 184 VAL VAL A . n 
A 1 155 HIS 155 185 185 HIS HIS A . n 
A 1 156 TYR 156 186 186 TYR TYR A . n 
A 1 157 TRP 157 187 187 TRP TRP A . n 
A 1 158 PRO 158 188 188 PRO PRO A . n 
A 1 159 THR 159 189 189 THR THR A . n 
A 1 160 GLU 160 190 190 GLU GLU A . n 
A 1 161 GLU 161 191 191 GLU GLU A . n 
A 1 162 GLU 162 192 192 GLU GLU A . n 
A 1 163 THR 163 193 193 THR THR A . n 
A 1 164 TYR 164 194 194 TYR TYR A . n 
A 1 165 GLY 165 195 195 GLY GLY A . n 
A 1 166 PRO 166 196 196 PRO PRO A . n 
A 1 167 PHE 167 197 197 PHE PHE A . n 
A 1 168 GLN 168 198 198 GLN GLN A . n 
A 1 169 ILE 169 199 199 ILE ILE A . n 
A 1 170 ARG 170 200 200 ARG ARG A . n 
A 1 171 ILE 171 201 201 ILE ILE A . n 
A 1 172 GLN 172 202 202 GLN GLN A . n 
A 1 173 ASP 173 203 203 ASP ASP A . n 
A 1 174 MET 174 204 204 MET MET A . n 
A 1 175 LYS 175 205 205 LYS LYS A . n 
A 1 176 GLU 176 206 206 GLU GLU A . n 
A 1 177 CYS 177 207 207 CYS CYS A . n 
A 1 178 PRO 178 208 208 PRO PRO A . n 
A 1 179 GLU 179 209 209 GLU GLU A . n 
A 1 180 TYR 180 210 210 TYR TYR A . n 
A 1 181 THR 181 211 211 THR THR A . n 
A 1 182 VAL 182 212 212 VAL VAL A . n 
A 1 183 ARG 183 213 213 ARG ARG A . n 
A 1 184 GLN 184 214 214 GLN GLN A . n 
A 1 185 LEU 185 215 215 LEU LEU A . n 
A 1 186 THR 186 216 216 THR THR A . n 
A 1 187 ILE 187 217 217 ILE ILE A . n 
A 1 188 GLN 188 218 218 GLN GLN A . n 
A 1 189 TYR 189 219 219 TYR TYR A . n 
A 1 190 GLN 190 220 220 GLN GLN A . n 
A 1 191 GLU 191 221 221 GLU GLU A . n 
A 1 192 GLU 192 222 222 GLU GLU A . n 
A 1 193 ARG 193 223 223 ARG ARG A . n 
A 1 194 ARG 194 224 224 ARG ARG A . n 
A 1 195 ASP 195 225 225 ASP ASP A . n 
A 1 196 VAL 196 226 226 VAL VAL A . n 
A 1 197 LYS 197 227 227 LYS LYS A . n 
A 1 198 HIS 198 228 228 HIS HIS A . n 
A 1 199 ILE 199 229 229 ILE ILE A . n 
A 1 200 LEU 200 230 230 LEU LEU A . n 
A 1 201 PHE 201 231 231 PHE PHE A . n 
A 1 202 SER 202 232 232 SER SER A . n 
A 1 203 ALA 203 233 233 ALA ALA A . n 
A 1 204 TRP 204 234 234 TRP TRP A . n 
A 1 205 PRO 205 235 235 PRO PRO A . n 
A 1 206 ASP 206 236 236 ASP ASP A . n 
A 1 207 HIS 207 237 237 HIS HIS A . n 
A 1 208 GLN 208 238 238 GLN GLN A . n 
A 1 209 THR 209 239 239 THR THR A . n 
A 1 210 PRO 210 240 240 PRO PRO A . n 
A 1 211 GLU 211 241 241 GLU GLU A . n 
A 1 212 SER 212 242 242 SER SER A . n 
A 1 213 ALA 213 243 243 ALA ALA A . n 
A 1 214 GLY 214 244 244 GLY GLY A . n 
A 1 215 PRO 215 245 245 PRO PRO A . n 
A 1 216 LEU 216 246 246 LEU LEU A . n 
A 1 217 LEU 217 247 247 LEU LEU A . n 
A 1 218 ARG 218 248 248 ARG ARG A . n 
A 1 219 LEU 219 249 249 LEU LEU A . n 
A 1 220 VAL 220 250 250 VAL VAL A . n 
A 1 221 ALA 221 251 251 ALA ALA A . n 
A 1 222 GLU 222 252 252 GLU GLU A . n 
A 1 223 VAL 223 253 253 VAL VAL A . n 
A 1 224 GLU 224 254 254 GLU GLU A . n 
A 1 225 GLU 225 255 255 GLU GLU A . n 
A 1 226 SER 226 256 256 SER SER A . n 
A 1 227 PRO 227 257 257 PRO PRO A . n 
A 1 228 GLU 228 258 258 GLU GLU A . n 
A 1 229 THR 229 259 259 THR THR A . n 
A 1 230 ALA 230 260 260 ALA ALA A . n 
A 1 231 ALA 231 261 261 ALA ALA A . n 
A 1 232 HIS 232 262 262 HIS HIS A . n 
A 1 233 PRO 233 263 263 PRO PRO A . n 
A 1 234 GLY 234 264 264 GLY GLY A . n 
A 1 235 PRO 235 265 265 PRO PRO A . n 
A 1 236 ILE 236 266 266 ILE ILE A . n 
A 1 237 VAL 237 267 267 VAL VAL A . n 
A 1 238 VAL 238 268 268 VAL VAL A . n 
A 1 239 HIS 239 269 269 HIS HIS A . n 
A 1 240 CYS 240 270 270 CYS CYS A . n 
A 1 241 SER 241 271 271 SER SER A . n 
A 1 242 ALA 242 272 272 ALA ALA A . n 
A 1 243 GLY 243 273 273 GLY GLY A . n 
A 1 244 ILE 244 274 274 ILE ILE A . n 
A 1 245 GLY 245 275 275 GLY GLY A . n 
A 1 246 ARG 246 276 276 ARG ARG A . n 
A 1 247 THR 247 277 277 THR THR A . n 
A 1 248 GLY 248 278 278 GLY GLY A . n 
A 1 249 CYS 249 279 279 CYS CYS A . n 
A 1 250 PHE 250 280 280 PHE PHE A . n 
A 1 251 ILE 251 281 281 ILE ILE A . n 
A 1 252 ALA 252 282 282 ALA ALA A . n 
A 1 253 THR 253 283 283 THR THR A . n 
A 1 254 ARG 254 284 284 ARG ARG A . n 
A 1 255 ILE 255 285 285 ILE ILE A . n 
A 1 256 GLY 256 286 286 GLY GLY A . n 
A 1 257 CYS 257 287 287 CYS CYS A . n 
A 1 258 GLN 258 288 288 GLN GLN A . n 
A 1 259 GLN 259 289 289 GLN GLN A . n 
A 1 260 LEU 260 290 290 LEU LEU A . n 
A 1 261 LYS 261 291 291 LYS LYS A . n 
A 1 262 ALA 262 292 292 ALA ALA A . n 
A 1 263 ARG 263 293 293 ARG ARG A . n 
A 1 264 GLY 264 294 294 GLY GLY A . n 
A 1 265 GLU 265 295 295 GLU GLU A . n 
A 1 266 VAL 266 296 296 VAL VAL A . n 
A 1 267 ASP 267 297 297 ASP ASP A . n 
A 1 268 ILE 268 298 298 ILE ILE A . n 
A 1 269 LEU 269 299 299 LEU LEU A . n 
A 1 270 GLY 270 300 300 GLY GLY A . n 
A 1 271 ILE 271 301 301 ILE ILE A . n 
A 1 272 VAL 272 302 302 VAL VAL A . n 
A 1 273 CYS 273 303 303 CYS CYS A . n 
A 1 274 GLN 274 304 304 GLN GLN A . n 
A 1 275 LEU 275 305 305 LEU LEU A . n 
A 1 276 ARG 276 306 306 ARG ARG A . n 
A 1 277 LEU 277 307 307 LEU LEU A . n 
A 1 278 ASP 278 308 308 ASP ASP A . n 
A 1 279 ARG 279 309 309 ARG ARG A . n 
A 1 280 GLY 280 310 310 GLY GLY A . n 
A 1 281 GLY 281 311 311 GLY GLY A . n 
A 1 282 MET 282 312 312 MET MET A . n 
A 1 283 ILE 283 313 313 ILE ILE A . n 
A 1 284 GLN 284 314 314 GLN GLN A . n 
A 1 285 THR 285 315 315 THR THR A . n 
A 1 286 ALA 286 316 316 ALA ALA A . n 
A 1 287 GLU 287 317 317 GLU GLU A . n 
A 1 288 GLN 288 318 318 GLN GLN A . n 
A 1 289 TYR 289 319 319 TYR TYR A . n 
A 1 290 GLN 290 320 320 GLN GLN A . n 
A 1 291 PHE 291 321 321 PHE PHE A . n 
A 1 292 LEU 292 322 322 LEU LEU A . n 
A 1 293 HIS 293 323 323 HIS HIS A . n 
A 1 294 HIS 294 324 324 HIS HIS A . n 
A 1 295 THR 295 325 325 THR THR A . n 
A 1 296 LEU 296 326 326 LEU LEU A . n 
A 1 297 ALA 297 327 327 ALA ALA A . n 
A 1 298 LEU 298 328 328 LEU LEU A . n 
A 1 299 TYR 299 329 329 TYR TYR A . n 
A 1 300 ALA 300 330 330 ALA ALA A . n 
A 1 301 GLY 301 331 331 GLY GLY A . n 
A 1 302 GLN 302 332 332 GLN GLN A . n 
A 1 303 LEU 303 333 333 LEU LEU A . n 
A 1 304 PRO 304 334 334 PRO PRO A . n 
A 1 305 GLU 305 335 335 GLU GLU A . n 
A 1 306 GLU 306 336 ?   ?   ?   A . n 
A 1 307 PRO 307 337 ?   ?   ?   A . n 
A 1 308 SER 308 338 ?   ?   ?   A . n 
A 1 309 PRO 309 339 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PO4 1   436 436 PO4 PO4 A . 
C 3 GOL 1   437 437 GOL GOL A . 
D 4 HOH 1   438 1   HOH HOH A . 
D 4 HOH 2   439 2   HOH HOH A . 
D 4 HOH 3   440 3   HOH HOH A . 
D 4 HOH 4   441 4   HOH HOH A . 
D 4 HOH 5   442 5   HOH HOH A . 
D 4 HOH 6   443 6   HOH HOH A . 
D 4 HOH 7   444 7   HOH HOH A . 
D 4 HOH 8   445 8   HOH HOH A . 
D 4 HOH 9   446 9   HOH HOH A . 
D 4 HOH 10  447 10  HOH HOH A . 
D 4 HOH 11  448 11  HOH HOH A . 
D 4 HOH 12  449 12  HOH HOH A . 
D 4 HOH 13  450 13  HOH HOH A . 
D 4 HOH 14  451 14  HOH HOH A . 
D 4 HOH 15  452 15  HOH HOH A . 
D 4 HOH 16  453 16  HOH HOH A . 
D 4 HOH 17  454 17  HOH HOH A . 
D 4 HOH 18  455 18  HOH HOH A . 
D 4 HOH 19  456 19  HOH HOH A . 
D 4 HOH 20  457 20  HOH HOH A . 
D 4 HOH 21  458 21  HOH HOH A . 
D 4 HOH 22  459 22  HOH HOH A . 
D 4 HOH 23  460 23  HOH HOH A . 
D 4 HOH 24  461 24  HOH HOH A . 
D 4 HOH 25  462 25  HOH HOH A . 
D 4 HOH 26  463 26  HOH HOH A . 
D 4 HOH 27  464 27  HOH HOH A . 
D 4 HOH 28  465 28  HOH HOH A . 
D 4 HOH 29  466 29  HOH HOH A . 
D 4 HOH 30  467 30  HOH HOH A . 
D 4 HOH 31  468 31  HOH HOH A . 
D 4 HOH 32  469 32  HOH HOH A . 
D 4 HOH 33  470 33  HOH HOH A . 
D 4 HOH 34  471 34  HOH HOH A . 
D 4 HOH 35  472 35  HOH HOH A . 
D 4 HOH 36  473 36  HOH HOH A . 
D 4 HOH 37  474 37  HOH HOH A . 
D 4 HOH 38  475 38  HOH HOH A . 
D 4 HOH 39  476 39  HOH HOH A . 
D 4 HOH 40  477 40  HOH HOH A . 
D 4 HOH 41  478 41  HOH HOH A . 
D 4 HOH 42  479 42  HOH HOH A . 
D 4 HOH 43  480 43  HOH HOH A . 
D 4 HOH 44  481 44  HOH HOH A . 
D 4 HOH 45  482 45  HOH HOH A . 
D 4 HOH 46  483 46  HOH HOH A . 
D 4 HOH 47  484 47  HOH HOH A . 
D 4 HOH 48  485 48  HOH HOH A . 
D 4 HOH 49  486 49  HOH HOH A . 
D 4 HOH 50  487 50  HOH HOH A . 
D 4 HOH 51  488 51  HOH HOH A . 
D 4 HOH 52  489 52  HOH HOH A . 
D 4 HOH 53  490 53  HOH HOH A . 
D 4 HOH 54  491 54  HOH HOH A . 
D 4 HOH 55  492 55  HOH HOH A . 
D 4 HOH 56  493 56  HOH HOH A . 
D 4 HOH 57  494 57  HOH HOH A . 
D 4 HOH 58  495 58  HOH HOH A . 
D 4 HOH 59  496 59  HOH HOH A . 
D 4 HOH 60  497 60  HOH HOH A . 
D 4 HOH 61  498 61  HOH HOH A . 
D 4 HOH 62  499 62  HOH HOH A . 
D 4 HOH 63  500 63  HOH HOH A . 
D 4 HOH 64  501 64  HOH HOH A . 
D 4 HOH 65  502 65  HOH HOH A . 
D 4 HOH 66  503 66  HOH HOH A . 
D 4 HOH 67  504 67  HOH HOH A . 
D 4 HOH 68  505 68  HOH HOH A . 
D 4 HOH 69  506 69  HOH HOH A . 
D 4 HOH 70  507 70  HOH HOH A . 
D 4 HOH 71  508 71  HOH HOH A . 
D 4 HOH 72  509 72  HOH HOH A . 
D 4 HOH 73  510 73  HOH HOH A . 
D 4 HOH 74  511 74  HOH HOH A . 
D 4 HOH 75  512 75  HOH HOH A . 
D 4 HOH 76  513 76  HOH HOH A . 
D 4 HOH 77  514 77  HOH HOH A . 
D 4 HOH 78  515 78  HOH HOH A . 
D 4 HOH 79  516 79  HOH HOH A . 
D 4 HOH 80  517 80  HOH HOH A . 
D 4 HOH 81  518 81  HOH HOH A . 
D 4 HOH 82  519 83  HOH HOH A . 
D 4 HOH 83  520 84  HOH HOH A . 
D 4 HOH 84  521 85  HOH HOH A . 
D 4 HOH 85  522 86  HOH HOH A . 
D 4 HOH 86  523 87  HOH HOH A . 
D 4 HOH 87  524 88  HOH HOH A . 
D 4 HOH 88  525 89  HOH HOH A . 
D 4 HOH 89  526 90  HOH HOH A . 
D 4 HOH 90  527 91  HOH HOH A . 
D 4 HOH 91  528 92  HOH HOH A . 
D 4 HOH 92  529 93  HOH HOH A . 
D 4 HOH 93  530 94  HOH HOH A . 
D 4 HOH 94  531 95  HOH HOH A . 
D 4 HOH 95  532 96  HOH HOH A . 
D 4 HOH 96  533 97  HOH HOH A . 
D 4 HOH 97  534 98  HOH HOH A . 
D 4 HOH 98  535 99  HOH HOH A . 
D 4 HOH 99  536 101 HOH HOH A . 
D 4 HOH 100 537 102 HOH HOH A . 
D 4 HOH 101 538 103 HOH HOH A . 
D 4 HOH 102 539 104 HOH HOH A . 
D 4 HOH 103 540 105 HOH HOH A . 
D 4 HOH 104 541 106 HOH HOH A . 
D 4 HOH 105 542 107 HOH HOH A . 
D 4 HOH 106 543 108 HOH HOH A . 
D 4 HOH 107 544 109 HOH HOH A . 
D 4 HOH 108 545 110 HOH HOH A . 
D 4 HOH 109 546 111 HOH HOH A . 
D 4 HOH 110 547 112 HOH HOH A . 
D 4 HOH 111 548 113 HOH HOH A . 
D 4 HOH 112 549 114 HOH HOH A . 
D 4 HOH 113 550 115 HOH HOH A . 
D 4 HOH 114 551 116 HOH HOH A . 
D 4 HOH 115 552 117 HOH HOH A . 
D 4 HOH 116 553 118 HOH HOH A . 
D 4 HOH 117 554 119 HOH HOH A . 
D 4 HOH 118 555 120 HOH HOH A . 
D 4 HOH 119 556 121 HOH HOH A . 
D 4 HOH 120 557 122 HOH HOH A . 
D 4 HOH 121 558 123 HOH HOH A . 
D 4 HOH 122 559 124 HOH HOH A . 
D 4 HOH 123 560 125 HOH HOH A . 
D 4 HOH 124 561 126 HOH HOH A . 
D 4 HOH 125 562 127 HOH HOH A . 
D 4 HOH 126 563 128 HOH HOH A . 
D 4 HOH 127 564 129 HOH HOH A . 
D 4 HOH 128 565 131 HOH HOH A . 
D 4 HOH 129 566 132 HOH HOH A . 
D 4 HOH 130 567 133 HOH HOH A . 
D 4 HOH 131 568 134 HOH HOH A . 
D 4 HOH 132 569 135 HOH HOH A . 
D 4 HOH 133 570 136 HOH HOH A . 
D 4 HOH 134 571 137 HOH HOH A . 
D 4 HOH 135 572 138 HOH HOH A . 
D 4 HOH 136 573 139 HOH HOH A . 
D 4 HOH 137 574 140 HOH HOH A . 
D 4 HOH 138 575 141 HOH HOH A . 
D 4 HOH 139 576 142 HOH HOH A . 
D 4 HOH 140 577 143 HOH HOH A . 
D 4 HOH 141 578 144 HOH HOH A . 
D 4 HOH 142 579 145 HOH HOH A . 
D 4 HOH 143 580 146 HOH HOH A . 
D 4 HOH 144 581 147 HOH HOH A . 
D 4 HOH 145 582 148 HOH HOH A . 
D 4 HOH 146 583 149 HOH HOH A . 
D 4 HOH 147 584 150 HOH HOH A . 
D 4 HOH 148 585 151 HOH HOH A . 
D 4 HOH 149 586 152 HOH HOH A . 
D 4 HOH 150 587 153 HOH HOH A . 
D 4 HOH 151 588 154 HOH HOH A . 
D 4 HOH 152 589 155 HOH HOH A . 
D 4 HOH 153 590 156 HOH HOH A . 
D 4 HOH 154 591 157 HOH HOH A . 
D 4 HOH 155 592 158 HOH HOH A . 
D 4 HOH 156 593 159 HOH HOH A . 
D 4 HOH 157 594 160 HOH HOH A . 
D 4 HOH 158 595 161 HOH HOH A . 
D 4 HOH 159 596 162 HOH HOH A . 
D 4 HOH 160 597 163 HOH HOH A . 
D 4 HOH 161 598 164 HOH HOH A . 
D 4 HOH 162 599 165 HOH HOH A . 
D 4 HOH 163 600 166 HOH HOH A . 
D 4 HOH 164 601 167 HOH HOH A . 
D 4 HOH 165 602 168 HOH HOH A . 
D 4 HOH 166 603 169 HOH HOH A . 
D 4 HOH 167 604 170 HOH HOH A . 
D 4 HOH 168 605 171 HOH HOH A . 
D 4 HOH 169 606 172 HOH HOH A . 
D 4 HOH 170 607 173 HOH HOH A . 
D 4 HOH 171 608 174 HOH HOH A . 
D 4 HOH 172 609 175 HOH HOH A . 
D 4 HOH 173 610 176 HOH HOH A . 
D 4 HOH 174 611 177 HOH HOH A . 
D 4 HOH 175 612 178 HOH HOH A . 
D 4 HOH 176 613 179 HOH HOH A . 
D 4 HOH 177 614 180 HOH HOH A . 
D 4 HOH 178 615 181 HOH HOH A . 
D 4 HOH 179 616 183 HOH HOH A . 
D 4 HOH 180 617 184 HOH HOH A . 
D 4 HOH 181 618 186 HOH HOH A . 
D 4 HOH 182 619 187 HOH HOH A . 
D 4 HOH 183 620 188 HOH HOH A . 
D 4 HOH 184 621 189 HOH HOH A . 
D 4 HOH 185 622 190 HOH HOH A . 
D 4 HOH 186 623 191 HOH HOH A . 
D 4 HOH 187 624 192 HOH HOH A . 
D 4 HOH 188 625 193 HOH HOH A . 
D 4 HOH 189 626 194 HOH HOH A . 
D 4 HOH 190 627 196 HOH HOH A . 
D 4 HOH 191 628 198 HOH HOH A . 
D 4 HOH 192 629 199 HOH HOH A . 
D 4 HOH 193 630 200 HOH HOH A . 
D 4 HOH 194 631 202 HOH HOH A . 
D 4 HOH 195 632 203 HOH HOH A . 
D 4 HOH 196 633 204 HOH HOH A . 
D 4 HOH 197 634 206 HOH HOH A . 
D 4 HOH 198 635 208 HOH HOH A . 
D 4 HOH 199 636 209 HOH HOH A . 
D 4 HOH 200 637 210 HOH HOH A . 
D 4 HOH 201 638 211 HOH HOH A . 
D 4 HOH 202 639 212 HOH HOH A . 
D 4 HOH 203 640 213 HOH HOH A . 
D 4 HOH 204 641 214 HOH HOH A . 
D 4 HOH 205 642 215 HOH HOH A . 
D 4 HOH 206 643 216 HOH HOH A . 
D 4 HOH 207 644 217 HOH HOH A . 
D 4 HOH 208 645 218 HOH HOH A . 
D 4 HOH 209 646 219 HOH HOH A . 
D 4 HOH 210 647 220 HOH HOH A . 
D 4 HOH 211 648 221 HOH HOH A . 
D 4 HOH 212 649 222 HOH HOH A . 
D 4 HOH 213 650 223 HOH HOH A . 
D 4 HOH 214 651 224 HOH HOH A . 
D 4 HOH 215 652 225 HOH HOH A . 
D 4 HOH 216 653 226 HOH HOH A . 
D 4 HOH 217 654 227 HOH HOH A . 
D 4 HOH 218 655 228 HOH HOH A . 
D 4 HOH 219 656 229 HOH HOH A . 
D 4 HOH 220 657 230 HOH HOH A . 
D 4 HOH 221 658 231 HOH HOH A . 
D 4 HOH 222 659 232 HOH HOH A . 
D 4 HOH 223 660 233 HOH HOH A . 
D 4 HOH 224 661 234 HOH HOH A . 
D 4 HOH 225 662 235 HOH HOH A . 
D 4 HOH 226 663 236 HOH HOH A . 
D 4 HOH 227 664 237 HOH HOH A . 
D 4 HOH 228 665 238 HOH HOH A . 
D 4 HOH 229 666 239 HOH HOH A . 
D 4 HOH 230 667 240 HOH HOH A . 
D 4 HOH 231 668 242 HOH HOH A . 
D 4 HOH 232 669 243 HOH HOH A . 
D 4 HOH 233 670 244 HOH HOH A . 
D 4 HOH 234 671 245 HOH HOH A . 
D 4 HOH 235 672 246 HOH HOH A . 
D 4 HOH 236 673 247 HOH HOH A . 
D 4 HOH 237 674 248 HOH HOH A . 
D 4 HOH 238 675 249 HOH HOH A . 
D 4 HOH 239 676 250 HOH HOH A . 
D 4 HOH 240 677 251 HOH HOH A . 
D 4 HOH 241 678 252 HOH HOH A . 
D 4 HOH 242 679 253 HOH HOH A . 
D 4 HOH 243 680 254 HOH HOH A . 
D 4 HOH 244 681 255 HOH HOH A . 
D 4 HOH 245 682 258 HOH HOH A . 
D 4 HOH 246 683 261 HOH HOH A . 
D 4 HOH 247 684 262 HOH HOH A . 
D 4 HOH 248 685 263 HOH HOH A . 
D 4 HOH 249 686 264 HOH HOH A . 
D 4 HOH 250 687 265 HOH HOH A . 
D 4 HOH 251 688 266 HOH HOH A . 
D 4 HOH 252 689 267 HOH HOH A . 
D 4 HOH 253 690 268 HOH HOH A . 
D 4 HOH 254 691 269 HOH HOH A . 
D 4 HOH 255 692 270 HOH HOH A . 
D 4 HOH 256 693 271 HOH HOH A . 
D 4 HOH 257 694 273 HOH HOH A . 
D 4 HOH 258 695 274 HOH HOH A . 
D 4 HOH 259 696 275 HOH HOH A . 
D 4 HOH 260 697 276 HOH HOH A . 
D 4 HOH 261 698 277 HOH HOH A . 
D 4 HOH 262 699 279 HOH HOH A . 
D 4 HOH 263 700 280 HOH HOH A . 
D 4 HOH 264 701 281 HOH HOH A . 
D 4 HOH 265 702 282 HOH HOH A . 
D 4 HOH 266 703 283 HOH HOH A . 
D 4 HOH 267 704 284 HOH HOH A . 
D 4 HOH 268 705 285 HOH HOH A . 
D 4 HOH 269 706 286 HOH HOH A . 
D 4 HOH 270 707 287 HOH HOH A . 
D 4 HOH 271 708 288 HOH HOH A . 
D 4 HOH 272 709 289 HOH HOH A . 
D 4 HOH 273 710 290 HOH HOH A . 
D 4 HOH 274 711 291 HOH HOH A . 
D 4 HOH 275 712 294 HOH HOH A . 
D 4 HOH 276 713 298 HOH HOH A . 
D 4 HOH 277 714 299 HOH HOH A . 
D 4 HOH 278 715 300 HOH HOH A . 
D 4 HOH 279 716 301 HOH HOH A . 
D 4 HOH 280 717 302 HOH HOH A . 
D 4 HOH 281 718 305 HOH HOH A . 
D 4 HOH 282 719 307 HOH HOH A . 
D 4 HOH 283 720 308 HOH HOH A . 
D 4 HOH 284 721 310 HOH HOH A . 
D 4 HOH 285 722 311 HOH HOH A . 
D 4 HOH 286 723 313 HOH HOH A . 
D 4 HOH 287 724 314 HOH HOH A . 
D 4 HOH 288 725 315 HOH HOH A . 
D 4 HOH 289 726 316 HOH HOH A . 
D 4 HOH 290 727 317 HOH HOH A . 
D 4 HOH 291 728 318 HOH HOH A . 
D 4 HOH 292 729 320 HOH HOH A . 
D 4 HOH 293 730 321 HOH HOH A . 
D 4 HOH 294 731 322 HOH HOH A . 
D 4 HOH 295 732 323 HOH HOH A . 
D 4 HOH 296 733 326 HOH HOH A . 
D 4 HOH 297 734 327 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-05-09 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO        .              ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK    .              ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
REFMAC       .              ?              program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 3 
PDB_EXTRACT  1.701          'Nov. 1, 2005' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
CrystalClear '(MSC/RIGAKU)' ?              ?       ?                    ?                        'data reduction'  ? ?          ? 
5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    335 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   B 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    691 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CG A MET 151 ? ? SD A MET 151 ? ? CE A MET 151 ? ? 89.72  100.20 -10.48 1.60 N 
2 1 CA A LEU 322 ? ? CB A LEU 322 ? ? CG A LEU 322 ? A 129.66 115.30 14.36  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 94  ? ? -109.49 79.07   
2 1 GLU A 190 ? ? -130.10 -59.80  
3 1 GLN A 220 ? ? 53.19   -123.53 
4 1 ILE A 274 ? ? -134.43 -39.55  
5 1 ILE A 313 ? ? 70.85   107.37  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    334 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    335 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   B 
_pdbx_validate_peptide_omega.omega            141.45 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 44  ? CG  ? A ASN 14  CG  
2  1 Y 1 A ASN 44  ? OD1 ? A ASN 14  OD1 
3  1 Y 1 A ASN 44  ? ND2 ? A ASN 14  ND2 
4  1 Y 1 A GLU 48  ? CD  ? A GLU 18  CD  
5  1 Y 1 A GLU 48  ? OE1 ? A GLU 18  OE1 
6  1 Y 1 A GLU 48  ? OE2 ? A GLU 18  OE2 
7  1 Y 1 A LYS 105 ? CG  ? A LYS 75  CG  
8  1 Y 1 A LYS 105 ? CD  ? A LYS 75  CD  
9  1 Y 1 A LYS 105 ? CE  ? A LYS 75  CE  
10 1 Y 1 A LYS 105 ? NZ  ? A LYS 75  NZ  
11 1 Y 1 A GLN 123 ? CG  ? A GLN 93  CG  
12 1 Y 1 A GLN 123 ? CD  ? A GLN 93  CD  
13 1 Y 1 A GLN 123 ? OE1 ? A GLN 93  OE1 
14 1 Y 1 A GLN 123 ? NE2 ? A GLN 93  NE2 
15 1 Y 1 A ASP 125 ? CG  ? A ASP 95  CG  
16 1 Y 1 A ASP 125 ? OD1 ? A ASP 95  OD1 
17 1 Y 1 A ASP 125 ? OD2 ? A ASP 95  OD2 
18 1 Y 1 A LEU 176 ? CG  ? A LEU 146 CG  
19 1 Y 1 A LEU 176 ? CD1 ? A LEU 146 CD1 
20 1 Y 1 A LEU 176 ? CD2 ? A LEU 146 CD2 
21 1 Y 1 A ARG 177 ? CG  ? A ARG 147 CG  
22 1 Y 1 A ARG 177 ? CD  ? A ARG 147 CD  
23 1 Y 1 A ARG 177 ? NE  ? A ARG 147 NE  
24 1 Y 1 A ARG 177 ? CZ  ? A ARG 147 CZ  
25 1 Y 1 A ARG 177 ? NH1 ? A ARG 147 NH1 
26 1 Y 1 A ARG 177 ? NH2 ? A ARG 147 NH2 
27 1 Y 1 A CYS 183 ? SG  ? A CYS 153 SG  
28 1 Y 1 A GLU 190 ? CD  ? A GLU 160 CD  
29 1 Y 1 A GLU 190 ? OE1 ? A GLU 160 OE1 
30 1 Y 1 A GLU 190 ? OE2 ? A GLU 160 OE2 
31 1 Y 1 A GLN 202 ? CD  ? A GLN 172 CD  
32 1 Y 1 A GLN 202 ? OE1 ? A GLN 172 OE1 
33 1 Y 1 A GLN 202 ? NE2 ? A GLN 172 NE2 
34 1 Y 1 A GLU 206 ? CD  ? A GLU 176 CD  
35 1 Y 1 A GLU 206 ? OE1 ? A GLU 176 OE1 
36 1 Y 1 A GLU 206 ? OE2 ? A GLU 176 OE2 
37 1 Y 1 A GLU 241 ? CD  ? A GLU 211 CD  
38 1 Y 1 A GLU 241 ? OE1 ? A GLU 211 OE1 
39 1 Y 1 A GLU 241 ? OE2 ? A GLU 211 OE2 
40 1 Y 1 A GLU 255 ? CD  ? A GLU 225 CD  
41 1 Y 1 A GLU 255 ? OE1 ? A GLU 225 OE1 
42 1 Y 1 A GLU 255 ? OE2 ? A GLU 225 OE2 
43 1 Y 1 A HIS 262 ? CG  ? A HIS 232 CG  
44 1 Y 1 A HIS 262 ? ND1 ? A HIS 232 ND1 
45 1 Y 1 A HIS 262 ? CD2 ? A HIS 232 CD2 
46 1 Y 1 A HIS 262 ? CE1 ? A HIS 232 CE1 
47 1 Y 1 A HIS 262 ? NE2 ? A HIS 232 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 31  ? A MET 1   
2  1 Y 1 A GLY 32  ? A GLY 2   
3  1 Y 1 A SER 33  ? A SER 3   
4  1 Y 1 A ASP 34  ? A ASP 4   
5  1 Y 1 A LYS 35  ? A LYS 5   
6  1 Y 1 A ILE 36  ? A ILE 6   
7  1 Y 1 A HIS 37  ? A HIS 7   
8  1 Y 1 A HIS 38  ? A HIS 8   
9  1 Y 1 A HIS 39  ? A HIS 9   
10 1 Y 1 A HIS 40  ? A HIS 10  
11 1 Y 1 A HIS 41  ? A HIS 11  
12 1 Y 1 A HIS 42  ? A HIS 12  
13 1 Y 1 A MET 43  ? A MET 13  
14 1 Y 1 A GLY 179 ? A GLY 149 
15 1 Y 1 A LYS 180 ? A LYS 150 
16 1 Y 1 A GLU 181 ? A GLU 151 
17 1 Y 1 A LYS 182 ? A LYS 152 
18 1 Y 1 A GLU 336 ? A GLU 306 
19 1 Y 1 A PRO 337 ? A PRO 307 
20 1 Y 1 A SER 338 ? A SER 308 
21 1 Y 1 A PRO 339 ? A PRO 309 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 GLYCEROL        GOL 
4 water           HOH 
#