data_2GSB
# 
_entry.id   2GSB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GSB         
RCSB  RCSB037492   
WWPDB D_1000037492 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2GSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kurosaki, C.'                                           1 
'Suetake, T.'                                            2 
'Yoshida, M.'                                            3 
'Hayashi, F.'                                            4 
'Yokoyma, S.'                                            5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the second SH2 domain of human Ras GTPase-activating protein 1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kurosaki, C.' 1 
primary 'Suetake, T.'  2 
primary 'Yoshida, M.'  3 
primary 'Hayashi, F.'  4 
primary 'Yokoyma, S.'  5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Ras GTPase-activating protein 1' 
_entity.formula_weight             13534.019 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'SH2 domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GTPase-activating protein, GAP, Ras p21 protein activator, p120GAP, RasGAP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGG
RYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQDQSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGG
RYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQDQSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ARG n 
1 9   GLU n 
1 10  GLU n 
1 11  ASP n 
1 12  PRO n 
1 13  HIS n 
1 14  GLU n 
1 15  GLY n 
1 16  LYS n 
1 17  ILE n 
1 18  TRP n 
1 19  PHE n 
1 20  HIS n 
1 21  GLY n 
1 22  LYS n 
1 23  ILE n 
1 24  SER n 
1 25  LYS n 
1 26  GLN n 
1 27  GLU n 
1 28  ALA n 
1 29  TYR n 
1 30  ASN n 
1 31  LEU n 
1 32  LEU n 
1 33  MET n 
1 34  THR n 
1 35  VAL n 
1 36  GLY n 
1 37  GLN n 
1 38  VAL n 
1 39  CYS n 
1 40  SER n 
1 41  PHE n 
1 42  LEU n 
1 43  VAL n 
1 44  ARG n 
1 45  PRO n 
1 46  SER n 
1 47  ASP n 
1 48  ASN n 
1 49  THR n 
1 50  PRO n 
1 51  GLY n 
1 52  ASP n 
1 53  TYR n 
1 54  SER n 
1 55  LEU n 
1 56  TYR n 
1 57  PHE n 
1 58  ARG n 
1 59  THR n 
1 60  ASN n 
1 61  GLU n 
1 62  ASN n 
1 63  ILE n 
1 64  GLN n 
1 65  ARG n 
1 66  PHE n 
1 67  LYS n 
1 68  ILE n 
1 69  CYS n 
1 70  PRO n 
1 71  THR n 
1 72  PRO n 
1 73  ASN n 
1 74  ASN n 
1 75  GLN n 
1 76  PHE n 
1 77  MET n 
1 78  MET n 
1 79  GLY n 
1 80  GLY n 
1 81  ARG n 
1 82  TYR n 
1 83  TYR n 
1 84  ASN n 
1 85  SER n 
1 86  ILE n 
1 87  GLY n 
1 88  ASP n 
1 89  ILE n 
1 90  ILE n 
1 91  ASP n 
1 92  HIS n 
1 93  TYR n 
1 94  ARG n 
1 95  LYS n 
1 96  GLU n 
1 97  GLN n 
1 98  ILE n 
1 99  VAL n 
1 100 GLU n 
1 101 GLY n 
1 102 TYR n 
1 103 TYR n 
1 104 LEU n 
1 105 LYS n 
1 106 GLU n 
1 107 PRO n 
1 108 VAL n 
1 109 PRO n 
1 110 MET n 
1 111 GLN n 
1 112 ASP n 
1 113 GLN n 
1 114 SER n 
1 115 GLY n 
1 116 PRO n 
1 117 SER n 
1 118 SER n 
1 119 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'RASA1, RASA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050711-17 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RASA1_HUMAN 
_struct_ref.pdbx_db_accession          P20936 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;REEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIG
DIIDHYRKEQIVEGYYLKEPVPMQDQ
;
_struct_ref.pdbx_align_begin           341 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2GSB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 113 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P20936 
_struct_ref_seq.db_align_beg                  341 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  446 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       113 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2GSB GLY A 1   ? UNP P20936 ? ? 'CLONING ARTIFACT' 1   1  
1 2GSB SER A 2   ? UNP P20936 ? ? 'CLONING ARTIFACT' 2   2  
1 2GSB SER A 3   ? UNP P20936 ? ? 'CLONING ARTIFACT' 3   3  
1 2GSB GLY A 4   ? UNP P20936 ? ? 'CLONING ARTIFACT' 4   4  
1 2GSB SER A 5   ? UNP P20936 ? ? 'CLONING ARTIFACT' 5   5  
1 2GSB SER A 6   ? UNP P20936 ? ? 'CLONING ARTIFACT' 6   6  
1 2GSB GLY A 7   ? UNP P20936 ? ? 'CLONING ARTIFACT' 7   7  
1 2GSB SER A 114 ? UNP P20936 ? ? 'CLONING ARTIFACT' 114 8  
1 2GSB GLY A 115 ? UNP P20936 ? ? 'CLONING ARTIFACT' 115 9  
1 2GSB PRO A 116 ? UNP P20936 ? ? 'CLONING ARTIFACT' 116 10 
1 2GSB SER A 117 ? UNP P20936 ? ? 'CLONING ARTIFACT' 117 11 
1 2GSB SER A 118 ? UNP P20936 ? ? 'CLONING ARTIFACT' 118 12 
1 2GSB GLY A 119 ? UNP P20936 ? ? 'CLONING ARTIFACT' 119 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '120 mM' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.27mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3, 10% D2O; 90% H2O' 
_pdbx_nmr_sample_details.solvent_system   '10% D2O; 90% H2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2GSB 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2GSB 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2GSB 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1c     Varian           1 
processing           NMRPipe 20031121 'Delaglio, F.'   2 
'data analysis'      NMRView 5.0.4    'Johnson, B. A.' 3 
'data analysis'      Kujira  0.934    'KOBAYASHI, N.'  4 
'structure solution' CYANA   2.0.17   'Guntert, P.'    5 
refinement           CYANA   2.0.17   'Guntert, P.'    6 
# 
_exptl.entry_id          2GSB 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2GSB 
_struct.title                     'Solution structure of the second SH2 domain of human Ras GTPase-activating protein 1' 
_struct.pdbx_descriptor           'Ras GTPase-activating protein 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GSB 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;GTPase-activating protein, GAP, Ras p21 protein activator, p120GAP, RasGAP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 12 ? LYS A 16 ? PRO A 12 LYS A 16 5 ? 5  
HELX_P HELX_P2 2 SER A 24 ? THR A 34 ? SER A 24 THR A 34 1 ? 11 
HELX_P HELX_P3 3 SER A 85 ? ARG A 94 ? SER A 85 ARG A 94 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 40 ? PRO A 45 ? SER A 40 PRO A 45 
A 2 TYR A 53 ? ARG A 58 ? TYR A 53 ARG A 58 
B 1 ILE A 68 ? THR A 71 ? ILE A 68 THR A 71 
B 2 GLN A 75 ? MET A 78 ? GLN A 75 MET A 78 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 42 ? N LEU A 42 O TYR A 56 ? O TYR A 56 
B 1 2 N THR A 71 ? N THR A 71 O GLN A 75 ? O GLN A 75 
# 
_database_PDB_matrix.entry_id          2GSB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2GSB 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 0.982   -31.589 -29.481 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 1.304   -30.281 -30.021 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 1.207   -29.184 -28.979 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 0.114   -28.839 -28.531 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 1.607   -32.334 -29.604 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 2.310   -30.302 -30.413 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 0.619   -30.058 -30.826 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 2.354   -28.636 -28.590 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 2.394   -27.576 -27.590 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 1.310   -26.536 -27.856 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 0.700   -26.007 -26.927 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 3.769   -26.905 -27.582 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 4.673   -27.603 -26.743 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 3.193   -28.954 -28.984 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 2.217   -28.025 -26.624 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 4.166   -26.891 -28.586 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 3.670   -25.891 -27.220 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 4.606   -28.545 -26.915 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 1.075   -26.248 -29.132 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 0.068   -25.269 -29.523 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 0.089   -24.065 -28.586 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -0.952  -23.628 -28.096 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -1.322  -25.908 -29.519 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -1.556  -26.628 -30.718 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 1.595   -26.703 -29.828 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 0.299   -24.936 -30.523 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -1.402  -26.588 -28.685 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -2.071  -25.134 -29.426 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -1.468  -26.036 -31.469 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 1.283   -23.534 -28.342 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 1.418   -22.385 -27.465 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 2.828   -22.226 -26.932 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 3.679   -23.091 -27.140 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 2.078   -23.925 -28.761 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 1.149   -21.494 -28.012 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 0.742   -22.502 -26.631 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 3.077   -21.117 -26.243 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 4.396   -20.845 -25.683 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 4.388   -21.014 -24.167 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 3.347   -21.279 -23.567 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 4.845   -19.428 -26.048 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 4.194   -18.463 -25.240 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 2.357   -20.465 -26.111 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 5.090   -21.554 -26.109 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 5.911   -19.342 -25.900 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 4.608   -19.233 -27.083 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 3.838   -17.767 -25.797 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 5.558   -20.859 -23.555 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 5.688   -20.998 -22.109 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 7.071   -20.554 -21.643 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 8.055   -20.685 -22.369 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 5.437   -22.448 -21.690 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 5.371   -22.568 -20.280 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 6.352   -20.648 -24.089 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 4.944   -20.366 -21.647 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 4.503   -22.786 -22.113 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 6.243   -23.069 -22.055 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 4.974   -21.776 -19.910 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 7.136   -20.027 -20.424 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 8.402   -19.570 -19.880 1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 8.366   -18.111 -19.472 1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 8.308   -17.792 -18.285 1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 6.319   -19.947 -19.889 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 8.647   -20.169 -19.015 1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 9.171   -19.704 -20.627 1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ARG A 1 8   ? 8.401   -17.221 -20.459 1.00 0.00 ? 8   ARG A N    1  
ATOM 67    C CA   . ARG A 1 8   ? 8.375   -15.787 -20.197 1.00 0.00 ? 8   ARG A CA   1  
ATOM 68    C C    . ARG A 1 8   ? 6.985   -15.213 -20.453 1.00 0.00 ? 8   ARG A C    1  
ATOM 69    O O    . ARG A 1 8   ? 6.560   -15.082 -21.601 1.00 0.00 ? 8   ARG A O    1  
ATOM 70    C CB   . ARG A 1 8   ? 9.405   -15.069 -21.070 1.00 0.00 ? 8   ARG A CB   1  
ATOM 71    C CG   . ARG A 1 8   ? 9.331   -15.452 -22.539 1.00 0.00 ? 8   ARG A CG   1  
ATOM 72    C CD   . ARG A 1 8   ? 9.846   -14.334 -23.433 1.00 0.00 ? 8   ARG A CD   1  
ATOM 73    N NE   . ARG A 1 8   ? 11.285  -14.135 -23.286 1.00 0.00 ? 8   ARG A NE   1  
ATOM 74    C CZ   . ARG A 1 8   ? 11.960  -13.170 -23.901 1.00 0.00 ? 8   ARG A CZ   1  
ATOM 75    N NH1  . ARG A 1 8   ? 11.329  -12.320 -24.699 1.00 0.00 ? 8   ARG A NH1  1  
ATOM 76    N NH2  . ARG A 1 8   ? 13.269  -13.053 -23.717 1.00 0.00 ? 8   ARG A NH2  1  
ATOM 77    H H    . ARG A 1 8   ? 8.448   -17.537 -21.386 1.00 0.00 ? 8   ARG A H    1  
ATOM 78    H HA   . ARG A 1 8   ? 8.628   -15.636 -19.158 1.00 0.00 ? 8   ARG A HA   1  
ATOM 79    H HB2  . ARG A 1 8   ? 9.246   -14.003 -20.991 1.00 0.00 ? 8   ARG A HB2  1  
ATOM 80    H HB3  . ARG A 1 8   ? 10.394  -15.305 -20.708 1.00 0.00 ? 8   ARG A HB3  1  
ATOM 81    H HG2  . ARG A 1 8   ? 9.932   -16.334 -22.702 1.00 0.00 ? 8   ARG A HG2  1  
ATOM 82    H HG3  . ARG A 1 8   ? 8.303   -15.661 -22.796 1.00 0.00 ? 8   ARG A HG3  1  
ATOM 83    H HD2  . ARG A 1 8   ? 9.630   -14.585 -24.461 1.00 0.00 ? 8   ARG A HD2  1  
ATOM 84    H HD3  . ARG A 1 8   ? 9.336   -13.419 -23.171 1.00 0.00 ? 8   ARG A HD3  1  
ATOM 85    H HE   . ARG A 1 8   ? 11.771  -14.752 -22.701 1.00 0.00 ? 8   ARG A HE   1  
ATOM 86    H HH11 . ARG A 1 8   ? 10.343  -12.405 -24.839 1.00 0.00 ? 8   ARG A HH11 1  
ATOM 87    H HH12 . ARG A 1 8   ? 11.839  -11.593 -25.160 1.00 0.00 ? 8   ARG A HH12 1  
ATOM 88    H HH21 . ARG A 1 8   ? 13.748  -13.692 -23.115 1.00 0.00 ? 8   ARG A HH21 1  
ATOM 89    H HH22 . ARG A 1 8   ? 13.776  -12.327 -24.180 1.00 0.00 ? 8   ARG A HH22 1  
ATOM 90    N N    . GLU A 1 9   ? 6.282   -14.874 -19.377 1.00 0.00 ? 9   GLU A N    1  
ATOM 91    C CA   . GLU A 1 9   ? 4.940   -14.316 -19.487 1.00 0.00 ? 9   GLU A CA   1  
ATOM 92    C C    . GLU A 1 9   ? 4.736   -13.186 -18.481 1.00 0.00 ? 9   GLU A C    1  
ATOM 93    O O    . GLU A 1 9   ? 5.490   -13.057 -17.517 1.00 0.00 ? 9   GLU A O    1  
ATOM 94    C CB   . GLU A 1 9   ? 3.890   -15.406 -19.264 1.00 0.00 ? 9   GLU A CB   1  
ATOM 95    C CG   . GLU A 1 9   ? 3.834   -16.435 -20.381 1.00 0.00 ? 9   GLU A CG   1  
ATOM 96    C CD   . GLU A 1 9   ? 2.931   -16.009 -21.522 1.00 0.00 ? 9   GLU A CD   1  
ATOM 97    O OE1  . GLU A 1 9   ? 3.381   -15.205 -22.366 1.00 0.00 ? 9   GLU A OE1  1  
ATOM 98    O OE2  . GLU A 1 9   ? 1.775   -16.479 -21.572 1.00 0.00 ? 9   GLU A OE2  1  
ATOM 99    H H    . GLU A 1 9   ? 6.676   -15.003 -18.489 1.00 0.00 ? 9   GLU A H    1  
ATOM 100   H HA   . GLU A 1 9   ? 4.826   -13.918 -20.484 1.00 0.00 ? 9   GLU A HA   1  
ATOM 101   H HB2  . GLU A 1 9   ? 4.112   -15.920 -18.340 1.00 0.00 ? 9   GLU A HB2  1  
ATOM 102   H HB3  . GLU A 1 9   ? 2.918   -14.942 -19.183 1.00 0.00 ? 9   GLU A HB3  1  
ATOM 103   H HG2  . GLU A 1 9   ? 4.832   -16.582 -20.768 1.00 0.00 ? 9   GLU A HG2  1  
ATOM 104   H HG3  . GLU A 1 9   ? 3.465   -17.366 -19.978 1.00 0.00 ? 9   GLU A HG3  1  
ATOM 105   N N    . GLU A 1 10  ? 3.713   -12.371 -18.715 1.00 0.00 ? 10  GLU A N    1  
ATOM 106   C CA   . GLU A 1 10  ? 3.411   -11.251 -17.831 1.00 0.00 ? 10  GLU A CA   1  
ATOM 107   C C    . GLU A 1 10  ? 2.004   -11.376 -17.254 1.00 0.00 ? 10  GLU A C    1  
ATOM 108   O O    . GLU A 1 10  ? 1.095   -11.882 -17.913 1.00 0.00 ? 10  GLU A O    1  
ATOM 109   C CB   . GLU A 1 10  ? 3.550   -9.926  -18.583 1.00 0.00 ? 10  GLU A CB   1  
ATOM 110   C CG   . GLU A 1 10  ? 4.960   -9.652  -19.079 1.00 0.00 ? 10  GLU A CG   1  
ATOM 111   C CD   . GLU A 1 10  ? 5.970   -9.571  -17.950 1.00 0.00 ? 10  GLU A CD   1  
ATOM 112   O OE1  . GLU A 1 10  ? 5.997   -8.536  -17.252 1.00 0.00 ? 10  GLU A OE1  1  
ATOM 113   O OE2  . GLU A 1 10  ? 6.732   -10.542 -17.766 1.00 0.00 ? 10  GLU A OE2  1  
ATOM 114   H H    . GLU A 1 10  ? 3.148   -12.525 -19.500 1.00 0.00 ? 10  GLU A H    1  
ATOM 115   H HA   . GLU A 1 10  ? 4.123   -11.269 -17.019 1.00 0.00 ? 10  GLU A HA   1  
ATOM 116   H HB2  . GLU A 1 10  ? 2.887   -9.939  -19.435 1.00 0.00 ? 10  GLU A HB2  1  
ATOM 117   H HB3  . GLU A 1 10  ? 3.260   -9.120  -17.925 1.00 0.00 ? 10  GLU A HB3  1  
ATOM 118   H HG2  . GLU A 1 10  ? 5.254   -10.448 -19.747 1.00 0.00 ? 10  GLU A HG2  1  
ATOM 119   H HG3  . GLU A 1 10  ? 4.964   -8.714  -19.614 1.00 0.00 ? 10  GLU A HG3  1  
ATOM 120   N N    . ASP A 1 11  ? 1.833   -10.913 -16.021 1.00 0.00 ? 11  ASP A N    1  
ATOM 121   C CA   . ASP A 1 11  ? 0.537   -10.972 -15.355 1.00 0.00 ? 11  ASP A CA   1  
ATOM 122   C C    . ASP A 1 11  ? -0.222  -9.660  -15.526 1.00 0.00 ? 11  ASP A C    1  
ATOM 123   O O    . ASP A 1 11  ? 0.365   -8.594  -15.711 1.00 0.00 ? 11  ASP A O    1  
ATOM 124   C CB   . ASP A 1 11  ? 0.717   -11.282 -13.869 1.00 0.00 ? 11  ASP A CB   1  
ATOM 125   C CG   . ASP A 1 11  ? 0.950   -12.757 -13.608 1.00 0.00 ? 11  ASP A CG   1  
ATOM 126   O OD1  . ASP A 1 11  ? 0.048   -13.564 -13.917 1.00 0.00 ? 11  ASP A OD1  1  
ATOM 127   O OD2  . ASP A 1 11  ? 2.035   -13.104 -13.098 1.00 0.00 ? 11  ASP A OD2  1  
ATOM 128   H H    . ASP A 1 11  ? 2.596   -10.521 -15.548 1.00 0.00 ? 11  ASP A H    1  
ATOM 129   H HA   . ASP A 1 11  ? -0.035  -11.766 -15.812 1.00 0.00 ? 11  ASP A HA   1  
ATOM 130   H HB2  . ASP A 1 11  ? 1.567   -10.730 -13.493 1.00 0.00 ? 11  ASP A HB2  1  
ATOM 131   H HB3  . ASP A 1 11  ? -0.170  -10.976 -13.334 1.00 0.00 ? 11  ASP A HB3  1  
ATOM 132   N N    . PRO A 1 12  ? -1.560  -9.737  -15.464 1.00 0.00 ? 12  PRO A N    1  
ATOM 133   C CA   . PRO A 1 12  ? -2.428  -8.565  -15.610 1.00 0.00 ? 12  PRO A CA   1  
ATOM 134   C C    . PRO A 1 12  ? -2.330  -7.619  -14.418 1.00 0.00 ? 12  PRO A C    1  
ATOM 135   O O    . PRO A 1 12  ? -2.318  -6.398  -14.581 1.00 0.00 ? 12  PRO A O    1  
ATOM 136   C CB   . PRO A 1 12  ? -3.831  -9.172  -15.696 1.00 0.00 ? 12  PRO A CB   1  
ATOM 137   C CG   . PRO A 1 12  ? -3.724  -10.478 -14.988 1.00 0.00 ? 12  PRO A CG   1  
ATOM 138   C CD   . PRO A 1 12  ? -2.328  -10.975 -15.246 1.00 0.00 ? 12  PRO A CD   1  
ATOM 139   H HA   . PRO A 1 12  ? -2.212  -8.022  -16.518 1.00 0.00 ? 12  PRO A HA   1  
ATOM 140   H HB2  . PRO A 1 12  ? -4.540  -8.515  -15.211 1.00 0.00 ? 12  PRO A HB2  1  
ATOM 141   H HB3  . PRO A 1 12  ? -4.106  -9.306  -16.731 1.00 0.00 ? 12  PRO A HB3  1  
ATOM 142   H HG2  . PRO A 1 12  ? -3.882  -10.336 -13.930 1.00 0.00 ? 12  PRO A HG2  1  
ATOM 143   H HG3  . PRO A 1 12  ? -4.448  -11.172 -15.388 1.00 0.00 ? 12  PRO A HG3  1  
ATOM 144   H HD2  . PRO A 1 12  ? -1.955  -11.514 -14.387 1.00 0.00 ? 12  PRO A HD2  1  
ATOM 145   H HD3  . PRO A 1 12  ? -2.307  -11.601 -16.125 1.00 0.00 ? 12  PRO A HD3  1  
ATOM 146   N N    . HIS A 1 13  ? -2.259  -8.189  -13.220 1.00 0.00 ? 13  HIS A N    1  
ATOM 147   C CA   . HIS A 1 13  ? -2.160  -7.395  -12.000 1.00 0.00 ? 13  HIS A CA   1  
ATOM 148   C C    . HIS A 1 13  ? -0.859  -6.599  -11.974 1.00 0.00 ? 13  HIS A C    1  
ATOM 149   O O    . HIS A 1 13  ? -0.809  -5.492  -11.438 1.00 0.00 ? 13  HIS A O    1  
ATOM 150   C CB   . HIS A 1 13  ? -2.242  -8.299  -10.770 1.00 0.00 ? 13  HIS A CB   1  
ATOM 151   C CG   . HIS A 1 13  ? -2.831  -7.624  -9.569  1.00 0.00 ? 13  HIS A CG   1  
ATOM 152   N ND1  . HIS A 1 13  ? -3.780  -8.216  -8.763  1.00 0.00 ? 13  HIS A ND1  1  
ATOM 153   C CD2  . HIS A 1 13  ? -2.598  -6.401  -9.038  1.00 0.00 ? 13  HIS A CD2  1  
ATOM 154   C CE1  . HIS A 1 13  ? -4.107  -7.386  -7.789  1.00 0.00 ? 13  HIS A CE1  1  
ATOM 155   N NE2  . HIS A 1 13  ? -3.404  -6.277  -7.933  1.00 0.00 ? 13  HIS A NE2  1  
ATOM 156   H H    . HIS A 1 13  ? -2.273  -9.166  -13.154 1.00 0.00 ? 13  HIS A H    1  
ATOM 157   H HA   . HIS A 1 13  ? -2.990  -6.705  -11.985 1.00 0.00 ? 13  HIS A HA   1  
ATOM 158   H HB2  . HIS A 1 13  ? -2.857  -9.157  -11.002 1.00 0.00 ? 13  HIS A HB2  1  
ATOM 159   H HB3  . HIS A 1 13  ? -1.249  -8.634  -10.509 1.00 0.00 ? 13  HIS A HB3  1  
ATOM 160   H HD1  . HIS A 1 13  ? -4.159  -9.111  -8.887  1.00 0.00 ? 13  HIS A HD1  1  
ATOM 161   H HD2  . HIS A 1 13  ? -1.907  -5.659  -9.414  1.00 0.00 ? 13  HIS A HD2  1  
ATOM 162   H HE1  . HIS A 1 13  ? -4.827  -7.580  -7.007  1.00 0.00 ? 13  HIS A HE1  1  
ATOM 163   N N    . GLU A 1 14  ? 0.191   -7.170  -12.556 1.00 0.00 ? 14  GLU A N    1  
ATOM 164   C CA   . GLU A 1 14  ? 1.492   -6.513  -12.598 1.00 0.00 ? 14  GLU A CA   1  
ATOM 165   C C    . GLU A 1 14  ? 1.551   -5.494  -13.732 1.00 0.00 ? 14  GLU A C    1  
ATOM 166   O O    . GLU A 1 14  ? 2.592   -4.889  -13.985 1.00 0.00 ? 14  GLU A O    1  
ATOM 167   C CB   . GLU A 1 14  ? 2.606   -7.548  -12.769 1.00 0.00 ? 14  GLU A CB   1  
ATOM 168   C CG   . GLU A 1 14  ? 2.697   -8.540  -11.621 1.00 0.00 ? 14  GLU A CG   1  
ATOM 169   C CD   . GLU A 1 14  ? 3.899   -9.456  -11.736 1.00 0.00 ? 14  GLU A CD   1  
ATOM 170   O OE1  . GLU A 1 14  ? 4.957   -8.990  -12.210 1.00 0.00 ? 14  GLU A OE1  1  
ATOM 171   O OE2  . GLU A 1 14  ? 3.783   -10.639 -11.353 1.00 0.00 ? 14  GLU A OE2  1  
ATOM 172   H H    . GLU A 1 14  ? 0.088   -8.054  -12.967 1.00 0.00 ? 14  GLU A H    1  
ATOM 173   H HA   . GLU A 1 14  ? 1.633   -5.998  -11.660 1.00 0.00 ? 14  GLU A HA   1  
ATOM 174   H HB2  . GLU A 1 14  ? 2.431   -8.099  -13.681 1.00 0.00 ? 14  GLU A HB2  1  
ATOM 175   H HB3  . GLU A 1 14  ? 3.551   -7.032  -12.847 1.00 0.00 ? 14  GLU A HB3  1  
ATOM 176   H HG2  . GLU A 1 14  ? 2.769   -7.991  -10.694 1.00 0.00 ? 14  GLU A HG2  1  
ATOM 177   H HG3  . GLU A 1 14  ? 1.801   -9.144  -11.612 1.00 0.00 ? 14  GLU A HG3  1  
ATOM 178   N N    . GLY A 1 15  ? 0.424   -5.310  -14.414 1.00 0.00 ? 15  GLY A N    1  
ATOM 179   C CA   . GLY A 1 15  ? 0.369   -4.365  -15.514 1.00 0.00 ? 15  GLY A CA   1  
ATOM 180   C C    . GLY A 1 15  ? -0.264  -3.047  -15.114 1.00 0.00 ? 15  GLY A C    1  
ATOM 181   O O    . GLY A 1 15  ? -0.189  -2.063  -15.852 1.00 0.00 ? 15  GLY A O    1  
ATOM 182   H H    . GLY A 1 15  ? -0.376  -5.820  -14.168 1.00 0.00 ? 15  GLY A H    1  
ATOM 183   H HA2  . GLY A 1 15  ? 1.373   -4.178  -15.865 1.00 0.00 ? 15  GLY A HA2  1  
ATOM 184   H HA3  . GLY A 1 15  ? -0.208  -4.798  -16.317 1.00 0.00 ? 15  GLY A HA3  1  
ATOM 185   N N    . LYS A 1 16  ? -0.892  -3.025  -13.943 1.00 0.00 ? 16  LYS A N    1  
ATOM 186   C CA   . LYS A 1 16  ? -1.542  -1.818  -13.446 1.00 0.00 ? 16  LYS A CA   1  
ATOM 187   C C    . LYS A 1 16  ? -0.523  -0.706  -13.217 1.00 0.00 ? 16  LYS A C    1  
ATOM 188   O O    . LYS A 1 16  ? 0.627   -0.969  -12.863 1.00 0.00 ? 16  LYS A O    1  
ATOM 189   C CB   . LYS A 1 16  ? -2.288  -2.116  -12.143 1.00 0.00 ? 16  LYS A CB   1  
ATOM 190   C CG   . LYS A 1 16  ? -3.264  -3.275  -12.253 1.00 0.00 ? 16  LYS A CG   1  
ATOM 191   C CD   . LYS A 1 16  ? -4.436  -2.934  -13.157 1.00 0.00 ? 16  LYS A CD   1  
ATOM 192   C CE   . LYS A 1 16  ? -5.385  -4.113  -13.309 1.00 0.00 ? 16  LYS A CE   1  
ATOM 193   N NZ   . LYS A 1 16  ? -6.657  -3.719  -13.975 1.00 0.00 ? 16  LYS A NZ   1  
ATOM 194   H H    . LYS A 1 16  ? -0.919  -3.840  -13.400 1.00 0.00 ? 16  LYS A H    1  
ATOM 195   H HA   . LYS A 1 16  ? -2.252  -1.492  -14.191 1.00 0.00 ? 16  LYS A HA   1  
ATOM 196   H HB2  . LYS A 1 16  ? -1.567  -2.351  -11.375 1.00 0.00 ? 16  LYS A HB2  1  
ATOM 197   H HB3  . LYS A 1 16  ? -2.841  -1.235  -11.849 1.00 0.00 ? 16  LYS A HB3  1  
ATOM 198   H HG2  . LYS A 1 16  ? -2.747  -4.132  -12.660 1.00 0.00 ? 16  LYS A HG2  1  
ATOM 199   H HG3  . LYS A 1 16  ? -3.638  -3.513  -11.267 1.00 0.00 ? 16  LYS A HG3  1  
ATOM 200   H HD2  . LYS A 1 16  ? -4.978  -2.103  -12.732 1.00 0.00 ? 16  LYS A HD2  1  
ATOM 201   H HD3  . LYS A 1 16  ? -4.059  -2.659  -14.133 1.00 0.00 ? 16  LYS A HD3  1  
ATOM 202   H HE2  . LYS A 1 16  ? -4.900  -4.875  -13.899 1.00 0.00 ? 16  LYS A HE2  1  
ATOM 203   H HE3  . LYS A 1 16  ? -5.609  -4.506  -12.328 1.00 0.00 ? 16  LYS A HE3  1  
ATOM 204   H HZ1  . LYS A 1 16  ? -6.704  -2.685  -14.072 1.00 0.00 ? 16  LYS A HZ1  1  
ATOM 205   H HZ2  . LYS A 1 16  ? -7.470  -4.040  -13.411 1.00 0.00 ? 16  LYS A HZ2  1  
ATOM 206   H HZ3  . LYS A 1 16  ? -6.713  -4.148  -14.920 1.00 0.00 ? 16  LYS A HZ3  1  
ATOM 207   N N    . ILE A 1 17  ? -0.953  0.535   -13.419 1.00 0.00 ? 17  ILE A N    1  
ATOM 208   C CA   . ILE A 1 17  ? -0.078  1.686   -13.232 1.00 0.00 ? 17  ILE A CA   1  
ATOM 209   C C    . ILE A 1 17  ? 0.022   2.066   -11.759 1.00 0.00 ? 17  ILE A C    1  
ATOM 210   O O    . ILE A 1 17  ? 1.015   2.651   -11.325 1.00 0.00 ? 17  ILE A O    1  
ATOM 211   C CB   . ILE A 1 17  ? -0.572  2.905   -14.033 1.00 0.00 ? 17  ILE A CB   1  
ATOM 212   C CG1  . ILE A 1 17  ? 0.430   4.055   -13.923 1.00 0.00 ? 17  ILE A CG1  1  
ATOM 213   C CG2  . ILE A 1 17  ? -1.944  3.341   -13.541 1.00 0.00 ? 17  ILE A CG2  1  
ATOM 214   C CD1  . ILE A 1 17  ? 0.305   5.074   -15.034 1.00 0.00 ? 17  ILE A CD1  1  
ATOM 215   H H    . ILE A 1 17  ? -1.880  0.680   -13.701 1.00 0.00 ? 17  ILE A H    1  
ATOM 216   H HA   . ILE A 1 17  ? 0.905   1.418   -13.592 1.00 0.00 ? 17  ILE A HA   1  
ATOM 217   H HB   . ILE A 1 17  ? -0.664  2.614   -15.069 1.00 0.00 ? 17  ILE A HB   1  
ATOM 218   H HG12 . ILE A 1 17  ? 0.279   4.568   -12.986 1.00 0.00 ? 17  ILE A HG12 1  
ATOM 219   H HG13 . ILE A 1 17  ? 1.432   3.653   -13.952 1.00 0.00 ? 17  ILE A HG13 1  
ATOM 220   H HG21 . ILE A 1 17  ? -2.703  2.718   -13.991 1.00 0.00 ? 17  ILE A HG21 1  
ATOM 221   H HG22 . ILE A 1 17  ? -1.989  3.241   -12.467 1.00 0.00 ? 17  ILE A HG22 1  
ATOM 222   H HG23 . ILE A 1 17  ? -2.115  4.371   -13.815 1.00 0.00 ? 17  ILE A HG23 1  
ATOM 223   H HD11 . ILE A 1 17  ? -0.711  5.086   -15.400 1.00 0.00 ? 17  ILE A HD11 1  
ATOM 224   H HD12 . ILE A 1 17  ? 0.565   6.052   -14.658 1.00 0.00 ? 17  ILE A HD12 1  
ATOM 225   H HD13 . ILE A 1 17  ? 0.974   4.810   -15.841 1.00 0.00 ? 17  ILE A HD13 1  
ATOM 226   N N    . TRP A 1 18  ? -1.010  1.729   -10.995 1.00 0.00 ? 18  TRP A N    1  
ATOM 227   C CA   . TRP A 1 18  ? -1.038  2.034   -9.569  1.00 0.00 ? 18  TRP A CA   1  
ATOM 228   C C    . TRP A 1 18  ? -0.343  0.940   -8.766  1.00 0.00 ? 18  TRP A C    1  
ATOM 229   O O    . TRP A 1 18  ? 0.053   1.155   -7.619  1.00 0.00 ? 18  TRP A O    1  
ATOM 230   C CB   . TRP A 1 18  ? -2.481  2.198   -9.089  1.00 0.00 ? 18  TRP A CB   1  
ATOM 231   C CG   . TRP A 1 18  ? -3.405  1.141   -9.614  1.00 0.00 ? 18  TRP A CG   1  
ATOM 232   C CD1  . TRP A 1 18  ? -4.253  1.248   -10.679 1.00 0.00 ? 18  TRP A CD1  1  
ATOM 233   C CD2  . TRP A 1 18  ? -3.575  -0.183  -9.095  1.00 0.00 ? 18  TRP A CD2  1  
ATOM 234   N NE1  . TRP A 1 18  ? -4.940  0.071   -10.853 1.00 0.00 ? 18  TRP A NE1  1  
ATOM 235   C CE2  . TRP A 1 18  ? -4.542  -0.823  -9.895  1.00 0.00 ? 18  TRP A CE2  1  
ATOM 236   C CE3  . TRP A 1 18  ? -3.004  -0.890  -8.033  1.00 0.00 ? 18  TRP A CE3  1  
ATOM 237   C CZ2  . TRP A 1 18  ? -4.948  -2.134  -9.665  1.00 0.00 ? 18  TRP A CZ2  1  
ATOM 238   C CZ3  . TRP A 1 18  ? -3.409  -2.191  -7.806  1.00 0.00 ? 18  TRP A CZ3  1  
ATOM 239   C CH2  . TRP A 1 18  ? -4.373  -2.803  -8.619  1.00 0.00 ? 18  TRP A CH2  1  
ATOM 240   H H    . TRP A 1 18  ? -1.773  1.264   -11.400 1.00 0.00 ? 18  TRP A H    1  
ATOM 241   H HA   . TRP A 1 18  ? -0.510  2.964   -9.420  1.00 0.00 ? 18  TRP A HA   1  
ATOM 242   H HB2  . TRP A 1 18  ? -2.502  2.154   -8.011  1.00 0.00 ? 18  TRP A HB2  1  
ATOM 243   H HB3  . TRP A 1 18  ? -2.853  3.159   -9.415  1.00 0.00 ? 18  TRP A HB3  1  
ATOM 244   H HD1  . TRP A 1 18  ? -4.358  2.135   -11.285 1.00 0.00 ? 18  TRP A HD1  1  
ATOM 245   H HE1  . TRP A 1 18  ? -5.606  -0.100  -11.552 1.00 0.00 ? 18  TRP A HE1  1  
ATOM 246   H HE3  . TRP A 1 18  ? -2.260  -0.436  -7.396  1.00 0.00 ? 18  TRP A HE3  1  
ATOM 247   H HZ2  . TRP A 1 18  ? -5.690  -2.620  -10.282 1.00 0.00 ? 18  TRP A HZ2  1  
ATOM 248   H HZ3  . TRP A 1 18  ? -2.979  -2.754  -6.990  1.00 0.00 ? 18  TRP A HZ3  1  
ATOM 249   H HH2  . TRP A 1 18  ? -4.659  -3.821  -8.404  1.00 0.00 ? 18  TRP A HH2  1  
ATOM 250   N N    . PHE A 1 19  ? -0.197  -0.233  -9.373  1.00 0.00 ? 19  PHE A N    1  
ATOM 251   C CA   . PHE A 1 19  ? 0.450   -1.361  -8.712  1.00 0.00 ? 19  PHE A CA   1  
ATOM 252   C C    . PHE A 1 19  ? 1.968   -1.221  -8.760  1.00 0.00 ? 19  PHE A C    1  
ATOM 253   O O    . PHE A 1 19  ? 2.523   -0.679  -9.717  1.00 0.00 ? 19  PHE A O    1  
ATOM 254   C CB   . PHE A 1 19  ? 0.026   -2.676  -9.370  1.00 0.00 ? 19  PHE A CB   1  
ATOM 255   C CG   . PHE A 1 19  ? 0.661   -3.888  -8.751  1.00 0.00 ? 19  PHE A CG   1  
ATOM 256   C CD1  . PHE A 1 19  ? 0.276   -4.321  -7.493  1.00 0.00 ? 19  PHE A CD1  1  
ATOM 257   C CD2  . PHE A 1 19  ? 1.643   -4.594  -9.427  1.00 0.00 ? 19  PHE A CD2  1  
ATOM 258   C CE1  . PHE A 1 19  ? 0.860   -5.435  -6.920  1.00 0.00 ? 19  PHE A CE1  1  
ATOM 259   C CE2  . PHE A 1 19  ? 2.230   -5.709  -8.860  1.00 0.00 ? 19  PHE A CE2  1  
ATOM 260   C CZ   . PHE A 1 19  ? 1.837   -6.131  -7.605  1.00 0.00 ? 19  PHE A CZ   1  
ATOM 261   H H    . PHE A 1 19  ? -0.533  -0.343  -10.287 1.00 0.00 ? 19  PHE A H    1  
ATOM 262   H HA   . PHE A 1 19  ? 0.133   -1.366  -7.681  1.00 0.00 ? 19  PHE A HA   1  
ATOM 263   H HB2  . PHE A 1 19  ? -1.045  -2.783  -9.286  1.00 0.00 ? 19  PHE A HB2  1  
ATOM 264   H HB3  . PHE A 1 19  ? 0.301   -2.652  -10.414 1.00 0.00 ? 19  PHE A HB3  1  
ATOM 265   H HD1  . PHE A 1 19  ? -0.489  -3.779  -6.956  1.00 0.00 ? 19  PHE A HD1  1  
ATOM 266   H HD2  . PHE A 1 19  ? 1.951   -4.264  -10.410 1.00 0.00 ? 19  PHE A HD2  1  
ATOM 267   H HE1  . PHE A 1 19  ? 0.550   -5.764  -5.939  1.00 0.00 ? 19  PHE A HE1  1  
ATOM 268   H HE2  . PHE A 1 19  ? 2.993   -6.251  -9.399  1.00 0.00 ? 19  PHE A HE2  1  
ATOM 269   H HZ   . PHE A 1 19  ? 2.294   -7.002  -7.160  1.00 0.00 ? 19  PHE A HZ   1  
ATOM 270   N N    . HIS A 1 20  ? 2.635   -1.713  -7.721  1.00 0.00 ? 20  HIS A N    1  
ATOM 271   C CA   . HIS A 1 20  ? 4.090   -1.643  -7.644  1.00 0.00 ? 20  HIS A CA   1  
ATOM 272   C C    . HIS A 1 20  ? 4.663   -2.917  -7.030  1.00 0.00 ? 20  HIS A C    1  
ATOM 273   O O    . HIS A 1 20  ? 4.255   -3.334  -5.946  1.00 0.00 ? 20  HIS A O    1  
ATOM 274   C CB   . HIS A 1 20  ? 4.521   -0.429  -6.821  1.00 0.00 ? 20  HIS A CB   1  
ATOM 275   C CG   . HIS A 1 20  ? 4.499   0.855   -7.592  1.00 0.00 ? 20  HIS A CG   1  
ATOM 276   N ND1  . HIS A 1 20  ? 5.643   1.492   -8.025  1.00 0.00 ? 20  HIS A ND1  1  
ATOM 277   C CD2  . HIS A 1 20  ? 3.463   1.620   -8.009  1.00 0.00 ? 20  HIS A CD2  1  
ATOM 278   C CE1  . HIS A 1 20  ? 5.312   2.594   -8.674  1.00 0.00 ? 20  HIS A CE1  1  
ATOM 279   N NE2  . HIS A 1 20  ? 3.995   2.695   -8.679  1.00 0.00 ? 20  HIS A NE2  1  
ATOM 280   H H    . HIS A 1 20  ? 2.137   -2.133  -6.989  1.00 0.00 ? 20  HIS A H    1  
ATOM 281   H HA   . HIS A 1 20  ? 4.471   -1.540  -8.648  1.00 0.00 ? 20  HIS A HA   1  
ATOM 282   H HB2  . HIS A 1 20  ? 3.855   -0.319  -5.977  1.00 0.00 ? 20  HIS A HB2  1  
ATOM 283   H HB3  . HIS A 1 20  ? 5.527   -0.584  -6.461  1.00 0.00 ? 20  HIS A HB3  1  
ATOM 284   H HD1  . HIS A 1 20  ? 6.561   1.183   -7.878  1.00 0.00 ? 20  HIS A HD1  1  
ATOM 285   H HD2  . HIS A 1 20  ? 2.413   1.423   -7.846  1.00 0.00 ? 20  HIS A HD2  1  
ATOM 286   H HE1  . HIS A 1 20  ? 6.000   3.294   -9.124  1.00 0.00 ? 20  HIS A HE1  1  
ATOM 287   N N    . GLY A 1 21  ? 5.611   -3.532  -7.731  1.00 0.00 ? 21  GLY A N    1  
ATOM 288   C CA   . GLY A 1 21  ? 6.223   -4.753  -7.239  1.00 0.00 ? 21  GLY A CA   1  
ATOM 289   C C    . GLY A 1 21  ? 7.729   -4.755  -7.411  1.00 0.00 ? 21  GLY A C    1  
ATOM 290   O O    . GLY A 1 21  ? 8.459   -5.248  -6.550  1.00 0.00 ? 21  GLY A O    1  
ATOM 291   H H    . GLY A 1 21  ? 5.896   -3.154  -8.589  1.00 0.00 ? 21  GLY A H    1  
ATOM 292   H HA2  . GLY A 1 21  ? 5.990   -4.862  -6.190  1.00 0.00 ? 21  GLY A HA2  1  
ATOM 293   H HA3  . GLY A 1 21  ? 5.810   -5.592  -7.779  1.00 0.00 ? 21  GLY A HA3  1  
ATOM 294   N N    . LYS A 1 22  ? 8.197   -4.205  -8.526  1.00 0.00 ? 22  LYS A N    1  
ATOM 295   C CA   . LYS A 1 22  ? 9.626   -4.145  -8.809  1.00 0.00 ? 22  LYS A CA   1  
ATOM 296   C C    . LYS A 1 22  ? 10.367  -3.386  -7.713  1.00 0.00 ? 22  LYS A C    1  
ATOM 297   O O    . LYS A 1 22  ? 11.469  -3.767  -7.318  1.00 0.00 ? 22  LYS A O    1  
ATOM 298   C CB   . LYS A 1 22  ? 9.871   -3.476  -10.163 1.00 0.00 ? 22  LYS A CB   1  
ATOM 299   C CG   . LYS A 1 22  ? 9.591   -4.382  -11.349 1.00 0.00 ? 22  LYS A CG   1  
ATOM 300   C CD   . LYS A 1 22  ? 9.540   -3.598  -12.650 1.00 0.00 ? 22  LYS A CD   1  
ATOM 301   C CE   . LYS A 1 22  ? 10.936  -3.293  -13.172 1.00 0.00 ? 22  LYS A CE   1  
ATOM 302   N NZ   . LYS A 1 22  ? 10.897  -2.517  -14.442 1.00 0.00 ? 22  LYS A NZ   1  
ATOM 303   H H    . LYS A 1 22  ? 7.565   -3.828  -9.174  1.00 0.00 ? 22  LYS A H    1  
ATOM 304   H HA   . LYS A 1 22  ? 10.000  -5.158  -8.845  1.00 0.00 ? 22  LYS A HA   1  
ATOM 305   H HB2  . LYS A 1 22  ? 9.234   -2.607  -10.242 1.00 0.00 ? 22  LYS A HB2  1  
ATOM 306   H HB3  . LYS A 1 22  ? 10.903  -3.160  -10.214 1.00 0.00 ? 22  LYS A HB3  1  
ATOM 307   H HG2  . LYS A 1 22  ? 10.374  -5.123  -11.418 1.00 0.00 ? 22  LYS A HG2  1  
ATOM 308   H HG3  . LYS A 1 22  ? 8.640   -4.874  -11.199 1.00 0.00 ? 22  LYS A HG3  1  
ATOM 309   H HD2  . LYS A 1 22  ? 9.011   -4.180  -13.390 1.00 0.00 ? 22  LYS A HD2  1  
ATOM 310   H HD3  . LYS A 1 22  ? 9.018   -2.668  -12.479 1.00 0.00 ? 22  LYS A HD3  1  
ATOM 311   H HE2  . LYS A 1 22  ? 11.468  -2.722  -12.427 1.00 0.00 ? 22  LYS A HE2  1  
ATOM 312   H HE3  . LYS A 1 22  ? 11.453  -4.226  -13.346 1.00 0.00 ? 22  LYS A HE3  1  
ATOM 313   H HZ1  . LYS A 1 22  ? 11.702  -2.779  -15.046 1.00 0.00 ? 22  LYS A HZ1  1  
ATOM 314   H HZ2  . LYS A 1 22  ? 10.947  -1.498  -14.239 1.00 0.00 ? 22  LYS A HZ2  1  
ATOM 315   H HZ3  . LYS A 1 22  ? 10.014  -2.714  -14.954 1.00 0.00 ? 22  LYS A HZ3  1  
ATOM 316   N N    . ILE A 1 23  ? 9.754   -2.313  -7.225  1.00 0.00 ? 23  ILE A N    1  
ATOM 317   C CA   . ILE A 1 23  ? 10.355  -1.503  -6.173  1.00 0.00 ? 23  ILE A CA   1  
ATOM 318   C C    . ILE A 1 23  ? 10.289  -2.214  -4.826  1.00 0.00 ? 23  ILE A C    1  
ATOM 319   O O    . ILE A 1 23  ? 9.853   -3.362  -4.739  1.00 0.00 ? 23  ILE A O    1  
ATOM 320   C CB   . ILE A 1 23  ? 9.662   -0.133  -6.052  1.00 0.00 ? 23  ILE A CB   1  
ATOM 321   C CG1  . ILE A 1 23  ? 8.232   -0.305  -5.535  1.00 0.00 ? 23  ILE A CG1  1  
ATOM 322   C CG2  . ILE A 1 23  ? 9.662   0.582   -7.395  1.00 0.00 ? 23  ILE A CG2  1  
ATOM 323   C CD1  . ILE A 1 23  ? 7.682   0.931   -4.856  1.00 0.00 ? 23  ILE A CD1  1  
ATOM 324   H H    . ILE A 1 23  ? 8.877   -2.060  -7.581  1.00 0.00 ? 23  ILE A H    1  
ATOM 325   H HA   . ILE A 1 23  ? 11.391  -1.338  -6.431  1.00 0.00 ? 23  ILE A HA   1  
ATOM 326   H HB   . ILE A 1 23  ? 10.221  0.468   -5.351  1.00 0.00 ? 23  ILE A HB   1  
ATOM 327   H HG12 . ILE A 1 23  ? 7.583   -0.544  -6.362  1.00 0.00 ? 23  ILE A HG12 1  
ATOM 328   H HG13 . ILE A 1 23  ? 8.211   -1.114  -4.820  1.00 0.00 ? 23  ILE A HG13 1  
ATOM 329   H HG21 . ILE A 1 23  ? 8.908   1.355   -7.392  1.00 0.00 ? 23  ILE A HG21 1  
ATOM 330   H HG22 . ILE A 1 23  ? 10.631  1.027   -7.565  1.00 0.00 ? 23  ILE A HG22 1  
ATOM 331   H HG23 . ILE A 1 23  ? 9.448   -0.127  -8.181  1.00 0.00 ? 23  ILE A HG23 1  
ATOM 332   H HD11 . ILE A 1 23  ? 6.857   0.654   -4.217  1.00 0.00 ? 23  ILE A HD11 1  
ATOM 333   H HD12 . ILE A 1 23  ? 8.458   1.392   -4.264  1.00 0.00 ? 23  ILE A HD12 1  
ATOM 334   H HD13 . ILE A 1 23  ? 7.338   1.629   -5.605  1.00 0.00 ? 23  ILE A HD13 1  
ATOM 335   N N    . SER A 1 24  ? 10.724  -1.524  -3.777  1.00 0.00 ? 24  SER A N    1  
ATOM 336   C CA   . SER A 1 24  ? 10.717  -2.091  -2.433  1.00 0.00 ? 24  SER A CA   1  
ATOM 337   C C    . SER A 1 24  ? 9.918   -1.210  -1.477  1.00 0.00 ? 24  SER A C    1  
ATOM 338   O O    . SER A 1 24  ? 9.357   -0.190  -1.876  1.00 0.00 ? 24  SER A O    1  
ATOM 339   C CB   . SER A 1 24  ? 12.148  -2.254  -1.918  1.00 0.00 ? 24  SER A CB   1  
ATOM 340   O OG   . SER A 1 24  ? 12.222  -3.267  -0.929  1.00 0.00 ? 24  SER A OG   1  
ATOM 341   H H    . SER A 1 24  ? 11.061  -0.613  -3.910  1.00 0.00 ? 24  SER A H    1  
ATOM 342   H HA   . SER A 1 24  ? 10.249  -3.062  -2.485  1.00 0.00 ? 24  SER A HA   1  
ATOM 343   H HB2  . SER A 1 24  ? 12.795  -2.522  -2.739  1.00 0.00 ? 24  SER A HB2  1  
ATOM 344   H HB3  . SER A 1 24  ? 12.481  -1.321  -1.486  1.00 0.00 ? 24  SER A HB3  1  
ATOM 345   H HG   . SER A 1 24  ? 12.688  -2.930  -0.160  1.00 0.00 ? 24  SER A HG   1  
ATOM 346   N N    . LYS A 1 25  ? 9.870   -1.613  -0.212  1.00 0.00 ? 25  LYS A N    1  
ATOM 347   C CA   . LYS A 1 25  ? 9.142   -0.863  0.804   1.00 0.00 ? 25  LYS A CA   1  
ATOM 348   C C    . LYS A 1 25  ? 9.790   0.496   1.046   1.00 0.00 ? 25  LYS A C    1  
ATOM 349   O O    . LYS A 1 25  ? 9.110   1.522   1.072   1.00 0.00 ? 25  LYS A O    1  
ATOM 350   C CB   . LYS A 1 25  ? 9.089   -1.655  2.113   1.00 0.00 ? 25  LYS A CB   1  
ATOM 351   C CG   . LYS A 1 25  ? 8.555   -0.853  3.287   1.00 0.00 ? 25  LYS A CG   1  
ATOM 352   C CD   . LYS A 1 25  ? 8.417   -1.713  4.532   1.00 0.00 ? 25  LYS A CD   1  
ATOM 353   C CE   . LYS A 1 25  ? 9.758   -1.921  5.219   1.00 0.00 ? 25  LYS A CE   1  
ATOM 354   N NZ   . LYS A 1 25  ? 9.615   -2.658  6.505   1.00 0.00 ? 25  LYS A NZ   1  
ATOM 355   H H    . LYS A 1 25  ? 10.338  -2.436  0.046   1.00 0.00 ? 25  LYS A H    1  
ATOM 356   H HA   . LYS A 1 25  ? 8.135   -0.710  0.445   1.00 0.00 ? 25  LYS A HA   1  
ATOM 357   H HB2  . LYS A 1 25  ? 8.453   -2.516  1.973   1.00 0.00 ? 25  LYS A HB2  1  
ATOM 358   H HB3  . LYS A 1 25  ? 10.086  -1.991  2.357   1.00 0.00 ? 25  LYS A HB3  1  
ATOM 359   H HG2  . LYS A 1 25  ? 9.237   -0.042  3.497   1.00 0.00 ? 25  LYS A HG2  1  
ATOM 360   H HG3  . LYS A 1 25  ? 7.585   -0.453  3.028   1.00 0.00 ? 25  LYS A HG3  1  
ATOM 361   H HD2  . LYS A 1 25  ? 7.743   -1.227  5.223   1.00 0.00 ? 25  LYS A HD2  1  
ATOM 362   H HD3  . LYS A 1 25  ? 8.014   -2.676  4.251   1.00 0.00 ? 25  LYS A HD3  1  
ATOM 363   H HE2  . LYS A 1 25  ? 10.402  -2.484  4.560   1.00 0.00 ? 25  LYS A HE2  1  
ATOM 364   H HE3  . LYS A 1 25  ? 10.200  -0.955  5.414   1.00 0.00 ? 25  LYS A HE3  1  
ATOM 365   H HZ1  . LYS A 1 25  ? 8.679   -2.473  6.920   1.00 0.00 ? 25  LYS A HZ1  1  
ATOM 366   H HZ2  . LYS A 1 25  ? 10.347  -2.349  7.177   1.00 0.00 ? 25  LYS A HZ2  1  
ATOM 367   H HZ3  . LYS A 1 25  ? 9.716   -3.680  6.344   1.00 0.00 ? 25  LYS A HZ3  1  
ATOM 368   N N    . GLN A 1 26  ? 11.108  0.496   1.221   1.00 0.00 ? 26  GLN A N    1  
ATOM 369   C CA   . GLN A 1 26  ? 11.847  1.730   1.460   1.00 0.00 ? 26  GLN A CA   1  
ATOM 370   C C    . GLN A 1 26  ? 11.728  2.675   0.269   1.00 0.00 ? 26  GLN A C    1  
ATOM 371   O O    . GLN A 1 26  ? 11.443  3.860   0.432   1.00 0.00 ? 26  GLN A O    1  
ATOM 372   C CB   . GLN A 1 26  ? 13.319  1.422   1.737   1.00 0.00 ? 26  GLN A CB   1  
ATOM 373   C CG   . GLN A 1 26  ? 13.609  1.094   3.193   1.00 0.00 ? 26  GLN A CG   1  
ATOM 374   C CD   . GLN A 1 26  ? 12.709  0.000   3.735   1.00 0.00 ? 26  GLN A CD   1  
ATOM 375   O OE1  . GLN A 1 26  ? 11.489  0.154   3.787   1.00 0.00 ? 26  GLN A OE1  1  
ATOM 376   N NE2  . GLN A 1 26  ? 13.309  -1.113  4.141   1.00 0.00 ? 26  GLN A NE2  1  
ATOM 377   H H    . GLN A 1 26  ? 11.594  -0.354  1.189   1.00 0.00 ? 26  GLN A H    1  
ATOM 378   H HA   . GLN A 1 26  ? 11.419  2.209   2.328   1.00 0.00 ? 26  GLN A HA   1  
ATOM 379   H HB2  . GLN A 1 26  ? 13.618  0.578   1.134   1.00 0.00 ? 26  GLN A HB2  1  
ATOM 380   H HB3  . GLN A 1 26  ? 13.913  2.280   1.459   1.00 0.00 ? 26  GLN A HB3  1  
ATOM 381   H HG2  . GLN A 1 26  ? 14.635  0.769   3.278   1.00 0.00 ? 26  GLN A HG2  1  
ATOM 382   H HG3  . GLN A 1 26  ? 13.464  1.985   3.785   1.00 0.00 ? 26  GLN A HG3  1  
ATOM 383   H HE21 . GLN A 1 26  ? 14.286  -1.164  4.071   1.00 0.00 ? 26  GLN A HE21 1  
ATOM 384   H HE22 . GLN A 1 26  ? 12.752  -1.835  4.497   1.00 0.00 ? 26  GLN A HE22 1  
ATOM 385   N N    . GLU A 1 27  ? 11.949  2.140   -0.929  1.00 0.00 ? 27  GLU A N    1  
ATOM 386   C CA   . GLU A 1 27  ? 11.868  2.938   -2.147  1.00 0.00 ? 27  GLU A CA   1  
ATOM 387   C C    . GLU A 1 27  ? 10.504  3.613   -2.265  1.00 0.00 ? 27  GLU A C    1  
ATOM 388   O O    . GLU A 1 27  ? 10.415  4.818   -2.496  1.00 0.00 ? 27  GLU A O    1  
ATOM 389   C CB   . GLU A 1 27  ? 12.123  2.061   -3.374  1.00 0.00 ? 27  GLU A CB   1  
ATOM 390   C CG   . GLU A 1 27  ? 13.590  1.726   -3.589  1.00 0.00 ? 27  GLU A CG   1  
ATOM 391   C CD   . GLU A 1 27  ? 13.788  0.424   -4.340  1.00 0.00 ? 27  GLU A CD   1  
ATOM 392   O OE1  . GLU A 1 27  ? 13.584  0.414   -5.572  1.00 0.00 ? 27  GLU A OE1  1  
ATOM 393   O OE2  . GLU A 1 27  ? 14.146  -0.584  -3.697  1.00 0.00 ? 27  GLU A OE2  1  
ATOM 394   H H    . GLU A 1 27  ? 12.172  1.188   -0.994  1.00 0.00 ? 27  GLU A H    1  
ATOM 395   H HA   . GLU A 1 27  ? 12.630  3.700   -2.096  1.00 0.00 ? 27  GLU A HA   1  
ATOM 396   H HB2  . GLU A 1 27  ? 11.577  1.136   -3.262  1.00 0.00 ? 27  GLU A HB2  1  
ATOM 397   H HB3  . GLU A 1 27  ? 11.762  2.577   -4.252  1.00 0.00 ? 27  GLU A HB3  1  
ATOM 398   H HG2  . GLU A 1 27  ? 14.049  2.523   -4.154  1.00 0.00 ? 27  GLU A HG2  1  
ATOM 399   H HG3  . GLU A 1 27  ? 14.072  1.646   -2.625  1.00 0.00 ? 27  GLU A HG3  1  
ATOM 400   N N    . ALA A 1 28  ? 9.445   2.826   -2.107  1.00 0.00 ? 28  ALA A N    1  
ATOM 401   C CA   . ALA A 1 28  ? 8.087   3.346   -2.194  1.00 0.00 ? 28  ALA A CA   1  
ATOM 402   C C    . ALA A 1 28  ? 7.967   4.691   -1.486  1.00 0.00 ? 28  ALA A C    1  
ATOM 403   O O    . ALA A 1 28  ? 7.334   5.617   -1.993  1.00 0.00 ? 28  ALA A O    1  
ATOM 404   C CB   . ALA A 1 28  ? 7.100   2.348   -1.606  1.00 0.00 ? 28  ALA A CB   1  
ATOM 405   H H    . ALA A 1 28  ? 9.581   1.872   -1.925  1.00 0.00 ? 28  ALA A H    1  
ATOM 406   H HA   . ALA A 1 28  ? 7.846   3.478   -3.239  1.00 0.00 ? 28  ALA A HA   1  
ATOM 407   H HB1  . ALA A 1 28  ? 6.538   2.823   -0.815  1.00 0.00 ? 28  ALA A HB1  1  
ATOM 408   H HB2  . ALA A 1 28  ? 6.424   2.013   -2.377  1.00 0.00 ? 28  ALA A HB2  1  
ATOM 409   H HB3  . ALA A 1 28  ? 7.639   1.502   -1.206  1.00 0.00 ? 28  ALA A HB3  1  
ATOM 410   N N    . TYR A 1 29  ? 8.579   4.792   -0.311  1.00 0.00 ? 29  TYR A N    1  
ATOM 411   C CA   . TYR A 1 29  ? 8.538   6.024   0.469   1.00 0.00 ? 29  TYR A CA   1  
ATOM 412   C C    . TYR A 1 29  ? 9.133   7.187   -0.319  1.00 0.00 ? 29  TYR A C    1  
ATOM 413   O O    . TYR A 1 29  ? 8.444   8.157   -0.630  1.00 0.00 ? 29  TYR A O    1  
ATOM 414   C CB   . TYR A 1 29  ? 9.296   5.844   1.785   1.00 0.00 ? 29  TYR A CB   1  
ATOM 415   C CG   . TYR A 1 29  ? 8.455   5.249   2.892   1.00 0.00 ? 29  TYR A CG   1  
ATOM 416   C CD1  . TYR A 1 29  ? 7.467   5.998   3.519   1.00 0.00 ? 29  TYR A CD1  1  
ATOM 417   C CD2  . TYR A 1 29  ? 8.649   3.939   3.311   1.00 0.00 ? 29  TYR A CD2  1  
ATOM 418   C CE1  . TYR A 1 29  ? 6.697   5.460   4.531   1.00 0.00 ? 29  TYR A CE1  1  
ATOM 419   C CE2  . TYR A 1 29  ? 7.882   3.391   4.321   1.00 0.00 ? 29  TYR A CE2  1  
ATOM 420   C CZ   . TYR A 1 29  ? 6.908   4.156   4.928   1.00 0.00 ? 29  TYR A CZ   1  
ATOM 421   O OH   . TYR A 1 29  ? 6.143   3.614   5.936   1.00 0.00 ? 29  TYR A OH   1  
ATOM 422   H H    . TYR A 1 29  ? 9.068   4.019   0.042   1.00 0.00 ? 29  TYR A H    1  
ATOM 423   H HA   . TYR A 1 29  ? 7.504   6.244   0.688   1.00 0.00 ? 29  TYR A HA   1  
ATOM 424   H HB2  . TYR A 1 29  ? 10.138  5.189   1.621   1.00 0.00 ? 29  TYR A HB2  1  
ATOM 425   H HB3  . TYR A 1 29  ? 9.654   6.806   2.120   1.00 0.00 ? 29  TYR A HB3  1  
ATOM 426   H HD1  . TYR A 1 29  ? 7.305   7.020   3.206   1.00 0.00 ? 29  TYR A HD1  1  
ATOM 427   H HD2  . TYR A 1 29  ? 9.413   3.343   2.833   1.00 0.00 ? 29  TYR A HD2  1  
ATOM 428   H HE1  . TYR A 1 29  ? 5.934   6.058   5.007   1.00 0.00 ? 29  TYR A HE1  1  
ATOM 429   H HE2  . TYR A 1 29  ? 8.047   2.370   4.633   1.00 0.00 ? 29  TYR A HE2  1  
ATOM 430   H HH   . TYR A 1 29  ? 5.916   4.300   6.569   1.00 0.00 ? 29  TYR A HH   1  
ATOM 431   N N    . ASN A 1 30  ? 10.419  7.080   -0.639  1.00 0.00 ? 30  ASN A N    1  
ATOM 432   C CA   . ASN A 1 30  ? 11.109  8.122   -1.391  1.00 0.00 ? 30  ASN A CA   1  
ATOM 433   C C    . ASN A 1 30  ? 10.470  8.317   -2.762  1.00 0.00 ? 30  ASN A C    1  
ATOM 434   O O    . ASN A 1 30  ? 10.623  9.367   -3.387  1.00 0.00 ? 30  ASN A O    1  
ATOM 435   C CB   . ASN A 1 30  ? 12.589  7.770   -1.551  1.00 0.00 ? 30  ASN A CB   1  
ATOM 436   C CG   . ASN A 1 30  ? 13.402  8.926   -2.101  1.00 0.00 ? 30  ASN A CG   1  
ATOM 437   O OD1  . ASN A 1 30  ? 13.211  10.077  -1.708  1.00 0.00 ? 30  ASN A OD1  1  
ATOM 438   N ND2  . ASN A 1 30  ? 14.315  8.624   -3.016  1.00 0.00 ? 30  ASN A ND2  1  
ATOM 439   H H    . ASN A 1 30  ? 10.916  6.282   -0.363  1.00 0.00 ? 30  ASN A H    1  
ATOM 440   H HA   . ASN A 1 30  ? 11.025  9.043   -0.833  1.00 0.00 ? 30  ASN A HA   1  
ATOM 441   H HB2  . ASN A 1 30  ? 12.994  7.497   -0.587  1.00 0.00 ? 30  ASN A HB2  1  
ATOM 442   H HB3  . ASN A 1 30  ? 12.683  6.933   -2.226  1.00 0.00 ? 30  ASN A HB3  1  
ATOM 443   H HD21 . ASN A 1 30  ? 14.412  7.685   -3.282  1.00 0.00 ? 30  ASN A HD21 1  
ATOM 444   H HD22 . ASN A 1 30  ? 14.856  9.352   -3.388  1.00 0.00 ? 30  ASN A HD22 1  
ATOM 445   N N    . LEU A 1 31  ? 9.752   7.299   -3.225  1.00 0.00 ? 31  LEU A N    1  
ATOM 446   C CA   . LEU A 1 31  ? 9.089   7.357   -4.522  1.00 0.00 ? 31  LEU A CA   1  
ATOM 447   C C    . LEU A 1 31  ? 7.886   8.294   -4.477  1.00 0.00 ? 31  LEU A C    1  
ATOM 448   O O    . LEU A 1 31  ? 7.790   9.238   -5.262  1.00 0.00 ? 31  LEU A O    1  
ATOM 449   C CB   . LEU A 1 31  ? 8.644   5.959   -4.953  1.00 0.00 ? 31  LEU A CB   1  
ATOM 450   C CG   . LEU A 1 31  ? 9.716   5.086   -5.608  1.00 0.00 ? 31  LEU A CG   1  
ATOM 451   C CD1  . LEU A 1 31  ? 9.244   3.643   -5.705  1.00 0.00 ? 31  LEU A CD1  1  
ATOM 452   C CD2  . LEU A 1 31  ? 10.074  5.625   -6.985  1.00 0.00 ? 31  LEU A CD2  1  
ATOM 453   H H    . LEU A 1 31  ? 9.667   6.488   -2.681  1.00 0.00 ? 31  LEU A H    1  
ATOM 454   H HA   . LEU A 1 31  ? 9.799   7.738   -5.241  1.00 0.00 ? 31  LEU A HA   1  
ATOM 455   H HB2  . LEU A 1 31  ? 8.287   5.441   -4.077  1.00 0.00 ? 31  LEU A HB2  1  
ATOM 456   H HB3  . LEU A 1 31  ? 7.833   6.073   -5.658  1.00 0.00 ? 31  LEU A HB3  1  
ATOM 457   H HG   . LEU A 1 31  ? 10.608  5.104   -4.998  1.00 0.00 ? 31  LEU A HG   1  
ATOM 458   H HD11 . LEU A 1 31  ? 8.265   3.615   -6.159  1.00 0.00 ? 31  LEU A HD11 1  
ATOM 459   H HD12 . LEU A 1 31  ? 9.194   3.214   -4.715  1.00 0.00 ? 31  LEU A HD12 1  
ATOM 460   H HD13 . LEU A 1 31  ? 9.939   3.077   -6.308  1.00 0.00 ? 31  LEU A HD13 1  
ATOM 461   H HD21 . LEU A 1 31  ? 9.896   6.690   -7.012  1.00 0.00 ? 31  LEU A HD21 1  
ATOM 462   H HD22 . LEU A 1 31  ? 9.463   5.139   -7.732  1.00 0.00 ? 31  LEU A HD22 1  
ATOM 463   H HD23 . LEU A 1 31  ? 11.116  5.429   -7.189  1.00 0.00 ? 31  LEU A HD23 1  
ATOM 464   N N    . LEU A 1 32  ? 6.970   8.028   -3.551  1.00 0.00 ? 32  LEU A N    1  
ATOM 465   C CA   . LEU A 1 32  ? 5.774   8.849   -3.401  1.00 0.00 ? 32  LEU A CA   1  
ATOM 466   C C    . LEU A 1 32  ? 6.142   10.305  -3.132  1.00 0.00 ? 32  LEU A C    1  
ATOM 467   O O    . LEU A 1 32  ? 5.295   11.194  -3.211  1.00 0.00 ? 32  LEU A O    1  
ATOM 468   C CB   . LEU A 1 32  ? 4.903   8.313   -2.264  1.00 0.00 ? 32  LEU A CB   1  
ATOM 469   C CG   . LEU A 1 32  ? 4.017   7.114   -2.605  1.00 0.00 ? 32  LEU A CG   1  
ATOM 470   C CD1  . LEU A 1 32  ? 3.588   6.389   -1.338  1.00 0.00 ? 32  LEU A CD1  1  
ATOM 471   C CD2  . LEU A 1 32  ? 2.801   7.560   -3.404  1.00 0.00 ? 32  LEU A CD2  1  
ATOM 472   H H    . LEU A 1 32  ? 7.101   7.263   -2.954  1.00 0.00 ? 32  LEU A H    1  
ATOM 473   H HA   . LEU A 1 32  ? 5.218   8.796   -4.325  1.00 0.00 ? 32  LEU A HA   1  
ATOM 474   H HB2  . LEU A 1 32  ? 5.557   8.021   -1.456  1.00 0.00 ? 32  LEU A HB2  1  
ATOM 475   H HB3  . LEU A 1 32  ? 4.261   9.116   -1.932  1.00 0.00 ? 32  LEU A HB3  1  
ATOM 476   H HG   . LEU A 1 32  ? 4.580   6.419   -3.212  1.00 0.00 ? 32  LEU A HG   1  
ATOM 477   H HD11 . LEU A 1 32  ? 4.463   6.085   -0.784  1.00 0.00 ? 32  LEU A HD11 1  
ATOM 478   H HD12 . LEU A 1 32  ? 3.007   5.518   -1.601  1.00 0.00 ? 32  LEU A HD12 1  
ATOM 479   H HD13 . LEU A 1 32  ? 2.989   7.051   -0.730  1.00 0.00 ? 32  LEU A HD13 1  
ATOM 480   H HD21 . LEU A 1 32  ? 2.426   6.729   -3.983  1.00 0.00 ? 32  LEU A HD21 1  
ATOM 481   H HD22 . LEU A 1 32  ? 3.082   8.364   -4.069  1.00 0.00 ? 32  LEU A HD22 1  
ATOM 482   H HD23 . LEU A 1 32  ? 2.032   7.904   -2.727  1.00 0.00 ? 32  LEU A HD23 1  
ATOM 483   N N    . MET A 1 33  ? 7.411   10.540  -2.815  1.00 0.00 ? 33  MET A N    1  
ATOM 484   C CA   . MET A 1 33  ? 7.892   11.888  -2.538  1.00 0.00 ? 33  MET A CA   1  
ATOM 485   C C    . MET A 1 33  ? 8.527   12.505  -3.780  1.00 0.00 ? 33  MET A C    1  
ATOM 486   O O    . MET A 1 33  ? 8.553   13.727  -3.936  1.00 0.00 ? 33  MET A O    1  
ATOM 487   C CB   . MET A 1 33  ? 8.903   11.866  -1.391  1.00 0.00 ? 33  MET A CB   1  
ATOM 488   C CG   . MET A 1 33  ? 8.319   11.381  -0.074  1.00 0.00 ? 33  MET A CG   1  
ATOM 489   S SD   . MET A 1 33  ? 9.137   12.108  1.359   1.00 0.00 ? 33  MET A SD   1  
ATOM 490   C CE   . MET A 1 33  ? 8.928   13.854  1.018   1.00 0.00 ? 33  MET A CE   1  
ATOM 491   H H    . MET A 1 33  ? 8.040   9.789   -2.768  1.00 0.00 ? 33  MET A H    1  
ATOM 492   H HA   . MET A 1 33  ? 7.043   12.489  -2.246  1.00 0.00 ? 33  MET A HA   1  
ATOM 493   H HB2  . MET A 1 33  ? 9.720   11.213  -1.659  1.00 0.00 ? 33  MET A HB2  1  
ATOM 494   H HB3  . MET A 1 33  ? 9.285   12.866  -1.243  1.00 0.00 ? 33  MET A HB3  1  
ATOM 495   H HG2  . MET A 1 33  ? 7.271   11.642  -0.042  1.00 0.00 ? 33  MET A HG2  1  
ATOM 496   H HG3  . MET A 1 33  ? 8.422   10.308  -0.024  1.00 0.00 ? 33  MET A HG3  1  
ATOM 497   H HE1  . MET A 1 33  ? 8.572   14.355  1.906   1.00 0.00 ? 33  MET A HE1  1  
ATOM 498   H HE2  . MET A 1 33  ? 9.876   14.279  0.722   1.00 0.00 ? 33  MET A HE2  1  
ATOM 499   H HE3  . MET A 1 33  ? 8.211   13.982  0.220   1.00 0.00 ? 33  MET A HE3  1  
ATOM 500   N N    . THR A 1 34  ? 9.039   11.653  -4.663  1.00 0.00 ? 34  THR A N    1  
ATOM 501   C CA   . THR A 1 34  ? 9.676   12.115  -5.890  1.00 0.00 ? 34  THR A CA   1  
ATOM 502   C C    . THR A 1 34  ? 8.783   11.866  -7.100  1.00 0.00 ? 34  THR A C    1  
ATOM 503   O O    . THR A 1 34  ? 8.252   12.803  -7.696  1.00 0.00 ? 34  THR A O    1  
ATOM 504   C CB   . THR A 1 34  ? 11.032  11.419  -6.115  1.00 0.00 ? 34  THR A CB   1  
ATOM 505   O OG1  . THR A 1 34  ? 10.871  9.998   -6.044  1.00 0.00 ? 34  THR A OG1  1  
ATOM 506   C CG2  . THR A 1 34  ? 12.051  11.872  -5.080  1.00 0.00 ? 34  THR A CG2  1  
ATOM 507   H H    . THR A 1 34  ? 8.988   10.691  -4.482  1.00 0.00 ? 34  THR A H    1  
ATOM 508   H HA   . THR A 1 34  ? 9.851   13.177  -5.796  1.00 0.00 ? 34  THR A HA   1  
ATOM 509   H HB   . THR A 1 34  ? 11.396  11.684  -7.097  1.00 0.00 ? 34  THR A HB   1  
ATOM 510   H HG1  . THR A 1 34  ? 11.683  9.600   -5.720  1.00 0.00 ? 34  THR A HG1  1  
ATOM 511   H HG21 . THR A 1 34  ? 12.896  11.200  -5.090  1.00 0.00 ? 34  THR A HG21 1  
ATOM 512   H HG22 . THR A 1 34  ? 11.596  11.866  -4.101  1.00 0.00 ? 34  THR A HG22 1  
ATOM 513   H HG23 . THR A 1 34  ? 12.383  12.871  -5.317  1.00 0.00 ? 34  THR A HG23 1  
ATOM 514   N N    . VAL A 1 35  ? 8.619   10.596  -7.457  1.00 0.00 ? 35  VAL A N    1  
ATOM 515   C CA   . VAL A 1 35  ? 7.788   10.224  -8.596  1.00 0.00 ? 35  VAL A CA   1  
ATOM 516   C C    . VAL A 1 35  ? 6.323   10.557  -8.339  1.00 0.00 ? 35  VAL A C    1  
ATOM 517   O O    . VAL A 1 35  ? 5.544   10.742  -9.273  1.00 0.00 ? 35  VAL A O    1  
ATOM 518   C CB   . VAL A 1 35  ? 7.913   8.722   -8.915  1.00 0.00 ? 35  VAL A CB   1  
ATOM 519   C CG1  . VAL A 1 35  ? 9.366   8.348   -9.164  1.00 0.00 ? 35  VAL A CG1  1  
ATOM 520   C CG2  . VAL A 1 35  ? 7.325   7.887   -7.787  1.00 0.00 ? 35  VAL A CG2  1  
ATOM 521   H H    . VAL A 1 35  ? 9.068   9.893   -6.943  1.00 0.00 ? 35  VAL A H    1  
ATOM 522   H HA   . VAL A 1 35  ? 8.129   10.782  -9.455  1.00 0.00 ? 35  VAL A HA   1  
ATOM 523   H HB   . VAL A 1 35  ? 7.352   8.518   -9.815  1.00 0.00 ? 35  VAL A HB   1  
ATOM 524   H HG11 . VAL A 1 35  ? 9.421   7.323   -9.499  1.00 0.00 ? 35  VAL A HG11 1  
ATOM 525   H HG12 . VAL A 1 35  ? 9.781   8.998   -9.920  1.00 0.00 ? 35  VAL A HG12 1  
ATOM 526   H HG13 . VAL A 1 35  ? 9.928   8.457   -8.248  1.00 0.00 ? 35  VAL A HG13 1  
ATOM 527   H HG21 . VAL A 1 35  ? 8.046   7.805   -6.988  1.00 0.00 ? 35  VAL A HG21 1  
ATOM 528   H HG22 . VAL A 1 35  ? 6.429   8.364   -7.415  1.00 0.00 ? 35  VAL A HG22 1  
ATOM 529   H HG23 . VAL A 1 35  ? 7.082   6.902   -8.156  1.00 0.00 ? 35  VAL A HG23 1  
ATOM 530   N N    . GLY A 1 36  ? 5.953   10.632  -7.064  1.00 0.00 ? 36  GLY A N    1  
ATOM 531   C CA   . GLY A 1 36  ? 4.582   10.944  -6.706  1.00 0.00 ? 36  GLY A CA   1  
ATOM 532   C C    . GLY A 1 36  ? 4.450   12.298  -6.039  1.00 0.00 ? 36  GLY A C    1  
ATOM 533   O O    . GLY A 1 36  ? 5.414   13.061  -5.973  1.00 0.00 ? 36  GLY A O    1  
ATOM 534   H H    . GLY A 1 36  ? 6.617   10.475  -6.360  1.00 0.00 ? 36  GLY A H    1  
ATOM 535   H HA2  . GLY A 1 36  ? 3.977   10.934  -7.600  1.00 0.00 ? 36  GLY A HA2  1  
ATOM 536   H HA3  . GLY A 1 36  ? 4.217   10.185  -6.029  1.00 0.00 ? 36  GLY A HA3  1  
ATOM 537   N N    . GLN A 1 37  ? 3.254   12.599  -5.544  1.00 0.00 ? 37  GLN A N    1  
ATOM 538   C CA   . GLN A 1 37  ? 3.000   13.872  -4.880  1.00 0.00 ? 37  GLN A CA   1  
ATOM 539   C C    . GLN A 1 37  ? 1.638   13.866  -4.193  1.00 0.00 ? 37  GLN A C    1  
ATOM 540   O O    . GLN A 1 37  ? 0.866   12.917  -4.330  1.00 0.00 ? 37  GLN A O    1  
ATOM 541   C CB   . GLN A 1 37  ? 3.070   15.020  -5.889  1.00 0.00 ? 37  GLN A CB   1  
ATOM 542   C CG   . GLN A 1 37  ? 3.407   16.363  -5.261  1.00 0.00 ? 37  GLN A CG   1  
ATOM 543   C CD   . GLN A 1 37  ? 4.111   17.298  -6.225  1.00 0.00 ? 37  GLN A CD   1  
ATOM 544   O OE1  . GLN A 1 37  ? 3.717   17.424  -7.385  1.00 0.00 ? 37  GLN A OE1  1  
ATOM 545   N NE2  . GLN A 1 37  ? 5.159   17.960  -5.749  1.00 0.00 ? 37  GLN A NE2  1  
ATOM 546   H H    . GLN A 1 37  ? 2.525   11.950  -5.627  1.00 0.00 ? 37  GLN A H    1  
ATOM 547   H HA   . GLN A 1 37  ? 3.765   14.015  -4.133  1.00 0.00 ? 37  GLN A HA   1  
ATOM 548   H HB2  . GLN A 1 37  ? 3.826   14.791  -6.625  1.00 0.00 ? 37  GLN A HB2  1  
ATOM 549   H HB3  . GLN A 1 37  ? 2.114   15.108  -6.383  1.00 0.00 ? 37  GLN A HB3  1  
ATOM 550   H HG2  . GLN A 1 37  ? 2.491   16.832  -4.933  1.00 0.00 ? 37  GLN A HG2  1  
ATOM 551   H HG3  . GLN A 1 37  ? 4.050   16.195  -4.410  1.00 0.00 ? 37  GLN A HG3  1  
ATOM 552   H HE21 . GLN A 1 37  ? 5.416   17.808  -4.815  1.00 0.00 ? 37  GLN A HE21 1  
ATOM 553   H HE22 . GLN A 1 37  ? 5.633   18.570  -6.350  1.00 0.00 ? 37  GLN A HE22 1  
ATOM 554   N N    . VAL A 1 38  ? 1.349   14.932  -3.454  1.00 0.00 ? 38  VAL A N    1  
ATOM 555   C CA   . VAL A 1 38  ? 0.080   15.050  -2.746  1.00 0.00 ? 38  VAL A CA   1  
ATOM 556   C C    . VAL A 1 38  ? -1.068  14.495  -3.580  1.00 0.00 ? 38  VAL A C    1  
ATOM 557   O O    . VAL A 1 38  ? -1.119  14.693  -4.794  1.00 0.00 ? 38  VAL A O    1  
ATOM 558   C CB   . VAL A 1 38  ? -0.226  16.515  -2.382  1.00 0.00 ? 38  VAL A CB   1  
ATOM 559   C CG1  . VAL A 1 38  ? -1.335  16.588  -1.344  1.00 0.00 ? 38  VAL A CG1  1  
ATOM 560   C CG2  . VAL A 1 38  ? 1.030   17.213  -1.882  1.00 0.00 ? 38  VAL A CG2  1  
ATOM 561   H H    . VAL A 1 38  ? 2.005   15.657  -3.383  1.00 0.00 ? 38  VAL A H    1  
ATOM 562   H HA   . VAL A 1 38  ? 0.155   14.482  -1.830  1.00 0.00 ? 38  VAL A HA   1  
ATOM 563   H HB   . VAL A 1 38  ? -0.563  17.023  -3.274  1.00 0.00 ? 38  VAL A HB   1  
ATOM 564   H HG11 . VAL A 1 38  ? -1.576  15.591  -1.005  1.00 0.00 ? 38  VAL A HG11 1  
ATOM 565   H HG12 . VAL A 1 38  ? -1.006  17.185  -0.506  1.00 0.00 ? 38  VAL A HG12 1  
ATOM 566   H HG13 . VAL A 1 38  ? -2.212  17.039  -1.786  1.00 0.00 ? 38  VAL A HG13 1  
ATOM 567   H HG21 . VAL A 1 38  ? 1.674   17.439  -2.719  1.00 0.00 ? 38  VAL A HG21 1  
ATOM 568   H HG22 . VAL A 1 38  ? 0.758   18.130  -1.380  1.00 0.00 ? 38  VAL A HG22 1  
ATOM 569   H HG23 . VAL A 1 38  ? 1.551   16.567  -1.191  1.00 0.00 ? 38  VAL A HG23 1  
ATOM 570   N N    . CYS A 1 39  ? -1.989  13.799  -2.921  1.00 0.00 ? 39  CYS A N    1  
ATOM 571   C CA   . CYS A 1 39  ? -3.138  13.214  -3.602  1.00 0.00 ? 39  CYS A CA   1  
ATOM 572   C C    . CYS A 1 39  ? -2.707  12.060  -4.501  1.00 0.00 ? 39  CYS A C    1  
ATOM 573   O O    . CYS A 1 39  ? -3.287  11.838  -5.564  1.00 0.00 ? 39  CYS A O    1  
ATOM 574   C CB   . CYS A 1 39  ? -3.863  14.277  -4.429  1.00 0.00 ? 39  CYS A CB   1  
ATOM 575   S SG   . CYS A 1 39  ? -3.775  15.943  -3.730  1.00 0.00 ? 39  CYS A SG   1  
ATOM 576   H H    . CYS A 1 39  ? -1.893  13.676  -1.953  1.00 0.00 ? 39  CYS A H    1  
ATOM 577   H HA   . CYS A 1 39  ? -3.811  12.836  -2.848  1.00 0.00 ? 39  CYS A HA   1  
ATOM 578   H HB2  . CYS A 1 39  ? -3.427  14.313  -5.417  1.00 0.00 ? 39  CYS A HB2  1  
ATOM 579   H HB3  . CYS A 1 39  ? -4.905  14.009  -4.512  1.00 0.00 ? 39  CYS A HB3  1  
ATOM 580   H HG   . CYS A 1 39  ? -4.137  15.872  -2.459  1.00 0.00 ? 39  CYS A HG   1  
ATOM 581   N N    . SER A 1 40  ? -1.686  11.328  -4.067  1.00 0.00 ? 40  SER A N    1  
ATOM 582   C CA   . SER A 1 40  ? -1.173  10.199  -4.835  1.00 0.00 ? 40  SER A CA   1  
ATOM 583   C C    . SER A 1 40  ? -0.996  8.973   -3.945  1.00 0.00 ? 40  SER A C    1  
ATOM 584   O O    . SER A 1 40  ? -0.469  9.067   -2.836  1.00 0.00 ? 40  SER A O    1  
ATOM 585   C CB   . SER A 1 40  ? 0.160   10.565  -5.491  1.00 0.00 ? 40  SER A CB   1  
ATOM 586   O OG   . SER A 1 40  ? 0.031   11.722  -6.298  1.00 0.00 ? 40  SER A OG   1  
ATOM 587   H H    . SER A 1 40  ? -1.265  11.555  -3.211  1.00 0.00 ? 40  SER A H    1  
ATOM 588   H HA   . SER A 1 40  ? -1.893  9.969   -5.606  1.00 0.00 ? 40  SER A HA   1  
ATOM 589   H HB2  . SER A 1 40  ? 0.895   10.755  -4.724  1.00 0.00 ? 40  SER A HB2  1  
ATOM 590   H HB3  . SER A 1 40  ? 0.490   9.743   -6.110  1.00 0.00 ? 40  SER A HB3  1  
ATOM 591   H HG   . SER A 1 40  ? -0.387  11.488  -7.130  1.00 0.00 ? 40  SER A HG   1  
ATOM 592   N N    . PHE A 1 41  ? -1.440  7.822   -4.440  1.00 0.00 ? 41  PHE A N    1  
ATOM 593   C CA   . PHE A 1 41  ? -1.332  6.576   -3.690  1.00 0.00 ? 41  PHE A CA   1  
ATOM 594   C C    . PHE A 1 41  ? -0.729  5.472   -4.554  1.00 0.00 ? 41  PHE A C    1  
ATOM 595   O O    . PHE A 1 41  ? -0.489  5.663   -5.747  1.00 0.00 ? 41  PHE A O    1  
ATOM 596   C CB   . PHE A 1 41  ? -2.708  6.143   -3.178  1.00 0.00 ? 41  PHE A CB   1  
ATOM 597   C CG   . PHE A 1 41  ? -3.557  5.480   -4.225  1.00 0.00 ? 41  PHE A CG   1  
ATOM 598   C CD1  . PHE A 1 41  ? -3.507  4.108   -4.409  1.00 0.00 ? 41  PHE A CD1  1  
ATOM 599   C CD2  . PHE A 1 41  ? -4.403  6.230   -5.025  1.00 0.00 ? 41  PHE A CD2  1  
ATOM 600   C CE1  . PHE A 1 41  ? -4.287  3.495   -5.371  1.00 0.00 ? 41  PHE A CE1  1  
ATOM 601   C CE2  . PHE A 1 41  ? -5.186  5.622   -5.989  1.00 0.00 ? 41  PHE A CE2  1  
ATOM 602   C CZ   . PHE A 1 41  ? -5.127  4.253   -6.163  1.00 0.00 ? 41  PHE A CZ   1  
ATOM 603   H H    . PHE A 1 41  ? -1.851  7.811   -5.330  1.00 0.00 ? 41  PHE A H    1  
ATOM 604   H HA   . PHE A 1 41  ? -0.683  6.752   -2.847  1.00 0.00 ? 41  PHE A HA   1  
ATOM 605   H HB2  . PHE A 1 41  ? -2.578  5.444   -2.365  1.00 0.00 ? 41  PHE A HB2  1  
ATOM 606   H HB3  . PHE A 1 41  ? -3.239  7.012   -2.819  1.00 0.00 ? 41  PHE A HB3  1  
ATOM 607   H HD1  . PHE A 1 41  ? -2.850  3.514   -3.790  1.00 0.00 ? 41  PHE A HD1  1  
ATOM 608   H HD2  . PHE A 1 41  ? -4.450  7.301   -4.891  1.00 0.00 ? 41  PHE A HD2  1  
ATOM 609   H HE1  . PHE A 1 41  ? -4.238  2.424   -5.504  1.00 0.00 ? 41  PHE A HE1  1  
ATOM 610   H HE2  . PHE A 1 41  ? -5.842  6.217   -6.607  1.00 0.00 ? 41  PHE A HE2  1  
ATOM 611   H HZ   . PHE A 1 41  ? -5.738  3.776   -6.915  1.00 0.00 ? 41  PHE A HZ   1  
ATOM 612   N N    . LEU A 1 42  ? -0.487  4.317   -3.944  1.00 0.00 ? 42  LEU A N    1  
ATOM 613   C CA   . LEU A 1 42  ? 0.089   3.182   -4.656  1.00 0.00 ? 42  LEU A CA   1  
ATOM 614   C C    . LEU A 1 42  ? -0.070  1.896   -3.851  1.00 0.00 ? 42  LEU A C    1  
ATOM 615   O O    . LEU A 1 42  ? -0.012  1.911   -2.621  1.00 0.00 ? 42  LEU A O    1  
ATOM 616   C CB   . LEU A 1 42  ? 1.569   3.435   -4.948  1.00 0.00 ? 42  LEU A CB   1  
ATOM 617   C CG   . LEU A 1 42  ? 2.534   3.185   -3.788  1.00 0.00 ? 42  LEU A CG   1  
ATOM 618   C CD1  . LEU A 1 42  ? 2.743   1.694   -3.579  1.00 0.00 ? 42  LEU A CD1  1  
ATOM 619   C CD2  . LEU A 1 42  ? 3.863   3.883   -4.040  1.00 0.00 ? 42  LEU A CD2  1  
ATOM 620   H H    . LEU A 1 42  ? -0.700  4.225   -2.992  1.00 0.00 ? 42  LEU A H    1  
ATOM 621   H HA   . LEU A 1 42  ? -0.441  3.074   -5.591  1.00 0.00 ? 42  LEU A HA   1  
ATOM 622   H HB2  . LEU A 1 42  ? 1.860   2.791   -5.763  1.00 0.00 ? 42  LEU A HB2  1  
ATOM 623   H HB3  . LEU A 1 42  ? 1.674   4.467   -5.251  1.00 0.00 ? 42  LEU A HB3  1  
ATOM 624   H HG   . LEU A 1 42  ? 2.108   3.592   -2.880  1.00 0.00 ? 42  LEU A HG   1  
ATOM 625   H HD11 . LEU A 1 42  ? 3.786   1.454   -3.719  1.00 0.00 ? 42  LEU A HD11 1  
ATOM 626   H HD12 . LEU A 1 42  ? 2.148   1.143   -4.292  1.00 0.00 ? 42  LEU A HD12 1  
ATOM 627   H HD13 . LEU A 1 42  ? 2.443   1.425   -2.576  1.00 0.00 ? 42  LEU A HD13 1  
ATOM 628   H HD21 . LEU A 1 42  ? 4.499   3.768   -3.175  1.00 0.00 ? 42  LEU A HD21 1  
ATOM 629   H HD22 . LEU A 1 42  ? 3.689   4.933   -4.222  1.00 0.00 ? 42  LEU A HD22 1  
ATOM 630   H HD23 . LEU A 1 42  ? 4.342   3.442   -4.901  1.00 0.00 ? 42  LEU A HD23 1  
ATOM 631   N N    . VAL A 1 43  ? -0.269  0.785   -4.552  1.00 0.00 ? 43  VAL A N    1  
ATOM 632   C CA   . VAL A 1 43  ? -0.433  -0.510  -3.903  1.00 0.00 ? 43  VAL A CA   1  
ATOM 633   C C    . VAL A 1 43  ? 0.812   -1.373  -4.074  1.00 0.00 ? 43  VAL A C    1  
ATOM 634   O O    . VAL A 1 43  ? 1.405   -1.417  -5.153  1.00 0.00 ? 43  VAL A O    1  
ATOM 635   C CB   . VAL A 1 43  ? -1.651  -1.269  -4.463  1.00 0.00 ? 43  VAL A CB   1  
ATOM 636   C CG1  . VAL A 1 43  ? -1.762  -2.645  -3.825  1.00 0.00 ? 43  VAL A CG1  1  
ATOM 637   C CG2  . VAL A 1 43  ? -2.925  -0.466  -4.243  1.00 0.00 ? 43  VAL A CG2  1  
ATOM 638   H H    . VAL A 1 43  ? -0.306  0.837   -5.530  1.00 0.00 ? 43  VAL A H    1  
ATOM 639   H HA   . VAL A 1 43  ? -0.597  -0.337  -2.849  1.00 0.00 ? 43  VAL A HA   1  
ATOM 640   H HB   . VAL A 1 43  ? -1.511  -1.399  -5.526  1.00 0.00 ? 43  VAL A HB   1  
ATOM 641   H HG11 . VAL A 1 43  ? -2.237  -2.557  -2.859  1.00 0.00 ? 43  VAL A HG11 1  
ATOM 642   H HG12 . VAL A 1 43  ? -2.352  -3.290  -4.460  1.00 0.00 ? 43  VAL A HG12 1  
ATOM 643   H HG13 . VAL A 1 43  ? -0.775  -3.066  -3.703  1.00 0.00 ? 43  VAL A HG13 1  
ATOM 644   H HG21 . VAL A 1 43  ? -3.489  -0.903  -3.433  1.00 0.00 ? 43  VAL A HG21 1  
ATOM 645   H HG22 . VAL A 1 43  ? -2.670  0.554   -3.996  1.00 0.00 ? 43  VAL A HG22 1  
ATOM 646   H HG23 . VAL A 1 43  ? -3.519  -0.480  -5.145  1.00 0.00 ? 43  VAL A HG23 1  
ATOM 647   N N    . ARG A 1 44  ? 1.203   -2.057  -3.005  1.00 0.00 ? 44  ARG A N    1  
ATOM 648   C CA   . ARG A 1 44  ? 2.379   -2.919  -3.037  1.00 0.00 ? 44  ARG A CA   1  
ATOM 649   C C    . ARG A 1 44  ? 2.133   -4.204  -2.253  1.00 0.00 ? 44  ARG A C    1  
ATOM 650   O O    . ARG A 1 44  ? 1.462   -4.212  -1.220  1.00 0.00 ? 44  ARG A O    1  
ATOM 651   C CB   . ARG A 1 44  ? 3.592   -2.183  -2.463  1.00 0.00 ? 44  ARG A CB   1  
ATOM 652   C CG   . ARG A 1 44  ? 3.434   -1.795  -1.002  1.00 0.00 ? 44  ARG A CG   1  
ATOM 653   C CD   . ARG A 1 44  ? 4.726   -1.230  -0.434  1.00 0.00 ? 44  ARG A CD   1  
ATOM 654   N NE   . ARG A 1 44  ? 5.825   -2.188  -0.514  1.00 0.00 ? 44  ARG A NE   1  
ATOM 655   C CZ   . ARG A 1 44  ? 6.597   -2.332  -1.585  1.00 0.00 ? 44  ARG A CZ   1  
ATOM 656   N NH1  . ARG A 1 44  ? 6.392   -1.583  -2.660  1.00 0.00 ? 44  ARG A NH1  1  
ATOM 657   N NH2  . ARG A 1 44  ? 7.578   -3.226  -1.583  1.00 0.00 ? 44  ARG A NH2  1  
ATOM 658   H H    . ARG A 1 44  ? 0.690   -1.980  -2.173  1.00 0.00 ? 44  ARG A H    1  
ATOM 659   H HA   . ARG A 1 44  ? 2.577   -3.172  -4.067  1.00 0.00 ? 44  ARG A HA   1  
ATOM 660   H HB2  . ARG A 1 44  ? 4.460   -2.821  -2.552  1.00 0.00 ? 44  ARG A HB2  1  
ATOM 661   H HB3  . ARG A 1 44  ? 3.756   -1.284  -3.037  1.00 0.00 ? 44  ARG A HB3  1  
ATOM 662   H HG2  . ARG A 1 44  ? 2.660   -1.046  -0.920  1.00 0.00 ? 44  ARG A HG2  1  
ATOM 663   H HG3  . ARG A 1 44  ? 3.153   -2.670  -0.435  1.00 0.00 ? 44  ARG A HG3  1  
ATOM 664   H HD2  . ARG A 1 44  ? 4.992   -0.344  -0.991  1.00 0.00 ? 44  ARG A HD2  1  
ATOM 665   H HD3  . ARG A 1 44  ? 4.564   -0.968  0.601   1.00 0.00 ? 44  ARG A HD3  1  
ATOM 666   H HE   . ARG A 1 44  ? 5.994   -2.752  0.269   1.00 0.00 ? 44  ARG A HE   1  
ATOM 667   H HH11 . ARG A 1 44  ? 5.655   -0.908  -2.665  1.00 0.00 ? 44  ARG A HH11 1  
ATOM 668   H HH12 . ARG A 1 44  ? 6.976   -1.693  -3.465  1.00 0.00 ? 44  ARG A HH12 1  
ATOM 669   H HH21 . ARG A 1 44  ? 7.736   -3.792  -0.774  1.00 0.00 ? 44  ARG A HH21 1  
ATOM 670   H HH22 . ARG A 1 44  ? 8.158   -3.334  -2.389  1.00 0.00 ? 44  ARG A HH22 1  
ATOM 671   N N    . PRO A 1 45  ? 2.686   -5.318  -2.753  1.00 0.00 ? 45  PRO A N    1  
ATOM 672   C CA   . PRO A 1 45  ? 2.541   -6.630  -2.116  1.00 0.00 ? 45  PRO A CA   1  
ATOM 673   C C    . PRO A 1 45  ? 3.306   -6.724  -0.800  1.00 0.00 ? 45  PRO A C    1  
ATOM 674   O O    . PRO A 1 45  ? 4.525   -6.558  -0.767  1.00 0.00 ? 45  PRO A O    1  
ATOM 675   C CB   . PRO A 1 45  ? 3.132   -7.594  -3.148  1.00 0.00 ? 45  PRO A CB   1  
ATOM 676   C CG   . PRO A 1 45  ? 4.088   -6.766  -3.936  1.00 0.00 ? 45  PRO A CG   1  
ATOM 677   C CD   . PRO A 1 45  ? 3.498   -5.383  -3.980  1.00 0.00 ? 45  PRO A CD   1  
ATOM 678   H HA   . PRO A 1 45  ? 1.503   -6.875  -1.945  1.00 0.00 ? 45  PRO A HA   1  
ATOM 679   H HB2  . PRO A 1 45  ? 3.635   -8.405  -2.640  1.00 0.00 ? 45  PRO A HB2  1  
ATOM 680   H HB3  . PRO A 1 45  ? 2.343   -7.987  -3.772  1.00 0.00 ? 45  PRO A HB3  1  
ATOM 681   H HG2  . PRO A 1 45  ? 5.049   -6.748  -3.445  1.00 0.00 ? 45  PRO A HG2  1  
ATOM 682   H HG3  . PRO A 1 45  ? 4.182   -7.165  -4.935  1.00 0.00 ? 45  PRO A HG3  1  
ATOM 683   H HD2  . PRO A 1 45  ? 4.280   -4.639  -3.965  1.00 0.00 ? 45  PRO A HD2  1  
ATOM 684   H HD3  . PRO A 1 45  ? 2.879   -5.265  -4.858  1.00 0.00 ? 45  PRO A HD3  1  
ATOM 685   N N    . SER A 1 46  ? 2.583   -6.991  0.282   1.00 0.00 ? 46  SER A N    1  
ATOM 686   C CA   . SER A 1 46  ? 3.194   -7.103  1.601   1.00 0.00 ? 46  SER A CA   1  
ATOM 687   C C    . SER A 1 46  ? 4.359   -8.088  1.578   1.00 0.00 ? 46  SER A C    1  
ATOM 688   O O    . SER A 1 46  ? 4.169   -9.287  1.376   1.00 0.00 ? 46  SER A O    1  
ATOM 689   C CB   . SER A 1 46  ? 2.155   -7.550  2.632   1.00 0.00 ? 46  SER A CB   1  
ATOM 690   O OG   . SER A 1 46  ? 1.420   -6.444  3.128   1.00 0.00 ? 46  SER A OG   1  
ATOM 691   H H    . SER A 1 46  ? 1.614   -7.113  0.192   1.00 0.00 ? 46  SER A H    1  
ATOM 692   H HA   . SER A 1 46  ? 3.567   -6.128  1.878   1.00 0.00 ? 46  SER A HA   1  
ATOM 693   H HB2  . SER A 1 46  ? 1.469   -8.244  2.170   1.00 0.00 ? 46  SER A HB2  1  
ATOM 694   H HB3  . SER A 1 46  ? 2.656   -8.034  3.458   1.00 0.00 ? 46  SER A HB3  1  
ATOM 695   H HG   . SER A 1 46  ? 1.314   -5.792  2.431   1.00 0.00 ? 46  SER A HG   1  
ATOM 696   N N    . ASP A 1 47  ? 5.565   -7.571  1.786   1.00 0.00 ? 47  ASP A N    1  
ATOM 697   C CA   . ASP A 1 47  ? 6.763   -8.403  1.791   1.00 0.00 ? 47  ASP A CA   1  
ATOM 698   C C    . ASP A 1 47  ? 6.793   -9.306  3.020   1.00 0.00 ? 47  ASP A C    1  
ATOM 699   O O    . ASP A 1 47  ? 6.639   -10.522 2.913   1.00 0.00 ? 47  ASP A O    1  
ATOM 700   C CB   . ASP A 1 47  ? 8.017   -7.529  1.754   1.00 0.00 ? 47  ASP A CB   1  
ATOM 701   C CG   . ASP A 1 47  ? 8.460   -7.212  0.339   1.00 0.00 ? 47  ASP A CG   1  
ATOM 702   O OD1  . ASP A 1 47  ? 7.594   -7.174  -0.560  1.00 0.00 ? 47  ASP A OD1  1  
ATOM 703   O OD2  . ASP A 1 47  ? 9.673   -7.000  0.131   1.00 0.00 ? 47  ASP A OD2  1  
ATOM 704   H H    . ASP A 1 47  ? 5.652   -6.607  1.942   1.00 0.00 ? 47  ASP A H    1  
ATOM 705   H HA   . ASP A 1 47  ? 6.740   -9.022  0.906   1.00 0.00 ? 47  ASP A HA   1  
ATOM 706   H HB2  . ASP A 1 47  ? 7.815   -6.599  2.265   1.00 0.00 ? 47  ASP A HB2  1  
ATOM 707   H HB3  . ASP A 1 47  ? 8.822   -8.044  2.257   1.00 0.00 ? 47  ASP A HB3  1  
ATOM 708   N N    . ASN A 1 48  ? 6.994   -8.702  4.187   1.00 0.00 ? 48  ASN A N    1  
ATOM 709   C CA   . ASN A 1 48  ? 7.046   -9.452  5.437   1.00 0.00 ? 48  ASN A CA   1  
ATOM 710   C C    . ASN A 1 48  ? 5.921   -10.480 5.501   1.00 0.00 ? 48  ASN A C    1  
ATOM 711   O O    . ASN A 1 48  ? 6.025   -11.489 6.200   1.00 0.00 ? 48  ASN A O    1  
ATOM 712   C CB   . ASN A 1 48  ? 6.951   -8.500  6.631   1.00 0.00 ? 48  ASN A CB   1  
ATOM 713   C CG   . ASN A 1 48  ? 5.711   -7.628  6.578   1.00 0.00 ? 48  ASN A CG   1  
ATOM 714   O OD1  . ASN A 1 48  ? 4.598   -8.123  6.399   1.00 0.00 ? 48  ASN A OD1  1  
ATOM 715   N ND2  . ASN A 1 48  ? 5.899   -6.323  6.734   1.00 0.00 ? 48  ASN A ND2  1  
ATOM 716   H H    . ASN A 1 48  ? 7.110   -7.729  4.208   1.00 0.00 ? 48  ASN A H    1  
ATOM 717   H HA   . ASN A 1 48  ? 7.993   -9.968  5.474   1.00 0.00 ? 48  ASN A HA   1  
ATOM 718   H HB2  . ASN A 1 48  ? 6.922   -9.078  7.543   1.00 0.00 ? 48  ASN A HB2  1  
ATOM 719   H HB3  . ASN A 1 48  ? 7.819   -7.859  6.643   1.00 0.00 ? 48  ASN A HB3  1  
ATOM 720   H HD21 . ASN A 1 48  ? 6.814   -6.000  6.873   1.00 0.00 ? 48  ASN A HD21 1  
ATOM 721   H HD22 . ASN A 1 48  ? 5.115   -5.736  6.705   1.00 0.00 ? 48  ASN A HD22 1  
ATOM 722   N N    . THR A 1 49  ? 4.844   -10.218 4.767   1.00 0.00 ? 49  THR A N    1  
ATOM 723   C CA   . THR A 1 49  ? 3.699   -11.120 4.741   1.00 0.00 ? 49  THR A CA   1  
ATOM 724   C C    . THR A 1 49  ? 3.280   -11.435 3.310   1.00 0.00 ? 49  THR A C    1  
ATOM 725   O O    . THR A 1 49  ? 2.525   -10.694 2.680   1.00 0.00 ? 49  THR A O    1  
ATOM 726   C CB   . THR A 1 49  ? 2.496   -10.523 5.496   1.00 0.00 ? 49  THR A CB   1  
ATOM 727   O OG1  . THR A 1 49  ? 2.797   -10.418 6.892   1.00 0.00 ? 49  THR A OG1  1  
ATOM 728   C CG2  . THR A 1 49  ? 1.255   -11.381 5.302   1.00 0.00 ? 49  THR A CG2  1  
ATOM 729   H H    . THR A 1 49  ? 4.820   -9.398  4.232   1.00 0.00 ? 49  THR A H    1  
ATOM 730   H HA   . THR A 1 49  ? 3.986   -12.038 5.233   1.00 0.00 ? 49  THR A HA   1  
ATOM 731   H HB   . THR A 1 49  ? 2.298   -9.536  5.103   1.00 0.00 ? 49  THR A HB   1  
ATOM 732   H HG1  . THR A 1 49  ? 3.397   -11.124 7.144   1.00 0.00 ? 49  THR A HG1  1  
ATOM 733   H HG21 . THR A 1 49  ? 0.606   -11.274 6.159   1.00 0.00 ? 49  THR A HG21 1  
ATOM 734   H HG22 . THR A 1 49  ? 1.546   -12.416 5.198   1.00 0.00 ? 49  THR A HG22 1  
ATOM 735   H HG23 . THR A 1 49  ? 0.733   -11.063 4.413   1.00 0.00 ? 49  THR A HG23 1  
ATOM 736   N N    . PRO A 1 50  ? 3.780   -12.562 2.781   1.00 0.00 ? 50  PRO A N    1  
ATOM 737   C CA   . PRO A 1 50  ? 3.470   -13.002 1.417   1.00 0.00 ? 50  PRO A CA   1  
ATOM 738   C C    . PRO A 1 50  ? 2.023   -13.460 1.271   1.00 0.00 ? 50  PRO A C    1  
ATOM 739   O O    . PRO A 1 50  ? 1.707   -14.629 1.486   1.00 0.00 ? 50  PRO A O    1  
ATOM 740   C CB   . PRO A 1 50  ? 4.427   -14.176 1.197   1.00 0.00 ? 50  PRO A CB   1  
ATOM 741   C CG   . PRO A 1 50  ? 4.716   -14.691 2.565   1.00 0.00 ? 50  PRO A CG   1  
ATOM 742   C CD   . PRO A 1 50  ? 4.687   -13.493 3.473   1.00 0.00 ? 50  PRO A CD   1  
ATOM 743   H HA   . PRO A 1 50  ? 3.677   -12.227 0.694   1.00 0.00 ? 50  PRO A HA   1  
ATOM 744   H HB2  . PRO A 1 50  ? 3.946   -14.926 0.585   1.00 0.00 ? 50  PRO A HB2  1  
ATOM 745   H HB3  . PRO A 1 50  ? 5.325   -13.827 0.710   1.00 0.00 ? 50  PRO A HB3  1  
ATOM 746   H HG2  . PRO A 1 50  ? 3.958   -15.402 2.857   1.00 0.00 ? 50  PRO A HG2  1  
ATOM 747   H HG3  . PRO A 1 50  ? 5.692   -15.152 2.585   1.00 0.00 ? 50  PRO A HG3  1  
ATOM 748   H HD2  . PRO A 1 50  ? 4.295   -13.764 4.442   1.00 0.00 ? 50  PRO A HD2  1  
ATOM 749   H HD3  . PRO A 1 50  ? 5.675   -13.068 3.569   1.00 0.00 ? 50  PRO A HD3  1  
ATOM 750   N N    . GLY A 1 51  ? 1.147   -12.529 0.902   1.00 0.00 ? 51  GLY A N    1  
ATOM 751   C CA   . GLY A 1 51  ? -0.256  -12.857 0.733   1.00 0.00 ? 51  GLY A CA   1  
ATOM 752   C C    . GLY A 1 51  ? -1.167  -11.687 1.046   1.00 0.00 ? 51  GLY A C    1  
ATOM 753   O O    . GLY A 1 51  ? -2.365  -11.732 0.767   1.00 0.00 ? 51  GLY A O    1  
ATOM 754   H H    . GLY A 1 51  ? 1.457   -11.613 0.744   1.00 0.00 ? 51  GLY A H    1  
ATOM 755   H HA2  . GLY A 1 51  ? -0.422  -13.166 -0.288  1.00 0.00 ? 51  GLY A HA2  1  
ATOM 756   H HA3  . GLY A 1 51  ? -0.504  -13.677 1.391   1.00 0.00 ? 51  GLY A HA3  1  
ATOM 757   N N    . ASP A 1 52  ? -0.599  -10.637 1.628   1.00 0.00 ? 52  ASP A N    1  
ATOM 758   C CA   . ASP A 1 52  ? -1.368  -9.449  1.980   1.00 0.00 ? 52  ASP A CA   1  
ATOM 759   C C    . ASP A 1 52  ? -0.947  -8.256  1.127   1.00 0.00 ? 52  ASP A C    1  
ATOM 760   O O    . ASP A 1 52  ? -0.135  -8.391  0.211   1.00 0.00 ? 52  ASP A O    1  
ATOM 761   C CB   . ASP A 1 52  ? -1.189  -9.120  3.463   1.00 0.00 ? 52  ASP A CB   1  
ATOM 762   C CG   . ASP A 1 52  ? -2.196  -9.837  4.340   1.00 0.00 ? 52  ASP A CG   1  
ATOM 763   O OD1  . ASP A 1 52  ? -2.399  -11.053 4.138   1.00 0.00 ? 52  ASP A OD1  1  
ATOM 764   O OD2  . ASP A 1 52  ? -2.782  -9.183  5.228   1.00 0.00 ? 52  ASP A OD2  1  
ATOM 765   H H    . ASP A 1 52  ? 0.361   -10.660 1.825   1.00 0.00 ? 52  ASP A H    1  
ATOM 766   H HA   . ASP A 1 52  ? -2.410  -9.660  1.790   1.00 0.00 ? 52  ASP A HA   1  
ATOM 767   H HB2  . ASP A 1 52  ? -0.197  -9.413  3.772   1.00 0.00 ? 52  ASP A HB2  1  
ATOM 768   H HB3  . ASP A 1 52  ? -1.307  -8.056  3.605   1.00 0.00 ? 52  ASP A HB3  1  
ATOM 769   N N    . TYR A 1 53  ? -1.504  -7.090  1.434   1.00 0.00 ? 53  TYR A N    1  
ATOM 770   C CA   . TYR A 1 53  ? -1.189  -5.874  0.693   1.00 0.00 ? 53  TYR A CA   1  
ATOM 771   C C    . TYR A 1 53  ? -1.169  -4.662  1.620   1.00 0.00 ? 53  TYR A C    1  
ATOM 772   O O    . TYR A 1 53  ? -1.637  -4.727  2.756   1.00 0.00 ? 53  TYR A O    1  
ATOM 773   C CB   . TYR A 1 53  ? -2.206  -5.656  -0.428  1.00 0.00 ? 53  TYR A CB   1  
ATOM 774   C CG   . TYR A 1 53  ? -2.172  -6.728  -1.494  1.00 0.00 ? 53  TYR A CG   1  
ATOM 775   C CD1  . TYR A 1 53  ? -2.872  -7.917  -1.334  1.00 0.00 ? 53  TYR A CD1  1  
ATOM 776   C CD2  . TYR A 1 53  ? -1.439  -6.551  -2.661  1.00 0.00 ? 53  TYR A CD2  1  
ATOM 777   C CE1  . TYR A 1 53  ? -2.842  -8.900  -2.305  1.00 0.00 ? 53  TYR A CE1  1  
ATOM 778   C CE2  . TYR A 1 53  ? -1.405  -7.527  -3.638  1.00 0.00 ? 53  TYR A CE2  1  
ATOM 779   C CZ   . TYR A 1 53  ? -2.108  -8.700  -3.455  1.00 0.00 ? 53  TYR A CZ   1  
ATOM 780   O OH   . TYR A 1 53  ? -2.077  -9.675  -4.425  1.00 0.00 ? 53  TYR A OH   1  
ATOM 781   H H    . TYR A 1 53  ? -2.144  -7.046  2.174   1.00 0.00 ? 53  TYR A H    1  
ATOM 782   H HA   . TYR A 1 53  ? -0.208  -5.996  0.257   1.00 0.00 ? 53  TYR A HA   1  
ATOM 783   H HB2  . TYR A 1 53  ? -3.199  -5.641  -0.006  1.00 0.00 ? 53  TYR A HB2  1  
ATOM 784   H HB3  . TYR A 1 53  ? -2.008  -4.707  -0.905  1.00 0.00 ? 53  TYR A HB3  1  
ATOM 785   H HD1  . TYR A 1 53  ? -3.446  -8.070  -0.432  1.00 0.00 ? 53  TYR A HD1  1  
ATOM 786   H HD2  . TYR A 1 53  ? -0.890  -5.631  -2.802  1.00 0.00 ? 53  TYR A HD2  1  
ATOM 787   H HE1  . TYR A 1 53  ? -3.393  -9.818  -2.162  1.00 0.00 ? 53  TYR A HE1  1  
ATOM 788   H HE2  . TYR A 1 53  ? -0.830  -7.371  -4.539  1.00 0.00 ? 53  TYR A HE2  1  
ATOM 789   H HH   . TYR A 1 53  ? -2.914  -10.147 -4.431  1.00 0.00 ? 53  TYR A HH   1  
ATOM 790   N N    . SER A 1 54  ? -0.623  -3.556  1.124   1.00 0.00 ? 54  SER A N    1  
ATOM 791   C CA   . SER A 1 54  ? -0.538  -2.329  1.907   1.00 0.00 ? 54  SER A CA   1  
ATOM 792   C C    . SER A 1 54  ? -0.605  -1.102  1.003   1.00 0.00 ? 54  SER A C    1  
ATOM 793   O O    . SER A 1 54  ? 0.120   -1.005  0.012   1.00 0.00 ? 54  SER A O    1  
ATOM 794   C CB   . SER A 1 54  ? 0.758   -2.306  2.720   1.00 0.00 ? 54  SER A CB   1  
ATOM 795   O OG   . SER A 1 54  ? 1.812   -2.942  2.018   1.00 0.00 ? 54  SER A OG   1  
ATOM 796   H H    . SER A 1 54  ? -0.266  -3.567  0.211   1.00 0.00 ? 54  SER A H    1  
ATOM 797   H HA   . SER A 1 54  ? -1.378  -2.309  2.585   1.00 0.00 ? 54  SER A HA   1  
ATOM 798   H HB2  . SER A 1 54  ? 1.039   -1.283  2.916   1.00 0.00 ? 54  SER A HB2  1  
ATOM 799   H HB3  . SER A 1 54  ? 0.601   -2.822  3.656   1.00 0.00 ? 54  SER A HB3  1  
ATOM 800   H HG   . SER A 1 54  ? 2.393   -3.382  2.643   1.00 0.00 ? 54  SER A HG   1  
ATOM 801   N N    . LEU A 1 55  ? -1.482  -0.166  1.351   1.00 0.00 ? 55  LEU A N    1  
ATOM 802   C CA   . LEU A 1 55  ? -1.646  1.056   0.572   1.00 0.00 ? 55  LEU A CA   1  
ATOM 803   C C    . LEU A 1 55  ? -0.775  2.178   1.128   1.00 0.00 ? 55  LEU A C    1  
ATOM 804   O O    . LEU A 1 55  ? -0.669  2.352   2.343   1.00 0.00 ? 55  LEU A O    1  
ATOM 805   C CB   . LEU A 1 55  ? -3.113  1.489   0.568   1.00 0.00 ? 55  LEU A CB   1  
ATOM 806   C CG   . LEU A 1 55  ? -3.548  2.379   -0.597  1.00 0.00 ? 55  LEU A CG   1  
ATOM 807   C CD1  . LEU A 1 55  ? -4.040  1.533   -1.760  1.00 0.00 ? 55  LEU A CD1  1  
ATOM 808   C CD2  . LEU A 1 55  ? -4.627  3.354   -0.149  1.00 0.00 ? 55  LEU A CD2  1  
ATOM 809   H H    . LEU A 1 55  ? -2.032  -0.299  2.151   1.00 0.00 ? 55  LEU A H    1  
ATOM 810   H HA   . LEU A 1 55  ? -1.339  0.847   -0.442  1.00 0.00 ? 55  LEU A HA   1  
ATOM 811   H HB2  . LEU A 1 55  ? -3.721  0.598   0.547   1.00 0.00 ? 55  LEU A HB2  1  
ATOM 812   H HB3  . LEU A 1 55  ? -3.300  2.029   1.486   1.00 0.00 ? 55  LEU A HB3  1  
ATOM 813   H HG   . LEU A 1 55  ? -2.698  2.954   -0.939  1.00 0.00 ? 55  LEU A HG   1  
ATOM 814   H HD11 . LEU A 1 55  ? -3.312  0.769   -1.983  1.00 0.00 ? 55  LEU A HD11 1  
ATOM 815   H HD12 . LEU A 1 55  ? -4.180  2.161   -2.628  1.00 0.00 ? 55  LEU A HD12 1  
ATOM 816   H HD13 . LEU A 1 55  ? -4.980  1.070   -1.496  1.00 0.00 ? 55  LEU A HD13 1  
ATOM 817   H HD21 . LEU A 1 55  ? -5.434  3.351   -0.867  1.00 0.00 ? 55  LEU A HD21 1  
ATOM 818   H HD22 . LEU A 1 55  ? -4.209  4.348   -0.082  1.00 0.00 ? 55  LEU A HD22 1  
ATOM 819   H HD23 . LEU A 1 55  ? -5.003  3.056   0.818   1.00 0.00 ? 55  LEU A HD23 1  
ATOM 820   N N    . TYR A 1 56  ? -0.153  2.937   0.232   1.00 0.00 ? 56  TYR A N    1  
ATOM 821   C CA   . TYR A 1 56  ? 0.709   4.042   0.634   1.00 0.00 ? 56  TYR A CA   1  
ATOM 822   C C    . TYR A 1 56  ? 0.213   5.361   0.049   1.00 0.00 ? 56  TYR A C    1  
ATOM 823   O O    . TYR A 1 56  ? 0.368   5.622   -1.144  1.00 0.00 ? 56  TYR A O    1  
ATOM 824   C CB   . TYR A 1 56  ? 2.148   3.782   0.185   1.00 0.00 ? 56  TYR A CB   1  
ATOM 825   C CG   . TYR A 1 56  ? 2.863   2.742   1.018   1.00 0.00 ? 56  TYR A CG   1  
ATOM 826   C CD1  . TYR A 1 56  ? 2.437   1.420   1.029   1.00 0.00 ? 56  TYR A CD1  1  
ATOM 827   C CD2  . TYR A 1 56  ? 3.965   3.082   1.794   1.00 0.00 ? 56  TYR A CD2  1  
ATOM 828   C CE1  . TYR A 1 56  ? 3.087   0.466   1.789   1.00 0.00 ? 56  TYR A CE1  1  
ATOM 829   C CE2  . TYR A 1 56  ? 4.622   2.135   2.555   1.00 0.00 ? 56  TYR A CE2  1  
ATOM 830   C CZ   . TYR A 1 56  ? 4.179   0.829   2.550   1.00 0.00 ? 56  TYR A CZ   1  
ATOM 831   O OH   . TYR A 1 56  ? 4.830   -0.117  3.308   1.00 0.00 ? 56  TYR A OH   1  
ATOM 832   H H    . TYR A 1 56  ? -0.276  2.749   -0.721  1.00 0.00 ? 56  TYR A H    1  
ATOM 833   H HA   . TYR A 1 56  ? 0.685   4.107   1.711   1.00 0.00 ? 56  TYR A HA   1  
ATOM 834   H HB2  . TYR A 1 56  ? 2.143   3.440   -0.838  1.00 0.00 ? 56  TYR A HB2  1  
ATOM 835   H HB3  . TYR A 1 56  ? 2.710   4.703   0.249   1.00 0.00 ? 56  TYR A HB3  1  
ATOM 836   H HD1  . TYR A 1 56  ? 1.581   1.139   0.432   1.00 0.00 ? 56  TYR A HD1  1  
ATOM 837   H HD2  . TYR A 1 56  ? 4.308   4.106   1.796   1.00 0.00 ? 56  TYR A HD2  1  
ATOM 838   H HE1  . TYR A 1 56  ? 2.741   -0.557  1.785   1.00 0.00 ? 56  TYR A HE1  1  
ATOM 839   H HE2  . TYR A 1 56  ? 5.476   2.419   3.151   1.00 0.00 ? 56  TYR A HE2  1  
ATOM 840   H HH   . TYR A 1 56  ? 4.260   -0.397  4.029   1.00 0.00 ? 56  TYR A HH   1  
ATOM 841   N N    . PHE A 1 57  ? -0.385  6.189   0.898   1.00 0.00 ? 57  PHE A N    1  
ATOM 842   C CA   . PHE A 1 57  ? -0.905  7.482   0.468   1.00 0.00 ? 57  PHE A CA   1  
ATOM 843   C C    . PHE A 1 57  ? 0.038   8.610   0.872   1.00 0.00 ? 57  PHE A C    1  
ATOM 844   O O    . PHE A 1 57  ? 0.737   8.517   1.881   1.00 0.00 ? 57  PHE A O    1  
ATOM 845   C CB   . PHE A 1 57  ? -2.293  7.722   1.067   1.00 0.00 ? 57  PHE A CB   1  
ATOM 846   C CG   . PHE A 1 57  ? -2.988  8.928   0.503   1.00 0.00 ? 57  PHE A CG   1  
ATOM 847   C CD1  . PHE A 1 57  ? -2.967  9.183   -0.859  1.00 0.00 ? 57  PHE A CD1  1  
ATOM 848   C CD2  . PHE A 1 57  ? -3.663  9.807   1.335   1.00 0.00 ? 57  PHE A CD2  1  
ATOM 849   C CE1  . PHE A 1 57  ? -3.606  10.292  -1.381  1.00 0.00 ? 57  PHE A CE1  1  
ATOM 850   C CE2  . PHE A 1 57  ? -4.304  10.917  0.819   1.00 0.00 ? 57  PHE A CE2  1  
ATOM 851   C CZ   . PHE A 1 57  ? -4.275  11.161  -0.541  1.00 0.00 ? 57  PHE A CZ   1  
ATOM 852   H H    . PHE A 1 57  ? -0.479  5.925   1.838   1.00 0.00 ? 57  PHE A H    1  
ATOM 853   H HA   . PHE A 1 57  ? -0.985  7.464   -0.608  1.00 0.00 ? 57  PHE A HA   1  
ATOM 854   H HB2  . PHE A 1 57  ? -2.915  6.861   0.874   1.00 0.00 ? 57  PHE A HB2  1  
ATOM 855   H HB3  . PHE A 1 57  ? -2.197  7.861   2.133   1.00 0.00 ? 57  PHE A HB3  1  
ATOM 856   H HD1  . PHE A 1 57  ? -2.443  8.504   -1.517  1.00 0.00 ? 57  PHE A HD1  1  
ATOM 857   H HD2  . PHE A 1 57  ? -3.686  9.619   2.398   1.00 0.00 ? 57  PHE A HD2  1  
ATOM 858   H HE1  . PHE A 1 57  ? -3.581  10.479  -2.444  1.00 0.00 ? 57  PHE A HE1  1  
ATOM 859   H HE2  . PHE A 1 57  ? -4.826  11.595  1.478   1.00 0.00 ? 57  PHE A HE2  1  
ATOM 860   H HZ   . PHE A 1 57  ? -4.776  12.027  -0.946  1.00 0.00 ? 57  PHE A HZ   1  
ATOM 861   N N    . ARG A 1 58  ? 0.052   9.676   0.078   1.00 0.00 ? 58  ARG A N    1  
ATOM 862   C CA   . ARG A 1 58  ? 0.911   10.822  0.351   1.00 0.00 ? 58  ARG A CA   1  
ATOM 863   C C    . ARG A 1 58  ? 0.079   12.075  0.608   1.00 0.00 ? 58  ARG A C    1  
ATOM 864   O O    . ARG A 1 58  ? -0.757  12.457  -0.211  1.00 0.00 ? 58  ARG A O    1  
ATOM 865   C CB   . ARG A 1 58  ? 1.866   11.061  -0.819  1.00 0.00 ? 58  ARG A CB   1  
ATOM 866   C CG   . ARG A 1 58  ? 2.575   12.404  -0.761  1.00 0.00 ? 58  ARG A CG   1  
ATOM 867   C CD   . ARG A 1 58  ? 3.697   12.398  0.265   1.00 0.00 ? 58  ARG A CD   1  
ATOM 868   N NE   . ARG A 1 58  ? 4.237   13.736  0.494   1.00 0.00 ? 58  ARG A NE   1  
ATOM 869   C CZ   . ARG A 1 58  ? 4.973   14.393  -0.396  1.00 0.00 ? 58  ARG A CZ   1  
ATOM 870   N NH1  . ARG A 1 58  ? 5.255   13.839  -1.567  1.00 0.00 ? 58  ARG A NH1  1  
ATOM 871   N NH2  . ARG A 1 58  ? 5.429   15.607  -0.114  1.00 0.00 ? 58  ARG A NH2  1  
ATOM 872   H H    . ARG A 1 58  ? -0.528  9.691   -0.712  1.00 0.00 ? 58  ARG A H    1  
ATOM 873   H HA   . ARG A 1 58  ? 1.488   10.600  1.236   1.00 0.00 ? 58  ARG A HA   1  
ATOM 874   H HB2  . ARG A 1 58  ? 2.616   10.283  -0.822  1.00 0.00 ? 58  ARG A HB2  1  
ATOM 875   H HB3  . ARG A 1 58  ? 1.306   11.014  -1.741  1.00 0.00 ? 58  ARG A HB3  1  
ATOM 876   H HG2  . ARG A 1 58  ? 2.993   12.623  -1.733  1.00 0.00 ? 58  ARG A HG2  1  
ATOM 877   H HG3  . ARG A 1 58  ? 1.859   13.168  -0.495  1.00 0.00 ? 58  ARG A HG3  1  
ATOM 878   H HD2  . ARG A 1 58  ? 3.312   12.012  1.197   1.00 0.00 ? 58  ARG A HD2  1  
ATOM 879   H HD3  . ARG A 1 58  ? 4.489   11.756  -0.091  1.00 0.00 ? 58  ARG A HD3  1  
ATOM 880   H HE   . ARG A 1 58  ? 4.041   14.164  1.353   1.00 0.00 ? 58  ARG A HE   1  
ATOM 881   H HH11 . ARG A 1 58  ? 4.912   12.925  -1.782  1.00 0.00 ? 58  ARG A HH11 1  
ATOM 882   H HH12 . ARG A 1 58  ? 5.808   14.337  -2.235  1.00 0.00 ? 58  ARG A HH12 1  
ATOM 883   H HH21 . ARG A 1 58  ? 5.218   16.028  0.768   1.00 0.00 ? 58  ARG A HH21 1  
ATOM 884   H HH22 . ARG A 1 58  ? 5.982   16.101  -0.784  1.00 0.00 ? 58  ARG A HH22 1  
ATOM 885   N N    . THR A 1 59  ? 0.314   12.711  1.751   1.00 0.00 ? 59  THR A N    1  
ATOM 886   C CA   . THR A 1 59  ? -0.414  13.920  2.117   1.00 0.00 ? 59  THR A CA   1  
ATOM 887   C C    . THR A 1 59  ? 0.544   15.048  2.484   1.00 0.00 ? 59  THR A C    1  
ATOM 888   O O    . THR A 1 59  ? 1.637   14.806  2.994   1.00 0.00 ? 59  THR A O    1  
ATOM 889   C CB   . THR A 1 59  ? -1.367  13.665  3.300   1.00 0.00 ? 59  THR A CB   1  
ATOM 890   O OG1  . THR A 1 59  ? -0.630  13.178  4.427   1.00 0.00 ? 59  THR A OG1  1  
ATOM 891   C CG2  . THR A 1 59  ? -2.445  12.661  2.920   1.00 0.00 ? 59  THR A CG2  1  
ATOM 892   H H    . THR A 1 59  ? 0.993   12.357  2.363   1.00 0.00 ? 59  THR A H    1  
ATOM 893   H HA   . THR A 1 59  ? -1.004  14.224  1.265   1.00 0.00 ? 59  THR A HA   1  
ATOM 894   H HB   . THR A 1 59  ? -1.843  14.598  3.566   1.00 0.00 ? 59  THR A HB   1  
ATOM 895   H HG1  . THR A 1 59  ? -0.563  12.222  4.377   1.00 0.00 ? 59  THR A HG1  1  
ATOM 896   H HG21 . THR A 1 59  ? -2.011  11.673  2.860   1.00 0.00 ? 59  THR A HG21 1  
ATOM 897   H HG22 . THR A 1 59  ? -2.865  12.929  1.962   1.00 0.00 ? 59  THR A HG22 1  
ATOM 898   H HG23 . THR A 1 59  ? -3.222  12.667  3.668   1.00 0.00 ? 59  THR A HG23 1  
ATOM 899   N N    . ASN A 1 60  ? 0.125   16.282  2.223   1.00 0.00 ? 60  ASN A N    1  
ATOM 900   C CA   . ASN A 1 60  ? 0.946   17.448  2.526   1.00 0.00 ? 60  ASN A CA   1  
ATOM 901   C C    . ASN A 1 60  ? 1.597   17.312  3.899   1.00 0.00 ? 60  ASN A C    1  
ATOM 902   O O    . ASN A 1 60  ? 2.713   17.783  4.116   1.00 0.00 ? 60  ASN A O    1  
ATOM 903   C CB   . ASN A 1 60  ? 0.099   18.721  2.475   1.00 0.00 ? 60  ASN A CB   1  
ATOM 904   C CG   . ASN A 1 60  ? -1.335  18.479  2.905   1.00 0.00 ? 60  ASN A CG   1  
ATOM 905   O OD1  . ASN A 1 60  ? -1.600  18.139  4.058   1.00 0.00 ? 60  ASN A OD1  1  
ATOM 906   N ND2  . ASN A 1 60  ? -2.268  18.654  1.977   1.00 0.00 ? 60  ASN A ND2  1  
ATOM 907   H H    . ASN A 1 60  ? -0.757  16.411  1.815   1.00 0.00 ? 60  ASN A H    1  
ATOM 908   H HA   . ASN A 1 60  ? 1.721   17.512  1.778   1.00 0.00 ? 60  ASN A HA   1  
ATOM 909   H HB2  . ASN A 1 60  ? 0.531   19.461  3.134   1.00 0.00 ? 60  ASN A HB2  1  
ATOM 910   H HB3  . ASN A 1 60  ? 0.094   19.103  1.466   1.00 0.00 ? 60  ASN A HB3  1  
ATOM 911   H HD21 . ASN A 1 60  ? -1.984  18.926  1.079   1.00 0.00 ? 60  ASN A HD21 1  
ATOM 912   H HD22 . ASN A 1 60  ? -3.204  18.505  2.228   1.00 0.00 ? 60  ASN A HD22 1  
ATOM 913   N N    . GLU A 1 61  ? 0.892   16.665  4.821   1.00 0.00 ? 61  GLU A N    1  
ATOM 914   C CA   . GLU A 1 61  ? 1.403   16.467  6.173   1.00 0.00 ? 61  GLU A CA   1  
ATOM 915   C C    . GLU A 1 61  ? 2.521   15.429  6.186   1.00 0.00 ? 61  GLU A C    1  
ATOM 916   O O    . GLU A 1 61  ? 3.671   15.744  6.490   1.00 0.00 ? 61  GLU A O    1  
ATOM 917   C CB   . GLU A 1 61  ? 0.274   16.029  7.109   1.00 0.00 ? 61  GLU A CB   1  
ATOM 918   C CG   . GLU A 1 61  ? -0.512  17.188  7.698   1.00 0.00 ? 61  GLU A CG   1  
ATOM 919   C CD   . GLU A 1 61  ? 0.337   18.080  8.583   1.00 0.00 ? 61  GLU A CD   1  
ATOM 920   O OE1  . GLU A 1 61  ? 0.581   17.702  9.748   1.00 0.00 ? 61  GLU A OE1  1  
ATOM 921   O OE2  . GLU A 1 61  ? 0.757   19.156  8.110   1.00 0.00 ? 61  GLU A OE2  1  
ATOM 922   H H    . GLU A 1 61  ? 0.008   16.312  4.588   1.00 0.00 ? 61  GLU A H    1  
ATOM 923   H HA   . GLU A 1 61  ? 1.799   17.410  6.519   1.00 0.00 ? 61  GLU A HA   1  
ATOM 924   H HB2  . GLU A 1 61  ? -0.409  15.399  6.559   1.00 0.00 ? 61  GLU A HB2  1  
ATOM 925   H HB3  . GLU A 1 61  ? 0.699   15.460  7.923   1.00 0.00 ? 61  GLU A HB3  1  
ATOM 926   H HG2  . GLU A 1 61  ? -0.911  17.783  6.890   1.00 0.00 ? 61  GLU A HG2  1  
ATOM 927   H HG3  . GLU A 1 61  ? -1.326  16.791  8.287   1.00 0.00 ? 61  GLU A HG3  1  
ATOM 928   N N    . ASN A 1 62  ? 2.174   14.190  5.855   1.00 0.00 ? 62  ASN A N    1  
ATOM 929   C CA   . ASN A 1 62  ? 3.147   13.104  5.829   1.00 0.00 ? 62  ASN A CA   1  
ATOM 930   C C    . ASN A 1 62  ? 2.585   11.886  5.102   1.00 0.00 ? 62  ASN A C    1  
ATOM 931   O O    . ASN A 1 62  ? 1.406   11.851  4.749   1.00 0.00 ? 62  ASN A O    1  
ATOM 932   C CB   . ASN A 1 62  ? 3.551   12.719  7.254   1.00 0.00 ? 62  ASN A CB   1  
ATOM 933   C CG   . ASN A 1 62  ? 4.908   12.046  7.309   1.00 0.00 ? 62  ASN A CG   1  
ATOM 934   O OD1  . ASN A 1 62  ? 5.022   10.885  7.702   1.00 0.00 ? 62  ASN A OD1  1  
ATOM 935   N ND2  . ASN A 1 62  ? 5.946   12.774  6.913   1.00 0.00 ? 62  ASN A ND2  1  
ATOM 936   H H    . ASN A 1 62  ? 1.241   14.000  5.622   1.00 0.00 ? 62  ASN A H    1  
ATOM 937   H HA   . ASN A 1 62  ? 4.020   13.454  5.299   1.00 0.00 ? 62  ASN A HA   1  
ATOM 938   H HB2  . ASN A 1 62  ? 3.588   13.610  7.864   1.00 0.00 ? 62  ASN A HB2  1  
ATOM 939   H HB3  . ASN A 1 62  ? 2.816   12.041  7.660   1.00 0.00 ? 62  ASN A HB3  1  
ATOM 940   H HD21 . ASN A 1 62  ? 5.780   13.692  6.612   1.00 0.00 ? 62  ASN A HD21 1  
ATOM 941   H HD22 . ASN A 1 62  ? 6.835   12.363  6.937   1.00 0.00 ? 62  ASN A HD22 1  
ATOM 942   N N    . ILE A 1 63  ? 3.437   10.891  4.881   1.00 0.00 ? 63  ILE A N    1  
ATOM 943   C CA   . ILE A 1 63  ? 3.025   9.671   4.197   1.00 0.00 ? 63  ILE A CA   1  
ATOM 944   C C    . ILE A 1 63  ? 2.409   8.675   5.173   1.00 0.00 ? 63  ILE A C    1  
ATOM 945   O O    . ILE A 1 63  ? 2.979   8.389   6.226   1.00 0.00 ? 63  ILE A O    1  
ATOM 946   C CB   . ILE A 1 63  ? 4.211   9.001   3.478   1.00 0.00 ? 63  ILE A CB   1  
ATOM 947   C CG1  . ILE A 1 63  ? 4.686   9.871   2.312   1.00 0.00 ? 63  ILE A CG1  1  
ATOM 948   C CG2  . ILE A 1 63  ? 3.818   7.616   2.986   1.00 0.00 ? 63  ILE A CG2  1  
ATOM 949   C CD1  . ILE A 1 63  ? 6.131   9.633   1.931   1.00 0.00 ? 63  ILE A CD1  1  
ATOM 950   H H    . ILE A 1 63  ? 4.364   10.978  5.185   1.00 0.00 ? 63  ILE A H    1  
ATOM 951   H HA   . ILE A 1 63  ? 2.285   9.938   3.456   1.00 0.00 ? 63  ILE A HA   1  
ATOM 952   H HB   . ILE A 1 63  ? 5.017   8.890   4.187   1.00 0.00 ? 63  ILE A HB   1  
ATOM 953   H HG12 . ILE A 1 63  ? 4.077   9.666   1.446   1.00 0.00 ? 63  ILE A HG12 1  
ATOM 954   H HG13 . ILE A 1 63  ? 4.581   10.912  2.584   1.00 0.00 ? 63  ILE A HG13 1  
ATOM 955   H HG21 . ILE A 1 63  ? 4.305   7.417   2.043   1.00 0.00 ? 63  ILE A HG21 1  
ATOM 956   H HG22 . ILE A 1 63  ? 4.124   6.877   3.711   1.00 0.00 ? 63  ILE A HG22 1  
ATOM 957   H HG23 . ILE A 1 63  ? 2.747   7.571   2.854   1.00 0.00 ? 63  ILE A HG23 1  
ATOM 958   H HD11 . ILE A 1 63  ? 6.555   8.881   2.579   1.00 0.00 ? 63  ILE A HD11 1  
ATOM 959   H HD12 . ILE A 1 63  ? 6.182   9.299   0.906   1.00 0.00 ? 63  ILE A HD12 1  
ATOM 960   H HD13 . ILE A 1 63  ? 6.687   10.554  2.037   1.00 0.00 ? 63  ILE A HD13 1  
ATOM 961   N N    . GLN A 1 64  ? 1.242   8.149   4.815   1.00 0.00 ? 64  GLN A N    1  
ATOM 962   C CA   . GLN A 1 64  ? 0.548   7.184   5.660   1.00 0.00 ? 64  GLN A CA   1  
ATOM 963   C C    . GLN A 1 64  ? 0.738   5.765   5.134   1.00 0.00 ? 64  GLN A C    1  
ATOM 964   O O    . GLN A 1 64  ? 1.476   5.542   4.174   1.00 0.00 ? 64  GLN A O    1  
ATOM 965   C CB   . GLN A 1 64  ? -0.943  7.517   5.734   1.00 0.00 ? 64  GLN A CB   1  
ATOM 966   C CG   . GLN A 1 64  ? -1.225  8.988   5.994   1.00 0.00 ? 64  GLN A CG   1  
ATOM 967   C CD   . GLN A 1 64  ? -2.664  9.367   5.704   1.00 0.00 ? 64  GLN A CD   1  
ATOM 968   O OE1  . GLN A 1 64  ? -3.594  8.663   6.097   1.00 0.00 ? 64  GLN A OE1  1  
ATOM 969   N NE2  . GLN A 1 64  ? -2.855  10.484  5.012   1.00 0.00 ? 64  GLN A NE2  1  
ATOM 970   H H    . GLN A 1 64  ? 0.837   8.417   3.964   1.00 0.00 ? 64  GLN A H    1  
ATOM 971   H HA   . GLN A 1 64  ? 0.972   7.246   6.651   1.00 0.00 ? 64  GLN A HA   1  
ATOM 972   H HB2  . GLN A 1 64  ? -1.408  7.243   4.799   1.00 0.00 ? 64  GLN A HB2  1  
ATOM 973   H HB3  . GLN A 1 64  ? -1.389  6.942   6.532   1.00 0.00 ? 64  GLN A HB3  1  
ATOM 974   H HG2  . GLN A 1 64  ? -1.014  9.205   7.031   1.00 0.00 ? 64  GLN A HG2  1  
ATOM 975   H HG3  . GLN A 1 64  ? -0.578  9.582   5.365   1.00 0.00 ? 64  GLN A HG3  1  
ATOM 976   H HE21 . GLN A 1 64  ? -2.066  10.994  4.731   1.00 0.00 ? 64  GLN A HE21 1  
ATOM 977   H HE22 . GLN A 1 64  ? -3.774  10.752  4.810   1.00 0.00 ? 64  GLN A HE22 1  
ATOM 978   N N    . ARG A 1 65  ? 0.068   4.809   5.769   1.00 0.00 ? 65  ARG A N    1  
ATOM 979   C CA   . ARG A 1 65  ? 0.165   3.411   5.366   1.00 0.00 ? 65  ARG A CA   1  
ATOM 980   C C    . ARG A 1 65  ? -1.029  2.613   5.881   1.00 0.00 ? 65  ARG A C    1  
ATOM 981   O O    . ARG A 1 65  ? -1.210  2.456   7.089   1.00 0.00 ? 65  ARG A O    1  
ATOM 982   C CB   . ARG A 1 65  ? 1.466   2.797   5.886   1.00 0.00 ? 65  ARG A CB   1  
ATOM 983   C CG   . ARG A 1 65  ? 1.767   1.425   5.304   1.00 0.00 ? 65  ARG A CG   1  
ATOM 984   C CD   . ARG A 1 65  ? 2.691   0.626   6.210   1.00 0.00 ? 65  ARG A CD   1  
ATOM 985   N NE   . ARG A 1 65  ? 2.894   -0.734  5.721   1.00 0.00 ? 65  ARG A NE   1  
ATOM 986   C CZ   . ARG A 1 65  ? 3.830   -1.552  6.191   1.00 0.00 ? 65  ARG A CZ   1  
ATOM 987   N NH1  . ARG A 1 65  ? 4.644   -1.148  7.156   1.00 0.00 ? 65  ARG A NH1  1  
ATOM 988   N NH2  . ARG A 1 65  ? 3.953   -2.776  5.694   1.00 0.00 ? 65  ARG A NH2  1  
ATOM 989   H H    . ARG A 1 65  ? -0.504  5.049   6.527   1.00 0.00 ? 65  ARG A H    1  
ATOM 990   H HA   . ARG A 1 65  ? 0.168   3.377   4.287   1.00 0.00 ? 65  ARG A HA   1  
ATOM 991   H HB2  . ARG A 1 65  ? 2.285   3.456   5.640   1.00 0.00 ? 65  ARG A HB2  1  
ATOM 992   H HB3  . ARG A 1 65  ? 1.400   2.702   6.959   1.00 0.00 ? 65  ARG A HB3  1  
ATOM 993   H HG2  . ARG A 1 65  ? 0.841   0.883   5.185   1.00 0.00 ? 65  ARG A HG2  1  
ATOM 994   H HG3  . ARG A 1 65  ? 2.240   1.550   4.341   1.00 0.00 ? 65  ARG A HG3  1  
ATOM 995   H HD2  . ARG A 1 65  ? 3.646   1.127   6.260   1.00 0.00 ? 65  ARG A HD2  1  
ATOM 996   H HD3  . ARG A 1 65  ? 2.255   0.583   7.197   1.00 0.00 ? 65  ARG A HD3  1  
ATOM 997   H HE   . ARG A 1 65  ? 2.304   -1.053  5.007   1.00 0.00 ? 65  ARG A HE   1  
ATOM 998   H HH11 . ARG A 1 65  ? 4.553   -0.226  7.533   1.00 0.00 ? 65  ARG A HH11 1  
ATOM 999   H HH12 . ARG A 1 65  ? 5.347   -1.766  7.509   1.00 0.00 ? 65  ARG A HH12 1  
ATOM 1000  H HH21 . ARG A 1 65  ? 3.342   -3.084  4.966   1.00 0.00 ? 65  ARG A HH21 1  
ATOM 1001  H HH22 . ARG A 1 65  ? 4.658   -3.390  6.048   1.00 0.00 ? 65  ARG A HH22 1  
ATOM 1002  N N    . PHE A 1 66  ? -1.842  2.111   4.957   1.00 0.00 ? 66  PHE A N    1  
ATOM 1003  C CA   . PHE A 1 66  ? -3.019  1.330   5.317   1.00 0.00 ? 66  PHE A CA   1  
ATOM 1004  C C    . PHE A 1 66  ? -2.718  -0.164  5.266   1.00 0.00 ? 66  PHE A C    1  
ATOM 1005  O O    . PHE A 1 66  ? -1.692  -0.585  4.731   1.00 0.00 ? 66  PHE A O    1  
ATOM 1006  C CB   . PHE A 1 66  ? -4.182  1.660   4.379   1.00 0.00 ? 66  PHE A CB   1  
ATOM 1007  C CG   . PHE A 1 66  ? -4.705  3.059   4.541   1.00 0.00 ? 66  PHE A CG   1  
ATOM 1008  C CD1  . PHE A 1 66  ? -5.549  3.380   5.592   1.00 0.00 ? 66  PHE A CD1  1  
ATOM 1009  C CD2  . PHE A 1 66  ? -4.353  4.052   3.641   1.00 0.00 ? 66  PHE A CD2  1  
ATOM 1010  C CE1  . PHE A 1 66  ? -6.031  4.667   5.744   1.00 0.00 ? 66  PHE A CE1  1  
ATOM 1011  C CE2  . PHE A 1 66  ? -4.832  5.340   3.788   1.00 0.00 ? 66  PHE A CE2  1  
ATOM 1012  C CZ   . PHE A 1 66  ? -5.673  5.648   4.840   1.00 0.00 ? 66  PHE A CZ   1  
ATOM 1013  H H    . PHE A 1 66  ? -1.645  2.270   4.010   1.00 0.00 ? 66  PHE A H    1  
ATOM 1014  H HA   . PHE A 1 66  ? -3.296  1.595   6.326   1.00 0.00 ? 66  PHE A HA   1  
ATOM 1015  H HB2  . PHE A 1 66  ? -3.855  1.545   3.357   1.00 0.00 ? 66  PHE A HB2  1  
ATOM 1016  H HB3  . PHE A 1 66  ? -4.995  0.976   4.572   1.00 0.00 ? 66  PHE A HB3  1  
ATOM 1017  H HD1  . PHE A 1 66  ? -5.830  2.613   6.300   1.00 0.00 ? 66  PHE A HD1  1  
ATOM 1018  H HD2  . PHE A 1 66  ? -3.696  3.813   2.818   1.00 0.00 ? 66  PHE A HD2  1  
ATOM 1019  H HE1  . PHE A 1 66  ? -6.688  4.903   6.567   1.00 0.00 ? 66  PHE A HE1  1  
ATOM 1020  H HE2  . PHE A 1 66  ? -4.551  6.105   3.080   1.00 0.00 ? 66  PHE A HE2  1  
ATOM 1021  H HZ   . PHE A 1 66  ? -6.048  6.653   4.957   1.00 0.00 ? 66  PHE A HZ   1  
ATOM 1022  N N    . LYS A 1 67  ? -3.619  -0.963  5.827   1.00 0.00 ? 67  LYS A N    1  
ATOM 1023  C CA   . LYS A 1 67  ? -3.452  -2.412  5.846   1.00 0.00 ? 67  LYS A CA   1  
ATOM 1024  C C    . LYS A 1 67  ? -4.605  -3.102  5.125   1.00 0.00 ? 67  LYS A C    1  
ATOM 1025  O O    . LYS A 1 67  ? -5.773  -2.867  5.436   1.00 0.00 ? 67  LYS A O    1  
ATOM 1026  C CB   . LYS A 1 67  ? -3.362  -2.917  7.288   1.00 0.00 ? 67  LYS A CB   1  
ATOM 1027  C CG   . LYS A 1 67  ? -4.676  -2.830  8.045   1.00 0.00 ? 67  LYS A CG   1  
ATOM 1028  C CD   . LYS A 1 67  ? -4.505  -3.219  9.504   1.00 0.00 ? 67  LYS A CD   1  
ATOM 1029  C CE   . LYS A 1 67  ? -4.563  -4.728  9.689   1.00 0.00 ? 67  LYS A CE   1  
ATOM 1030  N NZ   . LYS A 1 67  ? -3.777  -5.172  10.873  1.00 0.00 ? 67  LYS A NZ   1  
ATOM 1031  H H    . LYS A 1 67  ? -4.417  -0.569  6.238   1.00 0.00 ? 67  LYS A H    1  
ATOM 1032  H HA   . LYS A 1 67  ? -2.531  -2.646  5.334   1.00 0.00 ? 67  LYS A HA   1  
ATOM 1033  H HB2  . LYS A 1 67  ? -3.045  -3.949  7.276   1.00 0.00 ? 67  LYS A HB2  1  
ATOM 1034  H HB3  . LYS A 1 67  ? -2.626  -2.329  7.817   1.00 0.00 ? 67  LYS A HB3  1  
ATOM 1035  H HG2  . LYS A 1 67  ? -5.044  -1.816  7.995   1.00 0.00 ? 67  LYS A HG2  1  
ATOM 1036  H HG3  . LYS A 1 67  ? -5.391  -3.498  7.585   1.00 0.00 ? 67  LYS A HG3  1  
ATOM 1037  H HD2  . LYS A 1 67  ? -3.548  -2.862  9.854   1.00 0.00 ? 67  LYS A HD2  1  
ATOM 1038  H HD3  . LYS A 1 67  ? -5.296  -2.764  10.084  1.00 0.00 ? 67  LYS A HD3  1  
ATOM 1039  H HE2  . LYS A 1 67  ? -5.593  -5.022  9.820   1.00 0.00 ? 67  LYS A HE2  1  
ATOM 1040  H HE3  . LYS A 1 67  ? -4.163  -5.201  8.804   1.00 0.00 ? 67  LYS A HE3  1  
ATOM 1041  H HZ1  . LYS A 1 67  ? -2.801  -4.819  10.807  1.00 0.00 ? 67  LYS A HZ1  1  
ATOM 1042  H HZ2  . LYS A 1 67  ? -3.756  -6.211  10.919  1.00 0.00 ? 67  LYS A HZ2  1  
ATOM 1043  H HZ3  . LYS A 1 67  ? -4.208  -4.806  11.746  1.00 0.00 ? 67  LYS A HZ3  1  
ATOM 1044  N N    . ILE A 1 68  ? -4.270  -3.955  4.163   1.00 0.00 ? 68  ILE A N    1  
ATOM 1045  C CA   . ILE A 1 68  ? -5.278  -4.680  3.400   1.00 0.00 ? 68  ILE A CA   1  
ATOM 1046  C C    . ILE A 1 68  ? -5.098  -6.187  3.546   1.00 0.00 ? 68  ILE A C    1  
ATOM 1047  O O    . ILE A 1 68  ? -4.309  -6.801  2.826   1.00 0.00 ? 68  ILE A O    1  
ATOM 1048  C CB   . ILE A 1 68  ? -5.229  -4.310  1.906   1.00 0.00 ? 68  ILE A CB   1  
ATOM 1049  C CG1  . ILE A 1 68  ? -5.414  -2.802  1.725   1.00 0.00 ? 68  ILE A CG1  1  
ATOM 1050  C CG2  . ILE A 1 68  ? -6.293  -5.077  1.135   1.00 0.00 ? 68  ILE A CG2  1  
ATOM 1051  C CD1  . ILE A 1 68  ? -5.275  -2.344  0.290   1.00 0.00 ? 68  ILE A CD1  1  
ATOM 1052  H H    . ILE A 1 68  ? -3.322  -4.100  3.961   1.00 0.00 ? 68  ILE A H    1  
ATOM 1053  H HA   . ILE A 1 68  ? -6.249  -4.406  3.787   1.00 0.00 ? 68  ILE A HA   1  
ATOM 1054  H HB   . ILE A 1 68  ? -4.263  -4.596  1.519   1.00 0.00 ? 68  ILE A HB   1  
ATOM 1055  H HG12 . ILE A 1 68  ? -6.398  -2.523  2.068   1.00 0.00 ? 68  ILE A HG12 1  
ATOM 1056  H HG13 . ILE A 1 68  ? -4.671  -2.283  2.313   1.00 0.00 ? 68  ILE A HG13 1  
ATOM 1057  H HG21 . ILE A 1 68  ? -7.269  -4.684  1.382   1.00 0.00 ? 68  ILE A HG21 1  
ATOM 1058  H HG22 . ILE A 1 68  ? -6.119  -4.966  0.075   1.00 0.00 ? 68  ILE A HG22 1  
ATOM 1059  H HG23 . ILE A 1 68  ? -6.248  -6.122  1.401   1.00 0.00 ? 68  ILE A HG23 1  
ATOM 1060  H HD11 . ILE A 1 68  ? -4.425  -2.832  -0.163  1.00 0.00 ? 68  ILE A HD11 1  
ATOM 1061  H HD12 . ILE A 1 68  ? -6.171  -2.597  -0.257  1.00 0.00 ? 68  ILE A HD12 1  
ATOM 1062  H HD13 . ILE A 1 68  ? -5.130  -1.274  0.267   1.00 0.00 ? 68  ILE A HD13 1  
ATOM 1063  N N    . CYS A 1 69  ? -5.836  -6.778  4.479   1.00 0.00 ? 69  CYS A N    1  
ATOM 1064  C CA   . CYS A 1 69  ? -5.759  -8.215  4.718   1.00 0.00 ? 69  CYS A CA   1  
ATOM 1065  C C    . CYS A 1 69  ? -6.748  -8.968  3.834   1.00 0.00 ? 69  CYS A C    1  
ATOM 1066  O O    . CYS A 1 69  ? -7.870  -8.521  3.596   1.00 0.00 ? 69  CYS A O    1  
ATOM 1067  C CB   . CYS A 1 69  ? -6.035  -8.524  6.190   1.00 0.00 ? 69  CYS A CB   1  
ATOM 1068  S SG   . CYS A 1 69  ? -4.635  -8.201  7.288   1.00 0.00 ? 69  CYS A SG   1  
ATOM 1069  H H    . CYS A 1 69  ? -6.447  -6.236  5.020   1.00 0.00 ? 69  CYS A H    1  
ATOM 1070  H HA   . CYS A 1 69  ? -4.758  -8.538  4.473   1.00 0.00 ? 69  CYS A HA   1  
ATOM 1071  H HB2  . CYS A 1 69  ? -6.863  -7.917  6.528   1.00 0.00 ? 69  CYS A HB2  1  
ATOM 1072  H HB3  . CYS A 1 69  ? -6.299  -9.566  6.288   1.00 0.00 ? 69  CYS A HB3  1  
ATOM 1073  H HG   . CYS A 1 69  ? -4.417  -9.294  8.003   1.00 0.00 ? 69  CYS A HG   1  
ATOM 1074  N N    . PRO A 1 70  ? -6.323  -10.137 3.332   1.00 0.00 ? 70  PRO A N    1  
ATOM 1075  C CA   . PRO A 1 70  ? -7.155  -10.976 2.465   1.00 0.00 ? 70  PRO A CA   1  
ATOM 1076  C C    . PRO A 1 70  ? -8.320  -11.610 3.217   1.00 0.00 ? 70  PRO A C    1  
ATOM 1077  O O    . PRO A 1 70  ? -8.206  -11.937 4.399   1.00 0.00 ? 70  PRO A O    1  
ATOM 1078  C CB   . PRO A 1 70  ? -6.184  -12.054 1.976   1.00 0.00 ? 70  PRO A CB   1  
ATOM 1079  C CG   . PRO A 1 70  ? -5.136  -12.126 3.032   1.00 0.00 ? 70  PRO A CG   1  
ATOM 1080  C CD   . PRO A 1 70  ? -4.997  -10.730 3.574   1.00 0.00 ? 70  PRO A CD   1  
ATOM 1081  H HA   . PRO A 1 70  ? -7.534  -10.420 1.620   1.00 0.00 ? 70  PRO A HA   1  
ATOM 1082  H HB2  . PRO A 1 70  ? -6.708  -12.993 1.873   1.00 0.00 ? 70  PRO A HB2  1  
ATOM 1083  H HB3  . PRO A 1 70  ? -5.767  -11.762 1.024   1.00 0.00 ? 70  PRO A HB3  1  
ATOM 1084  H HG2  . PRO A 1 70  ? -5.447  -12.802 3.813   1.00 0.00 ? 70  PRO A HG2  1  
ATOM 1085  H HG3  . PRO A 1 70  ? -4.202  -12.454 2.599   1.00 0.00 ? 70  PRO A HG3  1  
ATOM 1086  H HD2  . PRO A 1 70  ? -4.772  -10.756 4.630   1.00 0.00 ? 70  PRO A HD2  1  
ATOM 1087  H HD3  . PRO A 1 70  ? -4.230  -10.191 3.037   1.00 0.00 ? 70  PRO A HD3  1  
ATOM 1088  N N    . THR A 1 71  ? -9.442  -11.782 2.525   1.00 0.00 ? 71  THR A N    1  
ATOM 1089  C CA   . THR A 1 71  ? -10.628 -12.377 3.127   1.00 0.00 ? 71  THR A CA   1  
ATOM 1090  C C    . THR A 1 71  ? -10.962 -13.715 2.479   1.00 0.00 ? 71  THR A C    1  
ATOM 1091  O O    . THR A 1 71  ? -10.690 -13.947 1.301   1.00 0.00 ? 71  THR A O    1  
ATOM 1092  C CB   . THR A 1 71  ? -11.848 -11.443 3.007   1.00 0.00 ? 71  THR A CB   1  
ATOM 1093  O OG1  . THR A 1 71  ? -12.154 -11.212 1.628   1.00 0.00 ? 71  THR A OG1  1  
ATOM 1094  C CG2  . THR A 1 71  ? -11.583 -10.116 3.702   1.00 0.00 ? 71  THR A CG2  1  
ATOM 1095  H H    . THR A 1 71  ? -9.471  -11.502 1.586   1.00 0.00 ? 71  THR A H    1  
ATOM 1096  H HA   . THR A 1 71  ? -10.426 -12.536 4.176   1.00 0.00 ? 71  THR A HA   1  
ATOM 1097  H HB   . THR A 1 71  ? -12.694 -11.918 3.481   1.00 0.00 ? 71  THR A HB   1  
ATOM 1098  H HG1  . THR A 1 71  ? -11.353 -11.293 1.104   1.00 0.00 ? 71  THR A HG1  1  
ATOM 1099  H HG21 . THR A 1 71  ? -11.644 -9.313  2.982   1.00 0.00 ? 71  THR A HG21 1  
ATOM 1100  H HG22 . THR A 1 71  ? -10.597 -10.130 4.142   1.00 0.00 ? 71  THR A HG22 1  
ATOM 1101  H HG23 . THR A 1 71  ? -12.321 -9.962  4.475   1.00 0.00 ? 71  THR A HG23 1  
ATOM 1102  N N    . PRO A 1 72  ? -11.567 -14.619 3.264   1.00 0.00 ? 72  PRO A N    1  
ATOM 1103  C CA   . PRO A 1 72  ? -11.952 -15.951 2.787   1.00 0.00 ? 72  PRO A CA   1  
ATOM 1104  C C    . PRO A 1 72  ? -13.106 -15.898 1.792   1.00 0.00 ? 72  PRO A C    1  
ATOM 1105  O O    . PRO A 1 72  ? -13.572 -16.931 1.312   1.00 0.00 ? 72  PRO A O    1  
ATOM 1106  C CB   . PRO A 1 72  ? -12.381 -16.676 4.065   1.00 0.00 ? 72  PRO A CB   1  
ATOM 1107  C CG   . PRO A 1 72  ? -12.801 -15.589 4.994   1.00 0.00 ? 72  PRO A CG   1  
ATOM 1108  C CD   . PRO A 1 72  ? -11.921 -14.411 4.678   1.00 0.00 ? 72  PRO A CD   1  
ATOM 1109  H HA   . PRO A 1 72  ? -11.117 -16.469 2.340   1.00 0.00 ? 72  PRO A HA   1  
ATOM 1110  H HB2  . PRO A 1 72  ? -13.199 -17.347 3.844   1.00 0.00 ? 72  PRO A HB2  1  
ATOM 1111  H HB3  . PRO A 1 72  ? -11.547 -17.235 4.463   1.00 0.00 ? 72  PRO A HB3  1  
ATOM 1112  H HG2  . PRO A 1 72  ? -13.837 -15.340 4.823   1.00 0.00 ? 72  PRO A HG2  1  
ATOM 1113  H HG3  . PRO A 1 72  ? -12.653 -15.904 6.016   1.00 0.00 ? 72  PRO A HG3  1  
ATOM 1114  H HD2  . PRO A 1 72  ? -12.466 -13.488 4.807   1.00 0.00 ? 72  PRO A HD2  1  
ATOM 1115  H HD3  . PRO A 1 72  ? -11.039 -14.421 5.302   1.00 0.00 ? 72  PRO A HD3  1  
ATOM 1116  N N    . ASN A 1 73  ? -13.563 -14.688 1.486   1.00 0.00 ? 73  ASN A N    1  
ATOM 1117  C CA   . ASN A 1 73  ? -14.664 -14.501 0.547   1.00 0.00 ? 73  ASN A CA   1  
ATOM 1118  C C    . ASN A 1 73  ? -14.177 -13.837 -0.737  1.00 0.00 ? 73  ASN A C    1  
ATOM 1119  O O    . ASN A 1 73  ? -14.864 -12.993 -1.310  1.00 0.00 ? 73  ASN A O    1  
ATOM 1120  C CB   . ASN A 1 73  ? -15.768 -13.656 1.185   1.00 0.00 ? 73  ASN A CB   1  
ATOM 1121  C CG   . ASN A 1 73  ? -16.365 -14.316 2.413   1.00 0.00 ? 73  ASN A CG   1  
ATOM 1122  O OD1  . ASN A 1 73  ? -15.842 -15.313 2.912   1.00 0.00 ? 73  ASN A OD1  1  
ATOM 1123  N ND2  . ASN A 1 73  ? -17.466 -13.762 2.906   1.00 0.00 ? 73  ASN A ND2  1  
ATOM 1124  H H    . ASN A 1 73  ? -13.151 -13.902 1.901   1.00 0.00 ? 73  ASN A H    1  
ATOM 1125  H HA   . ASN A 1 73  ? -15.062 -15.475 0.306   1.00 0.00 ? 73  ASN A HA   1  
ATOM 1126  H HB2  . ASN A 1 73  ? -15.357 -12.700 1.478   1.00 0.00 ? 73  ASN A HB2  1  
ATOM 1127  H HB3  . ASN A 1 73  ? -16.556 -13.499 0.464   1.00 0.00 ? 73  ASN A HB3  1  
ATOM 1128  H HD21 . ASN A 1 73  ? -17.827 -12.969 2.457   1.00 0.00 ? 73  ASN A HD21 1  
ATOM 1129  H HD22 . ASN A 1 73  ? -17.872 -14.168 3.700   1.00 0.00 ? 73  ASN A HD22 1  
ATOM 1130  N N    . ASN A 1 74  ? -12.986 -14.224 -1.183  1.00 0.00 ? 74  ASN A N    1  
ATOM 1131  C CA   . ASN A 1 74  ? -12.407 -13.666 -2.399  1.00 0.00 ? 74  ASN A CA   1  
ATOM 1132  C C    . ASN A 1 74  ? -12.579 -12.151 -2.438  1.00 0.00 ? 74  ASN A C    1  
ATOM 1133  O O    . ASN A 1 74  ? -13.063 -11.597 -3.425  1.00 0.00 ? 74  ASN A O    1  
ATOM 1134  C CB   . ASN A 1 74  ? -13.055 -14.296 -3.633  1.00 0.00 ? 74  ASN A CB   1  
ATOM 1135  C CG   . ASN A 1 74  ? -12.117 -14.333 -4.824  1.00 0.00 ? 74  ASN A CG   1  
ATOM 1136  O OD1  . ASN A 1 74  ? -10.951 -14.706 -4.699  1.00 0.00 ? 74  ASN A OD1  1  
ATOM 1137  N ND2  . ASN A 1 74  ? -12.623 -13.943 -5.988  1.00 0.00 ? 74  ASN A ND2  1  
ATOM 1138  H H    . ASN A 1 74  ? -12.485 -14.902 -0.682  1.00 0.00 ? 74  ASN A H    1  
ATOM 1139  H HA   . ASN A 1 74  ? -11.352 -13.897 -2.400  1.00 0.00 ? 74  ASN A HA   1  
ATOM 1140  H HB2  . ASN A 1 74  ? -13.349 -15.310 -3.401  1.00 0.00 ? 74  ASN A HB2  1  
ATOM 1141  H HB3  . ASN A 1 74  ? -13.930 -13.725 -3.905  1.00 0.00 ? 74  ASN A HB3  1  
ATOM 1142  H HD21 . ASN A 1 74  ? -13.561 -13.658 -6.014  1.00 0.00 ? 74  ASN A HD21 1  
ATOM 1143  H HD22 . ASN A 1 74  ? -12.039 -13.957 -6.775  1.00 0.00 ? 74  ASN A HD22 1  
ATOM 1144  N N    . GLN A 1 75  ? -12.179 -11.487 -1.358  1.00 0.00 ? 75  GLN A N    1  
ATOM 1145  C CA   . GLN A 1 75  ? -12.289 -10.036 -1.270  1.00 0.00 ? 75  GLN A CA   1  
ATOM 1146  C C    . GLN A 1 75  ? -11.162 -9.455  -0.422  1.00 0.00 ? 75  GLN A C    1  
ATOM 1147  O O    . GLN A 1 75  ? -10.333 -10.190 0.116   1.00 0.00 ? 75  GLN A O    1  
ATOM 1148  C CB   . GLN A 1 75  ? -13.643 -9.642  -0.678  1.00 0.00 ? 75  GLN A CB   1  
ATOM 1149  C CG   . GLN A 1 75  ? -14.802 -9.806  -1.648  1.00 0.00 ? 75  GLN A CG   1  
ATOM 1150  C CD   . GLN A 1 75  ? -16.146 -9.526  -1.005  1.00 0.00 ? 75  GLN A CD   1  
ATOM 1151  O OE1  . GLN A 1 75  ? -16.222 -9.173  0.173   1.00 0.00 ? 75  GLN A OE1  1  
ATOM 1152  N NE2  . GLN A 1 75  ? -17.216 -9.682  -1.775  1.00 0.00 ? 75  GLN A NE2  1  
ATOM 1153  H H    . GLN A 1 75  ? -11.801 -11.985 -0.604  1.00 0.00 ? 75  GLN A H    1  
ATOM 1154  H HA   . GLN A 1 75  ? -12.213 -9.636  -2.269  1.00 0.00 ? 75  GLN A HA   1  
ATOM 1155  H HB2  . GLN A 1 75  ? -13.837 -10.256 0.188   1.00 0.00 ? 75  GLN A HB2  1  
ATOM 1156  H HB3  . GLN A 1 75  ? -13.602 -8.607  -0.373  1.00 0.00 ? 75  GLN A HB3  1  
ATOM 1157  H HG2  . GLN A 1 75  ? -14.666 -9.121  -2.471  1.00 0.00 ? 75  GLN A HG2  1  
ATOM 1158  H HG3  . GLN A 1 75  ? -14.802 -10.819 -2.021  1.00 0.00 ? 75  GLN A HG3  1  
ATOM 1159  H HE21 . GLN A 1 75  ? -17.079 -9.966  -2.704  1.00 0.00 ? 75  GLN A HE21 1  
ATOM 1160  H HE22 . GLN A 1 75  ? -18.097 -9.508  -1.385  1.00 0.00 ? 75  GLN A HE22 1  
ATOM 1161  N N    . PHE A 1 76  ? -11.137 -8.132  -0.307  1.00 0.00 ? 76  PHE A N    1  
ATOM 1162  C CA   . PHE A 1 76  ? -10.110 -7.452  0.474   1.00 0.00 ? 76  PHE A CA   1  
ATOM 1163  C C    . PHE A 1 76  ? -10.739 -6.585  1.561   1.00 0.00 ? 76  PHE A C    1  
ATOM 1164  O O    . PHE A 1 76  ? -11.827 -6.038  1.382   1.00 0.00 ? 76  PHE A O    1  
ATOM 1165  C CB   . PHE A 1 76  ? -9.233  -6.590  -0.437  1.00 0.00 ? 76  PHE A CB   1  
ATOM 1166  C CG   . PHE A 1 76  ? -8.395  -7.390  -1.393  1.00 0.00 ? 76  PHE A CG   1  
ATOM 1167  C CD1  . PHE A 1 76  ? -8.985  -8.093  -2.432  1.00 0.00 ? 76  PHE A CD1  1  
ATOM 1168  C CD2  . PHE A 1 76  ? -7.017  -7.439  -1.255  1.00 0.00 ? 76  PHE A CD2  1  
ATOM 1169  C CE1  . PHE A 1 76  ? -8.217  -8.830  -3.312  1.00 0.00 ? 76  PHE A CE1  1  
ATOM 1170  C CE2  . PHE A 1 76  ? -6.243  -8.174  -2.133  1.00 0.00 ? 76  PHE A CE2  1  
ATOM 1171  C CZ   . PHE A 1 76  ? -6.844  -8.870  -3.164  1.00 0.00 ? 76  PHE A CZ   1  
ATOM 1172  H H    . PHE A 1 76  ? -11.825 -7.599  -0.759  1.00 0.00 ? 76  PHE A H    1  
ATOM 1173  H HA   . PHE A 1 76  ? -9.496  -8.206  0.942   1.00 0.00 ? 76  PHE A HA   1  
ATOM 1174  H HB2  . PHE A 1 76  ? -9.864  -5.935  -1.018  1.00 0.00 ? 76  PHE A HB2  1  
ATOM 1175  H HB3  . PHE A 1 76  ? -8.568  -5.997  0.172   1.00 0.00 ? 76  PHE A HB3  1  
ATOM 1176  H HD1  . PHE A 1 76  ? -10.058 -8.062  -2.550  1.00 0.00 ? 76  PHE A HD1  1  
ATOM 1177  H HD2  . PHE A 1 76  ? -6.546  -6.894  -0.448  1.00 0.00 ? 76  PHE A HD2  1  
ATOM 1178  H HE1  . PHE A 1 76  ? -8.689  -9.372  -4.118  1.00 0.00 ? 76  PHE A HE1  1  
ATOM 1179  H HE2  . PHE A 1 76  ? -5.171  -8.203  -2.013  1.00 0.00 ? 76  PHE A HE2  1  
ATOM 1180  H HZ   . PHE A 1 76  ? -6.241  -9.445  -3.850  1.00 0.00 ? 76  PHE A HZ   1  
ATOM 1181  N N    . MET A 1 77  ? -10.045 -6.465  2.689   1.00 0.00 ? 77  MET A N    1  
ATOM 1182  C CA   . MET A 1 77  ? -10.535 -5.665  3.805   1.00 0.00 ? 77  MET A CA   1  
ATOM 1183  C C    . MET A 1 77  ? -9.653  -4.439  4.024   1.00 0.00 ? 77  MET A C    1  
ATOM 1184  O O    . MET A 1 77  ? -8.428  -4.544  4.061   1.00 0.00 ? 77  MET A O    1  
ATOM 1185  C CB   . MET A 1 77  ? -10.584 -6.507  5.081   1.00 0.00 ? 77  MET A CB   1  
ATOM 1186  C CG   . MET A 1 77  ? -11.913 -7.214  5.292   1.00 0.00 ? 77  MET A CG   1  
ATOM 1187  S SD   . MET A 1 77  ? -11.827 -8.489  6.564   1.00 0.00 ? 77  MET A SD   1  
ATOM 1188  C CE   . MET A 1 77  ? -10.849 -7.656  7.812   1.00 0.00 ? 77  MET A CE   1  
ATOM 1189  H H    . MET A 1 77  ? -9.184  -6.925  2.772   1.00 0.00 ? 77  MET A H    1  
ATOM 1190  H HA   . MET A 1 77  ? -11.535 -5.336  3.563   1.00 0.00 ? 77  MET A HA   1  
ATOM 1191  H HB2  . MET A 1 77  ? -9.806  -7.254  5.035   1.00 0.00 ? 77  MET A HB2  1  
ATOM 1192  H HB3  . MET A 1 77  ? -10.405 -5.864  5.930   1.00 0.00 ? 77  MET A HB3  1  
ATOM 1193  H HG2  . MET A 1 77  ? -12.652 -6.484  5.584   1.00 0.00 ? 77  MET A HG2  1  
ATOM 1194  H HG3  . MET A 1 77  ? -12.212 -7.673  4.361   1.00 0.00 ? 77  MET A HG3  1  
ATOM 1195  H HE1  . MET A 1 77  ? -9.802  -7.857  7.643   1.00 0.00 ? 77  MET A HE1  1  
ATOM 1196  H HE2  . MET A 1 77  ? -11.025 -6.592  7.757   1.00 0.00 ? 77  MET A HE2  1  
ATOM 1197  H HE3  . MET A 1 77  ? -11.131 -8.018  8.791   1.00 0.00 ? 77  MET A HE3  1  
ATOM 1198  N N    . MET A 1 78  ? -10.285 -3.279  4.167   1.00 0.00 ? 78  MET A N    1  
ATOM 1199  C CA   . MET A 1 78  ? -9.556  -2.034  4.383   1.00 0.00 ? 78  MET A CA   1  
ATOM 1200  C C    . MET A 1 78  ? -10.260 -1.165  5.420   1.00 0.00 ? 78  MET A C    1  
ATOM 1201  O O    . MET A 1 78  ? -11.350 -0.649  5.175   1.00 0.00 ? 78  MET A O    1  
ATOM 1202  C CB   . MET A 1 78  ? -9.416  -1.266  3.067   1.00 0.00 ? 78  MET A CB   1  
ATOM 1203  C CG   . MET A 1 78  ? -8.307  -0.226  3.086   1.00 0.00 ? 78  MET A CG   1  
ATOM 1204  S SD   . MET A 1 78  ? -7.894  0.379   1.439   1.00 0.00 ? 78  MET A SD   1  
ATOM 1205  C CE   . MET A 1 78  ? -7.501  2.090   1.796   1.00 0.00 ? 78  MET A CE   1  
ATOM 1206  H H    . MET A 1 78  ? -11.264 -3.259  4.128   1.00 0.00 ? 78  MET A H    1  
ATOM 1207  H HA   . MET A 1 78  ? -8.572  -2.286  4.749   1.00 0.00 ? 78  MET A HA   1  
ATOM 1208  H HB2  . MET A 1 78  ? -9.207  -1.969  2.274   1.00 0.00 ? 78  MET A HB2  1  
ATOM 1209  H HB3  . MET A 1 78  ? -10.347 -0.763  2.856   1.00 0.00 ? 78  MET A HB3  1  
ATOM 1210  H HG2  . MET A 1 78  ? -8.625  0.609   3.692   1.00 0.00 ? 78  MET A HG2  1  
ATOM 1211  H HG3  . MET A 1 78  ? -7.425  -0.670  3.524   1.00 0.00 ? 78  MET A HG3  1  
ATOM 1212  H HE1  . MET A 1 78  ? -8.344  2.561   2.278   1.00 0.00 ? 78  MET A HE1  1  
ATOM 1213  H HE2  . MET A 1 78  ? -6.642  2.132   2.449   1.00 0.00 ? 78  MET A HE2  1  
ATOM 1214  H HE3  . MET A 1 78  ? -7.278  2.607   0.874   1.00 0.00 ? 78  MET A HE3  1  
ATOM 1215  N N    . GLY A 1 79  ? -9.630  -1.008  6.580   1.00 0.00 ? 79  GLY A N    1  
ATOM 1216  C CA   . GLY A 1 79  ? -10.211 -0.201  7.637   1.00 0.00 ? 79  GLY A CA   1  
ATOM 1217  C C    . GLY A 1 79  ? -11.576 -0.703  8.066   1.00 0.00 ? 79  GLY A C    1  
ATOM 1218  O O    . GLY A 1 79  ? -12.503 0.083   8.254   1.00 0.00 ? 79  GLY A O    1  
ATOM 1219  H H    . GLY A 1 79  ? -8.763  -1.443  6.720   1.00 0.00 ? 79  GLY A H    1  
ATOM 1220  H HA2  . GLY A 1 79  ? -9.550  -0.214  8.490   1.00 0.00 ? 79  GLY A HA2  1  
ATOM 1221  H HA3  . GLY A 1 79  ? -10.309 0.816   7.285   1.00 0.00 ? 79  GLY A HA3  1  
ATOM 1222  N N    . GLY A 1 80  ? -11.700 -2.018  8.219   1.00 0.00 ? 80  GLY A N    1  
ATOM 1223  C CA   . GLY A 1 80  ? -12.965 -2.601  8.625   1.00 0.00 ? 80  GLY A CA   1  
ATOM 1224  C C    . GLY A 1 80  ? -14.002 -2.562  7.521   1.00 0.00 ? 80  GLY A C    1  
ATOM 1225  O O    . GLY A 1 80  ? -15.203 -2.509  7.790   1.00 0.00 ? 80  GLY A O    1  
ATOM 1226  H H    . GLY A 1 80  ? -10.926 -2.596  8.055   1.00 0.00 ? 80  GLY A H    1  
ATOM 1227  H HA2  . GLY A 1 80  ? -12.799 -3.629  8.913   1.00 0.00 ? 80  GLY A HA2  1  
ATOM 1228  H HA3  . GLY A 1 80  ? -13.343 -2.056  9.478   1.00 0.00 ? 80  GLY A HA3  1  
ATOM 1229  N N    . ARG A 1 81  ? -13.540 -2.586  6.275   1.00 0.00 ? 81  ARG A N    1  
ATOM 1230  C CA   . ARG A 1 81  ? -14.437 -2.550  5.126   1.00 0.00 ? 81  ARG A CA   1  
ATOM 1231  C C    . ARG A 1 81  ? -14.340 -3.842  4.320   1.00 0.00 ? 81  ARG A C    1  
ATOM 1232  O O    . ARG A 1 81  ? -13.516 -4.709  4.614   1.00 0.00 ? 81  ARG A O    1  
ATOM 1233  C CB   . ARG A 1 81  ? -14.107 -1.353  4.233   1.00 0.00 ? 81  ARG A CB   1  
ATOM 1234  C CG   . ARG A 1 81  ? -14.017 -0.037  4.987   1.00 0.00 ? 81  ARG A CG   1  
ATOM 1235  C CD   . ARG A 1 81  ? -15.385 0.607   5.150   1.00 0.00 ? 81  ARG A CD   1  
ATOM 1236  N NE   . ARG A 1 81  ? -16.039 0.197   6.390   1.00 0.00 ? 81  ARG A NE   1  
ATOM 1237  C CZ   . ARG A 1 81  ? -17.161 0.744   6.845   1.00 0.00 ? 81  ARG A CZ   1  
ATOM 1238  N NH1  . ARG A 1 81  ? -17.750 1.717   6.165   1.00 0.00 ? 81  ARG A NH1  1  
ATOM 1239  N NH2  . ARG A 1 81  ? -17.695 0.316   7.981   1.00 0.00 ? 81  ARG A NH2  1  
ATOM 1240  H H    . ARG A 1 81  ? -12.572 -2.629  6.125   1.00 0.00 ? 81  ARG A H    1  
ATOM 1241  H HA   . ARG A 1 81  ? -15.446 -2.445  5.496   1.00 0.00 ? 81  ARG A HA   1  
ATOM 1242  H HB2  . ARG A 1 81  ? -13.158 -1.531  3.748   1.00 0.00 ? 81  ARG A HB2  1  
ATOM 1243  H HB3  . ARG A 1 81  ? -14.875 -1.260  3.480   1.00 0.00 ? 81  ARG A HB3  1  
ATOM 1244  H HG2  . ARG A 1 81  ? -13.599 -0.221  5.966   1.00 0.00 ? 81  ARG A HG2  1  
ATOM 1245  H HG3  . ARG A 1 81  ? -13.374 0.637   4.440   1.00 0.00 ? 81  ARG A HG3  1  
ATOM 1246  H HD2  . ARG A 1 81  ? -15.265 1.680   5.156   1.00 0.00 ? 81  ARG A HD2  1  
ATOM 1247  H HD3  . ARG A 1 81  ? -16.005 0.319   4.314   1.00 0.00 ? 81  ARG A HD3  1  
ATOM 1248  H HE   . ARG A 1 81  ? -15.620 -0.521  6.908   1.00 0.00 ? 81  ARG A HE   1  
ATOM 1249  H HH11 . ARG A 1 81  ? -17.351 2.041   5.308   1.00 0.00 ? 81  ARG A HH11 1  
ATOM 1250  H HH12 . ARG A 1 81  ? -18.596 2.127   6.509   1.00 0.00 ? 81  ARG A HH12 1  
ATOM 1251  H HH21 . ARG A 1 81  ? -17.253 -0.418  8.496   1.00 0.00 ? 81  ARG A HH21 1  
ATOM 1252  H HH22 . ARG A 1 81  ? -18.539 0.728   8.323   1.00 0.00 ? 81  ARG A HH22 1  
ATOM 1253  N N    . TYR A 1 82  ? -15.187 -3.964  3.305   1.00 0.00 ? 82  TYR A N    1  
ATOM 1254  C CA   . TYR A 1 82  ? -15.200 -5.151  2.458   1.00 0.00 ? 82  TYR A CA   1  
ATOM 1255  C C    . TYR A 1 82  ? -15.608 -4.798  1.031   1.00 0.00 ? 82  TYR A C    1  
ATOM 1256  O O    . TYR A 1 82  ? -16.761 -4.457  0.769   1.00 0.00 ? 82  TYR A O    1  
ATOM 1257  C CB   . TYR A 1 82  ? -16.155 -6.200  3.029   1.00 0.00 ? 82  TYR A CB   1  
ATOM 1258  C CG   . TYR A 1 82  ? -16.124 -6.290  4.538   1.00 0.00 ? 82  TYR A CG   1  
ATOM 1259  C CD1  . TYR A 1 82  ? -15.215 -7.119  5.185   1.00 0.00 ? 82  TYR A CD1  1  
ATOM 1260  C CD2  . TYR A 1 82  ? -17.003 -5.548  5.316   1.00 0.00 ? 82  TYR A CD2  1  
ATOM 1261  C CE1  . TYR A 1 82  ? -15.184 -7.205  6.564   1.00 0.00 ? 82  TYR A CE1  1  
ATOM 1262  C CE2  . TYR A 1 82  ? -16.978 -5.627  6.695   1.00 0.00 ? 82  TYR A CE2  1  
ATOM 1263  C CZ   . TYR A 1 82  ? -16.066 -6.457  7.314   1.00 0.00 ? 82  TYR A CZ   1  
ATOM 1264  O OH   . TYR A 1 82  ? -16.039 -6.539  8.688   1.00 0.00 ? 82  TYR A OH   1  
ATOM 1265  H H    . TYR A 1 82  ? -15.821 -3.239  3.120   1.00 0.00 ? 82  TYR A H    1  
ATOM 1266  H HA   . TYR A 1 82  ? -14.200 -5.559  2.444   1.00 0.00 ? 82  TYR A HA   1  
ATOM 1267  H HB2  . TYR A 1 82  ? -17.164 -5.958  2.733   1.00 0.00 ? 82  TYR A HB2  1  
ATOM 1268  H HB3  . TYR A 1 82  ? -15.892 -7.170  2.633   1.00 0.00 ? 82  TYR A HB3  1  
ATOM 1269  H HD1  . TYR A 1 82  ? -14.525 -7.704  4.595   1.00 0.00 ? 82  TYR A HD1  1  
ATOM 1270  H HD2  . TYR A 1 82  ? -17.716 -4.899  4.828   1.00 0.00 ? 82  TYR A HD2  1  
ATOM 1271  H HE1  . TYR A 1 82  ? -14.470 -7.855  7.049   1.00 0.00 ? 82  TYR A HE1  1  
ATOM 1272  H HE2  . TYR A 1 82  ? -17.669 -5.041  7.283   1.00 0.00 ? 82  TYR A HE2  1  
ATOM 1273  H HH   . TYR A 1 82  ? -16.744 -7.117  8.988   1.00 0.00 ? 82  TYR A HH   1  
ATOM 1274  N N    . TYR A 1 83  ? -14.653 -4.884  0.112   1.00 0.00 ? 83  TYR A N    1  
ATOM 1275  C CA   . TYR A 1 83  ? -14.911 -4.572  -1.289  1.00 0.00 ? 83  TYR A CA   1  
ATOM 1276  C C    . TYR A 1 83  ? -14.711 -5.804  -2.167  1.00 0.00 ? 83  TYR A C    1  
ATOM 1277  O O    . TYR A 1 83  ? -14.087 -6.780  -1.753  1.00 0.00 ? 83  TYR A O    1  
ATOM 1278  C CB   . TYR A 1 83  ? -13.992 -3.443  -1.760  1.00 0.00 ? 83  TYR A CB   1  
ATOM 1279  C CG   . TYR A 1 83  ? -14.160 -2.160  -0.978  1.00 0.00 ? 83  TYR A CG   1  
ATOM 1280  C CD1  . TYR A 1 83  ? -13.544 -1.990  0.256   1.00 0.00 ? 83  TYR A CD1  1  
ATOM 1281  C CD2  . TYR A 1 83  ? -14.935 -1.119  -1.473  1.00 0.00 ? 83  TYR A CD2  1  
ATOM 1282  C CE1  . TYR A 1 83  ? -13.696 -0.820  0.974   1.00 0.00 ? 83  TYR A CE1  1  
ATOM 1283  C CE2  . TYR A 1 83  ? -15.091 0.055   -0.762  1.00 0.00 ? 83  TYR A CE2  1  
ATOM 1284  C CZ   . TYR A 1 83  ? -14.470 0.200   0.461   1.00 0.00 ? 83  TYR A CZ   1  
ATOM 1285  O OH   . TYR A 1 83  ? -14.623 1.368   1.172   1.00 0.00 ? 83  TYR A OH   1  
ATOM 1286  H H    . TYR A 1 83  ? -13.753 -5.161  0.381   1.00 0.00 ? 83  TYR A H    1  
ATOM 1287  H HA   . TYR A 1 83  ? -15.937 -4.247  -1.373  1.00 0.00 ? 83  TYR A HA   1  
ATOM 1288  H HB2  . TYR A 1 83  ? -12.965 -3.759  -1.661  1.00 0.00 ? 83  TYR A HB2  1  
ATOM 1289  H HB3  . TYR A 1 83  ? -14.199 -3.229  -2.798  1.00 0.00 ? 83  TYR A HB3  1  
ATOM 1290  H HD1  . TYR A 1 83  ? -12.939 -2.790  0.655   1.00 0.00 ? 83  TYR A HD1  1  
ATOM 1291  H HD2  . TYR A 1 83  ? -15.421 -1.236  -2.431  1.00 0.00 ? 83  TYR A HD2  1  
ATOM 1292  H HE1  . TYR A 1 83  ? -13.209 -0.705  1.932   1.00 0.00 ? 83  TYR A HE1  1  
ATOM 1293  H HE2  . TYR A 1 83  ? -15.698 0.854   -1.163  1.00 0.00 ? 83  TYR A HE2  1  
ATOM 1294  H HH   . TYR A 1 83  ? -13.775 1.637   1.532   1.00 0.00 ? 83  TYR A HH   1  
ATOM 1295  N N    . ASN A 1 84  ? -15.248 -5.750  -3.382  1.00 0.00 ? 84  ASN A N    1  
ATOM 1296  C CA   . ASN A 1 84  ? -15.130 -6.861  -4.320  1.00 0.00 ? 84  ASN A CA   1  
ATOM 1297  C C    . ASN A 1 84  ? -13.665 -7.172  -4.613  1.00 0.00 ? 84  ASN A C    1  
ATOM 1298  O O    . ASN A 1 84  ? -13.251 -8.331  -4.598  1.00 0.00 ? 84  ASN A O    1  
ATOM 1299  C CB   . ASN A 1 84  ? -15.864 -6.536  -5.622  1.00 0.00 ? 84  ASN A CB   1  
ATOM 1300  C CG   . ASN A 1 84  ? -17.366 -6.450  -5.433  1.00 0.00 ? 84  ASN A CG   1  
ATOM 1301  O OD1  . ASN A 1 84  ? -17.857 -5.662  -4.624  1.00 0.00 ? 84  ASN A OD1  1  
ATOM 1302  N ND2  . ASN A 1 84  ? -18.104 -7.264  -6.179  1.00 0.00 ? 84  ASN A ND2  1  
ATOM 1303  H H    . ASN A 1 84  ? -15.734 -4.944  -3.655  1.00 0.00 ? 84  ASN A H    1  
ATOM 1304  H HA   . ASN A 1 84  ? -15.586 -7.728  -3.866  1.00 0.00 ? 84  ASN A HA   1  
ATOM 1305  H HB2  . ASN A 1 84  ? -15.513 -5.586  -5.999  1.00 0.00 ? 84  ASN A HB2  1  
ATOM 1306  H HB3  . ASN A 1 84  ? -15.654 -7.307  -6.349  1.00 0.00 ? 84  ASN A HB3  1  
ATOM 1307  H HD21 . ASN A 1 84  ? -17.645 -7.865  -6.802  1.00 0.00 ? 84  ASN A HD21 1  
ATOM 1308  H HD22 . ASN A 1 84  ? -19.078 -7.228  -6.078  1.00 0.00 ? 84  ASN A HD22 1  
ATOM 1309  N N    . SER A 1 85  ? -12.886 -6.129  -4.878  1.00 0.00 ? 85  SER A N    1  
ATOM 1310  C CA   . SER A 1 85  ? -11.468 -6.291  -5.178  1.00 0.00 ? 85  SER A CA   1  
ATOM 1311  C C    . SER A 1 85  ? -10.727 -4.964  -5.035  1.00 0.00 ? 85  SER A C    1  
ATOM 1312  O O    . SER A 1 85  ? -11.346 -3.905  -4.929  1.00 0.00 ? 85  SER A O    1  
ATOM 1313  C CB   . SER A 1 85  ? -11.283 -6.841  -6.593  1.00 0.00 ? 85  SER A CB   1  
ATOM 1314  O OG   . SER A 1 85  ? -11.755 -5.921  -7.563  1.00 0.00 ? 85  SER A OG   1  
ATOM 1315  H H    . SER A 1 85  ? -13.274 -5.229  -4.875  1.00 0.00 ? 85  SER A H    1  
ATOM 1316  H HA   . SER A 1 85  ? -11.058 -6.996  -4.471  1.00 0.00 ? 85  SER A HA   1  
ATOM 1317  H HB2  . SER A 1 85  ? -10.235 -7.027  -6.771  1.00 0.00 ? 85  SER A HB2  1  
ATOM 1318  H HB3  . SER A 1 85  ? -11.835 -7.765  -6.692  1.00 0.00 ? 85  SER A HB3  1  
ATOM 1319  H HG   . SER A 1 85  ? -11.406 -6.158  -8.426  1.00 0.00 ? 85  SER A HG   1  
ATOM 1320  N N    . ILE A 1 86  ? -9.401  -5.032  -5.033  1.00 0.00 ? 86  ILE A N    1  
ATOM 1321  C CA   . ILE A 1 86  ? -8.576  -3.837  -4.905  1.00 0.00 ? 86  ILE A CA   1  
ATOM 1322  C C    . ILE A 1 86  ? -9.015  -2.757  -5.887  1.00 0.00 ? 86  ILE A C    1  
ATOM 1323  O O    . ILE A 1 86  ? -9.484  -1.692  -5.487  1.00 0.00 ? 86  ILE A O    1  
ATOM 1324  C CB   . ILE A 1 86  ? -7.087  -4.153  -5.139  1.00 0.00 ? 86  ILE A CB   1  
ATOM 1325  C CG1  . ILE A 1 86  ? -6.574  -5.121  -4.072  1.00 0.00 ? 86  ILE A CG1  1  
ATOM 1326  C CG2  . ILE A 1 86  ? -6.266  -2.872  -5.138  1.00 0.00 ? 86  ILE A CG2  1  
ATOM 1327  C CD1  . ILE A 1 86  ? -5.065  -5.222  -4.021  1.00 0.00 ? 86  ILE A CD1  1  
ATOM 1328  H H    . ILE A 1 86  ? -8.966  -5.905  -5.121  1.00 0.00 ? 86  ILE A H    1  
ATOM 1329  H HA   . ILE A 1 86  ? -8.689  -3.461  -3.898  1.00 0.00 ? 86  ILE A HA   1  
ATOM 1330  H HB   . ILE A 1 86  ? -6.988  -4.614  -6.110  1.00 0.00 ? 86  ILE A HB   1  
ATOM 1331  H HG12 . ILE A 1 86  ? -6.917  -4.794  -3.103  1.00 0.00 ? 86  ILE A HG12 1  
ATOM 1332  H HG13 . ILE A 1 86  ? -6.966  -6.108  -4.273  1.00 0.00 ? 86  ILE A HG13 1  
ATOM 1333  H HG21 . ILE A 1 86  ? -5.224  -3.111  -5.290  1.00 0.00 ? 86  ILE A HG21 1  
ATOM 1334  H HG22 . ILE A 1 86  ? -6.606  -2.226  -5.934  1.00 0.00 ? 86  ILE A HG22 1  
ATOM 1335  H HG23 . ILE A 1 86  ? -6.386  -2.369  -4.190  1.00 0.00 ? 86  ILE A HG23 1  
ATOM 1336  H HD11 . ILE A 1 86  ? -4.677  -4.473  -3.347  1.00 0.00 ? 86  ILE A HD11 1  
ATOM 1337  H HD12 . ILE A 1 86  ? -4.781  -6.203  -3.673  1.00 0.00 ? 86  ILE A HD12 1  
ATOM 1338  H HD13 . ILE A 1 86  ? -4.661  -5.059  -5.010  1.00 0.00 ? 86  ILE A HD13 1  
ATOM 1339  N N    . GLY A 1 87  ? -8.862  -3.040  -7.177  1.00 0.00 ? 87  GLY A N    1  
ATOM 1340  C CA   . GLY A 1 87  ? -9.250  -2.084  -8.198  1.00 0.00 ? 87  GLY A CA   1  
ATOM 1341  C C    . GLY A 1 87  ? -10.490 -1.300  -7.817  1.00 0.00 ? 87  GLY A C    1  
ATOM 1342  O O    . GLY A 1 87  ? -10.567 -0.094  -8.052  1.00 0.00 ? 87  GLY A O    1  
ATOM 1343  H H    . GLY A 1 87  ? -8.482  -3.905  -7.438  1.00 0.00 ? 87  GLY A H    1  
ATOM 1344  H HA2  . GLY A 1 87  ? -8.435  -1.393  -8.357  1.00 0.00 ? 87  GLY A HA2  1  
ATOM 1345  H HA3  . GLY A 1 87  ? -9.442  -2.615  -9.118  1.00 0.00 ? 87  GLY A HA3  1  
ATOM 1346  N N    . ASP A 1 88  ? -11.464 -1.986  -7.229  1.00 0.00 ? 88  ASP A N    1  
ATOM 1347  C CA   . ASP A 1 88  ? -12.707 -1.347  -6.815  1.00 0.00 ? 88  ASP A CA   1  
ATOM 1348  C C    . ASP A 1 88  ? -12.460 -0.365  -5.675  1.00 0.00 ? 88  ASP A C    1  
ATOM 1349  O O    . ASP A 1 88  ? -12.792 0.817   -5.777  1.00 0.00 ? 88  ASP A O    1  
ATOM 1350  C CB   . ASP A 1 88  ? -13.729 -2.401  -6.384  1.00 0.00 ? 88  ASP A CB   1  
ATOM 1351  C CG   . ASP A 1 88  ? -14.508 -2.965  -7.556  1.00 0.00 ? 88  ASP A CG   1  
ATOM 1352  O OD1  . ASP A 1 88  ? -13.920 -3.099  -8.650  1.00 0.00 ? 88  ASP A OD1  1  
ATOM 1353  O OD2  . ASP A 1 88  ? -15.705 -3.273  -7.379  1.00 0.00 ? 88  ASP A OD2  1  
ATOM 1354  H H    . ASP A 1 88  ? -11.343 -2.946  -7.068  1.00 0.00 ? 88  ASP A H    1  
ATOM 1355  H HA   . ASP A 1 88  ? -13.099 -0.804  -7.662  1.00 0.00 ? 88  ASP A HA   1  
ATOM 1356  H HB2  . ASP A 1 88  ? -13.213 -3.214  -5.895  1.00 0.00 ? 88  ASP A HB2  1  
ATOM 1357  H HB3  . ASP A 1 88  ? -14.427 -1.954  -5.692  1.00 0.00 ? 88  ASP A HB3  1  
ATOM 1358  N N    . ILE A 1 89  ? -11.877 -0.861  -4.589  1.00 0.00 ? 89  ILE A N    1  
ATOM 1359  C CA   . ILE A 1 89  ? -11.586 -0.027  -3.430  1.00 0.00 ? 89  ILE A CA   1  
ATOM 1360  C C    . ILE A 1 89  ? -11.191 1.384   -3.853  1.00 0.00 ? 89  ILE A C    1  
ATOM 1361  O O    . ILE A 1 89  ? -11.631 2.368   -3.257  1.00 0.00 ? 89  ILE A O    1  
ATOM 1362  C CB   . ILE A 1 89  ? -10.457 -0.628  -2.572  1.00 0.00 ? 89  ILE A CB   1  
ATOM 1363  C CG1  . ILE A 1 89  ? -10.876 -1.993  -2.022  1.00 0.00 ? 89  ILE A CG1  1  
ATOM 1364  C CG2  . ILE A 1 89  ? -10.092 0.317   -1.438  1.00 0.00 ? 89  ILE A CG2  1  
ATOM 1365  C CD1  . ILE A 1 89  ? -9.827  -2.639  -1.144  1.00 0.00 ? 89  ILE A CD1  1  
ATOM 1366  H H    . ILE A 1 89  ? -11.636 -1.810  -4.567  1.00 0.00 ? 89  ILE A H    1  
ATOM 1367  H HA   . ILE A 1 89  ? -12.480 0.027   -2.825  1.00 0.00 ? 89  ILE A HA   1  
ATOM 1368  H HB   . ILE A 1 89  ? -9.587  -0.753  -3.199  1.00 0.00 ? 89  ILE A HB   1  
ATOM 1369  H HG12 . ILE A 1 89  ? -11.774 -1.877  -1.435  1.00 0.00 ? 89  ILE A HG12 1  
ATOM 1370  H HG13 . ILE A 1 89  ? -11.075 -2.660  -2.848  1.00 0.00 ? 89  ILE A HG13 1  
ATOM 1371  H HG21 . ILE A 1 89  ? -10.644 1.239   -1.546  1.00 0.00 ? 89  ILE A HG21 1  
ATOM 1372  H HG22 . ILE A 1 89  ? -10.341 -0.142  -0.493  1.00 0.00 ? 89  ILE A HG22 1  
ATOM 1373  H HG23 . ILE A 1 89  ? -9.033  0.526   -1.469  1.00 0.00 ? 89  ILE A HG23 1  
ATOM 1374  H HD11 . ILE A 1 89  ? -8.856  -2.230  -1.382  1.00 0.00 ? 89  ILE A HD11 1  
ATOM 1375  H HD12 . ILE A 1 89  ? -10.056 -2.445  -0.107  1.00 0.00 ? 89  ILE A HD12 1  
ATOM 1376  H HD13 . ILE A 1 89  ? -9.820  -3.706  -1.318  1.00 0.00 ? 89  ILE A HD13 1  
ATOM 1377  N N    . ILE A 1 90  ? -10.360 1.475   -4.886  1.00 0.00 ? 90  ILE A N    1  
ATOM 1378  C CA   . ILE A 1 90  ? -9.908  2.766   -5.391  1.00 0.00 ? 90  ILE A CA   1  
ATOM 1379  C C    . ILE A 1 90  ? -11.055 3.534   -6.040  1.00 0.00 ? 90  ILE A C    1  
ATOM 1380  O O    . ILE A 1 90  ? -11.409 4.628   -5.601  1.00 0.00 ? 90  ILE A O    1  
ATOM 1381  C CB   . ILE A 1 90  ? -8.770  2.602   -6.415  1.00 0.00 ? 90  ILE A CB   1  
ATOM 1382  C CG1  . ILE A 1 90  ? -7.552  1.950   -5.757  1.00 0.00 ? 90  ILE A CG1  1  
ATOM 1383  C CG2  . ILE A 1 90  ? -8.397  3.951   -7.012  1.00 0.00 ? 90  ILE A CG2  1  
ATOM 1384  C CD1  . ILE A 1 90  ? -6.666  1.206   -6.731  1.00 0.00 ? 90  ILE A CD1  1  
ATOM 1385  H H    . ILE A 1 90  ? -10.044 0.655   -5.319  1.00 0.00 ? 90  ILE A H    1  
ATOM 1386  H HA   . ILE A 1 90  ? -9.534  3.338   -4.554  1.00 0.00 ? 90  ILE A HA   1  
ATOM 1387  H HB   . ILE A 1 90  ? -9.122  1.968   -7.213  1.00 0.00 ? 90  ILE A HB   1  
ATOM 1388  H HG12 . ILE A 1 90  ? -6.956  2.712   -5.282  1.00 0.00 ? 90  ILE A HG12 1  
ATOM 1389  H HG13 . ILE A 1 90  ? -7.891  1.246   -5.010  1.00 0.00 ? 90  ILE A HG13 1  
ATOM 1390  H HG21 . ILE A 1 90  ? -8.095  4.623   -6.222  1.00 0.00 ? 90  ILE A HG21 1  
ATOM 1391  H HG22 . ILE A 1 90  ? -7.580  3.823   -7.706  1.00 0.00 ? 90  ILE A HG22 1  
ATOM 1392  H HG23 . ILE A 1 90  ? -9.249  4.364   -7.530  1.00 0.00 ? 90  ILE A HG23 1  
ATOM 1393  H HD11 . ILE A 1 90  ? -7.147  0.285   -7.026  1.00 0.00 ? 90  ILE A HD11 1  
ATOM 1394  H HD12 . ILE A 1 90  ? -6.493  1.819   -7.602  1.00 0.00 ? 90  ILE A HD12 1  
ATOM 1395  H HD13 . ILE A 1 90  ? -5.721  0.980   -6.257  1.00 0.00 ? 90  ILE A HD13 1  
ATOM 1396  N N    . ASP A 1 91  ? -11.631 2.952   -7.086  1.00 0.00 ? 91  ASP A N    1  
ATOM 1397  C CA   . ASP A 1 91  ? -12.740 3.581   -7.795  1.00 0.00 ? 91  ASP A CA   1  
ATOM 1398  C C    . ASP A 1 91  ? -13.778 4.117   -6.813  1.00 0.00 ? 91  ASP A C    1  
ATOM 1399  O O    . ASP A 1 91  ? -14.448 5.114   -7.086  1.00 0.00 ? 91  ASP A O    1  
ATOM 1400  C CB   . ASP A 1 91  ? -13.393 2.581   -8.751  1.00 0.00 ? 91  ASP A CB   1  
ATOM 1401  C CG   . ASP A 1 91  ? -14.236 3.262   -9.812  1.00 0.00 ? 91  ASP A CG   1  
ATOM 1402  O OD1  . ASP A 1 91  ? -15.433 3.507   -9.553  1.00 0.00 ? 91  ASP A OD1  1  
ATOM 1403  O OD2  . ASP A 1 91  ? -13.697 3.550   -10.901 1.00 0.00 ? 91  ASP A OD2  1  
ATOM 1404  H H    . ASP A 1 91  ? -11.303 2.079   -7.388  1.00 0.00 ? 91  ASP A H    1  
ATOM 1405  H HA   . ASP A 1 91  ? -12.343 4.406   -8.367  1.00 0.00 ? 91  ASP A HA   1  
ATOM 1406  H HB2  . ASP A 1 91  ? -12.622 2.007   -9.243  1.00 0.00 ? 91  ASP A HB2  1  
ATOM 1407  H HB3  . ASP A 1 91  ? -14.028 1.915   -8.186  1.00 0.00 ? 91  ASP A HB3  1  
ATOM 1408  N N    . HIS A 1 92  ? -13.905 3.450   -5.671  1.00 0.00 ? 92  HIS A N    1  
ATOM 1409  C CA   . HIS A 1 92  ? -14.862 3.860   -4.649  1.00 0.00 ? 92  HIS A CA   1  
ATOM 1410  C C    . HIS A 1 92  ? -14.355 5.083   -3.890  1.00 0.00 ? 92  HIS A C    1  
ATOM 1411  O O    . HIS A 1 92  ? -15.077 6.067   -3.726  1.00 0.00 ? 92  HIS A O    1  
ATOM 1412  C CB   . HIS A 1 92  ? -15.122 2.712   -3.674  1.00 0.00 ? 92  HIS A CB   1  
ATOM 1413  C CG   . HIS A 1 92  ? -16.407 2.848   -2.917  1.00 0.00 ? 92  HIS A CG   1  
ATOM 1414  N ND1  . HIS A 1 92  ? -16.514 3.549   -1.735  1.00 0.00 ? 92  HIS A ND1  1  
ATOM 1415  C CD2  . HIS A 1 92  ? -17.645 2.369   -3.181  1.00 0.00 ? 92  HIS A CD2  1  
ATOM 1416  C CE1  . HIS A 1 92  ? -17.761 3.494   -1.304  1.00 0.00 ? 92  HIS A CE1  1  
ATOM 1417  N NE2  . HIS A 1 92  ? -18.468 2.784   -2.164  1.00 0.00 ? 92  HIS A NE2  1  
ATOM 1418  H H    . HIS A 1 92  ? -13.343 2.664   -5.511  1.00 0.00 ? 92  HIS A H    1  
ATOM 1419  H HA   . HIS A 1 92  ? -15.786 4.117   -5.144  1.00 0.00 ? 92  HIS A HA   1  
ATOM 1420  H HB2  . HIS A 1 92  ? -15.158 1.783   -4.223  1.00 0.00 ? 92  HIS A HB2  1  
ATOM 1421  H HB3  . HIS A 1 92  ? -14.316 2.668   -2.955  1.00 0.00 ? 92  HIS A HB3  1  
ATOM 1422  H HD1  . HIS A 1 92  ? -15.783 4.016   -1.278  1.00 0.00 ? 92  HIS A HD1  1  
ATOM 1423  H HD2  . HIS A 1 92  ? -17.933 1.770   -4.034  1.00 0.00 ? 92  HIS A HD2  1  
ATOM 1424  H HE1  . HIS A 1 92  ? -18.139 3.952   -0.402  1.00 0.00 ? 92  HIS A HE1  1  
ATOM 1425  N N    . TYR A 1 93  ? -13.112 5.013   -3.428  1.00 0.00 ? 93  TYR A N    1  
ATOM 1426  C CA   . TYR A 1 93  ? -12.510 6.113   -2.684  1.00 0.00 ? 93  TYR A CA   1  
ATOM 1427  C C    . TYR A 1 93  ? -12.554 7.406   -3.492  1.00 0.00 ? 93  TYR A C    1  
ATOM 1428  O O    . TYR A 1 93  ? -12.641 8.499   -2.932  1.00 0.00 ? 93  TYR A O    1  
ATOM 1429  C CB   . TYR A 1 93  ? -11.064 5.777   -2.316  1.00 0.00 ? 93  TYR A CB   1  
ATOM 1430  C CG   . TYR A 1 93  ? -10.935 4.965   -1.047  1.00 0.00 ? 93  TYR A CG   1  
ATOM 1431  C CD1  . TYR A 1 93  ? -11.649 5.307   0.095   1.00 0.00 ? 93  TYR A CD1  1  
ATOM 1432  C CD2  . TYR A 1 93  ? -10.099 3.857   -0.990  1.00 0.00 ? 93  TYR A CD2  1  
ATOM 1433  C CE1  . TYR A 1 93  ? -11.533 4.569   1.257   1.00 0.00 ? 93  TYR A CE1  1  
ATOM 1434  C CE2  . TYR A 1 93  ? -9.978  3.112   0.167   1.00 0.00 ? 93  TYR A CE2  1  
ATOM 1435  C CZ   . TYR A 1 93  ? -10.697 3.472   1.288   1.00 0.00 ? 93  TYR A CZ   1  
ATOM 1436  O OH   . TYR A 1 93  ? -10.580 2.734   2.443   1.00 0.00 ? 93  TYR A OH   1  
ATOM 1437  H H    . TYR A 1 93  ? -12.586 4.202   -3.590  1.00 0.00 ? 93  TYR A H    1  
ATOM 1438  H HA   . TYR A 1 93  ? -13.079 6.250   -1.776  1.00 0.00 ? 93  TYR A HA   1  
ATOM 1439  H HB2  . TYR A 1 93  ? -10.618 5.209   -3.118  1.00 0.00 ? 93  TYR A HB2  1  
ATOM 1440  H HB3  . TYR A 1 93  ? -10.511 6.695   -2.181  1.00 0.00 ? 93  TYR A HB3  1  
ATOM 1441  H HD1  . TYR A 1 93  ? -12.303 6.166   0.067   1.00 0.00 ? 93  TYR A HD1  1  
ATOM 1442  H HD2  . TYR A 1 93  ? -9.537  3.577   -1.869  1.00 0.00 ? 93  TYR A HD2  1  
ATOM 1443  H HE1  . TYR A 1 93  ? -12.096 4.850   2.135   1.00 0.00 ? 93  TYR A HE1  1  
ATOM 1444  H HE2  . TYR A 1 93  ? -9.323  2.254   0.192   1.00 0.00 ? 93  TYR A HE2  1  
ATOM 1445  H HH   . TYR A 1 93  ? -10.729 1.806   2.246   1.00 0.00 ? 93  TYR A HH   1  
ATOM 1446  N N    . ARG A 1 94  ? -12.493 7.273   -4.813  1.00 0.00 ? 94  ARG A N    1  
ATOM 1447  C CA   . ARG A 1 94  ? -12.525 8.430   -5.700  1.00 0.00 ? 94  ARG A CA   1  
ATOM 1448  C C    . ARG A 1 94  ? -13.794 9.248   -5.481  1.00 0.00 ? 94  ARG A C    1  
ATOM 1449  O O    . ARG A 1 94  ? -13.911 10.374  -5.963  1.00 0.00 ? 94  ARG A O    1  
ATOM 1450  C CB   . ARG A 1 94  ? -12.439 7.982   -7.160  1.00 0.00 ? 94  ARG A CB   1  
ATOM 1451  C CG   . ARG A 1 94  ? -11.141 7.271   -7.504  1.00 0.00 ? 94  ARG A CG   1  
ATOM 1452  C CD   . ARG A 1 94  ? -11.121 6.819   -8.956  1.00 0.00 ? 94  ARG A CD   1  
ATOM 1453  N NE   . ARG A 1 94  ? -9.932  6.029   -9.267  1.00 0.00 ? 94  ARG A NE   1  
ATOM 1454  C CZ   . ARG A 1 94  ? -9.813  5.278   -10.356 1.00 0.00 ? 94  ARG A CZ   1  
ATOM 1455  N NH1  . ARG A 1 94  ? -10.805 5.216   -11.234 1.00 0.00 ? 94  ARG A NH1  1  
ATOM 1456  N NH2  . ARG A 1 94  ? -8.700  4.589   -10.570 1.00 0.00 ? 94  ARG A NH2  1  
ATOM 1457  H H    . ARG A 1 94  ? -12.424 6.375   -5.201  1.00 0.00 ? 94  ARG A H    1  
ATOM 1458  H HA   . ARG A 1 94  ? -11.669 9.047   -5.471  1.00 0.00 ? 94  ARG A HA   1  
ATOM 1459  H HB2  . ARG A 1 94  ? -13.258 7.309   -7.367  1.00 0.00 ? 94  ARG A HB2  1  
ATOM 1460  H HB3  . ARG A 1 94  ? -12.528 8.850   -7.796  1.00 0.00 ? 94  ARG A HB3  1  
ATOM 1461  H HG2  . ARG A 1 94  ? -10.315 7.948   -7.339  1.00 0.00 ? 94  ARG A HG2  1  
ATOM 1462  H HG3  . ARG A 1 94  ? -11.034 6.407   -6.865  1.00 0.00 ? 94  ARG A HG3  1  
ATOM 1463  H HD2  . ARG A 1 94  ? -11.999 6.219   -9.144  1.00 0.00 ? 94  ARG A HD2  1  
ATOM 1464  H HD3  . ARG A 1 94  ? -11.138 7.692   -9.591  1.00 0.00 ? 94  ARG A HD3  1  
ATOM 1465  H HE   . ARG A 1 94  ? -9.187  6.061   -8.632  1.00 0.00 ? 94  ARG A HE   1  
ATOM 1466  H HH11 . ARG A 1 94  ? -11.644 5.735   -11.076 1.00 0.00 ? 94  ARG A HH11 1  
ATOM 1467  H HH12 . ARG A 1 94  ? -10.712 4.651   -12.054 1.00 0.00 ? 94  ARG A HH12 1  
ATOM 1468  H HH21 . ARG A 1 94  ? -7.950  4.634   -9.910  1.00 0.00 ? 94  ARG A HH21 1  
ATOM 1469  H HH22 . ARG A 1 94  ? -8.611  4.024   -11.389 1.00 0.00 ? 94  ARG A HH22 1  
ATOM 1470  N N    . LYS A 1 95  ? -14.743 8.673   -4.750  1.00 0.00 ? 95  LYS A N    1  
ATOM 1471  C CA   . LYS A 1 95  ? -16.005 9.347   -4.466  1.00 0.00 ? 95  LYS A CA   1  
ATOM 1472  C C    . LYS A 1 95  ? -16.136 9.650   -2.977  1.00 0.00 ? 95  LYS A C    1  
ATOM 1473  O O    . LYS A 1 95  ? -16.766 10.633  -2.588  1.00 0.00 ? 95  LYS A O    1  
ATOM 1474  C CB   . LYS A 1 95  ? -17.183 8.487   -4.928  1.00 0.00 ? 95  LYS A CB   1  
ATOM 1475  C CG   . LYS A 1 95  ? -17.253 8.310   -6.435  1.00 0.00 ? 95  LYS A CG   1  
ATOM 1476  C CD   . LYS A 1 95  ? -16.459 7.099   -6.892  1.00 0.00 ? 95  LYS A CD   1  
ATOM 1477  C CE   . LYS A 1 95  ? -16.934 6.600   -8.249  1.00 0.00 ? 95  LYS A CE   1  
ATOM 1478  N NZ   . LYS A 1 95  ? -16.444 7.463   -9.359  1.00 0.00 ? 95  LYS A NZ   1  
ATOM 1479  H H    . LYS A 1 95  ? -14.592 7.772   -4.393  1.00 0.00 ? 95  LYS A H    1  
ATOM 1480  H HA   . LYS A 1 95  ? -16.014 10.278  -5.013  1.00 0.00 ? 95  LYS A HA   1  
ATOM 1481  H HB2  . LYS A 1 95  ? -17.098 7.509   -4.476  1.00 0.00 ? 95  LYS A HB2  1  
ATOM 1482  H HB3  . LYS A 1 95  ? -18.102 8.948   -4.597  1.00 0.00 ? 95  LYS A HB3  1  
ATOM 1483  H HG2  . LYS A 1 95  ? -18.285 8.181   -6.725  1.00 0.00 ? 95  LYS A HG2  1  
ATOM 1484  H HG3  . LYS A 1 95  ? -16.851 9.194   -6.911  1.00 0.00 ? 95  LYS A HG3  1  
ATOM 1485  H HD2  . LYS A 1 95  ? -15.416 7.369   -6.966  1.00 0.00 ? 95  LYS A HD2  1  
ATOM 1486  H HD3  . LYS A 1 95  ? -16.576 6.307   -6.166  1.00 0.00 ? 95  LYS A HD3  1  
ATOM 1487  H HE2  . LYS A 1 95  ? -16.568 5.596   -8.397  1.00 0.00 ? 95  LYS A HE2  1  
ATOM 1488  H HE3  . LYS A 1 95  ? -18.014 6.595   -8.257  1.00 0.00 ? 95  LYS A HE3  1  
ATOM 1489  H HZ1  . LYS A 1 95  ? -15.964 8.302   -8.974  1.00 0.00 ? 95  LYS A HZ1  1  
ATOM 1490  H HZ2  . LYS A 1 95  ? -17.242 7.774   -9.948  1.00 0.00 ? 95  LYS A HZ2  1  
ATOM 1491  H HZ3  . LYS A 1 95  ? -15.773 6.936   -9.953  1.00 0.00 ? 95  LYS A HZ3  1  
ATOM 1492  N N    . GLU A 1 96  ? -15.535 8.801   -2.149  1.00 0.00 ? 96  GLU A N    1  
ATOM 1493  C CA   . GLU A 1 96  ? -15.585 8.980   -0.703  1.00 0.00 ? 96  GLU A CA   1  
ATOM 1494  C C    . GLU A 1 96  ? -14.181 9.130   -0.124  1.00 0.00 ? 96  GLU A C    1  
ATOM 1495  O O    . GLU A 1 96  ? -13.388 8.189   -0.143  1.00 0.00 ? 96  GLU A O    1  
ATOM 1496  C CB   . GLU A 1 96  ? -16.296 7.796   -0.045  1.00 0.00 ? 96  GLU A CB   1  
ATOM 1497  C CG   . GLU A 1 96  ? -17.797 7.781   -0.278  1.00 0.00 ? 96  GLU A CG   1  
ATOM 1498  C CD   . GLU A 1 96  ? -18.528 6.864   0.683   1.00 0.00 ? 96  GLU A CD   1  
ATOM 1499  O OE1  . GLU A 1 96  ? -17.981 5.789   1.009   1.00 0.00 ? 96  GLU A OE1  1  
ATOM 1500  O OE2  . GLU A 1 96  ? -19.646 7.220   1.110   1.00 0.00 ? 96  GLU A OE2  1  
ATOM 1501  H H    . GLU A 1 96  ? -15.047 8.036   -2.520  1.00 0.00 ? 96  GLU A H    1  
ATOM 1502  H HA   . GLU A 1 96  ? -16.143 9.881   -0.500  1.00 0.00 ? 96  GLU A HA   1  
ATOM 1503  H HB2  . GLU A 1 96  ? -15.882 6.879   -0.438  1.00 0.00 ? 96  GLU A HB2  1  
ATOM 1504  H HB3  . GLU A 1 96  ? -16.119 7.832   1.020   1.00 0.00 ? 96  GLU A HB3  1  
ATOM 1505  H HG2  . GLU A 1 96  ? -18.178 8.783   -0.155  1.00 0.00 ? 96  GLU A HG2  1  
ATOM 1506  H HG3  . GLU A 1 96  ? -17.989 7.446   -1.287  1.00 0.00 ? 96  GLU A HG3  1  
ATOM 1507  N N    . GLN A 1 97  ? -13.883 10.320  0.388   1.00 0.00 ? 97  GLN A N    1  
ATOM 1508  C CA   . GLN A 1 97  ? -12.574 10.594  0.971   1.00 0.00 ? 97  GLN A CA   1  
ATOM 1509  C C    . GLN A 1 97  ? -12.088 9.408   1.798   1.00 0.00 ? 97  GLN A C    1  
ATOM 1510  O O    . GLN A 1 97  ? -12.826 8.873   2.627   1.00 0.00 ? 97  GLN A O    1  
ATOM 1511  C CB   . GLN A 1 97  ? -12.634 11.849  1.842   1.00 0.00 ? 97  GLN A CB   1  
ATOM 1512  C CG   . GLN A 1 97  ? -13.872 11.922  2.721   1.00 0.00 ? 97  GLN A CG   1  
ATOM 1513  C CD   . GLN A 1 97  ? -14.305 13.348  3.002   1.00 0.00 ? 97  GLN A CD   1  
ATOM 1514  O OE1  . GLN A 1 97  ? -15.331 13.807  2.500   1.00 0.00 ? 97  GLN A OE1  1  
ATOM 1515  N NE2  . GLN A 1 97  ? -13.523 14.056  3.808   1.00 0.00 ? 97  GLN A NE2  1  
ATOM 1516  H H    . GLN A 1 97  ? -14.557 11.029  0.373   1.00 0.00 ? 97  GLN A H    1  
ATOM 1517  H HA   . GLN A 1 97  ? -11.880 10.760  0.162   1.00 0.00 ? 97  GLN A HA   1  
ATOM 1518  H HB2  . GLN A 1 97  ? -11.763 11.871  2.481   1.00 0.00 ? 97  GLN A HB2  1  
ATOM 1519  H HB3  . GLN A 1 97  ? -12.622 12.718  1.201   1.00 0.00 ? 97  GLN A HB3  1  
ATOM 1520  H HG2  . GLN A 1 97  ? -14.681 11.408  2.224   1.00 0.00 ? 97  GLN A HG2  1  
ATOM 1521  H HG3  . GLN A 1 97  ? -13.660 11.434  3.660   1.00 0.00 ? 97  GLN A HG3  1  
ATOM 1522  H HE21 . GLN A 1 97  ? -12.720 13.625  4.170   1.00 0.00 ? 97  GLN A HE21 1  
ATOM 1523  H HE22 . GLN A 1 97  ? -13.779 14.980  4.006   1.00 0.00 ? 97  GLN A HE22 1  
ATOM 1524  N N    . ILE A 1 98  ? -10.844 9.003   1.568   1.00 0.00 ? 98  ILE A N    1  
ATOM 1525  C CA   . ILE A 1 98  ? -10.260 7.882   2.293   1.00 0.00 ? 98  ILE A CA   1  
ATOM 1526  C C    . ILE A 1 98  ? -9.671  8.335   3.625   1.00 0.00 ? 98  ILE A C    1  
ATOM 1527  O O    . ILE A 1 98  ? -9.432  7.523   4.519   1.00 0.00 ? 98  ILE A O    1  
ATOM 1528  C CB   . ILE A 1 98  ? -9.160  7.189   1.467   1.00 0.00 ? 98  ILE A CB   1  
ATOM 1529  C CG1  . ILE A 1 98  ? -8.419  6.161   2.325   1.00 0.00 ? 98  ILE A CG1  1  
ATOM 1530  C CG2  . ILE A 1 98  ? -8.189  8.218   0.909   1.00 0.00 ? 98  ILE A CG2  1  
ATOM 1531  C CD1  . ILE A 1 98  ? -7.455  5.300   1.539   1.00 0.00 ? 98  ILE A CD1  1  
ATOM 1532  H H    . ILE A 1 98  ? -10.306 9.470   0.896   1.00 0.00 ? 98  ILE A H    1  
ATOM 1533  H HA   . ILE A 1 98  ? -11.045 7.164   2.485   1.00 0.00 ? 98  ILE A HA   1  
ATOM 1534  H HB   . ILE A 1 98  ? -9.629  6.683   0.637   1.00 0.00 ? 98  ILE A HB   1  
ATOM 1535  H HG12 . ILE A 1 98  ? -7.857  6.676   3.088   1.00 0.00 ? 98  ILE A HG12 1  
ATOM 1536  H HG13 . ILE A 1 98  ? -9.141  5.508   2.794   1.00 0.00 ? 98  ILE A HG13 1  
ATOM 1537  H HG21 . ILE A 1 98  ? -8.300  8.272   -0.165  1.00 0.00 ? 98  ILE A HG21 1  
ATOM 1538  H HG22 . ILE A 1 98  ? -8.403  9.185   1.340   1.00 0.00 ? 98  ILE A HG22 1  
ATOM 1539  H HG23 . ILE A 1 98  ? -7.178  7.930   1.153   1.00 0.00 ? 98  ILE A HG23 1  
ATOM 1540  H HD11 . ILE A 1 98  ? -7.961  4.883   0.681   1.00 0.00 ? 98  ILE A HD11 1  
ATOM 1541  H HD12 . ILE A 1 98  ? -6.622  5.902   1.209   1.00 0.00 ? 98  ILE A HD12 1  
ATOM 1542  H HD13 . ILE A 1 98  ? -7.094  4.499   2.167   1.00 0.00 ? 98  ILE A HD13 1  
ATOM 1543  N N    . VAL A 1 99  ? -9.440  9.638   3.751   1.00 0.00 ? 99  VAL A N    1  
ATOM 1544  C CA   . VAL A 1 99  ? -8.882  10.201  4.974   1.00 0.00 ? 99  VAL A CA   1  
ATOM 1545  C C    . VAL A 1 99  ? -9.817  11.243  5.577   1.00 0.00 ? 99  VAL A C    1  
ATOM 1546  O O    . VAL A 1 99  ? -10.851 11.572  4.996   1.00 0.00 ? 99  VAL A O    1  
ATOM 1547  C CB   . VAL A 1 99  ? -7.508  10.848  4.719   1.00 0.00 ? 99  VAL A CB   1  
ATOM 1548  C CG1  . VAL A 1 99  ? -6.657  10.811  5.979   1.00 0.00 ? 99  VAL A CG1  1  
ATOM 1549  C CG2  . VAL A 1 99  ? -6.798  10.152  3.566   1.00 0.00 ? 99  VAL A CG2  1  
ATOM 1550  H H    . VAL A 1 99  ? -9.652  10.235  3.003   1.00 0.00 ? 99  VAL A H    1  
ATOM 1551  H HA   . VAL A 1 99  ? -8.751  9.396   5.683   1.00 0.00 ? 99  VAL A HA   1  
ATOM 1552  H HB   . VAL A 1 99  ? -7.664  11.881  4.447   1.00 0.00 ? 99  VAL A HB   1  
ATOM 1553  H HG11 . VAL A 1 99  ? -7.089  10.116  6.684   1.00 0.00 ? 99  VAL A HG11 1  
ATOM 1554  H HG12 . VAL A 1 99  ? -5.655  10.494  5.728   1.00 0.00 ? 99  VAL A HG12 1  
ATOM 1555  H HG13 . VAL A 1 99  ? -6.624  11.796  6.420   1.00 0.00 ? 99  VAL A HG13 1  
ATOM 1556  H HG21 . VAL A 1 99  ? -6.738  9.093   3.768   1.00 0.00 ? 99  VAL A HG21 1  
ATOM 1557  H HG22 . VAL A 1 99  ? -7.352  10.313  2.652   1.00 0.00 ? 99  VAL A HG22 1  
ATOM 1558  H HG23 . VAL A 1 99  ? -5.803  10.557  3.459   1.00 0.00 ? 99  VAL A HG23 1  
ATOM 1559  N N    . GLU A 1 100 ? -9.447  11.758  6.745   1.00 0.00 ? 100 GLU A N    1  
ATOM 1560  C CA   . GLU A 1 100 ? -10.254 12.763  7.426   1.00 0.00 ? 100 GLU A CA   1  
ATOM 1561  C C    . GLU A 1 100 ? -10.622 13.900  6.477   1.00 0.00 ? 100 GLU A C    1  
ATOM 1562  O O    . GLU A 1 100 ? -11.648 14.557  6.647   1.00 0.00 ? 100 GLU A O    1  
ATOM 1563  C CB   . GLU A 1 100 ? -9.501  13.319  8.637   1.00 0.00 ? 100 GLU A CB   1  
ATOM 1564  C CG   . GLU A 1 100 ? -8.232  14.070  8.272   1.00 0.00 ? 100 GLU A CG   1  
ATOM 1565  C CD   . GLU A 1 100 ? -7.372  14.384  9.481   1.00 0.00 ? 100 GLU A CD   1  
ATOM 1566  O OE1  . GLU A 1 100 ? -7.706  15.336  10.216  1.00 0.00 ? 100 GLU A OE1  1  
ATOM 1567  O OE2  . GLU A 1 100 ? -6.365  13.676  9.692   1.00 0.00 ? 100 GLU A OE2  1  
ATOM 1568  H H    . GLU A 1 100 ? -8.611  11.455  7.158   1.00 0.00 ? 100 GLU A H    1  
ATOM 1569  H HA   . GLU A 1 100 ? -11.161 12.286  7.766   1.00 0.00 ? 100 GLU A HA   1  
ATOM 1570  H HB2  . GLU A 1 100 ? -10.153 13.994  9.172   1.00 0.00 ? 100 GLU A HB2  1  
ATOM 1571  H HB3  . GLU A 1 100 ? -9.235  12.499  9.287   1.00 0.00 ? 100 GLU A HB3  1  
ATOM 1572  H HG2  . GLU A 1 100 ? -7.656  13.466  7.587   1.00 0.00 ? 100 GLU A HG2  1  
ATOM 1573  H HG3  . GLU A 1 100 ? -8.503  14.998  7.791   1.00 0.00 ? 100 GLU A HG3  1  
ATOM 1574  N N    . GLY A 1 101 ? -9.776  14.126  5.476   1.00 0.00 ? 101 GLY A N    1  
ATOM 1575  C CA   . GLY A 1 101 ? -10.029 15.183  4.515   1.00 0.00 ? 101 GLY A CA   1  
ATOM 1576  C C    . GLY A 1 101 ? -9.123  15.094  3.303   1.00 0.00 ? 101 GLY A C    1  
ATOM 1577  O O    . GLY A 1 101 ? -8.442  16.059  2.957   1.00 0.00 ? 101 GLY A O    1  
ATOM 1578  H H    . GLY A 1 101 ? -8.974  13.570  5.390   1.00 0.00 ? 101 GLY A H    1  
ATOM 1579  H HA2  . GLY A 1 101 ? -11.057 15.120  4.189   1.00 0.00 ? 101 GLY A HA2  1  
ATOM 1580  H HA3  . GLY A 1 101 ? -9.873  16.137  4.997   1.00 0.00 ? 101 GLY A HA3  1  
ATOM 1581  N N    . TYR A 1 102 ? -9.114  13.933  2.658   1.00 0.00 ? 102 TYR A N    1  
ATOM 1582  C CA   . TYR A 1 102 ? -8.281  13.720  1.480   1.00 0.00 ? 102 TYR A CA   1  
ATOM 1583  C C    . TYR A 1 102 ? -8.961  12.773  0.496   1.00 0.00 ? 102 TYR A C    1  
ATOM 1584  O O    . TYR A 1 102 ? -9.692  11.866  0.894   1.00 0.00 ? 102 TYR A O    1  
ATOM 1585  C CB   . TYR A 1 102 ? -6.919  13.156  1.888   1.00 0.00 ? 102 TYR A CB   1  
ATOM 1586  C CG   . TYR A 1 102 ? -6.057  14.143  2.644   1.00 0.00 ? 102 TYR A CG   1  
ATOM 1587  C CD1  . TYR A 1 102 ? -6.282  14.403  3.990   1.00 0.00 ? 102 TYR A CD1  1  
ATOM 1588  C CD2  . TYR A 1 102 ? -5.017  14.813  2.012   1.00 0.00 ? 102 TYR A CD2  1  
ATOM 1589  C CE1  . TYR A 1 102 ? -5.498  15.304  4.684   1.00 0.00 ? 102 TYR A CE1  1  
ATOM 1590  C CE2  . TYR A 1 102 ? -4.227  15.715  2.698   1.00 0.00 ? 102 TYR A CE2  1  
ATOM 1591  C CZ   . TYR A 1 102 ? -4.471  15.957  4.034   1.00 0.00 ? 102 TYR A CZ   1  
ATOM 1592  O OH   . TYR A 1 102 ? -3.687  16.854  4.722   1.00 0.00 ? 102 TYR A OH   1  
ATOM 1593  H H    . TYR A 1 102 ? -9.679  13.201  2.982   1.00 0.00 ? 102 TYR A H    1  
ATOM 1594  H HA   . TYR A 1 102 ? -8.135  14.676  1.000   1.00 0.00 ? 102 TYR A HA   1  
ATOM 1595  H HB2  . TYR A 1 102 ? -7.068  12.295  2.520   1.00 0.00 ? 102 TYR A HB2  1  
ATOM 1596  H HB3  . TYR A 1 102 ? -6.380  12.857  1.001   1.00 0.00 ? 102 TYR A HB3  1  
ATOM 1597  H HD1  . TYR A 1 102 ? -7.086  13.889  4.496   1.00 0.00 ? 102 TYR A HD1  1  
ATOM 1598  H HD2  . TYR A 1 102 ? -4.828  14.622  0.965   1.00 0.00 ? 102 TYR A HD2  1  
ATOM 1599  H HE1  . TYR A 1 102 ? -5.689  15.493  5.730   1.00 0.00 ? 102 TYR A HE1  1  
ATOM 1600  H HE2  . TYR A 1 102 ? -3.423  16.227  2.190   1.00 0.00 ? 102 TYR A HE2  1  
ATOM 1601  H HH   . TYR A 1 102 ? -3.904  16.817  5.657   1.00 0.00 ? 102 TYR A HH   1  
ATOM 1602  N N    . TYR A 1 103 ? -8.715  12.992  -0.791  1.00 0.00 ? 103 TYR A N    1  
ATOM 1603  C CA   . TYR A 1 103 ? -9.305  12.161  -1.834  1.00 0.00 ? 103 TYR A CA   1  
ATOM 1604  C C    . TYR A 1 103 ? -8.231  11.632  -2.781  1.00 0.00 ? 103 TYR A C    1  
ATOM 1605  O O    . TYR A 1 103 ? -7.189  12.260  -2.969  1.00 0.00 ? 103 TYR A O    1  
ATOM 1606  C CB   . TYR A 1 103 ? -10.348 12.956  -2.620  1.00 0.00 ? 103 TYR A CB   1  
ATOM 1607  C CG   . TYR A 1 103 ? -11.671 13.095  -1.902  1.00 0.00 ? 103 TYR A CG   1  
ATOM 1608  C CD1  . TYR A 1 103 ? -12.662 12.131  -2.037  1.00 0.00 ? 103 TYR A CD1  1  
ATOM 1609  C CD2  . TYR A 1 103 ? -11.930 14.191  -1.088  1.00 0.00 ? 103 TYR A CD2  1  
ATOM 1610  C CE1  . TYR A 1 103 ? -13.873 12.254  -1.383  1.00 0.00 ? 103 TYR A CE1  1  
ATOM 1611  C CE2  . TYR A 1 103 ? -13.137 14.322  -0.429  1.00 0.00 ? 103 TYR A CE2  1  
ATOM 1612  C CZ   . TYR A 1 103 ? -14.105 13.351  -0.580  1.00 0.00 ? 103 TYR A CZ   1  
ATOM 1613  O OH   . TYR A 1 103 ? -15.309 13.477  0.074   1.00 0.00 ? 103 TYR A OH   1  
ATOM 1614  H H    . TYR A 1 103 ? -8.124  13.731  -1.046  1.00 0.00 ? 103 TYR A H    1  
ATOM 1615  H HA   . TYR A 1 103 ? -9.790  11.323  -1.355  1.00 0.00 ? 103 TYR A HA   1  
ATOM 1616  H HB2  . TYR A 1 103 ? -9.968  13.948  -2.808  1.00 0.00 ? 103 TYR A HB2  1  
ATOM 1617  H HB3  . TYR A 1 103 ? -10.532 12.461  -3.563  1.00 0.00 ? 103 TYR A HB3  1  
ATOM 1618  H HD1  . TYR A 1 103 ? -12.476 11.272  -2.666  1.00 0.00 ? 103 TYR A HD1  1  
ATOM 1619  H HD2  . TYR A 1 103 ? -11.169 14.950  -0.971  1.00 0.00 ? 103 TYR A HD2  1  
ATOM 1620  H HE1  . TYR A 1 103 ? -14.631 11.494  -1.500  1.00 0.00 ? 103 TYR A HE1  1  
ATOM 1621  H HE2  . TYR A 1 103 ? -13.320 15.181  0.200   1.00 0.00 ? 103 TYR A HE2  1  
ATOM 1622  H HH   . TYR A 1 103 ? -15.943 13.911  -0.502  1.00 0.00 ? 103 TYR A HH   1  
ATOM 1623  N N    . LEU A 1 104 ? -8.495  10.474  -3.375  1.00 0.00 ? 104 LEU A N    1  
ATOM 1624  C CA   . LEU A 1 104 ? -7.553  9.859   -4.304  1.00 0.00 ? 104 LEU A CA   1  
ATOM 1625  C C    . LEU A 1 104 ? -7.639  10.514  -5.679  1.00 0.00 ? 104 LEU A C    1  
ATOM 1626  O O    . LEU A 1 104 ? -8.623  10.346  -6.399  1.00 0.00 ? 104 LEU A O    1  
ATOM 1627  C CB   . LEU A 1 104 ? -7.829  8.359   -4.423  1.00 0.00 ? 104 LEU A CB   1  
ATOM 1628  C CG   . LEU A 1 104 ? -7.773  7.561   -3.120  1.00 0.00 ? 104 LEU A CG   1  
ATOM 1629  C CD1  . LEU A 1 104 ? -7.884  6.071   -3.401  1.00 0.00 ? 104 LEU A CD1  1  
ATOM 1630  C CD2  . LEU A 1 104 ? -6.490  7.868   -2.361  1.00 0.00 ? 104 LEU A CD2  1  
ATOM 1631  H H    . LEU A 1 104 ? -9.342  10.020  -3.185  1.00 0.00 ? 104 LEU A H    1  
ATOM 1632  H HA   . LEU A 1 104 ? -6.558  10.004  -3.911  1.00 0.00 ? 104 LEU A HA   1  
ATOM 1633  H HB2  . LEU A 1 104 ? -8.815  8.237   -4.843  1.00 0.00 ? 104 LEU A HB2  1  
ATOM 1634  H HB3  . LEU A 1 104 ? -7.097  7.942   -5.100  1.00 0.00 ? 104 LEU A HB3  1  
ATOM 1635  H HG   . LEU A 1 104 ? -8.608  7.845   -2.495  1.00 0.00 ? 104 LEU A HG   1  
ATOM 1636  H HD11 . LEU A 1 104 ? -8.495  5.915   -4.277  1.00 0.00 ? 104 LEU A HD11 1  
ATOM 1637  H HD12 . LEU A 1 104 ? -8.336  5.577   -2.554  1.00 0.00 ? 104 LEU A HD12 1  
ATOM 1638  H HD13 . LEU A 1 104 ? -6.898  5.662   -3.571  1.00 0.00 ? 104 LEU A HD13 1  
ATOM 1639  H HD21 . LEU A 1 104 ? -6.659  8.695   -1.688  1.00 0.00 ? 104 LEU A HD21 1  
ATOM 1640  H HD22 . LEU A 1 104 ? -5.711  8.130   -3.063  1.00 0.00 ? 104 LEU A HD22 1  
ATOM 1641  H HD23 . LEU A 1 104 ? -6.189  6.999   -1.796  1.00 0.00 ? 104 LEU A HD23 1  
ATOM 1642  N N    . LYS A 1 105 ? -6.600  11.259  -6.039  1.00 0.00 ? 105 LYS A N    1  
ATOM 1643  C CA   . LYS A 1 105 ? -6.554  11.937  -7.330  1.00 0.00 ? 105 LYS A CA   1  
ATOM 1644  C C    . LYS A 1 105 ? -5.997  11.015  -8.409  1.00 0.00 ? 105 LYS A C    1  
ATOM 1645  O O    . LYS A 1 105 ? -6.706  10.638  -9.341  1.00 0.00 ? 105 LYS A O    1  
ATOM 1646  C CB   . LYS A 1 105 ? -5.699  13.203  -7.234  1.00 0.00 ? 105 LYS A CB   1  
ATOM 1647  C CG   . LYS A 1 105 ? -6.415  14.373  -6.581  1.00 0.00 ? 105 LYS A CG   1  
ATOM 1648  C CD   . LYS A 1 105 ? -7.198  15.186  -7.599  1.00 0.00 ? 105 LYS A CD   1  
ATOM 1649  C CE   . LYS A 1 105 ? -8.261  16.042  -6.929  1.00 0.00 ? 105 LYS A CE   1  
ATOM 1650  N NZ   . LYS A 1 105 ? -9.359  15.215  -6.356  1.00 0.00 ? 105 LYS A NZ   1  
ATOM 1651  H H    . LYS A 1 105 ? -5.844  11.356  -5.422  1.00 0.00 ? 105 LYS A H    1  
ATOM 1652  H HA   . LYS A 1 105 ? -7.563  12.214  -7.595  1.00 0.00 ? 105 LYS A HA   1  
ATOM 1653  H HB2  . LYS A 1 105 ? -4.814  12.982  -6.657  1.00 0.00 ? 105 LYS A HB2  1  
ATOM 1654  H HB3  . LYS A 1 105 ? -5.404  13.500  -8.230  1.00 0.00 ? 105 LYS A HB3  1  
ATOM 1655  H HG2  . LYS A 1 105 ? -7.099  13.994  -5.836  1.00 0.00 ? 105 LYS A HG2  1  
ATOM 1656  H HG3  . LYS A 1 105 ? -5.683  15.012  -6.109  1.00 0.00 ? 105 LYS A HG3  1  
ATOM 1657  H HD2  . LYS A 1 105 ? -6.516  15.831  -8.132  1.00 0.00 ? 105 LYS A HD2  1  
ATOM 1658  H HD3  . LYS A 1 105 ? -7.676  14.511  -8.294  1.00 0.00 ? 105 LYS A HD3  1  
ATOM 1659  H HE2  . LYS A 1 105 ? -7.800  16.612  -6.136  1.00 0.00 ? 105 LYS A HE2  1  
ATOM 1660  H HE3  . LYS A 1 105 ? -8.676  16.717  -7.663  1.00 0.00 ? 105 LYS A HE3  1  
ATOM 1661  H HZ1  . LYS A 1 105 ? -10.127 15.828  -6.014  1.00 0.00 ? 105 LYS A HZ1  1  
ATOM 1662  H HZ2  . LYS A 1 105 ? -9.003  14.650  -5.559  1.00 0.00 ? 105 LYS A HZ2  1  
ATOM 1663  H HZ3  . LYS A 1 105 ? -9.739  14.573  -7.080  1.00 0.00 ? 105 LYS A HZ3  1  
ATOM 1664  N N    . GLU A 1 106 ? -4.724  10.656  -8.276  1.00 0.00 ? 106 GLU A N    1  
ATOM 1665  C CA   . GLU A 1 106 ? -4.074  9.777   -9.241  1.00 0.00 ? 106 GLU A CA   1  
ATOM 1666  C C    . GLU A 1 106 ? -2.949  8.983   -8.582  1.00 0.00 ? 106 GLU A C    1  
ATOM 1667  O O    . GLU A 1 106 ? -2.184  9.501   -7.768  1.00 0.00 ? 106 GLU A O    1  
ATOM 1668  C CB   . GLU A 1 106 ? -3.520  10.590  -10.412 1.00 0.00 ? 106 GLU A CB   1  
ATOM 1669  C CG   . GLU A 1 106 ? -2.328  11.457  -10.043 1.00 0.00 ? 106 GLU A CG   1  
ATOM 1670  C CD   . GLU A 1 106 ? -2.076  12.563  -11.048 1.00 0.00 ? 106 GLU A CD   1  
ATOM 1671  O OE1  . GLU A 1 106 ? -2.931  13.466  -11.164 1.00 0.00 ? 106 GLU A OE1  1  
ATOM 1672  O OE2  . GLU A 1 106 ? -1.024  12.526  -11.720 1.00 0.00 ? 106 GLU A OE2  1  
ATOM 1673  H H    . GLU A 1 106 ? -4.211  10.990  -7.511  1.00 0.00 ? 106 GLU A H    1  
ATOM 1674  H HA   . GLU A 1 106 ? -4.815  9.086   -9.612  1.00 0.00 ? 106 GLU A HA   1  
ATOM 1675  H HB2  . GLU A 1 106 ? -3.217  9.911   -11.195 1.00 0.00 ? 106 GLU A HB2  1  
ATOM 1676  H HB3  . GLU A 1 106 ? -4.302  11.233  -10.789 1.00 0.00 ? 106 GLU A HB3  1  
ATOM 1677  H HG2  . GLU A 1 106 ? -2.509  11.903  -9.077  1.00 0.00 ? 106 GLU A HG2  1  
ATOM 1678  H HG3  . GLU A 1 106 ? -1.448  10.832  -9.989  1.00 0.00 ? 106 GLU A HG3  1  
ATOM 1679  N N    . PRO A 1 107 ? -2.846  7.695   -8.941  1.00 0.00 ? 107 PRO A N    1  
ATOM 1680  C CA   . PRO A 1 107 ? -1.819  6.802   -8.397  1.00 0.00 ? 107 PRO A CA   1  
ATOM 1681  C C    . PRO A 1 107 ? -0.421  7.154   -8.895  1.00 0.00 ? 107 PRO A C    1  
ATOM 1682  O O    . PRO A 1 107 ? -0.254  8.048   -9.725  1.00 0.00 ? 107 PRO A O    1  
ATOM 1683  C CB   . PRO A 1 107 ? -2.238  5.423   -8.913  1.00 0.00 ? 107 PRO A CB   1  
ATOM 1684  C CG   . PRO A 1 107 ? -3.023  5.703   -10.148 1.00 0.00 ? 107 PRO A CG   1  
ATOM 1685  C CD   . PRO A 1 107 ? -3.724  7.012   -9.905  1.00 0.00 ? 107 PRO A CD   1  
ATOM 1686  H HA   . PRO A 1 107 ? -1.825  6.801   -7.317  1.00 0.00 ? 107 PRO A HA   1  
ATOM 1687  H HB2  . PRO A 1 107 ? -1.358  4.833   -9.128  1.00 0.00 ? 107 PRO A HB2  1  
ATOM 1688  H HB3  . PRO A 1 107 ? -2.840  4.924   -8.168  1.00 0.00 ? 107 PRO A HB3  1  
ATOM 1689  H HG2  . PRO A 1 107 ? -2.358  5.785   -10.994 1.00 0.00 ? 107 PRO A HG2  1  
ATOM 1690  H HG3  . PRO A 1 107 ? -3.745  4.917   -10.310 1.00 0.00 ? 107 PRO A HG3  1  
ATOM 1691  H HD2  . PRO A 1 107 ? -3.800  7.575   -10.824 1.00 0.00 ? 107 PRO A HD2  1  
ATOM 1692  H HD3  . PRO A 1 107 ? -4.703  6.842   -9.482  1.00 0.00 ? 107 PRO A HD3  1  
ATOM 1693  N N    . VAL A 1 108 ? 0.580   6.446   -8.384  1.00 0.00 ? 108 VAL A N    1  
ATOM 1694  C CA   . VAL A 1 108 ? 1.964   6.683   -8.779  1.00 0.00 ? 108 VAL A CA   1  
ATOM 1695  C C    . VAL A 1 108 ? 2.343   5.836   -9.989  1.00 0.00 ? 108 VAL A C    1  
ATOM 1696  O O    . VAL A 1 108 ? 2.065   4.638   -10.051 1.00 0.00 ? 108 VAL A O    1  
ATOM 1697  C CB   . VAL A 1 108 ? 2.937   6.375   -7.625  1.00 0.00 ? 108 VAL A CB   1  
ATOM 1698  C CG1  . VAL A 1 108 ? 4.378   6.446   -8.109  1.00 0.00 ? 108 VAL A CG1  1  
ATOM 1699  C CG2  . VAL A 1 108 ? 2.708   7.333   -6.466  1.00 0.00 ? 108 VAL A CG2  1  
ATOM 1700  H H    . VAL A 1 108 ? 0.384   5.746   -7.727  1.00 0.00 ? 108 VAL A H    1  
ATOM 1701  H HA   . VAL A 1 108 ? 2.063   7.727   -9.037  1.00 0.00 ? 108 VAL A HA   1  
ATOM 1702  H HB   . VAL A 1 108 ? 2.746   5.371   -7.278  1.00 0.00 ? 108 VAL A HB   1  
ATOM 1703  H HG11 . VAL A 1 108 ? 4.629   7.470   -8.343  1.00 0.00 ? 108 VAL A HG11 1  
ATOM 1704  H HG12 . VAL A 1 108 ? 5.036   6.081   -7.334  1.00 0.00 ? 108 VAL A HG12 1  
ATOM 1705  H HG13 . VAL A 1 108 ? 4.490   5.837   -8.994  1.00 0.00 ? 108 VAL A HG13 1  
ATOM 1706  H HG21 . VAL A 1 108 ? 3.419   7.123   -5.681  1.00 0.00 ? 108 VAL A HG21 1  
ATOM 1707  H HG22 . VAL A 1 108 ? 2.839   8.350   -6.807  1.00 0.00 ? 108 VAL A HG22 1  
ATOM 1708  H HG23 . VAL A 1 108 ? 1.705   7.207   -6.087  1.00 0.00 ? 108 VAL A HG23 1  
ATOM 1709  N N    . PRO A 1 109 ? 2.995   6.470   -10.974 1.00 0.00 ? 109 PRO A N    1  
ATOM 1710  C CA   . PRO A 1 109 ? 3.428   5.794   -12.200 1.00 0.00 ? 109 PRO A CA   1  
ATOM 1711  C C    . PRO A 1 109 ? 4.565   4.810   -11.949 1.00 0.00 ? 109 PRO A C    1  
ATOM 1712  O O    . PRO A 1 109 ? 5.419   5.039   -11.093 1.00 0.00 ? 109 PRO A O    1  
ATOM 1713  C CB   . PRO A 1 109 ? 3.904   6.945   -13.091 1.00 0.00 ? 109 PRO A CB   1  
ATOM 1714  C CG   . PRO A 1 109 ? 4.292   8.024   -12.140 1.00 0.00 ? 109 PRO A CG   1  
ATOM 1715  C CD   . PRO A 1 109 ? 3.360   7.897   -10.967 1.00 0.00 ? 109 PRO A CD   1  
ATOM 1716  H HA   . PRO A 1 109 ? 2.608   5.280   -12.681 1.00 0.00 ? 109 PRO A HA   1  
ATOM 1717  H HB2  . PRO A 1 109 ? 4.746   6.619   -13.685 1.00 0.00 ? 109 PRO A HB2  1  
ATOM 1718  H HB3  . PRO A 1 109 ? 3.099   7.260   -13.739 1.00 0.00 ? 109 PRO A HB3  1  
ATOM 1719  H HG2  . PRO A 1 109 ? 5.314   7.885   -11.824 1.00 0.00 ? 109 PRO A HG2  1  
ATOM 1720  H HG3  . PRO A 1 109 ? 4.171   8.989   -12.612 1.00 0.00 ? 109 PRO A HG3  1  
ATOM 1721  H HD2  . PRO A 1 109 ? 3.869   8.160   -10.051 1.00 0.00 ? 109 PRO A HD2  1  
ATOM 1722  H HD3  . PRO A 1 109 ? 2.488   8.518   -11.108 1.00 0.00 ? 109 PRO A HD3  1  
ATOM 1723  N N    . MET A 1 110 ? 4.571   3.714   -12.701 1.00 0.00 ? 110 MET A N    1  
ATOM 1724  C CA   . MET A 1 110 ? 5.605   2.696   -12.560 1.00 0.00 ? 110 MET A CA   1  
ATOM 1725  C C    . MET A 1 110 ? 6.841   3.060   -13.377 1.00 0.00 ? 110 MET A C    1  
ATOM 1726  O O    . MET A 1 110 ? 6.740   3.721   -14.410 1.00 0.00 ? 110 MET A O    1  
ATOM 1727  C CB   . MET A 1 110 ? 5.071   1.332   -13.001 1.00 0.00 ? 110 MET A CB   1  
ATOM 1728  C CG   . MET A 1 110 ? 4.607   1.300   -14.448 1.00 0.00 ? 110 MET A CG   1  
ATOM 1729  S SD   . MET A 1 110 ? 5.976   1.163   -15.614 1.00 0.00 ? 110 MET A SD   1  
ATOM 1730  C CE   . MET A 1 110 ? 5.403   2.230   -16.935 1.00 0.00 ? 110 MET A CE   1  
ATOM 1731  H H    . MET A 1 110 ? 3.863   3.587   -13.367 1.00 0.00 ? 110 MET A H    1  
ATOM 1732  H HA   . MET A 1 110 ? 5.879   2.645   -11.517 1.00 0.00 ? 110 MET A HA   1  
ATOM 1733  H HB2  . MET A 1 110 ? 5.853   0.597   -12.880 1.00 0.00 ? 110 MET A HB2  1  
ATOM 1734  H HB3  . MET A 1 110 ? 4.236   1.064   -12.372 1.00 0.00 ? 110 MET A HB3  1  
ATOM 1735  H HG2  . MET A 1 110 ? 3.952   0.452   -14.584 1.00 0.00 ? 110 MET A HG2  1  
ATOM 1736  H HG3  . MET A 1 110 ? 4.063   2.209   -14.657 1.00 0.00 ? 110 MET A HG3  1  
ATOM 1737  H HE1  . MET A 1 110 ? 5.726   3.243   -16.745 1.00 0.00 ? 110 MET A HE1  1  
ATOM 1738  H HE2  . MET A 1 110 ? 5.814   1.891   -17.874 1.00 0.00 ? 110 MET A HE2  1  
ATOM 1739  H HE3  . MET A 1 110 ? 4.324   2.198   -16.980 1.00 0.00 ? 110 MET A HE3  1  
ATOM 1740  N N    . GLN A 1 111 ? 8.005   2.625   -12.906 1.00 0.00 ? 111 GLN A N    1  
ATOM 1741  C CA   . GLN A 1 111 ? 9.260   2.907   -13.593 1.00 0.00 ? 111 GLN A CA   1  
ATOM 1742  C C    . GLN A 1 111 ? 9.665   1.739   -14.486 1.00 0.00 ? 111 GLN A C    1  
ATOM 1743  O O    . GLN A 1 111 ? 9.644   0.584   -14.062 1.00 0.00 ? 111 GLN A O    1  
ATOM 1744  C CB   . GLN A 1 111 ? 10.368  3.197   -12.579 1.00 0.00 ? 111 GLN A CB   1  
ATOM 1745  C CG   . GLN A 1 111 ? 10.167  4.494   -11.813 1.00 0.00 ? 111 GLN A CG   1  
ATOM 1746  C CD   . GLN A 1 111 ? 10.244  5.717   -12.706 1.00 0.00 ? 111 GLN A CD   1  
ATOM 1747  O OE1  . GLN A 1 111 ? 11.119  5.816   -13.567 1.00 0.00 ? 111 GLN A OE1  1  
ATOM 1748  N NE2  . GLN A 1 111 ? 9.327   6.656   -12.506 1.00 0.00 ? 111 GLN A NE2  1  
ATOM 1749  H H    . GLN A 1 111 ? 8.021   2.103   -12.077 1.00 0.00 ? 111 GLN A H    1  
ATOM 1750  H HA   . GLN A 1 111 ? 9.111   3.780   -14.209 1.00 0.00 ? 111 GLN A HA   1  
ATOM 1751  H HB2  . GLN A 1 111 ? 10.408  2.386   -11.866 1.00 0.00 ? 111 GLN A HB2  1  
ATOM 1752  H HB3  . GLN A 1 111 ? 11.311  3.254   -13.101 1.00 0.00 ? 111 GLN A HB3  1  
ATOM 1753  H HG2  . GLN A 1 111 ? 9.195   4.473   -11.342 1.00 0.00 ? 111 GLN A HG2  1  
ATOM 1754  H HG3  . GLN A 1 111 ? 10.932  4.571   -11.054 1.00 0.00 ? 111 GLN A HG3  1  
ATOM 1755  H HE21 . GLN A 1 111 ? 8.661   6.509   -11.801 1.00 0.00 ? 111 GLN A HE21 1  
ATOM 1756  H HE22 . GLN A 1 111 ? 9.354   7.457   -13.068 1.00 0.00 ? 111 GLN A HE22 1  
ATOM 1757  N N    . ASP A 1 112 ? 10.034  2.048   -15.725 1.00 0.00 ? 112 ASP A N    1  
ATOM 1758  C CA   . ASP A 1 112 ? 10.445  1.025   -16.679 1.00 0.00 ? 112 ASP A CA   1  
ATOM 1759  C C    . ASP A 1 112 ? 11.935  1.133   -16.983 1.00 0.00 ? 112 ASP A C    1  
ATOM 1760  O O    . ASP A 1 112 ? 12.332  1.752   -17.971 1.00 0.00 ? 112 ASP A O    1  
ATOM 1761  C CB   . ASP A 1 112 ? 9.637   1.148   -17.971 1.00 0.00 ? 112 ASP A CB   1  
ATOM 1762  C CG   . ASP A 1 112 ? 10.331  0.498   -19.152 1.00 0.00 ? 112 ASP A CG   1  
ATOM 1763  O OD1  . ASP A 1 112 ? 10.801  -0.649  -19.006 1.00 0.00 ? 112 ASP A OD1  1  
ATOM 1764  O OD2  . ASP A 1 112 ? 10.406  1.138   -20.222 1.00 0.00 ? 112 ASP A OD2  1  
ATOM 1765  H H    . ASP A 1 112 ? 10.029  2.988   -16.004 1.00 0.00 ? 112 ASP A H    1  
ATOM 1766  H HA   . ASP A 1 112 ? 10.250  0.060   -16.234 1.00 0.00 ? 112 ASP A HA   1  
ATOM 1767  H HB2  . ASP A 1 112 ? 8.677   0.670   -17.835 1.00 0.00 ? 112 ASP A HB2  1  
ATOM 1768  H HB3  . ASP A 1 112 ? 9.485   2.193   -18.195 1.00 0.00 ? 112 ASP A HB3  1  
ATOM 1769  N N    . GLN A 1 113 ? 12.755  0.529   -16.129 1.00 0.00 ? 113 GLN A N    1  
ATOM 1770  C CA   . GLN A 1 113 ? 14.201  0.560   -16.307 1.00 0.00 ? 113 GLN A CA   1  
ATOM 1771  C C    . GLN A 1 113 ? 14.573  0.382   -17.775 1.00 0.00 ? 113 GLN A C    1  
ATOM 1772  O O    . GLN A 1 113 ? 15.236  1.234   -18.366 1.00 0.00 ? 113 GLN A O    1  
ATOM 1773  C CB   . GLN A 1 113 ? 14.864  -0.532  -15.464 1.00 0.00 ? 113 GLN A CB   1  
ATOM 1774  C CG   . GLN A 1 113 ? 16.287  -0.199  -15.047 1.00 0.00 ? 113 GLN A CG   1  
ATOM 1775  C CD   . GLN A 1 113 ? 17.116  0.354   -16.190 1.00 0.00 ? 113 GLN A CD   1  
ATOM 1776  O OE1  . GLN A 1 113 ? 17.174  1.565   -16.401 1.00 0.00 ? 113 GLN A OE1  1  
ATOM 1777  N NE2  . GLN A 1 113 ? 17.764  -0.534  -16.935 1.00 0.00 ? 113 GLN A NE2  1  
ATOM 1778  H H    . GLN A 1 113 ? 12.377  0.052   -15.361 1.00 0.00 ? 113 GLN A H    1  
ATOM 1779  H HA   . GLN A 1 113 ? 14.556  1.524   -15.973 1.00 0.00 ? 113 GLN A HA   1  
ATOM 1780  H HB2  . GLN A 1 113 ? 14.276  -0.687  -14.572 1.00 0.00 ? 113 GLN A HB2  1  
ATOM 1781  H HB3  . GLN A 1 113 ? 14.884  -1.448  -16.036 1.00 0.00 ? 113 GLN A HB3  1  
ATOM 1782  H HG2  . GLN A 1 113 ? 16.255  0.537   -14.258 1.00 0.00 ? 113 GLN A HG2  1  
ATOM 1783  H HG3  . GLN A 1 113 ? 16.760  -1.098  -14.680 1.00 0.00 ? 113 GLN A HG3  1  
ATOM 1784  H HE21 . GLN A 1 113 ? 17.670  -1.484  -16.709 1.00 0.00 ? 113 GLN A HE21 1  
ATOM 1785  H HE22 . GLN A 1 113 ? 18.306  -0.205  -17.681 1.00 0.00 ? 113 GLN A HE22 1  
ATOM 1786  N N    . SER A 1 114 ? 14.143  -0.732  -18.358 1.00 0.00 ? 114 SER A N    1  
ATOM 1787  C CA   . SER A 1 114 ? 14.434  -1.025  -19.757 1.00 0.00 ? 114 SER A CA   1  
ATOM 1788  C C    . SER A 1 114 ? 14.454  0.255   -20.587 1.00 0.00 ? 114 SER A C    1  
ATOM 1789  O O    . SER A 1 114 ? 13.458  0.974   -20.664 1.00 0.00 ? 114 SER A O    1  
ATOM 1790  C CB   . SER A 1 114 ? 13.398  -1.997  -20.323 1.00 0.00 ? 114 SER A CB   1  
ATOM 1791  O OG   . SER A 1 114 ? 13.365  -3.200  -19.575 1.00 0.00 ? 114 SER A OG   1  
ATOM 1792  H H    . SER A 1 114 ? 13.618  -1.374  -17.835 1.00 0.00 ? 114 SER A H    1  
ATOM 1793  H HA   . SER A 1 114 ? 15.410  -1.485  -19.803 1.00 0.00 ? 114 SER A HA   1  
ATOM 1794  H HB2  . SER A 1 114 ? 12.421  -1.539  -20.288 1.00 0.00 ? 114 SER A HB2  1  
ATOM 1795  H HB3  . SER A 1 114 ? 13.649  -2.231  -21.348 1.00 0.00 ? 114 SER A HB3  1  
ATOM 1796  H HG   . SER A 1 114 ? 13.028  -3.021  -18.694 1.00 0.00 ? 114 SER A HG   1  
ATOM 1797  N N    . GLY A 1 115 ? 15.596  0.534   -21.207 1.00 0.00 ? 115 GLY A N    1  
ATOM 1798  C CA   . GLY A 1 115 ? 15.726  1.726   -22.024 1.00 0.00 ? 115 GLY A CA   1  
ATOM 1799  C C    . GLY A 1 115 ? 17.155  1.978   -22.461 1.00 0.00 ? 115 GLY A C    1  
ATOM 1800  O O    . GLY A 1 115 ? 18.108  1.488   -21.853 1.00 0.00 ? 115 GLY A O    1  
ATOM 1801  H H    . GLY A 1 115 ? 16.358  -0.076  -21.110 1.00 0.00 ? 115 GLY A H    1  
ATOM 1802  H HA2  . GLY A 1 115 ? 15.106  1.618   -22.901 1.00 0.00 ? 115 GLY A HA2  1  
ATOM 1803  H HA3  . GLY A 1 115 ? 15.381  2.577   -21.454 1.00 0.00 ? 115 GLY A HA3  1  
ATOM 1804  N N    . PRO A 1 116 ? 17.320  2.756   -23.540 1.00 0.00 ? 116 PRO A N    1  
ATOM 1805  C CA   . PRO A 1 116 ? 18.641  3.088   -24.083 1.00 0.00 ? 116 PRO A CA   1  
ATOM 1806  C C    . PRO A 1 116 ? 19.426  4.022   -23.169 1.00 0.00 ? 116 PRO A C    1  
ATOM 1807  O O    . PRO A 1 116 ? 20.650  3.934   -23.078 1.00 0.00 ? 116 PRO A O    1  
ATOM 1808  C CB   . PRO A 1 116 ? 18.316  3.784   -25.407 1.00 0.00 ? 116 PRO A CB   1  
ATOM 1809  C CG   . PRO A 1 116 ? 16.946  4.339   -25.217 1.00 0.00 ? 116 PRO A CG   1  
ATOM 1810  C CD   . PRO A 1 116 ? 16.230  3.373   -24.314 1.00 0.00 ? 116 PRO A CD   1  
ATOM 1811  H HA   . PRO A 1 116 ? 19.225  2.200   -24.276 1.00 0.00 ? 116 PRO A HA   1  
ATOM 1812  H HB2  . PRO A 1 116 ? 19.038  4.566   -25.592 1.00 0.00 ? 116 PRO A HB2  1  
ATOM 1813  H HB3  . PRO A 1 116 ? 18.342  3.065   -26.212 1.00 0.00 ? 116 PRO A HB3  1  
ATOM 1814  H HG2  . PRO A 1 116 ? 17.005  5.312   -24.754 1.00 0.00 ? 116 PRO A HG2  1  
ATOM 1815  H HG3  . PRO A 1 116 ? 16.442  4.405   -26.170 1.00 0.00 ? 116 PRO A HG3  1  
ATOM 1816  H HD2  . PRO A 1 116 ? 15.546  3.899   -23.665 1.00 0.00 ? 116 PRO A HD2  1  
ATOM 1817  H HD3  . PRO A 1 116 ? 15.704  2.631   -24.897 1.00 0.00 ? 116 PRO A HD3  1  
ATOM 1818  N N    . SER A 1 117 ? 18.712  4.917   -22.492 1.00 0.00 ? 117 SER A N    1  
ATOM 1819  C CA   . SER A 1 117 ? 19.343  5.870   -21.586 1.00 0.00 ? 117 SER A CA   1  
ATOM 1820  C C    . SER A 1 117 ? 20.283  5.159   -20.617 1.00 0.00 ? 117 SER A C    1  
ATOM 1821  O O    . SER A 1 117 ? 19.844  4.569   -19.629 1.00 0.00 ? 117 SER A O    1  
ATOM 1822  C CB   . SER A 1 117 ? 18.279  6.645   -20.807 1.00 0.00 ? 117 SER A CB   1  
ATOM 1823  O OG   . SER A 1 117 ? 18.824  7.820   -20.231 1.00 0.00 ? 117 SER A OG   1  
ATOM 1824  H H    . SER A 1 117 ? 17.739  4.937   -22.606 1.00 0.00 ? 117 SER A H    1  
ATOM 1825  H HA   . SER A 1 117 ? 19.918  6.563   -22.182 1.00 0.00 ? 117 SER A HA   1  
ATOM 1826  H HB2  . SER A 1 117 ? 17.479  6.925   -21.475 1.00 0.00 ? 117 SER A HB2  1  
ATOM 1827  H HB3  . SER A 1 117 ? 17.888  6.020   -20.018 1.00 0.00 ? 117 SER A HB3  1  
ATOM 1828  H HG   . SER A 1 117 ? 19.518  8.163   -20.799 1.00 0.00 ? 117 SER A HG   1  
ATOM 1829  N N    . SER A 1 118 ? 21.578  5.219   -20.907 1.00 0.00 ? 118 SER A N    1  
ATOM 1830  C CA   . SER A 1 118 ? 22.581  4.577   -20.065 1.00 0.00 ? 118 SER A CA   1  
ATOM 1831  C C    . SER A 1 118 ? 23.621  5.589   -19.592 1.00 0.00 ? 118 SER A C    1  
ATOM 1832  O O    . SER A 1 118 ? 23.635  6.736   -20.038 1.00 0.00 ? 118 SER A O    1  
ATOM 1833  C CB   . SER A 1 118 ? 23.267  3.442   -20.826 1.00 0.00 ? 118 SER A CB   1  
ATOM 1834  O OG   . SER A 1 118 ? 24.180  2.748   -19.993 1.00 0.00 ? 118 SER A OG   1  
ATOM 1835  H H    . SER A 1 118 ? 21.866  5.703   -21.709 1.00 0.00 ? 118 SER A H    1  
ATOM 1836  H HA   . SER A 1 118 ? 22.076  4.168   -19.202 1.00 0.00 ? 118 SER A HA   1  
ATOM 1837  H HB2  . SER A 1 118 ? 22.521  2.746   -21.178 1.00 0.00 ? 118 SER A HB2  1  
ATOM 1838  H HB3  . SER A 1 118 ? 23.805  3.850   -21.669 1.00 0.00 ? 118 SER A HB3  1  
ATOM 1839  H HG   . SER A 1 118 ? 23.855  1.860   -19.831 1.00 0.00 ? 118 SER A HG   1  
ATOM 1840  N N    . GLY A 1 119 ? 24.491  5.154   -18.685 1.00 0.00 ? 119 GLY A N    1  
ATOM 1841  C CA   . GLY A 1 119 ? 25.522  6.033   -18.167 1.00 0.00 ? 119 GLY A CA   1  
ATOM 1842  C C    . GLY A 1 119 ? 26.189  6.850   -19.255 1.00 0.00 ? 119 GLY A C    1  
ATOM 1843  O O    . GLY A 1 119 ? 27.408  6.798   -19.421 1.00 0.00 ? 119 GLY A O    1  
ATOM 1844  H H    . GLY A 1 119 ? 24.431  4.230   -18.366 1.00 0.00 ? 119 GLY A H    1  
ATOM 1845  H HA2  . GLY A 1 119 ? 25.079  6.705   -17.447 1.00 0.00 ? 119 GLY A HA2  1  
ATOM 1846  H HA3  . GLY A 1 119 ? 26.273  5.435   -17.671 1.00 0.00 ? 119 GLY A HA3  1  
ATOM 1847  N N    . GLY A 1 1   ? 11.422  -19.520 -4.515  1.00 0.00 ? 1   GLY A N    2  
ATOM 1848  C CA   . GLY A 1 1   ? 12.100  -19.104 -5.729  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1849  C C    . GLY A 1 1   ? 11.207  -19.192 -6.951  1.00 0.00 ? 1   GLY A C    2  
ATOM 1850  O O    . GLY A 1 1   ? 10.044  -19.583 -6.851  1.00 0.00 ? 1   GLY A O    2  
ATOM 1851  H H1   . GLY A 1 1   ? 11.938  -19.676 -3.697  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1852  H HA2  . GLY A 1 1   ? 12.432  -18.084 -5.611  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1853  H HA3  . GLY A 1 1   ? 12.961  -19.737 -5.882  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1854  N N    . SER A 1 2   ? 11.750  -18.825 -8.107  1.00 0.00 ? 2   SER A N    2  
ATOM 1855  C CA   . SER A 1 2   ? 10.993  -18.859 -9.352  1.00 0.00 ? 2   SER A CA   2  
ATOM 1856  C C    . SER A 1 2   ? 11.631  -19.821 -10.350 1.00 0.00 ? 2   SER A C    2  
ATOM 1857  O O    . SER A 1 2   ? 12.537  -19.449 -11.095 1.00 0.00 ? 2   SER A O    2  
ATOM 1858  C CB   . SER A 1 2   ? 10.909  -17.457 -9.961  1.00 0.00 ? 2   SER A CB   2  
ATOM 1859  O OG   . SER A 1 2   ? 12.198  -16.892 -10.121 1.00 0.00 ? 2   SER A OG   2  
ATOM 1860  H H    . SER A 1 2   ? 12.682  -18.522 -8.122  1.00 0.00 ? 2   SER A H    2  
ATOM 1861  H HA   . SER A 1 2   ? 9.995   -19.204 -9.125  1.00 0.00 ? 2   SER A HA   2  
ATOM 1862  H HB2  . SER A 1 2   ? 10.432  -17.515 -10.927 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1863  H HB3  . SER A 1 2   ? 10.327  -16.820 -9.310  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1864  H HG   . SER A 1 2   ? 12.207  -16.329 -10.898 1.00 0.00 ? 2   SER A HG   2  
ATOM 1865  N N    . SER A 1 3   ? 11.149  -21.060 -10.358 1.00 0.00 ? 3   SER A N    2  
ATOM 1866  C CA   . SER A 1 3   ? 11.674  -22.078 -11.261 1.00 0.00 ? 3   SER A CA   2  
ATOM 1867  C C    . SER A 1 3   ? 10.549  -22.955 -11.803 1.00 0.00 ? 3   SER A C    2  
ATOM 1868  O O    . SER A 1 3   ? 9.913   -23.699 -11.058 1.00 0.00 ? 3   SER A O    2  
ATOM 1869  C CB   . SER A 1 3   ? 12.709  -22.944 -10.540 1.00 0.00 ? 3   SER A CB   2  
ATOM 1870  O OG   . SER A 1 3   ? 12.193  -23.447 -9.320  1.00 0.00 ? 3   SER A OG   2  
ATOM 1871  H H    . SER A 1 3   ? 10.426  -21.295 -9.740  1.00 0.00 ? 3   SER A H    2  
ATOM 1872  H HA   . SER A 1 3   ? 12.151  -21.574 -12.087 1.00 0.00 ? 3   SER A HA   2  
ATOM 1873  H HB2  . SER A 1 3   ? 12.981  -23.776 -11.172 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1874  H HB3  . SER A 1 3   ? 13.586  -22.350 -10.329 1.00 0.00 ? 3   SER A HB3  2  
ATOM 1875  H HG   . SER A 1 3   ? 11.251  -23.607 -9.413  1.00 0.00 ? 3   SER A HG   2  
ATOM 1876  N N    . GLY A 1 4   ? 10.310  -22.860 -13.107 1.00 0.00 ? 4   GLY A N    2  
ATOM 1877  C CA   . GLY A 1 4   ? 9.262   -23.650 -13.728 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1878  C C    . GLY A 1 4   ? 8.507   -22.877 -14.792 1.00 0.00 ? 4   GLY A C    2  
ATOM 1879  O O    . GLY A 1 4   ? 8.255   -23.392 -15.881 1.00 0.00 ? 4   GLY A O    2  
ATOM 1880  H H    . GLY A 1 4   ? 10.849  -22.250 -13.652 1.00 0.00 ? 4   GLY A H    2  
ATOM 1881  H HA2  . GLY A 1 4   ? 9.705   -24.525 -14.180 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1882  H HA3  . GLY A 1 4   ? 8.565   -23.965 -12.966 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1883  N N    . SER A 1 5   ? 8.145   -21.638 -14.476 1.00 0.00 ? 5   SER A N    2  
ATOM 1884  C CA   . SER A 1 5   ? 7.409   -20.795 -15.410 1.00 0.00 ? 5   SER A CA   2  
ATOM 1885  C C    . SER A 1 5   ? 7.907   -21.003 -16.837 1.00 0.00 ? 5   SER A C    2  
ATOM 1886  O O    . SER A 1 5   ? 9.112   -21.019 -17.090 1.00 0.00 ? 5   SER A O    2  
ATOM 1887  C CB   . SER A 1 5   ? 7.548   -19.322 -15.020 1.00 0.00 ? 5   SER A CB   2  
ATOM 1888  O OG   . SER A 1 5   ? 6.531   -18.538 -15.618 1.00 0.00 ? 5   SER A OG   2  
ATOM 1889  H H    . SER A 1 5   ? 8.375   -21.284 -13.591 1.00 0.00 ? 5   SER A H    2  
ATOM 1890  H HA   . SER A 1 5   ? 6.367   -21.075 -15.361 1.00 0.00 ? 5   SER A HA   2  
ATOM 1891  H HB2  . SER A 1 5   ? 7.473   -19.229 -13.947 1.00 0.00 ? 5   SER A HB2  2  
ATOM 1892  H HB3  . SER A 1 5   ? 8.510   -18.955 -15.347 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1893  H HG   . SER A 1 5   ? 6.901   -17.702 -15.911 1.00 0.00 ? 5   SER A HG   2  
ATOM 1894  N N    . SER A 1 6   ? 6.970   -21.162 -17.767 1.00 0.00 ? 6   SER A N    2  
ATOM 1895  C CA   . SER A 1 6   ? 7.313   -21.374 -19.169 1.00 0.00 ? 6   SER A CA   2  
ATOM 1896  C C    . SER A 1 6   ? 6.895   -20.176 -20.016 1.00 0.00 ? 6   SER A C    2  
ATOM 1897  O O    . SER A 1 6   ? 5.738   -19.757 -19.992 1.00 0.00 ? 6   SER A O    2  
ATOM 1898  C CB   . SER A 1 6   ? 6.641   -22.644 -19.694 1.00 0.00 ? 6   SER A CB   2  
ATOM 1899  O OG   . SER A 1 6   ? 7.257   -23.090 -20.889 1.00 0.00 ? 6   SER A OG   2  
ATOM 1900  H H    . SER A 1 6   ? 6.027   -21.140 -17.503 1.00 0.00 ? 6   SER A H    2  
ATOM 1901  H HA   . SER A 1 6   ? 8.384   -21.490 -19.234 1.00 0.00 ? 6   SER A HA   2  
ATOM 1902  H HB2  . SER A 1 6   ? 6.719   -23.423 -18.951 1.00 0.00 ? 6   SER A HB2  2  
ATOM 1903  H HB3  . SER A 1 6   ? 5.599   -22.440 -19.894 1.00 0.00 ? 6   SER A HB3  2  
ATOM 1904  H HG   . SER A 1 6   ? 7.058   -24.019 -21.025 1.00 0.00 ? 6   SER A HG   2  
ATOM 1905  N N    . GLY A 1 7   ? 7.847   -19.628 -20.766 1.00 0.00 ? 7   GLY A N    2  
ATOM 1906  C CA   . GLY A 1 7   ? 7.559   -18.484 -21.611 1.00 0.00 ? 7   GLY A CA   2  
ATOM 1907  C C    . GLY A 1 7   ? 7.335   -17.215 -20.813 1.00 0.00 ? 7   GLY A C    2  
ATOM 1908  O O    . GLY A 1 7   ? 6.271   -17.025 -20.223 1.00 0.00 ? 7   GLY A O    2  
ATOM 1909  H H    . GLY A 1 7   ? 8.752   -20.005 -20.745 1.00 0.00 ? 7   GLY A H    2  
ATOM 1910  H HA2  . GLY A 1 7   ? 8.389   -18.331 -22.285 1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1911  H HA3  . GLY A 1 7   ? 6.672   -18.693 -22.190 1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1912  N N    . ARG A 1 8   ? 8.340   -16.346 -20.791 1.00 0.00 ? 8   ARG A N    2  
ATOM 1913  C CA   . ARG A 1 8   ? 8.249   -15.090 -20.056 1.00 0.00 ? 8   ARG A CA   2  
ATOM 1914  C C    . ARG A 1 8   ? 6.992   -14.319 -20.452 1.00 0.00 ? 8   ARG A C    2  
ATOM 1915  O O    . ARG A 1 8   ? 6.965   -13.645 -21.480 1.00 0.00 ? 8   ARG A O    2  
ATOM 1916  C CB   . ARG A 1 8   ? 9.489   -14.232 -20.314 1.00 0.00 ? 8   ARG A CB   2  
ATOM 1917  C CG   . ARG A 1 8   ? 10.626  -14.499 -19.342 1.00 0.00 ? 8   ARG A CG   2  
ATOM 1918  C CD   . ARG A 1 8   ? 11.905  -13.800 -19.776 1.00 0.00 ? 8   ARG A CD   2  
ATOM 1919  N NE   . ARG A 1 8   ? 13.080  -14.333 -19.092 1.00 0.00 ? 8   ARG A NE   2  
ATOM 1920  C CZ   . ARG A 1 8   ? 13.582  -15.540 -19.326 1.00 0.00 ? 8   ARG A CZ   2  
ATOM 1921  N NH1  . ARG A 1 8   ? 13.016  -16.335 -20.223 1.00 0.00 ? 8   ARG A NH1  2  
ATOM 1922  N NH2  . ARG A 1 8   ? 14.654  -15.955 -18.662 1.00 0.00 ? 8   ARG A NH2  2  
ATOM 1923  H H    . ARG A 1 8   ? 9.163   -16.554 -21.281 1.00 0.00 ? 8   ARG A H    2  
ATOM 1924  H HA   . ARG A 1 8   ? 8.196   -15.325 -19.004 1.00 0.00 ? 8   ARG A HA   2  
ATOM 1925  H HB2  . ARG A 1 8   ? 9.846   -14.428 -21.314 1.00 0.00 ? 8   ARG A HB2  2  
ATOM 1926  H HB3  . ARG A 1 8   ? 9.214   -13.191 -20.235 1.00 0.00 ? 8   ARG A HB3  2  
ATOM 1927  H HG2  . ARG A 1 8   ? 10.345  -14.136 -18.364 1.00 0.00 ? 8   ARG A HG2  2  
ATOM 1928  H HG3  . ARG A 1 8   ? 10.806  -15.563 -19.296 1.00 0.00 ? 8   ARG A HG3  2  
ATOM 1929  H HD2  . ARG A 1 8   ? 12.029  -13.934 -20.840 1.00 0.00 ? 8   ARG A HD2  2  
ATOM 1930  H HD3  . ARG A 1 8   ? 11.817  -12.747 -19.554 1.00 0.00 ? 8   ARG A HD3  2  
ATOM 1931  H HE   . ARG A 1 8   ? 13.514  -13.763 -18.424 1.00 0.00 ? 8   ARG A HE   2  
ATOM 1932  H HH11 . ARG A 1 8   ? 12.209  -16.025 -20.726 1.00 0.00 ? 8   ARG A HH11 2  
ATOM 1933  H HH12 . ARG A 1 8   ? 13.397  -17.243 -20.399 1.00 0.00 ? 8   ARG A HH12 2  
ATOM 1934  H HH21 . ARG A 1 8   ? 15.084  -15.358 -17.985 1.00 0.00 ? 8   ARG A HH21 2  
ATOM 1935  H HH22 . ARG A 1 8   ? 15.032  -16.863 -18.839 1.00 0.00 ? 8   ARG A HH22 2  
ATOM 1936  N N    . GLU A 1 9   ? 5.955   -14.425 -19.627 1.00 0.00 ? 9   GLU A N    2  
ATOM 1937  C CA   . GLU A 1 9   ? 4.696   -13.739 -19.892 1.00 0.00 ? 9   GLU A CA   2  
ATOM 1938  C C    . GLU A 1 9   ? 4.456   -12.629 -18.873 1.00 0.00 ? 9   GLU A C    2  
ATOM 1939  O O    . GLU A 1 9   ? 5.236   -12.454 -17.937 1.00 0.00 ? 9   GLU A O    2  
ATOM 1940  C CB   . GLU A 1 9   ? 3.532   -14.732 -19.864 1.00 0.00 ? 9   GLU A CB   2  
ATOM 1941  C CG   . GLU A 1 9   ? 3.502   -15.668 -21.061 1.00 0.00 ? 9   GLU A CG   2  
ATOM 1942  C CD   . GLU A 1 9   ? 2.100   -16.131 -21.404 1.00 0.00 ? 9   GLU A CD   2  
ATOM 1943  O OE1  . GLU A 1 9   ? 1.448   -16.746 -20.534 1.00 0.00 ? 9   GLU A OE1  2  
ATOM 1944  O OE2  . GLU A 1 9   ? 1.654   -15.879 -22.543 1.00 0.00 ? 9   GLU A OE2  2  
ATOM 1945  H H    . GLU A 1 9   ? 6.038   -14.978 -18.822 1.00 0.00 ? 9   GLU A H    2  
ATOM 1946  H HA   . GLU A 1 9   ? 4.759   -13.300 -20.876 1.00 0.00 ? 9   GLU A HA   2  
ATOM 1947  H HB2  . GLU A 1 9   ? 3.606   -15.330 -18.968 1.00 0.00 ? 9   GLU A HB2  2  
ATOM 1948  H HB3  . GLU A 1 9   ? 2.605   -14.180 -19.843 1.00 0.00 ? 9   GLU A HB3  2  
ATOM 1949  H HG2  . GLU A 1 9   ? 3.913   -15.152 -21.916 1.00 0.00 ? 9   GLU A HG2  2  
ATOM 1950  H HG3  . GLU A 1 9   ? 4.108   -16.535 -20.840 1.00 0.00 ? 9   GLU A HG3  2  
ATOM 1951  N N    . GLU A 1 10  ? 3.372   -11.883 -19.063 1.00 0.00 ? 10  GLU A N    2  
ATOM 1952  C CA   . GLU A 1 10  ? 3.031   -10.790 -18.160 1.00 0.00 ? 10  GLU A CA   2  
ATOM 1953  C C    . GLU A 1 10  ? 1.636   -10.984 -17.574 1.00 0.00 ? 10  GLU A C    2  
ATOM 1954  O O    . GLU A 1 10  ? 0.744   -11.521 -18.231 1.00 0.00 ? 10  GLU A O    2  
ATOM 1955  C CB   . GLU A 1 10  ? 3.105   -9.450  -18.896 1.00 0.00 ? 10  GLU A CB   2  
ATOM 1956  C CG   . GLU A 1 10  ? 4.500   -9.100  -19.384 1.00 0.00 ? 10  GLU A CG   2  
ATOM 1957  C CD   . GLU A 1 10  ? 4.488   -8.069  -20.497 1.00 0.00 ? 10  GLU A CD   2  
ATOM 1958  O OE1  . GLU A 1 10  ? 3.586   -7.205  -20.494 1.00 0.00 ? 10  GLU A OE1  2  
ATOM 1959  O OE2  . GLU A 1 10  ? 5.379   -8.127  -21.370 1.00 0.00 ? 10  GLU A OE2  2  
ATOM 1960  H H    . GLU A 1 10  ? 2.790   -12.072 -19.827 1.00 0.00 ? 10  GLU A H    2  
ATOM 1961  H HA   . GLU A 1 10  ? 3.750   -10.787 -17.355 1.00 0.00 ? 10  GLU A HA   2  
ATOM 1962  H HB2  . GLU A 1 10  ? 2.445   -9.485  -19.750 1.00 0.00 ? 10  GLU A HB2  2  
ATOM 1963  H HB3  . GLU A 1 10  ? 2.773   -8.668  -18.229 1.00 0.00 ? 10  GLU A HB3  2  
ATOM 1964  H HG2  . GLU A 1 10  ? 5.069   -8.706  -18.556 1.00 0.00 ? 10  GLU A HG2  2  
ATOM 1965  H HG3  . GLU A 1 10  ? 4.976   -9.998  -19.751 1.00 0.00 ? 10  GLU A HG3  2  
ATOM 1966  N N    . ASP A 1 11  ? 1.456   -10.544 -16.333 1.00 0.00 ? 11  ASP A N    2  
ATOM 1967  C CA   . ASP A 1 11  ? 0.169   -10.668 -15.657 1.00 0.00 ? 11  ASP A CA   2  
ATOM 1968  C C    . ASP A 1 11  ? -0.504  -9.307  -15.516 1.00 0.00 ? 11  ASP A C    2  
ATOM 1969  O O    . ASP A 1 11  ? 0.151   -8.272  -15.393 1.00 0.00 ? 11  ASP A O    2  
ATOM 1970  C CB   . ASP A 1 11  ? 0.354   -11.306 -14.279 1.00 0.00 ? 11  ASP A CB   2  
ATOM 1971  C CG   . ASP A 1 11  ? 0.853   -12.735 -14.363 1.00 0.00 ? 11  ASP A CG   2  
ATOM 1972  O OD1  . ASP A 1 11  ? 0.017   -13.646 -14.537 1.00 0.00 ? 11  ASP A OD1  2  
ATOM 1973  O OD2  . ASP A 1 11  ? 2.079   -12.941 -14.257 1.00 0.00 ? 11  ASP A OD2  2  
ATOM 1974  H H    . ASP A 1 11  ? 2.205   -10.125 -15.861 1.00 0.00 ? 11  ASP A H    2  
ATOM 1975  H HA   . ASP A 1 11  ? -0.460  -11.307 -16.257 1.00 0.00 ? 11  ASP A HA   2  
ATOM 1976  H HB2  . ASP A 1 11  ? 1.070   -10.727 -13.715 1.00 0.00 ? 11  ASP A HB2  2  
ATOM 1977  H HB3  . ASP A 1 11  ? -0.593  -11.304 -13.759 1.00 0.00 ? 11  ASP A HB3  2  
ATOM 1978  N N    . PRO A 1 12  ? -1.845  -9.305  -15.535 1.00 0.00 ? 12  PRO A N    2  
ATOM 1979  C CA   . PRO A 1 12  ? -2.637  -8.078  -15.411 1.00 0.00 ? 12  PRO A CA   2  
ATOM 1980  C C    . PRO A 1 12  ? -2.559  -7.476  -14.012 1.00 0.00 ? 12  PRO A C    2  
ATOM 1981  O O    . PRO A 1 12  ? -2.387  -6.267  -13.855 1.00 0.00 ? 12  PRO A O    2  
ATOM 1982  C CB   . PRO A 1 12  ? -4.064  -8.544  -15.714 1.00 0.00 ? 12  PRO A CB   2  
ATOM 1983  C CG   . PRO A 1 12  ? -4.071  -9.992  -15.364 1.00 0.00 ? 12  PRO A CG   2  
ATOM 1984  C CD   . PRO A 1 12  ? -2.692  -10.502 -15.679 1.00 0.00 ? 12  PRO A CD   2  
ATOM 1985  H HA   . PRO A 1 12  ? -2.337  -7.337  -16.138 1.00 0.00 ? 12  PRO A HA   2  
ATOM 1986  H HB2  . PRO A 1 12  ? -4.764  -7.986  -15.108 1.00 0.00 ? 12  PRO A HB2  2  
ATOM 1987  H HB3  . PRO A 1 12  ? -4.282  -8.390  -16.760 1.00 0.00 ? 12  PRO A HB3  2  
ATOM 1988  H HG2  . PRO A 1 12  ? -4.285  -10.115 -14.313 1.00 0.00 ? 12  PRO A HG2  2  
ATOM 1989  H HG3  . PRO A 1 12  ? -4.807  -10.510 -15.961 1.00 0.00 ? 12  PRO A HG3  2  
ATOM 1990  H HD2  . PRO A 1 12  ? -2.402  -11.266 -14.974 1.00 0.00 ? 12  PRO A HD2  2  
ATOM 1991  H HD3  . PRO A 1 12  ? -2.652  -10.882 -16.689 1.00 0.00 ? 12  PRO A HD3  2  
ATOM 1992  N N    . HIS A 1 13  ? -2.686  -8.327  -12.999 1.00 0.00 ? 13  HIS A N    2  
ATOM 1993  C CA   . HIS A 1 13  ? -2.629  -7.879  -11.612 1.00 0.00 ? 13  HIS A CA   2  
ATOM 1994  C C    . HIS A 1 13  ? -1.309  -7.170  -11.325 1.00 0.00 ? 13  HIS A C    2  
ATOM 1995  O O    . HIS A 1 13  ? -1.277  -6.158  -10.625 1.00 0.00 ? 13  HIS A O    2  
ATOM 1996  C CB   . HIS A 1 13  ? -2.801  -9.065  -10.663 1.00 0.00 ? 13  HIS A CB   2  
ATOM 1997  C CG   . HIS A 1 13  ? -3.423  -8.697  -9.352  1.00 0.00 ? 13  HIS A CG   2  
ATOM 1998  N ND1  . HIS A 1 13  ? -4.334  -9.501  -8.699  1.00 0.00 ? 13  HIS A ND1  2  
ATOM 1999  C CD2  . HIS A 1 13  ? -3.260  -7.604  -8.570  1.00 0.00 ? 13  HIS A CD2  2  
ATOM 2000  C CE1  . HIS A 1 13  ? -4.705  -8.918  -7.573  1.00 0.00 ? 13  HIS A CE1  2  
ATOM 2001  N NE2  . HIS A 1 13  ? -4.068  -7.766  -7.471  1.00 0.00 ? 13  HIS A NE2  2  
ATOM 2002  H H    . HIS A 1 13  ? -2.822  -9.279  -13.189 1.00 0.00 ? 13  HIS A H    2  
ATOM 2003  H HA   . HIS A 1 13  ? -3.439  -7.183  -11.455 1.00 0.00 ? 13  HIS A HA   2  
ATOM 2004  H HB2  . HIS A 1 13  ? -3.432  -9.805  -11.133 1.00 0.00 ? 13  HIS A HB2  2  
ATOM 2005  H HB3  . HIS A 1 13  ? -1.832  -9.500  -10.461 1.00 0.00 ? 13  HIS A HB3  2  
ATOM 2006  H HD1  . HIS A 1 13  ? -4.660  -10.369 -9.015  1.00 0.00 ? 13  HIS A HD1  2  
ATOM 2007  H HD2  . HIS A 1 13  ? -2.615  -6.761  -8.772  1.00 0.00 ? 13  HIS A HD2  2  
ATOM 2008  H HE1  . HIS A 1 13  ? -5.410  -9.315  -6.858  1.00 0.00 ? 13  HIS A HE1  2  
ATOM 2009  N N    . GLU A 1 14  ? -0.222  -7.708  -11.870 1.00 0.00 ? 14  GLU A N    2  
ATOM 2010  C CA   . GLU A 1 14  ? 1.100   -7.126  -11.670 1.00 0.00 ? 14  GLU A CA   2  
ATOM 2011  C C    . GLU A 1 14  ? 1.417   -6.108  -12.762 1.00 0.00 ? 14  GLU A C    2  
ATOM 2012  O O    . GLU A 1 14  ? 2.450   -5.441  -12.722 1.00 0.00 ? 14  GLU A O    2  
ATOM 2013  C CB   . GLU A 1 14  ? 2.167   -8.223  -11.655 1.00 0.00 ? 14  GLU A CB   2  
ATOM 2014  C CG   . GLU A 1 14  ? 2.574   -8.695  -13.041 1.00 0.00 ? 14  GLU A CG   2  
ATOM 2015  C CD   . GLU A 1 14  ? 3.673   -7.844  -13.648 1.00 0.00 ? 14  GLU A CD   2  
ATOM 2016  O OE1  . GLU A 1 14  ? 4.723   -7.676  -12.993 1.00 0.00 ? 14  GLU A OE1  2  
ATOM 2017  O OE2  . GLU A 1 14  ? 3.483   -7.345  -14.777 1.00 0.00 ? 14  GLU A OE2  2  
ATOM 2018  H H    . GLU A 1 14  ? -0.312  -8.515  -12.419 1.00 0.00 ? 14  GLU A H    2  
ATOM 2019  H HA   . GLU A 1 14  ? 1.100   -6.624  -10.715 1.00 0.00 ? 14  GLU A HA   2  
ATOM 2020  H HB2  . GLU A 1 14  ? 3.045   -7.847  -11.152 1.00 0.00 ? 14  GLU A HB2  2  
ATOM 2021  H HB3  . GLU A 1 14  ? 1.785   -9.072  -11.107 1.00 0.00 ? 14  GLU A HB3  2  
ATOM 2022  H HG2  . GLU A 1 14  ? 2.926   -9.713  -12.972 1.00 0.00 ? 14  GLU A HG2  2  
ATOM 2023  H HG3  . GLU A 1 14  ? 1.711   -8.657  -13.689 1.00 0.00 ? 14  GLU A HG3  2  
ATOM 2024  N N    . GLY A 1 15  ? 0.520   -5.995  -13.736 1.00 0.00 ? 15  GLY A N    2  
ATOM 2025  C CA   . GLY A 1 15  ? 0.722   -5.057  -14.825 1.00 0.00 ? 15  GLY A CA   2  
ATOM 2026  C C    . GLY A 1 15  ? 0.086   -3.708  -14.553 1.00 0.00 ? 15  GLY A C    2  
ATOM 2027  O O    . GLY A 1 15  ? 0.305   -2.749  -15.295 1.00 0.00 ? 15  GLY A O    2  
ATOM 2028  H H    . GLY A 1 15  ? -0.286  -6.553  -13.716 1.00 0.00 ? 15  GLY A H    2  
ATOM 2029  H HA2  . GLY A 1 15  ? 1.782   -4.920  -14.976 1.00 0.00 ? 15  GLY A HA2  2  
ATOM 2030  H HA3  . GLY A 1 15  ? 0.290   -5.470  -15.725 1.00 0.00 ? 15  GLY A HA3  2  
ATOM 2031  N N    . LYS A 1 16  ? -0.704  -3.631  -13.488 1.00 0.00 ? 16  LYS A N    2  
ATOM 2032  C CA   . LYS A 1 16  ? -1.374  -2.390  -13.119 1.00 0.00 ? 16  LYS A CA   2  
ATOM 2033  C C    . LYS A 1 16  ? -0.368  -1.254  -12.965 1.00 0.00 ? 16  LYS A C    2  
ATOM 2034  O O    . LYS A 1 16  ? 0.817   -1.489  -12.729 1.00 0.00 ? 16  LYS A O    2  
ATOM 2035  C CB   . LYS A 1 16  ? -2.154  -2.575  -11.816 1.00 0.00 ? 16  LYS A CB   2  
ATOM 2036  C CG   . LYS A 1 16  ? -3.155  -3.717  -11.863 1.00 0.00 ? 16  LYS A CG   2  
ATOM 2037  C CD   . LYS A 1 16  ? -4.340  -3.384  -12.754 1.00 0.00 ? 16  LYS A CD   2  
ATOM 2038  C CE   . LYS A 1 16  ? -5.271  -4.576  -12.911 1.00 0.00 ? 16  LYS A CE   2  
ATOM 2039  N NZ   . LYS A 1 16  ? -6.069  -4.823  -11.678 1.00 0.00 ? 16  LYS A NZ   2  
ATOM 2040  H H    . LYS A 1 16  ? -0.839  -4.430  -12.935 1.00 0.00 ? 16  LYS A H    2  
ATOM 2041  H HA   . LYS A 1 16  ? -2.065  -2.138  -13.910 1.00 0.00 ? 16  LYS A HA   2  
ATOM 2042  H HB2  . LYS A 1 16  ? -1.455  -2.770  -11.016 1.00 0.00 ? 16  LYS A HB2  2  
ATOM 2043  H HB3  . LYS A 1 16  ? -2.691  -1.663  -11.599 1.00 0.00 ? 16  LYS A HB3  2  
ATOM 2044  H HG2  . LYS A 1 16  ? -2.664  -4.598  -12.249 1.00 0.00 ? 16  LYS A HG2  2  
ATOM 2045  H HG3  . LYS A 1 16  ? -3.512  -3.911  -10.861 1.00 0.00 ? 16  LYS A HG3  2  
ATOM 2046  H HD2  . LYS A 1 16  ? -4.891  -2.566  -12.314 1.00 0.00 ? 16  LYS A HD2  2  
ATOM 2047  H HD3  . LYS A 1 16  ? -3.975  -3.092  -13.728 1.00 0.00 ? 16  LYS A HD3  2  
ATOM 2048  H HE2  . LYS A 1 16  ? -5.944  -4.384  -13.733 1.00 0.00 ? 16  LYS A HE2  2  
ATOM 2049  H HE3  . LYS A 1 16  ? -4.679  -5.452  -13.128 1.00 0.00 ? 16  LYS A HE3  2  
ATOM 2050  H HZ1  . LYS A 1 16  ? -6.431  -3.923  -11.301 1.00 0.00 ? 16  LYS A HZ1  2  
ATOM 2051  H HZ2  . LYS A 1 16  ? -5.476  -5.275  -10.954 1.00 0.00 ? 16  LYS A HZ2  2  
ATOM 2052  H HZ3  . LYS A 1 16  ? -6.873  -5.446  -11.892 1.00 0.00 ? 16  LYS A HZ3  2  
ATOM 2053  N N    . ILE A 1 17  ? -0.849  -0.022  -13.098 1.00 0.00 ? 17  ILE A N    2  
ATOM 2054  C CA   . ILE A 1 17  ? 0.008   1.150   -12.971 1.00 0.00 ? 17  ILE A CA   2  
ATOM 2055  C C    . ILE A 1 17  ? 0.128   1.588   -11.515 1.00 0.00 ? 17  ILE A C    2  
ATOM 2056  O O    . ILE A 1 17  ? 1.172   2.081   -11.089 1.00 0.00 ? 17  ILE A O    2  
ATOM 2057  C CB   . ILE A 1 17  ? -0.522  2.329   -13.808 1.00 0.00 ? 17  ILE A CB   2  
ATOM 2058  C CG1  . ILE A 1 17  ? 0.448   3.510   -13.737 1.00 0.00 ? 17  ILE A CG1  2  
ATOM 2059  C CG2  . ILE A 1 17  ? -1.905  2.742   -13.325 1.00 0.00 ? 17  ILE A CG2  2  
ATOM 2060  C CD1  . ILE A 1 17  ? 0.385   4.417   -14.946 1.00 0.00 ? 17  ILE A CD1  2  
ATOM 2061  H H    . ILE A 1 17  ? -1.803  0.101   -13.286 1.00 0.00 ? 17  ILE A H    2  
ATOM 2062  H HA   . ILE A 1 17  ? 0.989   0.886   -13.339 1.00 0.00 ? 17  ILE A HA   2  
ATOM 2063  H HB   . ILE A 1 17  ? -0.608  2.004   -14.834 1.00 0.00 ? 17  ILE A HB   2  
ATOM 2064  H HG12 . ILE A 1 17  ? 0.219   4.104   -12.866 1.00 0.00 ? 17  ILE A HG12 2  
ATOM 2065  H HG13 . ILE A 1 17  ? 1.457   3.133   -13.655 1.00 0.00 ? 17  ILE A HG13 2  
ATOM 2066  H HG21 . ILE A 1 17  ? -1.807  3.472   -12.535 1.00 0.00 ? 17  ILE A HG21 2  
ATOM 2067  H HG22 . ILE A 1 17  ? -2.458  3.173   -14.146 1.00 0.00 ? 17  ILE A HG22 2  
ATOM 2068  H HG23 . ILE A 1 17  ? -2.429  1.875   -12.951 1.00 0.00 ? 17  ILE A HG23 2  
ATOM 2069  H HD11 . ILE A 1 17  ? 0.944   3.974   -15.758 1.00 0.00 ? 17  ILE A HD11 2  
ATOM 2070  H HD12 . ILE A 1 17  ? -0.643  4.548   -15.246 1.00 0.00 ? 17  ILE A HD12 2  
ATOM 2071  H HD13 . ILE A 1 17  ? 0.813   5.378   -14.698 1.00 0.00 ? 17  ILE A HD13 2  
ATOM 2072  N N    . TRP A 1 18  ? -0.946  1.402   -10.757 1.00 0.00 ? 18  TRP A N    2  
ATOM 2073  C CA   . TRP A 1 18  ? -0.961  1.777   -9.348  1.00 0.00 ? 18  TRP A CA   2  
ATOM 2074  C C    . TRP A 1 18  ? -0.218  0.747   -8.503  1.00 0.00 ? 18  TRP A C    2  
ATOM 2075  O O    . TRP A 1 18  ? 0.198   1.034   -7.381  1.00 0.00 ? 18  TRP A O    2  
ATOM 2076  C CB   . TRP A 1 18  ? -2.401  1.918   -8.851  1.00 0.00 ? 18  TRP A CB   2  
ATOM 2077  C CG   . TRP A 1 18  ? -3.302  0.818   -9.323  1.00 0.00 ? 18  TRP A CG   2  
ATOM 2078  C CD1  . TRP A 1 18  ? -4.189  0.873   -10.360 1.00 0.00 ? 18  TRP A CD1  2  
ATOM 2079  C CD2  . TRP A 1 18  ? -3.406  -0.500  -8.774  1.00 0.00 ? 18  TRP A CD2  2  
ATOM 2080  N NE1  . TRP A 1 18  ? -4.838  -0.331  -10.489 1.00 0.00 ? 18  TRP A NE1  2  
ATOM 2081  C CE2  . TRP A 1 18  ? -4.375  -1.191  -9.528  1.00 0.00 ? 18  TRP A CE2  2  
ATOM 2082  C CE3  . TRP A 1 18  ? -2.774  -1.165  -7.720  1.00 0.00 ? 18  TRP A CE3  2  
ATOM 2083  C CZ2  . TRP A 1 18  ? -4.725  -2.511  -9.259  1.00 0.00 ? 18  TRP A CZ2  2  
ATOM 2084  C CZ3  . TRP A 1 18  ? -3.122  -2.476  -7.454  1.00 0.00 ? 18  TRP A CZ3  2  
ATOM 2085  C CH2  . TRP A 1 18  ? -4.090  -3.138  -8.222  1.00 0.00 ? 18  TRP A CH2  2  
ATOM 2086  H H    . TRP A 1 18  ? -1.749  1.004   -11.155 1.00 0.00 ? 18  TRP A H    2  
ATOM 2087  H HA   . TRP A 1 18  ? -0.462  2.730   -9.254  1.00 0.00 ? 18  TRP A HA   2  
ATOM 2088  H HB2  . TRP A 1 18  ? -2.405  1.912   -7.772  1.00 0.00 ? 18  TRP A HB2  2  
ATOM 2089  H HB3  . TRP A 1 18  ? -2.805  2.856   -9.204  1.00 0.00 ? 18  TRP A HB3  2  
ATOM 2090  H HD1  . TRP A 1 18  ? -4.348  1.743   -10.979 1.00 0.00 ? 18  TRP A HD1  2  
ATOM 2091  H HE1  . TRP A 1 18  ? -5.521  -0.541  -11.161 1.00 0.00 ? 18  TRP A HE1  2  
ATOM 2092  H HE3  . TRP A 1 18  ? -2.025  -0.672  -7.117  1.00 0.00 ? 18  TRP A HE3  2  
ATOM 2093  H HZ2  . TRP A 1 18  ? -5.468  -3.036  -9.842  1.00 0.00 ? 18  TRP A HZ2  2  
ATOM 2094  H HZ3  . TRP A 1 18  ? -2.644  -3.005  -6.643  1.00 0.00 ? 18  TRP A HZ3  2  
ATOM 2095  H HH2  . TRP A 1 18  ? -4.331  -4.161  -7.978  1.00 0.00 ? 18  TRP A HH2  2  
ATOM 2096  N N    . PHE A 1 19  ? -0.054  -0.453  -9.050  1.00 0.00 ? 19  PHE A N    2  
ATOM 2097  C CA   . PHE A 1 19  ? 0.639   -1.526  -8.346  1.00 0.00 ? 19  PHE A CA   2  
ATOM 2098  C C    . PHE A 1 19  ? 2.151   -1.384  -8.492  1.00 0.00 ? 19  PHE A C    2  
ATOM 2099  O O    . PHE A 1 19  ? 2.641   -0.789  -9.452  1.00 0.00 ? 19  PHE A O    2  
ATOM 2100  C CB   . PHE A 1 19  ? 0.190   -2.888  -8.879  1.00 0.00 ? 19  PHE A CB   2  
ATOM 2101  C CG   . PHE A 1 19  ? 0.752   -4.048  -8.108  1.00 0.00 ? 19  PHE A CG   2  
ATOM 2102  C CD1  . PHE A 1 19  ? 0.387   -4.262  -6.789  1.00 0.00 ? 19  PHE A CD1  2  
ATOM 2103  C CD2  . PHE A 1 19  ? 1.645   -4.925  -8.703  1.00 0.00 ? 19  PHE A CD2  2  
ATOM 2104  C CE1  . PHE A 1 19  ? 0.903   -5.329  -6.077  1.00 0.00 ? 19  PHE A CE1  2  
ATOM 2105  C CE2  . PHE A 1 19  ? 2.164   -5.993  -7.997  1.00 0.00 ? 19  PHE A CE2  2  
ATOM 2106  C CZ   . PHE A 1 19  ? 1.792   -6.196  -6.682  1.00 0.00 ? 19  PHE A CZ   2  
ATOM 2107  H H    . PHE A 1 19  ? -0.408  -0.621  -9.949  1.00 0.00 ? 19  PHE A H    2  
ATOM 2108  H HA   . PHE A 1 19  ? 0.382   -1.455  -7.301  1.00 0.00 ? 19  PHE A HA   2  
ATOM 2109  H HB2  . PHE A 1 19  ? -0.887  -2.948  -8.829  1.00 0.00 ? 19  PHE A HB2  2  
ATOM 2110  H HB3  . PHE A 1 19  ? 0.505   -2.986  -9.906  1.00 0.00 ? 19  PHE A HB3  2  
ATOM 2111  H HD1  . PHE A 1 19  ? -0.309  -3.586  -6.314  1.00 0.00 ? 19  PHE A HD1  2  
ATOM 2112  H HD2  . PHE A 1 19  ? 1.936   -4.767  -9.732  1.00 0.00 ? 19  PHE A HD2  2  
ATOM 2113  H HE1  . PHE A 1 19  ? 0.611   -5.485  -5.050  1.00 0.00 ? 19  PHE A HE1  2  
ATOM 2114  H HE2  . PHE A 1 19  ? 2.859   -6.669  -8.473  1.00 0.00 ? 19  PHE A HE2  2  
ATOM 2115  H HZ   . PHE A 1 19  ? 2.197   -7.029  -6.129  1.00 0.00 ? 19  PHE A HZ   2  
ATOM 2116  N N    . HIS A 1 20  ? 2.887   -1.935  -7.531  1.00 0.00 ? 20  HIS A N    2  
ATOM 2117  C CA   . HIS A 1 20  ? 4.344   -1.870  -7.551  1.00 0.00 ? 20  HIS A CA   2  
ATOM 2118  C C    . HIS A 1 20  ? 4.951   -3.071  -6.832  1.00 0.00 ? 20  HIS A C    2  
ATOM 2119  O O    . HIS A 1 20  ? 4.833   -3.203  -5.615  1.00 0.00 ? 20  HIS A O    2  
ATOM 2120  C CB   . HIS A 1 20  ? 4.827   -0.574  -6.901  1.00 0.00 ? 20  HIS A CB   2  
ATOM 2121  C CG   . HIS A 1 20  ? 4.725   0.621   -7.798  1.00 0.00 ? 20  HIS A CG   2  
ATOM 2122  N ND1  . HIS A 1 20  ? 5.717   0.983   -8.685  1.00 0.00 ? 20  HIS A ND1  2  
ATOM 2123  C CD2  . HIS A 1 20  ? 3.740   1.538   -7.943  1.00 0.00 ? 20  HIS A CD2  2  
ATOM 2124  C CE1  . HIS A 1 20  ? 5.347   2.071   -9.336  1.00 0.00 ? 20  HIS A CE1  2  
ATOM 2125  N NE2  . HIS A 1 20  ? 4.151   2.428   -8.905  1.00 0.00 ? 20  HIS A NE2  2  
ATOM 2126  H H    . HIS A 1 20  ? 2.439   -2.395  -6.791  1.00 0.00 ? 20  HIS A H    2  
ATOM 2127  H HA   . HIS A 1 20  ? 4.662   -1.885  -8.583  1.00 0.00 ? 20  HIS A HA   2  
ATOM 2128  H HB2  . HIS A 1 20  ? 4.233   -0.378  -6.020  1.00 0.00 ? 20  HIS A HB2  2  
ATOM 2129  H HB3  . HIS A 1 20  ? 5.862   -0.687  -6.613  1.00 0.00 ? 20  HIS A HB3  2  
ATOM 2130  H HD1  . HIS A 1 20  ? 6.566   0.513   -8.816  1.00 0.00 ? 20  HIS A HD1  2  
ATOM 2131  H HD2  . HIS A 1 20  ? 2.804   1.565   -7.403  1.00 0.00 ? 20  HIS A HD2  2  
ATOM 2132  H HE1  . HIS A 1 20  ? 5.924   2.583   -10.092 1.00 0.00 ? 20  HIS A HE1  2  
ATOM 2133  N N    . GLY A 1 21  ? 5.600   -3.945  -7.595  1.00 0.00 ? 21  GLY A N    2  
ATOM 2134  C CA   . GLY A 1 21  ? 6.215   -5.124  -7.014  1.00 0.00 ? 21  GLY A CA   2  
ATOM 2135  C C    . GLY A 1 21  ? 7.700   -5.209  -7.308  1.00 0.00 ? 21  GLY A C    2  
ATOM 2136  O O    . GLY A 1 21  ? 8.424   -5.976  -6.673  1.00 0.00 ? 21  GLY A O    2  
ATOM 2137  H H    . GLY A 1 21  ? 5.662   -3.789  -8.561  1.00 0.00 ? 21  GLY A H    2  
ATOM 2138  H HA2  . GLY A 1 21  ? 6.071   -5.101  -5.944  1.00 0.00 ? 21  GLY A HA2  2  
ATOM 2139  H HA3  . GLY A 1 21  ? 5.730   -6.003  -7.413  1.00 0.00 ? 21  GLY A HA3  2  
ATOM 2140  N N    . LYS A 1 22  ? 8.155   -4.420  -8.275  1.00 0.00 ? 22  LYS A N    2  
ATOM 2141  C CA   . LYS A 1 22  ? 9.563   -4.408  -8.654  1.00 0.00 ? 22  LYS A CA   2  
ATOM 2142  C C    . LYS A 1 22  ? 10.391  -3.615  -7.648  1.00 0.00 ? 22  LYS A C    2  
ATOM 2143  O O    . LYS A 1 22  ? 11.370  -4.122  -7.099  1.00 0.00 ? 22  LYS A O    2  
ATOM 2144  C CB   . LYS A 1 22  ? 9.731   -3.810  -10.053 1.00 0.00 ? 22  LYS A CB   2  
ATOM 2145  C CG   . LYS A 1 22  ? 8.815   -4.430  -11.093 1.00 0.00 ? 22  LYS A CG   2  
ATOM 2146  C CD   . LYS A 1 22  ? 9.456   -5.640  -11.751 1.00 0.00 ? 22  LYS A CD   2  
ATOM 2147  C CE   . LYS A 1 22  ? 9.134   -6.921  -10.996 1.00 0.00 ? 22  LYS A CE   2  
ATOM 2148  N NZ   . LYS A 1 22  ? 7.873   -7.547  -11.478 1.00 0.00 ? 22  LYS A NZ   2  
ATOM 2149  H H    . LYS A 1 22  ? 7.529   -3.830  -8.746  1.00 0.00 ? 22  LYS A H    2  
ATOM 2150  H HA   . LYS A 1 22  ? 9.913   -5.430  -8.664  1.00 0.00 ? 22  LYS A HA   2  
ATOM 2151  H HB2  . LYS A 1 22  ? 9.524   -2.751  -10.005 1.00 0.00 ? 22  LYS A HB2  2  
ATOM 2152  H HB3  . LYS A 1 22  ? 10.754  -3.954  -10.372 1.00 0.00 ? 22  LYS A HB3  2  
ATOM 2153  H HG2  . LYS A 1 22  ? 7.897   -4.738  -10.615 1.00 0.00 ? 22  LYS A HG2  2  
ATOM 2154  H HG3  . LYS A 1 22  ? 8.597   -3.692  -11.853 1.00 0.00 ? 22  LYS A HG3  2  
ATOM 2155  H HD2  . LYS A 1 22  ? 9.085   -5.729  -12.761 1.00 0.00 ? 22  LYS A HD2  2  
ATOM 2156  H HD3  . LYS A 1 22  ? 10.528  -5.503  -11.770 1.00 0.00 ? 22  LYS A HD3  2  
ATOM 2157  H HE2  . LYS A 1 22  ? 9.947   -7.618  -11.132 1.00 0.00 ? 22  LYS A HE2  2  
ATOM 2158  H HE3  . LYS A 1 22  ? 9.032   -6.688  -9.946  1.00 0.00 ? 22  LYS A HE3  2  
ATOM 2159  H HZ1  . LYS A 1 22  ? 8.085   -8.270  -12.196 1.00 0.00 ? 22  LYS A HZ1  2  
ATOM 2160  H HZ2  . LYS A 1 22  ? 7.255   -6.826  -11.902 1.00 0.00 ? 22  LYS A HZ2  2  
ATOM 2161  H HZ3  . LYS A 1 22  ? 7.371   -7.997  -10.686 1.00 0.00 ? 22  LYS A HZ3  2  
ATOM 2162  N N    . ILE A 1 23  ? 9.991   -2.371  -7.409  1.00 0.00 ? 23  ILE A N    2  
ATOM 2163  C CA   . ILE A 1 23  ? 10.694  -1.510  -6.466  1.00 0.00 ? 23  ILE A CA   2  
ATOM 2164  C C    . ILE A 1 23  ? 10.748  -2.142  -5.079  1.00 0.00 ? 23  ILE A C    2  
ATOM 2165  O O    . ILE A 1 23  ? 10.194  -3.218  -4.854  1.00 0.00 ? 23  ILE A O    2  
ATOM 2166  C CB   . ILE A 1 23  ? 10.028  -0.126  -6.363  1.00 0.00 ? 23  ILE A CB   2  
ATOM 2167  C CG1  . ILE A 1 23  ? 8.650   -0.247  -5.709  1.00 0.00 ? 23  ILE A CG1  2  
ATOM 2168  C CG2  . ILE A 1 23  ? 9.912   0.511   -7.739  1.00 0.00 ? 23  ILE A CG2  2  
ATOM 2169  C CD1  . ILE A 1 23  ? 8.132   1.058   -5.145  1.00 0.00 ? 23  ILE A CD1  2  
ATOM 2170  H H    . ILE A 1 23  ? 9.203   -2.024  -7.877  1.00 0.00 ? 23  ILE A H    2  
ATOM 2171  H HA   . ILE A 1 23  ? 11.703  -1.376  -6.828  1.00 0.00 ? 23  ILE A HA   2  
ATOM 2172  H HB   . ILE A 1 23  ? 10.654  0.506   -5.752  1.00 0.00 ? 23  ILE A HB   2  
ATOM 2173  H HG12 . ILE A 1 23  ? 7.939   -0.596  -6.442  1.00 0.00 ? 23  ILE A HG12 2  
ATOM 2174  H HG13 . ILE A 1 23  ? 8.705   -0.961  -4.899  1.00 0.00 ? 23  ILE A HG13 2  
ATOM 2175  H HG21 . ILE A 1 23  ? 8.876   0.735   -7.947  1.00 0.00 ? 23  ILE A HG21 2  
ATOM 2176  H HG22 . ILE A 1 23  ? 10.488  1.424   -7.763  1.00 0.00 ? 23  ILE A HG22 2  
ATOM 2177  H HG23 . ILE A 1 23  ? 10.289  -0.172  -8.485  1.00 0.00 ? 23  ILE A HG23 2  
ATOM 2178  H HD11 . ILE A 1 23  ? 7.745   1.669   -5.947  1.00 0.00 ? 23  ILE A HD11 2  
ATOM 2179  H HD12 . ILE A 1 23  ? 7.345   0.856   -4.433  1.00 0.00 ? 23  ILE A HD12 2  
ATOM 2180  H HD13 . ILE A 1 23  ? 8.938   1.581   -4.651  1.00 0.00 ? 23  ILE A HD13 2  
ATOM 2181  N N    . SER A 1 24  ? 11.417  -1.464  -4.152  1.00 0.00 ? 24  SER A N    2  
ATOM 2182  C CA   . SER A 1 24  ? 11.544  -1.960  -2.787  1.00 0.00 ? 24  SER A CA   2  
ATOM 2183  C C    . SER A 1 24  ? 10.735  -1.101  -1.819  1.00 0.00 ? 24  SER A C    2  
ATOM 2184  O O    . SER A 1 24  ? 10.134  -0.101  -2.212  1.00 0.00 ? 24  SER A O    2  
ATOM 2185  C CB   . SER A 1 24  ? 13.014  -1.977  -2.363  1.00 0.00 ? 24  SER A CB   2  
ATOM 2186  O OG   . SER A 1 24  ? 13.179  -2.632  -1.117  1.00 0.00 ? 24  SER A OG   2  
ATOM 2187  H H    . SER A 1 24  ? 11.837  -0.612  -4.393  1.00 0.00 ? 24  SER A H    2  
ATOM 2188  H HA   . SER A 1 24  ? 11.160  -2.968  -2.763  1.00 0.00 ? 24  SER A HA   2  
ATOM 2189  H HB2  . SER A 1 24  ? 13.595  -2.498  -3.109  1.00 0.00 ? 24  SER A HB2  2  
ATOM 2190  H HB3  . SER A 1 24  ? 13.372  -0.961  -2.273  1.00 0.00 ? 24  SER A HB3  2  
ATOM 2191  H HG   . SER A 1 24  ? 13.052  -3.576  -1.233  1.00 0.00 ? 24  SER A HG   2  
ATOM 2192  N N    . LYS A 1 25  ? 10.724  -1.499  -0.552  1.00 0.00 ? 25  LYS A N    2  
ATOM 2193  C CA   . LYS A 1 25  ? 9.991   -0.768  0.474   1.00 0.00 ? 25  LYS A CA   2  
ATOM 2194  C C    . LYS A 1 25  ? 10.583  0.623   0.679   1.00 0.00 ? 25  LYS A C    2  
ATOM 2195  O O    . LYS A 1 25  ? 9.876   1.558   1.054   1.00 0.00 ? 25  LYS A O    2  
ATOM 2196  C CB   . LYS A 1 25  ? 10.010  -1.542  1.794   1.00 0.00 ? 25  LYS A CB   2  
ATOM 2197  C CG   . LYS A 1 25  ? 9.781   -0.668  3.015   1.00 0.00 ? 25  LYS A CG   2  
ATOM 2198  C CD   . LYS A 1 25  ? 9.102   -1.440  4.134   1.00 0.00 ? 25  LYS A CD   2  
ATOM 2199  C CE   . LYS A 1 25  ? 8.936   -0.585  5.381   1.00 0.00 ? 25  LYS A CE   2  
ATOM 2200  N NZ   . LYS A 1 25  ? 10.243  -0.300  6.036   1.00 0.00 ? 25  LYS A NZ   2  
ATOM 2201  H H    . LYS A 1 25  ? 11.223  -2.305  -0.300  1.00 0.00 ? 25  LYS A H    2  
ATOM 2202  H HA   . LYS A 1 25  ? 8.969   -0.665  0.142   1.00 0.00 ? 25  LYS A HA   2  
ATOM 2203  H HB2  . LYS A 1 25  ? 9.237   -2.296  1.767   1.00 0.00 ? 25  LYS A HB2  2  
ATOM 2204  H HB3  . LYS A 1 25  ? 10.970  -2.027  1.899   1.00 0.00 ? 25  LYS A HB3  2  
ATOM 2205  H HG2  . LYS A 1 25  ? 10.734  -0.305  3.370   1.00 0.00 ? 25  LYS A HG2  2  
ATOM 2206  H HG3  . LYS A 1 25  ? 9.156   0.168   2.736   1.00 0.00 ? 25  LYS A HG3  2  
ATOM 2207  H HD2  . LYS A 1 25  ? 8.127   -1.761  3.799   1.00 0.00 ? 25  LYS A HD2  2  
ATOM 2208  H HD3  . LYS A 1 25  ? 9.703   -2.305  4.379   1.00 0.00 ? 25  LYS A HD3  2  
ATOM 2209  H HE2  . LYS A 1 25  ? 8.472   0.348   5.102   1.00 0.00 ? 25  LYS A HE2  2  
ATOM 2210  H HE3  . LYS A 1 25  ? 8.300   -1.109  6.079   1.00 0.00 ? 25  LYS A HE3  2  
ATOM 2211  H HZ1  . LYS A 1 25  ? 10.182  0.581   6.586   1.00 0.00 ? 25  LYS A HZ1  2  
ATOM 2212  H HZ2  . LYS A 1 25  ? 10.987  -0.195  5.317   1.00 0.00 ? 25  LYS A HZ2  2  
ATOM 2213  H HZ3  . LYS A 1 25  ? 10.500  -1.079  6.675   1.00 0.00 ? 25  LYS A HZ3  2  
ATOM 2214  N N    . GLN A 1 26  ? 11.882  0.750   0.430   1.00 0.00 ? 26  GLN A N    2  
ATOM 2215  C CA   . GLN A 1 26  ? 12.568  2.027   0.588   1.00 0.00 ? 26  GLN A CA   2  
ATOM 2216  C C    . GLN A 1 26  ? 12.291  2.944   -0.600  1.00 0.00 ? 26  GLN A C    2  
ATOM 2217  O O    . GLN A 1 26  ? 12.037  4.135   -0.429  1.00 0.00 ? 26  GLN A O    2  
ATOM 2218  C CB   . GLN A 1 26  ? 14.074  1.807   0.737   1.00 0.00 ? 26  GLN A CB   2  
ATOM 2219  C CG   . GLN A 1 26  ? 14.446  0.928   1.920   1.00 0.00 ? 26  GLN A CG   2  
ATOM 2220  C CD   . GLN A 1 26  ? 14.668  1.723   3.191   1.00 0.00 ? 26  GLN A CD   2  
ATOM 2221  O OE1  . GLN A 1 26  ? 13.716  2.162   3.837   1.00 0.00 ? 26  GLN A OE1  2  
ATOM 2222  N NE2  . GLN A 1 26  ? 15.930  1.913   3.558   1.00 0.00 ? 26  GLN A NE2  2  
ATOM 2223  H H    . GLN A 1 26  ? 12.391  -0.032  0.135   1.00 0.00 ? 26  GLN A H    2  
ATOM 2224  H HA   . GLN A 1 26  ? 12.192  2.497   1.484   1.00 0.00 ? 26  GLN A HA   2  
ATOM 2225  H HB2  . GLN A 1 26  ? 14.448  1.341   -0.163  1.00 0.00 ? 26  GLN A HB2  2  
ATOM 2226  H HB3  . GLN A 1 26  ? 14.555  2.765   0.863   1.00 0.00 ? 26  GLN A HB3  2  
ATOM 2227  H HG2  . GLN A 1 26  ? 13.648  0.220   2.091   1.00 0.00 ? 26  GLN A HG2  2  
ATOM 2228  H HG3  . GLN A 1 26  ? 15.354  0.394   1.683   1.00 0.00 ? 26  GLN A HG3  2  
ATOM 2229  H HE21 . GLN A 1 26  ? 16.638  1.535   2.994   1.00 0.00 ? 26  GLN A HE21 2  
ATOM 2230  H HE22 . GLN A 1 26  ? 16.103  2.424   4.375   1.00 0.00 ? 26  GLN A HE22 2  
ATOM 2231  N N    . GLU A 1 27  ? 12.343  2.378   -1.802  1.00 0.00 ? 27  GLU A N    2  
ATOM 2232  C CA   . GLU A 1 27  ? 12.099  3.146   -3.017  1.00 0.00 ? 27  GLU A CA   2  
ATOM 2233  C C    . GLU A 1 27  ? 10.697  3.750   -3.007  1.00 0.00 ? 27  GLU A C    2  
ATOM 2234  O O    . GLU A 1 27  ? 10.499  4.891   -3.422  1.00 0.00 ? 27  GLU A O    2  
ATOM 2235  C CB   . GLU A 1 27  ? 12.275  2.258   -4.251  1.00 0.00 ? 27  GLU A CB   2  
ATOM 2236  C CG   . GLU A 1 27  ? 13.727  2.043   -4.644  1.00 0.00 ? 27  GLU A CG   2  
ATOM 2237  C CD   . GLU A 1 27  ? 14.663  2.069   -3.452  1.00 0.00 ? 27  GLU A CD   2  
ATOM 2238  O OE1  . GLU A 1 27  ? 14.484  1.236   -2.539  1.00 0.00 ? 27  GLU A OE1  2  
ATOM 2239  O OE2  . GLU A 1 27  ? 15.575  2.922   -3.432  1.00 0.00 ? 27  GLU A OE2  2  
ATOM 2240  H H    . GLU A 1 27  ? 12.550  1.423   -1.873  1.00 0.00 ? 27  GLU A H    2  
ATOM 2241  H HA   . GLU A 1 27  ? 12.822  3.946   -3.055  1.00 0.00 ? 27  GLU A HA   2  
ATOM 2242  H HB2  . GLU A 1 27  ? 11.830  1.295   -4.053  1.00 0.00 ? 27  GLU A HB2  2  
ATOM 2243  H HB3  . GLU A 1 27  ? 11.762  2.717   -5.085  1.00 0.00 ? 27  GLU A HB3  2  
ATOM 2244  H HG2  . GLU A 1 27  ? 13.816  1.084   -5.132  1.00 0.00 ? 27  GLU A HG2  2  
ATOM 2245  H HG3  . GLU A 1 27  ? 14.020  2.824   -5.331  1.00 0.00 ? 27  GLU A HG3  2  
ATOM 2246  N N    . ALA A 1 28  ? 9.729   2.975   -2.531  1.00 0.00 ? 28  ALA A N    2  
ATOM 2247  C CA   . ALA A 1 28  ? 8.347   3.433   -2.465  1.00 0.00 ? 28  ALA A CA   2  
ATOM 2248  C C    . ALA A 1 28  ? 8.239   4.743   -1.692  1.00 0.00 ? 28  ALA A C    2  
ATOM 2249  O O    . ALA A 1 28  ? 7.409   5.595   -2.010  1.00 0.00 ? 28  ALA A O    2  
ATOM 2250  C CB   . ALA A 1 28  ? 7.467   2.367   -1.826  1.00 0.00 ? 28  ALA A CB   2  
ATOM 2251  H H    . ALA A 1 28  ? 9.950   2.074   -2.214  1.00 0.00 ? 28  ALA A H    2  
ATOM 2252  H HA   . ALA A 1 28  ? 7.999   3.592   -3.475  1.00 0.00 ? 28  ALA A HA   2  
ATOM 2253  H HB1  . ALA A 1 28  ? 6.821   1.938   -2.578  1.00 0.00 ? 28  ALA A HB1  2  
ATOM 2254  H HB2  . ALA A 1 28  ? 8.090   1.594   -1.402  1.00 0.00 ? 28  ALA A HB2  2  
ATOM 2255  H HB3  . ALA A 1 28  ? 6.868   2.815   -1.048  1.00 0.00 ? 28  ALA A HB3  2  
ATOM 2256  N N    . TYR A 1 29  ? 9.081   4.897   -0.677  1.00 0.00 ? 29  TYR A N    2  
ATOM 2257  C CA   . TYR A 1 29  ? 9.078   6.103   0.143   1.00 0.00 ? 29  TYR A CA   2  
ATOM 2258  C C    . TYR A 1 29  ? 9.449   7.327   -0.688  1.00 0.00 ? 29  TYR A C    2  
ATOM 2259  O O    . TYR A 1 29  ? 8.726   8.323   -0.704  1.00 0.00 ? 29  TYR A O    2  
ATOM 2260  C CB   . TYR A 1 29  ? 10.052  5.952   1.312   1.00 0.00 ? 29  TYR A CB   2  
ATOM 2261  C CG   . TYR A 1 29  ? 9.435   5.314   2.536   1.00 0.00 ? 29  TYR A CG   2  
ATOM 2262  C CD1  . TYR A 1 29  ? 8.617   6.047   3.388   1.00 0.00 ? 29  TYR A CD1  2  
ATOM 2263  C CD2  . TYR A 1 29  ? 9.670   3.980   2.842   1.00 0.00 ? 29  TYR A CD2  2  
ATOM 2264  C CE1  . TYR A 1 29  ? 8.051   5.469   4.508   1.00 0.00 ? 29  TYR A CE1  2  
ATOM 2265  C CE2  . TYR A 1 29  ? 9.107   3.393   3.959   1.00 0.00 ? 29  TYR A CE2  2  
ATOM 2266  C CZ   . TYR A 1 29  ? 8.299   4.142   4.789   1.00 0.00 ? 29  TYR A CZ   2  
ATOM 2267  O OH   . TYR A 1 29  ? 7.738   3.562   5.903   1.00 0.00 ? 29  TYR A OH   2  
ATOM 2268  H H    . TYR A 1 29  ? 9.720   4.182   -0.473  1.00 0.00 ? 29  TYR A H    2  
ATOM 2269  H HA   . TYR A 1 29  ? 8.080   6.236   0.533   1.00 0.00 ? 29  TYR A HA   2  
ATOM 2270  H HB2  . TYR A 1 29  ? 10.883  5.338   1.003   1.00 0.00 ? 29  TYR A HB2  2  
ATOM 2271  H HB3  . TYR A 1 29  ? 10.418  6.928   1.595   1.00 0.00 ? 29  TYR A HB3  2  
ATOM 2272  H HD1  . TYR A 1 29  ? 8.425   7.087   3.165   1.00 0.00 ? 29  TYR A HD1  2  
ATOM 2273  H HD2  . TYR A 1 29  ? 10.304  3.396   2.190   1.00 0.00 ? 29  TYR A HD2  2  
ATOM 2274  H HE1  . TYR A 1 29  ? 7.418   6.055   5.158   1.00 0.00 ? 29  TYR A HE1  2  
ATOM 2275  H HE2  . TYR A 1 29  ? 9.301   2.354   4.180   1.00 0.00 ? 29  TYR A HE2  2  
ATOM 2276  H HH   . TYR A 1 29  ? 8.378   2.979   6.317   1.00 0.00 ? 29  TYR A HH   2  
ATOM 2277  N N    . ASN A 1 30  ? 10.581  7.245   -1.379  1.00 0.00 ? 30  ASN A N    2  
ATOM 2278  C CA   . ASN A 1 30  ? 11.050  8.346   -2.213  1.00 0.00 ? 30  ASN A CA   2  
ATOM 2279  C C    . ASN A 1 30  ? 10.114  8.568   -3.397  1.00 0.00 ? 30  ASN A C    2  
ATOM 2280  O O    . ASN A 1 30  ? 9.806   9.705   -3.755  1.00 0.00 ? 30  ASN A O    2  
ATOM 2281  C CB   . ASN A 1 30  ? 12.468  8.065   -2.715  1.00 0.00 ? 30  ASN A CB   2  
ATOM 2282  C CG   . ASN A 1 30  ? 13.465  7.925   -1.581  1.00 0.00 ? 30  ASN A CG   2  
ATOM 2283  O OD1  . ASN A 1 30  ? 13.085  7.818   -0.415  1.00 0.00 ? 30  ASN A OD1  2  
ATOM 2284  N ND2  . ASN A 1 30  ? 14.749  7.925   -1.920  1.00 0.00 ? 30  ASN A ND2  2  
ATOM 2285  H H    . ASN A 1 30  ? 11.115  6.425   -1.326  1.00 0.00 ? 30  ASN A H    2  
ATOM 2286  H HA   . ASN A 1 30  ? 11.062  9.239   -1.607  1.00 0.00 ? 30  ASN A HA   2  
ATOM 2287  H HB2  . ASN A 1 30  ? 12.467  7.147   -3.283  1.00 0.00 ? 30  ASN A HB2  2  
ATOM 2288  H HB3  . ASN A 1 30  ? 12.785  8.877   -3.351  1.00 0.00 ? 30  ASN A HB3  2  
ATOM 2289  H HD21 . ASN A 1 30  ? 14.978  8.014   -2.869  1.00 0.00 ? 30  ASN A HD21 2  
ATOM 2290  H HD22 . ASN A 1 30  ? 15.415  7.835   -1.207  1.00 0.00 ? 30  ASN A HD22 2  
ATOM 2291  N N    . LEU A 1 31  ? 9.663   7.474   -4.001  1.00 0.00 ? 31  LEU A N    2  
ATOM 2292  C CA   . LEU A 1 31  ? 8.761   7.547   -5.145  1.00 0.00 ? 31  LEU A CA   2  
ATOM 2293  C C    . LEU A 1 31  ? 7.583   8.470   -4.851  1.00 0.00 ? 31  LEU A C    2  
ATOM 2294  O O    . LEU A 1 31  ? 7.363   9.458   -5.553  1.00 0.00 ? 31  LEU A O    2  
ATOM 2295  C CB   . LEU A 1 31  ? 8.252   6.152   -5.509  1.00 0.00 ? 31  LEU A CB   2  
ATOM 2296  C CG   . LEU A 1 31  ? 9.180   5.305   -6.382  1.00 0.00 ? 31  LEU A CG   2  
ATOM 2297  C CD1  . LEU A 1 31  ? 8.739   3.850   -6.374  1.00 0.00 ? 31  LEU A CD1  2  
ATOM 2298  C CD2  . LEU A 1 31  ? 9.214   5.846   -7.804  1.00 0.00 ? 31  LEU A CD2  2  
ATOM 2299  H H    . LEU A 1 31  ? 9.944   6.595   -3.671  1.00 0.00 ? 31  LEU A H    2  
ATOM 2300  H HA   . LEU A 1 31  ? 9.317   7.948   -5.980  1.00 0.00 ? 31  LEU A HA   2  
ATOM 2301  H HB2  . LEU A 1 31  ? 8.080   5.612   -4.590  1.00 0.00 ? 31  LEU A HB2  2  
ATOM 2302  H HB3  . LEU A 1 31  ? 7.316   6.269   -6.036  1.00 0.00 ? 31  LEU A HB3  2  
ATOM 2303  H HG   . LEU A 1 31  ? 10.183  5.352   -5.981  1.00 0.00 ? 31  LEU A HG   2  
ATOM 2304  H HD11 . LEU A 1 31  ? 8.673   3.499   -5.355  1.00 0.00 ? 31  LEU A HD11 2  
ATOM 2305  H HD12 . LEU A 1 31  ? 9.459   3.253   -6.914  1.00 0.00 ? 31  LEU A HD12 2  
ATOM 2306  H HD13 . LEU A 1 31  ? 7.772   3.764   -6.848  1.00 0.00 ? 31  LEU A HD13 2  
ATOM 2307  H HD21 . LEU A 1 31  ? 9.937   6.646   -7.867  1.00 0.00 ? 31  LEU A HD21 2  
ATOM 2308  H HD22 . LEU A 1 31  ? 8.237   6.224   -8.069  1.00 0.00 ? 31  LEU A HD22 2  
ATOM 2309  H HD23 . LEU A 1 31  ? 9.492   5.055   -8.483  1.00 0.00 ? 31  LEU A HD23 2  
ATOM 2310  N N    . LEU A 1 32  ? 6.829   8.143   -3.807  1.00 0.00 ? 32  LEU A N    2  
ATOM 2311  C CA   . LEU A 1 32  ? 5.673   8.944   -3.417  1.00 0.00 ? 32  LEU A CA   2  
ATOM 2312  C C    . LEU A 1 32  ? 6.100   10.346  -2.995  1.00 0.00 ? 32  LEU A C    2  
ATOM 2313  O O    . LEU A 1 32  ? 5.268   11.242  -2.854  1.00 0.00 ? 32  LEU A O    2  
ATOM 2314  C CB   . LEU A 1 32  ? 4.918   8.263   -2.274  1.00 0.00 ? 32  LEU A CB   2  
ATOM 2315  C CG   . LEU A 1 32  ? 3.928   7.171   -2.681  1.00 0.00 ? 32  LEU A CG   2  
ATOM 2316  C CD1  . LEU A 1 32  ? 3.571   6.302   -1.485  1.00 0.00 ? 32  LEU A CD1  2  
ATOM 2317  C CD2  . LEU A 1 32  ? 2.676   7.786   -3.289  1.00 0.00 ? 32  LEU A CD2  2  
ATOM 2318  H H    . LEU A 1 32  ? 7.053   7.345   -3.285  1.00 0.00 ? 32  LEU A H    2  
ATOM 2319  H HA   . LEU A 1 32  ? 5.020   9.022   -4.273  1.00 0.00 ? 32  LEU A HA   2  
ATOM 2320  H HB2  . LEU A 1 32  ? 5.648   7.819   -1.615  1.00 0.00 ? 32  LEU A HB2  2  
ATOM 2321  H HB3  . LEU A 1 32  ? 4.370   9.026   -1.740  1.00 0.00 ? 32  LEU A HB3  2  
ATOM 2322  H HG   . LEU A 1 32  ? 4.387   6.538   -3.428  1.00 0.00 ? 32  LEU A HG   2  
ATOM 2323  H HD11 . LEU A 1 32  ? 4.170   6.594   -0.636  1.00 0.00 ? 32  LEU A HD11 2  
ATOM 2324  H HD12 . LEU A 1 32  ? 3.762   5.267   -1.722  1.00 0.00 ? 32  LEU A HD12 2  
ATOM 2325  H HD13 . LEU A 1 32  ? 2.524   6.429   -1.248  1.00 0.00 ? 32  LEU A HD13 2  
ATOM 2326  H HD21 . LEU A 1 32  ? 2.868   8.050   -4.318  1.00 0.00 ? 32  LEU A HD21 2  
ATOM 2327  H HD22 . LEU A 1 32  ? 2.405   8.673   -2.734  1.00 0.00 ? 32  LEU A HD22 2  
ATOM 2328  H HD23 . LEU A 1 32  ? 1.867   7.073   -3.245  1.00 0.00 ? 32  LEU A HD23 2  
ATOM 2329  N N    . MET A 1 33  ? 7.402   10.529  -2.798  1.00 0.00 ? 33  MET A N    2  
ATOM 2330  C CA   . MET A 1 33  ? 7.939   11.824  -2.396  1.00 0.00 ? 33  MET A CA   2  
ATOM 2331  C C    . MET A 1 33  ? 8.625   12.516  -3.570  1.00 0.00 ? 33  MET A C    2  
ATOM 2332  O O    . MET A 1 33  ? 8.972   13.695  -3.492  1.00 0.00 ? 33  MET A O    2  
ATOM 2333  C CB   . MET A 1 33  ? 8.927   11.654  -1.241  1.00 0.00 ? 33  MET A CB   2  
ATOM 2334  C CG   . MET A 1 33  ? 8.257   11.395  0.099   1.00 0.00 ? 33  MET A CG   2  
ATOM 2335  S SD   . MET A 1 33  ? 7.172   12.743  0.604   1.00 0.00 ? 33  MET A SD   2  
ATOM 2336  C CE   . MET A 1 33  ? 8.234   14.157  0.321   1.00 0.00 ? 33  MET A CE   2  
ATOM 2337  H H    . MET A 1 33  ? 8.016   9.776   -2.927  1.00 0.00 ? 33  MET A H    2  
ATOM 2338  H HA   . MET A 1 33  ? 7.114   12.436  -2.065  1.00 0.00 ? 33  MET A HA   2  
ATOM 2339  H HB2  . MET A 1 33  ? 9.579   10.821  -1.460  1.00 0.00 ? 33  MET A HB2  2  
ATOM 2340  H HB3  . MET A 1 33  ? 9.520   12.552  -1.154  1.00 0.00 ? 33  MET A HB3  2  
ATOM 2341  H HG2  . MET A 1 33  ? 7.673   10.490  0.026   1.00 0.00 ? 33  MET A HG2  2  
ATOM 2342  H HG3  . MET A 1 33  ? 9.023   11.266  0.849   1.00 0.00 ? 33  MET A HG3  2  
ATOM 2343  H HE1  . MET A 1 33  ? 9.234   13.929  0.658   1.00 0.00 ? 33  MET A HE1  2  
ATOM 2344  H HE2  . MET A 1 33  ? 8.252   14.388  -0.733  1.00 0.00 ? 33  MET A HE2  2  
ATOM 2345  H HE3  . MET A 1 33  ? 7.854   15.007  0.870   1.00 0.00 ? 33  MET A HE3  2  
ATOM 2346  N N    . THR A 1 34  ? 8.818   11.776  -4.657  1.00 0.00 ? 34  THR A N    2  
ATOM 2347  C CA   . THR A 1 34  ? 9.464   12.318  -5.846  1.00 0.00 ? 34  THR A CA   2  
ATOM 2348  C C    . THR A 1 34  ? 8.495   12.372  -7.021  1.00 0.00 ? 34  THR A C    2  
ATOM 2349  O O    . THR A 1 34  ? 8.170   13.449  -7.522  1.00 0.00 ? 34  THR A O    2  
ATOM 2350  C CB   . THR A 1 34  ? 10.694  11.482  -6.247  1.00 0.00 ? 34  THR A CB   2  
ATOM 2351  O OG1  . THR A 1 34  ? 10.358  10.090  -6.257  1.00 0.00 ? 34  THR A OG1  2  
ATOM 2352  C CG2  . THR A 1 34  ? 11.849  11.724  -5.288  1.00 0.00 ? 34  THR A CG2  2  
ATOM 2353  H H    . THR A 1 34  ? 8.519   10.843  -4.658  1.00 0.00 ? 34  THR A H    2  
ATOM 2354  H HA   . THR A 1 34  ? 9.794   13.321  -5.618  1.00 0.00 ? 34  THR A HA   2  
ATOM 2355  H HB   . THR A 1 34  ? 11.002  11.777  -7.240  1.00 0.00 ? 34  THR A HB   2  
ATOM 2356  H HG1  . THR A 1 34  ? 11.135  9.572   -6.032  1.00 0.00 ? 34  THR A HG1  2  
ATOM 2357  H HG21 . THR A 1 34  ? 11.647  12.605  -4.696  1.00 0.00 ? 34  THR A HG21 2  
ATOM 2358  H HG22 . THR A 1 34  ? 12.759  11.869  -5.850  1.00 0.00 ? 34  THR A HG22 2  
ATOM 2359  H HG23 . THR A 1 34  ? 11.960  10.871  -4.636  1.00 0.00 ? 34  THR A HG23 2  
ATOM 2360  N N    . VAL A 1 35  ? 8.034   11.204  -7.458  1.00 0.00 ? 35  VAL A N    2  
ATOM 2361  C CA   . VAL A 1 35  ? 7.100   11.119  -8.574  1.00 0.00 ? 35  VAL A CA   2  
ATOM 2362  C C    . VAL A 1 35  ? 5.661   11.292  -8.101  1.00 0.00 ? 35  VAL A C    2  
ATOM 2363  O O    . VAL A 1 35  ? 4.785   11.676  -8.874  1.00 0.00 ? 35  VAL A O    2  
ATOM 2364  C CB   . VAL A 1 35  ? 7.228   9.772   -9.311  1.00 0.00 ? 35  VAL A CB   2  
ATOM 2365  C CG1  . VAL A 1 35  ? 8.640   9.588   -9.846  1.00 0.00 ? 35  VAL A CG1  2  
ATOM 2366  C CG2  . VAL A 1 35  ? 6.844   8.623   -8.391  1.00 0.00 ? 35  VAL A CG2  2  
ATOM 2367  H H    . VAL A 1 35  ? 8.330   10.380  -7.018  1.00 0.00 ? 35  VAL A H    2  
ATOM 2368  H HA   . VAL A 1 35  ? 7.338   11.910  -9.270  1.00 0.00 ? 35  VAL A HA   2  
ATOM 2369  H HB   . VAL A 1 35  ? 6.547   9.778   -10.149 1.00 0.00 ? 35  VAL A HB   2  
ATOM 2370  H HG11 . VAL A 1 35  ? 8.711   8.636   -10.351 1.00 0.00 ? 35  VAL A HG11 2  
ATOM 2371  H HG12 . VAL A 1 35  ? 8.868   10.383  -10.541 1.00 0.00 ? 35  VAL A HG12 2  
ATOM 2372  H HG13 . VAL A 1 35  ? 9.342   9.614   -9.026  1.00 0.00 ? 35  VAL A HG13 2  
ATOM 2373  H HG21 . VAL A 1 35  ? 7.584   8.524   -7.612  1.00 0.00 ? 35  VAL A HG21 2  
ATOM 2374  H HG22 . VAL A 1 35  ? 5.879   8.824   -7.947  1.00 0.00 ? 35  VAL A HG22 2  
ATOM 2375  H HG23 . VAL A 1 35  ? 6.794   7.707   -8.960  1.00 0.00 ? 35  VAL A HG23 2  
ATOM 2376  N N    . GLY A 1 36  ? 5.425   11.007  -6.824  1.00 0.00 ? 36  GLY A N    2  
ATOM 2377  C CA   . GLY A 1 36  ? 4.091   11.138  -6.269  1.00 0.00 ? 36  GLY A CA   2  
ATOM 2378  C C    . GLY A 1 36  ? 3.866   12.486  -5.613  1.00 0.00 ? 36  GLY A C    2  
ATOM 2379  O O    . GLY A 1 36  ? 4.815   13.137  -5.177  1.00 0.00 ? 36  GLY A O    2  
ATOM 2380  H H    . GLY A 1 36  ? 6.164   10.705  -6.254  1.00 0.00 ? 36  GLY A H    2  
ATOM 2381  H HA2  . GLY A 1 36  ? 3.369   11.010  -7.061  1.00 0.00 ? 36  GLY A HA2  2  
ATOM 2382  H HA3  . GLY A 1 36  ? 3.943   10.363  -5.531  1.00 0.00 ? 36  GLY A HA3  2  
ATOM 2383  N N    . GLN A 1 37  ? 2.606   12.906  -5.544  1.00 0.00 ? 37  GLN A N    2  
ATOM 2384  C CA   . GLN A 1 37  ? 2.261   14.186  -4.939  1.00 0.00 ? 37  GLN A CA   2  
ATOM 2385  C C    . GLN A 1 37  ? 1.396   13.986  -3.698  1.00 0.00 ? 37  GLN A C    2  
ATOM 2386  O O    . GLN A 1 37  ? 1.147   12.856  -3.278  1.00 0.00 ? 37  GLN A O    2  
ATOM 2387  C CB   . GLN A 1 37  ? 1.527   15.070  -5.949  1.00 0.00 ? 37  GLN A CB   2  
ATOM 2388  C CG   . GLN A 1 37  ? 2.457   15.892  -6.827  1.00 0.00 ? 37  GLN A CG   2  
ATOM 2389  C CD   . GLN A 1 37  ? 2.994   17.120  -6.119  1.00 0.00 ? 37  GLN A CD   2  
ATOM 2390  O OE1  . GLN A 1 37  ? 2.443   18.214  -6.245  1.00 0.00 ? 37  GLN A OE1  2  
ATOM 2391  N NE2  . GLN A 1 37  ? 4.076   16.946  -5.369  1.00 0.00 ? 37  GLN A NE2  2  
ATOM 2392  H H    . GLN A 1 37  ? 1.894   12.342  -5.909  1.00 0.00 ? 37  GLN A H    2  
ATOM 2393  H HA   . GLN A 1 37  ? 3.179   14.674  -4.648  1.00 0.00 ? 37  GLN A HA   2  
ATOM 2394  H HB2  . GLN A 1 37  ? 0.924   14.442  -6.588  1.00 0.00 ? 37  GLN A HB2  2  
ATOM 2395  H HB3  . GLN A 1 37  ? 0.881   15.750  -5.412  1.00 0.00 ? 37  GLN A HB3  2  
ATOM 2396  H HG2  . GLN A 1 37  ? 3.291   15.273  -7.123  1.00 0.00 ? 37  GLN A HG2  2  
ATOM 2397  H HG3  . GLN A 1 37  ? 1.915   16.208  -7.706  1.00 0.00 ? 37  GLN A HG3  2  
ATOM 2398  H HE21 . GLN A 1 37  ? 4.462   16.046  -5.316  1.00 0.00 ? 37  GLN A HE21 2  
ATOM 2399  H HE22 . GLN A 1 37  ? 4.444   17.723  -4.901  1.00 0.00 ? 37  GLN A HE22 2  
ATOM 2400  N N    . VAL A 1 38  ? 0.942   15.091  -3.115  1.00 0.00 ? 38  VAL A N    2  
ATOM 2401  C CA   . VAL A 1 38  ? 0.105   15.037  -1.922  1.00 0.00 ? 38  VAL A CA   2  
ATOM 2402  C C    . VAL A 1 38  ? -1.236  14.376  -2.221  1.00 0.00 ? 38  VAL A C    2  
ATOM 2403  O O    . VAL A 1 38  ? -2.040  14.144  -1.318  1.00 0.00 ? 38  VAL A O    2  
ATOM 2404  C CB   . VAL A 1 38  ? -0.145  16.444  -1.348  1.00 0.00 ? 38  VAL A CB   2  
ATOM 2405  C CG1  . VAL A 1 38  ? -1.064  16.372  -0.138  1.00 0.00 ? 38  VAL A CG1  2  
ATOM 2406  C CG2  . VAL A 1 38  ? 1.172   17.114  -0.988  1.00 0.00 ? 38  VAL A CG2  2  
ATOM 2407  H H    . VAL A 1 38  ? 1.175   15.963  -3.496  1.00 0.00 ? 38  VAL A H    2  
ATOM 2408  H HA   . VAL A 1 38  ? 0.624   14.454  -1.176  1.00 0.00 ? 38  VAL A HA   2  
ATOM 2409  H HB   . VAL A 1 38  ? -0.632  17.039  -2.107  1.00 0.00 ? 38  VAL A HB   2  
ATOM 2410  H HG11 . VAL A 1 38  ? -2.090  16.307  -0.469  1.00 0.00 ? 38  VAL A HG11 2  
ATOM 2411  H HG12 . VAL A 1 38  ? -0.818  15.499  0.449   1.00 0.00 ? 38  VAL A HG12 2  
ATOM 2412  H HG13 . VAL A 1 38  ? -0.935  17.259  0.465   1.00 0.00 ? 38  VAL A HG13 2  
ATOM 2413  H HG21 . VAL A 1 38  ? 1.140   18.152  -1.284  1.00 0.00 ? 38  VAL A HG21 2  
ATOM 2414  H HG22 . VAL A 1 38  ? 1.330   17.049  0.078   1.00 0.00 ? 38  VAL A HG22 2  
ATOM 2415  H HG23 . VAL A 1 38  ? 1.981   16.618  -1.503  1.00 0.00 ? 38  VAL A HG23 2  
ATOM 2416  N N    . CYS A 1 39  ? -1.470  14.076  -3.494  1.00 0.00 ? 39  CYS A N    2  
ATOM 2417  C CA   . CYS A 1 39  ? -2.715  13.441  -3.913  1.00 0.00 ? 39  CYS A CA   2  
ATOM 2418  C C    . CYS A 1 39  ? -2.436  12.205  -4.762  1.00 0.00 ? 39  CYS A C    2  
ATOM 2419  O O    . CYS A 1 39  ? -3.112  11.960  -5.761  1.00 0.00 ? 39  CYS A O    2  
ATOM 2420  C CB   . CYS A 1 39  ? -3.576  14.431  -4.699  1.00 0.00 ? 39  CYS A CB   2  
ATOM 2421  S SG   . CYS A 1 39  ? -3.505  16.127  -4.077  1.00 0.00 ? 39  CYS A SG   2  
ATOM 2422  H H    . CYS A 1 39  ? -0.790  14.285  -4.168  1.00 0.00 ? 39  CYS A H    2  
ATOM 2423  H HA   . CYS A 1 39  ? -3.247  13.139  -3.024  1.00 0.00 ? 39  CYS A HA   2  
ATOM 2424  H HB2  . CYS A 1 39  ? -3.248  14.444  -5.728  1.00 0.00 ? 39  CYS A HB2  2  
ATOM 2425  H HB3  . CYS A 1 39  ? -4.606  14.108  -4.661  1.00 0.00 ? 39  CYS A HB3  2  
ATOM 2426  H HG   . CYS A 1 39  ? -3.017  16.895  -5.040  1.00 0.00 ? 39  CYS A HG   2  
ATOM 2427  N N    . SER A 1 40  ? -1.434  11.430  -4.359  1.00 0.00 ? 40  SER A N    2  
ATOM 2428  C CA   . SER A 1 40  ? -1.061  10.222  -5.086  1.00 0.00 ? 40  SER A CA   2  
ATOM 2429  C C    . SER A 1 40  ? -0.847  9.055   -4.126  1.00 0.00 ? 40  SER A C    2  
ATOM 2430  O O    . SER A 1 40  ? -0.464  9.248   -2.972  1.00 0.00 ? 40  SER A O    2  
ATOM 2431  C CB   . SER A 1 40  ? 0.209   10.465  -5.903  1.00 0.00 ? 40  SER A CB   2  
ATOM 2432  O OG   . SER A 1 40  ? 0.309   9.543   -6.975  1.00 0.00 ? 40  SER A OG   2  
ATOM 2433  H H    . SER A 1 40  ? -0.932  11.679  -3.554  1.00 0.00 ? 40  SER A H    2  
ATOM 2434  H HA   . SER A 1 40  ? -1.870  9.977   -5.757  1.00 0.00 ? 40  SER A HA   2  
ATOM 2435  H HB2  . SER A 1 40  ? 0.189   11.466  -6.306  1.00 0.00 ? 40  SER A HB2  2  
ATOM 2436  H HB3  . SER A 1 40  ? 1.072   10.351  -5.264  1.00 0.00 ? 40  SER A HB3  2  
ATOM 2437  H HG   . SER A 1 40  ? -0.569  9.252   -7.230  1.00 0.00 ? 40  SER A HG   2  
ATOM 2438  N N    . PHE A 1 41  ? -1.097  7.844   -4.613  1.00 0.00 ? 41  PHE A N    2  
ATOM 2439  C CA   . PHE A 1 41  ? -0.933  6.645   -3.800  1.00 0.00 ? 41  PHE A CA   2  
ATOM 2440  C C    . PHE A 1 41  ? -0.516  5.457   -4.661  1.00 0.00 ? 41  PHE A C    2  
ATOM 2441  O O    . PHE A 1 41  ? -0.347  5.584   -5.875  1.00 0.00 ? 41  PHE A O    2  
ATOM 2442  C CB   . PHE A 1 41  ? -2.234  6.322   -3.061  1.00 0.00 ? 41  PHE A CB   2  
ATOM 2443  C CG   . PHE A 1 41  ? -3.221  5.554   -3.893  1.00 0.00 ? 41  PHE A CG   2  
ATOM 2444  C CD1  . PHE A 1 41  ? -4.121  6.218   -4.711  1.00 0.00 ? 41  PHE A CD1  2  
ATOM 2445  C CD2  . PHE A 1 41  ? -3.248  4.169   -3.858  1.00 0.00 ? 41  PHE A CD2  2  
ATOM 2446  C CE1  . PHE A 1 41  ? -5.031  5.513   -5.477  1.00 0.00 ? 41  PHE A CE1  2  
ATOM 2447  C CE2  . PHE A 1 41  ? -4.155  3.460   -4.622  1.00 0.00 ? 41  PHE A CE2  2  
ATOM 2448  C CZ   . PHE A 1 41  ? -5.047  4.133   -5.434  1.00 0.00 ? 41  PHE A CZ   2  
ATOM 2449  H H    . PHE A 1 41  ? -1.400  7.755   -5.541  1.00 0.00 ? 41  PHE A H    2  
ATOM 2450  H HA   . PHE A 1 41  ? -0.157  6.840   -3.076  1.00 0.00 ? 41  PHE A HA   2  
ATOM 2451  H HB2  . PHE A 1 41  ? -2.006  5.730   -2.188  1.00 0.00 ? 41  PHE A HB2  2  
ATOM 2452  H HB3  . PHE A 1 41  ? -2.703  7.244   -2.754  1.00 0.00 ? 41  PHE A HB3  2  
ATOM 2453  H HD1  . PHE A 1 41  ? -4.109  7.297   -4.747  1.00 0.00 ? 41  PHE A HD1  2  
ATOM 2454  H HD2  . PHE A 1 41  ? -2.550  3.642   -3.223  1.00 0.00 ? 41  PHE A HD2  2  
ATOM 2455  H HE1  . PHE A 1 41  ? -5.727  6.042   -6.111  1.00 0.00 ? 41  PHE A HE1  2  
ATOM 2456  H HE2  . PHE A 1 41  ? -4.165  2.381   -4.585  1.00 0.00 ? 41  PHE A HE2  2  
ATOM 2457  H HZ   . PHE A 1 41  ? -5.757  3.581   -6.031  1.00 0.00 ? 41  PHE A HZ   2  
ATOM 2458  N N    . LEU A 1 42  ? -0.350  4.302   -4.025  1.00 0.00 ? 42  LEU A N    2  
ATOM 2459  C CA   . LEU A 1 42  ? 0.048   3.090   -4.732  1.00 0.00 ? 42  LEU A CA   2  
ATOM 2460  C C    . LEU A 1 42  ? -0.241  1.850   -3.892  1.00 0.00 ? 42  LEU A C    2  
ATOM 2461  O O    . LEU A 1 42  ? -0.593  1.951   -2.716  1.00 0.00 ? 42  LEU A O    2  
ATOM 2462  C CB   . LEU A 1 42  ? 1.535   3.146   -5.084  1.00 0.00 ? 42  LEU A CB   2  
ATOM 2463  C CG   . LEU A 1 42  ? 2.488   3.451   -3.927  1.00 0.00 ? 42  LEU A CG   2  
ATOM 2464  C CD1  . LEU A 1 42  ? 2.931   2.165   -3.247  1.00 0.00 ? 42  LEU A CD1  2  
ATOM 2465  C CD2  . LEU A 1 42  ? 3.693   4.237   -4.422  1.00 0.00 ? 42  LEU A CD2  2  
ATOM 2466  H H    . LEU A 1 42  ? -0.500  4.263   -3.058  1.00 0.00 ? 42  LEU A H    2  
ATOM 2467  H HA   . LEU A 1 42  ? -0.528  3.034   -5.644  1.00 0.00 ? 42  LEU A HA   2  
ATOM 2468  H HB2  . LEU A 1 42  ? 1.814   2.189   -5.498  1.00 0.00 ? 42  LEU A HB2  2  
ATOM 2469  H HB3  . LEU A 1 42  ? 1.668   3.913   -5.834  1.00 0.00 ? 42  LEU A HB3  2  
ATOM 2470  H HG   . LEU A 1 42  ? 1.971   4.055   -3.194  1.00 0.00 ? 42  LEU A HG   2  
ATOM 2471  H HD11 . LEU A 1 42  ? 2.111   1.762   -2.671  1.00 0.00 ? 42  LEU A HD11 2  
ATOM 2472  H HD12 . LEU A 1 42  ? 3.763   2.373   -2.592  1.00 0.00 ? 42  LEU A HD12 2  
ATOM 2473  H HD13 . LEU A 1 42  ? 3.233   1.448   -3.996  1.00 0.00 ? 42  LEU A HD13 2  
ATOM 2474  H HD21 . LEU A 1 42  ? 4.310   4.516   -3.581  1.00 0.00 ? 42  LEU A HD21 2  
ATOM 2475  H HD22 . LEU A 1 42  ? 3.357   5.129   -4.932  1.00 0.00 ? 42  LEU A HD22 2  
ATOM 2476  H HD23 . LEU A 1 42  ? 4.267   3.626   -5.103  1.00 0.00 ? 42  LEU A HD23 2  
ATOM 2477  N N    . VAL A 1 43  ? -0.087  0.679   -4.502  1.00 0.00 ? 43  VAL A N    2  
ATOM 2478  C CA   . VAL A 1 43  ? -0.328  -0.582  -3.809  1.00 0.00 ? 43  VAL A CA   2  
ATOM 2479  C C    . VAL A 1 43  ? 0.854   -1.532  -3.971  1.00 0.00 ? 43  VAL A C    2  
ATOM 2480  O O    . VAL A 1 43  ? 1.432   -1.640  -5.052  1.00 0.00 ? 43  VAL A O    2  
ATOM 2481  C CB   . VAL A 1 43  ? -1.603  -1.272  -4.328  1.00 0.00 ? 43  VAL A CB   2  
ATOM 2482  C CG1  . VAL A 1 43  ? -1.838  -2.582  -3.590  1.00 0.00 ? 43  VAL A CG1  2  
ATOM 2483  C CG2  . VAL A 1 43  ? -2.803  -0.349  -4.187  1.00 0.00 ? 43  VAL A CG2  2  
ATOM 2484  H H    . VAL A 1 43  ? 0.196   0.662   -5.440  1.00 0.00 ? 43  VAL A H    2  
ATOM 2485  H HA   . VAL A 1 43  ? -0.462  -0.365  -2.759  1.00 0.00 ? 43  VAL A HA   2  
ATOM 2486  H HB   . VAL A 1 43  ? -1.467  -1.495  -5.376  1.00 0.00 ? 43  VAL A HB   2  
ATOM 2487  H HG11 . VAL A 1 43  ? -2.269  -3.304  -4.269  1.00 0.00 ? 43  VAL A HG11 2  
ATOM 2488  H HG12 . VAL A 1 43  ? -0.899  -2.957  -3.212  1.00 0.00 ? 43  VAL A HG12 2  
ATOM 2489  H HG13 . VAL A 1 43  ? -2.517  -2.414  -2.767  1.00 0.00 ? 43  VAL A HG13 2  
ATOM 2490  H HG21 . VAL A 1 43  ? -3.311  -0.558  -3.258  1.00 0.00 ? 43  VAL A HG21 2  
ATOM 2491  H HG22 . VAL A 1 43  ? -2.470  0.679   -4.192  1.00 0.00 ? 43  VAL A HG22 2  
ATOM 2492  H HG23 . VAL A 1 43  ? -3.481  -0.510  -5.012  1.00 0.00 ? 43  VAL A HG23 2  
ATOM 2493  N N    . ARG A 1 44  ? 1.206   -2.219  -2.889  1.00 0.00 ? 44  ARG A N    2  
ATOM 2494  C CA   . ARG A 1 44  ? 2.319   -3.160  -2.911  1.00 0.00 ? 44  ARG A CA   2  
ATOM 2495  C C    . ARG A 1 44  ? 2.016   -4.380  -2.046  1.00 0.00 ? 44  ARG A C    2  
ATOM 2496  O O    . ARG A 1 44  ? 1.308   -4.300  -1.042  1.00 0.00 ? 44  ARG A O    2  
ATOM 2497  C CB   . ARG A 1 44  ? 3.599   -2.480  -2.421  1.00 0.00 ? 44  ARG A CB   2  
ATOM 2498  C CG   . ARG A 1 44  ? 3.771   -1.061  -2.938  1.00 0.00 ? 44  ARG A CG   2  
ATOM 2499  C CD   . ARG A 1 44  ? 4.989   -0.389  -2.324  1.00 0.00 ? 44  ARG A CD   2  
ATOM 2500  N NE   . ARG A 1 44  ? 5.239   -0.848  -0.960  1.00 0.00 ? 44  ARG A NE   2  
ATOM 2501  C CZ   . ARG A 1 44  ? 5.927   -1.946  -0.668  1.00 0.00 ? 44  ARG A CZ   2  
ATOM 2502  N NH1  . ARG A 1 44  ? 6.432   -2.694  -1.640  1.00 0.00 ? 44  ARG A NH1  2  
ATOM 2503  N NH2  . ARG A 1 44  ? 6.111   -2.298  0.598   1.00 0.00 ? 44  ARG A NH2  2  
ATOM 2504  H H    . ARG A 1 44  ? 0.706   -2.089  -2.056  1.00 0.00 ? 44  ARG A H    2  
ATOM 2505  H HA   . ARG A 1 44  ? 2.461   -3.483  -3.931  1.00 0.00 ? 44  ARG A HA   2  
ATOM 2506  H HB2  . ARG A 1 44  ? 3.585   -2.447  -1.341  1.00 0.00 ? 44  ARG A HB2  2  
ATOM 2507  H HB3  . ARG A 1 44  ? 4.448   -3.064  -2.744  1.00 0.00 ? 44  ARG A HB3  2  
ATOM 2508  H HG2  . ARG A 1 44  ? 3.893   -1.091  -4.011  1.00 0.00 ? 44  ARG A HG2  2  
ATOM 2509  H HG3  . ARG A 1 44  ? 2.891   -0.488  -2.689  1.00 0.00 ? 44  ARG A HG3  2  
ATOM 2510  H HD2  . ARG A 1 44  ? 5.853   -0.613  -2.932  1.00 0.00 ? 44  ARG A HD2  2  
ATOM 2511  H HD3  . ARG A 1 44  ? 4.826   0.678   -2.311  1.00 0.00 ? 44  ARG A HD3  2  
ATOM 2512  H HE   . ARG A 1 44  ? 4.875   -0.310  -0.227  1.00 0.00 ? 44  ARG A HE   2  
ATOM 2513  H HH11 . ARG A 1 44  ? 6.295   -2.430  -2.595  1.00 0.00 ? 44  ARG A HH11 2  
ATOM 2514  H HH12 . ARG A 1 44  ? 6.951   -3.519  -1.418  1.00 0.00 ? 44  ARG A HH12 2  
ATOM 2515  H HH21 . ARG A 1 44  ? 5.733   -1.737  1.333   1.00 0.00 ? 44  ARG A HH21 2  
ATOM 2516  H HH22 . ARG A 1 44  ? 6.629   -3.124  0.816   1.00 0.00 ? 44  ARG A HH22 2  
ATOM 2517  N N    . PRO A 1 45  ? 2.563   -5.539  -2.445  1.00 0.00 ? 45  PRO A N    2  
ATOM 2518  C CA   . PRO A 1 45  ? 2.365   -6.798  -1.721  1.00 0.00 ? 45  PRO A CA   2  
ATOM 2519  C C    . PRO A 1 45  ? 3.079   -6.811  -0.374  1.00 0.00 ? 45  PRO A C    2  
ATOM 2520  O O    . PRO A 1 45  ? 4.297   -6.646  -0.305  1.00 0.00 ? 45  PRO A O    2  
ATOM 2521  C CB   . PRO A 1 45  ? 2.972   -7.845  -2.658  1.00 0.00 ? 45  PRO A CB   2  
ATOM 2522  C CG   . PRO A 1 45  ? 3.974   -7.095  -3.466  1.00 0.00 ? 45  PRO A CG   2  
ATOM 2523  C CD   . PRO A 1 45  ? 3.417   -5.708  -3.632  1.00 0.00 ? 45  PRO A CD   2  
ATOM 2524  H HA   . PRO A 1 45  ? 1.316   -7.010  -1.573  1.00 0.00 ? 45  PRO A HA   2  
ATOM 2525  H HB2  . PRO A 1 45  ? 3.438   -8.626  -2.075  1.00 0.00 ? 45  PRO A HB2  2  
ATOM 2526  H HB3  . PRO A 1 45  ? 2.198   -8.267  -3.282  1.00 0.00 ? 45  PRO A HB3  2  
ATOM 2527  H HG2  . PRO A 1 45  ? 4.916   -7.060  -2.942  1.00 0.00 ? 45  PRO A HG2  2  
ATOM 2528  H HG3  . PRO A 1 45  ? 4.096   -7.567  -4.430  1.00 0.00 ? 45  PRO A HG3  2  
ATOM 2529  H HD2  . PRO A 1 45  ? 4.214   -4.979  -3.640  1.00 0.00 ? 45  PRO A HD2  2  
ATOM 2530  H HD3  . PRO A 1 45  ? 2.834   -5.641  -4.539  1.00 0.00 ? 45  PRO A HD3  2  
ATOM 2531  N N    . SER A 1 46  ? 2.314   -7.008  0.695   1.00 0.00 ? 46  SER A N    2  
ATOM 2532  C CA   . SER A 1 46  ? 2.874   -7.039  2.041   1.00 0.00 ? 46  SER A CA   2  
ATOM 2533  C C    . SER A 1 46  ? 3.753   -8.271  2.235   1.00 0.00 ? 46  SER A C    2  
ATOM 2534  O O    . SER A 1 46  ? 3.575   -9.286  1.562   1.00 0.00 ? 46  SER A O    2  
ATOM 2535  C CB   . SER A 1 46  ? 1.753   -7.029  3.083   1.00 0.00 ? 46  SER A CB   2  
ATOM 2536  O OG   . SER A 1 46  ? 2.243   -6.641  4.355   1.00 0.00 ? 46  SER A OG   2  
ATOM 2537  H H    . SER A 1 46  ? 1.349   -7.134  0.575   1.00 0.00 ? 46  SER A H    2  
ATOM 2538  H HA   . SER A 1 46  ? 3.480   -6.155  2.168   1.00 0.00 ? 46  SER A HA   2  
ATOM 2539  H HB2  . SER A 1 46  ? 0.988   -6.331  2.777   1.00 0.00 ? 46  SER A HB2  2  
ATOM 2540  H HB3  . SER A 1 46  ? 1.328   -8.019  3.160   1.00 0.00 ? 46  SER A HB3  2  
ATOM 2541  H HG   . SER A 1 46  ? 2.923   -5.972  4.246   1.00 0.00 ? 46  SER A HG   2  
ATOM 2542  N N    . ASP A 1 47  ? 4.701   -8.173  3.160   1.00 0.00 ? 47  ASP A N    2  
ATOM 2543  C CA   . ASP A 1 47  ? 5.608   -9.279  3.445   1.00 0.00 ? 47  ASP A CA   2  
ATOM 2544  C C    . ASP A 1 47  ? 5.369   -9.830  4.848   1.00 0.00 ? 47  ASP A C    2  
ATOM 2545  O O    . ASP A 1 47  ? 5.383   -11.042 5.059   1.00 0.00 ? 47  ASP A O    2  
ATOM 2546  C CB   . ASP A 1 47  ? 7.061   -8.824  3.304   1.00 0.00 ? 47  ASP A CB   2  
ATOM 2547  C CG   . ASP A 1 47  ? 8.018   -9.681  4.110   1.00 0.00 ? 47  ASP A CG   2  
ATOM 2548  O OD1  . ASP A 1 47  ? 8.255   -9.354  5.291   1.00 0.00 ? 47  ASP A OD1  2  
ATOM 2549  O OD2  . ASP A 1 47  ? 8.530   -10.678 3.558   1.00 0.00 ? 47  ASP A OD2  2  
ATOM 2550  H H    . ASP A 1 47  ? 4.793   -7.337  3.664   1.00 0.00 ? 47  ASP A H    2  
ATOM 2551  H HA   . ASP A 1 47  ? 5.414   -10.061 2.727   1.00 0.00 ? 47  ASP A HA   2  
ATOM 2552  H HB2  . ASP A 1 47  ? 7.349   -8.877  2.264   1.00 0.00 ? 47  ASP A HB2  2  
ATOM 2553  H HB3  . ASP A 1 47  ? 7.147   -7.802  3.645   1.00 0.00 ? 47  ASP A HB3  2  
ATOM 2554  N N    . ASN A 1 48  ? 5.150   -8.931  5.802   1.00 0.00 ? 48  ASN A N    2  
ATOM 2555  C CA   . ASN A 1 48  ? 4.909   -9.328  7.185   1.00 0.00 ? 48  ASN A CA   2  
ATOM 2556  C C    . ASN A 1 48  ? 3.888   -10.459 7.256   1.00 0.00 ? 48  ASN A C    2  
ATOM 2557  O O    . ASN A 1 48  ? 4.100   -11.461 7.940   1.00 0.00 ? 48  ASN A O    2  
ATOM 2558  C CB   . ASN A 1 48  ? 4.420   -8.131  8.003   1.00 0.00 ? 48  ASN A CB   2  
ATOM 2559  C CG   . ASN A 1 48  ? 3.549   -7.193  7.190   1.00 0.00 ? 48  ASN A CG   2  
ATOM 2560  O OD1  . ASN A 1 48  ? 2.350   -7.423  7.030   1.00 0.00 ? 48  ASN A OD1  2  
ATOM 2561  N ND2  . ASN A 1 48  ? 4.150   -6.128  6.672   1.00 0.00 ? 48  ASN A ND2  2  
ATOM 2562  H H    . ASN A 1 48  ? 5.151   -7.979  5.571   1.00 0.00 ? 48  ASN A H    2  
ATOM 2563  H HA   . ASN A 1 48  ? 5.844   -9.676  7.597   1.00 0.00 ? 48  ASN A HA   2  
ATOM 2564  H HB2  . ASN A 1 48  ? 3.843   -8.489  8.843   1.00 0.00 ? 48  ASN A HB2  2  
ATOM 2565  H HB3  . ASN A 1 48  ? 5.273   -7.578  8.366   1.00 0.00 ? 48  ASN A HB3  2  
ATOM 2566  H HD21 . ASN A 1 48  ? 5.108   -6.009  6.840   1.00 0.00 ? 48  ASN A HD21 2  
ATOM 2567  H HD22 . ASN A 1 48  ? 3.610   -5.504  6.142   1.00 0.00 ? 48  ASN A HD22 2  
ATOM 2568  N N    . THR A 1 49  ? 2.778   -10.292 6.544   1.00 0.00 ? 49  THR A N    2  
ATOM 2569  C CA   . THR A 1 49  ? 1.723   -11.298 6.527   1.00 0.00 ? 49  THR A CA   2  
ATOM 2570  C C    . THR A 1 49  ? 1.721   -12.070 5.213   1.00 0.00 ? 49  THR A C    2  
ATOM 2571  O O    . THR A 1 49  ? 1.880   -11.504 4.132   1.00 0.00 ? 49  THR A O    2  
ATOM 2572  C CB   . THR A 1 49  ? 0.336   -10.660 6.737   1.00 0.00 ? 49  THR A CB   2  
ATOM 2573  O OG1  . THR A 1 49  ? 0.313   -9.930  7.968   1.00 0.00 ? 49  THR A OG1  2  
ATOM 2574  C CG2  . THR A 1 49  ? -0.752  -11.724 6.752   1.00 0.00 ? 49  THR A CG2  2  
ATOM 2575  H H    . THR A 1 49  ? 2.666   -9.472  6.019   1.00 0.00 ? 49  THR A H    2  
ATOM 2576  H HA   . THR A 1 49  ? 1.905   -11.987 7.339   1.00 0.00 ? 49  THR A HA   2  
ATOM 2577  H HB   . THR A 1 49  ? 0.142   -9.980  5.919   1.00 0.00 ? 49  THR A HB   2  
ATOM 2578  H HG1  . THR A 1 49  ? 0.231   -8.991  7.782   1.00 0.00 ? 49  THR A HG1  2  
ATOM 2579  H HG21 . THR A 1 49  ? -0.723  -12.254 7.692   1.00 0.00 ? 49  THR A HG21 2  
ATOM 2580  H HG22 . THR A 1 49  ? -0.587  -12.418 5.941   1.00 0.00 ? 49  THR A HG22 2  
ATOM 2581  H HG23 . THR A 1 49  ? -1.716  -11.254 6.633   1.00 0.00 ? 49  THR A HG23 2  
ATOM 2582  N N    . PRO A 1 50  ? 1.536   -13.396 5.305   1.00 0.00 ? 50  PRO A N    2  
ATOM 2583  C CA   . PRO A 1 50  ? 1.508   -14.274 4.132   1.00 0.00 ? 50  PRO A CA   2  
ATOM 2584  C C    . PRO A 1 50  ? 0.263   -14.062 3.278   1.00 0.00 ? 50  PRO A C    2  
ATOM 2585  O O    . PRO A 1 50  ? -0.760  -14.714 3.482   1.00 0.00 ? 50  PRO A O    2  
ATOM 2586  C CB   . PRO A 1 50  ? 1.505   -15.679 4.741   1.00 0.00 ? 50  PRO A CB   2  
ATOM 2587  C CG   . PRO A 1 50  ? 0.913   -15.503 6.097   1.00 0.00 ? 50  PRO A CG   2  
ATOM 2588  C CD   . PRO A 1 50  ? 1.340   -14.138 6.562   1.00 0.00 ? 50  PRO A CD   2  
ATOM 2589  H HA   . PRO A 1 50  ? 2.389   -14.147 3.520   1.00 0.00 ? 50  PRO A HA   2  
ATOM 2590  H HB2  . PRO A 1 50  ? 0.906   -16.338 4.129   1.00 0.00 ? 50  PRO A HB2  2  
ATOM 2591  H HB3  . PRO A 1 50  ? 2.517   -16.052 4.799   1.00 0.00 ? 50  PRO A HB3  2  
ATOM 2592  H HG2  . PRO A 1 50  ? -0.164  -15.558 6.037   1.00 0.00 ? 50  PRO A HG2  2  
ATOM 2593  H HG3  . PRO A 1 50  ? 1.292   -16.262 6.765   1.00 0.00 ? 50  PRO A HG3  2  
ATOM 2594  H HD2  . PRO A 1 50  ? 0.565   -13.684 7.161   1.00 0.00 ? 50  PRO A HD2  2  
ATOM 2595  H HD3  . PRO A 1 50  ? 2.263   -14.202 7.119   1.00 0.00 ? 50  PRO A HD3  2  
ATOM 2596  N N    . GLY A 1 51  ? 0.358   -13.144 2.320   1.00 0.00 ? 51  GLY A N    2  
ATOM 2597  C CA   . GLY A 1 51  ? -0.768  -12.862 1.449   1.00 0.00 ? 51  GLY A CA   2  
ATOM 2598  C C    . GLY A 1 51  ? -1.545  -11.636 1.885   1.00 0.00 ? 51  GLY A C    2  
ATOM 2599  O O    . GLY A 1 51  ? -2.748  -11.712 2.138   1.00 0.00 ? 51  GLY A O    2  
ATOM 2600  H H    . GLY A 1 51  ? 1.199   -12.655 2.204   1.00 0.00 ? 51  GLY A H    2  
ATOM 2601  H HA2  . GLY A 1 51  ? -0.403  -12.707 0.445   1.00 0.00 ? 51  GLY A HA2  2  
ATOM 2602  H HA3  . GLY A 1 51  ? -1.433  -13.714 1.452   1.00 0.00 ? 51  GLY A HA3  2  
ATOM 2603  N N    . ASP A 1 52  ? -0.858  -10.503 1.973   1.00 0.00 ? 52  ASP A N    2  
ATOM 2604  C CA   . ASP A 1 52  ? -1.491  -9.254  2.382   1.00 0.00 ? 52  ASP A CA   2  
ATOM 2605  C C    . ASP A 1 52  ? -1.049  -8.102  1.484   1.00 0.00 ? 52  ASP A C    2  
ATOM 2606  O O    . ASP A 1 52  ? -0.076  -8.220  0.739   1.00 0.00 ? 52  ASP A O    2  
ATOM 2607  C CB   . ASP A 1 52  ? -1.153  -8.939  3.840   1.00 0.00 ? 52  ASP A CB   2  
ATOM 2608  C CG   . ASP A 1 52  ? -2.128  -9.576  4.810   1.00 0.00 ? 52  ASP A CG   2  
ATOM 2609  O OD1  . ASP A 1 52  ? -2.462  -10.764 4.622   1.00 0.00 ? 52  ASP A OD1  2  
ATOM 2610  O OD2  . ASP A 1 52  ? -2.558  -8.886  5.758   1.00 0.00 ? 52  ASP A OD2  2  
ATOM 2611  H H    . ASP A 1 52  ? 0.099   -10.506 1.758   1.00 0.00 ? 52  ASP A H    2  
ATOM 2612  H HA   . ASP A 1 52  ? -2.559  -9.377  2.288   1.00 0.00 ? 52  ASP A HA   2  
ATOM 2613  H HB2  . ASP A 1 52  ? -0.162  -9.308  4.061   1.00 0.00 ? 52  ASP A HB2  2  
ATOM 2614  H HB3  . ASP A 1 52  ? -1.175  -7.869  3.985   1.00 0.00 ? 52  ASP A HB3  2  
ATOM 2615  N N    . TYR A 1 53  ? -1.771  -6.990  1.560   1.00 0.00 ? 53  TYR A N    2  
ATOM 2616  C CA   . TYR A 1 53  ? -1.456  -5.817  0.753   1.00 0.00 ? 53  TYR A CA   2  
ATOM 2617  C C    . TYR A 1 53  ? -1.365  -4.566  1.621   1.00 0.00 ? 53  TYR A C    2  
ATOM 2618  O O    . TYR A 1 53  ? -1.854  -4.543  2.750   1.00 0.00 ? 53  TYR A O    2  
ATOM 2619  C CB   . TYR A 1 53  ? -2.515  -5.621  -0.334  1.00 0.00 ? 53  TYR A CB   2  
ATOM 2620  C CG   . TYR A 1 53  ? -2.389  -6.595  -1.484  1.00 0.00 ? 53  TYR A CG   2  
ATOM 2621  C CD1  . TYR A 1 53  ? -1.369  -6.469  -2.419  1.00 0.00 ? 53  TYR A CD1  2  
ATOM 2622  C CD2  . TYR A 1 53  ? -3.291  -7.641  -1.637  1.00 0.00 ? 53  TYR A CD2  2  
ATOM 2623  C CE1  . TYR A 1 53  ? -1.250  -7.356  -3.471  1.00 0.00 ? 53  TYR A CE1  2  
ATOM 2624  C CE2  . TYR A 1 53  ? -3.180  -8.533  -2.685  1.00 0.00 ? 53  TYR A CE2  2  
ATOM 2625  C CZ   . TYR A 1 53  ? -2.158  -8.386  -3.600  1.00 0.00 ? 53  TYR A CZ   2  
ATOM 2626  O OH   . TYR A 1 53  ? -2.044  -9.272  -4.647  1.00 0.00 ? 53  TYR A OH   2  
ATOM 2627  H H    . TYR A 1 53  ? -2.535  -6.956  2.173   1.00 0.00 ? 53  TYR A H    2  
ATOM 2628  H HA   . TYR A 1 53  ? -0.498  -5.986  0.282   1.00 0.00 ? 53  TYR A HA   2  
ATOM 2629  H HB2  . TYR A 1 53  ? -3.494  -5.747  0.100   1.00 0.00 ? 53  TYR A HB2  2  
ATOM 2630  H HB3  . TYR A 1 53  ? -2.429  -4.622  -0.735  1.00 0.00 ? 53  TYR A HB3  2  
ATOM 2631  H HD1  . TYR A 1 53  ? -0.659  -5.660  -2.315  1.00 0.00 ? 53  TYR A HD1  2  
ATOM 2632  H HD2  . TYR A 1 53  ? -4.091  -7.753  -0.918  1.00 0.00 ? 53  TYR A HD2  2  
ATOM 2633  H HE1  . TYR A 1 53  ? -0.450  -7.241  -4.188  1.00 0.00 ? 53  TYR A HE1  2  
ATOM 2634  H HE2  . TYR A 1 53  ? -3.890  -9.340  -2.786  1.00 0.00 ? 53  TYR A HE2  2  
ATOM 2635  H HH   . TYR A 1 53  ? -2.541  -8.943  -5.400  1.00 0.00 ? 53  TYR A HH   2  
ATOM 2636  N N    . SER A 1 54  ? -0.735  -3.526  1.084   1.00 0.00 ? 54  SER A N    2  
ATOM 2637  C CA   . SER A 1 54  ? -0.575  -2.271  1.809   1.00 0.00 ? 54  SER A CA   2  
ATOM 2638  C C    . SER A 1 54  ? -0.762  -1.078  0.878   1.00 0.00 ? 54  SER A C    2  
ATOM 2639  O O    . SER A 1 54  ? -0.517  -1.170  -0.326  1.00 0.00 ? 54  SER A O    2  
ATOM 2640  C CB   . SER A 1 54  ? 0.805   -2.209  2.466   1.00 0.00 ? 54  SER A CB   2  
ATOM 2641  O OG   . SER A 1 54  ? 0.798   -1.340  3.586   1.00 0.00 ? 54  SER A OG   2  
ATOM 2642  H H    . SER A 1 54  ? -0.366  -3.606  0.179   1.00 0.00 ? 54  SER A H    2  
ATOM 2643  H HA   . SER A 1 54  ? -1.332  -2.235  2.578   1.00 0.00 ? 54  SER A HA   2  
ATOM 2644  H HB2  . SER A 1 54  ? 1.090   -3.197  2.793   1.00 0.00 ? 54  SER A HB2  2  
ATOM 2645  H HB3  . SER A 1 54  ? 1.526   -1.845  1.748   1.00 0.00 ? 54  SER A HB3  2  
ATOM 2646  H HG   . SER A 1 54  ? -0.015  -1.462  4.080   1.00 0.00 ? 54  SER A HG   2  
ATOM 2647  N N    . LEU A 1 55  ? -1.198  0.043   1.442   1.00 0.00 ? 55  LEU A N    2  
ATOM 2648  C CA   . LEU A 1 55  ? -1.419  1.257   0.663   1.00 0.00 ? 55  LEU A CA   2  
ATOM 2649  C C    . LEU A 1 55  ? -0.572  2.408   1.197   1.00 0.00 ? 55  LEU A C    2  
ATOM 2650  O O    . LEU A 1 55  ? -0.405  2.559   2.408   1.00 0.00 ? 55  LEU A O    2  
ATOM 2651  C CB   . LEU A 1 55  ? -2.899  1.642   0.691   1.00 0.00 ? 55  LEU A CB   2  
ATOM 2652  C CG   . LEU A 1 55  ? -3.381  2.538   -0.450  1.00 0.00 ? 55  LEU A CG   2  
ATOM 2653  C CD1  . LEU A 1 55  ? -3.768  1.700   -1.659  1.00 0.00 ? 55  LEU A CD1  2  
ATOM 2654  C CD2  . LEU A 1 55  ? -4.553  3.396   0.003   1.00 0.00 ? 55  LEU A CD2  2  
ATOM 2655  H H    . LEU A 1 55  ? -1.376  0.056   2.405   1.00 0.00 ? 55  LEU A H    2  
ATOM 2656  H HA   . LEU A 1 55  ? -1.127  1.054   -0.356  1.00 0.00 ? 55  LEU A HA   2  
ATOM 2657  H HB2  . LEU A 1 55  ? -3.478  0.732   0.664   1.00 0.00 ? 55  LEU A HB2  2  
ATOM 2658  H HB3  . LEU A 1 55  ? -3.088  2.159   1.621   1.00 0.00 ? 55  LEU A HB3  2  
ATOM 2659  H HG   . LEU A 1 55  ? -2.577  3.198   -0.746  1.00 0.00 ? 55  LEU A HG   2  
ATOM 2660  H HD11 . LEU A 1 55  ? -4.004  2.351   -2.488  1.00 0.00 ? 55  LEU A HD11 2  
ATOM 2661  H HD12 . LEU A 1 55  ? -4.631  1.097   -1.418  1.00 0.00 ? 55  LEU A HD12 2  
ATOM 2662  H HD13 . LEU A 1 55  ? -2.944  1.056   -1.930  1.00 0.00 ? 55  LEU A HD13 2  
ATOM 2663  H HD21 . LEU A 1 55  ? -5.445  3.094   -0.525  1.00 0.00 ? 55  LEU A HD21 2  
ATOM 2664  H HD22 . LEU A 1 55  ? -4.343  4.434   -0.210  1.00 0.00 ? 55  LEU A HD22 2  
ATOM 2665  H HD23 . LEU A 1 55  ? -4.702  3.269   1.065   1.00 0.00 ? 55  LEU A HD23 2  
ATOM 2666  N N    . TYR A 1 56  ? -0.043  3.217   0.287   1.00 0.00 ? 56  TYR A N    2  
ATOM 2667  C CA   . TYR A 1 56  ? 0.787   4.355   0.666   1.00 0.00 ? 56  TYR A CA   2  
ATOM 2668  C C    . TYR A 1 56  ? 0.255   5.646   0.051   1.00 0.00 ? 56  TYR A C    2  
ATOM 2669  O O    . TYR A 1 56  ? 0.187   5.784   -1.170  1.00 0.00 ? 56  TYR A O    2  
ATOM 2670  C CB   . TYR A 1 56  ? 2.234   4.126   0.227   1.00 0.00 ? 56  TYR A CB   2  
ATOM 2671  C CG   . TYR A 1 56  ? 2.917   2.992   0.957   1.00 0.00 ? 56  TYR A CG   2  
ATOM 2672  C CD1  . TYR A 1 56  ? 2.570   1.670   0.708   1.00 0.00 ? 56  TYR A CD1  2  
ATOM 2673  C CD2  . TYR A 1 56  ? 3.908   3.242   1.898   1.00 0.00 ? 56  TYR A CD2  2  
ATOM 2674  C CE1  . TYR A 1 56  ? 3.190   0.630   1.373   1.00 0.00 ? 56  TYR A CE1  2  
ATOM 2675  C CE2  . TYR A 1 56  ? 4.535   2.209   2.567   1.00 0.00 ? 56  TYR A CE2  2  
ATOM 2676  C CZ   . TYR A 1 56  ? 4.172   0.905   2.302   1.00 0.00 ? 56  TYR A CZ   2  
ATOM 2677  O OH   . TYR A 1 56  ? 4.793   -0.127  2.967   1.00 0.00 ? 56  TYR A OH   2  
ATOM 2678  H H    . TYR A 1 56  ? -0.212  3.045   -0.663  1.00 0.00 ? 56  TYR A H    2  
ATOM 2679  H HA   . TYR A 1 56  ? 0.758   4.443   1.742   1.00 0.00 ? 56  TYR A HA   2  
ATOM 2680  H HB2  . TYR A 1 56  ? 2.251   3.898   -0.828  1.00 0.00 ? 56  TYR A HB2  2  
ATOM 2681  H HB3  . TYR A 1 56  ? 2.804   5.026   0.405   1.00 0.00 ? 56  TYR A HB3  2  
ATOM 2682  H HD1  . TYR A 1 56  ? 1.800   1.458   -0.020  1.00 0.00 ? 56  TYR A HD1  2  
ATOM 2683  H HD2  . TYR A 1 56  ? 4.189   4.265   2.104   1.00 0.00 ? 56  TYR A HD2  2  
ATOM 2684  H HE1  . TYR A 1 56  ? 2.907   -0.391  1.165   1.00 0.00 ? 56  TYR A HE1  2  
ATOM 2685  H HE2  . TYR A 1 56  ? 5.304   2.424   3.295   1.00 0.00 ? 56  TYR A HE2  2  
ATOM 2686  H HH   . TYR A 1 56  ? 4.266   -0.380  3.728   1.00 0.00 ? 56  TYR A HH   2  
ATOM 2687  N N    . PHE A 1 57  ? -0.121  6.590   0.908   1.00 0.00 ? 57  PHE A N    2  
ATOM 2688  C CA   . PHE A 1 57  ? -0.648  7.870   0.451   1.00 0.00 ? 57  PHE A CA   2  
ATOM 2689  C C    . PHE A 1 57  ? 0.169   9.028   1.018   1.00 0.00 ? 57  PHE A C    2  
ATOM 2690  O O    . PHE A 1 57  ? 0.716   8.935   2.117   1.00 0.00 ? 57  PHE A O    2  
ATOM 2691  C CB   . PHE A 1 57  ? -2.115  8.018   0.859   1.00 0.00 ? 57  PHE A CB   2  
ATOM 2692  C CG   . PHE A 1 57  ? -2.757  9.275   0.346   1.00 0.00 ? 57  PHE A CG   2  
ATOM 2693  C CD1  . PHE A 1 57  ? -2.735  9.577   -1.006  1.00 0.00 ? 57  PHE A CD1  2  
ATOM 2694  C CD2  . PHE A 1 57  ? -3.382  10.154  1.215   1.00 0.00 ? 57  PHE A CD2  2  
ATOM 2695  C CE1  . PHE A 1 57  ? -3.325  10.732  -1.483  1.00 0.00 ? 57  PHE A CE1  2  
ATOM 2696  C CE2  . PHE A 1 57  ? -3.975  11.311  0.744   1.00 0.00 ? 57  PHE A CE2  2  
ATOM 2697  C CZ   . PHE A 1 57  ? -3.945  11.601  -0.606  1.00 0.00 ? 57  PHE A CZ   2  
ATOM 2698  H H    . PHE A 1 57  ? -0.043  6.421   1.870   1.00 0.00 ? 57  PHE A H    2  
ATOM 2699  H HA   . PHE A 1 57  ? -0.579  7.891   -0.626  1.00 0.00 ? 57  PHE A HA   2  
ATOM 2700  H HB2  . PHE A 1 57  ? -2.675  7.179   0.475   1.00 0.00 ? 57  PHE A HB2  2  
ATOM 2701  H HB3  . PHE A 1 57  ? -2.182  8.026   1.937   1.00 0.00 ? 57  PHE A HB3  2  
ATOM 2702  H HD1  . PHE A 1 57  ? -2.250  8.897   -1.694  1.00 0.00 ? 57  PHE A HD1  2  
ATOM 2703  H HD2  . PHE A 1 57  ? -3.405  9.929   2.271   1.00 0.00 ? 57  PHE A HD2  2  
ATOM 2704  H HE1  . PHE A 1 57  ? -3.300  10.956  -2.539  1.00 0.00 ? 57  PHE A HE1  2  
ATOM 2705  H HE2  . PHE A 1 57  ? -4.458  11.989  1.432   1.00 0.00 ? 57  PHE A HE2  2  
ATOM 2706  H HZ   . PHE A 1 57  ? -4.407  12.504  -0.976  1.00 0.00 ? 57  PHE A HZ   2  
ATOM 2707  N N    . ARG A 1 58  ? 0.246   10.117  0.260   1.00 0.00 ? 58  ARG A N    2  
ATOM 2708  C CA   . ARG A 1 58  ? 0.997   11.292  0.686   1.00 0.00 ? 58  ARG A CA   2  
ATOM 2709  C C    . ARG A 1 58  ? 0.055   12.427  1.077   1.00 0.00 ? 58  ARG A C    2  
ATOM 2710  O O    . ARG A 1 58  ? -0.769  12.869  0.276   1.00 0.00 ? 58  ARG A O    2  
ATOM 2711  C CB   . ARG A 1 58  ? 1.935   11.756  -0.430  1.00 0.00 ? 58  ARG A CB   2  
ATOM 2712  C CG   . ARG A 1 58  ? 2.574   13.109  -0.165  1.00 0.00 ? 58  ARG A CG   2  
ATOM 2713  C CD   . ARG A 1 58  ? 3.821   12.978  0.694   1.00 0.00 ? 58  ARG A CD   2  
ATOM 2714  N NE   . ARG A 1 58  ? 4.224   14.257  1.273   1.00 0.00 ? 58  ARG A NE   2  
ATOM 2715  C CZ   . ARG A 1 58  ? 4.966   15.153  0.631   1.00 0.00 ? 58  ARG A CZ   2  
ATOM 2716  N NH1  . ARG A 1 58  ? 5.383   14.911  -0.604  1.00 0.00 ? 58  ARG A NH1  2  
ATOM 2717  N NH2  . ARG A 1 58  ? 5.291   16.294  1.225   1.00 0.00 ? 58  ARG A NH2  2  
ATOM 2718  H H    . ARG A 1 58  ? -0.212  10.130  -0.606  1.00 0.00 ? 58  ARG A H    2  
ATOM 2719  H HA   . ARG A 1 58  ? 1.586   11.015  1.547   1.00 0.00 ? 58  ARG A HA   2  
ATOM 2720  H HB2  . ARG A 1 58  ? 2.724   11.027  -0.547  1.00 0.00 ? 58  ARG A HB2  2  
ATOM 2721  H HB3  . ARG A 1 58  ? 1.376   11.820  -1.351  1.00 0.00 ? 58  ARG A HB3  2  
ATOM 2722  H HG2  . ARG A 1 58  ? 2.846   13.559  -1.109  1.00 0.00 ? 58  ARG A HG2  2  
ATOM 2723  H HG3  . ARG A 1 58  ? 1.861   13.740  0.344   1.00 0.00 ? 58  ARG A HG3  2  
ATOM 2724  H HD2  . ARG A 1 58  ? 3.620   12.280  1.493   1.00 0.00 ? 58  ARG A HD2  2  
ATOM 2725  H HD3  . ARG A 1 58  ? 4.627   12.601  0.081   1.00 0.00 ? 58  ARG A HD3  2  
ATOM 2726  H HE   . ARG A 1 58  ? 3.927   14.457  2.185   1.00 0.00 ? 58  ARG A HE   2  
ATOM 2727  H HH11 . ARG A 1 58  ? 5.139   14.052  -1.054  1.00 0.00 ? 58  ARG A HH11 2  
ATOM 2728  H HH12 . ARG A 1 58  ? 5.941   15.588  -1.085  1.00 0.00 ? 58  ARG A HH12 2  
ATOM 2729  H HH21 . ARG A 1 58  ? 4.978   16.480  2.156   1.00 0.00 ? 58  ARG A HH21 2  
ATOM 2730  H HH22 . ARG A 1 58  ? 5.849   16.968  0.742   1.00 0.00 ? 58  ARG A HH22 2  
ATOM 2731  N N    . THR A 1 59  ? 0.182   12.894  2.315   1.00 0.00 ? 59  THR A N    2  
ATOM 2732  C CA   . THR A 1 59  ? -0.658  13.976  2.814   1.00 0.00 ? 59  THR A CA   2  
ATOM 2733  C C    . THR A 1 59  ? 0.176   15.201  3.171   1.00 0.00 ? 59  THR A C    2  
ATOM 2734  O O    . THR A 1 59  ? 1.399   15.192  3.032   1.00 0.00 ? 59  THR A O    2  
ATOM 2735  C CB   . THR A 1 59  ? -1.462  13.537  4.052   1.00 0.00 ? 59  THR A CB   2  
ATOM 2736  O OG1  . THR A 1 59  ? -0.570  13.192  5.118   1.00 0.00 ? 59  THR A OG1  2  
ATOM 2737  C CG2  . THR A 1 59  ? -2.354  12.350  3.726   1.00 0.00 ? 59  THR A CG2  2  
ATOM 2738  H H    . THR A 1 59  ? 0.858   12.501  2.906   1.00 0.00 ? 59  THR A H    2  
ATOM 2739  H HA   . THR A 1 59  ? -1.356  14.243  2.033   1.00 0.00 ? 59  THR A HA   2  
ATOM 2740  H HB   . THR A 1 59  ? -2.085  14.362  4.368   1.00 0.00 ? 59  THR A HB   2  
ATOM 2741  H HG1  . THR A 1 59  ? 0.198   12.740  4.759   1.00 0.00 ? 59  THR A HG1  2  
ATOM 2742  H HG21 . THR A 1 59  ? -2.482  12.279  2.656   1.00 0.00 ? 59  THR A HG21 2  
ATOM 2743  H HG22 . THR A 1 59  ? -3.317  12.483  4.196   1.00 0.00 ? 59  THR A HG22 2  
ATOM 2744  H HG23 . THR A 1 59  ? -1.896  11.444  4.094   1.00 0.00 ? 59  THR A HG23 2  
ATOM 2745  N N    . ASN A 1 60  ? -0.492  16.253  3.631   1.00 0.00 ? 60  ASN A N    2  
ATOM 2746  C CA   . ASN A 1 60  ? 0.189   17.486  4.009   1.00 0.00 ? 60  ASN A CA   2  
ATOM 2747  C C    . ASN A 1 60  ? 1.050   17.274  5.250   1.00 0.00 ? 60  ASN A C    2  
ATOM 2748  O O    . ASN A 1 60  ? 2.048   17.965  5.450   1.00 0.00 ? 60  ASN A O    2  
ATOM 2749  C CB   . ASN A 1 60  ? -0.830  18.598  4.265   1.00 0.00 ? 60  ASN A CB   2  
ATOM 2750  C CG   . ASN A 1 60  ? -1.188  19.357  3.002   1.00 0.00 ? 60  ASN A CG   2  
ATOM 2751  O OD1  . ASN A 1 60  ? -0.537  19.206  1.968   1.00 0.00 ? 60  ASN A OD1  2  
ATOM 2752  N ND2  . ASN A 1 60  ? -2.227  20.180  3.081   1.00 0.00 ? 60  ASN A ND2  2  
ATOM 2753  H H    . ASN A 1 60  ? -1.467  16.199  3.719   1.00 0.00 ? 60  ASN A H    2  
ATOM 2754  H HA   . ASN A 1 60  ? 0.826   17.777  3.187   1.00 0.00 ? 60  ASN A HA   2  
ATOM 2755  H HB2  . ASN A 1 60  ? -1.734  18.164  4.669   1.00 0.00 ? 60  ASN A HB2  2  
ATOM 2756  H HB3  . ASN A 1 60  ? -0.421  19.296  4.980   1.00 0.00 ? 60  ASN A HB3  2  
ATOM 2757  H HD21 . ASN A 1 60  ? -2.699  20.251  3.937   1.00 0.00 ? 60  ASN A HD21 2  
ATOM 2758  H HD22 . ASN A 1 60  ? -2.481  20.683  2.279   1.00 0.00 ? 60  ASN A HD22 2  
ATOM 2759  N N    . GLU A 1 61  ? 0.656   16.313  6.080   1.00 0.00 ? 61  GLU A N    2  
ATOM 2760  C CA   . GLU A 1 61  ? 1.393   16.010  7.301   1.00 0.00 ? 61  GLU A CA   2  
ATOM 2761  C C    . GLU A 1 61  ? 2.568   15.081  7.012   1.00 0.00 ? 61  GLU A C    2  
ATOM 2762  O O    . GLU A 1 61  ? 3.727   15.480  7.111   1.00 0.00 ? 61  GLU A O    2  
ATOM 2763  C CB   . GLU A 1 61  ? 0.465   15.370  8.337   1.00 0.00 ? 61  GLU A CB   2  
ATOM 2764  C CG   . GLU A 1 61  ? 0.903   15.604  9.773   1.00 0.00 ? 61  GLU A CG   2  
ATOM 2765  C CD   . GLU A 1 61  ? 0.173   14.713  10.758  1.00 0.00 ? 61  GLU A CD   2  
ATOM 2766  O OE1  . GLU A 1 61  ? -1.071  14.795  10.824  1.00 0.00 ? 61  GLU A OE1  2  
ATOM 2767  O OE2  . GLU A 1 61  ? 0.846   13.932  11.463  1.00 0.00 ? 61  GLU A OE2  2  
ATOM 2768  H H    . GLU A 1 61  ? -0.148  15.795  5.865   1.00 0.00 ? 61  GLU A H    2  
ATOM 2769  H HA   . GLU A 1 61  ? 1.773   16.939  7.698   1.00 0.00 ? 61  GLU A HA   2  
ATOM 2770  H HB2  . GLU A 1 61  ? -0.527  15.777  8.214   1.00 0.00 ? 61  GLU A HB2  2  
ATOM 2771  H HB3  . GLU A 1 61  ? 0.432   14.305  8.162   1.00 0.00 ? 61  GLU A HB3  2  
ATOM 2772  H HG2  . GLU A 1 61  ? 1.962   15.406  9.849   1.00 0.00 ? 61  GLU A HG2  2  
ATOM 2773  H HG3  . GLU A 1 61  ? 0.711   16.635  10.031  1.00 0.00 ? 61  GLU A HG3  2  
ATOM 2774  N N    . ASN A 1 62  ? 2.259   13.839  6.654   1.00 0.00 ? 62  ASN A N    2  
ATOM 2775  C CA   . ASN A 1 62  ? 3.289   12.852  6.351   1.00 0.00 ? 62  ASN A CA   2  
ATOM 2776  C C    . ASN A 1 62  ? 2.680   11.612  5.702   1.00 0.00 ? 62  ASN A C    2  
ATOM 2777  O O    . ASN A 1 62  ? 1.525   11.270  5.955   1.00 0.00 ? 62  ASN A O    2  
ATOM 2778  C CB   . ASN A 1 62  ? 4.037   12.457  7.626   1.00 0.00 ? 62  ASN A CB   2  
ATOM 2779  C CG   . ASN A 1 62  ? 3.098   12.140  8.773   1.00 0.00 ? 62  ASN A CG   2  
ATOM 2780  O OD1  . ASN A 1 62  ? 2.227   11.278  8.657   1.00 0.00 ? 62  ASN A OD1  2  
ATOM 2781  N ND2  . ASN A 1 62  ? 3.270   12.839  9.889   1.00 0.00 ? 62  ASN A ND2  2  
ATOM 2782  H H    . ASN A 1 62  ? 1.316   13.579  6.592   1.00 0.00 ? 62  ASN A H    2  
ATOM 2783  H HA   . ASN A 1 62  ? 3.985   13.301  5.660   1.00 0.00 ? 62  ASN A HA   2  
ATOM 2784  H HB2  . ASN A 1 62  ? 4.639   11.583  7.427   1.00 0.00 ? 62  ASN A HB2  2  
ATOM 2785  H HB3  . ASN A 1 62  ? 4.680   13.271  7.925   1.00 0.00 ? 62  ASN A HB3  2  
ATOM 2786  H HD21 . ASN A 1 62  ? 3.984   13.511  9.910   1.00 0.00 ? 62  ASN A HD21 2  
ATOM 2787  H HD22 . ASN A 1 62  ? 2.677   12.654  10.647  1.00 0.00 ? 62  ASN A HD22 2  
ATOM 2788  N N    . ILE A 1 63  ? 3.466   10.944  4.863   1.00 0.00 ? 63  ILE A N    2  
ATOM 2789  C CA   . ILE A 1 63  ? 3.005   9.743   4.179   1.00 0.00 ? 63  ILE A CA   2  
ATOM 2790  C C    . ILE A 1 63  ? 2.427   8.735   5.167   1.00 0.00 ? 63  ILE A C    2  
ATOM 2791  O O    . ILE A 1 63  ? 3.086   8.349   6.131   1.00 0.00 ? 63  ILE A O    2  
ATOM 2792  C CB   . ILE A 1 63  ? 4.145   9.073   3.389   1.00 0.00 ? 63  ILE A CB   2  
ATOM 2793  C CG1  . ILE A 1 63  ? 4.746   10.058  2.384   1.00 0.00 ? 63  ILE A CG1  2  
ATOM 2794  C CG2  . ILE A 1 63  ? 3.636   7.827   2.679   1.00 0.00 ? 63  ILE A CG2  2  
ATOM 2795  C CD1  . ILE A 1 63  ? 6.047   9.583   1.776   1.00 0.00 ? 63  ILE A CD1  2  
ATOM 2796  H H    . ILE A 1 63  ? 4.377   11.267  4.702   1.00 0.00 ? 63  ILE A H    2  
ATOM 2797  H HA   . ILE A 1 63  ? 2.232   10.032  3.482   1.00 0.00 ? 63  ILE A HA   2  
ATOM 2798  H HB   . ILE A 1 63  ? 4.910   8.772   4.088   1.00 0.00 ? 63  ILE A HB   2  
ATOM 2799  H HG12 . ILE A 1 63  ? 4.043   10.217  1.581   1.00 0.00 ? 63  ILE A HG12 2  
ATOM 2800  H HG13 . ILE A 1 63  ? 4.935   10.998  2.882   1.00 0.00 ? 63  ILE A HG13 2  
ATOM 2801  H HG21 . ILE A 1 63  ? 2.744   7.471   3.172   1.00 0.00 ? 63  ILE A HG21 2  
ATOM 2802  H HG22 . ILE A 1 63  ? 3.407   8.068   1.651   1.00 0.00 ? 63  ILE A HG22 2  
ATOM 2803  H HG23 . ILE A 1 63  ? 4.395   7.060   2.709   1.00 0.00 ? 63  ILE A HG23 2  
ATOM 2804  H HD11 . ILE A 1 63  ? 5.915   9.434   0.714   1.00 0.00 ? 63  ILE A HD11 2  
ATOM 2805  H HD12 . ILE A 1 63  ? 6.815   10.323  1.944   1.00 0.00 ? 63  ILE A HD12 2  
ATOM 2806  H HD13 . ILE A 1 63  ? 6.339   8.650   2.236   1.00 0.00 ? 63  ILE A HD13 2  
ATOM 2807  N N    . GLN A 1 64  ? 1.191   8.314   4.918   1.00 0.00 ? 64  GLN A N    2  
ATOM 2808  C CA   . GLN A 1 64  ? 0.524   7.350   5.785   1.00 0.00 ? 64  GLN A CA   2  
ATOM 2809  C C    . GLN A 1 64  ? 0.737   5.926   5.282   1.00 0.00 ? 64  GLN A C    2  
ATOM 2810  O O    . GLN A 1 64  ? 1.446   5.704   4.301   1.00 0.00 ? 64  GLN A O    2  
ATOM 2811  C CB   . GLN A 1 64  ? -0.973  7.656   5.867   1.00 0.00 ? 64  GLN A CB   2  
ATOM 2812  C CG   . GLN A 1 64  ? -1.324  8.701   6.913   1.00 0.00 ? 64  GLN A CG   2  
ATOM 2813  C CD   . GLN A 1 64  ? -2.743  8.558   7.427   1.00 0.00 ? 64  GLN A CD   2  
ATOM 2814  O OE1  . GLN A 1 64  ? -2.998  7.825   8.383   1.00 0.00 ? 64  GLN A OE1  2  
ATOM 2815  N NE2  . GLN A 1 64  ? -3.676  9.259   6.794   1.00 0.00 ? 64  GLN A NE2  2  
ATOM 2816  H H    . GLN A 1 64  ? 0.717   8.659   4.134   1.00 0.00 ? 64  GLN A H    2  
ATOM 2817  H HA   . GLN A 1 64  ? 0.954   7.438   6.771   1.00 0.00 ? 64  GLN A HA   2  
ATOM 2818  H HB2  . GLN A 1 64  ? -1.308  8.014   4.905   1.00 0.00 ? 64  GLN A HB2  2  
ATOM 2819  H HB3  . GLN A 1 64  ? -1.501  6.745   6.107   1.00 0.00 ? 64  GLN A HB3  2  
ATOM 2820  H HG2  . GLN A 1 64  ? -0.644  8.600   7.747   1.00 0.00 ? 64  GLN A HG2  2  
ATOM 2821  H HG3  . GLN A 1 64  ? -1.212  9.682   6.475   1.00 0.00 ? 64  GLN A HG3  2  
ATOM 2822  H HE21 . GLN A 1 64  ? -3.399  9.822   6.040   1.00 0.00 ? 64  GLN A HE21 2  
ATOM 2823  H HE22 . GLN A 1 64  ? -4.601  9.185   7.105   1.00 0.00 ? 64  GLN A HE22 2  
ATOM 2824  N N    . ARG A 1 65  ? 0.120   4.965   5.962   1.00 0.00 ? 65  ARG A N    2  
ATOM 2825  C CA   . ARG A 1 65  ? 0.244   3.562   5.585   1.00 0.00 ? 65  ARG A CA   2  
ATOM 2826  C C    . ARG A 1 65  ? -0.941  2.753   6.104   1.00 0.00 ? 65  ARG A C    2  
ATOM 2827  O O    . ARG A 1 65  ? -1.175  2.680   7.311   1.00 0.00 ? 65  ARG A O    2  
ATOM 2828  C CB   . ARG A 1 65  ? 1.550   2.980   6.127   1.00 0.00 ? 65  ARG A CB   2  
ATOM 2829  C CG   . ARG A 1 65  ? 1.867   1.593   5.593   1.00 0.00 ? 65  ARG A CG   2  
ATOM 2830  C CD   . ARG A 1 65  ? 2.939   0.906   6.425   1.00 0.00 ? 65  ARG A CD   2  
ATOM 2831  N NE   . ARG A 1 65  ? 2.385   0.281   7.623   1.00 0.00 ? 65  ARG A NE   2  
ATOM 2832  C CZ   . ARG A 1 65  ? 2.991   -0.696  8.289   1.00 0.00 ? 65  ARG A CZ   2  
ATOM 2833  N NH1  . ARG A 1 65  ? 4.163   -1.156  7.876   1.00 0.00 ? 65  ARG A NH1  2  
ATOM 2834  N NH2  . ARG A 1 65  ? 2.423   -1.213  9.371   1.00 0.00 ? 65  ARG A NH2  2  
ATOM 2835  H H    . ARG A 1 65  ? -0.431  5.205   6.736   1.00 0.00 ? 65  ARG A H    2  
ATOM 2836  H HA   . ARG A 1 65  ? 0.256   3.508   4.507   1.00 0.00 ? 65  ARG A HA   2  
ATOM 2837  H HB2  . ARG A 1 65  ? 2.364   3.639   5.860   1.00 0.00 ? 65  ARG A HB2  2  
ATOM 2838  H HB3  . ARG A 1 65  ? 1.485   2.921   7.203   1.00 0.00 ? 65  ARG A HB3  2  
ATOM 2839  H HG2  . ARG A 1 65  ? 0.969   0.993   5.618   1.00 0.00 ? 65  ARG A HG2  2  
ATOM 2840  H HG3  . ARG A 1 65  ? 2.215   1.680   4.574   1.00 0.00 ? 65  ARG A HG3  2  
ATOM 2841  H HD2  . ARG A 1 65  ? 3.413   0.147   5.821   1.00 0.00 ? 65  ARG A HD2  2  
ATOM 2842  H HD3  . ARG A 1 65  ? 3.673   1.642   6.720   1.00 0.00 ? 65  ARG A HD3  2  
ATOM 2843  H HE   . ARG A 1 65  ? 1.520   0.607   7.946   1.00 0.00 ? 65  ARG A HE   2  
ATOM 2844  H HH11 . ARG A 1 65  ? 4.593   -0.768  7.062   1.00 0.00 ? 65  ARG A HH11 2  
ATOM 2845  H HH12 . ARG A 1 65  ? 4.617   -1.891  8.380   1.00 0.00 ? 65  ARG A HH12 2  
ATOM 2846  H HH21 . ARG A 1 65  ? 1.539   -0.868  9.686   1.00 0.00 ? 65  ARG A HH21 2  
ATOM 2847  H HH22 . ARG A 1 65  ? 2.879   -1.948  9.871   1.00 0.00 ? 65  ARG A HH22 2  
ATOM 2848  N N    . PHE A 1 66  ? -1.685  2.147   5.185   1.00 0.00 ? 66  PHE A N    2  
ATOM 2849  C CA   . PHE A 1 66  ? -2.847  1.344   5.550   1.00 0.00 ? 66  PHE A CA   2  
ATOM 2850  C C    . PHE A 1 66  ? -2.512  -0.144  5.515   1.00 0.00 ? 66  PHE A C    2  
ATOM 2851  O O    . PHE A 1 66  ? -1.439  -0.541  5.059   1.00 0.00 ? 66  PHE A O    2  
ATOM 2852  C CB   . PHE A 1 66  ? -4.014  1.638   4.606   1.00 0.00 ? 66  PHE A CB   2  
ATOM 2853  C CG   . PHE A 1 66  ? -4.419  3.084   4.586   1.00 0.00 ? 66  PHE A CG   2  
ATOM 2854  C CD1  . PHE A 1 66  ? -3.806  3.978   3.723   1.00 0.00 ? 66  PHE A CD1  2  
ATOM 2855  C CD2  . PHE A 1 66  ? -5.414  3.550   5.431   1.00 0.00 ? 66  PHE A CD2  2  
ATOM 2856  C CE1  . PHE A 1 66  ? -4.177  5.309   3.704   1.00 0.00 ? 66  PHE A CE1  2  
ATOM 2857  C CE2  . PHE A 1 66  ? -5.789  4.880   5.416   1.00 0.00 ? 66  PHE A CE2  2  
ATOM 2858  C CZ   . PHE A 1 66  ? -5.170  5.761   4.550   1.00 0.00 ? 66  PHE A CZ   2  
ATOM 2859  H H    . PHE A 1 66  ? -1.448  2.243   4.239   1.00 0.00 ? 66  PHE A H    2  
ATOM 2860  H HA   . PHE A 1 66  ? -3.132  1.613   6.556   1.00 0.00 ? 66  PHE A HA   2  
ATOM 2861  H HB2  . PHE A 1 66  ? -3.733  1.359   3.601   1.00 0.00 ? 66  PHE A HB2  2  
ATOM 2862  H HB3  . PHE A 1 66  ? -4.870  1.056   4.911   1.00 0.00 ? 66  PHE A HB3  2  
ATOM 2863  H HD1  . PHE A 1 66  ? -3.030  3.626   3.059   1.00 0.00 ? 66  PHE A HD1  2  
ATOM 2864  H HD2  . PHE A 1 66  ? -5.899  2.862   6.109   1.00 0.00 ? 66  PHE A HD2  2  
ATOM 2865  H HE1  . PHE A 1 66  ? -3.692  5.996   3.026   1.00 0.00 ? 66  PHE A HE1  2  
ATOM 2866  H HE2  . PHE A 1 66  ? -6.566  5.230   6.080   1.00 0.00 ? 66  PHE A HE2  2  
ATOM 2867  H HZ   . PHE A 1 66  ? -5.462  6.800   4.538   1.00 0.00 ? 66  PHE A HZ   2  
ATOM 2868  N N    . LYS A 1 67  ? -3.437  -0.965  6.000   1.00 0.00 ? 67  LYS A N    2  
ATOM 2869  C CA   . LYS A 1 67  ? -3.243  -2.409  6.024   1.00 0.00 ? 67  LYS A CA   2  
ATOM 2870  C C    . LYS A 1 67  ? -4.422  -3.128  5.375   1.00 0.00 ? 67  LYS A C    2  
ATOM 2871  O O    . LYS A 1 67  ? -5.574  -2.923  5.760   1.00 0.00 ? 67  LYS A O    2  
ATOM 2872  C CB   . LYS A 1 67  ? -3.065  -2.897  7.464   1.00 0.00 ? 67  LYS A CB   2  
ATOM 2873  C CG   . LYS A 1 67  ? -4.280  -2.653  8.343   1.00 0.00 ? 67  LYS A CG   2  
ATOM 2874  C CD   . LYS A 1 67  ? -3.928  -2.745  9.819   1.00 0.00 ? 67  LYS A CD   2  
ATOM 2875  C CE   . LYS A 1 67  ? -3.196  -1.500  10.296  1.00 0.00 ? 67  LYS A CE   2  
ATOM 2876  N NZ   . LYS A 1 67  ? -4.091  -0.310  10.330  1.00 0.00 ? 67  LYS A NZ   2  
ATOM 2877  H H    . LYS A 1 67  ? -4.273  -0.589  6.350   1.00 0.00 ? 67  LYS A H    2  
ATOM 2878  H HA   . LYS A 1 67  ? -2.348  -2.633  5.464   1.00 0.00 ? 67  LYS A HA   2  
ATOM 2879  H HB2  . LYS A 1 67  ? -2.864  -3.958  7.450   1.00 0.00 ? 67  LYS A HB2  2  
ATOM 2880  H HB3  . LYS A 1 67  ? -2.221  -2.385  7.903   1.00 0.00 ? 67  LYS A HB3  2  
ATOM 2881  H HG2  . LYS A 1 67  ? -4.669  -1.666  8.138   1.00 0.00 ? 67  LYS A HG2  2  
ATOM 2882  H HG3  . LYS A 1 67  ? -5.033  -3.394  8.115   1.00 0.00 ? 67  LYS A HG3  2  
ATOM 2883  H HD2  . LYS A 1 67  ? -4.837  -2.856  10.391  1.00 0.00 ? 67  LYS A HD2  2  
ATOM 2884  H HD3  . LYS A 1 67  ? -3.294  -3.606  9.975   1.00 0.00 ? 67  LYS A HD3  2  
ATOM 2885  H HE2  . LYS A 1 67  ? -2.814  -1.681  11.289  1.00 0.00 ? 67  LYS A HE2  2  
ATOM 2886  H HE3  . LYS A 1 67  ? -2.373  -1.302  9.625   1.00 0.00 ? 67  LYS A HE3  2  
ATOM 2887  H HZ1  . LYS A 1 67  ? -3.633  0.495   9.856   1.00 0.00 ? 67  LYS A HZ1  2  
ATOM 2888  H HZ2  . LYS A 1 67  ? -4.296  -0.045  11.315  1.00 0.00 ? 67  LYS A HZ2  2  
ATOM 2889  H HZ3  . LYS A 1 67  ? -4.986  -0.521  9.845   1.00 0.00 ? 67  LYS A HZ3  2  
ATOM 2890  N N    . ILE A 1 68  ? -4.127  -3.970  4.391   1.00 0.00 ? 68  ILE A N    2  
ATOM 2891  C CA   . ILE A 1 68  ? -5.163  -4.720  3.692   1.00 0.00 ? 68  ILE A CA   2  
ATOM 2892  C C    . ILE A 1 68  ? -5.101  -6.202  4.044   1.00 0.00 ? 68  ILE A C    2  
ATOM 2893  O O    . ILE A 1 68  ? -4.073  -6.854  3.854   1.00 0.00 ? 68  ILE A O    2  
ATOM 2894  C CB   . ILE A 1 68  ? -5.038  -4.562  2.165   1.00 0.00 ? 68  ILE A CB   2  
ATOM 2895  C CG1  . ILE A 1 68  ? -5.204  -3.093  1.768   1.00 0.00 ? 68  ILE A CG1  2  
ATOM 2896  C CG2  . ILE A 1 68  ? -6.070  -5.427  1.457   1.00 0.00 ? 68  ILE A CG2  2  
ATOM 2897  C CD1  . ILE A 1 68  ? -4.763  -2.797  0.351   1.00 0.00 ? 68  ILE A CD1  2  
ATOM 2898  H H    . ILE A 1 68  ? -3.190  -4.091  4.130   1.00 0.00 ? 68  ILE A H    2  
ATOM 2899  H HA   . ILE A 1 68  ? -6.122  -4.328  3.998   1.00 0.00 ? 68  ILE A HA   2  
ATOM 2900  H HB   . ILE A 1 68  ? -4.057  -4.899  1.869   1.00 0.00 ? 68  ILE A HB   2  
ATOM 2901  H HG12 . ILE A 1 68  ? -6.243  -2.818  1.855   1.00 0.00 ? 68  ILE A HG12 2  
ATOM 2902  H HG13 . ILE A 1 68  ? -4.616  -2.479  2.434   1.00 0.00 ? 68  ILE A HG13 2  
ATOM 2903  H HG21 . ILE A 1 68  ? -6.608  -4.829  0.736   1.00 0.00 ? 68  ILE A HG21 2  
ATOM 2904  H HG22 . ILE A 1 68  ? -5.571  -6.239  0.949   1.00 0.00 ? 68  ILE A HG22 2  
ATOM 2905  H HG23 . ILE A 1 68  ? -6.763  -5.828  2.182   1.00 0.00 ? 68  ILE A HG23 2  
ATOM 2906  H HD11 . ILE A 1 68  ? -4.534  -3.723  -0.156  1.00 0.00 ? 68  ILE A HD11 2  
ATOM 2907  H HD12 . ILE A 1 68  ? -5.556  -2.285  -0.173  1.00 0.00 ? 68  ILE A HD12 2  
ATOM 2908  H HD13 . ILE A 1 68  ? -3.882  -2.172  0.372   1.00 0.00 ? 68  ILE A HD13 2  
ATOM 2909  N N    . CYS A 1 69  ? -6.207  -6.729  4.557   1.00 0.00 ? 69  CYS A N    2  
ATOM 2910  C CA   . CYS A 1 69  ? -6.280  -8.136  4.936   1.00 0.00 ? 69  CYS A CA   2  
ATOM 2911  C C    . CYS A 1 69  ? -7.291  -8.881  4.070   1.00 0.00 ? 69  CYS A C    2  
ATOM 2912  O O    . CYS A 1 69  ? -8.407  -8.416  3.837   1.00 0.00 ? 69  CYS A O    2  
ATOM 2913  C CB   . CYS A 1 69  ? -6.657  -8.270  6.412   1.00 0.00 ? 69  CYS A CB   2  
ATOM 2914  S SG   . CYS A 1 69  ? -6.511  -9.951  7.062   1.00 0.00 ? 69  CYS A SG   2  
ATOM 2915  H H    . CYS A 1 69  ? -6.994  -6.159  4.685   1.00 0.00 ? 69  CYS A H    2  
ATOM 2916  H HA   . CYS A 1 69  ? -5.304  -8.571  4.782   1.00 0.00 ? 69  CYS A HA   2  
ATOM 2917  H HB2  . CYS A 1 69  ? -6.012  -7.633  7.000   1.00 0.00 ? 69  CYS A HB2  2  
ATOM 2918  H HB3  . CYS A 1 69  ? -7.681  -7.953  6.544   1.00 0.00 ? 69  CYS A HB3  2  
ATOM 2919  H HG   . CYS A 1 69  ? -7.692  -10.307 7.542   1.00 0.00 ? 69  CYS A HG   2  
ATOM 2920  N N    . PRO A 1 70  ? -6.893  -10.064 3.580   1.00 0.00 ? 70  PRO A N    2  
ATOM 2921  C CA   . PRO A 1 70  ? -7.749  -10.897 2.731   1.00 0.00 ? 70  PRO A CA   2  
ATOM 2922  C C    . PRO A 1 70  ? -8.919  -11.500 3.502   1.00 0.00 ? 70  PRO A C    2  
ATOM 2923  O O    . PRO A 1 70  ? -8.862  -11.647 4.723   1.00 0.00 ? 70  PRO A O    2  
ATOM 2924  C CB   . PRO A 1 70  ? -6.804  -12.000 2.247   1.00 0.00 ? 70  PRO A CB   2  
ATOM 2925  C CG   . PRO A 1 70  ? -5.747  -12.079 3.294   1.00 0.00 ? 70  PRO A CG   2  
ATOM 2926  C CD   . PRO A 1 70  ? -5.576  -10.679 3.817   1.00 0.00 ? 70  PRO A CD   2  
ATOM 2927  H HA   . PRO A 1 70  ? -8.125  -10.345 1.882   1.00 0.00 ? 70  PRO A HA   2  
ATOM 2928  H HB2  . PRO A 1 70  ? -7.346  -12.931 2.161   1.00 0.00 ? 70  PRO A HB2  2  
ATOM 2929  H HB3  . PRO A 1 70  ? -6.389  -11.728 1.288   1.00 0.00 ? 70  PRO A HB3  2  
ATOM 2930  H HG2  . PRO A 1 70  ? -6.064  -12.739 4.086   1.00 0.00 ? 70  PRO A HG2  2  
ATOM 2931  H HG3  . PRO A 1 70  ? -4.824  -12.430 2.857   1.00 0.00 ? 70  PRO A HG3  2  
ATOM 2932  H HD2  . PRO A 1 70  ? -5.342  -10.696 4.871   1.00 0.00 ? 70  PRO A HD2  2  
ATOM 2933  H HD3  . PRO A 1 70  ? -4.805  -10.162 3.266   1.00 0.00 ? 70  PRO A HD3  2  
ATOM 2934  N N    . THR A 1 71  ? -9.980  -11.848 2.781   1.00 0.00 ? 71  THR A N    2  
ATOM 2935  C CA   . THR A 1 71  ? -11.164 -12.434 3.397   1.00 0.00 ? 71  THR A CA   2  
ATOM 2936  C C    . THR A 1 71  ? -11.632 -13.664 2.628   1.00 0.00 ? 71  THR A C    2  
ATOM 2937  O O    . THR A 1 71  ? -11.424 -13.789 1.421   1.00 0.00 ? 71  THR A O    2  
ATOM 2938  C CB   . THR A 1 71  ? -12.320 -11.418 3.470   1.00 0.00 ? 71  THR A CB   2  
ATOM 2939  O OG1  . THR A 1 71  ? -12.652 -10.958 2.155   1.00 0.00 ? 71  THR A OG1  2  
ATOM 2940  C CG2  . THR A 1 71  ? -11.945 -10.234 4.348   1.00 0.00 ? 71  THR A CG2  2  
ATOM 2941  H H    . THR A 1 71  ? -9.966  -11.706 1.811   1.00 0.00 ? 71  THR A H    2  
ATOM 2942  H HA   . THR A 1 71  ? -10.906 -12.727 4.404   1.00 0.00 ? 71  THR A HA   2  
ATOM 2943  H HB   . THR A 1 71  ? -13.182 -11.908 3.900   1.00 0.00 ? 71  THR A HB   2  
ATOM 2944  H HG1  . THR A 1 71  ? -13.037 -10.080 2.211   1.00 0.00 ? 71  THR A HG1  2  
ATOM 2945  H HG21 . THR A 1 71  ? -11.457 -10.590 5.243   1.00 0.00 ? 71  THR A HG21 2  
ATOM 2946  H HG22 . THR A 1 71  ? -12.838 -9.689  4.617   1.00 0.00 ? 71  THR A HG22 2  
ATOM 2947  H HG23 . THR A 1 71  ? -11.275 -9.584  3.807   1.00 0.00 ? 71  THR A HG23 2  
ATOM 2948  N N    . PRO A 1 72  ? -12.280 -14.597 3.341   1.00 0.00 ? 72  PRO A N    2  
ATOM 2949  C CA   . PRO A 1 72  ? -12.792 -15.835 2.746   1.00 0.00 ? 72  PRO A CA   2  
ATOM 2950  C C    . PRO A 1 72  ? -13.974 -15.585 1.815   1.00 0.00 ? 72  PRO A C    2  
ATOM 2951  O O    . PRO A 1 72  ? -14.549 -16.521 1.262   1.00 0.00 ? 72  PRO A O    2  
ATOM 2952  C CB   . PRO A 1 72  ? -13.232 -16.657 3.960   1.00 0.00 ? 72  PRO A CB   2  
ATOM 2953  C CG   . PRO A 1 72  ? -13.526 -15.647 5.015   1.00 0.00 ? 72  PRO A CG   2  
ATOM 2954  C CD   . PRO A 1 72  ? -12.564 -14.515 4.784   1.00 0.00 ? 72  PRO A CD   2  
ATOM 2955  H HA   . PRO A 1 72  ? -12.020 -16.366 2.210   1.00 0.00 ? 72  PRO A HA   2  
ATOM 2956  H HB2  . PRO A 1 72  ? -14.111 -17.234 3.707   1.00 0.00 ? 72  PRO A HB2  2  
ATOM 2957  H HB3  . PRO A 1 72  ? -12.434 -17.319 4.259   1.00 0.00 ? 72  PRO A HB3  2  
ATOM 2958  H HG2  . PRO A 1 72  ? -14.544 -15.300 4.918   1.00 0.00 ? 72  PRO A HG2  2  
ATOM 2959  H HG3  . PRO A 1 72  ? -13.368 -16.080 5.991   1.00 0.00 ? 72  PRO A HG3  2  
ATOM 2960  H HD2  . PRO A 1 72  ? -13.025 -13.571 5.033   1.00 0.00 ? 72  PRO A HD2  2  
ATOM 2961  H HD3  . PRO A 1 72  ? -11.663 -14.662 5.362   1.00 0.00 ? 72  PRO A HD3  2  
ATOM 2962  N N    . ASN A 1 73  ? -14.331 -14.315 1.647   1.00 0.00 ? 73  ASN A N    2  
ATOM 2963  C CA   . ASN A 1 73  ? -15.445 -13.943 0.783   1.00 0.00 ? 73  ASN A CA   2  
ATOM 2964  C C    . ASN A 1 73  ? -14.940 -13.347 -0.528  1.00 0.00 ? 73  ASN A C    2  
ATOM 2965  O O    . ASN A 1 73  ? -15.491 -12.367 -1.029  1.00 0.00 ? 73  ASN A O    2  
ATOM 2966  C CB   . ASN A 1 73  ? -16.356 -12.940 1.494   1.00 0.00 ? 73  ASN A CB   2  
ATOM 2967  C CG   . ASN A 1 73  ? -17.304 -13.612 2.469   1.00 0.00 ? 73  ASN A CG   2  
ATOM 2968  O OD1  . ASN A 1 73  ? -18.480 -13.816 2.168   1.00 0.00 ? 73  ASN A OD1  2  
ATOM 2969  N ND2  . ASN A 1 73  ? -16.795 -13.958 3.646   1.00 0.00 ? 73  ASN A ND2  2  
ATOM 2970  H H    . ASN A 1 73  ? -13.833 -13.613 2.115   1.00 0.00 ? 73  ASN A H    2  
ATOM 2971  H HA   . ASN A 1 73  ? -16.009 -14.837 0.565   1.00 0.00 ? 73  ASN A HA   2  
ATOM 2972  H HB2  . ASN A 1 73  ? -15.747 -12.235 2.042   1.00 0.00 ? 73  ASN A HB2  2  
ATOM 2973  H HB3  . ASN A 1 73  ? -16.941 -12.409 0.759   1.00 0.00 ? 73  ASN A HB3  2  
ATOM 2974  H HD21 . ASN A 1 73  ? -15.849 -13.763 3.817   1.00 0.00 ? 73  ASN A HD21 2  
ATOM 2975  H HD22 . ASN A 1 73  ? -17.385 -14.394 4.295   1.00 0.00 ? 73  ASN A HD22 2  
ATOM 2976  N N    . ASN A 1 74  ? -13.890 -13.947 -1.079  1.00 0.00 ? 74  ASN A N    2  
ATOM 2977  C CA   . ASN A 1 74  ? -13.311 -13.476 -2.332  1.00 0.00 ? 74  ASN A CA   2  
ATOM 2978  C C    . ASN A 1 74  ? -13.266 -11.951 -2.372  1.00 0.00 ? 74  ASN A C    2  
ATOM 2979  O O    . ASN A 1 74  ? -13.626 -11.336 -3.375  1.00 0.00 ? 74  ASN A O    2  
ATOM 2980  C CB   . ASN A 1 74  ? -14.116 -14.004 -3.521  1.00 0.00 ? 74  ASN A CB   2  
ATOM 2981  C CG   . ASN A 1 74  ? -13.269 -14.163 -4.768  1.00 0.00 ? 74  ASN A CG   2  
ATOM 2982  O OD1  . ASN A 1 74  ? -12.187 -14.748 -4.727  1.00 0.00 ? 74  ASN A OD1  2  
ATOM 2983  N ND2  . ASN A 1 74  ? -13.759 -13.639 -5.886  1.00 0.00 ? 74  ASN A ND2  2  
ATOM 2984  H H    . ASN A 1 74  ? -13.494 -14.724 -0.633  1.00 0.00 ? 74  ASN A H    2  
ATOM 2985  H HA   . ASN A 1 74  ? -12.302 -13.856 -2.395  1.00 0.00 ? 74  ASN A HA   2  
ATOM 2986  H HB2  . ASN A 1 74  ? -14.531 -14.969 -3.266  1.00 0.00 ? 74  ASN A HB2  2  
ATOM 2987  H HB3  . ASN A 1 74  ? -14.920 -13.317 -3.738  1.00 0.00 ? 74  ASN A HB3  2  
ATOM 2988  H HD21 . ASN A 1 74  ? -14.627 -13.187 -5.844  1.00 0.00 ? 74  ASN A HD21 2  
ATOM 2989  H HD22 . ASN A 1 74  ? -13.232 -13.728 -6.708  1.00 0.00 ? 74  ASN A HD22 2  
ATOM 2990  N N    . GLN A 1 75  ? -12.822 -11.349 -1.273  1.00 0.00 ? 75  GLN A N    2  
ATOM 2991  C CA   . GLN A 1 75  ? -12.730 -9.897  -1.183  1.00 0.00 ? 75  GLN A CA   2  
ATOM 2992  C C    . GLN A 1 75  ? -11.472 -9.476  -0.430  1.00 0.00 ? 75  GLN A C    2  
ATOM 2993  O O    . GLN A 1 75  ? -10.650 -10.314 -0.057  1.00 0.00 ? 75  GLN A O    2  
ATOM 2994  C CB   . GLN A 1 75  ? -13.969 -9.329  -0.488  1.00 0.00 ? 75  GLN A CB   2  
ATOM 2995  C CG   . GLN A 1 75  ? -15.168 -9.179  -1.410  1.00 0.00 ? 75  GLN A CG   2  
ATOM 2996  C CD   . GLN A 1 75  ? -16.488 -9.306  -0.675  1.00 0.00 ? 75  GLN A CD   2  
ATOM 2997  O OE1  . GLN A 1 75  ? -16.552 -9.870  0.418   1.00 0.00 ? 75  GLN A OE1  2  
ATOM 2998  N NE2  . GLN A 1 75  ? -17.551 -8.780  -1.272  1.00 0.00 ? 75  GLN A NE2  2  
ATOM 2999  H H    . GLN A 1 75  ? -12.549 -11.894 -0.506  1.00 0.00 ? 75  GLN A H    2  
ATOM 3000  H HA   . GLN A 1 75  ? -12.681 -9.505  -2.187  1.00 0.00 ? 75  GLN A HA   2  
ATOM 3001  H HB2  . GLN A 1 75  ? -14.245 -9.985  0.323   1.00 0.00 ? 75  GLN A HB2  2  
ATOM 3002  H HB3  . GLN A 1 75  ? -13.727 -8.355  -0.087  1.00 0.00 ? 75  GLN A HB3  2  
ATOM 3003  H HG2  . GLN A 1 75  ? -15.127 -8.207  -1.878  1.00 0.00 ? 75  GLN A HG2  2  
ATOM 3004  H HG3  . GLN A 1 75  ? -15.120 -9.945  -2.169  1.00 0.00 ? 75  GLN A HG3  2  
ATOM 3005  H HE21 . GLN A 1 75  ? -17.426 -8.347  -2.142  1.00 0.00 ? 75  GLN A HE21 2  
ATOM 3006  H HE22 . GLN A 1 75  ? -18.417 -8.849  -0.820  1.00 0.00 ? 75  GLN A HE22 2  
ATOM 3007  N N    . PHE A 1 76  ? -11.328 -8.174  -0.208  1.00 0.00 ? 76  PHE A N    2  
ATOM 3008  C CA   . PHE A 1 76  ? -10.170 -7.642  0.499   1.00 0.00 ? 76  PHE A CA   2  
ATOM 3009  C C    . PHE A 1 76  ? -10.584 -6.540  1.470   1.00 0.00 ? 76  PHE A C    2  
ATOM 3010  O O    . PHE A 1 76  ? -11.221 -5.562  1.079   1.00 0.00 ? 76  PHE A O    2  
ATOM 3011  C CB   . PHE A 1 76  ? -9.142  -7.101  -0.496  1.00 0.00 ? 76  PHE A CB   2  
ATOM 3012  C CG   . PHE A 1 76  ? -8.433  -8.176  -1.270  1.00 0.00 ? 76  PHE A CG   2  
ATOM 3013  C CD1  . PHE A 1 76  ? -9.096  -8.887  -2.257  1.00 0.00 ? 76  PHE A CD1  2  
ATOM 3014  C CD2  . PHE A 1 76  ? -7.105  -8.474  -1.011  1.00 0.00 ? 76  PHE A CD2  2  
ATOM 3015  C CE1  . PHE A 1 76  ? -8.446  -9.877  -2.971  1.00 0.00 ? 76  PHE A CE1  2  
ATOM 3016  C CE2  . PHE A 1 76  ? -6.451  -9.463  -1.721  1.00 0.00 ? 76  PHE A CE2  2  
ATOM 3017  C CZ   . PHE A 1 76  ? -7.122  -10.165 -2.703  1.00 0.00 ? 76  PHE A CZ   2  
ATOM 3018  H H    . PHE A 1 76  ? -12.018 -7.555  -0.530  1.00 0.00 ? 76  PHE A H    2  
ATOM 3019  H HA   . PHE A 1 76  ? -9.725  -8.450  1.060   1.00 0.00 ? 76  PHE A HA   2  
ATOM 3020  H HB2  . PHE A 1 76  ? -9.641  -6.457  -1.204  1.00 0.00 ? 76  PHE A HB2  2  
ATOM 3021  H HB3  . PHE A 1 76  ? -8.398  -6.531  0.040   1.00 0.00 ? 76  PHE A HB3  2  
ATOM 3022  H HD1  . PHE A 1 76  ? -10.131 -8.663  -2.469  1.00 0.00 ? 76  PHE A HD1  2  
ATOM 3023  H HD2  . PHE A 1 76  ? -6.579  -7.925  -0.243  1.00 0.00 ? 76  PHE A HD2  2  
ATOM 3024  H HE1  . PHE A 1 76  ? -8.974  -10.425 -3.738  1.00 0.00 ? 76  PHE A HE1  2  
ATOM 3025  H HE2  . PHE A 1 76  ? -5.415  -9.685  -1.509  1.00 0.00 ? 76  PHE A HE2  2  
ATOM 3026  H HZ   . PHE A 1 76  ? -6.613  -10.938 -3.259  1.00 0.00 ? 76  PHE A HZ   2  
ATOM 3027  N N    . MET A 1 77  ? -10.217 -6.706  2.736   1.00 0.00 ? 77  MET A N    2  
ATOM 3028  C CA   . MET A 1 77  ? -10.550 -5.725  3.763   1.00 0.00 ? 77  MET A CA   2  
ATOM 3029  C C    . MET A 1 77  ? -9.465  -4.658  3.867   1.00 0.00 ? 77  MET A C    2  
ATOM 3030  O O    . MET A 1 77  ? -8.308  -4.963  4.154   1.00 0.00 ? 77  MET A O    2  
ATOM 3031  C CB   . MET A 1 77  ? -10.736 -6.414  5.116   1.00 0.00 ? 77  MET A CB   2  
ATOM 3032  C CG   . MET A 1 77  ? -12.110 -7.038  5.297   1.00 0.00 ? 77  MET A CG   2  
ATOM 3033  S SD   . MET A 1 77  ? -12.248 -7.984  6.826   1.00 0.00 ? 77  MET A SD   2  
ATOM 3034  C CE   . MET A 1 77  ? -11.507 -6.847  7.995   1.00 0.00 ? 77  MET A CE   2  
ATOM 3035  H H    . MET A 1 77  ? -9.710  -7.506  2.987   1.00 0.00 ? 77  MET A H    2  
ATOM 3036  H HA   . MET A 1 77  ? -11.478 -5.251  3.480   1.00 0.00 ? 77  MET A HA   2  
ATOM 3037  H HB2  . MET A 1 77  ? -9.995  -7.193  5.215   1.00 0.00 ? 77  MET A HB2  2  
ATOM 3038  H HB3  . MET A 1 77  ? -10.589 -5.687  5.901   1.00 0.00 ? 77  MET A HB3  2  
ATOM 3039  H HG2  . MET A 1 77  ? -12.850 -6.251  5.309   1.00 0.00 ? 77  MET A HG2  2  
ATOM 3040  H HG3  . MET A 1 77  ? -12.303 -7.697  4.463   1.00 0.00 ? 77  MET A HG3  2  
ATOM 3041  H HE1  . MET A 1 77  ? -10.432 -6.867  7.884   1.00 0.00 ? 77  MET A HE1  2  
ATOM 3042  H HE2  . MET A 1 77  ? -11.870 -5.848  7.805   1.00 0.00 ? 77  MET A HE2  2  
ATOM 3043  H HE3  . MET A 1 77  ? -11.771 -7.142  9.000   1.00 0.00 ? 77  MET A HE3  2  
ATOM 3044  N N    . MET A 1 78  ? -9.847  -3.407  3.632   1.00 0.00 ? 78  MET A N    2  
ATOM 3045  C CA   . MET A 1 78  ? -8.906  -2.295  3.701   1.00 0.00 ? 78  MET A CA   2  
ATOM 3046  C C    . MET A 1 78  ? -8.959  -1.622  5.069   1.00 0.00 ? 78  MET A C    2  
ATOM 3047  O O    . MET A 1 78  ? -7.985  -1.642  5.820   1.00 0.00 ? 78  MET A O    2  
ATOM 3048  C CB   . MET A 1 78  ? -9.210  -1.273  2.605   1.00 0.00 ? 78  MET A CB   2  
ATOM 3049  C CG   . MET A 1 78  ? -8.060  -0.317  2.329   1.00 0.00 ? 78  MET A CG   2  
ATOM 3050  S SD   . MET A 1 78  ? -7.997  1.050   3.503   1.00 0.00 ? 78  MET A SD   2  
ATOM 3051  C CE   . MET A 1 78  ? -6.890  2.174   2.655   1.00 0.00 ? 78  MET A CE   2  
ATOM 3052  H H    . MET A 1 78  ? -10.784 -3.226  3.408   1.00 0.00 ? 78  MET A H    2  
ATOM 3053  H HA   . MET A 1 78  ? -7.914  -2.691  3.547   1.00 0.00 ? 78  MET A HA   2  
ATOM 3054  H HB2  . MET A 1 78  ? -9.438  -1.800  1.690   1.00 0.00 ? 78  MET A HB2  2  
ATOM 3055  H HB3  . MET A 1 78  ? -10.070 -0.691  2.899   1.00 0.00 ? 78  MET A HB3  2  
ATOM 3056  H HG2  . MET A 1 78  ? -7.132  -0.865  2.387   1.00 0.00 ? 78  MET A HG2  2  
ATOM 3057  H HG3  . MET A 1 78  ? -8.177  0.086   1.334   1.00 0.00 ? 78  MET A HG3  2  
ATOM 3058  H HE1  . MET A 1 78  ? -7.130  3.190   2.928   1.00 0.00 ? 78  MET A HE1  2  
ATOM 3059  H HE2  . MET A 1 78  ? -5.871  1.956   2.939   1.00 0.00 ? 78  MET A HE2  2  
ATOM 3060  H HE3  . MET A 1 78  ? -7.001  2.051   1.587   1.00 0.00 ? 78  MET A HE3  2  
ATOM 3061  N N    . GLY A 1 79  ? -10.104 -1.024  5.386   1.00 0.00 ? 79  GLY A N    2  
ATOM 3062  C CA   . GLY A 1 79  ? -10.262 -0.353  6.663   1.00 0.00 ? 79  GLY A CA   2  
ATOM 3063  C C    . GLY A 1 79  ? -11.426 -0.900  7.465   1.00 0.00 ? 79  GLY A C    2  
ATOM 3064  O O    . GLY A 1 79  ? -11.286 -1.199  8.650   1.00 0.00 ? 79  GLY A O    2  
ATOM 3065  H H    . GLY A 1 79  ? -10.848 -1.040  4.747   1.00 0.00 ? 79  GLY A H    2  
ATOM 3066  H HA2  . GLY A 1 79  ? -9.355  -0.474  7.236   1.00 0.00 ? 79  GLY A HA2  2  
ATOM 3067  H HA3  . GLY A 1 79  ? -10.426 0.700   6.485   1.00 0.00 ? 79  GLY A HA3  2  
ATOM 3068  N N    . GLY A 1 80  ? -12.580 -1.029  6.818   1.00 0.00 ? 80  GLY A N    2  
ATOM 3069  C CA   . GLY A 1 80  ? -13.757 -1.542  7.495   1.00 0.00 ? 80  GLY A CA   2  
ATOM 3070  C C    . GLY A 1 80  ? -14.837 -1.983  6.527   1.00 0.00 ? 80  GLY A C    2  
ATOM 3071  O O    . GLY A 1 80  ? -16.021 -1.726  6.748   1.00 0.00 ? 80  GLY A O    2  
ATOM 3072  H H    . GLY A 1 80  ? -12.633 -0.775  5.873   1.00 0.00 ? 80  GLY A H    2  
ATOM 3073  H HA2  . GLY A 1 80  ? -13.469 -2.384  8.106   1.00 0.00 ? 80  GLY A HA2  2  
ATOM 3074  H HA3  . GLY A 1 80  ? -14.157 -0.767  8.133   1.00 0.00 ? 80  GLY A HA3  2  
ATOM 3075  N N    . ARG A 1 81  ? -14.429 -2.647  5.451   1.00 0.00 ? 81  ARG A N    2  
ATOM 3076  C CA   . ARG A 1 81  ? -15.371 -3.122  4.444   1.00 0.00 ? 81  ARG A CA   2  
ATOM 3077  C C    . ARG A 1 81  ? -14.785 -4.294  3.661   1.00 0.00 ? 81  ARG A C    2  
ATOM 3078  O O    . ARG A 1 81  ? -13.626 -4.663  3.852   1.00 0.00 ? 81  ARG A O    2  
ATOM 3079  C CB   . ARG A 1 81  ? -15.740 -1.989  3.486   1.00 0.00 ? 81  ARG A CB   2  
ATOM 3080  C CG   . ARG A 1 81  ? -16.859 -1.097  3.999   1.00 0.00 ? 81  ARG A CG   2  
ATOM 3081  C CD   . ARG A 1 81  ? -18.115 -1.898  4.303   1.00 0.00 ? 81  ARG A CD   2  
ATOM 3082  N NE   . ARG A 1 81  ? -19.311 -1.060  4.310   1.00 0.00 ? 81  ARG A NE   2  
ATOM 3083  C CZ   . ARG A 1 81  ? -20.543 -1.535  4.169   1.00 0.00 ? 81  ARG A CZ   2  
ATOM 3084  N NH1  . ARG A 1 81  ? -20.740 -2.837  4.011   1.00 0.00 ? 81  ARG A NH1  2  
ATOM 3085  N NH2  . ARG A 1 81  ? -21.580 -0.709  4.186   1.00 0.00 ? 81  ARG A NH2  2  
ATOM 3086  H H    . ARG A 1 81  ? -13.472 -2.821  5.330   1.00 0.00 ? 81  ARG A H    2  
ATOM 3087  H HA   . ARG A 1 81  ? -16.262 -3.455  4.954   1.00 0.00 ? 81  ARG A HA   2  
ATOM 3088  H HB2  . ARG A 1 81  ? -14.868 -1.374  3.319   1.00 0.00 ? 81  ARG A HB2  2  
ATOM 3089  H HB3  . ARG A 1 81  ? -16.054 -2.417  2.545   1.00 0.00 ? 81  ARG A HB3  2  
ATOM 3090  H HG2  . ARG A 1 81  ? -16.530 -0.608  4.904   1.00 0.00 ? 81  ARG A HG2  2  
ATOM 3091  H HG3  . ARG A 1 81  ? -17.088 -0.355  3.249   1.00 0.00 ? 81  ARG A HG3  2  
ATOM 3092  H HD2  . ARG A 1 81  ? -18.229 -2.664  3.550   1.00 0.00 ? 81  ARG A HD2  2  
ATOM 3093  H HD3  . ARG A 1 81  ? -18.005 -2.361  5.273   1.00 0.00 ? 81  ARG A HD3  2  
ATOM 3094  H HE   . ARG A 1 81  ? -19.188 -0.095  4.426   1.00 0.00 ? 81  ARG A HE   2  
ATOM 3095  H HH11 . ARG A 1 81  ? -19.960 -3.462  3.999   1.00 0.00 ? 81  ARG A HH11 2  
ATOM 3096  H HH12 . ARG A 1 81  ? -21.669 -3.193  3.906   1.00 0.00 ? 81  ARG A HH12 2  
ATOM 3097  H HH21 . ARG A 1 81  ? -21.436 0.273   4.305   1.00 0.00 ? 81  ARG A HH21 2  
ATOM 3098  H HH22 . ARG A 1 81  ? -22.507 -1.068  4.080   1.00 0.00 ? 81  ARG A HH22 2  
ATOM 3099  N N    . TYR A 1 82  ? -15.593 -4.874  2.781   1.00 0.00 ? 82  TYR A N    2  
ATOM 3100  C CA   . TYR A 1 82  ? -15.156 -6.005  1.972   1.00 0.00 ? 82  TYR A CA   2  
ATOM 3101  C C    . TYR A 1 82  ? -15.329 -5.711  0.485   1.00 0.00 ? 82  TYR A C    2  
ATOM 3102  O O    . TYR A 1 82  ? -16.417 -5.873  -0.069  1.00 0.00 ? 82  TYR A O    2  
ATOM 3103  C CB   . TYR A 1 82  ? -15.941 -7.263  2.349   1.00 0.00 ? 82  TYR A CB   2  
ATOM 3104  C CG   . TYR A 1 82  ? -16.368 -7.298  3.799   1.00 0.00 ? 82  TYR A CG   2  
ATOM 3105  C CD1  . TYR A 1 82  ? -15.426 -7.362  4.820   1.00 0.00 ? 82  TYR A CD1  2  
ATOM 3106  C CD2  . TYR A 1 82  ? -17.712 -7.267  4.150   1.00 0.00 ? 82  TYR A CD2  2  
ATOM 3107  C CE1  . TYR A 1 82  ? -15.811 -7.395  6.146   1.00 0.00 ? 82  TYR A CE1  2  
ATOM 3108  C CE2  . TYR A 1 82  ? -18.106 -7.298  5.473   1.00 0.00 ? 82  TYR A CE2  2  
ATOM 3109  C CZ   . TYR A 1 82  ? -17.152 -7.362  6.468   1.00 0.00 ? 82  TYR A CZ   2  
ATOM 3110  O OH   . TYR A 1 82  ? -17.541 -7.395  7.787   1.00 0.00 ? 82  TYR A OH   2  
ATOM 3111  H H    . TYR A 1 82  ? -16.506 -4.534  2.674   1.00 0.00 ? 82  TYR A H    2  
ATOM 3112  H HA   . TYR A 1 82  ? -14.108 -6.173  2.174   1.00 0.00 ? 82  TYR A HA   2  
ATOM 3113  H HB2  . TYR A 1 82  ? -16.830 -7.319  1.741   1.00 0.00 ? 82  TYR A HB2  2  
ATOM 3114  H HB3  . TYR A 1 82  ? -15.327 -8.131  2.163   1.00 0.00 ? 82  TYR A HB3  2  
ATOM 3115  H HD1  . TYR A 1 82  ? -14.376 -7.388  4.564   1.00 0.00 ? 82  TYR A HD1  2  
ATOM 3116  H HD2  . TYR A 1 82  ? -18.456 -7.217  3.368   1.00 0.00 ? 82  TYR A HD2  2  
ATOM 3117  H HE1  . TYR A 1 82  ? -15.065 -7.445  6.925   1.00 0.00 ? 82  TYR A HE1  2  
ATOM 3118  H HE2  . TYR A 1 82  ? -19.156 -7.273  5.726   1.00 0.00 ? 82  TYR A HE2  2  
ATOM 3119  H HH   . TYR A 1 82  ? -17.483 -8.295  8.116   1.00 0.00 ? 82  TYR A HH   2  
ATOM 3120  N N    . TYR A 1 83  ? -14.249 -5.278  -0.155  1.00 0.00 ? 83  TYR A N    2  
ATOM 3121  C CA   . TYR A 1 83  ? -14.280 -4.958  -1.577  1.00 0.00 ? 83  TYR A CA   2  
ATOM 3122  C C    . TYR A 1 83  ? -13.895 -6.172  -2.417  1.00 0.00 ? 83  TYR A C    2  
ATOM 3123  O O    . TYR A 1 83  ? -12.927 -6.869  -2.114  1.00 0.00 ? 83  TYR A O    2  
ATOM 3124  C CB   . TYR A 1 83  ? -13.336 -3.794  -1.881  1.00 0.00 ? 83  TYR A CB   2  
ATOM 3125  C CG   . TYR A 1 83  ? -13.470 -2.638  -0.915  1.00 0.00 ? 83  TYR A CG   2  
ATOM 3126  C CD1  . TYR A 1 83  ? -12.911 -2.702  0.355   1.00 0.00 ? 83  TYR A CD1  2  
ATOM 3127  C CD2  . TYR A 1 83  ? -14.155 -1.484  -1.272  1.00 0.00 ? 83  TYR A CD2  2  
ATOM 3128  C CE1  . TYR A 1 83  ? -13.030 -1.649  1.242   1.00 0.00 ? 83  TYR A CE1  2  
ATOM 3129  C CE2  . TYR A 1 83  ? -14.278 -0.426  -0.393  1.00 0.00 ? 83  TYR A CE2  2  
ATOM 3130  C CZ   . TYR A 1 83  ? -13.715 -0.513  0.863   1.00 0.00 ? 83  TYR A CZ   2  
ATOM 3131  O OH   . TYR A 1 83  ? -13.837 0.539   1.742   1.00 0.00 ? 83  TYR A OH   2  
ATOM 3132  H H    . TYR A 1 83  ? -13.411 -5.168  0.340   1.00 0.00 ? 83  TYR A H    2  
ATOM 3133  H HA   . TYR A 1 83  ? -15.289 -4.666  -1.830  1.00 0.00 ? 83  TYR A HA   2  
ATOM 3134  H HB2  . TYR A 1 83  ? -12.317 -4.145  -1.838  1.00 0.00 ? 83  TYR A HB2  2  
ATOM 3135  H HB3  . TYR A 1 83  ? -13.542 -3.422  -2.874  1.00 0.00 ? 83  TYR A HB3  2  
ATOM 3136  H HD1  . TYR A 1 83  ? -12.375 -3.593  0.650   1.00 0.00 ? 83  TYR A HD1  2  
ATOM 3137  H HD2  . TYR A 1 83  ? -14.596 -1.419  -2.257  1.00 0.00 ? 83  TYR A HD2  2  
ATOM 3138  H HE1  . TYR A 1 83  ? -12.589 -1.717  2.225   1.00 0.00 ? 83  TYR A HE1  2  
ATOM 3139  H HE2  . TYR A 1 83  ? -14.815 0.464   -0.690  1.00 0.00 ? 83  TYR A HE2  2  
ATOM 3140  H HH   . TYR A 1 83  ? -14.405 1.211   1.359   1.00 0.00 ? 83  TYR A HH   2  
ATOM 3141  N N    . ASN A 1 84  ? -14.661 -6.419  -3.475  1.00 0.00 ? 84  ASN A N    2  
ATOM 3142  C CA   . ASN A 1 84  ? -14.401 -7.549  -4.360  1.00 0.00 ? 84  ASN A CA   2  
ATOM 3143  C C    . ASN A 1 84  ? -12.913 -7.658  -4.680  1.00 0.00 ? 84  ASN A C    2  
ATOM 3144  O O    . ASN A 1 84  ? -12.357 -8.755  -4.730  1.00 0.00 ? 84  ASN A O    2  
ATOM 3145  C CB   . ASN A 1 84  ? -15.204 -7.405  -5.654  1.00 0.00 ? 84  ASN A CB   2  
ATOM 3146  C CG   . ASN A 1 84  ? -15.052 -8.608  -6.566  1.00 0.00 ? 84  ASN A CG   2  
ATOM 3147  O OD1  . ASN A 1 84  ? -16.005 -9.353  -6.792  1.00 0.00 ? 84  ASN A OD1  2  
ATOM 3148  N ND2  . ASN A 1 84  ? -13.849 -8.802  -7.093  1.00 0.00 ? 84  ASN A ND2  2  
ATOM 3149  H H    . ASN A 1 84  ? -15.419 -5.828  -3.665  1.00 0.00 ? 84  ASN A H    2  
ATOM 3150  H HA   . ASN A 1 84  ? -14.714 -8.448  -3.850  1.00 0.00 ? 84  ASN A HA   2  
ATOM 3151  H HB2  . ASN A 1 84  ? -16.250 -7.292  -5.411  1.00 0.00 ? 84  ASN A HB2  2  
ATOM 3152  H HB3  . ASN A 1 84  ? -14.866 -6.528  -6.185  1.00 0.00 ? 84  ASN A HB3  2  
ATOM 3153  H HD21 . ASN A 1 84  ? -13.136 -8.167  -6.868  1.00 0.00 ? 84  ASN A HD21 2  
ATOM 3154  H HD22 . ASN A 1 84  ? -13.723 -9.571  -7.687  1.00 0.00 ? 84  ASN A HD22 2  
ATOM 3155  N N    . SER A 1 85  ? -12.275 -6.512  -4.897  1.00 0.00 ? 85  SER A N    2  
ATOM 3156  C CA   . SER A 1 85  ? -10.852 -6.478  -5.216  1.00 0.00 ? 85  SER A CA   2  
ATOM 3157  C C    . SER A 1 85  ? -10.289 -5.071  -5.038  1.00 0.00 ? 85  SER A C    2  
ATOM 3158  O O    . SER A 1 85  ? -11.038 -4.106  -4.885  1.00 0.00 ? 85  SER A O    2  
ATOM 3159  C CB   . SER A 1 85  ? -10.618 -6.956  -6.650  1.00 0.00 ? 85  SER A CB   2  
ATOM 3160  O OG   . SER A 1 85  ? -11.285 -6.121  -7.581  1.00 0.00 ? 85  SER A OG   2  
ATOM 3161  H H    . SER A 1 85  ? -12.774 -5.670  -4.843  1.00 0.00 ? 85  SER A H    2  
ATOM 3162  H HA   . SER A 1 85  ? -10.344 -7.145  -4.536  1.00 0.00 ? 85  SER A HA   2  
ATOM 3163  H HB2  . SER A 1 85  ? -9.560  -6.941  -6.864  1.00 0.00 ? 85  SER A HB2  2  
ATOM 3164  H HB3  . SER A 1 85  ? -10.992 -7.964  -6.756  1.00 0.00 ? 85  SER A HB3  2  
ATOM 3165  H HG   . SER A 1 85  ? -12.137 -6.505  -7.803  1.00 0.00 ? 85  SER A HG   2  
ATOM 3166  N N    . ILE A 1 86  ? -8.965  -4.964  -5.060  1.00 0.00 ? 86  ILE A N    2  
ATOM 3167  C CA   . ILE A 1 86  ? -8.301  -3.676  -4.903  1.00 0.00 ? 86  ILE A CA   2  
ATOM 3168  C C    . ILE A 1 86  ? -8.810  -2.666  -5.926  1.00 0.00 ? 86  ILE A C    2  
ATOM 3169  O O    . ILE A 1 86  ? -9.075  -1.511  -5.595  1.00 0.00 ? 86  ILE A O    2  
ATOM 3170  C CB   . ILE A 1 86  ? -6.773  -3.809  -5.046  1.00 0.00 ? 86  ILE A CB   2  
ATOM 3171  C CG1  . ILE A 1 86  ? -6.215  -4.724  -3.954  1.00 0.00 ? 86  ILE A CG1  2  
ATOM 3172  C CG2  . ILE A 1 86  ? -6.114  -2.439  -4.985  1.00 0.00 ? 86  ILE A CG2  2  
ATOM 3173  C CD1  . ILE A 1 86  ? -4.708  -4.858  -3.990  1.00 0.00 ? 86  ILE A CD1  2  
ATOM 3174  H H    . ILE A 1 86  ? -8.422  -5.770  -5.186  1.00 0.00 ? 86  ILE A H    2  
ATOM 3175  H HA   . ILE A 1 86  ? -8.519  -3.308  -3.910  1.00 0.00 ? 86  ILE A HA   2  
ATOM 3176  H HB   . ILE A 1 86  ? -6.561  -4.242  -6.012  1.00 0.00 ? 86  ILE A HB   2  
ATOM 3177  H HG12 . ILE A 1 86  ? -6.489  -4.331  -2.988  1.00 0.00 ? 86  ILE A HG12 2  
ATOM 3178  H HG13 . ILE A 1 86  ? -6.639  -5.711  -4.071  1.00 0.00 ? 86  ILE A HG13 2  
ATOM 3179  H HG21 . ILE A 1 86  ? -5.543  -2.355  -4.072  1.00 0.00 ? 86  ILE A HG21 2  
ATOM 3180  H HG22 . ILE A 1 86  ? -5.456  -2.319  -5.833  1.00 0.00 ? 86  ILE A HG22 2  
ATOM 3181  H HG23 . ILE A 1 86  ? -6.874  -1.673  -5.007  1.00 0.00 ? 86  ILE A HG23 2  
ATOM 3182  H HD11 . ILE A 1 86  ? -4.400  -5.208  -4.965  1.00 0.00 ? 86  ILE A HD11 2  
ATOM 3183  H HD12 . ILE A 1 86  ? -4.256  -3.897  -3.793  1.00 0.00 ? 86  ILE A HD12 2  
ATOM 3184  H HD13 . ILE A 1 86  ? -4.392  -5.566  -3.238  1.00 0.00 ? 86  ILE A HD13 2  
ATOM 3185  N N    . GLY A 1 87  ? -8.947  -3.111  -7.171  1.00 0.00 ? 87  GLY A N    2  
ATOM 3186  C CA   . GLY A 1 87  ? -9.426  -2.235  -8.224  1.00 0.00 ? 87  GLY A CA   2  
ATOM 3187  C C    . GLY A 1 87  ? -10.667 -1.464  -7.817  1.00 0.00 ? 87  GLY A C    2  
ATOM 3188  O O    . GLY A 1 87  ? -10.832 -0.301  -8.185  1.00 0.00 ? 87  GLY A O    2  
ATOM 3189  H H    . GLY A 1 87  ? -8.721  -4.043  -7.377  1.00 0.00 ? 87  GLY A H    2  
ATOM 3190  H HA2  . GLY A 1 87  ? -8.645  -1.533  -8.476  1.00 0.00 ? 87  GLY A HA2  2  
ATOM 3191  H HA3  . GLY A 1 87  ? -9.656  -2.830  -9.095  1.00 0.00 ? 87  GLY A HA3  2  
ATOM 3192  N N    . ASP A 1 88  ? -11.541 -2.113  -7.056  1.00 0.00 ? 88  ASP A N    2  
ATOM 3193  C CA   . ASP A 1 88  ? -12.774 -1.482  -6.599  1.00 0.00 ? 88  ASP A CA   2  
ATOM 3194  C C    . ASP A 1 88  ? -12.483 -0.432  -5.532  1.00 0.00 ? 88  ASP A C    2  
ATOM 3195  O O    . ASP A 1 88  ? -13.100 0.634   -5.511  1.00 0.00 ? 88  ASP A O    2  
ATOM 3196  C CB   . ASP A 1 88  ? -13.737 -2.535  -6.048  1.00 0.00 ? 88  ASP A CB   2  
ATOM 3197  C CG   . ASP A 1 88  ? -14.509 -3.243  -7.144  1.00 0.00 ? 88  ASP A CG   2  
ATOM 3198  O OD1  . ASP A 1 88  ? -13.878 -3.668  -8.134  1.00 0.00 ? 88  ASP A OD1  2  
ATOM 3199  O OD2  . ASP A 1 88  ? -15.743 -3.374  -7.010  1.00 0.00 ? 88  ASP A OD2  2  
ATOM 3200  H H    . ASP A 1 88  ? -11.353 -3.039  -6.795  1.00 0.00 ? 88  ASP A H    2  
ATOM 3201  H HA   . ASP A 1 88  ? -13.232 -0.997  -7.448  1.00 0.00 ? 88  ASP A HA   2  
ATOM 3202  H HB2  . ASP A 1 88  ? -13.175 -3.273  -5.494  1.00 0.00 ? 88  ASP A HB2  2  
ATOM 3203  H HB3  . ASP A 1 88  ? -14.443 -2.055  -5.387  1.00 0.00 ? 88  ASP A HB3  2  
ATOM 3204  N N    . ILE A 1 89  ? -11.541 -0.740  -4.647  1.00 0.00 ? 89  ILE A N    2  
ATOM 3205  C CA   . ILE A 1 89  ? -11.169 0.177   -3.577  1.00 0.00 ? 89  ILE A CA   2  
ATOM 3206  C C    . ILE A 1 89  ? -10.812 1.552   -4.131  1.00 0.00 ? 89  ILE A C    2  
ATOM 3207  O O    . ILE A 1 89  ? -11.040 2.573   -3.481  1.00 0.00 ? 89  ILE A O    2  
ATOM 3208  C CB   . ILE A 1 89  ? -9.978  -0.361  -2.762  1.00 0.00 ? 89  ILE A CB   2  
ATOM 3209  C CG1  . ILE A 1 89  ? -10.334 -1.707  -2.126  1.00 0.00 ? 89  ILE A CG1  2  
ATOM 3210  C CG2  . ILE A 1 89  ? -9.569  0.643   -1.696  1.00 0.00 ? 89  ILE A CG2  2  
ATOM 3211  C CD1  . ILE A 1 89  ? -9.140  -2.441  -1.558  1.00 0.00 ? 89  ILE A CD1  2  
ATOM 3212  H H    . ILE A 1 89  ? -11.085 -1.605  -4.715  1.00 0.00 ? 89  ILE A H    2  
ATOM 3213  H HA   . ILE A 1 89  ? -12.017 0.277   -2.914  1.00 0.00 ? 89  ILE A HA   2  
ATOM 3214  H HB   . ILE A 1 89  ? -9.144  -0.498  -3.433  1.00 0.00 ? 89  ILE A HB   2  
ATOM 3215  H HG12 . ILE A 1 89  ? -11.035 -1.544  -1.323  1.00 0.00 ? 89  ILE A HG12 2  
ATOM 3216  H HG13 . ILE A 1 89  ? -10.790 -2.340  -2.873  1.00 0.00 ? 89  ILE A HG13 2  
ATOM 3217  H HG21 . ILE A 1 89  ? -9.350  0.122   -0.775  1.00 0.00 ? 89  ILE A HG21 2  
ATOM 3218  H HG22 . ILE A 1 89  ? -8.690  1.177   -2.023  1.00 0.00 ? 89  ILE A HG22 2  
ATOM 3219  H HG23 . ILE A 1 89  ? -10.375 1.343   -1.531  1.00 0.00 ? 89  ILE A HG23 2  
ATOM 3220  H HD11 . ILE A 1 89  ? -8.231  -1.947  -1.870  1.00 0.00 ? 89  ILE A HD11 2  
ATOM 3221  H HD12 . ILE A 1 89  ? -9.198  -2.443  -0.480  1.00 0.00 ? 89  ILE A HD12 2  
ATOM 3222  H HD13 . ILE A 1 89  ? -9.138  -3.459  -1.920  1.00 0.00 ? 89  ILE A HD13 2  
ATOM 3223  N N    . ILE A 1 90  ? -10.252 1.571   -5.336  1.00 0.00 ? 90  ILE A N    2  
ATOM 3224  C CA   . ILE A 1 90  ? -9.866  2.821   -5.979  1.00 0.00 ? 90  ILE A CA   2  
ATOM 3225  C C    . ILE A 1 90  ? -11.091 3.606   -6.434  1.00 0.00 ? 90  ILE A C    2  
ATOM 3226  O O    . ILE A 1 90  ? -11.412 4.655   -5.874  1.00 0.00 ? 90  ILE A O    2  
ATOM 3227  C CB   . ILE A 1 90  ? -8.951  2.570   -7.192  1.00 0.00 ? 90  ILE A CB   2  
ATOM 3228  C CG1  . ILE A 1 90  ? -7.610  1.991   -6.737  1.00 0.00 ? 90  ILE A CG1  2  
ATOM 3229  C CG2  . ILE A 1 90  ? -8.740  3.860   -7.971  1.00 0.00 ? 90  ILE A CG2  2  
ATOM 3230  C CD1  . ILE A 1 90  ? -7.612  0.483   -6.619  1.00 0.00 ? 90  ILE A CD1  2  
ATOM 3231  H H    . ILE A 1 90  ? -10.096 0.724   -5.804  1.00 0.00 ? 90  ILE A H    2  
ATOM 3232  H HA   . ILE A 1 90  ? -9.320  3.411   -5.257  1.00 0.00 ? 90  ILE A HA   2  
ATOM 3233  H HB   . ILE A 1 90  ? -9.439  1.861   -7.843  1.00 0.00 ? 90  ILE A HB   2  
ATOM 3234  H HG12 . ILE A 1 90  ? -6.846  2.267   -7.446  1.00 0.00 ? 90  ILE A HG12 2  
ATOM 3235  H HG13 . ILE A 1 90  ? -7.361  2.400   -5.768  1.00 0.00 ? 90  ILE A HG13 2  
ATOM 3236  H HG21 . ILE A 1 90  ? -8.292  4.601   -7.326  1.00 0.00 ? 90  ILE A HG21 2  
ATOM 3237  H HG22 . ILE A 1 90  ? -8.086  3.671   -8.809  1.00 0.00 ? 90  ILE A HG22 2  
ATOM 3238  H HG23 . ILE A 1 90  ? -9.691  4.223   -8.331  1.00 0.00 ? 90  ILE A HG23 2  
ATOM 3239  H HD11 . ILE A 1 90  ? -7.533  0.203   -5.579  1.00 0.00 ? 90  ILE A HD11 2  
ATOM 3240  H HD12 . ILE A 1 90  ? -8.529  0.090   -7.031  1.00 0.00 ? 90  ILE A HD12 2  
ATOM 3241  H HD13 . ILE A 1 90  ? -6.771  0.079   -7.164  1.00 0.00 ? 90  ILE A HD13 2  
ATOM 3242  N N    . ASP A 1 91  ? -11.773 3.092   -7.451  1.00 0.00 ? 91  ASP A N    2  
ATOM 3243  C CA   . ASP A 1 91  ? -12.966 3.744   -7.980  1.00 0.00 ? 91  ASP A CA   2  
ATOM 3244  C C    . ASP A 1 91  ? -13.951 4.064   -6.861  1.00 0.00 ? 91  ASP A C    2  
ATOM 3245  O O    . ASP A 1 91  ? -14.773 4.973   -6.984  1.00 0.00 ? 91  ASP A O    2  
ATOM 3246  C CB   . ASP A 1 91  ? -13.636 2.855   -9.028  1.00 0.00 ? 91  ASP A CB   2  
ATOM 3247  C CG   . ASP A 1 91  ? -12.715 2.533   -10.189 1.00 0.00 ? 91  ASP A CG   2  
ATOM 3248  O OD1  . ASP A 1 91  ? -11.960 3.432   -10.614 1.00 0.00 ? 91  ASP A OD1  2  
ATOM 3249  O OD2  . ASP A 1 91  ? -12.750 1.381   -10.671 1.00 0.00 ? 91  ASP A OD2  2  
ATOM 3250  H H    . ASP A 1 91  ? -11.467 2.253   -7.856  1.00 0.00 ? 91  ASP A H    2  
ATOM 3251  H HA   . ASP A 1 91  ? -12.659 4.667   -8.447  1.00 0.00 ? 91  ASP A HA   2  
ATOM 3252  H HB2  . ASP A 1 91  ? -13.938 1.927   -8.564  1.00 0.00 ? 91  ASP A HB2  2  
ATOM 3253  H HB3  . ASP A 1 91  ? -14.509 3.360   -9.414  1.00 0.00 ? 91  ASP A HB3  2  
ATOM 3254  N N    . HIS A 1 92  ? -13.865 3.310   -5.769  1.00 0.00 ? 92  HIS A N    2  
ATOM 3255  C CA   . HIS A 1 92  ? -14.750 3.514   -4.627  1.00 0.00 ? 92  HIS A CA   2  
ATOM 3256  C C    . HIS A 1 92  ? -14.341 4.753   -3.837  1.00 0.00 ? 92  HIS A C    2  
ATOM 3257  O O    . HIS A 1 92  ? -15.152 5.650   -3.607  1.00 0.00 ? 92  HIS A O    2  
ATOM 3258  C CB   . HIS A 1 92  ? -14.733 2.285   -3.717  1.00 0.00 ? 92  HIS A CB   2  
ATOM 3259  C CG   . HIS A 1 92  ? -15.785 2.314   -2.652  1.00 0.00 ? 92  HIS A CG   2  
ATOM 3260  N ND1  . HIS A 1 92  ? -15.660 3.048   -1.491  1.00 0.00 ? 92  HIS A ND1  2  
ATOM 3261  C CD2  . HIS A 1 92  ? -16.987 1.696   -2.577  1.00 0.00 ? 92  HIS A CD2  2  
ATOM 3262  C CE1  . HIS A 1 92  ? -16.739 2.878   -0.748  1.00 0.00 ? 92  HIS A CE1  2  
ATOM 3263  N NE2  . HIS A 1 92  ? -17.560 2.063   -1.384  1.00 0.00 ? 92  HIS A NE2  2  
ATOM 3264  H H    . HIS A 1 92  ? -13.189 2.602   -5.730  1.00 0.00 ? 92  HIS A H    2  
ATOM 3265  H HA   . HIS A 1 92  ? -15.750 3.657   -5.005  1.00 0.00 ? 92  HIS A HA   2  
ATOM 3266  H HB2  . HIS A 1 92  ? -14.891 1.400   -4.315  1.00 0.00 ? 92  HIS A HB2  2  
ATOM 3267  H HB3  . HIS A 1 92  ? -13.770 2.218   -3.232  1.00 0.00 ? 92  HIS A HB3  2  
ATOM 3268  H HD1  . HIS A 1 92  ? -14.895 3.608   -1.247  1.00 0.00 ? 92  HIS A HD1  2  
ATOM 3269  H HD2  . HIS A 1 92  ? -17.416 1.036   -3.318  1.00 0.00 ? 92  HIS A HD2  2  
ATOM 3270  H HE1  . HIS A 1 92  ? -16.921 3.330   0.216   1.00 0.00 ? 92  HIS A HE1  2  
ATOM 3271  N N    . TYR A 1 93  ? -13.079 4.795   -3.423  1.00 0.00 ? 93  TYR A N    2  
ATOM 3272  C CA   . TYR A 1 93  ? -12.564 5.923   -2.656  1.00 0.00 ? 93  TYR A CA   2  
ATOM 3273  C C    . TYR A 1 93  ? -12.539 7.192   -3.502  1.00 0.00 ? 93  TYR A C    2  
ATOM 3274  O O    . TYR A 1 93  ? -12.725 8.296   -2.990  1.00 0.00 ? 93  TYR A O    2  
ATOM 3275  C CB   . TYR A 1 93  ? -11.158 5.614   -2.138  1.00 0.00 ? 93  TYR A CB   2  
ATOM 3276  C CG   . TYR A 1 93  ? -11.147 4.884   -0.814  1.00 0.00 ? 93  TYR A CG   2  
ATOM 3277  C CD1  . TYR A 1 93  ? -11.956 5.298   0.237   1.00 0.00 ? 93  TYR A CD1  2  
ATOM 3278  C CD2  . TYR A 1 93  ? -10.328 3.779   -0.614  1.00 0.00 ? 93  TYR A CD2  2  
ATOM 3279  C CE1  . TYR A 1 93  ? -11.948 4.635   1.449   1.00 0.00 ? 93  TYR A CE1  2  
ATOM 3280  C CE2  . TYR A 1 93  ? -10.315 3.109   0.593   1.00 0.00 ? 93  TYR A CE2  2  
ATOM 3281  C CZ   . TYR A 1 93  ? -11.127 3.540   1.622   1.00 0.00 ? 93  TYR A CZ   2  
ATOM 3282  O OH   . TYR A 1 93  ? -11.117 2.876   2.827   1.00 0.00 ? 93  TYR A OH   2  
ATOM 3283  H H    . TYR A 1 93  ? -12.480 4.050   -3.638  1.00 0.00 ? 93  TYR A H    2  
ATOM 3284  H HA   . TYR A 1 93  ? -13.221 6.078   -1.813  1.00 0.00 ? 93  TYR A HA   2  
ATOM 3285  H HB2  . TYR A 1 93  ? -10.643 4.999   -2.859  1.00 0.00 ? 93  TYR A HB2  2  
ATOM 3286  H HB3  . TYR A 1 93  ? -10.617 6.541   -2.011  1.00 0.00 ? 93  TYR A HB3  2  
ATOM 3287  H HD1  . TYR A 1 93  ? -12.599 6.155   0.098   1.00 0.00 ? 93  TYR A HD1  2  
ATOM 3288  H HD2  . TYR A 1 93  ? -9.694  3.444   -1.422  1.00 0.00 ? 93  TYR A HD2  2  
ATOM 3289  H HE1  . TYR A 1 93  ? -12.584 4.972   2.254   1.00 0.00 ? 93  TYR A HE1  2  
ATOM 3290  H HE2  . TYR A 1 93  ? -9.672  2.252   0.730   1.00 0.00 ? 93  TYR A HE2  2  
ATOM 3291  H HH   . TYR A 1 93  ? -10.217 2.626   3.047   1.00 0.00 ? 93  TYR A HH   2  
ATOM 3292  N N    . ARG A 1 94  ? -12.309 7.025   -4.800  1.00 0.00 ? 94  ARG A N    2  
ATOM 3293  C CA   . ARG A 1 94  ? -12.260 8.156   -5.719  1.00 0.00 ? 94  ARG A CA   2  
ATOM 3294  C C    . ARG A 1 94  ? -13.336 9.182   -5.377  1.00 0.00 ? 94  ARG A C    2  
ATOM 3295  O O    . ARG A 1 94  ? -13.126 10.387  -5.511  1.00 0.00 ? 94  ARG A O    2  
ATOM 3296  C CB   . ARG A 1 94  ? -12.435 7.678   -7.161  1.00 0.00 ? 94  ARG A CB   2  
ATOM 3297  C CG   . ARG A 1 94  ? -11.140 7.222   -7.814  1.00 0.00 ? 94  ARG A CG   2  
ATOM 3298  C CD   . ARG A 1 94  ? -11.295 7.084   -9.320  1.00 0.00 ? 94  ARG A CD   2  
ATOM 3299  N NE   . ARG A 1 94  ? -11.318 8.382   -9.989  1.00 0.00 ? 94  ARG A NE   2  
ATOM 3300  C CZ   . ARG A 1 94  ? -11.305 8.528   -11.309 1.00 0.00 ? 94  ARG A CZ   2  
ATOM 3301  N NH1  . ARG A 1 94  ? -11.271 7.463   -12.098 1.00 0.00 ? 94  ARG A NH1  2  
ATOM 3302  N NH2  . ARG A 1 94  ? -11.328 9.743   -11.844 1.00 0.00 ? 94  ARG A NH2  2  
ATOM 3303  H H    . ARG A 1 94  ? -12.169 6.120   -5.149  1.00 0.00 ? 94  ARG A H    2  
ATOM 3304  H HA   . ARG A 1 94  ? -11.291 8.622   -5.619  1.00 0.00 ? 94  ARG A HA   2  
ATOM 3305  H HB2  . ARG A 1 94  ? -13.129 6.849   -7.171  1.00 0.00 ? 94  ARG A HB2  2  
ATOM 3306  H HB3  . ARG A 1 94  ? -12.844 8.486   -7.748  1.00 0.00 ? 94  ARG A HB3  2  
ATOM 3307  H HG2  . ARG A 1 94  ? -10.369 7.949   -7.607  1.00 0.00 ? 94  ARG A HG2  2  
ATOM 3308  H HG3  . ARG A 1 94  ? -10.857 6.266   -7.400  1.00 0.00 ? 94  ARG A HG3  2  
ATOM 3309  H HD2  . ARG A 1 94  ? -10.465 6.507   -9.702  1.00 0.00 ? 94  ARG A HD2  2  
ATOM 3310  H HD3  . ARG A 1 94  ? -12.219 6.565   -9.528  1.00 0.00 ? 94  ARG A HD3  2  
ATOM 3311  H HE   . ARG A 1 94  ? -11.343 9.182   -9.426  1.00 0.00 ? 94  ARG A HE   2  
ATOM 3312  H HH11 . ARG A 1 94  ? -11.255 6.546   -11.698 1.00 0.00 ? 94  ARG A HH11 2  
ATOM 3313  H HH12 . ARG A 1 94  ? -11.263 7.576   -13.092 1.00 0.00 ? 94  ARG A HH12 2  
ATOM 3314  H HH21 . ARG A 1 94  ? -11.354 10.548  -11.253 1.00 0.00 ? 94  ARG A HH21 2  
ATOM 3315  H HH22 . ARG A 1 94  ? -11.319 9.852   -12.837 1.00 0.00 ? 94  ARG A HH22 2  
ATOM 3316  N N    . LYS A 1 95  ? -14.491 8.695   -4.935  1.00 0.00 ? 95  LYS A N    2  
ATOM 3317  C CA   . LYS A 1 95  ? -15.602 9.567   -4.573  1.00 0.00 ? 95  LYS A CA   2  
ATOM 3318  C C    . LYS A 1 95  ? -15.659 9.777   -3.063  1.00 0.00 ? 95  LYS A C    2  
ATOM 3319  O O    . LYS A 1 95  ? -16.104 10.822  -2.590  1.00 0.00 ? 95  LYS A O    2  
ATOM 3320  C CB   . LYS A 1 95  ? -16.924 8.976   -5.067  1.00 0.00 ? 95  LYS A CB   2  
ATOM 3321  C CG   . LYS A 1 95  ? -17.337 7.712   -4.333  1.00 0.00 ? 95  LYS A CG   2  
ATOM 3322  C CD   . LYS A 1 95  ? -18.753 7.296   -4.693  1.00 0.00 ? 95  LYS A CD   2  
ATOM 3323  C CE   . LYS A 1 95  ? -19.778 7.971   -3.794  1.00 0.00 ? 95  LYS A CE   2  
ATOM 3324  N NZ   . LYS A 1 95  ? -20.209 9.290   -4.335  1.00 0.00 ? 95  LYS A NZ   2  
ATOM 3325  H H    . LYS A 1 95  ? -14.598 7.724   -4.849  1.00 0.00 ? 95  LYS A H    2  
ATOM 3326  H HA   . LYS A 1 95  ? -15.443 10.522  -5.051  1.00 0.00 ? 95  LYS A HA   2  
ATOM 3327  H HB2  . LYS A 1 95  ? -17.703 9.713   -4.940  1.00 0.00 ? 95  LYS A HB2  2  
ATOM 3328  H HB3  . LYS A 1 95  ? -16.829 8.742   -6.118  1.00 0.00 ? 95  LYS A HB3  2  
ATOM 3329  H HG2  . LYS A 1 95  ? -16.660 6.914   -4.600  1.00 0.00 ? 95  LYS A HG2  2  
ATOM 3330  H HG3  . LYS A 1 95  ? -17.283 7.891   -3.269  1.00 0.00 ? 95  LYS A HG3  2  
ATOM 3331  H HD2  . LYS A 1 95  ? -18.952 7.574   -5.717  1.00 0.00 ? 95  LYS A HD2  2  
ATOM 3332  H HD3  . LYS A 1 95  ? -18.843 6.224   -4.585  1.00 0.00 ? 95  LYS A HD3  2  
ATOM 3333  H HE2  . LYS A 1 95  ? -20.640 7.328   -3.707  1.00 0.00 ? 95  LYS A HE2  2  
ATOM 3334  H HE3  . LYS A 1 95  ? -19.339 8.118   -2.818  1.00 0.00 ? 95  LYS A HE3  2  
ATOM 3335  H HZ1  . LYS A 1 95  ? -21.157 9.528   -3.982  1.00 0.00 ? 95  LYS A HZ1  2  
ATOM 3336  H HZ2  . LYS A 1 95  ? -20.236 9.257   -5.374  1.00 0.00 ? 95  LYS A HZ2  2  
ATOM 3337  H HZ3  . LYS A 1 95  ? -19.543 10.032  -4.039  1.00 0.00 ? 95  LYS A HZ3  2  
ATOM 3338  N N    . GLU A 1 96  ? -15.205 8.777   -2.314  1.00 0.00 ? 96  GLU A N    2  
ATOM 3339  C CA   . GLU A 1 96  ? -15.206 8.854   -0.858  1.00 0.00 ? 96  GLU A CA   2  
ATOM 3340  C C    . GLU A 1 96  ? -13.808 9.165   -0.329  1.00 0.00 ? 96  GLU A C    2  
ATOM 3341  O O    . GLU A 1 96  ? -12.859 8.424   -0.583  1.00 0.00 ? 96  GLU A O    2  
ATOM 3342  C CB   . GLU A 1 96  ? -15.710 7.540   -0.256  1.00 0.00 ? 96  GLU A CB   2  
ATOM 3343  C CG   . GLU A 1 96  ? -17.224 7.442   -0.190  1.00 0.00 ? 96  GLU A CG   2  
ATOM 3344  C CD   . GLU A 1 96  ? -17.801 8.131   1.031   1.00 0.00 ? 96  GLU A CD   2  
ATOM 3345  O OE1  . GLU A 1 96  ? -17.694 7.562   2.138   1.00 0.00 ? 96  GLU A OE1  2  
ATOM 3346  O OE2  . GLU A 1 96  ? -18.361 9.237   0.881   1.00 0.00 ? 96  GLU A OE2  2  
ATOM 3347  H H    . GLU A 1 96  ? -14.863 7.969   -2.750  1.00 0.00 ? 96  GLU A H    2  
ATOM 3348  H HA   . GLU A 1 96  ? -15.873 9.651   -0.568  1.00 0.00 ? 96  GLU A HA   2  
ATOM 3349  H HB2  . GLU A 1 96  ? -15.341 6.719   -0.853  1.00 0.00 ? 96  GLU A HB2  2  
ATOM 3350  H HB3  . GLU A 1 96  ? -15.320 7.446   0.747   1.00 0.00 ? 96  GLU A HB3  2  
ATOM 3351  H HG2  . GLU A 1 96  ? -17.641 7.903   -1.074  1.00 0.00 ? 96  GLU A HG2  2  
ATOM 3352  H HG3  . GLU A 1 96  ? -17.504 6.399   -0.164  1.00 0.00 ? 96  GLU A HG3  2  
ATOM 3353  N N    . GLN A 1 97  ? -13.692 10.266  0.406   1.00 0.00 ? 97  GLN A N    2  
ATOM 3354  C CA   . GLN A 1 97  ? -12.411 10.676  0.969   1.00 0.00 ? 97  GLN A CA   2  
ATOM 3355  C C    . GLN A 1 97  ? -11.809 9.562   1.820   1.00 0.00 ? 97  GLN A C    2  
ATOM 3356  O O    . GLN A 1 97  ? -12.380 9.167   2.836   1.00 0.00 ? 97  GLN A O    2  
ATOM 3357  C CB   . GLN A 1 97  ? -12.582 11.941  1.812   1.00 0.00 ? 97  GLN A CB   2  
ATOM 3358  C CG   . GLN A 1 97  ? -13.728 11.860  2.806   1.00 0.00 ? 97  GLN A CG   2  
ATOM 3359  C CD   . GLN A 1 97  ? -13.679 12.962  3.846   1.00 0.00 ? 97  GLN A CD   2  
ATOM 3360  O OE1  . GLN A 1 97  ? -13.837 12.712  5.041   1.00 0.00 ? 97  GLN A OE1  2  
ATOM 3361  N NE2  . GLN A 1 97  ? -13.458 14.192  3.395   1.00 0.00 ? 97  GLN A NE2  2  
ATOM 3362  H H    . GLN A 1 97  ? -14.485 10.815  0.573   1.00 0.00 ? 97  GLN A H    2  
ATOM 3363  H HA   . GLN A 1 97  ? -11.741 10.888  0.150   1.00 0.00 ? 97  GLN A HA   2  
ATOM 3364  H HB2  . GLN A 1 97  ? -11.669 12.120  2.360   1.00 0.00 ? 97  GLN A HB2  2  
ATOM 3365  H HB3  . GLN A 1 97  ? -12.765 12.777  1.152   1.00 0.00 ? 97  GLN A HB3  2  
ATOM 3366  H HG2  . GLN A 1 97  ? -14.661 11.936  2.268   1.00 0.00 ? 97  GLN A HG2  2  
ATOM 3367  H HG3  . GLN A 1 97  ? -13.682 10.906  3.311   1.00 0.00 ? 97  GLN A HG3  2  
ATOM 3368  H HE21 . GLN A 1 97  ? -13.342 14.316  2.429   1.00 0.00 ? 97  GLN A HE21 2  
ATOM 3369  H HE22 . GLN A 1 97  ? -13.421 14.923  4.045   1.00 0.00 ? 97  GLN A HE22 2  
ATOM 3370  N N    . ILE A 1 98  ? -10.653 9.061   1.397   1.00 0.00 ? 98  ILE A N    2  
ATOM 3371  C CA   . ILE A 1 98  ? -9.974  7.994   2.120   1.00 0.00 ? 98  ILE A CA   2  
ATOM 3372  C C    . ILE A 1 98  ? -9.367  8.510   3.420   1.00 0.00 ? 98  ILE A C    2  
ATOM 3373  O O    . ILE A 1 98  ? -9.060  7.735   4.326   1.00 0.00 ? 98  ILE A O    2  
ATOM 3374  C CB   . ILE A 1 98  ? -8.862  7.354   1.267   1.00 0.00 ? 98  ILE A CB   2  
ATOM 3375  C CG1  . ILE A 1 98  ? -8.067  6.345   2.099   1.00 0.00 ? 98  ILE A CG1  2  
ATOM 3376  C CG2  . ILE A 1 98  ? -7.942  8.427   0.704   1.00 0.00 ? 98  ILE A CG2  2  
ATOM 3377  C CD1  . ILE A 1 98  ? -7.054  5.563   1.293   1.00 0.00 ? 98  ILE A CD1  2  
ATOM 3378  H H    . ILE A 1 98  ? -10.247 9.418   0.579   1.00 0.00 ? 98  ILE A H    2  
ATOM 3379  H HA   . ILE A 1 98  ? -10.704 7.232   2.354   1.00 0.00 ? 98  ILE A HA   2  
ATOM 3380  H HB   . ILE A 1 98  ? -9.326  6.841   0.438   1.00 0.00 ? 98  ILE A HB   2  
ATOM 3381  H HG12 . ILE A 1 98  ? -7.538  6.869   2.878   1.00 0.00 ? 98  ILE A HG12 2  
ATOM 3382  H HG13 . ILE A 1 98  ? -8.753  5.640   2.546   1.00 0.00 ? 98  ILE A HG13 2  
ATOM 3383  H HG21 . ILE A 1 98  ? -7.900  8.337   -0.371  1.00 0.00 ? 98  ILE A HG21 2  
ATOM 3384  H HG22 . ILE A 1 98  ? -8.323  9.402   0.969   1.00 0.00 ? 98  ILE A HG22 2  
ATOM 3385  H HG23 . ILE A 1 98  ? -6.951  8.303   1.115   1.00 0.00 ? 98  ILE A HG23 2  
ATOM 3386  H HD11 . ILE A 1 98  ? -6.568  6.221   0.588   1.00 0.00 ? 98  ILE A HD11 2  
ATOM 3387  H HD12 . ILE A 1 98  ? -6.316  5.138   1.957   1.00 0.00 ? 98  ILE A HD12 2  
ATOM 3388  H HD13 . ILE A 1 98  ? -7.555  4.770   0.757   1.00 0.00 ? 98  ILE A HD13 2  
ATOM 3389  N N    . VAL A 1 99  ? -9.197  9.826   3.506   1.00 0.00 ? 99  VAL A N    2  
ATOM 3390  C CA   . VAL A 1 99  ? -8.629  10.448  4.696   1.00 0.00 ? 99  VAL A CA   2  
ATOM 3391  C C    . VAL A 1 99  ? -9.598  11.457  5.304   1.00 0.00 ? 99  VAL A C    2  
ATOM 3392  O O    . VAL A 1 99  ? -10.671 11.707  4.758   1.00 0.00 ? 99  VAL A O    2  
ATOM 3393  C CB   . VAL A 1 99  ? -7.299  11.156  4.380   1.00 0.00 ? 99  VAL A CB   2  
ATOM 3394  C CG1  . VAL A 1 99  ? -6.401  11.179  5.607   1.00 0.00 ? 99  VAL A CG1  2  
ATOM 3395  C CG2  . VAL A 1 99  ? -6.600  10.478  3.210   1.00 0.00 ? 99  VAL A CG2  2  
ATOM 3396  H H    . VAL A 1 99  ? -9.461  10.392  2.751   1.00 0.00 ? 99  VAL A H    2  
ATOM 3397  H HA   . VAL A 1 99  ? -8.436  9.669   5.420   1.00 0.00 ? 99  VAL A HA   2  
ATOM 3398  H HB   . VAL A 1 99  ? -7.515  12.176  4.100   1.00 0.00 ? 99  VAL A HB   2  
ATOM 3399  H HG11 . VAL A 1 99  ? -6.401  12.171  6.035   1.00 0.00 ? 99  VAL A HG11 2  
ATOM 3400  H HG12 . VAL A 1 99  ? -6.768  10.471  6.336   1.00 0.00 ? 99  VAL A HG12 2  
ATOM 3401  H HG13 . VAL A 1 99  ? -5.394  10.912  5.321   1.00 0.00 ? 99  VAL A HG13 2  
ATOM 3402  H HG21 . VAL A 1 99  ? -6.485  9.425   3.422   1.00 0.00 ? 99  VAL A HG21 2  
ATOM 3403  H HG22 . VAL A 1 99  ? -7.193  10.603  2.315   1.00 0.00 ? 99  VAL A HG22 2  
ATOM 3404  H HG23 . VAL A 1 99  ? -5.628  10.925  3.063   1.00 0.00 ? 99  VAL A HG23 2  
ATOM 3405  N N    . GLU A 1 100 ? -9.209  12.034  6.437   1.00 0.00 ? 100 GLU A N    2  
ATOM 3406  C CA   . GLU A 1 100 ? -10.043 13.016  7.118   1.00 0.00 ? 100 GLU A CA   2  
ATOM 3407  C C    . GLU A 1 100 ? -10.391 14.175  6.188   1.00 0.00 ? 100 GLU A C    2  
ATOM 3408  O O    . GLU A 1 100 ? -11.282 14.972  6.477   1.00 0.00 ? 100 GLU A O    2  
ATOM 3409  C CB   . GLU A 1 100 ? -9.332  13.545  8.365   1.00 0.00 ? 100 GLU A CB   2  
ATOM 3410  C CG   . GLU A 1 100 ? -8.061  14.320  8.059   1.00 0.00 ? 100 GLU A CG   2  
ATOM 3411  C CD   . GLU A 1 100 ? -7.339  14.775  9.312   1.00 0.00 ? 100 GLU A CD   2  
ATOM 3412  O OE1  . GLU A 1 100 ? -8.021  15.103  10.304  1.00 0.00 ? 100 GLU A OE1  2  
ATOM 3413  O OE2  . GLU A 1 100 ? -6.090  14.803  9.299   1.00 0.00 ? 100 GLU A OE2  2  
ATOM 3414  H H    . GLU A 1 100 ? -8.341  11.793  6.823   1.00 0.00 ? 100 GLU A H    2  
ATOM 3415  H HA   . GLU A 1 100 ? -10.957 12.525  7.418   1.00 0.00 ? 100 GLU A HA   2  
ATOM 3416  H HB2  . GLU A 1 100 ? -10.006 14.197  8.901   1.00 0.00 ? 100 GLU A HB2  2  
ATOM 3417  H HB3  . GLU A 1 100 ? -9.075  12.710  9.000   1.00 0.00 ? 100 GLU A HB3  2  
ATOM 3418  H HG2  . GLU A 1 100 ? -7.397  13.686  7.489   1.00 0.00 ? 100 GLU A HG2  2  
ATOM 3419  H HG3  . GLU A 1 100 ? -8.317  15.190  7.472   1.00 0.00 ? 100 GLU A HG3  2  
ATOM 3420  N N    . GLY A 1 101 ? -9.679  14.261  5.068   1.00 0.00 ? 101 GLY A N    2  
ATOM 3421  C CA   . GLY A 1 101 ? -9.925  15.324  4.112   1.00 0.00 ? 101 GLY A CA   2  
ATOM 3422  C C    . GLY A 1 101 ? -9.011  15.243  2.905   1.00 0.00 ? 101 GLY A C    2  
ATOM 3423  O O    . GLY A 1 101 ? -8.367  16.226  2.538   1.00 0.00 ? 101 GLY A O    2  
ATOM 3424  H H    . GLY A 1 101 ? -8.980  13.596  4.889   1.00 0.00 ? 101 GLY A H    2  
ATOM 3425  H HA2  . GLY A 1 101 ? -10.950 15.263  3.779   1.00 0.00 ? 101 GLY A HA2  2  
ATOM 3426  H HA3  . GLY A 1 101 ? -9.772  16.275  4.601   1.00 0.00 ? 101 GLY A HA3  2  
ATOM 3427  N N    . TYR A 1 102 ? -8.952  14.068  2.288   1.00 0.00 ? 102 TYR A N    2  
ATOM 3428  C CA   . TYR A 1 102 ? -8.107  13.860  1.119   1.00 0.00 ? 102 TYR A CA   2  
ATOM 3429  C C    . TYR A 1 102 ? -8.640  12.720  0.256   1.00 0.00 ? 102 TYR A C    2  
ATOM 3430  O O    . TYR A 1 102 ? -8.946  11.638  0.758   1.00 0.00 ? 102 TYR A O    2  
ATOM 3431  C CB   . TYR A 1 102 ? -6.670  13.560  1.549   1.00 0.00 ? 102 TYR A CB   2  
ATOM 3432  C CG   . TYR A 1 102 ? -5.948  14.758  2.124   1.00 0.00 ? 102 TYR A CG   2  
ATOM 3433  C CD1  . TYR A 1 102 ? -6.164  15.160  3.436   1.00 0.00 ? 102 TYR A CD1  2  
ATOM 3434  C CD2  . TYR A 1 102 ? -5.048  15.486  1.355   1.00 0.00 ? 102 TYR A CD2  2  
ATOM 3435  C CE1  . TYR A 1 102 ? -5.507  16.253  3.966   1.00 0.00 ? 102 TYR A CE1  2  
ATOM 3436  C CE2  . TYR A 1 102 ? -4.385  16.581  1.877   1.00 0.00 ? 102 TYR A CE2  2  
ATOM 3437  C CZ   . TYR A 1 102 ? -4.619  16.960  3.182   1.00 0.00 ? 102 TYR A CZ   2  
ATOM 3438  O OH   . TYR A 1 102 ? -3.961  18.050  3.707   1.00 0.00 ? 102 TYR A OH   2  
ATOM 3439  H H    . TYR A 1 102 ? -9.489  13.321  2.628   1.00 0.00 ? 102 TYR A H    2  
ATOM 3440  H HA   . TYR A 1 102 ? -8.116  14.771  0.537   1.00 0.00 ? 102 TYR A HA   2  
ATOM 3441  H HB2  . TYR A 1 102 ? -6.680  12.787  2.301   1.00 0.00 ? 102 TYR A HB2  2  
ATOM 3442  H HB3  . TYR A 1 102 ? -6.110  13.215  0.692   1.00 0.00 ? 102 TYR A HB3  2  
ATOM 3443  H HD1  . TYR A 1 102 ? -6.860  14.603  4.047   1.00 0.00 ? 102 TYR A HD1  2  
ATOM 3444  H HD2  . TYR A 1 102 ? -4.868  15.186  0.333   1.00 0.00 ? 102 TYR A HD2  2  
ATOM 3445  H HE1  . TYR A 1 102 ? -5.689  16.551  4.988   1.00 0.00 ? 102 TYR A HE1  2  
ATOM 3446  H HE2  . TYR A 1 102 ? -3.690  17.135  1.264   1.00 0.00 ? 102 TYR A HE2  2  
ATOM 3447  H HH   . TYR A 1 102 ? -3.716  17.868  4.617   1.00 0.00 ? 102 TYR A HH   2  
ATOM 3448  N N    . TYR A 1 103 ? -8.748  12.971  -1.044  1.00 0.00 ? 103 TYR A N    2  
ATOM 3449  C CA   . TYR A 1 103 ? -9.246  11.967  -1.977  1.00 0.00 ? 103 TYR A CA   2  
ATOM 3450  C C    . TYR A 1 103 ? -8.112  11.408  -2.831  1.00 0.00 ? 103 TYR A C    2  
ATOM 3451  O O    . TYR A 1 103 ? -7.006  11.950  -2.848  1.00 0.00 ? 103 TYR A O    2  
ATOM 3452  C CB   . TYR A 1 103 ? -10.328 12.568  -2.876  1.00 0.00 ? 103 TYR A CB   2  
ATOM 3453  C CG   . TYR A 1 103 ? -11.573 12.985  -2.127  1.00 0.00 ? 103 TYR A CG   2  
ATOM 3454  C CD1  . TYR A 1 103 ? -11.690 14.261  -1.589  1.00 0.00 ? 103 TYR A CD1  2  
ATOM 3455  C CD2  . TYR A 1 103 ? -12.634 12.104  -1.958  1.00 0.00 ? 103 TYR A CD2  2  
ATOM 3456  C CE1  . TYR A 1 103 ? -12.826 14.646  -0.903  1.00 0.00 ? 103 TYR A CE1  2  
ATOM 3457  C CE2  . TYR A 1 103 ? -13.774 12.481  -1.276  1.00 0.00 ? 103 TYR A CE2  2  
ATOM 3458  C CZ   . TYR A 1 103 ? -13.866 13.753  -0.750  1.00 0.00 ? 103 TYR A CZ   2  
ATOM 3459  O OH   . TYR A 1 103 ? -14.999 14.132  -0.069  1.00 0.00 ? 103 TYR A OH   2  
ATOM 3460  H H    . TYR A 1 103 ? -8.489  13.853  -1.384  1.00 0.00 ? 103 TYR A H    2  
ATOM 3461  H HA   . TYR A 1 103 ? -9.677  11.163  -1.400  1.00 0.00 ? 103 TYR A HA   2  
ATOM 3462  H HB2  . TYR A 1 103 ? -9.931  13.442  -3.370  1.00 0.00 ? 103 TYR A HB2  2  
ATOM 3463  H HB3  . TYR A 1 103 ? -10.615 11.839  -3.619  1.00 0.00 ? 103 TYR A HB3  2  
ATOM 3464  H HD1  . TYR A 1 103 ? -10.873 14.958  -1.710  1.00 0.00 ? 103 TYR A HD1  2  
ATOM 3465  H HD2  . TYR A 1 103 ? -12.559 11.108  -2.371  1.00 0.00 ? 103 TYR A HD2  2  
ATOM 3466  H HE1  . TYR A 1 103 ? -12.898 15.642  -0.492  1.00 0.00 ? 103 TYR A HE1  2  
ATOM 3467  H HE2  . TYR A 1 103 ? -14.589 11.782  -1.156  1.00 0.00 ? 103 TYR A HE2  2  
ATOM 3468  H HH   . TYR A 1 103 ? -15.018 15.088  0.015   1.00 0.00 ? 103 TYR A HH   2  
ATOM 3469  N N    . LEU A 1 104 ? -8.395  10.321  -3.540  1.00 0.00 ? 104 LEU A N    2  
ATOM 3470  C CA   . LEU A 1 104 ? -7.401  9.687   -4.398  1.00 0.00 ? 104 LEU A CA   2  
ATOM 3471  C C    . LEU A 1 104 ? -7.474  10.240  -5.818  1.00 0.00 ? 104 LEU A C    2  
ATOM 3472  O O    . LEU A 1 104 ? -8.286  9.794   -6.629  1.00 0.00 ? 104 LEU A O    2  
ATOM 3473  C CB   . LEU A 1 104 ? -7.608  8.171   -4.418  1.00 0.00 ? 104 LEU A CB   2  
ATOM 3474  C CG   . LEU A 1 104 ? -7.400  7.448   -3.087  1.00 0.00 ? 104 LEU A CG   2  
ATOM 3475  C CD1  . LEU A 1 104 ? -7.772  5.979   -3.215  1.00 0.00 ? 104 LEU A CD1  2  
ATOM 3476  C CD2  . LEU A 1 104 ? -5.961  7.597   -2.618  1.00 0.00 ? 104 LEU A CD2  2  
ATOM 3477  H H    . LEU A 1 104 ? -9.294  9.935   -3.486  1.00 0.00 ? 104 LEU A H    2  
ATOM 3478  H HA   . LEU A 1 104 ? -6.425  9.903   -3.990  1.00 0.00 ? 104 LEU A HA   2  
ATOM 3479  H HB2  . LEU A 1 104 ? -8.618  7.980   -4.745  1.00 0.00 ? 104 LEU A HB2  2  
ATOM 3480  H HB3  . LEU A 1 104 ? -6.915  7.753   -5.135  1.00 0.00 ? 104 LEU A HB3  2  
ATOM 3481  H HG   . LEU A 1 104 ? -8.044  7.891   -2.340  1.00 0.00 ? 104 LEU A HG   2  
ATOM 3482  H HD11 . LEU A 1 104 ? -7.434  5.603   -4.168  1.00 0.00 ? 104 LEU A HD11 2  
ATOM 3483  H HD12 . LEU A 1 104 ? -8.845  5.872   -3.145  1.00 0.00 ? 104 LEU A HD12 2  
ATOM 3484  H HD13 . LEU A 1 104 ? -7.303  5.419   -2.419  1.00 0.00 ? 104 LEU A HD13 2  
ATOM 3485  H HD21 . LEU A 1 104 ? -5.496  6.623   -2.569  1.00 0.00 ? 104 LEU A HD21 2  
ATOM 3486  H HD22 . LEU A 1 104 ? -5.947  8.051   -1.638  1.00 0.00 ? 104 LEU A HD22 2  
ATOM 3487  H HD23 . LEU A 1 104 ? -5.418  8.220   -3.313  1.00 0.00 ? 104 LEU A HD23 2  
ATOM 3488  N N    . LYS A 1 105 ? -6.619  11.214  -6.112  1.00 0.00 ? 105 LYS A N    2  
ATOM 3489  C CA   . LYS A 1 105 ? -6.583  11.827  -7.435  1.00 0.00 ? 105 LYS A CA   2  
ATOM 3490  C C    . LYS A 1 105 ? -6.091  10.833  -8.482  1.00 0.00 ? 105 LYS A C    2  
ATOM 3491  O O    . LYS A 1 105 ? -6.834  10.452  -9.386  1.00 0.00 ? 105 LYS A O    2  
ATOM 3492  C CB   . LYS A 1 105 ? -5.679  13.061  -7.423  1.00 0.00 ? 105 LYS A CB   2  
ATOM 3493  C CG   . LYS A 1 105 ? -6.387  14.330  -6.982  1.00 0.00 ? 105 LYS A CG   2  
ATOM 3494  C CD   . LYS A 1 105 ? -5.778  15.563  -7.629  1.00 0.00 ? 105 LYS A CD   2  
ATOM 3495  C CE   . LYS A 1 105 ? -6.136  16.828  -6.865  1.00 0.00 ? 105 LYS A CE   2  
ATOM 3496  N NZ   . LYS A 1 105 ? -6.155  18.025  -7.752  1.00 0.00 ? 105 LYS A NZ   2  
ATOM 3497  H H    . LYS A 1 105 ? -5.996  11.527  -5.423  1.00 0.00 ? 105 LYS A H    2  
ATOM 3498  H HA   . LYS A 1 105 ? -7.588  12.130  -7.688  1.00 0.00 ? 105 LYS A HA   2  
ATOM 3499  H HB2  . LYS A 1 105 ? -4.854  12.882  -6.749  1.00 0.00 ? 105 LYS A HB2  2  
ATOM 3500  H HB3  . LYS A 1 105 ? -5.291  13.218  -8.419  1.00 0.00 ? 105 LYS A HB3  2  
ATOM 3501  H HG2  . LYS A 1 105 ? -7.428  14.267  -7.264  1.00 0.00 ? 105 LYS A HG2  2  
ATOM 3502  H HG3  . LYS A 1 105 ? -6.308  14.422  -5.908  1.00 0.00 ? 105 LYS A HG3  2  
ATOM 3503  H HD2  . LYS A 1 105 ? -4.703  15.457  -7.643  1.00 0.00 ? 105 LYS A HD2  2  
ATOM 3504  H HD3  . LYS A 1 105 ? -6.146  15.647  -8.642  1.00 0.00 ? 105 LYS A HD3  2  
ATOM 3505  H HE2  . LYS A 1 105 ? -7.113  16.702  -6.424  1.00 0.00 ? 105 LYS A HE2  2  
ATOM 3506  H HE3  . LYS A 1 105 ? -5.406  16.981  -6.085  1.00 0.00 ? 105 LYS A HE3  2  
ATOM 3507  H HZ1  . LYS A 1 105 ? -5.245  18.118  -8.246  1.00 0.00 ? 105 LYS A HZ1  2  
ATOM 3508  H HZ2  . LYS A 1 105 ? -6.321  18.884  -7.190  1.00 0.00 ? 105 LYS A HZ2  2  
ATOM 3509  H HZ3  . LYS A 1 105 ? -6.913  17.934  -8.458  1.00 0.00 ? 105 LYS A HZ3  2  
ATOM 3510  N N    . GLU A 1 106 ? -4.835  10.417  -8.353  1.00 0.00 ? 106 GLU A N    2  
ATOM 3511  C CA   . GLU A 1 106 ? -4.246  9.467   -9.289  1.00 0.00 ? 106 GLU A CA   2  
ATOM 3512  C C    . GLU A 1 106 ? -3.074  8.729   -8.649  1.00 0.00 ? 106 GLU A C    2  
ATOM 3513  O O    . GLU A 1 106 ? -2.311  9.288   -7.861  1.00 0.00 ? 106 GLU A O    2  
ATOM 3514  C CB   . GLU A 1 106 ? -3.778  10.188  -10.555 1.00 0.00 ? 106 GLU A CB   2  
ATOM 3515  C CG   . GLU A 1 106 ? -2.750  11.275  -10.292 1.00 0.00 ? 106 GLU A CG   2  
ATOM 3516  C CD   . GLU A 1 106 ? -1.938  11.620  -11.526 1.00 0.00 ? 106 GLU A CD   2  
ATOM 3517  O OE1  . GLU A 1 106 ? -2.494  12.260  -12.443 1.00 0.00 ? 106 GLU A OE1  2  
ATOM 3518  O OE2  . GLU A 1 106 ? -0.746  11.250  -11.573 1.00 0.00 ? 106 GLU A OE2  2  
ATOM 3519  H H    . GLU A 1 106 ? -4.292  10.758  -7.611  1.00 0.00 ? 106 GLU A H    2  
ATOM 3520  H HA   . GLU A 1 106 ? -5.006  8.749   -9.555  1.00 0.00 ? 106 GLU A HA   2  
ATOM 3521  H HB2  . GLU A 1 106 ? -3.343  9.463   -11.227 1.00 0.00 ? 106 GLU A HB2  2  
ATOM 3522  H HB3  . GLU A 1 106 ? -4.634  10.640  -11.034 1.00 0.00 ? 106 GLU A HB3  2  
ATOM 3523  H HG2  . GLU A 1 106 ? -3.263  12.164  -9.957  1.00 0.00 ? 106 GLU A HG2  2  
ATOM 3524  H HG3  . GLU A 1 106 ? -2.076  10.936  -9.519  1.00 0.00 ? 106 GLU A HG3  2  
ATOM 3525  N N    . PRO A 1 107 ? -2.926  7.441   -8.994  1.00 0.00 ? 107 PRO A N    2  
ATOM 3526  C CA   . PRO A 1 107 ? -1.850  6.598   -8.466  1.00 0.00 ? 107 PRO A CA   2  
ATOM 3527  C C    . PRO A 1 107 ? -0.481  7.000   -9.003  1.00 0.00 ? 107 PRO A C    2  
ATOM 3528  O O    . PRO A 1 107 ? -0.372  7.880   -9.858  1.00 0.00 ? 107 PRO A O    2  
ATOM 3529  C CB   . PRO A 1 107 ? -2.225  5.196   -8.954  1.00 0.00 ? 107 PRO A CB   2  
ATOM 3530  C CG   . PRO A 1 107 ? -3.050  5.428   -10.173 1.00 0.00 ? 107 PRO A CG   2  
ATOM 3531  C CD   . PRO A 1 107 ? -3.799  6.710   -9.929  1.00 0.00 ? 107 PRO A CD   2  
ATOM 3532  H HA   . PRO A 1 107 ? -1.830  6.611   -7.386  1.00 0.00 ? 107 PRO A HA   2  
ATOM 3533  H HB2  . PRO A 1 107 ? -1.327  4.640   -9.184  1.00 0.00 ? 107 PRO A HB2  2  
ATOM 3534  H HB3  . PRO A 1 107 ? -2.788  4.683   -8.189  1.00 0.00 ? 107 PRO A HB3  2  
ATOM 3535  H HG2  . PRO A 1 107 ? -2.411  5.526   -11.036 1.00 0.00 ? 107 PRO A HG2  2  
ATOM 3536  H HG3  . PRO A 1 107 ? -3.743  4.610   -10.308 1.00 0.00 ? 107 PRO A HG3  2  
ATOM 3537  H HD2  . PRO A 1 107 ? -3.920  7.257   -10.851 1.00 0.00 ? 107 PRO A HD2  2  
ATOM 3538  H HD3  . PRO A 1 107 ? -4.759  6.506   -9.479  1.00 0.00 ? 107 PRO A HD3  2  
ATOM 3539  N N    . VAL A 1 108 ? 0.563   6.351   -8.497  1.00 0.00 ? 108 VAL A N    2  
ATOM 3540  C CA   . VAL A 1 108 ? 1.925   6.640   -8.927  1.00 0.00 ? 108 VAL A CA   2  
ATOM 3541  C C    . VAL A 1 108 ? 2.310   5.797   -10.137 1.00 0.00 ? 108 VAL A C    2  
ATOM 3542  O O    . VAL A 1 108 ? 2.196   4.571   -10.133 1.00 0.00 ? 108 VAL A O    2  
ATOM 3543  C CB   . VAL A 1 108 ? 2.938   6.386   -7.794  1.00 0.00 ? 108 VAL A CB   2  
ATOM 3544  C CG1  . VAL A 1 108 ? 4.362   6.463   -8.323  1.00 0.00 ? 108 VAL A CG1  2  
ATOM 3545  C CG2  . VAL A 1 108 ? 2.727   7.376   -6.659  1.00 0.00 ? 108 VAL A CG2  2  
ATOM 3546  H H    . VAL A 1 108 ? 0.412   5.660   -7.818  1.00 0.00 ? 108 VAL A H    2  
ATOM 3547  H HA   . VAL A 1 108 ? 1.975   7.685   -9.198  1.00 0.00 ? 108 VAL A HA   2  
ATOM 3548  H HB   . VAL A 1 108 ? 2.774   5.390   -7.410  1.00 0.00 ? 108 VAL A HB   2  
ATOM 3549  H HG11 . VAL A 1 108 ? 4.451   7.306   -8.994  1.00 0.00 ? 108 VAL A HG11 2  
ATOM 3550  H HG12 . VAL A 1 108 ? 5.047   6.585   -7.497  1.00 0.00 ? 108 VAL A HG12 2  
ATOM 3551  H HG13 . VAL A 1 108 ? 4.597   5.554   -8.856  1.00 0.00 ? 108 VAL A HG13 2  
ATOM 3552  H HG21 . VAL A 1 108 ? 2.224   6.883   -5.841  1.00 0.00 ? 108 VAL A HG21 2  
ATOM 3553  H HG22 . VAL A 1 108 ? 3.684   7.747   -6.322  1.00 0.00 ? 108 VAL A HG22 2  
ATOM 3554  H HG23 . VAL A 1 108 ? 2.125   8.201   -7.008  1.00 0.00 ? 108 VAL A HG23 2  
ATOM 3555  N N    . PRO A 1 109 ? 2.779   6.467   -11.201 1.00 0.00 ? 109 PRO A N    2  
ATOM 3556  C CA   . PRO A 1 109 ? 3.191   5.799   -12.438 1.00 0.00 ? 109 PRO A CA   2  
ATOM 3557  C C    . PRO A 1 109 ? 4.472   4.990   -12.261 1.00 0.00 ? 109 PRO A C    2  
ATOM 3558  O O    . PRO A 1 109 ? 5.110   5.043   -11.210 1.00 0.00 ? 109 PRO A O    2  
ATOM 3559  C CB   . PRO A 1 109 ? 3.423   6.960   -13.408 1.00 0.00 ? 109 PRO A CB   2  
ATOM 3560  C CG   . PRO A 1 109 ? 3.740   8.125   -12.535 1.00 0.00 ? 109 PRO A CG   2  
ATOM 3561  C CD   . PRO A 1 109 ? 2.942   7.929   -11.276 1.00 0.00 ? 109 PRO A CD   2  
ATOM 3562  H HA   . PRO A 1 109 ? 2.412   5.157   -12.822 1.00 0.00 ? 109 PRO A HA   2  
ATOM 3563  H HB2  . PRO A 1 109 ? 4.246   6.724   -14.067 1.00 0.00 ? 109 PRO A HB2  2  
ATOM 3564  H HB3  . PRO A 1 109 ? 2.529   7.134   -13.988 1.00 0.00 ? 109 PRO A HB3  2  
ATOM 3565  H HG2  . PRO A 1 109 ? 4.796   8.140   -12.312 1.00 0.00 ? 109 PRO A HG2  2  
ATOM 3566  H HG3  . PRO A 1 109 ? 3.446   9.042   -13.026 1.00 0.00 ? 109 PRO A HG3  2  
ATOM 3567  H HD2  . PRO A 1 109 ? 3.488   8.300   -10.422 1.00 0.00 ? 109 PRO A HD2  2  
ATOM 3568  H HD3  . PRO A 1 109 ? 1.983   8.419   -11.357 1.00 0.00 ? 109 PRO A HD3  2  
ATOM 3569  N N    . MET A 1 110 ? 4.841   4.242   -13.295 1.00 0.00 ? 110 MET A N    2  
ATOM 3570  C CA   . MET A 1 110 ? 6.047   3.423   -13.253 1.00 0.00 ? 110 MET A CA   2  
ATOM 3571  C C    . MET A 1 110 ? 7.257   4.211   -13.744 1.00 0.00 ? 110 MET A C    2  
ATOM 3572  O O    . MET A 1 110 ? 7.159   5.406   -14.020 1.00 0.00 ? 110 MET A O    2  
ATOM 3573  C CB   . MET A 1 110 ? 5.865   2.164   -14.104 1.00 0.00 ? 110 MET A CB   2  
ATOM 3574  C CG   . MET A 1 110 ? 4.466   1.574   -14.024 1.00 0.00 ? 110 MET A CG   2  
ATOM 3575  S SD   . MET A 1 110 ? 3.981   0.729   -15.541 1.00 0.00 ? 110 MET A SD   2  
ATOM 3576  C CE   . MET A 1 110 ? 3.964   2.095   -16.699 1.00 0.00 ? 110 MET A CE   2  
ATOM 3577  H H    . MET A 1 110 ? 4.291   4.240   -14.107 1.00 0.00 ? 110 MET A H    2  
ATOM 3578  H HA   . MET A 1 110 ? 6.214   3.131   -12.227 1.00 0.00 ? 110 MET A HA   2  
ATOM 3579  H HB2  . MET A 1 110 ? 6.071   2.408   -15.136 1.00 0.00 ? 110 MET A HB2  2  
ATOM 3580  H HB3  . MET A 1 110 ? 6.568   1.414   -13.773 1.00 0.00 ? 110 MET A HB3  2  
ATOM 3581  H HG2  . MET A 1 110 ? 4.434   0.866   -13.209 1.00 0.00 ? 110 MET A HG2  2  
ATOM 3582  H HG3  . MET A 1 110 ? 3.764   2.372   -13.832 1.00 0.00 ? 110 MET A HG3  2  
ATOM 3583  H HE1  . MET A 1 110 ? 4.959   2.506   -16.786 1.00 0.00 ? 110 MET A HE1  2  
ATOM 3584  H HE2  . MET A 1 110 ? 3.634   1.744   -17.665 1.00 0.00 ? 110 MET A HE2  2  
ATOM 3585  H HE3  . MET A 1 110 ? 3.289   2.860   -16.343 1.00 0.00 ? 110 MET A HE3  2  
ATOM 3586  N N    . GLN A 1 111 ? 8.396   3.534   -13.849 1.00 0.00 ? 111 GLN A N    2  
ATOM 3587  C CA   . GLN A 1 111 ? 9.625   4.173   -14.306 1.00 0.00 ? 111 GLN A CA   2  
ATOM 3588  C C    . GLN A 1 111 ? 10.053  3.623   -15.662 1.00 0.00 ? 111 GLN A C    2  
ATOM 3589  O O    . GLN A 1 111 ? 11.105  2.996   -15.785 1.00 0.00 ? 111 GLN A O    2  
ATOM 3590  C CB   . GLN A 1 111 ? 10.743  3.966   -13.282 1.00 0.00 ? 111 GLN A CB   2  
ATOM 3591  C CG   . GLN A 1 111 ? 10.389  4.456   -11.887 1.00 0.00 ? 111 GLN A CG   2  
ATOM 3592  C CD   . GLN A 1 111 ? 9.346   3.589   -11.211 1.00 0.00 ? 111 GLN A CD   2  
ATOM 3593  O OE1  . GLN A 1 111 ? 9.609   2.436   -10.867 1.00 0.00 ? 111 GLN A OE1  2  
ATOM 3594  N NE2  . GLN A 1 111 ? 8.154   4.140   -11.016 1.00 0.00 ? 111 GLN A NE2  2  
ATOM 3595  H H    . GLN A 1 111 ? 8.411   2.583   -13.614 1.00 0.00 ? 111 GLN A H    2  
ATOM 3596  H HA   . GLN A 1 111 ? 9.431   5.230   -14.405 1.00 0.00 ? 111 GLN A HA   2  
ATOM 3597  H HB2  . GLN A 1 111 ? 10.970  2.912   -13.223 1.00 0.00 ? 111 GLN A HB2  2  
ATOM 3598  H HB3  . GLN A 1 111 ? 11.622  4.498   -13.615 1.00 0.00 ? 111 GLN A HB3  2  
ATOM 3599  H HG2  . GLN A 1 111 ? 11.283  4.455   -11.282 1.00 0.00 ? 111 GLN A HG2  2  
ATOM 3600  H HG3  . GLN A 1 111 ? 10.007  5.464   -11.960 1.00 0.00 ? 111 GLN A HG3  2  
ATOM 3601  H HE21 . GLN A 1 111 ? 8.016   5.063   -11.318 1.00 0.00 ? 111 GLN A HE21 2  
ATOM 3602  H HE22 . GLN A 1 111 ? 7.460   3.602   -10.582 1.00 0.00 ? 111 GLN A HE22 2  
ATOM 3603  N N    . ASP A 1 112 ? 9.231   3.863   -16.678 1.00 0.00 ? 112 ASP A N    2  
ATOM 3604  C CA   . ASP A 1 112 ? 9.525   3.392   -18.027 1.00 0.00 ? 112 ASP A CA   2  
ATOM 3605  C C    . ASP A 1 112 ? 10.687  4.172   -18.633 1.00 0.00 ? 112 ASP A C    2  
ATOM 3606  O O    . ASP A 1 112 ? 10.899  5.340   -18.308 1.00 0.00 ? 112 ASP A O    2  
ATOM 3607  C CB   . ASP A 1 112 ? 8.287   3.522   -18.916 1.00 0.00 ? 112 ASP A CB   2  
ATOM 3608  C CG   . ASP A 1 112 ? 8.542   3.053   -20.335 1.00 0.00 ? 112 ASP A CG   2  
ATOM 3609  O OD1  . ASP A 1 112 ? 8.553   1.825   -20.560 1.00 0.00 ? 112 ASP A OD1  2  
ATOM 3610  O OD2  . ASP A 1 112 ? 8.732   3.914   -21.220 1.00 0.00 ? 112 ASP A OD2  2  
ATOM 3611  H H    . ASP A 1 112 ? 8.407   4.369   -16.517 1.00 0.00 ? 112 ASP A H    2  
ATOM 3612  H HA   . ASP A 1 112 ? 9.802   2.351   -17.961 1.00 0.00 ? 112 ASP A HA   2  
ATOM 3613  H HB2  . ASP A 1 112 ? 7.488   2.927   -18.499 1.00 0.00 ? 112 ASP A HB2  2  
ATOM 3614  H HB3  . ASP A 1 112 ? 7.982   4.558   -18.947 1.00 0.00 ? 112 ASP A HB3  2  
ATOM 3615  N N    . GLN A 1 113 ? 11.436  3.518   -19.515 1.00 0.00 ? 113 GLN A N    2  
ATOM 3616  C CA   . GLN A 1 113 ? 12.578  4.151   -20.165 1.00 0.00 ? 113 GLN A CA   2  
ATOM 3617  C C    . GLN A 1 113 ? 12.119  5.232   -21.138 1.00 0.00 ? 113 GLN A C    2  
ATOM 3618  O O    . GLN A 1 113 ? 11.686  4.936   -22.251 1.00 0.00 ? 113 GLN A O    2  
ATOM 3619  C CB   . GLN A 1 113 ? 13.414  3.105   -20.904 1.00 0.00 ? 113 GLN A CB   2  
ATOM 3620  C CG   . GLN A 1 113 ? 14.679  3.669   -21.530 1.00 0.00 ? 113 GLN A CG   2  
ATOM 3621  C CD   . GLN A 1 113 ? 15.703  4.093   -20.495 1.00 0.00 ? 113 GLN A CD   2  
ATOM 3622  O OE1  . GLN A 1 113 ? 15.865  3.443   -19.462 1.00 0.00 ? 113 GLN A OE1  2  
ATOM 3623  N NE2  . GLN A 1 113 ? 16.403  5.188   -20.768 1.00 0.00 ? 113 GLN A NE2  2  
ATOM 3624  H H    . GLN A 1 113 ? 11.216  2.589   -19.733 1.00 0.00 ? 113 GLN A H    2  
ATOM 3625  H HA   . GLN A 1 113 ? 13.184  4.607   -19.398 1.00 0.00 ? 113 GLN A HA   2  
ATOM 3626  H HB2  . GLN A 1 113 ? 13.698  2.330   -20.208 1.00 0.00 ? 113 GLN A HB2  2  
ATOM 3627  H HB3  . GLN A 1 113 ? 12.814  2.670   -21.689 1.00 0.00 ? 113 GLN A HB3  2  
ATOM 3628  H HG2  . GLN A 1 113 ? 15.121  2.914   -22.162 1.00 0.00 ? 113 GLN A HG2  2  
ATOM 3629  H HG3  . GLN A 1 113 ? 14.416  4.529   -22.128 1.00 0.00 ? 113 GLN A HG3  2  
ATOM 3630  H HE21 . GLN A 1 113 ? 16.219  5.656   -21.611 1.00 0.00 ? 113 GLN A HE21 2  
ATOM 3631  H HE22 . GLN A 1 113 ? 17.071  5.486   -20.117 1.00 0.00 ? 113 GLN A HE22 2  
ATOM 3632  N N    . SER A 1 114 ? 12.219  6.487   -20.710 1.00 0.00 ? 114 SER A N    2  
ATOM 3633  C CA   . SER A 1 114 ? 11.810  7.613   -21.541 1.00 0.00 ? 114 SER A CA   2  
ATOM 3634  C C    . SER A 1 114 ? 12.905  7.975   -22.541 1.00 0.00 ? 114 SER A C    2  
ATOM 3635  O O    . SER A 1 114 ? 14.088  7.750   -22.291 1.00 0.00 ? 114 SER A O    2  
ATOM 3636  C CB   . SER A 1 114 ? 11.480  8.825   -20.669 1.00 0.00 ? 114 SER A CB   2  
ATOM 3637  O OG   . SER A 1 114 ? 10.417  8.537   -19.776 1.00 0.00 ? 114 SER A OG   2  
ATOM 3638  H H    . SER A 1 114 ? 12.572  6.658   -19.812 1.00 0.00 ? 114 SER A H    2  
ATOM 3639  H HA   . SER A 1 114 ? 10.925  7.319   -22.085 1.00 0.00 ? 114 SER A HA   2  
ATOM 3640  H HB2  . SER A 1 114 ? 12.351  9.101   -20.094 1.00 0.00 ? 114 SER A HB2  2  
ATOM 3641  H HB3  . SER A 1 114 ? 11.189  9.652   -21.301 1.00 0.00 ? 114 SER A HB3  2  
ATOM 3642  H HG   . SER A 1 114 ? 10.686  7.841   -19.172 1.00 0.00 ? 114 SER A HG   2  
ATOM 3643  N N    . GLY A 1 115 ? 12.499  8.537   -23.675 1.00 0.00 ? 115 GLY A N    2  
ATOM 3644  C CA   . GLY A 1 115 ? 13.456  8.921   -24.697 1.00 0.00 ? 115 GLY A CA   2  
ATOM 3645  C C    . GLY A 1 115 ? 14.127  7.725   -25.342 1.00 0.00 ? 115 GLY A C    2  
ATOM 3646  O O    . GLY A 1 115 ? 14.405  6.717   -24.692 1.00 0.00 ? 115 GLY A O    2  
ATOM 3647  H H    . GLY A 1 115 ? 11.542  8.692   -23.820 1.00 0.00 ? 115 GLY A H    2  
ATOM 3648  H HA2  . GLY A 1 115 ? 12.944  9.489   -25.459 1.00 0.00 ? 115 GLY A HA2  2  
ATOM 3649  H HA3  . GLY A 1 115 ? 14.214  9.545   -24.246 1.00 0.00 ? 115 GLY A HA3  2  
ATOM 3650  N N    . PRO A 1 116 ? 14.396  7.828   -26.652 1.00 0.00 ? 116 PRO A N    2  
ATOM 3651  C CA   . PRO A 1 116 ? 15.040  6.755   -27.414 1.00 0.00 ? 116 PRO A CA   2  
ATOM 3652  C C    . PRO A 1 116 ? 16.503  6.568   -27.029 1.00 0.00 ? 116 PRO A C    2  
ATOM 3653  O O    . PRO A 1 116 ? 16.956  7.081   -26.006 1.00 0.00 ? 116 PRO A O    2  
ATOM 3654  C CB   . PRO A 1 116 ? 14.926  7.232   -28.864 1.00 0.00 ? 116 PRO A CB   2  
ATOM 3655  C CG   . PRO A 1 116 ? 14.830  8.715   -28.769 1.00 0.00 ? 116 PRO A CG   2  
ATOM 3656  C CD   . PRO A 1 116 ? 14.092  9.000   -27.490 1.00 0.00 ? 116 PRO A CD   2  
ATOM 3657  H HA   . PRO A 1 116 ? 14.516  5.817   -27.300 1.00 0.00 ? 116 PRO A HA   2  
ATOM 3658  H HB2  . PRO A 1 116 ? 15.804  6.927   -29.416 1.00 0.00 ? 116 PRO A HB2  2  
ATOM 3659  H HB3  . PRO A 1 116 ? 14.044  6.807   -29.319 1.00 0.00 ? 116 PRO A HB3  2  
ATOM 3660  H HG2  . PRO A 1 116 ? 15.818  9.146   -28.735 1.00 0.00 ? 116 PRO A HG2  2  
ATOM 3661  H HG3  . PRO A 1 116 ? 14.278  9.102   -29.613 1.00 0.00 ? 116 PRO A HG3  2  
ATOM 3662  H HD2  . PRO A 1 116 ? 14.463  9.906   -27.034 1.00 0.00 ? 116 PRO A HD2  2  
ATOM 3663  H HD3  . PRO A 1 116 ? 13.030  9.076   -27.675 1.00 0.00 ? 116 PRO A HD3  2  
ATOM 3664  N N    . SER A 1 117 ? 17.239  5.830   -27.854 1.00 0.00 ? 117 SER A N    2  
ATOM 3665  C CA   . SER A 1 117 ? 18.651  5.572   -27.597 1.00 0.00 ? 117 SER A CA   2  
ATOM 3666  C C    . SER A 1 117 ? 19.517  6.118   -28.728 1.00 0.00 ? 117 SER A C    2  
ATOM 3667  O O    . SER A 1 117 ? 19.909  5.383   -29.635 1.00 0.00 ? 117 SER A O    2  
ATOM 3668  C CB   . SER A 1 117 ? 18.895  4.071   -27.431 1.00 0.00 ? 117 SER A CB   2  
ATOM 3669  O OG   . SER A 1 117 ? 18.517  3.361   -28.597 1.00 0.00 ? 117 SER A OG   2  
ATOM 3670  H H    . SER A 1 117 ? 16.820  5.447   -28.654 1.00 0.00 ? 117 SER A H    2  
ATOM 3671  H HA   . SER A 1 117 ? 18.918  6.075   -26.680 1.00 0.00 ? 117 SER A HA   2  
ATOM 3672  H HB2  . SER A 1 117 ? 19.944  3.898   -27.243 1.00 0.00 ? 117 SER A HB2  2  
ATOM 3673  H HB3  . SER A 1 117 ? 18.315  3.705   -26.597 1.00 0.00 ? 117 SER A HB3  2  
ATOM 3674  H HG   . SER A 1 117 ? 19.136  2.643   -28.750 1.00 0.00 ? 117 SER A HG   2  
ATOM 3675  N N    . SER A 1 118 ? 19.813  7.412   -28.667 1.00 0.00 ? 118 SER A N    2  
ATOM 3676  C CA   . SER A 1 118 ? 20.629  8.059   -29.688 1.00 0.00 ? 118 SER A CA   2  
ATOM 3677  C C    . SER A 1 118 ? 21.324  9.295   -29.125 1.00 0.00 ? 118 SER A C    2  
ATOM 3678  O O    . SER A 1 118 ? 20.674  10.222  -28.644 1.00 0.00 ? 118 SER A O    2  
ATOM 3679  C CB   . SER A 1 118 ? 19.767  8.448   -30.890 1.00 0.00 ? 118 SER A CB   2  
ATOM 3680  O OG   . SER A 1 118 ? 19.033  7.336   -31.373 1.00 0.00 ? 118 SER A OG   2  
ATOM 3681  H H    . SER A 1 118 ? 19.471  7.946   -27.919 1.00 0.00 ? 118 SER A H    2  
ATOM 3682  H HA   . SER A 1 118 ? 21.381  7.352   -30.008 1.00 0.00 ? 118 SER A HA   2  
ATOM 3683  H HB2  . SER A 1 118 ? 19.074  9.222   -30.597 1.00 0.00 ? 118 SER A HB2  2  
ATOM 3684  H HB3  . SER A 1 118 ? 20.403  8.816   -31.682 1.00 0.00 ? 118 SER A HB3  2  
ATOM 3685  H HG   . SER A 1 118 ? 18.094  7.497   -31.257 1.00 0.00 ? 118 SER A HG   2  
ATOM 3686  N N    . GLY A 1 119 ? 22.652  9.300   -29.188 1.00 0.00 ? 119 GLY A N    2  
ATOM 3687  C CA   . GLY A 1 119 ? 23.415  10.426  -28.682 1.00 0.00 ? 119 GLY A CA   2  
ATOM 3688  C C    . GLY A 1 119 ? 24.877  10.361  -29.077 1.00 0.00 ? 119 GLY A C    2  
ATOM 3689  O O    . GLY A 1 119 ? 25.260  10.835  -30.146 1.00 0.00 ? 119 GLY A O    2  
ATOM 3690  H H    . GLY A 1 119 ? 23.118  8.533   -29.583 1.00 0.00 ? 119 GLY A H    2  
ATOM 3691  H HA2  . GLY A 1 119 ? 22.988  11.339  -29.069 1.00 0.00 ? 119 GLY A HA2  2  
ATOM 3692  H HA3  . GLY A 1 119 ? 23.346  10.437  -27.604 1.00 0.00 ? 119 GLY A HA3  2  
ATOM 3693  N N    . GLY A 1 1   ? 11.958  -13.349 -12.093 1.00 0.00 ? 1   GLY A N    3  
ATOM 3694  C CA   . GLY A 1 1   ? 11.509  -14.728 -12.140 1.00 0.00 ? 1   GLY A CA   3  
ATOM 3695  C C    . GLY A 1 1   ? 12.443  -15.614 -12.942 1.00 0.00 ? 1   GLY A C    3  
ATOM 3696  O O    . GLY A 1 1   ? 13.389  -16.183 -12.398 1.00 0.00 ? 1   GLY A O    3  
ATOM 3697  H H1   . GLY A 1 1   ? 12.683  -13.051 -12.681 1.00 0.00 ? 1   GLY A H1   3  
ATOM 3698  H HA2  . GLY A 1 1   ? 11.446  -15.109 -11.132 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3699  H HA3  . GLY A 1 1   ? 10.527  -14.760 -12.589 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3700  N N    . SER A 1 2   ? 12.175  -15.732 -14.238 1.00 0.00 ? 2   SER A N    3  
ATOM 3701  C CA   . SER A 1 2   ? 12.995  -16.559 -15.115 1.00 0.00 ? 2   SER A CA   3  
ATOM 3702  C C    . SER A 1 2   ? 13.435  -17.836 -14.404 1.00 0.00 ? 2   SER A C    3  
ATOM 3703  O O    . SER A 1 2   ? 14.584  -18.260 -14.520 1.00 0.00 ? 2   SER A O    3  
ATOM 3704  C CB   . SER A 1 2   ? 14.222  -15.778 -15.589 1.00 0.00 ? 2   SER A CB   3  
ATOM 3705  O OG   . SER A 1 2   ? 13.895  -14.920 -16.668 1.00 0.00 ? 2   SER A OG   3  
ATOM 3706  H H    . SER A 1 2   ? 11.407  -15.253 -14.613 1.00 0.00 ? 2   SER A H    3  
ATOM 3707  H HA   . SER A 1 2   ? 12.397  -16.827 -15.973 1.00 0.00 ? 2   SER A HA   3  
ATOM 3708  H HB2  . SER A 1 2   ? 14.603  -15.182 -14.773 1.00 0.00 ? 2   SER A HB2  3  
ATOM 3709  H HB3  . SER A 1 2   ? 14.984  -16.472 -15.914 1.00 0.00 ? 2   SER A HB3  3  
ATOM 3710  H HG   . SER A 1 2   ? 14.415  -14.115 -16.606 1.00 0.00 ? 2   SER A HG   3  
ATOM 3711  N N    . SER A 1 3   ? 12.510  -18.443 -13.667 1.00 0.00 ? 3   SER A N    3  
ATOM 3712  C CA   . SER A 1 3   ? 12.801  -19.669 -12.933 1.00 0.00 ? 3   SER A CA   3  
ATOM 3713  C C    . SER A 1 3   ? 11.881  -20.801 -13.378 1.00 0.00 ? 3   SER A C    3  
ATOM 3714  O O    . SER A 1 3   ? 10.749  -20.566 -13.801 1.00 0.00 ? 3   SER A O    3  
ATOM 3715  C CB   . SER A 1 3   ? 12.650  -19.435 -11.428 1.00 0.00 ? 3   SER A CB   3  
ATOM 3716  O OG   . SER A 1 3   ? 13.870  -18.998 -10.855 1.00 0.00 ? 3   SER A OG   3  
ATOM 3717  H H    . SER A 1 3   ? 11.611  -18.056 -13.614 1.00 0.00 ? 3   SER A H    3  
ATOM 3718  H HA   . SER A 1 3   ? 13.823  -19.947 -13.144 1.00 0.00 ? 3   SER A HA   3  
ATOM 3719  H HB2  . SER A 1 3   ? 11.896  -18.683 -11.258 1.00 0.00 ? 3   SER A HB2  3  
ATOM 3720  H HB3  . SER A 1 3   ? 12.353  -20.358 -10.952 1.00 0.00 ? 3   SER A HB3  3  
ATOM 3721  H HG   . SER A 1 3   ? 13.834  -18.049 -10.712 1.00 0.00 ? 3   SER A HG   3  
ATOM 3722  N N    . GLY A 1 4   ? 12.375  -22.031 -13.280 1.00 0.00 ? 4   GLY A N    3  
ATOM 3723  C CA   . GLY A 1 4   ? 11.585  -23.182 -13.676 1.00 0.00 ? 4   GLY A CA   3  
ATOM 3724  C C    . GLY A 1 4   ? 11.150  -23.115 -15.126 1.00 0.00 ? 4   GLY A C    3  
ATOM 3725  O O    . GLY A 1 4   ? 11.975  -22.935 -16.022 1.00 0.00 ? 4   GLY A O    3  
ATOM 3726  H H    . GLY A 1 4   ? 13.284  -22.158 -12.935 1.00 0.00 ? 4   GLY A H    3  
ATOM 3727  H HA2  . GLY A 1 4   ? 12.172  -24.076 -13.528 1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3728  H HA3  . GLY A 1 4   ? 10.706  -23.233 -13.051 1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3729  N N    . SER A 1 5   ? 9.849   -23.261 -15.360 1.00 0.00 ? 5   SER A N    3  
ATOM 3730  C CA   . SER A 1 5   ? 9.306   -23.222 -16.712 1.00 0.00 ? 5   SER A CA   3  
ATOM 3731  C C    . SER A 1 5   ? 9.813   -21.996 -17.466 1.00 0.00 ? 5   SER A C    3  
ATOM 3732  O O    . SER A 1 5   ? 10.315  -21.047 -16.863 1.00 0.00 ? 5   SER A O    3  
ATOM 3733  C CB   . SER A 1 5   ? 7.777   -23.213 -16.671 1.00 0.00 ? 5   SER A CB   3  
ATOM 3734  O OG   . SER A 1 5   ? 7.263   -24.526 -16.533 1.00 0.00 ? 5   SER A OG   3  
ATOM 3735  H H    . SER A 1 5   ? 9.241   -23.402 -14.604 1.00 0.00 ? 5   SER A H    3  
ATOM 3736  H HA   . SER A 1 5   ? 9.638   -24.110 -17.229 1.00 0.00 ? 5   SER A HA   3  
ATOM 3737  H HB2  . SER A 1 5   ? 7.446   -22.620 -15.832 1.00 0.00 ? 5   SER A HB2  3  
ATOM 3738  H HB3  . SER A 1 5   ? 7.397   -22.784 -17.587 1.00 0.00 ? 5   SER A HB3  3  
ATOM 3739  H HG   . SER A 1 5   ? 6.675   -24.563 -15.775 1.00 0.00 ? 5   SER A HG   3  
ATOM 3740  N N    . SER A 1 6   ? 9.676   -22.023 -18.787 1.00 0.00 ? 6   SER A N    3  
ATOM 3741  C CA   . SER A 1 6   ? 10.123  -20.916 -19.625 1.00 0.00 ? 6   SER A CA   3  
ATOM 3742  C C    . SER A 1 6   ? 8.933   -20.139 -20.180 1.00 0.00 ? 6   SER A C    3  
ATOM 3743  O O    . SER A 1 6   ? 8.917   -19.757 -21.349 1.00 0.00 ? 6   SER A O    3  
ATOM 3744  C CB   . SER A 1 6   ? 10.988  -21.435 -20.775 1.00 0.00 ? 6   SER A CB   3  
ATOM 3745  O OG   . SER A 1 6   ? 12.350  -21.516 -20.392 1.00 0.00 ? 6   SER A OG   3  
ATOM 3746  H H    . SER A 1 6   ? 9.268   -22.808 -19.210 1.00 0.00 ? 6   SER A H    3  
ATOM 3747  H HA   . SER A 1 6   ? 10.715  -20.254 -19.011 1.00 0.00 ? 6   SER A HA   3  
ATOM 3748  H HB2  . SER A 1 6   ? 10.649  -22.419 -21.061 1.00 0.00 ? 6   SER A HB2  3  
ATOM 3749  H HB3  . SER A 1 6   ? 10.902  -20.765 -21.618 1.00 0.00 ? 6   SER A HB3  3  
ATOM 3750  H HG   . SER A 1 6   ? 12.421  -21.982 -19.556 1.00 0.00 ? 6   SER A HG   3  
ATOM 3751  N N    . GLY A 1 7   ? 7.936   -19.910 -19.330 1.00 0.00 ? 7   GLY A N    3  
ATOM 3752  C CA   . GLY A 1 7   ? 6.755   -19.181 -19.753 1.00 0.00 ? 7   GLY A CA   3  
ATOM 3753  C C    . GLY A 1 7   ? 6.552   -17.901 -18.967 1.00 0.00 ? 7   GLY A C    3  
ATOM 3754  O O    . GLY A 1 7   ? 7.095   -17.743 -17.873 1.00 0.00 ? 7   GLY A O    3  
ATOM 3755  H H    . GLY A 1 7   ? 8.003   -20.239 -18.409 1.00 0.00 ? 7   GLY A H    3  
ATOM 3756  H HA2  . GLY A 1 7   ? 6.851   -18.936 -20.800 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3757  H HA3  . GLY A 1 7   ? 5.889   -19.812 -19.619 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3758  N N    . ARG A 1 8   ? 5.768   -16.983 -19.525 1.00 0.00 ? 8   ARG A N    3  
ATOM 3759  C CA   . ARG A 1 8   ? 5.498   -15.709 -18.870 1.00 0.00 ? 8   ARG A CA   3  
ATOM 3760  C C    . ARG A 1 8   ? 4.119   -15.716 -18.216 1.00 0.00 ? 8   ARG A C    3  
ATOM 3761  O O    . ARG A 1 8   ? 3.097   -15.754 -18.901 1.00 0.00 ? 8   ARG A O    3  
ATOM 3762  C CB   . ARG A 1 8   ? 5.590   -14.563 -19.879 1.00 0.00 ? 8   ARG A CB   3  
ATOM 3763  C CG   . ARG A 1 8   ? 7.004   -14.295 -20.368 1.00 0.00 ? 8   ARG A CG   3  
ATOM 3764  C CD   . ARG A 1 8   ? 7.003   -13.491 -21.659 1.00 0.00 ? 8   ARG A CD   3  
ATOM 3765  N NE   . ARG A 1 8   ? 8.331   -13.427 -22.265 1.00 0.00 ? 8   ARG A NE   3  
ATOM 3766  C CZ   . ARG A 1 8   ? 8.553   -13.009 -23.506 1.00 0.00 ? 8   ARG A CZ   3  
ATOM 3767  N NH1  . ARG A 1 8   ? 7.541   -12.619 -24.269 1.00 0.00 ? 8   ARG A NH1  3  
ATOM 3768  N NH2  . ARG A 1 8   ? 9.790   -12.980 -23.986 1.00 0.00 ? 8   ARG A NH2  3  
ATOM 3769  H H    . ARG A 1 8   ? 5.364   -17.167 -20.398 1.00 0.00 ? 8   ARG A H    3  
ATOM 3770  H HA   . ARG A 1 8   ? 6.245   -15.564 -18.104 1.00 0.00 ? 8   ARG A HA   3  
ATOM 3771  H HB2  . ARG A 1 8   ? 4.976   -14.802 -20.735 1.00 0.00 ? 8   ARG A HB2  3  
ATOM 3772  H HB3  . ARG A 1 8   ? 5.215   -13.662 -19.417 1.00 0.00 ? 8   ARG A HB3  3  
ATOM 3773  H HG2  . ARG A 1 8   ? 7.537   -13.739 -19.611 1.00 0.00 ? 8   ARG A HG2  3  
ATOM 3774  H HG3  . ARG A 1 8   ? 7.499   -15.238 -20.542 1.00 0.00 ? 8   ARG A HG3  3  
ATOM 3775  H HD2  . ARG A 1 8   ? 6.322   -13.955 -22.356 1.00 0.00 ? 8   ARG A HD2  3  
ATOM 3776  H HD3  . ARG A 1 8   ? 6.668   -12.488 -21.442 1.00 0.00 ? 8   ARG A HD3  3  
ATOM 3777  H HE   . ARG A 1 8   ? 9.093   -13.711 -21.718 1.00 0.00 ? 8   ARG A HE   3  
ATOM 3778  H HH11 . ARG A 1 8   ? 6.608   -12.639 -23.909 1.00 0.00 ? 8   ARG A HH11 3  
ATOM 3779  H HH12 . ARG A 1 8   ? 7.711   -12.303 -25.202 1.00 0.00 ? 8   ARG A HH12 3  
ATOM 3780  H HH21 . ARG A 1 8   ? 10.555  -13.273 -23.413 1.00 0.00 ? 8   ARG A HH21 3  
ATOM 3781  H HH22 . ARG A 1 8   ? 9.956   -12.665 -24.920 1.00 0.00 ? 8   ARG A HH22 3  
ATOM 3782  N N    . GLU A 1 9   ? 4.099   -15.680 -16.888 1.00 0.00 ? 9   GLU A N    3  
ATOM 3783  C CA   . GLU A 1 9   ? 2.846   -15.683 -16.143 1.00 0.00 ? 9   GLU A CA   3  
ATOM 3784  C C    . GLU A 1 9   ? 2.129   -14.342 -16.277 1.00 0.00 ? 9   GLU A C    3  
ATOM 3785  O O    . GLU A 1 9   ? 2.704   -13.290 -16.002 1.00 0.00 ? 9   GLU A O    3  
ATOM 3786  C CB   . GLU A 1 9   ? 3.105   -15.989 -14.666 1.00 0.00 ? 9   GLU A CB   3  
ATOM 3787  C CG   . GLU A 1 9   ? 3.085   -17.473 -14.339 1.00 0.00 ? 9   GLU A CG   3  
ATOM 3788  C CD   . GLU A 1 9   ? 2.719   -17.747 -12.894 1.00 0.00 ? 9   GLU A CD   3  
ATOM 3789  O OE1  . GLU A 1 9   ? 1.559   -17.478 -12.515 1.00 0.00 ? 9   GLU A OE1  3  
ATOM 3790  O OE2  . GLU A 1 9   ? 3.590   -18.231 -12.142 1.00 0.00 ? 9   GLU A OE2  3  
ATOM 3791  H H    . GLU A 1 9   ? 4.947   -15.650 -16.397 1.00 0.00 ? 9   GLU A H    3  
ATOM 3792  H HA   . GLU A 1 9   ? 2.216   -16.457 -16.556 1.00 0.00 ? 9   GLU A HA   3  
ATOM 3793  H HB2  . GLU A 1 9   ? 4.073   -15.594 -14.393 1.00 0.00 ? 9   GLU A HB2  3  
ATOM 3794  H HB3  . GLU A 1 9   ? 2.347   -15.501 -14.071 1.00 0.00 ? 9   GLU A HB3  3  
ATOM 3795  H HG2  . GLU A 1 9   ? 2.361   -17.959 -14.976 1.00 0.00 ? 9   GLU A HG2  3  
ATOM 3796  H HG3  . GLU A 1 9   ? 4.065   -17.884 -14.531 1.00 0.00 ? 9   GLU A HG3  3  
ATOM 3797  N N    . GLU A 1 10  ? 0.870   -14.391 -16.702 1.00 0.00 ? 10  GLU A N    3  
ATOM 3798  C CA   . GLU A 1 10  ? 0.076   -13.180 -16.875 1.00 0.00 ? 10  GLU A CA   3  
ATOM 3799  C C    . GLU A 1 10  ? -0.998  -13.076 -15.795 1.00 0.00 ? 10  GLU A C    3  
ATOM 3800  O O    . GLU A 1 10  ? -1.903  -13.907 -15.723 1.00 0.00 ? 10  GLU A O    3  
ATOM 3801  C CB   . GLU A 1 10  ? -0.574  -13.163 -18.260 1.00 0.00 ? 10  GLU A CB   3  
ATOM 3802  C CG   . GLU A 1 10  ? 0.426   -13.073 -19.400 1.00 0.00 ? 10  GLU A CG   3  
ATOM 3803  C CD   . GLU A 1 10  ? -0.241  -13.071 -20.762 1.00 0.00 ? 10  GLU A CD   3  
ATOM 3804  O OE1  . GLU A 1 10  ? -1.366  -12.540 -20.870 1.00 0.00 ? 10  GLU A OE1  3  
ATOM 3805  O OE2  . GLU A 1 10  ? 0.361   -13.602 -21.719 1.00 0.00 ? 10  GLU A OE2  3  
ATOM 3806  H H    . GLU A 1 10  ? 0.467   -15.261 -16.905 1.00 0.00 ? 10  GLU A H    3  
ATOM 3807  H HA   . GLU A 1 10  ? 0.739   -12.333 -16.788 1.00 0.00 ? 10  GLU A HA   3  
ATOM 3808  H HB2  . GLU A 1 10  ? -1.151  -14.067 -18.385 1.00 0.00 ? 10  GLU A HB2  3  
ATOM 3809  H HB3  . GLU A 1 10  ? -1.237  -12.313 -18.322 1.00 0.00 ? 10  GLU A HB3  3  
ATOM 3810  H HG2  . GLU A 1 10  ? 0.993   -12.160 -19.294 1.00 0.00 ? 10  GLU A HG2  3  
ATOM 3811  H HG3  . GLU A 1 10  ? 1.094   -13.919 -19.344 1.00 0.00 ? 10  GLU A HG3  3  
ATOM 3812  N N    . ASP A 1 11  ? -0.889  -12.050 -14.959 1.00 0.00 ? 11  ASP A N    3  
ATOM 3813  C CA   . ASP A 1 11  ? -1.850  -11.836 -13.883 1.00 0.00 ? 11  ASP A CA   3  
ATOM 3814  C C    . ASP A 1 11  ? -2.544  -10.486 -14.035 1.00 0.00 ? 11  ASP A C    3  
ATOM 3815  O O    . ASP A 1 11  ? -1.976  -9.523  -14.552 1.00 0.00 ? 11  ASP A O    3  
ATOM 3816  C CB   . ASP A 1 11  ? -1.153  -11.915 -12.524 1.00 0.00 ? 11  ASP A CB   3  
ATOM 3817  C CG   . ASP A 1 11  ? -1.029  -13.339 -12.018 1.00 0.00 ? 11  ASP A CG   3  
ATOM 3818  O OD1  . ASP A 1 11  ? -2.021  -13.861 -11.468 1.00 0.00 ? 11  ASP A OD1  3  
ATOM 3819  O OD2  . ASP A 1 11  ? 0.059   -13.931 -12.174 1.00 0.00 ? 11  ASP A OD2  3  
ATOM 3820  H H    . ASP A 1 11  ? -0.145  -11.421 -15.067 1.00 0.00 ? 11  ASP A H    3  
ATOM 3821  H HA   . ASP A 1 11  ? -2.593  -12.616 -13.942 1.00 0.00 ? 11  ASP A HA   3  
ATOM 3822  H HB2  . ASP A 1 11  ? -0.161  -11.496 -12.611 1.00 0.00 ? 11  ASP A HB2  3  
ATOM 3823  H HB3  . ASP A 1 11  ? -1.718  -11.343 -11.803 1.00 0.00 ? 11  ASP A HB3  3  
ATOM 3824  N N    . PRO A 1 12  ? -3.801  -10.411 -13.575 1.00 0.00 ? 12  PRO A N    3  
ATOM 3825  C CA   . PRO A 1 12  ? -4.600  -9.184  -13.649 1.00 0.00 ? 12  PRO A CA   3  
ATOM 3826  C C    . PRO A 1 12  ? -4.086  -8.100  -12.707 1.00 0.00 ? 12  PRO A C    3  
ATOM 3827  O O    . PRO A 1 12  ? -3.993  -6.931  -13.081 1.00 0.00 ? 12  PRO A O    3  
ATOM 3828  C CB   . PRO A 1 12  ? -5.997  -9.643  -13.225 1.00 0.00 ? 12  PRO A CB   3  
ATOM 3829  C CG   . PRO A 1 12  ? -5.759  -10.845 -12.377 1.00 0.00 ? 12  PRO A CG   3  
ATOM 3830  C CD   . PRO A 1 12  ? -4.540  -11.518 -12.946 1.00 0.00 ? 12  PRO A CD   3  
ATOM 3831  H HA   . PRO A 1 12  ? -4.637  -8.795  -14.656 1.00 0.00 ? 12  PRO A HA   3  
ATOM 3832  H HB2  . PRO A 1 12  ? -6.484  -8.856  -12.667 1.00 0.00 ? 12  PRO A HB2  3  
ATOM 3833  H HB3  . PRO A 1 12  ? -6.581  -9.886  -14.100 1.00 0.00 ? 12  PRO A HB3  3  
ATOM 3834  H HG2  . PRO A 1 12  ? -5.580  -10.545 -11.356 1.00 0.00 ? 12  PRO A HG2  3  
ATOM 3835  H HG3  . PRO A 1 12  ? -6.611  -11.506 -12.432 1.00 0.00 ? 12  PRO A HG3  3  
ATOM 3836  H HD2  . PRO A 1 12  ? -3.958  -11.972 -12.158 1.00 0.00 ? 12  PRO A HD2  3  
ATOM 3837  H HD3  . PRO A 1 12  ? -4.826  -12.257 -13.681 1.00 0.00 ? 12  PRO A HD3  3  
ATOM 3838  N N    . HIS A 1 13  ? -3.754  -8.496  -11.482 1.00 0.00 ? 13  HIS A N    3  
ATOM 3839  C CA   . HIS A 1 13  ? -3.249  -7.558  -10.486 1.00 0.00 ? 13  HIS A CA   3  
ATOM 3840  C C    . HIS A 1 13  ? -2.019  -6.821  -11.008 1.00 0.00 ? 13  HIS A C    3  
ATOM 3841  O O    . HIS A 1 13  ? -1.819  -5.643  -10.714 1.00 0.00 ? 13  HIS A O    3  
ATOM 3842  C CB   . HIS A 1 13  ? -2.905  -8.293  -9.190  1.00 0.00 ? 13  HIS A CB   3  
ATOM 3843  C CG   . HIS A 1 13  ? -4.094  -8.553  -8.316  1.00 0.00 ? 13  HIS A CG   3  
ATOM 3844  N ND1  . HIS A 1 13  ? -4.136  -9.572  -7.388  1.00 0.00 ? 13  HIS A ND1  3  
ATOM 3845  C CD2  . HIS A 1 13  ? -5.287  -7.919  -8.232  1.00 0.00 ? 13  HIS A CD2  3  
ATOM 3846  C CE1  . HIS A 1 13  ? -5.305  -9.555  -6.772  1.00 0.00 ? 13  HIS A CE1  3  
ATOM 3847  N NE2  . HIS A 1 13  ? -6.021  -8.561  -7.265  1.00 0.00 ? 13  HIS A NE2  3  
ATOM 3848  H H    . HIS A 1 13  ? -3.851  -9.441  -11.243 1.00 0.00 ? 13  HIS A H    3  
ATOM 3849  H HA   . HIS A 1 13  ? -4.027  -6.837  -10.285 1.00 0.00 ? 13  HIS A HA   3  
ATOM 3850  H HB2  . HIS A 1 13  ? -2.457  -9.246  -9.432  1.00 0.00 ? 13  HIS A HB2  3  
ATOM 3851  H HB3  . HIS A 1 13  ? -2.200  -7.702  -8.624  1.00 0.00 ? 13  HIS A HB3  3  
ATOM 3852  H HD1  . HIS A 1 13  ? -3.418  -10.213 -7.209  1.00 0.00 ? 13  HIS A HD1  3  
ATOM 3853  H HD2  . HIS A 1 13  ? -5.603  -7.067  -8.817  1.00 0.00 ? 13  HIS A HD2  3  
ATOM 3854  H HE1  . HIS A 1 13  ? -5.621  -10.236 -5.996  1.00 0.00 ? 13  HIS A HE1  3  
ATOM 3855  N N    . GLU A 1 14  ? -1.199  -7.524  -11.783 1.00 0.00 ? 14  GLU A N    3  
ATOM 3856  C CA   . GLU A 1 14  ? 0.012   -6.936  -12.344 1.00 0.00 ? 14  GLU A CA   3  
ATOM 3857  C C    . GLU A 1 14  ? -0.309  -6.114  -13.589 1.00 0.00 ? 14  GLU A C    3  
ATOM 3858  O O    . GLU A 1 14  ? -1.355  -6.291  -14.210 1.00 0.00 ? 14  GLU A O    3  
ATOM 3859  C CB   . GLU A 1 14  ? 1.024   -8.030  -12.689 1.00 0.00 ? 14  GLU A CB   3  
ATOM 3860  C CG   . GLU A 1 14  ? 1.399   -8.908  -11.507 1.00 0.00 ? 14  GLU A CG   3  
ATOM 3861  C CD   . GLU A 1 14  ? 2.459   -9.935  -11.856 1.00 0.00 ? 14  GLU A CD   3  
ATOM 3862  O OE1  . GLU A 1 14  ? 3.436   -9.568  -12.542 1.00 0.00 ? 14  GLU A OE1  3  
ATOM 3863  O OE2  . GLU A 1 14  ? 2.312   -11.104 -11.443 1.00 0.00 ? 14  GLU A OE2  3  
ATOM 3864  H H    . GLU A 1 14  ? -1.413  -8.460  -11.981 1.00 0.00 ? 14  GLU A H    3  
ATOM 3865  H HA   . GLU A 1 14  ? 0.441   -6.285  -11.598 1.00 0.00 ? 14  GLU A HA   3  
ATOM 3866  H HB2  . GLU A 1 14  ? 0.606   -8.660  -13.461 1.00 0.00 ? 14  GLU A HB2  3  
ATOM 3867  H HB3  . GLU A 1 14  ? 1.924   -7.566  -13.065 1.00 0.00 ? 14  GLU A HB3  3  
ATOM 3868  H HG2  . GLU A 1 14  ? 1.775   -8.280  -10.714 1.00 0.00 ? 14  GLU A HG2  3  
ATOM 3869  H HG3  . GLU A 1 14  ? 0.515   -9.427  -11.165 1.00 0.00 ? 14  GLU A HG3  3  
ATOM 3870  N N    . GLY A 1 15  ? 0.601   -5.212  -13.945 1.00 0.00 ? 15  GLY A N    3  
ATOM 3871  C CA   . GLY A 1 15  ? 0.396   -4.374  -15.113 1.00 0.00 ? 15  GLY A CA   3  
ATOM 3872  C C    . GLY A 1 15  ? -0.149  -3.006  -14.757 1.00 0.00 ? 15  GLY A C    3  
ATOM 3873  O O    . GLY A 1 15  ? 0.056   -2.037  -15.489 1.00 0.00 ? 15  GLY A O    3  
ATOM 3874  H H    . GLY A 1 15  ? 1.417   -5.114  -13.411 1.00 0.00 ? 15  GLY A H    3  
ATOM 3875  H HA2  . GLY A 1 15  ? 1.340   -4.253  -15.625 1.00 0.00 ? 15  GLY A HA2  3  
ATOM 3876  H HA3  . GLY A 1 15  ? -0.301  -4.865  -15.776 1.00 0.00 ? 15  GLY A HA3  3  
ATOM 3877  N N    . LYS A 1 16  ? -0.848  -2.924  -13.630 1.00 0.00 ? 16  LYS A N    3  
ATOM 3878  C CA   . LYS A 1 16  ? -1.426  -1.664  -13.177 1.00 0.00 ? 16  LYS A CA   3  
ATOM 3879  C C    . LYS A 1 16  ? -0.351  -0.591  -13.037 1.00 0.00 ? 16  LYS A C    3  
ATOM 3880  O O    . LYS A 1 16  ? 0.844   -0.886  -13.087 1.00 0.00 ? 16  LYS A O    3  
ATOM 3881  C CB   . LYS A 1 16  ? -2.142  -1.860  -11.838 1.00 0.00 ? 16  LYS A CB   3  
ATOM 3882  C CG   . LYS A 1 16  ? -3.156  -2.991  -11.851 1.00 0.00 ? 16  LYS A CG   3  
ATOM 3883  C CD   . LYS A 1 16  ? -4.416  -2.602  -12.606 1.00 0.00 ? 16  LYS A CD   3  
ATOM 3884  C CE   . LYS A 1 16  ? -5.375  -3.775  -12.733 1.00 0.00 ? 16  LYS A CE   3  
ATOM 3885  N NZ   . LYS A 1 16  ? -6.792  -3.327  -12.829 1.00 0.00 ? 16  LYS A NZ   3  
ATOM 3886  H H    . LYS A 1 16  ? -0.977  -3.732  -13.088 1.00 0.00 ? 16  LYS A H    3  
ATOM 3887  H HA   . LYS A 1 16  ? -2.144  -1.344  -13.916 1.00 0.00 ? 16  LYS A HA   3  
ATOM 3888  H HB2  . LYS A 1 16  ? -1.406  -2.073  -11.078 1.00 0.00 ? 16  LYS A HB2  3  
ATOM 3889  H HB3  . LYS A 1 16  ? -2.657  -0.946  -11.583 1.00 0.00 ? 16  LYS A HB3  3  
ATOM 3890  H HG2  . LYS A 1 16  ? -2.715  -3.853  -12.330 1.00 0.00 ? 16  LYS A HG2  3  
ATOM 3891  H HG3  . LYS A 1 16  ? -3.419  -3.238  -10.832 1.00 0.00 ? 16  LYS A HG3  3  
ATOM 3892  H HD2  . LYS A 1 16  ? -4.912  -1.803  -12.074 1.00 0.00 ? 16  LYS A HD2  3  
ATOM 3893  H HD3  . LYS A 1 16  ? -4.143  -2.262  -13.595 1.00 0.00 ? 16  LYS A HD3  3  
ATOM 3894  H HE2  . LYS A 1 16  ? -5.123  -4.334  -13.621 1.00 0.00 ? 16  LYS A HE2  3  
ATOM 3895  H HE3  . LYS A 1 16  ? -5.264  -4.409  -11.866 1.00 0.00 ? 16  LYS A HE3  3  
ATOM 3896  H HZ1  . LYS A 1 16  ? -7.115  -3.372  -13.816 1.00 0.00 ? 16  LYS A HZ1  3  
ATOM 3897  H HZ2  . LYS A 1 16  ? -6.880  -2.347  -12.492 1.00 0.00 ? 16  LYS A HZ2  3  
ATOM 3898  H HZ3  . LYS A 1 16  ? -7.400  -3.938  -12.248 1.00 0.00 ? 16  LYS A HZ3  3  
ATOM 3899  N N    . ILE A 1 17  ? -0.783  0.653   -12.862 1.00 0.00 ? 17  ILE A N    3  
ATOM 3900  C CA   . ILE A 1 17  ? 0.144   1.768   -12.713 1.00 0.00 ? 17  ILE A CA   3  
ATOM 3901  C C    . ILE A 1 17  ? 0.429   2.054   -11.242 1.00 0.00 ? 17  ILE A C    3  
ATOM 3902  O O    . ILE A 1 17  ? 1.502   2.545   -10.892 1.00 0.00 ? 17  ILE A O    3  
ATOM 3903  C CB   . ILE A 1 17  ? -0.403  3.047   -13.375 1.00 0.00 ? 17  ILE A CB   3  
ATOM 3904  C CG1  . ILE A 1 17  ? 0.588   4.199   -13.206 1.00 0.00 ? 17  ILE A CG1  3  
ATOM 3905  C CG2  . ILE A 1 17  ? -1.756  3.413   -12.783 1.00 0.00 ? 17  ILE A CG2  3  
ATOM 3906  C CD1  . ILE A 1 17  ? 0.403   5.309   -14.217 1.00 0.00 ? 17  ILE A CD1  3  
ATOM 3907  H H    . ILE A 1 17  ? -1.747  0.824   -12.831 1.00 0.00 ? 17  ILE A H    3  
ATOM 3908  H HA   . ILE A 1 17  ? 1.069   1.501   -13.203 1.00 0.00 ? 17  ILE A HA   3  
ATOM 3909  H HB   . ILE A 1 17  ? -0.540  2.850   -14.428 1.00 0.00 ? 17  ILE A HB   3  
ATOM 3910  H HG12 . ILE A 1 17  ? 0.472   4.625   -12.222 1.00 0.00 ? 17  ILE A HG12 3  
ATOM 3911  H HG13 . ILE A 1 17  ? 1.594   3.818   -13.312 1.00 0.00 ? 17  ILE A HG13 3  
ATOM 3912  H HG21 . ILE A 1 17  ? -1.675  4.352   -12.254 1.00 0.00 ? 17  ILE A HG21 3  
ATOM 3913  H HG22 . ILE A 1 17  ? -2.482  3.509   -13.576 1.00 0.00 ? 17  ILE A HG22 3  
ATOM 3914  H HG23 . ILE A 1 17  ? -2.071  2.640   -12.098 1.00 0.00 ? 17  ILE A HG23 3  
ATOM 3915  H HD11 . ILE A 1 17  ? -0.577  5.230   -14.664 1.00 0.00 ? 17  ILE A HD11 3  
ATOM 3916  H HD12 . ILE A 1 17  ? 0.499   6.265   -13.724 1.00 0.00 ? 17  ILE A HD12 3  
ATOM 3917  H HD13 . ILE A 1 17  ? 1.156   5.224   -14.987 1.00 0.00 ? 17  ILE A HD13 3  
ATOM 3918  N N    . TRP A 1 18  ? -0.537  1.741   -10.387 1.00 0.00 ? 18  TRP A N    3  
ATOM 3919  C CA   . TRP A 1 18  ? -0.390  1.961   -8.953  1.00 0.00 ? 18  TRP A CA   3  
ATOM 3920  C C    . TRP A 1 18  ? 0.349   0.800   -8.296  1.00 0.00 ? 18  TRP A C    3  
ATOM 3921  O O    . TRP A 1 18  ? 1.149   0.998   -7.382  1.00 0.00 ? 18  TRP A O    3  
ATOM 3922  C CB   . TRP A 1 18  ? -1.761  2.144   -8.300  1.00 0.00 ? 18  TRP A CB   3  
ATOM 3923  C CG   . TRP A 1 18  ? -2.810  1.230   -8.856  1.00 0.00 ? 18  TRP A CG   3  
ATOM 3924  C CD1  . TRP A 1 18  ? -3.728  1.529   -9.822  1.00 0.00 ? 18  TRP A CD1  3  
ATOM 3925  C CD2  . TRP A 1 18  ? -3.050  -0.130  -8.479  1.00 0.00 ? 18  TRP A CD2  3  
ATOM 3926  N NE1  . TRP A 1 18  ? -4.524  0.436   -10.067 1.00 0.00 ? 18  TRP A NE1  3  
ATOM 3927  C CE2  . TRP A 1 18  ? -4.128  -0.595  -9.257  1.00 0.00 ? 18  TRP A CE2  3  
ATOM 3928  C CE3  . TRP A 1 18  ? -2.457  -1.001  -7.560  1.00 0.00 ? 18  TRP A CE3  3  
ATOM 3929  C CZ2  . TRP A 1 18  ? -4.624  -1.890  -9.142  1.00 0.00 ? 18  TRP A CZ2  3  
ATOM 3930  C CZ3  . TRP A 1 18  ? -2.951  -2.287  -7.448  1.00 0.00 ? 18  TRP A CZ3  3  
ATOM 3931  C CH2  . TRP A 1 18  ? -4.025  -2.722  -8.235  1.00 0.00 ? 18  TRP A CH2  3  
ATOM 3932  H H    . TRP A 1 18  ? -1.370  1.352   -10.727 1.00 0.00 ? 18  TRP A H    3  
ATOM 3933  H HA   . TRP A 1 18  ? 0.188   2.864   -8.815  1.00 0.00 ? 18  TRP A HA   3  
ATOM 3934  H HB2  . TRP A 1 18  ? -1.677  1.950   -7.241  1.00 0.00 ? 18  TRP A HB2  3  
ATOM 3935  H HB3  . TRP A 1 18  ? -2.090  3.162   -8.451  1.00 0.00 ? 18  TRP A HB3  3  
ATOM 3936  H HD1  . TRP A 1 18  ? -3.807  2.488   -10.311 1.00 0.00 ? 18  TRP A HD1  3  
ATOM 3937  H HE1  . TRP A 1 18  ? -5.256  0.400   -10.719 1.00 0.00 ? 18  TRP A HE1  3  
ATOM 3938  H HE3  . TRP A 1 18  ? -1.628  -0.684  -6.945  1.00 0.00 ? 18  TRP A HE3  3  
ATOM 3939  H HZ2  . TRP A 1 18  ? -5.451  -2.241  -9.742  1.00 0.00 ? 18  TRP A HZ2  3  
ATOM 3940  H HZ3  . TRP A 1 18  ? -2.506  -2.974  -6.743  1.00 0.00 ? 18  TRP A HZ3  3  
ATOM 3941  H HH2  . TRP A 1 18  ? -4.378  -3.734  -8.113  1.00 0.00 ? 18  TRP A HH2  3  
ATOM 3942  N N    . PHE A 1 19  ? 0.076   -0.412  -8.768  1.00 0.00 ? 19  PHE A N    3  
ATOM 3943  C CA   . PHE A 1 19  ? 0.715   -1.605  -8.226  1.00 0.00 ? 19  PHE A CA   3  
ATOM 3944  C C    . PHE A 1 19  ? 2.226   -1.553  -8.429  1.00 0.00 ? 19  PHE A C    3  
ATOM 3945  O O    . PHE A 1 19  ? 2.710   -1.473  -9.559  1.00 0.00 ? 19  PHE A O    3  
ATOM 3946  C CB   . PHE A 1 19  ? 0.143   -2.861  -8.887  1.00 0.00 ? 19  PHE A CB   3  
ATOM 3947  C CG   . PHE A 1 19  ? 0.670   -4.140  -8.303  1.00 0.00 ? 19  PHE A CG   3  
ATOM 3948  C CD1  . PHE A 1 19  ? 0.395   -4.482  -6.989  1.00 0.00 ? 19  PHE A CD1  3  
ATOM 3949  C CD2  . PHE A 1 19  ? 1.442   -5.000  -9.067  1.00 0.00 ? 19  PHE A CD2  3  
ATOM 3950  C CE1  . PHE A 1 19  ? 0.880   -5.657  -6.448  1.00 0.00 ? 19  PHE A CE1  3  
ATOM 3951  C CE2  . PHE A 1 19  ? 1.929   -6.178  -8.532  1.00 0.00 ? 19  PHE A CE2  3  
ATOM 3952  C CZ   . PHE A 1 19  ? 1.647   -6.507  -7.221  1.00 0.00 ? 19  PHE A CZ   3  
ATOM 3953  H H    . PHE A 1 19  ? -0.571  -0.505  -9.499  1.00 0.00 ? 19  PHE A H    3  
ATOM 3954  H HA   . PHE A 1 19  ? 0.507   -1.639  -7.168  1.00 0.00 ? 19  PHE A HA   3  
ATOM 3955  H HB2  . PHE A 1 19  ? -0.931  -2.862  -8.773  1.00 0.00 ? 19  PHE A HB2  3  
ATOM 3956  H HB3  . PHE A 1 19  ? 0.388   -2.849  -9.938  1.00 0.00 ? 19  PHE A HB3  3  
ATOM 3957  H HD1  . PHE A 1 19  ? -0.206  -3.819  -6.383  1.00 0.00 ? 19  PHE A HD1  3  
ATOM 3958  H HD2  . PHE A 1 19  ? 1.663   -4.743  -10.094 1.00 0.00 ? 19  PHE A HD2  3  
ATOM 3959  H HE1  . PHE A 1 19  ? 0.657   -5.913  -5.423  1.00 0.00 ? 19  PHE A HE1  3  
ATOM 3960  H HE2  . PHE A 1 19  ? 2.528   -6.839  -9.139  1.00 0.00 ? 19  PHE A HE2  3  
ATOM 3961  H HZ   . PHE A 1 19  ? 2.027   -7.426  -6.801  1.00 0.00 ? 19  PHE A HZ   3  
ATOM 3962  N N    . HIS A 1 20  ? 2.968   -1.599  -7.327  1.00 0.00 ? 20  HIS A N    3  
ATOM 3963  C CA   . HIS A 1 20  ? 4.424   -1.557  -7.383  1.00 0.00 ? 20  HIS A CA   3  
ATOM 3964  C C    . HIS A 1 20  ? 5.028   -2.820  -6.776  1.00 0.00 ? 20  HIS A C    3  
ATOM 3965  O O    . HIS A 1 20  ? 5.260   -2.891  -5.570  1.00 0.00 ? 20  HIS A O    3  
ATOM 3966  C CB   . HIS A 1 20  ? 4.949   -0.323  -6.648  1.00 0.00 ? 20  HIS A CB   3  
ATOM 3967  C CG   . HIS A 1 20  ? 5.022   0.901   -7.509  1.00 0.00 ? 20  HIS A CG   3  
ATOM 3968  N ND1  . HIS A 1 20  ? 6.006   1.098   -8.455  1.00 0.00 ? 20  HIS A ND1  3  
ATOM 3969  C CD2  . HIS A 1 20  ? 4.225   1.993   -7.564  1.00 0.00 ? 20  HIS A CD2  3  
ATOM 3970  C CE1  . HIS A 1 20  ? 5.812   2.260   -9.053  1.00 0.00 ? 20  HIS A CE1  3  
ATOM 3971  N NE2  . HIS A 1 20  ? 4.737   2.823   -8.531  1.00 0.00 ? 20  HIS A NE2  3  
ATOM 3972  H H    . HIS A 1 20  ? 2.524   -1.662  -6.456  1.00 0.00 ? 20  HIS A H    3  
ATOM 3973  H HA   . HIS A 1 20  ? 4.715   -1.497  -8.421  1.00 0.00 ? 20  HIS A HA   3  
ATOM 3974  H HB2  . HIS A 1 20  ? 4.297   -0.104  -5.816  1.00 0.00 ? 20  HIS A HB2  3  
ATOM 3975  H HB3  . HIS A 1 20  ? 5.943   -0.528  -6.277  1.00 0.00 ? 20  HIS A HB3  3  
ATOM 3976  H HD1  . HIS A 1 20  ? 6.738   0.479   -8.656  1.00 0.00 ? 20  HIS A HD1  3  
ATOM 3977  H HD2  . HIS A 1 20  ? 3.348   2.179   -6.959  1.00 0.00 ? 20  HIS A HD2  3  
ATOM 3978  H HE1  . HIS A 1 20  ? 6.426   2.678   -9.836  1.00 0.00 ? 20  HIS A HE1  3  
ATOM 3979  N N    . GLY A 1 21  ? 5.280   -3.815  -7.621  1.00 0.00 ? 21  GLY A N    3  
ATOM 3980  C CA   . GLY A 1 21  ? 5.853   -5.062  -7.149  1.00 0.00 ? 21  GLY A CA   3  
ATOM 3981  C C    . GLY A 1 21  ? 7.330   -5.179  -7.469  1.00 0.00 ? 21  GLY A C    3  
ATOM 3982  O O    . GLY A 1 21  ? 8.000   -6.106  -7.015  1.00 0.00 ? 21  GLY A O    3  
ATOM 3983  H H    . GLY A 1 21  ? 5.074   -3.702  -8.573  1.00 0.00 ? 21  GLY A H    3  
ATOM 3984  H HA2  . GLY A 1 21  ? 5.721   -5.124  -6.080  1.00 0.00 ? 21  GLY A HA2  3  
ATOM 3985  H HA3  . GLY A 1 21  ? 5.330   -5.884  -7.615  1.00 0.00 ? 21  GLY A HA3  3  
ATOM 3986  N N    . LYS A 1 22  ? 7.840   -4.236  -8.255  1.00 0.00 ? 22  LYS A N    3  
ATOM 3987  C CA   . LYS A 1 22  ? 9.247   -4.236  -8.636  1.00 0.00 ? 22  LYS A CA   3  
ATOM 3988  C C    . LYS A 1 22  ? 10.094  -3.519  -7.590  1.00 0.00 ? 22  LYS A C    3  
ATOM 3989  O O    . LYS A 1 22  ? 11.203  -3.952  -7.273  1.00 0.00 ? 22  LYS A O    3  
ATOM 3990  C CB   . LYS A 1 22  ? 9.427   -3.566  -10.000 1.00 0.00 ? 22  LYS A CB   3  
ATOM 3991  C CG   . LYS A 1 22  ? 9.141   -4.488  -11.173 1.00 0.00 ? 22  LYS A CG   3  
ATOM 3992  C CD   . LYS A 1 22  ? 7.649   -4.707  -11.360 1.00 0.00 ? 22  LYS A CD   3  
ATOM 3993  C CE   . LYS A 1 22  ? 7.018   -3.586  -12.172 1.00 0.00 ? 22  LYS A CE   3  
ATOM 3994  N NZ   . LYS A 1 22  ? 6.647   -2.424  -11.318 1.00 0.00 ? 22  LYS A NZ   3  
ATOM 3995  H H    . LYS A 1 22  ? 7.255   -3.522  -8.586  1.00 0.00 ? 22  LYS A H    3  
ATOM 3996  H HA   . LYS A 1 22  ? 9.572   -5.263  -8.704  1.00 0.00 ? 22  LYS A HA   3  
ATOM 3997  H HB2  . LYS A 1 22  ? 8.759   -2.720  -10.063 1.00 0.00 ? 22  LYS A HB2  3  
ATOM 3998  H HB3  . LYS A 1 22  ? 10.446  -3.217  -10.085 1.00 0.00 ? 22  LYS A HB3  3  
ATOM 3999  H HG2  . LYS A 1 22  ? 9.544   -4.047  -12.073 1.00 0.00 ? 22  LYS A HG2  3  
ATOM 4000  H HG3  . LYS A 1 22  ? 9.616   -5.442  -10.994 1.00 0.00 ? 22  LYS A HG3  3  
ATOM 4001  H HD2  . LYS A 1 22  ? 7.493   -5.642  -11.876 1.00 0.00 ? 22  LYS A HD2  3  
ATOM 4002  H HD3  . LYS A 1 22  ? 7.176   -4.747  -10.389 1.00 0.00 ? 22  LYS A HD3  3  
ATOM 4003  H HE2  . LYS A 1 22  ? 7.724   -3.261  -12.921 1.00 0.00 ? 22  LYS A HE2  3  
ATOM 4004  H HE3  . LYS A 1 22  ? 6.130   -3.966  -12.655 1.00 0.00 ? 22  LYS A HE3  3  
ATOM 4005  H HZ1  . LYS A 1 22  ? 7.454   -1.772  -11.232 1.00 0.00 ? 22  LYS A HZ1  3  
ATOM 4006  H HZ2  . LYS A 1 22  ? 6.377   -2.750  -10.369 1.00 0.00 ? 22  LYS A HZ2  3  
ATOM 4007  H HZ3  . LYS A 1 22  ? 5.845   -1.913  -11.739 1.00 0.00 ? 22  LYS A HZ3  3  
ATOM 4008  N N    . ILE A 1 23  ? 9.566   -2.423  -7.057  1.00 0.00 ? 23  ILE A N    3  
ATOM 4009  C CA   . ILE A 1 23  ? 10.273  -1.649  -6.045  1.00 0.00 ? 23  ILE A CA   3  
ATOM 4010  C C    . ILE A 1 23  ? 10.038  -2.221  -4.651  1.00 0.00 ? 23  ILE A C    3  
ATOM 4011  O O    . ILE A 1 23  ? 9.271   -3.168  -4.479  1.00 0.00 ? 23  ILE A O    3  
ATOM 4012  C CB   . ILE A 1 23  ? 9.838   -0.171  -6.061  1.00 0.00 ? 23  ILE A CB   3  
ATOM 4013  C CG1  . ILE A 1 23  ? 8.521   0.004   -5.303  1.00 0.00 ? 23  ILE A CG1  3  
ATOM 4014  C CG2  . ILE A 1 23  ? 9.702   0.325   -7.493  1.00 0.00 ? 23  ILE A CG2  3  
ATOM 4015  C CD1  . ILE A 1 23  ? 8.705   0.371   -3.847  1.00 0.00 ? 23  ILE A CD1  3  
ATOM 4016  H H    . ILE A 1 23  ? 8.678   -2.129  -7.351  1.00 0.00 ? 23  ILE A H    3  
ATOM 4017  H HA   . ILE A 1 23  ? 11.329  -1.695  -6.268  1.00 0.00 ? 23  ILE A HA   3  
ATOM 4018  H HB   . ILE A 1 23  ? 10.605  0.412   -5.575  1.00 0.00 ? 23  ILE A HB   3  
ATOM 4019  H HG12 . ILE A 1 23  ? 7.944   0.786   -5.771  1.00 0.00 ? 23  ILE A HG12 3  
ATOM 4020  H HG13 . ILE A 1 23  ? 7.965   -0.922  -5.345  1.00 0.00 ? 23  ILE A HG13 3  
ATOM 4021  H HG21 . ILE A 1 23  ? 9.098   -0.369  -8.058  1.00 0.00 ? 23  ILE A HG21 3  
ATOM 4022  H HG22 . ILE A 1 23  ? 9.229   1.296   -7.493  1.00 0.00 ? 23  ILE A HG22 3  
ATOM 4023  H HG23 . ILE A 1 23  ? 10.681  0.400   -7.943  1.00 0.00 ? 23  ILE A HG23 3  
ATOM 4024  H HD11 . ILE A 1 23  ? 8.534   -0.500  -3.232  1.00 0.00 ? 23  ILE A HD11 3  
ATOM 4025  H HD12 . ILE A 1 23  ? 9.711   0.731   -3.691  1.00 0.00 ? 23  ILE A HD12 3  
ATOM 4026  H HD13 . ILE A 1 23  ? 8.000   1.144   -3.579  1.00 0.00 ? 23  ILE A HD13 3  
ATOM 4027  N N    . SER A 1 24  ? 10.703  -1.638  -3.659  1.00 0.00 ? 24  SER A N    3  
ATOM 4028  C CA   . SER A 1 24  ? 10.568  -2.091  -2.279  1.00 0.00 ? 24  SER A CA   3  
ATOM 4029  C C    . SER A 1 24  ? 10.053  -0.967  -1.386  1.00 0.00 ? 24  SER A C    3  
ATOM 4030  O O    . SER A 1 24  ? 10.295  0.211   -1.648  1.00 0.00 ? 24  SER A O    3  
ATOM 4031  C CB   . SER A 1 24  ? 11.912  -2.600  -1.754  1.00 0.00 ? 24  SER A CB   3  
ATOM 4032  O OG   . SER A 1 24  ? 12.314  -3.776  -2.435  1.00 0.00 ? 24  SER A OG   3  
ATOM 4033  H H    . SER A 1 24  ? 11.300  -0.888  -3.860  1.00 0.00 ? 24  SER A H    3  
ATOM 4034  H HA   . SER A 1 24  ? 9.855   -2.902  -2.264  1.00 0.00 ? 24  SER A HA   3  
ATOM 4035  H HB2  . SER A 1 24  ? 12.664  -1.839  -1.899  1.00 0.00 ? 24  SER A HB2  3  
ATOM 4036  H HB3  . SER A 1 24  ? 11.822  -2.822  -0.700  1.00 0.00 ? 24  SER A HB3  3  
ATOM 4037  H HG   . SER A 1 24  ? 12.145  -4.541  -1.881  1.00 0.00 ? 24  SER A HG   3  
ATOM 4038  N N    . LYS A 1 25  ? 9.339   -1.340  -0.329  1.00 0.00 ? 25  LYS A N    3  
ATOM 4039  C CA   . LYS A 1 25  ? 8.789   -0.365  0.606   1.00 0.00 ? 25  LYS A CA   3  
ATOM 4040  C C    . LYS A 1 25  ? 9.713   0.842   0.740   1.00 0.00 ? 25  LYS A C    3  
ATOM 4041  O O    . LYS A 1 25  ? 9.318   1.971   0.452   1.00 0.00 ? 25  LYS A O    3  
ATOM 4042  C CB   . LYS A 1 25  ? 8.572   -1.009  1.977   1.00 0.00 ? 25  LYS A CB   3  
ATOM 4043  C CG   . LYS A 1 25  ? 8.126   -0.027  3.046   1.00 0.00 ? 25  LYS A CG   3  
ATOM 4044  C CD   . LYS A 1 25  ? 7.661   -0.744  4.303   1.00 0.00 ? 25  LYS A CD   3  
ATOM 4045  C CE   . LYS A 1 25  ? 7.120   0.234   5.334   1.00 0.00 ? 25  LYS A CE   3  
ATOM 4046  N NZ   . LYS A 1 25  ? 8.203   0.798   6.187   1.00 0.00 ? 25  LYS A NZ   3  
ATOM 4047  H H    . LYS A 1 25  ? 9.179   -2.294  -0.173  1.00 0.00 ? 25  LYS A H    3  
ATOM 4048  H HA   . LYS A 1 25  ? 7.838   -0.034  0.218   1.00 0.00 ? 25  LYS A HA   3  
ATOM 4049  H HB2  . LYS A 1 25  ? 7.818   -1.776  1.886   1.00 0.00 ? 25  LYS A HB2  3  
ATOM 4050  H HB3  . LYS A 1 25  ? 9.498   -1.463  2.299   1.00 0.00 ? 25  LYS A HB3  3  
ATOM 4051  H HG2  . LYS A 1 25  ? 8.955   0.618   3.299   1.00 0.00 ? 25  LYS A HG2  3  
ATOM 4052  H HG3  . LYS A 1 25  ? 7.310   0.567   2.659   1.00 0.00 ? 25  LYS A HG3  3  
ATOM 4053  H HD2  . LYS A 1 25  ? 6.880   -1.441  4.041   1.00 0.00 ? 25  LYS A HD2  3  
ATOM 4054  H HD3  . LYS A 1 25  ? 8.496   -1.279  4.731   1.00 0.00 ? 25  LYS A HD3  3  
ATOM 4055  H HE2  . LYS A 1 25  ? 6.622   1.042   4.820   1.00 0.00 ? 25  LYS A HE2  3  
ATOM 4056  H HE3  . LYS A 1 25  ? 6.410   -0.283  5.964   1.00 0.00 ? 25  LYS A HE3  3  
ATOM 4057  H HZ1  . LYS A 1 25  ? 7.956   1.763   6.487   1.00 0.00 ? 25  LYS A HZ1  3  
ATOM 4058  H HZ2  . LYS A 1 25  ? 9.096   0.830   5.655   1.00 0.00 ? 25  LYS A HZ2  3  
ATOM 4059  H HZ3  . LYS A 1 25  ? 8.337   0.207   7.032   1.00 0.00 ? 25  LYS A HZ3  3  
ATOM 4060  N N    . GLN A 1 26  ? 10.943  0.594   1.177   1.00 0.00 ? 26  GLN A N    3  
ATOM 4061  C CA   . GLN A 1 26  ? 11.922  1.661   1.348   1.00 0.00 ? 26  GLN A CA   3  
ATOM 4062  C C    . GLN A 1 26  ? 11.855  2.651   0.190   1.00 0.00 ? 26  GLN A C    3  
ATOM 4063  O O    . GLN A 1 26  ? 11.789  3.862   0.400   1.00 0.00 ? 26  GLN A O    3  
ATOM 4064  C CB   . GLN A 1 26  ? 13.332  1.077   1.454   1.00 0.00 ? 26  GLN A CB   3  
ATOM 4065  C CG   . GLN A 1 26  ? 13.738  0.723   2.875   1.00 0.00 ? 26  GLN A CG   3  
ATOM 4066  C CD   . GLN A 1 26  ? 13.685  1.914   3.811   1.00 0.00 ? 26  GLN A CD   3  
ATOM 4067  O OE1  . GLN A 1 26  ? 13.657  3.064   3.370   1.00 0.00 ? 26  GLN A OE1  3  
ATOM 4068  N NE2  . GLN A 1 26  ? 13.670  1.646   5.111   1.00 0.00 ? 26  GLN A NE2  3  
ATOM 4069  H H    . GLN A 1 26  ? 11.198  -0.327  1.390   1.00 0.00 ? 26  GLN A H    3  
ATOM 4070  H HA   . GLN A 1 26  ? 11.688  2.182   2.264   1.00 0.00 ? 26  GLN A HA   3  
ATOM 4071  H HB2  . GLN A 1 26  ? 13.383  0.180   0.854   1.00 0.00 ? 26  GLN A HB2  3  
ATOM 4072  H HB3  . GLN A 1 26  ? 14.037  1.798   1.070   1.00 0.00 ? 26  GLN A HB3  3  
ATOM 4073  H HG2  . GLN A 1 26  ? 13.070  -0.038  3.248   1.00 0.00 ? 26  GLN A HG2  3  
ATOM 4074  H HG3  . GLN A 1 26  ? 14.748  0.339   2.862   1.00 0.00 ? 26  GLN A HG3  3  
ATOM 4075  H HE21 . GLN A 1 26  ? 13.696  0.706   5.390   1.00 0.00 ? 26  GLN A HE21 3  
ATOM 4076  H HE22 . GLN A 1 26  ? 13.637  2.396   5.739   1.00 0.00 ? 26  GLN A HE22 3  
ATOM 4077  N N    . GLU A 1 27  ? 11.873  2.128   -1.032  1.00 0.00 ? 27  GLU A N    3  
ATOM 4078  C CA   . GLU A 1 27  ? 11.816  2.968   -2.223  1.00 0.00 ? 27  GLU A CA   3  
ATOM 4079  C C    . GLU A 1 27  ? 10.475  3.690   -2.315  1.00 0.00 ? 27  GLU A C    3  
ATOM 4080  O O    . GLU A 1 27  ? 10.423  4.918   -2.381  1.00 0.00 ? 27  GLU A O    3  
ATOM 4081  C CB   . GLU A 1 27  ? 12.041  2.124   -3.480  1.00 0.00 ? 27  GLU A CB   3  
ATOM 4082  C CG   . GLU A 1 27  ? 13.505  1.972   -3.856  1.00 0.00 ? 27  GLU A CG   3  
ATOM 4083  C CD   . GLU A 1 27  ? 14.368  1.547   -2.684  1.00 0.00 ? 27  GLU A CD   3  
ATOM 4084  O OE1  . GLU A 1 27  ? 13.841  0.872   -1.774  1.00 0.00 ? 27  GLU A OE1  3  
ATOM 4085  O OE2  . GLU A 1 27  ? 15.568  1.889   -2.675  1.00 0.00 ? 27  GLU A OE2  3  
ATOM 4086  H H    . GLU A 1 27  ? 11.927  1.155   -1.135  1.00 0.00 ? 27  GLU A H    3  
ATOM 4087  H HA   . GLU A 1 27  ? 12.603  3.703   -2.149  1.00 0.00 ? 27  GLU A HA   3  
ATOM 4088  H HB2  . GLU A 1 27  ? 11.627  1.140   -3.317  1.00 0.00 ? 27  GLU A HB2  3  
ATOM 4089  H HB3  . GLU A 1 27  ? 11.525  2.589   -4.307  1.00 0.00 ? 27  GLU A HB3  3  
ATOM 4090  H HG2  . GLU A 1 27  ? 13.588  1.226   -4.633  1.00 0.00 ? 27  GLU A HG2  3  
ATOM 4091  H HG3  . GLU A 1 27  ? 13.869  2.918   -4.228  1.00 0.00 ? 27  GLU A HG3  3  
ATOM 4092  N N    . ALA A 1 28  ? 9.393   2.918   -2.320  1.00 0.00 ? 28  ALA A N    3  
ATOM 4093  C CA   . ALA A 1 28  ? 8.052   3.484   -2.403  1.00 0.00 ? 28  ALA A CA   3  
ATOM 4094  C C    . ALA A 1 28  ? 7.969   4.811   -1.657  1.00 0.00 ? 28  ALA A C    3  
ATOM 4095  O O    . ALA A 1 28  ? 7.263   5.728   -2.078  1.00 0.00 ? 28  ALA A O    3  
ATOM 4096  C CB   . ALA A 1 28  ? 7.030   2.501   -1.851  1.00 0.00 ? 28  ALA A CB   3  
ATOM 4097  H H    . ALA A 1 28  ? 9.499   1.946   -2.266  1.00 0.00 ? 28  ALA A H    3  
ATOM 4098  H HA   . ALA A 1 28  ? 7.825   3.653   -3.446  1.00 0.00 ? 28  ALA A HA   3  
ATOM 4099  H HB1  . ALA A 1 28  ? 7.540   1.723   -1.301  1.00 0.00 ? 28  ALA A HB1  3  
ATOM 4100  H HB2  . ALA A 1 28  ? 6.350   3.021   -1.192  1.00 0.00 ? 28  ALA A HB2  3  
ATOM 4101  H HB3  . ALA A 1 28  ? 6.476   2.061   -2.667  1.00 0.00 ? 28  ALA A HB3  3  
ATOM 4102  N N    . TYR A 1 29  ? 8.693   4.908   -0.548  1.00 0.00 ? 29  TYR A N    3  
ATOM 4103  C CA   . TYR A 1 29  ? 8.699   6.123   0.258   1.00 0.00 ? 29  TYR A CA   3  
ATOM 4104  C C    . TYR A 1 29  ? 9.336   7.280   -0.505  1.00 0.00 ? 29  TYR A C    3  
ATOM 4105  O O    . TYR A 1 29  ? 8.769   8.368   -0.591  1.00 0.00 ? 29  TYR A O    3  
ATOM 4106  C CB   . TYR A 1 29  ? 9.450   5.886   1.569   1.00 0.00 ? 29  TYR A CB   3  
ATOM 4107  C CG   . TYR A 1 29  ? 8.566   5.399   2.695   1.00 0.00 ? 29  TYR A CG   3  
ATOM 4108  C CD1  . TYR A 1 29  ? 7.682   6.261   3.333   1.00 0.00 ? 29  TYR A CD1  3  
ATOM 4109  C CD2  . TYR A 1 29  ? 8.614   4.077   3.120   1.00 0.00 ? 29  TYR A CD2  3  
ATOM 4110  C CE1  . TYR A 1 29  ? 6.873   5.820   4.362   1.00 0.00 ? 29  TYR A CE1  3  
ATOM 4111  C CE2  . TYR A 1 29  ? 7.808   3.628   4.148   1.00 0.00 ? 29  TYR A CE2  3  
ATOM 4112  C CZ   . TYR A 1 29  ? 6.939   4.503   4.765   1.00 0.00 ? 29  TYR A CZ   3  
ATOM 4113  O OH   . TYR A 1 29  ? 6.135   4.059   5.790   1.00 0.00 ? 29  TYR A OH   3  
ATOM 4114  H H    . TYR A 1 29  ? 9.236   4.143   -0.263  1.00 0.00 ? 29  TYR A H    3  
ATOM 4115  H HA   . TYR A 1 29  ? 7.673   6.376   0.483   1.00 0.00 ? 29  TYR A HA   3  
ATOM 4116  H HB2  . TYR A 1 29  ? 10.218  5.146   1.408   1.00 0.00 ? 29  TYR A HB2  3  
ATOM 4117  H HB3  . TYR A 1 29  ? 9.909   6.812   1.885   1.00 0.00 ? 29  TYR A HB3  3  
ATOM 4118  H HD1  . TYR A 1 29  ? 7.633   7.292   3.015   1.00 0.00 ? 29  TYR A HD1  3  
ATOM 4119  H HD2  . TYR A 1 29  ? 9.297   3.395   2.634   1.00 0.00 ? 29  TYR A HD2  3  
ATOM 4120  H HE1  . TYR A 1 29  ? 6.192   6.505   4.846   1.00 0.00 ? 29  TYR A HE1  3  
ATOM 4121  H HE2  . TYR A 1 29  ? 7.859   2.597   4.464   1.00 0.00 ? 29  TYR A HE2  3  
ATOM 4122  H HH   . TYR A 1 29  ? 5.356   4.618   5.850   1.00 0.00 ? 29  TYR A HH   3  
ATOM 4123  N N    . ASN A 1 30  ? 10.519  7.035   -1.059  1.00 0.00 ? 30  ASN A N    3  
ATOM 4124  C CA   . ASN A 1 30  ? 11.235  8.055   -1.815  1.00 0.00 ? 30  ASN A CA   3  
ATOM 4125  C C    . ASN A 1 30  ? 10.520  8.361   -3.128  1.00 0.00 ? 30  ASN A C    3  
ATOM 4126  O O    . ASN A 1 30  ? 10.718  9.421   -3.723  1.00 0.00 ? 30  ASN A O    3  
ATOM 4127  C CB   . ASN A 1 30  ? 12.669  7.600   -2.096  1.00 0.00 ? 30  ASN A CB   3  
ATOM 4128  C CG   . ASN A 1 30  ? 13.444  7.313   -0.825  1.00 0.00 ? 30  ASN A CG   3  
ATOM 4129  O OD1  . ASN A 1 30  ? 12.859  7.058   0.228   1.00 0.00 ? 30  ASN A OD1  3  
ATOM 4130  N ND2  . ASN A 1 30  ? 14.768  7.355   -0.917  1.00 0.00 ? 30  ASN A ND2  3  
ATOM 4131  H H    . ASN A 1 30  ? 10.921  6.147   -0.956  1.00 0.00 ? 30  ASN A H    3  
ATOM 4132  H HA   . ASN A 1 30  ? 11.263  8.953   -1.216  1.00 0.00 ? 30  ASN A HA   3  
ATOM 4133  H HB2  . ASN A 1 30  ? 12.643  6.698   -2.690  1.00 0.00 ? 30  ASN A HB2  3  
ATOM 4134  H HB3  . ASN A 1 30  ? 13.185  8.373   -2.645  1.00 0.00 ? 30  ASN A HB3  3  
ATOM 4135  H HD21 . ASN A 1 30  ? 15.165  7.565   -1.788  1.00 0.00 ? 30  ASN A HD21 3  
ATOM 4136  H HD22 . ASN A 1 30  ? 15.294  7.173   -0.111  1.00 0.00 ? 30  ASN A HD22 3  
ATOM 4137  N N    . LEU A 1 31  ? 9.688   7.426   -3.573  1.00 0.00 ? 31  LEU A N    3  
ATOM 4138  C CA   . LEU A 1 31  ? 8.942   7.595   -4.816  1.00 0.00 ? 31  LEU A CA   3  
ATOM 4139  C C    . LEU A 1 31  ? 7.843   8.640   -4.653  1.00 0.00 ? 31  LEU A C    3  
ATOM 4140  O O    . LEU A 1 31  ? 7.818   9.646   -5.364  1.00 0.00 ? 31  LEU A O    3  
ATOM 4141  C CB   . LEU A 1 31  ? 8.334   6.262   -5.253  1.00 0.00 ? 31  LEU A CB   3  
ATOM 4142  C CG   . LEU A 1 31  ? 9.278   5.295   -5.969  1.00 0.00 ? 31  LEU A CG   3  
ATOM 4143  C CD1  . LEU A 1 31  ? 8.589   3.963   -6.219  1.00 0.00 ? 31  LEU A CD1  3  
ATOM 4144  C CD2  . LEU A 1 31  ? 9.767   5.899   -7.278  1.00 0.00 ? 31  LEU A CD2  3  
ATOM 4145  H H    . LEU A 1 31  ? 9.572   6.603   -3.056  1.00 0.00 ? 31  LEU A H    3  
ATOM 4146  H HA   . LEU A 1 31  ? 9.634   7.932   -5.574  1.00 0.00 ? 31  LEU A HA   3  
ATOM 4147  H HB2  . LEU A 1 31  ? 7.958   5.765   -4.372  1.00 0.00 ? 31  LEU A HB2  3  
ATOM 4148  H HB3  . LEU A 1 31  ? 7.511   6.478   -5.921  1.00 0.00 ? 31  LEU A HB3  3  
ATOM 4149  H HG   . LEU A 1 31  ? 10.140  5.113   -5.342  1.00 0.00 ? 31  LEU A HG   3  
ATOM 4150  H HD11 . LEU A 1 31  ? 7.839   3.798   -5.461  1.00 0.00 ? 31  LEU A HD11 3  
ATOM 4151  H HD12 . LEU A 1 31  ? 9.319   3.168   -6.181  1.00 0.00 ? 31  LEU A HD12 3  
ATOM 4152  H HD13 . LEU A 1 31  ? 8.122   3.976   -7.193  1.00 0.00 ? 31  LEU A HD13 3  
ATOM 4153  H HD21 . LEU A 1 31  ? 10.832  6.066   -7.221  1.00 0.00 ? 31  LEU A HD21 3  
ATOM 4154  H HD22 . LEU A 1 31  ? 9.264   6.839   -7.451  1.00 0.00 ? 31  LEU A HD22 3  
ATOM 4155  H HD23 . LEU A 1 31  ? 9.552   5.220   -8.090  1.00 0.00 ? 31  LEU A HD23 3  
ATOM 4156  N N    . LEU A 1 32  ? 6.937   8.397   -3.713  1.00 0.00 ? 32  LEU A N    3  
ATOM 4157  C CA   . LEU A 1 32  ? 5.836   9.318   -3.454  1.00 0.00 ? 32  LEU A CA   3  
ATOM 4158  C C    . LEU A 1 32  ? 6.359   10.701  -3.082  1.00 0.00 ? 32  LEU A C    3  
ATOM 4159  O O    . LEU A 1 32  ? 5.604   11.672  -3.044  1.00 0.00 ? 32  LEU A O    3  
ATOM 4160  C CB   . LEU A 1 32  ? 4.946   8.778   -2.334  1.00 0.00 ? 32  LEU A CB   3  
ATOM 4161  C CG   . LEU A 1 32  ? 3.947   7.691   -2.734  1.00 0.00 ? 32  LEU A CG   3  
ATOM 4162  C CD1  . LEU A 1 32  ? 3.448   6.946   -1.506  1.00 0.00 ? 32  LEU A CD1  3  
ATOM 4163  C CD2  . LEU A 1 32  ? 2.782   8.296   -3.504  1.00 0.00 ? 32  LEU A CD2  3  
ATOM 4164  H H    . LEU A 1 32  ? 7.010   7.579   -3.178  1.00 0.00 ? 32  LEU A H    3  
ATOM 4165  H HA   . LEU A 1 32  ? 5.252   9.398   -4.359  1.00 0.00 ? 32  LEU A HA   3  
ATOM 4166  H HB2  . LEU A 1 32  ? 5.588   8.370   -1.568  1.00 0.00 ? 32  LEU A HB2  3  
ATOM 4167  H HB3  . LEU A 1 32  ? 4.387   9.609   -1.927  1.00 0.00 ? 32  LEU A HB3  3  
ATOM 4168  H HG   . LEU A 1 32  ? 4.441   6.978   -3.379  1.00 0.00 ? 32  LEU A HG   3  
ATOM 4169  H HD11 . LEU A 1 32  ? 3.812   7.436   -0.615  1.00 0.00 ? 32  LEU A HD11 3  
ATOM 4170  H HD12 . LEU A 1 32  ? 3.809   5.929   -1.531  1.00 0.00 ? 32  LEU A HD12 3  
ATOM 4171  H HD13 . LEU A 1 32  ? 2.368   6.944   -1.501  1.00 0.00 ? 32  LEU A HD13 3  
ATOM 4172  H HD21 . LEU A 1 32  ? 3.155   8.805   -4.380  1.00 0.00 ? 32  LEU A HD21 3  
ATOM 4173  H HD22 . LEU A 1 32  ? 2.261   9.001   -2.873  1.00 0.00 ? 32  LEU A HD22 3  
ATOM 4174  H HD23 . LEU A 1 32  ? 2.103   7.511   -3.804  1.00 0.00 ? 32  LEU A HD23 3  
ATOM 4175  N N    . MET A 1 33  ? 7.658   10.784  -2.810  1.00 0.00 ? 33  MET A N    3  
ATOM 4176  C CA   . MET A 1 33  ? 8.282   12.050  -2.444  1.00 0.00 ? 33  MET A CA   3  
ATOM 4177  C C    . MET A 1 33  ? 9.006   12.664  -3.638  1.00 0.00 ? 33  MET A C    3  
ATOM 4178  O O    . MET A 1 33  ? 9.148   13.884  -3.731  1.00 0.00 ? 33  MET A O    3  
ATOM 4179  C CB   . MET A 1 33  ? 9.264   11.843  -1.289  1.00 0.00 ? 33  MET A CB   3  
ATOM 4180  C CG   . MET A 1 33  ? 8.621   11.958  0.083   1.00 0.00 ? 33  MET A CG   3  
ATOM 4181  S SD   . MET A 1 33  ? 8.658   13.641  0.730   1.00 0.00 ? 33  MET A SD   3  
ATOM 4182  C CE   . MET A 1 33  ? 7.756   14.514  -0.548  1.00 0.00 ? 33  MET A CE   3  
ATOM 4183  H H    . MET A 1 33  ? 8.209   9.975   -2.857  1.00 0.00 ? 33  MET A H    3  
ATOM 4184  H HA   . MET A 1 33  ? 7.502   12.724  -2.125  1.00 0.00 ? 33  MET A HA   3  
ATOM 4185  H HB2  . MET A 1 33  ? 9.703   10.860  -1.376  1.00 0.00 ? 33  MET A HB2  3  
ATOM 4186  H HB3  . MET A 1 33  ? 10.046  12.585  -1.359  1.00 0.00 ? 33  MET A HB3  3  
ATOM 4187  H HG2  . MET A 1 33  ? 7.592   11.638  0.012   1.00 0.00 ? 33  MET A HG2  3  
ATOM 4188  H HG3  . MET A 1 33  ? 9.149   11.312  0.769   1.00 0.00 ? 33  MET A HG3  3  
ATOM 4189  H HE1  . MET A 1 33  ? 6.785   14.060  -0.678  1.00 0.00 ? 33  MET A HE1  3  
ATOM 4190  H HE2  . MET A 1 33  ? 7.635   15.548  -0.260  1.00 0.00 ? 33  MET A HE2  3  
ATOM 4191  H HE3  . MET A 1 33  ? 8.306   14.460  -1.477  1.00 0.00 ? 33  MET A HE3  3  
ATOM 4192  N N    . THR A 1 34  ? 9.463   11.811  -4.550  1.00 0.00 ? 34  THR A N    3  
ATOM 4193  C CA   . THR A 1 34  ? 10.173  12.270  -5.737  1.00 0.00 ? 34  THR A CA   3  
ATOM 4194  C C    . THR A 1 34  ? 9.248   12.317  -6.948  1.00 0.00 ? 34  THR A C    3  
ATOM 4195  O O    . THR A 1 34  ? 8.859   13.393  -7.403  1.00 0.00 ? 34  THR A O    3  
ATOM 4196  C CB   . THR A 1 34  ? 11.375  11.362  -6.059  1.00 0.00 ? 34  THR A CB   3  
ATOM 4197  O OG1  . THR A 1 34  ? 10.922  10.037  -6.356  1.00 0.00 ? 34  THR A OG1  3  
ATOM 4198  C CG2  . THR A 1 34  ? 12.350  11.321  -4.892  1.00 0.00 ? 34  THR A CG2  3  
ATOM 4199  H H    . THR A 1 34  ? 9.319   10.851  -4.420  1.00 0.00 ? 34  THR A H    3  
ATOM 4200  H HA   . THR A 1 34  ? 10.543  13.266  -5.540  1.00 0.00 ? 34  THR A HA   3  
ATOM 4201  H HB   . THR A 1 34  ? 11.887  11.762  -6.923  1.00 0.00 ? 34  THR A HB   3  
ATOM 4202  H HG1  . THR A 1 34  ? 10.922  9.511   -5.553  1.00 0.00 ? 34  THR A HG1  3  
ATOM 4203  H HG21 . THR A 1 34  ? 11.905  11.803  -4.034  1.00 0.00 ? 34  THR A HG21 3  
ATOM 4204  H HG22 . THR A 1 34  ? 13.259  11.836  -5.164  1.00 0.00 ? 34  THR A HG22 3  
ATOM 4205  H HG23 . THR A 1 34  ? 12.576  10.294  -4.649  1.00 0.00 ? 34  THR A HG23 3  
ATOM 4206  N N    . VAL A 1 35  ? 8.898   11.144  -7.465  1.00 0.00 ? 35  VAL A N    3  
ATOM 4207  C CA   . VAL A 1 35  ? 8.016   11.051  -8.622  1.00 0.00 ? 35  VAL A CA   3  
ATOM 4208  C C    . VAL A 1 35  ? 6.580   11.403  -8.249  1.00 0.00 ? 35  VAL A C    3  
ATOM 4209  O O    . VAL A 1 35  ? 5.922   12.183  -8.935  1.00 0.00 ? 35  VAL A O    3  
ATOM 4210  C CB   . VAL A 1 35  ? 8.044   9.640   -9.238  1.00 0.00 ? 35  VAL A CB   3  
ATOM 4211  C CG1  . VAL A 1 35  ? 9.418   9.335   -9.814  1.00 0.00 ? 35  VAL A CG1  3  
ATOM 4212  C CG2  . VAL A 1 35  ? 7.649   8.599   -8.201  1.00 0.00 ? 35  VAL A CG2  3  
ATOM 4213  H H    . VAL A 1 35  ? 9.240   10.321  -7.058  1.00 0.00 ? 35  VAL A H    3  
ATOM 4214  H HA   . VAL A 1 35  ? 8.366   11.753  -9.366  1.00 0.00 ? 35  VAL A HA   3  
ATOM 4215  H HB   . VAL A 1 35  ? 7.325   9.606   -10.043 1.00 0.00 ? 35  VAL A HB   3  
ATOM 4216  H HG11 . VAL A 1 35  ? 10.175  9.812   -9.208  1.00 0.00 ? 35  VAL A HG11 3  
ATOM 4217  H HG12 . VAL A 1 35  ? 9.578   8.267   -9.819  1.00 0.00 ? 35  VAL A HG12 3  
ATOM 4218  H HG13 . VAL A 1 35  ? 9.476   9.713   -10.824 1.00 0.00 ? 35  VAL A HG13 3  
ATOM 4219  H HG21 . VAL A 1 35  ? 8.287   8.694   -7.335  1.00 0.00 ? 35  VAL A HG21 3  
ATOM 4220  H HG22 . VAL A 1 35  ? 6.620   8.754   -7.908  1.00 0.00 ? 35  VAL A HG22 3  
ATOM 4221  H HG23 . VAL A 1 35  ? 7.758   7.611   -8.622  1.00 0.00 ? 35  VAL A HG23 3  
ATOM 4222  N N    . GLY A 1 36  ? 6.100   10.821  -7.154  1.00 0.00 ? 36  GLY A N    3  
ATOM 4223  C CA   . GLY A 1 36  ? 4.745   11.085  -6.707  1.00 0.00 ? 36  GLY A CA   3  
ATOM 4224  C C    . GLY A 1 36  ? 4.629   12.392  -5.947  1.00 0.00 ? 36  GLY A C    3  
ATOM 4225  O O    . GLY A 1 36  ? 5.637   13.010  -5.607  1.00 0.00 ? 36  GLY A O    3  
ATOM 4226  H H    . GLY A 1 36  ? 6.670   10.207  -6.646  1.00 0.00 ? 36  GLY A H    3  
ATOM 4227  H HA2  . GLY A 1 36  ? 4.094   11.122  -7.568  1.00 0.00 ? 36  GLY A HA2  3  
ATOM 4228  H HA3  . GLY A 1 36  ? 4.427   10.278  -6.063  1.00 0.00 ? 36  GLY A HA3  3  
ATOM 4229  N N    . GLN A 1 37  ? 3.396   12.813  -5.683  1.00 0.00 ? 37  GLN A N    3  
ATOM 4230  C CA   . GLN A 1 37  ? 3.154   14.056  -4.961  1.00 0.00 ? 37  GLN A CA   3  
ATOM 4231  C C    . GLN A 1 37  ? 1.783   14.039  -4.291  1.00 0.00 ? 37  GLN A C    3  
ATOM 4232  O O    . GLN A 1 37  ? 1.005   13.103  -4.473  1.00 0.00 ? 37  GLN A O    3  
ATOM 4233  C CB   . GLN A 1 37  ? 3.255   15.251  -5.911  1.00 0.00 ? 37  GLN A CB   3  
ATOM 4234  C CG   . GLN A 1 37  ? 3.555   16.564  -5.207  1.00 0.00 ? 37  GLN A CG   3  
ATOM 4235  C CD   . GLN A 1 37  ? 4.313   17.538  -6.087  1.00 0.00 ? 37  GLN A CD   3  
ATOM 4236  O OE1  . GLN A 1 37  ? 3.929   17.789  -7.230  1.00 0.00 ? 37  GLN A OE1  3  
ATOM 4237  N NE2  . GLN A 1 37  ? 5.397   18.094  -5.559  1.00 0.00 ? 37  GLN A NE2  3  
ATOM 4238  H H    . GLN A 1 37  ? 2.633   12.276  -5.980  1.00 0.00 ? 37  GLN A H    3  
ATOM 4239  H HA   . GLN A 1 37  ? 3.912   14.150  -4.198  1.00 0.00 ? 37  GLN A HA   3  
ATOM 4240  H HB2  . GLN A 1 37  ? 4.042   15.062  -6.625  1.00 0.00 ? 37  GLN A HB2  3  
ATOM 4241  H HB3  . GLN A 1 37  ? 2.319   15.356  -6.438  1.00 0.00 ? 37  GLN A HB3  3  
ATOM 4242  H HG2  . GLN A 1 37  ? 2.622   17.022  -4.912  1.00 0.00 ? 37  GLN A HG2  3  
ATOM 4243  H HG3  . GLN A 1 37  ? 4.148   16.359  -4.328  1.00 0.00 ? 37  GLN A HG3  3  
ATOM 4244  H HE21 . GLN A 1 37  ? 5.644   17.846  -4.643  1.00 0.00 ? 37  GLN A HE21 3  
ATOM 4245  H HE22 . GLN A 1 37  ? 5.907   18.727  -6.106  1.00 0.00 ? 37  GLN A HE22 3  
ATOM 4246  N N    . VAL A 1 38  ? 1.495   15.080  -3.517  1.00 0.00 ? 38  VAL A N    3  
ATOM 4247  C CA   . VAL A 1 38  ? 0.218   15.184  -2.821  1.00 0.00 ? 38  VAL A CA   3  
ATOM 4248  C C    . VAL A 1 38  ? -0.911  14.585  -3.651  1.00 0.00 ? 38  VAL A C    3  
ATOM 4249  O O    . VAL A 1 38  ? -0.934  14.719  -4.875  1.00 0.00 ? 38  VAL A O    3  
ATOM 4250  C CB   . VAL A 1 38  ? -0.123  16.649  -2.491  1.00 0.00 ? 38  VAL A CB   3  
ATOM 4251  C CG1  . VAL A 1 38  ? -1.242  16.719  -1.463  1.00 0.00 ? 38  VAL A CG1  3  
ATOM 4252  C CG2  . VAL A 1 38  ? 1.112   17.386  -1.998  1.00 0.00 ? 38  VAL A CG2  3  
ATOM 4253  H H    . VAL A 1 38  ? 2.157   15.795  -3.411  1.00 0.00 ? 38  VAL A H    3  
ATOM 4254  H HA   . VAL A 1 38  ? 0.298   14.638  -1.892  1.00 0.00 ? 38  VAL A HA   3  
ATOM 4255  H HB   . VAL A 1 38  ? -0.466  17.130  -3.396  1.00 0.00 ? 38  VAL A HB   3  
ATOM 4256  H HG11 . VAL A 1 38  ? -0.887  17.230  -0.580  1.00 0.00 ? 38  VAL A HG11 3  
ATOM 4257  H HG12 . VAL A 1 38  ? -2.081  17.257  -1.879  1.00 0.00 ? 38  VAL A HG12 3  
ATOM 4258  H HG13 . VAL A 1 38  ? -1.551  15.718  -1.199  1.00 0.00 ? 38  VAL A HG13 3  
ATOM 4259  H HG21 . VAL A 1 38  ? 0.813   18.299  -1.505  1.00 0.00 ? 38  VAL A HG21 3  
ATOM 4260  H HG22 . VAL A 1 38  ? 1.651   16.760  -1.300  1.00 0.00 ? 38  VAL A HG22 3  
ATOM 4261  H HG23 . VAL A 1 38  ? 1.751   17.621  -2.836  1.00 0.00 ? 38  VAL A HG23 3  
ATOM 4262  N N    . CYS A 1 39  ? -1.847  13.924  -2.978  1.00 0.00 ? 39  CYS A N    3  
ATOM 4263  C CA   . CYS A 1 39  ? -2.980  13.303  -3.654  1.00 0.00 ? 39  CYS A CA   3  
ATOM 4264  C C    . CYS A 1 39  ? -2.527  12.115  -4.496  1.00 0.00 ? 39  CYS A C    3  
ATOM 4265  O O    . CYS A 1 39  ? -3.072  11.858  -5.569  1.00 0.00 ? 39  CYS A O    3  
ATOM 4266  C CB   . CYS A 1 39  ? -3.697  14.326  -4.537  1.00 0.00 ? 39  CYS A CB   3  
ATOM 4267  S SG   . CYS A 1 39  ? -4.078  15.883  -3.702  1.00 0.00 ? 39  CYS A SG   3  
ATOM 4268  H H    . CYS A 1 39  ? -1.774  13.851  -2.003  1.00 0.00 ? 39  CYS A H    3  
ATOM 4269  H HA   . CYS A 1 39  ? -3.665  12.952  -2.897  1.00 0.00 ? 39  CYS A HA   3  
ATOM 4270  H HB2  . CYS A 1 39  ? -3.073  14.555  -5.389  1.00 0.00 ? 39  CYS A HB2  3  
ATOM 4271  H HB3  . CYS A 1 39  ? -4.627  13.901  -4.885  1.00 0.00 ? 39  CYS A HB3  3  
ATOM 4272  H HG   . CYS A 1 39  ? -3.400  15.914  -2.565  1.00 0.00 ? 39  CYS A HG   3  
ATOM 4273  N N    . SER A 1 40  ? -1.524  11.395  -4.003  1.00 0.00 ? 40  SER A N    3  
ATOM 4274  C CA   . SER A 1 40  ? -0.993  10.237  -4.713  1.00 0.00 ? 40  SER A CA   3  
ATOM 4275  C C    . SER A 1 40  ? -1.034  8.993   -3.830  1.00 0.00 ? 40  SER A C    3  
ATOM 4276  O O    . SER A 1 40  ? -0.807  9.068   -2.622  1.00 0.00 ? 40  SER A O    3  
ATOM 4277  C CB   . SER A 1 40  ? 0.442   10.506  -5.169  1.00 0.00 ? 40  SER A CB   3  
ATOM 4278  O OG   . SER A 1 40  ? 1.301   10.705  -4.060  1.00 0.00 ? 40  SER A OG   3  
ATOM 4279  H H    . SER A 1 40  ? -1.131  11.651  -3.142  1.00 0.00 ? 40  SER A H    3  
ATOM 4280  H HA   . SER A 1 40  ? -1.612  10.068  -5.581  1.00 0.00 ? 40  SER A HA   3  
ATOM 4281  H HB2  . SER A 1 40  ? 0.800   9.663   -5.740  1.00 0.00 ? 40  SER A HB2  3  
ATOM 4282  H HB3  . SER A 1 40  ? 0.460   11.393  -5.787  1.00 0.00 ? 40  SER A HB3  3  
ATOM 4283  H HG   . SER A 1 40  ? 1.878   11.452  -4.231  1.00 0.00 ? 40  SER A HG   3  
ATOM 4284  N N    . PHE A 1 41  ? -1.325  7.850   -4.442  1.00 0.00 ? 41  PHE A N    3  
ATOM 4285  C CA   . PHE A 1 41  ? -1.396  6.589   -3.713  1.00 0.00 ? 41  PHE A CA   3  
ATOM 4286  C C    . PHE A 1 41  ? -0.758  5.460   -4.517  1.00 0.00 ? 41  PHE A C    3  
ATOM 4287  O O    . PHE A 1 41  ? -0.587  5.567   -5.732  1.00 0.00 ? 41  PHE A O    3  
ATOM 4288  C CB   . PHE A 1 41  ? -2.852  6.244   -3.392  1.00 0.00 ? 41  PHE A CB   3  
ATOM 4289  C CG   . PHE A 1 41  ? -3.537  5.467   -4.480  1.00 0.00 ? 41  PHE A CG   3  
ATOM 4290  C CD1  . PHE A 1 41  ? -3.285  4.115   -4.648  1.00 0.00 ? 41  PHE A CD1  3  
ATOM 4291  C CD2  . PHE A 1 41  ? -4.433  6.088   -5.334  1.00 0.00 ? 41  PHE A CD2  3  
ATOM 4292  C CE1  . PHE A 1 41  ? -3.914  3.397   -5.647  1.00 0.00 ? 41  PHE A CE1  3  
ATOM 4293  C CE2  . PHE A 1 41  ? -5.066  5.375   -6.335  1.00 0.00 ? 41  PHE A CE2  3  
ATOM 4294  C CZ   . PHE A 1 41  ? -4.805  4.028   -6.492  1.00 0.00 ? 41  PHE A CZ   3  
ATOM 4295  H H    . PHE A 1 41  ? -1.496  7.855   -5.408  1.00 0.00 ? 41  PHE A H    3  
ATOM 4296  H HA   . PHE A 1 41  ? -0.852  6.710   -2.790  1.00 0.00 ? 41  PHE A HA   3  
ATOM 4297  H HB2  . PHE A 1 41  ? -2.883  5.650   -2.491  1.00 0.00 ? 41  PHE A HB2  3  
ATOM 4298  H HB3  . PHE A 1 41  ? -3.405  7.157   -3.236  1.00 0.00 ? 41  PHE A HB3  3  
ATOM 4299  H HD1  . PHE A 1 41  ? -2.587  3.619   -3.987  1.00 0.00 ? 41  PHE A HD1  3  
ATOM 4300  H HD2  . PHE A 1 41  ? -4.638  7.142   -5.213  1.00 0.00 ? 41  PHE A HD2  3  
ATOM 4301  H HE1  . PHE A 1 41  ? -3.707  2.343   -5.768  1.00 0.00 ? 41  PHE A HE1  3  
ATOM 4302  H HE2  . PHE A 1 41  ? -5.762  5.872   -6.994  1.00 0.00 ? 41  PHE A HE2  3  
ATOM 4303  H HZ   . PHE A 1 41  ? -5.298  3.469   -7.273  1.00 0.00 ? 41  PHE A HZ   3  
ATOM 4304  N N    . LEU A 1 42  ? -0.409  4.378   -3.830  1.00 0.00 ? 42  LEU A N    3  
ATOM 4305  C CA   . LEU A 1 42  ? 0.211   3.227   -4.478  1.00 0.00 ? 42  LEU A CA   3  
ATOM 4306  C C    . LEU A 1 42  ? 0.173   2.004   -3.568  1.00 0.00 ? 42  LEU A C    3  
ATOM 4307  O O    . LEU A 1 42  ? 0.180   2.128   -2.343  1.00 0.00 ? 42  LEU A O    3  
ATOM 4308  C CB   . LEU A 1 42  ? 1.657   3.549   -4.859  1.00 0.00 ? 42  LEU A CB   3  
ATOM 4309  C CG   . LEU A 1 42  ? 2.695   3.387   -3.749  1.00 0.00 ? 42  LEU A CG   3  
ATOM 4310  C CD1  . LEU A 1 42  ? 2.938   1.915   -3.456  1.00 0.00 ? 42  LEU A CD1  3  
ATOM 4311  C CD2  . LEU A 1 42  ? 3.996   4.079   -4.131  1.00 0.00 ? 42  LEU A CD2  3  
ATOM 4312  H H    . LEU A 1 42  ? -0.571  4.351   -2.864  1.00 0.00 ? 42  LEU A H    3  
ATOM 4313  H HA   . LEU A 1 42  ? -0.350  3.011   -5.375  1.00 0.00 ? 42  LEU A HA   3  
ATOM 4314  H HB2  . LEU A 1 42  ? 1.937   2.897   -5.672  1.00 0.00 ? 42  LEU A HB2  3  
ATOM 4315  H HB3  . LEU A 1 42  ? 1.688   4.575   -5.197  1.00 0.00 ? 42  LEU A HB3  3  
ATOM 4316  H HG   . LEU A 1 42  ? 2.322   3.850   -2.846  1.00 0.00 ? 42  LEU A HG   3  
ATOM 4317  H HD11 . LEU A 1 42  ? 2.723   1.332   -4.338  1.00 0.00 ? 42  LEU A HD11 3  
ATOM 4318  H HD12 . LEU A 1 42  ? 2.295   1.598   -2.648  1.00 0.00 ? 42  LEU A HD12 3  
ATOM 4319  H HD13 . LEU A 1 42  ? 3.970   1.771   -3.171  1.00 0.00 ? 42  LEU A HD13 3  
ATOM 4320  H HD21 . LEU A 1 42  ? 4.172   4.909   -3.462  1.00 0.00 ? 42  LEU A HD21 3  
ATOM 4321  H HD22 . LEU A 1 42  ? 3.926   4.443   -5.146  1.00 0.00 ? 42  LEU A HD22 3  
ATOM 4322  H HD23 . LEU A 1 42  ? 4.813   3.376   -4.056  1.00 0.00 ? 42  LEU A HD23 3  
ATOM 4323  N N    . VAL A 1 43  ? 0.135   0.822   -4.175  1.00 0.00 ? 43  VAL A N    3  
ATOM 4324  C CA   . VAL A 1 43  ? 0.100   -0.425  -3.420  1.00 0.00 ? 43  VAL A CA   3  
ATOM 4325  C C    . VAL A 1 43  ? 1.315   -1.291  -3.731  1.00 0.00 ? 43  VAL A C    3  
ATOM 4326  O O    . VAL A 1 43  ? 1.847   -1.255  -4.841  1.00 0.00 ? 43  VAL A O    3  
ATOM 4327  C CB   . VAL A 1 43  ? -1.180  -1.228  -3.721  1.00 0.00 ? 43  VAL A CB   3  
ATOM 4328  C CG1  . VAL A 1 43  ? -1.345  -2.364  -2.723  1.00 0.00 ? 43  VAL A CG1  3  
ATOM 4329  C CG2  . VAL A 1 43  ? -2.397  -0.315  -3.708  1.00 0.00 ? 43  VAL A CG2  3  
ATOM 4330  H H    . VAL A 1 43  ? 0.131   0.787   -5.154  1.00 0.00 ? 43  VAL A H    3  
ATOM 4331  H HA   . VAL A 1 43  ? 0.105   -0.178  -2.368  1.00 0.00 ? 43  VAL A HA   3  
ATOM 4332  H HB   . VAL A 1 43  ? -1.087  -1.656  -4.708  1.00 0.00 ? 43  VAL A HB   3  
ATOM 4333  H HG11 . VAL A 1 43  ? -0.911  -3.266  -3.130  1.00 0.00 ? 43  VAL A HG11 3  
ATOM 4334  H HG12 . VAL A 1 43  ? -0.847  -2.107  -1.800  1.00 0.00 ? 43  VAL A HG12 3  
ATOM 4335  H HG13 . VAL A 1 43  ? -2.396  -2.525  -2.533  1.00 0.00 ? 43  VAL A HG13 3  
ATOM 4336  H HG21 . VAL A 1 43  ? -3.270  -0.884  -3.426  1.00 0.00 ? 43  VAL A HG21 3  
ATOM 4337  H HG22 . VAL A 1 43  ? -2.242  0.482   -2.996  1.00 0.00 ? 43  VAL A HG22 3  
ATOM 4338  H HG23 . VAL A 1 43  ? -2.542  0.105   -4.692  1.00 0.00 ? 43  VAL A HG23 3  
ATOM 4339  N N    . ARG A 1 44  ? 1.750   -2.068  -2.745  1.00 0.00 ? 44  ARG A N    3  
ATOM 4340  C CA   . ARG A 1 44  ? 2.904   -2.943  -2.913  1.00 0.00 ? 44  ARG A CA   3  
ATOM 4341  C C    . ARG A 1 44  ? 2.789   -4.172  -2.016  1.00 0.00 ? 44  ARG A C    3  
ATOM 4342  O O    . ARG A 1 44  ? 2.313   -4.101  -0.883  1.00 0.00 ? 44  ARG A O    3  
ATOM 4343  C CB   . ARG A 1 44  ? 4.195   -2.186  -2.598  1.00 0.00 ? 44  ARG A CB   3  
ATOM 4344  C CG   . ARG A 1 44  ? 4.235   -1.610  -1.192  1.00 0.00 ? 44  ARG A CG   3  
ATOM 4345  C CD   . ARG A 1 44  ? 5.645   -1.197  -0.799  1.00 0.00 ? 44  ARG A CD   3  
ATOM 4346  N NE   . ARG A 1 44  ? 6.475   -2.347  -0.449  1.00 0.00 ? 44  ARG A NE   3  
ATOM 4347  C CZ   . ARG A 1 44  ? 6.270   -3.101  0.625   1.00 0.00 ? 44  ARG A CZ   3  
ATOM 4348  N NH1  . ARG A 1 44  ? 5.269   -2.828  1.450   1.00 0.00 ? 44  ARG A NH1  3  
ATOM 4349  N NH2  . ARG A 1 44  ? 7.069   -4.131  0.876   1.00 0.00 ? 44  ARG A NH2  3  
ATOM 4350  H H    . ARG A 1 44  ? 1.284   -2.052  -1.882  1.00 0.00 ? 44  ARG A H    3  
ATOM 4351  H HA   . ARG A 1 44  ? 2.928   -3.265  -3.943  1.00 0.00 ? 44  ARG A HA   3  
ATOM 4352  H HB2  . ARG A 1 44  ? 5.031   -2.861  -2.710  1.00 0.00 ? 44  ARG A HB2  3  
ATOM 4353  H HB3  . ARG A 1 44  ? 4.302   -1.373  -3.300  1.00 0.00 ? 44  ARG A HB3  3  
ATOM 4354  H HG2  . ARG A 1 44  ? 3.593   -0.742  -1.150  1.00 0.00 ? 44  ARG A HG2  3  
ATOM 4355  H HG3  . ARG A 1 44  ? 3.881   -2.356  -0.497  1.00 0.00 ? 44  ARG A HG3  3  
ATOM 4356  H HD2  . ARG A 1 44  ? 6.098   -0.678  -1.630  1.00 0.00 ? 44  ARG A HD2  3  
ATOM 4357  H HD3  . ARG A 1 44  ? 5.588   -0.534  0.052   1.00 0.00 ? 44  ARG A HD3  3  
ATOM 4358  H HE   . ARG A 1 44  ? 7.220   -2.566  -1.045  1.00 0.00 ? 44  ARG A HE   3  
ATOM 4359  H HH11 . ARG A 1 44  ? 4.665   -2.053  1.263   1.00 0.00 ? 44  ARG A HH11 3  
ATOM 4360  H HH12 . ARG A 1 44  ? 5.116   -3.398  2.257   1.00 0.00 ? 44  ARG A HH12 3  
ATOM 4361  H HH21 . ARG A 1 44  ? 7.824   -4.340  0.256   1.00 0.00 ? 44  ARG A HH21 3  
ATOM 4362  H HH22 . ARG A 1 44  ? 6.914   -4.698  1.684   1.00 0.00 ? 44  ARG A HH22 3  
ATOM 4363  N N    . PRO A 1 45  ? 3.236   -5.326  -2.533  1.00 0.00 ? 45  PRO A N    3  
ATOM 4364  C CA   . PRO A 1 45  ? 3.195   -6.592  -1.795  1.00 0.00 ? 45  PRO A CA   3  
ATOM 4365  C C    . PRO A 1 45  ? 4.181   -6.618  -0.632  1.00 0.00 ? 45  PRO A C    3  
ATOM 4366  O O    . PRO A 1 45  ? 5.369   -6.350  -0.808  1.00 0.00 ? 45  PRO A O    3  
ATOM 4367  C CB   . PRO A 1 45  ? 3.585   -7.630  -2.851  1.00 0.00 ? 45  PRO A CB   3  
ATOM 4368  C CG   . PRO A 1 45  ? 4.393   -6.872  -3.847  1.00 0.00 ? 45  PRO A CG   3  
ATOM 4369  C CD   . PRO A 1 45  ? 3.816   -5.484  -3.877  1.00 0.00 ? 45  PRO A CD   3  
ATOM 4370  H HA   . PRO A 1 45  ? 2.201   -6.806  -1.429  1.00 0.00 ? 45  PRO A HA   3  
ATOM 4371  H HB2  . PRO A 1 45  ? 4.164   -8.417  -2.388  1.00 0.00 ? 45  PRO A HB2  3  
ATOM 4372  H HB3  . PRO A 1 45  ? 2.695   -8.046  -3.299  1.00 0.00 ? 45  PRO A HB3  3  
ATOM 4373  H HG2  . PRO A 1 45  ? 5.426   -6.843  -3.536  1.00 0.00 ? 45  PRO A HG2  3  
ATOM 4374  H HG3  . PRO A 1 45  ? 4.305   -7.335  -4.819  1.00 0.00 ? 45  PRO A HG3  3  
ATOM 4375  H HD2  . PRO A 1 45  ? 4.595   -4.755  -4.049  1.00 0.00 ? 45  PRO A HD2  3  
ATOM 4376  H HD3  . PRO A 1 45  ? 3.053   -5.408  -4.637  1.00 0.00 ? 45  PRO A HD3  3  
ATOM 4377  N N    . SER A 1 46  ? 3.680   -6.943  0.555   1.00 0.00 ? 46  SER A N    3  
ATOM 4378  C CA   . SER A 1 46  ? 4.516   -7.001  1.748   1.00 0.00 ? 46  SER A CA   3  
ATOM 4379  C C    . SER A 1 46  ? 5.675   -7.974  1.552   1.00 0.00 ? 46  SER A C    3  
ATOM 4380  O O    . SER A 1 46  ? 5.499   -9.190  1.629   1.00 0.00 ? 46  SER A O    3  
ATOM 4381  C CB   . SER A 1 46  ? 3.683   -7.420  2.961   1.00 0.00 ? 46  SER A CB   3  
ATOM 4382  O OG   . SER A 1 46  ? 4.494   -7.549  4.116   1.00 0.00 ? 46  SER A OG   3  
ATOM 4383  H H    . SER A 1 46  ? 2.724   -7.147  0.631   1.00 0.00 ? 46  SER A H    3  
ATOM 4384  H HA   . SER A 1 46  ? 4.916   -6.013  1.920   1.00 0.00 ? 46  SER A HA   3  
ATOM 4385  H HB2  . SER A 1 46  ? 2.926   -6.674  3.149   1.00 0.00 ? 46  SER A HB2  3  
ATOM 4386  H HB3  . SER A 1 46  ? 3.211   -8.370  2.759   1.00 0.00 ? 46  SER A HB3  3  
ATOM 4387  H HG   . SER A 1 46  ? 3.971   -7.911  4.835   1.00 0.00 ? 46  SER A HG   3  
ATOM 4388  N N    . ASP A 1 47  ? 6.860   -7.429  1.298   1.00 0.00 ? 47  ASP A N    3  
ATOM 4389  C CA   . ASP A 1 47  ? 8.049   -8.247  1.091   1.00 0.00 ? 47  ASP A CA   3  
ATOM 4390  C C    . ASP A 1 47  ? 8.130   -9.360  2.132   1.00 0.00 ? 47  ASP A C    3  
ATOM 4391  O O    . ASP A 1 47  ? 8.150   -10.542 1.790   1.00 0.00 ? 47  ASP A O    3  
ATOM 4392  C CB   . ASP A 1 47  ? 9.308   -7.381  1.154   1.00 0.00 ? 47  ASP A CB   3  
ATOM 4393  C CG   . ASP A 1 47  ? 10.573  -8.178  0.904   1.00 0.00 ? 47  ASP A CG   3  
ATOM 4394  O OD1  . ASP A 1 47  ? 11.112  -8.754  1.871   1.00 0.00 ? 47  ASP A OD1  3  
ATOM 4395  O OD2  . ASP A 1 47  ? 11.024  -8.225  -0.260  1.00 0.00 ? 47  ASP A OD2  3  
ATOM 4396  H H    . ASP A 1 47  ? 6.936   -6.453  1.248   1.00 0.00 ? 47  ASP A H    3  
ATOM 4397  H HA   . ASP A 1 47  ? 7.979   -8.693  0.111   1.00 0.00 ? 47  ASP A HA   3  
ATOM 4398  H HB2  . ASP A 1 47  ? 9.240   -6.604  0.407   1.00 0.00 ? 47  ASP A HB2  3  
ATOM 4399  H HB3  . ASP A 1 47  ? 9.377   -6.928  2.133   1.00 0.00 ? 47  ASP A HB3  3  
ATOM 4400  N N    . ASN A 1 48  ? 8.178   -8.974  3.402   1.00 0.00 ? 48  ASN A N    3  
ATOM 4401  C CA   . ASN A 1 48  ? 8.259   -9.939  4.492   1.00 0.00 ? 48  ASN A CA   3  
ATOM 4402  C C    . ASN A 1 48  ? 7.095   -10.923 4.435   1.00 0.00 ? 48  ASN A C    3  
ATOM 4403  O O    . ASN A 1 48  ? 7.284   -12.134 4.559   1.00 0.00 ? 48  ASN A O    3  
ATOM 4404  C CB   . ASN A 1 48  ? 8.265   -9.217  5.841   1.00 0.00 ? 48  ASN A CB   3  
ATOM 4405  C CG   . ASN A 1 48  ? 9.356   -8.167  5.931   1.00 0.00 ? 48  ASN A CG   3  
ATOM 4406  O OD1  . ASN A 1 48  ? 9.078   -6.976  6.070   1.00 0.00 ? 48  ASN A OD1  3  
ATOM 4407  N ND2  . ASN A 1 48  ? 10.607  -8.607  5.851   1.00 0.00 ? 48  ASN A ND2  3  
ATOM 4408  H H    . ASN A 1 48  ? 8.159   -8.016  3.612   1.00 0.00 ? 48  ASN A H    3  
ATOM 4409  H HA   . ASN A 1 48  ? 9.184   -10.486 4.383   1.00 0.00 ? 48  ASN A HA   3  
ATOM 4410  H HB2  . ASN A 1 48  ? 7.311   -8.729  5.986   1.00 0.00 ? 48  ASN A HB2  3  
ATOM 4411  H HB3  . ASN A 1 48  ? 8.419   -9.938  6.629   1.00 0.00 ? 48  ASN A HB3  3  
ATOM 4412  H HD21 . ASN A 1 48  ? 10.753  -9.569  5.740   1.00 0.00 ? 48  ASN A HD21 3  
ATOM 4413  H HD22 . ASN A 1 48  ? 11.332  -7.950  5.907   1.00 0.00 ? 48  ASN A HD22 3  
ATOM 4414  N N    . THR A 1 49  ? 5.890   -10.396 4.245   1.00 0.00 ? 49  THR A N    3  
ATOM 4415  C CA   . THR A 1 49  ? 4.695   -11.226 4.171   1.00 0.00 ? 49  THR A CA   3  
ATOM 4416  C C    . THR A 1 49  ? 4.207   -11.362 2.733   1.00 0.00 ? 49  THR A C    3  
ATOM 4417  O O    . THR A 1 49  ? 3.434   -10.544 2.234   1.00 0.00 ? 49  THR A O    3  
ATOM 4418  C CB   . THR A 1 49  ? 3.556   -10.651 5.035   1.00 0.00 ? 49  THR A CB   3  
ATOM 4419  O OG1  . THR A 1 49  ? 4.047   -10.330 6.341   1.00 0.00 ? 49  THR A OG1  3  
ATOM 4420  C CG2  . THR A 1 49  ? 2.409   -11.644 5.149   1.00 0.00 ? 49  THR A CG2  3  
ATOM 4421  H H    . THR A 1 49  ? 5.804   -9.424  4.153   1.00 0.00 ? 49  THR A H    3  
ATOM 4422  H HA   . THR A 1 49  ? 4.946   -12.206 4.550   1.00 0.00 ? 49  THR A HA   3  
ATOM 4423  H HB   . THR A 1 49  ? 3.188   -9.750  4.565   1.00 0.00 ? 49  THR A HB   3  
ATOM 4424  H HG1  . THR A 1 49  ? 3.358   -9.885  6.842   1.00 0.00 ? 49  THR A HG1  3  
ATOM 4425  H HG21 . THR A 1 49  ? 2.352   -12.233 4.246   1.00 0.00 ? 49  THR A HG21 3  
ATOM 4426  H HG22 . THR A 1 49  ? 1.482   -11.108 5.288   1.00 0.00 ? 49  THR A HG22 3  
ATOM 4427  H HG23 . THR A 1 49  ? 2.579   -12.294 5.993   1.00 0.00 ? 49  THR A HG23 3  
ATOM 4428  N N    . PRO A 1 50  ? 4.667   -12.420 2.049   1.00 0.00 ? 50  PRO A N    3  
ATOM 4429  C CA   . PRO A 1 50  ? 4.289   -12.688 0.658   1.00 0.00 ? 50  PRO A CA   3  
ATOM 4430  C C    . PRO A 1 50  ? 2.831   -13.113 0.525   1.00 0.00 ? 50  PRO A C    3  
ATOM 4431  O O    . PRO A 1 50  ? 2.507   -14.295 0.626   1.00 0.00 ? 50  PRO A O    3  
ATOM 4432  C CB   . PRO A 1 50  ? 5.219   -13.835 0.253   1.00 0.00 ? 50  PRO A CB   3  
ATOM 4433  C CG   . PRO A 1 50  ? 5.562   -14.515 1.533   1.00 0.00 ? 50  PRO A CG   3  
ATOM 4434  C CD   . PRO A 1 50  ? 5.591   -13.436 2.580   1.00 0.00 ? 50  PRO A CD   3  
ATOM 4435  H HA   . PRO A 1 50  ? 4.473   -11.833 0.025   1.00 0.00 ? 50  PRO A HA   3  
ATOM 4436  H HB2  . PRO A 1 50  ? 4.700   -14.501 -0.422  1.00 0.00 ? 50  PRO A HB2  3  
ATOM 4437  H HB3  . PRO A 1 50  ? 6.098   -13.436 -0.230  1.00 0.00 ? 50  PRO A HB3  3  
ATOM 4438  H HG2  . PRO A 1 50  ? 4.808   -15.249 1.772   1.00 0.00 ? 50  PRO A HG2  3  
ATOM 4439  H HG3  . PRO A 1 50  ? 6.532   -14.983 1.451   1.00 0.00 ? 50  PRO A HG3  3  
ATOM 4440  H HD2  . PRO A 1 50  ? 5.239   -13.819 3.527   1.00 0.00 ? 50  PRO A HD2  3  
ATOM 4441  H HD3  . PRO A 1 50  ? 6.588   -13.034 2.681   1.00 0.00 ? 50  PRO A HD3  3  
ATOM 4442  N N    . GLY A 1 51  ? 1.954   -12.139 0.297   1.00 0.00 ? 51  GLY A N    3  
ATOM 4443  C CA   . GLY A 1 51  ? 0.540   -12.433 0.153   1.00 0.00 ? 51  GLY A CA   3  
ATOM 4444  C C    . GLY A 1 51  ? -0.339  -11.269 0.567   1.00 0.00 ? 51  GLY A C    3  
ATOM 4445  O O    . GLY A 1 51  ? -1.442  -11.100 0.047   1.00 0.00 ? 51  GLY A O    3  
ATOM 4446  H H    . GLY A 1 51  ? 2.270   -11.214 0.226   1.00 0.00 ? 51  GLY A H    3  
ATOM 4447  H HA2  . GLY A 1 51  ? 0.337   -12.675 -0.879  1.00 0.00 ? 51  GLY A HA2  3  
ATOM 4448  H HA3  . GLY A 1 51  ? 0.298   -13.288 0.768   1.00 0.00 ? 51  GLY A HA3  3  
ATOM 4449  N N    . ASP A 1 52  ? 0.150   -10.466 1.506   1.00 0.00 ? 52  ASP A N    3  
ATOM 4450  C CA   . ASP A 1 52  ? -0.599  -9.312  1.989   1.00 0.00 ? 52  ASP A CA   3  
ATOM 4451  C C    . ASP A 1 52  ? -0.311  -8.080  1.136   1.00 0.00 ? 52  ASP A C    3  
ATOM 4452  O O    . ASP A 1 52  ? 0.495   -8.131  0.207   1.00 0.00 ? 52  ASP A O    3  
ATOM 4453  C CB   . ASP A 1 52  ? -0.251  -9.028  3.451   1.00 0.00 ? 52  ASP A CB   3  
ATOM 4454  C CG   . ASP A 1 52  ? -1.156  -9.768  4.416   1.00 0.00 ? 52  ASP A CG   3  
ATOM 4455  O OD1  . ASP A 1 52  ? -1.770  -10.773 4.001   1.00 0.00 ? 52  ASP A OD1  3  
ATOM 4456  O OD2  . ASP A 1 52  ? -1.251  -9.342  5.587   1.00 0.00 ? 52  ASP A OD2  3  
ATOM 4457  H H    . ASP A 1 52  ? 1.035   -10.653 1.881   1.00 0.00 ? 52  ASP A H    3  
ATOM 4458  H HA   . ASP A 1 52  ? -1.651  -9.545  1.918   1.00 0.00 ? 52  ASP A HA   3  
ATOM 4459  H HB2  . ASP A 1 52  ? 0.768   -9.332  3.638   1.00 0.00 ? 52  ASP A HB2  3  
ATOM 4460  H HB3  . ASP A 1 52  ? -0.346  -7.968  3.638   1.00 0.00 ? 52  ASP A HB3  3  
ATOM 4461  N N    . TYR A 1 53  ? -0.975  -6.976  1.458   1.00 0.00 ? 53  TYR A N    3  
ATOM 4462  C CA   . TYR A 1 53  ? -0.793  -5.732  0.720   1.00 0.00 ? 53  TYR A CA   3  
ATOM 4463  C C    . TYR A 1 53  ? -0.997  -4.523  1.628   1.00 0.00 ? 53  TYR A C    3  
ATOM 4464  O O    . TYR A 1 53  ? -1.775  -4.573  2.581   1.00 0.00 ? 53  TYR A O    3  
ATOM 4465  C CB   . TYR A 1 53  ? -1.765  -5.667  -0.459  1.00 0.00 ? 53  TYR A CB   3  
ATOM 4466  C CG   . TYR A 1 53  ? -1.577  -6.784  -1.461  1.00 0.00 ? 53  TYR A CG   3  
ATOM 4467  C CD1  . TYR A 1 53  ? -0.609  -6.696  -2.455  1.00 0.00 ? 53  TYR A CD1  3  
ATOM 4468  C CD2  . TYR A 1 53  ? -2.366  -7.926  -1.415  1.00 0.00 ? 53  TYR A CD2  3  
ATOM 4469  C CE1  . TYR A 1 53  ? -0.434  -7.713  -3.373  1.00 0.00 ? 53  TYR A CE1  3  
ATOM 4470  C CE2  . TYR A 1 53  ? -2.197  -8.949  -2.328  1.00 0.00 ? 53  TYR A CE2  3  
ATOM 4471  C CZ   . TYR A 1 53  ? -1.230  -8.838  -3.305  1.00 0.00 ? 53  TYR A CZ   3  
ATOM 4472  O OH   . TYR A 1 53  ? -1.059  -9.854  -4.217  1.00 0.00 ? 53  TYR A OH   3  
ATOM 4473  H H    . TYR A 1 53  ? -1.603  -6.997  2.210   1.00 0.00 ? 53  TYR A H    3  
ATOM 4474  H HA   . TYR A 1 53  ? 0.219   -5.716  0.341   1.00 0.00 ? 53  TYR A HA   3  
ATOM 4475  H HB2  . TYR A 1 53  ? -2.776  -5.724  -0.087  1.00 0.00 ? 53  TYR A HB2  3  
ATOM 4476  H HB3  . TYR A 1 53  ? -1.630  -4.729  -0.978  1.00 0.00 ? 53  TYR A HB3  3  
ATOM 4477  H HD1  . TYR A 1 53  ? 0.012   -5.814  -2.506  1.00 0.00 ? 53  TYR A HD1  3  
ATOM 4478  H HD2  . TYR A 1 53  ? -3.123  -8.010  -0.649  1.00 0.00 ? 53  TYR A HD2  3  
ATOM 4479  H HE1  . TYR A 1 53  ? 0.323   -7.627  -4.138  1.00 0.00 ? 53  TYR A HE1  3  
ATOM 4480  H HE2  . TYR A 1 53  ? -2.821  -9.829  -2.275  1.00 0.00 ? 53  TYR A HE2  3  
ATOM 4481  H HH   . TYR A 1 53  ? -1.579  -10.615 -3.949  1.00 0.00 ? 53  TYR A HH   3  
ATOM 4482  N N    . SER A 1 54  ? -0.292  -3.438  1.326   1.00 0.00 ? 54  SER A N    3  
ATOM 4483  C CA   . SER A 1 54  ? -0.392  -2.216  2.116   1.00 0.00 ? 54  SER A CA   3  
ATOM 4484  C C    . SER A 1 54  ? -0.371  -0.984  1.217   1.00 0.00 ? 54  SER A C    3  
ATOM 4485  O O    . SER A 1 54  ? 0.567   -0.781  0.444   1.00 0.00 ? 54  SER A O    3  
ATOM 4486  C CB   . SER A 1 54  ? 0.753   -2.143  3.128   1.00 0.00 ? 54  SER A CB   3  
ATOM 4487  O OG   . SER A 1 54  ? 0.679   -3.209  4.060   1.00 0.00 ? 54  SER A OG   3  
ATOM 4488  H H    . SER A 1 54  ? 0.312   -3.460  0.554   1.00 0.00 ? 54  SER A H    3  
ATOM 4489  H HA   . SER A 1 54  ? -1.331  -2.243  2.649   1.00 0.00 ? 54  SER A HA   3  
ATOM 4490  H HB2  . SER A 1 54  ? 1.696   -2.202  2.606   1.00 0.00 ? 54  SER A HB2  3  
ATOM 4491  H HB3  . SER A 1 54  ? 0.696   -1.207  3.664   1.00 0.00 ? 54  SER A HB3  3  
ATOM 4492  H HG   . SER A 1 54  ? -0.236  -3.481  4.163   1.00 0.00 ? 54  SER A HG   3  
ATOM 4493  N N    . LEU A 1 55  ? -1.410  -0.164  1.323   1.00 0.00 ? 55  LEU A N    3  
ATOM 4494  C CA   . LEU A 1 55  ? -1.513  1.049   0.520   1.00 0.00 ? 55  LEU A CA   3  
ATOM 4495  C C    . LEU A 1 55  ? -0.597  2.141   1.064   1.00 0.00 ? 55  LEU A C    3  
ATOM 4496  O O    . LEU A 1 55  ? -0.279  2.164   2.253   1.00 0.00 ? 55  LEU A O    3  
ATOM 4497  C CB   . LEU A 1 55  ? -2.959  1.547   0.494   1.00 0.00 ? 55  LEU A CB   3  
ATOM 4498  C CG   . LEU A 1 55  ? -3.246  2.728   -0.434  1.00 0.00 ? 55  LEU A CG   3  
ATOM 4499  C CD1  . LEU A 1 55  ? -3.440  2.248   -1.864  1.00 0.00 ? 55  LEU A CD1  3  
ATOM 4500  C CD2  . LEU A 1 55  ? -4.470  3.496   0.043   1.00 0.00 ? 55  LEU A CD2  3  
ATOM 4501  H H    . LEU A 1 55  ? -2.126  -0.379  1.956   1.00 0.00 ? 55  LEU A H    3  
ATOM 4502  H HA   . LEU A 1 55  ? -1.206  0.807   -0.487  1.00 0.00 ? 55  LEU A HA   3  
ATOM 4503  H HB2  . LEU A 1 55  ? -3.586  0.724   0.186   1.00 0.00 ? 55  LEU A HB2  3  
ATOM 4504  H HB3  . LEU A 1 55  ? -3.224  1.843   1.499   1.00 0.00 ? 55  LEU A HB3  3  
ATOM 4505  H HG   . LEU A 1 55  ? -2.401  3.402   -0.421  1.00 0.00 ? 55  LEU A HG   3  
ATOM 4506  H HD11 . LEU A 1 55  ? -2.519  2.374   -2.414  1.00 0.00 ? 55  LEU A HD11 3  
ATOM 4507  H HD12 . LEU A 1 55  ? -4.222  2.824   -2.334  1.00 0.00 ? 55  LEU A HD12 3  
ATOM 4508  H HD13 . LEU A 1 55  ? -3.716  1.203   -1.859  1.00 0.00 ? 55  LEU A HD13 3  
ATOM 4509  H HD21 . LEU A 1 55  ? -4.248  3.977   0.984   1.00 0.00 ? 55  LEU A HD21 3  
ATOM 4510  H HD22 . LEU A 1 55  ? -5.296  2.811   0.174   1.00 0.00 ? 55  LEU A HD22 3  
ATOM 4511  H HD23 . LEU A 1 55  ? -4.735  4.243   -0.690  1.00 0.00 ? 55  LEU A HD23 3  
ATOM 4512  N N    . TYR A 1 56  ? -0.178  3.046   0.186   1.00 0.00 ? 56  TYR A N    3  
ATOM 4513  C CA   . TYR A 1 56  ? 0.701   4.141   0.578   1.00 0.00 ? 56  TYR A CA   3  
ATOM 4514  C C    . TYR A 1 56  ? 0.212   5.466   0.002   1.00 0.00 ? 56  TYR A C    3  
ATOM 4515  O O    . TYR A 1 56  ? 0.509   5.806   -1.144  1.00 0.00 ? 56  TYR A O    3  
ATOM 4516  C CB   . TYR A 1 56  ? 2.132   3.866   0.112   1.00 0.00 ? 56  TYR A CB   3  
ATOM 4517  C CG   . TYR A 1 56  ? 2.888   2.911   1.006   1.00 0.00 ? 56  TYR A CG   3  
ATOM 4518  C CD1  . TYR A 1 56  ? 3.601   3.373   2.105   1.00 0.00 ? 56  TYR A CD1  3  
ATOM 4519  C CD2  . TYR A 1 56  ? 2.888   1.544   0.753   1.00 0.00 ? 56  TYR A CD2  3  
ATOM 4520  C CE1  . TYR A 1 56  ? 4.294   2.503   2.925   1.00 0.00 ? 56  TYR A CE1  3  
ATOM 4521  C CE2  . TYR A 1 56  ? 3.577   0.667   1.568   1.00 0.00 ? 56  TYR A CE2  3  
ATOM 4522  C CZ   . TYR A 1 56  ? 4.279   1.151   2.652   1.00 0.00 ? 56  TYR A CZ   3  
ATOM 4523  O OH   . TYR A 1 56  ? 4.966   0.281   3.467   1.00 0.00 ? 56  TYR A OH   3  
ATOM 4524  H H    . TYR A 1 56  ? -0.465  2.975   -0.748  1.00 0.00 ? 56  TYR A H    3  
ATOM 4525  H HA   . TYR A 1 56  ? 0.691   4.205   1.657   1.00 0.00 ? 56  TYR A HA   3  
ATOM 4526  H HB2  . TYR A 1 56  ? 2.104   3.440   -0.879  1.00 0.00 ? 56  TYR A HB2  3  
ATOM 4527  H HB3  . TYR A 1 56  ? 2.679   4.798   0.083   1.00 0.00 ? 56  TYR A HB3  3  
ATOM 4528  H HD1  . TYR A 1 56  ? 3.611   4.433   2.316   1.00 0.00 ? 56  TYR A HD1  3  
ATOM 4529  H HD2  . TYR A 1 56  ? 2.337   1.168   -0.097  1.00 0.00 ? 56  TYR A HD2  3  
ATOM 4530  H HE1  . TYR A 1 56  ? 4.843   2.882   3.774   1.00 0.00 ? 56  TYR A HE1  3  
ATOM 4531  H HE2  . TYR A 1 56  ? 3.565   -0.392  1.355   1.00 0.00 ? 56  TYR A HE2  3  
ATOM 4532  H HH   . TYR A 1 56  ? 4.727   0.444   4.383   1.00 0.00 ? 56  TYR A HH   3  
ATOM 4533  N N    . PHE A 1 57  ? -0.540  6.211   0.805   1.00 0.00 ? 57  PHE A N    3  
ATOM 4534  C CA   . PHE A 1 57  ? -1.072  7.500   0.377   1.00 0.00 ? 57  PHE A CA   3  
ATOM 4535  C C    . PHE A 1 57  ? -0.182  8.642   0.855   1.00 0.00 ? 57  PHE A C    3  
ATOM 4536  O O    . PHE A 1 57  ? 0.376   8.591   1.952   1.00 0.00 ? 57  PHE A O    3  
ATOM 4537  C CB   . PHE A 1 57  ? -2.495  7.690   0.907   1.00 0.00 ? 57  PHE A CB   3  
ATOM 4538  C CG   . PHE A 1 57  ? -3.235  8.818   0.247   1.00 0.00 ? 57  PHE A CG   3  
ATOM 4539  C CD1  . PHE A 1 57  ? -3.213  8.967   -1.130  1.00 0.00 ? 57  PHE A CD1  3  
ATOM 4540  C CD2  . PHE A 1 57  ? -3.951  9.731   1.005   1.00 0.00 ? 57  PHE A CD2  3  
ATOM 4541  C CE1  . PHE A 1 57  ? -3.893  10.004  -1.740  1.00 0.00 ? 57  PHE A CE1  3  
ATOM 4542  C CE2  . PHE A 1 57  ? -4.634  10.769  0.400   1.00 0.00 ? 57  PHE A CE2  3  
ATOM 4543  C CZ   . PHE A 1 57  ? -4.604  10.907  -0.974  1.00 0.00 ? 57  PHE A CZ   3  
ATOM 4544  H H    . PHE A 1 57  ? -0.742  5.887   1.708   1.00 0.00 ? 57  PHE A H    3  
ATOM 4545  H HA   . PHE A 1 57  ? -1.096  7.505   -0.702  1.00 0.00 ? 57  PHE A HA   3  
ATOM 4546  H HB2  . PHE A 1 57  ? -3.057  6.783   0.742   1.00 0.00 ? 57  PHE A HB2  3  
ATOM 4547  H HB3  . PHE A 1 57  ? -2.452  7.894   1.966   1.00 0.00 ? 57  PHE A HB3  3  
ATOM 4548  H HD1  . PHE A 1 57  ? -2.657  8.261   -1.731  1.00 0.00 ? 57  PHE A HD1  3  
ATOM 4549  H HD2  . PHE A 1 57  ? -3.975  9.625   2.079   1.00 0.00 ? 57  PHE A HD2  3  
ATOM 4550  H HE1  . PHE A 1 57  ? -3.867  10.108  -2.815  1.00 0.00 ? 57  PHE A HE1  3  
ATOM 4551  H HE2  . PHE A 1 57  ? -5.188  11.474  1.001   1.00 0.00 ? 57  PHE A HE2  3  
ATOM 4552  H HZ   . PHE A 1 57  ? -5.136  11.717  -1.449  1.00 0.00 ? 57  PHE A HZ   3  
ATOM 4553  N N    . ARG A 1 58  ? -0.053  9.672   0.025   1.00 0.00 ? 58  ARG A N    3  
ATOM 4554  C CA   . ARG A 1 58  ? 0.770   10.827  0.362   1.00 0.00 ? 58  ARG A CA   3  
ATOM 4555  C C    . ARG A 1 58  ? -0.096  12.056  0.624   1.00 0.00 ? 58  ARG A C    3  
ATOM 4556  O O    . ARG A 1 58  ? -0.993  12.375  -0.157  1.00 0.00 ? 58  ARG A O    3  
ATOM 4557  C CB   . ARG A 1 58  ? 1.761   11.120  -0.766  1.00 0.00 ? 58  ARG A CB   3  
ATOM 4558  C CG   . ARG A 1 58  ? 2.451   12.468  -0.636  1.00 0.00 ? 58  ARG A CG   3  
ATOM 4559  C CD   . ARG A 1 58  ? 3.584   12.419  0.378   1.00 0.00 ? 58  ARG A CD   3  
ATOM 4560  N NE   . ARG A 1 58  ? 3.931   13.748  0.875   1.00 0.00 ? 58  ARG A NE   3  
ATOM 4561  C CZ   . ARG A 1 58  ? 5.042   14.012  1.553   1.00 0.00 ? 58  ARG A CZ   3  
ATOM 4562  N NH1  . ARG A 1 58  ? 5.910   13.043  1.812   1.00 0.00 ? 58  ARG A NH1  3  
ATOM 4563  N NH2  . ARG A 1 58  ? 5.288   15.246  1.972   1.00 0.00 ? 58  ARG A NH2  3  
ATOM 4564  H H    . ARG A 1 58  ? -0.523  9.655   -0.835  1.00 0.00 ? 58  ARG A H    3  
ATOM 4565  H HA   . ARG A 1 58  ? 1.321   10.592  1.261   1.00 0.00 ? 58  ARG A HA   3  
ATOM 4566  H HB2  . ARG A 1 58  ? 2.520   10.352  -0.771  1.00 0.00 ? 58  ARG A HB2  3  
ATOM 4567  H HB3  . ARG A 1 58  ? 1.233   11.100  -1.707  1.00 0.00 ? 58  ARG A HB3  3  
ATOM 4568  H HG2  . ARG A 1 58  ? 2.855   12.750  -1.597  1.00 0.00 ? 58  ARG A HG2  3  
ATOM 4569  H HG3  . ARG A 1 58  ? 1.726   13.203  -0.318  1.00 0.00 ? 58  ARG A HG3  3  
ATOM 4570  H HD2  . ARG A 1 58  ? 3.278   11.803  1.210   1.00 0.00 ? 58  ARG A HD2  3  
ATOM 4571  H HD3  . ARG A 1 58  ? 4.452   11.983  -0.094  1.00 0.00 ? 58  ARG A HD3  3  
ATOM 4572  H HE   . ARG A 1 58  ? 3.304   14.478  0.695   1.00 0.00 ? 58  ARG A HE   3  
ATOM 4573  H HH11 . ARG A 1 58  ? 5.728   12.112  1.496   1.00 0.00 ? 58  ARG A HH11 3  
ATOM 4574  H HH12 . ARG A 1 58  ? 6.747   13.245  2.322   1.00 0.00 ? 58  ARG A HH12 3  
ATOM 4575  H HH21 . ARG A 1 58  ? 4.636   15.979  1.779   1.00 0.00 ? 58  ARG A HH21 3  
ATOM 4576  H HH22 . ARG A 1 58  ? 6.125   15.444  2.482   1.00 0.00 ? 58  ARG A HH22 3  
ATOM 4577  N N    . THR A 1 59  ? 0.177   12.742  1.730   1.00 0.00 ? 59  THR A N    3  
ATOM 4578  C CA   . THR A 1 59  ? -0.578  13.933  2.096   1.00 0.00 ? 59  THR A CA   3  
ATOM 4579  C C    . THR A 1 59  ? 0.351   15.063  2.523   1.00 0.00 ? 59  THR A C    3  
ATOM 4580  O O    . THR A 1 59  ? 1.531   14.841  2.791   1.00 0.00 ? 59  THR A O    3  
ATOM 4581  C CB   . THR A 1 59  ? -1.571  13.641  3.236   1.00 0.00 ? 59  THR A CB   3  
ATOM 4582  O OG1  . THR A 1 59  ? -0.858  13.324  4.437   1.00 0.00 ? 59  THR A OG1  3  
ATOM 4583  C CG2  . THR A 1 59  ? -2.493  12.488  2.869   1.00 0.00 ? 59  THR A CG2  3  
ATOM 4584  H H    . THR A 1 59  ? 0.903   12.437  2.312   1.00 0.00 ? 59  THR A H    3  
ATOM 4585  H HA   . THR A 1 59  ? -1.141  14.251  1.230   1.00 0.00 ? 59  THR A HA   3  
ATOM 4586  H HB   . THR A 1 59  ? -2.172  14.523  3.405   1.00 0.00 ? 59  THR A HB   3  
ATOM 4587  H HG1  . THR A 1 59  ? -1.451  12.895  5.058   1.00 0.00 ? 59  THR A HG1  3  
ATOM 4588  H HG21 . THR A 1 59  ? -2.494  12.355  1.798   1.00 0.00 ? 59  THR A HG21 3  
ATOM 4589  H HG22 . THR A 1 59  ? -3.495  12.707  3.206   1.00 0.00 ? 59  THR A HG22 3  
ATOM 4590  H HG23 . THR A 1 59  ? -2.144  11.583  3.344   1.00 0.00 ? 59  THR A HG23 3  
ATOM 4591  N N    . ASN A 1 60  ? -0.189  16.276  2.586   1.00 0.00 ? 60  ASN A N    3  
ATOM 4592  C CA   . ASN A 1 60  ? 0.593   17.442  2.982   1.00 0.00 ? 60  ASN A CA   3  
ATOM 4593  C C    . ASN A 1 60  ? 1.379   17.161  4.259   1.00 0.00 ? 60  ASN A C    3  
ATOM 4594  O O    . ASN A 1 60  ? 2.535   17.562  4.388   1.00 0.00 ? 60  ASN A O    3  
ATOM 4595  C CB   . ASN A 1 60  ? -0.323  18.650  3.189   1.00 0.00 ? 60  ASN A CB   3  
ATOM 4596  C CG   . ASN A 1 60  ? -0.599  19.394  1.897   1.00 0.00 ? 60  ASN A CG   3  
ATOM 4597  O OD1  . ASN A 1 60  ? 0.315   19.920  1.263   1.00 0.00 ? 60  ASN A OD1  3  
ATOM 4598  N ND2  . ASN A 1 60  ? -1.866  19.441  1.501   1.00 0.00 ? 60  ASN A ND2  3  
ATOM 4599  H H    . ASN A 1 60  ? -1.136  16.390  2.361   1.00 0.00 ? 60  ASN A H    3  
ATOM 4600  H HA   . ASN A 1 60  ? 1.288   17.660  2.185   1.00 0.00 ? 60  ASN A HA   3  
ATOM 4601  H HB2  . ASN A 1 60  ? -1.265  18.314  3.597   1.00 0.00 ? 60  ASN A HB2  3  
ATOM 4602  H HB3  . ASN A 1 60  ? 0.142   19.332  3.884   1.00 0.00 ? 60  ASN A HB3  3  
ATOM 4603  H HD21 . ASN A 1 60  ? -2.542  18.999  2.056   1.00 0.00 ? 60  ASN A HD21 3  
ATOM 4604  H HD22 . ASN A 1 60  ? -2.073  19.915  0.668   1.00 0.00 ? 60  ASN A HD22 3  
ATOM 4605  N N    . GLU A 1 61  ? 0.744   16.469  5.199   1.00 0.00 ? 61  GLU A N    3  
ATOM 4606  C CA   . GLU A 1 61  ? 1.384   16.135  6.466   1.00 0.00 ? 61  GLU A CA   3  
ATOM 4607  C C    . GLU A 1 61  ? 2.513   15.129  6.256   1.00 0.00 ? 61  GLU A C    3  
ATOM 4608  O O    . GLU A 1 61  ? 3.677   15.422  6.525   1.00 0.00 ? 61  GLU A O    3  
ATOM 4609  C CB   . GLU A 1 61  ? 0.358   15.568  7.448   1.00 0.00 ? 61  GLU A CB   3  
ATOM 4610  C CG   . GLU A 1 61  ? -0.519  16.629  8.092   1.00 0.00 ? 61  GLU A CG   3  
ATOM 4611  C CD   . GLU A 1 61  ? -1.491  16.050  9.102   1.00 0.00 ? 61  GLU A CD   3  
ATOM 4612  O OE1  . GLU A 1 61  ? -2.499  15.448  8.678   1.00 0.00 ? 61  GLU A OE1  3  
ATOM 4613  O OE2  . GLU A 1 61  ? -1.241  16.198  10.316  1.00 0.00 ? 61  GLU A OE2  3  
ATOM 4614  H H    . GLU A 1 61  ? -0.178  16.176  5.037   1.00 0.00 ? 61  GLU A H    3  
ATOM 4615  H HA   . GLU A 1 61  ? 1.799   17.042  6.877   1.00 0.00 ? 61  GLU A HA   3  
ATOM 4616  H HB2  . GLU A 1 61  ? -0.281  14.873  6.923   1.00 0.00 ? 61  GLU A HB2  3  
ATOM 4617  H HB3  . GLU A 1 61  ? 0.881   15.040  8.232   1.00 0.00 ? 61  GLU A HB3  3  
ATOM 4618  H HG2  . GLU A 1 61  ? 0.114   17.345  8.595   1.00 0.00 ? 61  GLU A HG2  3  
ATOM 4619  H HG3  . GLU A 1 61  ? -1.083  17.130  7.318   1.00 0.00 ? 61  GLU A HG3  3  
ATOM 4620  N N    . ASN A 1 62  ? 2.158   13.942  5.774   1.00 0.00 ? 62  ASN A N    3  
ATOM 4621  C CA   . ASN A 1 62  ? 3.140   12.892  5.529   1.00 0.00 ? 62  ASN A CA   3  
ATOM 4622  C C    . ASN A 1 62  ? 2.490   11.686  4.858   1.00 0.00 ? 62  ASN A C    3  
ATOM 4623  O O    . ASN A 1 62  ? 1.268   11.625  4.717   1.00 0.00 ? 62  ASN A O    3  
ATOM 4624  C CB   . ASN A 1 62  ? 3.799   12.465  6.842   1.00 0.00 ? 62  ASN A CB   3  
ATOM 4625  C CG   . ASN A 1 62  ? 2.802   11.890  7.830   1.00 0.00 ? 62  ASN A CG   3  
ATOM 4626  O OD1  . ASN A 1 62  ? 1.779   12.508  8.127   1.00 0.00 ? 62  ASN A OD1  3  
ATOM 4627  N ND2  . ASN A 1 62  ? 3.098   10.702  8.344   1.00 0.00 ? 62  ASN A ND2  3  
ATOM 4628  H H    . ASN A 1 62  ? 1.213   13.768  5.579   1.00 0.00 ? 62  ASN A H    3  
ATOM 4629  H HA   . ASN A 1 62  ? 3.896   13.292  4.870   1.00 0.00 ? 62  ASN A HA   3  
ATOM 4630  H HB2  . ASN A 1 62  ? 4.546   11.713  6.635   1.00 0.00 ? 62  ASN A HB2  3  
ATOM 4631  H HB3  . ASN A 1 62  ? 4.274   13.323  7.295   1.00 0.00 ? 62  ASN A HB3  3  
ATOM 4632  H HD21 . ASN A 1 62  ? 3.930   10.269  8.062   1.00 0.00 ? 62  ASN A HD21 3  
ATOM 4633  H HD22 . ASN A 1 62  ? 2.470   10.307  8.985   1.00 0.00 ? 62  ASN A HD22 3  
ATOM 4634  N N    . ILE A 1 63  ? 3.315   10.729  4.447   1.00 0.00 ? 63  ILE A N    3  
ATOM 4635  C CA   . ILE A 1 63  ? 2.821   9.524   3.792   1.00 0.00 ? 63  ILE A CA   3  
ATOM 4636  C C    . ILE A 1 63  ? 2.252   8.540   4.809   1.00 0.00 ? 63  ILE A C    3  
ATOM 4637  O O    . ILE A 1 63  ? 2.941   8.132   5.743   1.00 0.00 ? 63  ILE A O    3  
ATOM 4638  C CB   . ILE A 1 63  ? 3.931   8.826   2.984   1.00 0.00 ? 63  ILE A CB   3  
ATOM 4639  C CG1  . ILE A 1 63  ? 4.418   9.735   1.854   1.00 0.00 ? 63  ILE A CG1  3  
ATOM 4640  C CG2  . ILE A 1 63  ? 3.429   7.503   2.428   1.00 0.00 ? 63  ILE A CG2  3  
ATOM 4641  C CD1  . ILE A 1 63  ? 5.686   9.246   1.189   1.00 0.00 ? 63  ILE A CD1  3  
ATOM 4642  H H    . ILE A 1 63  ? 4.279   10.836  4.587   1.00 0.00 ? 63  ILE A H    3  
ATOM 4643  H HA   . ILE A 1 63  ? 2.035   9.814   3.109   1.00 0.00 ? 63  ILE A HA   3  
ATOM 4644  H HB   . ILE A 1 63  ? 4.755   8.620   3.651   1.00 0.00 ? 63  ILE A HB   3  
ATOM 4645  H HG12 . ILE A 1 63  ? 3.652   9.802   1.098   1.00 0.00 ? 63  ILE A HG12 3  
ATOM 4646  H HG13 . ILE A 1 63  ? 4.611   10.721  2.253   1.00 0.00 ? 63  ILE A HG13 3  
ATOM 4647  H HG21 . ILE A 1 63  ? 2.354   7.459   2.518   1.00 0.00 ? 63  ILE A HG21 3  
ATOM 4648  H HG22 . ILE A 1 63  ? 3.705   7.422   1.387   1.00 0.00 ? 63  ILE A HG22 3  
ATOM 4649  H HG23 . ILE A 1 63  ? 3.871   6.688   2.982   1.00 0.00 ? 63  ILE A HG23 3  
ATOM 4650  H HD11 . ILE A 1 63  ? 5.486   8.319   0.671   1.00 0.00 ? 63  ILE A HD11 3  
ATOM 4651  H HD12 . ILE A 1 63  ? 6.031   9.987   0.483   1.00 0.00 ? 63  ILE A HD12 3  
ATOM 4652  H HD13 . ILE A 1 63  ? 6.446   9.082   1.939   1.00 0.00 ? 63  ILE A HD13 3  
ATOM 4653  N N    . GLN A 1 64  ? 0.992   8.163   4.618   1.00 0.00 ? 64  GLN A N    3  
ATOM 4654  C CA   . GLN A 1 64  ? 0.332   7.225   5.518   1.00 0.00 ? 64  GLN A CA   3  
ATOM 4655  C C    . GLN A 1 64  ? 0.493   5.791   5.025   1.00 0.00 ? 64  GLN A C    3  
ATOM 4656  O O    . GLN A 1 64  ? 1.123   5.545   3.996   1.00 0.00 ? 64  GLN A O    3  
ATOM 4657  C CB   . GLN A 1 64  ? -1.153  7.569   5.647   1.00 0.00 ? 64  GLN A CB   3  
ATOM 4658  C CG   . GLN A 1 64  ? -1.427  8.749   6.566   1.00 0.00 ? 64  GLN A CG   3  
ATOM 4659  C CD   . GLN A 1 64  ? -2.897  8.894   6.908   1.00 0.00 ? 64  GLN A CD   3  
ATOM 4660  O OE1  . GLN A 1 64  ? -3.560  7.922   7.271   1.00 0.00 ? 64  GLN A OE1  3  
ATOM 4661  N NE2  . GLN A 1 64  ? -3.414  10.111  6.793   1.00 0.00 ? 64  GLN A NE2  3  
ATOM 4662  H H    . GLN A 1 64  ? 0.496   8.523   3.855   1.00 0.00 ? 64  GLN A H    3  
ATOM 4663  H HA   . GLN A 1 64  ? 0.797   7.313   6.488   1.00 0.00 ? 64  GLN A HA   3  
ATOM 4664  H HB2  . GLN A 1 64  ? -1.542  7.805   4.668   1.00 0.00 ? 64  GLN A HB2  3  
ATOM 4665  H HB3  . GLN A 1 64  ? -1.677  6.709   6.036   1.00 0.00 ? 64  GLN A HB3  3  
ATOM 4666  H HG2  . GLN A 1 64  ? -0.873  8.611   7.483   1.00 0.00 ? 64  GLN A HG2  3  
ATOM 4667  H HG3  . GLN A 1 64  ? -1.094  9.653   6.078   1.00 0.00 ? 64  GLN A HG3  3  
ATOM 4668  H HE21 . GLN A 1 64  ? -2.826  10.838  6.497   1.00 0.00 ? 64  GLN A HE21 3  
ATOM 4669  H HE22 . GLN A 1 64  ? -4.362  10.233  7.007   1.00 0.00 ? 64  GLN A HE22 3  
ATOM 4670  N N    . ARG A 1 65  ? -0.081  4.848   5.765   1.00 0.00 ? 65  ARG A N    3  
ATOM 4671  C CA   . ARG A 1 65  ? 0.001   3.438   5.403   1.00 0.00 ? 65  ARG A CA   3  
ATOM 4672  C C    . ARG A 1 65  ? -1.232  2.680   5.889   1.00 0.00 ? 65  ARG A C    3  
ATOM 4673  O O    . ARG A 1 65  ? -1.584  2.737   7.067   1.00 0.00 ? 65  ARG A O    3  
ATOM 4674  C CB   . ARG A 1 65  ? 1.264   2.810   5.994   1.00 0.00 ? 65  ARG A CB   3  
ATOM 4675  C CG   . ARG A 1 65  ? 1.504   1.380   5.537   1.00 0.00 ? 65  ARG A CG   3  
ATOM 4676  C CD   . ARG A 1 65  ? 2.439   0.643   6.484   1.00 0.00 ? 65  ARG A CD   3  
ATOM 4677  N NE   . ARG A 1 65  ? 2.584   -0.765  6.123   1.00 0.00 ? 65  ARG A NE   3  
ATOM 4678  C CZ   . ARG A 1 65  ? 3.412   -1.600  6.741   1.00 0.00 ? 65  ARG A CZ   3  
ATOM 4679  N NH1  . ARG A 1 65  ? 4.165   -1.171  7.744   1.00 0.00 ? 65  ARG A NH1  3  
ATOM 4680  N NH2  . ARG A 1 65  ? 3.488   -2.867  6.355   1.00 0.00 ? 65  ARG A NH2  3  
ATOM 4681  H H    . ARG A 1 65  ? -0.570  5.106   6.574   1.00 0.00 ? 65  ARG A H    3  
ATOM 4682  H HA   . ARG A 1 65  ? 0.047   3.374   4.326   1.00 0.00 ? 65  ARG A HA   3  
ATOM 4683  H HB2  . ARG A 1 65  ? 2.118   3.405   5.703   1.00 0.00 ? 65  ARG A HB2  3  
ATOM 4684  H HB3  . ARG A 1 65  ? 1.183   2.813   7.070   1.00 0.00 ? 65  ARG A HB3  3  
ATOM 4685  H HG2  . ARG A 1 65  ? 0.559   0.859   5.504   1.00 0.00 ? 65  ARG A HG2  3  
ATOM 4686  H HG3  . ARG A 1 65  ? 1.944   1.396   4.551   1.00 0.00 ? 65  ARG A HG3  3  
ATOM 4687  H HD2  . ARG A 1 65  ? 3.409   1.115   6.451   1.00 0.00 ? 65  ARG A HD2  3  
ATOM 4688  H HD3  . ARG A 1 65  ? 2.040   0.709   7.485   1.00 0.00 ? 65  ARG A HD3  3  
ATOM 4689  H HE   . ARG A 1 65  ? 2.037   -1.103  5.385   1.00 0.00 ? 65  ARG A HE   3  
ATOM 4690  H HH11 . ARG A 1 65  ? 4.109   -0.217  8.038   1.00 0.00 ? 65  ARG A HH11 3  
ATOM 4691  H HH12 . ARG A 1 65  ? 4.787   -1.802  8.208   1.00 0.00 ? 65  ARG A HH12 3  
ATOM 4692  H HH21 . ARG A 1 65  ? 2.922   -3.194  5.599   1.00 0.00 ? 65  ARG A HH21 3  
ATOM 4693  H HH22 . ARG A 1 65  ? 4.112   -3.495  6.820   1.00 0.00 ? 65  ARG A HH22 3  
ATOM 4694  N N    . PHE A 1 66  ? -1.883  1.971   4.973   1.00 0.00 ? 66  PHE A N    3  
ATOM 4695  C CA   . PHE A 1 66  ? -3.076  1.202   5.307   1.00 0.00 ? 66  PHE A CA   3  
ATOM 4696  C C    . PHE A 1 66  ? -2.758  -0.287  5.392   1.00 0.00 ? 66  PHE A C    3  
ATOM 4697  O O    . PHE A 1 66  ? -1.632  -0.710  5.129   1.00 0.00 ? 66  PHE A O    3  
ATOM 4698  C CB   . PHE A 1 66  ? -4.171  1.443   4.265   1.00 0.00 ? 66  PHE A CB   3  
ATOM 4699  C CG   . PHE A 1 66  ? -4.453  2.897   4.016   1.00 0.00 ? 66  PHE A CG   3  
ATOM 4700  C CD1  . PHE A 1 66  ? -3.537  3.688   3.341   1.00 0.00 ? 66  PHE A CD1  3  
ATOM 4701  C CD2  . PHE A 1 66  ? -5.634  3.472   4.456   1.00 0.00 ? 66  PHE A CD2  3  
ATOM 4702  C CE1  . PHE A 1 66  ? -3.794  5.026   3.112   1.00 0.00 ? 66  PHE A CE1  3  
ATOM 4703  C CE2  . PHE A 1 66  ? -5.896  4.810   4.229   1.00 0.00 ? 66  PHE A CE2  3  
ATOM 4704  C CZ   . PHE A 1 66  ? -4.976  5.588   3.555   1.00 0.00 ? 66  PHE A CZ   3  
ATOM 4705  H H    . PHE A 1 66  ? -1.552  1.964   4.049   1.00 0.00 ? 66  PHE A H    3  
ATOM 4706  H HA   . PHE A 1 66  ? -3.427  1.539   6.270   1.00 0.00 ? 66  PHE A HA   3  
ATOM 4707  H HB2  . PHE A 1 66  ? -3.870  0.998   3.328   1.00 0.00 ? 66  PHE A HB2  3  
ATOM 4708  H HB3  . PHE A 1 66  ? -5.086  0.979   4.602   1.00 0.00 ? 66  PHE A HB3  3  
ATOM 4709  H HD1  . PHE A 1 66  ? -2.613  3.250   2.993   1.00 0.00 ? 66  PHE A HD1  3  
ATOM 4710  H HD2  . PHE A 1 66  ? -6.355  2.864   4.984   1.00 0.00 ? 66  PHE A HD2  3  
ATOM 4711  H HE1  . PHE A 1 66  ? -3.073  5.632   2.584   1.00 0.00 ? 66  PHE A HE1  3  
ATOM 4712  H HE2  . PHE A 1 66  ? -6.821  5.246   4.578   1.00 0.00 ? 66  PHE A HE2  3  
ATOM 4713  H HZ   . PHE A 1 66  ? -5.178  6.634   3.377   1.00 0.00 ? 66  PHE A HZ   3  
ATOM 4714  N N    . LYS A 1 67  ? -3.758  -1.080  5.763   1.00 0.00 ? 67  LYS A N    3  
ATOM 4715  C CA   . LYS A 1 67  ? -3.588  -2.523  5.883   1.00 0.00 ? 67  LYS A CA   3  
ATOM 4716  C C    . LYS A 1 67  ? -4.651  -3.265  5.081   1.00 0.00 ? 67  LYS A C    3  
ATOM 4717  O O    . LYS A 1 67  ? -5.839  -2.953  5.169   1.00 0.00 ? 67  LYS A O    3  
ATOM 4718  C CB   . LYS A 1 67  ? -3.656  -2.944  7.353   1.00 0.00 ? 67  LYS A CB   3  
ATOM 4719  C CG   . LYS A 1 67  ? -5.031  -2.764  7.974   1.00 0.00 ? 67  LYS A CG   3  
ATOM 4720  C CD   . LYS A 1 67  ? -5.049  -3.210  9.427   1.00 0.00 ? 67  LYS A CD   3  
ATOM 4721  C CE   . LYS A 1 67  ? -5.035  -4.726  9.545   1.00 0.00 ? 67  LYS A CE   3  
ATOM 4722  N NZ   . LYS A 1 67  ? -4.564  -5.173  10.885  1.00 0.00 ? 67  LYS A NZ   3  
ATOM 4723  H H    . LYS A 1 67  ? -4.633  -0.684  5.960   1.00 0.00 ? 67  LYS A H    3  
ATOM 4724  H HA   . LYS A 1 67  ? -2.615  -2.776  5.490   1.00 0.00 ? 67  LYS A HA   3  
ATOM 4725  H HB2  . LYS A 1 67  ? -3.383  -3.986  7.429   1.00 0.00 ? 67  LYS A HB2  3  
ATOM 4726  H HB3  . LYS A 1 67  ? -2.949  -2.353  7.918   1.00 0.00 ? 67  LYS A HB3  3  
ATOM 4727  H HG2  . LYS A 1 67  ? -5.305  -1.721  7.925   1.00 0.00 ? 67  LYS A HG2  3  
ATOM 4728  H HG3  . LYS A 1 67  ? -5.746  -3.353  7.417   1.00 0.00 ? 67  LYS A HG3  3  
ATOM 4729  H HD2  . LYS A 1 67  ? -4.178  -2.813  9.927   1.00 0.00 ? 67  LYS A HD2  3  
ATOM 4730  H HD3  . LYS A 1 67  ? -5.943  -2.828  9.900   1.00 0.00 ? 67  LYS A HD3  3  
ATOM 4731  H HE2  . LYS A 1 67  ? -6.036  -5.095  9.383   1.00 0.00 ? 67  LYS A HE2  3  
ATOM 4732  H HE3  . LYS A 1 67  ? -4.376  -5.127  8.789   1.00 0.00 ? 67  LYS A HE3  3  
ATOM 4733  H HZ1  . LYS A 1 67  ? -5.354  -5.164  11.562  1.00 0.00 ? 67  LYS A HZ1  3  
ATOM 4734  H HZ2  . LYS A 1 67  ? -3.818  -4.537  11.233  1.00 0.00 ? 67  LYS A HZ2  3  
ATOM 4735  H HZ3  . LYS A 1 67  ? -4.183  -6.139  10.826  1.00 0.00 ? 67  LYS A HZ3  3  
ATOM 4736  N N    . ILE A 1 68  ? -4.217  -4.249  4.300   1.00 0.00 ? 68  ILE A N    3  
ATOM 4737  C CA   . ILE A 1 68  ? -5.133  -5.036  3.484   1.00 0.00 ? 68  ILE A CA   3  
ATOM 4738  C C    . ILE A 1 68  ? -4.899  -6.530  3.681   1.00 0.00 ? 68  ILE A C    3  
ATOM 4739  O O    . ILE A 1 68  ? -3.836  -7.052  3.341   1.00 0.00 ? 68  ILE A O    3  
ATOM 4740  C CB   . ILE A 1 68  ? -4.988  -4.698  1.989   1.00 0.00 ? 68  ILE A CB   3  
ATOM 4741  C CG1  . ILE A 1 68  ? -5.153  -3.194  1.765   1.00 0.00 ? 68  ILE A CG1  3  
ATOM 4742  C CG2  . ILE A 1 68  ? -6.007  -5.476  1.169   1.00 0.00 ? 68  ILE A CG2  3  
ATOM 4743  C CD1  . ILE A 1 68  ? -4.837  -2.754  0.353   1.00 0.00 ? 68  ILE A CD1  3  
ATOM 4744  H H    . ILE A 1 68  ? -3.259  -4.450  4.272   1.00 0.00 ? 68  ILE A H    3  
ATOM 4745  H HA   . ILE A 1 68  ? -6.142  -4.798  3.791   1.00 0.00 ? 68  ILE A HA   3  
ATOM 4746  H HB   . ILE A 1 68  ? -4.001  -4.996  1.669   1.00 0.00 ? 68  ILE A HB   3  
ATOM 4747  H HG12 . ILE A 1 68  ? -6.173  -2.914  1.978   1.00 0.00 ? 68  ILE A HG12 3  
ATOM 4748  H HG13 . ILE A 1 68  ? -4.492  -2.663  2.435   1.00 0.00 ? 68  ILE A HG13 3  
ATOM 4749  H HG21 . ILE A 1 68  ? -5.522  -5.901  0.302   1.00 0.00 ? 68  ILE A HG21 3  
ATOM 4750  H HG22 . ILE A 1 68  ? -6.424  -6.268  1.772   1.00 0.00 ? 68  ILE A HG22 3  
ATOM 4751  H HG23 . ILE A 1 68  ? -6.796  -4.812  0.850   1.00 0.00 ? 68  ILE A HG23 3  
ATOM 4752  H HD11 . ILE A 1 68  ? -4.137  -1.932  0.380   1.00 0.00 ? 68  ILE A HD11 3  
ATOM 4753  H HD12 . ILE A 1 68  ? -4.404  -3.579  -0.193  1.00 0.00 ? 68  ILE A HD12 3  
ATOM 4754  H HD13 . ILE A 1 68  ? -5.746  -2.436  -0.137  1.00 0.00 ? 68  ILE A HD13 3  
ATOM 4755  N N    . CYS A 1 69  ? -5.897  -7.213  4.231   1.00 0.00 ? 69  CYS A N    3  
ATOM 4756  C CA   . CYS A 1 69  ? -5.800  -8.648  4.472   1.00 0.00 ? 69  CYS A CA   3  
ATOM 4757  C C    . CYS A 1 69  ? -6.749  -9.418  3.559   1.00 0.00 ? 69  CYS A C    3  
ATOM 4758  O O    . CYS A 1 69  ? -7.919  -9.068  3.402   1.00 0.00 ? 69  CYS A O    3  
ATOM 4759  C CB   . CYS A 1 69  ? -6.114  -8.962  5.936   1.00 0.00 ? 69  CYS A CB   3  
ATOM 4760  S SG   . CYS A 1 69  ? -5.536  -10.585 6.483   1.00 0.00 ? 69  CYS A SG   3  
ATOM 4761  H H    . CYS A 1 69  ? -6.719  -6.741  4.480   1.00 0.00 ? 69  CYS A H    3  
ATOM 4762  H HA   . CYS A 1 69  ? -4.788  -8.952  4.257   1.00 0.00 ? 69  CYS A HA   3  
ATOM 4763  H HB2  . CYS A 1 69  ? -5.646  -8.219  6.564   1.00 0.00 ? 69  CYS A HB2  3  
ATOM 4764  H HB3  . CYS A 1 69  ? -7.183  -8.926  6.083   1.00 0.00 ? 69  CYS A HB3  3  
ATOM 4765  H HG   . CYS A 1 69  ? -6.249  -11.507 5.853   1.00 0.00 ? 69  CYS A HG   3  
ATOM 4766  N N    . PRO A 1 70  ? -6.235  -10.491 2.941   1.00 0.00 ? 70  PRO A N    3  
ATOM 4767  C CA   . PRO A 1 70  ? -7.019  -11.333 2.032   1.00 0.00 ? 70  PRO A CA   3  
ATOM 4768  C C    . PRO A 1 70  ? -8.083  -12.143 2.765   1.00 0.00 ? 70  PRO A C    3  
ATOM 4769  O O    . PRO A 1 70  ? -7.865  -12.604 3.886   1.00 0.00 ? 70  PRO A O    3  
ATOM 4770  C CB   . PRO A 1 70  ? -5.970  -12.262 1.416   1.00 0.00 ? 70  PRO A CB   3  
ATOM 4771  C CG   . PRO A 1 70  ? -4.875  -12.318 2.423   1.00 0.00 ? 70  PRO A CG   3  
ATOM 4772  C CD   . PRO A 1 70  ? -4.848  -10.967 3.082   1.00 0.00 ? 70  PRO A CD   3  
ATOM 4773  H HA   . PRO A 1 70  ? -7.486  -10.748 1.254   1.00 0.00 ? 70  PRO A HA   3  
ATOM 4774  H HB2  . PRO A 1 70  ? -6.404  -13.237 1.248   1.00 0.00 ? 70  PRO A HB2  3  
ATOM 4775  H HB3  . PRO A 1 70  ? -5.625  -11.849 0.480   1.00 0.00 ? 70  PRO A HB3  3  
ATOM 4776  H HG2  . PRO A 1 70  ? -5.084  -13.086 3.151   1.00 0.00 ? 70  PRO A HG2  3  
ATOM 4777  H HG3  . PRO A 1 70  ? -3.933  -12.513 1.931   1.00 0.00 ? 70  PRO A HG3  3  
ATOM 4778  H HD2  . PRO A 1 70  ? -4.577  -11.060 4.123   1.00 0.00 ? 70  PRO A HD2  3  
ATOM 4779  H HD3  . PRO A 1 70  ? -4.162  -10.310 2.569   1.00 0.00 ? 70  PRO A HD3  3  
ATOM 4780  N N    . THR A 1 71  ? -9.236  -12.313 2.125   1.00 0.00 ? 71  THR A N    3  
ATOM 4781  C CA   . THR A 1 71  ? -10.334 -13.067 2.716   1.00 0.00 ? 71  THR A CA   3  
ATOM 4782  C C    . THR A 1 71  ? -10.761 -14.218 1.812   1.00 0.00 ? 71  THR A C    3  
ATOM 4783  O O    . THR A 1 71  ? -10.757 -14.110 0.586   1.00 0.00 ? 71  THR A O    3  
ATOM 4784  C CB   . THR A 1 71  ? -11.552 -12.165 2.989   1.00 0.00 ? 71  THR A CB   3  
ATOM 4785  O OG1  . THR A 1 71  ? -12.117 -11.718 1.752   1.00 0.00 ? 71  THR A OG1  3  
ATOM 4786  C CG2  . THR A 1 71  ? -11.157 -10.964 3.835   1.00 0.00 ? 71  THR A CG2  3  
ATOM 4787  H H    . THR A 1 71  ? -9.349  -11.922 1.234   1.00 0.00 ? 71  THR A H    3  
ATOM 4788  H HA   . THR A 1 71  ? -9.993  -13.470 3.659   1.00 0.00 ? 71  THR A HA   3  
ATOM 4789  H HB   . THR A 1 71  ? -12.293 -12.739 3.528   1.00 0.00 ? 71  THR A HB   3  
ATOM 4790  H HG1  . THR A 1 71  ? -13.050 -11.524 1.877   1.00 0.00 ? 71  THR A HG1  3  
ATOM 4791  H HG21 . THR A 1 71  ? -10.084 -10.943 3.952   1.00 0.00 ? 71  THR A HG21 3  
ATOM 4792  H HG22 . THR A 1 71  ? -11.624 -11.038 4.806   1.00 0.00 ? 71  THR A HG22 3  
ATOM 4793  H HG23 . THR A 1 71  ? -11.483 -10.058 3.347   1.00 0.00 ? 71  THR A HG23 3  
ATOM 4794  N N    . PRO A 1 72  ? -11.138 -15.348 2.429   1.00 0.00 ? 72  PRO A N    3  
ATOM 4795  C CA   . PRO A 1 72  ? -11.576 -16.541 1.698   1.00 0.00 ? 72  PRO A CA   3  
ATOM 4796  C C    . PRO A 1 72  ? -12.928 -16.342 1.022   1.00 0.00 ? 72  PRO A C    3  
ATOM 4797  O O    . PRO A 1 72  ? -13.376 -17.189 0.250   1.00 0.00 ? 72  PRO A O    3  
ATOM 4798  C CB   . PRO A 1 72  ? -11.675 -17.609 2.790   1.00 0.00 ? 72  PRO A CB   3  
ATOM 4799  C CG   . PRO A 1 72  ? -11.909 -16.845 4.047   1.00 0.00 ? 72  PRO A CG   3  
ATOM 4800  C CD   . PRO A 1 72  ? -11.166 -15.548 3.888   1.00 0.00 ? 72  PRO A CD   3  
ATOM 4801  H HA   . PRO A 1 72  ? -10.847 -16.844 0.961   1.00 0.00 ? 72  PRO A HA   3  
ATOM 4802  H HB2  . PRO A 1 72  ? -12.498 -18.275 2.572   1.00 0.00 ? 72  PRO A HB2  3  
ATOM 4803  H HB3  . PRO A 1 72  ? -10.754 -18.170 2.835   1.00 0.00 ? 72  PRO A HB3  3  
ATOM 4804  H HG2  . PRO A 1 72  ? -12.965 -16.660 4.173   1.00 0.00 ? 72  PRO A HG2  3  
ATOM 4805  H HG3  . PRO A 1 72  ? -11.520 -17.398 4.890   1.00 0.00 ? 72  PRO A HG3  3  
ATOM 4806  H HD2  . PRO A 1 72  ? -11.699 -14.745 4.377   1.00 0.00 ? 72  PRO A HD2  3  
ATOM 4807  H HD3  . PRO A 1 72  ? -10.165 -15.635 4.284   1.00 0.00 ? 72  PRO A HD3  3  
ATOM 4808  N N    . ASN A 1 73  ? -13.573 -15.218 1.317   1.00 0.00 ? 73  ASN A N    3  
ATOM 4809  C CA   . ASN A 1 73  ? -14.875 -14.909 0.738   1.00 0.00 ? 73  ASN A CA   3  
ATOM 4810  C C    . ASN A 1 73  ? -14.720 -14.303 -0.654  1.00 0.00 ? 73  ASN A C    3  
ATOM 4811  O O    . ASN A 1 73  ? -15.653 -13.704 -1.188  1.00 0.00 ? 73  ASN A O    3  
ATOM 4812  C CB   . ASN A 1 73  ? -15.644 -13.946 1.644   1.00 0.00 ? 73  ASN A CB   3  
ATOM 4813  C CG   . ASN A 1 73  ? -16.226 -14.638 2.861   1.00 0.00 ? 73  ASN A CG   3  
ATOM 4814  O OD1  . ASN A 1 73  ? -17.280 -15.270 2.785   1.00 0.00 ? 73  ASN A OD1  3  
ATOM 4815  N ND2  . ASN A 1 73  ? -15.541 -14.521 3.992   1.00 0.00 ? 73  ASN A ND2  3  
ATOM 4816  H H    . ASN A 1 73  ? -13.164 -14.582 1.940   1.00 0.00 ? 73  ASN A H    3  
ATOM 4817  H HA   . ASN A 1 73  ? -15.429 -15.832 0.656   1.00 0.00 ? 73  ASN A HA   3  
ATOM 4818  H HB2  . ASN A 1 73  ? -14.976 -13.168 1.982   1.00 0.00 ? 73  ASN A HB2  3  
ATOM 4819  H HB3  . ASN A 1 73  ? -16.453 -13.502 1.083   1.00 0.00 ? 73  ASN A HB3  3  
ATOM 4820  H HD21 . ASN A 1 73  ? -14.709 -14.002 3.979   1.00 0.00 ? 73  ASN A HD21 3  
ATOM 4821  H HD22 . ASN A 1 73  ? -15.894 -14.959 4.795   1.00 0.00 ? 73  ASN A HD22 3  
ATOM 4822  N N    . ASN A 1 74  ? -13.536 -14.463 -1.235  1.00 0.00 ? 74  ASN A N    3  
ATOM 4823  C CA   . ASN A 1 74  ? -13.259 -13.931 -2.565  1.00 0.00 ? 74  ASN A CA   3  
ATOM 4824  C C    . ASN A 1 74  ? -13.247 -12.406 -2.549  1.00 0.00 ? 74  ASN A C    3  
ATOM 4825  O O    . ASN A 1 74  ? -13.641 -11.763 -3.521  1.00 0.00 ? 74  ASN A O    3  
ATOM 4826  C CB   . ASN A 1 74  ? -14.302 -14.434 -3.565  1.00 0.00 ? 74  ASN A CB   3  
ATOM 4827  C CG   . ASN A 1 74  ? -14.713 -15.869 -3.300  1.00 0.00 ? 74  ASN A CG   3  
ATOM 4828  O OD1  . ASN A 1 74  ? -13.869 -16.760 -3.202  1.00 0.00 ? 74  ASN A OD1  3  
ATOM 4829  N ND2  . ASN A 1 74  ? -16.015 -16.100 -3.182  1.00 0.00 ? 74  ASN A ND2  3  
ATOM 4830  H H    . ASN A 1 74  ? -12.832 -14.950 -0.759  1.00 0.00 ? 74  ASN A H    3  
ATOM 4831  H HA   . ASN A 1 74  ? -12.285 -14.284 -2.866  1.00 0.00 ? 74  ASN A HA   3  
ATOM 4832  H HB2  . ASN A 1 74  ? -15.182 -13.811 -3.502  1.00 0.00 ? 74  ASN A HB2  3  
ATOM 4833  H HB3  . ASN A 1 74  ? -13.894 -14.374 -4.563  1.00 0.00 ? 74  ASN A HB3  3  
ATOM 4834  H HD21 . ASN A 1 74  ? -16.630 -15.341 -3.272  1.00 0.00 ? 74  ASN A HD21 3  
ATOM 4835  H HD22 . ASN A 1 74  ? -16.309 -17.019 -3.010  1.00 0.00 ? 74  ASN A HD22 3  
ATOM 4836  N N    . GLN A 1 75  ? -12.792 -11.834 -1.438  1.00 0.00 ? 75  GLN A N    3  
ATOM 4837  C CA   . GLN A 1 75  ? -12.729 -10.385 -1.296  1.00 0.00 ? 75  GLN A CA   3  
ATOM 4838  C C    . GLN A 1 75  ? -11.454 -9.963  -0.573  1.00 0.00 ? 75  GLN A C    3  
ATOM 4839  O O    . GLN A 1 75  ? -10.696 -10.804 -0.089  1.00 0.00 ? 75  GLN A O    3  
ATOM 4840  C CB   . GLN A 1 75  ? -13.954 -9.872  -0.536  1.00 0.00 ? 75  GLN A CB   3  
ATOM 4841  C CG   . GLN A 1 75  ? -15.263 -10.084 -1.278  1.00 0.00 ? 75  GLN A CG   3  
ATOM 4842  C CD   . GLN A 1 75  ? -15.600 -8.934  -2.207  1.00 0.00 ? 75  GLN A CD   3  
ATOM 4843  O OE1  . GLN A 1 75  ? -14.781 -8.526  -3.031  1.00 0.00 ? 75  GLN A OE1  3  
ATOM 4844  N NE2  . GLN A 1 75  ? -16.811 -8.405  -2.079  1.00 0.00 ? 75  GLN A NE2  3  
ATOM 4845  H H    . GLN A 1 75  ? -12.493 -12.401 -0.698  1.00 0.00 ? 75  GLN A H    3  
ATOM 4846  H HA   . GLN A 1 75  ? -12.726 -9.955  -2.286  1.00 0.00 ? 75  GLN A HA   3  
ATOM 4847  H HB2  . GLN A 1 75  ? -14.015 -10.385 0.412   1.00 0.00 ? 75  GLN A HB2  3  
ATOM 4848  H HB3  . GLN A 1 75  ? -13.834 -8.814  -0.357  1.00 0.00 ? 75  GLN A HB3  3  
ATOM 4849  H HG2  . GLN A 1 75  ? -15.189 -10.989 -1.863  1.00 0.00 ? 75  GLN A HG2  3  
ATOM 4850  H HG3  . GLN A 1 75  ? -16.059 -10.189 -0.555  1.00 0.00 ? 75  GLN A HG3  3  
ATOM 4851  H HE21 . GLN A 1 75  ? -17.411 -8.780  -1.400  1.00 0.00 ? 75  GLN A HE21 3  
ATOM 4852  H HE22 . GLN A 1 75  ? -17.055 -7.660  -2.666  1.00 0.00 ? 75  GLN A HE22 3  
ATOM 4853  N N    . PHE A 1 76  ? -11.223 -8.657  -0.504  1.00 0.00 ? 76  PHE A N    3  
ATOM 4854  C CA   . PHE A 1 76  ? -10.039 -8.123  0.158   1.00 0.00 ? 76  PHE A CA   3  
ATOM 4855  C C    . PHE A 1 76  ? -10.424 -7.086  1.209   1.00 0.00 ? 76  PHE A C    3  
ATOM 4856  O O    . PHE A 1 76  ? -11.055 -6.077  0.898   1.00 0.00 ? 76  PHE A O    3  
ATOM 4857  C CB   . PHE A 1 76  ? -9.092  -7.499  -0.868  1.00 0.00 ? 76  PHE A CB   3  
ATOM 4858  C CG   . PHE A 1 76  ? -8.342  -8.511  -1.686  1.00 0.00 ? 76  PHE A CG   3  
ATOM 4859  C CD1  . PHE A 1 76  ? -9.015  -9.360  -2.549  1.00 0.00 ? 76  PHE A CD1  3  
ATOM 4860  C CD2  . PHE A 1 76  ? -6.963  -8.613  -1.592  1.00 0.00 ? 76  PHE A CD2  3  
ATOM 4861  C CE1  . PHE A 1 76  ? -8.327  -10.293 -3.301  1.00 0.00 ? 76  PHE A CE1  3  
ATOM 4862  C CE2  . PHE A 1 76  ? -6.270  -9.543  -2.342  1.00 0.00 ? 76  PHE A CE2  3  
ATOM 4863  C CZ   . PHE A 1 76  ? -6.953  -10.384 -3.199  1.00 0.00 ? 76  PHE A CZ   3  
ATOM 4864  H H    . PHE A 1 76  ? -11.865 -8.036  -0.910  1.00 0.00 ? 76  PHE A H    3  
ATOM 4865  H HA   . PHE A 1 76  ? -9.536  -8.944  0.647   1.00 0.00 ? 76  PHE A HA   3  
ATOM 4866  H HB2  . PHE A 1 76  ? -9.663  -6.883  -1.546  1.00 0.00 ? 76  PHE A HB2  3  
ATOM 4867  H HB3  . PHE A 1 76  ? -8.369  -6.884  -0.353  1.00 0.00 ? 76  PHE A HB3  3  
ATOM 4868  H HD1  . PHE A 1 76  ? -10.090 -9.290  -2.631  1.00 0.00 ? 76  PHE A HD1  3  
ATOM 4869  H HD2  . PHE A 1 76  ? -6.427  -7.955  -0.922  1.00 0.00 ? 76  PHE A HD2  3  
ATOM 4870  H HE1  . PHE A 1 76  ? -8.863  -10.949 -3.971  1.00 0.00 ? 76  PHE A HE1  3  
ATOM 4871  H HE2  . PHE A 1 76  ? -5.195  -9.612  -2.260  1.00 0.00 ? 76  PHE A HE2  3  
ATOM 4872  H HZ   . PHE A 1 76  ? -6.413  -11.112 -3.786  1.00 0.00 ? 76  PHE A HZ   3  
ATOM 4873  N N    . MET A 1 77  ? -10.040 -7.344  2.455   1.00 0.00 ? 77  MET A N    3  
ATOM 4874  C CA   . MET A 1 77  ? -10.344 -6.433  3.552   1.00 0.00 ? 77  MET A CA   3  
ATOM 4875  C C    . MET A 1 77  ? -9.386  -5.246  3.555   1.00 0.00 ? 77  MET A C    3  
ATOM 4876  O O    . MET A 1 77  ? -8.197  -5.396  3.276   1.00 0.00 ? 77  MET A O    3  
ATOM 4877  C CB   . MET A 1 77  ? -10.267 -7.169  4.891   1.00 0.00 ? 77  MET A CB   3  
ATOM 4878  C CG   . MET A 1 77  ? -11.554 -7.886  5.266   1.00 0.00 ? 77  MET A CG   3  
ATOM 4879  S SD   . MET A 1 77  ? -11.320 -9.085  6.592   1.00 0.00 ? 77  MET A SD   3  
ATOM 4880  C CE   . MET A 1 77  ? -11.044 -7.996  7.988   1.00 0.00 ? 77  MET A CE   3  
ATOM 4881  H H    . MET A 1 77  ? -9.539  -8.166  2.642   1.00 0.00 ? 77  MET A H    3  
ATOM 4882  H HA   . MET A 1 77  ? -11.350 -6.068  3.410   1.00 0.00 ? 77  MET A HA   3  
ATOM 4883  H HB2  . MET A 1 77  ? -9.474  -7.900  4.841   1.00 0.00 ? 77  MET A HB2  3  
ATOM 4884  H HB3  . MET A 1 77  ? -10.039 -6.455  5.669   1.00 0.00 ? 77  MET A HB3  3  
ATOM 4885  H HG2  . MET A 1 77  ? -12.279 -7.153  5.586   1.00 0.00 ? 77  MET A HG2  3  
ATOM 4886  H HG3  . MET A 1 77  ? -11.928 -8.402  4.394   1.00 0.00 ? 77  MET A HG3  3  
ATOM 4887  H HE1  . MET A 1 77  ? -11.633 -7.098  7.866   1.00 0.00 ? 77  MET A HE1  3  
ATOM 4888  H HE2  . MET A 1 77  ? -11.336 -8.497  8.898   1.00 0.00 ? 77  MET A HE2  3  
ATOM 4889  H HE3  . MET A 1 77  ? -9.997  -7.735  8.039   1.00 0.00 ? 77  MET A HE3  3  
ATOM 4890  N N    . MET A 1 78  ? -9.912  -4.067  3.872   1.00 0.00 ? 78  MET A N    3  
ATOM 4891  C CA   . MET A 1 78  ? -9.102  -2.855  3.911   1.00 0.00 ? 78  MET A CA   3  
ATOM 4892  C C    . MET A 1 78  ? -9.050  -2.282  5.324   1.00 0.00 ? 78  MET A C    3  
ATOM 4893  O O    . MET A 1 78  ? -8.731  -1.110  5.517   1.00 0.00 ? 78  MET A O    3  
ATOM 4894  C CB   . MET A 1 78  ? -9.661  -1.810  2.944   1.00 0.00 ? 78  MET A CB   3  
ATOM 4895  C CG   . MET A 1 78  ? -8.598  -0.899  2.352   1.00 0.00 ? 78  MET A CG   3  
ATOM 4896  S SD   . MET A 1 78  ? -8.333  0.589   3.335   1.00 0.00 ? 78  MET A SD   3  
ATOM 4897  C CE   . MET A 1 78  ? -7.817  1.744   2.067   1.00 0.00 ? 78  MET A CE   3  
ATOM 4898  H H    . MET A 1 78  ? -10.867 -4.011  4.085   1.00 0.00 ? 78  MET A H    3  
ATOM 4899  H HA   . MET A 1 78  ? -8.100  -3.117  3.604   1.00 0.00 ? 78  MET A HA   3  
ATOM 4900  H HB2  . MET A 1 78  ? -10.161 -2.319  2.134   1.00 0.00 ? 78  MET A HB2  3  
ATOM 4901  H HB3  . MET A 1 78  ? -10.377 -1.197  3.470   1.00 0.00 ? 78  MET A HB3  3  
ATOM 4902  H HG2  . MET A 1 78  ? -7.668  -1.444  2.293   1.00 0.00 ? 78  MET A HG2  3  
ATOM 4903  H HG3  . MET A 1 78  ? -8.906  -0.608  1.359   1.00 0.00 ? 78  MET A HG3  3  
ATOM 4904  H HE1  . MET A 1 78  ? -8.353  2.674   2.188   1.00 0.00 ? 78  MET A HE1  3  
ATOM 4905  H HE2  . MET A 1 78  ? -6.756  1.926   2.157   1.00 0.00 ? 78  MET A HE2  3  
ATOM 4906  H HE3  . MET A 1 78  ? -8.031  1.329   1.093   1.00 0.00 ? 78  MET A HE3  3  
ATOM 4907  N N    . GLY A 1 79  ? -9.366  -3.117  6.309   1.00 0.00 ? 79  GLY A N    3  
ATOM 4908  C CA   . GLY A 1 79  ? -9.350  -2.674  7.691   1.00 0.00 ? 79  GLY A CA   3  
ATOM 4909  C C    . GLY A 1 79  ? -10.520 -3.217  8.488   1.00 0.00 ? 79  GLY A C    3  
ATOM 4910  O O    . GLY A 1 79  ? -10.618 -2.990  9.693   1.00 0.00 ? 79  GLY A O    3  
ATOM 4911  H H    . GLY A 1 79  ? -9.613  -4.041  6.096   1.00 0.00 ? 79  GLY A H    3  
ATOM 4912  H HA2  . GLY A 1 79  ? -8.431  -3.003  8.152   1.00 0.00 ? 79  GLY A HA2  3  
ATOM 4913  H HA3  . GLY A 1 79  ? -9.385  -1.595  7.711   1.00 0.00 ? 79  GLY A HA3  3  
ATOM 4914  N N    . GLY A 1 80  ? -11.412 -3.935  7.812   1.00 0.00 ? 80  GLY A N    3  
ATOM 4915  C CA   . GLY A 1 80  ? -12.571 -4.498  8.480   1.00 0.00 ? 80  GLY A CA   3  
ATOM 4916  C C    . GLY A 1 80  ? -13.761 -4.643  7.553   1.00 0.00 ? 80  GLY A C    3  
ATOM 4917  O O    . GLY A 1 80  ? -14.718 -5.351  7.868   1.00 0.00 ? 80  GLY A O    3  
ATOM 4918  H H    . GLY A 1 80  ? -11.282 -4.083  6.852   1.00 0.00 ? 80  GLY A H    3  
ATOM 4919  H HA2  . GLY A 1 80  ? -12.310 -5.471  8.870   1.00 0.00 ? 80  GLY A HA2  3  
ATOM 4920  H HA3  . GLY A 1 80  ? -12.846 -3.854  9.302   1.00 0.00 ? 80  GLY A HA3  3  
ATOM 4921  N N    . ARG A 1 81  ? -13.703 -3.971  6.408   1.00 0.00 ? 81  ARG A N    3  
ATOM 4922  C CA   . ARG A 1 81  ? -14.786 -4.027  5.434   1.00 0.00 ? 81  ARG A CA   3  
ATOM 4923  C C    . ARG A 1 81  ? -14.349 -4.774  4.177   1.00 0.00 ? 81  ARG A C    3  
ATOM 4924  O O    . ARG A 1 81  ? -13.170 -4.782  3.825   1.00 0.00 ? 81  ARG A O    3  
ATOM 4925  C CB   . ARG A 1 81  ? -15.243 -2.614  5.066   1.00 0.00 ? 81  ARG A CB   3  
ATOM 4926  C CG   . ARG A 1 81  ? -15.555 -1.742  6.272   1.00 0.00 ? 81  ARG A CG   3  
ATOM 4927  C CD   . ARG A 1 81  ? -17.003 -1.897  6.711   1.00 0.00 ? 81  ARG A CD   3  
ATOM 4928  N NE   . ARG A 1 81  ? -17.163 -2.954  7.706   1.00 0.00 ? 81  ARG A NE   3  
ATOM 4929  C CZ   . ARG A 1 81  ? -18.312 -3.220  8.317   1.00 0.00 ? 81  ARG A CZ   3  
ATOM 4930  N NH1  . ARG A 1 81  ? -19.396 -2.510  8.036   1.00 0.00 ? 81  ARG A NH1  3  
ATOM 4931  N NH2  . ARG A 1 81  ? -18.378 -4.198  9.211   1.00 0.00 ? 81  ARG A NH2  3  
ATOM 4932  H H    . ARG A 1 81  ? -12.913 -3.424  6.214   1.00 0.00 ? 81  ARG A H    3  
ATOM 4933  H HA   . ARG A 1 81  ? -15.611 -4.556  5.885   1.00 0.00 ? 81  ARG A HA   3  
ATOM 4934  H HB2  . ARG A 1 81  ? -14.463 -2.133  4.495   1.00 0.00 ? 81  ARG A HB2  3  
ATOM 4935  H HB3  . ARG A 1 81  ? -16.133 -2.683  4.459   1.00 0.00 ? 81  ARG A HB3  3  
ATOM 4936  H HG2  . ARG A 1 81  ? -14.910 -2.029  7.089   1.00 0.00 ? 81  ARG A HG2  3  
ATOM 4937  H HG3  . ARG A 1 81  ? -15.374 -0.709  6.013   1.00 0.00 ? 81  ARG A HG3  3  
ATOM 4938  H HD2  . ARG A 1 81  ? -17.338 -0.962  7.136   1.00 0.00 ? 81  ARG A HD2  3  
ATOM 4939  H HD3  . ARG A 1 81  ? -17.604 -2.134  5.846   1.00 0.00 ? 81  ARG A HD3  3  
ATOM 4940  H HE   . ARG A 1 81  ? -16.374 -3.491  7.928   1.00 0.00 ? 81  ARG A HE   3  
ATOM 4941  H HH11 . ARG A 1 81  ? -19.349 -1.773  7.362   1.00 0.00 ? 81  ARG A HH11 3  
ATOM 4942  H HH12 . ARG A 1 81  ? -20.260 -2.713  8.497   1.00 0.00 ? 81  ARG A HH12 3  
ATOM 4943  H HH21 . ARG A 1 81  ? -17.563 -4.736  9.425   1.00 0.00 ? 81  ARG A HH21 3  
ATOM 4944  H HH22 . ARG A 1 81  ? -19.243 -4.398  9.670   1.00 0.00 ? 81  ARG A HH22 3  
ATOM 4945  N N    . TYR A 1 82  ? -15.308 -5.403  3.506   1.00 0.00 ? 82  TYR A N    3  
ATOM 4946  C CA   . TYR A 1 82  ? -15.022 -6.156  2.291   1.00 0.00 ? 82  TYR A CA   3  
ATOM 4947  C C    . TYR A 1 82  ? -15.258 -5.299  1.051   1.00 0.00 ? 82  TYR A C    3  
ATOM 4948  O O    . TYR A 1 82  ? -16.213 -4.524  0.989   1.00 0.00 ? 82  TYR A O    3  
ATOM 4949  C CB   . TYR A 1 82  ? -15.892 -7.413  2.228   1.00 0.00 ? 82  TYR A CB   3  
ATOM 4950  C CG   . TYR A 1 82  ? -15.900 -8.208  3.514   1.00 0.00 ? 82  TYR A CG   3  
ATOM 4951  C CD1  . TYR A 1 82  ? -14.714 -8.636  4.096   1.00 0.00 ? 82  TYR A CD1  3  
ATOM 4952  C CD2  . TYR A 1 82  ? -17.094 -8.532  4.146   1.00 0.00 ? 82  TYR A CD2  3  
ATOM 4953  C CE1  . TYR A 1 82  ? -14.716 -9.364  5.271   1.00 0.00 ? 82  TYR A CE1  3  
ATOM 4954  C CE2  . TYR A 1 82  ? -17.106 -9.258  5.321   1.00 0.00 ? 82  TYR A CE2  3  
ATOM 4955  C CZ   . TYR A 1 82  ? -15.914 -9.672  5.880   1.00 0.00 ? 82  TYR A CZ   3  
ATOM 4956  O OH   . TYR A 1 82  ? -15.922 -10.396 7.049   1.00 0.00 ? 82  TYR A OH   3  
ATOM 4957  H H    . TYR A 1 82  ? -16.230 -5.360  3.836   1.00 0.00 ? 82  TYR A H    3  
ATOM 4958  H HA   . TYR A 1 82  ? -13.984 -6.450  2.319   1.00 0.00 ? 82  TYR A HA   3  
ATOM 4959  H HB2  . TYR A 1 82  ? -16.910 -7.127  2.009   1.00 0.00 ? 82  TYR A HB2  3  
ATOM 4960  H HB3  . TYR A 1 82  ? -15.527 -8.056  1.442   1.00 0.00 ? 82  TYR A HB3  3  
ATOM 4961  H HD1  . TYR A 1 82  ? -13.776 -8.393  3.617   1.00 0.00 ? 82  TYR A HD1  3  
ATOM 4962  H HD2  . TYR A 1 82  ? -18.026 -8.207  3.706   1.00 0.00 ? 82  TYR A HD2  3  
ATOM 4963  H HE1  . TYR A 1 82  ? -13.783 -9.688  5.708   1.00 0.00 ? 82  TYR A HE1  3  
ATOM 4964  H HE2  . TYR A 1 82  ? -18.045 -9.500  5.798   1.00 0.00 ? 82  TYR A HE2  3  
ATOM 4965  H HH   . TYR A 1 82  ? -16.004 -11.331 6.846   1.00 0.00 ? 82  TYR A HH   3  
ATOM 4966  N N    . TYR A 1 83  ? -14.380 -5.444  0.064   1.00 0.00 ? 83  TYR A N    3  
ATOM 4967  C CA   . TYR A 1 83  ? -14.489 -4.683  -1.174  1.00 0.00 ? 83  TYR A CA   3  
ATOM 4968  C C    . TYR A 1 83  ? -14.309 -5.589  -2.388  1.00 0.00 ? 83  TYR A C    3  
ATOM 4969  O O    . TYR A 1 83  ? -13.445 -6.465  -2.400  1.00 0.00 ? 83  TYR A O    3  
ATOM 4970  C CB   . TYR A 1 83  ? -13.449 -3.562  -1.202  1.00 0.00 ? 83  TYR A CB   3  
ATOM 4971  C CG   . TYR A 1 83  ? -13.831 -2.360  -0.368  1.00 0.00 ? 83  TYR A CG   3  
ATOM 4972  C CD1  . TYR A 1 83  ? -14.570 -1.318  -0.913  1.00 0.00 ? 83  TYR A CD1  3  
ATOM 4973  C CD2  . TYR A 1 83  ? -13.454 -2.268  0.966   1.00 0.00 ? 83  TYR A CD2  3  
ATOM 4974  C CE1  . TYR A 1 83  ? -14.921 -0.218  -0.155  1.00 0.00 ? 83  TYR A CE1  3  
ATOM 4975  C CE2  . TYR A 1 83  ? -13.801 -1.172  1.732   1.00 0.00 ? 83  TYR A CE2  3  
ATOM 4976  C CZ   . TYR A 1 83  ? -14.534 -0.149  1.167   1.00 0.00 ? 83  TYR A CZ   3  
ATOM 4977  O OH   . TYR A 1 83  ? -14.883 0.944   1.927   1.00 0.00 ? 83  TYR A OH   3  
ATOM 4978  H H    . TYR A 1 83  ? -13.639 -6.077  0.172   1.00 0.00 ? 83  TYR A H    3  
ATOM 4979  H HA   . TYR A 1 83  ? -15.476 -4.245  -1.209  1.00 0.00 ? 83  TYR A HA   3  
ATOM 4980  H HB2  . TYR A 1 83  ? -12.511 -3.941  -0.826  1.00 0.00 ? 83  TYR A HB2  3  
ATOM 4981  H HB3  . TYR A 1 83  ? -13.315 -3.230  -2.221  1.00 0.00 ? 83  TYR A HB3  3  
ATOM 4982  H HD1  . TYR A 1 83  ? -14.872 -1.374  -1.949  1.00 0.00 ? 83  TYR A HD1  3  
ATOM 4983  H HD2  . TYR A 1 83  ? -12.879 -3.070  1.406   1.00 0.00 ? 83  TYR A HD2  3  
ATOM 4984  H HE1  . TYR A 1 83  ? -15.495 0.583   -0.597  1.00 0.00 ? 83  TYR A HE1  3  
ATOM 4985  H HE2  . TYR A 1 83  ? -13.498 -1.118  2.768   1.00 0.00 ? 83  TYR A HE2  3  
ATOM 4986  H HH   . TYR A 1 83  ? -15.191 1.648   1.351   1.00 0.00 ? 83  TYR A HH   3  
ATOM 4987  N N    . ASN A 1 84  ? -15.132 -5.370  -3.409  1.00 0.00 ? 84  ASN A N    3  
ATOM 4988  C CA   . ASN A 1 84  ? -15.065 -6.167  -4.629  1.00 0.00 ? 84  ASN A CA   3  
ATOM 4989  C C    . ASN A 1 84  ? -13.625 -6.562  -4.942  1.00 0.00 ? 84  ASN A C    3  
ATOM 4990  O O    . ASN A 1 84  ? -13.304 -7.745  -5.047  1.00 0.00 ? 84  ASN A O    3  
ATOM 4991  C CB   . ASN A 1 84  ? -15.660 -5.388  -5.804  1.00 0.00 ? 84  ASN A CB   3  
ATOM 4992  C CG   . ASN A 1 84  ? -15.446 -6.091  -7.131  1.00 0.00 ? 84  ASN A CG   3  
ATOM 4993  O OD1  . ASN A 1 84  ? -15.250 -7.305  -7.178  1.00 0.00 ? 84  ASN A OD1  3  
ATOM 4994  N ND2  . ASN A 1 84  ? -15.483 -5.328  -8.217  1.00 0.00 ? 84  ASN A ND2  3  
ATOM 4995  H H    . ASN A 1 84  ? -15.801 -4.657  -3.340  1.00 0.00 ? 84  ASN A H    3  
ATOM 4996  H HA   . ASN A 1 84  ? -15.646 -7.063  -4.472  1.00 0.00 ? 84  ASN A HA   3  
ATOM 4997  H HB2  . ASN A 1 84  ? -16.722 -5.269  -5.649  1.00 0.00 ? 84  ASN A HB2  3  
ATOM 4998  H HB3  . ASN A 1 84  ? -15.196 -4.414  -5.855  1.00 0.00 ? 84  ASN A HB3  3  
ATOM 4999  H HD21 . ASN A 1 84  ? -15.644 -4.368  -8.104  1.00 0.00 ? 84  ASN A HD21 3  
ATOM 5000  H HD22 . ASN A 1 84  ? -15.349 -5.757  -9.088  1.00 0.00 ? 84  ASN A HD22 3  
ATOM 5001  N N    . SER A 1 85  ? -12.762 -5.562  -5.090  1.00 0.00 ? 85  SER A N    3  
ATOM 5002  C CA   . SER A 1 85  ? -11.357 -5.804  -5.395  1.00 0.00 ? 85  SER A CA   3  
ATOM 5003  C C    . SER A 1 85  ? -10.542 -4.522  -5.256  1.00 0.00 ? 85  SER A C    3  
ATOM 5004  O O    . SER A 1 85  ? -11.096 -3.423  -5.211  1.00 0.00 ? 85  SER A O    3  
ATOM 5005  C CB   . SER A 1 85  ? -11.209 -6.365  -6.810  1.00 0.00 ? 85  SER A CB   3  
ATOM 5006  O OG   . SER A 1 85  ? -11.532 -7.744  -6.849  1.00 0.00 ? 85  SER A OG   3  
ATOM 5007  H H    . SER A 1 85  ? -13.079 -4.639  -4.995  1.00 0.00 ? 85  SER A H    3  
ATOM 5008  H HA   . SER A 1 85  ? -10.985 -6.532  -4.688  1.00 0.00 ? 85  SER A HA   3  
ATOM 5009  H HB2  . SER A 1 85  ? -11.872 -5.834  -7.476  1.00 0.00 ? 85  SER A HB2  3  
ATOM 5010  H HB3  . SER A 1 85  ? -10.188 -6.237  -7.141  1.00 0.00 ? 85  SER A HB3  3  
ATOM 5011  H HG   . SER A 1 85  ? -12.485 -7.852  -6.794  1.00 0.00 ? 85  SER A HG   3  
ATOM 5012  N N    . ILE A 1 86  ? -9.223  -4.671  -5.187  1.00 0.00 ? 86  ILE A N    3  
ATOM 5013  C CA   . ILE A 1 86  ? -8.331  -3.526  -5.054  1.00 0.00 ? 86  ILE A CA   3  
ATOM 5014  C C    . ILE A 1 86  ? -8.726  -2.408  -6.013  1.00 0.00 ? 86  ILE A C    3  
ATOM 5015  O O    . ILE A 1 86  ? -8.889  -1.257  -5.609  1.00 0.00 ? 86  ILE A O    3  
ATOM 5016  C CB   . ILE A 1 86  ? -6.866  -3.920  -5.318  1.00 0.00 ? 86  ILE A CB   3  
ATOM 5017  C CG1  . ILE A 1 86  ? -6.435  -5.034  -4.362  1.00 0.00 ? 86  ILE A CG1  3  
ATOM 5018  C CG2  . ILE A 1 86  ? -5.957  -2.708  -5.173  1.00 0.00 ? 86  ILE A CG2  3  
ATOM 5019  C CD1  . ILE A 1 86  ? -5.004  -5.481  -4.563  1.00 0.00 ? 86  ILE A CD1  3  
ATOM 5020  H H    . ILE A 1 86  ? -8.841  -5.572  -5.228  1.00 0.00 ? 86  ILE A H    3  
ATOM 5021  H HA   . ILE A 1 86  ? -8.408  -3.160  -4.041  1.00 0.00 ? 86  ILE A HA   3  
ATOM 5022  H HB   . ILE A 1 86  ? -6.790  -4.277  -6.334  1.00 0.00 ? 86  ILE A HB   3  
ATOM 5023  H HG12 . ILE A 1 86  ? -6.534  -4.687  -3.346  1.00 0.00 ? 86  ILE A HG12 3  
ATOM 5024  H HG13 . ILE A 1 86  ? -7.075  -5.892  -4.509  1.00 0.00 ? 86  ILE A HG13 3  
ATOM 5025  H HG21 . ILE A 1 86  ? -5.346  -2.609  -6.057  1.00 0.00 ? 86  ILE A HG21 3  
ATOM 5026  H HG22 . ILE A 1 86  ? -6.559  -1.820  -5.051  1.00 0.00 ? 86  ILE A HG22 3  
ATOM 5027  H HG23 . ILE A 1 86  ? -5.323  -2.836  -4.309  1.00 0.00 ? 86  ILE A HG23 3  
ATOM 5028  H HD11 . ILE A 1 86  ? -4.457  -5.365  -3.638  1.00 0.00 ? 86  ILE A HD11 3  
ATOM 5029  H HD12 . ILE A 1 86  ? -4.989  -6.518  -4.863  1.00 0.00 ? 86  ILE A HD12 3  
ATOM 5030  H HD13 . ILE A 1 86  ? -4.542  -4.878  -5.331  1.00 0.00 ? 86  ILE A HD13 3  
ATOM 5031  N N    . GLY A 1 87  ? -8.880  -2.755  -7.288  1.00 0.00 ? 87  GLY A N    3  
ATOM 5032  C CA   . GLY A 1 87  ? -9.256  -1.770  -8.284  1.00 0.00 ? 87  GLY A CA   3  
ATOM 5033  C C    . GLY A 1 87  ? -10.491 -0.985  -7.887  1.00 0.00 ? 87  GLY A C    3  
ATOM 5034  O O    . GLY A 1 87  ? -10.558 0.227   -8.095  1.00 0.00 ? 87  GLY A O    3  
ATOM 5035  H H    . GLY A 1 87  ? -8.737  -3.688  -7.553  1.00 0.00 ? 87  GLY A H    3  
ATOM 5036  H HA2  . GLY A 1 87  ? -8.435  -1.083  -8.424  1.00 0.00 ? 87  GLY A HA2  3  
ATOM 5037  H HA3  . GLY A 1 87  ? -9.451  -2.276  -9.219  1.00 0.00 ? 87  GLY A HA3  3  
ATOM 5038  N N    . ASP A 1 88  ? -11.471 -1.676  -7.316  1.00 0.00 ? 88  ASP A N    3  
ATOM 5039  C CA   . ASP A 1 88  ? -12.710 -1.036  -6.889  1.00 0.00 ? 88  ASP A CA   3  
ATOM 5040  C C    . ASP A 1 88  ? -12.455 -0.080  -5.728  1.00 0.00 ? 88  ASP A C    3  
ATOM 5041  O O    . ASP A 1 88  ? -12.829 1.092   -5.783  1.00 0.00 ? 88  ASP A O    3  
ATOM 5042  C CB   . ASP A 1 88  ? -13.739 -2.091  -6.481  1.00 0.00 ? 88  ASP A CB   3  
ATOM 5043  C CG   . ASP A 1 88  ? -15.071 -1.480  -6.093  1.00 0.00 ? 88  ASP A CG   3  
ATOM 5044  O OD1  . ASP A 1 88  ? -15.155 -0.887  -4.998  1.00 0.00 ? 88  ASP A OD1  3  
ATOM 5045  O OD2  . ASP A 1 88  ? -16.031 -1.597  -6.884  1.00 0.00 ? 88  ASP A OD2  3  
ATOM 5046  H H    . ASP A 1 88  ? -11.358 -2.640  -7.177  1.00 0.00 ? 88  ASP A H    3  
ATOM 5047  H HA   . ASP A 1 88  ? -13.097 -0.473  -7.724  1.00 0.00 ? 88  ASP A HA   3  
ATOM 5048  H HB2  . ASP A 1 88  ? -13.901 -2.766  -7.309  1.00 0.00 ? 88  ASP A HB2  3  
ATOM 5049  H HB3  . ASP A 1 88  ? -13.359 -2.648  -5.637  1.00 0.00 ? 88  ASP A HB3  3  
ATOM 5050  N N    . ILE A 1 89  ? -11.819 -0.588  -4.678  1.00 0.00 ? 89  ILE A N    3  
ATOM 5051  C CA   . ILE A 1 89  ? -11.515 0.221   -3.504  1.00 0.00 ? 89  ILE A CA   3  
ATOM 5052  C C    . ILE A 1 89  ? -11.064 1.621   -3.904  1.00 0.00 ? 89  ILE A C    3  
ATOM 5053  O O    . ILE A 1 89  ? -11.345 2.597   -3.207  1.00 0.00 ? 89  ILE A O    3  
ATOM 5054  C CB   . ILE A 1 89  ? -10.421 -0.431  -2.639  1.00 0.00 ? 89  ILE A CB   3  
ATOM 5055  C CG1  . ILE A 1 89  ? -10.833 -1.850  -2.239  1.00 0.00 ? 89  ILE A CG1  3  
ATOM 5056  C CG2  . ILE A 1 89  ? -10.148 0.415   -1.404  1.00 0.00 ? 89  ILE A CG2  3  
ATOM 5057  C CD1  . ILE A 1 89  ? -9.889  -2.498  -1.251  1.00 0.00 ? 89  ILE A CD1  3  
ATOM 5058  H H    . ILE A 1 89  ? -11.547 -1.529  -4.693  1.00 0.00 ? 89  ILE A H    3  
ATOM 5059  H HA   . ILE A 1 89  ? -12.416 0.299   -2.912  1.00 0.00 ? 89  ILE A HA   3  
ATOM 5060  H HB   . ILE A 1 89  ? -9.513  -0.479  -3.221  1.00 0.00 ? 89  ILE A HB   3  
ATOM 5061  H HG12 . ILE A 1 89  ? -11.813 -1.819  -1.790  1.00 0.00 ? 89  ILE A HG12 3  
ATOM 5062  H HG13 . ILE A 1 89  ? -10.866 -2.469  -3.123  1.00 0.00 ? 89  ILE A HG13 3  
ATOM 5063  H HG21 . ILE A 1 89  ? -9.082  0.540   -1.283  1.00 0.00 ? 89  ILE A HG21 3  
ATOM 5064  H HG22 . ILE A 1 89  ? -10.612 1.382   -1.521  1.00 0.00 ? 89  ILE A HG22 3  
ATOM 5065  H HG23 . ILE A 1 89  ? -10.554 -0.077  -0.533  1.00 0.00 ? 89  ILE A HG23 3  
ATOM 5066  H HD11 . ILE A 1 89  ? -10.123 -2.158  -0.253  1.00 0.00 ? 89  ILE A HD11 3  
ATOM 5067  H HD12 . ILE A 1 89  ? -9.996  -3.571  -1.301  1.00 0.00 ? 89  ILE A HD12 3  
ATOM 5068  H HD13 . ILE A 1 89  ? -8.872  -2.226  -1.494  1.00 0.00 ? 89  ILE A HD13 3  
ATOM 5069  N N    . ILE A 1 90  ? -10.366 1.713   -5.030  1.00 0.00 ? 90  ILE A N    3  
ATOM 5070  C CA   . ILE A 1 90  ? -9.879  2.995   -5.524  1.00 0.00 ? 90  ILE A CA   3  
ATOM 5071  C C    . ILE A 1 90  ? -11.013 3.821   -6.121  1.00 0.00 ? 90  ILE A C    3  
ATOM 5072  O O    . ILE A 1 90  ? -11.146 5.011   -5.835  1.00 0.00 ? 90  ILE A O    3  
ATOM 5073  C CB   . ILE A 1 90  ? -8.781  2.808   -6.588  1.00 0.00 ? 90  ILE A CB   3  
ATOM 5074  C CG1  . ILE A 1 90  ? -7.555  2.131   -5.972  1.00 0.00 ? 90  ILE A CG1  3  
ATOM 5075  C CG2  . ILE A 1 90  ? -8.401  4.149   -7.198  1.00 0.00 ? 90  ILE A CG2  3  
ATOM 5076  C CD1  . ILE A 1 90  ? -6.715  1.374   -6.977  1.00 0.00 ? 90  ILE A CD1  3  
ATOM 5077  H H    . ILE A 1 90  ? -10.174 0.900   -5.542  1.00 0.00 ? 90  ILE A H    3  
ATOM 5078  H HA   . ILE A 1 90  ? -9.456  3.535   -4.689  1.00 0.00 ? 90  ILE A HA   3  
ATOM 5079  H HB   . ILE A 1 90  ? -9.174  2.181   -7.373  1.00 0.00 ? 90  ILE A HB   3  
ATOM 5080  H HG12 . ILE A 1 90  ? -6.928  2.880   -5.515  1.00 0.00 ? 90  ILE A HG12 3  
ATOM 5081  H HG13 . ILE A 1 90  ? -7.881  1.431   -5.217  1.00 0.00 ? 90  ILE A HG13 3  
ATOM 5082  H HG21 . ILE A 1 90  ? -8.755  4.194   -8.218  1.00 0.00 ? 90  ILE A HG21 3  
ATOM 5083  H HG22 . ILE A 1 90  ? -8.853  4.945   -6.626  1.00 0.00 ? 90  ILE A HG22 3  
ATOM 5084  H HG23 . ILE A 1 90  ? -7.327  4.260   -7.185  1.00 0.00 ? 90  ILE A HG23 3  
ATOM 5085  H HD11 . ILE A 1 90  ? -7.236  0.478   -7.281  1.00 0.00 ? 90  ILE A HD11 3  
ATOM 5086  H HD12 . ILE A 1 90  ? -6.536  1.997   -7.840  1.00 0.00 ? 90  ILE A HD12 3  
ATOM 5087  H HD13 . ILE A 1 90  ? -5.771  1.104   -6.526  1.00 0.00 ? 90  ILE A HD13 3  
ATOM 5088  N N    . ASP A 1 91  ? -11.831 3.182   -6.950  1.00 0.00 ? 91  ASP A N    3  
ATOM 5089  C CA   . ASP A 1 91  ? -12.957 3.856   -7.586  1.00 0.00 ? 91  ASP A CA   3  
ATOM 5090  C C    . ASP A 1 91  ? -13.955 4.348   -6.542  1.00 0.00 ? 91  ASP A C    3  
ATOM 5091  O O    . ASP A 1 91  ? -14.532 5.427   -6.680  1.00 0.00 ? 91  ASP A O    3  
ATOM 5092  C CB   . ASP A 1 91  ? -13.652 2.916   -8.571  1.00 0.00 ? 91  ASP A CB   3  
ATOM 5093  C CG   . ASP A 1 91  ? -14.786 3.593   -9.316  1.00 0.00 ? 91  ASP A CG   3  
ATOM 5094  O OD1  . ASP A 1 91  ? -14.539 4.644   -9.944  1.00 0.00 ? 91  ASP A OD1  3  
ATOM 5095  O OD2  . ASP A 1 91  ? -15.920 3.072   -9.270  1.00 0.00 ? 91  ASP A OD2  3  
ATOM 5096  H H    . ASP A 1 91  ? -11.673 2.233   -7.139  1.00 0.00 ? 91  ASP A H    3  
ATOM 5097  H HA   . ASP A 1 91  ? -12.571 4.708   -8.126  1.00 0.00 ? 91  ASP A HA   3  
ATOM 5098  H HB2  . ASP A 1 91  ? -12.930 2.566   -9.295  1.00 0.00 ? 91  ASP A HB2  3  
ATOM 5099  H HB3  . ASP A 1 91  ? -14.053 2.071   -8.031  1.00 0.00 ? 91  ASP A HB3  3  
ATOM 5100  N N    . HIS A 1 92  ? -14.155 3.548   -5.499  1.00 0.00 ? 92  HIS A N    3  
ATOM 5101  C CA   . HIS A 1 92  ? -15.084 3.902   -4.432  1.00 0.00 ? 92  HIS A CA   3  
ATOM 5102  C C    . HIS A 1 92  ? -14.574 5.104   -3.644  1.00 0.00 ? 92  HIS A C    3  
ATOM 5103  O O    . HIS A 1 92  ? -15.359 5.926   -3.170  1.00 0.00 ? 92  HIS A O    3  
ATOM 5104  C CB   . HIS A 1 92  ? -15.292 2.713   -3.494  1.00 0.00 ? 92  HIS A CB   3  
ATOM 5105  C CG   . HIS A 1 92  ? -16.643 2.689   -2.847  1.00 0.00 ? 92  HIS A CG   3  
ATOM 5106  N ND1  . HIS A 1 92  ? -17.079 3.667   -1.978  1.00 0.00 ? 92  HIS A ND1  3  
ATOM 5107  C CD2  . HIS A 1 92  ? -17.658 1.799   -2.948  1.00 0.00 ? 92  HIS A CD2  3  
ATOM 5108  C CE1  . HIS A 1 92  ? -18.302 3.379   -1.571  1.00 0.00 ? 92  HIS A CE1  3  
ATOM 5109  N NE2  . HIS A 1 92  ? -18.677 2.250   -2.146  1.00 0.00 ? 92  HIS A NE2  3  
ATOM 5110  H H    . HIS A 1 92  ? -13.666 2.701   -5.446  1.00 0.00 ? 92  HIS A H    3  
ATOM 5111  H HA   . HIS A 1 92  ? -16.029 4.160   -4.887  1.00 0.00 ? 92  HIS A HA   3  
ATOM 5112  H HB2  . HIS A 1 92  ? -15.177 1.796   -4.054  1.00 0.00 ? 92  HIS A HB2  3  
ATOM 5113  H HB3  . HIS A 1 92  ? -14.549 2.746   -2.710  1.00 0.00 ? 92  HIS A HB3  3  
ATOM 5114  H HD1  . HIS A 1 92  ? -16.566 4.454   -1.699  1.00 0.00 ? 92  HIS A HD1  3  
ATOM 5115  H HD2  . HIS A 1 92  ? -17.665 0.900   -3.549  1.00 0.00 ? 92  HIS A HD2  3  
ATOM 5116  H HE1  . HIS A 1 92  ? -18.895 3.965   -0.886  1.00 0.00 ? 92  HIS A HE1  3  
ATOM 5117  N N    . TYR A 1 93  ? -13.256 5.200   -3.507  1.00 0.00 ? 93  TYR A N    3  
ATOM 5118  C CA   . TYR A 1 93  ? -12.642 6.300   -2.773  1.00 0.00 ? 93  TYR A CA   3  
ATOM 5119  C C    . TYR A 1 93  ? -12.698 7.592   -3.582  1.00 0.00 ? 93  TYR A C    3  
ATOM 5120  O O    . TYR A 1 93  ? -12.736 8.687   -3.020  1.00 0.00 ? 93  TYR A O    3  
ATOM 5121  C CB   . TYR A 1 93  ? -11.190 5.963   -2.429  1.00 0.00 ? 93  TYR A CB   3  
ATOM 5122  C CG   . TYR A 1 93  ? -11.032 5.249   -1.105  1.00 0.00 ? 93  TYR A CG   3  
ATOM 5123  C CD1  . TYR A 1 93  ? -11.687 5.701   0.034   1.00 0.00 ? 93  TYR A CD1  3  
ATOM 5124  C CD2  . TYR A 1 93  ? -10.228 4.121   -0.994  1.00 0.00 ? 93  TYR A CD2  3  
ATOM 5125  C CE1  . TYR A 1 93  ? -11.544 5.053   1.245   1.00 0.00 ? 93  TYR A CE1  3  
ATOM 5126  C CE2  . TYR A 1 93  ? -10.080 3.466   0.213   1.00 0.00 ? 93  TYR A CE2  3  
ATOM 5127  C CZ   . TYR A 1 93  ? -10.740 3.935   1.330   1.00 0.00 ? 93  TYR A CZ   3  
ATOM 5128  O OH   . TYR A 1 93  ? -10.597 3.286   2.534   1.00 0.00 ? 93  TYR A OH   3  
ATOM 5129  H H    . TYR A 1 93  ? -12.683 4.513   -3.907  1.00 0.00 ? 93  TYR A H    3  
ATOM 5130  H HA   . TYR A 1 93  ? -13.196 6.438   -1.856  1.00 0.00 ? 93  TYR A HA   3  
ATOM 5131  H HB2  . TYR A 1 93  ? -10.783 5.326   -3.199  1.00 0.00 ? 93  TYR A HB2  3  
ATOM 5132  H HB3  . TYR A 1 93  ? -10.617 6.877   -2.384  1.00 0.00 ? 93  TYR A HB3  3  
ATOM 5133  H HD1  . TYR A 1 93  ? -12.316 6.577   -0.037  1.00 0.00 ? 93  TYR A HD1  3  
ATOM 5134  H HD2  . TYR A 1 93  ? -9.712  3.756   -1.870  1.00 0.00 ? 93  TYR A HD2  3  
ATOM 5135  H HE1  . TYR A 1 93  ? -12.061 5.420   2.119   1.00 0.00 ? 93  TYR A HE1  3  
ATOM 5136  H HE2  . TYR A 1 93  ? -9.451  2.591   0.280   1.00 0.00 ? 93  TYR A HE2  3  
ATOM 5137  H HH   . TYR A 1 93  ? -10.780 2.350   2.417   1.00 0.00 ? 93  TYR A HH   3  
ATOM 5138  N N    . ARG A 1 94  ? -12.703 7.456   -4.903  1.00 0.00 ? 94  ARG A N    3  
ATOM 5139  C CA   . ARG A 1 94  ? -12.754 8.612   -5.791  1.00 0.00 ? 94  ARG A CA   3  
ATOM 5140  C C    . ARG A 1 94  ? -13.942 9.507   -5.450  1.00 0.00 ? 94  ARG A C    3  
ATOM 5141  O O    . ARG A 1 94  ? -13.916 10.712  -5.698  1.00 0.00 ? 94  ARG A O    3  
ATOM 5142  C CB   . ARG A 1 94  ? -12.844 8.158   -7.249  1.00 0.00 ? 94  ARG A CB   3  
ATOM 5143  C CG   . ARG A 1 94  ? -11.532 7.631   -7.805  1.00 0.00 ? 94  ARG A CG   3  
ATOM 5144  C CD   . ARG A 1 94  ? -11.658 7.262   -9.275  1.00 0.00 ? 94  ARG A CD   3  
ATOM 5145  N NE   . ARG A 1 94  ? -11.908 8.431   -10.114 1.00 0.00 ? 94  ARG A NE   3  
ATOM 5146  C CZ   . ARG A 1 94  ? -10.981 9.335   -10.409 1.00 0.00 ? 94  ARG A CZ   3  
ATOM 5147  N NH1  . ARG A 1 94  ? -9.749  9.205   -9.937  1.00 0.00 ? 94  ARG A NH1  3  
ATOM 5148  N NH2  . ARG A 1 94  ? -11.286 10.372  -11.179 1.00 0.00 ? 94  ARG A NH2  3  
ATOM 5149  H H    . ARG A 1 94  ? -12.671 6.557   -5.292  1.00 0.00 ? 94  ARG A H    3  
ATOM 5150  H HA   . ARG A 1 94  ? -11.843 9.175   -5.654  1.00 0.00 ? 94  ARG A HA   3  
ATOM 5151  H HB2  . ARG A 1 94  ? -13.583 7.374   -7.325  1.00 0.00 ? 94  ARG A HB2  3  
ATOM 5152  H HB3  . ARG A 1 94  ? -13.156 8.996   -7.855  1.00 0.00 ? 94  ARG A HB3  3  
ATOM 5153  H HG2  . ARG A 1 94  ? -10.775 8.394   -7.701  1.00 0.00 ? 94  ARG A HG2  3  
ATOM 5154  H HG3  . ARG A 1 94  ? -11.242 6.754   -7.246  1.00 0.00 ? 94  ARG A HG3  3  
ATOM 5155  H HD2  . ARG A 1 94  ? -10.740 6.791   -9.595  1.00 0.00 ? 94  ARG A HD2  3  
ATOM 5156  H HD3  . ARG A 1 94  ? -12.477 6.567   -9.389  1.00 0.00 ? 94  ARG A HD3  3  
ATOM 5157  H HE   . ARG A 1 94  ? -12.812 8.547   -10.473 1.00 0.00 ? 94  ARG A HE   3  
ATOM 5158  H HH11 . ARG A 1 94  ? -9.517  8.424   -9.358  1.00 0.00 ? 94  ARG A HH11 3  
ATOM 5159  H HH12 . ARG A 1 94  ? -9.052  9.886   -10.162 1.00 0.00 ? 94  ARG A HH12 3  
ATOM 5160  H HH21 . ARG A 1 94  ? -12.214 10.474  -11.537 1.00 0.00 ? 94  ARG A HH21 3  
ATOM 5161  H HH22 . ARG A 1 94  ? -10.588 11.052  -11.401 1.00 0.00 ? 94  ARG A HH22 3  
ATOM 5162  N N    . LYS A 1 95  ? -14.983 8.908   -4.882  1.00 0.00 ? 95  LYS A N    3  
ATOM 5163  C CA   . LYS A 1 95  ? -16.181 9.649   -4.506  1.00 0.00 ? 95  LYS A CA   3  
ATOM 5164  C C    . LYS A 1 95  ? -16.255 9.834   -2.994  1.00 0.00 ? 95  LYS A C    3  
ATOM 5165  O O    . LYS A 1 95  ? -17.021 10.659  -2.498  1.00 0.00 ? 95  LYS A O    3  
ATOM 5166  C CB   . LYS A 1 95  ? -17.432 8.922   -5.004  1.00 0.00 ? 95  LYS A CB   3  
ATOM 5167  C CG   . LYS A 1 95  ? -17.465 8.728   -6.510  1.00 0.00 ? 95  LYS A CG   3  
ATOM 5168  C CD   . LYS A 1 95  ? -16.725 7.468   -6.926  1.00 0.00 ? 95  LYS A CD   3  
ATOM 5169  C CE   . LYS A 1 95  ? -17.191 6.972   -8.286  1.00 0.00 ? 95  LYS A CE   3  
ATOM 5170  N NZ   . LYS A 1 95  ? -18.577 6.428   -8.233  1.00 0.00 ? 95  LYS A NZ   3  
ATOM 5171  H H    . LYS A 1 95  ? -14.944 7.943   -4.710  1.00 0.00 ? 95  LYS A H    3  
ATOM 5172  H HA   . LYS A 1 95  ? -16.130 10.621  -4.974  1.00 0.00 ? 95  LYS A HA   3  
ATOM 5173  H HB2  . LYS A 1 95  ? -17.479 7.950   -4.535  1.00 0.00 ? 95  LYS A HB2  3  
ATOM 5174  H HB3  . LYS A 1 95  ? -18.304 9.493   -4.716  1.00 0.00 ? 95  LYS A HB3  3  
ATOM 5175  H HG2  . LYS A 1 95  ? -18.493 8.652   -6.832  1.00 0.00 ? 95  LYS A HG2  3  
ATOM 5176  H HG3  . LYS A 1 95  ? -17.000 9.581   -6.983  1.00 0.00 ? 95  LYS A HG3  3  
ATOM 5177  H HD2  . LYS A 1 95  ? -15.668 7.681   -6.976  1.00 0.00 ? 95  LYS A HD2  3  
ATOM 5178  H HD3  . LYS A 1 95  ? -16.904 6.696   -6.190  1.00 0.00 ? 95  LYS A HD3  3  
ATOM 5179  H HE2  . LYS A 1 95  ? -17.163 7.794   -8.984  1.00 0.00 ? 95  LYS A HE2  3  
ATOM 5180  H HE3  . LYS A 1 95  ? -16.521 6.193   -8.619  1.00 0.00 ? 95  LYS A HE3  3  
ATOM 5181  H HZ1  . LYS A 1 95  ? -19.018 6.483   -9.174  1.00 0.00 ? 95  LYS A HZ1  3  
ATOM 5182  H HZ2  . LYS A 1 95  ? -19.151 6.977   -7.562  1.00 0.00 ? 95  LYS A HZ2  3  
ATOM 5183  H HZ3  . LYS A 1 95  ? -18.560 5.435   -7.927  1.00 0.00 ? 95  LYS A HZ3  3  
ATOM 5184  N N    . GLU A 1 96  ? -15.453 9.062   -2.268  1.00 0.00 ? 96  GLU A N    3  
ATOM 5185  C CA   . GLU A 1 96  ? -15.428 9.142   -0.812  1.00 0.00 ? 96  GLU A CA   3  
ATOM 5186  C C    . GLU A 1 96  ? -14.010 9.385   -0.305  1.00 0.00 ? 96  GLU A C    3  
ATOM 5187  O O    . GLU A 1 96  ? -13.106 8.588   -0.555  1.00 0.00 ? 96  GLU A O    3  
ATOM 5188  C CB   . GLU A 1 96  ? -15.988 7.857   -0.199  1.00 0.00 ? 96  GLU A CB   3  
ATOM 5189  C CG   . GLU A 1 96  ? -17.504 7.775   -0.237  1.00 0.00 ? 96  GLU A CG   3  
ATOM 5190  C CD   . GLU A 1 96  ? -18.155 8.442   0.960   1.00 0.00 ? 96  GLU A CD   3  
ATOM 5191  O OE1  . GLU A 1 96  ? -17.546 9.375   1.523   1.00 0.00 ? 96  GLU A OE1  3  
ATOM 5192  O OE2  . GLU A 1 96  ? -19.274 8.030   1.332   1.00 0.00 ? 96  GLU A OE2  3  
ATOM 5193  H H    . GLU A 1 96  ? -14.865 8.422   -2.722  1.00 0.00 ? 96  GLU A H    3  
ATOM 5194  H HA   . GLU A 1 96  ? -16.051 9.972   -0.515  1.00 0.00 ? 96  GLU A HA   3  
ATOM 5195  H HB2  . GLU A 1 96  ? -15.588 7.011   -0.738  1.00 0.00 ? 96  GLU A HB2  3  
ATOM 5196  H HB3  . GLU A 1 96  ? -15.671 7.797   0.832   1.00 0.00 ? 96  GLU A HB3  3  
ATOM 5197  H HG2  . GLU A 1 96  ? -17.856 8.259   -1.135  1.00 0.00 ? 96  GLU A HG2  3  
ATOM 5198  H HG3  . GLU A 1 96  ? -17.796 6.734   -0.253  1.00 0.00 ? 96  GLU A HG3  3  
ATOM 5199  N N    . GLN A 1 97  ? -13.824 10.491  0.408   1.00 0.00 ? 97  GLN A N    3  
ATOM 5200  C CA   . GLN A 1 97  ? -12.516 10.840  0.950   1.00 0.00 ? 97  GLN A CA   3  
ATOM 5201  C C    . GLN A 1 97  ? -11.908 9.663   1.705   1.00 0.00 ? 97  GLN A C    3  
ATOM 5202  O O    . GLN A 1 97  ? -12.426 9.243   2.741   1.00 0.00 ? 97  GLN A O    3  
ATOM 5203  C CB   . GLN A 1 97  ? -12.630 12.052  1.876   1.00 0.00 ? 97  GLN A CB   3  
ATOM 5204  C CG   . GLN A 1 97  ? -13.084 13.318  1.168   1.00 0.00 ? 97  GLN A CG   3  
ATOM 5205  C CD   . GLN A 1 97  ? -13.140 14.517  2.095   1.00 0.00 ? 97  GLN A CD   3  
ATOM 5206  O OE1  . GLN A 1 97  ? -13.779 14.474  3.146   1.00 0.00 ? 97  GLN A OE1  3  
ATOM 5207  N NE2  . GLN A 1 97  ? -12.469 15.595  1.708   1.00 0.00 ? 97  GLN A NE2  3  
ATOM 5208  H H    . GLN A 1 97  ? -14.584 11.086  0.574   1.00 0.00 ? 97  GLN A H    3  
ATOM 5209  H HA   . GLN A 1 97  ? -11.871 11.091  0.121   1.00 0.00 ? 97  GLN A HA   3  
ATOM 5210  H HB2  . GLN A 1 97  ? -13.341 11.827  2.657   1.00 0.00 ? 97  GLN A HB2  3  
ATOM 5211  H HB3  . GLN A 1 97  ? -11.665 12.241  2.322   1.00 0.00 ? 97  GLN A HB3  3  
ATOM 5212  H HG2  . GLN A 1 97  ? -12.394 13.534  0.366   1.00 0.00 ? 97  GLN A HG2  3  
ATOM 5213  H HG3  . GLN A 1 97  ? -14.070 13.152  0.758   1.00 0.00 ? 97  GLN A HG3  3  
ATOM 5214  H HE21 . GLN A 1 97  ? -11.983 15.558  0.857   1.00 0.00 ? 97  GLN A HE21 3  
ATOM 5215  H HE22 . GLN A 1 97  ? -12.488 16.385  2.287   1.00 0.00 ? 97  GLN A HE22 3  
ATOM 5216  N N    . ILE A 1 98  ? -10.807 9.134   1.181   1.00 0.00 ? 98  ILE A N    3  
ATOM 5217  C CA   . ILE A 1 98  ? -10.129 8.006   1.807   1.00 0.00 ? 98  ILE A CA   3  
ATOM 5218  C C    . ILE A 1 98  ? -9.508  8.409   3.140   1.00 0.00 ? 98  ILE A C    3  
ATOM 5219  O O    . ILE A 1 98  ? -9.297  7.571   4.018   1.00 0.00 ? 98  ILE A O    3  
ATOM 5220  C CB   . ILE A 1 98  ? -9.029  7.433   0.894   1.00 0.00 ? 98  ILE A CB   3  
ATOM 5221  C CG1  . ILE A 1 98  ? -8.231  6.357   1.633   1.00 0.00 ? 98  ILE A CG1  3  
ATOM 5222  C CG2  . ILE A 1 98  ? -8.110  8.544   0.411   1.00 0.00 ? 98  ILE A CG2  3  
ATOM 5223  C CD1  . ILE A 1 98  ? -7.271  5.599   0.744   1.00 0.00 ? 98  ILE A CD1  3  
ATOM 5224  H H    . ILE A 1 98  ? -10.442 9.513   0.354   1.00 0.00 ? 98  ILE A H    3  
ATOM 5225  H HA   . ILE A 1 98  ? -10.863 7.233   1.983   1.00 0.00 ? 98  ILE A HA   3  
ATOM 5226  H HB   . ILE A 1 98  ? -9.504  6.990   0.031   1.00 0.00 ? 98  ILE A HB   3  
ATOM 5227  H HG12 . ILE A 1 98  ? -7.658  6.821   2.420   1.00 0.00 ? 98  ILE A HG12 3  
ATOM 5228  H HG13 . ILE A 1 98  ? -8.918  5.644   2.066   1.00 0.00 ? 98  ILE A HG13 3  
ATOM 5229  H HG21 . ILE A 1 98  ? -8.391  9.475   0.882   1.00 0.00 ? 98  ILE A HG21 3  
ATOM 5230  H HG22 . ILE A 1 98  ? -7.089  8.305   0.671   1.00 0.00 ? 98  ILE A HG22 3  
ATOM 5231  H HG23 . ILE A 1 98  ? -8.195  8.643   -0.661  1.00 0.00 ? 98  ILE A HG23 3  
ATOM 5232  H HD11 . ILE A 1 98  ? -7.259  4.558   1.032   1.00 0.00 ? 98  ILE A HD11 3  
ATOM 5233  H HD12 . ILE A 1 98  ? -7.588  5.684   -0.284  1.00 0.00 ? 98  ILE A HD12 3  
ATOM 5234  H HD13 . ILE A 1 98  ? -6.279  6.013   0.850   1.00 0.00 ? 98  ILE A HD13 3  
ATOM 5235  N N    . VAL A 1 99  ? -9.219  9.698   3.287   1.00 0.00 ? 99  VAL A N    3  
ATOM 5236  C CA   . VAL A 1 99  ? -8.625  10.214  4.515   1.00 0.00 ? 99  VAL A CA   3  
ATOM 5237  C C    . VAL A 1 99  ? -9.575  11.171  5.225   1.00 0.00 ? 99  VAL A C    3  
ATOM 5238  O O    . VAL A 1 99  ? -10.707 11.375  4.788   1.00 0.00 ? 99  VAL A O    3  
ATOM 5239  C CB   . VAL A 1 99  ? -7.297  10.941  4.233   1.00 0.00 ? 99  VAL A CB   3  
ATOM 5240  C CG1  . VAL A 1 99  ? -6.363  10.829  5.428   1.00 0.00 ? 99  VAL A CG1  3  
ATOM 5241  C CG2  . VAL A 1 99  ? -6.640  10.384  2.979   1.00 0.00 ? 99  VAL A CG2  3  
ATOM 5242  H H    . VAL A 1 99  ? -9.411  10.317  2.552   1.00 0.00 ? 99  VAL A H    3  
ATOM 5243  H HA   . VAL A 1 99  ? -8.421  9.375   5.165   1.00 0.00 ? 99  VAL A HA   3  
ATOM 5244  H HB   . VAL A 1 99  ? -7.510  11.987  4.068   1.00 0.00 ? 99  VAL A HB   3  
ATOM 5245  H HG11 . VAL A 1 99  ? -5.407  10.443  5.103   1.00 0.00 ? 99  VAL A HG11 3  
ATOM 5246  H HG12 . VAL A 1 99  ? -6.226  11.805  5.872   1.00 0.00 ? 99  VAL A HG12 3  
ATOM 5247  H HG13 . VAL A 1 99  ? -6.791  10.158  6.158   1.00 0.00 ? 99  VAL A HG13 3  
ATOM 5248  H HG21 . VAL A 1 99  ? -7.265  10.592  2.123   1.00 0.00 ? 99  VAL A HG21 3  
ATOM 5249  H HG22 . VAL A 1 99  ? -5.675  10.849  2.840   1.00 0.00 ? 99  VAL A HG22 3  
ATOM 5250  H HG23 . VAL A 1 99  ? -6.514  9.317   3.082   1.00 0.00 ? 99  VAL A HG23 3  
ATOM 5251  N N    . GLU A 1 100 ? -9.106  11.756  6.323   1.00 0.00 ? 100 GLU A N    3  
ATOM 5252  C CA   . GLU A 1 100 ? -9.915  12.692  7.094   1.00 0.00 ? 100 GLU A CA   3  
ATOM 5253  C C    . GLU A 1 100 ? -10.472 13.796  6.200   1.00 0.00 ? 100 GLU A C    3  
ATOM 5254  O O    . GLU A 1 100 ? -11.451 14.455  6.545   1.00 0.00 ? 100 GLU A O    3  
ATOM 5255  C CB   . GLU A 1 100 ? -9.086  13.306  8.225   1.00 0.00 ? 100 GLU A CB   3  
ATOM 5256  C CG   . GLU A 1 100 ? -7.955  14.194  7.736   1.00 0.00 ? 100 GLU A CG   3  
ATOM 5257  C CD   . GLU A 1 100 ? -7.133  14.770  8.873   1.00 0.00 ? 100 GLU A CD   3  
ATOM 5258  O OE1  . GLU A 1 100 ? -7.734  15.263  9.850   1.00 0.00 ? 100 GLU A OE1  3  
ATOM 5259  O OE2  . GLU A 1 100 ? -5.888  14.727  8.785   1.00 0.00 ? 100 GLU A OE2  3  
ATOM 5260  H H    . GLU A 1 100 ? -8.195  11.553  6.621   1.00 0.00 ? 100 GLU A H    3  
ATOM 5261  H HA   . GLU A 1 100 ? -10.740 12.143  7.523   1.00 0.00 ? 100 GLU A HA   3  
ATOM 5262  H HB2  . GLU A 1 100 ? -9.737  13.898  8.851   1.00 0.00 ? 100 GLU A HB2  3  
ATOM 5263  H HB3  . GLU A 1 100 ? -8.660  12.508  8.816   1.00 0.00 ? 100 GLU A HB3  3  
ATOM 5264  H HG2  . GLU A 1 100 ? -7.304  13.611  7.102   1.00 0.00 ? 100 GLU A HG2  3  
ATOM 5265  H HG3  . GLU A 1 100 ? -8.375  15.010  7.166   1.00 0.00 ? 100 GLU A HG3  3  
ATOM 5266  N N    . GLY A 1 101 ? -9.838  13.991  5.047   1.00 0.00 ? 101 GLY A N    3  
ATOM 5267  C CA   . GLY A 1 101 ? -10.283 15.016  4.121   1.00 0.00 ? 101 GLY A CA   3  
ATOM 5268  C C    . GLY A 1 101 ? -9.409  15.098  2.884   1.00 0.00 ? 101 GLY A C    3  
ATOM 5269  O O    . GLY A 1 101 ? -8.929  16.174  2.526   1.00 0.00 ? 101 GLY A O    3  
ATOM 5270  H H    . GLY A 1 101 ? -9.062  13.435  4.824   1.00 0.00 ? 101 GLY A H    3  
ATOM 5271  H HA2  . GLY A 1 101 ? -11.296 14.798  3.819   1.00 0.00 ? 101 GLY A HA2  3  
ATOM 5272  H HA3  . GLY A 1 101 ? -10.265 15.972  4.623   1.00 0.00 ? 101 GLY A HA3  3  
ATOM 5273  N N    . TYR A 1 102 ? -9.201  13.960  2.232   1.00 0.00 ? 102 TYR A N    3  
ATOM 5274  C CA   . TYR A 1 102 ? -8.376  13.907  1.031   1.00 0.00 ? 102 TYR A CA   3  
ATOM 5275  C C    . TYR A 1 102 ? -8.950  12.921  0.019   1.00 0.00 ? 102 TYR A C    3  
ATOM 5276  O O    . TYR A 1 102 ? -9.465  11.864  0.387   1.00 0.00 ? 102 TYR A O    3  
ATOM 5277  C CB   . TYR A 1 102 ? -6.943  13.511  1.389   1.00 0.00 ? 102 TYR A CB   3  
ATOM 5278  C CG   . TYR A 1 102 ? -6.119  14.653  1.941   1.00 0.00 ? 102 TYR A CG   3  
ATOM 5279  C CD1  . TYR A 1 102 ? -6.153  14.969  3.293   1.00 0.00 ? 102 TYR A CD1  3  
ATOM 5280  C CD2  . TYR A 1 102 ? -5.306  15.414  1.110   1.00 0.00 ? 102 TYR A CD2  3  
ATOM 5281  C CE1  . TYR A 1 102 ? -5.403  16.012  3.802   1.00 0.00 ? 102 TYR A CE1  3  
ATOM 5282  C CE2  . TYR A 1 102 ? -4.552  16.458  1.610   1.00 0.00 ? 102 TYR A CE2  3  
ATOM 5283  C CZ   . TYR A 1 102 ? -4.603  16.753  2.956   1.00 0.00 ? 102 TYR A CZ   3  
ATOM 5284  O OH   . TYR A 1 102 ? -3.854  17.791  3.459   1.00 0.00 ? 102 TYR A OH   3  
ATOM 5285  H H    . TYR A 1 102 ? -9.611  13.135  2.566   1.00 0.00 ? 102 TYR A H    3  
ATOM 5286  H HA   . TYR A 1 102 ? -8.367  14.893  0.591   1.00 0.00 ? 102 TYR A HA   3  
ATOM 5287  H HB2  . TYR A 1 102 ? -6.967  12.730  2.134   1.00 0.00 ? 102 TYR A HB2  3  
ATOM 5288  H HB3  . TYR A 1 102 ? -6.447  13.142  0.503   1.00 0.00 ? 102 TYR A HB3  3  
ATOM 5289  H HD1  . TYR A 1 102 ? -6.779  14.387  3.953   1.00 0.00 ? 102 TYR A HD1  3  
ATOM 5290  H HD2  . TYR A 1 102 ? -5.268  15.180  0.056   1.00 0.00 ? 102 TYR A HD2  3  
ATOM 5291  H HE1  . TYR A 1 102 ? -5.443  16.243  4.856   1.00 0.00 ? 102 TYR A HE1  3  
ATOM 5292  H HE2  . TYR A 1 102 ? -3.926  17.038  0.948   1.00 0.00 ? 102 TYR A HE2  3  
ATOM 5293  H HH   . TYR A 1 102 ? -4.400  18.578  3.524   1.00 0.00 ? 102 TYR A HH   3  
ATOM 5294  N N    . TYR A 1 103 ? -8.857  13.273  -1.259  1.00 0.00 ? 103 TYR A N    3  
ATOM 5295  C CA   . TYR A 1 103 ? -9.368  12.421  -2.326  1.00 0.00 ? 103 TYR A CA   3  
ATOM 5296  C C    . TYR A 1 103 ? -8.225  11.808  -3.128  1.00 0.00 ? 103 TYR A C    3  
ATOM 5297  O O    . TYR A 1 103 ? -7.069  12.210  -2.991  1.00 0.00 ? 103 TYR A O    3  
ATOM 5298  C CB   . TYR A 1 103 ? -10.284 13.223  -3.252  1.00 0.00 ? 103 TYR A CB   3  
ATOM 5299  C CG   . TYR A 1 103 ? -11.664 13.462  -2.681  1.00 0.00 ? 103 TYR A CG   3  
ATOM 5300  C CD1  . TYR A 1 103 ? -12.622 12.456  -2.683  1.00 0.00 ? 103 TYR A CD1  3  
ATOM 5301  C CD2  . TYR A 1 103 ? -12.008 14.694  -2.139  1.00 0.00 ? 103 TYR A CD2  3  
ATOM 5302  C CE1  . TYR A 1 103 ? -13.884 12.671  -2.163  1.00 0.00 ? 103 TYR A CE1  3  
ATOM 5303  C CE2  . TYR A 1 103 ? -13.267 14.917  -1.616  1.00 0.00 ? 103 TYR A CE2  3  
ATOM 5304  C CZ   . TYR A 1 103 ? -14.202 13.903  -1.631  1.00 0.00 ? 103 TYR A CZ   3  
ATOM 5305  O OH   . TYR A 1 103 ? -15.457 14.120  -1.110  1.00 0.00 ? 103 TYR A OH   3  
ATOM 5306  H H    . TYR A 1 103 ? -8.436  14.127  -1.490  1.00 0.00 ? 103 TYR A H    3  
ATOM 5307  H HA   . TYR A 1 103 ? -9.940  11.626  -1.870  1.00 0.00 ? 103 TYR A HA   3  
ATOM 5308  H HB2  . TYR A 1 103 ? -9.836  14.184  -3.447  1.00 0.00 ? 103 TYR A HB2  3  
ATOM 5309  H HB3  . TYR A 1 103 ? -10.399 12.688  -4.184  1.00 0.00 ? 103 TYR A HB3  3  
ATOM 5310  H HD1  . TYR A 1 103 ? -12.370 11.492  -3.101  1.00 0.00 ? 103 TYR A HD1  3  
ATOM 5311  H HD2  . TYR A 1 103 ? -11.274 15.487  -2.129  1.00 0.00 ? 103 TYR A HD2  3  
ATOM 5312  H HE1  . TYR A 1 103 ? -14.616 11.876  -2.174  1.00 0.00 ? 103 TYR A HE1  3  
ATOM 5313  H HE2  . TYR A 1 103 ? -13.517 15.882  -1.199  1.00 0.00 ? 103 TYR A HE2  3  
ATOM 5314  H HH   . TYR A 1 103 ? -16.040 13.403  -1.371  1.00 0.00 ? 103 TYR A HH   3  
ATOM 5315  N N    . LEU A 1 104 ? -8.556  10.832  -3.967  1.00 0.00 ? 104 LEU A N    3  
ATOM 5316  C CA   . LEU A 1 104 ? -7.558  10.162  -4.794  1.00 0.00 ? 104 LEU A CA   3  
ATOM 5317  C C    . LEU A 1 104 ? -7.462  10.817  -6.168  1.00 0.00 ? 104 LEU A C    3  
ATOM 5318  O O    . LEU A 1 104 ? -8.280  10.556  -7.051  1.00 0.00 ? 104 LEU A O    3  
ATOM 5319  C CB   . LEU A 1 104 ? -7.905  8.680   -4.945  1.00 0.00 ? 104 LEU A CB   3  
ATOM 5320  C CG   . LEU A 1 104 ? -7.788  7.831   -3.679  1.00 0.00 ? 104 LEU A CG   3  
ATOM 5321  C CD1  . LEU A 1 104 ? -8.260  6.409   -3.944  1.00 0.00 ? 104 LEU A CD1  3  
ATOM 5322  C CD2  . LEU A 1 104 ? -6.355  7.832   -3.167  1.00 0.00 ? 104 LEU A CD2  3  
ATOM 5323  H H    . LEU A 1 104 ? -9.494  10.555  -4.032  1.00 0.00 ? 104 LEU A H    3  
ATOM 5324  H HA   . LEU A 1 104 ? -6.603  10.252  -4.298  1.00 0.00 ? 104 LEU A HA   3  
ATOM 5325  H HB2  . LEU A 1 104 ? -8.923  8.613   -5.295  1.00 0.00 ? 104 LEU A HB2  3  
ATOM 5326  H HB3  . LEU A 1 104 ? -7.242  8.261   -5.689  1.00 0.00 ? 104 LEU A HB3  3  
ATOM 5327  H HG   . LEU A 1 104 ? -8.419  8.253   -2.910  1.00 0.00 ? 104 LEU A HG   3  
ATOM 5328  H HD11 . LEU A 1 104 ? -9.006  6.418   -4.724  1.00 0.00 ? 104 LEU A HD11 3  
ATOM 5329  H HD12 . LEU A 1 104 ? -8.687  5.998   -3.041  1.00 0.00 ? 104 LEU A HD12 3  
ATOM 5330  H HD13 . LEU A 1 104 ? -7.421  5.803   -4.253  1.00 0.00 ? 104 LEU A HD13 3  
ATOM 5331  H HD21 . LEU A 1 104 ? -5.757  8.495   -3.774  1.00 0.00 ? 104 LEU A HD21 3  
ATOM 5332  H HD22 . LEU A 1 104 ? -5.952  6.831   -3.223  1.00 0.00 ? 104 LEU A HD22 3  
ATOM 5333  H HD23 . LEU A 1 104 ? -6.339  8.169   -2.141  1.00 0.00 ? 104 LEU A HD23 3  
ATOM 5334  N N    . LYS A 1 105 ? -6.456  11.667  -6.344  1.00 0.00 ? 105 LYS A N    3  
ATOM 5335  C CA   . LYS A 1 105 ? -6.249  12.356  -7.611  1.00 0.00 ? 105 LYS A CA   3  
ATOM 5336  C C    . LYS A 1 105 ? -5.723  11.396  -8.674  1.00 0.00 ? 105 LYS A C    3  
ATOM 5337  O O    . LYS A 1 105 ? -6.404  11.115  -9.659  1.00 0.00 ? 105 LYS A O    3  
ATOM 5338  C CB   . LYS A 1 105 ? -5.269  13.518  -7.429  1.00 0.00 ? 105 LYS A CB   3  
ATOM 5339  C CG   . LYS A 1 105 ? -5.905  14.761  -6.831  1.00 0.00 ? 105 LYS A CG   3  
ATOM 5340  C CD   . LYS A 1 105 ? -6.771  15.489  -7.846  1.00 0.00 ? 105 LYS A CD   3  
ATOM 5341  C CE   . LYS A 1 105 ? -7.118  16.894  -7.377  1.00 0.00 ? 105 LYS A CE   3  
ATOM 5342  N NZ   . LYS A 1 105 ? -8.176  16.883  -6.329  1.00 0.00 ? 105 LYS A NZ   3  
ATOM 5343  H H    . LYS A 1 105 ? -5.836  11.834  -5.602  1.00 0.00 ? 105 LYS A H    3  
ATOM 5344  H HA   . LYS A 1 105 ? -7.201  12.747  -7.936  1.00 0.00 ? 105 LYS A HA   3  
ATOM 5345  H HB2  . LYS A 1 105 ? -4.469  13.200  -6.778  1.00 0.00 ? 105 LYS A HB2  3  
ATOM 5346  H HB3  . LYS A 1 105 ? -4.856  13.779  -8.393  1.00 0.00 ? 105 LYS A HB3  3  
ATOM 5347  H HG2  . LYS A 1 105 ? -6.519  14.472  -5.991  1.00 0.00 ? 105 LYS A HG2  3  
ATOM 5348  H HG3  . LYS A 1 105 ? -5.123  15.428  -6.495  1.00 0.00 ? 105 LYS A HG3  3  
ATOM 5349  H HD2  . LYS A 1 105 ? -6.235  15.555  -8.781  1.00 0.00 ? 105 LYS A HD2  3  
ATOM 5350  H HD3  . LYS A 1 105 ? -7.685  14.931  -7.991  1.00 0.00 ? 105 LYS A HD3  3  
ATOM 5351  H HE2  . LYS A 1 105 ? -6.229  17.355  -6.975  1.00 0.00 ? 105 LYS A HE2  3  
ATOM 5352  H HE3  . LYS A 1 105 ? -7.468  17.465  -8.224  1.00 0.00 ? 105 LYS A HE3  3  
ATOM 5353  H HZ1  . LYS A 1 105 ? -8.448  17.857  -6.088  1.00 0.00 ? 105 LYS A HZ1  3  
ATOM 5354  H HZ2  . LYS A 1 105 ? -7.824  16.412  -5.471  1.00 0.00 ? 105 LYS A HZ2  3  
ATOM 5355  H HZ3  . LYS A 1 105 ? -9.015  16.374  -6.673  1.00 0.00 ? 105 LYS A HZ3  3  
ATOM 5356  N N    . GLU A 1 106 ? -4.509  10.897  -8.465  1.00 0.00 ? 106 GLU A N    3  
ATOM 5357  C CA   . GLU A 1 106 ? -3.894  9.968   -9.405  1.00 0.00 ? 106 GLU A CA   3  
ATOM 5358  C C    . GLU A 1 106 ? -2.792  9.158   -8.728  1.00 0.00 ? 106 GLU A C    3  
ATOM 5359  O O    . GLU A 1 106 ? -2.061  9.653   -7.870  1.00 0.00 ? 106 GLU A O    3  
ATOM 5360  C CB   . GLU A 1 106 ? -3.321  10.726  -10.605 1.00 0.00 ? 106 GLU A CB   3  
ATOM 5361  C CG   . GLU A 1 106 ? -2.144  11.620  -10.253 1.00 0.00 ? 106 GLU A CG   3  
ATOM 5362  C CD   . GLU A 1 106 ? -1.355  12.052  -11.474 1.00 0.00 ? 106 GLU A CD   3  
ATOM 5363  O OE1  . GLU A 1 106 ? -1.972  12.576  -12.425 1.00 0.00 ? 106 GLU A OE1  3  
ATOM 5364  O OE2  . GLU A 1 106 ? -0.120  11.866  -11.478 1.00 0.00 ? 106 GLU A OE2  3  
ATOM 5365  H H    . GLU A 1 106 ? -4.015  11.160  -7.660  1.00 0.00 ? 106 GLU A H    3  
ATOM 5366  H HA   . GLU A 1 106 ? -4.660  9.291   -9.752  1.00 0.00 ? 106 GLU A HA   3  
ATOM 5367  H HB2  . GLU A 1 106 ? -2.995  10.010  -11.345 1.00 0.00 ? 106 GLU A HB2  3  
ATOM 5368  H HB3  . GLU A 1 106 ? -4.099  11.342  -11.030 1.00 0.00 ? 106 GLU A HB3  3  
ATOM 5369  H HG2  . GLU A 1 106 ? -2.515  12.502  -9.753  1.00 0.00 ? 106 GLU A HG2  3  
ATOM 5370  H HG3  . GLU A 1 106 ? -1.485  11.082  -9.589  1.00 0.00 ? 106 GLU A HG3  3  
ATOM 5371  N N    . PRO A 1 107 ? -2.669  7.882   -9.122  1.00 0.00 ? 107 PRO A N    3  
ATOM 5372  C CA   . PRO A 1 107 ? -1.660  6.975   -8.566  1.00 0.00 ? 107 PRO A CA   3  
ATOM 5373  C C    . PRO A 1 107 ? -0.245  7.347   -8.999  1.00 0.00 ? 107 PRO A C    3  
ATOM 5374  O O    . PRO A 1 107 ? -0.052  8.245   -9.819  1.00 0.00 ? 107 PRO A O    3  
ATOM 5375  C CB   . PRO A 1 107 ? -2.053  5.612   -9.139  1.00 0.00 ? 107 PRO A CB   3  
ATOM 5376  C CG   . PRO A 1 107 ? -2.790  5.927   -10.395 1.00 0.00 ? 107 PRO A CG   3  
ATOM 5377  C CD   . PRO A 1 107 ? -3.506  7.225   -10.140 1.00 0.00 ? 107 PRO A CD   3  
ATOM 5378  H HA   . PRO A 1 107 ? -1.707  6.942   -7.487  1.00 0.00 ? 107 PRO A HA   3  
ATOM 5379  H HB2  . PRO A 1 107 ? -1.163  5.032   -9.338  1.00 0.00 ? 107 PRO A HB2  3  
ATOM 5380  H HB3  . PRO A 1 107 ? -2.680  5.088   -8.434  1.00 0.00 ? 107 PRO A HB3  3  
ATOM 5381  H HG2  . PRO A 1 107 ? -2.094  6.037   -11.212 1.00 0.00 ? 107 PRO A HG2  3  
ATOM 5382  H HG3  . PRO A 1 107 ? -3.502  5.143   -10.609 1.00 0.00 ? 107 PRO A HG3  3  
ATOM 5383  H HD2  . PRO A 1 107 ? -3.549  7.815   -11.043 1.00 0.00 ? 107 PRO A HD2  3  
ATOM 5384  H HD3  . PRO A 1 107 ? -4.500  7.039   -9.760  1.00 0.00 ? 107 PRO A HD3  3  
ATOM 5385  N N    . VAL A 1 108 ? 0.741   6.652   -8.443  1.00 0.00 ? 108 VAL A N    3  
ATOM 5386  C CA   . VAL A 1 108 ? 2.138   6.908   -8.773  1.00 0.00 ? 108 VAL A CA   3  
ATOM 5387  C C    . VAL A 1 108 ? 2.547   6.171   -10.043 1.00 0.00 ? 108 VAL A C    3  
ATOM 5388  O O    . VAL A 1 108 ? 2.258   4.988   -10.224 1.00 0.00 ? 108 VAL A O    3  
ATOM 5389  C CB   . VAL A 1 108 ? 3.073   6.486   -7.624  1.00 0.00 ? 108 VAL A CB   3  
ATOM 5390  C CG1  . VAL A 1 108 ? 4.528   6.570   -8.060  1.00 0.00 ? 108 VAL A CG1  3  
ATOM 5391  C CG2  . VAL A 1 108 ? 2.826   7.345   -6.393  1.00 0.00 ? 108 VAL A CG2  3  
ATOM 5392  H H    . VAL A 1 108 ? 0.524   5.949   -7.795  1.00 0.00 ? 108 VAL A H    3  
ATOM 5393  H HA   . VAL A 1 108 ? 2.254   7.971   -8.931  1.00 0.00 ? 108 VAL A HA   3  
ATOM 5394  H HB   . VAL A 1 108 ? 2.856   5.459   -7.369  1.00 0.00 ? 108 VAL A HB   3  
ATOM 5395  H HG11 . VAL A 1 108 ? 4.803   7.606   -8.194  1.00 0.00 ? 108 VAL A HG11 3  
ATOM 5396  H HG12 . VAL A 1 108 ? 5.157   6.124   -7.305  1.00 0.00 ? 108 VAL A HG12 3  
ATOM 5397  H HG13 . VAL A 1 108 ? 4.654   6.042   -8.994  1.00 0.00 ? 108 VAL A HG13 3  
ATOM 5398  H HG21 . VAL A 1 108 ? 3.303   8.305   -6.524  1.00 0.00 ? 108 VAL A HG21 3  
ATOM 5399  H HG22 . VAL A 1 108 ? 1.763   7.486   -6.259  1.00 0.00 ? 108 VAL A HG22 3  
ATOM 5400  H HG23 . VAL A 1 108 ? 3.236   6.855   -5.523  1.00 0.00 ? 108 VAL A HG23 3  
ATOM 5401  N N    . PRO A 1 109 ? 3.236   6.885   -10.945 1.00 0.00 ? 109 PRO A N    3  
ATOM 5402  C CA   . PRO A 1 109 ? 3.701   6.319   -12.215 1.00 0.00 ? 109 PRO A CA   3  
ATOM 5403  C C    . PRO A 1 109 ? 4.819   5.301   -12.021 1.00 0.00 ? 109 PRO A C    3  
ATOM 5404  O O    . PRO A 1 109 ? 5.470   5.271   -10.977 1.00 0.00 ? 109 PRO A O    3  
ATOM 5405  C CB   . PRO A 1 109 ? 4.216   7.540   -12.981 1.00 0.00 ? 109 PRO A CB   3  
ATOM 5406  C CG   . PRO A 1 109 ? 4.585   8.522   -11.923 1.00 0.00 ? 109 PRO A CG   3  
ATOM 5407  C CD   . PRO A 1 109 ? 3.615   8.300   -10.795 1.00 0.00 ? 109 PRO A CD   3  
ATOM 5408  H HA   . PRO A 1 109 ? 2.891   5.862   -12.765 1.00 0.00 ? 109 PRO A HA   3  
ATOM 5409  H HB2  . PRO A 1 109 ? 5.073   7.259   -13.576 1.00 0.00 ? 109 PRO A HB2  3  
ATOM 5410  H HB3  . PRO A 1 109 ? 3.436   7.923   -13.621 1.00 0.00 ? 109 PRO A HB3  3  
ATOM 5411  H HG2  . PRO A 1 109 ? 5.595   8.341   -11.590 1.00 0.00 ? 109 PRO A HG2  3  
ATOM 5412  H HG3  . PRO A 1 109 ? 4.489   9.527   -12.307 1.00 0.00 ? 109 PRO A HG3  3  
ATOM 5413  H HD2  . PRO A 1 109 ? 4.097   8.471   -9.844  1.00 0.00 ? 109 PRO A HD2  3  
ATOM 5414  H HD3  . PRO A 1 109 ? 2.754   8.943   -10.906 1.00 0.00 ? 109 PRO A HD3  3  
ATOM 5415  N N    . MET A 1 110 ? 5.038   4.468   -13.033 1.00 0.00 ? 110 MET A N    3  
ATOM 5416  C CA   . MET A 1 110 ? 6.080   3.450   -12.973 1.00 0.00 ? 110 MET A CA   3  
ATOM 5417  C C    . MET A 1 110 ? 7.446   4.051   -13.288 1.00 0.00 ? 110 MET A C    3  
ATOM 5418  O O    . MET A 1 110 ? 7.564   5.251   -13.532 1.00 0.00 ? 110 MET A O    3  
ATOM 5419  C CB   . MET A 1 110 ? 5.771   2.316   -13.953 1.00 0.00 ? 110 MET A CB   3  
ATOM 5420  C CG   . MET A 1 110 ? 4.440   1.631   -13.689 1.00 0.00 ? 110 MET A CG   3  
ATOM 5421  S SD   . MET A 1 110 ? 4.150   0.231   -14.789 1.00 0.00 ? 110 MET A SD   3  
ATOM 5422  C CE   . MET A 1 110 ? 4.978   0.790   -16.275 1.00 0.00 ? 110 MET A CE   3  
ATOM 5423  H H    . MET A 1 110 ? 4.487   4.540   -13.840 1.00 0.00 ? 110 MET A H    3  
ATOM 5424  H HA   . MET A 1 110 ? 6.097   3.052   -11.970 1.00 0.00 ? 110 MET A HA   3  
ATOM 5425  H HB2  . MET A 1 110 ? 5.753   2.716   -14.955 1.00 0.00 ? 110 MET A HB2  3  
ATOM 5426  H HB3  . MET A 1 110 ? 6.553   1.573   -13.884 1.00 0.00 ? 110 MET A HB3  3  
ATOM 5427  H HG2  . MET A 1 110 ? 4.428   1.277   -12.669 1.00 0.00 ? 110 MET A HG2  3  
ATOM 5428  H HG3  . MET A 1 110 ? 3.647   2.351   -13.828 1.00 0.00 ? 110 MET A HG3  3  
ATOM 5429  H HE1  . MET A 1 110 ? 6.042   0.838   -16.098 1.00 0.00 ? 110 MET A HE1  3  
ATOM 5430  H HE2  . MET A 1 110 ? 4.777   0.099   -17.080 1.00 0.00 ? 110 MET A HE2  3  
ATOM 5431  H HE3  . MET A 1 110 ? 4.613   1.771   -16.542 1.00 0.00 ? 110 MET A HE3  3  
ATOM 5432  N N    . GLN A 1 111 ? 8.475   3.208   -13.279 1.00 0.00 ? 111 GLN A N    3  
ATOM 5433  C CA   . GLN A 1 111 ? 9.832   3.658   -13.562 1.00 0.00 ? 111 GLN A CA   3  
ATOM 5434  C C    . GLN A 1 111 ? 10.463  2.821   -14.670 1.00 0.00 ? 111 GLN A C    3  
ATOM 5435  O O    . GLN A 1 111 ? 11.542  2.255   -14.495 1.00 0.00 ? 111 GLN A O    3  
ATOM 5436  C CB   . GLN A 1 111 ? 10.691  3.584   -12.298 1.00 0.00 ? 111 GLN A CB   3  
ATOM 5437  C CG   . GLN A 1 111 ? 10.152  4.418   -11.147 1.00 0.00 ? 111 GLN A CG   3  
ATOM 5438  C CD   . GLN A 1 111 ? 10.602  5.864   -11.213 1.00 0.00 ? 111 GLN A CD   3  
ATOM 5439  O OE1  . GLN A 1 111 ? 11.737  6.190   -10.864 1.00 0.00 ? 111 GLN A OE1  3  
ATOM 5440  N NE2  . GLN A 1 111 ? 9.712   6.741   -11.664 1.00 0.00 ? 111 GLN A NE2  3  
ATOM 5441  H H    . GLN A 1 111 ? 8.316   2.263   -13.077 1.00 0.00 ? 111 GLN A H    3  
ATOM 5442  H HA   . GLN A 1 111 ? 9.779   4.685   -13.890 1.00 0.00 ? 111 GLN A HA   3  
ATOM 5443  H HB2  . GLN A 1 111 ? 10.746  2.555   -11.975 1.00 0.00 ? 111 GLN A HB2  3  
ATOM 5444  H HB3  . GLN A 1 111 ? 11.686  3.933   -12.532 1.00 0.00 ? 111 GLN A HB3  3  
ATOM 5445  H HG2  . GLN A 1 111 ? 9.073   4.392   -11.174 1.00 0.00 ? 111 GLN A HG2  3  
ATOM 5446  H HG3  . GLN A 1 111 ? 10.498  3.991   -10.217 1.00 0.00 ? 111 GLN A HG3  3  
ATOM 5447  H HE21 . GLN A 1 111 ? 8.827   6.409   -11.923 1.00 0.00 ? 111 GLN A HE21 3  
ATOM 5448  H HE22 . GLN A 1 111 ? 9.976   7.682   -11.716 1.00 0.00 ? 111 GLN A HE22 3  
ATOM 5449  N N    . ASP A 1 112 ? 9.784   2.747   -15.808 1.00 0.00 ? 112 ASP A N    3  
ATOM 5450  C CA   . ASP A 1 112 ? 10.278  1.979   -16.945 1.00 0.00 ? 112 ASP A CA   3  
ATOM 5451  C C    . ASP A 1 112 ? 11.767  2.230   -17.164 1.00 0.00 ? 112 ASP A C    3  
ATOM 5452  O O    . ASP A 1 112 ? 12.167  3.313   -17.589 1.00 0.00 ? 112 ASP A O    3  
ATOM 5453  C CB   . ASP A 1 112 ? 9.496   2.339   -18.210 1.00 0.00 ? 112 ASP A CB   3  
ATOM 5454  C CG   . ASP A 1 112 ? 9.682   1.318   -19.315 1.00 0.00 ? 112 ASP A CG   3  
ATOM 5455  O OD1  . ASP A 1 112 ? 9.071   0.233   -19.228 1.00 0.00 ? 112 ASP A OD1  3  
ATOM 5456  O OD2  . ASP A 1 112 ? 10.438  1.605   -20.267 1.00 0.00 ? 112 ASP A OD2  3  
ATOM 5457  H H    . ASP A 1 112 ? 8.929   3.221   -15.887 1.00 0.00 ? 112 ASP A H    3  
ATOM 5458  H HA   . ASP A 1 112 ? 10.130  0.932   -16.728 1.00 0.00 ? 112 ASP A HA   3  
ATOM 5459  H HB2  . ASP A 1 112 ? 8.444   2.396   -17.971 1.00 0.00 ? 112 ASP A HB2  3  
ATOM 5460  H HB3  . ASP A 1 112 ? 9.832   3.300   -18.571 1.00 0.00 ? 112 ASP A HB3  3  
ATOM 5461  N N    . GLN A 1 113 ? 12.581  1.221   -16.870 1.00 0.00 ? 113 GLN A N    3  
ATOM 5462  C CA   . GLN A 1 113 ? 14.026  1.333   -17.033 1.00 0.00 ? 113 GLN A CA   3  
ATOM 5463  C C    . GLN A 1 113 ? 14.446  0.943   -18.446 1.00 0.00 ? 113 GLN A C    3  
ATOM 5464  O O    . GLN A 1 113 ? 13.942  -0.030  -19.007 1.00 0.00 ? 113 GLN A O    3  
ATOM 5465  C CB   . GLN A 1 113 ? 14.745  0.451   -16.011 1.00 0.00 ? 113 GLN A CB   3  
ATOM 5466  C CG   . GLN A 1 113 ? 16.238  0.725   -15.915 1.00 0.00 ? 113 GLN A CG   3  
ATOM 5467  C CD   . GLN A 1 113 ? 17.025  -0.487  -15.458 1.00 0.00 ? 113 GLN A CD   3  
ATOM 5468  O OE1  . GLN A 1 113 ? 16.489  -1.591  -15.365 1.00 0.00 ? 113 GLN A OE1  3  
ATOM 5469  N NE2  . GLN A 1 113 ? 18.305  -0.286  -15.168 1.00 0.00 ? 113 GLN A NE2  3  
ATOM 5470  H H    . GLN A 1 113 ? 12.201  0.382   -16.535 1.00 0.00 ? 113 GLN A H    3  
ATOM 5471  H HA   . GLN A 1 113 ? 14.299  2.363   -16.861 1.00 0.00 ? 113 GLN A HA   3  
ATOM 5472  H HB2  . GLN A 1 113 ? 14.307  0.617   -15.038 1.00 0.00 ? 113 GLN A HB2  3  
ATOM 5473  H HB3  . GLN A 1 113 ? 14.609  -0.584  -16.288 1.00 0.00 ? 113 GLN A HB3  3  
ATOM 5474  H HG2  . GLN A 1 113 ? 16.599  1.023   -16.888 1.00 0.00 ? 113 GLN A HG2  3  
ATOM 5475  H HG3  . GLN A 1 113 ? 16.398  1.528   -15.212 1.00 0.00 ? 113 GLN A HG3  3  
ATOM 5476  H HE21 . GLN A 1 113 ? 18.665  0.621   -15.264 1.00 0.00 ? 113 GLN A HE21 3  
ATOM 5477  H HE22 . GLN A 1 113 ? 18.838  -1.051  -14.869 1.00 0.00 ? 113 GLN A HE22 3  
ATOM 5478  N N    . SER A 1 114 ? 15.372  1.708   -19.015 1.00 0.00 ? 114 SER A N    3  
ATOM 5479  C CA   . SER A 1 114 ? 15.857  1.444   -20.365 1.00 0.00 ? 114 SER A CA   3  
ATOM 5480  C C    . SER A 1 114 ? 17.126  2.240   -20.651 1.00 0.00 ? 114 SER A C    3  
ATOM 5481  O O    . SER A 1 114 ? 17.142  3.466   -20.543 1.00 0.00 ? 114 SER A O    3  
ATOM 5482  C CB   . SER A 1 114 ? 14.780  1.792   -21.394 1.00 0.00 ? 114 SER A CB   3  
ATOM 5483  O OG   . SER A 1 114 ? 15.138  1.328   -22.684 1.00 0.00 ? 114 SER A OG   3  
ATOM 5484  H H    . SER A 1 114 ? 15.735  2.469   -18.517 1.00 0.00 ? 114 SER A H    3  
ATOM 5485  H HA   . SER A 1 114 ? 16.083  0.390   -20.436 1.00 0.00 ? 114 SER A HA   3  
ATOM 5486  H HB2  . SER A 1 114 ? 13.847  1.331   -21.106 1.00 0.00 ? 114 SER A HB2  3  
ATOM 5487  H HB3  . SER A 1 114 ? 14.655  2.864   -21.432 1.00 0.00 ? 114 SER A HB3  3  
ATOM 5488  H HG   . SER A 1 114 ? 14.358  1.301   -23.243 1.00 0.00 ? 114 SER A HG   3  
ATOM 5489  N N    . GLY A 1 115 ? 18.191  1.533   -21.018 1.00 0.00 ? 115 GLY A N    3  
ATOM 5490  C CA   . GLY A 1 115 ? 19.451  2.189   -21.314 1.00 0.00 ? 115 GLY A CA   3  
ATOM 5491  C C    . GLY A 1 115 ? 20.402  2.180   -20.133 1.00 0.00 ? 115 GLY A C    3  
ATOM 5492  O O    . GLY A 1 115 ? 19.986  2.199   -18.974 1.00 0.00 ? 115 GLY A O    3  
ATOM 5493  H H    . GLY A 1 115 ? 18.121  0.558   -21.087 1.00 0.00 ? 115 GLY A H    3  
ATOM 5494  H HA2  . GLY A 1 115 ? 19.921  1.685   -22.145 1.00 0.00 ? 115 GLY A HA2  3  
ATOM 5495  H HA3  . GLY A 1 115 ? 19.253  3.214   -21.593 1.00 0.00 ? 115 GLY A HA3  3  
ATOM 5496  N N    . PRO A 1 116 ? 21.711  2.148   -20.423 1.00 0.00 ? 116 PRO A N    3  
ATOM 5497  C CA   . PRO A 1 116 ? 22.750  2.134   -19.389 1.00 0.00 ? 116 PRO A CA   3  
ATOM 5498  C C    . PRO A 1 116 ? 22.847  3.462   -18.646 1.00 0.00 ? 116 PRO A C    3  
ATOM 5499  O O    . PRO A 1 116 ? 22.944  4.523   -19.262 1.00 0.00 ? 116 PRO A O    3  
ATOM 5500  C CB   . PRO A 1 116 ? 24.034  1.869   -20.180 1.00 0.00 ? 116 PRO A CB   3  
ATOM 5501  C CG   . PRO A 1 116 ? 23.743  2.370   -21.552 1.00 0.00 ? 116 PRO A CG   3  
ATOM 5502  C CD   . PRO A 1 116 ? 22.278  2.124   -21.782 1.00 0.00 ? 116 PRO A CD   3  
ATOM 5503  H HA   . PRO A 1 116 ? 22.592  1.336   -18.679 1.00 0.00 ? 116 PRO A HA   3  
ATOM 5504  H HB2  . PRO A 1 116 ? 24.855  2.406   -19.728 1.00 0.00 ? 116 PRO A HB2  3  
ATOM 5505  H HB3  . PRO A 1 116 ? 24.247  0.811   -20.183 1.00 0.00 ? 116 PRO A HB3  3  
ATOM 5506  H HG2  . PRO A 1 116 ? 23.960  3.426   -21.611 1.00 0.00 ? 116 PRO A HG2  3  
ATOM 5507  H HG3  . PRO A 1 116 ? 24.332  1.825   -22.274 1.00 0.00 ? 116 PRO A HG3  3  
ATOM 5508  H HD2  . PRO A 1 116 ? 21.854  2.909   -22.390 1.00 0.00 ? 116 PRO A HD2  3  
ATOM 5509  H HD3  . PRO A 1 116 ? 22.125  1.161   -22.245 1.00 0.00 ? 116 PRO A HD3  3  
ATOM 5510  N N    . SER A 1 117 ? 22.819  3.395   -17.319 1.00 0.00 ? 117 SER A N    3  
ATOM 5511  C CA   . SER A 1 117 ? 22.900  4.593   -16.491 1.00 0.00 ? 117 SER A CA   3  
ATOM 5512  C C    . SER A 1 117 ? 23.689  4.319   -15.214 1.00 0.00 ? 117 SER A C    3  
ATOM 5513  O O    . SER A 1 117 ? 23.510  3.285   -14.571 1.00 0.00 ? 117 SER A O    3  
ATOM 5514  C CB   . SER A 1 117 ? 21.497  5.093   -16.141 1.00 0.00 ? 117 SER A CB   3  
ATOM 5515  O OG   . SER A 1 117 ? 21.514  6.470   -15.810 1.00 0.00 ? 117 SER A OG   3  
ATOM 5516  H H    . SER A 1 117 ? 22.740  2.519   -16.886 1.00 0.00 ? 117 SER A H    3  
ATOM 5517  H HA   . SER A 1 117 ? 23.413  5.355   -17.060 1.00 0.00 ? 117 SER A HA   3  
ATOM 5518  H HB2  . SER A 1 117 ? 20.844  4.946   -16.987 1.00 0.00 ? 117 SER A HB2  3  
ATOM 5519  H HB3  . SER A 1 117 ? 21.121  4.536   -15.295 1.00 0.00 ? 117 SER A HB3  3  
ATOM 5520  H HG   . SER A 1 117 ? 20.959  6.955   -16.426 1.00 0.00 ? 117 SER A HG   3  
ATOM 5521  N N    . SER A 1 118 ? 24.562  5.254   -14.853 1.00 0.00 ? 118 SER A N    3  
ATOM 5522  C CA   . SER A 1 118 ? 25.381  5.113   -13.655 1.00 0.00 ? 118 SER A CA   3  
ATOM 5523  C C    . SER A 1 118 ? 24.772  5.882   -12.487 1.00 0.00 ? 118 SER A C    3  
ATOM 5524  O O    . SER A 1 118 ? 24.147  6.925   -12.673 1.00 0.00 ? 118 SER A O    3  
ATOM 5525  C CB   . SER A 1 118 ? 26.803  5.612   -13.923 1.00 0.00 ? 118 SER A CB   3  
ATOM 5526  O OG   . SER A 1 118 ? 26.807  6.990   -14.250 1.00 0.00 ? 118 SER A OG   3  
ATOM 5527  H H    . SER A 1 118 ? 24.659  6.057   -15.408 1.00 0.00 ? 118 SER A H    3  
ATOM 5528  H HA   . SER A 1 118 ? 25.419  4.064   -13.401 1.00 0.00 ? 118 SER A HA   3  
ATOM 5529  H HB2  . SER A 1 118 ? 27.406  5.462   -13.040 1.00 0.00 ? 118 SER A HB2  3  
ATOM 5530  H HB3  . SER A 1 118 ? 27.227  5.056   -14.747 1.00 0.00 ? 118 SER A HB3  3  
ATOM 5531  H HG   . SER A 1 118 ? 27.480  7.160   -14.913 1.00 0.00 ? 118 SER A HG   3  
ATOM 5532  N N    . GLY A 1 119 ? 24.959  5.357   -11.279 1.00 0.00 ? 119 GLY A N    3  
ATOM 5533  C CA   . GLY A 1 119 ? 24.423  6.005   -10.097 1.00 0.00 ? 119 GLY A CA   3  
ATOM 5534  C C    . GLY A 1 119 ? 24.883  7.444   -9.966  1.00 0.00 ? 119 GLY A C    3  
ATOM 5535  O O    . GLY A 1 119 ? 25.019  7.960   -8.856  1.00 0.00 ? 119 GLY A O    3  
ATOM 5536  H H    . GLY A 1 119 ? 25.466  4.523   -11.191 1.00 0.00 ? 119 GLY A H    3  
ATOM 5537  H HA2  . GLY A 1 119 ? 23.344  5.987   -10.148 1.00 0.00 ? 119 GLY A HA2  3  
ATOM 5538  H HA3  . GLY A 1 119 ? 24.742  5.456   -9.223  1.00 0.00 ? 119 GLY A HA3  3  
ATOM 5539  N N    . GLY A 1 1   ? 24.645  -15.116 -8.156  1.00 0.00 ? 1   GLY A N    4  
ATOM 5540  C CA   . GLY A 1 1   ? 25.110  -16.468 -7.907  1.00 0.00 ? 1   GLY A CA   4  
ATOM 5541  C C    . GLY A 1 1   ? 24.072  -17.317 -7.200  1.00 0.00 ? 1   GLY A C    4  
ATOM 5542  O O    . GLY A 1 1   ? 23.974  -17.296 -5.974  1.00 0.00 ? 1   GLY A O    4  
ATOM 5543  H H1   . GLY A 1 1   ? 24.781  -14.420 -7.479  1.00 0.00 ? 1   GLY A H1   4  
ATOM 5544  H HA2  . GLY A 1 1   ? 25.358  -16.931 -8.850  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5545  H HA3  . GLY A 1 1   ? 25.999  -16.423 -7.295  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5546  N N    . SER A 1 2   ? 23.293  -18.065 -7.976  1.00 0.00 ? 2   SER A N    4  
ATOM 5547  C CA   . SER A 1 2   ? 22.253  -18.920 -7.417  1.00 0.00 ? 2   SER A CA   4  
ATOM 5548  C C    . SER A 1 2   ? 21.721  -19.887 -8.471  1.00 0.00 ? 2   SER A C    4  
ATOM 5549  O O    . SER A 1 2   ? 21.690  -19.571 -9.660  1.00 0.00 ? 2   SER A O    4  
ATOM 5550  C CB   . SER A 1 2   ? 21.108  -18.071 -6.864  1.00 0.00 ? 2   SER A CB   4  
ATOM 5551  O OG   . SER A 1 2   ? 20.424  -18.751 -5.825  1.00 0.00 ? 2   SER A OG   4  
ATOM 5552  H H    . SER A 1 2   ? 23.420  -18.038 -8.948  1.00 0.00 ? 2   SER A H    4  
ATOM 5553  H HA   . SER A 1 2   ? 22.690  -19.490 -6.611  1.00 0.00 ? 2   SER A HA   4  
ATOM 5554  H HB2  . SER A 1 2   ? 21.505  -17.147 -6.472  1.00 0.00 ? 2   SER A HB2  4  
ATOM 5555  H HB3  . SER A 1 2   ? 20.408  -17.854 -7.658  1.00 0.00 ? 2   SER A HB3  4  
ATOM 5556  H HG   . SER A 1 2   ? 21.039  -19.321 -5.356  1.00 0.00 ? 2   SER A HG   4  
ATOM 5557  N N    . SER A 1 3   ? 21.304  -21.068 -8.024  1.00 0.00 ? 3   SER A N    4  
ATOM 5558  C CA   . SER A 1 3   ? 20.777  -22.084 -8.928  1.00 0.00 ? 3   SER A CA   4  
ATOM 5559  C C    . SER A 1 3   ? 19.578  -21.549 -9.706  1.00 0.00 ? 3   SER A C    4  
ATOM 5560  O O    . SER A 1 3   ? 18.585  -21.120 -9.120  1.00 0.00 ? 3   SER A O    4  
ATOM 5561  C CB   . SER A 1 3   ? 20.374  -23.334 -8.144  1.00 0.00 ? 3   SER A CB   4  
ATOM 5562  O OG   . SER A 1 3   ? 19.816  -24.315 -9.000  1.00 0.00 ? 3   SER A OG   4  
ATOM 5563  H H    . SER A 1 3   ? 21.355  -21.260 -7.065  1.00 0.00 ? 3   SER A H    4  
ATOM 5564  H HA   . SER A 1 3   ? 21.558  -22.343 -9.627  1.00 0.00 ? 3   SER A HA   4  
ATOM 5565  H HB2  . SER A 1 3   ? 21.246  -23.749 -7.661  1.00 0.00 ? 3   SER A HB2  4  
ATOM 5566  H HB3  . SER A 1 3   ? 19.642  -23.067 -7.396  1.00 0.00 ? 3   SER A HB3  4  
ATOM 5567  H HG   . SER A 1 3   ? 20.006  -25.190 -8.653  1.00 0.00 ? 3   SER A HG   4  
ATOM 5568  N N    . GLY A 1 4   ? 19.679  -21.580 -11.031 1.00 0.00 ? 4   GLY A N    4  
ATOM 5569  C CA   . GLY A 1 4   ? 18.597  -21.096 -11.869 1.00 0.00 ? 4   GLY A CA   4  
ATOM 5570  C C    . GLY A 1 4   ? 18.367  -19.606 -11.716 1.00 0.00 ? 4   GLY A C    4  
ATOM 5571  O O    . GLY A 1 4   ? 18.521  -19.056 -10.625 1.00 0.00 ? 4   GLY A O    4  
ATOM 5572  H H    . GLY A 1 4   ? 20.495  -21.934 -11.444 1.00 0.00 ? 4   GLY A H    4  
ATOM 5573  H HA2  . GLY A 1 4   ? 18.832  -21.310 -12.901 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5574  H HA3  . GLY A 1 4   ? 17.690  -21.618 -11.602 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5575  N N    . SER A 1 5   ? 17.998  -18.950 -12.812 1.00 0.00 ? 5   SER A N    4  
ATOM 5576  C CA   . SER A 1 5   ? 17.752  -17.513 -12.796 1.00 0.00 ? 5   SER A CA   4  
ATOM 5577  C C    . SER A 1 5   ? 16.423  -17.182 -13.468 1.00 0.00 ? 5   SER A C    4  
ATOM 5578  O O    . SER A 1 5   ? 15.590  -16.473 -12.904 1.00 0.00 ? 5   SER A O    4  
ATOM 5579  C CB   . SER A 1 5   ? 18.891  -16.771 -13.499 1.00 0.00 ? 5   SER A CB   4  
ATOM 5580  O OG   . SER A 1 5   ? 19.051  -15.465 -12.972 1.00 0.00 ? 5   SER A OG   4  
ATOM 5581  H H    . SER A 1 5   ? 17.892  -19.444 -13.651 1.00 0.00 ? 5   SER A H    4  
ATOM 5582  H HA   . SER A 1 5   ? 17.710  -17.195 -11.764 1.00 0.00 ? 5   SER A HA   4  
ATOM 5583  H HB2  . SER A 1 5   ? 19.812  -17.317 -13.361 1.00 0.00 ? 5   SER A HB2  4  
ATOM 5584  H HB3  . SER A 1 5   ? 18.670  -16.696 -14.554 1.00 0.00 ? 5   SER A HB3  4  
ATOM 5585  H HG   . SER A 1 5   ? 19.615  -15.500 -12.196 1.00 0.00 ? 5   SER A HG   4  
ATOM 5586  N N    . SER A 1 6   ? 16.233  -17.701 -14.676 1.00 0.00 ? 6   SER A N    4  
ATOM 5587  C CA   . SER A 1 6   ? 15.007  -17.458 -15.428 1.00 0.00 ? 6   SER A CA   4  
ATOM 5588  C C    . SER A 1 6   ? 13.807  -18.090 -14.730 1.00 0.00 ? 6   SER A C    4  
ATOM 5589  O O    . SER A 1 6   ? 13.960  -18.962 -13.875 1.00 0.00 ? 6   SER A O    4  
ATOM 5590  C CB   . SER A 1 6   ? 15.137  -18.014 -16.848 1.00 0.00 ? 6   SER A CB   4  
ATOM 5591  O OG   . SER A 1 6   ? 14.178  -17.430 -17.713 1.00 0.00 ? 6   SER A OG   4  
ATOM 5592  H H    . SER A 1 6   ? 16.935  -18.258 -15.073 1.00 0.00 ? 6   SER A H    4  
ATOM 5593  H HA   . SER A 1 6   ? 14.857  -16.390 -15.481 1.00 0.00 ? 6   SER A HA   4  
ATOM 5594  H HB2  . SER A 1 6   ? 16.124  -17.799 -17.228 1.00 0.00 ? 6   SER A HB2  4  
ATOM 5595  H HB3  . SER A 1 6   ? 14.983  -19.083 -16.828 1.00 0.00 ? 6   SER A HB3  4  
ATOM 5596  H HG   . SER A 1 6   ? 14.424  -16.521 -17.898 1.00 0.00 ? 6   SER A HG   4  
ATOM 5597  N N    . GLY A 1 7   ? 12.611  -17.643 -15.101 1.00 0.00 ? 7   GLY A N    4  
ATOM 5598  C CA   . GLY A 1 7   ? 11.402  -18.175 -14.501 1.00 0.00 ? 7   GLY A CA   4  
ATOM 5599  C C    . GLY A 1 7   ? 10.525  -17.091 -13.905 1.00 0.00 ? 7   GLY A C    4  
ATOM 5600  O O    . GLY A 1 7   ? 10.234  -17.106 -12.709 1.00 0.00 ? 7   GLY A O    4  
ATOM 5601  H H    . GLY A 1 7   ? 12.550  -16.946 -15.787 1.00 0.00 ? 7   GLY A H    4  
ATOM 5602  H HA2  . GLY A 1 7   ? 10.840  -18.703 -15.257 1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5603  H HA3  . GLY A 1 7   ? 11.676  -18.869 -13.720 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5604  N N    . ARG A 1 8   ? 10.104  -16.147 -14.741 1.00 0.00 ? 8   ARG A N    4  
ATOM 5605  C CA   . ARG A 1 8   ? 9.258   -15.049 -14.289 1.00 0.00 ? 8   ARG A CA   4  
ATOM 5606  C C    . ARG A 1 8   ? 7.810   -15.267 -14.717 1.00 0.00 ? 8   ARG A C    4  
ATOM 5607  O O    . ARG A 1 8   ? 7.507   -15.323 -15.908 1.00 0.00 ? 8   ARG A O    4  
ATOM 5608  C CB   . ARG A 1 8   ? 9.771   -13.719 -14.846 1.00 0.00 ? 8   ARG A CB   4  
ATOM 5609  C CG   . ARG A 1 8   ? 10.858  -13.082 -13.996 1.00 0.00 ? 8   ARG A CG   4  
ATOM 5610  C CD   . ARG A 1 8   ? 11.556  -11.954 -14.740 1.00 0.00 ? 8   ARG A CD   4  
ATOM 5611  N NE   . ARG A 1 8   ? 12.936  -11.778 -14.296 1.00 0.00 ? 8   ARG A NE   4  
ATOM 5612  C CZ   . ARG A 1 8   ? 13.889  -12.685 -14.480 1.00 0.00 ? 8   ARG A CZ   4  
ATOM 5613  N NH1  . ARG A 1 8   ? 13.612  -13.826 -15.096 1.00 0.00 ? 8   ARG A NH1  4  
ATOM 5614  N NH2  . ARG A 1 8   ? 15.121  -12.452 -14.047 1.00 0.00 ? 8   ARG A NH2  4  
ATOM 5615  H H    . ARG A 1 8   ? 10.370  -16.189 -15.683 1.00 0.00 ? 8   ARG A H    4  
ATOM 5616  H HA   . ARG A 1 8   ? 9.302   -15.018 -13.211 1.00 0.00 ? 8   ARG A HA   4  
ATOM 5617  H HB2  . ARG A 1 8   ? 10.170  -13.887 -15.836 1.00 0.00 ? 8   ARG A HB2  4  
ATOM 5618  H HB3  . ARG A 1 8   ? 8.944   -13.028 -14.912 1.00 0.00 ? 8   ARG A HB3  4  
ATOM 5619  H HG2  . ARG A 1 8   ? 10.412  -12.683 -13.097 1.00 0.00 ? 8   ARG A HG2  4  
ATOM 5620  H HG3  . ARG A 1 8   ? 11.586  -13.835 -13.736 1.00 0.00 ? 8   ARG A HG3  4  
ATOM 5621  H HD2  . ARG A 1 8   ? 11.554  -12.181 -15.795 1.00 0.00 ? 8   ARG A HD2  4  
ATOM 5622  H HD3  . ARG A 1 8   ? 11.012  -11.037 -14.567 1.00 0.00 ? 8   ARG A HD3  4  
ATOM 5623  H HE   . ARG A 1 8   ? 13.163  -10.942 -13.838 1.00 0.00 ? 8   ARG A HE   4  
ATOM 5624  H HH11 . ARG A 1 8   ? 12.685  -14.004 -15.424 1.00 0.00 ? 8   ARG A HH11 4  
ATOM 5625  H HH12 . ARG A 1 8   ? 14.332  -14.507 -15.235 1.00 0.00 ? 8   ARG A HH12 4  
ATOM 5626  H HH21 . ARG A 1 8   ? 15.334  -11.593 -13.583 1.00 0.00 ? 8   ARG A HH21 4  
ATOM 5627  H HH22 . ARG A 1 8   ? 15.837  -13.135 -14.186 1.00 0.00 ? 8   ARG A HH22 4  
ATOM 5628  N N    . GLU A 1 9   ? 6.921   -15.390 -13.736 1.00 0.00 ? 9   GLU A N    4  
ATOM 5629  C CA   . GLU A 1 9   ? 5.505   -15.603 -14.012 1.00 0.00 ? 9   GLU A CA   4  
ATOM 5630  C C    . GLU A 1 9   ? 4.775   -14.273 -14.172 1.00 0.00 ? 9   GLU A C    4  
ATOM 5631  O O    . GLU A 1 9   ? 5.218   -13.245 -13.661 1.00 0.00 ? 9   GLU A O    4  
ATOM 5632  C CB   . GLU A 1 9   ? 4.861   -16.419 -12.889 1.00 0.00 ? 9   GLU A CB   4  
ATOM 5633  C CG   . GLU A 1 9   ? 5.558   -17.742 -12.620 1.00 0.00 ? 9   GLU A CG   4  
ATOM 5634  C CD   . GLU A 1 9   ? 6.777   -17.589 -11.732 1.00 0.00 ? 9   GLU A CD   4  
ATOM 5635  O OE1  . GLU A 1 9   ? 6.777   -16.678 -10.877 1.00 0.00 ? 9   GLU A OE1  4  
ATOM 5636  O OE2  . GLU A 1 9   ? 7.731   -18.378 -11.891 1.00 0.00 ? 9   GLU A OE2  4  
ATOM 5637  H H    . GLU A 1 9   ? 7.224   -15.336 -12.806 1.00 0.00 ? 9   GLU A H    4  
ATOM 5638  H HA   . GLU A 1 9   ? 5.427   -16.156 -14.936 1.00 0.00 ? 9   GLU A HA   4  
ATOM 5639  H HB2  . GLU A 1 9   ? 4.879   -15.834 -11.980 1.00 0.00 ? 9   GLU A HB2  4  
ATOM 5640  H HB3  . GLU A 1 9   ? 3.834   -16.624 -13.153 1.00 0.00 ? 9   GLU A HB3  4  
ATOM 5641  H HG2  . GLU A 1 9   ? 4.861   -18.410 -12.136 1.00 0.00 ? 9   GLU A HG2  4  
ATOM 5642  H HG3  . GLU A 1 9   ? 5.869   -18.168 -13.562 1.00 0.00 ? 9   GLU A HG3  4  
ATOM 5643  N N    . GLU A 1 10  ? 3.654   -14.302 -14.886 1.00 0.00 ? 10  GLU A N    4  
ATOM 5644  C CA   . GLU A 1 10  ? 2.864   -13.098 -15.115 1.00 0.00 ? 10  GLU A CA   4  
ATOM 5645  C C    . GLU A 1 10  ? 1.600   -13.105 -14.260 1.00 0.00 ? 10  GLU A C    4  
ATOM 5646  O O    . GLU A 1 10  ? 0.947   -14.138 -14.108 1.00 0.00 ? 10  GLU A O    4  
ATOM 5647  C CB   . GLU A 1 10  ? 2.491   -12.979 -16.594 1.00 0.00 ? 10  GLU A CB   4  
ATOM 5648  C CG   . GLU A 1 10  ? 2.323   -14.320 -17.289 1.00 0.00 ? 10  GLU A CG   4  
ATOM 5649  C CD   . GLU A 1 10  ? 2.047   -14.178 -18.773 1.00 0.00 ? 10  GLU A CD   4  
ATOM 5650  O OE1  . GLU A 1 10  ? 0.941   -13.722 -19.131 1.00 0.00 ? 10  GLU A OE1  4  
ATOM 5651  O OE2  . GLU A 1 10  ? 2.939   -14.523 -19.577 1.00 0.00 ? 10  GLU A OE2  4  
ATOM 5652  H H    . GLU A 1 10  ? 3.352   -15.152 -15.268 1.00 0.00 ? 10  GLU A H    4  
ATOM 5653  H HA   . GLU A 1 10  ? 3.467   -12.247 -14.837 1.00 0.00 ? 10  GLU A HA   4  
ATOM 5654  H HB2  . GLU A 1 10  ? 1.561   -12.435 -16.676 1.00 0.00 ? 10  GLU A HB2  4  
ATOM 5655  H HB3  . GLU A 1 10  ? 3.266   -12.428 -17.105 1.00 0.00 ? 10  GLU A HB3  4  
ATOM 5656  H HG2  . GLU A 1 10  ? 3.229   -14.894 -17.160 1.00 0.00 ? 10  GLU A HG2  4  
ATOM 5657  H HG3  . GLU A 1 10  ? 1.497   -14.847 -16.833 1.00 0.00 ? 10  GLU A HG3  4  
ATOM 5658  N N    . ASP A 1 11  ? 1.263   -11.947 -13.703 1.00 0.00 ? 11  ASP A N    4  
ATOM 5659  C CA   . ASP A 1 11  ? 0.078   -11.819 -12.863 1.00 0.00 ? 11  ASP A CA   4  
ATOM 5660  C C    . ASP A 1 11  ? -0.779  -10.638 -13.308 1.00 0.00 ? 11  ASP A C    4  
ATOM 5661  O O    . ASP A 1 11  ? -0.321  -9.738  -14.012 1.00 0.00 ? 11  ASP A O    4  
ATOM 5662  C CB   . ASP A 1 11  ? 0.481   -11.649 -11.397 1.00 0.00 ? 11  ASP A CB   4  
ATOM 5663  C CG   . ASP A 1 11  ? 0.604   -12.976 -10.673 1.00 0.00 ? 11  ASP A CG   4  
ATOM 5664  O OD1  . ASP A 1 11  ? 1.514   -13.758 -11.019 1.00 0.00 ? 11  ASP A OD1  4  
ATOM 5665  O OD2  . ASP A 1 11  ? -0.210  -13.231 -9.761  1.00 0.00 ? 11  ASP A OD2  4  
ATOM 5666  H H    . ASP A 1 11  ? 1.824   -11.159 -13.862 1.00 0.00 ? 11  ASP A H    4  
ATOM 5667  H HA   . ASP A 1 11  ? -0.500  -12.725 -12.965 1.00 0.00 ? 11  ASP A HA   4  
ATOM 5668  H HB2  . ASP A 1 11  ? 1.435   -11.145 -11.350 1.00 0.00 ? 11  ASP A HB2  4  
ATOM 5669  H HB3  . ASP A 1 11  ? -0.263  -11.051 -10.893 1.00 0.00 ? 11  ASP A HB3  4  
ATOM 5670  N N    . PRO A 1 12  ? -2.053  -10.640 -12.890 1.00 0.00 ? 12  PRO A N    4  
ATOM 5671  C CA   . PRO A 1 12  ? -3.001  -9.576  -13.234 1.00 0.00 ? 12  PRO A CA   4  
ATOM 5672  C C    . PRO A 1 12  ? -2.672  -8.260  -12.538 1.00 0.00 ? 12  PRO A C    4  
ATOM 5673  O O    . PRO A 1 12  ? -2.742  -7.190  -13.145 1.00 0.00 ? 12  PRO A O    4  
ATOM 5674  C CB   . PRO A 1 12  ? -4.342  -10.122 -12.739 1.00 0.00 ? 12  PRO A CB   4  
ATOM 5675  C CG   . PRO A 1 12  ? -3.985  -11.076 -11.652 1.00 0.00 ? 12  PRO A CG   4  
ATOM 5676  C CD   . PRO A 1 12  ? -2.667  -11.681 -12.049 1.00 0.00 ? 12  PRO A CD   4  
ATOM 5677  H HA   . PRO A 1 12  ? -3.047  -9.416  -14.301 1.00 0.00 ? 12  PRO A HA   4  
ATOM 5678  H HB2  . PRO A 1 12  ? -4.950  -9.308  -12.368 1.00 0.00 ? 12  PRO A HB2  4  
ATOM 5679  H HB3  . PRO A 1 12  ? -4.854  -10.620 -13.549 1.00 0.00 ? 12  PRO A HB3  4  
ATOM 5680  H HG2  . PRO A 1 12  ? -3.888  -10.547 -10.716 1.00 0.00 ? 12  PRO A HG2  4  
ATOM 5681  H HG3  . PRO A 1 12  ? -4.741  -11.843 -11.574 1.00 0.00 ? 12  PRO A HG3  4  
ATOM 5682  H HD2  . PRO A 1 12  ? -2.063  -11.877 -11.175 1.00 0.00 ? 12  PRO A HD2  4  
ATOM 5683  H HD3  . PRO A 1 12  ? -2.823  -12.589 -12.612 1.00 0.00 ? 12  PRO A HD3  4  
ATOM 5684  N N    . HIS A 1 13  ? -2.312  -8.344  -11.261 1.00 0.00 ? 13  HIS A N    4  
ATOM 5685  C CA   . HIS A 1 13  ? -1.971  -7.159  -10.483 1.00 0.00 ? 13  HIS A CA   4  
ATOM 5686  C C    . HIS A 1 13  ? -0.771  -6.437  -11.089 1.00 0.00 ? 13  HIS A C    4  
ATOM 5687  O O    . HIS A 1 13  ? -0.685  -5.211  -11.043 1.00 0.00 ? 13  HIS A O    4  
ATOM 5688  C CB   . HIS A 1 13  ? -1.671  -7.543  -9.034  1.00 0.00 ? 13  HIS A CB   4  
ATOM 5689  C CG   . HIS A 1 13  ? -2.898  -7.809  -8.218  1.00 0.00 ? 13  HIS A CG   4  
ATOM 5690  N ND1  . HIS A 1 13  ? -2.942  -8.746  -7.208  1.00 0.00 ? 13  HIS A ND1  4  
ATOM 5691  C CD2  . HIS A 1 13  ? -4.131  -7.253  -8.267  1.00 0.00 ? 13  HIS A CD2  4  
ATOM 5692  C CE1  . HIS A 1 13  ? -4.149  -8.756  -6.671  1.00 0.00 ? 13  HIS A CE1  4  
ATOM 5693  N NE2  . HIS A 1 13  ? -4.890  -7.859  -7.296  1.00 0.00 ? 13  HIS A NE2  4  
ATOM 5694  H H    . HIS A 1 13  ? -2.275  -9.224  -10.833 1.00 0.00 ? 13  HIS A H    4  
ATOM 5695  H HA   . HIS A 1 13  ? -2.821  -6.494  -10.501 1.00 0.00 ? 13  HIS A HA   4  
ATOM 5696  H HB2  . HIS A 1 13  ? -1.066  -8.438  -9.024  1.00 0.00 ? 13  HIS A HB2  4  
ATOM 5697  H HB3  . HIS A 1 13  ? -1.125  -6.740  -8.561  1.00 0.00 ? 13  HIS A HB3  4  
ATOM 5698  H HD1  . HIS A 1 13  ? -2.199  -9.320  -6.927  1.00 0.00 ? 13  HIS A HD1  4  
ATOM 5699  H HD2  . HIS A 1 13  ? -4.459  -6.476  -8.944  1.00 0.00 ? 13  HIS A HD2  4  
ATOM 5700  H HE1  . HIS A 1 13  ? -4.476  -9.389  -5.860  1.00 0.00 ? 13  HIS A HE1  4  
ATOM 5701  N N    . GLU A 1 14  ? 0.152   -7.208  -11.657 1.00 0.00 ? 14  GLU A N    4  
ATOM 5702  C CA   . GLU A 1 14  ? 1.347   -6.641  -12.271 1.00 0.00 ? 14  GLU A CA   4  
ATOM 5703  C C    . GLU A 1 14  ? 0.978   -5.722  -13.432 1.00 0.00 ? 14  GLU A C    4  
ATOM 5704  O O    . GLU A 1 14  ? 1.757   -4.852  -13.821 1.00 0.00 ? 14  GLU A O    4  
ATOM 5705  C CB   . GLU A 1 14  ? 2.272   -7.756  -12.763 1.00 0.00 ? 14  GLU A CB   4  
ATOM 5706  C CG   . GLU A 1 14  ? 2.987   -8.492  -11.642 1.00 0.00 ? 14  GLU A CG   4  
ATOM 5707  C CD   . GLU A 1 14  ? 4.077   -9.414  -12.152 1.00 0.00 ? 14  GLU A CD   4  
ATOM 5708  O OE1  . GLU A 1 14  ? 3.906   -9.987  -13.249 1.00 0.00 ? 14  GLU A OE1  4  
ATOM 5709  O OE2  . GLU A 1 14  ? 5.102   -9.563  -11.455 1.00 0.00 ? 14  GLU A OE2  4  
ATOM 5710  H H    . GLU A 1 14  ? 0.026   -8.180  -11.663 1.00 0.00 ? 14  GLU A H    4  
ATOM 5711  H HA   . GLU A 1 14  ? 1.863   -6.063  -11.520 1.00 0.00 ? 14  GLU A HA   4  
ATOM 5712  H HB2  . GLU A 1 14  ? 1.688   -8.472  -13.321 1.00 0.00 ? 14  GLU A HB2  4  
ATOM 5713  H HB3  . GLU A 1 14  ? 3.018   -7.326  -13.415 1.00 0.00 ? 14  GLU A HB3  4  
ATOM 5714  H HG2  . GLU A 1 14  ? 3.433   -7.766  -10.978 1.00 0.00 ? 14  GLU A HG2  4  
ATOM 5715  H HG3  . GLU A 1 14  ? 2.264   -9.081  -11.097 1.00 0.00 ? 14  GLU A HG3  4  
ATOM 5716  N N    . GLY A 1 15  ? -0.216  -5.921  -13.981 1.00 0.00 ? 15  GLY A N    4  
ATOM 5717  C CA   . GLY A 1 15  ? -0.667  -5.104  -15.093 1.00 0.00 ? 15  GLY A CA   4  
ATOM 5718  C C    . GLY A 1 15  ? -1.221  -3.767  -14.642 1.00 0.00 ? 15  GLY A C    4  
ATOM 5719  O O    . GLY A 1 15  ? -1.329  -2.832  -15.434 1.00 0.00 ? 15  GLY A O    4  
ATOM 5720  H H    . GLY A 1 15  ? -0.795  -6.630  -13.630 1.00 0.00 ? 15  GLY A H    4  
ATOM 5721  H HA2  . GLY A 1 15  ? 0.165   -4.931  -15.759 1.00 0.00 ? 15  GLY A HA2  4  
ATOM 5722  H HA3  . GLY A 1 15  ? -1.438  -5.639  -15.628 1.00 0.00 ? 15  GLY A HA3  4  
ATOM 5723  N N    . LYS A 1 16  ? -1.576  -3.676  -13.364 1.00 0.00 ? 16  LYS A N    4  
ATOM 5724  C CA   . LYS A 1 16  ? -2.123  -2.445  -12.807 1.00 0.00 ? 16  LYS A CA   4  
ATOM 5725  C C    . LYS A 1 16  ? -1.051  -1.364  -12.721 1.00 0.00 ? 16  LYS A C    4  
ATOM 5726  O O    . LYS A 1 16  ? 0.121   -1.656  -12.482 1.00 0.00 ? 16  LYS A O    4  
ATOM 5727  C CB   . LYS A 1 16  ? -2.713  -2.706  -11.419 1.00 0.00 ? 16  LYS A CB   4  
ATOM 5728  C CG   . LYS A 1 16  ? -3.737  -3.827  -11.395 1.00 0.00 ? 16  LYS A CG   4  
ATOM 5729  C CD   . LYS A 1 16  ? -5.052  -3.395  -12.023 1.00 0.00 ? 16  LYS A CD   4  
ATOM 5730  C CE   . LYS A 1 16  ? -6.134  -4.446  -11.831 1.00 0.00 ? 16  LYS A CE   4  
ATOM 5731  N NZ   . LYS A 1 16  ? -7.482  -3.927  -12.192 1.00 0.00 ? 16  LYS A NZ   4  
ATOM 5732  H H    . LYS A 1 16  ? -1.466  -4.457  -12.781 1.00 0.00 ? 16  LYS A H    4  
ATOM 5733  H HA   . LYS A 1 16  ? -2.909  -2.104  -13.464 1.00 0.00 ? 16  LYS A HA   4  
ATOM 5734  H HB2  . LYS A 1 16  ? -1.911  -2.965  -10.744 1.00 0.00 ? 16  LYS A HB2  4  
ATOM 5735  H HB3  . LYS A 1 16  ? -3.190  -1.803  -11.068 1.00 0.00 ? 16  LYS A HB3  4  
ATOM 5736  H HG2  . LYS A 1 16  ? -3.348  -4.671  -11.945 1.00 0.00 ? 16  LYS A HG2  4  
ATOM 5737  H HG3  . LYS A 1 16  ? -3.917  -4.116  -10.369 1.00 0.00 ? 16  LYS A HG3  4  
ATOM 5738  H HD2  . LYS A 1 16  ? -5.375  -2.473  -11.562 1.00 0.00 ? 16  LYS A HD2  4  
ATOM 5739  H HD3  . LYS A 1 16  ? -4.900  -3.236  -13.081 1.00 0.00 ? 16  LYS A HD3  4  
ATOM 5740  H HE2  . LYS A 1 16  ? -5.906  -5.297  -12.455 1.00 0.00 ? 16  LYS A HE2  4  
ATOM 5741  H HE3  . LYS A 1 16  ? -6.140  -4.752  -10.795 1.00 0.00 ? 16  LYS A HE3  4  
ATOM 5742  H HZ1  . LYS A 1 16  ? -7.988  -4.624  -12.776 1.00 0.00 ? 16  LYS A HZ1  4  
ATOM 5743  H HZ2  . LYS A 1 16  ? -7.391  -3.042  -12.730 1.00 0.00 ? 16  LYS A HZ2  4  
ATOM 5744  H HZ3  . LYS A 1 16  ? -8.036  -3.743  -11.332 1.00 0.00 ? 16  LYS A HZ3  4  
ATOM 5745  N N    . ILE A 1 17  ? -1.460  -0.114  -12.914 1.00 0.00 ? 17  ILE A N    4  
ATOM 5746  C CA   . ILE A 1 17  ? -0.534  1.010   -12.855 1.00 0.00 ? 17  ILE A CA   4  
ATOM 5747  C C    . ILE A 1 17  ? -0.295  1.450   -11.415 1.00 0.00 ? 17  ILE A C    4  
ATOM 5748  O O    . ILE A 1 17  ? 0.816   1.835   -11.049 1.00 0.00 ? 17  ILE A O    4  
ATOM 5749  C CB   . ILE A 1 17  ? -1.054  2.211   -13.667 1.00 0.00 ? 17  ILE A CB   4  
ATOM 5750  C CG1  . ILE A 1 17  ? 0.009   3.309   -13.733 1.00 0.00 ? 17  ILE A CG1  4  
ATOM 5751  C CG2  . ILE A 1 17  ? -2.340  2.747   -13.055 1.00 0.00 ? 17  ILE A CG2  4  
ATOM 5752  C CD1  . ILE A 1 17  ? -0.163  4.246   -14.908 1.00 0.00 ? 17  ILE A CD1  4  
ATOM 5753  H H    . ILE A 1 17  ? -2.407  0.055   -13.101 1.00 0.00 ? 17  ILE A H    4  
ATOM 5754  H HA   . ILE A 1 17  ? 0.405   0.691   -13.284 1.00 0.00 ? 17  ILE A HA   4  
ATOM 5755  H HB   . ILE A 1 17  ? -1.275  1.872   -14.668 1.00 0.00 ? 17  ILE A HB   4  
ATOM 5756  H HG12 . ILE A 1 17  ? -0.033  3.897   -12.831 1.00 0.00 ? 17  ILE A HG12 4  
ATOM 5757  H HG13 . ILE A 1 17  ? 0.984   2.850   -13.814 1.00 0.00 ? 17  ILE A HG13 4  
ATOM 5758  H HG21 . ILE A 1 17  ? -2.970  1.922   -12.760 1.00 0.00 ? 17  ILE A HG21 4  
ATOM 5759  H HG22 . ILE A 1 17  ? -2.102  3.345   -12.188 1.00 0.00 ? 17  ILE A HG22 4  
ATOM 5760  H HG23 . ILE A 1 17  ? -2.858  3.355   -13.781 1.00 0.00 ? 17  ILE A HG23 4  
ATOM 5761  H HD11 . ILE A 1 17  ? -1.150  4.683   -14.879 1.00 0.00 ? 17  ILE A HD11 4  
ATOM 5762  H HD12 . ILE A 1 17  ? 0.580   5.028   -14.857 1.00 0.00 ? 17  ILE A HD12 4  
ATOM 5763  H HD13 . ILE A 1 17  ? -0.041  3.695   -15.829 1.00 0.00 ? 17  ILE A HD13 4  
ATOM 5764  N N    . TRP A 1 18  ? -1.343  1.388   -10.602 1.00 0.00 ? 18  TRP A N    4  
ATOM 5765  C CA   . TRP A 1 18  ? -1.246  1.778   -9.200  1.00 0.00 ? 18  TRP A CA   4  
ATOM 5766  C C    . TRP A 1 18  ? -0.501  0.722   -8.391  1.00 0.00 ? 18  TRP A C    4  
ATOM 5767  O O    . TRP A 1 18  ? -0.065  0.980   -7.268  1.00 0.00 ? 18  TRP A O    4  
ATOM 5768  C CB   . TRP A 1 18  ? -2.642  1.997   -8.613  1.00 0.00 ? 18  TRP A CB   4  
ATOM 5769  C CG   . TRP A 1 18  ? -3.593  0.878   -8.909  1.00 0.00 ? 18  TRP A CG   4  
ATOM 5770  C CD1  . TRP A 1 18  ? -4.581  0.870   -9.852  1.00 0.00 ? 18  TRP A CD1  4  
ATOM 5771  C CD2  . TRP A 1 18  ? -3.648  -0.396  -8.259  1.00 0.00 ? 18  TRP A CD2  4  
ATOM 5772  N NE1  . TRP A 1 18  ? -5.247  -0.332  -9.827  1.00 0.00 ? 18  TRP A NE1  4  
ATOM 5773  C CE2  . TRP A 1 18  ? -4.693  -1.126  -8.858  1.00 0.00 ? 18  TRP A CE2  4  
ATOM 5774  C CE3  . TRP A 1 18  ? -2.914  -0.992  -7.229  1.00 0.00 ? 18  TRP A CE3  4  
ATOM 5775  C CZ2  . TRP A 1 18  ? -5.021  -2.420  -8.461  1.00 0.00 ? 18  TRP A CZ2  4  
ATOM 5776  C CZ3  . TRP A 1 18  ? -3.241  -2.276  -6.835  1.00 0.00 ? 18  TRP A CZ3  4  
ATOM 5777  C CH2  . TRP A 1 18  ? -4.286  -2.979  -7.450  1.00 0.00 ? 18  TRP A CH2  4  
ATOM 5778  H H    . TRP A 1 18  ? -2.203  1.072   -10.952 1.00 0.00 ? 18  TRP A H    4  
ATOM 5779  H HA   . TRP A 1 18  ? -0.696  2.706   -9.152  1.00 0.00 ? 18  TRP A HA   4  
ATOM 5780  H HB2  . TRP A 1 18  ? -2.564  2.092   -7.540  1.00 0.00 ? 18  TRP A HB2  4  
ATOM 5781  H HB3  . TRP A 1 18  ? -3.058  2.906   -9.022  1.00 0.00 ? 18  TRP A HB3  4  
ATOM 5782  H HD1  . TRP A 1 18  ? -4.798  1.696   -10.512 1.00 0.00 ? 18  TRP A HD1  4  
ATOM 5783  H HE1  . TRP A 1 18  ? -5.996  -0.580  -10.409 1.00 0.00 ? 18  TRP A HE1  4  
ATOM 5784  H HE3  . TRP A 1 18  ? -2.106  -0.467  -6.743  1.00 0.00 ? 18  TRP A HE3  4  
ATOM 5785  H HZ2  . TRP A 1 18  ? -5.823  -2.975  -8.925  1.00 0.00 ? 18  TRP A HZ2  4  
ATOM 5786  H HZ3  . TRP A 1 18  ? -2.686  -2.753  -6.041  1.00 0.00 ? 18  TRP A HZ3  4  
ATOM 5787  H HH2  . TRP A 1 18  ? -4.507  -3.979  -7.110  1.00 0.00 ? 18  TRP A HH2  4  
ATOM 5788  N N    . PHE A 1 19  ? -0.357  -0.466  -8.967  1.00 0.00 ? 19  PHE A N    4  
ATOM 5789  C CA   . PHE A 1 19  ? 0.336   -1.562  -8.299  1.00 0.00 ? 19  PHE A CA   4  
ATOM 5790  C C    . PHE A 1 19  ? 1.847   -1.426  -8.456  1.00 0.00 ? 19  PHE A C    4  
ATOM 5791  O O    . PHE A 1 19  ? 2.348   -1.170  -9.552  1.00 0.00 ? 19  PHE A O    4  
ATOM 5792  C CB   . PHE A 1 19  ? -0.129  -2.906  -8.862  1.00 0.00 ? 19  PHE A CB   4  
ATOM 5793  C CG   . PHE A 1 19  ? 0.433   -4.090  -8.128  1.00 0.00 ? 19  PHE A CG   4  
ATOM 5794  C CD1  . PHE A 1 19  ? 0.125   -4.306  -6.794  1.00 0.00 ? 19  PHE A CD1  4  
ATOM 5795  C CD2  . PHE A 1 19  ? 1.270   -4.987  -8.771  1.00 0.00 ? 19  PHE A CD2  4  
ATOM 5796  C CE1  . PHE A 1 19  ? 0.641   -5.394  -6.117  1.00 0.00 ? 19  PHE A CE1  4  
ATOM 5797  C CE2  . PHE A 1 19  ? 1.790   -6.077  -8.099  1.00 0.00 ? 19  PHE A CE2  4  
ATOM 5798  C CZ   . PHE A 1 19  ? 1.474   -6.281  -6.770  1.00 0.00 ? 19  PHE A CZ   4  
ATOM 5799  H H    . PHE A 1 19  ? -0.727  -0.610  -9.864  1.00 0.00 ? 19  PHE A H    4  
ATOM 5800  H HA   . PHE A 1 19  ? 0.090   -1.516  -7.249  1.00 0.00 ? 19  PHE A HA   4  
ATOM 5801  H HB2  . PHE A 1 19  ? -1.205  -2.961  -8.803  1.00 0.00 ? 19  PHE A HB2  4  
ATOM 5802  H HB3  . PHE A 1 19  ? 0.175   -2.980  -9.895  1.00 0.00 ? 19  PHE A HB3  4  
ATOM 5803  H HD1  . PHE A 1 19  ? -0.527  -3.613  -6.283  1.00 0.00 ? 19  PHE A HD1  4  
ATOM 5804  H HD2  . PHE A 1 19  ? 1.518   -4.829  -9.812  1.00 0.00 ? 19  PHE A HD2  4  
ATOM 5805  H HE1  . PHE A 1 19  ? 0.393   -5.551  -5.078  1.00 0.00 ? 19  PHE A HE1  4  
ATOM 5806  H HE2  . PHE A 1 19  ? 2.440   -6.769  -8.613  1.00 0.00 ? 19  PHE A HE2  4  
ATOM 5807  H HZ   . PHE A 1 19  ? 1.879   -7.132  -6.242  1.00 0.00 ? 19  PHE A HZ   4  
ATOM 5808  N N    . HIS A 1 20  ? 2.569   -1.599  -7.354  1.00 0.00 ? 20  HIS A N    4  
ATOM 5809  C CA   . HIS A 1 20  ? 4.024   -1.496  -7.368  1.00 0.00 ? 20  HIS A CA   4  
ATOM 5810  C C    . HIS A 1 20  ? 4.658   -2.644  -6.589  1.00 0.00 ? 20  HIS A C    4  
ATOM 5811  O O    . HIS A 1 20  ? 4.867   -2.546  -5.380  1.00 0.00 ? 20  HIS A O    4  
ATOM 5812  C CB   . HIS A 1 20  ? 4.468   -0.157  -6.779  1.00 0.00 ? 20  HIS A CB   4  
ATOM 5813  C CG   . HIS A 1 20  ? 4.546   0.946   -7.789  1.00 0.00 ? 20  HIS A CG   4  
ATOM 5814  N ND1  . HIS A 1 20  ? 5.667   1.186   -8.556  1.00 0.00 ? 20  HIS A ND1  4  
ATOM 5815  C CD2  . HIS A 1 20  ? 3.634   1.876   -8.157  1.00 0.00 ? 20  HIS A CD2  4  
ATOM 5816  C CE1  . HIS A 1 20  ? 5.441   2.217   -9.351  1.00 0.00 ? 20  HIS A CE1  4  
ATOM 5817  N NE2  . HIS A 1 20  ? 4.214   2.653   -9.129  1.00 0.00 ? 20  HIS A NE2  4  
ATOM 5818  H H    . HIS A 1 20  ? 2.113   -1.801  -6.511  1.00 0.00 ? 20  HIS A H    4  
ATOM 5819  H HA   . HIS A 1 20  ? 4.350   -1.552  -8.396  1.00 0.00 ? 20  HIS A HA   4  
ATOM 5820  H HB2  . HIS A 1 20  ? 3.765   0.143   -6.015  1.00 0.00 ? 20  HIS A HB2  4  
ATOM 5821  H HB3  . HIS A 1 20  ? 5.447   -0.273  -6.336  1.00 0.00 ? 20  HIS A HB3  4  
ATOM 5822  H HD1  . HIS A 1 20  ? 6.503   0.678   -8.521  1.00 0.00 ? 20  HIS A HD1  4  
ATOM 5823  H HD2  . HIS A 1 20  ? 2.634   1.986   -7.760  1.00 0.00 ? 20  HIS A HD2  4  
ATOM 5824  H HE1  . HIS A 1 20  ? 6.139   2.632   -10.062 1.00 0.00 ? 20  HIS A HE1  4  
ATOM 5825  N N    . GLY A 1 21  ? 4.961   -3.733  -7.289  1.00 0.00 ? 21  GLY A N    4  
ATOM 5826  C CA   . GLY A 1 21  ? 5.567   -4.884  -6.646  1.00 0.00 ? 21  GLY A CA   4  
ATOM 5827  C C    . GLY A 1 21  ? 7.039   -5.026  -6.979  1.00 0.00 ? 21  GLY A C    4  
ATOM 5828  O O    . GLY A 1 21  ? 7.788   -5.678  -6.251  1.00 0.00 ? 21  GLY A O    4  
ATOM 5829  H H    . GLY A 1 21  ? 4.772   -3.754  -8.251  1.00 0.00 ? 21  GLY A H    4  
ATOM 5830  H HA2  . GLY A 1 21  ? 5.459   -4.783  -5.576  1.00 0.00 ? 21  GLY A HA2  4  
ATOM 5831  H HA3  . GLY A 1 21  ? 5.049   -5.775  -6.968  1.00 0.00 ? 21  GLY A HA3  4  
ATOM 5832  N N    . LYS A 1 22  ? 7.455   -4.417  -8.084  1.00 0.00 ? 22  LYS A N    4  
ATOM 5833  C CA   . LYS A 1 22  ? 8.847   -4.479  -8.514  1.00 0.00 ? 22  LYS A CA   4  
ATOM 5834  C C    . LYS A 1 22  ? 9.740   -3.664  -7.585  1.00 0.00 ? 22  LYS A C    4  
ATOM 5835  O O    . LYS A 1 22  ? 10.840  -4.092  -7.233  1.00 0.00 ? 22  LYS A O    4  
ATOM 5836  C CB   . LYS A 1 22  ? 8.982   -3.965  -9.950  1.00 0.00 ? 22  LYS A CB   4  
ATOM 5837  C CG   . LYS A 1 22  ? 8.405   -4.909  -10.990 1.00 0.00 ? 22  LYS A CG   4  
ATOM 5838  C CD   . LYS A 1 22  ? 9.379   -6.023  -11.334 1.00 0.00 ? 22  LYS A CD   4  
ATOM 5839  C CE   . LYS A 1 22  ? 10.549  -5.507  -12.157 1.00 0.00 ? 22  LYS A CE   4  
ATOM 5840  N NZ   . LYS A 1 22  ? 11.208  -6.597  -12.929 1.00 0.00 ? 22  LYS A NZ   4  
ATOM 5841  H H    . LYS A 1 22  ? 6.810   -3.913  -8.624  1.00 0.00 ? 22  LYS A H    4  
ATOM 5842  H HA   . LYS A 1 22  ? 9.160   -5.512  -8.480  1.00 0.00 ? 22  LYS A HA   4  
ATOM 5843  H HB2  . LYS A 1 22  ? 8.470   -3.017  -10.029 1.00 0.00 ? 22  LYS A HB2  4  
ATOM 5844  H HB3  . LYS A 1 22  ? 10.030  -3.818  -10.169 1.00 0.00 ? 22  LYS A HB3  4  
ATOM 5845  H HG2  . LYS A 1 22  ? 7.497   -5.346  -10.603 1.00 0.00 ? 22  LYS A HG2  4  
ATOM 5846  H HG3  . LYS A 1 22  ? 8.183   -4.348  -11.887 1.00 0.00 ? 22  LYS A HG3  4  
ATOM 5847  H HD2  . LYS A 1 22  ? 9.759   -6.452  -10.419 1.00 0.00 ? 22  LYS A HD2  4  
ATOM 5848  H HD3  . LYS A 1 22  ? 8.858   -6.782  -11.901 1.00 0.00 ? 22  LYS A HD3  4  
ATOM 5849  H HE2  . LYS A 1 22  ? 10.186  -4.759  -12.845 1.00 0.00 ? 22  LYS A HE2  4  
ATOM 5850  H HE3  . LYS A 1 22  ? 11.272  -5.062  -11.490 1.00 0.00 ? 22  LYS A HE3  4  
ATOM 5851  H HZ1  . LYS A 1 22  ? 11.961  -7.033  -12.359 1.00 0.00 ? 22  LYS A HZ1  4  
ATOM 5852  H HZ2  . LYS A 1 22  ? 11.626  -6.215  -13.801 1.00 0.00 ? 22  LYS A HZ2  4  
ATOM 5853  H HZ3  . LYS A 1 22  ? 10.512  -7.327  -13.182 1.00 0.00 ? 22  LYS A HZ3  4  
ATOM 5854  N N    . ILE A 1 23  ? 9.260   -2.489  -7.190  1.00 0.00 ? 23  ILE A N    4  
ATOM 5855  C CA   . ILE A 1 23  ? 10.015  -1.616  -6.300  1.00 0.00 ? 23  ILE A CA   4  
ATOM 5856  C C    . ILE A 1 23  ? 10.258  -2.285  -4.951  1.00 0.00 ? 23  ILE A C    4  
ATOM 5857  O O    . ILE A 1 23  ? 9.852   -3.426  -4.730  1.00 0.00 ? 23  ILE A O    4  
ATOM 5858  C CB   . ILE A 1 23  ? 9.287   -0.278  -6.073  1.00 0.00 ? 23  ILE A CB   4  
ATOM 5859  C CG1  . ILE A 1 23  ? 8.038   -0.491  -5.215  1.00 0.00 ? 23  ILE A CG1  4  
ATOM 5860  C CG2  . ILE A 1 23  ? 8.919   0.357   -7.405  1.00 0.00 ? 23  ILE A CG2  4  
ATOM 5861  C CD1  . ILE A 1 23  ? 7.460   0.792   -4.660  1.00 0.00 ? 23  ILE A CD1  4  
ATOM 5862  H H    . ILE A 1 23  ? 8.378   -2.204  -7.505  1.00 0.00 ? 23  ILE A H    4  
ATOM 5863  H HA   . ILE A 1 23  ? 10.968  -1.410  -6.764  1.00 0.00 ? 23  ILE A HA   4  
ATOM 5864  H HB   . ILE A 1 23  ? 9.960   0.389   -5.557  1.00 0.00 ? 23  ILE A HB   4  
ATOM 5865  H HG12 . ILE A 1 23  ? 7.275   -0.966  -5.812  1.00 0.00 ? 23  ILE A HG12 4  
ATOM 5866  H HG13 . ILE A 1 23  ? 8.288   -1.132  -4.382  1.00 0.00 ? 23  ILE A HG13 4  
ATOM 5867  H HG21 . ILE A 1 23  ? 8.406   1.291   -7.229  1.00 0.00 ? 23  ILE A HG21 4  
ATOM 5868  H HG22 . ILE A 1 23  ? 9.817   0.543   -7.975  1.00 0.00 ? 23  ILE A HG22 4  
ATOM 5869  H HG23 . ILE A 1 23  ? 8.274   -0.310  -7.957  1.00 0.00 ? 23  ILE A HG23 4  
ATOM 5870  H HD11 . ILE A 1 23  ? 6.517   0.583   -4.177  1.00 0.00 ? 23  ILE A HD11 4  
ATOM 5871  H HD12 . ILE A 1 23  ? 8.147   1.216   -3.943  1.00 0.00 ? 23  ILE A HD12 4  
ATOM 5872  H HD13 . ILE A 1 23  ? 7.303   1.494   -5.466  1.00 0.00 ? 23  ILE A HD13 4  
ATOM 5873  N N    . SER A 1 24  ? 10.922  -1.566  -4.051  1.00 0.00 ? 24  SER A N    4  
ATOM 5874  C CA   . SER A 1 24  ? 11.221  -2.090  -2.724  1.00 0.00 ? 24  SER A CA   4  
ATOM 5875  C C    . SER A 1 24  ? 10.404  -1.367  -1.657  1.00 0.00 ? 24  SER A C    4  
ATOM 5876  O O    . SER A 1 24  ? 9.563   -0.523  -1.968  1.00 0.00 ? 24  SER A O    4  
ATOM 5877  C CB   . SER A 1 24  ? 12.714  -1.949  -2.421  1.00 0.00 ? 24  SER A CB   4  
ATOM 5878  O OG   . SER A 1 24  ? 13.496  -2.655  -3.369  1.00 0.00 ? 24  SER A OG   4  
ATOM 5879  H H    . SER A 1 24  ? 11.219  -0.662  -4.287  1.00 0.00 ? 24  SER A H    4  
ATOM 5880  H HA   . SER A 1 24  ? 10.958  -3.137  -2.714  1.00 0.00 ? 24  SER A HA   4  
ATOM 5881  H HB2  . SER A 1 24  ? 12.988  -0.905  -2.453  1.00 0.00 ? 24  SER A HB2  4  
ATOM 5882  H HB3  . SER A 1 24  ? 12.918  -2.345  -1.437  1.00 0.00 ? 24  SER A HB3  4  
ATOM 5883  H HG   . SER A 1 24  ? 13.448  -2.210  -4.218  1.00 0.00 ? 24  SER A HG   4  
ATOM 5884  N N    . LYS A 1 25  ? 10.657  -1.704  -0.397  1.00 0.00 ? 25  LYS A N    4  
ATOM 5885  C CA   . LYS A 1 25  ? 9.947   -1.088  0.717   1.00 0.00 ? 25  LYS A CA   4  
ATOM 5886  C C    . LYS A 1 25  ? 10.393  0.357   0.914   1.00 0.00 ? 25  LYS A C    4  
ATOM 5887  O O    . LYS A 1 25  ? 9.585   1.225   1.244   1.00 0.00 ? 25  LYS A O    4  
ATOM 5888  C CB   . LYS A 1 25  ? 10.184  -1.885  2.002   1.00 0.00 ? 25  LYS A CB   4  
ATOM 5889  C CG   . LYS A 1 25  ? 9.899   -1.096  3.269   1.00 0.00 ? 25  LYS A CG   4  
ATOM 5890  C CD   . LYS A 1 25  ? 9.714   -2.012  4.467   1.00 0.00 ? 25  LYS A CD   4  
ATOM 5891  C CE   . LYS A 1 25  ? 9.109   -1.270  5.648   1.00 0.00 ? 25  LYS A CE   4  
ATOM 5892  N NZ   . LYS A 1 25  ? 10.153  -0.618  6.487   1.00 0.00 ? 25  LYS A NZ   4  
ATOM 5893  H H    . LYS A 1 25  ? 11.339  -2.384  -0.212  1.00 0.00 ? 25  LYS A H    4  
ATOM 5894  H HA   . LYS A 1 25  ? 8.893   -1.099  0.486   1.00 0.00 ? 25  LYS A HA   4  
ATOM 5895  H HB2  . LYS A 1 25  ? 9.545   -2.756  1.994   1.00 0.00 ? 25  LYS A HB2  4  
ATOM 5896  H HB3  . LYS A 1 25  ? 11.215  -2.206  2.028   1.00 0.00 ? 25  LYS A HB3  4  
ATOM 5897  H HG2  . LYS A 1 25  ? 10.727  -0.431  3.462   1.00 0.00 ? 25  LYS A HG2  4  
ATOM 5898  H HG3  . LYS A 1 25  ? 8.997   -0.518  3.126   1.00 0.00 ? 25  LYS A HG3  4  
ATOM 5899  H HD2  . LYS A 1 25  ? 9.056   -2.823  4.191   1.00 0.00 ? 25  LYS A HD2  4  
ATOM 5900  H HD3  . LYS A 1 25  ? 10.676  -2.410  4.757   1.00 0.00 ? 25  LYS A HD3  4  
ATOM 5901  H HE2  . LYS A 1 25  ? 8.436   -0.513  5.275   1.00 0.00 ? 25  LYS A HE2  4  
ATOM 5902  H HE3  . LYS A 1 25  ? 8.559   -1.973  6.255   1.00 0.00 ? 25  LYS A HE3  4  
ATOM 5903  H HZ1  . LYS A 1 25  ? 9.965   0.402   6.563   1.00 0.00 ? 25  LYS A HZ1  4  
ATOM 5904  H HZ2  . LYS A 1 25  ? 11.091  -0.755  6.060   1.00 0.00 ? 25  LYS A HZ2  4  
ATOM 5905  H HZ3  . LYS A 1 25  ? 10.155  -1.032  7.441   1.00 0.00 ? 25  LYS A HZ3  4  
ATOM 5906  N N    . GLN A 1 26  ? 11.682  0.608   0.708   1.00 0.00 ? 26  GLN A N    4  
ATOM 5907  C CA   . GLN A 1 26  ? 12.233  1.949   0.862   1.00 0.00 ? 26  GLN A CA   4  
ATOM 5908  C C    . GLN A 1 26  ? 11.960  2.795   -0.377  1.00 0.00 ? 26  GLN A C    4  
ATOM 5909  O O    . GLN A 1 26  ? 11.437  3.904   -0.279  1.00 0.00 ? 26  GLN A O    4  
ATOM 5910  C CB   . GLN A 1 26  ? 13.738  1.877   1.124   1.00 0.00 ? 26  GLN A CB   4  
ATOM 5911  C CG   . GLN A 1 26  ? 14.524  1.244   -0.012  1.00 0.00 ? 26  GLN A CG   4  
ATOM 5912  C CD   . GLN A 1 26  ? 15.883  0.737   0.429   1.00 0.00 ? 26  GLN A CD   4  
ATOM 5913  O OE1  . GLN A 1 26  ? 16.705  1.497   0.942   1.00 0.00 ? 26  GLN A OE1  4  
ATOM 5914  N NE2  . GLN A 1 26  ? 16.128  -0.553  0.231   1.00 0.00 ? 26  GLN A NE2  4  
ATOM 5915  H H    . GLN A 1 26  ? 12.275  -0.126  0.447   1.00 0.00 ? 26  GLN A H    4  
ATOM 5916  H HA   . GLN A 1 26  ? 11.751  2.410   1.711   1.00 0.00 ? 26  GLN A HA   4  
ATOM 5917  H HB2  . GLN A 1 26  ? 14.113  2.878   1.279   1.00 0.00 ? 26  GLN A HB2  4  
ATOM 5918  H HB3  . GLN A 1 26  ? 13.909  1.295   2.018   1.00 0.00 ? 26  GLN A HB3  4  
ATOM 5919  H HG2  . GLN A 1 26  ? 13.958  0.412   -0.405  1.00 0.00 ? 26  GLN A HG2  4  
ATOM 5920  H HG3  . GLN A 1 26  ? 14.665  1.980   -0.789  1.00 0.00 ? 26  GLN A HG3  4  
ATOM 5921  H HE21 . GLN A 1 26  ? 15.426  -1.098  -0.184  1.00 0.00 ? 26  GLN A HE21 4  
ATOM 5922  H HE22 . GLN A 1 26  ? 16.998  -0.906  0.506   1.00 0.00 ? 26  GLN A HE22 4  
ATOM 5923  N N    . GLU A 1 27  ? 12.318  2.263   -1.542  1.00 0.00 ? 27  GLU A N    4  
ATOM 5924  C CA   . GLU A 1 27  ? 12.113  2.971   -2.799  1.00 0.00 ? 27  GLU A CA   4  
ATOM 5925  C C    . GLU A 1 27  ? 10.738  3.632   -2.833  1.00 0.00 ? 27  GLU A C    4  
ATOM 5926  O O    . GLU A 1 27  ? 10.599  4.779   -3.257  1.00 0.00 ? 27  GLU A O    4  
ATOM 5927  C CB   . GLU A 1 27  ? 12.258  2.010   -3.981  1.00 0.00 ? 27  GLU A CB   4  
ATOM 5928  C CG   . GLU A 1 27  ? 13.682  1.895   -4.500  1.00 0.00 ? 27  GLU A CG   4  
ATOM 5929  C CD   . GLU A 1 27  ? 14.700  1.757   -3.385  1.00 0.00 ? 27  GLU A CD   4  
ATOM 5930  O OE1  . GLU A 1 27  ? 15.100  2.793   -2.815  1.00 0.00 ? 27  GLU A OE1  4  
ATOM 5931  O OE2  . GLU A 1 27  ? 15.096  0.612   -3.083  1.00 0.00 ? 27  GLU A OE2  4  
ATOM 5932  H H    . GLU A 1 27  ? 12.731  1.374   -1.555  1.00 0.00 ? 27  GLU A H    4  
ATOM 5933  H HA   . GLU A 1 27  ? 12.869  3.738   -2.876  1.00 0.00 ? 27  GLU A HA   4  
ATOM 5934  H HB2  . GLU A 1 27  ? 11.928  1.029   -3.674  1.00 0.00 ? 27  GLU A HB2  4  
ATOM 5935  H HB3  . GLU A 1 27  ? 11.630  2.355   -4.789  1.00 0.00 ? 27  GLU A HB3  4  
ATOM 5936  H HG2  . GLU A 1 27  ? 13.750  1.027   -5.138  1.00 0.00 ? 27  GLU A HG2  4  
ATOM 5937  H HG3  . GLU A 1 27  ? 13.915  2.780   -5.073  1.00 0.00 ? 27  GLU A HG3  4  
ATOM 5938  N N    . ALA A 1 28  ? 9.724   2.899   -2.385  1.00 0.00 ? 28  ALA A N    4  
ATOM 5939  C CA   . ALA A 1 28  ? 8.361   3.413   -2.362  1.00 0.00 ? 28  ALA A CA   4  
ATOM 5940  C C    . ALA A 1 28  ? 8.302   4.785   -1.698  1.00 0.00 ? 28  ALA A C    4  
ATOM 5941  O O    . ALA A 1 28  ? 7.599   5.681   -2.165  1.00 0.00 ? 28  ALA A O    4  
ATOM 5942  C CB   . ALA A 1 28  ? 7.440   2.437   -1.644  1.00 0.00 ? 28  ALA A CB   4  
ATOM 5943  H H    . ALA A 1 28  ? 9.898   1.991   -2.060  1.00 0.00 ? 28  ALA A H    4  
ATOM 5944  H HA   . ALA A 1 28  ? 8.021   3.504   -3.384  1.00 0.00 ? 28  ALA A HA   4  
ATOM 5945  H HB1  . ALA A 1 28  ? 6.980   2.932   -0.801  1.00 0.00 ? 28  ALA A HB1  4  
ATOM 5946  H HB2  . ALA A 1 28  ? 6.675   2.097   -2.325  1.00 0.00 ? 28  ALA A HB2  4  
ATOM 5947  H HB3  . ALA A 1 28  ? 8.014   1.592   -1.295  1.00 0.00 ? 28  ALA A HB3  4  
ATOM 5948  N N    . TYR A 1 29  ? 9.044   4.941   -0.608  1.00 0.00 ? 29  TYR A N    4  
ATOM 5949  C CA   . TYR A 1 29  ? 9.074   6.203   0.122   1.00 0.00 ? 29  TYR A CA   4  
ATOM 5950  C C    . TYR A 1 29  ? 9.630   7.324   -0.751  1.00 0.00 ? 29  TYR A C    4  
ATOM 5951  O O    . TYR A 1 29  ? 9.120   8.444   -0.742  1.00 0.00 ? 29  TYR A O    4  
ATOM 5952  C CB   . TYR A 1 29  ? 9.918   6.063   1.390   1.00 0.00 ? 29  TYR A CB   4  
ATOM 5953  C CG   . TYR A 1 29  ? 9.125   5.624   2.600   1.00 0.00 ? 29  TYR A CG   4  
ATOM 5954  C CD1  . TYR A 1 29  ? 8.079   6.398   3.088   1.00 0.00 ? 29  TYR A CD1  4  
ATOM 5955  C CD2  . TYR A 1 29  ? 9.421   4.435   3.255   1.00 0.00 ? 29  TYR A CD2  4  
ATOM 5956  C CE1  . TYR A 1 29  ? 7.352   6.001   4.193   1.00 0.00 ? 29  TYR A CE1  4  
ATOM 5957  C CE2  . TYR A 1 29  ? 8.698   4.030   4.361   1.00 0.00 ? 29  TYR A CE2  4  
ATOM 5958  C CZ   . TYR A 1 29  ? 7.665   4.816   4.826   1.00 0.00 ? 29  TYR A CZ   4  
ATOM 5959  O OH   . TYR A 1 29  ? 6.943   4.416   5.927   1.00 0.00 ? 29  TYR A OH   4  
ATOM 5960  H H    . TYR A 1 29  ? 9.584   4.190   -0.285  1.00 0.00 ? 29  TYR A H    4  
ATOM 5961  H HA   . TYR A 1 29  ? 8.060   6.449   0.401   1.00 0.00 ? 29  TYR A HA   4  
ATOM 5962  H HB2  . TYR A 1 29  ? 10.693  5.332   1.219   1.00 0.00 ? 29  TYR A HB2  4  
ATOM 5963  H HB3  . TYR A 1 29  ? 10.372  7.016   1.619   1.00 0.00 ? 29  TYR A HB3  4  
ATOM 5964  H HD1  . TYR A 1 29  ? 7.836   7.326   2.590   1.00 0.00 ? 29  TYR A HD1  4  
ATOM 5965  H HD2  . TYR A 1 29  ? 10.231  3.822   2.889   1.00 0.00 ? 29  TYR A HD2  4  
ATOM 5966  H HE1  . TYR A 1 29  ? 6.542   6.616   4.558   1.00 0.00 ? 29  TYR A HE1  4  
ATOM 5967  H HE2  . TYR A 1 29  ? 8.943   3.102   4.856   1.00 0.00 ? 29  TYR A HE2  4  
ATOM 5968  H HH   . TYR A 1 29  ? 7.538   4.040   6.580   1.00 0.00 ? 29  TYR A HH   4  
ATOM 5969  N N    . ASN A 1 30  ? 10.679  7.013   -1.505  1.00 0.00 ? 30  ASN A N    4  
ATOM 5970  C CA   . ASN A 1 30  ? 11.305  7.994   -2.385  1.00 0.00 ? 30  ASN A CA   4  
ATOM 5971  C C    . ASN A 1 30  ? 10.447  8.241   -3.622  1.00 0.00 ? 30  ASN A C    4  
ATOM 5972  O O    . ASN A 1 30  ? 10.438  9.341   -4.175  1.00 0.00 ? 30  ASN A O    4  
ATOM 5973  C CB   . ASN A 1 30  ? 12.698  7.518   -2.803  1.00 0.00 ? 30  ASN A CB   4  
ATOM 5974  C CG   . ASN A 1 30  ? 13.557  8.647   -3.340  1.00 0.00 ? 30  ASN A CG   4  
ATOM 5975  O OD1  . ASN A 1 30  ? 13.316  9.818   -3.048  1.00 0.00 ? 30  ASN A OD1  4  
ATOM 5976  N ND2  . ASN A 1 30  ? 14.567  8.298   -4.129  1.00 0.00 ? 30  ASN A ND2  4  
ATOM 5977  H H    . ASN A 1 30  ? 11.041  6.103   -1.470  1.00 0.00 ? 30  ASN A H    4  
ATOM 5978  H HA   . ASN A 1 30  ? 11.400  8.918   -1.836  1.00 0.00 ? 30  ASN A HA   4  
ATOM 5979  H HB2  . ASN A 1 30  ? 13.197  7.088   -1.947  1.00 0.00 ? 30  ASN A HB2  4  
ATOM 5980  H HB3  . ASN A 1 30  ? 12.600  6.767   -3.573  1.00 0.00 ? 30  ASN A HB3  4  
ATOM 5981  H HD21 . ASN A 1 30  ? 14.699  7.345   -4.318  1.00 0.00 ? 30  ASN A HD21 4  
ATOM 5982  H HD22 . ASN A 1 30  ? 15.139  9.007   -4.489  1.00 0.00 ? 30  ASN A HD22 4  
ATOM 5983  N N    . LEU A 1 31  ? 9.727   7.210   -4.051  1.00 0.00 ? 31  LEU A N    4  
ATOM 5984  C CA   . LEU A 1 31  ? 8.865   7.315   -5.223  1.00 0.00 ? 31  LEU A CA   4  
ATOM 5985  C C    . LEU A 1 31  ? 7.710   8.277   -4.965  1.00 0.00 ? 31  LEU A C    4  
ATOM 5986  O O    . LEU A 1 31  ? 7.558   9.282   -5.661  1.00 0.00 ? 31  LEU A O    4  
ATOM 5987  C CB   . LEU A 1 31  ? 8.320   5.937   -5.604  1.00 0.00 ? 31  LEU A CB   4  
ATOM 5988  C CG   . LEU A 1 31  ? 9.331   4.957   -6.201  1.00 0.00 ? 31  LEU A CG   4  
ATOM 5989  C CD1  . LEU A 1 31  ? 8.727   3.565   -6.306  1.00 0.00 ? 31  LEU A CD1  4  
ATOM 5990  C CD2  . LEU A 1 31  ? 9.800   5.441   -7.566  1.00 0.00 ? 31  LEU A CD2  4  
ATOM 5991  H H    . LEU A 1 31  ? 9.776   6.359   -3.570  1.00 0.00 ? 31  LEU A H    4  
ATOM 5992  H HA   . LEU A 1 31  ? 9.460   7.696   -6.040  1.00 0.00 ? 31  LEU A HA   4  
ATOM 5993  H HB2  . LEU A 1 31  ? 7.909   5.486   -4.714  1.00 0.00 ? 31  LEU A HB2  4  
ATOM 5994  H HB3  . LEU A 1 31  ? 7.531   6.083   -6.329  1.00 0.00 ? 31  LEU A HB3  4  
ATOM 5995  H HG   . LEU A 1 31  ? 10.193  4.898   -5.551  1.00 0.00 ? 31  LEU A HG   4  
ATOM 5996  H HD11 . LEU A 1 31  ? 9.492   2.862   -6.599  1.00 0.00 ? 31  LEU A HD11 4  
ATOM 5997  H HD12 . LEU A 1 31  ? 7.939   3.569   -7.044  1.00 0.00 ? 31  LEU A HD12 4  
ATOM 5998  H HD13 . LEU A 1 31  ? 8.320   3.276   -5.348  1.00 0.00 ? 31  LEU A HD13 4  
ATOM 5999  H HD21 . LEU A 1 31  ? 10.867  5.611   -7.539  1.00 0.00 ? 31  LEU A HD21 4  
ATOM 6000  H HD22 . LEU A 1 31  ? 9.295   6.362   -7.814  1.00 0.00 ? 31  LEU A HD22 4  
ATOM 6001  H HD23 . LEU A 1 31  ? 9.574   4.692   -8.310  1.00 0.00 ? 31  LEU A HD23 4  
ATOM 6002  N N    . LEU A 1 32  ? 6.900   7.965   -3.960  1.00 0.00 ? 32  LEU A N    4  
ATOM 6003  C CA   . LEU A 1 32  ? 5.759   8.803   -3.608  1.00 0.00 ? 32  LEU A CA   4  
ATOM 6004  C C    . LEU A 1 32  ? 6.214   10.204  -3.213  1.00 0.00 ? 32  LEU A C    4  
ATOM 6005  O O    . LEU A 1 32  ? 5.414   11.138  -3.167  1.00 0.00 ? 32  LEU A O    4  
ATOM 6006  C CB   . LEU A 1 32  ? 4.970   8.169   -2.461  1.00 0.00 ? 32  LEU A CB   4  
ATOM 6007  C CG   . LEU A 1 32  ? 3.986   7.066   -2.853  1.00 0.00 ? 32  LEU A CG   4  
ATOM 6008  C CD1  . LEU A 1 32  ? 3.667   6.185   -1.655  1.00 0.00 ? 32  LEU A CD1  4  
ATOM 6009  C CD2  . LEU A 1 32  ? 2.712   7.668   -3.429  1.00 0.00 ? 32  LEU A CD2  4  
ATOM 6010  H H    . LEU A 1 32  ? 7.072   7.152   -3.442  1.00 0.00 ? 32  LEU A H    4  
ATOM 6011  H HA   . LEU A 1 32  ? 5.121   8.877   -4.476  1.00 0.00 ? 32  LEU A HA   4  
ATOM 6012  H HB2  . LEU A 1 32  ? 5.678   7.748   -1.765  1.00 0.00 ? 32  LEU A HB2  4  
ATOM 6013  H HB3  . LEU A 1 32  ? 4.411   8.954   -1.972  1.00 0.00 ? 32  LEU A HB3  4  
ATOM 6014  H HG   . LEU A 1 32  ? 4.437   6.444   -3.614  1.00 0.00 ? 32  LEU A HG   4  
ATOM 6015  H HD11 . LEU A 1 32  ? 2.846   5.529   -1.900  1.00 0.00 ? 32  LEU A HD11 4  
ATOM 6016  H HD12 . LEU A 1 32  ? 3.393   6.806   -0.814  1.00 0.00 ? 32  LEU A HD12 4  
ATOM 6017  H HD13 . LEU A 1 32  ? 4.536   5.597   -1.400  1.00 0.00 ? 32  LEU A HD13 4  
ATOM 6018  H HD21 . LEU A 1 32  ? 2.931   8.127   -4.382  1.00 0.00 ? 32  LEU A HD21 4  
ATOM 6019  H HD22 . LEU A 1 32  ? 2.327   8.414   -2.749  1.00 0.00 ? 32  LEU A HD22 4  
ATOM 6020  H HD23 . LEU A 1 32  ? 1.976   6.890   -3.564  1.00 0.00 ? 32  LEU A HD23 4  
ATOM 6021  N N    . MET A 1 33  ? 7.506   10.344  -2.931  1.00 0.00 ? 33  MET A N    4  
ATOM 6022  C CA   . MET A 1 33  ? 8.068   11.632  -2.543  1.00 0.00 ? 33  MET A CA   4  
ATOM 6023  C C    . MET A 1 33  ? 8.609   12.377  -3.760  1.00 0.00 ? 33  MET A C    4  
ATOM 6024  O O    . MET A 1 33  ? 8.788   13.595  -3.726  1.00 0.00 ? 33  MET A O    4  
ATOM 6025  C CB   . MET A 1 33  ? 9.182   11.437  -1.513  1.00 0.00 ? 33  MET A CB   4  
ATOM 6026  C CG   . MET A 1 33  ? 8.689   11.452  -0.075  1.00 0.00 ? 33  MET A CG   4  
ATOM 6027  S SD   . MET A 1 33  ? 8.694   13.105  0.645   1.00 0.00 ? 33  MET A SD   4  
ATOM 6028  C CE   . MET A 1 33  ? 7.567   13.956  -0.457  1.00 0.00 ? 33  MET A CE   4  
ATOM 6029  H H    . MET A 1 33  ? 8.095   9.562   -2.985  1.00 0.00 ? 33  MET A H    4  
ATOM 6030  H HA   . MET A 1 33  ? 7.278   12.218  -2.099  1.00 0.00 ? 33  MET A HA   4  
ATOM 6031  H HB2  . MET A 1 33  ? 9.664   10.489  -1.696  1.00 0.00 ? 33  MET A HB2  4  
ATOM 6032  H HB3  . MET A 1 33  ? 9.907   12.229  -1.629  1.00 0.00 ? 33  MET A HB3  4  
ATOM 6033  H HG2  . MET A 1 33  ? 7.680   11.067  -0.050  1.00 0.00 ? 33  MET A HG2  4  
ATOM 6034  H HG3  . MET A 1 33  ? 9.330   10.814  0.517   1.00 0.00 ? 33  MET A HG3  4  
ATOM 6035  H HE1  . MET A 1 33  ? 7.384   14.953  -0.084  1.00 0.00 ? 33  MET A HE1  4  
ATOM 6036  H HE2  . MET A 1 33  ? 8.003   14.015  -1.443  1.00 0.00 ? 33  MET A HE2  4  
ATOM 6037  H HE3  . MET A 1 33  ? 6.634   13.414  -0.507  1.00 0.00 ? 33  MET A HE3  4  
ATOM 6038  N N    . THR A 1 34  ? 8.869   11.638  -4.834  1.00 0.00 ? 34  THR A N    4  
ATOM 6039  C CA   . THR A 1 34  ? 9.391   12.228  -6.060  1.00 0.00 ? 34  THR A CA   4  
ATOM 6040  C C    . THR A 1 34  ? 8.376   12.129  -7.193  1.00 0.00 ? 34  THR A C    4  
ATOM 6041  O O    . THR A 1 34  ? 7.752   13.121  -7.569  1.00 0.00 ? 34  THR A O    4  
ATOM 6042  C CB   . THR A 1 34  ? 10.701  11.546  -6.498  1.00 0.00 ? 34  THR A CB   4  
ATOM 6043  O OG1  . THR A 1 34  ? 10.466  10.159  -6.764  1.00 0.00 ? 34  THR A OG1  4  
ATOM 6044  C CG2  . THR A 1 34  ? 11.770  11.688  -5.425  1.00 0.00 ? 34  THR A CG2  4  
ATOM 6045  H H    . THR A 1 34  ? 8.706   10.672  -4.799  1.00 0.00 ? 34  THR A H    4  
ATOM 6046  H HA   . THR A 1 34  ? 9.600   13.270  -5.866  1.00 0.00 ? 34  THR A HA   4  
ATOM 6047  H HB   . THR A 1 34  ? 11.053  12.024  -7.401  1.00 0.00 ? 34  THR A HB   4  
ATOM 6048  H HG1  . THR A 1 34  ? 10.552  9.657   -5.950  1.00 0.00 ? 34  THR A HG1  4  
ATOM 6049  H HG21 . THR A 1 34  ? 11.364  12.225  -4.580  1.00 0.00 ? 34  THR A HG21 4  
ATOM 6050  H HG22 . THR A 1 34  ? 12.613  12.231  -5.826  1.00 0.00 ? 34  THR A HG22 4  
ATOM 6051  H HG23 . THR A 1 34  ? 12.092  10.708  -5.106  1.00 0.00 ? 34  THR A HG23 4  
ATOM 6052  N N    . VAL A 1 35  ? 8.216   10.925  -7.734  1.00 0.00 ? 35  VAL A N    4  
ATOM 6053  C CA   . VAL A 1 35  ? 7.275   10.696  -8.824  1.00 0.00 ? 35  VAL A CA   4  
ATOM 6054  C C    . VAL A 1 35  ? 5.837   10.901  -8.360  1.00 0.00 ? 35  VAL A C    4  
ATOM 6055  O O    . VAL A 1 35  ? 4.940   11.132  -9.170  1.00 0.00 ? 35  VAL A O    4  
ATOM 6056  C CB   . VAL A 1 35  ? 7.420   9.276   -9.401  1.00 0.00 ? 35  VAL A CB   4  
ATOM 6057  C CG1  . VAL A 1 35  ? 8.851   9.026   -9.852  1.00 0.00 ? 35  VAL A CG1  4  
ATOM 6058  C CG2  . VAL A 1 35  ? 6.985   8.238   -8.377  1.00 0.00 ? 35  VAL A CG2  4  
ATOM 6059  H H    . VAL A 1 35  ? 8.742   10.173  -7.391  1.00 0.00 ? 35  VAL A H    4  
ATOM 6060  H HA   . VAL A 1 35  ? 7.494   11.406  -9.609  1.00 0.00 ? 35  VAL A HA   4  
ATOM 6061  H HB   . VAL A 1 35  ? 6.774   9.192   -10.263 1.00 0.00 ? 35  VAL A HB   4  
ATOM 6062  H HG11 . VAL A 1 35  ? 8.978   7.978   -10.080 1.00 0.00 ? 35  VAL A HG11 4  
ATOM 6063  H HG12 . VAL A 1 35  ? 9.059   9.615   -10.733 1.00 0.00 ? 35  VAL A HG12 4  
ATOM 6064  H HG13 . VAL A 1 35  ? 9.531   9.307   -9.062  1.00 0.00 ? 35  VAL A HG13 4  
ATOM 6065  H HG21 . VAL A 1 35  ? 7.731   8.168   -7.599  1.00 0.00 ? 35  VAL A HG21 4  
ATOM 6066  H HG22 . VAL A 1 35  ? 6.040   8.532   -7.944  1.00 0.00 ? 35  VAL A HG22 4  
ATOM 6067  H HG23 . VAL A 1 35  ? 6.877   7.279   -8.860  1.00 0.00 ? 35  VAL A HG23 4  
ATOM 6068  N N    . GLY A 1 36  ? 5.625   10.814  -7.050  1.00 0.00 ? 36  GLY A N    4  
ATOM 6069  C CA   . GLY A 1 36  ? 4.294   10.993  -6.501  1.00 0.00 ? 36  GLY A CA   4  
ATOM 6070  C C    . GLY A 1 36  ? 4.058   12.403  -5.999  1.00 0.00 ? 36  GLY A C    4  
ATOM 6071  O O    . GLY A 1 36  ? 4.890   13.287  -6.200  1.00 0.00 ? 36  GLY A O    4  
ATOM 6072  H H    . GLY A 1 36  ? 6.379   10.628  -6.452  1.00 0.00 ? 36  GLY A H    4  
ATOM 6073  H HA2  . GLY A 1 36  ? 3.567   10.768  -7.267  1.00 0.00 ? 36  GLY A HA2  4  
ATOM 6074  H HA3  . GLY A 1 36  ? 4.161   10.304  -5.679  1.00 0.00 ? 36  GLY A HA3  4  
ATOM 6075  N N    . GLN A 1 37  ? 2.919   12.615  -5.347  1.00 0.00 ? 37  GLN A N    4  
ATOM 6076  C CA   . GLN A 1 37  ? 2.576   13.930  -4.818  1.00 0.00 ? 37  GLN A CA   4  
ATOM 6077  C C    . GLN A 1 37  ? 1.602   13.809  -3.650  1.00 0.00 ? 37  GLN A C    4  
ATOM 6078  O O    . GLN A 1 37  ? 1.206   12.707  -3.270  1.00 0.00 ? 37  GLN A O    4  
ATOM 6079  C CB   . GLN A 1 37  ? 1.967   14.802  -5.917  1.00 0.00 ? 37  GLN A CB   4  
ATOM 6080  C CG   . GLN A 1 37  ? 3.002   15.544  -6.747  1.00 0.00 ? 37  GLN A CG   4  
ATOM 6081  C CD   . GLN A 1 37  ? 2.447   16.806  -7.380  1.00 0.00 ? 37  GLN A CD   4  
ATOM 6082  O OE1  . GLN A 1 37  ? 1.637   17.511  -6.778  1.00 0.00 ? 37  GLN A OE1  4  
ATOM 6083  N NE2  . GLN A 1 37  ? 2.882   17.097  -8.600  1.00 0.00 ? 37  GLN A NE2  4  
ATOM 6084  H H    . GLN A 1 37  ? 2.296   11.871  -5.219  1.00 0.00 ? 37  GLN A H    4  
ATOM 6085  H HA   . GLN A 1 37  ? 3.485   14.393  -4.465  1.00 0.00 ? 37  GLN A HA   4  
ATOM 6086  H HB2  . GLN A 1 37  ? 1.388   14.175  -6.579  1.00 0.00 ? 37  GLN A HB2  4  
ATOM 6087  H HB3  . GLN A 1 37  ? 1.314   15.531  -5.461  1.00 0.00 ? 37  GLN A HB3  4  
ATOM 6088  H HG2  . GLN A 1 37  ? 3.830   15.815  -6.109  1.00 0.00 ? 37  GLN A HG2  4  
ATOM 6089  H HG3  . GLN A 1 37  ? 3.352   14.890  -7.532  1.00 0.00 ? 37  GLN A HG3  4  
ATOM 6090  H HE21 . GLN A 1 37  ? 3.526   16.488  -9.019  1.00 0.00 ? 37  GLN A HE21 4  
ATOM 6091  H HE22 . GLN A 1 37  ? 2.539   17.906  -9.033  1.00 0.00 ? 37  GLN A HE22 4  
ATOM 6092  N N    . VAL A 1 38  ? 1.218   14.950  -3.085  1.00 0.00 ? 38  VAL A N    4  
ATOM 6093  C CA   . VAL A 1 38  ? 0.290   14.972  -1.962  1.00 0.00 ? 38  VAL A CA   4  
ATOM 6094  C C    . VAL A 1 38  ? -1.078  14.436  -2.368  1.00 0.00 ? 38  VAL A C    4  
ATOM 6095  O O    . VAL A 1 38  ? -1.965  14.269  -1.530  1.00 0.00 ? 38  VAL A O    4  
ATOM 6096  C CB   . VAL A 1 38  ? 0.125   16.396  -1.398  1.00 0.00 ? 38  VAL A CB   4  
ATOM 6097  C CG1  . VAL A 1 38  ? -0.602  16.361  -0.062  1.00 0.00 ? 38  VAL A CG1  4  
ATOM 6098  C CG2  . VAL A 1 38  ? 1.479   17.074  -1.260  1.00 0.00 ? 38  VAL A CG2  4  
ATOM 6099  H H    . VAL A 1 38  ? 1.568   15.796  -3.433  1.00 0.00 ? 38  VAL A H    4  
ATOM 6100  H HA   . VAL A 1 38  ? 0.695   14.343  -1.182  1.00 0.00 ? 38  VAL A HA   4  
ATOM 6101  H HB   . VAL A 1 38  ? -0.472  16.969  -2.092  1.00 0.00 ? 38  VAL A HB   4  
ATOM 6102  H HG11 . VAL A 1 38  ? -0.994  15.369  0.108   1.00 0.00 ? 38  VAL A HG11 4  
ATOM 6103  H HG12 . VAL A 1 38  ? 0.087   16.618  0.729   1.00 0.00 ? 38  VAL A HG12 4  
ATOM 6104  H HG13 . VAL A 1 38  ? -1.416  17.071  -0.077  1.00 0.00 ? 38  VAL A HG13 4  
ATOM 6105  H HG21 . VAL A 1 38  ? 1.572   17.846  -2.009  1.00 0.00 ? 38  VAL A HG21 4  
ATOM 6106  H HG22 . VAL A 1 38  ? 1.563   17.515  -0.277  1.00 0.00 ? 38  VAL A HG22 4  
ATOM 6107  H HG23 . VAL A 1 38  ? 2.263   16.344  -1.395  1.00 0.00 ? 38  VAL A HG23 4  
ATOM 6108  N N    . CYS A 1 39  ? -1.242  14.168  -3.659  1.00 0.00 ? 39  CYS A N    4  
ATOM 6109  C CA   . CYS A 1 39  ? -2.504  13.651  -4.178  1.00 0.00 ? 39  CYS A CA   4  
ATOM 6110  C C    . CYS A 1 39  ? -2.279  12.372  -4.978  1.00 0.00 ? 39  CYS A C    4  
ATOM 6111  O O    . CYS A 1 39  ? -3.057  12.044  -5.874  1.00 0.00 ? 39  CYS A O    4  
ATOM 6112  C CB   . CYS A 1 39  ? -3.188  14.701  -5.054  1.00 0.00 ? 39  CYS A CB   4  
ATOM 6113  S SG   . CYS A 1 39  ? -3.944  16.057  -4.126  1.00 0.00 ? 39  CYS A SG   4  
ATOM 6114  H H    . CYS A 1 39  ? -0.498  14.322  -4.278  1.00 0.00 ? 39  CYS A H    4  
ATOM 6115  H HA   . CYS A 1 39  ? -3.140  13.426  -3.336  1.00 0.00 ? 39  CYS A HA   4  
ATOM 6116  H HB2  . CYS A 1 39  ? -2.458  15.131  -5.724  1.00 0.00 ? 39  CYS A HB2  4  
ATOM 6117  H HB3  . CYS A 1 39  ? -3.964  14.225  -5.634  1.00 0.00 ? 39  CYS A HB3  4  
ATOM 6118  H HG   . CYS A 1 39  ? -3.401  16.078  -2.918  1.00 0.00 ? 39  CYS A HG   4  
ATOM 6119  N N    . SER A 1 40  ? -1.208  11.655  -4.650  1.00 0.00 ? 40  SER A N    4  
ATOM 6120  C CA   . SER A 1 40  ? -0.878  10.415  -5.342  1.00 0.00 ? 40  SER A CA   4  
ATOM 6121  C C    . SER A 1 40  ? -0.741  9.261   -4.354  1.00 0.00 ? 40  SER A C    4  
ATOM 6122  O O    . SER A 1 40  ? -0.372  9.461   -3.196  1.00 0.00 ? 40  SER A O    4  
ATOM 6123  C CB   . SER A 1 40  ? 0.421   10.579  -6.135  1.00 0.00 ? 40  SER A CB   4  
ATOM 6124  O OG   . SER A 1 40  ? 0.590   11.919  -6.565  1.00 0.00 ? 40  SER A OG   4  
ATOM 6125  H H    . SER A 1 40  ? -0.626  11.970  -3.927  1.00 0.00 ? 40  SER A H    4  
ATOM 6126  H HA   . SER A 1 40  ? -1.682  10.193  -6.028  1.00 0.00 ? 40  SER A HA   4  
ATOM 6127  H HB2  . SER A 1 40  ? 1.258   10.306  -5.510  1.00 0.00 ? 40  SER A HB2  4  
ATOM 6128  H HB3  . SER A 1 40  ? 0.394   9.936   -7.002  1.00 0.00 ? 40  SER A HB3  4  
ATOM 6129  H HG   . SER A 1 40  ? 0.367   12.516  -5.847  1.00 0.00 ? 40  SER A HG   4  
ATOM 6130  N N    . PHE A 1 41  ? -1.041  8.053   -4.819  1.00 0.00 ? 41  PHE A N    4  
ATOM 6131  C CA   . PHE A 1 41  ? -0.953  6.866   -3.977  1.00 0.00 ? 41  PHE A CA   4  
ATOM 6132  C C    . PHE A 1 41  ? -0.372  5.689   -4.755  1.00 0.00 ? 41  PHE A C    4  
ATOM 6133  O O    . PHE A 1 41  ? -0.164  5.772   -5.966  1.00 0.00 ? 41  PHE A O    4  
ATOM 6134  C CB   . PHE A 1 41  ? -2.334  6.499   -3.431  1.00 0.00 ? 41  PHE A CB   4  
ATOM 6135  C CG   . PHE A 1 41  ? -3.243  5.889   -4.459  1.00 0.00 ? 41  PHE A CG   4  
ATOM 6136  C CD1  . PHE A 1 41  ? -3.953  6.691   -5.338  1.00 0.00 ? 41  PHE A CD1  4  
ATOM 6137  C CD2  . PHE A 1 41  ? -3.386  4.514   -4.548  1.00 0.00 ? 41  PHE A CD2  4  
ATOM 6138  C CE1  . PHE A 1 41  ? -4.791  6.132   -6.285  1.00 0.00 ? 41  PHE A CE1  4  
ATOM 6139  C CE2  . PHE A 1 41  ? -4.222  3.949   -5.493  1.00 0.00 ? 41  PHE A CE2  4  
ATOM 6140  C CZ   . PHE A 1 41  ? -4.924  4.759   -6.364  1.00 0.00 ? 41  PHE A CZ   4  
ATOM 6141  H H    . PHE A 1 41  ? -1.329  7.958   -5.752  1.00 0.00 ? 41  PHE A H    4  
ATOM 6142  H HA   . PHE A 1 41  ? -0.297  7.094   -3.151  1.00 0.00 ? 41  PHE A HA   4  
ATOM 6143  H HB2  . PHE A 1 41  ? -2.218  5.787   -2.628  1.00 0.00 ? 41  PHE A HB2  4  
ATOM 6144  H HB3  . PHE A 1 41  ? -2.811  7.390   -3.051  1.00 0.00 ? 41  PHE A HB3  4  
ATOM 6145  H HD1  . PHE A 1 41  ? -3.849  7.764   -5.279  1.00 0.00 ? 41  PHE A HD1  4  
ATOM 6146  H HD2  . PHE A 1 41  ? -2.837  3.878   -3.868  1.00 0.00 ? 41  PHE A HD2  4  
ATOM 6147  H HE1  . PHE A 1 41  ? -5.339  6.768   -6.964  1.00 0.00 ? 41  PHE A HE1  4  
ATOM 6148  H HE2  . PHE A 1 41  ? -4.324  2.876   -5.552  1.00 0.00 ? 41  PHE A HE2  4  
ATOM 6149  H HZ   . PHE A 1 41  ? -5.578  4.321   -7.102  1.00 0.00 ? 41  PHE A HZ   4  
ATOM 6150  N N    . LEU A 1 42  ? -0.111  4.593   -4.051  1.00 0.00 ? 42  LEU A N    4  
ATOM 6151  C CA   . LEU A 1 42  ? 0.446   3.398   -4.674  1.00 0.00 ? 42  LEU A CA   4  
ATOM 6152  C C    . LEU A 1 42  ? 0.297   2.186   -3.759  1.00 0.00 ? 42  LEU A C    4  
ATOM 6153  O O    . LEU A 1 42  ? 0.456   2.291   -2.543  1.00 0.00 ? 42  LEU A O    4  
ATOM 6154  C CB   . LEU A 1 42  ? 1.922   3.616   -5.013  1.00 0.00 ? 42  LEU A CB   4  
ATOM 6155  C CG   . LEU A 1 42  ? 2.920   3.313   -3.895  1.00 0.00 ? 42  LEU A CG   4  
ATOM 6156  C CD1  . LEU A 1 42  ? 3.020   1.813   -3.663  1.00 0.00 ? 42  LEU A CD1  4  
ATOM 6157  C CD2  . LEU A 1 42  ? 4.286   3.895   -4.227  1.00 0.00 ? 42  LEU A CD2  4  
ATOM 6158  H H    . LEU A 1 42  ? -0.298  4.586   -3.090  1.00 0.00 ? 42  LEU A H    4  
ATOM 6159  H HA   . LEU A 1 42  ? -0.101  3.214   -5.587  1.00 0.00 ? 42  LEU A HA   4  
ATOM 6160  H HB2  . LEU A 1 42  ? 2.165   2.985   -5.854  1.00 0.00 ? 42  LEU A HB2  4  
ATOM 6161  H HB3  . LEU A 1 42  ? 2.045   4.652   -5.296  1.00 0.00 ? 42  LEU A HB3  4  
ATOM 6162  H HG   . LEU A 1 42  ? 2.573   3.769   -2.979  1.00 0.00 ? 42  LEU A HG   4  
ATOM 6163  H HD11 . LEU A 1 42  ? 2.421   1.294   -4.395  1.00 0.00 ? 42  LEU A HD11 4  
ATOM 6164  H HD12 . LEU A 1 42  ? 2.661   1.578   -2.672  1.00 0.00 ? 42  LEU A HD12 4  
ATOM 6165  H HD13 . LEU A 1 42  ? 4.051   1.503   -3.755  1.00 0.00 ? 42  LEU A HD13 4  
ATOM 6166  H HD21 . LEU A 1 42  ? 4.835   3.198   -4.842  1.00 0.00 ? 42  LEU A HD21 4  
ATOM 6167  H HD22 . LEU A 1 42  ? 4.832   4.075   -3.312  1.00 0.00 ? 42  LEU A HD22 4  
ATOM 6168  H HD23 . LEU A 1 42  ? 4.160   4.825   -4.761  1.00 0.00 ? 42  LEU A HD23 4  
ATOM 6169  N N    . VAL A 1 43  ? -0.007  1.037   -4.353  1.00 0.00 ? 43  VAL A N    4  
ATOM 6170  C CA   . VAL A 1 43  ? -0.175  -0.196  -3.592  1.00 0.00 ? 43  VAL A CA   4  
ATOM 6171  C C    . VAL A 1 43  ? 1.022   -1.123  -3.777  1.00 0.00 ? 43  VAL A C    4  
ATOM 6172  O O    . VAL A 1 43  ? 1.526   -1.287  -4.888  1.00 0.00 ? 43  VAL A O    4  
ATOM 6173  C CB   . VAL A 1 43  ? -1.457  -0.942  -4.007  1.00 0.00 ? 43  VAL A CB   4  
ATOM 6174  C CG1  . VAL A 1 43  ? -1.630  -2.206  -3.179  1.00 0.00 ? 43  VAL A CG1  4  
ATOM 6175  C CG2  . VAL A 1 43  ? -2.669  -0.033  -3.868  1.00 0.00 ? 43  VAL A CG2  4  
ATOM 6176  H H    . VAL A 1 43  ? -0.122  1.017   -5.326  1.00 0.00 ? 43  VAL A H    4  
ATOM 6177  H HA   . VAL A 1 43  ? -0.257  0.066   -2.547  1.00 0.00 ? 43  VAL A HA   4  
ATOM 6178  H HB   . VAL A 1 43  ? -1.364  -1.227  -5.044  1.00 0.00 ? 43  VAL A HB   4  
ATOM 6179  H HG11 . VAL A 1 43  ? -0.675  -2.504  -2.772  1.00 0.00 ? 43  VAL A HG11 4  
ATOM 6180  H HG12 . VAL A 1 43  ? -2.323  -2.016  -2.372  1.00 0.00 ? 43  VAL A HG12 4  
ATOM 6181  H HG13 . VAL A 1 43  ? -2.015  -2.997  -3.806  1.00 0.00 ? 43  VAL A HG13 4  
ATOM 6182  H HG21 . VAL A 1 43  ? -3.212  -0.015  -4.801  1.00 0.00 ? 43  VAL A HG21 4  
ATOM 6183  H HG22 . VAL A 1 43  ? -3.313  -0.408  -3.085  1.00 0.00 ? 43  VAL A HG22 4  
ATOM 6184  H HG23 . VAL A 1 43  ? -2.345  0.966   -3.620  1.00 0.00 ? 43  VAL A HG23 4  
ATOM 6185  N N    . ARG A 1 44  ? 1.471   -1.726  -2.682  1.00 0.00 ? 44  ARG A N    4  
ATOM 6186  C CA   . ARG A 1 44  ? 2.609   -2.637  -2.723  1.00 0.00 ? 44  ARG A CA   4  
ATOM 6187  C C    . ARG A 1 44  ? 2.332   -3.891  -1.900  1.00 0.00 ? 44  ARG A C    4  
ATOM 6188  O O    . ARG A 1 44  ? 1.693   -3.845  -0.848  1.00 0.00 ? 44  ARG A O    4  
ATOM 6189  C CB   . ARG A 1 44  ? 3.866   -1.939  -2.201  1.00 0.00 ? 44  ARG A CB   4  
ATOM 6190  C CG   . ARG A 1 44  ? 3.703   -1.350  -0.809  1.00 0.00 ? 44  ARG A CG   4  
ATOM 6191  C CD   . ARG A 1 44  ? 5.026   -1.316  -0.060  1.00 0.00 ? 44  ARG A CD   4  
ATOM 6192  N NE   . ARG A 1 44  ? 5.491   -2.655  0.290   1.00 0.00 ? 44  ARG A NE   4  
ATOM 6193  C CZ   . ARG A 1 44  ? 6.472   -2.890  1.155   1.00 0.00 ? 44  ARG A CZ   4  
ATOM 6194  N NH1  . ARG A 1 44  ? 7.087   -1.880  1.754   1.00 0.00 ? 44  ARG A NH1  4  
ATOM 6195  N NH2  . ARG A 1 44  ? 6.839   -4.137  1.422   1.00 0.00 ? 44  ARG A NH2  4  
ATOM 6196  H H    . ARG A 1 44  ? 1.027   -1.555  -1.825  1.00 0.00 ? 44  ARG A H    4  
ATOM 6197  H HA   . ARG A 1 44  ? 2.768   -2.923  -3.752  1.00 0.00 ? 44  ARG A HA   4  
ATOM 6198  H HB2  . ARG A 1 44  ? 4.675   -2.654  -2.173  1.00 0.00 ? 44  ARG A HB2  4  
ATOM 6199  H HB3  . ARG A 1 44  ? 4.127   -1.139  -2.878  1.00 0.00 ? 44  ARG A HB3  4  
ATOM 6200  H HG2  . ARG A 1 44  ? 3.326   -0.342  -0.897  1.00 0.00 ? 44  ARG A HG2  4  
ATOM 6201  H HG3  . ARG A 1 44  ? 3.000   -1.953  -0.254  1.00 0.00 ? 44  ARG A HG3  4  
ATOM 6202  H HD2  . ARG A 1 44  ? 5.766   -0.840  -0.686  1.00 0.00 ? 44  ARG A HD2  4  
ATOM 6203  H HD3  . ARG A 1 44  ? 4.897   -0.741  0.845   1.00 0.00 ? 44  ARG A HD3  4  
ATOM 6204  H HE   . ARG A 1 44  ? 5.051   -3.416  -0.141  1.00 0.00 ? 44  ARG A HE   4  
ATOM 6205  H HH11 . ARG A 1 44  ? 6.812   -0.939  1.556   1.00 0.00 ? 44  ARG A HH11 4  
ATOM 6206  H HH12 . ARG A 1 44  ? 7.825   -2.059  2.406   1.00 0.00 ? 44  ARG A HH12 4  
ATOM 6207  H HH21 . ARG A 1 44  ? 6.378   -4.901  0.972   1.00 0.00 ? 44  ARG A HH21 4  
ATOM 6208  H HH22 . ARG A 1 44  ? 7.577   -4.312  2.072   1.00 0.00 ? 44  ARG A HH22 4  
ATOM 6209  N N    . PRO A 1 45  ? 2.821   -5.040  -2.389  1.00 0.00 ? 45  PRO A N    4  
ATOM 6210  C CA   . PRO A 1 45  ? 2.639   -6.329  -1.715  1.00 0.00 ? 45  PRO A CA   4  
ATOM 6211  C C    . PRO A 1 45  ? 3.439   -6.425  -0.421  1.00 0.00 ? 45  PRO A C    4  
ATOM 6212  O O    . PRO A 1 45  ? 4.643   -6.167  -0.404  1.00 0.00 ? 45  PRO A O    4  
ATOM 6213  C CB   . PRO A 1 45  ? 3.156   -7.342  -2.740  1.00 0.00 ? 45  PRO A CB   4  
ATOM 6214  C CG   . PRO A 1 45  ? 4.122   -6.575  -3.576  1.00 0.00 ? 45  PRO A CG   4  
ATOM 6215  C CD   . PRO A 1 45  ? 3.592   -5.169  -3.638  1.00 0.00 ? 45  PRO A CD   4  
ATOM 6216  H HA   . PRO A 1 45  ? 1.597   -6.524  -1.508  1.00 0.00 ? 45  PRO A HA   4  
ATOM 6217  H HB2  . PRO A 1 45  ? 3.640   -8.161  -2.227  1.00 0.00 ? 45  PRO A HB2  4  
ATOM 6218  H HB3  . PRO A 1 45  ? 2.333   -7.714  -3.330  1.00 0.00 ? 45  PRO A HB3  4  
ATOM 6219  H HG2  . PRO A 1 45  ? 5.098   -6.588  -3.114  1.00 0.00 ? 45  PRO A HG2  4  
ATOM 6220  H HG3  . PRO A 1 45  ? 4.169   -7.002  -4.567  1.00 0.00 ? 45  PRO A HG3  4  
ATOM 6221  H HD2  . PRO A 1 45  ? 4.405   -4.460  -3.664  1.00 0.00 ? 45  PRO A HD2  4  
ATOM 6222  H HD3  . PRO A 1 45  ? 2.952   -5.045  -4.499  1.00 0.00 ? 45  PRO A HD3  4  
ATOM 6223  N N    . SER A 1 46  ? 2.764   -6.797  0.662   1.00 0.00 ? 46  SER A N    4  
ATOM 6224  C CA   . SER A 1 46  ? 3.412   -6.923  1.962   1.00 0.00 ? 46  SER A CA   4  
ATOM 6225  C C    . SER A 1 46  ? 4.569   -7.916  1.898   1.00 0.00 ? 46  SER A C    4  
ATOM 6226  O O    . SER A 1 46  ? 4.552   -8.856  1.102   1.00 0.00 ? 46  SER A O    4  
ATOM 6227  C CB   . SER A 1 46  ? 2.400   -7.370  3.018   1.00 0.00 ? 46  SER A CB   4  
ATOM 6228  O OG   . SER A 1 46  ? 2.812   -6.978  4.317   1.00 0.00 ? 46  SER A OG   4  
ATOM 6229  H H    . SER A 1 46  ? 1.805   -6.989  0.584   1.00 0.00 ? 46  SER A H    4  
ATOM 6230  H HA   . SER A 1 46  ? 3.800   -5.953  2.234   1.00 0.00 ? 46  SER A HA   4  
ATOM 6231  H HB2  . SER A 1 46  ? 1.441   -6.921  2.808   1.00 0.00 ? 46  SER A HB2  4  
ATOM 6232  H HB3  . SER A 1 46  ? 2.307   -8.446  2.992   1.00 0.00 ? 46  SER A HB3  4  
ATOM 6233  H HG   . SER A 1 46  ? 3.690   -7.324  4.492   1.00 0.00 ? 46  SER A HG   4  
ATOM 6234  N N    . ASP A 1 47  ? 5.572   -7.700  2.741   1.00 0.00 ? 47  ASP A N    4  
ATOM 6235  C CA   . ASP A 1 47  ? 6.738   -8.575  2.782   1.00 0.00 ? 47  ASP A CA   4  
ATOM 6236  C C    . ASP A 1 47  ? 6.573   -9.650  3.851   1.00 0.00 ? 47  ASP A C    4  
ATOM 6237  O O    . ASP A 1 47  ? 6.554   -10.843 3.549   1.00 0.00 ? 47  ASP A O    4  
ATOM 6238  C CB   . ASP A 1 47  ? 8.004   -7.761  3.051   1.00 0.00 ? 47  ASP A CB   4  
ATOM 6239  C CG   . ASP A 1 47  ? 9.268   -8.579  2.869   1.00 0.00 ? 47  ASP A CG   4  
ATOM 6240  O OD1  . ASP A 1 47  ? 9.679   -9.257  3.833   1.00 0.00 ? 47  ASP A OD1  4  
ATOM 6241  O OD2  . ASP A 1 47  ? 9.846   -8.540  1.762   1.00 0.00 ? 47  ASP A OD2  4  
ATOM 6242  H H    . ASP A 1 47  ? 5.528   -6.934  3.351   1.00 0.00 ? 47  ASP A H    4  
ATOM 6243  H HA   . ASP A 1 47  ? 6.827   -9.054  1.819   1.00 0.00 ? 47  ASP A HA   4  
ATOM 6244  H HB2  . ASP A 1 47  ? 8.038   -6.924  2.369   1.00 0.00 ? 47  ASP A HB2  4  
ATOM 6245  H HB3  . ASP A 1 47  ? 7.978   -7.392  4.066   1.00 0.00 ? 47  ASP A HB3  4  
ATOM 6246  N N    . ASN A 1 48  ? 6.454   -9.220  5.103   1.00 0.00 ? 48  ASN A N    4  
ATOM 6247  C CA   . ASN A 1 48  ? 6.292   -10.146 6.218   1.00 0.00 ? 48  ASN A CA   4  
ATOM 6248  C C    . ASN A 1 48  ? 5.303   -11.253 5.866   1.00 0.00 ? 48  ASN A C    4  
ATOM 6249  O O    . ASN A 1 48  ? 5.623   -12.439 5.956   1.00 0.00 ? 48  ASN A O    4  
ATOM 6250  C CB   . ASN A 1 48  ? 5.814   -9.397  7.464   1.00 0.00 ? 48  ASN A CB   4  
ATOM 6251  C CG   . ASN A 1 48  ? 6.514   -8.063  7.641   1.00 0.00 ? 48  ASN A CG   4  
ATOM 6252  O OD1  . ASN A 1 48  ? 7.696   -8.010  7.980   1.00 0.00 ? 48  ASN A OD1  4  
ATOM 6253  N ND2  . ASN A 1 48  ? 5.784   -6.978  7.411   1.00 0.00 ? 48  ASN A ND2  4  
ATOM 6254  H H    . ASN A 1 48  ? 6.476   -8.256  5.281   1.00 0.00 ? 48  ASN A H    4  
ATOM 6255  H HA   . ASN A 1 48  ? 7.254   -10.590 6.422   1.00 0.00 ? 48  ASN A HA   4  
ATOM 6256  H HB2  . ASN A 1 48  ? 4.752   -9.217  7.384   1.00 0.00 ? 48  ASN A HB2  4  
ATOM 6257  H HB3  . ASN A 1 48  ? 6.007   -10.003 8.337   1.00 0.00 ? 48  ASN A HB3  4  
ATOM 6258  H HD21 . ASN A 1 48  ? 4.848   -7.097  7.144   1.00 0.00 ? 48  ASN A HD21 4  
ATOM 6259  H HD22 . ASN A 1 48  ? 6.211   -6.102  7.517   1.00 0.00 ? 48  ASN A HD22 4  
ATOM 6260  N N    . THR A 1 49  ? 4.099   -10.858 5.465   1.00 0.00 ? 49  THR A N    4  
ATOM 6261  C CA   . THR A 1 49  ? 3.062   -11.816 5.100   1.00 0.00 ? 49  THR A CA   4  
ATOM 6262  C C    . THR A 1 49  ? 3.058   -12.075 3.598   1.00 0.00 ? 49  THR A C    4  
ATOM 6263  O O    . THR A 1 49  ? 2.970   -11.155 2.785   1.00 0.00 ? 49  THR A O    4  
ATOM 6264  C CB   . THR A 1 49  ? 1.667   -11.324 5.528   1.00 0.00 ? 49  THR A CB   4  
ATOM 6265  O OG1  . THR A 1 49  ? 1.679   -10.961 6.914   1.00 0.00 ? 49  THR A OG1  4  
ATOM 6266  C CG2  . THR A 1 49  ? 0.618   -12.400 5.290   1.00 0.00 ? 49  THR A CG2  4  
ATOM 6267  H H    . THR A 1 49  ? 3.904   -9.899  5.414   1.00 0.00 ? 49  THR A H    4  
ATOM 6268  H HA   . THR A 1 49  ? 3.269   -12.743 5.615   1.00 0.00 ? 49  THR A HA   4  
ATOM 6269  H HB   . THR A 1 49  ? 1.411   -10.456 4.939   1.00 0.00 ? 49  THR A HB   4  
ATOM 6270  H HG1  . THR A 1 49  ? 0.905   -10.430 7.112   1.00 0.00 ? 49  THR A HG1  4  
ATOM 6271  H HG21 . THR A 1 49  ? 0.348   -12.854 6.232   1.00 0.00 ? 49  THR A HG21 4  
ATOM 6272  H HG22 . THR A 1 49  ? 1.018   -13.153 4.628   1.00 0.00 ? 49  THR A HG22 4  
ATOM 6273  H HG23 . THR A 1 49  ? -0.258  -11.955 4.842   1.00 0.00 ? 49  THR A HG23 4  
ATOM 6274  N N    . PRO A 1 50  ? 3.154   -13.358 3.218   1.00 0.00 ? 50  PRO A N    4  
ATOM 6275  C CA   . PRO A 1 50  ? 3.162   -13.768 1.810   1.00 0.00 ? 50  PRO A CA   4  
ATOM 6276  C C    . PRO A 1 50  ? 1.806   -13.569 1.141   1.00 0.00 ? 50  PRO A C    4  
ATOM 6277  O O    . PRO A 1 50  ? 1.612   -13.946 -0.014  1.00 0.00 ? 50  PRO A O    4  
ATOM 6278  C CB   . PRO A 1 50  ? 3.512   -15.257 1.877   1.00 0.00 ? 50  PRO A CB   4  
ATOM 6279  C CG   . PRO A 1 50  ? 3.063   -15.692 3.229   1.00 0.00 ? 50  PRO A CG   4  
ATOM 6280  C CD   . PRO A 1 50  ? 3.262   -14.507 4.133   1.00 0.00 ? 50  PRO A CD   4  
ATOM 6281  H HA   . PRO A 1 50  ? 3.920   -13.243 1.248   1.00 0.00 ? 50  PRO A HA   4  
ATOM 6282  H HB2  . PRO A 1 50  ? 2.987   -15.788 1.095   1.00 0.00 ? 50  PRO A HB2  4  
ATOM 6283  H HB3  . PRO A 1 50  ? 4.577   -15.385 1.755   1.00 0.00 ? 50  PRO A HB3  4  
ATOM 6284  H HG2  . PRO A 1 50  ? 2.020   -15.969 3.197   1.00 0.00 ? 50  PRO A HG2  4  
ATOM 6285  H HG3  . PRO A 1 50  ? 3.663   -16.524 3.565   1.00 0.00 ? 50  PRO A HG3  4  
ATOM 6286  H HD2  . PRO A 1 50  ? 2.489   -14.473 4.886   1.00 0.00 ? 50  PRO A HD2  4  
ATOM 6287  H HD3  . PRO A 1 50  ? 4.239   -14.543 4.592   1.00 0.00 ? 50  PRO A HD3  4  
ATOM 6288  N N    . GLY A 1 51  ? 0.871   -12.974 1.874   1.00 0.00 ? 51  GLY A N    4  
ATOM 6289  C CA   . GLY A 1 51  ? -0.455  -12.735 1.334   1.00 0.00 ? 51  GLY A CA   4  
ATOM 6290  C C    . GLY A 1 51  ? -1.122  -11.521 1.950   1.00 0.00 ? 51  GLY A C    4  
ATOM 6291  O O    . GLY A 1 51  ? -2.162  -11.638 2.598   1.00 0.00 ? 51  GLY A O    4  
ATOM 6292  H H    . GLY A 1 51  ? 1.083   -12.694 2.790   1.00 0.00 ? 51  GLY A H    4  
ATOM 6293  H HA2  . GLY A 1 51  ? -0.376  -12.587 0.267   1.00 0.00 ? 51  GLY A HA2  4  
ATOM 6294  H HA3  . GLY A 1 51  ? -1.069  -13.603 1.523   1.00 0.00 ? 51  GLY A HA3  4  
ATOM 6295  N N    . ASP A 1 52  ? -0.522  -10.353 1.749   1.00 0.00 ? 52  ASP A N    4  
ATOM 6296  C CA   . ASP A 1 52  ? -1.064  -9.112  2.291   1.00 0.00 ? 52  ASP A CA   4  
ATOM 6297  C C    . ASP A 1 52  ? -0.644  -7.918  1.438   1.00 0.00 ? 52  ASP A C    4  
ATOM 6298  O O    . ASP A 1 52  ? 0.299   -8.006  0.651   1.00 0.00 ? 52  ASP A O    4  
ATOM 6299  C CB   . ASP A 1 52  ? -0.598  -8.913  3.734   1.00 0.00 ? 52  ASP A CB   4  
ATOM 6300  C CG   . ASP A 1 52  ? -1.360  -7.810  4.442   1.00 0.00 ? 52  ASP A CG   4  
ATOM 6301  O OD1  . ASP A 1 52  ? -2.607  -7.866  4.455   1.00 0.00 ? 52  ASP A OD1  4  
ATOM 6302  O OD2  . ASP A 1 52  ? -0.709  -6.891  4.982   1.00 0.00 ? 52  ASP A OD2  4  
ATOM 6303  H H    . ASP A 1 52  ? 0.305   -10.324 1.224   1.00 0.00 ? 52  ASP A H    4  
ATOM 6304  H HA   . ASP A 1 52  ? -2.141  -9.187  2.277   1.00 0.00 ? 52  ASP A HA   4  
ATOM 6305  H HB2  . ASP A 1 52  ? -0.741  -9.833  4.281   1.00 0.00 ? 52  ASP A HB2  4  
ATOM 6306  H HB3  . ASP A 1 52  ? 0.452   -8.658  3.734   1.00 0.00 ? 52  ASP A HB3  4  
ATOM 6307  N N    . TYR A 1 53  ? -1.350  -6.805  1.600   1.00 0.00 ? 53  TYR A N    4  
ATOM 6308  C CA   . TYR A 1 53  ? -1.053  -5.595  0.843   1.00 0.00 ? 53  TYR A CA   4  
ATOM 6309  C C    . TYR A 1 53  ? -1.246  -4.351  1.706   1.00 0.00 ? 53  TYR A C    4  
ATOM 6310  O O    . TYR A 1 53  ? -1.744  -4.432  2.829   1.00 0.00 ? 53  TYR A O    4  
ATOM 6311  C CB   . TYR A 1 53  ? -1.945  -5.512  -0.397  1.00 0.00 ? 53  TYR A CB   4  
ATOM 6312  C CG   . TYR A 1 53  ? -1.811  -6.703  -1.319  1.00 0.00 ? 53  TYR A CG   4  
ATOM 6313  C CD1  . TYR A 1 53  ? -0.851  -6.725  -2.323  1.00 0.00 ? 53  TYR A CD1  4  
ATOM 6314  C CD2  . TYR A 1 53  ? -2.646  -7.806  -1.187  1.00 0.00 ? 53  TYR A CD2  4  
ATOM 6315  C CE1  . TYR A 1 53  ? -0.726  -7.810  -3.169  1.00 0.00 ? 53  TYR A CE1  4  
ATOM 6316  C CE2  . TYR A 1 53  ? -2.527  -8.896  -2.027  1.00 0.00 ? 53  TYR A CE2  4  
ATOM 6317  C CZ   . TYR A 1 53  ? -1.566  -8.894  -3.016  1.00 0.00 ? 53  TYR A CZ   4  
ATOM 6318  O OH   . TYR A 1 53  ? -1.445  -9.978  -3.855  1.00 0.00 ? 53  TYR A OH   4  
ATOM 6319  H H    . TYR A 1 53  ? -2.090  -6.797  2.242   1.00 0.00 ? 53  TYR A H    4  
ATOM 6320  H HA   . TYR A 1 53  ? -0.021  -5.645  0.529   1.00 0.00 ? 53  TYR A HA   4  
ATOM 6321  H HB2  . TYR A 1 53  ? -2.976  -5.447  -0.087  1.00 0.00 ? 53  TYR A HB2  4  
ATOM 6322  H HB3  . TYR A 1 53  ? -1.686  -4.626  -0.959  1.00 0.00 ? 53  TYR A HB3  4  
ATOM 6323  H HD1  . TYR A 1 53  ? -0.195  -5.874  -2.441  1.00 0.00 ? 53  TYR A HD1  4  
ATOM 6324  H HD2  . TYR A 1 53  ? -3.398  -7.805  -0.411  1.00 0.00 ? 53  TYR A HD2  4  
ATOM 6325  H HE1  . TYR A 1 53  ? 0.026   -7.809  -3.944  1.00 0.00 ? 53  TYR A HE1  4  
ATOM 6326  H HE2  . TYR A 1 53  ? -3.184  -9.745  -1.907  1.00 0.00 ? 53  TYR A HE2  4  
ATOM 6327  H HH   . TYR A 1 53  ? -0.882  -9.746  -4.598  1.00 0.00 ? 53  TYR A HH   4  
ATOM 6328  N N    . SER A 1 54  ? -0.850  -3.201  1.171   1.00 0.00 ? 54  SER A N    4  
ATOM 6329  C CA   . SER A 1 54  ? -0.976  -1.939  1.892   1.00 0.00 ? 54  SER A CA   4  
ATOM 6330  C C    . SER A 1 54  ? -0.908  -0.756  0.932   1.00 0.00 ? 54  SER A C    4  
ATOM 6331  O O    . SER A 1 54  ? -0.181  -0.789  -0.062  1.00 0.00 ? 54  SER A O    4  
ATOM 6332  C CB   . SER A 1 54  ? 0.126   -1.819  2.947   1.00 0.00 ? 54  SER A CB   4  
ATOM 6333  O OG   . SER A 1 54  ? 1.329   -2.418  2.499   1.00 0.00 ? 54  SER A OG   4  
ATOM 6334  H H    . SER A 1 54  ? -0.461  -3.201  0.272   1.00 0.00 ? 54  SER A H    4  
ATOM 6335  H HA   . SER A 1 54  ? -1.936  -1.934  2.385   1.00 0.00 ? 54  SER A HA   4  
ATOM 6336  H HB2  . SER A 1 54  ? 0.312   -0.775  3.151   1.00 0.00 ? 54  SER A HB2  4  
ATOM 6337  H HB3  . SER A 1 54  ? -0.193  -2.312  3.854   1.00 0.00 ? 54  SER A HB3  4  
ATOM 6338  H HG   . SER A 1 54  ? 1.935   -2.511  3.238   1.00 0.00 ? 54  SER A HG   4  
ATOM 6339  N N    . LEU A 1 55  ? -1.670  0.289   1.236   1.00 0.00 ? 55  LEU A N    4  
ATOM 6340  C CA   . LEU A 1 55  ? -1.697  1.485   0.401   1.00 0.00 ? 55  LEU A CA   4  
ATOM 6341  C C    . LEU A 1 55  ? -0.850  2.596   1.012   1.00 0.00 ? 55  LEU A C    4  
ATOM 6342  O O    . LEU A 1 55  ? -0.783  2.739   2.234   1.00 0.00 ? 55  LEU A O    4  
ATOM 6343  C CB   . LEU A 1 55  ? -3.137  1.968   0.216   1.00 0.00 ? 55  LEU A CB   4  
ATOM 6344  C CG   . LEU A 1 55  ? -3.339  3.109   -0.782  1.00 0.00 ? 55  LEU A CG   4  
ATOM 6345  C CD1  . LEU A 1 55  ? -4.718  3.024   -1.417  1.00 0.00 ? 55  LEU A CD1  4  
ATOM 6346  C CD2  . LEU A 1 55  ? -3.146  4.455   -0.100  1.00 0.00 ? 55  LEU A CD2  4  
ATOM 6347  H H    . LEU A 1 55  ? -2.227  0.257   2.041   1.00 0.00 ? 55  LEU A H    4  
ATOM 6348  H HA   . LEU A 1 55  ? -1.287  1.225   -0.563  1.00 0.00 ? 55  LEU A HA   4  
ATOM 6349  H HB2  . LEU A 1 55  ? -3.727  1.129   -0.117  1.00 0.00 ? 55  LEU A HB2  4  
ATOM 6350  H HB3  . LEU A 1 55  ? -3.499  2.302   1.179   1.00 0.00 ? 55  LEU A HB3  4  
ATOM 6351  H HG   . LEU A 1 55  ? -2.603  3.024   -1.570  1.00 0.00 ? 55  LEU A HG   4  
ATOM 6352  H HD11 . LEU A 1 55  ? -4.691  3.475   -2.398  1.00 0.00 ? 55  LEU A HD11 4  
ATOM 6353  H HD12 . LEU A 1 55  ? -5.432  3.549   -0.799  1.00 0.00 ? 55  LEU A HD12 4  
ATOM 6354  H HD13 . LEU A 1 55  ? -5.011  1.988   -1.505  1.00 0.00 ? 55  LEU A HD13 4  
ATOM 6355  H HD21 . LEU A 1 55  ? -2.315  4.394   0.588   1.00 0.00 ? 55  LEU A HD21 4  
ATOM 6356  H HD22 . LEU A 1 55  ? -4.043  4.716   0.442   1.00 0.00 ? 55  LEU A HD22 4  
ATOM 6357  H HD23 . LEU A 1 55  ? -2.941  5.210   -0.844  1.00 0.00 ? 55  LEU A HD23 4  
ATOM 6358  N N    . TYR A 1 56  ? -0.206  3.381   0.156   1.00 0.00 ? 56  TYR A N    4  
ATOM 6359  C CA   . TYR A 1 56  ? 0.638   4.479   0.612   1.00 0.00 ? 56  TYR A CA   4  
ATOM 6360  C C    . TYR A 1 56  ? 0.188   5.802   -0.001  1.00 0.00 ? 56  TYR A C    4  
ATOM 6361  O O    . TYR A 1 56  ? 0.160   5.956   -1.222  1.00 0.00 ? 56  TYR A O    4  
ATOM 6362  C CB   . TYR A 1 56  ? 2.100   4.210   0.254   1.00 0.00 ? 56  TYR A CB   4  
ATOM 6363  C CG   . TYR A 1 56  ? 2.723   3.088   1.054   1.00 0.00 ? 56  TYR A CG   4  
ATOM 6364  C CD1  . TYR A 1 56  ? 2.178   1.810   1.036   1.00 0.00 ? 56  TYR A CD1  4  
ATOM 6365  C CD2  . TYR A 1 56  ? 3.854   3.307   1.830   1.00 0.00 ? 56  TYR A CD2  4  
ATOM 6366  C CE1  . TYR A 1 56  ? 2.743   0.782   1.766   1.00 0.00 ? 56  TYR A CE1  4  
ATOM 6367  C CE2  . TYR A 1 56  ? 4.427   2.285   2.562   1.00 0.00 ? 56  TYR A CE2  4  
ATOM 6368  C CZ   . TYR A 1 56  ? 3.867   1.024   2.527   1.00 0.00 ? 56  TYR A CZ   4  
ATOM 6369  O OH   . TYR A 1 56  ? 4.434   0.004   3.256   1.00 0.00 ? 56  TYR A OH   4  
ATOM 6370  H H    . TYR A 1 56  ? -0.298  3.217   -0.806  1.00 0.00 ? 56  TYR A H    4  
ATOM 6371  H HA   . TYR A 1 56  ? 0.546   4.544   1.686   1.00 0.00 ? 56  TYR A HA   4  
ATOM 6372  H HB2  . TYR A 1 56  ? 2.165   3.947   -0.791  1.00 0.00 ? 56  TYR A HB2  4  
ATOM 6373  H HB3  . TYR A 1 56  ? 2.678   5.105   0.431   1.00 0.00 ? 56  TYR A HB3  4  
ATOM 6374  H HD1  . TYR A 1 56  ? 1.297   1.623   0.439   1.00 0.00 ? 56  TYR A HD1  4  
ATOM 6375  H HD2  . TYR A 1 56  ? 4.290   4.295   1.855   1.00 0.00 ? 56  TYR A HD2  4  
ATOM 6376  H HE1  . TYR A 1 56  ? 2.305   -0.205  1.739   1.00 0.00 ? 56  TYR A HE1  4  
ATOM 6377  H HE2  . TYR A 1 56  ? 5.307   2.474   3.158   1.00 0.00 ? 56  TYR A HE2  4  
ATOM 6378  H HH   . TYR A 1 56  ? 3.884   -0.186  4.020   1.00 0.00 ? 56  TYR A HH   4  
ATOM 6379  N N    . PHE A 1 57  ? -0.164  6.755   0.856   1.00 0.00 ? 57  PHE A N    4  
ATOM 6380  C CA   . PHE A 1 57  ? -0.613  8.065   0.401   1.00 0.00 ? 57  PHE A CA   4  
ATOM 6381  C C    . PHE A 1 57  ? 0.222   9.176   1.031   1.00 0.00 ? 57  PHE A C    4  
ATOM 6382  O O    . PHE A 1 57  ? 0.606   9.093   2.198   1.00 0.00 ? 57  PHE A O    4  
ATOM 6383  C CB   . PHE A 1 57  ? -2.091  8.268   0.741   1.00 0.00 ? 57  PHE A CB   4  
ATOM 6384  C CG   . PHE A 1 57  ? -2.692  9.486   0.101   1.00 0.00 ? 57  PHE A CG   4  
ATOM 6385  C CD1  . PHE A 1 57  ? -2.641  9.660   -1.272  1.00 0.00 ? 57  PHE A CD1  4  
ATOM 6386  C CD2  . PHE A 1 57  ? -3.307  10.459  0.874   1.00 0.00 ? 57  PHE A CD2  4  
ATOM 6387  C CE1  . PHE A 1 57  ? -3.193  10.780  -1.865  1.00 0.00 ? 57  PHE A CE1  4  
ATOM 6388  C CE2  . PHE A 1 57  ? -3.861  11.581  0.287   1.00 0.00 ? 57  PHE A CE2  4  
ATOM 6389  C CZ   . PHE A 1 57  ? -3.804  11.742  -1.084  1.00 0.00 ? 57  PHE A CZ   4  
ATOM 6390  H H    . PHE A 1 57  ? -0.120  6.571   1.819   1.00 0.00 ? 57  PHE A H    4  
ATOM 6391  H HA   . PHE A 1 57  ? -0.491  8.103   -0.670  1.00 0.00 ? 57  PHE A HA   4  
ATOM 6392  H HB2  . PHE A 1 57  ? -2.651  7.408   0.407   1.00 0.00 ? 57  PHE A HB2  4  
ATOM 6393  H HB3  . PHE A 1 57  ? -2.196  8.367   1.811   1.00 0.00 ? 57  PHE A HB3  4  
ATOM 6394  H HD1  . PHE A 1 57  ? -2.163  8.908   -1.884  1.00 0.00 ? 57  PHE A HD1  4  
ATOM 6395  H HD2  . PHE A 1 57  ? -3.352  10.334  1.946   1.00 0.00 ? 57  PHE A HD2  4  
ATOM 6396  H HE1  . PHE A 1 57  ? -3.146  10.903  -2.936  1.00 0.00 ? 57  PHE A HE1  4  
ATOM 6397  H HE2  . PHE A 1 57  ? -4.338  12.331  0.900   1.00 0.00 ? 57  PHE A HE2  4  
ATOM 6398  H HZ   . PHE A 1 57  ? -4.236  12.618  -1.544  1.00 0.00 ? 57  PHE A HZ   4  
ATOM 6399  N N    . ARG A 1 58  ? 0.501   10.214  0.250   1.00 0.00 ? 58  ARG A N    4  
ATOM 6400  C CA   . ARG A 1 58  ? 1.292   11.341  0.730   1.00 0.00 ? 58  ARG A CA   4  
ATOM 6401  C C    . ARG A 1 58  ? 0.391   12.490  1.170   1.00 0.00 ? 58  ARG A C    4  
ATOM 6402  O O    . ARG A 1 58  ? -0.523  12.890  0.447   1.00 0.00 ? 58  ARG A O    4  
ATOM 6403  C CB   . ARG A 1 58  ? 2.252   11.819  -0.361  1.00 0.00 ? 58  ARG A CB   4  
ATOM 6404  C CG   . ARG A 1 58  ? 2.865   13.181  -0.078  1.00 0.00 ? 58  ARG A CG   4  
ATOM 6405  C CD   . ARG A 1 58  ? 3.967   13.091  0.965   1.00 0.00 ? 58  ARG A CD   4  
ATOM 6406  N NE   . ARG A 1 58  ? 4.209   14.374  1.619   1.00 0.00 ? 58  ARG A NE   4  
ATOM 6407  C CZ   . ARG A 1 58  ? 4.736   15.425  1.001   1.00 0.00 ? 58  ARG A CZ   4  
ATOM 6408  N NH1  . ARG A 1 58  ? 5.074   15.346  -0.279  1.00 0.00 ? 58  ARG A NH1  4  
ATOM 6409  N NH2  . ARG A 1 58  ? 4.926   16.559  1.663   1.00 0.00 ? 58  ARG A NH2  4  
ATOM 6410  H H    . ARG A 1 58  ? 0.168   10.223  -0.671  1.00 0.00 ? 58  ARG A H    4  
ATOM 6411  H HA   . ARG A 1 58  ? 1.867   11.004  1.580   1.00 0.00 ? 58  ARG A HA   4  
ATOM 6412  H HB2  . ARG A 1 58  ? 3.053   11.102  -0.459  1.00 0.00 ? 58  ARG A HB2  4  
ATOM 6413  H HB3  . ARG A 1 58  ? 1.714   11.877  -1.295  1.00 0.00 ? 58  ARG A HB3  4  
ATOM 6414  H HG2  . ARG A 1 58  ? 3.282   13.575  -0.994  1.00 0.00 ? 58  ARG A HG2  4  
ATOM 6415  H HG3  . ARG A 1 58  ? 2.093   13.845  0.282   1.00 0.00 ? 58  ARG A HG3  4  
ATOM 6416  H HD2  . ARG A 1 58  ? 3.678   12.366  1.712   1.00 0.00 ? 58  ARG A HD2  4  
ATOM 6417  H HD3  . ARG A 1 58  ? 4.876   12.766  0.482   1.00 0.00 ? 58  ARG A HD3  4  
ATOM 6418  H HE   . ARG A 1 58  ? 3.966   14.455  2.564   1.00 0.00 ? 58  ARG A HE   4  
ATOM 6419  H HH11 . ARG A 1 58  ? 4.932   14.493  -0.780  1.00 0.00 ? 58  ARG A HH11 4  
ATOM 6420  H HH12 . ARG A 1 58  ? 5.470   16.139  -0.742  1.00 0.00 ? 58  ARG A HH12 4  
ATOM 6421  H HH21 . ARG A 1 58  ? 4.672   16.623  2.628   1.00 0.00 ? 58  ARG A HH21 4  
ATOM 6422  H HH22 . ARG A 1 58  ? 5.323   17.350  1.198   1.00 0.00 ? 58  ARG A HH22 4  
ATOM 6423  N N    . THR A 1 59  ? 0.653   13.019  2.361   1.00 0.00 ? 59  THR A N    4  
ATOM 6424  C CA   . THR A 1 59  ? -0.135  14.121  2.898   1.00 0.00 ? 59  THR A CA   4  
ATOM 6425  C C    . THR A 1 59  ? 0.763   15.222  3.450   1.00 0.00 ? 59  THR A C    4  
ATOM 6426  O O    . THR A 1 59  ? 1.960   15.018  3.648   1.00 0.00 ? 59  THR A O    4  
ATOM 6427  C CB   . THR A 1 59  ? -1.084  13.642  4.013   1.00 0.00 ? 59  THR A CB   4  
ATOM 6428  O OG1  . THR A 1 59  ? -0.330  13.269  5.172   1.00 0.00 ? 59  THR A OG1  4  
ATOM 6429  C CG2  . THR A 1 59  ? -1.919  12.461  3.542   1.00 0.00 ? 59  THR A CG2  4  
ATOM 6430  H H    . THR A 1 59  ? 1.394   12.658  2.891   1.00 0.00 ? 59  THR A H    4  
ATOM 6431  H HA   . THR A 1 59  ? -0.733  14.526  2.095   1.00 0.00 ? 59  THR A HA   4  
ATOM 6432  H HB   . THR A 1 59  ? -1.750  14.454  4.272   1.00 0.00 ? 59  THR A HB   4  
ATOM 6433  H HG1  . THR A 1 59  ? 0.527   12.932  4.901   1.00 0.00 ? 59  THR A HG1  4  
ATOM 6434  H HG21 . THR A 1 59  ? -1.349  11.875  2.837   1.00 0.00 ? 59  THR A HG21 4  
ATOM 6435  H HG22 . THR A 1 59  ? -2.819  12.822  3.067   1.00 0.00 ? 59  THR A HG22 4  
ATOM 6436  H HG23 . THR A 1 59  ? -2.182  11.846  4.390   1.00 0.00 ? 59  THR A HG23 4  
ATOM 6437  N N    . ASN A 1 60  ? 0.178   16.390  3.696   1.00 0.00 ? 60  ASN A N    4  
ATOM 6438  C CA   . ASN A 1 60  ? 0.927   17.524  4.226   1.00 0.00 ? 60  ASN A CA   4  
ATOM 6439  C C    . ASN A 1 60  ? 1.732   17.117  5.456   1.00 0.00 ? 60  ASN A C    4  
ATOM 6440  O O    . ASN A 1 60  ? 2.890   17.505  5.608   1.00 0.00 ? 60  ASN A O    4  
ATOM 6441  C CB   . ASN A 1 60  ? -0.024  18.669  4.580   1.00 0.00 ? 60  ASN A CB   4  
ATOM 6442  C CG   . ASN A 1 60  ? -0.571  19.368  3.350   1.00 0.00 ? 60  ASN A CG   4  
ATOM 6443  O OD1  . ASN A 1 60  ? 0.005   19.282  2.266   1.00 0.00 ? 60  ASN A OD1  4  
ATOM 6444  N ND2  . ASN A 1 60  ? -1.689  20.065  3.515   1.00 0.00 ? 60  ASN A ND2  4  
ATOM 6445  H H    . ASN A 1 60  ? -0.780  16.491  3.518   1.00 0.00 ? 60  ASN A H    4  
ATOM 6446  H HA   . ASN A 1 60  ? 1.608   17.858  3.458   1.00 0.00 ? 60  ASN A HA   4  
ATOM 6447  H HB2  . ASN A 1 60  ? -0.856  18.276  5.146   1.00 0.00 ? 60  ASN A HB2  4  
ATOM 6448  H HB3  . ASN A 1 60  ? 0.504   19.395  5.180   1.00 0.00 ? 60  ASN A HB3  4  
ATOM 6449  H HD21 . ASN A 1 60  ? -2.093  20.090  4.408   1.00 0.00 ? 60  ASN A HD21 4  
ATOM 6450  H HD22 . ASN A 1 60  ? -2.065  20.527  2.736   1.00 0.00 ? 60  ASN A HD22 4  
ATOM 6451  N N    . GLU A 1 61  ? 1.110   16.333  6.331   1.00 0.00 ? 61  GLU A N    4  
ATOM 6452  C CA   . GLU A 1 61  ? 1.769   15.874  7.548   1.00 0.00 ? 61  GLU A CA   4  
ATOM 6453  C C    . GLU A 1 61  ? 2.850   14.846  7.227   1.00 0.00 ? 61  GLU A C    4  
ATOM 6454  O O    . GLU A 1 61  ? 4.041   15.110  7.388   1.00 0.00 ? 61  GLU A O    4  
ATOM 6455  C CB   . GLU A 1 61  ? 0.746   15.270  8.512   1.00 0.00 ? 61  GLU A CB   4  
ATOM 6456  C CG   . GLU A 1 61  ? 1.156   15.364  9.972   1.00 0.00 ? 61  GLU A CG   4  
ATOM 6457  C CD   . GLU A 1 61  ? 0.298   14.501  10.876  1.00 0.00 ? 61  GLU A CD   4  
ATOM 6458  O OE1  . GLU A 1 61  ? 0.053   13.330  10.520  1.00 0.00 ? 61  GLU A OE1  4  
ATOM 6459  O OE2  . GLU A 1 61  ? -0.130  14.997  11.940  1.00 0.00 ? 61  GLU A OE2  4  
ATOM 6460  H H    . GLU A 1 61  ? 0.186   16.057  6.154   1.00 0.00 ? 61  GLU A H    4  
ATOM 6461  H HA   . GLU A 1 61  ? 2.231   16.729  8.018   1.00 0.00 ? 61  GLU A HA   4  
ATOM 6462  H HB2  . GLU A 1 61  ? -0.195  15.786  8.389   1.00 0.00 ? 61  GLU A HB2  4  
ATOM 6463  H HB3  . GLU A 1 61  ? 0.609   14.228  8.266   1.00 0.00 ? 61  GLU A HB3  4  
ATOM 6464  H HG2  . GLU A 1 61  ? 2.183   15.045  10.066  1.00 0.00 ? 61  GLU A HG2  4  
ATOM 6465  H HG3  . GLU A 1 61  ? 1.069   16.392  10.292  1.00 0.00 ? 61  GLU A HG3  4  
ATOM 6466  N N    . ASN A 1 62  ? 2.425   13.672  6.772   1.00 0.00 ? 62  ASN A N    4  
ATOM 6467  C CA   . ASN A 1 62  ? 3.356   12.603  6.429   1.00 0.00 ? 62  ASN A CA   4  
ATOM 6468  C C    . ASN A 1 62  ? 2.656   11.507  5.631   1.00 0.00 ? 62  ASN A C    4  
ATOM 6469  O O    . ASN A 1 62  ? 1.432   11.376  5.678   1.00 0.00 ? 62  ASN A O    4  
ATOM 6470  C CB   . ASN A 1 62  ? 3.974   12.010  7.697   1.00 0.00 ? 62  ASN A CB   4  
ATOM 6471  C CG   . ASN A 1 62  ? 2.925   11.541  8.686   1.00 0.00 ? 62  ASN A CG   4  
ATOM 6472  O OD1  . ASN A 1 62  ? 2.047   12.305  9.085   1.00 0.00 ? 62  ASN A OD1  4  
ATOM 6473  N ND2  . ASN A 1 62  ? 3.013   10.278  9.087   1.00 0.00 ? 62  ASN A ND2  4  
ATOM 6474  H H    . ASN A 1 62  ? 1.463   13.520  6.664   1.00 0.00 ? 62  ASN A H    4  
ATOM 6475  H HA   . ASN A 1 62  ? 4.141   13.028  5.822   1.00 0.00 ? 62  ASN A HA   4  
ATOM 6476  H HB2  . ASN A 1 62  ? 4.591   11.165  7.428   1.00 0.00 ? 62  ASN A HB2  4  
ATOM 6477  H HB3  . ASN A 1 62  ? 4.586   12.759  8.176   1.00 0.00 ? 62  ASN A HB3  4  
ATOM 6478  H HD21 . ASN A 1 62  ? 3.740   9.727   8.727   1.00 0.00 ? 62  ASN A HD21 4  
ATOM 6479  H HD22 . ASN A 1 62  ? 2.347   9.948   9.726   1.00 0.00 ? 62  ASN A HD22 4  
ATOM 6480  N N    . ILE A 1 63  ? 3.440   10.722  4.899   1.00 0.00 ? 63  ILE A N    4  
ATOM 6481  C CA   . ILE A 1 63  ? 2.895   9.637   4.093   1.00 0.00 ? 63  ILE A CA   4  
ATOM 6482  C C    . ILE A 1 63  ? 2.223   8.585   4.969   1.00 0.00 ? 63  ILE A C    4  
ATOM 6483  O O    . ILE A 1 63  ? 2.871   7.953   5.803   1.00 0.00 ? 63  ILE A O    4  
ATOM 6484  C CB   . ILE A 1 63  ? 3.990   8.961   3.246   1.00 0.00 ? 63  ILE A CB   4  
ATOM 6485  C CG1  . ILE A 1 63  ? 4.693   9.994   2.363   1.00 0.00 ? 63  ILE A CG1  4  
ATOM 6486  C CG2  . ILE A 1 63  ? 3.391   7.849   2.397   1.00 0.00 ? 63  ILE A CG2  4  
ATOM 6487  C CD1  . ILE A 1 63  ? 5.863   9.430   1.588   1.00 0.00 ? 63  ILE A CD1  4  
ATOM 6488  H H    . ILE A 1 63  ? 4.407   10.876  4.903   1.00 0.00 ? 63  ILE A H    4  
ATOM 6489  H HA   . ILE A 1 63  ? 2.158   10.057  3.424   1.00 0.00 ? 63  ILE A HA   4  
ATOM 6490  H HB   . ILE A 1 63  ? 4.712   8.520   3.916   1.00 0.00 ? 63  ILE A HB   4  
ATOM 6491  H HG12 . ILE A 1 63  ? 3.985   10.391  1.652   1.00 0.00 ? 63  ILE A HG12 4  
ATOM 6492  H HG13 . ILE A 1 63  ? 5.061   10.797  2.985   1.00 0.00 ? 63  ILE A HG13 4  
ATOM 6493  H HG21 . ILE A 1 63  ? 3.961   6.942   2.538   1.00 0.00 ? 63  ILE A HG21 4  
ATOM 6494  H HG22 . ILE A 1 63  ? 2.368   7.681   2.695   1.00 0.00 ? 63  ILE A HG22 4  
ATOM 6495  H HG23 . ILE A 1 63  ? 3.422   8.135   1.356   1.00 0.00 ? 63  ILE A HG23 4  
ATOM 6496  H HD11 . ILE A 1 63  ? 6.787   9.769   2.033   1.00 0.00 ? 63  ILE A HD11 4  
ATOM 6497  H HD12 . ILE A 1 63  ? 5.825   8.352   1.611   1.00 0.00 ? 63  ILE A HD12 4  
ATOM 6498  H HD13 . ILE A 1 63  ? 5.813   9.770   0.563   1.00 0.00 ? 63  ILE A HD13 4  
ATOM 6499  N N    . GLN A 1 64  ? 0.922   8.401   4.771   1.00 0.00 ? 64  GLN A N    4  
ATOM 6500  C CA   . GLN A 1 64  ? 0.163   7.424   5.542   1.00 0.00 ? 64  GLN A CA   4  
ATOM 6501  C C    . GLN A 1 64  ? 0.461   6.006   5.067   1.00 0.00 ? 64  GLN A C    4  
ATOM 6502  O O    . GLN A 1 64  ? 1.229   5.804   4.127   1.00 0.00 ? 64  GLN A O    4  
ATOM 6503  C CB   . GLN A 1 64  ? -1.336  7.708   5.430   1.00 0.00 ? 64  GLN A CB   4  
ATOM 6504  C CG   . GLN A 1 64  ? -1.861  8.639   6.511   1.00 0.00 ? 64  GLN A CG   4  
ATOM 6505  C CD   . GLN A 1 64  ? -1.795  10.099  6.107   1.00 0.00 ? 64  GLN A CD   4  
ATOM 6506  O OE1  . GLN A 1 64  ? -0.812  10.547  5.516   1.00 0.00 ? 64  GLN A OE1  4  
ATOM 6507  N NE2  . GLN A 1 64  ? -2.844  10.849  6.423   1.00 0.00 ? 64  GLN A NE2  4  
ATOM 6508  H H    . GLN A 1 64  ? 0.462   8.935   4.090   1.00 0.00 ? 64  GLN A H    4  
ATOM 6509  H HA   . GLN A 1 64  ? 0.461   7.514   6.575   1.00 0.00 ? 64  GLN A HA   4  
ATOM 6510  H HB2  . GLN A 1 64  ? -1.534  8.159   4.469   1.00 0.00 ? 64  GLN A HB2  4  
ATOM 6511  H HB3  . GLN A 1 64  ? -1.873  6.774   5.499   1.00 0.00 ? 64  GLN A HB3  4  
ATOM 6512  H HG2  . GLN A 1 64  ? -2.890  8.385   6.718   1.00 0.00 ? 64  GLN A HG2  4  
ATOM 6513  H HG3  . GLN A 1 64  ? -1.271  8.501   7.405   1.00 0.00 ? 64  GLN A HG3  4  
ATOM 6514  H HE21 . GLN A 1 64  ? -3.591  10.424  6.895   1.00 0.00 ? 64  GLN A HE21 4  
ATOM 6515  H HE22 . GLN A 1 64  ? -2.827  11.796  6.175   1.00 0.00 ? 64  GLN A HE22 4  
ATOM 6516  N N    . ARG A 1 65  ? -0.153  5.026   5.724   1.00 0.00 ? 65  ARG A N    4  
ATOM 6517  C CA   . ARG A 1 65  ? 0.048   3.626   5.369   1.00 0.00 ? 65  ARG A CA   4  
ATOM 6518  C C    . ARG A 1 65  ? -1.127  2.773   5.838   1.00 0.00 ? 65  ARG A C    4  
ATOM 6519  O O    . ARG A 1 65  ? -1.382  2.652   7.037   1.00 0.00 ? 65  ARG A O    4  
ATOM 6520  C CB   . ARG A 1 65  ? 1.348   3.104   5.984   1.00 0.00 ? 65  ARG A CB   4  
ATOM 6521  C CG   . ARG A 1 65  ? 1.621   1.641   5.678   1.00 0.00 ? 65  ARG A CG   4  
ATOM 6522  C CD   . ARG A 1 65  ? 2.639   1.051   6.642   1.00 0.00 ? 65  ARG A CD   4  
ATOM 6523  N NE   . ARG A 1 65  ? 3.038   -0.301  6.257   1.00 0.00 ? 65  ARG A NE   4  
ATOM 6524  C CZ   . ARG A 1 65  ? 4.039   -0.962  6.827   1.00 0.00 ? 65  ARG A CZ   4  
ATOM 6525  N NH1  . ARG A 1 65  ? 4.739   -0.399  7.803   1.00 0.00 ? 65  ARG A NH1  4  
ATOM 6526  N NH2  . ARG A 1 65  ? 4.342   -2.188  6.422   1.00 0.00 ? 65  ARG A NH2  4  
ATOM 6527  H H    . ARG A 1 65  ? -0.754  5.250   6.464   1.00 0.00 ? 65  ARG A H    4  
ATOM 6528  H HA   . ARG A 1 65  ? 0.117   3.563   4.294   1.00 0.00 ? 65  ARG A HA   4  
ATOM 6529  H HB2  . ARG A 1 65  ? 2.173   3.688   5.603   1.00 0.00 ? 65  ARG A HB2  4  
ATOM 6530  H HB3  . ARG A 1 65  ? 1.298   3.222   7.056   1.00 0.00 ? 65  ARG A HB3  4  
ATOM 6531  H HG2  . ARG A 1 65  ? 0.698   1.086   5.763   1.00 0.00 ? 65  ARG A HG2  4  
ATOM 6532  H HG3  . ARG A 1 65  ? 2.002   1.558   4.671   1.00 0.00 ? 65  ARG A HG3  4  
ATOM 6533  H HD2  . ARG A 1 65  ? 3.513   1.684   6.654   1.00 0.00 ? 65  ARG A HD2  4  
ATOM 6534  H HD3  . ARG A 1 65  ? 2.203   1.020   7.630   1.00 0.00 ? 65  ARG A HD3  4  
ATOM 6535  H HE   . ARG A 1 65  ? 2.534   -0.735  5.539   1.00 0.00 ? 65  ARG A HE   4  
ATOM 6536  H HH11 . ARG A 1 65  ? 4.512   0.525   8.111   1.00 0.00 ? 65  ARG A HH11 4  
ATOM 6537  H HH12 . ARG A 1 65  ? 5.492   -0.899  8.231   1.00 0.00 ? 65  ARG A HH12 4  
ATOM 6538  H HH21 . ARG A 1 65  ? 3.816   -2.616  5.688   1.00 0.00 ? 65  ARG A HH21 4  
ATOM 6539  H HH22 . ARG A 1 65  ? 5.096   -2.685  6.852   1.00 0.00 ? 65  ARG A HH22 4  
ATOM 6540  N N    . PHE A 1 66  ? -1.841  2.184   4.885   1.00 0.00 ? 66  PHE A N    4  
ATOM 6541  C CA   . PHE A 1 66  ? -2.990  1.343   5.199   1.00 0.00 ? 66  PHE A CA   4  
ATOM 6542  C C    . PHE A 1 66  ? -2.611  -0.135  5.155   1.00 0.00 ? 66  PHE A C    4  
ATOM 6543  O O    . PHE A 1 66  ? -1.479  -0.488  4.825   1.00 0.00 ? 66  PHE A O    4  
ATOM 6544  C CB   . PHE A 1 66  ? -4.133  1.617   4.220   1.00 0.00 ? 66  PHE A CB   4  
ATOM 6545  C CG   . PHE A 1 66  ? -4.632  3.034   4.262   1.00 0.00 ? 66  PHE A CG   4  
ATOM 6546  C CD1  . PHE A 1 66  ? -5.588  3.418   5.188   1.00 0.00 ? 66  PHE A CD1  4  
ATOM 6547  C CD2  . PHE A 1 66  ? -4.144  3.981   3.376   1.00 0.00 ? 66  PHE A CD2  4  
ATOM 6548  C CE1  . PHE A 1 66  ? -6.049  4.720   5.231   1.00 0.00 ? 66  PHE A CE1  4  
ATOM 6549  C CE2  . PHE A 1 66  ? -4.601  5.285   3.414   1.00 0.00 ? 66  PHE A CE2  4  
ATOM 6550  C CZ   . PHE A 1 66  ? -5.555  5.655   4.341   1.00 0.00 ? 66  PHE A CZ   4  
ATOM 6551  H H    . PHE A 1 66  ? -1.589  2.318   3.947   1.00 0.00 ? 66  PHE A H    4  
ATOM 6552  H HA   . PHE A 1 66  ? -3.316  1.589   6.198   1.00 0.00 ? 66  PHE A HA   4  
ATOM 6553  H HB2  . PHE A 1 66  ? -3.793  1.416   3.215   1.00 0.00 ? 66  PHE A HB2  4  
ATOM 6554  H HB3  . PHE A 1 66  ? -4.961  0.965   4.452   1.00 0.00 ? 66  PHE A HB3  4  
ATOM 6555  H HD1  . PHE A 1 66  ? -5.975  2.687   5.885   1.00 0.00 ? 66  PHE A HD1  4  
ATOM 6556  H HD2  . PHE A 1 66  ? -3.399  3.693   2.649   1.00 0.00 ? 66  PHE A HD2  4  
ATOM 6557  H HE1  . PHE A 1 66  ? -6.795  5.006   5.957   1.00 0.00 ? 66  PHE A HE1  4  
ATOM 6558  H HE2  . PHE A 1 66  ? -4.214  6.013   2.717   1.00 0.00 ? 66  PHE A HE2  4  
ATOM 6559  H HZ   . PHE A 1 66  ? -5.913  6.673   4.373   1.00 0.00 ? 66  PHE A HZ   4  
ATOM 6560  N N    . LYS A 1 67  ? -3.567  -0.995  5.490   1.00 0.00 ? 67  LYS A N    4  
ATOM 6561  C CA   . LYS A 1 67  ? -3.337  -2.434  5.489   1.00 0.00 ? 67  LYS A CA   4  
ATOM 6562  C C    . LYS A 1 67  ? -4.531  -3.176  4.896   1.00 0.00 ? 67  LYS A C    4  
ATOM 6563  O O    . LYS A 1 67  ? -5.669  -2.982  5.325   1.00 0.00 ? 67  LYS A O    4  
ATOM 6564  C CB   . LYS A 1 67  ? -3.070  -2.930  6.912   1.00 0.00 ? 67  LYS A CB   4  
ATOM 6565  C CG   . LYS A 1 67  ? -1.753  -2.442  7.489   1.00 0.00 ? 67  LYS A CG   4  
ATOM 6566  C CD   . LYS A 1 67  ? -1.916  -1.107  8.197   1.00 0.00 ? 67  LYS A CD   4  
ATOM 6567  C CE   . LYS A 1 67  ? -2.396  -1.291  9.629   1.00 0.00 ? 67  LYS A CE   4  
ATOM 6568  N NZ   . LYS A 1 67  ? -2.334  -0.020  10.402  1.00 0.00 ? 67  LYS A NZ   4  
ATOM 6569  H H    . LYS A 1 67  ? -4.451  -0.652  5.744   1.00 0.00 ? 67  LYS A H    4  
ATOM 6570  H HA   . LYS A 1 67  ? -2.468  -2.631  4.879   1.00 0.00 ? 67  LYS A HA   4  
ATOM 6571  H HB2  . LYS A 1 67  ? -3.869  -2.590  7.554   1.00 0.00 ? 67  LYS A HB2  4  
ATOM 6572  H HB3  . LYS A 1 67  ? -3.058  -4.011  6.907   1.00 0.00 ? 67  LYS A HB3  4  
ATOM 6573  H HG2  . LYS A 1 67  ? -1.388  -3.171  8.197   1.00 0.00 ? 67  LYS A HG2  4  
ATOM 6574  H HG3  . LYS A 1 67  ? -1.039  -2.328  6.686   1.00 0.00 ? 67  LYS A HG3  4  
ATOM 6575  H HD2  . LYS A 1 67  ? -0.963  -0.599  8.212   1.00 0.00 ? 67  LYS A HD2  4  
ATOM 6576  H HD3  . LYS A 1 67  ? -2.637  -0.509  7.659   1.00 0.00 ? 67  LYS A HD3  4  
ATOM 6577  H HE2  . LYS A 1 67  ? -3.417  -1.641  9.610   1.00 0.00 ? 67  LYS A HE2  4  
ATOM 6578  H HE3  . LYS A 1 67  ? -1.772  -2.027  10.112  1.00 0.00 ? 67  LYS A HE3  4  
ATOM 6579  H HZ1  . LYS A 1 67  ? -1.390  0.407   10.313  1.00 0.00 ? 67  LYS A HZ1  4  
ATOM 6580  H HZ2  . LYS A 1 67  ? -2.526  -0.203  11.407  1.00 0.00 ? 67  LYS A HZ2  4  
ATOM 6581  H HZ3  . LYS A 1 67  ? -3.041  0.652   10.042  1.00 0.00 ? 67  LYS A HZ3  4  
ATOM 6582  N N    . ILE A 1 68  ? -4.264  -4.026  3.910   1.00 0.00 ? 68  ILE A N    4  
ATOM 6583  C CA   . ILE A 1 68  ? -5.317  -4.798  3.262   1.00 0.00 ? 68  ILE A CA   4  
ATOM 6584  C C    . ILE A 1 68  ? -5.148  -6.290  3.528   1.00 0.00 ? 68  ILE A C    4  
ATOM 6585  O O    . ILE A 1 68  ? -4.254  -6.932  2.975   1.00 0.00 ? 68  ILE A O    4  
ATOM 6586  C CB   . ILE A 1 68  ? -5.335  -4.558  1.741   1.00 0.00 ? 68  ILE A CB   4  
ATOM 6587  C CG1  . ILE A 1 68  ? -5.486  -3.066  1.439   1.00 0.00 ? 68  ILE A CG1  4  
ATOM 6588  C CG2  . ILE A 1 68  ? -6.460  -5.352  1.093   1.00 0.00 ? 68  ILE A CG2  4  
ATOM 6589  C CD1  . ILE A 1 68  ? -5.017  -2.678  0.055   1.00 0.00 ? 68  ILE A CD1  4  
ATOM 6590  H H    . ILE A 1 68  ? -3.337  -4.137  3.613   1.00 0.00 ? 68  ILE A H    4  
ATOM 6591  H HA   . ILE A 1 68  ? -6.265  -4.476  3.668   1.00 0.00 ? 68  ILE A HA   4  
ATOM 6592  H HB   . ILE A 1 68  ? -4.399  -4.907  1.332   1.00 0.00 ? 68  ILE A HB   4  
ATOM 6593  H HG12 . ILE A 1 68  ? -6.526  -2.791  1.526   1.00 0.00 ? 68  ILE A HG12 4  
ATOM 6594  H HG13 . ILE A 1 68  ? -4.908  -2.501  2.157   1.00 0.00 ? 68  ILE A HG13 4  
ATOM 6595  H HG21 . ILE A 1 68  ? -6.280  -6.408  1.230   1.00 0.00 ? 68  ILE A HG21 4  
ATOM 6596  H HG22 . ILE A 1 68  ? -7.399  -5.084  1.553   1.00 0.00 ? 68  ILE A HG22 4  
ATOM 6597  H HG23 . ILE A 1 68  ? -6.498  -5.127  0.038   1.00 0.00 ? 68  ILE A HG23 4  
ATOM 6598  H HD11 . ILE A 1 68  ? -5.223  -1.631  -0.116  1.00 0.00 ? 68  ILE A HD11 4  
ATOM 6599  H HD12 . ILE A 1 68  ? -3.956  -2.856  -0.030  1.00 0.00 ? 68  ILE A HD12 4  
ATOM 6600  H HD13 . ILE A 1 68  ? -5.541  -3.271  -0.682  1.00 0.00 ? 68  ILE A HD13 4  
ATOM 6601  N N    . CYS A 1 69  ? -6.012  -6.835  4.376   1.00 0.00 ? 69  CYS A N    4  
ATOM 6602  C CA   . CYS A 1 69  ? -5.960  -8.253  4.716   1.00 0.00 ? 69  CYS A CA   4  
ATOM 6603  C C    . CYS A 1 69  ? -6.845  -9.069  3.779   1.00 0.00 ? 69  CYS A C    4  
ATOM 6604  O O    . CYS A 1 69  ? -7.925  -8.638  3.373   1.00 0.00 ? 69  CYS A O    4  
ATOM 6605  C CB   . CYS A 1 69  ? -6.395  -8.468  6.166   1.00 0.00 ? 69  CYS A CB   4  
ATOM 6606  S SG   . CYS A 1 69  ? -5.325  -7.669  7.384   1.00 0.00 ? 69  CYS A SG   4  
ATOM 6607  H H    . CYS A 1 69  ? -6.702  -6.272  4.785   1.00 0.00 ? 69  CYS A H    4  
ATOM 6608  H HA   . CYS A 1 69  ? -4.938  -8.582  4.603   1.00 0.00 ? 69  CYS A HA   4  
ATOM 6609  H HB2  . CYS A 1 69  ? -7.392  -8.074  6.296   1.00 0.00 ? 69  CYS A HB2  4  
ATOM 6610  H HB3  . CYS A 1 69  ? -6.404  -9.527  6.377   1.00 0.00 ? 69  CYS A HB3  4  
ATOM 6611  H HG   . CYS A 1 69  ? -5.522  -6.362  7.306   1.00 0.00 ? 69  CYS A HG   4  
ATOM 6612  N N    . PRO A 1 70  ? -6.378  -10.276 3.426   1.00 0.00 ? 70  PRO A N    4  
ATOM 6613  C CA   . PRO A 1 70  ? -7.112  -11.177 2.532   1.00 0.00 ? 70  PRO A CA   4  
ATOM 6614  C C    . PRO A 1 70  ? -8.368  -11.745 3.185   1.00 0.00 ? 70  PRO A C    4  
ATOM 6615  O O    . PRO A 1 70  ? -8.432  -11.896 4.405   1.00 0.00 ? 70  PRO A O    4  
ATOM 6616  C CB   . PRO A 1 70  ? -6.104  -12.294 2.250   1.00 0.00 ? 70  PRO A CB   4  
ATOM 6617  C CG   . PRO A 1 70  ? -5.191  -12.287 3.427   1.00 0.00 ? 70  PRO A CG   4  
ATOM 6618  C CD   . PRO A 1 70  ? -5.100  -10.854 3.872   1.00 0.00 ? 70  PRO A CD   4  
ATOM 6619  H HA   . PRO A 1 70  ? -7.378  -10.688 1.607   1.00 0.00 ? 70  PRO A HA   4  
ATOM 6620  H HB2  . PRO A 1 70  ? -6.624  -13.237 2.158   1.00 0.00 ? 70  PRO A HB2  4  
ATOM 6621  H HB3  . PRO A 1 70  ? -5.571  -12.080 1.336   1.00 0.00 ? 70  PRO A HB3  4  
ATOM 6622  H HG2  . PRO A 1 70  ? -5.604  -12.899 4.216   1.00 0.00 ? 70  PRO A HG2  4  
ATOM 6623  H HG3  . PRO A 1 70  ? -4.217  -12.653 3.138   1.00 0.00 ? 70  PRO A HG3  4  
ATOM 6624  H HD2  . PRO A 1 70  ? -5.004  -10.797 4.946   1.00 0.00 ? 70  PRO A HD2  4  
ATOM 6625  H HD3  . PRO A 1 70  ? -4.267  -10.362 3.391   1.00 0.00 ? 70  PRO A HD3  4  
ATOM 6626  N N    . THR A 1 71  ? -9.365  -12.060 2.364   1.00 0.00 ? 71  THR A N    4  
ATOM 6627  C CA   . THR A 1 71  ? -10.619 -12.611 2.861   1.00 0.00 ? 71  THR A CA   4  
ATOM 6628  C C    . THR A 1 71  ? -10.969 -13.913 2.149   1.00 0.00 ? 71  THR A C    4  
ATOM 6629  O O    . THR A 1 71  ? -10.666 -14.105 0.971   1.00 0.00 ? 71  THR A O    4  
ATOM 6630  C CB   . THR A 1 71  ? -11.780 -11.614 2.684   1.00 0.00 ? 71  THR A CB   4  
ATOM 6631  O OG1  . THR A 1 71  ? -12.114 -11.493 1.296   1.00 0.00 ? 71  THR A OG1  4  
ATOM 6632  C CG2  . THR A 1 71  ? -11.411 -10.249 3.243   1.00 0.00 ? 71  THR A CG2  4  
ATOM 6633  H H    . THR A 1 71  ? -9.253  -11.917 1.401   1.00 0.00 ? 71  THR A H    4  
ATOM 6634  H HA   . THR A 1 71  ? -10.501 -12.810 3.917   1.00 0.00 ? 71  THR A HA   4  
ATOM 6635  H HB   . THR A 1 71  ? -12.640 -11.987 3.222   1.00 0.00 ? 71  THR A HB   4  
ATOM 6636  H HG1  . THR A 1 71  ? -11.312 -11.539 0.769   1.00 0.00 ? 71  THR A HG1  4  
ATOM 6637  H HG21 . THR A 1 71  ? -12.177 -9.922  3.931   1.00 0.00 ? 71  THR A HG21 4  
ATOM 6638  H HG22 . THR A 1 71  ? -11.328 -9.539  2.434   1.00 0.00 ? 71  THR A HG22 4  
ATOM 6639  H HG23 . THR A 1 71  ? -10.467 -10.316 3.762   1.00 0.00 ? 71  THR A HG23 4  
ATOM 6640  N N    . PRO A 1 72  ? -11.622 -14.830 2.878   1.00 0.00 ? 72  PRO A N    4  
ATOM 6641  C CA   . PRO A 1 72  ? -12.028 -16.129 2.335   1.00 0.00 ? 72  PRO A CA   4  
ATOM 6642  C C    . PRO A 1 72  ? -13.149 -16.004 1.308   1.00 0.00 ? 72  PRO A C    4  
ATOM 6643  O O    . PRO A 1 72  ? -13.567 -16.994 0.709   1.00 0.00 ? 72  PRO A O    4  
ATOM 6644  C CB   . PRO A 1 72  ? -12.517 -16.892 3.569   1.00 0.00 ? 72  PRO A CB   4  
ATOM 6645  C CG   . PRO A 1 72  ? -12.937 -15.832 4.528   1.00 0.00 ? 72  PRO A CG   4  
ATOM 6646  C CD   . PRO A 1 72  ? -12.016 -14.668 4.288   1.00 0.00 ? 72  PRO A CD   4  
ATOM 6647  H HA   . PRO A 1 72  ? -11.193 -16.653 1.893   1.00 0.00 ? 72  PRO A HA   4  
ATOM 6648  H HB2  . PRO A 1 72  ? -13.346 -17.530 3.296   1.00 0.00 ? 72  PRO A HB2  4  
ATOM 6649  H HB3  . PRO A 1 72  ? -11.712 -17.490 3.969   1.00 0.00 ? 72  PRO A HB3  4  
ATOM 6650  H HG2  . PRO A 1 72  ? -13.960 -15.547 4.335   1.00 0.00 ? 72  PRO A HG2  4  
ATOM 6651  H HG3  . PRO A 1 72  ? -12.830 -16.191 5.541   1.00 0.00 ? 72  PRO A HG3  4  
ATOM 6652  H HD2  . PRO A 1 72  ? -12.539 -13.736 4.437   1.00 0.00 ? 72  PRO A HD2  4  
ATOM 6653  H HD3  . PRO A 1 72  ? -11.154 -14.728 4.937   1.00 0.00 ? 72  PRO A HD3  4  
ATOM 6654  N N    . ASN A 1 73  ? -13.629 -14.781 1.109   1.00 0.00 ? 73  ASN A N    4  
ATOM 6655  C CA   . ASN A 1 73  ? -14.702 -14.527 0.154   1.00 0.00 ? 73  ASN A CA   4  
ATOM 6656  C C    . ASN A 1 73  ? -14.149 -13.938 -1.140  1.00 0.00 ? 73  ASN A C    4  
ATOM 6657  O O    . ASN A 1 73  ? -14.812 -13.143 -1.804  1.00 0.00 ? 73  ASN A O    4  
ATOM 6658  C CB   . ASN A 1 73  ? -15.737 -13.577 0.759   1.00 0.00 ? 73  ASN A CB   4  
ATOM 6659  C CG   . ASN A 1 73  ? -15.126 -12.620 1.764   1.00 0.00 ? 73  ASN A CG   4  
ATOM 6660  O OD1  . ASN A 1 73  ? -14.911 -11.444 1.467   1.00 0.00 ? 73  ASN A OD1  4  
ATOM 6661  N ND2  . ASN A 1 73  ? -14.843 -13.120 2.961   1.00 0.00 ? 73  ASN A ND2  4  
ATOM 6662  H H    . ASN A 1 73  ? -13.255 -14.032 1.617   1.00 0.00 ? 73  ASN A H    4  
ATOM 6663  H HA   . ASN A 1 73  ? -15.178 -15.470 -0.067  1.00 0.00 ? 73  ASN A HA   4  
ATOM 6664  H HB2  . ASN A 1 73  ? -16.190 -12.996 -0.032  1.00 0.00 ? 73  ASN A HB2  4  
ATOM 6665  H HB3  . ASN A 1 73  ? -16.500 -14.155 1.258   1.00 0.00 ? 73  ASN A HB3  4  
ATOM 6666  H HD21 . ASN A 1 73  ? -15.041 -14.066 3.127   1.00 0.00 ? 73  ASN A HD21 4  
ATOM 6667  H HD22 . ASN A 1 73  ? -14.447 -12.523 3.630   1.00 0.00 ? 73  ASN A HD22 4  
ATOM 6668  N N    . ASN A 1 74  ? -12.930 -14.335 -1.492  1.00 0.00 ? 74  ASN A N    4  
ATOM 6669  C CA   . ASN A 1 74  ? -12.288 -13.847 -2.706  1.00 0.00 ? 74  ASN A CA   4  
ATOM 6670  C C    . ASN A 1 74  ? -12.402 -12.329 -2.810  1.00 0.00 ? 74  ASN A C    4  
ATOM 6671  O O    . ASN A 1 74  ? -12.598 -11.785 -3.896  1.00 0.00 ? 74  ASN A O    4  
ATOM 6672  C CB   . ASN A 1 74  ? -12.916 -14.502 -3.939  1.00 0.00 ? 74  ASN A CB   4  
ATOM 6673  C CG   . ASN A 1 74  ? -11.973 -14.522 -5.126  1.00 0.00 ? 74  ASN A CG   4  
ATOM 6674  O OD1  . ASN A 1 74  ? -11.299 -13.532 -5.415  1.00 0.00 ? 74  ASN A OD1  4  
ATOM 6675  N ND2  . ASN A 1 74  ? -11.922 -15.652 -5.822  1.00 0.00 ? 74  ASN A ND2  4  
ATOM 6676  H H    . ASN A 1 74  ? -12.451 -14.972 -0.921  1.00 0.00 ? 74  ASN A H    4  
ATOM 6677  H HA   . ASN A 1 74  ? -11.244 -14.116 -2.660  1.00 0.00 ? 74  ASN A HA   4  
ATOM 6678  H HB2  . ASN A 1 74  ? -13.184 -15.521 -3.700  1.00 0.00 ? 74  ASN A HB2  4  
ATOM 6679  H HB3  . ASN A 1 74  ? -13.805 -13.955 -4.216  1.00 0.00 ? 74  ASN A HB3  4  
ATOM 6680  H HD21 . ASN A 1 74  ? -12.487 -16.399 -5.534  1.00 0.00 ? 74  ASN A HD21 4  
ATOM 6681  H HD22 . ASN A 1 74  ? -11.320 -15.692 -6.594  1.00 0.00 ? 74  ASN A HD22 4  
ATOM 6682  N N    . GLN A 1 75  ? -12.278 -11.653 -1.672  1.00 0.00 ? 75  GLN A N    4  
ATOM 6683  C CA   . GLN A 1 75  ? -12.367 -10.198 -1.635  1.00 0.00 ? 75  GLN A CA   4  
ATOM 6684  C C    . GLN A 1 75  ? -11.225 -9.604  -0.817  1.00 0.00 ? 75  GLN A C    4  
ATOM 6685  O O    . GLN A 1 75  ? -10.426 -10.331 -0.228  1.00 0.00 ? 75  GLN A O    4  
ATOM 6686  C CB   . GLN A 1 75  ? -13.711 -9.763  -1.047  1.00 0.00 ? 75  GLN A CB   4  
ATOM 6687  C CG   . GLN A 1 75  ? -14.833 -9.706  -2.071  1.00 0.00 ? 75  GLN A CG   4  
ATOM 6688  C CD   . GLN A 1 75  ? -16.133 -9.192  -1.485  1.00 0.00 ? 75  GLN A CD   4  
ATOM 6689  O OE1  . GLN A 1 75  ? -16.888 -9.942  -0.866  1.00 0.00 ? 75  GLN A OE1  4  
ATOM 6690  N NE2  . GLN A 1 75  ? -16.401 -7.905  -1.676  1.00 0.00 ? 75  GLN A NE2  4  
ATOM 6691  H H    . GLN A 1 75  ? -12.123 -12.144 -0.839  1.00 0.00 ? 75  GLN A H    4  
ATOM 6692  H HA   . GLN A 1 75  ? -12.294 -9.836  -2.649  1.00 0.00 ? 75  GLN A HA   4  
ATOM 6693  H HB2  . GLN A 1 75  ? -13.994 -10.461 -0.273  1.00 0.00 ? 75  GLN A HB2  4  
ATOM 6694  H HB3  . GLN A 1 75  ? -13.599 -8.781  -0.613  1.00 0.00 ? 75  GLN A HB3  4  
ATOM 6695  H HG2  . GLN A 1 75  ? -14.535 -9.051  -2.876  1.00 0.00 ? 75  GLN A HG2  4  
ATOM 6696  H HG3  . GLN A 1 75  ? -14.998 -10.700 -2.460  1.00 0.00 ? 75  GLN A HG3  4  
ATOM 6697  H HE21 . GLN A 1 75  ? -15.753 -7.368  -2.180  1.00 0.00 ? 75  GLN A HE21 4  
ATOM 6698  H HE22 . GLN A 1 75  ? -17.234 -7.547  -1.308  1.00 0.00 ? 75  GLN A HE22 4  
ATOM 6699  N N    . PHE A 1 76  ? -11.154 -8.277  -0.787  1.00 0.00 ? 76  PHE A N    4  
ATOM 6700  C CA   . PHE A 1 76  ? -10.109 -7.584  -0.043  1.00 0.00 ? 76  PHE A CA   4  
ATOM 6701  C C    . PHE A 1 76  ? -10.711 -6.689  1.036   1.00 0.00 ? 76  PHE A C    4  
ATOM 6702  O O    . PHE A 1 76  ? -11.734 -6.041  0.820   1.00 0.00 ? 76  PHE A O    4  
ATOM 6703  C CB   . PHE A 1 76  ? -9.246  -6.749  -0.991  1.00 0.00 ? 76  PHE A CB   4  
ATOM 6704  C CG   . PHE A 1 76  ? -8.351  -7.574  -1.871  1.00 0.00 ? 76  PHE A CG   4  
ATOM 6705  C CD1  . PHE A 1 76  ? -7.315  -8.315  -1.326  1.00 0.00 ? 76  PHE A CD1  4  
ATOM 6706  C CD2  . PHE A 1 76  ? -8.545  -7.607  -3.243  1.00 0.00 ? 76  PHE A CD2  4  
ATOM 6707  C CE1  . PHE A 1 76  ? -6.489  -9.075  -2.133  1.00 0.00 ? 76  PHE A CE1  4  
ATOM 6708  C CE2  . PHE A 1 76  ? -7.723  -8.366  -4.054  1.00 0.00 ? 76  PHE A CE2  4  
ATOM 6709  C CZ   . PHE A 1 76  ? -6.693  -9.100  -3.499  1.00 0.00 ? 76  PHE A CZ   4  
ATOM 6710  H H    . PHE A 1 76  ? -11.821 -7.751  -1.277  1.00 0.00 ? 76  PHE A H    4  
ATOM 6711  H HA   . PHE A 1 76  ? -9.489  -8.331  0.430   1.00 0.00 ? 76  PHE A HA   4  
ATOM 6712  H HB2  . PHE A 1 76  ? -9.890  -6.163  -1.630  1.00 0.00 ? 76  PHE A HB2  4  
ATOM 6713  H HB3  . PHE A 1 76  ? -8.624  -6.086  -0.410  1.00 0.00 ? 76  PHE A HB3  4  
ATOM 6714  H HD1  . PHE A 1 76  ? -7.154  -8.296  -0.257  1.00 0.00 ? 76  PHE A HD1  4  
ATOM 6715  H HD2  . PHE A 1 76  ? -9.349  -7.032  -3.678  1.00 0.00 ? 76  PHE A HD2  4  
ATOM 6716  H HE1  . PHE A 1 76  ? -5.685  -9.648  -1.695  1.00 0.00 ? 76  PHE A HE1  4  
ATOM 6717  H HE2  . PHE A 1 76  ? -7.884  -8.383  -5.122  1.00 0.00 ? 76  PHE A HE2  4  
ATOM 6718  H HZ   . PHE A 1 76  ? -6.049  -9.694  -4.130  1.00 0.00 ? 76  PHE A HZ   4  
ATOM 6719  N N    . MET A 1 77  ? -10.069 -6.661  2.199   1.00 0.00 ? 77  MET A N    4  
ATOM 6720  C CA   . MET A 1 77  ? -10.540 -5.845  3.313   1.00 0.00 ? 77  MET A CA   4  
ATOM 6721  C C    . MET A 1 77  ? -9.644  -4.627  3.513   1.00 0.00 ? 77  MET A C    4  
ATOM 6722  O O    . MET A 1 77  ? -8.445  -4.761  3.759   1.00 0.00 ? 77  MET A O    4  
ATOM 6723  C CB   . MET A 1 77  ? -10.587 -6.675  4.597   1.00 0.00 ? 77  MET A CB   4  
ATOM 6724  C CG   . MET A 1 77  ? -11.908 -7.396  4.807   1.00 0.00 ? 77  MET A CG   4  
ATOM 6725  S SD   . MET A 1 77  ? -11.846 -8.580  6.166   1.00 0.00 ? 77  MET A SD   4  
ATOM 6726  C CE   . MET A 1 77  ? -11.314 -7.523  7.511   1.00 0.00 ? 77  MET A CE   4  
ATOM 6727  H H    . MET A 1 77  ? -9.258  -7.199  2.312   1.00 0.00 ? 77  MET A H    4  
ATOM 6728  H HA   . MET A 1 77  ? -11.538 -5.508  3.076   1.00 0.00 ? 77  MET A HA   4  
ATOM 6729  H HB2  . MET A 1 77  ? -9.800  -7.414  4.563   1.00 0.00 ? 77  MET A HB2  4  
ATOM 6730  H HB3  . MET A 1 77  ? -10.420 -6.022  5.440   1.00 0.00 ? 77  MET A HB3  4  
ATOM 6731  H HG2  . MET A 1 77  ? -12.673 -6.664  5.021   1.00 0.00 ? 77  MET A HG2  4  
ATOM 6732  H HG3  . MET A 1 77  ? -12.163 -7.923  3.899   1.00 0.00 ? 77  MET A HG3  4  
ATOM 6733  H HE1  . MET A 1 77  ? -11.958 -6.658  7.565   1.00 0.00 ? 77  MET A HE1  4  
ATOM 6734  H HE2  . MET A 1 77  ? -11.366 -8.070  8.440   1.00 0.00 ? 77  MET A HE2  4  
ATOM 6735  H HE3  . MET A 1 77  ? -10.297 -7.204  7.337   1.00 0.00 ? 77  MET A HE3  4  
ATOM 6736  N N    . MET A 1 78  ? -10.232 -3.441  3.405   1.00 0.00 ? 78  MET A N    4  
ATOM 6737  C CA   . MET A 1 78  ? -9.486  -2.200  3.575   1.00 0.00 ? 78  MET A CA   4  
ATOM 6738  C C    . MET A 1 78  ? -9.978  -1.432  4.798   1.00 0.00 ? 78  MET A C    4  
ATOM 6739  O O    . MET A 1 78  ? -10.580 -0.366  4.672   1.00 0.00 ? 78  MET A O    4  
ATOM 6740  C CB   . MET A 1 78  ? -9.613  -1.327  2.325   1.00 0.00 ? 78  MET A CB   4  
ATOM 6741  C CG   . MET A 1 78  ? -8.409  -0.432  2.083   1.00 0.00 ? 78  MET A CG   4  
ATOM 6742  S SD   . MET A 1 78  ? -8.512  1.129   2.980   1.00 0.00 ? 78  MET A SD   4  
ATOM 6743  C CE   . MET A 1 78  ? -7.186  2.052   2.207   1.00 0.00 ? 78  MET A CE   4  
ATOM 6744  H H    . MET A 1 78  ? -11.191 -3.398  3.207   1.00 0.00 ? 78  MET A H    4  
ATOM 6745  H HA   . MET A 1 78  ? -8.447  -2.455  3.720   1.00 0.00 ? 78  MET A HA   4  
ATOM 6746  H HB2  . MET A 1 78  ? -9.737  -1.967  1.464   1.00 0.00 ? 78  MET A HB2  4  
ATOM 6747  H HB3  . MET A 1 78  ? -10.486 -0.700  2.425   1.00 0.00 ? 78  MET A HB3  4  
ATOM 6748  H HG2  . MET A 1 78  ? -7.519  -0.954  2.400   1.00 0.00 ? 78  MET A HG2  4  
ATOM 6749  H HG3  . MET A 1 78  ? -8.342  -0.220  1.026   1.00 0.00 ? 78  MET A HG3  4  
ATOM 6750  H HE1  . MET A 1 78  ? -6.325  2.060   2.859   1.00 0.00 ? 78  MET A HE1  4  
ATOM 6751  H HE2  . MET A 1 78  ? -6.924  1.587   1.269   1.00 0.00 ? 78  MET A HE2  4  
ATOM 6752  H HE3  . MET A 1 78  ? -7.511  3.067   2.029   1.00 0.00 ? 78  MET A HE3  4  
ATOM 6753  N N    . GLY A 1 79  ? -9.720  -1.982  5.980   1.00 0.00 ? 79  GLY A N    4  
ATOM 6754  C CA   . GLY A 1 79  ? -10.145 -1.335  7.208   1.00 0.00 ? 79  GLY A CA   4  
ATOM 6755  C C    . GLY A 1 79  ? -11.408 -1.948  7.779   1.00 0.00 ? 79  GLY A C    4  
ATOM 6756  O O    . GLY A 1 79  ? -11.402 -2.479  8.888   1.00 0.00 ? 79  GLY A O    4  
ATOM 6757  H H    . GLY A 1 79  ? -9.236  -2.834  6.019   1.00 0.00 ? 79  GLY A H    4  
ATOM 6758  H HA2  . GLY A 1 79  ? -9.354  -1.419  7.939   1.00 0.00 ? 79  GLY A HA2  4  
ATOM 6759  H HA3  . GLY A 1 79  ? -10.325 -0.289  7.006   1.00 0.00 ? 79  GLY A HA3  4  
ATOM 6760  N N    . GLY A 1 80  ? -12.496 -1.872  7.019   1.00 0.00 ? 80  GLY A N    4  
ATOM 6761  C CA   . GLY A 1 80  ? -13.758 -2.427  7.473   1.00 0.00 ? 80  GLY A CA   4  
ATOM 6762  C C    . GLY A 1 80  ? -14.779 -2.536  6.358   1.00 0.00 ? 80  GLY A C    4  
ATOM 6763  O O    . GLY A 1 80  ? -15.974 -2.343  6.580   1.00 0.00 ? 80  GLY A O    4  
ATOM 6764  H H    . GLY A 1 80  ? -12.442 -1.437  6.143   1.00 0.00 ? 80  GLY A H    4  
ATOM 6765  H HA2  . GLY A 1 80  ? -13.581 -3.410  7.882   1.00 0.00 ? 80  GLY A HA2  4  
ATOM 6766  H HA3  . GLY A 1 80  ? -14.158 -1.791  8.250   1.00 0.00 ? 80  GLY A HA3  4  
ATOM 6767  N N    . ARG A 1 81  ? -14.307 -2.844  5.155   1.00 0.00 ? 81  ARG A N    4  
ATOM 6768  C CA   . ARG A 1 81  ? -15.187 -2.976  4.000   1.00 0.00 ? 81  ARG A CA   4  
ATOM 6769  C C    . ARG A 1 81  ? -14.674 -4.050  3.045   1.00 0.00 ? 81  ARG A C    4  
ATOM 6770  O O    . ARG A 1 81  ? -13.467 -4.246  2.906   1.00 0.00 ? 81  ARG A O    4  
ATOM 6771  C CB   . ARG A 1 81  ? -15.303 -1.639  3.265   1.00 0.00 ? 81  ARG A CB   4  
ATOM 6772  C CG   . ARG A 1 81  ? -16.177 -0.623  3.983   1.00 0.00 ? 81  ARG A CG   4  
ATOM 6773  C CD   . ARG A 1 81  ? -17.625 -1.082  4.048   1.00 0.00 ? 81  ARG A CD   4  
ATOM 6774  N NE   . ARG A 1 81  ? -18.551 0.042   4.163   1.00 0.00 ? 81  ARG A NE   4  
ATOM 6775  C CZ   . ARG A 1 81  ? -18.762 0.708   5.293   1.00 0.00 ? 81  ARG A CZ   4  
ATOM 6776  N NH1  . ARG A 1 81  ? -18.117 0.365   6.399   1.00 0.00 ? 81  ARG A NH1  4  
ATOM 6777  N NH2  . ARG A 1 81  ? -19.620 1.719   5.317   1.00 0.00 ? 81  ARG A NH2  4  
ATOM 6778  H H    . ARG A 1 81  ? -13.344 -2.986  5.040   1.00 0.00 ? 81  ARG A H    4  
ATOM 6779  H HA   . ARG A 1 81  ? -16.164 -3.266  4.358   1.00 0.00 ? 81  ARG A HA   4  
ATOM 6780  H HB2  . ARG A 1 81  ? -14.316 -1.215  3.154   1.00 0.00 ? 81  ARG A HB2  4  
ATOM 6781  H HB3  . ARG A 1 81  ? -15.723 -1.815  2.287   1.00 0.00 ? 81  ARG A HB3  4  
ATOM 6782  H HG2  . ARG A 1 81  ? -15.807 -0.492  4.990   1.00 0.00 ? 81  ARG A HG2  4  
ATOM 6783  H HG3  . ARG A 1 81  ? -16.129 0.317   3.454   1.00 0.00 ? 81  ARG A HG3  4  
ATOM 6784  H HD2  . ARG A 1 81  ? -17.855 -1.635  3.149   1.00 0.00 ? 81  ARG A HD2  4  
ATOM 6785  H HD3  . ARG A 1 81  ? -17.747 -1.726  4.907   1.00 0.00 ? 81  ARG A HD3  4  
ATOM 6786  H HE   . ARG A 1 81  ? -19.038 0.312   3.357   1.00 0.00 ? 81  ARG A HE   4  
ATOM 6787  H HH11 . ARG A 1 81  ? -17.469 -0.397  6.383   1.00 0.00 ? 81  ARG A HH11 4  
ATOM 6788  H HH12 . ARG A 1 81  ? -18.277 0.869   7.248   1.00 0.00 ? 81  ARG A HH12 4  
ATOM 6789  H HH21 . ARG A 1 81  ? -20.108 1.981   4.485   1.00 0.00 ? 81  ARG A HH21 4  
ATOM 6790  H HH22 . ARG A 1 81  ? -19.779 2.220   6.168   1.00 0.00 ? 81  ARG A HH22 4  
ATOM 6791  N N    . TYR A 1 82  ? -15.599 -4.742  2.390   1.00 0.00 ? 82  TYR A N    4  
ATOM 6792  C CA   . TYR A 1 82  ? -15.241 -5.798  1.450   1.00 0.00 ? 82  TYR A CA   4  
ATOM 6793  C C    . TYR A 1 82  ? -15.367 -5.312  0.010   1.00 0.00 ? 82  TYR A C    4  
ATOM 6794  O O    . TYR A 1 82  ? -16.369 -4.705  -0.367  1.00 0.00 ? 82  TYR A O    4  
ATOM 6795  C CB   . TYR A 1 82  ? -16.131 -7.024  1.666   1.00 0.00 ? 82  TYR A CB   4  
ATOM 6796  C CG   . TYR A 1 82  ? -16.410 -7.321  3.121   1.00 0.00 ? 82  TYR A CG   4  
ATOM 6797  C CD1  . TYR A 1 82  ? -15.370 -7.482  4.030   1.00 0.00 ? 82  TYR A CD1  4  
ATOM 6798  C CD2  . TYR A 1 82  ? -17.713 -7.443  3.589   1.00 0.00 ? 82  TYR A CD2  4  
ATOM 6799  C CE1  . TYR A 1 82  ? -15.621 -7.754  5.361   1.00 0.00 ? 82  TYR A CE1  4  
ATOM 6800  C CE2  . TYR A 1 82  ? -17.972 -7.714  4.918   1.00 0.00 ? 82  TYR A CE2  4  
ATOM 6801  C CZ   . TYR A 1 82  ? -16.923 -7.869  5.800   1.00 0.00 ? 82  TYR A CZ   4  
ATOM 6802  O OH   . TYR A 1 82  ? -17.177 -8.140  7.125   1.00 0.00 ? 82  TYR A OH   4  
ATOM 6803  H H    . TYR A 1 82  ? -16.546 -4.540  2.542   1.00 0.00 ? 82  TYR A H    4  
ATOM 6804  H HA   . TYR A 1 82  ? -14.214 -6.074  1.637   1.00 0.00 ? 82  TYR A HA   4  
ATOM 6805  H HB2  . TYR A 1 82  ? -17.077 -6.865  1.173   1.00 0.00 ? 82  TYR A HB2  4  
ATOM 6806  H HB3  . TYR A 1 82  ? -15.648 -7.890  1.236   1.00 0.00 ? 82  TYR A HB3  4  
ATOM 6807  H HD1  . TYR A 1 82  ? -14.351 -7.391  3.682   1.00 0.00 ? 82  TYR A HD1  4  
ATOM 6808  H HD2  . TYR A 1 82  ? -18.532 -7.322  2.895   1.00 0.00 ? 82  TYR A HD2  4  
ATOM 6809  H HE1  . TYR A 1 82  ? -14.799 -7.875  6.052   1.00 0.00 ? 82  TYR A HE1  4  
ATOM 6810  H HE2  . TYR A 1 82  ? -18.992 -7.805  5.262   1.00 0.00 ? 82  TYR A HE2  4  
ATOM 6811  H HH   . TYR A 1 82  ? -16.415 -7.894  7.654   1.00 0.00 ? 82  TYR A HH   4  
ATOM 6812  N N    . TYR A 1 83  ? -14.342 -5.583  -0.790  1.00 0.00 ? 83  TYR A N    4  
ATOM 6813  C CA   . TYR A 1 83  ? -14.335 -5.172  -2.189  1.00 0.00 ? 83  TYR A CA   4  
ATOM 6814  C C    . TYR A 1 83  ? -13.972 -6.342  -3.099  1.00 0.00 ? 83  TYR A C    4  
ATOM 6815  O O    . TYR A 1 83  ? -13.266 -7.263  -2.692  1.00 0.00 ? 83  TYR A O    4  
ATOM 6816  C CB   . TYR A 1 83  ? -13.348 -4.023  -2.400  1.00 0.00 ? 83  TYR A CB   4  
ATOM 6817  C CG   . TYR A 1 83  ? -13.806 -2.714  -1.798  1.00 0.00 ? 83  TYR A CG   4  
ATOM 6818  C CD1  . TYR A 1 83  ? -13.658 -2.462  -0.440  1.00 0.00 ? 83  TYR A CD1  4  
ATOM 6819  C CD2  . TYR A 1 83  ? -14.387 -1.729  -2.588  1.00 0.00 ? 83  TYR A CD2  4  
ATOM 6820  C CE1  . TYR A 1 83  ? -14.075 -1.267  0.115   1.00 0.00 ? 83  TYR A CE1  4  
ATOM 6821  C CE2  . TYR A 1 83  ? -14.805 -0.531  -2.042  1.00 0.00 ? 83  TYR A CE2  4  
ATOM 6822  C CZ   . TYR A 1 83  ? -14.648 -0.305  -0.690  1.00 0.00 ? 83  TYR A CZ   4  
ATOM 6823  O OH   . TYR A 1 83  ? -15.065 0.887   -0.143  1.00 0.00 ? 83  TYR A OH   4  
ATOM 6824  H H    . TYR A 1 83  ? -13.571 -6.070  -0.432  1.00 0.00 ? 83  TYR A H    4  
ATOM 6825  H HA   . TYR A 1 83  ? -15.329 -4.831  -2.440  1.00 0.00 ? 83  TYR A HA   4  
ATOM 6826  H HB2  . TYR A 1 83  ? -12.403 -4.282  -1.949  1.00 0.00 ? 83  TYR A HB2  4  
ATOM 6827  H HB3  . TYR A 1 83  ? -13.206 -3.869  -3.460  1.00 0.00 ? 83  TYR A HB3  4  
ATOM 6828  H HD1  . TYR A 1 83  ? -13.209 -3.218  0.188   1.00 0.00 ? 83  TYR A HD1  4  
ATOM 6829  H HD2  . TYR A 1 83  ? -14.509 -1.909  -3.646  1.00 0.00 ? 83  TYR A HD2  4  
ATOM 6830  H HE1  . TYR A 1 83  ? -13.952 -1.090  1.173   1.00 0.00 ? 83  TYR A HE1  4  
ATOM 6831  H HE2  . TYR A 1 83  ? -15.254 0.223   -2.672  1.00 0.00 ? 83  TYR A HE2  4  
ATOM 6832  H HH   . TYR A 1 83  ? -14.853 1.606   -0.742  1.00 0.00 ? 83  TYR A HH   4  
ATOM 6833  N N    . ASN A 1 84  ? -14.462 -6.297  -4.334  1.00 0.00 ? 84  ASN A N    4  
ATOM 6834  C CA   . ASN A 1 84  ? -14.190 -7.352  -5.303  1.00 0.00 ? 84  ASN A CA   4  
ATOM 6835  C C    . ASN A 1 84  ? -12.707 -7.396  -5.658  1.00 0.00 ? 84  ASN A C    4  
ATOM 6836  O O    . ASN A 1 84  ? -12.089 -8.461  -5.654  1.00 0.00 ? 84  ASN A O    4  
ATOM 6837  C CB   . ASN A 1 84  ? -15.023 -7.138  -6.569  1.00 0.00 ? 84  ASN A CB   4  
ATOM 6838  C CG   . ASN A 1 84  ? -16.505 -7.348  -6.328  1.00 0.00 ? 84  ASN A CG   4  
ATOM 6839  O OD1  . ASN A 1 84  ? -16.901 -8.151  -5.483  1.00 0.00 ? 84  ASN A OD1  4  
ATOM 6840  N ND2  . ASN A 1 84  ? -17.334 -6.624  -7.072  1.00 0.00 ? 84  ASN A ND2  4  
ATOM 6841  H H    . ASN A 1 84  ? -15.019 -5.536  -4.600  1.00 0.00 ? 84  ASN A H    4  
ATOM 6842  H HA   . ASN A 1 84  ? -14.469 -8.294  -4.854  1.00 0.00 ? 84  ASN A HA   4  
ATOM 6843  H HB2  . ASN A 1 84  ? -14.875 -6.128  -6.923  1.00 0.00 ? 84  ASN A HB2  4  
ATOM 6844  H HB3  . ASN A 1 84  ? -14.698 -7.833  -7.328  1.00 0.00 ? 84  ASN A HB3  4  
ATOM 6845  H HD21 . ASN A 1 84  ? -16.948 -6.004  -7.725  1.00 0.00 ? 84  ASN A HD21 4  
ATOM 6846  H HD22 . ASN A 1 84  ? -18.297 -6.739  -6.936  1.00 0.00 ? 84  ASN A HD22 4  
ATOM 6847  N N    . SER A 1 85  ? -12.143 -6.232  -5.963  1.00 0.00 ? 85  SER A N    4  
ATOM 6848  C CA   . SER A 1 85  ? -10.733 -6.138  -6.324  1.00 0.00 ? 85  SER A CA   4  
ATOM 6849  C C    . SER A 1 85  ? -10.149 -4.797  -5.888  1.00 0.00 ? 85  SER A C    4  
ATOM 6850  O O    . SER A 1 85  ? -10.844 -3.780  -5.877  1.00 0.00 ? 85  SER A O    4  
ATOM 6851  C CB   . SER A 1 85  ? -10.557 -6.317  -7.833  1.00 0.00 ? 85  SER A CB   4  
ATOM 6852  O OG   . SER A 1 85  ? -9.197  -6.186  -8.207  1.00 0.00 ? 85  SER A OG   4  
ATOM 6853  H H    . SER A 1 85  ? -12.688 -5.418  -5.948  1.00 0.00 ? 85  SER A H    4  
ATOM 6854  H HA   . SER A 1 85  ? -10.206 -6.930  -5.812  1.00 0.00 ? 85  SER A HA   4  
ATOM 6855  H HB2  . SER A 1 85  ? -10.904 -7.299  -8.119  1.00 0.00 ? 85  SER A HB2  4  
ATOM 6856  H HB3  . SER A 1 85  ? -11.135 -5.566  -8.351  1.00 0.00 ? 85  SER A HB3  4  
ATOM 6857  H HG   . SER A 1 85  ? -9.038  -5.297  -8.532  1.00 0.00 ? 85  SER A HG   4  
ATOM 6858  N N    . ILE A 1 86  ? -8.870  -4.804  -5.530  1.00 0.00 ? 86  ILE A N    4  
ATOM 6859  C CA   . ILE A 1 86  ? -8.192  -3.589  -5.094  1.00 0.00 ? 86  ILE A CA   4  
ATOM 6860  C C    . ILE A 1 86  ? -8.644  -2.385  -5.913  1.00 0.00 ? 86  ILE A C    4  
ATOM 6861  O O    . ILE A 1 86  ? -8.946  -1.326  -5.365  1.00 0.00 ? 86  ILE A O    4  
ATOM 6862  C CB   . ILE A 1 86  ? -6.663  -3.727  -5.205  1.00 0.00 ? 86  ILE A CB   4  
ATOM 6863  C CG1  . ILE A 1 86  ? -6.138  -4.699  -4.146  1.00 0.00 ? 86  ILE A CG1  4  
ATOM 6864  C CG2  . ILE A 1 86  ? -5.996  -2.367  -5.061  1.00 0.00 ? 86  ILE A CG2  4  
ATOM 6865  C CD1  . ILE A 1 86  ? -4.661  -4.995  -4.277  1.00 0.00 ? 86  ILE A CD1  4  
ATOM 6866  H H    . ILE A 1 86  ? -8.370  -5.646  -5.560  1.00 0.00 ? 86  ILE A H    4  
ATOM 6867  H HA   . ILE A 1 86  ? -8.444  -3.421  -4.057  1.00 0.00 ? 86  ILE A HA   4  
ATOM 6868  H HB   . ILE A 1 86  ? -6.428  -4.114  -6.185  1.00 0.00 ? 86  ILE A HB   4  
ATOM 6869  H HG12 . ILE A 1 86  ? -6.306  -4.279  -3.167  1.00 0.00 ? 86  ILE A HG12 4  
ATOM 6870  H HG13 . ILE A 1 86  ? -6.674  -5.633  -4.229  1.00 0.00 ? 86  ILE A HG13 4  
ATOM 6871  H HG21 . ILE A 1 86  ? -4.925  -2.495  -5.004  1.00 0.00 ? 86  ILE A HG21 4  
ATOM 6872  H HG22 . ILE A 1 86  ? -6.240  -1.755  -5.917  1.00 0.00 ? 86  ILE A HG22 4  
ATOM 6873  H HG23 . ILE A 1 86  ? -6.349  -1.886  -4.161  1.00 0.00 ? 86  ILE A HG23 4  
ATOM 6874  H HD11 . ILE A 1 86  ? -4.259  -4.461  -5.126  1.00 0.00 ? 86  ILE A HD11 4  
ATOM 6875  H HD12 . ILE A 1 86  ? -4.149  -4.683  -3.379  1.00 0.00 ? 86  ILE A HD12 4  
ATOM 6876  H HD13 . ILE A 1 86  ? -4.518  -6.057  -4.421  1.00 0.00 ? 86  ILE A HD13 4  
ATOM 6877  N N    . GLY A 1 87  ? -8.689  -2.555  -7.231  1.00 0.00 ? 87  GLY A N    4  
ATOM 6878  C CA   . GLY A 1 87  ? -9.106  -1.474  -8.105  1.00 0.00 ? 87  GLY A CA   4  
ATOM 6879  C C    . GLY A 1 87  ? -10.415 -0.847  -7.667  1.00 0.00 ? 87  GLY A C    4  
ATOM 6880  O O    . GLY A 1 87  ? -10.528 0.377   -7.585  1.00 0.00 ? 87  GLY A O    4  
ATOM 6881  H H    . GLY A 1 87  ? -8.436  -3.421  -7.613  1.00 0.00 ? 87  GLY A H    4  
ATOM 6882  H HA2  . GLY A 1 87  ? -8.339  -0.714  -8.111  1.00 0.00 ? 87  GLY A HA2  4  
ATOM 6883  H HA3  . GLY A 1 87  ? -9.223  -1.861  -9.107  1.00 0.00 ? 87  GLY A HA3  4  
ATOM 6884  N N    . ASP A 1 88  ? -11.406 -1.685  -7.386  1.00 0.00 ? 88  ASP A N    4  
ATOM 6885  C CA   . ASP A 1 88  ? -12.714 -1.206  -6.955  1.00 0.00 ? 88  ASP A CA   4  
ATOM 6886  C C    . ASP A 1 88  ? -12.578 -0.227  -5.793  1.00 0.00 ? 88  ASP A C    4  
ATOM 6887  O O    . ASP A 1 88  ? -13.087 0.892   -5.849  1.00 0.00 ? 88  ASP A O    4  
ATOM 6888  C CB   . ASP A 1 88  ? -13.602 -2.382  -6.547  1.00 0.00 ? 88  ASP A CB   4  
ATOM 6889  C CG   . ASP A 1 88  ? -15.076 -2.026  -6.561  1.00 0.00 ? 88  ASP A CG   4  
ATOM 6890  O OD1  . ASP A 1 88  ? -15.480 -1.141  -5.778  1.00 0.00 ? 88  ASP A OD1  4  
ATOM 6891  O OD2  . ASP A 1 88  ? -15.826 -2.634  -7.354  1.00 0.00 ? 88  ASP A OD2  4  
ATOM 6892  H H    . ASP A 1 88  ? -11.254 -2.650  -7.471  1.00 0.00 ? 88  ASP A H    4  
ATOM 6893  H HA   . ASP A 1 88  ? -13.171 -0.694  -7.788  1.00 0.00 ? 88  ASP A HA   4  
ATOM 6894  H HB2  . ASP A 1 88  ? -13.442 -3.201  -7.233  1.00 0.00 ? 88  ASP A HB2  4  
ATOM 6895  H HB3  . ASP A 1 88  ? -13.336 -2.696  -5.548  1.00 0.00 ? 88  ASP A HB3  4  
ATOM 6896  N N    . ILE A 1 89  ? -11.889 -0.658  -4.741  1.00 0.00 ? 89  ILE A N    4  
ATOM 6897  C CA   . ILE A 1 89  ? -11.687 0.180   -3.566  1.00 0.00 ? 89  ILE A CA   4  
ATOM 6898  C C    . ILE A 1 89  ? -11.382 1.621   -3.964  1.00 0.00 ? 89  ILE A C    4  
ATOM 6899  O O    . ILE A 1 89  ? -11.910 2.563   -3.374  1.00 0.00 ? 89  ILE A O    4  
ATOM 6900  C CB   . ILE A 1 89  ? -10.540 -0.351  -2.686  1.00 0.00 ? 89  ILE A CB   4  
ATOM 6901  C CG1  . ILE A 1 89  ? -10.917 -1.704  -2.080  1.00 0.00 ? 89  ILE A CG1  4  
ATOM 6902  C CG2  . ILE A 1 89  ? -10.204 0.651   -1.591  1.00 0.00 ? 89  ILE A CG2  4  
ATOM 6903  C CD1  . ILE A 1 89  ? -9.736  -2.469  -1.526  1.00 0.00 ? 89  ILE A CD1  4  
ATOM 6904  H H    . ILE A 1 89  ? -11.508 -1.560  -4.756  1.00 0.00 ? 89  ILE A H    4  
ATOM 6905  H HA   . ILE A 1 89  ? -12.597 0.164   -2.984  1.00 0.00 ? 89  ILE A HA   4  
ATOM 6906  H HB   . ILE A 1 89  ? -9.666  -0.474  -3.308  1.00 0.00 ? 89  ILE A HB   4  
ATOM 6907  H HG12 . ILE A 1 89  ? -11.618 -1.548  -1.275  1.00 0.00 ? 89  ILE A HG12 4  
ATOM 6908  H HG13 . ILE A 1 89  ? -11.380 -2.314  -2.842  1.00 0.00 ? 89  ILE A HG13 4  
ATOM 6909  H HG21 . ILE A 1 89  ? -9.941  1.598   -2.039  1.00 0.00 ? 89  ILE A HG21 4  
ATOM 6910  H HG22 . ILE A 1 89  ? -11.062 0.782   -0.949  1.00 0.00 ? 89  ILE A HG22 4  
ATOM 6911  H HG23 . ILE A 1 89  ? -9.372  0.284   -1.010  1.00 0.00 ? 89  ILE A HG23 4  
ATOM 6912  H HD11 . ILE A 1 89  ? -8.972  -2.551  -2.284  1.00 0.00 ? 89  ILE A HD11 4  
ATOM 6913  H HD12 . ILE A 1 89  ? -9.339  -1.947  -0.668  1.00 0.00 ? 89  ILE A HD12 4  
ATOM 6914  H HD13 . ILE A 1 89  ? -10.055 -3.458  -1.229  1.00 0.00 ? 89  ILE A HD13 4  
ATOM 6915  N N    . ILE A 1 90  ? -10.528 1.783   -4.969  1.00 0.00 ? 90  ILE A N    4  
ATOM 6916  C CA   . ILE A 1 90  ? -10.156 3.108   -5.448  1.00 0.00 ? 90  ILE A CA   4  
ATOM 6917  C C    . ILE A 1 90  ? -11.344 3.814   -6.091  1.00 0.00 ? 90  ILE A C    4  
ATOM 6918  O O    . ILE A 1 90  ? -11.740 4.899   -5.664  1.00 0.00 ? 90  ILE A O    4  
ATOM 6919  C CB   . ILE A 1 90  ? -9.003  3.035   -6.468  1.00 0.00 ? 90  ILE A CB   4  
ATOM 6920  C CG1  . ILE A 1 90  ? -7.713  2.586   -5.780  1.00 0.00 ? 90  ILE A CG1  4  
ATOM 6921  C CG2  . ILE A 1 90  ? -8.808  4.384   -7.144  1.00 0.00 ? 90  ILE A CG2  4  
ATOM 6922  C CD1  . ILE A 1 90  ? -7.522  1.085   -5.773  1.00 0.00 ? 90  ILE A CD1  4  
ATOM 6923  H H    . ILE A 1 90  ? -10.141 0.992   -5.400  1.00 0.00 ? 90  ILE A H    4  
ATOM 6924  H HA   . ILE A 1 90  ? -9.822  3.687   -4.599  1.00 0.00 ? 90  ILE A HA   4  
ATOM 6925  H HB   . ILE A 1 90  ? -9.269  2.314   -7.226  1.00 0.00 ? 90  ILE A HB   4  
ATOM 6926  H HG12 . ILE A 1 90  ? -6.869  3.024   -6.289  1.00 0.00 ? 90  ILE A HG12 4  
ATOM 6927  H HG13 . ILE A 1 90  ? -7.724  2.924   -4.754  1.00 0.00 ? 90  ILE A HG13 4  
ATOM 6928  H HG21 . ILE A 1 90  ? -9.738  4.699   -7.592  1.00 0.00 ? 90  ILE A HG21 4  
ATOM 6929  H HG22 . ILE A 1 90  ? -8.498  5.112   -6.410  1.00 0.00 ? 90  ILE A HG22 4  
ATOM 6930  H HG23 . ILE A 1 90  ? -8.051  4.297   -7.908  1.00 0.00 ? 90  ILE A HG23 4  
ATOM 6931  H HD11 . ILE A 1 90  ? -6.474  0.855   -5.656  1.00 0.00 ? 90  ILE A HD11 4  
ATOM 6932  H HD12 . ILE A 1 90  ? -8.080  0.655   -4.954  1.00 0.00 ? 90  ILE A HD12 4  
ATOM 6933  H HD13 . ILE A 1 90  ? -7.878  0.673   -6.706  1.00 0.00 ? 90  ILE A HD13 4  
ATOM 6934  N N    . ASP A 1 91  ? -11.910 3.192   -7.119  1.00 0.00 ? 91  ASP A N    4  
ATOM 6935  C CA   . ASP A 1 91  ? -13.056 3.759   -7.820  1.00 0.00 ? 91  ASP A CA   4  
ATOM 6936  C C    . ASP A 1 91  ? -14.109 4.250   -6.831  1.00 0.00 ? 91  ASP A C    4  
ATOM 6937  O O    . ASP A 1 91  ? -14.753 5.276   -7.053  1.00 0.00 ? 91  ASP A O    4  
ATOM 6938  C CB   . ASP A 1 91  ? -13.668 2.722   -8.763  1.00 0.00 ? 91  ASP A CB   4  
ATOM 6939  C CG   . ASP A 1 91  ? -12.621 1.996   -9.584  1.00 0.00 ? 91  ASP A CG   4  
ATOM 6940  O OD1  . ASP A 1 91  ? -11.893 2.667   -10.345 1.00 0.00 ? 91  ASP A OD1  4  
ATOM 6941  O OD2  . ASP A 1 91  ? -12.528 0.756   -9.464  1.00 0.00 ? 91  ASP A OD2  4  
ATOM 6942  H H    . ASP A 1 91  ? -11.549 2.329   -7.413  1.00 0.00 ? 91  ASP A H    4  
ATOM 6943  H HA   . ASP A 1 91  ? -12.707 4.599   -8.401  1.00 0.00 ? 91  ASP A HA   4  
ATOM 6944  H HB2  . ASP A 1 91  ? -14.213 1.992   -8.182  1.00 0.00 ? 91  ASP A HB2  4  
ATOM 6945  H HB3  . ASP A 1 91  ? -14.349 3.218   -9.439  1.00 0.00 ? 91  ASP A HB3  4  
ATOM 6946  N N    . HIS A 1 92  ? -14.280 3.510   -5.740  1.00 0.00 ? 92  HIS A N    4  
ATOM 6947  C CA   . HIS A 1 92  ? -15.256 3.870   -4.718  1.00 0.00 ? 92  HIS A CA   4  
ATOM 6948  C C    . HIS A 1 92  ? -14.726 4.995   -3.834  1.00 0.00 ? 92  HIS A C    4  
ATOM 6949  O O    . HIS A 1 92  ? -15.476 5.882   -3.425  1.00 0.00 ? 92  HIS A O    4  
ATOM 6950  C CB   . HIS A 1 92  ? -15.600 2.652   -3.860  1.00 0.00 ? 92  HIS A CB   4  
ATOM 6951  C CG   . HIS A 1 92  ? -16.890 2.792   -3.111  1.00 0.00 ? 92  HIS A CG   4  
ATOM 6952  N ND1  . HIS A 1 92  ? -16.950 3.000   -1.749  1.00 0.00 ? 92  HIS A ND1  4  
ATOM 6953  C CD2  . HIS A 1 92  ? -18.172 2.755   -3.542  1.00 0.00 ? 92  HIS A CD2  4  
ATOM 6954  C CE1  . HIS A 1 92  ? -18.214 3.083   -1.374  1.00 0.00 ? 92  HIS A CE1  4  
ATOM 6955  N NE2  . HIS A 1 92  ? -18.976 2.938   -2.443  1.00 0.00 ? 92  HIS A NE2  4  
ATOM 6956  H H    . HIS A 1 92  ? -13.737 2.703   -5.620  1.00 0.00 ? 92  HIS A H    4  
ATOM 6957  H HA   . HIS A 1 92  ? -16.149 4.212   -5.217  1.00 0.00 ? 92  HIS A HA   4  
ATOM 6958  H HB2  . HIS A 1 92  ? -15.680 1.783   -4.497  1.00 0.00 ? 92  HIS A HB2  4  
ATOM 6959  H HB3  . HIS A 1 92  ? -14.812 2.492   -3.139  1.00 0.00 ? 92  HIS A HB3  4  
ATOM 6960  H HD1  . HIS A 1 92  ? -16.181 3.074   -1.147  1.00 0.00 ? 92  HIS A HD1  4  
ATOM 6961  H HD2  . HIS A 1 92  ? -18.504 2.608   -4.560  1.00 0.00 ? 92  HIS A HD2  4  
ATOM 6962  H HE1  . HIS A 1 92  ? -18.565 3.242   -0.366  1.00 0.00 ? 92  HIS A HE1  4  
ATOM 6963  N N    . TYR A 1 93  ? -13.431 4.952   -3.542  1.00 0.00 ? 93  TYR A N    4  
ATOM 6964  C CA   . TYR A 1 93  ? -12.802 5.966   -2.704  1.00 0.00 ? 93  TYR A CA   4  
ATOM 6965  C C    . TYR A 1 93  ? -12.775 7.317   -3.411  1.00 0.00 ? 93  TYR A C    4  
ATOM 6966  O O    . TYR A 1 93  ? -12.745 8.366   -2.768  1.00 0.00 ? 93  TYR A O    4  
ATOM 6967  C CB   . TYR A 1 93  ? -11.379 5.542   -2.335  1.00 0.00 ? 93  TYR A CB   4  
ATOM 6968  C CG   . TYR A 1 93  ? -11.300 4.727   -1.064  1.00 0.00 ? 93  TYR A CG   4  
ATOM 6969  C CD1  . TYR A 1 93  ? -12.368 3.939   -0.652  1.00 0.00 ? 93  TYR A CD1  4  
ATOM 6970  C CD2  . TYR A 1 93  ? -10.157 4.745   -0.274  1.00 0.00 ? 93  TYR A CD2  4  
ATOM 6971  C CE1  . TYR A 1 93  ? -12.301 3.194   0.509   1.00 0.00 ? 93  TYR A CE1  4  
ATOM 6972  C CE2  . TYR A 1 93  ? -10.080 4.002   0.888   1.00 0.00 ? 93  TYR A CE2  4  
ATOM 6973  C CZ   . TYR A 1 93  ? -11.154 3.229   1.275   1.00 0.00 ? 93  TYR A CZ   4  
ATOM 6974  O OH   . TYR A 1 93  ? -11.083 2.487   2.432   1.00 0.00 ? 93  TYR A OH   4  
ATOM 6975  H H    . TYR A 1 93  ? -12.885 4.220   -3.897  1.00 0.00 ? 93  TYR A H    4  
ATOM 6976  H HA   . TYR A 1 93  ? -13.386 6.057   -1.799  1.00 0.00 ? 93  TYR A HA   4  
ATOM 6977  H HB2  . TYR A 1 93  ? -10.970 4.946   -3.136  1.00 0.00 ? 93  TYR A HB2  4  
ATOM 6978  H HB3  . TYR A 1 93  ? -10.771 6.425   -2.202  1.00 0.00 ? 93  TYR A HB3  4  
ATOM 6979  H HD1  . TYR A 1 93  ? -13.264 3.914   -1.256  1.00 0.00 ? 93  TYR A HD1  4  
ATOM 6980  H HD2  . TYR A 1 93  ? -9.317  5.352   -0.580  1.00 0.00 ? 93  TYR A HD2  4  
ATOM 6981  H HE1  . TYR A 1 93  ? -13.142 2.588   0.812   1.00 0.00 ? 93  TYR A HE1  4  
ATOM 6982  H HE2  . TYR A 1 93  ? -9.183  4.029   1.489   1.00 0.00 ? 93  TYR A HE2  4  
ATOM 6983  H HH   . TYR A 1 93  ? -10.568 2.964   3.087   1.00 0.00 ? 93  TYR A HH   4  
ATOM 6984  N N    . ARG A 1 94  ? -12.786 7.282   -4.740  1.00 0.00 ? 94  ARG A N    4  
ATOM 6985  C CA   . ARG A 1 94  ? -12.762 8.503   -5.536  1.00 0.00 ? 94  ARG A CA   4  
ATOM 6986  C C    . ARG A 1 94  ? -13.815 9.493   -5.046  1.00 0.00 ? 94  ARG A C    4  
ATOM 6987  O O    . ARG A 1 94  ? -13.673 10.704  -5.218  1.00 0.00 ? 94  ARG A O    4  
ATOM 6988  C CB   . ARG A 1 94  ? -12.999 8.180   -7.012  1.00 0.00 ? 94  ARG A CB   4  
ATOM 6989  C CG   . ARG A 1 94  ? -11.758 7.682   -7.734  1.00 0.00 ? 94  ARG A CG   4  
ATOM 6990  C CD   . ARG A 1 94  ? -12.015 7.493   -9.220  1.00 0.00 ? 94  ARG A CD   4  
ATOM 6991  N NE   . ARG A 1 94  ? -12.426 8.736   -9.867  1.00 0.00 ? 94  ARG A NE   4  
ATOM 6992  C CZ   . ARG A 1 94  ? -13.681 9.171   -9.895  1.00 0.00 ? 94  ARG A CZ   4  
ATOM 6993  N NH1  . ARG A 1 94  ? -14.643 8.466   -9.314  1.00 0.00 ? 94  ARG A NH1  4  
ATOM 6994  N NH2  . ARG A 1 94  ? -13.977 10.312  -10.503 1.00 0.00 ? 94  ARG A NH2  4  
ATOM 6995  H H    . ARG A 1 94  ? -12.810 6.415   -5.195  1.00 0.00 ? 94  ARG A H    4  
ATOM 6996  H HA   . ARG A 1 94  ? -11.786 8.952   -5.427  1.00 0.00 ? 94  ARG A HA   4  
ATOM 6997  H HB2  . ARG A 1 94  ? -13.760 7.416   -7.084  1.00 0.00 ? 94  ARG A HB2  4  
ATOM 6998  H HB3  . ARG A 1 94  ? -13.347 9.071   -7.512  1.00 0.00 ? 94  ARG A HB3  4  
ATOM 6999  H HG2  . ARG A 1 94  ? -10.965 8.405   -7.607  1.00 0.00 ? 94  ARG A HG2  4  
ATOM 7000  H HG3  . ARG A 1 94  ? -11.458 6.737   -7.306  1.00 0.00 ? 94  ARG A HG3  4  
ATOM 7001  H HD2  . ARG A 1 94  ? -11.109 7.139   -9.687  1.00 0.00 ? 94  ARG A HD2  4  
ATOM 7002  H HD3  . ARG A 1 94  ? -12.796 6.758   -9.346  1.00 0.00 ? 94  ARG A HD3  4  
ATOM 7003  H HE   . ARG A 1 94  ? -11.732 9.273   -10.303 1.00 0.00 ? 94  ARG A HE   4  
ATOM 7004  H HH11 . ARG A 1 94  ? -14.423 7.606   -8.854  1.00 0.00 ? 94  ARG A HH11 4  
ATOM 7005  H HH12 . ARG A 1 94  ? -15.587 8.796   -9.335  1.00 0.00 ? 94  ARG A HH12 4  
ATOM 7006  H HH21 . ARG A 1 94  ? -13.254 10.846  -10.942 1.00 0.00 ? 94  ARG A HH21 4  
ATOM 7007  H HH22 . ARG A 1 94  ? -14.921 10.638  -10.523 1.00 0.00 ? 94  ARG A HH22 4  
ATOM 7008  N N    . LYS A 1 95  ? -14.872 8.969   -4.435  1.00 0.00 ? 95  LYS A N    4  
ATOM 7009  C CA   . LYS A 1 95  ? -15.950 9.805   -3.918  1.00 0.00 ? 95  LYS A CA   4  
ATOM 7010  C C    . LYS A 1 95  ? -15.903 9.874   -2.395  1.00 0.00 ? 95  LYS A C    4  
ATOM 7011  O O    . LYS A 1 95  ? -16.348 10.852  -1.796  1.00 0.00 ? 95  LYS A O    4  
ATOM 7012  C CB   . LYS A 1 95  ? -17.307 9.262   -4.373  1.00 0.00 ? 95  LYS A CB   4  
ATOM 7013  C CG   . LYS A 1 95  ? -17.899 8.234   -3.425  1.00 0.00 ? 95  LYS A CG   4  
ATOM 7014  C CD   . LYS A 1 95  ? -18.986 7.414   -4.099  1.00 0.00 ? 95  LYS A CD   4  
ATOM 7015  C CE   . LYS A 1 95  ? -20.307 8.166   -4.139  1.00 0.00 ? 95  LYS A CE   4  
ATOM 7016  N NZ   . LYS A 1 95  ? -21.448 7.267   -4.465  1.00 0.00 ? 95  LYS A NZ   4  
ATOM 7017  H H    . LYS A 1 95  ? -14.929 7.996   -4.327  1.00 0.00 ? 95  LYS A H    4  
ATOM 7018  H HA   . LYS A 1 95  ? -15.818 10.800  -4.316  1.00 0.00 ? 95  LYS A HA   4  
ATOM 7019  H HB2  . LYS A 1 95  ? -18.001 10.086  -4.456  1.00 0.00 ? 95  LYS A HB2  4  
ATOM 7020  H HB3  . LYS A 1 95  ? -17.190 8.801   -5.343  1.00 0.00 ? 95  LYS A HB3  4  
ATOM 7021  H HG2  . LYS A 1 95  ? -17.115 7.569   -3.094  1.00 0.00 ? 95  LYS A HG2  4  
ATOM 7022  H HG3  . LYS A 1 95  ? -18.323 8.745   -2.572  1.00 0.00 ? 95  LYS A HG3  4  
ATOM 7023  H HD2  . LYS A 1 95  ? -18.681 7.191   -5.111  1.00 0.00 ? 95  LYS A HD2  4  
ATOM 7024  H HD3  . LYS A 1 95  ? -19.122 6.493   -3.551  1.00 0.00 ? 95  LYS A HD3  4  
ATOM 7025  H HE2  . LYS A 1 95  ? -20.480 8.616   -3.173  1.00 0.00 ? 95  LYS A HE2  4  
ATOM 7026  H HE3  . LYS A 1 95  ? -20.244 8.940   -4.890  1.00 0.00 ? 95  LYS A HE3  4  
ATOM 7027  H HZ1  . LYS A 1 95  ? -22.148 7.284   -3.696  1.00 0.00 ? 95  LYS A HZ1  4  
ATOM 7028  H HZ2  . LYS A 1 95  ? -21.110 6.291   -4.588  1.00 0.00 ? 95  LYS A HZ2  4  
ATOM 7029  H HZ3  . LYS A 1 95  ? -21.908 7.576   -5.345  1.00 0.00 ? 95  LYS A HZ3  4  
ATOM 7030  N N    . GLU A 1 96  ? -15.358 8.831   -1.776  1.00 0.00 ? 96  GLU A N    4  
ATOM 7031  C CA   . GLU A 1 96  ? -15.253 8.775   -0.323  1.00 0.00 ? 96  GLU A CA   4  
ATOM 7032  C C    . GLU A 1 96  ? -13.842 9.134   0.134   1.00 0.00 ? 96  GLU A C    4  
ATOM 7033  O O    . GLU A 1 96  ? -12.882 8.424   -0.166  1.00 0.00 ? 96  GLU A O    4  
ATOM 7034  C CB   . GLU A 1 96  ? -15.626 7.381   0.185   1.00 0.00 ? 96  GLU A CB   4  
ATOM 7035  C CG   . GLU A 1 96  ? -17.125 7.156   0.298   1.00 0.00 ? 96  GLU A CG   4  
ATOM 7036  C CD   . GLU A 1 96  ? -17.728 6.595   -0.976  1.00 0.00 ? 96  GLU A CD   4  
ATOM 7037  O OE1  . GLU A 1 96  ? -17.077 5.744   -1.617  1.00 0.00 ? 96  GLU A OE1  4  
ATOM 7038  O OE2  . GLU A 1 96  ? -18.852 7.008   -1.331  1.00 0.00 ? 96  GLU A OE2  4  
ATOM 7039  H H    . GLU A 1 96  ? -15.020 8.081   -2.309  1.00 0.00 ? 96  GLU A H    4  
ATOM 7040  H HA   . GLU A 1 96  ? -15.945 9.495   0.088   1.00 0.00 ? 96  GLU A HA   4  
ATOM 7041  H HB2  . GLU A 1 96  ? -15.222 6.644   -0.493  1.00 0.00 ? 96  GLU A HB2  4  
ATOM 7042  H HB3  . GLU A 1 96  ? -15.188 7.238   1.161   1.00 0.00 ? 96  GLU A HB3  4  
ATOM 7043  H HG2  . GLU A 1 96  ? -17.312 6.461   1.102   1.00 0.00 ? 96  GLU A HG2  4  
ATOM 7044  H HG3  . GLU A 1 96  ? -17.602 8.099   0.520   1.00 0.00 ? 96  GLU A HG3  4  
ATOM 7045  N N    . GLN A 1 97  ? -13.725 10.240  0.861   1.00 0.00 ? 97  GLN A N    4  
ATOM 7046  C CA   . GLN A 1 97  ? -12.431 10.694  1.358   1.00 0.00 ? 97  GLN A CA   4  
ATOM 7047  C C    . GLN A 1 97  ? -11.699 9.566   2.077   1.00 0.00 ? 97  GLN A C    4  
ATOM 7048  O O    . GLN A 1 97  ? -12.144 9.090   3.122   1.00 0.00 ? 97  GLN A O    4  
ATOM 7049  C CB   . GLN A 1 97  ? -12.613 11.884  2.303   1.00 0.00 ? 97  GLN A CB   4  
ATOM 7050  C CG   . GLN A 1 97  ? -13.298 13.076  1.655   1.00 0.00 ? 97  GLN A CG   4  
ATOM 7051  C CD   . GLN A 1 97  ? -13.450 14.248  2.604   1.00 0.00 ? 97  GLN A CD   4  
ATOM 7052  O OE1  . GLN A 1 97  ? -13.735 14.070  3.788   1.00 0.00 ? 97  GLN A OE1  4  
ATOM 7053  N NE2  . GLN A 1 97  ? -13.260 15.457  2.087   1.00 0.00 ? 97  GLN A NE2  4  
ATOM 7054  H H    . GLN A 1 97  ? -14.527 10.764  1.067   1.00 0.00 ? 97  GLN A H    4  
ATOM 7055  H HA   . GLN A 1 97  ? -11.841 11.007  0.510   1.00 0.00 ? 97  GLN A HA   4  
ATOM 7056  H HB2  . GLN A 1 97  ? -13.207 11.570  3.148   1.00 0.00 ? 97  GLN A HB2  4  
ATOM 7057  H HB3  . GLN A 1 97  ? -11.642 12.201  2.653   1.00 0.00 ? 97  GLN A HB3  4  
ATOM 7058  H HG2  . GLN A 1 97  ? -12.712 13.394  0.805   1.00 0.00 ? 97  GLN A HG2  4  
ATOM 7059  H HG3  . GLN A 1 97  ? -14.280 12.772  1.321   1.00 0.00 ? 97  GLN A HG3  4  
ATOM 7060  H HE21 . GLN A 1 97  ? -13.036 15.522  1.135   1.00 0.00 ? 97  GLN A HE21 4  
ATOM 7061  H HE22 . GLN A 1 97  ? -13.352 16.232  2.677   1.00 0.00 ? 97  GLN A HE22 4  
ATOM 7062  N N    . ILE A 1 98  ? -10.573 9.143   1.511   1.00 0.00 ? 98  ILE A N    4  
ATOM 7063  C CA   . ILE A 1 98  ? -9.779  8.072   2.099   1.00 0.00 ? 98  ILE A CA   4  
ATOM 7064  C C    . ILE A 1 98  ? -9.127  8.522   3.402   1.00 0.00 ? 98  ILE A C    4  
ATOM 7065  O O    . ILE A 1 98  ? -8.759  7.700   4.241   1.00 0.00 ? 98  ILE A O    4  
ATOM 7066  C CB   . ILE A 1 98  ? -8.683  7.587   1.131   1.00 0.00 ? 98  ILE A CB   4  
ATOM 7067  C CG1  . ILE A 1 98  ? -7.820  6.515   1.799   1.00 0.00 ? 98  ILE A CG1  4  
ATOM 7068  C CG2  . ILE A 1 98  ? -7.825  8.757   0.674   1.00 0.00 ? 98  ILE A CG2  4  
ATOM 7069  C CD1  . ILE A 1 98  ? -6.854  5.840   0.851   1.00 0.00 ? 98  ILE A CD1  4  
ATOM 7070  H H    . ILE A 1 98  ? -10.270 9.562   0.679   1.00 0.00 ? 98  ILE A H    4  
ATOM 7071  H HA   . ILE A 1 98  ? -10.440 7.243   2.307   1.00 0.00 ? 98  ILE A HA   4  
ATOM 7072  H HB   . ILE A 1 98  ? -9.163  7.163   0.263   1.00 0.00 ? 98  ILE A HB   4  
ATOM 7073  H HG12 . ILE A 1 98  ? -7.245  6.966   2.592   1.00 0.00 ? 98  ILE A HG12 4  
ATOM 7074  H HG13 . ILE A 1 98  ? -8.464  5.753   2.216   1.00 0.00 ? 98  ILE A HG13 4  
ATOM 7075  H HG21 . ILE A 1 98  ? -6.808  8.608   1.006   1.00 0.00 ? 98  ILE A HG21 4  
ATOM 7076  H HG22 . ILE A 1 98  ? -7.845  8.819   -0.403  1.00 0.00 ? 98  ILE A HG22 4  
ATOM 7077  H HG23 . ILE A 1 98  ? -8.211  9.673   1.095   1.00 0.00 ? 98  ILE A HG23 4  
ATOM 7078  H HD11 . ILE A 1 98  ? -7.405  5.355   0.060   1.00 0.00 ? 98  ILE A HD11 4  
ATOM 7079  H HD12 . ILE A 1 98  ? -6.189  6.578   0.428   1.00 0.00 ? 98  ILE A HD12 4  
ATOM 7080  H HD13 . ILE A 1 98  ? -6.276  5.103   1.391   1.00 0.00 ? 98  ILE A HD13 4  
ATOM 7081  N N    . VAL A 1 99  ? -8.990  9.834   3.567   1.00 0.00 ? 99  VAL A N    4  
ATOM 7082  C CA   . VAL A 1 99  ? -8.386  10.394  4.769   1.00 0.00 ? 99  VAL A CA   4  
ATOM 7083  C C    . VAL A 1 99  ? -9.324  11.389  5.443   1.00 0.00 ? 99  VAL A C    4  
ATOM 7084  O O    . VAL A 1 99  ? -10.469 11.560  5.024   1.00 0.00 ? 99  VAL A O    4  
ATOM 7085  C CB   . VAL A 1 99  ? -7.052  11.097  4.452   1.00 0.00 ? 99  VAL A CB   4  
ATOM 7086  C CG1  . VAL A 1 99  ? -6.107  11.010  5.641   1.00 0.00 ? 99  VAL A CG1  4  
ATOM 7087  C CG2  . VAL A 1 99  ? -6.416  10.495  3.209   1.00 0.00 ? 99  VAL A CG2  4  
ATOM 7088  H H    . VAL A 1 99  ? -9.304  10.439  2.863   1.00 0.00 ? 99  VAL A H    4  
ATOM 7089  H HA   . VAL A 1 99  ? -8.187  9.582   5.453   1.00 0.00 ? 99  VAL A HA   4  
ATOM 7090  H HB   . VAL A 1 99  ? -7.256  12.140  4.258   1.00 0.00 ? 99  VAL A HB   4  
ATOM 7091  H HG11 . VAL A 1 99  ? -6.469  10.266  6.334   1.00 0.00 ? 99  VAL A HG11 4  
ATOM 7092  H HG12 . VAL A 1 99  ? -5.121  10.735  5.297   1.00 0.00 ? 99  VAL A HG12 4  
ATOM 7093  H HG13 . VAL A 1 99  ? -6.062  11.969  6.135   1.00 0.00 ? 99  VAL A HG13 4  
ATOM 7094  H HG21 . VAL A 1 99  ? -6.387  9.420   3.305   1.00 0.00 ? 99  VAL A HG21 4  
ATOM 7095  H HG22 . VAL A 1 99  ? -6.999  10.762  2.340   1.00 0.00 ? 99  VAL A HG22 4  
ATOM 7096  H HG23 . VAL A 1 99  ? -5.411  10.874  3.099   1.00 0.00 ? 99  VAL A HG23 4  
ATOM 7097  N N    . GLU A 1 100 ? -8.831  12.044  6.490   1.00 0.00 ? 100 GLU A N    4  
ATOM 7098  C CA   . GLU A 1 100 ? -9.627  13.022  7.222   1.00 0.00 ? 100 GLU A CA   4  
ATOM 7099  C C    . GLU A 1 100 ? -9.624  14.371  6.508   1.00 0.00 ? 100 GLU A C    4  
ATOM 7100  O O    . GLU A 1 100 ? -9.545  15.422  7.142   1.00 0.00 ? 100 GLU A O    4  
ATOM 7101  C CB   . GLU A 1 100 ? -9.091  13.186  8.646   1.00 0.00 ? 100 GLU A CB   4  
ATOM 7102  C CG   . GLU A 1 100 ? -7.705  13.806  8.707   1.00 0.00 ? 100 GLU A CG   4  
ATOM 7103  C CD   . GLU A 1 100 ? -7.481  14.610  9.974   1.00 0.00 ? 100 GLU A CD   4  
ATOM 7104  O OE1  . GLU A 1 100 ? -8.285  15.525  10.246  1.00 0.00 ? 100 GLU A OE1  4  
ATOM 7105  O OE2  . GLU A 1 100 ? -6.501  14.322  10.692  1.00 0.00 ? 100 GLU A OE2  4  
ATOM 7106  H H    . GLU A 1 100 ? -7.912  11.865  6.777   1.00 0.00 ? 100 GLU A H    4  
ATOM 7107  H HA   . GLU A 1 100 ? -10.641 12.656  7.269   1.00 0.00 ? 100 GLU A HA   4  
ATOM 7108  H HB2  . GLU A 1 100 ? -9.770  13.814  9.203   1.00 0.00 ? 100 GLU A HB2  4  
ATOM 7109  H HB3  . GLU A 1 100 ? -9.048  12.214  9.115   1.00 0.00 ? 100 GLU A HB3  4  
ATOM 7110  H HG2  . GLU A 1 100 ? -6.969  13.018  8.665   1.00 0.00 ? 100 GLU A HG2  4  
ATOM 7111  H HG3  . GLU A 1 100 ? -7.580  14.460  7.857   1.00 0.00 ? 100 GLU A HG3  4  
ATOM 7112  N N    . GLY A 1 101 ? -9.709  14.331  5.181   1.00 0.00 ? 101 GLY A N    4  
ATOM 7113  C CA   . GLY A 1 101 ? -9.713  15.555  4.402   1.00 0.00 ? 101 GLY A CA   4  
ATOM 7114  C C    . GLY A 1 101 ? -8.866  15.448  3.149   1.00 0.00 ? 101 GLY A C    4  
ATOM 7115  O O    . GLY A 1 101 ? -8.213  16.412  2.748   1.00 0.00 ? 101 GLY A O    4  
ATOM 7116  H H    . GLY A 1 101 ? -9.769  13.464  4.729   1.00 0.00 ? 101 GLY A H    4  
ATOM 7117  H HA2  . GLY A 1 101 ? -10.729 15.785  4.118   1.00 0.00 ? 101 GLY A HA2  4  
ATOM 7118  H HA3  . GLY A 1 101 ? -9.330  16.359  5.013   1.00 0.00 ? 101 GLY A HA3  4  
ATOM 7119  N N    . TYR A 1 102 ? -8.876  14.273  2.530   1.00 0.00 ? 102 TYR A N    4  
ATOM 7120  C CA   . TYR A 1 102 ? -8.100  14.042  1.317   1.00 0.00 ? 102 TYR A CA   4  
ATOM 7121  C C    . TYR A 1 102 ? -8.773  12.999  0.430   1.00 0.00 ? 102 TYR A C    4  
ATOM 7122  O O    . TYR A 1 102 ? -9.326  12.015  0.919   1.00 0.00 ? 102 TYR A O    4  
ATOM 7123  C CB   . TYR A 1 102 ? -6.683  13.587  1.673   1.00 0.00 ? 102 TYR A CB   4  
ATOM 7124  C CG   . TYR A 1 102 ? -5.810  14.695  2.217   1.00 0.00 ? 102 TYR A CG   4  
ATOM 7125  C CD1  . TYR A 1 102 ? -5.803  14.999  3.572   1.00 0.00 ? 102 TYR A CD1  4  
ATOM 7126  C CD2  . TYR A 1 102 ? -4.991  15.437  1.375   1.00 0.00 ? 102 TYR A CD2  4  
ATOM 7127  C CE1  . TYR A 1 102 ? -5.007  16.011  4.074   1.00 0.00 ? 102 TYR A CE1  4  
ATOM 7128  C CE2  . TYR A 1 102 ? -4.191  16.450  1.868   1.00 0.00 ? 102 TYR A CE2  4  
ATOM 7129  C CZ   . TYR A 1 102 ? -4.203  16.733  3.217   1.00 0.00 ? 102 TYR A CZ   4  
ATOM 7130  O OH   . TYR A 1 102 ? -3.408  17.741  3.713   1.00 0.00 ? 102 TYR A OH   4  
ATOM 7131  H H    . TYR A 1 102 ? -9.416  13.543  2.897   1.00 0.00 ? 102 TYR A H    4  
ATOM 7132  H HA   . TYR A 1 102 ? -8.042  14.975  0.777   1.00 0.00 ? 102 TYR A HA   4  
ATOM 7133  H HB2  . TYR A 1 102 ? -6.738  12.811  2.421   1.00 0.00 ? 102 TYR A HB2  4  
ATOM 7134  H HB3  . TYR A 1 102 ? -6.206  13.193  0.787   1.00 0.00 ? 102 TYR A HB3  4  
ATOM 7135  H HD1  . TYR A 1 102 ? -6.434  14.430  4.240   1.00 0.00 ? 102 TYR A HD1  4  
ATOM 7136  H HD2  . TYR A 1 102 ? -4.984  15.213  0.318   1.00 0.00 ? 102 TYR A HD2  4  
ATOM 7137  H HE1  . TYR A 1 102 ? -5.016  16.232  5.131   1.00 0.00 ? 102 TYR A HE1  4  
ATOM 7138  H HE2  . TYR A 1 102 ? -3.561  17.017  1.197   1.00 0.00 ? 102 TYR A HE2  4  
ATOM 7139  H HH   . TYR A 1 102 ? -2.561  17.732  3.261   1.00 0.00 ? 102 TYR A HH   4  
ATOM 7140  N N    . TYR A 1 103 ? -8.721  13.224  -0.878  1.00 0.00 ? 103 TYR A N    4  
ATOM 7141  C CA   . TYR A 1 103 ? -9.327  12.306  -1.836  1.00 0.00 ? 103 TYR A CA   4  
ATOM 7142  C C    . TYR A 1 103 ? -8.261  11.641  -2.702  1.00 0.00 ? 103 TYR A C    4  
ATOM 7143  O O    . TYR A 1 103 ? -7.085  12.001  -2.646  1.00 0.00 ? 103 TYR A O    4  
ATOM 7144  C CB   . TYR A 1 103 ? -10.330 13.048  -2.721  1.00 0.00 ? 103 TYR A CB   4  
ATOM 7145  C CG   . TYR A 1 103 ? -11.719 13.123  -2.130  1.00 0.00 ? 103 TYR A CG   4  
ATOM 7146  C CD1  . TYR A 1 103 ? -12.448 11.969  -1.869  1.00 0.00 ? 103 TYR A CD1  4  
ATOM 7147  C CD2  . TYR A 1 103 ? -12.304 14.348  -1.832  1.00 0.00 ? 103 TYR A CD2  4  
ATOM 7148  C CE1  . TYR A 1 103 ? -13.718 12.032  -1.330  1.00 0.00 ? 103 TYR A CE1  4  
ATOM 7149  C CE2  . TYR A 1 103 ? -13.573 14.421  -1.291  1.00 0.00 ? 103 TYR A CE2  4  
ATOM 7150  C CZ   . TYR A 1 103 ? -14.276 13.261  -1.042  1.00 0.00 ? 103 TYR A CZ   4  
ATOM 7151  O OH   . TYR A 1 103 ? -15.541 13.328  -0.504  1.00 0.00 ? 103 TYR A OH   4  
ATOM 7152  H H    . TYR A 1 103 ? -8.266  14.026  -1.208  1.00 0.00 ? 103 TYR A H    4  
ATOM 7153  H HA   . TYR A 1 103 ? -9.849  11.543  -1.279  1.00 0.00 ? 103 TYR A HA   4  
ATOM 7154  H HB2  . TYR A 1 103 ? -9.982  14.058  -2.879  1.00 0.00 ? 103 TYR A HB2  4  
ATOM 7155  H HB3  . TYR A 1 103 ? -10.400 12.544  -3.674  1.00 0.00 ? 103 TYR A HB3  4  
ATOM 7156  H HD1  . TYR A 1 103 ? -12.007 11.008  -2.095  1.00 0.00 ? 103 TYR A HD1  4  
ATOM 7157  H HD2  . TYR A 1 103 ? -11.751 15.255  -2.028  1.00 0.00 ? 103 TYR A HD2  4  
ATOM 7158  H HE1  . TYR A 1 103 ? -14.269 11.124  -1.134  1.00 0.00 ? 103 TYR A HE1  4  
ATOM 7159  H HE2  . TYR A 1 103 ? -14.011 15.382  -1.066  1.00 0.00 ? 103 TYR A HE2  4  
ATOM 7160  H HH   . TYR A 1 103 ? -15.749 14.241  -0.290  1.00 0.00 ? 103 TYR A HH   4  
ATOM 7161  N N    . LEU A 1 104 ? -8.682  10.670  -3.504  1.00 0.00 ? 104 LEU A N    4  
ATOM 7162  C CA   . LEU A 1 104 ? -7.766  9.953   -4.385  1.00 0.00 ? 104 LEU A CA   4  
ATOM 7163  C C    . LEU A 1 104 ? -7.818  10.518  -5.801  1.00 0.00 ? 104 LEU A C    4  
ATOM 7164  O O    . LEU A 1 104 ? -8.728  10.209  -6.571  1.00 0.00 ? 104 LEU A O    4  
ATOM 7165  C CB   . LEU A 1 104 ? -8.108  8.462   -4.405  1.00 0.00 ? 104 LEU A CB   4  
ATOM 7166  C CG   . LEU A 1 104 ? -7.663  7.655   -3.185  1.00 0.00 ? 104 LEU A CG   4  
ATOM 7167  C CD1  . LEU A 1 104 ? -8.160  6.221   -3.284  1.00 0.00 ? 104 LEU A CD1  4  
ATOM 7168  C CD2  . LEU A 1 104 ? -6.147  7.687   -3.049  1.00 0.00 ? 104 LEU A CD2  4  
ATOM 7169  H H    . LEU A 1 104 ? -9.632  10.427  -3.505  1.00 0.00 ? 104 LEU A H    4  
ATOM 7170  H HA   . LEU A 1 104 ? -6.767  10.080  -3.996  1.00 0.00 ? 104 LEU A HA   4  
ATOM 7171  H HB2  . LEU A 1 104 ? -9.180  8.370   -4.489  1.00 0.00 ? 104 LEU A HB2  4  
ATOM 7172  H HB3  . LEU A 1 104 ? -7.642  8.029   -5.279  1.00 0.00 ? 104 LEU A HB3  4  
ATOM 7173  H HG   . LEU A 1 104 ? -8.089  8.095   -2.295  1.00 0.00 ? 104 LEU A HG   4  
ATOM 7174  H HD11 . LEU A 1 104 ? -9.017  6.182   -3.939  1.00 0.00 ? 104 LEU A HD11 4  
ATOM 7175  H HD12 . LEU A 1 104 ? -8.441  5.870   -2.302  1.00 0.00 ? 104 LEU A HD12 4  
ATOM 7176  H HD13 . LEU A 1 104 ? -7.375  5.594   -3.679  1.00 0.00 ? 104 LEU A HD13 4  
ATOM 7177  H HD21 . LEU A 1 104 ? -5.760  6.681   -3.109  1.00 0.00 ? 104 LEU A HD21 4  
ATOM 7178  H HD22 . LEU A 1 104 ? -5.881  8.119   -2.094  1.00 0.00 ? 104 LEU A HD22 4  
ATOM 7179  H HD23 . LEU A 1 104 ? -5.727  8.284   -3.844  1.00 0.00 ? 104 LEU A HD23 4  
ATOM 7180  N N    . LYS A 1 105 ? -6.835  11.346  -6.139  1.00 0.00 ? 105 LYS A N    4  
ATOM 7181  C CA   . LYS A 1 105 ? -6.766  11.951  -7.463  1.00 0.00 ? 105 LYS A CA   4  
ATOM 7182  C C    . LYS A 1 105 ? -6.300  10.936  -8.502  1.00 0.00 ? 105 LYS A C    4  
ATOM 7183  O O    . LYS A 1 105 ? -7.052  10.568  -9.403  1.00 0.00 ? 105 LYS A O    4  
ATOM 7184  C CB   . LYS A 1 105 ? -5.818  13.153  -7.448  1.00 0.00 ? 105 LYS A CB   4  
ATOM 7185  C CG   . LYS A 1 105 ? -6.480  14.444  -7.000  1.00 0.00 ? 105 LYS A CG   4  
ATOM 7186  C CD   . LYS A 1 105 ? -7.306  15.063  -8.115  1.00 0.00 ? 105 LYS A CD   4  
ATOM 7187  C CE   . LYS A 1 105 ? -8.216  16.163  -7.591  1.00 0.00 ? 105 LYS A CE   4  
ATOM 7188  N NZ   . LYS A 1 105 ? -8.745  17.017  -8.690  1.00 0.00 ? 105 LYS A NZ   4  
ATOM 7189  H H    . LYS A 1 105 ? -6.138  11.553  -5.481  1.00 0.00 ? 105 LYS A H    4  
ATOM 7190  H HA   . LYS A 1 105 ? -7.757  12.289  -7.726  1.00 0.00 ? 105 LYS A HA   4  
ATOM 7191  H HB2  . LYS A 1 105 ? -4.998  12.941  -6.776  1.00 0.00 ? 105 LYS A HB2  4  
ATOM 7192  H HB3  . LYS A 1 105 ? -5.426  13.300  -8.444  1.00 0.00 ? 105 LYS A HB3  4  
ATOM 7193  H HG2  . LYS A 1 105 ? -7.127  14.235  -6.161  1.00 0.00 ? 105 LYS A HG2  4  
ATOM 7194  H HG3  . LYS A 1 105 ? -5.714  15.146  -6.701  1.00 0.00 ? 105 LYS A HG3  4  
ATOM 7195  H HD2  . LYS A 1 105 ? -6.641  15.483  -8.854  1.00 0.00 ? 105 LYS A HD2  4  
ATOM 7196  H HD3  . LYS A 1 105 ? -7.913  14.293  -8.571  1.00 0.00 ? 105 LYS A HD3  4  
ATOM 7197  H HE2  . LYS A 1 105 ? -9.044  15.709  -7.069  1.00 0.00 ? 105 LYS A HE2  4  
ATOM 7198  H HE3  . LYS A 1 105 ? -7.654  16.780  -6.905  1.00 0.00 ? 105 LYS A HE3  4  
ATOM 7199  H HZ1  . LYS A 1 105 ? -9.666  16.655  -9.012  1.00 0.00 ? 105 LYS A HZ1  4  
ATOM 7200  H HZ2  . LYS A 1 105 ? -8.085  17.014  -9.493  1.00 0.00 ? 105 LYS A HZ2  4  
ATOM 7201  H HZ3  . LYS A 1 105 ? -8.866  17.994  -8.357  1.00 0.00 ? 105 LYS A HZ3  4  
ATOM 7202  N N    . GLU A 1 106 ? -5.056  10.487  -8.368  1.00 0.00 ? 106 GLU A N    4  
ATOM 7203  C CA   . GLU A 1 106 ? -4.492  9.514   -9.296  1.00 0.00 ? 106 GLU A CA   4  
ATOM 7204  C C    . GLU A 1 106 ? -3.309  8.784   -8.666  1.00 0.00 ? 106 GLU A C    4  
ATOM 7205  O O    . GLU A 1 106 ? -2.526  9.356   -7.907  1.00 0.00 ? 106 GLU A O    4  
ATOM 7206  C CB   . GLU A 1 106 ? -4.050  10.204  -10.588 1.00 0.00 ? 106 GLU A CB   4  
ATOM 7207  C CG   . GLU A 1 106 ? -2.912  11.192  -10.391 1.00 0.00 ? 106 GLU A CG   4  
ATOM 7208  C CD   . GLU A 1 106 ? -2.315  11.662  -11.703 1.00 0.00 ? 106 GLU A CD   4  
ATOM 7209  O OE1  . GLU A 1 106 ? -3.040  12.308  -12.488 1.00 0.00 ? 106 GLU A OE1  4  
ATOM 7210  O OE2  . GLU A 1 106 ? -1.121  11.384  -11.945 1.00 0.00 ? 106 GLU A OE2  4  
ATOM 7211  H H    . GLU A 1 106 ? -4.505  10.818  -7.629  1.00 0.00 ? 106 GLU A H    4  
ATOM 7212  H HA   . GLU A 1 106 ? -5.261  8.793   -9.529  1.00 0.00 ? 106 GLU A HA   4  
ATOM 7213  H HB2  . GLU A 1 106 ? -3.729  9.451   -11.292 1.00 0.00 ? 106 GLU A HB2  4  
ATOM 7214  H HB3  . GLU A 1 106 ? -4.893  10.737  -11.003 1.00 0.00 ? 106 GLU A HB3  4  
ATOM 7215  H HG2  . GLU A 1 106 ? -3.286  12.051  -9.856  1.00 0.00 ? 106 GLU A HG2  4  
ATOM 7216  H HG3  . GLU A 1 106 ? -2.136  10.716  -9.809  1.00 0.00 ? 106 GLU A HG3  4  
ATOM 7217  N N    . PRO A 1 107 ? -3.175  7.488   -8.986  1.00 0.00 ? 107 PRO A N    4  
ATOM 7218  C CA   . PRO A 1 107 ? -2.091  6.651   -8.463  1.00 0.00 ? 107 PRO A CA   4  
ATOM 7219  C C    . PRO A 1 107 ? -0.732  7.036   -9.039  1.00 0.00 ? 107 PRO A C    4  
ATOM 7220  O O    . PRO A 1 107 ? -0.621  7.988   -9.812  1.00 0.00 ? 107 PRO A O    4  
ATOM 7221  C CB   . PRO A 1 107 ? -2.483  5.242   -8.913  1.00 0.00 ? 107 PRO A CB   4  
ATOM 7222  C CG   . PRO A 1 107 ? -3.334  5.451   -10.118 1.00 0.00 ? 107 PRO A CG   4  
ATOM 7223  C CD   . PRO A 1 107 ? -4.071  6.741   -9.885  1.00 0.00 ? 107 PRO A CD   4  
ATOM 7224  H HA   . PRO A 1 107 ? -2.047  6.688   -7.385  1.00 0.00 ? 107 PRO A HA   4  
ATOM 7225  H HB2  . PRO A 1 107 ? -1.593  4.676   -9.150  1.00 0.00 ? 107 PRO A HB2  4  
ATOM 7226  H HB3  . PRO A 1 107 ? -3.030  4.748   -8.124  1.00 0.00 ? 107 PRO A HB3  4  
ATOM 7227  H HG2  . PRO A 1 107 ? -2.713  5.527   -10.997 1.00 0.00 ? 107 PRO A HG2  4  
ATOM 7228  H HG3  . PRO A 1 107 ? -4.033  4.634   -10.219 1.00 0.00 ? 107 PRO A HG3  4  
ATOM 7229  H HD2  . PRO A 1 107 ? -4.211  7.269   -10.817 1.00 0.00 ? 107 PRO A HD2  4  
ATOM 7230  H HD3  . PRO A 1 107 ? -5.022  6.552   -9.410  1.00 0.00 ? 107 PRO A HD3  4  
ATOM 7231  N N    . VAL A 1 108 ? 0.299   6.289   -8.659  1.00 0.00 ? 108 VAL A N    4  
ATOM 7232  C CA   . VAL A 1 108 ? 1.651   6.550   -9.139  1.00 0.00 ? 108 VAL A CA   4  
ATOM 7233  C C    . VAL A 1 108 ? 2.000   5.647   -10.316 1.00 0.00 ? 108 VAL A C    4  
ATOM 7234  O O    . VAL A 1 108 ? 1.812   4.431   -10.275 1.00 0.00 ? 108 VAL A O    4  
ATOM 7235  C CB   . VAL A 1 108 ? 2.692   6.347   -8.023  1.00 0.00 ? 108 VAL A CB   4  
ATOM 7236  C CG1  . VAL A 1 108 ? 4.089   6.217   -8.612  1.00 0.00 ? 108 VAL A CG1  4  
ATOM 7237  C CG2  . VAL A 1 108 ? 2.631   7.491   -7.023  1.00 0.00 ? 108 VAL A CG2  4  
ATOM 7238  H H    . VAL A 1 108 ? 0.148   5.543   -8.041  1.00 0.00 ? 108 VAL A H    4  
ATOM 7239  H HA   . VAL A 1 108 ? 1.697   7.580   -9.462  1.00 0.00 ? 108 VAL A HA   4  
ATOM 7240  H HB   . VAL A 1 108 ? 2.458   5.429   -7.503  1.00 0.00 ? 108 VAL A HB   4  
ATOM 7241  H HG11 . VAL A 1 108 ? 4.070   6.516   -9.650  1.00 0.00 ? 108 VAL A HG11 4  
ATOM 7242  H HG12 . VAL A 1 108 ? 4.771   6.851   -8.066  1.00 0.00 ? 108 VAL A HG12 4  
ATOM 7243  H HG13 . VAL A 1 108 ? 4.415   5.189   -8.541  1.00 0.00 ? 108 VAL A HG13 4  
ATOM 7244  H HG21 . VAL A 1 108 ? 3.594   7.604   -6.547  1.00 0.00 ? 108 VAL A HG21 4  
ATOM 7245  H HG22 . VAL A 1 108 ? 2.374   8.406   -7.537  1.00 0.00 ? 108 VAL A HG22 4  
ATOM 7246  H HG23 . VAL A 1 108 ? 1.883   7.277   -6.275  1.00 0.00 ? 108 VAL A HG23 4  
ATOM 7247  N N    . PRO A 1 109 ? 2.522   6.253   -11.393 1.00 0.00 ? 109 PRO A N    4  
ATOM 7248  C CA   . PRO A 1 109 ? 2.911   5.522   -12.603 1.00 0.00 ? 109 PRO A CA   4  
ATOM 7249  C C    . PRO A 1 109 ? 4.137   4.644   -12.381 1.00 0.00 ? 109 PRO A C    4  
ATOM 7250  O O    . PRO A 1 109 ? 4.782   4.715   -11.335 1.00 0.00 ? 109 PRO A O    4  
ATOM 7251  C CB   . PRO A 1 109 ? 3.224   6.635   -13.605 1.00 0.00 ? 109 PRO A CB   4  
ATOM 7252  C CG   . PRO A 1 109 ? 3.600   7.807   -12.764 1.00 0.00 ? 109 PRO A CG   4  
ATOM 7253  C CD   . PRO A 1 109 ? 2.774   7.699   -11.512 1.00 0.00 ? 109 PRO A CD   4  
ATOM 7254  H HA   . PRO A 1 109 ? 2.099   4.916   -12.978 1.00 0.00 ? 109 PRO A HA   4  
ATOM 7255  H HB2  . PRO A 1 109 ? 4.041   6.329   -14.244 1.00 0.00 ? 109 PRO A HB2  4  
ATOM 7256  H HB3  . PRO A 1 109 ? 2.350   6.843   -14.204 1.00 0.00 ? 109 PRO A HB3  4  
ATOM 7257  H HG2  . PRO A 1 109 ? 4.651   7.766   -12.525 1.00 0.00 ? 109 PRO A HG2  4  
ATOM 7258  H HG3  . PRO A 1 109 ? 3.368   8.723   -13.288 1.00 0.00 ? 109 PRO A HG3  4  
ATOM 7259  H HD2  . PRO A 1 109 ? 3.330   8.065   -10.661 1.00 0.00 ? 109 PRO A HD2  4  
ATOM 7260  H HD3  . PRO A 1 109 ? 1.848   8.243   -11.622 1.00 0.00 ? 109 PRO A HD3  4  
ATOM 7261  N N    . MET A 1 110 ? 4.455   3.817   -13.372 1.00 0.00 ? 110 MET A N    4  
ATOM 7262  C CA   . MET A 1 110 ? 5.606   2.926   -13.284 1.00 0.00 ? 110 MET A CA   4  
ATOM 7263  C C    . MET A 1 110 ? 6.883   3.645   -13.706 1.00 0.00 ? 110 MET A C    4  
ATOM 7264  O O    . MET A 1 110 ? 6.867   4.843   -13.987 1.00 0.00 ? 110 MET A O    4  
ATOM 7265  C CB   . MET A 1 110 ? 5.389   1.690   -14.159 1.00 0.00 ? 110 MET A CB   4  
ATOM 7266  C CG   . MET A 1 110 ? 3.987   1.112   -14.058 1.00 0.00 ? 110 MET A CG   4  
ATOM 7267  S SD   . MET A 1 110 ? 3.656   -0.131  -15.321 1.00 0.00 ? 110 MET A SD   4  
ATOM 7268  C CE   . MET A 1 110 ? 4.180   0.737   -16.797 1.00 0.00 ? 110 MET A CE   4  
ATOM 7269  H H    . MET A 1 110 ? 3.902   3.805   -14.181 1.00 0.00 ? 110 MET A H    4  
ATOM 7270  H HA   . MET A 1 110 ? 5.706   2.614   -12.255 1.00 0.00 ? 110 MET A HA   4  
ATOM 7271  H HB2  . MET A 1 110 ? 5.572   1.956   -15.189 1.00 0.00 ? 110 MET A HB2  4  
ATOM 7272  H HB3  . MET A 1 110 ? 6.092   0.926   -13.863 1.00 0.00 ? 110 MET A HB3  4  
ATOM 7273  H HG2  . MET A 1 110 ? 3.868   0.657   -13.086 1.00 0.00 ? 110 MET A HG2  4  
ATOM 7274  H HG3  . MET A 1 110 ? 3.273   1.915   -14.167 1.00 0.00 ? 110 MET A HG3  4  
ATOM 7275  H HE1  . MET A 1 110 ? 5.196   0.459   -17.037 1.00 0.00 ? 110 MET A HE1  4  
ATOM 7276  H HE2  . MET A 1 110 ? 3.531   0.474   -17.619 1.00 0.00 ? 110 MET A HE2  4  
ATOM 7277  H HE3  . MET A 1 110 ? 4.130   1.802   -16.625 1.00 0.00 ? 110 MET A HE3  4  
ATOM 7278  N N    . GLN A 1 111 ? 7.987   2.906   -13.749 1.00 0.00 ? 111 GLN A N    4  
ATOM 7279  C CA   . GLN A 1 111 ? 9.272   3.475   -14.137 1.00 0.00 ? 111 GLN A CA   4  
ATOM 7280  C C    . GLN A 1 111 ? 9.900   2.677   -15.275 1.00 0.00 ? 111 GLN A C    4  
ATOM 7281  O O    . GLN A 1 111 ? 10.758  1.823   -15.048 1.00 0.00 ? 111 GLN A O    4  
ATOM 7282  C CB   . GLN A 1 111 ? 10.221  3.508   -12.937 1.00 0.00 ? 111 GLN A CB   4  
ATOM 7283  C CG   . GLN A 1 111 ? 9.683   4.302   -11.758 1.00 0.00 ? 111 GLN A CG   4  
ATOM 7284  C CD   . GLN A 1 111 ? 10.034  5.774   -11.836 1.00 0.00 ? 111 GLN A CD   4  
ATOM 7285  O OE1  . GLN A 1 111 ? 11.000  6.228   -11.221 1.00 0.00 ? 111 GLN A OE1  4  
ATOM 7286  N NE2  . GLN A 1 111 ? 9.249   6.531   -12.594 1.00 0.00 ? 111 GLN A NE2  4  
ATOM 7287  H H    . GLN A 1 111 ? 7.936   1.956   -13.514 1.00 0.00 ? 111 GLN A H    4  
ATOM 7288  H HA   . GLN A 1 111 ? 9.099   4.485   -14.475 1.00 0.00 ? 111 GLN A HA   4  
ATOM 7289  H HB2  . GLN A 1 111 ? 10.404  2.496   -12.610 1.00 0.00 ? 111 GLN A HB2  4  
ATOM 7290  H HB3  . GLN A 1 111 ? 11.156  3.953   -13.245 1.00 0.00 ? 111 GLN A HB3  4  
ATOM 7291  H HG2  . GLN A 1 111 ? 8.607   4.205   -11.735 1.00 0.00 ? 111 GLN A HG2  4  
ATOM 7292  H HG3  . GLN A 1 111 ? 10.099  3.895   -10.847 1.00 0.00 ? 111 GLN A HG3  4  
ATOM 7293  H HE21 . GLN A 1 111 ? 8.497   6.101   -13.053 1.00 0.00 ? 111 GLN A HE21 4  
ATOM 7294  H HE22 . GLN A 1 111 ? 9.452   7.486   -12.662 1.00 0.00 ? 111 GLN A HE22 4  
ATOM 7295  N N    . ASP A 1 112 ? 9.467   2.960   -16.498 1.00 0.00 ? 112 ASP A N    4  
ATOM 7296  C CA   . ASP A 1 112 ? 9.987   2.269   -17.672 1.00 0.00 ? 112 ASP A CA   4  
ATOM 7297  C C    . ASP A 1 112 ? 11.480  1.993   -17.523 1.00 0.00 ? 112 ASP A C    4  
ATOM 7298  O O    . ASP A 1 112 ? 12.258  2.893   -17.211 1.00 0.00 ? 112 ASP A O    4  
ATOM 7299  C CB   . ASP A 1 112 ? 9.732   3.097   -18.932 1.00 0.00 ? 112 ASP A CB   4  
ATOM 7300  C CG   . ASP A 1 112 ? 9.998   4.574   -18.719 1.00 0.00 ? 112 ASP A CG   4  
ATOM 7301  O OD1  . ASP A 1 112 ? 11.103  4.915   -18.248 1.00 0.00 ? 112 ASP A OD1  4  
ATOM 7302  O OD2  . ASP A 1 112 ? 9.101   5.389   -19.021 1.00 0.00 ? 112 ASP A OD2  4  
ATOM 7303  H H    . ASP A 1 112 ? 8.781   3.651   -16.615 1.00 0.00 ? 112 ASP A H    4  
ATOM 7304  H HA   . ASP A 1 112 ? 9.467   1.327   -17.760 1.00 0.00 ? 112 ASP A HA   4  
ATOM 7305  H HB2  . ASP A 1 112 ? 10.377  2.744   -19.724 1.00 0.00 ? 112 ASP A HB2  4  
ATOM 7306  H HB3  . ASP A 1 112 ? 8.701   2.975   -19.233 1.00 0.00 ? 112 ASP A HB3  4  
ATOM 7307  N N    . GLN A 1 113 ? 11.871  0.743   -17.749 1.00 0.00 ? 113 GLN A N    4  
ATOM 7308  C CA   . GLN A 1 113 ? 13.270  0.349   -17.638 1.00 0.00 ? 113 GLN A CA   4  
ATOM 7309  C C    . GLN A 1 113 ? 14.165  1.288   -18.440 1.00 0.00 ? 113 GLN A C    4  
ATOM 7310  O O    . GLN A 1 113 ? 14.292  1.152   -19.657 1.00 0.00 ? 113 GLN A O    4  
ATOM 7311  C CB   . GLN A 1 113 ? 13.457  -1.090  -18.122 1.00 0.00 ? 113 GLN A CB   4  
ATOM 7312  C CG   . GLN A 1 113 ? 14.660  -1.788  -17.507 1.00 0.00 ? 113 GLN A CG   4  
ATOM 7313  C CD   . GLN A 1 113 ? 14.405  -2.245  -16.084 1.00 0.00 ? 113 GLN A CD   4  
ATOM 7314  O OE1  . GLN A 1 113 ? 13.787  -1.533  -15.292 1.00 0.00 ? 113 GLN A OE1  4  
ATOM 7315  N NE2  . GLN A 1 113 ? 14.880  -3.440  -15.752 1.00 0.00 ? 113 GLN A NE2  4  
ATOM 7316  H H    . GLN A 1 113 ? 11.203  0.070   -17.995 1.00 0.00 ? 113 GLN A H    4  
ATOM 7317  H HA   . GLN A 1 113 ? 13.550  0.408   -16.597 1.00 0.00 ? 113 GLN A HA   4  
ATOM 7318  H HB2  . GLN A 1 113 ? 12.573  -1.658  -17.874 1.00 0.00 ? 113 GLN A HB2  4  
ATOM 7319  H HB3  . GLN A 1 113 ? 13.582  -1.083  -19.194 1.00 0.00 ? 113 GLN A HB3  4  
ATOM 7320  H HG2  . GLN A 1 113 ? 14.905  -2.651  -18.107 1.00 0.00 ? 113 GLN A HG2  4  
ATOM 7321  H HG3  . GLN A 1 113 ? 15.495  -1.103  -17.505 1.00 0.00 ? 113 GLN A HG3  4  
ATOM 7322  H HE21 . GLN A 1 113 ? 15.363  -3.951  -16.435 1.00 0.00 ? 113 GLN A HE21 4  
ATOM 7323  H HE22 . GLN A 1 113 ? 14.730  -3.760  -14.839 1.00 0.00 ? 113 GLN A HE22 4  
ATOM 7324  N N    . SER A 1 114 ? 14.784  2.240   -17.750 1.00 0.00 ? 114 SER A N    4  
ATOM 7325  C CA   . SER A 1 114 ? 15.665  3.205   -18.399 1.00 0.00 ? 114 SER A CA   4  
ATOM 7326  C C    . SER A 1 114 ? 17.054  3.181   -17.770 1.00 0.00 ? 114 SER A C    4  
ATOM 7327  O O    . SER A 1 114 ? 17.281  2.513   -16.762 1.00 0.00 ? 114 SER A O    4  
ATOM 7328  C CB   . SER A 1 114 ? 15.073  4.612   -18.304 1.00 0.00 ? 114 SER A CB   4  
ATOM 7329  O OG   . SER A 1 114 ? 15.255  5.155   -17.007 1.00 0.00 ? 114 SER A OG   4  
ATOM 7330  H H    . SER A 1 114 ? 14.644  2.297   -16.782 1.00 0.00 ? 114 SER A H    4  
ATOM 7331  H HA   . SER A 1 114 ? 15.749  2.929   -19.440 1.00 0.00 ? 114 SER A HA   4  
ATOM 7332  H HB2  . SER A 1 114 ? 15.560  5.255   -19.021 1.00 0.00 ? 114 SER A HB2  4  
ATOM 7333  H HB3  . SER A 1 114 ? 14.015  4.570   -18.518 1.00 0.00 ? 114 SER A HB3  4  
ATOM 7334  H HG   . SER A 1 114 ? 14.576  5.812   -16.837 1.00 0.00 ? 114 SER A HG   4  
ATOM 7335  N N    . GLY A 1 115 ? 17.983  3.917   -18.374 1.00 0.00 ? 115 GLY A N    4  
ATOM 7336  C CA   . GLY A 1 115 ? 19.339  3.967   -17.860 1.00 0.00 ? 115 GLY A CA   4  
ATOM 7337  C C    . GLY A 1 115 ? 19.572  5.161   -16.954 1.00 0.00 ? 115 GLY A C    4  
ATOM 7338  O O    . GLY A 1 115 ? 19.006  6.236   -17.151 1.00 0.00 ? 115 GLY A O    4  
ATOM 7339  H H    . GLY A 1 115 ? 17.745  4.430   -19.174 1.00 0.00 ? 115 GLY A H    4  
ATOM 7340  H HA2  . GLY A 1 115 ? 19.536  3.063   -17.304 1.00 0.00 ? 115 GLY A HA2  4  
ATOM 7341  H HA3  . GLY A 1 115 ? 20.026  4.023   -18.692 1.00 0.00 ? 115 GLY A HA3  4  
ATOM 7342  N N    . PRO A 1 116 ? 20.423  4.977   -15.934 1.00 0.00 ? 116 PRO A N    4  
ATOM 7343  C CA   . PRO A 1 116 ? 20.748  6.036   -14.974 1.00 0.00 ? 116 PRO A CA   4  
ATOM 7344  C C    . PRO A 1 116 ? 21.584  7.148   -15.598 1.00 0.00 ? 116 PRO A C    4  
ATOM 7345  O O    . PRO A 1 116 ? 22.230  6.949   -16.626 1.00 0.00 ? 116 PRO A O    4  
ATOM 7346  C CB   . PRO A 1 116 ? 21.552  5.303   -13.897 1.00 0.00 ? 116 PRO A CB   4  
ATOM 7347  C CG   . PRO A 1 116 ? 22.139  4.127   -14.597 1.00 0.00 ? 116 PRO A CG   4  
ATOM 7348  C CD   . PRO A 1 116 ? 21.134  3.721   -15.639 1.00 0.00 ? 116 PRO A CD   4  
ATOM 7349  H HA   . PRO A 1 116 ? 19.857  6.460   -14.534 1.00 0.00 ? 116 PRO A HA   4  
ATOM 7350  H HB2  . PRO A 1 116 ? 22.321  5.958   -13.510 1.00 0.00 ? 116 PRO A HB2  4  
ATOM 7351  H HB3  . PRO A 1 116 ? 20.895  4.999   -13.096 1.00 0.00 ? 116 PRO A HB3  4  
ATOM 7352  H HG2  . PRO A 1 116 ? 23.072  4.404   -15.063 1.00 0.00 ? 116 PRO A HG2  4  
ATOM 7353  H HG3  . PRO A 1 116 ? 22.294  3.322   -13.893 1.00 0.00 ? 116 PRO A HG3  4  
ATOM 7354  H HD2  . PRO A 1 116 ? 21.634  3.345   -16.519 1.00 0.00 ? 116 PRO A HD2  4  
ATOM 7355  H HD3  . PRO A 1 116 ? 20.456  2.980   -15.242 1.00 0.00 ? 116 PRO A HD3  4  
ATOM 7356  N N    . SER A 1 117 ? 21.566  8.319   -14.970 1.00 0.00 ? 117 SER A N    4  
ATOM 7357  C CA   . SER A 1 117 ? 22.319  9.465   -15.466 1.00 0.00 ? 117 SER A CA   4  
ATOM 7358  C C    . SER A 1 117 ? 23.731  9.478   -14.888 1.00 0.00 ? 117 SER A C    4  
ATOM 7359  O O    . SER A 1 117 ? 23.999  8.858   -13.859 1.00 0.00 ? 117 SER A O    4  
ATOM 7360  C CB   . SER A 1 117 ? 21.600  10.768  -15.113 1.00 0.00 ? 117 SER A CB   4  
ATOM 7361  O OG   . SER A 1 117 ? 22.211  11.877  -15.749 1.00 0.00 ? 117 SER A OG   4  
ATOM 7362  H H    . SER A 1 117 ? 21.031  8.416   -14.154 1.00 0.00 ? 117 SER A H    4  
ATOM 7363  H HA   . SER A 1 117 ? 22.384  9.379   -16.541 1.00 0.00 ? 117 SER A HA   4  
ATOM 7364  H HB2  . SER A 1 117 ? 20.571  10.706  -15.433 1.00 0.00 ? 117 SER A HB2  4  
ATOM 7365  H HB3  . SER A 1 117 ? 21.635  10.916  -14.043 1.00 0.00 ? 117 SER A HB3  4  
ATOM 7366  H HG   . SER A 1 117 ? 21.879  12.690  -15.362 1.00 0.00 ? 117 SER A HG   4  
ATOM 7367  N N    . SER A 1 118 ? 24.632  10.189  -15.559 1.00 0.00 ? 118 SER A N    4  
ATOM 7368  C CA   . SER A 1 118 ? 26.018  10.281  -15.116 1.00 0.00 ? 118 SER A CA   4  
ATOM 7369  C C    . SER A 1 118 ? 26.100  10.853  -13.704 1.00 0.00 ? 118 SER A C    4  
ATOM 7370  O O    . SER A 1 118 ? 26.003  12.064  -13.506 1.00 0.00 ? 118 SER A O    4  
ATOM 7371  C CB   . SER A 1 118 ? 26.827  11.151  -16.079 1.00 0.00 ? 118 SER A CB   4  
ATOM 7372  O OG   . SER A 1 118 ? 28.185  10.745  -16.115 1.00 0.00 ? 118 SER A OG   4  
ATOM 7373  H H    . SER A 1 118 ? 24.358  10.661  -16.373 1.00 0.00 ? 118 SER A H    4  
ATOM 7374  H HA   . SER A 1 118 ? 26.431  9.283   -15.111 1.00 0.00 ? 118 SER A HA   4  
ATOM 7375  H HB2  . SER A 1 118 ? 26.413  11.066  -17.072 1.00 0.00 ? 118 SER A HB2  4  
ATOM 7376  H HB3  . SER A 1 118 ? 26.780  12.181  -15.756 1.00 0.00 ? 118 SER A HB3  4  
ATOM 7377  H HG   . SER A 1 118 ? 28.436  10.392  -15.259 1.00 0.00 ? 118 SER A HG   4  
ATOM 7378  N N    . GLY A 1 119 ? 26.280  9.973   -12.724 1.00 0.00 ? 119 GLY A N    4  
ATOM 7379  C CA   . GLY A 1 119 ? 26.372  10.408  -11.343 1.00 0.00 ? 119 GLY A CA   4  
ATOM 7380  C C    . GLY A 1 119 ? 27.532  9.765   -10.608 1.00 0.00 ? 119 GLY A C    4  
ATOM 7381  O O    . GLY A 1 119 ? 27.332  8.895   -9.761  1.00 0.00 ? 119 GLY A O    4  
ATOM 7382  H H    . GLY A 1 119 ? 26.351  9.019   -12.941 1.00 0.00 ? 119 GLY A H    4  
ATOM 7383  H HA2  . GLY A 1 119 ? 26.497  11.481  -11.322 1.00 0.00 ? 119 GLY A HA2  4  
ATOM 7384  H HA3  . GLY A 1 119 ? 25.453  10.153  -10.835 1.00 0.00 ? 119 GLY A HA3  4  
ATOM 7385  N N    . GLY A 1 1   ? 12.079  -20.593 -2.557  1.00 0.00 ? 1   GLY A N    5  
ATOM 7386  C CA   . GLY A 1 1   ? 10.749  -20.908 -2.068  1.00 0.00 ? 1   GLY A CA   5  
ATOM 7387  C C    . GLY A 1 1   ? 10.381  -22.362 -2.282  1.00 0.00 ? 1   GLY A C    5  
ATOM 7388  O O    . GLY A 1 1   ? 9.925   -23.037 -1.359  1.00 0.00 ? 1   GLY A O    5  
ATOM 7389  H H1   . GLY A 1 1   ? 12.238  -19.749 -3.028  1.00 0.00 ? 1   GLY A H1   5  
ATOM 7390  H HA2  . GLY A 1 1   ? 10.704  -20.687 -1.012  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7391  H HA3  . GLY A 1 1   ? 10.032  -20.288 -2.586  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7392  N N    . SER A 1 2   ? 10.579  -22.848 -3.504  1.00 0.00 ? 2   SER A N    5  
ATOM 7393  C CA   . SER A 1 2   ? 10.260  -24.231 -3.837  1.00 0.00 ? 2   SER A CA   5  
ATOM 7394  C C    . SER A 1 2   ? 11.160  -24.741 -4.958  1.00 0.00 ? 2   SER A C    5  
ATOM 7395  O O    . SER A 1 2   ? 11.816  -23.960 -5.647  1.00 0.00 ? 2   SER A O    5  
ATOM 7396  C CB   . SER A 1 2   ? 8.792   -24.352 -4.252  1.00 0.00 ? 2   SER A CB   5  
ATOM 7397  O OG   . SER A 1 2   ? 7.944   -24.403 -3.118  1.00 0.00 ? 2   SER A OG   5  
ATOM 7398  H H    . SER A 1 2   ? 10.946  -22.261 -4.198  1.00 0.00 ? 2   SER A H    5  
ATOM 7399  H HA   . SER A 1 2   ? 10.427  -24.832 -2.956  1.00 0.00 ? 2   SER A HA   5  
ATOM 7400  H HB2  . SER A 1 2   ? 8.519   -23.498 -4.853  1.00 0.00 ? 2   SER A HB2  5  
ATOM 7401  H HB3  . SER A 1 2   ? 8.657   -25.256 -4.829  1.00 0.00 ? 2   SER A HB3  5  
ATOM 7402  H HG   . SER A 1 2   ? 7.928   -23.544 -2.691  1.00 0.00 ? 2   SER A HG   5  
ATOM 7403  N N    . SER A 1 3   ? 11.187  -26.058 -5.135  1.00 0.00 ? 3   SER A N    5  
ATOM 7404  C CA   . SER A 1 3   ? 12.009  -26.675 -6.169  1.00 0.00 ? 3   SER A CA   5  
ATOM 7405  C C    . SER A 1 3   ? 11.139  -27.330 -7.237  1.00 0.00 ? 3   SER A C    5  
ATOM 7406  O O    . SER A 1 3   ? 9.987   -27.681 -6.985  1.00 0.00 ? 3   SER A O    5  
ATOM 7407  C CB   . SER A 1 3   ? 12.948  -27.713 -5.552  1.00 0.00 ? 3   SER A CB   5  
ATOM 7408  O OG   . SER A 1 3   ? 14.116  -27.100 -5.032  1.00 0.00 ? 3   SER A OG   5  
ATOM 7409  H H    . SER A 1 3   ? 10.641  -26.629 -4.553  1.00 0.00 ? 3   SER A H    5  
ATOM 7410  H HA   . SER A 1 3   ? 12.600  -25.897 -6.630  1.00 0.00 ? 3   SER A HA   5  
ATOM 7411  H HB2  . SER A 1 3   ? 12.438  -28.225 -4.750  1.00 0.00 ? 3   SER A HB2  5  
ATOM 7412  H HB3  . SER A 1 3   ? 13.237  -28.428 -6.309  1.00 0.00 ? 3   SER A HB3  5  
ATOM 7413  H HG   . SER A 1 3   ? 14.418  -27.589 -4.263  1.00 0.00 ? 3   SER A HG   5  
ATOM 7414  N N    . GLY A 1 4   ? 11.700  -27.492 -8.431  1.00 0.00 ? 4   GLY A N    5  
ATOM 7415  C CA   . GLY A 1 4   ? 10.962  -28.105 -9.520  1.00 0.00 ? 4   GLY A CA   5  
ATOM 7416  C C    . GLY A 1 4   ? 10.914  -27.227 -10.755 1.00 0.00 ? 4   GLY A C    5  
ATOM 7417  O O    . GLY A 1 4   ? 11.861  -26.492 -11.039 1.00 0.00 ? 4   GLY A O    5  
ATOM 7418  H H    . GLY A 1 4   ? 12.622  -27.193 -8.574  1.00 0.00 ? 4   GLY A H    5  
ATOM 7419  H HA2  . GLY A 1 4   ? 11.431  -29.043 -9.776  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7420  H HA3  . GLY A 1 4   ? 9.951   -28.298 -9.191  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7421  N N    . SER A 1 5   ? 9.811   -27.303 -11.491 1.00 0.00 ? 5   SER A N    5  
ATOM 7422  C CA   . SER A 1 5   ? 9.646   -26.513 -12.706 1.00 0.00 ? 5   SER A CA   5  
ATOM 7423  C C    . SER A 1 5   ? 8.351   -25.707 -12.658 1.00 0.00 ? 5   SER A C    5  
ATOM 7424  O O    . SER A 1 5   ? 7.326   -26.126 -13.195 1.00 0.00 ? 5   SER A O    5  
ATOM 7425  C CB   . SER A 1 5   ? 9.649   -27.422 -13.936 1.00 0.00 ? 5   SER A CB   5  
ATOM 7426  O OG   . SER A 1 5   ? 9.990   -26.698 -15.105 1.00 0.00 ? 5   SER A OG   5  
ATOM 7427  H H    . SER A 1 5   ? 9.091   -27.907 -11.212 1.00 0.00 ? 5   SER A H    5  
ATOM 7428  H HA   . SER A 1 5   ? 10.479  -25.829 -12.772 1.00 0.00 ? 5   SER A HA   5  
ATOM 7429  H HB2  . SER A 1 5   ? 10.369  -28.213 -13.794 1.00 0.00 ? 5   SER A HB2  5  
ATOM 7430  H HB3  . SER A 1 5   ? 8.665   -27.850 -14.066 1.00 0.00 ? 5   SER A HB3  5  
ATOM 7431  H HG   . SER A 1 5   ? 9.241   -26.687 -15.705 1.00 0.00 ? 5   SER A HG   5  
ATOM 7432  N N    . SER A 1 6   ? 8.407   -24.547 -12.011 1.00 0.00 ? 6   SER A N    5  
ATOM 7433  C CA   . SER A 1 6   ? 7.239   -23.683 -11.889 1.00 0.00 ? 6   SER A CA   5  
ATOM 7434  C C    . SER A 1 6   ? 7.424   -22.402 -12.696 1.00 0.00 ? 6   SER A C    5  
ATOM 7435  O O    . SER A 1 6   ? 8.237   -21.547 -12.346 1.00 0.00 ? 6   SER A O    5  
ATOM 7436  C CB   . SER A 1 6   ? 6.982   -23.342 -10.420 1.00 0.00 ? 6   SER A CB   5  
ATOM 7437  O OG   . SER A 1 6   ? 6.752   -24.513 -9.656  1.00 0.00 ? 6   SER A OG   5  
ATOM 7438  H H    . SER A 1 6   ? 9.254   -24.268 -11.603 1.00 0.00 ? 6   SER A H    5  
ATOM 7439  H HA   . SER A 1 6   ? 6.387   -24.220 -12.279 1.00 0.00 ? 6   SER A HA   5  
ATOM 7440  H HB2  . SER A 1 6   ? 7.841   -22.827 -10.017 1.00 0.00 ? 6   SER A HB2  5  
ATOM 7441  H HB3  . SER A 1 6   ? 6.113   -22.703 -10.348 1.00 0.00 ? 6   SER A HB3  5  
ATOM 7442  H HG   . SER A 1 6   ? 6.375   -25.193 -10.219 1.00 0.00 ? 6   SER A HG   5  
ATOM 7443  N N    . GLY A 1 7   ? 6.663   -22.276 -13.778 1.00 0.00 ? 7   GLY A N    5  
ATOM 7444  C CA   . GLY A 1 7   ? 6.757   -21.097 -14.619 1.00 0.00 ? 7   GLY A CA   5  
ATOM 7445  C C    . GLY A 1 7   ? 5.787   -20.009 -14.204 1.00 0.00 ? 7   GLY A C    5  
ATOM 7446  O O    . GLY A 1 7   ? 4.613   -20.040 -14.576 1.00 0.00 ? 7   GLY A O    5  
ATOM 7447  H H    . GLY A 1 7   ? 6.032   -22.990 -14.008 1.00 0.00 ? 7   GLY A H    5  
ATOM 7448  H HA2  . GLY A 1 7   ? 7.763   -20.708 -14.563 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7449  H HA3  . GLY A 1 7   ? 6.548   -21.379 -15.640 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7450  N N    . ARG A 1 8   ? 6.275   -19.046 -13.429 1.00 0.00 ? 8   ARG A N    5  
ATOM 7451  C CA   . ARG A 1 8   ? 5.442   -17.946 -12.961 1.00 0.00 ? 8   ARG A CA   5  
ATOM 7452  C C    . ARG A 1 8   ? 4.450   -17.518 -14.038 1.00 0.00 ? 8   ARG A C    5  
ATOM 7453  O O    . ARG A 1 8   ? 4.843   -17.120 -15.134 1.00 0.00 ? 8   ARG A O    5  
ATOM 7454  C CB   . ARG A 1 8   ? 6.313   -16.756 -12.553 1.00 0.00 ? 8   ARG A CB   5  
ATOM 7455  C CG   . ARG A 1 8   ? 5.706   -15.907 -11.448 1.00 0.00 ? 8   ARG A CG   5  
ATOM 7456  C CD   . ARG A 1 8   ? 6.270   -14.495 -11.456 1.00 0.00 ? 8   ARG A CD   5  
ATOM 7457  N NE   . ARG A 1 8   ? 5.805   -13.726 -12.607 1.00 0.00 ? 8   ARG A NE   5  
ATOM 7458  C CZ   . ARG A 1 8   ? 5.753   -12.399 -12.632 1.00 0.00 ? 8   ARG A CZ   5  
ATOM 7459  N NH1  . ARG A 1 8   ? 6.135   -11.698 -11.574 1.00 0.00 ? 8   ARG A NH1  5  
ATOM 7460  N NH2  . ARG A 1 8   ? 5.318   -11.772 -13.717 1.00 0.00 ? 8   ARG A NH2  5  
ATOM 7461  H H    . ARG A 1 8   ? 7.219   -19.077 -13.166 1.00 0.00 ? 8   ARG A H    5  
ATOM 7462  H HA   . ARG A 1 8   ? 4.892   -18.290 -12.098 1.00 0.00 ? 8   ARG A HA   5  
ATOM 7463  H HB2  . ARG A 1 8   ? 7.268   -17.125 -12.210 1.00 0.00 ? 8   ARG A HB2  5  
ATOM 7464  H HB3  . ARG A 1 8   ? 6.468   -16.127 -13.416 1.00 0.00 ? 8   ARG A HB3  5  
ATOM 7465  H HG2  . ARG A 1 8   ? 4.637   -15.856 -11.592 1.00 0.00 ? 8   ARG A HG2  5  
ATOM 7466  H HG3  . ARG A 1 8   ? 5.922   -16.367 -10.495 1.00 0.00 ? 8   ARG A HG3  5  
ATOM 7467  H HD2  . ARG A 1 8   ? 5.961   -13.993 -10.551 1.00 0.00 ? 8   ARG A HD2  5  
ATOM 7468  H HD3  . ARG A 1 8   ? 7.348   -14.553 -11.485 1.00 0.00 ? 8   ARG A HD3  5  
ATOM 7469  H HE   . ARG A 1 8   ? 5.518   -14.225 -13.400 1.00 0.00 ? 8   ARG A HE   5  
ATOM 7470  H HH11 . ARG A 1 8   ? 6.464   -12.168 -10.755 1.00 0.00 ? 8   ARG A HH11 5  
ATOM 7471  H HH12 . ARG A 1 8   ? 6.095   -10.698 -11.595 1.00 0.00 ? 8   ARG A HH12 5  
ATOM 7472  H HH21 . ARG A 1 8   ? 5.029   -12.297 -14.517 1.00 0.00 ? 8   ARG A HH21 5  
ATOM 7473  H HH22 . ARG A 1 8   ? 5.278   -10.773 -13.734 1.00 0.00 ? 8   ARG A HH22 5  
ATOM 7474  N N    . GLU A 1 9   ? 3.162   -17.604 -13.718 1.00 0.00 ? 9   GLU A N    5  
ATOM 7475  C CA   . GLU A 1 9   ? 2.115   -17.227 -14.660 1.00 0.00 ? 9   GLU A CA   5  
ATOM 7476  C C    . GLU A 1 9   ? 1.776   -15.745 -14.532 1.00 0.00 ? 9   GLU A C    5  
ATOM 7477  O O    . GLU A 1 9   ? 2.027   -15.128 -13.498 1.00 0.00 ? 9   GLU A O    5  
ATOM 7478  C CB   . GLU A 1 9   ? 0.860   -18.071 -14.425 1.00 0.00 ? 9   GLU A CB   5  
ATOM 7479  C CG   . GLU A 1 9   ? 0.954   -19.475 -14.998 1.00 0.00 ? 9   GLU A CG   5  
ATOM 7480  C CD   . GLU A 1 9   ? -0.024  -20.436 -14.351 1.00 0.00 ? 9   GLU A CD   5  
ATOM 7481  O OE1  . GLU A 1 9   ? -0.253  -20.318 -13.129 1.00 0.00 ? 9   GLU A OE1  5  
ATOM 7482  O OE2  . GLU A 1 9   ? -0.561  -21.307 -15.068 1.00 0.00 ? 9   GLU A OE2  5  
ATOM 7483  H H    . GLU A 1 9   ? 2.911   -17.929 -12.828 1.00 0.00 ? 9   GLU A H    5  
ATOM 7484  H HA   . GLU A 1 9   ? 2.482   -17.415 -15.657 1.00 0.00 ? 9   GLU A HA   5  
ATOM 7485  H HB2  . GLU A 1 9   ? 0.686   -18.149 -13.362 1.00 0.00 ? 9   GLU A HB2  5  
ATOM 7486  H HB3  . GLU A 1 9   ? 0.017   -17.574 -14.882 1.00 0.00 ? 9   GLU A HB3  5  
ATOM 7487  H HG2  . GLU A 1 9   ? 0.746   -19.433 -16.057 1.00 0.00 ? 9   GLU A HG2  5  
ATOM 7488  H HG3  . GLU A 1 9   ? 1.956   -19.846 -14.844 1.00 0.00 ? 9   GLU A HG3  5  
ATOM 7489  N N    . GLU A 1 10  ? 1.204   -15.181 -15.591 1.00 0.00 ? 10  GLU A N    5  
ATOM 7490  C CA   . GLU A 1 10  ? 0.832   -13.771 -15.598 1.00 0.00 ? 10  GLU A CA   5  
ATOM 7491  C C    . GLU A 1 10  ? -0.459  -13.545 -14.816 1.00 0.00 ? 10  GLU A C    5  
ATOM 7492  O O    . GLU A 1 10  ? -1.487  -14.159 -15.103 1.00 0.00 ? 10  GLU A O    5  
ATOM 7493  C CB   . GLU A 1 10  ? 0.665   -13.272 -17.034 1.00 0.00 ? 10  GLU A CB   5  
ATOM 7494  C CG   . GLU A 1 10  ? 1.968   -13.213 -17.814 1.00 0.00 ? 10  GLU A CG   5  
ATOM 7495  C CD   . GLU A 1 10  ? 2.268   -14.506 -18.547 1.00 0.00 ? 10  GLU A CD   5  
ATOM 7496  O OE1  . GLU A 1 10  ? 1.442   -14.913 -19.391 1.00 0.00 ? 10  GLU A OE1  5  
ATOM 7497  O OE2  . GLU A 1 10  ? 3.327   -15.110 -18.277 1.00 0.00 ? 10  GLU A OE2  5  
ATOM 7498  H H    . GLU A 1 10  ? 1.028   -15.726 -16.387 1.00 0.00 ? 10  GLU A H    5  
ATOM 7499  H HA   . GLU A 1 10  ? 1.627   -13.216 -15.124 1.00 0.00 ? 10  GLU A HA   5  
ATOM 7500  H HB2  . GLU A 1 10  ? -0.013  -13.931 -17.556 1.00 0.00 ? 10  GLU A HB2  5  
ATOM 7501  H HB3  . GLU A 1 10  ? 0.240   -12.279 -17.010 1.00 0.00 ? 10  GLU A HB3  5  
ATOM 7502  H HG2  . GLU A 1 10  ? 1.905   -12.413 -18.536 1.00 0.00 ? 10  GLU A HG2  5  
ATOM 7503  H HG3  . GLU A 1 10  ? 2.776   -13.011 -17.125 1.00 0.00 ? 10  GLU A HG3  5  
ATOM 7504  N N    . ASP A 1 11  ? -0.397  -12.661 -13.826 1.00 0.00 ? 11  ASP A N    5  
ATOM 7505  C CA   . ASP A 1 11  ? -1.561  -12.353 -13.003 1.00 0.00 ? 11  ASP A CA   5  
ATOM 7506  C C    . ASP A 1 11  ? -2.085  -10.953 -13.305 1.00 0.00 ? 11  ASP A C    5  
ATOM 7507  O O    . ASP A 1 11  ? -1.331  -10.039 -13.638 1.00 0.00 ? 11  ASP A O    5  
ATOM 7508  C CB   . ASP A 1 11  ? -1.207  -12.469 -11.519 1.00 0.00 ? 11  ASP A CB   5  
ATOM 7509  C CG   . ASP A 1 11  ? -0.483  -13.761 -11.196 1.00 0.00 ? 11  ASP A CG   5  
ATOM 7510  O OD1  . ASP A 1 11  ? -1.159  -14.801 -11.055 1.00 0.00 ? 11  ASP A OD1  5  
ATOM 7511  O OD2  . ASP A 1 11  ? 0.761   -13.732 -11.085 1.00 0.00 ? 11  ASP A OD2  5  
ATOM 7512  H H    . ASP A 1 11  ? 0.451   -12.204 -13.646 1.00 0.00 ? 11  ASP A H    5  
ATOM 7513  H HA   . ASP A 1 11  ? -2.332  -13.071 -13.236 1.00 0.00 ? 11  ASP A HA   5  
ATOM 7514  H HB2  . ASP A 1 11  ? -0.569  -11.642 -11.242 1.00 0.00 ? 11  ASP A HB2  5  
ATOM 7515  H HB3  . ASP A 1 11  ? -2.114  -12.429 -10.935 1.00 0.00 ? 11  ASP A HB3  5  
ATOM 7516  N N    . PRO A 1 12  ? -3.410  -10.779 -13.189 1.00 0.00 ? 12  PRO A N    5  
ATOM 7517  C CA   . PRO A 1 12  ? -4.066  -9.494  -13.446 1.00 0.00 ? 12  PRO A CA   5  
ATOM 7518  C C    . PRO A 1 12  ? -3.737  -8.452  -12.382 1.00 0.00 ? 12  PRO A C    5  
ATOM 7519  O O    . PRO A 1 12  ? -3.480  -7.289  -12.696 1.00 0.00 ? 12  PRO A O    5  
ATOM 7520  C CB   . PRO A 1 12  ? -5.556  -9.842  -13.410 1.00 0.00 ? 12  PRO A CB   5  
ATOM 7521  C CG   . PRO A 1 12  ? -5.641  -11.057 -12.553 1.00 0.00 ? 12  PRO A CG   5  
ATOM 7522  C CD   . PRO A 1 12  ? -4.370  -11.824 -12.796 1.00 0.00 ? 12  PRO A CD   5  
ATOM 7523  H HA   . PRO A 1 12  ? -3.808  -9.105  -14.420 1.00 0.00 ? 12  PRO A HA   5  
ATOM 7524  H HB2  . PRO A 1 12  ? -6.111  -9.017  -12.985 1.00 0.00 ? 12  PRO A HB2  5  
ATOM 7525  H HB3  . PRO A 1 12  ? -5.907  -10.040 -14.412 1.00 0.00 ? 12  PRO A HB3  5  
ATOM 7526  H HG2  . PRO A 1 12  ? -5.713  -10.770 -11.515 1.00 0.00 ? 12  PRO A HG2  5  
ATOM 7527  H HG3  . PRO A 1 12  ? -6.496  -11.650 -12.841 1.00 0.00 ? 12  PRO A HG3  5  
ATOM 7528  H HD2  . PRO A 1 12  ? -4.051  -12.321 -11.892 1.00 0.00 ? 12  PRO A HD2  5  
ATOM 7529  H HD3  . PRO A 1 12  ? -4.508  -12.540 -13.593 1.00 0.00 ? 12  PRO A HD3  5  
ATOM 7530  N N    . HIS A 1 13  ? -3.745  -8.876  -11.122 1.00 0.00 ? 13  HIS A N    5  
ATOM 7531  C CA   . HIS A 1 13  ? -3.446  -7.979  -10.012 1.00 0.00 ? 13  HIS A CA   5  
ATOM 7532  C C    . HIS A 1 13  ? -2.143  -7.225  -10.258 1.00 0.00 ? 13  HIS A C    5  
ATOM 7533  O O    . HIS A 1 13  ? -2.060  -6.019  -10.029 1.00 0.00 ? 13  HIS A O    5  
ATOM 7534  C CB   . HIS A 1 13  ? -3.355  -8.766  -8.704  1.00 0.00 ? 13  HIS A CB   5  
ATOM 7535  C CG   . HIS A 1 13  ? -4.671  -8.920  -8.005  1.00 0.00 ? 13  HIS A CG   5  
ATOM 7536  N ND1  . HIS A 1 13  ? -4.945  -9.957  -7.138  1.00 0.00 ? 13  HIS A ND1  5  
ATOM 7537  C CD2  . HIS A 1 13  ? -5.790  -8.161  -8.047  1.00 0.00 ? 13  HIS A CD2  5  
ATOM 7538  C CE1  . HIS A 1 13  ? -6.177  -9.829  -6.679  1.00 0.00 ? 13  HIS A CE1  5  
ATOM 7539  N NE2  . HIS A 1 13  ? -6.712  -8.747  -7.215  1.00 0.00 ? 13  HIS A NE2  5  
ATOM 7540  H H    . HIS A 1 13  ? -3.957  -9.814  -10.936 1.00 0.00 ? 13  HIS A H    5  
ATOM 7541  H HA   . HIS A 1 13  ? -4.252  -7.265  -9.936  1.00 0.00 ? 13  HIS A HA   5  
ATOM 7542  H HB2  . HIS A 1 13  ? -2.972  -9.754  -8.912  1.00 0.00 ? 13  HIS A HB2  5  
ATOM 7543  H HB3  . HIS A 1 13  ? -2.679  -8.257  -8.032  1.00 0.00 ? 13  HIS A HB3  5  
ATOM 7544  H HD1  . HIS A 1 13  ? -4.329  -10.679 -6.897  1.00 0.00 ? 13  HIS A HD1  5  
ATOM 7545  H HD2  . HIS A 1 13  ? -5.933  -7.260  -8.628  1.00 0.00 ? 13  HIS A HD2  5  
ATOM 7546  H HE1  . HIS A 1 13  ? -6.665  -10.496 -5.983  1.00 0.00 ? 13  HIS A HE1  5  
ATOM 7547  N N    . GLU A 1 14  ? -1.127  -7.946  -10.724 1.00 0.00 ? 14  GLU A N    5  
ATOM 7548  C CA   . GLU A 1 14  ? 0.172   -7.344  -10.999 1.00 0.00 ? 14  GLU A CA   5  
ATOM 7549  C C    . GLU A 1 14  ? 0.222   -6.781  -12.417 1.00 0.00 ? 14  GLU A C    5  
ATOM 7550  O O    . GLU A 1 14  ? -0.535  -7.201  -13.290 1.00 0.00 ? 14  GLU A O    5  
ATOM 7551  C CB   . GLU A 1 14  ? 1.287   -8.375  -10.809 1.00 0.00 ? 14  GLU A CB   5  
ATOM 7552  C CG   . GLU A 1 14  ? 1.412   -9.356  -11.962 1.00 0.00 ? 14  GLU A CG   5  
ATOM 7553  C CD   . GLU A 1 14  ? 2.080   -8.745  -13.178 1.00 0.00 ? 14  GLU A CD   5  
ATOM 7554  O OE1  . GLU A 1 14  ? 2.965   -7.882  -12.997 1.00 0.00 ? 14  GLU A OE1  5  
ATOM 7555  O OE2  . GLU A 1 14  ? 1.719   -9.129  -14.310 1.00 0.00 ? 14  GLU A OE2  5  
ATOM 7556  H H    . GLU A 1 14  ? -1.255  -8.903  -10.887 1.00 0.00 ? 14  GLU A H    5  
ATOM 7557  H HA   . GLU A 1 14  ? 0.318   -6.536  -10.299 1.00 0.00 ? 14  GLU A HA   5  
ATOM 7558  H HB2  . GLU A 1 14  ? 2.227   -7.854  -10.701 1.00 0.00 ? 14  GLU A HB2  5  
ATOM 7559  H HB3  . GLU A 1 14  ? 1.091   -8.935  -9.906  1.00 0.00 ? 14  GLU A HB3  5  
ATOM 7560  H HG2  . GLU A 1 14  ? 1.998   -10.202 -11.636 1.00 0.00 ? 14  GLU A HG2  5  
ATOM 7561  H HG3  . GLU A 1 14  ? 0.424   -9.691  -12.242 1.00 0.00 ? 14  GLU A HG3  5  
ATOM 7562  N N    . GLY A 1 15  ? 1.121   -5.826  -12.637 1.00 0.00 ? 15  GLY A N    5  
ATOM 7563  C CA   . GLY A 1 15  ? 1.253   -5.220  -13.949 1.00 0.00 ? 15  GLY A CA   5  
ATOM 7564  C C    . GLY A 1 15  ? 0.605   -3.852  -14.024 1.00 0.00 ? 15  GLY A C    5  
ATOM 7565  O O    . GLY A 1 15  ? 0.941   -3.043  -14.889 1.00 0.00 ? 15  GLY A O    5  
ATOM 7566  H H    . GLY A 1 15  ? 1.698   -5.530  -11.902 1.00 0.00 ? 15  GLY A H    5  
ATOM 7567  H HA2  . GLY A 1 15  ? 2.302   -5.123  -14.185 1.00 0.00 ? 15  GLY A HA2  5  
ATOM 7568  H HA3  . GLY A 1 15  ? 0.788   -5.866  -14.680 1.00 0.00 ? 15  GLY A HA3  5  
ATOM 7569  N N    . LYS A 1 16  ? -0.330  -3.591  -13.116 1.00 0.00 ? 16  LYS A N    5  
ATOM 7570  C CA   . LYS A 1 16  ? -1.028  -2.312  -13.081 1.00 0.00 ? 16  LYS A CA   5  
ATOM 7571  C C    . LYS A 1 16  ? -0.045  -1.159  -12.906 1.00 0.00 ? 16  LYS A C    5  
ATOM 7572  O O    . LYS A 1 16  ? 1.131   -1.374  -12.610 1.00 0.00 ? 16  LYS A O    5  
ATOM 7573  C CB   . LYS A 1 16  ? -2.054  -2.298  -11.946 1.00 0.00 ? 16  LYS A CB   5  
ATOM 7574  C CG   . LYS A 1 16  ? -3.022  -3.468  -11.986 1.00 0.00 ? 16  LYS A CG   5  
ATOM 7575  C CD   . LYS A 1 16  ? -4.109  -3.257  -13.027 1.00 0.00 ? 16  LYS A CD   5  
ATOM 7576  C CE   . LYS A 1 16  ? -5.347  -4.083  -12.715 1.00 0.00 ? 16  LYS A CE   5  
ATOM 7577  N NZ   . LYS A 1 16  ? -6.533  -3.619  -13.487 1.00 0.00 ? 16  LYS A NZ   5  
ATOM 7578  H H    . LYS A 1 16  ? -0.555  -4.276  -12.451 1.00 0.00 ? 16  LYS A H    5  
ATOM 7579  H HA   . LYS A 1 16  ? -1.544  -2.190  -14.022 1.00 0.00 ? 16  LYS A HA   5  
ATOM 7580  H HB2  . LYS A 1 16  ? -1.529  -2.324  -11.002 1.00 0.00 ? 16  LYS A HB2  5  
ATOM 7581  H HB3  . LYS A 1 16  ? -2.626  -1.383  -12.005 1.00 0.00 ? 16  LYS A HB3  5  
ATOM 7582  H HG2  . LYS A 1 16  ? -2.476  -4.367  -12.229 1.00 0.00 ? 16  LYS A HG2  5  
ATOM 7583  H HG3  . LYS A 1 16  ? -3.483  -3.576  -11.014 1.00 0.00 ? 16  LYS A HG3  5  
ATOM 7584  H HD2  . LYS A 1 16  ? -4.382  -2.212  -13.043 1.00 0.00 ? 16  LYS A HD2  5  
ATOM 7585  H HD3  . LYS A 1 16  ? -3.728  -3.546  -13.996 1.00 0.00 ? 16  LYS A HD3  5  
ATOM 7586  H HE2  . LYS A 1 16  ? -5.148  -5.114  -12.963 1.00 0.00 ? 16  LYS A HE2  5  
ATOM 7587  H HE3  . LYS A 1 16  ? -5.561  -4.002  -11.659 1.00 0.00 ? 16  LYS A HE3  5  
ATOM 7588  H HZ1  . LYS A 1 16  ? -7.129  -3.008  -12.893 1.00 0.00 ? 16  LYS A HZ1  5  
ATOM 7589  H HZ2  . LYS A 1 16  ? -7.097  -4.434  -13.801 1.00 0.00 ? 16  LYS A HZ2  5  
ATOM 7590  H HZ3  . LYS A 1 16  ? -6.227  -3.080  -14.323 1.00 0.00 ? 16  LYS A HZ3  5  
ATOM 7591  N N    . ILE A 1 17  ? -0.534  0.063   -13.089 1.00 0.00 ? 17  ILE A N    5  
ATOM 7592  C CA   . ILE A 1 17  ? 0.303   1.248   -12.948 1.00 0.00 ? 17  ILE A CA   5  
ATOM 7593  C C    . ILE A 1 17  ? 0.395   1.686   -11.491 1.00 0.00 ? 17  ILE A C    5  
ATOM 7594  O O    . ILE A 1 17  ? 1.391   2.275   -11.071 1.00 0.00 ? 17  ILE A O    5  
ATOM 7595  C CB   . ILE A 1 17  ? -0.235  2.420   -13.792 1.00 0.00 ? 17  ILE A CB   5  
ATOM 7596  C CG1  . ILE A 1 17  ? 0.663   3.648   -13.629 1.00 0.00 ? 17  ILE A CG1  5  
ATOM 7597  C CG2  . ILE A 1 17  ? -1.666  2.746   -13.393 1.00 0.00 ? 17  ILE A CG2  5  
ATOM 7598  C CD1  . ILE A 1 17  ? 0.508   4.661   -14.741 1.00 0.00 ? 17  ILE A CD1  5  
ATOM 7599  H H    . ILE A 1 17  ? -1.479  0.169   -13.323 1.00 0.00 ? 17  ILE A H    5  
ATOM 7600  H HA   . ILE A 1 17  ? 1.293   1.001   -13.302 1.00 0.00 ? 17  ILE A HA   5  
ATOM 7601  H HB   . ILE A 1 17  ? -0.235  2.118   -14.828 1.00 0.00 ? 17  ILE A HB   5  
ATOM 7602  H HG12 . ILE A 1 17  ? 0.425   4.139   -12.698 1.00 0.00 ? 17  ILE A HG12 5  
ATOM 7603  H HG13 . ILE A 1 17  ? 1.695   3.330   -13.610 1.00 0.00 ? 17  ILE A HG13 5  
ATOM 7604  H HG21 . ILE A 1 17  ? -1.932  2.182   -12.511 1.00 0.00 ? 17  ILE A HG21 5  
ATOM 7605  H HG22 . ILE A 1 17  ? -1.749  3.802   -13.182 1.00 0.00 ? 17  ILE A HG22 5  
ATOM 7606  H HG23 . ILE A 1 17  ? -2.333  2.487   -14.201 1.00 0.00 ? 17  ILE A HG23 5  
ATOM 7607  H HD11 . ILE A 1 17  ? -0.222  4.306   -15.453 1.00 0.00 ? 17  ILE A HD11 5  
ATOM 7608  H HD12 . ILE A 1 17  ? 0.180   5.603   -14.328 1.00 0.00 ? 17  ILE A HD12 5  
ATOM 7609  H HD13 . ILE A 1 17  ? 1.458   4.798   -15.238 1.00 0.00 ? 17  ILE A HD13 5  
ATOM 7610  N N    . TRP A 1 18  ? -0.649  1.393   -10.724 1.00 0.00 ? 18  TRP A N    5  
ATOM 7611  C CA   . TRP A 1 18  ? -0.685  1.755   -9.311  1.00 0.00 ? 18  TRP A CA   5  
ATOM 7612  C C    . TRP A 1 18  ? -0.077  0.653   -8.451  1.00 0.00 ? 18  TRP A C    5  
ATOM 7613  O O    . TRP A 1 18  ? 0.240   0.869   -7.281  1.00 0.00 ? 18  TRP A O    5  
ATOM 7614  C CB   . TRP A 1 18  ? -2.124  2.028   -8.870  1.00 0.00 ? 18  TRP A CB   5  
ATOM 7615  C CG   . TRP A 1 18  ? -3.082  0.944   -9.264  1.00 0.00 ? 18  TRP A CG   5  
ATOM 7616  C CD1  . TRP A 1 18  ? -3.980  0.977   -10.292 1.00 0.00 ? 18  TRP A CD1  5  
ATOM 7617  C CD2  . TRP A 1 18  ? -3.237  -0.332  -8.634  1.00 0.00 ? 18  TRP A CD2  5  
ATOM 7618  N NE1  . TRP A 1 18  ? -4.684  -0.202  -10.339 1.00 0.00 ? 18  TRP A NE1  5  
ATOM 7619  C CE2  . TRP A 1 18  ? -4.247  -1.022  -9.333  1.00 0.00 ? 18  TRP A CE2  5  
ATOM 7620  C CE3  . TRP A 1 18  ? -2.621  -0.960  -7.548  1.00 0.00 ? 18  TRP A CE3  5  
ATOM 7621  C CZ2  . TRP A 1 18  ? -4.653  -2.306  -8.980  1.00 0.00 ? 18  TRP A CZ2  5  
ATOM 7622  C CZ3  . TRP A 1 18  ? -3.025  -2.235  -7.199  1.00 0.00 ? 18  TRP A CZ3  5  
ATOM 7623  C CH2  . TRP A 1 18  ? -4.032  -2.897  -7.913  1.00 0.00 ? 18  TRP A CH2  5  
ATOM 7624  H H    . TRP A 1 18  ? -1.414  0.922   -11.116 1.00 0.00 ? 18  TRP A H    5  
ATOM 7625  H HA   . TRP A 1 18  ? -0.103  2.656   -9.186  1.00 0.00 ? 18  TRP A HA   5  
ATOM 7626  H HB2  . TRP A 1 18  ? -2.153  2.124   -7.795  1.00 0.00 ? 18  TRP A HB2  5  
ATOM 7627  H HB3  . TRP A 1 18  ? -2.462  2.951   -9.320  1.00 0.00 ? 18  TRP A HB3  5  
ATOM 7628  H HD1  . TRP A 1 18  ? -4.108  1.814   -10.961 1.00 0.00 ? 18  TRP A HD1  5  
ATOM 7629  H HE1  . TRP A 1 18  ? -5.385  -0.420  -10.990 1.00 0.00 ? 18  TRP A HE1  5  
ATOM 7630  H HE3  . TRP A 1 18  ? -1.843  -0.466  -6.985  1.00 0.00 ? 18  TRP A HE3  5  
ATOM 7631  H HZ2  . TRP A 1 18  ? -5.427  -2.830  -9.521  1.00 0.00 ? 18  TRP A HZ2  5  
ATOM 7632  H HZ3  . TRP A 1 18  ? -2.560  -2.736  -6.362  1.00 0.00 ? 18  TRP A HZ3  5  
ATOM 7633  H HH2  . TRP A 1 18  ? -4.316  -3.891  -7.604  1.00 0.00 ? 18  TRP A HH2  5  
ATOM 7634  N N    . PHE A 1 19  ? 0.083   -0.529  -9.037  1.00 0.00 ? 19  PHE A N    5  
ATOM 7635  C CA   . PHE A 1 19  ? 0.653   -1.665  -8.323  1.00 0.00 ? 19  PHE A CA   5  
ATOM 7636  C C    . PHE A 1 19  ? 2.176   -1.661  -8.422  1.00 0.00 ? 19  PHE A C    5  
ATOM 7637  O O    . PHE A 1 19  ? 2.744   -1.224  -9.423  1.00 0.00 ? 19  PHE A O    5  
ATOM 7638  C CB   . PHE A 1 19  ? 0.098   -2.977  -8.883  1.00 0.00 ? 19  PHE A CB   5  
ATOM 7639  C CG   . PHE A 1 19  ? 0.670   -4.200  -8.224  1.00 0.00 ? 19  PHE A CG   5  
ATOM 7640  C CD1  . PHE A 1 19  ? 0.351   -4.507  -6.911  1.00 0.00 ? 19  PHE A CD1  5  
ATOM 7641  C CD2  . PHE A 1 19  ? 1.524   -5.041  -8.917  1.00 0.00 ? 19  PHE A CD2  5  
ATOM 7642  C CE1  . PHE A 1 19  ? 0.876   -5.631  -6.302  1.00 0.00 ? 19  PHE A CE1  5  
ATOM 7643  C CE2  . PHE A 1 19  ? 2.052   -6.167  -8.313  1.00 0.00 ? 19  PHE A CE2  5  
ATOM 7644  C CZ   . PHE A 1 19  ? 1.727   -6.463  -7.004  1.00 0.00 ? 19  PHE A CZ   5  
ATOM 7645  H H    . PHE A 1 19  ? -0.189  -0.639  -9.973  1.00 0.00 ? 19  PHE A H    5  
ATOM 7646  H HA   . PHE A 1 19  ? 0.371   -1.579  -7.286  1.00 0.00 ? 19  PHE A HA   5  
ATOM 7647  H HB2  . PHE A 1 19  ? -0.972  -2.995  -8.744  1.00 0.00 ? 19  PHE A HB2  5  
ATOM 7648  H HB3  . PHE A 1 19  ? 0.321   -3.032  -9.938  1.00 0.00 ? 19  PHE A HB3  5  
ATOM 7649  H HD1  . PHE A 1 19  ? -0.315  -3.859  -6.361  1.00 0.00 ? 19  PHE A HD1  5  
ATOM 7650  H HD2  . PHE A 1 19  ? 1.780   -4.810  -9.942  1.00 0.00 ? 19  PHE A HD2  5  
ATOM 7651  H HE1  . PHE A 1 19  ? 0.620   -5.861  -5.278  1.00 0.00 ? 19  PHE A HE1  5  
ATOM 7652  H HE2  . PHE A 1 19  ? 2.717   -6.815  -8.865  1.00 0.00 ? 19  PHE A HE2  5  
ATOM 7653  H HZ   . PHE A 1 19  ? 2.139   -7.341  -6.530  1.00 0.00 ? 19  PHE A HZ   5  
ATOM 7654  N N    . HIS A 1 20  ? 2.832   -2.151  -7.374  1.00 0.00 ? 20  HIS A N    5  
ATOM 7655  C CA   . HIS A 1 20  ? 4.289   -2.204  -7.342  1.00 0.00 ? 20  HIS A CA   5  
ATOM 7656  C C    . HIS A 1 20  ? 4.772   -3.541  -6.786  1.00 0.00 ? 20  HIS A C    5  
ATOM 7657  O O    . HIS A 1 20  ? 4.355   -3.963  -5.708  1.00 0.00 ? 20  HIS A O    5  
ATOM 7658  C CB   . HIS A 1 20  ? 4.844   -1.057  -6.496  1.00 0.00 ? 20  HIS A CB   5  
ATOM 7659  C CG   . HIS A 1 20  ? 4.769   0.276   -7.174  1.00 0.00 ? 20  HIS A CG   5  
ATOM 7660  N ND1  . HIS A 1 20  ? 5.782   0.776   -7.965  1.00 0.00 ? 20  HIS A ND1  5  
ATOM 7661  C CD2  . HIS A 1 20  ? 3.794   1.215   -7.176  1.00 0.00 ? 20  HIS A CD2  5  
ATOM 7662  C CE1  . HIS A 1 20  ? 5.434   1.965   -8.424  1.00 0.00 ? 20  HIS A CE1  5  
ATOM 7663  N NE2  . HIS A 1 20  ? 4.231   2.255   -7.960  1.00 0.00 ? 20  HIS A NE2  5  
ATOM 7664  H H    . HIS A 1 20  ? 2.324   -2.484  -6.606  1.00 0.00 ? 20  HIS A H    5  
ATOM 7665  H HA   . HIS A 1 20  ? 4.648   -2.099  -8.355  1.00 0.00 ? 20  HIS A HA   5  
ATOM 7666  H HB2  . HIS A 1 20  ? 4.282   -0.993  -5.576  1.00 0.00 ? 20  HIS A HB2  5  
ATOM 7667  H HB3  . HIS A 1 20  ? 5.881   -1.257  -6.267  1.00 0.00 ? 20  HIS A HB3  5  
ATOM 7668  H HD1  . HIS A 1 20  ? 6.630   0.327   -8.161  1.00 0.00 ? 20  HIS A HD1  5  
ATOM 7669  H HD2  . HIS A 1 20  ? 2.848   1.158   -6.657  1.00 0.00 ? 20  HIS A HD2  5  
ATOM 7670  H HE1  . HIS A 1 20  ? 6.029   2.594   -9.068  1.00 0.00 ? 20  HIS A HE1  5  
ATOM 7671  N N    . GLY A 1 21  ? 5.652   -4.203  -7.531  1.00 0.00 ? 21  GLY A N    5  
ATOM 7672  C CA   . GLY A 1 21  ? 6.176   -5.485  -7.097  1.00 0.00 ? 21  GLY A CA   5  
ATOM 7673  C C    . GLY A 1 21  ? 7.685   -5.563  -7.210  1.00 0.00 ? 21  GLY A C    5  
ATOM 7674  O O    . GLY A 1 21  ? 8.336   -6.285  -6.454  1.00 0.00 ? 21  GLY A O    5  
ATOM 7675  H H    . GLY A 1 21  ? 5.948   -3.818  -8.382  1.00 0.00 ? 21  GLY A H    5  
ATOM 7676  H HA2  . GLY A 1 21  ? 5.893   -5.647  -6.067  1.00 0.00 ? 21  GLY A HA2  5  
ATOM 7677  H HA3  . GLY A 1 21  ? 5.740   -6.264  -7.706  1.00 0.00 ? 21  GLY A HA3  5  
ATOM 7678  N N    . LYS A 1 22  ? 8.245   -4.820  -8.159  1.00 0.00 ? 22  LYS A N    5  
ATOM 7679  C CA   . LYS A 1 22  ? 9.687   -4.808  -8.370  1.00 0.00 ? 22  LYS A CA   5  
ATOM 7680  C C    . LYS A 1 22  ? 10.389  -3.994  -7.288  1.00 0.00 ? 22  LYS A C    5  
ATOM 7681  O O    . LYS A 1 22  ? 11.251  -4.506  -6.573  1.00 0.00 ? 22  LYS A O    5  
ATOM 7682  C CB   . LYS A 1 22  ? 10.017  -4.233  -9.750  1.00 0.00 ? 22  LYS A CB   5  
ATOM 7683  C CG   . LYS A 1 22  ? 9.632   -5.150  -10.898 1.00 0.00 ? 22  LYS A CG   5  
ATOM 7684  C CD   . LYS A 1 22  ? 10.757  -6.111  -11.245 1.00 0.00 ? 22  LYS A CD   5  
ATOM 7685  C CE   . LYS A 1 22  ? 10.248  -7.298  -12.049 1.00 0.00 ? 22  LYS A CE   5  
ATOM 7686  N NZ   . LYS A 1 22  ? 10.233  -7.012  -13.510 1.00 0.00 ? 22  LYS A NZ   5  
ATOM 7687  H H    . LYS A 1 22  ? 7.673   -4.266  -8.731  1.00 0.00 ? 22  LYS A H    5  
ATOM 7688  H HA   . LYS A 1 22  ? 10.039  -5.828  -8.321  1.00 0.00 ? 22  LYS A HA   5  
ATOM 7689  H HB2  . LYS A 1 22  ? 9.491   -3.298  -9.872  1.00 0.00 ? 22  LYS A HB2  5  
ATOM 7690  H HB3  . LYS A 1 22  ? 11.080  -4.048  -9.805  1.00 0.00 ? 22  LYS A HB3  5  
ATOM 7691  H HG2  . LYS A 1 22  ? 8.760   -5.721  -10.615 1.00 0.00 ? 22  LYS A HG2  5  
ATOM 7692  H HG3  . LYS A 1 22  ? 9.405   -4.548  -11.766 1.00 0.00 ? 22  LYS A HG3  5  
ATOM 7693  H HD2  . LYS A 1 22  ? 11.500  -5.587  -11.828 1.00 0.00 ? 22  LYS A HD2  5  
ATOM 7694  H HD3  . LYS A 1 22  ? 11.205  -6.473  -10.330 1.00 0.00 ? 22  LYS A HD3  5  
ATOM 7695  H HE2  . LYS A 1 22  ? 10.891  -8.144  -11.863 1.00 0.00 ? 22  LYS A HE2  5  
ATOM 7696  H HE3  . LYS A 1 22  ? 9.244   -7.530  -11.726 1.00 0.00 ? 22  LYS A HE3  5  
ATOM 7697  H HZ1  . LYS A 1 22  ? 9.378   -7.414  -13.944 1.00 0.00 ? 22  LYS A HZ1  5  
ATOM 7698  H HZ2  . LYS A 1 22  ? 11.069  -7.433  -13.965 1.00 0.00 ? 22  LYS A HZ2  5  
ATOM 7699  H HZ3  . LYS A 1 22  ? 10.243  -5.986  -13.674 1.00 0.00 ? 22  LYS A HZ3  5  
ATOM 7700  N N    . ILE A 1 23  ? 10.014  -2.724  -7.172  1.00 0.00 ? 23  ILE A N    5  
ATOM 7701  C CA   . ILE A 1 23  ? 10.605  -1.841  -6.175  1.00 0.00 ? 23  ILE A CA   5  
ATOM 7702  C C    . ILE A 1 23  ? 10.475  -2.428  -4.774  1.00 0.00 ? 23  ILE A C    5  
ATOM 7703  O O    . ILE A 1 23  ? 10.002  -3.551  -4.602  1.00 0.00 ? 23  ILE A O    5  
ATOM 7704  C CB   . ILE A 1 23  ? 9.950   -0.447  -6.198  1.00 0.00 ? 23  ILE A CB   5  
ATOM 7705  C CG1  . ILE A 1 23  ? 8.510   -0.528  -5.687  1.00 0.00 ? 23  ILE A CG1  5  
ATOM 7706  C CG2  . ILE A 1 23  ? 9.987   0.132   -7.604  1.00 0.00 ? 23  ILE A CG2  5  
ATOM 7707  C CD1  . ILE A 1 23  ? 7.949   0.806   -5.248  1.00 0.00 ? 23  ILE A CD1  5  
ATOM 7708  H H    . ILE A 1 23  ? 9.322   -2.374  -7.771  1.00 0.00 ? 23  ILE A H    5  
ATOM 7709  H HA   . ILE A 1 23  ? 11.654  -1.728  -6.411  1.00 0.00 ? 23  ILE A HA   5  
ATOM 7710  H HB   . ILE A 1 23  ? 10.518  0.204   -5.551  1.00 0.00 ? 23  ILE A HB   5  
ATOM 7711  H HG12 . ILE A 1 23  ? 7.877   -0.911  -6.472  1.00 0.00 ? 23  ILE A HG12 5  
ATOM 7712  H HG13 . ILE A 1 23  ? 8.474   -1.199  -4.841  1.00 0.00 ? 23  ILE A HG13 5  
ATOM 7713  H HG21 . ILE A 1 23  ? 10.964  -0.032  -8.035  1.00 0.00 ? 23  ILE A HG21 5  
ATOM 7714  H HG22 . ILE A 1 23  ? 9.240   -0.354  -8.213  1.00 0.00 ? 23  ILE A HG22 5  
ATOM 7715  H HG23 . ILE A 1 23  ? 9.785   1.192   -7.563  1.00 0.00 ? 23  ILE A HG23 5  
ATOM 7716  H HD11 . ILE A 1 23  ? 6.870   0.771   -5.276  1.00 0.00 ? 23  ILE A HD11 5  
ATOM 7717  H HD12 . ILE A 1 23  ? 8.277   1.022   -4.242  1.00 0.00 ? 23  ILE A HD12 5  
ATOM 7718  H HD13 . ILE A 1 23  ? 8.300   1.581   -5.914  1.00 0.00 ? 23  ILE A HD13 5  
ATOM 7719  N N    . SER A 1 24  ? 10.898  -1.660  -3.775  1.00 0.00 ? 24  SER A N    5  
ATOM 7720  C CA   . SER A 1 24  ? 10.831  -2.105  -2.388  1.00 0.00 ? 24  SER A CA   5  
ATOM 7721  C C    . SER A 1 24  ? 10.042  -1.114  -1.537  1.00 0.00 ? 24  SER A C    5  
ATOM 7722  O O    . SER A 1 24  ? 9.550   -0.102  -2.037  1.00 0.00 ? 24  SER A O    5  
ATOM 7723  C CB   . SER A 1 24  ? 12.239  -2.277  -1.816  1.00 0.00 ? 24  SER A CB   5  
ATOM 7724  O OG   . SER A 1 24  ? 12.890  -3.397  -2.391  1.00 0.00 ? 24  SER A OG   5  
ATOM 7725  H H    . SER A 1 24  ? 11.266  -0.774  -3.976  1.00 0.00 ? 24  SER A H    5  
ATOM 7726  H HA   . SER A 1 24  ? 10.325  -3.059  -2.370  1.00 0.00 ? 24  SER A HA   5  
ATOM 7727  H HB2  . SER A 1 24  ? 12.820  -1.392  -2.026  1.00 0.00 ? 24  SER A HB2  5  
ATOM 7728  H HB3  . SER A 1 24  ? 12.176  -2.422  -0.747  1.00 0.00 ? 24  SER A HB3  5  
ATOM 7729  H HG   . SER A 1 24  ? 12.866  -4.132  -1.775  1.00 0.00 ? 24  SER A HG   5  
ATOM 7730  N N    . LYS A 1 25  ? 9.925   -1.413  -0.248  1.00 0.00 ? 25  LYS A N    5  
ATOM 7731  C CA   . LYS A 1 25  ? 9.198   -0.550  0.676   1.00 0.00 ? 25  LYS A CA   5  
ATOM 7732  C C    . LYS A 1 25  ? 9.801   0.851   0.700   1.00 0.00 ? 25  LYS A C    5  
ATOM 7733  O O    . LYS A 1 25  ? 9.094   1.843   0.526   1.00 0.00 ? 25  LYS A O    5  
ATOM 7734  C CB   . LYS A 1 25  ? 9.212   -1.148  2.084   1.00 0.00 ? 25  LYS A CB   5  
ATOM 7735  C CG   . LYS A 1 25  ? 8.755   -0.179  3.161   1.00 0.00 ? 25  LYS A CG   5  
ATOM 7736  C CD   . LYS A 1 25  ? 9.000   -0.737  4.553   1.00 0.00 ? 25  LYS A CD   5  
ATOM 7737  C CE   . LYS A 1 25  ? 8.451   0.188   5.628   1.00 0.00 ? 25  LYS A CE   5  
ATOM 7738  N NZ   . LYS A 1 25  ? 6.985   0.009   5.819   1.00 0.00 ? 25  LYS A NZ   5  
ATOM 7739  H H    . LYS A 1 25  ? 10.340  -2.234  0.092   1.00 0.00 ? 25  LYS A H    5  
ATOM 7740  H HA   . LYS A 1 25  ? 8.176   -0.483  0.333   1.00 0.00 ? 25  LYS A HA   5  
ATOM 7741  H HB2  . LYS A 1 25  ? 8.561   -2.009  2.103   1.00 0.00 ? 25  LYS A HB2  5  
ATOM 7742  H HB3  . LYS A 1 25  ? 10.219  -1.464  2.318   1.00 0.00 ? 25  LYS A HB3  5  
ATOM 7743  H HG2  . LYS A 1 25  ? 9.301   0.747   3.055   1.00 0.00 ? 25  LYS A HG2  5  
ATOM 7744  H HG3  . LYS A 1 25  ? 7.698   0.008   3.039   1.00 0.00 ? 25  LYS A HG3  5  
ATOM 7745  H HD2  . LYS A 1 25  ? 8.513   -1.697  4.638   1.00 0.00 ? 25  LYS A HD2  5  
ATOM 7746  H HD3  . LYS A 1 25  ? 10.064  -0.856  4.702   1.00 0.00 ? 25  LYS A HD3  5  
ATOM 7747  H HE2  . LYS A 1 25  ? 8.955   -0.024  6.559   1.00 0.00 ? 25  LYS A HE2  5  
ATOM 7748  H HE3  . LYS A 1 25  ? 8.646   1.210   5.339   1.00 0.00 ? 25  LYS A HE3  5  
ATOM 7749  H HZ1  . LYS A 1 25  ? 6.559   0.895   6.158   1.00 0.00 ? 25  LYS A HZ1  5  
ATOM 7750  H HZ2  . LYS A 1 25  ? 6.805   -0.739  6.518   1.00 0.00 ? 25  LYS A HZ2  5  
ATOM 7751  H HZ3  . LYS A 1 25  ? 6.537   -0.257  4.919   1.00 0.00 ? 25  LYS A HZ3  5  
ATOM 7752  N N    . GLN A 1 26  ? 11.110  0.923   0.916   1.00 0.00 ? 26  GLN A N    5  
ATOM 7753  C CA   . GLN A 1 26  ? 11.807  2.203   0.962   1.00 0.00 ? 26  GLN A CA   5  
ATOM 7754  C C    . GLN A 1 26  ? 11.525  3.022   -0.293  1.00 0.00 ? 26  GLN A C    5  
ATOM 7755  O O    . GLN A 1 26  ? 11.008  4.136   -0.215  1.00 0.00 ? 26  GLN A O    5  
ATOM 7756  C CB   . GLN A 1 26  ? 13.313  1.983   1.113   1.00 0.00 ? 26  GLN A CB   5  
ATOM 7757  C CG   . GLN A 1 26  ? 14.063  3.214   1.596   1.00 0.00 ? 26  GLN A CG   5  
ATOM 7758  C CD   . GLN A 1 26  ? 14.449  4.144   0.463   1.00 0.00 ? 26  GLN A CD   5  
ATOM 7759  O OE1  . GLN A 1 26  ? 14.196  3.854   -0.707  1.00 0.00 ? 26  GLN A OE1  5  
ATOM 7760  N NE2  . GLN A 1 26  ? 15.065  5.269   0.804   1.00 0.00 ? 26  GLN A NE2  5  
ATOM 7761  H H    . GLN A 1 26  ? 11.619  0.097   1.047   1.00 0.00 ? 26  GLN A H    5  
ATOM 7762  H HA   . GLN A 1 26  ? 11.444  2.747   1.821   1.00 0.00 ? 26  GLN A HA   5  
ATOM 7763  H HB2  . GLN A 1 26  ? 13.479  1.186   1.822   1.00 0.00 ? 26  GLN A HB2  5  
ATOM 7764  H HB3  . GLN A 1 26  ? 13.720  1.693   0.156   1.00 0.00 ? 26  GLN A HB3  5  
ATOM 7765  H HG2  . GLN A 1 26  ? 13.433  3.756   2.286   1.00 0.00 ? 26  GLN A HG2  5  
ATOM 7766  H HG3  . GLN A 1 26  ? 14.961  2.896   2.104   1.00 0.00 ? 26  GLN A HG3  5  
ATOM 7767  H HE21 . GLN A 1 26  ? 15.235  5.433   1.756   1.00 0.00 ? 26  GLN A HE21 5  
ATOM 7768  H HE22 . GLN A 1 26  ? 15.327  5.888   0.092   1.00 0.00 ? 26  GLN A HE22 5  
ATOM 7769  N N    . GLU A 1 27  ? 11.868  2.462   -1.449  1.00 0.00 ? 27  GLU A N    5  
ATOM 7770  C CA   . GLU A 1 27  ? 11.652  3.142   -2.721  1.00 0.00 ? 27  GLU A CA   5  
ATOM 7771  C C    . GLU A 1 27  ? 10.305  3.859   -2.732  1.00 0.00 ? 27  GLU A C    5  
ATOM 7772  O O    . GLU A 1 27  ? 10.226  5.051   -3.031  1.00 0.00 ? 27  GLU A O    5  
ATOM 7773  C CB   . GLU A 1 27  ? 11.720  2.143   -3.877  1.00 0.00 ? 27  GLU A CB   5  
ATOM 7774  C CG   . GLU A 1 27  ? 13.128  1.912   -4.400  1.00 0.00 ? 27  GLU A CG   5  
ATOM 7775  C CD   . GLU A 1 27  ? 13.872  0.846   -3.620  1.00 0.00 ? 27  GLU A CD   5  
ATOM 7776  O OE1  . GLU A 1 27  ? 13.716  0.798   -2.382  1.00 0.00 ? 27  GLU A OE1  5  
ATOM 7777  O OE2  . GLU A 1 27  ? 14.611  0.059   -4.249  1.00 0.00 ? 27  GLU A OE2  5  
ATOM 7778  H H    . GLU A 1 27  ? 12.276  1.571   -1.447  1.00 0.00 ? 27  GLU A H    5  
ATOM 7779  H HA   . GLU A 1 27  ? 12.436  3.874   -2.843  1.00 0.00 ? 27  GLU A HA   5  
ATOM 7780  H HB2  . GLU A 1 27  ? 11.322  1.196   -3.543  1.00 0.00 ? 27  GLU A HB2  5  
ATOM 7781  H HB3  . GLU A 1 27  ? 11.113  2.511   -4.691  1.00 0.00 ? 27  GLU A HB3  5  
ATOM 7782  H HG2  . GLU A 1 27  ? 13.069  1.605   -5.433  1.00 0.00 ? 27  GLU A HG2  5  
ATOM 7783  H HG3  . GLU A 1 27  ? 13.680  2.838   -4.332  1.00 0.00 ? 27  GLU A HG3  5  
ATOM 7784  N N    . ALA A 1 28  ? 9.247   3.124   -2.406  1.00 0.00 ? 28  ALA A N    5  
ATOM 7785  C CA   . ALA A 1 28  ? 7.904   3.689   -2.377  1.00 0.00 ? 28  ALA A CA   5  
ATOM 7786  C C    . ALA A 1 28  ? 7.910   5.091   -1.778  1.00 0.00 ? 28  ALA A C    5  
ATOM 7787  O O    . ALA A 1 28  ? 7.348   6.024   -2.351  1.00 0.00 ? 28  ALA A O    5  
ATOM 7788  C CB   . ALA A 1 28  ? 6.967   2.782   -1.593  1.00 0.00 ? 28  ALA A CB   5  
ATOM 7789  H H    . ALA A 1 28  ? 9.374   2.180   -2.177  1.00 0.00 ? 28  ALA A H    5  
ATOM 7790  H HA   . ALA A 1 28  ? 7.543   3.745   -3.394  1.00 0.00 ? 28  ALA A HA   5  
ATOM 7791  H HB1  . ALA A 1 28  ? 6.568   3.323   -0.747  1.00 0.00 ? 28  ALA A HB1  5  
ATOM 7792  H HB2  . ALA A 1 28  ? 6.156   2.464   -2.231  1.00 0.00 ? 28  ALA A HB2  5  
ATOM 7793  H HB3  . ALA A 1 28  ? 7.511   1.917   -1.244  1.00 0.00 ? 28  ALA A HB3  5  
ATOM 7794  N N    . TYR A 1 29  ? 8.549   5.232   -0.622  1.00 0.00 ? 29  TYR A N    5  
ATOM 7795  C CA   . TYR A 1 29  ? 8.626   6.520   0.057   1.00 0.00 ? 29  TYR A CA   5  
ATOM 7796  C C    . TYR A 1 29  ? 9.189   7.592   -0.871  1.00 0.00 ? 29  TYR A C    5  
ATOM 7797  O O    . TYR A 1 29  ? 8.535   8.597   -1.145  1.00 0.00 ? 29  TYR A O    5  
ATOM 7798  C CB   . TYR A 1 29  ? 9.494   6.408   1.311   1.00 0.00 ? 29  TYR A CB   5  
ATOM 7799  C CG   . TYR A 1 29  ? 8.769   5.818   2.499   1.00 0.00 ? 29  TYR A CG   5  
ATOM 7800  C CD1  . TYR A 1 29  ? 7.971   6.611   3.315   1.00 0.00 ? 29  TYR A CD1  5  
ATOM 7801  C CD2  . TYR A 1 29  ? 8.883   4.468   2.808   1.00 0.00 ? 29  TYR A CD2  5  
ATOM 7802  C CE1  . TYR A 1 29  ? 7.306   6.077   4.402   1.00 0.00 ? 29  TYR A CE1  5  
ATOM 7803  C CE2  . TYR A 1 29  ? 8.221   3.925   3.892   1.00 0.00 ? 29  TYR A CE2  5  
ATOM 7804  C CZ   . TYR A 1 29  ? 7.434   4.733   4.686   1.00 0.00 ? 29  TYR A CZ   5  
ATOM 7805  O OH   . TYR A 1 29  ? 6.775   4.196   5.767   1.00 0.00 ? 29  TYR A OH   5  
ATOM 7806  H H    . TYR A 1 29  ? 8.978   4.451   -0.214  1.00 0.00 ? 29  TYR A H    5  
ATOM 7807  H HA   . TYR A 1 29  ? 7.625   6.802   0.348   1.00 0.00 ? 29  TYR A HA   5  
ATOM 7808  H HB2  . TYR A 1 29  ? 10.345  5.780   1.097   1.00 0.00 ? 29  TYR A HB2  5  
ATOM 7809  H HB3  . TYR A 1 29  ? 9.841   7.393   1.589   1.00 0.00 ? 29  TYR A HB3  5  
ATOM 7810  H HD1  . TYR A 1 29  ? 7.872   7.664   3.089   1.00 0.00 ? 29  TYR A HD1  5  
ATOM 7811  H HD2  . TYR A 1 29  ? 9.500   3.838   2.184   1.00 0.00 ? 29  TYR A HD2  5  
ATOM 7812  H HE1  . TYR A 1 29  ? 6.690   6.709   5.024   1.00 0.00 ? 29  TYR A HE1  5  
ATOM 7813  H HE2  . TYR A 1 29  ? 8.321   2.873   4.115   1.00 0.00 ? 29  TYR A HE2  5  
ATOM 7814  H HH   . TYR A 1 29  ? 7.413   3.812   6.373   1.00 0.00 ? 29  TYR A HH   5  
ATOM 7815  N N    . ASN A 1 30  ? 10.407  7.368   -1.353  1.00 0.00 ? 30  ASN A N    5  
ATOM 7816  C CA   . ASN A 1 30  ? 11.060  8.314   -2.251  1.00 0.00 ? 30  ASN A CA   5  
ATOM 7817  C C    . ASN A 1 30  ? 10.169  8.630   -3.448  1.00 0.00 ? 30  ASN A C    5  
ATOM 7818  O O    . ASN A 1 30  ? 10.046  9.786   -3.856  1.00 0.00 ? 30  ASN A O    5  
ATOM 7819  C CB   . ASN A 1 30  ? 12.399  7.752   -2.732  1.00 0.00 ? 30  ASN A CB   5  
ATOM 7820  C CG   . ASN A 1 30  ? 13.116  8.695   -3.678  1.00 0.00 ? 30  ASN A CG   5  
ATOM 7821  O OD1  . ASN A 1 30  ? 12.966  9.914   -3.590  1.00 0.00 ? 30  ASN A OD1  5  
ATOM 7822  N ND2  . ASN A 1 30  ? 13.900  8.134   -4.591  1.00 0.00 ? 30  ASN A ND2  5  
ATOM 7823  H H    . ASN A 1 30  ? 10.879  6.548   -1.098  1.00 0.00 ? 30  ASN A H    5  
ATOM 7824  H HA   . ASN A 1 30  ? 11.239  9.225   -1.699  1.00 0.00 ? 30  ASN A HA   5  
ATOM 7825  H HB2  . ASN A 1 30  ? 13.037  7.577   -1.877  1.00 0.00 ? 30  ASN A HB2  5  
ATOM 7826  H HB3  . ASN A 1 30  ? 12.228  6.817   -3.244  1.00 0.00 ? 30  ASN A HB3  5  
ATOM 7827  H HD21 . ASN A 1 30  ? 13.972  7.156   -4.603  1.00 0.00 ? 30  ASN A HD21 5  
ATOM 7828  H HD22 . ASN A 1 30  ? 14.376  8.720   -5.216  1.00 0.00 ? 30  ASN A HD22 5  
ATOM 7829  N N    . LEU A 1 31  ? 9.550   7.597   -4.007  1.00 0.00 ? 31  LEU A N    5  
ATOM 7830  C CA   . LEU A 1 31  ? 8.669   7.764   -5.158  1.00 0.00 ? 31  LEU A CA   5  
ATOM 7831  C C    . LEU A 1 31  ? 7.554   8.758   -4.851  1.00 0.00 ? 31  LEU A C    5  
ATOM 7832  O O    . LEU A 1 31  ? 7.454   9.810   -5.485  1.00 0.00 ? 31  LEU A O    5  
ATOM 7833  C CB   . LEU A 1 31  ? 8.068   6.417   -5.565  1.00 0.00 ? 31  LEU A CB   5  
ATOM 7834  C CG   . LEU A 1 31  ? 9.053   5.378   -6.103  1.00 0.00 ? 31  LEU A CG   5  
ATOM 7835  C CD1  . LEU A 1 31  ? 8.488   3.975   -5.944  1.00 0.00 ? 31  LEU A CD1  5  
ATOM 7836  C CD2  . LEU A 1 31  ? 9.383   5.660   -7.561  1.00 0.00 ? 31  LEU A CD2  5  
ATOM 7837  H H    . LEU A 1 31  ? 9.687   6.700   -3.638  1.00 0.00 ? 31  LEU A H    5  
ATOM 7838  H HA   . LEU A 1 31  ? 9.262   8.146   -5.976  1.00 0.00 ? 31  LEU A HA   5  
ATOM 7839  H HB2  . LEU A 1 31  ? 7.584   5.995   -4.698  1.00 0.00 ? 31  LEU A HB2  5  
ATOM 7840  H HB3  . LEU A 1 31  ? 7.331   6.603   -6.333  1.00 0.00 ? 31  LEU A HB3  5  
ATOM 7841  H HG   . LEU A 1 31  ? 9.971   5.434   -5.535  1.00 0.00 ? 31  LEU A HG   5  
ATOM 7842  H HD11 . LEU A 1 31  ? 8.301   3.550   -6.918  1.00 0.00 ? 31  LEU A HD11 5  
ATOM 7843  H HD12 . LEU A 1 31  ? 7.564   4.020   -5.387  1.00 0.00 ? 31  LEU A HD12 5  
ATOM 7844  H HD13 . LEU A 1 31  ? 9.199   3.359   -5.412  1.00 0.00 ? 31  LEU A HD13 5  
ATOM 7845  H HD21 . LEU A 1 31  ? 9.138   6.686   -7.793  1.00 0.00 ? 31  LEU A HD21 5  
ATOM 7846  H HD22 . LEU A 1 31  ? 8.806   5.001   -8.195  1.00 0.00 ? 31  LEU A HD22 5  
ATOM 7847  H HD23 . LEU A 1 31  ? 10.436  5.493   -7.731  1.00 0.00 ? 31  LEU A HD23 5  
ATOM 7848  N N    . LEU A 1 32  ? 6.721   8.422   -3.874  1.00 0.00 ? 32  LEU A N    5  
ATOM 7849  C CA   . LEU A 1 32  ? 5.614   9.286   -3.480  1.00 0.00 ? 32  LEU A CA   5  
ATOM 7850  C C    . LEU A 1 32  ? 6.122   10.656  -3.040  1.00 0.00 ? 32  LEU A C    5  
ATOM 7851  O O    . LEU A 1 32  ? 5.346   11.599  -2.893  1.00 0.00 ? 32  LEU A O    5  
ATOM 7852  C CB   . LEU A 1 32  ? 4.813   8.640   -2.349  1.00 0.00 ? 32  LEU A CB   5  
ATOM 7853  C CG   . LEU A 1 32  ? 3.718   7.661   -2.775  1.00 0.00 ? 32  LEU A CG   5  
ATOM 7854  C CD1  . LEU A 1 32  ? 3.206   6.877   -1.577  1.00 0.00 ? 32  LEU A CD1  5  
ATOM 7855  C CD2  . LEU A 1 32  ? 2.577   8.402   -3.458  1.00 0.00 ? 32  LEU A CD2  5  
ATOM 7856  H H    . LEU A 1 32  ? 6.852   7.571   -3.405  1.00 0.00 ? 32  LEU A H    5  
ATOM 7857  H HA   . LEU A 1 32  ? 4.971   9.413   -4.338  1.00 0.00 ? 32  LEU A HA   5  
ATOM 7858  H HB2  . LEU A 1 32  ? 5.505   8.105   -1.717  1.00 0.00 ? 32  LEU A HB2  5  
ATOM 7859  H HB3  . LEU A 1 32  ? 4.347   9.432   -1.780  1.00 0.00 ? 32  LEU A HB3  5  
ATOM 7860  H HG   . LEU A 1 32  ? 4.130   6.956   -3.484  1.00 0.00 ? 32  LEU A HG   5  
ATOM 7861  H HD11 . LEU A 1 32  ? 3.069   7.546   -0.741  1.00 0.00 ? 32  LEU A HD11 5  
ATOM 7862  H HD12 . LEU A 1 32  ? 3.923   6.114   -1.314  1.00 0.00 ? 32  LEU A HD12 5  
ATOM 7863  H HD13 . LEU A 1 32  ? 2.262   6.414   -1.827  1.00 0.00 ? 32  LEU A HD13 5  
ATOM 7864  H HD21 . LEU A 1 32  ? 2.914   8.781   -4.411  1.00 0.00 ? 32  LEU A HD21 5  
ATOM 7865  H HD22 . LEU A 1 32  ? 2.260   9.226   -2.835  1.00 0.00 ? 32  LEU A HD22 5  
ATOM 7866  H HD23 . LEU A 1 32  ? 1.749   7.726   -3.610  1.00 0.00 ? 32  LEU A HD23 5  
ATOM 7867  N N    . MET A 1 33  ? 7.431   10.757  -2.834  1.00 0.00 ? 33  MET A N    5  
ATOM 7868  C CA   . MET A 1 33  ? 8.044   12.012  -2.415  1.00 0.00 ? 33  MET A CA   5  
ATOM 7869  C C    . MET A 1 33  ? 8.580   12.784  -3.616  1.00 0.00 ? 33  MET A C    5  
ATOM 7870  O O    . MET A 1 33  ? 8.824   13.988  -3.536  1.00 0.00 ? 33  MET A O    5  
ATOM 7871  C CB   . MET A 1 33  ? 9.175   11.745  -1.420  1.00 0.00 ? 33  MET A CB   5  
ATOM 7872  C CG   . MET A 1 33  ? 8.709   11.678  0.026   1.00 0.00 ? 33  MET A CG   5  
ATOM 7873  S SD   . MET A 1 33  ? 8.739   13.287  0.840   1.00 0.00 ? 33  MET A SD   5  
ATOM 7874  C CE   . MET A 1 33  ? 7.495   14.166  -0.103  1.00 0.00 ? 33  MET A CE   5  
ATOM 7875  H H    . MET A 1 33  ? 7.999   9.969   -2.968  1.00 0.00 ? 33  MET A H    5  
ATOM 7876  H HA   . MET A 1 33  ? 7.283   12.606  -1.930  1.00 0.00 ? 33  MET A HA   5  
ATOM 7877  H HB2  . MET A 1 33  ? 9.642   10.804  -1.669  1.00 0.00 ? 33  MET A HB2  5  
ATOM 7878  H HB3  . MET A 1 33  ? 9.906   12.535  -1.503  1.00 0.00 ? 33  MET A HB3  5  
ATOM 7879  H HG2  . MET A 1 33  ? 7.699   11.298  0.048   1.00 0.00 ? 33  MET A HG2  5  
ATOM 7880  H HG3  . MET A 1 33  ? 9.357   11.004  0.567   1.00 0.00 ? 33  MET A HG3  5  
ATOM 7881  H HE1  . MET A 1 33  ? 7.265   15.100  0.387   1.00 0.00 ? 33  MET A HE1  5  
ATOM 7882  H HE2  . MET A 1 33  ? 7.870   14.363  -1.097  1.00 0.00 ? 33  MET A HE2  5  
ATOM 7883  H HE3  . MET A 1 33  ? 6.601   13.564  -0.168  1.00 0.00 ? 33  MET A HE3  5  
ATOM 7884  N N    . THR A 1 34  ? 8.761   12.083  -4.731  1.00 0.00 ? 34  THR A N    5  
ATOM 7885  C CA   . THR A 1 34  ? 9.269   12.702  -5.949  1.00 0.00 ? 34  THR A CA   5  
ATOM 7886  C C    . THR A 1 34  ? 8.257   12.595  -7.084  1.00 0.00 ? 34  THR A C    5  
ATOM 7887  O O    . THR A 1 34  ? 7.605   13.575  -7.442  1.00 0.00 ? 34  THR A O    5  
ATOM 7888  C CB   . THR A 1 34  ? 10.595  12.057  -6.396  1.00 0.00 ? 34  THR A CB   5  
ATOM 7889  O OG1  . THR A 1 34  ? 10.499  10.630  -6.309  1.00 0.00 ? 34  THR A OG1  5  
ATOM 7890  C CG2  . THR A 1 34  ? 11.751  12.546  -5.537  1.00 0.00 ? 34  THR A CG2  5  
ATOM 7891  H H    . THR A 1 34  ? 8.548   11.126  -4.733  1.00 0.00 ? 34  THR A H    5  
ATOM 7892  H HA   . THR A 1 34  ? 9.453   13.746  -5.741  1.00 0.00 ? 34  THR A HA   5  
ATOM 7893  H HB   . THR A 1 34  ? 10.785  12.335  -7.423  1.00 0.00 ? 34  THR A HB   5  
ATOM 7894  H HG1  . THR A 1 34  ? 10.768  10.344  -5.433  1.00 0.00 ? 34  THR A HG1  5  
ATOM 7895  H HG21 . THR A 1 34  ? 12.341  13.256  -6.098  1.00 0.00 ? 34  THR A HG21 5  
ATOM 7896  H HG22 . THR A 1 34  ? 12.370  11.707  -5.255  1.00 0.00 ? 34  THR A HG22 5  
ATOM 7897  H HG23 . THR A 1 34  ? 11.363  13.022  -4.649  1.00 0.00 ? 34  THR A HG23 5  
ATOM 7898  N N    . VAL A 1 35  ? 8.131   11.397  -7.647  1.00 0.00 ? 35  VAL A N    5  
ATOM 7899  C CA   . VAL A 1 35  ? 7.196   11.161  -8.741  1.00 0.00 ? 35  VAL A CA   5  
ATOM 7900  C C    . VAL A 1 35  ? 5.756   11.369  -8.287  1.00 0.00 ? 35  VAL A C    5  
ATOM 7901  O O    . VAL A 1 35  ? 4.915   11.842  -9.051  1.00 0.00 ? 35  VAL A O    5  
ATOM 7902  C CB   . VAL A 1 35  ? 7.344   9.737   -9.309  1.00 0.00 ? 35  VAL A CB   5  
ATOM 7903  C CG1  . VAL A 1 35  ? 8.717   9.552   -9.937  1.00 0.00 ? 35  VAL A CG1  5  
ATOM 7904  C CG2  . VAL A 1 35  ? 7.103   8.703   -8.219  1.00 0.00 ? 35  VAL A CG2  5  
ATOM 7905  H H    . VAL A 1 35  ? 8.679   10.654  -7.318  1.00 0.00 ? 35  VAL A H    5  
ATOM 7906  H HA   . VAL A 1 35  ? 7.420   11.866  -9.529  1.00 0.00 ? 35  VAL A HA   5  
ATOM 7907  H HB   . VAL A 1 35  ? 6.599   9.599   -10.078 1.00 0.00 ? 35  VAL A HB   5  
ATOM 7908  H HG11 . VAL A 1 35  ? 9.015   10.469  -10.424 1.00 0.00 ? 35  VAL A HG11 5  
ATOM 7909  H HG12 . VAL A 1 35  ? 9.434   9.301   -9.169  1.00 0.00 ? 35  VAL A HG12 5  
ATOM 7910  H HG13 . VAL A 1 35  ? 8.674   8.756   -10.665 1.00 0.00 ? 35  VAL A HG13 5  
ATOM 7911  H HG21 . VAL A 1 35  ? 6.160   8.905   -7.734  1.00 0.00 ? 35  VAL A HG21 5  
ATOM 7912  H HG22 . VAL A 1 35  ? 7.077   7.716   -8.659  1.00 0.00 ? 35  VAL A HG22 5  
ATOM 7913  H HG23 . VAL A 1 35  ? 7.901   8.751   -7.494  1.00 0.00 ? 35  VAL A HG23 5  
ATOM 7914  N N    . GLY A 1 36  ? 5.477   11.013  -7.037  1.00 0.00 ? 36  GLY A N    5  
ATOM 7915  C CA   . GLY A 1 36  ? 4.137   11.168  -6.502  1.00 0.00 ? 36  GLY A CA   5  
ATOM 7916  C C    . GLY A 1 36  ? 3.920   12.527  -5.867  1.00 0.00 ? 36  GLY A C    5  
ATOM 7917  O O    . GLY A 1 36  ? 4.873   13.272  -5.640  1.00 0.00 ? 36  GLY A O    5  
ATOM 7918  H H    . GLY A 1 36  ? 6.188   10.641  -6.473  1.00 0.00 ? 36  GLY A H    5  
ATOM 7919  H HA2  . GLY A 1 36  ? 3.425   11.038  -7.303  1.00 0.00 ? 36  GLY A HA2  5  
ATOM 7920  H HA3  . GLY A 1 36  ? 3.969   10.404  -5.757  1.00 0.00 ? 36  GLY A HA3  5  
ATOM 7921  N N    . GLN A 1 37  ? 2.663   12.851  -5.582  1.00 0.00 ? 37  GLN A N    5  
ATOM 7922  C CA   . GLN A 1 37  ? 2.325   14.131  -4.971  1.00 0.00 ? 37  GLN A CA   5  
ATOM 7923  C C    . GLN A 1 37  ? 1.392   13.937  -3.780  1.00 0.00 ? 37  GLN A C    5  
ATOM 7924  O O    . GLN A 1 37  ? 1.057   12.809  -3.419  1.00 0.00 ? 37  GLN A O    5  
ATOM 7925  C CB   . GLN A 1 37  ? 1.670   15.054  -6.001  1.00 0.00 ? 37  GLN A CB   5  
ATOM 7926  C CG   . GLN A 1 37  ? 1.935   16.530  -5.750  1.00 0.00 ? 37  GLN A CG   5  
ATOM 7927  C CD   . GLN A 1 37  ? 1.965   17.343  -7.030  1.00 0.00 ? 37  GLN A CD   5  
ATOM 7928  O OE1  . GLN A 1 37  ? 2.125   16.798  -8.122  1.00 0.00 ? 37  GLN A OE1  5  
ATOM 7929  N NE2  . GLN A 1 37  ? 1.810   18.655  -6.901  1.00 0.00 ? 37  GLN A NE2  5  
ATOM 7930  H H    . GLN A 1 37  ? 1.947   12.215  -5.786  1.00 0.00 ? 37  GLN A H    5  
ATOM 7931  H HA   . GLN A 1 37  ? 3.240   14.586  -4.625  1.00 0.00 ? 37  GLN A HA   5  
ATOM 7932  H HB2  . GLN A 1 37  ? 2.047   14.804  -6.982  1.00 0.00 ? 37  GLN A HB2  5  
ATOM 7933  H HB3  . GLN A 1 37  ? 0.602   14.894  -5.983  1.00 0.00 ? 37  GLN A HB3  5  
ATOM 7934  H HG2  . GLN A 1 37  ? 1.155   16.919  -5.113  1.00 0.00 ? 37  GLN A HG2  5  
ATOM 7935  H HG3  . GLN A 1 37  ? 2.888   16.632  -5.254  1.00 0.00 ? 37  GLN A HG3  5  
ATOM 7936  H HE21 . GLN A 1 37  ? 1.688   19.020  -5.999  1.00 0.00 ? 37  GLN A HE21 5  
ATOM 7937  H HE22 . GLN A 1 37  ? 1.826   19.205  -7.711  1.00 0.00 ? 37  GLN A HE22 5  
ATOM 7938  N N    . VAL A 1 38  ? 0.977   15.044  -3.173  1.00 0.00 ? 38  VAL A N    5  
ATOM 7939  C CA   . VAL A 1 38  ? 0.082   14.996  -2.023  1.00 0.00 ? 38  VAL A CA   5  
ATOM 7940  C C    . VAL A 1 38  ? -1.250  14.352  -2.389  1.00 0.00 ? 38  VAL A C    5  
ATOM 7941  O O    . VAL A 1 38  ? -2.079  14.079  -1.520  1.00 0.00 ? 38  VAL A O    5  
ATOM 7942  C CB   . VAL A 1 38  ? -0.180  16.404  -1.456  1.00 0.00 ? 38  VAL A CB   5  
ATOM 7943  C CG1  . VAL A 1 38  ? -0.912  16.316  -0.126  1.00 0.00 ? 38  VAL A CG1  5  
ATOM 7944  C CG2  . VAL A 1 38  ? 1.127   17.169  -1.305  1.00 0.00 ? 38  VAL A CG2  5  
ATOM 7945  H H    . VAL A 1 38  ? 1.279   15.915  -3.508  1.00 0.00 ? 38  VAL A H    5  
ATOM 7946  H HA   . VAL A 1 38  ? 0.558   14.404  -1.254  1.00 0.00 ? 38  VAL A HA   5  
ATOM 7947  H HB   . VAL A 1 38  ? -0.807  16.940  -2.153  1.00 0.00 ? 38  VAL A HB   5  
ATOM 7948  H HG11 . VAL A 1 38  ? -1.971  16.456  -0.289  1.00 0.00 ? 38  VAL A HG11 5  
ATOM 7949  H HG12 . VAL A 1 38  ? -0.739  15.347  0.318   1.00 0.00 ? 38  VAL A HG12 5  
ATOM 7950  H HG13 . VAL A 1 38  ? -0.547  17.086  0.538   1.00 0.00 ? 38  VAL A HG13 5  
ATOM 7951  H HG21 . VAL A 1 38  ? 1.937   16.470  -1.162  1.00 0.00 ? 38  VAL A HG21 5  
ATOM 7952  H HG22 . VAL A 1 38  ? 1.308   17.752  -2.196  1.00 0.00 ? 38  VAL A HG22 5  
ATOM 7953  H HG23 . VAL A 1 38  ? 1.063   17.826  -0.451  1.00 0.00 ? 38  VAL A HG23 5  
ATOM 7954  N N    . CYS A 1 39  ? -1.449  14.110  -3.680  1.00 0.00 ? 39  CYS A N    5  
ATOM 7955  C CA   . CYS A 1 39  ? -2.681  13.497  -4.163  1.00 0.00 ? 39  CYS A CA   5  
ATOM 7956  C C    . CYS A 1 39  ? -2.381  12.252  -4.990  1.00 0.00 ? 39  CYS A C    5  
ATOM 7957  O O    . CYS A 1 39  ? -3.075  11.959  -5.964  1.00 0.00 ? 39  CYS A O    5  
ATOM 7958  C CB   . CYS A 1 39  ? -3.480  14.499  -4.998  1.00 0.00 ? 39  CYS A CB   5  
ATOM 7959  S SG   . CYS A 1 39  ? -2.741  14.876  -6.604  1.00 0.00 ? 39  CYS A SG   5  
ATOM 7960  H H    . CYS A 1 39  ? -0.750  14.350  -4.325  1.00 0.00 ? 39  CYS A H    5  
ATOM 7961  H HA   . CYS A 1 39  ? -3.267  13.211  -3.303  1.00 0.00 ? 39  CYS A HA   5  
ATOM 7962  H HB2  . CYS A 1 39  ? -4.468  14.100  -5.177  1.00 0.00 ? 39  CYS A HB2  5  
ATOM 7963  H HB3  . CYS A 1 39  ? -3.567  15.425  -4.449  1.00 0.00 ? 39  CYS A HB3  5  
ATOM 7964  H HG   . CYS A 1 39  ? -2.143  13.780  -7.046  1.00 0.00 ? 39  CYS A HG   5  
ATOM 7965  N N    . SER A 1 40  ? -1.342  11.522  -4.597  1.00 0.00 ? 40  SER A N    5  
ATOM 7966  C CA   . SER A 1 40  ? -0.947  10.311  -5.306  1.00 0.00 ? 40  SER A CA   5  
ATOM 7967  C C    . SER A 1 40  ? -0.871  9.123   -4.351  1.00 0.00 ? 40  SER A C    5  
ATOM 7968  O O    . SER A 1 40  ? -0.532  9.276   -3.177  1.00 0.00 ? 40  SER A O    5  
ATOM 7969  C CB   . SER A 1 40  ? 0.405   10.515  -5.993  1.00 0.00 ? 40  SER A CB   5  
ATOM 7970  O OG   . SER A 1 40  ? 1.446   10.647  -5.041  1.00 0.00 ? 40  SER A OG   5  
ATOM 7971  H H    . SER A 1 40  ? -0.828  11.807  -3.813  1.00 0.00 ? 40  SER A H    5  
ATOM 7972  H HA   . SER A 1 40  ? -1.696  10.106  -6.056  1.00 0.00 ? 40  SER A HA   5  
ATOM 7973  H HB2  . SER A 1 40  ? 0.617   9.665   -6.624  1.00 0.00 ? 40  SER A HB2  5  
ATOM 7974  H HB3  . SER A 1 40  ? 0.368   11.411  -6.595  1.00 0.00 ? 40  SER A HB3  5  
ATOM 7975  H HG   . SER A 1 40  ? 1.083   10.964  -4.211  1.00 0.00 ? 40  SER A HG   5  
ATOM 7976  N N    . PHE A 1 41  ? -1.189  7.939   -4.863  1.00 0.00 ? 41  PHE A N    5  
ATOM 7977  C CA   . PHE A 1 41  ? -1.158  6.724   -4.057  1.00 0.00 ? 41  PHE A CA   5  
ATOM 7978  C C    . PHE A 1 41  ? -0.513  5.576   -4.828  1.00 0.00 ? 41  PHE A C    5  
ATOM 7979  O O    . PHE A 1 41  ? -0.162  5.720   -6.000  1.00 0.00 ? 41  PHE A O    5  
ATOM 7980  C CB   . PHE A 1 41  ? -2.574  6.335   -3.629  1.00 0.00 ? 41  PHE A CB   5  
ATOM 7981  C CG   . PHE A 1 41  ? -3.371  5.679   -4.720  1.00 0.00 ? 41  PHE A CG   5  
ATOM 7982  C CD1  . PHE A 1 41  ? -3.246  4.322   -4.968  1.00 0.00 ? 41  PHE A CD1  5  
ATOM 7983  C CD2  . PHE A 1 41  ? -4.246  6.420   -5.498  1.00 0.00 ? 41  PHE A CD2  5  
ATOM 7984  C CE1  . PHE A 1 41  ? -3.978  3.715   -5.971  1.00 0.00 ? 41  PHE A CE1  5  
ATOM 7985  C CE2  . PHE A 1 41  ? -4.981  5.819   -6.502  1.00 0.00 ? 41  PHE A CE2  5  
ATOM 7986  C CZ   . PHE A 1 41  ? -4.846  4.465   -6.740  1.00 0.00 ? 41  PHE A CZ   5  
ATOM 7987  H H    . PHE A 1 41  ? -1.451  7.881   -5.806  1.00 0.00 ? 41  PHE A H    5  
ATOM 7988  H HA   . PHE A 1 41  ? -0.567  6.926   -3.176  1.00 0.00 ? 41  PHE A HA   5  
ATOM 7989  H HB2  . PHE A 1 41  ? -2.515  5.644   -2.801  1.00 0.00 ? 41  PHE A HB2  5  
ATOM 7990  H HB3  . PHE A 1 41  ? -3.104  7.221   -3.316  1.00 0.00 ? 41  PHE A HB3  5  
ATOM 7991  H HD1  . PHE A 1 41  ? -2.566  3.733   -4.366  1.00 0.00 ? 41  PHE A HD1  5  
ATOM 7992  H HD2  . PHE A 1 41  ? -4.351  7.479   -5.315  1.00 0.00 ? 41  PHE A HD2  5  
ATOM 7993  H HE1  . PHE A 1 41  ? -3.870  2.656   -6.154  1.00 0.00 ? 41  PHE A HE1  5  
ATOM 7994  H HE2  . PHE A 1 41  ? -5.658  6.408   -7.102  1.00 0.00 ? 41  PHE A HE2  5  
ATOM 7995  H HZ   . PHE A 1 41  ? -5.419  3.993   -7.524  1.00 0.00 ? 41  PHE A HZ   5  
ATOM 7996  N N    . LEU A 1 42  ? -0.361  4.436   -4.162  1.00 0.00 ? 42  LEU A N    5  
ATOM 7997  C CA   . LEU A 1 42  ? 0.242   3.262   -4.784  1.00 0.00 ? 42  LEU A CA   5  
ATOM 7998  C C    . LEU A 1 42  ? 0.153   2.051   -3.860  1.00 0.00 ? 42  LEU A C    5  
ATOM 7999  O O    . LEU A 1 42  ? 0.262   2.179   -2.640  1.00 0.00 ? 42  LEU A O    5  
ATOM 8000  C CB   . LEU A 1 42  ? 1.703   3.542   -5.138  1.00 0.00 ? 42  LEU A CB   5  
ATOM 8001  C CG   . LEU A 1 42  ? 2.714   3.372   -4.003  1.00 0.00 ? 42  LEU A CG   5  
ATOM 8002  C CD1  . LEU A 1 42  ? 2.960   1.898   -3.723  1.00 0.00 ? 42  LEU A CD1  5  
ATOM 8003  C CD2  . LEU A 1 42  ? 4.019   4.078   -4.341  1.00 0.00 ? 42  LEU A CD2  5  
ATOM 8004  H H    . LEU A 1 42  ? -0.660  4.383   -3.231  1.00 0.00 ? 42  LEU A H    5  
ATOM 8005  H HA   . LEU A 1 42  ? -0.306  3.049   -5.690  1.00 0.00 ? 42  LEU A HA   5  
ATOM 8006  H HB2  . LEU A 1 42  ? 1.985   2.870   -5.934  1.00 0.00 ? 42  LEU A HB2  5  
ATOM 8007  H HB3  . LEU A 1 42  ? 1.768   4.561   -5.491  1.00 0.00 ? 42  LEU A HB3  5  
ATOM 8008  H HG   . LEU A 1 42  ? 2.314   3.820   -3.104  1.00 0.00 ? 42  LEU A HG   5  
ATOM 8009  H HD11 . LEU A 1 42  ? 2.703   1.678   -2.698  1.00 0.00 ? 42  LEU A HD11 5  
ATOM 8010  H HD12 . LEU A 1 42  ? 4.002   1.668   -3.891  1.00 0.00 ? 42  LEU A HD12 5  
ATOM 8011  H HD13 . LEU A 1 42  ? 2.349   1.299   -4.384  1.00 0.00 ? 42  LEU A HD13 5  
ATOM 8012  H HD21 . LEU A 1 42  ? 4.401   4.569   -3.458  1.00 0.00 ? 42  LEU A HD21 5  
ATOM 8013  H HD22 . LEU A 1 42  ? 3.842   4.812   -5.113  1.00 0.00 ? 42  LEU A HD22 5  
ATOM 8014  H HD23 . LEU A 1 42  ? 4.739   3.353   -4.691  1.00 0.00 ? 42  LEU A HD23 5  
ATOM 8015  N N    . VAL A 1 43  ? -0.042  0.877   -4.450  1.00 0.00 ? 43  VAL A N    5  
ATOM 8016  C CA   . VAL A 1 43  ? -0.142  -0.358  -3.681  1.00 0.00 ? 43  VAL A CA   5  
ATOM 8017  C C    . VAL A 1 43  ? 1.140   -1.177  -3.787  1.00 0.00 ? 43  VAL A C    5  
ATOM 8018  O O    . VAL A 1 43  ? 1.936   -0.986  -4.707  1.00 0.00 ? 43  VAL A O    5  
ATOM 8019  C CB   . VAL A 1 43  ? -1.329  -1.219  -4.152  1.00 0.00 ? 43  VAL A CB   5  
ATOM 8020  C CG1  . VAL A 1 43  ? -1.438  -2.483  -3.313  1.00 0.00 ? 43  VAL A CG1  5  
ATOM 8021  C CG2  . VAL A 1 43  ? -2.621  -0.419  -4.098  1.00 0.00 ? 43  VAL A CG2  5  
ATOM 8022  H H    . VAL A 1 43  ? -0.121  0.839   -5.426  1.00 0.00 ? 43  VAL A H    5  
ATOM 8023  H HA   . VAL A 1 43  ? -0.304  -0.094  -2.646  1.00 0.00 ? 43  VAL A HA   5  
ATOM 8024  H HB   . VAL A 1 43  ? -1.152  -1.509  -5.178  1.00 0.00 ? 43  VAL A HB   5  
ATOM 8025  H HG11 . VAL A 1 43  ? -1.257  -2.243  -2.276  1.00 0.00 ? 43  VAL A HG11 5  
ATOM 8026  H HG12 . VAL A 1 43  ? -2.428  -2.901  -3.419  1.00 0.00 ? 43  VAL A HG12 5  
ATOM 8027  H HG13 . VAL A 1 43  ? -0.705  -3.202  -3.648  1.00 0.00 ? 43  VAL A HG13 5  
ATOM 8028  H HG21 . VAL A 1 43  ? -2.407  0.623   -4.280  1.00 0.00 ? 43  VAL A HG21 5  
ATOM 8029  H HG22 . VAL A 1 43  ? -3.303  -0.784  -4.853  1.00 0.00 ? 43  VAL A HG22 5  
ATOM 8030  H HG23 . VAL A 1 43  ? -3.073  -0.529  -3.123  1.00 0.00 ? 43  VAL A HG23 5  
ATOM 8031  N N    . ARG A 1 44  ? 1.333   -2.089  -2.841  1.00 0.00 ? 44  ARG A N    5  
ATOM 8032  C CA   . ARG A 1 44  ? 2.519   -2.938  -2.827  1.00 0.00 ? 44  ARG A CA   5  
ATOM 8033  C C    . ARG A 1 44  ? 2.330   -4.121  -1.883  1.00 0.00 ? 44  ARG A C    5  
ATOM 8034  O O    . ARG A 1 44  ? 1.720   -4.007  -0.819  1.00 0.00 ? 44  ARG A O    5  
ATOM 8035  C CB   . ARG A 1 44  ? 3.747   -2.127  -2.408  1.00 0.00 ? 44  ARG A CB   5  
ATOM 8036  C CG   . ARG A 1 44  ? 3.798   -1.824  -0.920  1.00 0.00 ? 44  ARG A CG   5  
ATOM 8037  C CD   . ARG A 1 44  ? 5.035   -1.018  -0.557  1.00 0.00 ? 44  ARG A CD   5  
ATOM 8038  N NE   . ARG A 1 44  ? 5.466   -1.264  0.816   1.00 0.00 ? 44  ARG A NE   5  
ATOM 8039  C CZ   . ARG A 1 44  ? 5.941   -2.430  1.239   1.00 0.00 ? 44  ARG A CZ   5  
ATOM 8040  N NH1  . ARG A 1 44  ? 6.046   -3.451  0.399   1.00 0.00 ? 44  ARG A NH1  5  
ATOM 8041  N NH2  . ARG A 1 44  ? 6.313   -2.577  2.504   1.00 0.00 ? 44  ARG A NH2  5  
ATOM 8042  H H    . ARG A 1 44  ? 0.662   -2.195  -2.134  1.00 0.00 ? 44  ARG A H    5  
ATOM 8043  H HA   . ARG A 1 44  ? 2.670   -3.312  -3.829  1.00 0.00 ? 44  ARG A HA   5  
ATOM 8044  H HB2  . ARG A 1 44  ? 4.636   -2.681  -2.671  1.00 0.00 ? 44  ARG A HB2  5  
ATOM 8045  H HB3  . ARG A 1 44  ? 3.744   -1.190  -2.944  1.00 0.00 ? 44  ARG A HB3  5  
ATOM 8046  H HG2  . ARG A 1 44  ? 2.920   -1.258  -0.647  1.00 0.00 ? 44  ARG A HG2  5  
ATOM 8047  H HG3  . ARG A 1 44  ? 3.812   -2.755  -0.373  1.00 0.00 ? 44  ARG A HG3  5  
ATOM 8048  H HD2  . ARG A 1 44  ? 5.835   -1.289  -1.230  1.00 0.00 ? 44  ARG A HD2  5  
ATOM 8049  H HD3  . ARG A 1 44  ? 4.809   0.032   -0.671  1.00 0.00 ? 44  ARG A HD3  5  
ATOM 8050  H HE   . ARG A 1 44  ? 5.397   -0.524  1.453   1.00 0.00 ? 44  ARG A HE   5  
ATOM 8051  H HH11 . ARG A 1 44  ? 5.767   -3.343  -0.555  1.00 0.00 ? 44  ARG A HH11 5  
ATOM 8052  H HH12 . ARG A 1 44  ? 6.405   -4.328  0.720   1.00 0.00 ? 44  ARG A HH12 5  
ATOM 8053  H HH21 . ARG A 1 44  ? 6.236   -1.810  3.140   1.00 0.00 ? 44  ARG A HH21 5  
ATOM 8054  H HH22 . ARG A 1 44  ? 6.670   -3.455  2.822   1.00 0.00 ? 44  ARG A HH22 5  
ATOM 8055  N N    . PRO A 1 45  ? 2.865   -5.285  -2.278  1.00 0.00 ? 45  PRO A N    5  
ATOM 8056  C CA   . PRO A 1 45  ? 2.769   -6.512  -1.482  1.00 0.00 ? 45  PRO A CA   5  
ATOM 8057  C C    . PRO A 1 45  ? 3.610   -6.445  -0.211  1.00 0.00 ? 45  PRO A C    5  
ATOM 8058  O O    . PRO A 1 45  ? 4.837   -6.374  -0.270  1.00 0.00 ? 45  PRO A O    5  
ATOM 8059  C CB   . PRO A 1 45  ? 3.310   -7.590  -2.424  1.00 0.00 ? 45  PRO A CB   5  
ATOM 8060  C CG   . PRO A 1 45  ? 4.211   -6.860  -3.359  1.00 0.00 ? 45  PRO A CG   5  
ATOM 8061  C CD   . PRO A 1 45  ? 3.606   -5.494  -3.534  1.00 0.00 ? 45  PRO A CD   5  
ATOM 8062  H HA   . PRO A 1 45  ? 1.745   -6.738  -1.223  1.00 0.00 ? 45  PRO A HA   5  
ATOM 8063  H HB2  . PRO A 1 45  ? 3.849   -8.333  -1.853  1.00 0.00 ? 45  PRO A HB2  5  
ATOM 8064  H HB3  . PRO A 1 45  ? 2.491   -8.058  -2.950  1.00 0.00 ? 45  PRO A HB3  5  
ATOM 8065  H HG2  . PRO A 1 45  ? 5.198   -6.781  -2.930  1.00 0.00 ? 45  PRO A HG2  5  
ATOM 8066  H HG3  . PRO A 1 45  ? 4.251   -7.375  -4.307  1.00 0.00 ? 45  PRO A HG3  5  
ATOM 8067  H HD2  . PRO A 1 45  ? 4.380   -4.751  -3.653  1.00 0.00 ? 45  PRO A HD2  5  
ATOM 8068  H HD3  . PRO A 1 45  ? 2.937   -5.484  -4.382  1.00 0.00 ? 45  PRO A HD3  5  
ATOM 8069  N N    . SER A 1 46  ? 2.941   -6.470  0.937   1.00 0.00 ? 46  SER A N    5  
ATOM 8070  C CA   . SER A 1 46  ? 3.626   -6.409  2.223   1.00 0.00 ? 46  SER A CA   5  
ATOM 8071  C C    . SER A 1 46  ? 4.833   -7.342  2.240   1.00 0.00 ? 46  SER A C    5  
ATOM 8072  O O    . SER A 1 46  ? 4.690   -8.556  2.382   1.00 0.00 ? 46  SER A O    5  
ATOM 8073  C CB   . SER A 1 46  ? 2.666   -6.777  3.355   1.00 0.00 ? 46  SER A CB   5  
ATOM 8074  O OG   . SER A 1 46  ? 3.245   -6.513  4.621   1.00 0.00 ? 46  SER A OG   5  
ATOM 8075  H H    . SER A 1 46  ? 1.962   -6.528  0.919   1.00 0.00 ? 46  SER A H    5  
ATOM 8076  H HA   . SER A 1 46  ? 3.968   -5.395  2.368   1.00 0.00 ? 46  SER A HA   5  
ATOM 8077  H HB2  . SER A 1 46  ? 1.761   -6.198  3.259   1.00 0.00 ? 46  SER A HB2  5  
ATOM 8078  H HB3  . SER A 1 46  ? 2.429   -7.830  3.293   1.00 0.00 ? 46  SER A HB3  5  
ATOM 8079  H HG   . SER A 1 46  ? 2.565   -6.210  5.227   1.00 0.00 ? 46  SER A HG   5  
ATOM 8080  N N    . ASP A 1 47  ? 6.021   -6.765  2.094   1.00 0.00 ? 47  ASP A N    5  
ATOM 8081  C CA   . ASP A 1 47  ? 7.254   -7.544  2.093   1.00 0.00 ? 47  ASP A CA   5  
ATOM 8082  C C    . ASP A 1 47  ? 7.382   -8.360  3.376   1.00 0.00 ? 47  ASP A C    5  
ATOM 8083  O O    . ASP A 1 47  ? 7.890   -9.481  3.362   1.00 0.00 ? 47  ASP A O    5  
ATOM 8084  C CB   . ASP A 1 47  ? 8.464   -6.622  1.938   1.00 0.00 ? 47  ASP A CB   5  
ATOM 8085  C CG   . ASP A 1 47  ? 9.715   -7.374  1.526   1.00 0.00 ? 47  ASP A CG   5  
ATOM 8086  O OD1  . ASP A 1 47  ? 10.352  -7.992  2.404   1.00 0.00 ? 47  ASP A OD1  5  
ATOM 8087  O OD2  . ASP A 1 47  ? 10.058  -7.342  0.325   1.00 0.00 ? 47  ASP A OD2  5  
ATOM 8088  H H    . ASP A 1 47  ? 6.070   -5.792  1.984   1.00 0.00 ? 47  ASP A H    5  
ATOM 8089  H HA   . ASP A 1 47  ? 7.218   -8.221  1.253   1.00 0.00 ? 47  ASP A HA   5  
ATOM 8090  H HB2  . ASP A 1 47  ? 8.249   -5.879  1.183   1.00 0.00 ? 47  ASP A HB2  5  
ATOM 8091  H HB3  . ASP A 1 47  ? 8.656   -6.129  2.879   1.00 0.00 ? 47  ASP A HB3  5  
ATOM 8092  N N    . ASN A 1 48  ? 6.918   -7.790  4.483   1.00 0.00 ? 48  ASN A N    5  
ATOM 8093  C CA   . ASN A 1 48  ? 6.983   -8.464  5.774   1.00 0.00 ? 48  ASN A CA   5  
ATOM 8094  C C    . ASN A 1 48  ? 6.011   -9.639  5.824   1.00 0.00 ? 48  ASN A C    5  
ATOM 8095  O O    . ASN A 1 48  ? 6.400   -10.770 6.119   1.00 0.00 ? 48  ASN A O    5  
ATOM 8096  C CB   . ASN A 1 48  ? 6.667   -7.480  6.903   1.00 0.00 ? 48  ASN A CB   5  
ATOM 8097  C CG   . ASN A 1 48  ? 7.056   -8.019  8.266   1.00 0.00 ? 48  ASN A CG   5  
ATOM 8098  O OD1  . ASN A 1 48  ? 6.197   -8.317  9.096   1.00 0.00 ? 48  ASN A OD1  5  
ATOM 8099  N ND2  . ASN A 1 48  ? 8.357   -8.147  8.502   1.00 0.00 ? 48  ASN A ND2  5  
ATOM 8100  H H    . ASN A 1 48  ? 6.524   -6.894  4.430   1.00 0.00 ? 48  ASN A H    5  
ATOM 8101  H HA   . ASN A 1 48  ? 7.987   -8.837  5.904   1.00 0.00 ? 48  ASN A HA   5  
ATOM 8102  H HB2  . ASN A 1 48  ? 7.210   -6.561  6.733   1.00 0.00 ? 48  ASN A HB2  5  
ATOM 8103  H HB3  . ASN A 1 48  ? 5.608   -7.272  6.907   1.00 0.00 ? 48  ASN A HB3  5  
ATOM 8104  H HD21 . ASN A 1 48  ? 8.984   -7.890  7.794   1.00 0.00 ? 48  ASN A HD21 5  
ATOM 8105  H HD22 . ASN A 1 48  ? 8.636   -8.494  9.375   1.00 0.00 ? 48  ASN A HD22 5  
ATOM 8106  N N    . THR A 1 49  ? 4.743   -9.365  5.531   1.00 0.00 ? 49  THR A N    5  
ATOM 8107  C CA   . THR A 1 49  ? 3.716   -10.398 5.542   1.00 0.00 ? 49  THR A CA   5  
ATOM 8108  C C    . THR A 1 49  ? 3.529   -11.002 4.155   1.00 0.00 ? 49  THR A C    5  
ATOM 8109  O O    . THR A 1 49  ? 3.152   -10.322 3.201   1.00 0.00 ? 49  THR A O    5  
ATOM 8110  C CB   . THR A 1 49  ? 2.366   -9.843  6.034   1.00 0.00 ? 49  THR A CB   5  
ATOM 8111  O OG1  . THR A 1 49  ? 2.563   -9.043  7.206   1.00 0.00 ? 49  THR A OG1  5  
ATOM 8112  C CG2  . THR A 1 49  ? 1.396   -10.973 6.342   1.00 0.00 ? 49  THR A CG2  5  
ATOM 8113  H H    . THR A 1 49  ? 4.495   -8.445  5.303   1.00 0.00 ? 49  THR A H    5  
ATOM 8114  H HA   . THR A 1 49  ? 4.031   -11.175 6.223   1.00 0.00 ? 49  THR A HA   5  
ATOM 8115  H HB   . THR A 1 49  ? 1.942   -9.227  5.254   1.00 0.00 ? 49  THR A HB   5  
ATOM 8116  H HG1  . THR A 1 49  ? 1.754   -9.029  7.723   1.00 0.00 ? 49  THR A HG1  5  
ATOM 8117  H HG21 . THR A 1 49  ? 1.164   -11.507 5.433   1.00 0.00 ? 49  THR A HG21 5  
ATOM 8118  H HG22 . THR A 1 49  ? 0.488   -10.564 6.761   1.00 0.00 ? 49  THR A HG22 5  
ATOM 8119  H HG23 . THR A 1 49  ? 1.847   -11.650 7.052   1.00 0.00 ? 49  THR A HG23 5  
ATOM 8120  N N    . PRO A 1 50  ? 3.796   -12.312 4.038   1.00 0.00 ? 50  PRO A N    5  
ATOM 8121  C CA   . PRO A 1 50  ? 3.663   -13.037 2.771   1.00 0.00 ? 50  PRO A CA   5  
ATOM 8122  C C    . PRO A 1 50  ? 2.207   -13.196 2.345   1.00 0.00 ? 50  PRO A C    5  
ATOM 8123  O O    . PRO A 1 50  ? 1.424   -13.866 3.015   1.00 0.00 ? 50  PRO A O    5  
ATOM 8124  C CB   . PRO A 1 50  ? 4.283   -14.402 3.077   1.00 0.00 ? 50  PRO A CB   5  
ATOM 8125  C CG   . PRO A 1 50  ? 4.132   -14.566 4.550   1.00 0.00 ? 50  PRO A CG   5  
ATOM 8126  C CD   . PRO A 1 50  ? 4.249   -13.185 5.134   1.00 0.00 ? 50  PRO A CD   5  
ATOM 8127  H HA   . PRO A 1 50  ? 4.218   -12.556 1.979   1.00 0.00 ? 50  PRO A HA   5  
ATOM 8128  H HB2  . PRO A 1 50  ? 3.750   -15.172 2.536   1.00 0.00 ? 50  PRO A HB2  5  
ATOM 8129  H HB3  . PRO A 1 50  ? 5.322   -14.403 2.784   1.00 0.00 ? 50  PRO A HB3  5  
ATOM 8130  H HG2  . PRO A 1 50  ? 3.164   -14.987 4.775   1.00 0.00 ? 50  PRO A HG2  5  
ATOM 8131  H HG3  . PRO A 1 50  ? 4.917   -15.201 4.931   1.00 0.00 ? 50  PRO A HG3  5  
ATOM 8132  H HD2  . PRO A 1 50  ? 3.608   -13.085 5.997   1.00 0.00 ? 50  PRO A HD2  5  
ATOM 8133  H HD3  . PRO A 1 50  ? 5.274   -12.972 5.397   1.00 0.00 ? 50  PRO A HD3  5  
ATOM 8134  N N    . GLY A 1 51  ? 1.852   -12.575 1.224   1.00 0.00 ? 51  GLY A N    5  
ATOM 8135  C CA   . GLY A 1 51  ? 0.491   -12.661 0.727   1.00 0.00 ? 51  GLY A CA   5  
ATOM 8136  C C    . GLY A 1 51  ? -0.393  -11.553 1.265   1.00 0.00 ? 51  GLY A C    5  
ATOM 8137  O O    . GLY A 1 51  ? -1.556  -11.784 1.596   1.00 0.00 ? 51  GLY A O    5  
ATOM 8138  H H    . GLY A 1 51  ? 2.520   -12.054 0.730   1.00 0.00 ? 51  GLY A H    5  
ATOM 8139  H HA2  . GLY A 1 51  ? 0.509   -12.602 -0.351  1.00 0.00 ? 51  GLY A HA2  5  
ATOM 8140  H HA3  . GLY A 1 51  ? 0.073   -13.613 1.019   1.00 0.00 ? 51  GLY A HA3  5  
ATOM 8141  N N    . ASP A 1 52  ? 0.159   -10.348 1.355   1.00 0.00 ? 52  ASP A N    5  
ATOM 8142  C CA   . ASP A 1 52  ? -0.587  -9.201  1.857   1.00 0.00 ? 52  ASP A CA   5  
ATOM 8143  C C    . ASP A 1 52  ? -0.224  -7.936  1.085   1.00 0.00 ? 52  ASP A C    5  
ATOM 8144  O O    . ASP A 1 52  ? 0.839   -7.856  0.469   1.00 0.00 ? 52  ASP A O    5  
ATOM 8145  C CB   . ASP A 1 52  ? -0.312  -9.000  3.348   1.00 0.00 ? 52  ASP A CB   5  
ATOM 8146  C CG   . ASP A 1 52  ? -1.181  -9.883  4.222   1.00 0.00 ? 52  ASP A CG   5  
ATOM 8147  O OD1  . ASP A 1 52  ? -0.989  -11.116 4.196   1.00 0.00 ? 52  ASP A OD1  5  
ATOM 8148  O OD2  . ASP A 1 52  ? -2.055  -9.340  4.931   1.00 0.00 ? 52  ASP A OD2  5  
ATOM 8149  H H    . ASP A 1 52  ? 1.091   -10.228 1.076   1.00 0.00 ? 52  ASP A H    5  
ATOM 8150  H HA   . ASP A 1 52  ? -1.639  -9.403  1.719   1.00 0.00 ? 52  ASP A HA   5  
ATOM 8151  H HB2  . ASP A 1 52  ? 0.723   -9.232  3.551   1.00 0.00 ? 52  ASP A HB2  5  
ATOM 8152  H HB3  . ASP A 1 52  ? -0.503  -7.969  3.607   1.00 0.00 ? 52  ASP A HB3  5  
ATOM 8153  N N    . TYR A 1 53  ? -1.115  -6.951  1.122   1.00 0.00 ? 53  TYR A N    5  
ATOM 8154  C CA   . TYR A 1 53  ? -0.890  -5.691  0.423   1.00 0.00 ? 53  TYR A CA   5  
ATOM 8155  C C    . TYR A 1 53  ? -1.080  -4.505  1.363   1.00 0.00 ? 53  TYR A C    5  
ATOM 8156  O O    . TYR A 1 53  ? -1.568  -4.658  2.483   1.00 0.00 ? 53  TYR A O    5  
ATOM 8157  C CB   . TYR A 1 53  ? -1.841  -5.569  -0.769  1.00 0.00 ? 53  TYR A CB   5  
ATOM 8158  C CG   . TYR A 1 53  ? -1.685  -6.679  -1.784  1.00 0.00 ? 53  TYR A CG   5  
ATOM 8159  C CD1  . TYR A 1 53  ? -0.547  -6.768  -2.576  1.00 0.00 ? 53  TYR A CD1  5  
ATOM 8160  C CD2  . TYR A 1 53  ? -2.677  -7.637  -1.952  1.00 0.00 ? 53  TYR A CD2  5  
ATOM 8161  C CE1  . TYR A 1 53  ? -0.401  -7.780  -3.505  1.00 0.00 ? 53  TYR A CE1  5  
ATOM 8162  C CE2  . TYR A 1 53  ? -2.539  -8.653  -2.878  1.00 0.00 ? 53  TYR A CE2  5  
ATOM 8163  C CZ   . TYR A 1 53  ? -1.399  -8.720  -3.652  1.00 0.00 ? 53  TYR A CZ   5  
ATOM 8164  O OH   . TYR A 1 53  ? -1.258  -9.730  -4.576  1.00 0.00 ? 53  TYR A OH   5  
ATOM 8165  H H    . TYR A 1 53  ? -1.944  -7.074  1.630   1.00 0.00 ? 53  TYR A H    5  
ATOM 8166  H HA   . TYR A 1 53  ? 0.128   -5.690  0.061   1.00 0.00 ? 53  TYR A HA   5  
ATOM 8167  H HB2  . TYR A 1 53  ? -2.859  -5.587  -0.412  1.00 0.00 ? 53  TYR A HB2  5  
ATOM 8168  H HB3  . TYR A 1 53  ? -1.657  -4.631  -1.272  1.00 0.00 ? 53  TYR A HB3  5  
ATOM 8169  H HD1  . TYR A 1 53  ? 0.233   -6.030  -2.459  1.00 0.00 ? 53  TYR A HD1  5  
ATOM 8170  H HD2  . TYR A 1 53  ? -3.568  -7.582  -1.344  1.00 0.00 ? 53  TYR A HD2  5  
ATOM 8171  H HE1  . TYR A 1 53  ? 0.491   -7.833  -4.112  1.00 0.00 ? 53  TYR A HE1  5  
ATOM 8172  H HE2  . TYR A 1 53  ? -3.320  -9.390  -2.993  1.00 0.00 ? 53  TYR A HE2  5  
ATOM 8173  H HH   . TYR A 1 53  ? -0.558  -10.324 -4.296  1.00 0.00 ? 53  TYR A HH   5  
ATOM 8174  N N    . SER A 1 54  ? -0.690  -3.322  0.899   1.00 0.00 ? 54  SER A N    5  
ATOM 8175  C CA   . SER A 1 54  ? -0.814  -2.109  1.698   1.00 0.00 ? 54  SER A CA   5  
ATOM 8176  C C    . SER A 1 54  ? -0.781  -0.868  0.811   1.00 0.00 ? 54  SER A C    5  
ATOM 8177  O O    . SER A 1 54  ? 0.101   -0.719  -0.036  1.00 0.00 ? 54  SER A O    5  
ATOM 8178  C CB   . SER A 1 54  ? 0.310   -2.039  2.734   1.00 0.00 ? 54  SER A CB   5  
ATOM 8179  O OG   . SER A 1 54  ? 1.516   -2.573  2.216   1.00 0.00 ? 54  SER A OG   5  
ATOM 8180  H H    . SER A 1 54  ? -0.308  -3.265  -0.002  1.00 0.00 ? 54  SER A H    5  
ATOM 8181  H HA   . SER A 1 54  ? -1.763  -2.145  2.211   1.00 0.00 ? 54  SER A HA   5  
ATOM 8182  H HB2  . SER A 1 54  ? 0.476   -1.009  3.012   1.00 0.00 ? 54  SER A HB2  5  
ATOM 8183  H HB3  . SER A 1 54  ? 0.025   -2.606  3.609   1.00 0.00 ? 54  SER A HB3  5  
ATOM 8184  H HG   . SER A 1 54  ? 1.780   -3.334  2.739   1.00 0.00 ? 54  SER A HG   5  
ATOM 8185  N N    . LEU A 1 55  ? -1.749  0.020   1.011   1.00 0.00 ? 55  LEU A N    5  
ATOM 8186  C CA   . LEU A 1 55  ? -1.832  1.249   0.230   1.00 0.00 ? 55  LEU A CA   5  
ATOM 8187  C C    . LEU A 1 55  ? -0.942  2.335   0.826   1.00 0.00 ? 55  LEU A C    5  
ATOM 8188  O O    . LEU A 1 55  ? -0.739  2.389   2.039   1.00 0.00 ? 55  LEU A O    5  
ATOM 8189  C CB   . LEU A 1 55  ? -3.280  1.739   0.166   1.00 0.00 ? 55  LEU A CB   5  
ATOM 8190  C CG   . LEU A 1 55  ? -3.583  2.804   -0.888  1.00 0.00 ? 55  LEU A CG   5  
ATOM 8191  C CD1  . LEU A 1 55  ? -3.975  2.155   -2.206  1.00 0.00 ? 55  LEU A CD1  5  
ATOM 8192  C CD2  . LEU A 1 55  ? -4.682  3.738   -0.402  1.00 0.00 ? 55  LEU A CD2  5  
ATOM 8193  H H    . LEU A 1 55  ? -2.423  -0.154  1.700   1.00 0.00 ? 55  LEU A H    5  
ATOM 8194  H HA   . LEU A 1 55  ? -1.491  1.030   -0.771  1.00 0.00 ? 55  LEU A HA   5  
ATOM 8195  H HB2  . LEU A 1 55  ? -3.909  0.886   -0.037  1.00 0.00 ? 55  LEU A HB2  5  
ATOM 8196  H HB3  . LEU A 1 55  ? -3.533  2.148   1.134   1.00 0.00 ? 55  LEU A HB3  5  
ATOM 8197  H HG   . LEU A 1 55  ? -2.693  3.395   -1.059  1.00 0.00 ? 55  LEU A HG   5  
ATOM 8198  H HD11 . LEU A 1 55  ? -4.738  1.412   -2.028  1.00 0.00 ? 55  LEU A HD11 5  
ATOM 8199  H HD12 . LEU A 1 55  ? -3.109  1.684   -2.647  1.00 0.00 ? 55  LEU A HD12 5  
ATOM 8200  H HD13 . LEU A 1 55  ? -4.356  2.909   -2.879  1.00 0.00 ? 55  LEU A HD13 5  
ATOM 8201  H HD21 . LEU A 1 55  ? -4.605  3.858   0.668   1.00 0.00 ? 55  LEU A HD21 5  
ATOM 8202  H HD22 . LEU A 1 55  ? -5.646  3.316   -0.649  1.00 0.00 ? 55  LEU A HD22 5  
ATOM 8203  H HD23 . LEU A 1 55  ? -4.576  4.699   -0.882  1.00 0.00 ? 55  LEU A HD23 5  
ATOM 8204  N N    . TYR A 1 56  ? -0.415  3.199   -0.034  1.00 0.00 ? 56  TYR A N    5  
ATOM 8205  C CA   . TYR A 1 56  ? 0.454   4.284   0.407   1.00 0.00 ? 56  TYR A CA   5  
ATOM 8206  C C    . TYR A 1 56  ? 0.040   5.607   -0.230  1.00 0.00 ? 56  TYR A C    5  
ATOM 8207  O O    . TYR A 1 56  ? 0.168   5.793   -1.441  1.00 0.00 ? 56  TYR A O    5  
ATOM 8208  C CB   . TYR A 1 56  ? 1.910   3.971   0.061   1.00 0.00 ? 56  TYR A CB   5  
ATOM 8209  C CG   . TYR A 1 56  ? 2.516   2.882   0.917   1.00 0.00 ? 56  TYR A CG   5  
ATOM 8210  C CD1  . TYR A 1 56  ? 2.012   1.587   0.886   1.00 0.00 ? 56  TYR A CD1  5  
ATOM 8211  C CD2  . TYR A 1 56  ? 3.591   3.146   1.756   1.00 0.00 ? 56  TYR A CD2  5  
ATOM 8212  C CE1  . TYR A 1 56  ? 2.561   0.588   1.667   1.00 0.00 ? 56  TYR A CE1  5  
ATOM 8213  C CE2  . TYR A 1 56  ? 4.148   2.153   2.538   1.00 0.00 ? 56  TYR A CE2  5  
ATOM 8214  C CZ   . TYR A 1 56  ? 3.629   0.876   2.491   1.00 0.00 ? 56  TYR A CZ   5  
ATOM 8215  O OH   . TYR A 1 56  ? 4.180   -0.116  3.270   1.00 0.00 ? 56  TYR A OH   5  
ATOM 8216  H H    . TYR A 1 56  ? -0.613  3.104   -0.989  1.00 0.00 ? 56  TYR A H    5  
ATOM 8217  H HA   . TYR A 1 56  ? 0.359   4.369   1.480   1.00 0.00 ? 56  TYR A HA   5  
ATOM 8218  H HB2  . TYR A 1 56  ? 1.969   3.655   -0.969  1.00 0.00 ? 56  TYR A HB2  5  
ATOM 8219  H HB3  . TYR A 1 56  ? 2.504   4.865   0.192   1.00 0.00 ? 56  TYR A HB3  5  
ATOM 8220  H HD1  . TYR A 1 56  ? 1.175   1.365   0.240   1.00 0.00 ? 56  TYR A HD1  5  
ATOM 8221  H HD2  . TYR A 1 56  ? 3.995   4.148   1.791   1.00 0.00 ? 56  TYR A HD2  5  
ATOM 8222  H HE1  . TYR A 1 56  ? 2.155   -0.412  1.630   1.00 0.00 ? 56  TYR A HE1  5  
ATOM 8223  H HE2  . TYR A 1 56  ? 4.984   2.378   3.184   1.00 0.00 ? 56  TYR A HE2  5  
ATOM 8224  H HH   . TYR A 1 56  ? 4.492   0.262   4.095   1.00 0.00 ? 56  TYR A HH   5  
ATOM 8225  N N    . PHE A 1 57  ? -0.456  6.523   0.594   1.00 0.00 ? 57  PHE A N    5  
ATOM 8226  C CA   . PHE A 1 57  ? -0.890  7.830   0.112   1.00 0.00 ? 57  PHE A CA   5  
ATOM 8227  C C    . PHE A 1 57  ? -0.091  8.947   0.778   1.00 0.00 ? 57  PHE A C    5  
ATOM 8228  O O    . PHE A 1 57  ? 0.400   8.792   1.896   1.00 0.00 ? 57  PHE A O    5  
ATOM 8229  C CB   . PHE A 1 57  ? -2.383  8.026   0.381   1.00 0.00 ? 57  PHE A CB   5  
ATOM 8230  C CG   . PHE A 1 57  ? -2.919  9.331   -0.137  1.00 0.00 ? 57  PHE A CG   5  
ATOM 8231  C CD1  . PHE A 1 57  ? -2.877  9.624   -1.490  1.00 0.00 ? 57  PHE A CD1  5  
ATOM 8232  C CD2  . PHE A 1 57  ? -3.463  10.264  0.731   1.00 0.00 ? 57  PHE A CD2  5  
ATOM 8233  C CE1  . PHE A 1 57  ? -3.370  10.823  -1.969  1.00 0.00 ? 57  PHE A CE1  5  
ATOM 8234  C CE2  . PHE A 1 57  ? -3.957  11.465  0.257   1.00 0.00 ? 57  PHE A CE2  5  
ATOM 8235  C CZ   . PHE A 1 57  ? -3.910  11.745  -1.094  1.00 0.00 ? 57  PHE A CZ   5  
ATOM 8236  H H    . PHE A 1 57  ? -0.534  6.316   1.549   1.00 0.00 ? 57  PHE A H    5  
ATOM 8237  H HA   . PHE A 1 57  ? -0.716  7.864   -0.952  1.00 0.00 ? 57  PHE A HA   5  
ATOM 8238  H HB2  . PHE A 1 57  ? -2.935  7.230   -0.095  1.00 0.00 ? 57  PHE A HB2  5  
ATOM 8239  H HB3  . PHE A 1 57  ? -2.558  7.993   1.446   1.00 0.00 ? 57  PHE A HB3  5  
ATOM 8240  H HD1  . PHE A 1 57  ? -2.455  8.903   -2.176  1.00 0.00 ? 57  PHE A HD1  5  
ATOM 8241  H HD2  . PHE A 1 57  ? -3.500  10.047  1.788   1.00 0.00 ? 57  PHE A HD2  5  
ATOM 8242  H HE1  . PHE A 1 57  ? -3.331  11.039  -3.027  1.00 0.00 ? 57  PHE A HE1  5  
ATOM 8243  H HE2  . PHE A 1 57  ? -4.379  12.184  0.944   1.00 0.00 ? 57  PHE A HE2  5  
ATOM 8244  H HZ   . PHE A 1 57  ? -4.295  12.682  -1.467  1.00 0.00 ? 57  PHE A HZ   5  
ATOM 8245  N N    . ARG A 1 58  ? 0.035   10.072  0.081   1.00 0.00 ? 58  ARG A N    5  
ATOM 8246  C CA   . ARG A 1 58  ? 0.775   11.214  0.602   1.00 0.00 ? 58  ARG A CA   5  
ATOM 8247  C C    . ARG A 1 58  ? -0.175  12.261  1.178   1.00 0.00 ? 58  ARG A C    5  
ATOM 8248  O O    . ARG A 1 58  ? -1.191  12.596  0.569   1.00 0.00 ? 58  ARG A O    5  
ATOM 8249  C CB   . ARG A 1 58  ? 1.632   11.840  -0.500  1.00 0.00 ? 58  ARG A CB   5  
ATOM 8250  C CG   . ARG A 1 58  ? 2.260   13.166  -0.104  1.00 0.00 ? 58  ARG A CG   5  
ATOM 8251  C CD   . ARG A 1 58  ? 3.494   12.962  0.761   1.00 0.00 ? 58  ARG A CD   5  
ATOM 8252  N NE   . ARG A 1 58  ? 4.096   14.231  1.164   1.00 0.00 ? 58  ARG A NE   5  
ATOM 8253  C CZ   . ARG A 1 58  ? 5.227   14.321  1.854   1.00 0.00 ? 58  ARG A CZ   5  
ATOM 8254  N NH1  . ARG A 1 58  ? 5.876   13.223  2.216   1.00 0.00 ? 58  ARG A NH1  5  
ATOM 8255  N NH2  . ARG A 1 58  ? 5.711   15.512  2.183   1.00 0.00 ? 58  ARG A NH2  5  
ATOM 8256  H H    . ARG A 1 58  ? -0.379  10.135  -0.805  1.00 0.00 ? 58  ARG A H    5  
ATOM 8257  H HA   . ARG A 1 58  ? 1.422   10.859  1.391   1.00 0.00 ? 58  ARG A HA   5  
ATOM 8258  H HB2  . ARG A 1 58  ? 2.426   11.153  -0.756  1.00 0.00 ? 58  ARG A HB2  5  
ATOM 8259  H HB3  . ARG A 1 58  ? 1.014   12.004  -1.370  1.00 0.00 ? 58  ARG A HB3  5  
ATOM 8260  H HG2  . ARG A 1 58  ? 2.546   13.700  -0.999  1.00 0.00 ? 58  ARG A HG2  5  
ATOM 8261  H HG3  . ARG A 1 58  ? 1.536   13.746  0.448   1.00 0.00 ? 58  ARG A HG3  5  
ATOM 8262  H HD2  . ARG A 1 58  ? 3.210   12.413  1.646   1.00 0.00 ? 58  ARG A HD2  5  
ATOM 8263  H HD3  . ARG A 1 58  ? 4.219   12.392  0.200   1.00 0.00 ? 58  ARG A HD3  5  
ATOM 8264  H HE   . ARG A 1 58  ? 3.632   15.055  0.907   1.00 0.00 ? 58  ARG A HE   5  
ATOM 8265  H HH11 . ARG A 1 58  ? 5.514   12.325  1.968   1.00 0.00 ? 58  ARG A HH11 5  
ATOM 8266  H HH12 . ARG A 1 58  ? 6.728   13.294  2.735   1.00 0.00 ? 58  ARG A HH12 5  
ATOM 8267  H HH21 . ARG A 1 58  ? 5.225   16.342  1.912   1.00 0.00 ? 58  ARG A HH21 5  
ATOM 8268  H HH22 . ARG A 1 58  ? 6.563   15.579  2.703   1.00 0.00 ? 58  ARG A HH22 5  
ATOM 8269  N N    . THR A 1 59  ? 0.163   12.773  2.358   1.00 0.00 ? 59  THR A N    5  
ATOM 8270  C CA   . THR A 1 59  ? -0.660  13.779  3.017   1.00 0.00 ? 59  THR A CA   5  
ATOM 8271  C C    . THR A 1 59  ? 0.175   14.984  3.436   1.00 0.00 ? 59  THR A C    5  
ATOM 8272  O O    . THR A 1 59  ? 1.382   14.871  3.646   1.00 0.00 ? 59  THR A O    5  
ATOM 8273  C CB   . THR A 1 59  ? -1.366  13.202  4.258   1.00 0.00 ? 59  THR A CB   5  
ATOM 8274  O OG1  . THR A 1 59  ? -0.396  12.736  5.202   1.00 0.00 ? 59  THR A OG1  5  
ATOM 8275  C CG2  . THR A 1 59  ? -2.294  12.060  3.871   1.00 0.00 ? 59  THR A CG2  5  
ATOM 8276  H H    . THR A 1 59  ? 0.984   12.466  2.794   1.00 0.00 ? 59  THR A H    5  
ATOM 8277  H HA   . THR A 1 59  ? -1.416  14.104  2.317   1.00 0.00 ? 59  THR A HA   5  
ATOM 8278  H HB   . THR A 1 59  ? -1.955  13.985  4.715   1.00 0.00 ? 59  THR A HB   5  
ATOM 8279  H HG1  . THR A 1 59  ? 0.446   13.166  5.034   1.00 0.00 ? 59  THR A HG1  5  
ATOM 8280  H HG21 . THR A 1 59  ? -2.753  12.277  2.918   1.00 0.00 ? 59  THR A HG21 5  
ATOM 8281  H HG22 . THR A 1 59  ? -3.061  11.948  4.623   1.00 0.00 ? 59  THR A HG22 5  
ATOM 8282  H HG23 . THR A 1 59  ? -1.726  11.145  3.796   1.00 0.00 ? 59  THR A HG23 5  
ATOM 8283  N N    . ASN A 1 60  ? -0.476  16.136  3.557   1.00 0.00 ? 60  ASN A N    5  
ATOM 8284  C CA   . ASN A 1 60  ? 0.208   17.363  3.951   1.00 0.00 ? 60  ASN A CA   5  
ATOM 8285  C C    . ASN A 1 60  ? 1.206   17.092  5.074   1.00 0.00 ? 60  ASN A C    5  
ATOM 8286  O O    . ASN A 1 60  ? 2.285   17.681  5.112   1.00 0.00 ? 60  ASN A O    5  
ATOM 8287  C CB   . ASN A 1 60  ? -0.808  18.416  4.399   1.00 0.00 ? 60  ASN A CB   5  
ATOM 8288  C CG   . ASN A 1 60  ? -1.500  18.037  5.694   1.00 0.00 ? 60  ASN A CG   5  
ATOM 8289  O OD1  . ASN A 1 60  ? -1.264  18.644  6.739   1.00 0.00 ? 60  ASN A OD1  5  
ATOM 8290  N ND2  . ASN A 1 60  ? -2.362  17.028  5.631   1.00 0.00 ? 60  ASN A ND2  5  
ATOM 8291  H H    . ASN A 1 60  ? -1.439  16.163  3.376   1.00 0.00 ? 60  ASN A H    5  
ATOM 8292  H HA   . ASN A 1 60  ? 0.743   17.735  3.091   1.00 0.00 ? 60  ASN A HA   5  
ATOM 8293  H HB2  . ASN A 1 60  ? -0.299  19.357  4.548   1.00 0.00 ? 60  ASN A HB2  5  
ATOM 8294  H HB3  . ASN A 1 60  ? -1.557  18.534  3.632   1.00 0.00 ? 60  ASN A HB3  5  
ATOM 8295  H HD21 . ASN A 1 60  ? -2.500  16.591  4.765   1.00 0.00 ? 60  ASN A HD21 5  
ATOM 8296  H HD22 . ASN A 1 60  ? -2.824  16.763  6.453   1.00 0.00 ? 60  ASN A HD22 5  
ATOM 8297  N N    . GLU A 1 61  ? 0.836   16.197  5.984   1.00 0.00 ? 61  GLU A N    5  
ATOM 8298  C CA   . GLU A 1 61  ? 1.698   15.849  7.107   1.00 0.00 ? 61  GLU A CA   5  
ATOM 8299  C C    . GLU A 1 61  ? 2.775   14.855  6.679   1.00 0.00 ? 61  GLU A C    5  
ATOM 8300  O O    . GLU A 1 61  ? 3.939   15.217  6.518   1.00 0.00 ? 61  GLU A O    5  
ATOM 8301  C CB   . GLU A 1 61  ? 0.871   15.260  8.251   1.00 0.00 ? 61  GLU A CB   5  
ATOM 8302  C CG   . GLU A 1 61  ? 0.033   16.290  8.990   1.00 0.00 ? 61  GLU A CG   5  
ATOM 8303  C CD   . GLU A 1 61  ? -1.216  15.692  9.607   1.00 0.00 ? 61  GLU A CD   5  
ATOM 8304  O OE1  . GLU A 1 61  ? -1.948  14.978  8.892   1.00 0.00 ? 61  GLU A OE1  5  
ATOM 8305  O OE2  . GLU A 1 61  ? -1.461  15.939  10.807  1.00 0.00 ? 61  GLU A OE2  5  
ATOM 8306  H H    . GLU A 1 61  ? -0.038  15.761  5.899   1.00 0.00 ? 61  GLU A H    5  
ATOM 8307  H HA   . GLU A 1 61  ? 2.177   16.754  7.450   1.00 0.00 ? 61  GLU A HA   5  
ATOM 8308  H HB2  . GLU A 1 61  ? 0.208   14.507  7.850   1.00 0.00 ? 61  GLU A HB2  5  
ATOM 8309  H HB3  . GLU A 1 61  ? 1.540   14.796  8.961   1.00 0.00 ? 61  GLU A HB3  5  
ATOM 8310  H HG2  . GLU A 1 61  ? 0.632   16.725  9.776   1.00 0.00 ? 61  GLU A HG2  5  
ATOM 8311  H HG3  . GLU A 1 61  ? -0.261  17.062  8.294   1.00 0.00 ? 61  GLU A HG3  5  
ATOM 8312  N N    . ASN A 1 62  ? 2.374   13.601  6.496   1.00 0.00 ? 62  ASN A N    5  
ATOM 8313  C CA   . ASN A 1 62  ? 3.304   12.554  6.088   1.00 0.00 ? 62  ASN A CA   5  
ATOM 8314  C C    . ASN A 1 62  ? 2.560   11.382  5.456   1.00 0.00 ? 62  ASN A C    5  
ATOM 8315  O O    . ASN A 1 62  ? 1.389   11.144  5.754   1.00 0.00 ? 62  ASN A O    5  
ATOM 8316  C CB   . ASN A 1 62  ? 4.117   12.068  7.290   1.00 0.00 ? 62  ASN A CB   5  
ATOM 8317  C CG   . ASN A 1 62  ? 3.242   11.731  8.482   1.00 0.00 ? 62  ASN A CG   5  
ATOM 8318  O OD1  . ASN A 1 62  ? 2.423   12.542  8.913   1.00 0.00 ? 62  ASN A OD1  5  
ATOM 8319  N ND2  . ASN A 1 62  ? 3.414   10.529  9.020   1.00 0.00 ? 62  ASN A ND2  5  
ATOM 8320  H H    . ASN A 1 62  ? 1.432   13.374  6.640   1.00 0.00 ? 62  ASN A H    5  
ATOM 8321  H HA   . ASN A 1 62  ? 3.977   12.975  5.356   1.00 0.00 ? 62  ASN A HA   5  
ATOM 8322  H HB2  . ASN A 1 62  ? 4.667   11.182  7.009   1.00 0.00 ? 62  ASN A HB2  5  
ATOM 8323  H HB3  . ASN A 1 62  ? 4.812   12.840  7.583   1.00 0.00 ? 62  ASN A HB3  5  
ATOM 8324  H HD21 . ASN A 1 62  ? 4.085   9.935   8.623   1.00 0.00 ? 62  ASN A HD21 5  
ATOM 8325  H HD22 . ASN A 1 62  ? 2.861   10.285  9.791   1.00 0.00 ? 62  ASN A HD22 5  
ATOM 8326  N N    . ILE A 1 63  ? 3.247   10.653  4.584   1.00 0.00 ? 63  ILE A N    5  
ATOM 8327  C CA   . ILE A 1 63  ? 2.652   9.505   3.911   1.00 0.00 ? 63  ILE A CA   5  
ATOM 8328  C C    . ILE A 1 63  ? 2.045   8.532   4.917   1.00 0.00 ? 63  ILE A C    5  
ATOM 8329  O O    . ILE A 1 63  ? 2.666   8.203   5.928   1.00 0.00 ? 63  ILE A O    5  
ATOM 8330  C CB   . ILE A 1 63  ? 3.687   8.757   3.051   1.00 0.00 ? 63  ILE A CB   5  
ATOM 8331  C CG1  . ILE A 1 63  ? 4.144   9.635   1.885   1.00 0.00 ? 63  ILE A CG1  5  
ATOM 8332  C CG2  . ILE A 1 63  ? 3.104   7.448   2.539   1.00 0.00 ? 63  ILE A CG2  5  
ATOM 8333  C CD1  . ILE A 1 63  ? 5.554   9.341   1.422   1.00 0.00 ? 63  ILE A CD1  5  
ATOM 8334  H H    . ILE A 1 63  ? 4.177   10.892  4.388   1.00 0.00 ? 63  ILE A H    5  
ATOM 8335  H HA   . ILE A 1 63  ? 1.869   9.868   3.262   1.00 0.00 ? 63  ILE A HA   5  
ATOM 8336  H HB   . ILE A 1 63  ? 4.539   8.525   3.673   1.00 0.00 ? 63  ILE A HB   5  
ATOM 8337  H HG12 . ILE A 1 63  ? 3.482   9.483   1.047   1.00 0.00 ? 63  ILE A HG12 5  
ATOM 8338  H HG13 . ILE A 1 63  ? 4.102   10.672  2.187   1.00 0.00 ? 63  ILE A HG13 5  
ATOM 8339  H HG21 . ILE A 1 63  ? 3.223   7.397   1.467   1.00 0.00 ? 63  ILE A HG21 5  
ATOM 8340  H HG22 . ILE A 1 63  ? 3.623   6.620   2.998   1.00 0.00 ? 63  ILE A HG22 5  
ATOM 8341  H HG23 . ILE A 1 63  ? 2.055   7.399   2.788   1.00 0.00 ? 63  ILE A HG23 5  
ATOM 8342  H HD11 . ILE A 1 63  ? 6.213   9.303   2.277   1.00 0.00 ? 63  ILE A HD11 5  
ATOM 8343  H HD12 . ILE A 1 63  ? 5.574   8.393   0.908   1.00 0.00 ? 63  ILE A HD12 5  
ATOM 8344  H HD13 . ILE A 1 63  ? 5.882   10.122  0.751   1.00 0.00 ? 63  ILE A HD13 5  
ATOM 8345  N N    . GLN A 1 64  ? 0.830   8.075   4.632   1.00 0.00 ? 64  GLN A N    5  
ATOM 8346  C CA   . GLN A 1 64  ? 0.141   7.139   5.512   1.00 0.00 ? 64  GLN A CA   5  
ATOM 8347  C C    . GLN A 1 64  ? 0.460   5.697   5.130   1.00 0.00 ? 64  GLN A C    5  
ATOM 8348  O O    . GLN A 1 64  ? 1.254   5.446   4.224   1.00 0.00 ? 64  GLN A O    5  
ATOM 8349  C CB   . GLN A 1 64  ? -1.370  7.371   5.456   1.00 0.00 ? 64  GLN A CB   5  
ATOM 8350  C CG   . GLN A 1 64  ? -1.816  8.647   6.152   1.00 0.00 ? 64  GLN A CG   5  
ATOM 8351  C CD   . GLN A 1 64  ? -3.226  8.551   6.699   1.00 0.00 ? 64  GLN A CD   5  
ATOM 8352  O OE1  . GLN A 1 64  ? -3.777  7.459   6.839   1.00 0.00 ? 64  GLN A OE1  5  
ATOM 8353  N NE2  . GLN A 1 64  ? -3.818  9.697   7.014   1.00 0.00 ? 64  GLN A NE2  5  
ATOM 8354  H H    . GLN A 1 64  ? 0.387   8.375   3.812   1.00 0.00 ? 64  GLN A H    5  
ATOM 8355  H HA   . GLN A 1 64  ? 0.486   7.316   6.519   1.00 0.00 ? 64  GLN A HA   5  
ATOM 8356  H HB2  . GLN A 1 64  ? -1.676  7.425   4.421   1.00 0.00 ? 64  GLN A HB2  5  
ATOM 8357  H HB3  . GLN A 1 64  ? -1.868  6.537   5.927   1.00 0.00 ? 64  GLN A HB3  5  
ATOM 8358  H HG2  . GLN A 1 64  ? -1.141  8.850   6.970   1.00 0.00 ? 64  GLN A HG2  5  
ATOM 8359  H HG3  . GLN A 1 64  ? -1.774  9.461   5.443   1.00 0.00 ? 64  GLN A HG3  5  
ATOM 8360  H HE21 . GLN A 1 64  ? -3.319  10.530  6.875   1.00 0.00 ? 64  GLN A HE21 5  
ATOM 8361  H HE22 . GLN A 1 64  ? -4.730  9.665   7.369   1.00 0.00 ? 64  GLN A HE22 5  
ATOM 8362  N N    . ARG A 1 65  ? -0.164  4.754   5.827   1.00 0.00 ? 65  ARG A N    5  
ATOM 8363  C CA   . ARG A 1 65  ? 0.055   3.337   5.562   1.00 0.00 ? 65  ARG A CA   5  
ATOM 8364  C C    . ARG A 1 65  ? -1.178  2.517   5.932   1.00 0.00 ? 65  ARG A C    5  
ATOM 8365  O O    . ARG A 1 65  ? -1.550  2.430   7.103   1.00 0.00 ? 65  ARG A O    5  
ATOM 8366  C CB   . ARG A 1 65  ? 1.269   2.832   6.343   1.00 0.00 ? 65  ARG A CB   5  
ATOM 8367  C CG   . ARG A 1 65  ? 1.700   1.426   5.958   1.00 0.00 ? 65  ARG A CG   5  
ATOM 8368  C CD   . ARG A 1 65  ? 2.489   0.759   7.074   1.00 0.00 ? 65  ARG A CD   5  
ATOM 8369  N NE   . ARG A 1 65  ? 1.617   0.087   8.034   1.00 0.00 ? 65  ARG A NE   5  
ATOM 8370  C CZ   . ARG A 1 65  ? 2.053   -0.462  9.163   1.00 0.00 ? 65  ARG A CZ   5  
ATOM 8371  N NH1  . ARG A 1 65  ? 3.341   -0.418  9.471   1.00 0.00 ? 65  ARG A NH1  5  
ATOM 8372  N NH2  . ARG A 1 65  ? 1.198   -1.055  9.986   1.00 0.00 ? 65  ARG A NH2  5  
ATOM 8373  H H    . ARG A 1 65  ? -0.786  5.016   6.538   1.00 0.00 ? 65  ARG A H    5  
ATOM 8374  H HA   . ARG A 1 65  ? 0.245   3.222   4.506   1.00 0.00 ? 65  ARG A HA   5  
ATOM 8375  H HB2  . ARG A 1 65  ? 2.100   3.499   6.167   1.00 0.00 ? 65  ARG A HB2  5  
ATOM 8376  H HB3  . ARG A 1 65  ? 1.032   2.836   7.396   1.00 0.00 ? 65  ARG A HB3  5  
ATOM 8377  H HG2  . ARG A 1 65  ? 0.820   0.834   5.751   1.00 0.00 ? 65  ARG A HG2  5  
ATOM 8378  H HG3  . ARG A 1 65  ? 2.317   1.478   5.074   1.00 0.00 ? 65  ARG A HG3  5  
ATOM 8379  H HD2  . ARG A 1 65  ? 3.157   0.031   6.639   1.00 0.00 ? 65  ARG A HD2  5  
ATOM 8380  H HD3  . ARG A 1 65  ? 3.064   1.513   7.590   1.00 0.00 ? 65  ARG A HD3  5  
ATOM 8381  H HE   . ARG A 1 65  ? 0.661   0.044   7.826   1.00 0.00 ? 65  ARG A HE   5  
ATOM 8382  H HH11 . ARG A 1 65  ? 3.987   0.029   8.853   1.00 0.00 ? 65  ARG A HH11 5  
ATOM 8383  H HH12 . ARG A 1 65  ? 3.666   -0.832  10.322  1.00 0.00 ? 65  ARG A HH12 5  
ATOM 8384  H HH21 . ARG A 1 65  ? 0.225   -1.090  9.757   1.00 0.00 ? 65  ARG A HH21 5  
ATOM 8385  H HH22 . ARG A 1 65  ? 1.526   -1.468  10.835  1.00 0.00 ? 65  ARG A HH22 5  
ATOM 8386  N N    . PHE A 1 66  ? -1.808  1.919   4.927   1.00 0.00 ? 66  PHE A N    5  
ATOM 8387  C CA   . PHE A 1 66  ? -3.000  1.108   5.146   1.00 0.00 ? 66  PHE A CA   5  
ATOM 8388  C C    . PHE A 1 66  ? -2.656  -0.379  5.134   1.00 0.00 ? 66  PHE A C    5  
ATOM 8389  O O    . PHE A 1 66  ? -1.524  -0.764  4.839   1.00 0.00 ? 66  PHE A O    5  
ATOM 8390  C CB   . PHE A 1 66  ? -4.051  1.408   4.076   1.00 0.00 ? 66  PHE A CB   5  
ATOM 8391  C CG   . PHE A 1 66  ? -4.451  2.855   4.018   1.00 0.00 ? 66  PHE A CG   5  
ATOM 8392  C CD1  . PHE A 1 66  ? -3.764  3.745   3.207   1.00 0.00 ? 66  PHE A CD1  5  
ATOM 8393  C CD2  . PHE A 1 66  ? -5.513  3.325   4.773   1.00 0.00 ? 66  PHE A CD2  5  
ATOM 8394  C CE1  . PHE A 1 66  ? -4.130  5.077   3.153   1.00 0.00 ? 66  PHE A CE1  5  
ATOM 8395  C CE2  . PHE A 1 66  ? -5.884  4.655   4.722   1.00 0.00 ? 66  PHE A CE2  5  
ATOM 8396  C CZ   . PHE A 1 66  ? -5.191  5.532   3.910   1.00 0.00 ? 66  PHE A CZ   5  
ATOM 8397  H H    . PHE A 1 66  ? -1.463  2.026   4.015   1.00 0.00 ? 66  PHE A H    5  
ATOM 8398  H HA   . PHE A 1 66  ? -3.401  1.364   6.114   1.00 0.00 ? 66  PHE A HA   5  
ATOM 8399  H HB2  . PHE A 1 66  ? -3.658  1.134   3.108   1.00 0.00 ? 66  PHE A HB2  5  
ATOM 8400  H HB3  . PHE A 1 66  ? -4.937  0.826   4.278   1.00 0.00 ? 66  PHE A HB3  5  
ATOM 8401  H HD1  . PHE A 1 66  ? -2.935  3.390   2.614   1.00 0.00 ? 66  PHE A HD1  5  
ATOM 8402  H HD2  . PHE A 1 66  ? -6.056  2.639   5.409   1.00 0.00 ? 66  PHE A HD2  5  
ATOM 8403  H HE1  . PHE A 1 66  ? -3.587  5.760   2.517   1.00 0.00 ? 66  PHE A HE1  5  
ATOM 8404  H HE2  . PHE A 1 66  ? -6.714  5.008   5.316   1.00 0.00 ? 66  PHE A HE2  5  
ATOM 8405  H HZ   . PHE A 1 66  ? -5.479  6.572   3.869   1.00 0.00 ? 66  PHE A HZ   5  
ATOM 8406  N N    . LYS A 1 67  ? -3.640  -1.210  5.458   1.00 0.00 ? 67  LYS A N    5  
ATOM 8407  C CA   . LYS A 1 67  ? -3.445  -2.655  5.484   1.00 0.00 ? 67  LYS A CA   5  
ATOM 8408  C C    . LYS A 1 67  ? -4.555  -3.368  4.719   1.00 0.00 ? 67  LYS A C    5  
ATOM 8409  O O    . LYS A 1 67  ? -5.738  -3.099  4.930   1.00 0.00 ? 67  LYS A O    5  
ATOM 8410  C CB   . LYS A 1 67  ? -3.402  -3.158  6.929   1.00 0.00 ? 67  LYS A CB   5  
ATOM 8411  C CG   . LYS A 1 67  ? -4.754  -3.137  7.621   1.00 0.00 ? 67  LYS A CG   5  
ATOM 8412  C CD   . LYS A 1 67  ? -4.607  -3.199  9.132   1.00 0.00 ? 67  LYS A CD   5  
ATOM 8413  C CE   . LYS A 1 67  ? -4.233  -4.597  9.600   1.00 0.00 ? 67  LYS A CE   5  
ATOM 8414  N NZ   . LYS A 1 67  ? -4.341  -4.734  11.078  1.00 0.00 ? 67  LYS A NZ   5  
ATOM 8415  H H    . LYS A 1 67  ? -4.521  -0.843  5.683   1.00 0.00 ? 67  LYS A H    5  
ATOM 8416  H HA   . LYS A 1 67  ? -2.500  -2.871  5.008   1.00 0.00 ? 67  LYS A HA   5  
ATOM 8417  H HB2  . LYS A 1 67  ? -3.034  -4.173  6.933   1.00 0.00 ? 67  LYS A HB2  5  
ATOM 8418  H HB3  . LYS A 1 67  ? -2.722  -2.536  7.493   1.00 0.00 ? 67  LYS A HB3  5  
ATOM 8419  H HG2  . LYS A 1 67  ? -5.269  -2.226  7.357   1.00 0.00 ? 67  LYS A HG2  5  
ATOM 8420  H HG3  . LYS A 1 67  ? -5.330  -3.989  7.289   1.00 0.00 ? 67  LYS A HG3  5  
ATOM 8421  H HD2  . LYS A 1 67  ? -3.834  -2.510  9.439   1.00 0.00 ? 67  LYS A HD2  5  
ATOM 8422  H HD3  . LYS A 1 67  ? -5.546  -2.915  9.587   1.00 0.00 ? 67  LYS A HD3  5  
ATOM 8423  H HE2  . LYS A 1 67  ? -4.896  -5.308  9.131   1.00 0.00 ? 67  LYS A HE2  5  
ATOM 8424  H HE3  . LYS A 1 67  ? -3.216  -4.801  9.301   1.00 0.00 ? 67  LYS A HE3  5  
ATOM 8425  H HZ1  . LYS A 1 67  ? -5.031  -5.475  11.319  1.00 0.00 ? 67  LYS A HZ1  5  
ATOM 8426  H HZ2  . LYS A 1 67  ? -4.653  -3.836  11.499  1.00 0.00 ? 67  LYS A HZ2  5  
ATOM 8427  H HZ3  . LYS A 1 67  ? -3.417  -4.991  11.482  1.00 0.00 ? 67  LYS A HZ3  5  
ATOM 8428  N N    . ILE A 1 68  ? -4.166  -4.279  3.833   1.00 0.00 ? 68  ILE A N    5  
ATOM 8429  C CA   . ILE A 1 68  ? -5.130  -5.032  3.040   1.00 0.00 ? 68  ILE A CA   5  
ATOM 8430  C C    . ILE A 1 68  ? -4.955  -6.533  3.242   1.00 0.00 ? 68  ILE A C    5  
ATOM 8431  O O    . ILE A 1 68  ? -4.051  -7.146  2.672   1.00 0.00 ? 68  ILE A O    5  
ATOM 8432  C CB   . ILE A 1 68  ? -4.999  -4.709  1.540   1.00 0.00 ? 68  ILE A CB   5  
ATOM 8433  C CG1  . ILE A 1 68  ? -5.253  -3.221  1.292   1.00 0.00 ? 68  ILE A CG1  5  
ATOM 8434  C CG2  . ILE A 1 68  ? -5.965  -5.559  0.728   1.00 0.00 ? 68  ILE A CG2  5  
ATOM 8435  C CD1  . ILE A 1 68  ? -4.908  -2.775  -0.112  1.00 0.00 ? 68  ILE A CD1  5  
ATOM 8436  H H    . ILE A 1 68  ? -3.209  -4.448  3.710   1.00 0.00 ? 68  ILE A H    5  
ATOM 8437  H HA   . ILE A 1 68  ? -6.121  -4.749  3.363   1.00 0.00 ? 68  ILE A HA   5  
ATOM 8438  H HB   . ILE A 1 68  ? -3.994  -4.952  1.228   1.00 0.00 ? 68  ILE A HB   5  
ATOM 8439  H HG12 . ILE A 1 68  ? -6.296  -3.007  1.460   1.00 0.00 ? 68  ILE A HG12 5  
ATOM 8440  H HG13 . ILE A 1 68  ? -4.655  -2.642  1.981   1.00 0.00 ? 68  ILE A HG13 5  
ATOM 8441  H HG21 . ILE A 1 68  ? -5.581  -6.566  0.652   1.00 0.00 ? 68  ILE A HG21 5  
ATOM 8442  H HG22 . ILE A 1 68  ? -6.926  -5.578  1.219   1.00 0.00 ? 68  ILE A HG22 5  
ATOM 8443  H HG23 . ILE A 1 68  ? -6.072  -5.139  -0.260  1.00 0.00 ? 68  ILE A HG23 5  
ATOM 8444  H HD11 . ILE A 1 68  ? -3.987  -2.210  -0.095  1.00 0.00 ? 68  ILE A HD11 5  
ATOM 8445  H HD12 . ILE A 1 68  ? -4.789  -3.640  -0.746  1.00 0.00 ? 68  ILE A HD12 5  
ATOM 8446  H HD13 . ILE A 1 68  ? -5.703  -2.152  -0.497  1.00 0.00 ? 68  ILE A HD13 5  
ATOM 8447  N N    . CYS A 1 69  ? -5.825  -7.120  4.057   1.00 0.00 ? 69  CYS A N    5  
ATOM 8448  C CA   . CYS A 1 69  ? -5.767  -8.551  4.335   1.00 0.00 ? 69  CYS A CA   5  
ATOM 8449  C C    . CYS A 1 69  ? -6.711  -9.321  3.417   1.00 0.00 ? 69  CYS A C    5  
ATOM 8450  O O    . CYS A 1 69  ? -7.815  -8.875  3.105   1.00 0.00 ? 69  CYS A O    5  
ATOM 8451  C CB   . CYS A 1 69  ? -6.124  -8.822  5.797   1.00 0.00 ? 69  CYS A CB   5  
ATOM 8452  S SG   . CYS A 1 69  ? -4.985  -8.075  6.986   1.00 0.00 ? 69  CYS A SG   5  
ATOM 8453  H H    . CYS A 1 69  ? -6.522  -6.579  4.483   1.00 0.00 ? 69  CYS A H    5  
ATOM 8454  H HA   . CYS A 1 69  ? -4.756  -8.883  4.152   1.00 0.00 ? 69  CYS A HA   5  
ATOM 8455  H HB2  . CYS A 1 69  ? -7.110  -8.431  5.997   1.00 0.00 ? 69  CYS A HB2  5  
ATOM 8456  H HB3  . CYS A 1 69  ? -6.126  -9.889  5.967   1.00 0.00 ? 69  CYS A HB3  5  
ATOM 8457  H HG   . CYS A 1 69  ? -4.293  -9.050  7.556   1.00 0.00 ? 69  CYS A HG   5  
ATOM 8458  N N    . PRO A 1 70  ? -6.267  -10.506 2.971   1.00 0.00 ? 70  PRO A N    5  
ATOM 8459  C CA   . PRO A 1 70  ? -7.056  -11.363 2.081   1.00 0.00 ? 70  PRO A CA   5  
ATOM 8460  C C    . PRO A 1 70  ? -8.265  -11.970 2.783   1.00 0.00 ? 70  PRO A C    5  
ATOM 8461  O O    . PRO A 1 70  ? -8.239  -12.212 3.990   1.00 0.00 ? 70  PRO A O    5  
ATOM 8462  C CB   . PRO A 1 70  ? -6.067  -12.459 1.675   1.00 0.00 ? 70  PRO A CB   5  
ATOM 8463  C CG   . PRO A 1 70  ? -5.079  -12.509 2.790   1.00 0.00 ? 70  PRO A CG   5  
ATOM 8464  C CD   . PRO A 1 70  ? -4.961  -11.100 3.302   1.00 0.00 ? 70  PRO A CD   5  
ATOM 8465  H HA   . PRO A 1 70  ? -7.383  -10.827 1.201   1.00 0.00 ? 70  PRO A HA   5  
ATOM 8466  H HB2  . PRO A 1 70  ? -6.591  -13.398 1.568   1.00 0.00 ? 70  PRO A HB2  5  
ATOM 8467  H HB3  . PRO A 1 70  ? -5.595  -12.195 0.741   1.00 0.00 ? 70  PRO A HB3  5  
ATOM 8468  H HG2  . PRO A 1 70  ? -5.439  -13.162 3.570   1.00 0.00 ? 70  PRO A HG2  5  
ATOM 8469  H HG3  . PRO A 1 70  ? -4.125  -12.854 2.419   1.00 0.00 ? 70  PRO A HG3  5  
ATOM 8470  H HD2  . PRO A 1 70  ? -4.796  -11.099 4.369   1.00 0.00 ? 70  PRO A HD2  5  
ATOM 8471  H HD3  . PRO A 1 70  ? -4.162  -10.580 2.794   1.00 0.00 ? 70  PRO A HD3  5  
ATOM 8472  N N    . THR A 1 71  ? -9.326  -12.214 2.020   1.00 0.00 ? 71  THR A N    5  
ATOM 8473  C CA   . THR A 1 71  ? -10.546 -12.792 2.569   1.00 0.00 ? 71  THR A CA   5  
ATOM 8474  C C    . THR A 1 71  ? -10.984 -14.014 1.769   1.00 0.00 ? 71  THR A C    5  
ATOM 8475  O O    . THR A 1 71  ? -10.763 -14.107 0.562   1.00 0.00 ? 71  THR A O    5  
ATOM 8476  C CB   . THR A 1 71  ? -11.695 -11.766 2.588   1.00 0.00 ? 71  THR A CB   5  
ATOM 8477  O OG1  . THR A 1 71  ? -11.963 -11.306 1.259   1.00 0.00 ? 71  THR A OG1  5  
ATOM 8478  C CG2  . THR A 1 71  ? -11.349 -10.583 3.480   1.00 0.00 ? 71  THR A CG2  5  
ATOM 8479  H H    . THR A 1 71  ? -9.286  -11.999 1.065   1.00 0.00 ? 71  THR A H    5  
ATOM 8480  H HA   . THR A 1 71  ? -10.344 -13.094 3.587   1.00 0.00 ? 71  THR A HA   5  
ATOM 8481  H HB   . THR A 1 71  ? -12.580 -12.247 2.980   1.00 0.00 ? 71  THR A HB   5  
ATOM 8482  H HG1  . THR A 1 71  ? -12.903 -11.139 1.161   1.00 0.00 ? 71  THR A HG1  5  
ATOM 8483  H HG21 . THR A 1 71  ? -10.853 -9.824  2.895   1.00 0.00 ? 71  THR A HG21 5  
ATOM 8484  H HG22 . THR A 1 71  ? -10.696 -10.911 4.275   1.00 0.00 ? 71  THR A HG22 5  
ATOM 8485  H HG23 . THR A 1 71  ? -12.255 -10.176 3.903   1.00 0.00 ? 71  THR A HG23 5  
ATOM 8486  N N    . PRO A 1 72  ? -11.621 -14.974 2.455   1.00 0.00 ? 72  PRO A N    5  
ATOM 8487  C CA   . PRO A 1 72  ? -12.105 -16.207 1.828   1.00 0.00 ? 72  PRO A CA   5  
ATOM 8488  C C    . PRO A 1 72  ? -13.283 -15.958 0.892   1.00 0.00 ? 72  PRO A C    5  
ATOM 8489  O O    . PRO A 1 72  ? -13.811 -16.887 0.283   1.00 0.00 ? 72  PRO A O    5  
ATOM 8490  C CB   . PRO A 1 72  ? -12.540 -17.064 3.019   1.00 0.00 ? 72  PRO A CB   5  
ATOM 8491  C CG   . PRO A 1 72  ? -12.862 -16.084 4.093   1.00 0.00 ? 72  PRO A CG   5  
ATOM 8492  C CD   . PRO A 1 72  ? -11.919 -14.929 3.897   1.00 0.00 ? 72  PRO A CD   5  
ATOM 8493  H HA   . PRO A 1 72  ? -11.318 -16.712 1.287   1.00 0.00 ? 72  PRO A HA   5  
ATOM 8494  H HB2  . PRO A 1 72  ? -13.406 -17.651 2.746   1.00 0.00 ? 72  PRO A HB2  5  
ATOM 8495  H HB3  . PRO A 1 72  ? -11.733 -17.718 3.311   1.00 0.00 ? 72  PRO A HB3  5  
ATOM 8496  H HG2  . PRO A 1 72  ? -13.885 -15.754 3.995   1.00 0.00 ? 72  PRO A HG2  5  
ATOM 8497  H HG3  . PRO A 1 72  ? -12.704 -16.536 5.061   1.00 0.00 ? 72  PRO A HG3  5  
ATOM 8498  H HD2  . PRO A 1 72  ? -12.400 -14.000 4.163   1.00 0.00 ? 72  PRO A HD2  5  
ATOM 8499  H HD3  . PRO A 1 72  ? -11.021 -15.072 4.480   1.00 0.00 ? 72  PRO A HD3  5  
ATOM 8500  N N    . ASN A 1 73  ? -13.689 -14.697 0.782   1.00 0.00 ? 73  ASN A N    5  
ATOM 8501  C CA   . ASN A 1 73  ? -14.805 -14.326 -0.080  1.00 0.00 ? 73  ASN A CA   5  
ATOM 8502  C C    . ASN A 1 73  ? -14.309 -13.627 -1.341  1.00 0.00 ? 73  ASN A C    5  
ATOM 8503  O O    . ASN A 1 73  ? -14.926 -12.676 -1.820  1.00 0.00 ? 73  ASN A O    5  
ATOM 8504  C CB   . ASN A 1 73  ? -15.778 -13.416 0.673   1.00 0.00 ? 73  ASN A CB   5  
ATOM 8505  C CG   . ASN A 1 73  ? -16.989 -13.048 -0.162  1.00 0.00 ? 73  ASN A CG   5  
ATOM 8506  O OD1  . ASN A 1 73  ? -17.559 -13.891 -0.854  1.00 0.00 ? 73  ASN A OD1  5  
ATOM 8507  N ND2  . ASN A 1 73  ? -17.388 -11.783 -0.099  1.00 0.00 ? 73  ASN A ND2  5  
ATOM 8508  H H    . ASN A 1 73  ? -13.228 -14.000 1.294   1.00 0.00 ? 73  ASN A H    5  
ATOM 8509  H HA   . ASN A 1 73  ? -15.320 -15.232 -0.363  1.00 0.00 ? 73  ASN A HA   5  
ATOM 8510  H HB2  . ASN A 1 73  ? -16.119 -13.922 1.564   1.00 0.00 ? 73  ASN A HB2  5  
ATOM 8511  H HB3  . ASN A 1 73  ? -15.267 -12.507 0.954   1.00 0.00 ? 73  ASN A HB3  5  
ATOM 8512  H HD21 . ASN A 1 73  ? -16.886 -11.166 0.474   1.00 0.00 ? 73  ASN A HD21 5  
ATOM 8513  H HD22 . ASN A 1 73  ? -18.170 -11.518 -0.628  1.00 0.00 ? 73  ASN A HD22 5  
ATOM 8514  N N    . ASN A 1 74  ? -13.190 -14.105 -1.875  1.00 0.00 ? 74  ASN A N    5  
ATOM 8515  C CA   . ASN A 1 74  ? -12.610 -13.526 -3.082  1.00 0.00 ? 74  ASN A CA   5  
ATOM 8516  C C    . ASN A 1 74  ? -12.666 -12.002 -3.035  1.00 0.00 ? 74  ASN A C    5  
ATOM 8517  O O    . ASN A 1 74  ? -13.062 -11.356 -4.005  1.00 0.00 ? 74  ASN A O    5  
ATOM 8518  C CB   . ASN A 1 74  ? -13.346 -14.036 -4.322  1.00 0.00 ? 74  ASN A CB   5  
ATOM 8519  C CG   . ASN A 1 74  ? -12.900 -15.428 -4.728  1.00 0.00 ? 74  ASN A CG   5  
ATOM 8520  O OD1  . ASN A 1 74  ? -11.988 -15.998 -4.129  1.00 0.00 ? 74  ASN A OD1  5  
ATOM 8521  N ND2  . ASN A 1 74  ? -13.541 -15.980 -5.751  1.00 0.00 ? 74  ASN A ND2  5  
ATOM 8522  H H    . ASN A 1 74  ? -12.743 -14.865 -1.448  1.00 0.00 ? 74  ASN A H    5  
ATOM 8523  H HA   . ASN A 1 74  ? -11.577 -13.835 -3.134  1.00 0.00 ? 74  ASN A HA   5  
ATOM 8524  H HB2  . ASN A 1 74  ? -14.407 -14.066 -4.117  1.00 0.00 ? 74  ASN A HB2  5  
ATOM 8525  H HB3  . ASN A 1 74  ? -13.161 -13.364 -5.146  1.00 0.00 ? 74  ASN A HB3  5  
ATOM 8526  H HD21 . ASN A 1 74  ? -14.257 -15.467 -6.180  1.00 0.00 ? 74  ASN A HD21 5  
ATOM 8527  H HD22 . ASN A 1 74  ? -13.273 -16.879 -6.034  1.00 0.00 ? 74  ASN A HD22 5  
ATOM 8528  N N    . GLN A 1 75  ? -12.267 -11.436 -1.901  1.00 0.00 ? 75  GLN A N    5  
ATOM 8529  C CA   . GLN A 1 75  ? -12.272 -9.988  -1.727  1.00 0.00 ? 75  GLN A CA   5  
ATOM 8530  C C    . GLN A 1 75  ? -11.111 -9.541  -0.845  1.00 0.00 ? 75  GLN A C    5  
ATOM 8531  O O    . GLN A 1 75  ? -10.355 -10.366 -0.332  1.00 0.00 ? 75  GLN A O    5  
ATOM 8532  C CB   . GLN A 1 75  ? -13.598 -9.531  -1.116  1.00 0.00 ? 75  GLN A CB   5  
ATOM 8533  C CG   . GLN A 1 75  ? -14.724 -9.405  -2.130  1.00 0.00 ? 75  GLN A CG   5  
ATOM 8534  C CD   . GLN A 1 75  ? -15.878 -8.565  -1.619  1.00 0.00 ? 75  GLN A CD   5  
ATOM 8535  O OE1  . GLN A 1 75  ? -15.908 -8.175  -0.451  1.00 0.00 ? 75  GLN A OE1  5  
ATOM 8536  N NE2  . GLN A 1 75  ? -16.836 -8.280  -2.493  1.00 0.00 ? 75  GLN A NE2  5  
ATOM 8537  H H    . GLN A 1 75  ? -11.963 -12.004 -1.163  1.00 0.00 ? 75  GLN A H    5  
ATOM 8538  H HA   . GLN A 1 75  ? -12.161 -9.537  -2.702  1.00 0.00 ? 75  GLN A HA   5  
ATOM 8539  H HB2  . GLN A 1 75  ? -13.898 -10.244 -0.363  1.00 0.00 ? 75  GLN A HB2  5  
ATOM 8540  H HB3  . GLN A 1 75  ? -13.452 -8.567  -0.651  1.00 0.00 ? 75  GLN A HB3  5  
ATOM 8541  H HG2  . GLN A 1 75  ? -14.334 -8.946  -3.026  1.00 0.00 ? 75  GLN A HG2  5  
ATOM 8542  H HG3  . GLN A 1 75  ? -15.092 -10.393 -2.363  1.00 0.00 ? 75  GLN A HG3  5  
ATOM 8543  H HE21 . GLN A 1 75  ? -16.745 -8.625  -3.406  1.00 0.00 ? 75  GLN A HE21 5  
ATOM 8544  H HE22 . GLN A 1 75  ? -17.594 -7.740  -2.189  1.00 0.00 ? 75  GLN A HE22 5  
ATOM 8545  N N    . PHE A 1 76  ? -10.975 -8.230  -0.674  1.00 0.00 ? 76  PHE A N    5  
ATOM 8546  C CA   . PHE A 1 76  ? -9.904  -7.673  0.145   1.00 0.00 ? 76  PHE A CA   5  
ATOM 8547  C C    . PHE A 1 76  ? -10.471 -6.786  1.250   1.00 0.00 ? 76  PHE A C    5  
ATOM 8548  O O    . PHE A 1 76  ? -11.419 -6.034  1.031   1.00 0.00 ? 76  PHE A O    5  
ATOM 8549  C CB   . PHE A 1 76  ? -8.935  -6.869  -0.723  1.00 0.00 ? 76  PHE A CB   5  
ATOM 8550  C CG   . PHE A 1 76  ? -8.056  -7.725  -1.590  1.00 0.00 ? 76  PHE A CG   5  
ATOM 8551  C CD1  . PHE A 1 76  ? -7.076  -8.527  -1.028  1.00 0.00 ? 76  PHE A CD1  5  
ATOM 8552  C CD2  . PHE A 1 76  ? -8.210  -7.727  -2.967  1.00 0.00 ? 76  PHE A CD2  5  
ATOM 8553  C CE1  . PHE A 1 76  ? -6.266  -9.316  -1.823  1.00 0.00 ? 76  PHE A CE1  5  
ATOM 8554  C CE2  . PHE A 1 76  ? -7.403  -8.514  -3.767  1.00 0.00 ? 76  PHE A CE2  5  
ATOM 8555  C CZ   . PHE A 1 76  ? -6.429  -9.308  -3.195  1.00 0.00 ? 76  PHE A CZ   5  
ATOM 8556  H H    . PHE A 1 76  ? -11.609 -7.623  -1.110  1.00 0.00 ? 76  PHE A H    5  
ATOM 8557  H HA   . PHE A 1 76  ? -9.372  -8.496  0.597   1.00 0.00 ? 76  PHE A HA   5  
ATOM 8558  H HB2  . PHE A 1 76  ? -9.499  -6.214  -1.369  1.00 0.00 ? 76  PHE A HB2  5  
ATOM 8559  H HB3  . PHE A 1 76  ? -8.297  -6.277  -0.084  1.00 0.00 ? 76  PHE A HB3  5  
ATOM 8560  H HD1  . PHE A 1 76  ? -6.947  -8.534  0.045   1.00 0.00 ? 76  PHE A HD1  5  
ATOM 8561  H HD2  . PHE A 1 76  ? -8.970  -7.105  -3.417  1.00 0.00 ? 76  PHE A HD2  5  
ATOM 8562  H HE1  . PHE A 1 76  ? -5.505  -9.936  -1.372  1.00 0.00 ? 76  PHE A HE1  5  
ATOM 8563  H HE2  . PHE A 1 76  ? -7.532  -8.506  -4.839  1.00 0.00 ? 76  PHE A HE2  5  
ATOM 8564  H HZ   . PHE A 1 76  ? -5.798  -9.924  -3.818  1.00 0.00 ? 76  PHE A HZ   5  
ATOM 8565  N N    . MET A 1 77  ? -9.882  -6.882  2.438   1.00 0.00 ? 77  MET A N    5  
ATOM 8566  C CA   . MET A 1 77  ? -10.326 -6.088  3.577   1.00 0.00 ? 77  MET A CA   5  
ATOM 8567  C C    . MET A 1 77  ? -9.335  -4.969  3.880   1.00 0.00 ? 77  MET A C    5  
ATOM 8568  O O    . MET A 1 77  ? -8.147  -5.218  4.082   1.00 0.00 ? 77  MET A O    5  
ATOM 8569  C CB   . MET A 1 77  ? -10.501 -6.978  4.809   1.00 0.00 ? 77  MET A CB   5  
ATOM 8570  C CG   . MET A 1 77  ? -11.890 -7.585  4.928   1.00 0.00 ? 77  MET A CG   5  
ATOM 8571  S SD   . MET A 1 77  ? -11.980 -8.871  6.190   1.00 0.00 ? 77  MET A SD   5  
ATOM 8572  C CE   . MET A 1 77  ? -11.197 -8.044  7.572   1.00 0.00 ? 77  MET A CE   5  
ATOM 8573  H H    . MET A 1 77  ? -9.129  -7.500  2.551   1.00 0.00 ? 77  MET A H    5  
ATOM 8574  H HA   . MET A 1 77  ? -11.280 -5.650  3.323   1.00 0.00 ? 77  MET A HA   5  
ATOM 8575  H HB2  . MET A 1 77  ? -9.783  -7.783  4.762   1.00 0.00 ? 77  MET A HB2  5  
ATOM 8576  H HB3  . MET A 1 77  ? -10.312 -6.389  5.694   1.00 0.00 ? 77  MET A HB3  5  
ATOM 8577  H HG2  . MET A 1 77  ? -12.590 -6.803  5.182   1.00 0.00 ? 77  MET A HG2  5  
ATOM 8578  H HG3  . MET A 1 77  ? -12.162 -8.015  3.976   1.00 0.00 ? 77  MET A HG3  5  
ATOM 8579  H HE1  . MET A 1 77  ? -10.129 -8.007  7.413   1.00 0.00 ? 77  MET A HE1  5  
ATOM 8580  H HE2  . MET A 1 77  ? -11.583 -7.039  7.656   1.00 0.00 ? 77  MET A HE2  5  
ATOM 8581  H HE3  . MET A 1 77  ? -11.406 -8.588  8.482   1.00 0.00 ? 77  MET A HE3  5  
ATOM 8582  N N    . MET A 1 78  ? -9.832  -3.737  3.910   1.00 0.00 ? 78  MET A N    5  
ATOM 8583  C CA   . MET A 1 78  ? -8.988  -2.580  4.189   1.00 0.00 ? 78  MET A CA   5  
ATOM 8584  C C    . MET A 1 78  ? -9.506  -1.810  5.401   1.00 0.00 ? 78  MET A C    5  
ATOM 8585  O O    . MET A 1 78  ? -10.366 -0.940  5.274   1.00 0.00 ? 78  MET A O    5  
ATOM 8586  C CB   . MET A 1 78  ? -8.931  -1.658  2.971   1.00 0.00 ? 78  MET A CB   5  
ATOM 8587  C CG   . MET A 1 78  ? -7.854  -0.589  3.067   1.00 0.00 ? 78  MET A CG   5  
ATOM 8588  S SD   . MET A 1 78  ? -7.494  0.180   1.476   1.00 0.00 ? 78  MET A SD   5  
ATOM 8589  C CE   . MET A 1 78  ? -7.145  1.862   1.985   1.00 0.00 ? 78  MET A CE   5  
ATOM 8590  H H    . MET A 1 78  ? -10.787 -3.601  3.741   1.00 0.00 ? 78  MET A H    5  
ATOM 8591  H HA   . MET A 1 78  ? -7.993  -2.940  4.404   1.00 0.00 ? 78  MET A HA   5  
ATOM 8592  H HB2  . MET A 1 78  ? -8.739  -2.254  2.091   1.00 0.00 ? 78  MET A HB2  5  
ATOM 8593  H HB3  . MET A 1 78  ? -9.886  -1.166  2.860   1.00 0.00 ? 78  MET A HB3  5  
ATOM 8594  H HG2  . MET A 1 78  ? -8.184  0.176   3.754   1.00 0.00 ? 78  MET A HG2  5  
ATOM 8595  H HG3  . MET A 1 78  ? -6.950  -1.043  3.445   1.00 0.00 ? 78  MET A HG3  5  
ATOM 8596  H HE1  . MET A 1 78  ? -6.211  2.183   1.549   1.00 0.00 ? 78  MET A HE1  5  
ATOM 8597  H HE2  . MET A 1 78  ? -7.941  2.511   1.650   1.00 0.00 ? 78  MET A HE2  5  
ATOM 8598  H HE3  . MET A 1 78  ? -7.073  1.904   3.062   1.00 0.00 ? 78  MET A HE3  5  
ATOM 8599  N N    . GLY A 1 79  ? -8.975  -2.138  6.575   1.00 0.00 ? 79  GLY A N    5  
ATOM 8600  C CA   . GLY A 1 79  ? -9.396  -1.468  7.792   1.00 0.00 ? 79  GLY A CA   5  
ATOM 8601  C C    . GLY A 1 79  ? -10.537 -2.186  8.484   1.00 0.00 ? 79  GLY A C    5  
ATOM 8602  O O    . GLY A 1 79  ? -10.390 -2.657  9.612   1.00 0.00 ? 79  GLY A O    5  
ATOM 8603  H H    . GLY A 1 79  ? -8.292  -2.840  6.616   1.00 0.00 ? 79  GLY A H    5  
ATOM 8604  H HA2  . GLY A 1 79  ? -8.556  -1.411  8.468   1.00 0.00 ? 79  GLY A HA2  5  
ATOM 8605  H HA3  . GLY A 1 79  ? -9.715  -0.465  7.545   1.00 0.00 ? 79  GLY A HA3  5  
ATOM 8606  N N    . GLY A 1 80  ? -11.679 -2.271  7.809   1.00 0.00 ? 80  GLY A N    5  
ATOM 8607  C CA   . GLY A 1 80  ? -12.833 -2.937  8.383   1.00 0.00 ? 80  GLY A CA   5  
ATOM 8608  C C    . GLY A 1 80  ? -14.004 -2.999  7.422   1.00 0.00 ? 80  GLY A C    5  
ATOM 8609  O O    . GLY A 1 80  ? -15.160 -3.034  7.844   1.00 0.00 ? 80  GLY A O    5  
ATOM 8610  H H    . GLY A 1 80  ? -11.738 -1.877  6.913   1.00 0.00 ? 80  GLY A H    5  
ATOM 8611  H HA2  . GLY A 1 80  ? -12.554 -3.942  8.660   1.00 0.00 ? 80  GLY A HA2  5  
ATOM 8612  H HA3  . GLY A 1 80  ? -13.139 -2.402  9.270   1.00 0.00 ? 80  GLY A HA3  5  
ATOM 8613  N N    . ARG A 1 81  ? -13.705 -3.013  6.127   1.00 0.00 ? 81  ARG A N    5  
ATOM 8614  C CA   . ARG A 1 81  ? -14.742 -3.068  5.104   1.00 0.00 ? 81  ARG A CA   5  
ATOM 8615  C C    . ARG A 1 81  ? -14.500 -4.232  4.147   1.00 0.00 ? 81  ARG A C    5  
ATOM 8616  O O    . ARG A 1 81  ? -13.493 -4.934  4.250   1.00 0.00 ? 81  ARG A O    5  
ATOM 8617  C CB   . ARG A 1 81  ? -14.789 -1.754  4.323   1.00 0.00 ? 81  ARG A CB   5  
ATOM 8618  C CG   . ARG A 1 81  ? -15.282 -0.574  5.145   1.00 0.00 ? 81  ARG A CG   5  
ATOM 8619  C CD   . ARG A 1 81  ? -16.798 -0.467  5.112   1.00 0.00 ? 81  ARG A CD   5  
ATOM 8620  N NE   . ARG A 1 81  ? -17.264 0.846   5.549   1.00 0.00 ? 81  ARG A NE   5  
ATOM 8621  C CZ   . ARG A 1 81  ? -18.542 1.207   5.558   1.00 0.00 ? 81  ARG A CZ   5  
ATOM 8622  N NH1  . ARG A 1 81  ? -19.478 0.357   5.157   1.00 0.00 ? 81  ARG A NH1  5  
ATOM 8623  N NH2  . ARG A 1 81  ? -18.888 2.420   5.970   1.00 0.00 ? 81  ARG A NH2  5  
ATOM 8624  H H    . ARG A 1 81  ? -12.764 -2.983  5.853   1.00 0.00 ? 81  ARG A H    5  
ATOM 8625  H HA   . ARG A 1 81  ? -15.689 -3.216  5.600   1.00 0.00 ? 81  ARG A HA   5  
ATOM 8626  H HB2  . ARG A 1 81  ? -13.795 -1.525  3.966   1.00 0.00 ? 81  ARG A HB2  5  
ATOM 8627  H HB3  . ARG A 1 81  ? -15.448 -1.875  3.477   1.00 0.00 ? 81  ARG A HB3  5  
ATOM 8628  H HG2  . ARG A 1 81  ? -14.964 -0.703  6.170   1.00 0.00 ? 81  ARG A HG2  5  
ATOM 8629  H HG3  . ARG A 1 81  ? -14.856 0.334   4.746   1.00 0.00 ? 81  ARG A HG3  5  
ATOM 8630  H HD2  . ARG A 1 81  ? -17.136 -0.640  4.101   1.00 0.00 ? 81  ARG A HD2  5  
ATOM 8631  H HD3  . ARG A 1 81  ? -17.213 -1.221  5.763   1.00 0.00 ? 81  ARG A HD3  5  
ATOM 8632  H HE   . ARG A 1 81  ? -16.590 1.490   5.850   1.00 0.00 ? 81  ARG A HE   5  
ATOM 8633  H HH11 . ARG A 1 81  ? -19.220 -0.558  4.847   1.00 0.00 ? 81  ARG A HH11 5  
ATOM 8634  H HH12 . ARG A 1 81  ? -20.440 0.631   5.166   1.00 0.00 ? 81  ARG A HH12 5  
ATOM 8635  H HH21 . ARG A 1 81  ? -18.186 3.064   6.274   1.00 0.00 ? 81  ARG A HH21 5  
ATOM 8636  H HH22 . ARG A 1 81  ? -19.850 2.691   5.977   1.00 0.00 ? 81  ARG A HH22 5  
ATOM 8637  N N    . TYR A 1 82  ? -15.429 -4.431  3.219   1.00 0.00 ? 82  TYR A N    5  
ATOM 8638  C CA   . TYR A 1 82  ? -15.318 -5.511  2.246   1.00 0.00 ? 82  TYR A CA   5  
ATOM 8639  C C    . TYR A 1 82  ? -15.561 -4.997  0.831   1.00 0.00 ? 82  TYR A C    5  
ATOM 8640  O O    . TYR A 1 82  ? -16.631 -4.469  0.525   1.00 0.00 ? 82  TYR A O    5  
ATOM 8641  C CB   . TYR A 1 82  ? -16.313 -6.625  2.574   1.00 0.00 ? 82  TYR A CB   5  
ATOM 8642  C CG   . TYR A 1 82  ? -16.406 -6.939  4.050   1.00 0.00 ? 82  TYR A CG   5  
ATOM 8643  C CD1  . TYR A 1 82  ? -15.334 -7.505  4.729   1.00 0.00 ? 82  TYR A CD1  5  
ATOM 8644  C CD2  . TYR A 1 82  ? -17.566 -6.670  4.766   1.00 0.00 ? 82  TYR A CD2  5  
ATOM 8645  C CE1  . TYR A 1 82  ? -15.415 -7.794  6.078   1.00 0.00 ? 82  TYR A CE1  5  
ATOM 8646  C CE2  . TYR A 1 82  ? -17.655 -6.954  6.115   1.00 0.00 ? 82  TYR A CE2  5  
ATOM 8647  C CZ   . TYR A 1 82  ? -16.577 -7.517  6.766   1.00 0.00 ? 82  TYR A CZ   5  
ATOM 8648  O OH   . TYR A 1 82  ? -16.662 -7.803  8.110   1.00 0.00 ? 82  TYR A OH   5  
ATOM 8649  H H    . TYR A 1 82  ? -16.208 -3.838  3.188   1.00 0.00 ? 82  TYR A H    5  
ATOM 8650  H HA   . TYR A 1 82  ? -14.315 -5.909  2.305   1.00 0.00 ? 82  TYR A HA   5  
ATOM 8651  H HB2  . TYR A 1 82  ? -17.295 -6.332  2.236   1.00 0.00 ? 82  TYR A HB2  5  
ATOM 8652  H HB3  . TYR A 1 82  ? -16.015 -7.528  2.061   1.00 0.00 ? 82  TYR A HB3  5  
ATOM 8653  H HD1  . TYR A 1 82  ? -14.425 -7.722  4.187   1.00 0.00 ? 82  TYR A HD1  5  
ATOM 8654  H HD2  . TYR A 1 82  ? -18.409 -6.230  4.253   1.00 0.00 ? 82  TYR A HD2  5  
ATOM 8655  H HE1  . TYR A 1 82  ? -14.571 -8.235  6.588   1.00 0.00 ? 82  TYR A HE1  5  
ATOM 8656  H HE2  . TYR A 1 82  ? -18.565 -6.738  6.655   1.00 0.00 ? 82  TYR A HE2  5  
ATOM 8657  H HH   . TYR A 1 82  ? -17.105 -7.082  8.563   1.00 0.00 ? 82  TYR A HH   5  
ATOM 8658  N N    . TYR A 1 83  ? -14.562 -5.156  -0.029  1.00 0.00 ? 83  TYR A N    5  
ATOM 8659  C CA   . TYR A 1 83  ? -14.665 -4.706  -1.412  1.00 0.00 ? 83  TYR A CA   5  
ATOM 8660  C C    . TYR A 1 83  ? -14.499 -5.875  -2.379  1.00 0.00 ? 83  TYR A C    5  
ATOM 8661  O O    . TYR A 1 83  ? -13.946 -6.915  -2.024  1.00 0.00 ? 83  TYR A O    5  
ATOM 8662  C CB   . TYR A 1 83  ? -13.611 -3.637  -1.703  1.00 0.00 ? 83  TYR A CB   5  
ATOM 8663  C CG   . TYR A 1 83  ? -13.750 -2.400  -0.844  1.00 0.00 ? 83  TYR A CG   5  
ATOM 8664  C CD1  . TYR A 1 83  ? -13.200 -2.351  0.431   1.00 0.00 ? 83  TYR A CD1  5  
ATOM 8665  C CD2  . TYR A 1 83  ? -14.432 -1.282  -1.308  1.00 0.00 ? 83  TYR A CD2  5  
ATOM 8666  C CE1  . TYR A 1 83  ? -13.325 -1.223  1.219   1.00 0.00 ? 83  TYR A CE1  5  
ATOM 8667  C CE2  . TYR A 1 83  ? -14.561 -0.150  -0.527  1.00 0.00 ? 83  TYR A CE2  5  
ATOM 8668  C CZ   . TYR A 1 83  ? -14.006 -0.125  0.736   1.00 0.00 ? 83  TYR A CZ   5  
ATOM 8669  O OH   . TYR A 1 83  ? -14.133 1.000   1.518   1.00 0.00 ? 83  TYR A OH   5  
ATOM 8670  H H    . TYR A 1 83  ? -13.734 -5.584  0.273   1.00 0.00 ? 83  TYR A H    5  
ATOM 8671  H HA   . TYR A 1 83  ? -15.646 -4.277  -1.549  1.00 0.00 ? 83  TYR A HA   5  
ATOM 8672  H HB2  . TYR A 1 83  ? -12.630 -4.051  -1.530  1.00 0.00 ? 83  TYR A HB2  5  
ATOM 8673  H HB3  . TYR A 1 83  ? -13.691 -3.334  -2.737  1.00 0.00 ? 83  TYR A HB3  5  
ATOM 8674  H HD1  . TYR A 1 83  ? -12.668 -3.212  0.807   1.00 0.00 ? 83  TYR A HD1  5  
ATOM 8675  H HD2  . TYR A 1 83  ? -14.865 -1.304  -2.297  1.00 0.00 ? 83  TYR A HD2  5  
ATOM 8676  H HE1  . TYR A 1 83  ? -12.891 -1.204  2.208   1.00 0.00 ? 83  TYR A HE1  5  
ATOM 8677  H HE2  . TYR A 1 83  ? -15.094 0.710   -0.905  1.00 0.00 ? 83  TYR A HE2  5  
ATOM 8678  H HH   . TYR A 1 83  ? -14.063 1.783   0.966   1.00 0.00 ? 83  TYR A HH   5  
ATOM 8679  N N    . ASN A 1 84  ? -14.984 -5.695  -3.603  1.00 0.00 ? 84  ASN A N    5  
ATOM 8680  C CA   . ASN A 1 84  ? -14.891 -6.734  -4.622  1.00 0.00 ? 84  ASN A CA   5  
ATOM 8681  C C    . ASN A 1 84  ? -13.434 -7.038  -4.958  1.00 0.00 ? 84  ASN A C    5  
ATOM 8682  O O    . ASN A 1 84  ? -13.015 -8.195  -4.961  1.00 0.00 ? 84  ASN A O    5  
ATOM 8683  C CB   . ASN A 1 84  ? -15.639 -6.306  -5.887  1.00 0.00 ? 84  ASN A CB   5  
ATOM 8684  C CG   . ASN A 1 84  ? -15.721 -7.418  -6.915  1.00 0.00 ? 84  ASN A CG   5  
ATOM 8685  O OD1  . ASN A 1 84  ? -15.899 -8.586  -6.569  1.00 0.00 ? 84  ASN A OD1  5  
ATOM 8686  N ND2  . ASN A 1 84  ? -15.591 -7.059  -8.186  1.00 0.00 ? 84  ASN A ND2  5  
ATOM 8687  H H    . ASN A 1 84  ? -15.415 -4.844  -3.827  1.00 0.00 ? 84  ASN A H    5  
ATOM 8688  H HA   . ASN A 1 84  ? -15.351 -7.628  -4.228  1.00 0.00 ? 84  ASN A HA   5  
ATOM 8689  H HB2  . ASN A 1 84  ? -16.644 -6.013  -5.621  1.00 0.00 ? 84  ASN A HB2  5  
ATOM 8690  H HB3  . ASN A 1 84  ? -15.129 -5.465  -6.332  1.00 0.00 ? 84  ASN A HB3  5  
ATOM 8691  H HD21 . ASN A 1 84  ? -15.451 -6.110  -8.388  1.00 0.00 ? 84  ASN A HD21 5  
ATOM 8692  H HD22 . ASN A 1 84  ? -15.640 -7.758  -8.872  1.00 0.00 ? 84  ASN A HD22 5  
ATOM 8693  N N    . SER A 1 85  ? -12.667 -5.989  -5.240  1.00 0.00 ? 85  SER A N    5  
ATOM 8694  C CA   . SER A 1 85  ? -11.257 -6.143  -5.580  1.00 0.00 ? 85  SER A CA   5  
ATOM 8695  C C    . SER A 1 85  ? -10.507 -4.828  -5.395  1.00 0.00 ? 85  SER A C    5  
ATOM 8696  O O    . SER A 1 85  ? -11.117 -3.770  -5.233  1.00 0.00 ? 85  SER A O    5  
ATOM 8697  C CB   . SER A 1 85  ? -11.109 -6.628  -7.024  1.00 0.00 ? 85  SER A CB   5  
ATOM 8698  O OG   . SER A 1 85  ? -11.804 -7.846  -7.226  1.00 0.00 ? 85  SER A OG   5  
ATOM 8699  H H    . SER A 1 85  ? -13.059 -5.091  -5.221  1.00 0.00 ? 85  SER A H    5  
ATOM 8700  H HA   . SER A 1 85  ? -10.834 -6.882  -4.916  1.00 0.00 ? 85  SER A HA   5  
ATOM 8701  H HB2  . SER A 1 85  ? -11.510 -5.884  -7.694  1.00 0.00 ? 85  SER A HB2  5  
ATOM 8702  H HB3  . SER A 1 85  ? -10.062 -6.784  -7.243  1.00 0.00 ? 85  SER A HB3  5  
ATOM 8703  H HG   . SER A 1 85  ? -12.119 -7.889  -8.132  1.00 0.00 ? 85  SER A HG   5  
ATOM 8704  N N    . ILE A 1 86  ? -9.180  -4.902  -5.419  1.00 0.00 ? 86  ILE A N    5  
ATOM 8705  C CA   . ILE A 1 86  ? -8.346  -3.718  -5.254  1.00 0.00 ? 86  ILE A CA   5  
ATOM 8706  C C    . ILE A 1 86  ? -8.820  -2.583  -6.155  1.00 0.00 ? 86  ILE A C    5  
ATOM 8707  O O    . ILE A 1 86  ? -9.187  -1.510  -5.678  1.00 0.00 ? 86  ILE A O    5  
ATOM 8708  C CB   . ILE A 1 86  ? -6.869  -4.023  -5.565  1.00 0.00 ? 86  ILE A CB   5  
ATOM 8709  C CG1  . ILE A 1 86  ? -6.307  -5.020  -4.550  1.00 0.00 ? 86  ILE A CG1  5  
ATOM 8710  C CG2  . ILE A 1 86  ? -6.052  -2.740  -5.563  1.00 0.00 ? 86  ILE A CG2  5  
ATOM 8711  C CD1  . ILE A 1 86  ? -4.873  -5.417  -4.823  1.00 0.00 ? 86  ILE A CD1  5  
ATOM 8712  H H    . ILE A 1 86  ? -8.753  -5.774  -5.551  1.00 0.00 ? 86  ILE A H    5  
ATOM 8713  H HA   . ILE A 1 86  ? -8.418  -3.401  -4.224  1.00 0.00 ? 86  ILE A HA   5  
ATOM 8714  H HB   . ILE A 1 86  ? -6.813  -4.455  -6.552  1.00 0.00 ? 86  ILE A HB   5  
ATOM 8715  H HG12 . ILE A 1 86  ? -6.347  -4.583  -3.565  1.00 0.00 ? 86  ILE A HG12 5  
ATOM 8716  H HG13 . ILE A 1 86  ? -6.909  -5.917  -4.567  1.00 0.00 ? 86  ILE A HG13 5  
ATOM 8717  H HG21 . ILE A 1 86  ? -6.493  -2.033  -4.876  1.00 0.00 ? 86  ILE A HG21 5  
ATOM 8718  H HG22 . ILE A 1 86  ? -5.041  -2.958  -5.254  1.00 0.00 ? 86  ILE A HG22 5  
ATOM 8719  H HG23 . ILE A 1 86  ? -6.042  -2.318  -6.557  1.00 0.00 ? 86  ILE A HG23 5  
ATOM 8720  H HD11 . ILE A 1 86  ? -4.260  -5.165  -3.970  1.00 0.00 ? 86  ILE A HD11 5  
ATOM 8721  H HD12 . ILE A 1 86  ? -4.821  -6.480  -5.004  1.00 0.00 ? 86  ILE A HD12 5  
ATOM 8722  H HD13 . ILE A 1 86  ? -4.512  -4.886  -5.692  1.00 0.00 ? 86  ILE A HD13 5  
ATOM 8723  N N    . GLY A 1 87  ? -8.809  -2.827  -7.462  1.00 0.00 ? 87  GLY A N    5  
ATOM 8724  C CA   . GLY A 1 87  ? -9.242  -1.817  -8.409  1.00 0.00 ? 87  GLY A CA   5  
ATOM 8725  C C    . GLY A 1 87  ? -10.422 -1.012  -7.901  1.00 0.00 ? 87  GLY A C    5  
ATOM 8726  O O    . GLY A 1 87  ? -10.446 0.212   -8.025  1.00 0.00 ? 87  GLY A O    5  
ATOM 8727  H H    . GLY A 1 87  ? -8.506  -3.701  -7.785  1.00 0.00 ? 87  GLY A H    5  
ATOM 8728  H HA2  . GLY A 1 87  ? -8.419  -1.145  -8.604  1.00 0.00 ? 87  GLY A HA2  5  
ATOM 8729  H HA3  . GLY A 1 87  ? -9.523  -2.302  -9.332  1.00 0.00 ? 87  GLY A HA3  5  
ATOM 8730  N N    . ASP A 1 88  ? -11.402 -1.701  -7.328  1.00 0.00 ? 88  ASP A N    5  
ATOM 8731  C CA   . ASP A 1 88  ? -12.591 -1.043  -6.799  1.00 0.00 ? 88  ASP A CA   5  
ATOM 8732  C C    . ASP A 1 88  ? -12.227 -0.093  -5.662  1.00 0.00 ? 88  ASP A C    5  
ATOM 8733  O O    . ASP A 1 88  ? -12.514 1.102   -5.723  1.00 0.00 ? 88  ASP A O    5  
ATOM 8734  C CB   . ASP A 1 88  ? -13.600 -2.083  -6.308  1.00 0.00 ? 88  ASP A CB   5  
ATOM 8735  C CG   . ASP A 1 88  ? -14.882 -1.452  -5.801  1.00 0.00 ? 88  ASP A CG   5  
ATOM 8736  O OD1  . ASP A 1 88  ? -14.862 -0.879  -4.692  1.00 0.00 ? 88  ASP A OD1  5  
ATOM 8737  O OD2  . ASP A 1 88  ? -15.905 -1.531  -6.514  1.00 0.00 ? 88  ASP A OD2  5  
ATOM 8738  H H    . ASP A 1 88  ? -11.324 -2.676  -7.258  1.00 0.00 ? 88  ASP A H    5  
ATOM 8739  H HA   . ASP A 1 88  ? -13.038 -0.472  -7.599  1.00 0.00 ? 88  ASP A HA   5  
ATOM 8740  H HB2  . ASP A 1 88  ? -13.846 -2.749  -7.123  1.00 0.00 ? 88  ASP A HB2  5  
ATOM 8741  H HB3  . ASP A 1 88  ? -13.157 -2.652  -5.504  1.00 0.00 ? 88  ASP A HB3  5  
ATOM 8742  N N    . ILE A 1 89  ? -11.594 -0.634  -4.627  1.00 0.00 ? 89  ILE A N    5  
ATOM 8743  C CA   . ILE A 1 89  ? -11.191 0.165   -3.476  1.00 0.00 ? 89  ILE A CA   5  
ATOM 8744  C C    . ILE A 1 89  ? -10.776 1.570   -3.901  1.00 0.00 ? 89  ILE A C    5  
ATOM 8745  O O    . ILE A 1 89  ? -11.170 2.558   -3.282  1.00 0.00 ? 89  ILE A O    5  
ATOM 8746  C CB   . ILE A 1 89  ? -10.026 -0.493  -2.714  1.00 0.00 ? 89  ILE A CB   5  
ATOM 8747  C CG1  . ILE A 1 89  ? -10.493 -1.788  -2.045  1.00 0.00 ? 89  ILE A CG1  5  
ATOM 8748  C CG2  . ILE A 1 89  ? -9.459  0.468   -1.680  1.00 0.00 ? 89  ILE A CG2  5  
ATOM 8749  C CD1  . ILE A 1 89  ? -9.358  -2.707  -1.649  1.00 0.00 ? 89  ILE A CD1  5  
ATOM 8750  H H    . ILE A 1 89  ? -11.393 -1.593  -4.636  1.00 0.00 ? 89  ILE A H    5  
ATOM 8751  H HA   . ILE A 1 89  ? -12.037 0.238   -2.808  1.00 0.00 ? 89  ILE A HA   5  
ATOM 8752  H HB   . ILE A 1 89  ? -9.246  -0.724  -3.422  1.00 0.00 ? 89  ILE A HB   5  
ATOM 8753  H HG12 . ILE A 1 89  ? -11.048 -1.545  -1.153  1.00 0.00 ? 89  ILE A HG12 5  
ATOM 8754  H HG13 . ILE A 1 89  ? -11.134 -2.326  -2.728  1.00 0.00 ? 89  ILE A HG13 5  
ATOM 8755  H HG21 . ILE A 1 89  ? -10.135 1.301   -1.554  1.00 0.00 ? 89  ILE A HG21 5  
ATOM 8756  H HG22 . ILE A 1 89  ? -9.341  -0.045  -0.738  1.00 0.00 ? 89  ILE A HG22 5  
ATOM 8757  H HG23 . ILE A 1 89  ? -8.499  0.832   -2.015  1.00 0.00 ? 89  ILE A HG23 5  
ATOM 8758  H HD11 . ILE A 1 89  ? -9.608  -3.723  -1.916  1.00 0.00 ? 89  ILE A HD11 5  
ATOM 8759  H HD12 . ILE A 1 89  ? -8.457  -2.409  -2.164  1.00 0.00 ? 89  ILE A HD12 5  
ATOM 8760  H HD13 . ILE A 1 89  ? -9.200  -2.645  -0.582  1.00 0.00 ? 89  ILE A HD13 5  
ATOM 8761  N N    . ILE A 1 90  ? -9.980  1.650   -4.962  1.00 0.00 ? 90  ILE A N    5  
ATOM 8762  C CA   . ILE A 1 90  ? -9.514  2.934   -5.472  1.00 0.00 ? 90  ILE A CA   5  
ATOM 8763  C C    . ILE A 1 90  ? -10.686 3.828   -5.862  1.00 0.00 ? 90  ILE A C    5  
ATOM 8764  O O    . ILE A 1 90  ? -10.851 4.923   -5.323  1.00 0.00 ? 90  ILE A O    5  
ATOM 8765  C CB   . ILE A 1 90  ? -8.591  2.754   -6.692  1.00 0.00 ? 90  ILE A CB   5  
ATOM 8766  C CG1  . ILE A 1 90  ? -7.277  2.093   -6.271  1.00 0.00 ? 90  ILE A CG1  5  
ATOM 8767  C CG2  . ILE A 1 90  ? -8.327  4.096   -7.358  1.00 0.00 ? 90  ILE A CG2  5  
ATOM 8768  C CD1  . ILE A 1 90  ? -7.325  0.581   -6.298  1.00 0.00 ? 90  ILE A CD1  5  
ATOM 8769  H H    . ILE A 1 90  ? -9.700  0.826   -5.413  1.00 0.00 ? 90  ILE A H    5  
ATOM 8770  H HA   . ILE A 1 90  ? -8.951  3.419   -4.688  1.00 0.00 ? 90  ILE A HA   5  
ATOM 8771  H HB   . ILE A 1 90  ? -9.094  2.118   -7.405  1.00 0.00 ? 90  ILE A HB   5  
ATOM 8772  H HG12 . ILE A 1 90  ? -6.492  2.411   -6.939  1.00 0.00 ? 90  ILE A HG12 5  
ATOM 8773  H HG13 . ILE A 1 90  ? -7.034  2.401   -5.265  1.00 0.00 ? 90  ILE A HG13 5  
ATOM 8774  H HG21 . ILE A 1 90  ? -7.849  4.760   -6.653  1.00 0.00 ? 90  ILE A HG21 5  
ATOM 8775  H HG22 . ILE A 1 90  ? -7.680  3.952   -8.211  1.00 0.00 ? 90  ILE A HG22 5  
ATOM 8776  H HG23 . ILE A 1 90  ? -9.261  4.527   -7.683  1.00 0.00 ? 90  ILE A HG23 5  
ATOM 8777  H HD11 . ILE A 1 90  ? -7.174  0.199   -5.299  1.00 0.00 ? 90  ILE A HD11 5  
ATOM 8778  H HD12 . ILE A 1 90  ? -8.286  0.258   -6.668  1.00 0.00 ? 90  ILE A HD12 5  
ATOM 8779  H HD13 . ILE A 1 90  ? -6.545  0.208   -6.947  1.00 0.00 ? 90  ILE A HD13 5  
ATOM 8780  N N    . ASP A 1 91  ? -11.497 3.354   -6.801  1.00 0.00 ? 91  ASP A N    5  
ATOM 8781  C CA   . ASP A 1 91  ? -12.657 4.109   -7.262  1.00 0.00 ? 91  ASP A CA   5  
ATOM 8782  C C    . ASP A 1 91  ? -13.542 4.516   -6.089  1.00 0.00 ? 91  ASP A C    5  
ATOM 8783  O O    . ASP A 1 91  ? -13.830 5.698   -5.895  1.00 0.00 ? 91  ASP A O    5  
ATOM 8784  C CB   . ASP A 1 91  ? -13.465 3.283   -8.264  1.00 0.00 ? 91  ASP A CB   5  
ATOM 8785  C CG   . ASP A 1 91  ? -12.623 2.800   -9.429  1.00 0.00 ? 91  ASP A CG   5  
ATOM 8786  O OD1  . ASP A 1 91  ? -12.074 3.653   -10.159 1.00 0.00 ? 91  ASP A OD1  5  
ATOM 8787  O OD2  . ASP A 1 91  ? -12.511 1.570   -9.610  1.00 0.00 ? 91  ASP A OD2  5  
ATOM 8788  H H    . ASP A 1 91  ? -11.313 2.474   -7.193  1.00 0.00 ? 91  ASP A H    5  
ATOM 8789  H HA   . ASP A 1 91  ? -12.298 5.001   -7.752  1.00 0.00 ? 91  ASP A HA   5  
ATOM 8790  H HB2  . ASP A 1 91  ? -13.877 2.421   -7.761  1.00 0.00 ? 91  ASP A HB2  5  
ATOM 8791  H HB3  . ASP A 1 91  ? -14.271 3.888   -8.652  1.00 0.00 ? 91  ASP A HB3  5  
ATOM 8792  N N    . HIS A 1 92  ? -13.972 3.530   -5.308  1.00 0.00 ? 92  HIS A N    5  
ATOM 8793  C CA   . HIS A 1 92  ? -14.825 3.785   -4.153  1.00 0.00 ? 92  HIS A CA   5  
ATOM 8794  C C    . HIS A 1 92  ? -14.264 4.920   -3.303  1.00 0.00 ? 92  HIS A C    5  
ATOM 8795  O O    . HIS A 1 92  ? -15.013 5.665   -2.671  1.00 0.00 ? 92  HIS A O    5  
ATOM 8796  C CB   . HIS A 1 92  ? -14.966 2.520   -3.306  1.00 0.00 ? 92  HIS A CB   5  
ATOM 8797  C CG   . HIS A 1 92  ? -16.191 2.508   -2.446  1.00 0.00 ? 92  HIS A CG   5  
ATOM 8798  N ND1  . HIS A 1 92  ? -16.160 2.745   -1.088  1.00 0.00 ? 92  HIS A ND1  5  
ATOM 8799  C CD2  . HIS A 1 92  ? -17.490 2.287   -2.758  1.00 0.00 ? 92  HIS A CD2  5  
ATOM 8800  C CE1  . HIS A 1 92  ? -17.386 2.668   -0.601  1.00 0.00 ? 92  HIS A CE1  5  
ATOM 8801  N NE2  . HIS A 1 92  ? -18.212 2.392   -1.594  1.00 0.00 ? 92  HIS A NE2  5  
ATOM 8802  H H    . HIS A 1 92  ? -13.708 2.608   -5.513  1.00 0.00 ? 92  HIS A H    5  
ATOM 8803  H HA   . HIS A 1 92  ? -15.799 4.073   -4.518  1.00 0.00 ? 92  HIS A HA   5  
ATOM 8804  H HB2  . HIS A 1 92  ? -15.011 1.661   -3.960  1.00 0.00 ? 92  HIS A HB2  5  
ATOM 8805  H HB3  . HIS A 1 92  ? -14.104 2.429   -2.660  1.00 0.00 ? 92  HIS A HB3  5  
ATOM 8806  H HD1  . HIS A 1 92  ? -15.358 2.938   -0.559  1.00 0.00 ? 92  HIS A HD1  5  
ATOM 8807  H HD2  . HIS A 1 92  ? -17.886 2.068   -3.740  1.00 0.00 ? 92  HIS A HD2  5  
ATOM 8808  H HE1  . HIS A 1 92  ? -17.666 2.809   0.432   1.00 0.00 ? 92  HIS A HE1  5  
ATOM 8809  N N    . TYR A 1 93  ? -12.941 5.046   -3.292  1.00 0.00 ? 93  TYR A N    5  
ATOM 8810  C CA   . TYR A 1 93  ? -12.279 6.089   -2.517  1.00 0.00 ? 93  TYR A CA   5  
ATOM 8811  C C    . TYR A 1 93  ? -12.311 7.422   -3.258  1.00 0.00 ? 93  TYR A C    5  
ATOM 8812  O O    . TYR A 1 93  ? -12.503 8.477   -2.653  1.00 0.00 ? 93  TYR A O    5  
ATOM 8813  C CB   . TYR A 1 93  ? -10.832 5.692   -2.221  1.00 0.00 ? 93  TYR A CB   5  
ATOM 8814  C CG   . TYR A 1 93  ? -10.674 4.877   -0.957  1.00 0.00 ? 93  TYR A CG   5  
ATOM 8815  C CD1  . TYR A 1 93  ? -11.232 5.303   0.242   1.00 0.00 ? 93  TYR A CD1  5  
ATOM 8816  C CD2  . TYR A 1 93  ? -9.968  3.681   -0.962  1.00 0.00 ? 93  TYR A CD2  5  
ATOM 8817  C CE1  . TYR A 1 93  ? -11.090 4.563   1.400   1.00 0.00 ? 93  TYR A CE1  5  
ATOM 8818  C CE2  . TYR A 1 93  ? -9.822  2.932   0.190   1.00 0.00 ? 93  TYR A CE2  5  
ATOM 8819  C CZ   . TYR A 1 93  ? -10.384 3.378   1.369   1.00 0.00 ? 93  TYR A CZ   5  
ATOM 8820  O OH   . TYR A 1 93  ? -10.241 2.636   2.519   1.00 0.00 ? 93  TYR A OH   5  
ATOM 8821  H H    . TYR A 1 93  ? -12.397 4.422   -3.816  1.00 0.00 ? 93  TYR A H    5  
ATOM 8822  H HA   . TYR A 1 93  ? -12.811 6.196   -1.583  1.00 0.00 ? 93  TYR A HA   5  
ATOM 8823  H HB2  . TYR A 1 93  ? -10.451 5.105   -3.042  1.00 0.00 ? 93  TYR A HB2  5  
ATOM 8824  H HB3  . TYR A 1 93  ? -10.235 6.586   -2.116  1.00 0.00 ? 93  TYR A HB3  5  
ATOM 8825  H HD1  . TYR A 1 93  ? -11.785 6.232   0.263   1.00 0.00 ? 93  TYR A HD1  5  
ATOM 8826  H HD2  . TYR A 1 93  ? -9.529  3.334   -1.886  1.00 0.00 ? 93  TYR A HD2  5  
ATOM 8827  H HE1  . TYR A 1 93  ? -11.530 4.911   2.322   1.00 0.00 ? 93  TYR A HE1  5  
ATOM 8828  H HE2  . TYR A 1 93  ? -9.270  2.005   0.167   1.00 0.00 ? 93  TYR A HE2  5  
ATOM 8829  H HH   . TYR A 1 93  ? -11.074 2.208   2.729   1.00 0.00 ? 93  TYR A HH   5  
ATOM 8830  N N    . ARG A 1 94  ? -12.123 7.366   -4.572  1.00 0.00 ? 94  ARG A N    5  
ATOM 8831  C CA   . ARG A 1 94  ? -12.129 8.567   -5.397  1.00 0.00 ? 94  ARG A CA   5  
ATOM 8832  C C    . ARG A 1 94  ? -13.321 9.456   -5.054  1.00 0.00 ? 94  ARG A C    5  
ATOM 8833  O O    . ARG A 1 94  ? -13.262 10.677  -5.202  1.00 0.00 ? 94  ARG A O    5  
ATOM 8834  C CB   . ARG A 1 94  ? -12.168 8.194   -6.880  1.00 0.00 ? 94  ARG A CB   5  
ATOM 8835  C CG   . ARG A 1 94  ? -10.804 7.859   -7.460  1.00 0.00 ? 94  ARG A CG   5  
ATOM 8836  C CD   . ARG A 1 94  ? -10.894 7.530   -8.942  1.00 0.00 ? 94  ARG A CD   5  
ATOM 8837  N NE   . ARG A 1 94  ? -9.697  6.845   -9.424  1.00 0.00 ? 94  ARG A NE   5  
ATOM 8838  C CZ   . ARG A 1 94  ? -8.518  7.439   -9.570  1.00 0.00 ? 94  ARG A CZ   5  
ATOM 8839  N NH1  . ARG A 1 94  ? -8.379  8.724   -9.271  1.00 0.00 ? 94  ARG A NH1  5  
ATOM 8840  N NH2  . ARG A 1 94  ? -7.476  6.749   -10.014 1.00 0.00 ? 94  ARG A NH2  5  
ATOM 8841  H H    . ARG A 1 94  ? -11.975 6.495   -4.997  1.00 0.00 ? 94  ARG A H    5  
ATOM 8842  H HA   . ARG A 1 94  ? -11.219 9.113   -5.197  1.00 0.00 ? 94  ARG A HA   5  
ATOM 8843  H HB2  . ARG A 1 94  ? -12.809 7.333   -7.006  1.00 0.00 ? 94  ARG A HB2  5  
ATOM 8844  H HB3  . ARG A 1 94  ? -12.579 9.022   -7.437  1.00 0.00 ? 94  ARG A HB3  5  
ATOM 8845  H HG2  . ARG A 1 94  ? -10.150 8.709   -7.331  1.00 0.00 ? 94  ARG A HG2  5  
ATOM 8846  H HG3  . ARG A 1 94  ? -10.398 7.008   -6.935  1.00 0.00 ? 94  ARG A HG3  5  
ATOM 8847  H HD2  . ARG A 1 94  ? -11.751 6.893   -9.104  1.00 0.00 ? 94  ARG A HD2  5  
ATOM 8848  H HD3  . ARG A 1 94  ? -11.018 8.449   -9.495  1.00 0.00 ? 94  ARG A HD3  5  
ATOM 8849  H HE   . ARG A 1 94  ? -9.778  5.895   -9.651  1.00 0.00 ? 94  ARG A HE   5  
ATOM 8850  H HH11 . ARG A 1 94  ? -9.162  9.246   -8.935  1.00 0.00 ? 94  ARG A HH11 5  
ATOM 8851  H HH12 . ARG A 1 94  ? -7.489  9.169   -9.381  1.00 0.00 ? 94  ARG A HH12 5  
ATOM 8852  H HH21 . ARG A 1 94  ? -7.577  5.781   -10.240 1.00 0.00 ? 94  ARG A HH21 5  
ATOM 8853  H HH22 . ARG A 1 94  ? -6.589  7.197   -10.123 1.00 0.00 ? 94  ARG A HH22 5  
ATOM 8854  N N    . LYS A 1 95  ? -14.402 8.835   -4.596  1.00 0.00 ? 95  LYS A N    5  
ATOM 8855  C CA   . LYS A 1 95  ? -15.609 9.568   -4.230  1.00 0.00 ? 95  LYS A CA   5  
ATOM 8856  C C    . LYS A 1 95  ? -15.711 9.728   -2.717  1.00 0.00 ? 95  LYS A C    5  
ATOM 8857  O O    . LYS A 1 95  ? -16.457 10.573  -2.223  1.00 0.00 ? 95  LYS A O    5  
ATOM 8858  C CB   . LYS A 1 95  ? -16.849 8.847   -4.763  1.00 0.00 ? 95  LYS A CB   5  
ATOM 8859  C CG   . LYS A 1 95  ? -16.836 8.645   -6.268  1.00 0.00 ? 95  LYS A CG   5  
ATOM 8860  C CD   . LYS A 1 95  ? -16.163 7.337   -6.649  1.00 0.00 ? 95  LYS A CD   5  
ATOM 8861  C CE   . LYS A 1 95  ? -16.507 6.927   -8.073  1.00 0.00 ? 95  LYS A CE   5  
ATOM 8862  N NZ   . LYS A 1 95  ? -15.781 7.752   -9.078  1.00 0.00 ? 95  LYS A NZ   5  
ATOM 8863  H H    . LYS A 1 95  ? -14.389 7.859   -4.500  1.00 0.00 ? 95  LYS A H    5  
ATOM 8864  H HA   . LYS A 1 95  ? -15.551 10.548  -4.681  1.00 0.00 ? 95  LYS A HA   5  
ATOM 8865  H HB2  . LYS A 1 95  ? -16.918 7.878   -4.291  1.00 0.00 ? 95  LYS A HB2  5  
ATOM 8866  H HB3  . LYS A 1 95  ? -17.725 9.426   -4.506  1.00 0.00 ? 95  LYS A HB3  5  
ATOM 8867  H HG2  . LYS A 1 95  ? -17.854 8.632   -6.630  1.00 0.00 ? 95  LYS A HG2  5  
ATOM 8868  H HG3  . LYS A 1 95  ? -16.299 9.463   -6.727  1.00 0.00 ? 95  LYS A HG3  5  
ATOM 8869  H HD2  . LYS A 1 95  ? -15.093 7.456   -6.570  1.00 0.00 ? 95  LYS A HD2  5  
ATOM 8870  H HD3  . LYS A 1 95  ? -16.493 6.562   -5.971  1.00 0.00 ? 95  LYS A HD3  5  
ATOM 8871  H HE2  . LYS A 1 95  ? -16.240 5.891   -8.210  1.00 0.00 ? 95  LYS A HE2  5  
ATOM 8872  H HE3  . LYS A 1 95  ? -17.570 7.047   -8.221  1.00 0.00 ? 95  LYS A HE3  5  
ATOM 8873  H HZ1  . LYS A 1 95  ? -16.384 8.537   -9.398  1.00 0.00 ? 95  LYS A HZ1  5  
ATOM 8874  H HZ2  . LYS A 1 95  ? -15.525 7.170   -9.901  1.00 0.00 ? 95  LYS A HZ2  5  
ATOM 8875  H HZ3  . LYS A 1 95  ? -14.913 8.143   -8.660  1.00 0.00 ? 95  LYS A HZ3  5  
ATOM 8876  N N    . GLU A 1 96  ? -14.956 8.912   -1.988  1.00 0.00 ? 96  GLU A N    5  
ATOM 8877  C CA   . GLU A 1 96  ? -14.963 8.965   -0.531  1.00 0.00 ? 96  GLU A CA   5  
ATOM 8878  C C    . GLU A 1 96  ? -13.569 9.274   0.009   1.00 0.00 ? 96  GLU A C    5  
ATOM 8879  O O    . GLU A 1 96  ? -12.633 8.499   -0.182  1.00 0.00 ? 96  GLU A O    5  
ATOM 8880  C CB   . GLU A 1 96  ? -15.463 7.639   0.048   1.00 0.00 ? 96  GLU A CB   5  
ATOM 8881  C CG   . GLU A 1 96  ? -16.961 7.437   -0.101  1.00 0.00 ? 96  GLU A CG   5  
ATOM 8882  C CD   . GLU A 1 96  ? -17.744 7.982   1.078   1.00 0.00 ? 96  GLU A CD   5  
ATOM 8883  O OE1  . GLU A 1 96  ? -17.245 7.880   2.218   1.00 0.00 ? 96  GLU A OE1  5  
ATOM 8884  O OE2  . GLU A 1 96  ? -18.854 8.511   0.861   1.00 0.00 ? 96  GLU A OE2  5  
ATOM 8885  H H    . GLU A 1 96  ? -14.383 8.259   -2.440  1.00 0.00 ? 96  GLU A H    5  
ATOM 8886  H HA   . GLU A 1 96  ? -15.635 9.754   -0.230  1.00 0.00 ? 96  GLU A HA   5  
ATOM 8887  H HB2  . GLU A 1 96  ? -14.959 6.828   -0.456  1.00 0.00 ? 96  GLU A HB2  5  
ATOM 8888  H HB3  . GLU A 1 96  ? -15.219 7.605   1.099   1.00 0.00 ? 96  GLU A HB3  5  
ATOM 8889  H HG2  . GLU A 1 96  ? -17.293 7.941   -0.997  1.00 0.00 ? 96  GLU A HG2  5  
ATOM 8890  H HG3  . GLU A 1 96  ? -17.162 6.379   -0.189  1.00 0.00 ? 96  GLU A HG3  5  
ATOM 8891  N N    . GLN A 1 97  ? -13.442 10.413  0.682   1.00 0.00 ? 97  GLN A N    5  
ATOM 8892  C CA   . GLN A 1 97  ? -12.163 10.826  1.248   1.00 0.00 ? 97  GLN A CA   5  
ATOM 8893  C C    . GLN A 1 97  ? -11.520 9.685   2.030   1.00 0.00 ? 97  GLN A C    5  
ATOM 8894  O O    . GLN A 1 97  ? -11.884 9.423   3.177   1.00 0.00 ? 97  GLN A O    5  
ATOM 8895  C CB   . GLN A 1 97  ? -12.352 12.040  2.159   1.00 0.00 ? 97  GLN A CB   5  
ATOM 8896  C CG   . GLN A 1 97  ? -13.611 11.973  3.008   1.00 0.00 ? 97  GLN A CG   5  
ATOM 8897  C CD   . GLN A 1 97  ? -13.667 13.069  4.055   1.00 0.00 ? 97  GLN A CD   5  
ATOM 8898  O OE1  . GLN A 1 97  ? -13.719 12.796  5.254   1.00 0.00 ? 97  GLN A OE1  5  
ATOM 8899  N NE2  . GLN A 1 97  ? -13.657 14.318  3.605   1.00 0.00 ? 97  GLN A NE2  5  
ATOM 8900  H H    . GLN A 1 97  ? -14.225 10.989  0.801   1.00 0.00 ? 97  GLN A H    5  
ATOM 8901  H HA   . GLN A 1 97  ? -11.511 11.097  0.432   1.00 0.00 ? 97  GLN A HA   5  
ATOM 8902  H HB2  . GLN A 1 97  ? -11.501 12.116  2.819   1.00 0.00 ? 97  GLN A HB2  5  
ATOM 8903  H HB3  . GLN A 1 97  ? -12.404 12.929  1.547   1.00 0.00 ? 97  GLN A HB3  5  
ATOM 8904  H HG2  . GLN A 1 97  ? -14.471 12.069  2.363   1.00 0.00 ? 97  GLN A HG2  5  
ATOM 8905  H HG3  . GLN A 1 97  ? -13.642 11.016  3.508   1.00 0.00 ? 97  GLN A HG3  5  
ATOM 8906  H HE21 . GLN A 1 97  ? -13.615 14.461  2.636   1.00 0.00 ? 97  GLN A HE21 5  
ATOM 8907  H HE22 . GLN A 1 97  ? -13.694 15.046  4.259   1.00 0.00 ? 97  GLN A HE22 5  
ATOM 8908  N N    . ILE A 1 98  ? -10.563 9.009   1.402   1.00 0.00 ? 98  ILE A N    5  
ATOM 8909  C CA   . ILE A 1 98  ? -9.869  7.897   2.040   1.00 0.00 ? 98  ILE A CA   5  
ATOM 8910  C C    . ILE A 1 98  ? -9.244  8.325   3.363   1.00 0.00 ? 98  ILE A C    5  
ATOM 8911  O O    . ILE A 1 98  ? -8.995  7.499   4.241   1.00 0.00 ? 98  ILE A O    5  
ATOM 8912  C CB   . ILE A 1 98  ? -8.770  7.322   1.128   1.00 0.00 ? 98  ILE A CB   5  
ATOM 8913  C CG1  . ILE A 1 98  ? -7.992  6.226   1.859   1.00 0.00 ? 98  ILE A CG1  5  
ATOM 8914  C CG2  . ILE A 1 98  ? -7.832  8.428   0.667   1.00 0.00 ? 98  ILE A CG2  5  
ATOM 8915  C CD1  . ILE A 1 98  ? -7.017  5.484   0.972   1.00 0.00 ? 98  ILE A CD1  5  
ATOM 8916  H H    . ILE A 1 98  ? -10.317 9.266   0.489   1.00 0.00 ? 98  ILE A H    5  
ATOM 8917  H HA   . ILE A 1 98  ? -10.594 7.119   2.231   1.00 0.00 ? 98  ILE A HA   5  
ATOM 8918  H HB   . ILE A 1 98  ? -9.242  6.898   0.255   1.00 0.00 ? 98  ILE A HB   5  
ATOM 8919  H HG12 . ILE A 1 98  ? -7.432  6.669   2.668   1.00 0.00 ? 98  ILE A HG12 5  
ATOM 8920  H HG13 . ILE A 1 98  ? -8.690  5.507   2.261   1.00 0.00 ? 98  ILE A HG13 5  
ATOM 8921  H HG21 . ILE A 1 98  ? -7.904  8.538   -0.405  1.00 0.00 ? 98  ILE A HG21 5  
ATOM 8922  H HG22 . ILE A 1 98  ? -8.109  9.356   1.143   1.00 0.00 ? 98  ILE A HG22 5  
ATOM 8923  H HG23 . ILE A 1 98  ? -6.817  8.175   0.935   1.00 0.00 ? 98  ILE A HG23 5  
ATOM 8924  H HD11 . ILE A 1 98  ? -6.758  6.101   0.125   1.00 0.00 ? 98  ILE A HD11 5  
ATOM 8925  H HD12 . ILE A 1 98  ? -6.125  5.249   1.534   1.00 0.00 ? 98  ILE A HD12 5  
ATOM 8926  H HD13 . ILE A 1 98  ? -7.473  4.568   0.623   1.00 0.00 ? 98  ILE A HD13 5  
ATOM 8927  N N    . VAL A 1 99  ? -8.994  9.624   3.501   1.00 0.00 ? 99  VAL A N    5  
ATOM 8928  C CA   . VAL A 1 99  ? -8.401  10.163  4.718   1.00 0.00 ? 99  VAL A CA   5  
ATOM 8929  C C    . VAL A 1 99  ? -9.356  11.125  5.415   1.00 0.00 ? 99  VAL A C    5  
ATOM 8930  O O    . VAL A 1 99  ? -10.416 11.455  4.885   1.00 0.00 ? 99  VAL A O    5  
ATOM 8931  C CB   . VAL A 1 99  ? -7.078  10.895  4.422   1.00 0.00 ? 99  VAL A CB   5  
ATOM 8932  C CG1  . VAL A 1 99  ? -6.172  10.876  5.643   1.00 0.00 ? 99  VAL A CG1  5  
ATOM 8933  C CG2  . VAL A 1 99  ? -6.382  10.271  3.222   1.00 0.00 ? 99  VAL A CG2  5  
ATOM 8934  H H    . VAL A 1 99  ? -9.215  10.233  2.766   1.00 0.00 ? 99  VAL A H    5  
ATOM 8935  H HA   . VAL A 1 99  ? -8.189  9.337   5.381   1.00 0.00 ? 99  VAL A HA   5  
ATOM 8936  H HB   . VAL A 1 99  ? -7.305  11.924  4.185   1.00 0.00 ? 99  VAL A HB   5  
ATOM 8937  H HG11 . VAL A 1 99  ? -5.152  10.705  5.331   1.00 0.00 ? 99  VAL A HG11 5  
ATOM 8938  H HG12 . VAL A 1 99  ? -6.238  11.825  6.156   1.00 0.00 ? 99  VAL A HG12 5  
ATOM 8939  H HG13 . VAL A 1 99  ? -6.482  10.084  6.309   1.00 0.00 ? 99  VAL A HG13 5  
ATOM 8940  H HG21 . VAL A 1 99  ? -6.386  9.196   3.323   1.00 0.00 ? 99  VAL A HG21 5  
ATOM 8941  H HG22 . VAL A 1 99  ? -6.904  10.549  2.317   1.00 0.00 ? 99  VAL A HG22 5  
ATOM 8942  H HG23 . VAL A 1 99  ? -5.363  10.624  3.172   1.00 0.00 ? 99  VAL A HG23 5  
ATOM 8943  N N    . GLU A 1 100 ? -8.972  11.571  6.608   1.00 0.00 ? 100 GLU A N    5  
ATOM 8944  C CA   . GLU A 1 100 ? -9.795  12.496  7.378   1.00 0.00 ? 100 GLU A CA   5  
ATOM 8945  C C    . GLU A 1 100 ? -10.339 13.611  6.488   1.00 0.00 ? 100 GLU A C    5  
ATOM 8946  O O    . GLU A 1 100 ? -11.385 14.192  6.772   1.00 0.00 ? 100 GLU A O    5  
ATOM 8947  C CB   . GLU A 1 100 ? -8.987  13.096  8.530   1.00 0.00 ? 100 GLU A CB   5  
ATOM 8948  C CG   . GLU A 1 100 ? -7.816  13.950  8.072   1.00 0.00 ? 100 GLU A CG   5  
ATOM 8949  C CD   . GLU A 1 100 ? -7.220  14.774  9.196   1.00 0.00 ? 100 GLU A CD   5  
ATOM 8950  O OE1  . GLU A 1 100 ? -6.301  14.271  9.877   1.00 0.00 ? 100 GLU A OE1  5  
ATOM 8951  O OE2  . GLU A 1 100 ? -7.672  15.921  9.397   1.00 0.00 ? 100 GLU A OE2  5  
ATOM 8952  H H    . GLU A 1 100 ? -8.116  11.271  6.978   1.00 0.00 ? 100 GLU A H    5  
ATOM 8953  H HA   . GLU A 1 100 ? -10.626 11.940  7.785   1.00 0.00 ? 100 GLU A HA   5  
ATOM 8954  H HB2  . GLU A 1 100 ? -9.641  13.710  9.131   1.00 0.00 ? 100 GLU A HB2  5  
ATOM 8955  H HB3  . GLU A 1 100 ? -8.601  12.292  9.139   1.00 0.00 ? 100 GLU A HB3  5  
ATOM 8956  H HG2  . GLU A 1 100 ? -7.049  13.303  7.675   1.00 0.00 ? 100 GLU A HG2  5  
ATOM 8957  H HG3  . GLU A 1 100 ? -8.157  14.620  7.296   1.00 0.00 ? 100 GLU A HG3  5  
ATOM 8958  N N    . GLY A 1 101 ? -9.618  13.905  5.410   1.00 0.00 ? 101 GLY A N    5  
ATOM 8959  C CA   . GLY A 1 101 ? -10.042 14.949  4.496   1.00 0.00 ? 101 GLY A CA   5  
ATOM 8960  C C    . GLY A 1 101 ? -9.195  14.998  3.240   1.00 0.00 ? 101 GLY A C    5  
ATOM 8961  O O    . GLY A 1 101 ? -8.595  16.027  2.928   1.00 0.00 ? 101 GLY A O    5  
ATOM 8962  H H    . GLY A 1 101 ? -8.791  13.408  5.235   1.00 0.00 ? 101 GLY A H    5  
ATOM 8963  H HA2  . GLY A 1 101 ? -11.070 14.773  4.218   1.00 0.00 ? 101 GLY A HA2  5  
ATOM 8964  H HA3  . GLY A 1 101 ? -9.973  15.902  5.000   1.00 0.00 ? 101 GLY A HA3  5  
ATOM 8965  N N    . TYR A 1 102 ? -9.145  13.885  2.518   1.00 0.00 ? 102 TYR A N    5  
ATOM 8966  C CA   . TYR A 1 102 ? -8.362  13.804  1.291   1.00 0.00 ? 102 TYR A CA   5  
ATOM 8967  C C    . TYR A 1 102 ? -8.943  12.760  0.342   1.00 0.00 ? 102 TYR A C    5  
ATOM 8968  O O    . TYR A 1 102 ? -9.425  11.712  0.773   1.00 0.00 ? 102 TYR A O    5  
ATOM 8969  C CB   . TYR A 1 102 ? -6.906  13.464  1.611   1.00 0.00 ? 102 TYR A CB   5  
ATOM 8970  C CG   . TYR A 1 102 ? -6.105  14.644  2.113   1.00 0.00 ? 102 TYR A CG   5  
ATOM 8971  C CD1  . TYR A 1 102 ? -6.204  15.066  3.433   1.00 0.00 ? 102 TYR A CD1  5  
ATOM 8972  C CD2  . TYR A 1 102 ? -5.247  15.336  1.267   1.00 0.00 ? 102 TYR A CD2  5  
ATOM 8973  C CE1  . TYR A 1 102 ? -5.475  16.144  3.895   1.00 0.00 ? 102 TYR A CE1  5  
ATOM 8974  C CE2  . TYR A 1 102 ? -4.512  16.414  1.721   1.00 0.00 ? 102 TYR A CE2  5  
ATOM 8975  C CZ   . TYR A 1 102 ? -4.630  16.815  3.036   1.00 0.00 ? 102 TYR A CZ   5  
ATOM 8976  O OH   . TYR A 1 102 ? -3.901  17.888  3.493   1.00 0.00 ? 102 TYR A OH   5  
ATOM 8977  H H    . TYR A 1 102 ? -9.645  13.097  2.818   1.00 0.00 ? 102 TYR A H    5  
ATOM 8978  H HA   . TYR A 1 102 ? -8.398  14.770  0.810   1.00 0.00 ? 102 TYR A HA   5  
ATOM 8979  H HB2  . TYR A 1 102 ? -6.881  12.699  2.372   1.00 0.00 ? 102 TYR A HB2  5  
ATOM 8980  H HB3  . TYR A 1 102 ? -6.425  13.092  0.718   1.00 0.00 ? 102 TYR A HB3  5  
ATOM 8981  H HD1  . TYR A 1 102 ? -6.867  14.537  4.104   1.00 0.00 ? 102 TYR A HD1  5  
ATOM 8982  H HD2  . TYR A 1 102 ? -5.157  15.020  0.238   1.00 0.00 ? 102 TYR A HD2  5  
ATOM 8983  H HE1  . TYR A 1 102 ? -5.566  16.457  4.925   1.00 0.00 ? 102 TYR A HE1  5  
ATOM 8984  H HE2  . TYR A 1 102 ? -3.851  16.940  1.048   1.00 0.00 ? 102 TYR A HE2  5  
ATOM 8985  H HH   . TYR A 1 102 ? -4.368  18.306  4.220   1.00 0.00 ? 102 TYR A HH   5  
ATOM 8986  N N    . TYR A 1 103 ? -8.892  13.054  -0.953  1.00 0.00 ? 103 TYR A N    5  
ATOM 8987  C CA   . TYR A 1 103 ? -9.415  12.143  -1.964  1.00 0.00 ? 103 TYR A CA   5  
ATOM 8988  C C    . TYR A 1 103 ? -8.307  11.683  -2.908  1.00 0.00 ? 103 TYR A C    5  
ATOM 8989  O O    . TYR A 1 103 ? -7.183  12.185  -2.856  1.00 0.00 ? 103 TYR A O    5  
ATOM 8990  C CB   . TYR A 1 103 ? -10.531 12.818  -2.762  1.00 0.00 ? 103 TYR A CB   5  
ATOM 8991  C CG   . TYR A 1 103 ? -11.774 13.097  -1.947  1.00 0.00 ? 103 TYR A CG   5  
ATOM 8992  C CD1  . TYR A 1 103 ? -11.919 14.291  -1.251  1.00 0.00 ? 103 TYR A CD1  5  
ATOM 8993  C CD2  . TYR A 1 103 ? -12.803 12.166  -1.871  1.00 0.00 ? 103 TYR A CD2  5  
ATOM 8994  C CE1  . TYR A 1 103 ? -13.052 14.550  -0.505  1.00 0.00 ? 103 TYR A CE1  5  
ATOM 8995  C CE2  . TYR A 1 103 ? -13.940 12.417  -1.129  1.00 0.00 ? 103 TYR A CE2  5  
ATOM 8996  C CZ   . TYR A 1 103 ? -14.060 13.610  -0.447  1.00 0.00 ? 103 TYR A CZ   5  
ATOM 8997  O OH   . TYR A 1 103 ? -15.191 13.863  0.295   1.00 0.00 ? 103 TYR A OH   5  
ATOM 8998  H H    . TYR A 1 103 ? -8.496  13.904  -1.235  1.00 0.00 ? 103 TYR A H    5  
ATOM 8999  H HA   . TYR A 1 103 ? -9.820  11.280  -1.456  1.00 0.00 ? 103 TYR A HA   5  
ATOM 9000  H HB2  . TYR A 1 103 ? -10.170 13.759  -3.147  1.00 0.00 ? 103 TYR A HB2  5  
ATOM 9001  H HB3  . TYR A 1 103 ? -10.812 12.180  -3.587  1.00 0.00 ? 103 TYR A HB3  5  
ATOM 9002  H HD1  . TYR A 1 103 ? -11.128 15.026  -1.299  1.00 0.00 ? 103 TYR A HD1  5  
ATOM 9003  H HD2  . TYR A 1 103 ? -12.705 11.232  -2.406  1.00 0.00 ? 103 TYR A HD2  5  
ATOM 9004  H HE1  . TYR A 1 103 ? -13.147 15.484  0.029   1.00 0.00 ? 103 TYR A HE1  5  
ATOM 9005  H HE2  . TYR A 1 103 ? -14.729 11.681  -1.083  1.00 0.00 ? 103 TYR A HE2  5  
ATOM 9006  H HH   . TYR A 1 103 ? -14.967 14.431  1.036   1.00 0.00 ? 103 TYR A HH   5  
ATOM 9007  N N    . LEU A 1 104 ? -8.632  10.726  -3.769  1.00 0.00 ? 104 LEU A N    5  
ATOM 9008  C CA   . LEU A 1 104 ? -7.666  10.198  -4.726  1.00 0.00 ? 104 LEU A CA   5  
ATOM 9009  C C    . LEU A 1 104 ? -7.700  10.991  -6.029  1.00 0.00 ? 104 LEU A C    5  
ATOM 9010  O O    . LEU A 1 104 ? -8.760  11.178  -6.627  1.00 0.00 ? 104 LEU A O    5  
ATOM 9011  C CB   . LEU A 1 104 ? -7.953  8.722   -5.008  1.00 0.00 ? 104 LEU A CB   5  
ATOM 9012  C CG   . LEU A 1 104 ? -7.963  7.796   -3.790  1.00 0.00 ? 104 LEU A CG   5  
ATOM 9013  C CD1  . LEU A 1 104 ? -8.455  6.410   -4.178  1.00 0.00 ? 104 LEU A CD1  5  
ATOM 9014  C CD2  . LEU A 1 104 ? -6.576  7.717   -3.169  1.00 0.00 ? 104 LEU A CD2  5  
ATOM 9015  H H    . LEU A 1 104 ? -9.543  10.365  -3.763  1.00 0.00 ? 104 LEU A H    5  
ATOM 9016  H HA   . LEU A 1 104 ? -6.683  10.288  -4.289  1.00 0.00 ? 104 LEU A HA   5  
ATOM 9017  H HB2  . LEU A 1 104 ? -8.921  8.657   -5.480  1.00 0.00 ? 104 LEU A HB2  5  
ATOM 9018  H HB3  . LEU A 1 104 ? -7.196  8.363   -5.691  1.00 0.00 ? 104 LEU A HB3  5  
ATOM 9019  H HG   . LEU A 1 104 ? -8.640  8.195   -3.048  1.00 0.00 ? 104 LEU A HG   5  
ATOM 9020  H HD11 . LEU A 1 104 ? -9.526  6.432   -4.309  1.00 0.00 ? 104 LEU A HD11 5  
ATOM 9021  H HD12 . LEU A 1 104 ? -8.202  5.708   -3.397  1.00 0.00 ? 104 LEU A HD12 5  
ATOM 9022  H HD13 . LEU A 1 104 ? -7.984  6.106   -5.101  1.00 0.00 ? 104 LEU A HD13 5  
ATOM 9023  H HD21 . LEU A 1 104 ? -6.667  7.515   -2.112  1.00 0.00 ? 104 LEU A HD21 5  
ATOM 9024  H HD22 . LEU A 1 104 ? -6.063  8.657   -3.313  1.00 0.00 ? 104 LEU A HD22 5  
ATOM 9025  H HD23 . LEU A 1 104 ? -6.015  6.924   -3.641  1.00 0.00 ? 104 LEU A HD23 5  
ATOM 9026  N N    . LYS A 1 105 ? -6.533  11.455  -6.464  1.00 0.00 ? 105 LYS A N    5  
ATOM 9027  C CA   . LYS A 1 105 ? -6.427  12.225  -7.697  1.00 0.00 ? 105 LYS A CA   5  
ATOM 9028  C C    . LYS A 1 105 ? -5.849  11.373  -8.823  1.00 0.00 ? 105 LYS A C    5  
ATOM 9029  O O    . LYS A 1 105 ? -6.544  11.044  -9.783  1.00 0.00 ? 105 LYS A O    5  
ATOM 9030  C CB   . LYS A 1 105 ? -5.552  13.461  -7.477  1.00 0.00 ? 105 LYS A CB   5  
ATOM 9031  C CG   . LYS A 1 105 ? -6.250  14.573  -6.713  1.00 0.00 ? 105 LYS A CG   5  
ATOM 9032  C CD   . LYS A 1 105 ? -7.284  15.278  -7.575  1.00 0.00 ? 105 LYS A CD   5  
ATOM 9033  C CE   . LYS A 1 105 ? -7.663  16.632  -6.996  1.00 0.00 ? 105 LYS A CE   5  
ATOM 9034  N NZ   . LYS A 1 105 ? -8.802  16.529  -6.043  1.00 0.00 ? 105 LYS A NZ   5  
ATOM 9035  H H    . LYS A 1 105 ? -5.723  11.273  -5.942  1.00 0.00 ? 105 LYS A H    5  
ATOM 9036  H HA   . LYS A 1 105 ? -7.421  12.543  -7.976  1.00 0.00 ? 105 LYS A HA   5  
ATOM 9037  H HB2  . LYS A 1 105 ? -4.672  13.170  -6.923  1.00 0.00 ? 105 LYS A HB2  5  
ATOM 9038  H HB3  . LYS A 1 105 ? -5.250  13.849  -8.439  1.00 0.00 ? 105 LYS A HB3  5  
ATOM 9039  H HG2  . LYS A 1 105 ? -6.745  14.150  -5.851  1.00 0.00 ? 105 LYS A HG2  5  
ATOM 9040  H HG3  . LYS A 1 105 ? -5.513  15.293  -6.390  1.00 0.00 ? 105 LYS A HG3  5  
ATOM 9041  H HD2  . LYS A 1 105 ? -6.876  15.424  -8.565  1.00 0.00 ? 105 LYS A HD2  5  
ATOM 9042  H HD3  . LYS A 1 105 ? -8.170  14.662  -7.637  1.00 0.00 ? 105 LYS A HD3  5  
ATOM 9043  H HE2  . LYS A 1 105 ? -6.807  17.040  -6.479  1.00 0.00 ? 105 LYS A HE2  5  
ATOM 9044  H HE3  . LYS A 1 105 ? -7.940  17.290  -7.806  1.00 0.00 ? 105 LYS A HE3  5  
ATOM 9045  H HZ1  . LYS A 1 105 ? -8.890  17.409  -5.495  1.00 0.00 ? 105 LYS A HZ1  5  
ATOM 9046  H HZ2  . LYS A 1 105 ? -8.646  15.739  -5.385  1.00 0.00 ? 105 LYS A HZ2  5  
ATOM 9047  H HZ3  . LYS A 1 105 ? -9.688  16.365  -6.561  1.00 0.00 ? 105 LYS A HZ3  5  
ATOM 9048  N N    . GLU A 1 106 ? -4.574  11.020  -8.696  1.00 0.00 ? 106 GLU A N    5  
ATOM 9049  C CA   . GLU A 1 106 ? -3.904  10.206  -9.703  1.00 0.00 ? 106 GLU A CA   5  
ATOM 9050  C C    . GLU A 1 106 ? -2.810  9.350   -9.071  1.00 0.00 ? 106 GLU A C    5  
ATOM 9051  O O    . GLU A 1 106 ? -2.061  9.797   -8.202  1.00 0.00 ? 106 GLU A O    5  
ATOM 9052  C CB   . GLU A 1 106 ? -3.304  11.096  -10.794 1.00 0.00 ? 106 GLU A CB   5  
ATOM 9053  C CG   . GLU A 1 106 ? -2.314  12.121  -10.268 1.00 0.00 ? 106 GLU A CG   5  
ATOM 9054  C CD   . GLU A 1 106 ? -1.434  12.696  -11.360 1.00 0.00 ? 106 GLU A CD   5  
ATOM 9055  O OE1  . GLU A 1 106 ? -1.293  12.042  -12.414 1.00 0.00 ? 106 GLU A OE1  5  
ATOM 9056  O OE2  . GLU A 1 106 ? -0.886  13.801  -11.161 1.00 0.00 ? 106 GLU A OE2  5  
ATOM 9057  H H    . GLU A 1 106 ? -4.072  11.314  -7.907  1.00 0.00 ? 106 GLU A H    5  
ATOM 9058  H HA   . GLU A 1 106 ? -4.641  9.555   -10.148 1.00 0.00 ? 106 GLU A HA   5  
ATOM 9059  H HB2  . GLU A 1 106 ? -2.796  10.470  -11.513 1.00 0.00 ? 106 GLU A HB2  5  
ATOM 9060  H HB3  . GLU A 1 106 ? -4.105  11.623  -11.292 1.00 0.00 ? 106 GLU A HB3  5  
ATOM 9061  H HG2  . GLU A 1 106 ? -2.862  12.928  -9.806  1.00 0.00 ? 106 GLU A HG2  5  
ATOM 9062  H HG3  . GLU A 1 106 ? -1.684  11.647  -9.530  1.00 0.00 ? 106 GLU A HG3  5  
ATOM 9063  N N    . PRO A 1 107 ? -2.714  8.089   -9.518  1.00 0.00 ? 107 PRO A N    5  
ATOM 9064  C CA   . PRO A 1 107 ? -1.715  7.144   -9.011  1.00 0.00 ? 107 PRO A CA   5  
ATOM 9065  C C    . PRO A 1 107 ? -0.299  7.508   -9.443  1.00 0.00 ? 107 PRO A C    5  
ATOM 9066  O O    . PRO A 1 107 ? -0.099  8.431   -10.233 1.00 0.00 ? 107 PRO A O    5  
ATOM 9067  C CB   . PRO A 1 107 ? -2.138  5.811   -9.634  1.00 0.00 ? 107 PRO A CB   5  
ATOM 9068  C CG   . PRO A 1 107 ? -2.883  6.191   -10.868 1.00 0.00 ? 107 PRO A CG   5  
ATOM 9069  C CD   . PRO A 1 107 ? -3.572  7.489   -10.553 1.00 0.00 ? 107 PRO A CD   5  
ATOM 9070  H HA   . PRO A 1 107 ? -1.752  7.067   -7.934  1.00 0.00 ? 107 PRO A HA   5  
ATOM 9071  H HB2  . PRO A 1 107 ? -1.260  5.225   -9.866  1.00 0.00 ? 107 PRO A HB2  5  
ATOM 9072  H HB3  . PRO A 1 107 ? -2.768  5.270   -8.944  1.00 0.00 ? 107 PRO A HB3  5  
ATOM 9073  H HG2  . PRO A 1 107 ? -2.193  6.322   -11.688 1.00 0.00 ? 107 PRO A HG2  5  
ATOM 9074  H HG3  . PRO A 1 107 ? -3.610  5.428   -11.106 1.00 0.00 ? 107 PRO A HG3  5  
ATOM 9075  H HD2  . PRO A 1 107 ? -3.615  8.117   -11.430 1.00 0.00 ? 107 PRO A HD2  5  
ATOM 9076  H HD3  . PRO A 1 107 ? -4.566  7.306   -10.170 1.00 0.00 ? 107 PRO A HD3  5  
ATOM 9077  N N    . VAL A 1 108 ? 0.681   6.778   -8.921  1.00 0.00 ? 108 VAL A N    5  
ATOM 9078  C CA   . VAL A 1 108 ? 2.079   7.024   -9.255  1.00 0.00 ? 108 VAL A CA   5  
ATOM 9079  C C    . VAL A 1 108 ? 2.562   6.066   -10.339 1.00 0.00 ? 108 VAL A C    5  
ATOM 9080  O O    . VAL A 1 108 ? 2.401   4.849   -10.243 1.00 0.00 ? 108 VAL A O    5  
ATOM 9081  C CB   . VAL A 1 108 ? 2.985   6.881   -8.018  1.00 0.00 ? 108 VAL A CB   5  
ATOM 9082  C CG1  . VAL A 1 108 ? 4.439   6.722   -8.436  1.00 0.00 ? 108 VAL A CG1  5  
ATOM 9083  C CG2  . VAL A 1 108 ? 2.816   8.077   -7.093  1.00 0.00 ? 108 VAL A CG2  5  
ATOM 9084  H H    . VAL A 1 108 ? 0.459   6.056   -8.297  1.00 0.00 ? 108 VAL A H    5  
ATOM 9085  H HA   . VAL A 1 108 ? 2.162   8.037   -9.621  1.00 0.00 ? 108 VAL A HA   5  
ATOM 9086  H HB   . VAL A 1 108 ? 2.689   5.992   -7.481  1.00 0.00 ? 108 VAL A HB   5  
ATOM 9087  H HG11 . VAL A 1 108 ? 5.075   7.226   -7.724  1.00 0.00 ? 108 VAL A HG11 5  
ATOM 9088  H HG12 . VAL A 1 108 ? 4.692   5.672   -8.468  1.00 0.00 ? 108 VAL A HG12 5  
ATOM 9089  H HG13 . VAL A 1 108 ? 4.582   7.157   -9.415  1.00 0.00 ? 108 VAL A HG13 5  
ATOM 9090  H HG21 . VAL A 1 108 ? 2.157   8.798   -7.555  1.00 0.00 ? 108 VAL A HG21 5  
ATOM 9091  H HG22 . VAL A 1 108 ? 2.390   7.750   -6.155  1.00 0.00 ? 108 VAL A HG22 5  
ATOM 9092  H HG23 . VAL A 1 108 ? 3.778   8.532   -6.912  1.00 0.00 ? 108 VAL A HG23 5  
ATOM 9093  N N    . PRO A 1 109 ? 3.170   6.626   -11.395 1.00 0.00 ? 109 PRO A N    5  
ATOM 9094  C CA   . PRO A 1 109 ? 3.690   5.839   -12.517 1.00 0.00 ? 109 PRO A CA   5  
ATOM 9095  C C    . PRO A 1 109 ? 4.911   5.013   -12.129 1.00 0.00 ? 109 PRO A C    5  
ATOM 9096  O O    . PRO A 1 109 ? 5.682   5.402   -11.252 1.00 0.00 ? 109 PRO A O    5  
ATOM 9097  C CB   . PRO A 1 109 ? 4.071   6.903   -13.550 1.00 0.00 ? 109 PRO A CB   5  
ATOM 9098  C CG   . PRO A 1 109 ? 4.334   8.131   -12.749 1.00 0.00 ? 109 PRO A CG   5  
ATOM 9099  C CD   . PRO A 1 109 ? 3.396   8.070   -11.576 1.00 0.00 ? 109 PRO A CD   5  
ATOM 9100  H HA   . PRO A 1 109 ? 2.933   5.189   -12.931 1.00 0.00 ? 109 PRO A HA   5  
ATOM 9101  H HB2  . PRO A 1 109 ? 4.952   6.586   -14.090 1.00 0.00 ? 109 PRO A HB2  5  
ATOM 9102  H HB3  . PRO A 1 109 ? 3.253   7.050   -14.239 1.00 0.00 ? 109 PRO A HB3  5  
ATOM 9103  H HG2  . PRO A 1 109 ? 5.359   8.136   -12.410 1.00 0.00 ? 109 PRO A HG2  5  
ATOM 9104  H HG3  . PRO A 1 109 ? 4.131   9.008   -13.345 1.00 0.00 ? 109 PRO A HG3  5  
ATOM 9105  H HD2  . PRO A 1 109 ? 3.858   8.500   -10.700 1.00 0.00 ? 109 PRO A HD2  5  
ATOM 9106  H HD3  . PRO A 1 109 ? 2.471   8.578   -11.805 1.00 0.00 ? 109 PRO A HD3  5  
ATOM 9107  N N    . MET A 1 110 ? 5.081   3.871   -12.788 1.00 0.00 ? 110 MET A N    5  
ATOM 9108  C CA   . MET A 1 110 ? 6.211   2.991   -12.512 1.00 0.00 ? 110 MET A CA   5  
ATOM 9109  C C    . MET A 1 110 ? 7.380   3.300   -13.441 1.00 0.00 ? 110 MET A C    5  
ATOM 9110  O O    . MET A 1 110 ? 7.184   3.715   -14.583 1.00 0.00 ? 110 MET A O    5  
ATOM 9111  C CB   . MET A 1 110 ? 5.794   1.527   -12.667 1.00 0.00 ? 110 MET A CB   5  
ATOM 9112  C CG   . MET A 1 110 ? 4.897   1.274   -13.868 1.00 0.00 ? 110 MET A CG   5  
ATOM 9113  S SD   . MET A 1 110 ? 5.102   -0.382  -14.552 1.00 0.00 ? 110 MET A SD   5  
ATOM 9114  C CE   . MET A 1 110 ? 5.579   0.003   -16.235 1.00 0.00 ? 110 MET A CE   5  
ATOM 9115  H H    . MET A 1 110 ? 4.433   3.614   -13.477 1.00 0.00 ? 110 MET A H    5  
ATOM 9116  H HA   . MET A 1 110 ? 6.521   3.161   -11.492 1.00 0.00 ? 110 MET A HA   5  
ATOM 9117  H HB2  . MET A 1 110 ? 6.681   0.921   -12.774 1.00 0.00 ? 110 MET A HB2  5  
ATOM 9118  H HB3  . MET A 1 110 ? 5.263   1.220   -11.778 1.00 0.00 ? 110 MET A HB3  5  
ATOM 9119  H HG2  . MET A 1 110 ? 3.868   1.399   -13.566 1.00 0.00 ? 110 MET A HG2  5  
ATOM 9120  H HG3  . MET A 1 110 ? 5.135   1.997   -14.635 1.00 0.00 ? 110 MET A HG3  5  
ATOM 9121  H HE1  . MET A 1 110 ? 5.550   1.072   -16.382 1.00 0.00 ? 110 MET A HE1  5  
ATOM 9122  H HE2  . MET A 1 110 ? 6.580   -0.359  -16.416 1.00 0.00 ? 110 MET A HE2  5  
ATOM 9123  H HE3  . MET A 1 110 ? 4.893   -0.473  -16.920 1.00 0.00 ? 110 MET A HE3  5  
ATOM 9124  N N    . GLN A 1 111 ? 8.596   3.094   -12.944 1.00 0.00 ? 111 GLN A N    5  
ATOM 9125  C CA   . GLN A 1 111 ? 9.796   3.352   -13.730 1.00 0.00 ? 111 GLN A CA   5  
ATOM 9126  C C    . GLN A 1 111 ? 10.429  2.047   -14.201 1.00 0.00 ? 111 GLN A C    5  
ATOM 9127  O O    . GLN A 1 111 ? 10.685  1.146   -13.402 1.00 0.00 ? 111 GLN A O    5  
ATOM 9128  C CB   . GLN A 1 111 ? 10.806  4.156   -12.909 1.00 0.00 ? 111 GLN A CB   5  
ATOM 9129  C CG   . GLN A 1 111 ? 10.253  5.470   -12.382 1.00 0.00 ? 111 GLN A CG   5  
ATOM 9130  C CD   . GLN A 1 111 ? 9.708   6.358   -13.483 1.00 0.00 ? 111 GLN A CD   5  
ATOM 9131  O OE1  . GLN A 1 111 ? 10.228  6.372   -14.599 1.00 0.00 ? 111 GLN A OE1  5  
ATOM 9132  N NE2  . GLN A 1 111 ? 8.654   7.105   -13.175 1.00 0.00 ? 111 GLN A NE2  5  
ATOM 9133  H H    . GLN A 1 111 ? 8.687   2.762   -12.027 1.00 0.00 ? 111 GLN A H    5  
ATOM 9134  H HA   . GLN A 1 111 ? 9.508   3.930   -14.595 1.00 0.00 ? 111 GLN A HA   5  
ATOM 9135  H HB2  . GLN A 1 111 ? 11.124  3.559   -12.067 1.00 0.00 ? 111 GLN A HB2  5  
ATOM 9136  H HB3  . GLN A 1 111 ? 11.663  4.374   -13.529 1.00 0.00 ? 111 GLN A HB3  5  
ATOM 9137  H HG2  . GLN A 1 111 ? 9.456   5.257   -11.685 1.00 0.00 ? 111 GLN A HG2  5  
ATOM 9138  H HG3  . GLN A 1 111 ? 11.044  5.999   -11.871 1.00 0.00 ? 111 GLN A HG3  5  
ATOM 9139  H HE21 . GLN A 1 111 ? 8.294   7.042   -12.265 1.00 0.00 ? 111 GLN A HE21 5  
ATOM 9140  H HE22 . GLN A 1 111 ? 8.282   7.688   -13.868 1.00 0.00 ? 111 GLN A HE22 5  
ATOM 9141  N N    . ASP A 1 112 ? 10.679  1.952   -15.502 1.00 0.00 ? 112 ASP A N    5  
ATOM 9142  C CA   . ASP A 1 112 ? 11.284  0.757   -16.079 1.00 0.00 ? 112 ASP A CA   5  
ATOM 9143  C C    . ASP A 1 112 ? 12.763  0.984   -16.373 1.00 0.00 ? 112 ASP A C    5  
ATOM 9144  O O    . ASP A 1 112 ? 13.117  1.650   -17.345 1.00 0.00 ? 112 ASP A O    5  
ATOM 9145  C CB   . ASP A 1 112 ? 10.551  0.358   -17.362 1.00 0.00 ? 112 ASP A CB   5  
ATOM 9146  C CG   . ASP A 1 112 ? 11.043  -0.962  -17.922 1.00 0.00 ? 112 ASP A CG   5  
ATOM 9147  O OD1  . ASP A 1 112 ? 10.886  -1.993  -17.235 1.00 0.00 ? 112 ASP A OD1  5  
ATOM 9148  O OD2  . ASP A 1 112 ? 11.585  -0.964  -19.048 1.00 0.00 ? 112 ASP A OD2  5  
ATOM 9149  H H    . ASP A 1 112 ? 10.453  2.704   -16.088 1.00 0.00 ? 112 ASP A H    5  
ATOM 9150  H HA   . ASP A 1 112 ? 11.191  -0.042  -15.360 1.00 0.00 ? 112 ASP A HA   5  
ATOM 9151  H HB2  . ASP A 1 112 ? 9.495   0.268   -17.153 1.00 0.00 ? 112 ASP A HB2  5  
ATOM 9152  H HB3  . ASP A 1 112 ? 10.703  1.124   -18.108 1.00 0.00 ? 112 ASP A HB3  5  
ATOM 9153  N N    . GLN A 1 113 ? 13.622  0.426   -15.526 1.00 0.00 ? 113 GLN A N    5  
ATOM 9154  C CA   . GLN A 1 113 ? 15.063  0.570   -15.694 1.00 0.00 ? 113 GLN A CA   5  
ATOM 9155  C C    . GLN A 1 113 ? 15.715  -0.780  -15.978 1.00 0.00 ? 113 GLN A C    5  
ATOM 9156  O O    . GLN A 1 113 ? 16.356  -0.965  -17.012 1.00 0.00 ? 113 GLN A O    5  
ATOM 9157  C CB   . GLN A 1 113 ? 15.684  1.197   -14.445 1.00 0.00 ? 113 GLN A CB   5  
ATOM 9158  C CG   . GLN A 1 113 ? 17.197  1.328   -14.517 1.00 0.00 ? 113 GLN A CG   5  
ATOM 9159  C CD   . GLN A 1 113 ? 17.640  2.525   -15.335 1.00 0.00 ? 113 GLN A CD   5  
ATOM 9160  O OE1  . GLN A 1 113 ? 17.076  2.813   -16.391 1.00 0.00 ? 113 GLN A OE1  5  
ATOM 9161  N NE2  . GLN A 1 113 ? 18.656  3.230   -14.851 1.00 0.00 ? 113 GLN A NE2  5  
ATOM 9162  H H    . GLN A 1 113 ? 13.278  -0.093  -14.770 1.00 0.00 ? 113 GLN A H    5  
ATOM 9163  H HA   . GLN A 1 113 ? 15.235  1.222   -16.537 1.00 0.00 ? 113 GLN A HA   5  
ATOM 9164  H HB2  . GLN A 1 113 ? 15.265  2.182   -14.305 1.00 0.00 ? 113 GLN A HB2  5  
ATOM 9165  H HB3  . GLN A 1 113 ? 15.438  0.585   -13.589 1.00 0.00 ? 113 GLN A HB3  5  
ATOM 9166  H HG2  . GLN A 1 113 ? 17.585  1.433   -13.515 1.00 0.00 ? 113 GLN A HG2  5  
ATOM 9167  H HG3  . GLN A 1 113 ? 17.601  0.433   -14.967 1.00 0.00 ? 113 GLN A HG3  5  
ATOM 9168  H HE21 . GLN A 1 113 ? 19.057  2.941   -14.004 1.00 0.00 ? 113 GLN A HE21 5  
ATOM 9169  H HE22 . GLN A 1 113 ? 18.963  4.008   -15.359 1.00 0.00 ? 113 GLN A HE22 5  
ATOM 9170  N N    . SER A 1 114 ? 15.547  -1.719  -15.053 1.00 0.00 ? 114 SER A N    5  
ATOM 9171  C CA   . SER A 1 114 ? 16.123  -3.050  -15.201 1.00 0.00 ? 114 SER A CA   5  
ATOM 9172  C C    . SER A 1 114 ? 15.051  -4.125  -15.050 1.00 0.00 ? 114 SER A C    5  
ATOM 9173  O O    . SER A 1 114 ? 14.348  -4.180  -14.042 1.00 0.00 ? 114 SER A O    5  
ATOM 9174  C CB   . SER A 1 114 ? 17.230  -3.269  -14.168 1.00 0.00 ? 114 SER A CB   5  
ATOM 9175  O OG   . SER A 1 114 ? 16.686  -3.518  -12.883 1.00 0.00 ? 114 SER A OG   5  
ATOM 9176  H H    . SER A 1 114 ? 15.025  -1.510  -14.249 1.00 0.00 ? 114 SER A H    5  
ATOM 9177  H HA   . SER A 1 114 ? 16.548  -3.119  -16.192 1.00 0.00 ? 114 SER A HA   5  
ATOM 9178  H HB2  . SER A 1 114 ? 17.831  -4.115  -14.462 1.00 0.00 ? 114 SER A HB2  5  
ATOM 9179  H HB3  . SER A 1 114 ? 17.851  -2.386  -14.118 1.00 0.00 ? 114 SER A HB3  5  
ATOM 9180  H HG   . SER A 1 114 ? 16.399  -2.691  -12.491 1.00 0.00 ? 114 SER A HG   5  
ATOM 9181  N N    . GLY A 1 115 ? 14.932  -4.980  -16.062 1.00 0.00 ? 115 GLY A N    5  
ATOM 9182  C CA   . GLY A 1 115 ? 13.945  -6.043  -16.024 1.00 0.00 ? 115 GLY A CA   5  
ATOM 9183  C C    . GLY A 1 115 ? 14.525  -7.356  -15.538 1.00 0.00 ? 115 GLY A C    5  
ATOM 9184  O O    . GLY A 1 115 ? 15.559  -7.394  -14.871 1.00 0.00 ? 115 GLY A O    5  
ATOM 9185  H H    . GLY A 1 115 ? 15.520  -4.888  -16.841 1.00 0.00 ? 115 GLY A H    5  
ATOM 9186  H HA2  . GLY A 1 115 ? 13.142  -5.750  -15.364 1.00 0.00 ? 115 GLY A HA2  5  
ATOM 9187  H HA3  . GLY A 1 115 ? 13.547  -6.185  -17.018 1.00 0.00 ? 115 GLY A HA3  5  
ATOM 9188  N N    . PRO A 1 116 ? 13.850  -8.466  -15.873 1.00 0.00 ? 116 PRO A N    5  
ATOM 9189  C CA   . PRO A 1 116 ? 14.285  -9.808  -15.475 1.00 0.00 ? 116 PRO A CA   5  
ATOM 9190  C C    . PRO A 1 116 ? 15.555  -10.243 -16.199 1.00 0.00 ? 116 PRO A C    5  
ATOM 9191  O O    . PRO A 1 116 ? 15.697  -10.033 -17.404 1.00 0.00 ? 116 PRO A O    5  
ATOM 9192  C CB   . PRO A 1 116 ? 13.107  -10.697 -15.879 1.00 0.00 ? 116 PRO A CB   5  
ATOM 9193  C CG   . PRO A 1 116 ? 12.433  -9.955  -16.981 1.00 0.00 ? 116 PRO A CG   5  
ATOM 9194  C CD   . PRO A 1 116 ? 12.610  -8.496  -16.666 1.00 0.00 ? 116 PRO A CD   5  
ATOM 9195  H HA   . PRO A 1 116 ? 14.440  -9.875  -14.408 1.00 0.00 ? 116 PRO A HA   5  
ATOM 9196  H HB2  . PRO A 1 116 ? 13.476  -11.656 -16.216 1.00 0.00 ? 116 PRO A HB2  5  
ATOM 9197  H HB3  . PRO A 1 116 ? 12.449  -10.835 -15.035 1.00 0.00 ? 116 PRO A HB3  5  
ATOM 9198  H HG2  . PRO A 1 116 ? 12.899  -10.195 -17.924 1.00 0.00 ? 116 PRO A HG2  5  
ATOM 9199  H HG3  . PRO A 1 116 ? 11.383  -10.209 -17.005 1.00 0.00 ? 116 PRO A HG3  5  
ATOM 9200  H HD2  . PRO A 1 116 ? 12.720  -7.924  -17.575 1.00 0.00 ? 116 PRO A HD2  5  
ATOM 9201  H HD3  . PRO A 1 116 ? 11.774  -8.130  -16.087 1.00 0.00 ? 116 PRO A HD3  5  
ATOM 9202  N N    . SER A 1 117 ? 16.475  -10.852 -15.457 1.00 0.00 ? 117 SER A N    5  
ATOM 9203  C CA   . SER A 1 117 ? 17.734  -11.314 -16.029 1.00 0.00 ? 117 SER A CA   5  
ATOM 9204  C C    . SER A 1 117 ? 18.033  -12.747 -15.598 1.00 0.00 ? 117 SER A C    5  
ATOM 9205  O O    . SER A 1 117 ? 18.613  -12.980 -14.537 1.00 0.00 ? 117 SER A O    5  
ATOM 9206  C CB   . SER A 1 117 ? 18.880  -10.393 -15.605 1.00 0.00 ? 117 SER A CB   5  
ATOM 9207  O OG   . SER A 1 117 ? 19.007  -9.296  -16.493 1.00 0.00 ? 117 SER A OG   5  
ATOM 9208  H H    . SER A 1 117 ? 16.303  -10.990 -14.502 1.00 0.00 ? 117 SER A H    5  
ATOM 9209  H HA   . SER A 1 117 ? 17.640  -11.286 -17.104 1.00 0.00 ? 117 SER A HA   5  
ATOM 9210  H HB2  . SER A 1 117 ? 18.687  -10.016 -14.612 1.00 0.00 ? 117 SER A HB2  5  
ATOM 9211  H HB3  . SER A 1 117 ? 19.805  -10.950 -15.605 1.00 0.00 ? 117 SER A HB3  5  
ATOM 9212  H HG   . SER A 1 117 ? 19.453  -8.572  -16.046 1.00 0.00 ? 117 SER A HG   5  
ATOM 9213  N N    . SER A 1 118 ? 17.632  -13.704 -16.428 1.00 0.00 ? 118 SER A N    5  
ATOM 9214  C CA   . SER A 1 118 ? 17.852  -15.115 -16.133 1.00 0.00 ? 118 SER A CA   5  
ATOM 9215  C C    . SER A 1 118 ? 17.549  -15.979 -17.353 1.00 0.00 ? 118 SER A C    5  
ATOM 9216  O O    . SER A 1 118 ? 16.807  -15.574 -18.246 1.00 0.00 ? 118 SER A O    5  
ATOM 9217  C CB   . SER A 1 118 ? 16.980  -15.553 -14.954 1.00 0.00 ? 118 SER A CB   5  
ATOM 9218  O OG   . SER A 1 118 ? 17.441  -16.776 -14.406 1.00 0.00 ? 118 SER A OG   5  
ATOM 9219  H H    . SER A 1 118 ? 17.174  -13.455 -17.259 1.00 0.00 ? 118 SER A H    5  
ATOM 9220  H HA   . SER A 1 118 ? 18.891  -15.239 -15.867 1.00 0.00 ? 118 SER A HA   5  
ATOM 9221  H HB2  . SER A 1 118 ? 17.010  -14.794 -14.186 1.00 0.00 ? 118 SER A HB2  5  
ATOM 9222  H HB3  . SER A 1 118 ? 15.962  -15.683 -15.292 1.00 0.00 ? 118 SER A HB3  5  
ATOM 9223  H HG   . SER A 1 118 ? 18.381  -16.869 -14.575 1.00 0.00 ? 118 SER A HG   5  
ATOM 9224  N N    . GLY A 1 119 ? 18.130  -17.175 -17.383 1.00 0.00 ? 119 GLY A N    5  
ATOM 9225  C CA   . GLY A 1 119 ? 17.911  -18.078 -18.497 1.00 0.00 ? 119 GLY A CA   5  
ATOM 9226  C C    . GLY A 1 119 ? 18.494  -19.456 -18.249 1.00 0.00 ? 119 GLY A C    5  
ATOM 9227  O O    . GLY A 1 119 ? 18.272  -20.381 -19.030 1.00 0.00 ? 119 GLY A O    5  
ATOM 9228  H H    . GLY A 1 119 ? 18.713  -17.445 -16.642 1.00 0.00 ? 119 GLY A H    5  
ATOM 9229  H HA2  . GLY A 1 119 ? 16.849  -18.173 -18.666 1.00 0.00 ? 119 GLY A HA2  5  
ATOM 9230  H HA3  . GLY A 1 119 ? 18.371  -17.660 -19.380 1.00 0.00 ? 119 GLY A HA3  5  
ATOM 9231  N N    . GLY A 1 1   ? -0.250  -26.922 -8.442  1.00 0.00 ? 1   GLY A N    6  
ATOM 9232  C CA   . GLY A 1 1   ? 0.022   -26.643 -9.840  1.00 0.00 ? 1   GLY A CA   6  
ATOM 9233  C C    . GLY A 1 1   ? 1.335   -27.240 -10.305 1.00 0.00 ? 1   GLY A C    6  
ATOM 9234  O O    . GLY A 1 1   ? 1.490   -28.461 -10.349 1.00 0.00 ? 1   GLY A O    6  
ATOM 9235  H H1   . GLY A 1 1   ? -0.227  -27.846 -8.115  1.00 0.00 ? 1   GLY A H1   6  
ATOM 9236  H HA2  . GLY A 1 1   ? -0.779  -27.050 -10.440 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 9237  H HA3  . GLY A 1 1   ? 0.056   -25.573 -9.982  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 9238  N N    . SER A 1 2   ? 2.284   -26.378 -10.656 1.00 0.00 ? 2   SER A N    6  
ATOM 9239  C CA   . SER A 1 2   ? 3.589   -26.827 -11.126 1.00 0.00 ? 2   SER A CA   6  
ATOM 9240  C C    . SER A 1 2   ? 3.442   -27.945 -12.154 1.00 0.00 ? 2   SER A C    6  
ATOM 9241  O O    . SER A 1 2   ? 4.178   -28.931 -12.125 1.00 0.00 ? 2   SER A O    6  
ATOM 9242  C CB   . SER A 1 2   ? 4.440   -27.310 -9.950  1.00 0.00 ? 2   SER A CB   6  
ATOM 9243  O OG   . SER A 1 2   ? 5.823   -27.201 -10.241 1.00 0.00 ? 2   SER A OG   6  
ATOM 9244  H H    . SER A 1 2   ? 2.100   -25.417 -10.600 1.00 0.00 ? 2   SER A H    6  
ATOM 9245  H HA   . SER A 1 2   ? 4.081   -25.987 -11.593 1.00 0.00 ? 2   SER A HA   6  
ATOM 9246  H HB2  . SER A 1 2   ? 4.220   -26.710 -9.080  1.00 0.00 ? 2   SER A HB2  6  
ATOM 9247  H HB3  . SER A 1 2   ? 4.208   -28.344 -9.742  1.00 0.00 ? 2   SER A HB3  6  
ATOM 9248  H HG   . SER A 1 2   ? 6.009   -27.639 -11.075 1.00 0.00 ? 2   SER A HG   6  
ATOM 9249  N N    . SER A 1 3   ? 2.485   -27.783 -13.062 1.00 0.00 ? 3   SER A N    6  
ATOM 9250  C CA   . SER A 1 3   ? 2.236   -28.779 -14.097 1.00 0.00 ? 3   SER A CA   6  
ATOM 9251  C C    . SER A 1 3   ? 2.452   -28.185 -15.486 1.00 0.00 ? 3   SER A C    6  
ATOM 9252  O O    . SER A 1 3   ? 1.839   -27.181 -15.846 1.00 0.00 ? 3   SER A O    6  
ATOM 9253  C CB   . SER A 1 3   ? 0.812   -29.324 -13.979 1.00 0.00 ? 3   SER A CB   6  
ATOM 9254  O OG   . SER A 1 3   ? 0.637   -30.473 -14.790 1.00 0.00 ? 3   SER A OG   6  
ATOM 9255  H H    . SER A 1 3   ? 1.931   -26.974 -13.033 1.00 0.00 ? 3   SER A H    6  
ATOM 9256  H HA   . SER A 1 3   ? 2.936   -29.589 -13.953 1.00 0.00 ? 3   SER A HA   6  
ATOM 9257  H HB2  . SER A 1 3   ? 0.615   -29.590 -12.952 1.00 0.00 ? 3   SER A HB2  6  
ATOM 9258  H HB3  . SER A 1 3   ? 0.111   -28.565 -14.295 1.00 0.00 ? 3   SER A HB3  6  
ATOM 9259  H HG   . SER A 1 3   ? -0.208  -30.420 -15.243 1.00 0.00 ? 3   SER A HG   6  
ATOM 9260  N N    . GLY A 1 4   ? 3.329   -28.813 -16.262 1.00 0.00 ? 4   GLY A N    6  
ATOM 9261  C CA   . GLY A 1 4   ? 3.611   -28.333 -17.603 1.00 0.00 ? 4   GLY A CA   6  
ATOM 9262  C C    . GLY A 1 4   ? 4.934   -27.599 -17.689 1.00 0.00 ? 4   GLY A C    6  
ATOM 9263  O O    . GLY A 1 4   ? 5.542   -27.279 -16.667 1.00 0.00 ? 4   GLY A O    6  
ATOM 9264  H H    . GLY A 1 4   ? 3.789   -29.610 -15.922 1.00 0.00 ? 4   GLY A H    6  
ATOM 9265  H HA2  . GLY A 1 4   ? 3.634   -29.176 -18.278 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 9266  H HA3  . GLY A 1 4   ? 2.820   -27.663 -17.906 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 9267  N N    . SER A 1 5   ? 5.383   -27.332 -18.911 1.00 0.00 ? 5   SER A N    6  
ATOM 9268  C CA   . SER A 1 5   ? 6.645   -26.636 -19.127 1.00 0.00 ? 5   SER A CA   6  
ATOM 9269  C C    . SER A 1 5   ? 6.823   -25.507 -18.116 1.00 0.00 ? 5   SER A C    6  
ATOM 9270  O O    . SER A 1 5   ? 5.857   -25.044 -17.510 1.00 0.00 ? 5   SER A O    6  
ATOM 9271  C CB   . SER A 1 5   ? 6.706   -26.075 -20.550 1.00 0.00 ? 5   SER A CB   6  
ATOM 9272  O OG   . SER A 1 5   ? 7.131   -27.065 -21.470 1.00 0.00 ? 5   SER A OG   6  
ATOM 9273  H H    . SER A 1 5   ? 4.853   -27.613 -19.687 1.00 0.00 ? 5   SER A H    6  
ATOM 9274  H HA   . SER A 1 5   ? 7.445   -27.350 -18.997 1.00 0.00 ? 5   SER A HA   6  
ATOM 9275  H HB2  . SER A 1 5   ? 5.726   -25.728 -20.839 1.00 0.00 ? 5   SER A HB2  6  
ATOM 9276  H HB3  . SER A 1 5   ? 7.403   -25.250 -20.579 1.00 0.00 ? 5   SER A HB3  6  
ATOM 9277  H HG   . SER A 1 5   ? 6.914   -27.935 -21.128 1.00 0.00 ? 5   SER A HG   6  
ATOM 9278  N N    . SER A 1 6   ? 8.066   -25.071 -17.938 1.00 0.00 ? 6   SER A N    6  
ATOM 9279  C CA   . SER A 1 6   ? 8.373   -24.000 -16.998 1.00 0.00 ? 6   SER A CA   6  
ATOM 9280  C C    . SER A 1 6   ? 8.259   -22.636 -17.672 1.00 0.00 ? 6   SER A C    6  
ATOM 9281  O O    . SER A 1 6   ? 9.066   -22.287 -18.533 1.00 0.00 ? 6   SER A O    6  
ATOM 9282  C CB   . SER A 1 6   ? 9.780   -24.183 -16.425 1.00 0.00 ? 6   SER A CB   6  
ATOM 9283  O OG   . SER A 1 6   ? 10.738  -24.319 -17.460 1.00 0.00 ? 6   SER A OG   6  
ATOM 9284  H H    . SER A 1 6   ? 8.794   -25.481 -18.451 1.00 0.00 ? 6   SER A H    6  
ATOM 9285  H HA   . SER A 1 6   ? 7.656   -24.051 -16.192 1.00 0.00 ? 6   SER A HA   6  
ATOM 9286  H HB2  . SER A 1 6   ? 10.036  -23.323 -15.825 1.00 0.00 ? 6   SER A HB2  6  
ATOM 9287  H HB3  . SER A 1 6   ? 9.803   -25.071 -15.810 1.00 0.00 ? 6   SER A HB3  6  
ATOM 9288  H HG   . SER A 1 6   ? 11.588  -24.556 -17.082 1.00 0.00 ? 6   SER A HG   6  
ATOM 9289  N N    . GLY A 1 7   ? 7.251   -21.867 -17.272 1.00 0.00 ? 7   GLY A N    6  
ATOM 9290  C CA   . GLY A 1 7   ? 7.049   -20.550 -17.847 1.00 0.00 ? 7   GLY A CA   6  
ATOM 9291  C C    . GLY A 1 7   ? 6.155   -19.674 -16.990 1.00 0.00 ? 7   GLY A C    6  
ATOM 9292  O O    . GLY A 1 7   ? 5.226   -20.164 -16.348 1.00 0.00 ? 7   GLY A O    6  
ATOM 9293  H H    . GLY A 1 7   ? 6.639   -22.197 -16.581 1.00 0.00 ? 7   GLY A H    6  
ATOM 9294  H HA2  . GLY A 1 7   ? 8.008   -20.067 -17.959 1.00 0.00 ? 7   GLY A HA2  6  
ATOM 9295  H HA3  . GLY A 1 7   ? 6.596   -20.661 -18.821 1.00 0.00 ? 7   GLY A HA3  6  
ATOM 9296  N N    . ARG A 1 8   ? 6.438   -18.376 -16.979 1.00 0.00 ? 8   ARG A N    6  
ATOM 9297  C CA   . ARG A 1 8   ? 5.654   -17.431 -16.192 1.00 0.00 ? 8   ARG A CA   6  
ATOM 9298  C C    . ARG A 1 8   ? 4.916   -16.450 -17.098 1.00 0.00 ? 8   ARG A C    6  
ATOM 9299  O O    . ARG A 1 8   ? 5.519   -15.536 -17.661 1.00 0.00 ? 8   ARG A O    6  
ATOM 9300  C CB   . ARG A 1 8   ? 6.560   -16.666 -15.225 1.00 0.00 ? 8   ARG A CB   6  
ATOM 9301  C CG   . ARG A 1 8   ? 7.043   -17.503 -14.052 1.00 0.00 ? 8   ARG A CG   6  
ATOM 9302  C CD   . ARG A 1 8   ? 7.734   -16.645 -13.003 1.00 0.00 ? 8   ARG A CD   6  
ATOM 9303  N NE   . ARG A 1 8   ? 6.903   -15.519 -12.583 1.00 0.00 ? 8   ARG A NE   6  
ATOM 9304  C CZ   . ARG A 1 8   ? 7.359   -14.498 -11.867 1.00 0.00 ? 8   ARG A CZ   6  
ATOM 9305  N NH1  . ARG A 1 8   ? 8.630   -14.460 -11.493 1.00 0.00 ? 8   ARG A NH1  6  
ATOM 9306  N NH2  . ARG A 1 8   ? 6.541   -13.510 -11.523 1.00 0.00 ? 8   ARG A NH2  6  
ATOM 9307  H H    . ARG A 1 8   ? 7.191   -18.045 -17.511 1.00 0.00 ? 8   ARG A H    6  
ATOM 9308  H HA   . ARG A 1 8   ? 4.929   -17.993 -15.624 1.00 0.00 ? 8   ARG A HA   6  
ATOM 9309  H HB2  . ARG A 1 8   ? 7.425   -16.310 -15.765 1.00 0.00 ? 8   ARG A HB2  6  
ATOM 9310  H HB3  . ARG A 1 8   ? 6.016   -15.819 -14.836 1.00 0.00 ? 8   ARG A HB3  6  
ATOM 9311  H HG2  . ARG A 1 8   ? 6.194   -17.993 -13.598 1.00 0.00 ? 8   ARG A HG2  6  
ATOM 9312  H HG3  . ARG A 1 8   ? 7.739   -18.245 -14.414 1.00 0.00 ? 8   ARG A HG3  6  
ATOM 9313  H HD2  . ARG A 1 8   ? 7.952   -17.259 -12.142 1.00 0.00 ? 8   ARG A HD2  6  
ATOM 9314  H HD3  . ARG A 1 8   ? 8.655   -16.266 -13.418 1.00 0.00 ? 8   ARG A HD3  6  
ATOM 9315  H HE   . ARG A 1 8   ? 5.960   -15.527 -12.848 1.00 0.00 ? 8   ARG A HE   6  
ATOM 9316  H HH11 . ARG A 1 8   ? 9.248   -15.202 -11.751 1.00 0.00 ? 8   ARG A HH11 6  
ATOM 9317  H HH12 . ARG A 1 8   ? 8.971   -13.689 -10.955 1.00 0.00 ? 8   ARG A HH12 6  
ATOM 9318  H HH21 . ARG A 1 8   ? 5.582   -13.535 -11.803 1.00 0.00 ? 8   ARG A HH21 6  
ATOM 9319  H HH22 . ARG A 1 8   ? 6.885   -12.742 -10.984 1.00 0.00 ? 8   ARG A HH22 6  
ATOM 9320  N N    . GLU A 1 9   ? 3.608   -16.647 -17.235 1.00 0.00 ? 9   GLU A N    6  
ATOM 9321  C CA   . GLU A 1 9   ? 2.789   -15.780 -18.073 1.00 0.00 ? 9   GLU A CA   6  
ATOM 9322  C C    . GLU A 1 9   ? 2.781   -14.352 -17.536 1.00 0.00 ? 9   GLU A C    6  
ATOM 9323  O O    . GLU A 1 9   ? 3.383   -14.064 -16.502 1.00 0.00 ? 9   GLU A O    6  
ATOM 9324  C CB   . GLU A 1 9   ? 1.358   -16.315 -18.153 1.00 0.00 ? 9   GLU A CB   6  
ATOM 9325  C CG   . GLU A 1 9   ? 0.601   -16.226 -16.838 1.00 0.00 ? 9   GLU A CG   6  
ATOM 9326  C CD   . GLU A 1 9   ? -0.708  -16.990 -16.866 1.00 0.00 ? 9   GLU A CD   6  
ATOM 9327  O OE1  . GLU A 1 9   ? -0.784  -18.010 -17.583 1.00 0.00 ? 9   GLU A OE1  6  
ATOM 9328  O OE2  . GLU A 1 9   ? -1.657  -16.569 -16.171 1.00 0.00 ? 9   GLU A OE2  6  
ATOM 9329  H H    . GLU A 1 9   ? 3.185   -17.393 -16.760 1.00 0.00 ? 9   GLU A H    6  
ATOM 9330  H HA   . GLU A 1 9   ? 3.218   -15.776 -19.064 1.00 0.00 ? 9   GLU A HA   6  
ATOM 9331  H HB2  . GLU A 1 9   ? 0.816   -15.749 -18.896 1.00 0.00 ? 9   GLU A HB2  6  
ATOM 9332  H HB3  . GLU A 1 9   ? 1.390   -17.351 -18.456 1.00 0.00 ? 9   GLU A HB3  6  
ATOM 9333  H HG2  . GLU A 1 9   ? 1.221   -16.632 -16.053 1.00 0.00 ? 9   GLU A HG2  6  
ATOM 9334  H HG3  . GLU A 1 9   ? 0.390   -15.187 -16.628 1.00 0.00 ? 9   GLU A HG3  6  
ATOM 9335  N N    . GLU A 1 10  ? 2.096   -13.462 -18.247 1.00 0.00 ? 10  GLU A N    6  
ATOM 9336  C CA   . GLU A 1 10  ? 2.011   -12.064 -17.842 1.00 0.00 ? 10  GLU A CA   6  
ATOM 9337  C C    . GLU A 1 10  ? 0.610   -11.727 -17.339 1.00 0.00 ? 10  GLU A C    6  
ATOM 9338  O O    . GLU A 1 10  ? -0.351  -11.713 -18.110 1.00 0.00 ? 10  GLU A O    6  
ATOM 9339  C CB   . GLU A 1 10  ? 2.379   -11.148 -19.011 1.00 0.00 ? 10  GLU A CB   6  
ATOM 9340  C CG   . GLU A 1 10  ? 3.812   -11.317 -19.488 1.00 0.00 ? 10  GLU A CG   6  
ATOM 9341  C CD   . GLU A 1 10  ? 4.230   -10.241 -20.471 1.00 0.00 ? 10  GLU A CD   6  
ATOM 9342  O OE1  . GLU A 1 10  ? 3.423   -9.905  -21.363 1.00 0.00 ? 10  GLU A OE1  6  
ATOM 9343  O OE2  . GLU A 1 10  ? 5.365   -9.735  -20.349 1.00 0.00 ? 10  GLU A OE2  6  
ATOM 9344  H H    . GLU A 1 10  ? 1.637   -13.753 -19.062 1.00 0.00 ? 10  GLU A H    6  
ATOM 9345  H HA   . GLU A 1 10  ? 2.715   -11.908 -17.039 1.00 0.00 ? 10  GLU A HA   6  
ATOM 9346  H HB2  . GLU A 1 10  ? 1.718   -11.357 -19.839 1.00 0.00 ? 10  GLU A HB2  6  
ATOM 9347  H HB3  . GLU A 1 10  ? 2.243   -10.121 -18.704 1.00 0.00 ? 10  GLU A HB3  6  
ATOM 9348  H HG2  . GLU A 1 10  ? 4.470   -11.276 -18.633 1.00 0.00 ? 10  GLU A HG2  6  
ATOM 9349  H HG3  . GLU A 1 10  ? 3.907   -12.280 -19.968 1.00 0.00 ? 10  GLU A HG3  6  
ATOM 9350  N N    . ASP A 1 11  ? 0.501   -11.457 -16.043 1.00 0.00 ? 11  ASP A N    6  
ATOM 9351  C CA   . ASP A 1 11  ? -0.781  -11.120 -15.437 1.00 0.00 ? 11  ASP A CA   6  
ATOM 9352  C C    . ASP A 1 11  ? -1.001  -9.610  -15.434 1.00 0.00 ? 11  ASP A C    6  
ATOM 9353  O O    . ASP A 1 11  ? -0.071  -8.824  -15.253 1.00 0.00 ? 11  ASP A O    6  
ATOM 9354  C CB   . ASP A 1 11  ? -0.853  -11.661 -14.008 1.00 0.00 ? 11  ASP A CB   6  
ATOM 9355  C CG   . ASP A 1 11  ? -1.110  -13.155 -13.968 1.00 0.00 ? 11  ASP A CG   6  
ATOM 9356  O OD1  . ASP A 1 11  ? -2.254  -13.568 -14.249 1.00 0.00 ? 11  ASP A OD1  6  
ATOM 9357  O OD2  . ASP A 1 11  ? -0.166  -13.911 -13.655 1.00 0.00 ? 11  ASP A OD2  6  
ATOM 9358  H H    . ASP A 1 11  ? 1.304   -11.485 -15.481 1.00 0.00 ? 11  ASP A H    6  
ATOM 9359  H HA   . ASP A 1 11  ? -1.559  -11.582 -16.027 1.00 0.00 ? 11  ASP A HA   6  
ATOM 9360  H HB2  . ASP A 1 11  ? 0.084   -11.463 -13.508 1.00 0.00 ? 11  ASP A HB2  6  
ATOM 9361  H HB3  . ASP A 1 11  ? -1.652  -11.162 -13.481 1.00 0.00 ? 11  ASP A HB3  6  
ATOM 9362  N N    . PRO A 1 12  ? -2.259  -9.194  -15.638 1.00 0.00 ? 12  PRO A N    6  
ATOM 9363  C CA   . PRO A 1 12  ? -2.630  -7.776  -15.664 1.00 0.00 ? 12  PRO A CA   6  
ATOM 9364  C C    . PRO A 1 12  ? -2.535  -7.127  -14.287 1.00 0.00 ? 12  PRO A C    6  
ATOM 9365  O O    . PRO A 1 12  ? -2.058  -6.000  -14.152 1.00 0.00 ? 12  PRO A O    6  
ATOM 9366  C CB   . PRO A 1 12  ? -4.082  -7.798  -16.146 1.00 0.00 ? 12  PRO A CB   6  
ATOM 9367  C CG   . PRO A 1 12  ? -4.591  -9.142  -15.756 1.00 0.00 ? 12  PRO A CG   6  
ATOM 9368  C CD   . PRO A 1 12  ? -3.417  -10.076 -15.860 1.00 0.00 ? 12  PRO A CD   6  
ATOM 9369  H HA   . PRO A 1 12  ? -2.024  -7.220  -16.365 1.00 0.00 ? 12  PRO A HA   6  
ATOM 9370  H HB2  . PRO A 1 12  ? -4.638  -7.008  -15.661 1.00 0.00 ? 12  PRO A HB2  6  
ATOM 9371  H HB3  . PRO A 1 12  ? -4.112  -7.661  -17.217 1.00 0.00 ? 12  PRO A HB3  6  
ATOM 9372  H HG2  . PRO A 1 12  ? -4.959  -9.115  -14.741 1.00 0.00 ? 12  PRO A HG2  6  
ATOM 9373  H HG3  . PRO A 1 12  ? -5.375  -9.449  -16.433 1.00 0.00 ? 12  PRO A HG3  6  
ATOM 9374  H HD2  . PRO A 1 12  ? -3.473  -10.839 -15.098 1.00 0.00 ? 12  PRO A HD2  6  
ATOM 9375  H HD3  . PRO A 1 12  ? -3.378  -10.524 -16.843 1.00 0.00 ? 12  PRO A HD3  6  
ATOM 9376  N N    . HIS A 1 13  ? -2.993  -7.846  -13.267 1.00 0.00 ? 13  HIS A N    6  
ATOM 9377  C CA   . HIS A 1 13  ? -2.959  -7.340  -11.899 1.00 0.00 ? 13  HIS A CA   6  
ATOM 9378  C C    . HIS A 1 13  ? -1.525  -7.068  -11.456 1.00 0.00 ? 13  HIS A C    6  
ATOM 9379  O O    . HIS A 1 13  ? -1.289  -6.296  -10.528 1.00 0.00 ? 13  HIS A O    6  
ATOM 9380  C CB   . HIS A 1 13  ? -3.619  -8.338  -10.947 1.00 0.00 ? 13  HIS A CB   6  
ATOM 9381  C CG   . HIS A 1 13  ? -3.779  -7.818  -9.552  1.00 0.00 ? 13  HIS A CG   6  
ATOM 9382  N ND1  . HIS A 1 13  ? -3.271  -8.464  -8.445  1.00 0.00 ? 13  HIS A ND1  6  
ATOM 9383  C CD2  . HIS A 1 13  ? -4.395  -6.706  -9.087  1.00 0.00 ? 13  HIS A CD2  6  
ATOM 9384  C CE1  . HIS A 1 13  ? -3.568  -7.773  -7.359  1.00 0.00 ? 13  HIS A CE1  6  
ATOM 9385  N NE2  . HIS A 1 13  ? -4.250  -6.701  -7.721  1.00 0.00 ? 13  HIS A NE2  6  
ATOM 9386  H H    . HIS A 1 13  ? -3.362  -8.737  -13.438 1.00 0.00 ? 13  HIS A H    6  
ATOM 9387  H HA   . HIS A 1 13  ? -3.512  -6.413  -11.875 1.00 0.00 ? 13  HIS A HA   6  
ATOM 9388  H HB2  . HIS A 1 13  ? -4.600  -8.589  -11.322 1.00 0.00 ? 13  HIS A HB2  6  
ATOM 9389  H HB3  . HIS A 1 13  ? -3.016  -9.234  -10.901 1.00 0.00 ? 13  HIS A HB3  6  
ATOM 9390  H HD1  . HIS A 1 13  ? -2.769  -9.305  -8.453  1.00 0.00 ? 13  HIS A HD1  6  
ATOM 9391  H HD2  . HIS A 1 13  ? -4.906  -5.960  -9.679  1.00 0.00 ? 13  HIS A HD2  6  
ATOM 9392  H HE1  . HIS A 1 13  ? -3.300  -8.038  -6.347  1.00 0.00 ? 13  HIS A HE1  6  
ATOM 9393  N N    . GLU A 1 14  ? -0.572  -7.707  -12.127 1.00 0.00 ? 14  GLU A N    6  
ATOM 9394  C CA   . GLU A 1 14  ? 0.839   -7.535  -11.800 1.00 0.00 ? 14  GLU A CA   6  
ATOM 9395  C C    . GLU A 1 14  ? 1.469   -6.448  -12.667 1.00 0.00 ? 14  GLU A C    6  
ATOM 9396  O O    . GLU A 1 14  ? 2.678   -6.227  -12.623 1.00 0.00 ? 14  GLU A O    6  
ATOM 9397  C CB   . GLU A 1 14  ? 1.594   -8.852  -11.987 1.00 0.00 ? 14  GLU A CB   6  
ATOM 9398  C CG   . GLU A 1 14  ? 1.088   -9.975  -11.097 1.00 0.00 ? 14  GLU A CG   6  
ATOM 9399  C CD   . GLU A 1 14  ? 1.687   -9.930  -9.704  1.00 0.00 ? 14  GLU A CD   6  
ATOM 9400  O OE1  . GLU A 1 14  ? 1.123   -9.228  -8.839  1.00 0.00 ? 14  GLU A OE1  6  
ATOM 9401  O OE2  . GLU A 1 14  ? 2.719   -10.596 -9.480  1.00 0.00 ? 14  GLU A OE2  6  
ATOM 9402  H H    . GLU A 1 14  ? -0.823  -8.310  -12.858 1.00 0.00 ? 14  GLU A H    6  
ATOM 9403  H HA   . GLU A 1 14  ? 0.905   -7.236  -10.765 1.00 0.00 ? 14  GLU A HA   6  
ATOM 9404  H HB2  . GLU A 1 14  ? 1.498   -9.165  -13.016 1.00 0.00 ? 14  GLU A HB2  6  
ATOM 9405  H HB3  . GLU A 1 14  ? 2.638   -8.689  -11.766 1.00 0.00 ? 14  GLU A HB3  6  
ATOM 9406  H HG2  . GLU A 1 14  ? 0.014   -9.895  -11.013 1.00 0.00 ? 14  GLU A HG2  6  
ATOM 9407  H HG3  . GLU A 1 14  ? 1.342   -10.921 -11.552 1.00 0.00 ? 14  GLU A HG3  6  
ATOM 9408  N N    . GLY A 1 15  ? 0.638   -5.772  -13.456 1.00 0.00 ? 15  GLY A N    6  
ATOM 9409  C CA   . GLY A 1 15  ? 1.131   -4.718  -14.322 1.00 0.00 ? 15  GLY A CA   6  
ATOM 9410  C C    . GLY A 1 15  ? 0.255   -3.481  -14.287 1.00 0.00 ? 15  GLY A C    6  
ATOM 9411  O O    . GLY A 1 15  ? -0.039  -2.889  -15.325 1.00 0.00 ? 15  GLY A O    6  
ATOM 9412  H H    . GLY A 1 15  ? -0.317  -5.992  -13.449 1.00 0.00 ? 15  GLY A H    6  
ATOM 9413  H HA2  . GLY A 1 15  ? 2.129   -4.448  -14.010 1.00 0.00 ? 15  GLY A HA2  6  
ATOM 9414  H HA3  . GLY A 1 15  ? 1.169   -5.089  -15.336 1.00 0.00 ? 15  GLY A HA3  6  
ATOM 9415  N N    . LYS A 1 16  ? -0.166  -3.090  -13.089 1.00 0.00 ? 16  LYS A N    6  
ATOM 9416  C CA   . LYS A 1 16  ? -1.014  -1.916  -12.921 1.00 0.00 ? 16  LYS A CA   6  
ATOM 9417  C C    . LYS A 1 16  ? -0.175  -0.673  -12.646 1.00 0.00 ? 16  LYS A C    6  
ATOM 9418  O O    . LYS A 1 16  ? 0.946   -0.767  -12.147 1.00 0.00 ? 16  LYS A O    6  
ATOM 9419  C CB   . LYS A 1 16  ? -2.006  -2.138  -11.776 1.00 0.00 ? 16  LYS A CB   6  
ATOM 9420  C CG   . LYS A 1 16  ? -2.601  -3.536  -11.749 1.00 0.00 ? 16  LYS A CG   6  
ATOM 9421  C CD   . LYS A 1 16  ? -3.718  -3.686  -12.768 1.00 0.00 ? 16  LYS A CD   6  
ATOM 9422  C CE   . LYS A 1 16  ? -5.029  -3.118  -12.245 1.00 0.00 ? 16  LYS A CE   6  
ATOM 9423  N NZ   . LYS A 1 16  ? -6.140  -3.303  -13.219 1.00 0.00 ? 16  LYS A NZ   6  
ATOM 9424  H H    . LYS A 1 16  ? 0.102   -3.603  -12.297 1.00 0.00 ? 16  LYS A H    6  
ATOM 9425  H HA   . LYS A 1 16  ? -1.564  -1.770  -13.838 1.00 0.00 ? 16  LYS A HA   6  
ATOM 9426  H HB2  . LYS A 1 16  ? -1.499  -1.967  -10.838 1.00 0.00 ? 16  LYS A HB2  6  
ATOM 9427  H HB3  . LYS A 1 16  ? -2.814  -1.428  -11.874 1.00 0.00 ? 16  LYS A HB3  6  
ATOM 9428  H HG2  . LYS A 1 16  ? -1.825  -4.252  -11.974 1.00 0.00 ? 16  LYS A HG2  6  
ATOM 9429  H HG3  . LYS A 1 16  ? -2.997  -3.729  -10.762 1.00 0.00 ? 16  LYS A HG3  6  
ATOM 9430  H HD2  . LYS A 1 16  ? -3.445  -3.159  -13.670 1.00 0.00 ? 16  LYS A HD2  6  
ATOM 9431  H HD3  . LYS A 1 16  ? -3.853  -4.735  -12.989 1.00 0.00 ? 16  LYS A HD3  6  
ATOM 9432  H HE2  . LYS A 1 16  ? -5.282  -3.621  -11.324 1.00 0.00 ? 16  LYS A HE2  6  
ATOM 9433  H HE3  . LYS A 1 16  ? -4.899  -2.063  -12.056 1.00 0.00 ? 16  LYS A HE3  6  
ATOM 9434  H HZ1  . LYS A 1 16  ? -6.094  -4.253  -13.638 1.00 0.00 ? 16  LYS A HZ1  6  
ATOM 9435  H HZ2  . LYS A 1 16  ? -6.070  -2.597  -13.979 1.00 0.00 ? 16  LYS A HZ2  6  
ATOM 9436  H HZ3  . LYS A 1 16  ? -7.057  -3.191  -12.741 1.00 0.00 ? 16  LYS A HZ3  6  
ATOM 9437  N N    . ILE A 1 17  ? -0.726  0.491   -12.974 1.00 0.00 ? 17  ILE A N    6  
ATOM 9438  C CA   . ILE A 1 17  ? -0.028  1.753   -12.760 1.00 0.00 ? 17  ILE A CA   6  
ATOM 9439  C C    . ILE A 1 17  ? 0.128   2.050   -11.273 1.00 0.00 ? 17  ILE A C    6  
ATOM 9440  O O    . ILE A 1 17  ? 1.136   2.611   -10.844 1.00 0.00 ? 17  ILE A O    6  
ATOM 9441  C CB   . ILE A 1 17  ? -0.767  2.926   -13.431 1.00 0.00 ? 17  ILE A CB   6  
ATOM 9442  C CG1  . ILE A 1 17  ? 0.090   4.193   -13.381 1.00 0.00 ? 17  ILE A CG1  6  
ATOM 9443  C CG2  . ILE A 1 17  ? -2.110  3.161   -12.756 1.00 0.00 ? 17  ILE A CG2  6  
ATOM 9444  C CD1  . ILE A 1 17  ? 0.986   4.363   -14.588 1.00 0.00 ? 17  ILE A CD1  6  
ATOM 9445  H H    . ILE A 1 17  ? -1.622  0.502   -13.369 1.00 0.00 ? 17  ILE A H    6  
ATOM 9446  H HA   . ILE A 1 17  ? 0.953   1.670   -13.205 1.00 0.00 ? 17  ILE A HA   6  
ATOM 9447  H HB   . ILE A 1 17  ? -0.950  2.664   -14.462 1.00 0.00 ? 17  ILE A HB   6  
ATOM 9448  H HG12 . ILE A 1 17  ? -0.556  5.054   -13.324 1.00 0.00 ? 17  ILE A HG12 6  
ATOM 9449  H HG13 . ILE A 1 17  ? 0.717   4.159   -12.503 1.00 0.00 ? 17  ILE A HG13 6  
ATOM 9450  H HG21 . ILE A 1 17  ? -2.816  3.538   -13.481 1.00 0.00 ? 17  ILE A HG21 6  
ATOM 9451  H HG22 . ILE A 1 17  ? -2.476  2.230   -12.350 1.00 0.00 ? 17  ILE A HG22 6  
ATOM 9452  H HG23 . ILE A 1 17  ? -1.992  3.881   -11.960 1.00 0.00 ? 17  ILE A HG23 6  
ATOM 9453  H HD11 . ILE A 1 17  ? 1.884   3.778   -14.455 1.00 0.00 ? 17  ILE A HD11 6  
ATOM 9454  H HD12 . ILE A 1 17  ? 0.466   4.031   -15.473 1.00 0.00 ? 17  ILE A HD12 6  
ATOM 9455  H HD13 . ILE A 1 17  ? 1.250   5.406   -14.695 1.00 0.00 ? 17  ILE A HD13 6  
ATOM 9456  N N    . TRP A 1 18  ? -0.875  1.667   -10.491 1.00 0.00 ? 18  TRP A N    6  
ATOM 9457  C CA   . TRP A 1 18  ? -0.848  1.890   -9.050  1.00 0.00 ? 18  TRP A CA   6  
ATOM 9458  C C    . TRP A 1 18  ? -0.066  0.788   -8.342  1.00 0.00 ? 18  TRP A C    6  
ATOM 9459  O O    . TRP A 1 18  ? 0.567   1.026   -7.314  1.00 0.00 ? 18  TRP A O    6  
ATOM 9460  C CB   . TRP A 1 18  ? -2.273  1.957   -8.497  1.00 0.00 ? 18  TRP A CB   6  
ATOM 9461  C CG   . TRP A 1 18  ? -3.117  0.781   -8.885  1.00 0.00 ? 18  TRP A CG   6  
ATOM 9462  C CD1  . TRP A 1 18  ? -3.984  0.706   -9.937  1.00 0.00 ? 18  TRP A CD1  6  
ATOM 9463  C CD2  . TRP A 1 18  ? -3.174  -0.488  -8.225  1.00 0.00 ? 18  TRP A CD2  6  
ATOM 9464  N NE1  . TRP A 1 18  ? -4.578  -0.532  -9.971  1.00 0.00 ? 18  TRP A NE1  6  
ATOM 9465  C CE2  . TRP A 1 18  ? -4.097  -1.284  -8.931  1.00 0.00 ? 18  TRP A CE2  6  
ATOM 9466  C CE3  . TRP A 1 18  ? -2.534  -1.030  -7.107  1.00 0.00 ? 18  TRP A CE3  6  
ATOM 9467  C CZ2  . TRP A 1 18  ? -4.394  -2.591  -8.554  1.00 0.00 ? 18  TRP A CZ2  6  
ATOM 9468  C CZ3  . TRP A 1 18  ? -2.831  -2.327  -6.734  1.00 0.00 ? 18  TRP A CZ3  6  
ATOM 9469  C CH2  . TRP A 1 18  ? -3.753  -3.096  -7.456  1.00 0.00 ? 18  TRP A CH2  6  
ATOM 9470  H H    . TRP A 1 18  ? -1.652  1.223   -10.892 1.00 0.00 ? 18  TRP A H    6  
ATOM 9471  H HA   . TRP A 1 18  ? -0.357  2.835   -8.871  1.00 0.00 ? 18  TRP A HA   6  
ATOM 9472  H HB2  . TRP A 1 18  ? -2.232  1.996   -7.419  1.00 0.00 ? 18  TRP A HB2  6  
ATOM 9473  H HB3  . TRP A 1 18  ? -2.753  2.850   -8.869  1.00 0.00 ? 18  TRP A HB3  6  
ATOM 9474  H HD1  . TRP A 1 18  ? -4.168  1.512   -10.631 1.00 0.00 ? 18  TRP A HD1  6  
ATOM 9475  H HE1  . TRP A 1 18  ? -5.237  -0.830  -10.633 1.00 0.00 ? 18  TRP A HE1  6  
ATOM 9476  H HE3  . TRP A 1 18  ? -1.820  -0.454  -6.538  1.00 0.00 ? 18  TRP A HE3  6  
ATOM 9477  H HZ2  . TRP A 1 18  ? -5.103  -3.196  -9.100  1.00 0.00 ? 18  TRP A HZ2  6  
ATOM 9478  H HZ3  . TRP A 1 18  ? -2.346  -2.763  -5.872  1.00 0.00 ? 18  TRP A HZ3  6  
ATOM 9479  H HH2  . TRP A 1 18  ? -3.954  -4.104  -7.128  1.00 0.00 ? 18  TRP A HH2  6  
ATOM 9480  N N    . PHE A 1 19  ? -0.114  -0.417  -8.900  1.00 0.00 ? 19  PHE A N    6  
ATOM 9481  C CA   . PHE A 1 19  ? 0.589   -1.556  -8.322  1.00 0.00 ? 19  PHE A CA   6  
ATOM 9482  C C    . PHE A 1 19  ? 2.096   -1.426  -8.527  1.00 0.00 ? 19  PHE A C    6  
ATOM 9483  O O    . PHE A 1 19  ? 2.552   -0.880  -9.533  1.00 0.00 ? 19  PHE A O    6  
ATOM 9484  C CB   . PHE A 1 19  ? 0.089   -2.861  -8.944  1.00 0.00 ? 19  PHE A CB   6  
ATOM 9485  C CG   . PHE A 1 19  ? 0.738   -4.087  -8.368  1.00 0.00 ? 19  PHE A CG   6  
ATOM 9486  C CD1  . PHE A 1 19  ? 0.605   -4.390  -7.022  1.00 0.00 ? 19  PHE A CD1  6  
ATOM 9487  C CD2  . PHE A 1 19  ? 1.481   -4.936  -9.172  1.00 0.00 ? 19  PHE A CD2  6  
ATOM 9488  C CE1  . PHE A 1 19  ? 1.203   -5.517  -6.490  1.00 0.00 ? 19  PHE A CE1  6  
ATOM 9489  C CE2  . PHE A 1 19  ? 2.080   -6.065  -8.645  1.00 0.00 ? 19  PHE A CE2  6  
ATOM 9490  C CZ   . PHE A 1 19  ? 1.940   -6.356  -7.302  1.00 0.00 ? 19  PHE A CZ   6  
ATOM 9491  H H    . PHE A 1 19  ? -0.636  -0.543  -9.720  1.00 0.00 ? 19  PHE A H    6  
ATOM 9492  H HA   . PHE A 1 19  ? 0.382   -1.569  -7.263  1.00 0.00 ? 19  PHE A HA   6  
ATOM 9493  H HB2  . PHE A 1 19  ? -0.976  -2.943  -8.782  1.00 0.00 ? 19  PHE A HB2  6  
ATOM 9494  H HB3  . PHE A 1 19  ? 0.288   -2.845  -10.004 1.00 0.00 ? 19  PHE A HB3  6  
ATOM 9495  H HD1  . PHE A 1 19  ? 0.028   -3.735  -6.386  1.00 0.00 ? 19  PHE A HD1  6  
ATOM 9496  H HD2  . PHE A 1 19  ? 1.591   -4.709  -10.223 1.00 0.00 ? 19  PHE A HD2  6  
ATOM 9497  H HE1  . PHE A 1 19  ? 1.091   -5.743  -5.440  1.00 0.00 ? 19  PHE A HE1  6  
ATOM 9498  H HE2  . PHE A 1 19  ? 2.655   -6.719  -9.284  1.00 0.00 ? 19  PHE A HE2  6  
ATOM 9499  H HZ   . PHE A 1 19  ? 2.407   -7.237  -6.889  1.00 0.00 ? 19  PHE A HZ   6  
ATOM 9500  N N    . HIS A 1 20  ? 2.864   -1.931  -7.567  1.00 0.00 ? 20  HIS A N    6  
ATOM 9501  C CA   . HIS A 1 20  ? 4.319   -1.872  -7.642  1.00 0.00 ? 20  HIS A CA   6  
ATOM 9502  C C    . HIS A 1 20  ? 4.948   -3.075  -6.946  1.00 0.00 ? 20  HIS A C    6  
ATOM 9503  O O    . HIS A 1 20  ? 4.968   -3.153  -5.718  1.00 0.00 ? 20  HIS A O    6  
ATOM 9504  C CB   . HIS A 1 20  ? 4.831   -0.577  -7.011  1.00 0.00 ? 20  HIS A CB   6  
ATOM 9505  C CG   . HIS A 1 20  ? 4.711   0.616   -7.908  1.00 0.00 ? 20  HIS A CG   6  
ATOM 9506  N ND1  . HIS A 1 20  ? 5.674   0.964   -8.831  1.00 0.00 ? 20  HIS A ND1  6  
ATOM 9507  C CD2  . HIS A 1 20  ? 3.731   1.543   -8.022  1.00 0.00 ? 20  HIS A CD2  6  
ATOM 9508  C CE1  . HIS A 1 20  ? 5.293   2.054   -9.473  1.00 0.00 ? 20  HIS A CE1  6  
ATOM 9509  N NE2  . HIS A 1 20  ? 4.117   2.425   -9.001  1.00 0.00 ? 20  HIS A NE2  6  
ATOM 9510  H H    . HIS A 1 20  ? 2.442   -2.353  -6.790  1.00 0.00 ? 20  HIS A H    6  
ATOM 9511  H HA   . HIS A 1 20  ? 4.598   -1.889  -8.685  1.00 0.00 ? 20  HIS A HA   6  
ATOM 9512  H HB2  . HIS A 1 20  ? 4.266   -0.374  -6.113  1.00 0.00 ? 20  HIS A HB2  6  
ATOM 9513  H HB3  . HIS A 1 20  ? 5.874   -0.696  -6.755  1.00 0.00 ? 20  HIS A HB3  6  
ATOM 9514  H HD1  . HIS A 1 20  ? 6.513   0.484   -8.991  1.00 0.00 ? 20  HIS A HD1  6  
ATOM 9515  H HD2  . HIS A 1 20  ? 2.815   1.582   -7.449  1.00 0.00 ? 20  HIS A HD2  6  
ATOM 9516  H HE1  . HIS A 1 20  ? 5.848   2.556   -10.251 1.00 0.00 ? 20  HIS A HE1  6  
ATOM 9517  N N    . GLY A 1 21  ? 5.460   -4.011  -7.739  1.00 0.00 ? 21  GLY A N    6  
ATOM 9518  C CA   . GLY A 1 21  ? 6.082   -5.197  -7.181  1.00 0.00 ? 21  GLY A CA   6  
ATOM 9519  C C    . GLY A 1 21  ? 7.546   -5.316  -7.555  1.00 0.00 ? 21  GLY A C    6  
ATOM 9520  O O    . GLY A 1 21  ? 8.260   -6.174  -7.037  1.00 0.00 ? 21  GLY A O    6  
ATOM 9521  H H    . GLY A 1 21  ? 5.416   -3.895  -8.711  1.00 0.00 ? 21  GLY A H    6  
ATOM 9522  H HA2  . GLY A 1 21  ? 5.998   -5.162  -6.105  1.00 0.00 ? 21  GLY A HA2  6  
ATOM 9523  H HA3  . GLY A 1 21  ? 5.558   -6.069  -7.544  1.00 0.00 ? 21  GLY A HA3  6  
ATOM 9524  N N    . LYS A 1 22  ? 7.995   -4.453  -8.461  1.00 0.00 ? 22  LYS A N    6  
ATOM 9525  C CA   . LYS A 1 22  ? 9.383   -4.464  -8.906  1.00 0.00 ? 22  LYS A CA   6  
ATOM 9526  C C    . LYS A 1 22  ? 10.273  -3.696  -7.934  1.00 0.00 ? 22  LYS A C    6  
ATOM 9527  O O    . LYS A 1 22  ? 11.364  -4.147  -7.588  1.00 0.00 ? 22  LYS A O    6  
ATOM 9528  C CB   . LYS A 1 22  ? 9.496   -3.857  -10.306 1.00 0.00 ? 22  LYS A CB   6  
ATOM 9529  C CG   . LYS A 1 22  ? 9.529   -2.338  -10.310 1.00 0.00 ? 22  LYS A CG   6  
ATOM 9530  C CD   . LYS A 1 22  ? 9.480   -1.783  -11.723 1.00 0.00 ? 22  LYS A CD   6  
ATOM 9531  C CE   . LYS A 1 22  ? 9.755   -0.287  -11.744 1.00 0.00 ? 22  LYS A CE   6  
ATOM 9532  N NZ   . LYS A 1 22  ? 11.028  0.053   -11.050 1.00 0.00 ? 22  LYS A NZ   6  
ATOM 9533  H H    . LYS A 1 22  ? 7.377   -3.792  -8.838  1.00 0.00 ? 22  LYS A H    6  
ATOM 9534  H HA   . LYS A 1 22  ? 9.713   -5.492  -8.941  1.00 0.00 ? 22  LYS A HA   6  
ATOM 9535  H HB2  . LYS A 1 22  ? 10.403  -4.217  -10.770 1.00 0.00 ? 22  LYS A HB2  6  
ATOM 9536  H HB3  . LYS A 1 22  ? 8.649   -4.179  -10.895 1.00 0.00 ? 22  LYS A HB3  6  
ATOM 9537  H HG2  . LYS A 1 22  ? 8.677   -1.968  -9.759  1.00 0.00 ? 22  LYS A HG2  6  
ATOM 9538  H HG3  . LYS A 1 22  ? 10.440  -2.006  -9.833  1.00 0.00 ? 22  LYS A HG3  6  
ATOM 9539  H HD2  . LYS A 1 22  ? 10.227  -2.282  -12.323 1.00 0.00 ? 22  LYS A HD2  6  
ATOM 9540  H HD3  . LYS A 1 22  ? 8.500   -1.966  -12.139 1.00 0.00 ? 22  LYS A HD3  6  
ATOM 9541  H HE2  . LYS A 1 22  ? 9.815   0.041   -12.770 1.00 0.00 ? 22  LYS A HE2  6  
ATOM 9542  H HE3  . LYS A 1 22  ? 8.939   0.222   -11.252 1.00 0.00 ? 22  LYS A HE3  6  
ATOM 9543  H HZ1  . LYS A 1 22  ? 11.789  -0.579  -11.371 1.00 0.00 ? 22  LYS A HZ1  6  
ATOM 9544  H HZ2  . LYS A 1 22  ? 10.914  -0.054  -10.022 1.00 0.00 ? 22  LYS A HZ2  6  
ATOM 9545  H HZ3  . LYS A 1 22  ? 11.296  1.036   -11.258 1.00 0.00 ? 22  LYS A HZ3  6  
ATOM 9546  N N    . ILE A 1 23  ? 9.798   -2.534  -7.497  1.00 0.00 ? 23  ILE A N    6  
ATOM 9547  C CA   . ILE A 1 23  ? 10.549  -1.705  -6.563  1.00 0.00 ? 23  ILE A CA   6  
ATOM 9548  C C    . ILE A 1 23  ? 10.551  -2.315  -5.165  1.00 0.00 ? 23  ILE A C    6  
ATOM 9549  O O    . ILE A 1 23  ? 10.033  -3.411  -4.955  1.00 0.00 ? 23  ILE A O    6  
ATOM 9550  C CB   . ILE A 1 23  ? 9.974   -0.278  -6.488  1.00 0.00 ? 23  ILE A CB   6  
ATOM 9551  C CG1  . ILE A 1 23  ? 8.601   -0.293  -5.814  1.00 0.00 ? 23  ILE A CG1  6  
ATOM 9552  C CG2  . ILE A 1 23  ? 9.881   0.329   -7.880  1.00 0.00 ? 23  ILE A CG2  6  
ATOM 9553  C CD1  . ILE A 1 23  ? 8.173   1.057   -5.284  1.00 0.00 ? 23  ILE A CD1  6  
ATOM 9554  H H    . ILE A 1 23  ? 8.921   -2.228  -7.810  1.00 0.00 ? 23  ILE A H    6  
ATOM 9555  H HA   . ILE A 1 23  ? 11.568  -1.643  -6.918  1.00 0.00 ? 23  ILE A HA   6  
ATOM 9556  H HB   . ILE A 1 23  ? 10.649  0.327   -5.902  1.00 0.00 ? 23  ILE A HB   6  
ATOM 9557  H HG12 . ILE A 1 23  ? 7.860   -0.618  -6.528  1.00 0.00 ? 23  ILE A HG12 6  
ATOM 9558  H HG13 . ILE A 1 23  ? 8.623   -0.985  -4.984  1.00 0.00 ? 23  ILE A HG13 6  
ATOM 9559  H HG21 . ILE A 1 23  ? 10.860  0.658   -8.195  1.00 0.00 ? 23  ILE A HG21 6  
ATOM 9560  H HG22 . ILE A 1 23  ? 9.512   -0.413  -8.572  1.00 0.00 ? 23  ILE A HG22 6  
ATOM 9561  H HG23 . ILE A 1 23  ? 9.207   1.171   -7.861  1.00 0.00 ? 23  ILE A HG23 6  
ATOM 9562  H HD11 . ILE A 1 23  ? 7.582   0.923   -4.390  1.00 0.00 ? 23  ILE A HD11 6  
ATOM 9563  H HD12 . ILE A 1 23  ? 9.047   1.647   -5.053  1.00 0.00 ? 23  ILE A HD12 6  
ATOM 9564  H HD13 . ILE A 1 23  ? 7.582   1.567   -6.032  1.00 0.00 ? 23  ILE A HD13 6  
ATOM 9565  N N    . SER A 1 24  ? 11.135  -1.595  -4.212  1.00 0.00 ? 24  SER A N    6  
ATOM 9566  C CA   . SER A 1 24  ? 11.205  -2.066  -2.834  1.00 0.00 ? 24  SER A CA   6  
ATOM 9567  C C    . SER A 1 24  ? 10.508  -1.090  -1.890  1.00 0.00 ? 24  SER A C    6  
ATOM 9568  O O    . SER A 1 24  ? 10.226  0.051   -2.256  1.00 0.00 ? 24  SER A O    6  
ATOM 9569  C CB   . SER A 1 24  ? 12.663  -2.250  -2.409  1.00 0.00 ? 24  SER A CB   6  
ATOM 9570  O OG   . SER A 1 24  ? 12.759  -3.071  -1.259  1.00 0.00 ? 24  SER A OG   6  
ATOM 9571  H H    . SER A 1 24  ? 11.530  -0.728  -4.443  1.00 0.00 ? 24  SER A H    6  
ATOM 9572  H HA   . SER A 1 24  ? 10.701  -3.019  -2.783  1.00 0.00 ? 24  SER A HA   6  
ATOM 9573  H HB2  . SER A 1 24  ? 13.214  -2.712  -3.214  1.00 0.00 ? 24  SER A HB2  6  
ATOM 9574  H HB3  . SER A 1 24  ? 13.095  -1.285  -2.186  1.00 0.00 ? 24  SER A HB3  6  
ATOM 9575  H HG   . SER A 1 24  ? 13.140  -2.567  -0.536  1.00 0.00 ? 24  SER A HG   6  
ATOM 9576  N N    . LYS A 1 25  ? 10.233  -1.548  -0.674  1.00 0.00 ? 25  LYS A N    6  
ATOM 9577  C CA   . LYS A 1 25  ? 9.571   -0.717  0.325   1.00 0.00 ? 25  LYS A CA   6  
ATOM 9578  C C    . LYS A 1 25  ? 10.224  0.659   0.409   1.00 0.00 ? 25  LYS A C    6  
ATOM 9579  O O    . LYS A 1 25  ? 9.575   1.678   0.180   1.00 0.00 ? 25  LYS A O    6  
ATOM 9580  C CB   . LYS A 1 25  ? 9.614   -1.398  1.695   1.00 0.00 ? 25  LYS A CB   6  
ATOM 9581  C CG   . LYS A 1 25  ? 9.001   -0.566  2.808   1.00 0.00 ? 25  LYS A CG   6  
ATOM 9582  C CD   . LYS A 1 25  ? 8.685   -1.414  4.029   1.00 0.00 ? 25  LYS A CD   6  
ATOM 9583  C CE   . LYS A 1 25  ? 7.994   -0.598  5.110   1.00 0.00 ? 25  LYS A CE   6  
ATOM 9584  N NZ   . LYS A 1 25  ? 7.630   -1.433  6.288   1.00 0.00 ? 25  LYS A NZ   6  
ATOM 9585  H H    . LYS A 1 25  ? 10.483  -2.467  -0.441  1.00 0.00 ? 25  LYS A H    6  
ATOM 9586  H HA   . LYS A 1 25  ? 8.541   -0.595  0.025   1.00 0.00 ? 25  LYS A HA   6  
ATOM 9587  H HB2  . LYS A 1 25  ? 9.078   -2.334  1.635   1.00 0.00 ? 25  LYS A HB2  6  
ATOM 9588  H HB3  . LYS A 1 25  ? 10.644  -1.600  1.951   1.00 0.00 ? 25  LYS A HB3  6  
ATOM 9589  H HG2  . LYS A 1 25  ? 9.697   0.209   3.091   1.00 0.00 ? 25  LYS A HG2  6  
ATOM 9590  H HG3  . LYS A 1 25  ? 8.086   -0.117  2.446   1.00 0.00 ? 25  LYS A HG3  6  
ATOM 9591  H HD2  . LYS A 1 25  ? 8.036   -2.225  3.735   1.00 0.00 ? 25  LYS A HD2  6  
ATOM 9592  H HD3  . LYS A 1 25  ? 9.607   -1.815  4.426   1.00 0.00 ? 25  LYS A HD3  6  
ATOM 9593  H HE2  . LYS A 1 25  ? 8.660   0.189   5.430   1.00 0.00 ? 25  LYS A HE2  6  
ATOM 9594  H HE3  . LYS A 1 25  ? 7.097   -0.163  4.696   1.00 0.00 ? 25  LYS A HE3  6  
ATOM 9595  H HZ1  . LYS A 1 25  ? 7.806   -0.907  7.167   1.00 0.00 ? 25  LYS A HZ1  6  
ATOM 9596  H HZ2  . LYS A 1 25  ? 8.198   -2.304  6.298   1.00 0.00 ? 25  LYS A HZ2  6  
ATOM 9597  H HZ3  . LYS A 1 25  ? 6.623   -1.690  6.246   1.00 0.00 ? 25  LYS A HZ3  6  
ATOM 9598  N N    . GLN A 1 26  ? 11.512  0.678   0.737   1.00 0.00 ? 26  GLN A N    6  
ATOM 9599  C CA   . GLN A 1 26  ? 12.253  1.929   0.849   1.00 0.00 ? 26  GLN A CA   6  
ATOM 9600  C C    . GLN A 1 26  ? 11.972  2.837   -0.343  1.00 0.00 ? 26  GLN A C    6  
ATOM 9601  O O    . GLN A 1 26  ? 11.474  3.950   -0.183  1.00 0.00 ? 26  GLN A O    6  
ATOM 9602  C CB   . GLN A 1 26  ? 13.753  1.651   0.952   1.00 0.00 ? 26  GLN A CB   6  
ATOM 9603  C CG   . GLN A 1 26  ? 14.573  2.869   1.347   1.00 0.00 ? 26  GLN A CG   6  
ATOM 9604  C CD   . GLN A 1 26  ? 16.049  2.558   1.491   1.00 0.00 ? 26  GLN A CD   6  
ATOM 9605  O OE1  . GLN A 1 26  ? 16.472  1.412   1.334   1.00 0.00 ? 26  GLN A OE1  6  
ATOM 9606  N NE2  . GLN A 1 26  ? 16.843  3.579   1.790   1.00 0.00 ? 26  GLN A NE2  6  
ATOM 9607  H H    . GLN A 1 26  ? 11.975  -0.168  0.907   1.00 0.00 ? 26  GLN A H    6  
ATOM 9608  H HA   . GLN A 1 26  ? 11.926  2.427   1.750   1.00 0.00 ? 26  GLN A HA   6  
ATOM 9609  H HB2  . GLN A 1 26  ? 13.915  0.880   1.690   1.00 0.00 ? 26  GLN A HB2  6  
ATOM 9610  H HB3  . GLN A 1 26  ? 14.109  1.301   -0.006  1.00 0.00 ? 26  GLN A HB3  6  
ATOM 9611  H HG2  . GLN A 1 26  ? 14.453  3.629   0.589   1.00 0.00 ? 26  GLN A HG2  6  
ATOM 9612  H HG3  . GLN A 1 26  ? 14.205  3.243   2.291   1.00 0.00 ? 26  GLN A HG3  6  
ATOM 9613  H HE21 . GLN A 1 26  ? 16.436  4.464   1.902   1.00 0.00 ? 26  GLN A HE21 6  
ATOM 9614  H HE22 . GLN A 1 26  ? 17.802  3.406   1.890   1.00 0.00 ? 26  GLN A HE22 6  
ATOM 9615  N N    . GLU A 1 27  ? 12.297  2.353   -1.538  1.00 0.00 ? 27  GLU A N    6  
ATOM 9616  C CA   . GLU A 1 27  ? 12.080  3.123   -2.758  1.00 0.00 ? 27  GLU A CA   6  
ATOM 9617  C C    . GLU A 1 27  ? 10.682  3.733   -2.775  1.00 0.00 ? 27  GLU A C    6  
ATOM 9618  O O    . GLU A 1 27  ? 10.512  4.913   -3.082  1.00 0.00 ? 27  GLU A O    6  
ATOM 9619  C CB   . GLU A 1 27  ? 12.276  2.236   -3.989  1.00 0.00 ? 27  GLU A CB   6  
ATOM 9620  C CG   . GLU A 1 27  ? 13.713  2.186   -4.481  1.00 0.00 ? 27  GLU A CG   6  
ATOM 9621  C CD   . GLU A 1 27  ? 14.684  1.743   -3.403  1.00 0.00 ? 27  GLU A CD   6  
ATOM 9622  O OE1  . GLU A 1 27  ? 14.911  0.521   -3.276  1.00 0.00 ? 27  GLU A OE1  6  
ATOM 9623  O OE2  . GLU A 1 27  ? 15.215  2.617   -2.687  1.00 0.00 ? 27  GLU A OE2  6  
ATOM 9624  H H    . GLU A 1 27  ? 12.691  1.458   -1.601  1.00 0.00 ? 27  GLU A H    6  
ATOM 9625  H HA   . GLU A 1 27  ? 12.808  3.920   -2.781  1.00 0.00 ? 27  GLU A HA   6  
ATOM 9626  H HB2  . GLU A 1 27  ? 11.965  1.230   -3.747  1.00 0.00 ? 27  GLU A HB2  6  
ATOM 9627  H HB3  . GLU A 1 27  ? 11.657  2.611   -4.790  1.00 0.00 ? 27  GLU A HB3  6  
ATOM 9628  H HG2  . GLU A 1 27  ? 13.774  1.492   -5.306  1.00 0.00 ? 27  GLU A HG2  6  
ATOM 9629  H HG3  . GLU A 1 27  ? 13.999  3.171   -4.819  1.00 0.00 ? 27  GLU A HG3  6  
ATOM 9630  N N    . ALA A 1 28  ? 9.684   2.921   -2.443  1.00 0.00 ? 28  ALA A N    6  
ATOM 9631  C CA   . ALA A 1 28  ? 8.301   3.380   -2.418  1.00 0.00 ? 28  ALA A CA   6  
ATOM 9632  C C    . ALA A 1 28  ? 8.183   4.730   -1.718  1.00 0.00 ? 28  ALA A C    6  
ATOM 9633  O O    . ALA A 1 28  ? 7.510   5.638   -2.208  1.00 0.00 ? 28  ALA A O    6  
ATOM 9634  C CB   . ALA A 1 28  ? 7.414   2.350   -1.734  1.00 0.00 ? 28  ALA A CB   6  
ATOM 9635  H H    . ALA A 1 28  ? 9.883   1.991   -2.207  1.00 0.00 ? 28  ALA A H    6  
ATOM 9636  H HA   . ALA A 1 28  ? 7.966   3.485   -3.440  1.00 0.00 ? 28  ALA A HA   6  
ATOM 9637  H HB1  . ALA A 1 28  ? 7.054   2.751   -0.798  1.00 0.00 ? 28  ALA A HB1  6  
ATOM 9638  H HB2  . ALA A 1 28  ? 6.576   2.116   -2.372  1.00 0.00 ? 28  ALA A HB2  6  
ATOM 9639  H HB3  . ALA A 1 28  ? 7.985   1.453   -1.546  1.00 0.00 ? 28  ALA A HB3  6  
ATOM 9640  N N    . TYR A 1 29  ? 8.840   4.856   -0.571  1.00 0.00 ? 29  TYR A N    6  
ATOM 9641  C CA   . TYR A 1 29  ? 8.806   6.094   0.198   1.00 0.00 ? 29  TYR A CA   6  
ATOM 9642  C C    . TYR A 1 29  ? 9.274   7.274   -0.649  1.00 0.00 ? 29  TYR A C    6  
ATOM 9643  O O    . TYR A 1 29  ? 8.661   8.340   -0.640  1.00 0.00 ? 29  TYR A O    6  
ATOM 9644  C CB   . TYR A 1 29  ? 9.681   5.968   1.446   1.00 0.00 ? 29  TYR A CB   6  
ATOM 9645  C CG   . TYR A 1 29  ? 8.997   5.266   2.597   1.00 0.00 ? 29  TYR A CG   6  
ATOM 9646  C CD1  . TYR A 1 29  ? 8.060   5.928   3.382   1.00 0.00 ? 29  TYR A CD1  6  
ATOM 9647  C CD2  . TYR A 1 29  ? 9.287   3.942   2.901   1.00 0.00 ? 29  TYR A CD2  6  
ATOM 9648  C CE1  . TYR A 1 29  ? 7.433   5.291   4.435   1.00 0.00 ? 29  TYR A CE1  6  
ATOM 9649  C CE2  . TYR A 1 29  ? 8.664   3.297   3.951   1.00 0.00 ? 29  TYR A CE2  6  
ATOM 9650  C CZ   . TYR A 1 29  ? 7.738   3.975   4.715   1.00 0.00 ? 29  TYR A CZ   6  
ATOM 9651  O OH   . TYR A 1 29  ? 7.116   3.337   5.763   1.00 0.00 ? 29  TYR A OH   6  
ATOM 9652  H H    . TYR A 1 29  ? 9.359   4.097   -0.231  1.00 0.00 ? 29  TYR A H    6  
ATOM 9653  H HA   . TYR A 1 29  ? 7.784   6.268   0.503   1.00 0.00 ? 29  TYR A HA   6  
ATOM 9654  H HB2  . TYR A 1 29  ? 10.570  5.409   1.199   1.00 0.00 ? 29  TYR A HB2  6  
ATOM 9655  H HB3  . TYR A 1 29  ? 9.964   6.956   1.780   1.00 0.00 ? 29  TYR A HB3  6  
ATOM 9656  H HD1  . TYR A 1 29  ? 7.824   6.959   3.160   1.00 0.00 ? 29  TYR A HD1  6  
ATOM 9657  H HD2  . TYR A 1 29  ? 10.014  3.414   2.300   1.00 0.00 ? 29  TYR A HD2  6  
ATOM 9658  H HE1  . TYR A 1 29  ? 6.707   5.822   5.034   1.00 0.00 ? 29  TYR A HE1  6  
ATOM 9659  H HE2  . TYR A 1 29  ? 8.903   2.267   4.171   1.00 0.00 ? 29  TYR A HE2  6  
ATOM 9660  H HH   . TYR A 1 29  ? 6.559   3.962   6.234   1.00 0.00 ? 29  TYR A HH   6  
ATOM 9661  N N    . ASN A 1 30  ? 10.366  7.073   -1.379  1.00 0.00 ? 30  ASN A N    6  
ATOM 9662  C CA   . ASN A 1 30  ? 10.919  8.119   -2.232  1.00 0.00 ? 30  ASN A CA   6  
ATOM 9663  C C    . ASN A 1 30  ? 9.978   8.427   -3.393  1.00 0.00 ? 30  ASN A C    6  
ATOM 9664  O O    . ASN A 1 30  ? 9.712   9.590   -3.699  1.00 0.00 ? 30  ASN A O    6  
ATOM 9665  C CB   . ASN A 1 30  ? 12.288  7.698   -2.769  1.00 0.00 ? 30  ASN A CB   6  
ATOM 9666  C CG   . ASN A 1 30  ? 12.935  8.778   -3.614  1.00 0.00 ? 30  ASN A CG   6  
ATOM 9667  O OD1  . ASN A 1 30  ? 13.179  9.888   -3.142  1.00 0.00 ? 30  ASN A OD1  6  
ATOM 9668  N ND2  . ASN A 1 30  ? 13.214  8.457   -4.872  1.00 0.00 ? 30  ASN A ND2  6  
ATOM 9669  H H    . ASN A 1 30  ? 10.812  6.200   -1.344  1.00 0.00 ? 30  ASN A H    6  
ATOM 9670  H HA   . ASN A 1 30  ? 11.035  9.008   -1.632  1.00 0.00 ? 30  ASN A HA   6  
ATOM 9671  H HB2  . ASN A 1 30  ? 12.942  7.479   -1.938  1.00 0.00 ? 30  ASN A HB2  6  
ATOM 9672  H HB3  . ASN A 1 30  ? 12.174  6.812   -3.375  1.00 0.00 ? 30  ASN A HB3  6  
ATOM 9673  H HD21 . ASN A 1 30  ? 12.991  7.554   -5.180  1.00 0.00 ? 30  ASN A HD21 6  
ATOM 9674  H HD22 . ASN A 1 30  ? 13.633  9.136   -5.441  1.00 0.00 ? 30  ASN A HD22 6  
ATOM 9675  N N    . LEU A 1 31  ? 9.476   7.378   -4.036  1.00 0.00 ? 31  LEU A N    6  
ATOM 9676  C CA   . LEU A 1 31  ? 8.564   7.536   -5.163  1.00 0.00 ? 31  LEU A CA   6  
ATOM 9677  C C    . LEU A 1 31  ? 7.457   8.531   -4.832  1.00 0.00 ? 31  LEU A C    6  
ATOM 9678  O O    . LEU A 1 31  ? 7.347   9.586   -5.459  1.00 0.00 ? 31  LEU A O    6  
ATOM 9679  C CB   . LEU A 1 31  ? 7.955   6.185   -5.544  1.00 0.00 ? 31  LEU A CB   6  
ATOM 9680  C CG   . LEU A 1 31  ? 8.807   5.296   -6.451  1.00 0.00 ? 31  LEU A CG   6  
ATOM 9681  C CD1  . LEU A 1 31  ? 8.370   3.844   -6.337  1.00 0.00 ? 31  LEU A CD1  6  
ATOM 9682  C CD2  . LEU A 1 31  ? 8.721   5.770   -7.894  1.00 0.00 ? 31  LEU A CD2  6  
ATOM 9683  H H    . LEU A 1 31  ? 9.725   6.476   -3.746  1.00 0.00 ? 31  LEU A H    6  
ATOM 9684  H HA   . LEU A 1 31  ? 9.133   7.914   -5.999  1.00 0.00 ? 31  LEU A HA   6  
ATOM 9685  H HB2  . LEU A 1 31  ? 7.763   5.640   -4.633  1.00 0.00 ? 31  LEU A HB2  6  
ATOM 9686  H HB3  . LEU A 1 31  ? 7.019   6.377   -6.051  1.00 0.00 ? 31  LEU A HB3  6  
ATOM 9687  H HG   . LEU A 1 31  ? 9.840   5.359   -6.138  1.00 0.00 ? 31  LEU A HG   6  
ATOM 9688  H HD11 . LEU A 1 31  ? 9.241   3.209   -6.290  1.00 0.00 ? 31  LEU A HD11 6  
ATOM 9689  H HD12 . LEU A 1 31  ? 7.777   3.578   -7.199  1.00 0.00 ? 31  LEU A HD12 6  
ATOM 9690  H HD13 . LEU A 1 31  ? 7.780   3.715   -5.441  1.00 0.00 ? 31  LEU A HD13 6  
ATOM 9691  H HD21 . LEU A 1 31  ? 9.149   6.758   -7.975  1.00 0.00 ? 31  LEU A HD21 6  
ATOM 9692  H HD22 . LEU A 1 31  ? 7.686   5.800   -8.203  1.00 0.00 ? 31  LEU A HD22 6  
ATOM 9693  H HD23 . LEU A 1 31  ? 9.267   5.088   -8.529  1.00 0.00 ? 31  LEU A HD23 6  
ATOM 9694  N N    . LEU A 1 32  ? 6.639   8.191   -3.842  1.00 0.00 ? 32  LEU A N    6  
ATOM 9695  C CA   . LEU A 1 32  ? 5.540   9.056   -3.426  1.00 0.00 ? 32  LEU A CA   6  
ATOM 9696  C C    . LEU A 1 32  ? 6.064   10.396  -2.920  1.00 0.00 ? 32  LEU A C    6  
ATOM 9697  O O    . LEU A 1 32  ? 5.298   11.340  -2.727  1.00 0.00 ? 32  LEU A O    6  
ATOM 9698  C CB   . LEU A 1 32  ? 4.714   8.374   -2.334  1.00 0.00 ? 32  LEU A CB   6  
ATOM 9699  C CG   . LEU A 1 32  ? 3.660   7.375   -2.814  1.00 0.00 ? 32  LEU A CG   6  
ATOM 9700  C CD1  . LEU A 1 32  ? 3.381   6.336   -1.740  1.00 0.00 ? 32  LEU A CD1  6  
ATOM 9701  C CD2  . LEU A 1 32  ? 2.380   8.098   -3.206  1.00 0.00 ? 32  LEU A CD2  6  
ATOM 9702  H H    . LEU A 1 32  ? 6.776   7.338   -3.380  1.00 0.00 ? 32  LEU A H    6  
ATOM 9703  H HA   . LEU A 1 32  ? 4.911   9.230   -4.286  1.00 0.00 ? 32  LEU A HA   6  
ATOM 9704  H HB2  . LEU A 1 32  ? 5.396   7.847   -1.684  1.00 0.00 ? 32  LEU A HB2  6  
ATOM 9705  H HB3  . LEU A 1 32  ? 4.208   9.146   -1.772  1.00 0.00 ? 32  LEU A HB3  6  
ATOM 9706  H HG   . LEU A 1 32  ? 4.035   6.859   -3.688  1.00 0.00 ? 32  LEU A HG   6  
ATOM 9707  H HD11 . LEU A 1 32  ? 2.715   5.582   -2.132  1.00 0.00 ? 32  LEU A HD11 6  
ATOM 9708  H HD12 . LEU A 1 32  ? 2.921   6.814   -0.888  1.00 0.00 ? 32  LEU A HD12 6  
ATOM 9709  H HD13 . LEU A 1 32  ? 4.309   5.874   -1.436  1.00 0.00 ? 32  LEU A HD13 6  
ATOM 9710  H HD21 . LEU A 1 32  ? 2.626   8.982   -3.776  1.00 0.00 ? 32  LEU A HD21 6  
ATOM 9711  H HD22 . LEU A 1 32  ? 1.841   8.384   -2.314  1.00 0.00 ? 32  LEU A HD22 6  
ATOM 9712  H HD23 . LEU A 1 32  ? 1.765   7.443   -3.804  1.00 0.00 ? 32  LEU A HD23 6  
ATOM 9713  N N    . MET A 1 33  ? 7.374   10.472  -2.711  1.00 0.00 ? 33  MET A N    6  
ATOM 9714  C CA   . MET A 1 33  ? 8.001   11.699  -2.231  1.00 0.00 ? 33  MET A CA   6  
ATOM 9715  C C    . MET A 1 33  ? 8.526   12.532  -3.396  1.00 0.00 ? 33  MET A C    6  
ATOM 9716  O O    . MET A 1 33  ? 8.853   13.709  -3.234  1.00 0.00 ? 33  MET A O    6  
ATOM 9717  C CB   . MET A 1 33  ? 9.143   11.371  -1.268  1.00 0.00 ? 33  MET A CB   6  
ATOM 9718  C CG   . MET A 1 33  ? 8.706   11.278  0.184   1.00 0.00 ? 33  MET A CG   6  
ATOM 9719  S SD   . MET A 1 33  ? 8.784   12.865  1.036   1.00 0.00 ? 33  MET A SD   6  
ATOM 9720  C CE   . MET A 1 33  ? 7.437   13.741  0.245   1.00 0.00 ? 33  MET A CE   6  
ATOM 9721  H H    . MET A 1 33  ? 7.934   9.686   -2.883  1.00 0.00 ? 33  MET A H    6  
ATOM 9722  H HA   . MET A 1 33  ? 7.251   12.270  -1.705  1.00 0.00 ? 33  MET A HA   6  
ATOM 9723  H HB2  . MET A 1 33  ? 9.577   10.423  -1.552  1.00 0.00 ? 33  MET A HB2  6  
ATOM 9724  H HB3  . MET A 1 33  ? 9.897   12.140  -1.346  1.00 0.00 ? 33  MET A HB3  6  
ATOM 9725  H HG2  . MET A 1 33  ? 7.688   10.918  0.218   1.00 0.00 ? 33  MET A HG2  6  
ATOM 9726  H HG3  . MET A 1 33  ? 9.350   10.578  0.696   1.00 0.00 ? 33  MET A HG3  6  
ATOM 9727  H HE1  . MET A 1 33  ? 7.781   14.164  -0.688  1.00 0.00 ? 33  MET A HE1  6  
ATOM 9728  H HE2  . MET A 1 33  ? 6.626   13.055  0.052   1.00 0.00 ? 33  MET A HE2  6  
ATOM 9729  H HE3  . MET A 1 33  ? 7.092   14.533  0.894   1.00 0.00 ? 33  MET A HE3  6  
ATOM 9730  N N    . THR A 1 34  ? 8.605   11.916  -4.571  1.00 0.00 ? 34  THR A N    6  
ATOM 9731  C CA   . THR A 1 34  ? 9.091   12.600  -5.763  1.00 0.00 ? 34  THR A CA   6  
ATOM 9732  C C    . THR A 1 34  ? 8.116   12.443  -6.924  1.00 0.00 ? 34  THR A C    6  
ATOM 9733  O O    . THR A 1 34  ? 7.424   13.390  -7.299  1.00 0.00 ? 34  THR A O    6  
ATOM 9734  C CB   . THR A 1 34  ? 10.472  12.069  -6.191  1.00 0.00 ? 34  THR A CB   6  
ATOM 9735  O OG1  . THR A 1 34  ? 10.493  10.639  -6.112  1.00 0.00 ? 34  THR A OG1  6  
ATOM 9736  C CG2  . THR A 1 34  ? 11.571  12.647  -5.312  1.00 0.00 ? 34  THR A CG2  6  
ATOM 9737  H H    . THR A 1 34  ? 8.329   10.978  -4.637  1.00 0.00 ? 34  THR A H    6  
ATOM 9738  H HA   . THR A 1 34  ? 9.190   13.650  -5.527  1.00 0.00 ? 34  THR A HA   6  
ATOM 9739  H HB   . THR A 1 34  ? 10.655  12.368  -7.213  1.00 0.00 ? 34  THR A HB   6  
ATOM 9740  H HG1  . THR A 1 34  ? 10.604  10.371  -5.196  1.00 0.00 ? 34  THR A HG1  6  
ATOM 9741  H HG21 . THR A 1 34  ? 11.681  13.701  -5.519  1.00 0.00 ? 34  THR A HG21 6  
ATOM 9742  H HG22 . THR A 1 34  ? 12.502  12.140  -5.519  1.00 0.00 ? 34  THR A HG22 6  
ATOM 9743  H HG23 . THR A 1 34  ? 11.310  12.510  -4.274  1.00 0.00 ? 34  THR A HG23 6  
ATOM 9744  N N    . VAL A 1 35  ? 8.066   11.241  -7.490  1.00 0.00 ? 35  VAL A N    6  
ATOM 9745  C CA   . VAL A 1 35  ? 7.173   10.960  -8.608  1.00 0.00 ? 35  VAL A CA   6  
ATOM 9746  C C    . VAL A 1 35  ? 5.713   11.077  -8.188  1.00 0.00 ? 35  VAL A C    6  
ATOM 9747  O O    . VAL A 1 35  ? 4.832   11.289  -9.020  1.00 0.00 ? 35  VAL A O    6  
ATOM 9748  C CB   . VAL A 1 35  ? 7.420   9.552   -9.182  1.00 0.00 ? 35  VAL A CB   6  
ATOM 9749  C CG1  . VAL A 1 35  ? 8.886   9.370   -9.541  1.00 0.00 ? 35  VAL A CG1  6  
ATOM 9750  C CG2  . VAL A 1 35  ? 6.969   8.487   -8.192  1.00 0.00 ? 35  VAL A CG2  6  
ATOM 9751  H H    . VAL A 1 35  ? 8.642   10.527  -7.146  1.00 0.00 ? 35  VAL A H    6  
ATOM 9752  H HA   . VAL A 1 35  ? 7.374   11.682  -9.385  1.00 0.00 ? 35  VAL A HA   6  
ATOM 9753  H HB   . VAL A 1 35  ? 6.835   9.445   -10.084 1.00 0.00 ? 35  VAL A HB   6  
ATOM 9754  H HG11 . VAL A 1 35  ? 9.169   8.339   -9.389  1.00 0.00 ? 35  VAL A HG11 6  
ATOM 9755  H HG12 . VAL A 1 35  ? 9.040   9.638   -10.576 1.00 0.00 ? 35  VAL A HG12 6  
ATOM 9756  H HG13 . VAL A 1 35  ? 9.492   10.005  -8.911  1.00 0.00 ? 35  VAL A HG13 6  
ATOM 9757  H HG21 . VAL A 1 35  ? 6.042   8.795   -7.732  1.00 0.00 ? 35  VAL A HG21 6  
ATOM 9758  H HG22 . VAL A 1 35  ? 6.820   7.552   -8.712  1.00 0.00 ? 35  VAL A HG22 6  
ATOM 9759  H HG23 . VAL A 1 35  ? 7.724   8.360   -7.431  1.00 0.00 ? 35  VAL A HG23 6  
ATOM 9760  N N    . GLY A 1 36  ? 5.462   10.938  -6.890  1.00 0.00 ? 36  GLY A N    6  
ATOM 9761  C CA   . GLY A 1 36  ? 4.106   11.032  -6.381  1.00 0.00 ? 36  GLY A CA   6  
ATOM 9762  C C    . GLY A 1 36  ? 3.869   12.307  -5.595  1.00 0.00 ? 36  GLY A C    6  
ATOM 9763  O O    . GLY A 1 36  ? 4.794   13.088  -5.374  1.00 0.00 ? 36  GLY A O    6  
ATOM 9764  H H    . GLY A 1 36  ? 6.204   10.770  -6.272  1.00 0.00 ? 36  GLY A H    6  
ATOM 9765  H HA2  . GLY A 1 36  ? 3.419   11.002  -7.213  1.00 0.00 ? 36  GLY A HA2  6  
ATOM 9766  H HA3  . GLY A 1 36  ? 3.916   10.186  -5.738  1.00 0.00 ? 36  GLY A HA3  6  
ATOM 9767  N N    . GLN A 1 37  ? 2.626   12.517  -5.174  1.00 0.00 ? 37  GLN A N    6  
ATOM 9768  C CA   . GLN A 1 37  ? 2.270   13.707  -4.410  1.00 0.00 ? 37  GLN A CA   6  
ATOM 9769  C C    . GLN A 1 37  ? 1.184   13.393  -3.387  1.00 0.00 ? 37  GLN A C    6  
ATOM 9770  O O    . GLN A 1 37  ? 0.779   12.241  -3.230  1.00 0.00 ? 37  GLN A O    6  
ATOM 9771  C CB   . GLN A 1 37  ? 1.798   14.819  -5.348  1.00 0.00 ? 37  GLN A CB   6  
ATOM 9772  C CG   . GLN A 1 37  ? 0.990   14.313  -6.532  1.00 0.00 ? 37  GLN A CG   6  
ATOM 9773  C CD   . GLN A 1 37  ? 0.728   15.392  -7.564  1.00 0.00 ? 37  GLN A CD   6  
ATOM 9774  O OE1  . GLN A 1 37  ? 0.446   16.541  -7.221  1.00 0.00 ? 37  GLN A OE1  6  
ATOM 9775  N NE2  . GLN A 1 37  ? 0.820   15.029  -8.838  1.00 0.00 ? 37  GLN A NE2  6  
ATOM 9776  H H    . GLN A 1 37  ? 1.933   11.858  -5.382  1.00 0.00 ? 37  GLN A H    6  
ATOM 9777  H HA   . GLN A 1 37  ? 3.154   14.042  -3.887  1.00 0.00 ? 37  GLN A HA   6  
ATOM 9778  H HB2  . GLN A 1 37  ? 1.184   15.509  -4.789  1.00 0.00 ? 37  GLN A HB2  6  
ATOM 9779  H HB3  . GLN A 1 37  ? 2.661   15.344  -5.728  1.00 0.00 ? 37  GLN A HB3  6  
ATOM 9780  H HG2  . GLN A 1 37  ? 1.533   13.509  -7.006  1.00 0.00 ? 37  GLN A HG2  6  
ATOM 9781  H HG3  . GLN A 1 37  ? 0.041   13.942  -6.172  1.00 0.00 ? 37  GLN A HG3  6  
ATOM 9782  H HE21 . GLN A 1 37  ? 1.048   14.096  -9.037  1.00 0.00 ? 37  GLN A HE21 6  
ATOM 9783  H HE22 . GLN A 1 37  ? 0.656   15.706  -9.526  1.00 0.00 ? 37  GLN A HE22 6  
ATOM 9784  N N    . VAL A 1 38  ? 0.716   14.425  -2.692  1.00 0.00 ? 38  VAL A N    6  
ATOM 9785  C CA   . VAL A 1 38  ? -0.325  14.259  -1.684  1.00 0.00 ? 38  VAL A CA   6  
ATOM 9786  C C    . VAL A 1 38  ? -1.640  13.821  -2.319  1.00 0.00 ? 38  VAL A C    6  
ATOM 9787  O O    . VAL A 1 38  ? -2.620  13.557  -1.621  1.00 0.00 ? 38  VAL A O    6  
ATOM 9788  C CB   . VAL A 1 38  ? -0.556  15.562  -0.897  1.00 0.00 ? 38  VAL A CB   6  
ATOM 9789  C CG1  . VAL A 1 38  ? -1.542  15.333  0.238   1.00 0.00 ? 38  VAL A CG1  6  
ATOM 9790  C CG2  . VAL A 1 38  ? 0.762   16.106  -0.368  1.00 0.00 ? 38  VAL A CG2  6  
ATOM 9791  H H    . VAL A 1 38  ? 1.078   15.319  -2.862  1.00 0.00 ? 38  VAL A H    6  
ATOM 9792  H HA   . VAL A 1 38  ? 0.000   13.497  -0.991  1.00 0.00 ? 38  VAL A HA   6  
ATOM 9793  H HB   . VAL A 1 38  ? -0.980  16.295  -1.569  1.00 0.00 ? 38  VAL A HB   6  
ATOM 9794  H HG11 . VAL A 1 38  ? -1.786  14.282  0.296   1.00 0.00 ? 38  VAL A HG11 6  
ATOM 9795  H HG12 . VAL A 1 38  ? -1.099  15.652  1.170   1.00 0.00 ? 38  VAL A HG12 6  
ATOM 9796  H HG13 . VAL A 1 38  ? -2.442  15.900  0.054   1.00 0.00 ? 38  VAL A HG13 6  
ATOM 9797  H HG21 . VAL A 1 38  ? 1.277   16.632  -1.158  1.00 0.00 ? 38  VAL A HG21 6  
ATOM 9798  H HG22 . VAL A 1 38  ? 0.569   16.785  0.450   1.00 0.00 ? 38  VAL A HG22 6  
ATOM 9799  H HG23 . VAL A 1 38  ? 1.375   15.288  -0.019  1.00 0.00 ? 38  VAL A HG23 6  
ATOM 9800  N N    . CYS A 1 39  ? -1.654  13.745  -3.645  1.00 0.00 ? 39  CYS A N    6  
ATOM 9801  C CA   . CYS A 1 39  ? -2.850  13.339  -4.375  1.00 0.00 ? 39  CYS A CA   6  
ATOM 9802  C C    . CYS A 1 39  ? -2.584  12.082  -5.197  1.00 0.00 ? 39  CYS A C    6  
ATOM 9803  O O    . CYS A 1 39  ? -3.189  11.876  -6.249  1.00 0.00 ? 39  CYS A O    6  
ATOM 9804  C CB   . CYS A 1 39  ? -3.323  14.470  -5.289  1.00 0.00 ? 39  CYS A CB   6  
ATOM 9805  S SG   . CYS A 1 39  ? -3.567  16.049  -4.444  1.00 0.00 ? 39  CYS A SG   6  
ATOM 9806  H H    . CYS A 1 39  ? -0.841  13.968  -4.146  1.00 0.00 ? 39  CYS A H    6  
ATOM 9807  H HA   . CYS A 1 39  ? -3.622  13.125  -3.652  1.00 0.00 ? 39  CYS A HA   6  
ATOM 9808  H HB2  . CYS A 1 39  ? -2.590  14.624  -6.067  1.00 0.00 ? 39  CYS A HB2  6  
ATOM 9809  H HB3  . CYS A 1 39  ? -4.263  14.188  -5.741  1.00 0.00 ? 39  CYS A HB3  6  
ATOM 9810  H HG   . CYS A 1 39  ? -2.446  16.746  -4.549  1.00 0.00 ? 39  CYS A HG   6  
ATOM 9811  N N    . SER A 1 40  ? -1.674  11.244  -4.710  1.00 0.00 ? 40  SER A N    6  
ATOM 9812  C CA   . SER A 1 40  ? -1.324  10.009  -5.402  1.00 0.00 ? 40  SER A CA   6  
ATOM 9813  C C    . SER A 1 40  ? -0.987  8.904   -4.405  1.00 0.00 ? 40  SER A C    6  
ATOM 9814  O O    . SER A 1 40  ? -0.417  9.162   -3.344  1.00 0.00 ? 40  SER A O    6  
ATOM 9815  C CB   . SER A 1 40  ? -0.139  10.244  -6.340  1.00 0.00 ? 40  SER A CB   6  
ATOM 9816  O OG   . SER A 1 40  ? -0.364  11.366  -7.175  1.00 0.00 ? 40  SER A OG   6  
ATOM 9817  H H    . SER A 1 40  ? -1.226  11.463  -3.866  1.00 0.00 ? 40  SER A H    6  
ATOM 9818  H HA   . SER A 1 40  ? -2.179  9.702   -5.985  1.00 0.00 ? 40  SER A HA   6  
ATOM 9819  H HB2  . SER A 1 40  ? 0.751   10.418  -5.755  1.00 0.00 ? 40  SER A HB2  6  
ATOM 9820  H HB3  . SER A 1 40  ? 0.004   9.371   -6.961  1.00 0.00 ? 40  SER A HB3  6  
ATOM 9821  H HG   . SER A 1 40  ? 0.251   11.346  -7.912  1.00 0.00 ? 40  SER A HG   6  
ATOM 9822  N N    . PHE A 1 41  ? -1.345  7.672   -4.753  1.00 0.00 ? 41  PHE A N    6  
ATOM 9823  C CA   . PHE A 1 41  ? -1.082  6.527   -3.889  1.00 0.00 ? 41  PHE A CA   6  
ATOM 9824  C C    . PHE A 1 41  ? -0.469  5.377   -4.683  1.00 0.00 ? 41  PHE A C    6  
ATOM 9825  O O    . PHE A 1 41  ? -0.363  5.440   -5.908  1.00 0.00 ? 41  PHE A O    6  
ATOM 9826  C CB   . PHE A 1 41  ? -2.374  6.064   -3.214  1.00 0.00 ? 41  PHE A CB   6  
ATOM 9827  C CG   . PHE A 1 41  ? -3.301  5.324   -4.136  1.00 0.00 ? 41  PHE A CG   6  
ATOM 9828  C CD1  . PHE A 1 41  ? -3.906  5.974   -5.199  1.00 0.00 ? 41  PHE A CD1  6  
ATOM 9829  C CD2  . PHE A 1 41  ? -3.566  3.978   -3.939  1.00 0.00 ? 41  PHE A CD2  6  
ATOM 9830  C CE1  . PHE A 1 41  ? -4.759  5.295   -6.048  1.00 0.00 ? 41  PHE A CE1  6  
ATOM 9831  C CE2  . PHE A 1 41  ? -4.418  3.294   -4.786  1.00 0.00 ? 41  PHE A CE2  6  
ATOM 9832  C CZ   . PHE A 1 41  ? -5.015  3.954   -5.842  1.00 0.00 ? 41  PHE A CZ   6  
ATOM 9833  H H    . PHE A 1 41  ? -1.797  7.531   -5.611  1.00 0.00 ? 41  PHE A H    6  
ATOM 9834  H HA   . PHE A 1 41  ? -0.381  6.839   -3.130  1.00 0.00 ? 41  PHE A HA   6  
ATOM 9835  H HB2  . PHE A 1 41  ? -2.128  5.406   -2.394  1.00 0.00 ? 41  PHE A HB2  6  
ATOM 9836  H HB3  . PHE A 1 41  ? -2.901  6.925   -2.832  1.00 0.00 ? 41  PHE A HB3  6  
ATOM 9837  H HD1  . PHE A 1 41  ? -3.706  7.023   -5.362  1.00 0.00 ? 41  PHE A HD1  6  
ATOM 9838  H HD2  . PHE A 1 41  ? -3.099  3.461   -3.113  1.00 0.00 ? 41  PHE A HD2  6  
ATOM 9839  H HE1  . PHE A 1 41  ? -5.224  5.813   -6.874  1.00 0.00 ? 41  PHE A HE1  6  
ATOM 9840  H HE2  . PHE A 1 41  ? -4.615  2.245   -4.621  1.00 0.00 ? 41  PHE A HE2  6  
ATOM 9841  H HZ   . PHE A 1 41  ? -5.681  3.422   -6.504  1.00 0.00 ? 41  PHE A HZ   6  
ATOM 9842  N N    . LEU A 1 42  ? -0.066  4.327   -3.975  1.00 0.00 ? 42  LEU A N    6  
ATOM 9843  C CA   . LEU A 1 42  ? 0.538   3.162   -4.612  1.00 0.00 ? 42  LEU A CA   6  
ATOM 9844  C C    . LEU A 1 42  ? 0.457   1.941   -3.701  1.00 0.00 ? 42  LEU A C    6  
ATOM 9845  O O    . LEU A 1 42  ? 0.674   2.038   -2.494  1.00 0.00 ? 42  LEU A O    6  
ATOM 9846  C CB   . LEU A 1 42  ? 1.997   3.450   -4.970  1.00 0.00 ? 42  LEU A CB   6  
ATOM 9847  C CG   . LEU A 1 42  ? 3.019   3.217   -3.857  1.00 0.00 ? 42  LEU A CG   6  
ATOM 9848  C CD1  . LEU A 1 42  ? 3.372   1.741   -3.756  1.00 0.00 ? 42  LEU A CD1  6  
ATOM 9849  C CD2  . LEU A 1 42  ? 4.269   4.051   -4.098  1.00 0.00 ? 42  LEU A CD2  6  
ATOM 9850  H H    . LEU A 1 42  ? -0.177  4.335   -3.002  1.00 0.00 ? 42  LEU A H    6  
ATOM 9851  H HA   . LEU A 1 42  ? -0.013  2.957   -5.518  1.00 0.00 ? 42  LEU A HA   6  
ATOM 9852  H HB2  . LEU A 1 42  ? 2.264   2.817   -5.802  1.00 0.00 ? 42  LEU A HB2  6  
ATOM 9853  H HB3  . LEU A 1 42  ? 2.064   4.485   -5.271  1.00 0.00 ? 42  LEU A HB3  6  
ATOM 9854  H HG   . LEU A 1 42  ? 2.590   3.522   -2.912  1.00 0.00 ? 42  LEU A HG   6  
ATOM 9855  H HD11 . LEU A 1 42  ? 4.331   1.568   -4.220  1.00 0.00 ? 42  LEU A HD11 6  
ATOM 9856  H HD12 . LEU A 1 42  ? 2.617   1.155   -4.261  1.00 0.00 ? 42  LEU A HD12 6  
ATOM 9857  H HD13 . LEU A 1 42  ? 3.416   1.451   -2.716  1.00 0.00 ? 42  LEU A HD13 6  
ATOM 9858  H HD21 . LEU A 1 42  ? 5.129   3.400   -4.155  1.00 0.00 ? 42  LEU A HD21 6  
ATOM 9859  H HD22 . LEU A 1 42  ? 4.399   4.748   -3.283  1.00 0.00 ? 42  LEU A HD22 6  
ATOM 9860  H HD23 . LEU A 1 42  ? 4.166   4.594   -5.025  1.00 0.00 ? 42  LEU A HD23 6  
ATOM 9861  N N    . VAL A 1 43  ? 0.144   0.790   -4.289  1.00 0.00 ? 43  VAL A N    6  
ATOM 9862  C CA   . VAL A 1 43  ? 0.038   -0.451  -3.532  1.00 0.00 ? 43  VAL A CA   6  
ATOM 9863  C C    . VAL A 1 43  ? 1.327   -1.261  -3.621  1.00 0.00 ? 43  VAL A C    6  
ATOM 9864  O O    . VAL A 1 43  ? 2.031   -1.218  -4.630  1.00 0.00 ? 43  VAL A O    6  
ATOM 9865  C CB   . VAL A 1 43  ? -1.134  -1.316  -4.032  1.00 0.00 ? 43  VAL A CB   6  
ATOM 9866  C CG1  . VAL A 1 43  ? -1.184  -2.636  -3.279  1.00 0.00 ? 43  VAL A CG1  6  
ATOM 9867  C CG2  . VAL A 1 43  ? -2.449  -0.563  -3.893  1.00 0.00 ? 43  VAL A CG2  6  
ATOM 9868  H H    . VAL A 1 43  ? -0.018  0.776   -5.255  1.00 0.00 ? 43  VAL A H    6  
ATOM 9869  H HA   . VAL A 1 43  ? -0.145  -0.197  -2.498  1.00 0.00 ? 43  VAL A HA   6  
ATOM 9870  H HB   . VAL A 1 43  ? -0.976  -1.530  -5.079  1.00 0.00 ? 43  VAL A HB   6  
ATOM 9871  H HG11 . VAL A 1 43  ? -0.637  -3.386  -3.831  1.00 0.00 ? 43  VAL A HG11 6  
ATOM 9872  H HG12 . VAL A 1 43  ? -0.740  -2.511  -2.302  1.00 0.00 ? 43  VAL A HG12 6  
ATOM 9873  H HG13 . VAL A 1 43  ? -2.212  -2.949  -3.169  1.00 0.00 ? 43  VAL A HG13 6  
ATOM 9874  H HG21 . VAL A 1 43  ? -2.952  -0.539  -4.847  1.00 0.00 ? 43  VAL A HG21 6  
ATOM 9875  H HG22 . VAL A 1 43  ? -3.075  -1.062  -3.168  1.00 0.00 ? 43  VAL A HG22 6  
ATOM 9876  H HG23 . VAL A 1 43  ? -2.252  0.447   -3.563  1.00 0.00 ? 43  VAL A HG23 6  
ATOM 9877  N N    . ARG A 1 44  ? 1.629   -2.000  -2.558  1.00 0.00 ? 44  ARG A N    6  
ATOM 9878  C CA   . ARG A 1 44  ? 2.834   -2.820  -2.516  1.00 0.00 ? 44  ARG A CA   6  
ATOM 9879  C C    . ARG A 1 44  ? 2.637   -4.029  -1.606  1.00 0.00 ? 44  ARG A C    6  
ATOM 9880  O O    . ARG A 1 44  ? 2.039   -3.939  -0.533  1.00 0.00 ? 44  ARG A O    6  
ATOM 9881  C CB   . ARG A 1 44  ? 4.024   -1.991  -2.029  1.00 0.00 ? 44  ARG A CB   6  
ATOM 9882  C CG   . ARG A 1 44  ? 5.055   -2.799  -1.258  1.00 0.00 ? 44  ARG A CG   6  
ATOM 9883  C CD   . ARG A 1 44  ? 6.443   -2.192  -1.380  1.00 0.00 ? 44  ARG A CD   6  
ATOM 9884  N NE   . ARG A 1 44  ? 7.491   -3.146  -1.025  1.00 0.00 ? 44  ARG A NE   6  
ATOM 9885  C CZ   . ARG A 1 44  ? 7.848   -4.166  -1.797  1.00 0.00 ? 44  ARG A CZ   6  
ATOM 9886  N NH1  . ARG A 1 44  ? 7.244   -4.364  -2.961  1.00 0.00 ? 44  ARG A NH1  6  
ATOM 9887  N NH2  . ARG A 1 44  ? 8.810   -4.991  -1.405  1.00 0.00 ? 44  ARG A NH2  6  
ATOM 9888  H H    . ARG A 1 44  ? 1.028   -1.993  -1.784  1.00 0.00 ? 44  ARG A H    6  
ATOM 9889  H HA   . ARG A 1 44  ? 3.034   -3.168  -3.518  1.00 0.00 ? 44  ARG A HA   6  
ATOM 9890  H HB2  . ARG A 1 44  ? 4.513   -1.548  -2.885  1.00 0.00 ? 44  ARG A HB2  6  
ATOM 9891  H HB3  . ARG A 1 44  ? 3.660   -1.204  -1.386  1.00 0.00 ? 44  ARG A HB3  6  
ATOM 9892  H HG2  . ARG A 1 44  ? 4.774   -2.822  -0.215  1.00 0.00 ? 44  ARG A HG2  6  
ATOM 9893  H HG3  . ARG A 1 44  ? 5.075   -3.805  -1.649  1.00 0.00 ? 44  ARG A HG3  6  
ATOM 9894  H HD2  . ARG A 1 44  ? 6.593   -1.870  -2.399  1.00 0.00 ? 44  ARG A HD2  6  
ATOM 9895  H HD3  . ARG A 1 44  ? 6.507   -1.339  -0.720  1.00 0.00 ? 44  ARG A HD3  6  
ATOM 9896  H HE   . ARG A 1 44  ? 7.950   -3.018  -0.169  1.00 0.00 ? 44  ARG A HE   6  
ATOM 9897  H HH11 . ARG A 1 44  ? 6.519   -3.743  -3.259  1.00 0.00 ? 44  ARG A HH11 6  
ATOM 9898  H HH12 . ARG A 1 44  ? 7.515   -5.132  -3.541  1.00 0.00 ? 44  ARG A HH12 6  
ATOM 9899  H HH21 . ARG A 1 44  ? 9.267   -4.845  -0.529  1.00 0.00 ? 44  ARG A HH21 6  
ATOM 9900  H HH22 . ARG A 1 44  ? 9.078   -5.759  -1.987  1.00 0.00 ? 44  ARG A HH22 6  
ATOM 9901  N N    . PRO A 1 45  ? 3.151   -5.189  -2.042  1.00 0.00 ? 45  PRO A N    6  
ATOM 9902  C CA   . PRO A 1 45  ? 3.044   -6.438  -1.283  1.00 0.00 ? 45  PRO A CA   6  
ATOM 9903  C C    . PRO A 1 45  ? 3.897   -6.423  -0.019  1.00 0.00 ? 45  PRO A C    6  
ATOM 9904  O O    . PRO A 1 45  ? 5.099   -6.164  -0.074  1.00 0.00 ? 45  PRO A O    6  
ATOM 9905  C CB   . PRO A 1 45  ? 3.559   -7.494  -2.263  1.00 0.00 ? 45  PRO A CB   6  
ATOM 9906  C CG   . PRO A 1 45  ? 4.462   -6.749  -3.184  1.00 0.00 ? 45  PRO A CG   6  
ATOM 9907  C CD   . PRO A 1 45  ? 3.876   -5.369  -3.311  1.00 0.00 ? 45  PRO A CD   6  
ATOM 9908  H HA   . PRO A 1 45  ? 2.019   -6.657  -1.021  1.00 0.00 ? 45  PRO A HA   6  
ATOM 9909  H HB2  . PRO A 1 45  ? 4.093   -8.262  -1.721  1.00 0.00 ? 45  PRO A HB2  6  
ATOM 9910  H HB3  . PRO A 1 45  ? 2.728   -7.933  -2.795  1.00 0.00 ? 45  PRO A HB3  6  
ATOM 9911  H HG2  . PRO A 1 45  ? 5.454   -6.697  -2.764  1.00 0.00 ? 45  PRO A HG2  6  
ATOM 9912  H HG3  . PRO A 1 45  ? 4.486   -7.235  -4.148  1.00 0.00 ? 45  PRO A HG3  6  
ATOM 9913  H HD2  . PRO A 1 45  ? 4.660   -4.634  -3.415  1.00 0.00 ? 45  PRO A HD2  6  
ATOM 9914  H HD3  . PRO A 1 45  ? 3.199   -5.323  -4.151  1.00 0.00 ? 45  PRO A HD3  6  
ATOM 9915  N N    . SER A 1 46  ? 3.268   -6.702  1.118   1.00 0.00 ? 46  SER A N    6  
ATOM 9916  C CA   . SER A 1 46  ? 3.970   -6.717  2.396   1.00 0.00 ? 46  SER A CA   6  
ATOM 9917  C C    . SER A 1 46  ? 5.128   -7.709  2.368   1.00 0.00 ? 46  SER A C    6  
ATOM 9918  O O    . SER A 1 46  ? 5.416   -8.316  1.336   1.00 0.00 ? 46  SER A O    6  
ATOM 9919  C CB   . SER A 1 46  ? 3.004   -7.074  3.528   1.00 0.00 ? 46  SER A CB   6  
ATOM 9920  O OG   . SER A 1 46  ? 3.487   -6.610  4.776   1.00 0.00 ? 46  SER A OG   6  
ATOM 9921  H H    . SER A 1 46  ? 2.308   -6.900  1.096   1.00 0.00 ? 46  SER A H    6  
ATOM 9922  H HA   . SER A 1 46  ? 4.363   -5.727  2.570   1.00 0.00 ? 46  SER A HA   6  
ATOM 9923  H HB2  . SER A 1 46  ? 2.044   -6.620  3.336   1.00 0.00 ? 46  SER A HB2  6  
ATOM 9924  H HB3  . SER A 1 46  ? 2.891   -8.148  3.575   1.00 0.00 ? 46  SER A HB3  6  
ATOM 9925  H HG   . SER A 1 46  ? 2.794   -6.122  5.227   1.00 0.00 ? 46  SER A HG   6  
ATOM 9926  N N    . ASP A 1 47  ? 5.789   -7.869  3.509   1.00 0.00 ? 47  ASP A N    6  
ATOM 9927  C CA   . ASP A 1 47  ? 6.916   -8.788  3.618   1.00 0.00 ? 47  ASP A CA   6  
ATOM 9928  C C    . ASP A 1 47  ? 6.674   -9.818  4.718   1.00 0.00 ? 47  ASP A C    6  
ATOM 9929  O O    . ASP A 1 47  ? 6.372   -10.978 4.440   1.00 0.00 ? 47  ASP A O    6  
ATOM 9930  C CB   . ASP A 1 47  ? 8.206   -8.017  3.899   1.00 0.00 ? 47  ASP A CB   6  
ATOM 9931  C CG   . ASP A 1 47  ? 8.531   -7.015  2.809   1.00 0.00 ? 47  ASP A CG   6  
ATOM 9932  O OD1  . ASP A 1 47  ? 8.913   -7.448  1.701   1.00 0.00 ? 47  ASP A OD1  6  
ATOM 9933  O OD2  . ASP A 1 47  ? 8.404   -5.799  3.062   1.00 0.00 ? 47  ASP A OD2  6  
ATOM 9934  H H    . ASP A 1 47  ? 5.512   -7.357  4.298   1.00 0.00 ? 47  ASP A H    6  
ATOM 9935  H HA   . ASP A 1 47  ? 7.015   -9.305  2.675   1.00 0.00 ? 47  ASP A HA   6  
ATOM 9936  H HB2  . ASP A 1 47  ? 8.102   -7.482  4.833   1.00 0.00 ? 47  ASP A HB2  6  
ATOM 9937  H HB3  . ASP A 1 47  ? 9.026   -8.715  3.979   1.00 0.00 ? 47  ASP A HB3  6  
ATOM 9938  N N    . ASN A 1 48  ? 6.809   -9.384  5.967   1.00 0.00 ? 48  ASN A N    6  
ATOM 9939  C CA   . ASN A 1 48  ? 6.607   -10.268 7.109   1.00 0.00 ? 48  ASN A CA   6  
ATOM 9940  C C    . ASN A 1 48  ? 5.208   -10.877 7.084   1.00 0.00 ? 48  ASN A C    6  
ATOM 9941  O O    . ASN A 1 48  ? 5.047   -12.084 6.899   1.00 0.00 ? 48  ASN A O    6  
ATOM 9942  C CB   . ASN A 1 48  ? 6.820   -9.503  8.417   1.00 0.00 ? 48  ASN A CB   6  
ATOM 9943  C CG   . ASN A 1 48  ? 8.277   -9.464  8.833   1.00 0.00 ? 48  ASN A CG   6  
ATOM 9944  O OD1  . ASN A 1 48  ? 9.096   -8.791  8.206   1.00 0.00 ? 48  ASN A OD1  6  
ATOM 9945  N ND2  . ASN A 1 48  ? 8.608   -10.188 9.896   1.00 0.00 ? 48  ASN A ND2  6  
ATOM 9946  H H    . ASN A 1 48  ? 7.051   -8.448  6.125   1.00 0.00 ? 48  ASN A H    6  
ATOM 9947  H HA   . ASN A 1 48  ? 7.334   -11.064 7.045   1.00 0.00 ? 48  ASN A HA   6  
ATOM 9948  H HB2  . ASN A 1 48  ? 6.473   -8.487  8.293   1.00 0.00 ? 48  ASN A HB2  6  
ATOM 9949  H HB3  . ASN A 1 48  ? 6.252   -9.979  9.202   1.00 0.00 ? 48  ASN A HB3  6  
ATOM 9950  H HD21 . ASN A 1 48  ? 7.904   -10.700 10.346  1.00 0.00 ? 48  ASN A HD21 6  
ATOM 9951  H HD22 . ASN A 1 48  ? 9.544   -10.180 10.188  1.00 0.00 ? 48  ASN A HD22 6  
ATOM 9952  N N    . THR A 1 49  ? 4.198   -10.033 7.272   1.00 0.00 ? 49  THR A N    6  
ATOM 9953  C CA   . THR A 1 49  ? 2.813   -10.487 7.273   1.00 0.00 ? 49  THR A CA   6  
ATOM 9954  C C    . THR A 1 49  ? 2.609   -11.631 6.285   1.00 0.00 ? 49  THR A C    6  
ATOM 9955  O O    . THR A 1 49  ? 3.309   -11.747 5.279   1.00 0.00 ? 49  THR A O    6  
ATOM 9956  C CB   . THR A 1 49  ? 1.846   -9.341  6.920   1.00 0.00 ? 49  THR A CB   6  
ATOM 9957  O OG1  . THR A 1 49  ? 2.098   -8.879  5.589   1.00 0.00 ? 49  THR A OG1  6  
ATOM 9958  C CG2  . THR A 1 49  ? 1.996   -8.187  7.900   1.00 0.00 ? 49  THR A CG2  6  
ATOM 9959  H H    . THR A 1 49  ? 4.391   -9.083  7.415   1.00 0.00 ? 49  THR A H    6  
ATOM 9960  H HA   . THR A 1 49  ? 2.577   -10.837 8.267   1.00 0.00 ? 49  THR A HA   6  
ATOM 9961  H HB   . THR A 1 49  ? 0.834   -9.714  6.978   1.00 0.00 ? 49  THR A HB   6  
ATOM 9962  H HG1  . THR A 1 49  ? 2.834   -8.262  5.597   1.00 0.00 ? 49  THR A HG1  6  
ATOM 9963  H HG21 . THR A 1 49  ? 2.945   -8.267  8.409   1.00 0.00 ? 49  THR A HG21 6  
ATOM 9964  H HG22 . THR A 1 49  ? 1.195   -8.222  8.622   1.00 0.00 ? 49  THR A HG22 6  
ATOM 9965  H HG23 . THR A 1 49  ? 1.955   -7.252  7.362   1.00 0.00 ? 49  THR A HG23 6  
ATOM 9966  N N    . PRO A 1 50  ? 1.627   -12.496 6.576   1.00 0.00 ? 50  PRO A N    6  
ATOM 9967  C CA   . PRO A 1 50  ? 1.307   -13.646 5.724   1.00 0.00 ? 50  PRO A CA   6  
ATOM 9968  C C    . PRO A 1 50  ? 0.680   -13.228 4.398   1.00 0.00 ? 50  PRO A C    6  
ATOM 9969  O O    . PRO A 1 50  ? -0.537  -13.293 4.228   1.00 0.00 ? 50  PRO A O    6  
ATOM 9970  C CB   . PRO A 1 50  ? 0.303   -14.441 6.563   1.00 0.00 ? 50  PRO A CB   6  
ATOM 9971  C CG   . PRO A 1 50  ? -0.321  -13.431 7.464   1.00 0.00 ? 50  PRO A CG   6  
ATOM 9972  C CD   . PRO A 1 50  ? 0.752   -12.419 7.758   1.00 0.00 ? 50  PRO A CD   6  
ATOM 9973  H HA   . PRO A 1 50  ? 2.180   -14.253 5.533   1.00 0.00 ? 50  PRO A HA   6  
ATOM 9974  H HB2  . PRO A 1 50  ? -0.430  -14.899 5.914   1.00 0.00 ? 50  PRO A HB2  6  
ATOM 9975  H HB3  . PRO A 1 50  ? 0.822   -15.203 7.124   1.00 0.00 ? 50  PRO A HB3  6  
ATOM 9976  H HG2  . PRO A 1 50  ? -1.155  -12.960 6.966   1.00 0.00 ? 50  PRO A HG2  6  
ATOM 9977  H HG3  . PRO A 1 50  ? -0.647  -13.907 8.377   1.00 0.00 ? 50  PRO A HG3  6  
ATOM 9978  H HD2  . PRO A 1 50  ? 0.323   -11.433 7.857   1.00 0.00 ? 50  PRO A HD2  6  
ATOM 9979  H HD3  . PRO A 1 50  ? 1.291   -12.690 8.654   1.00 0.00 ? 50  PRO A HD3  6  
ATOM 9980  N N    . GLY A 1 51  ? 1.520   -12.800 3.461   1.00 0.00 ? 51  GLY A N    6  
ATOM 9981  C CA   . GLY A 1 51  ? 1.029   -12.378 2.162   1.00 0.00 ? 51  GLY A CA   6  
ATOM 9982  C C    . GLY A 1 51  ? 0.015   -11.256 2.261   1.00 0.00 ? 51  GLY A C    6  
ATOM 9983  O O    . GLY A 1 51  ? -0.997  -11.261 1.560   1.00 0.00 ? 51  GLY A O    6  
ATOM 9984  H H    . GLY A 1 51  ? 2.480   -12.769 3.653   1.00 0.00 ? 51  GLY A H    6  
ATOM 9985  H HA2  . GLY A 1 51  ? 1.864   -12.043 1.565   1.00 0.00 ? 51  GLY A HA2  6  
ATOM 9986  H HA3  . GLY A 1 51  ? 0.566   -13.223 1.673   1.00 0.00 ? 51  GLY A HA3  6  
ATOM 9987  N N    . ASP A 1 52  ? 0.285   -10.293 3.135   1.00 0.00 ? 52  ASP A N    6  
ATOM 9988  C CA   . ASP A 1 52  ? -0.612  -9.159  3.325   1.00 0.00 ? 52  ASP A CA   6  
ATOM 9989  C C    . ASP A 1 52  ? -0.199  -7.985  2.442   1.00 0.00 ? 52  ASP A C    6  
ATOM 9990  O O    . ASP A 1 52  ? 0.904   -7.965  1.895   1.00 0.00 ? 52  ASP A O    6  
ATOM 9991  C CB   . ASP A 1 52  ? -0.623  -8.730  4.793   1.00 0.00 ? 52  ASP A CB   6  
ATOM 9992  C CG   . ASP A 1 52  ? -1.958  -8.147  5.216   1.00 0.00 ? 52  ASP A CG   6  
ATOM 9993  O OD1  . ASP A 1 52  ? -2.993  -8.801  4.974   1.00 0.00 ? 52  ASP A OD1  6  
ATOM 9994  O OD2  . ASP A 1 52  ? -1.966  -7.037  5.788   1.00 0.00 ? 52  ASP A OD2  6  
ATOM 9995  H H    . ASP A 1 52  ? 1.108   -10.345 3.665   1.00 0.00 ? 52  ASP A H    6  
ATOM 9996  H HA   . ASP A 1 52  ? -1.606  -9.472  3.043   1.00 0.00 ? 52  ASP A HA   6  
ATOM 9997  H HB2  . ASP A 1 52  ? -0.414  -9.589  5.414   1.00 0.00 ? 52  ASP A HB2  6  
ATOM 9998  H HB3  . ASP A 1 52  ? 0.141   -7.983  4.949   1.00 0.00 ? 52  ASP A HB3  6  
ATOM 9999  N N    . TYR A 1 53  ? -1.090  -7.010  2.308   1.00 0.00 ? 53  TYR A N    6  
ATOM 10000 C CA   . TYR A 1 53  ? -0.819  -5.834  1.489   1.00 0.00 ? 53  TYR A CA   6  
ATOM 10001 C C    . TYR A 1 53  ? -0.861  -4.562  2.331   1.00 0.00 ? 53  TYR A C    6  
ATOM 10002 O O    . TYR A 1 53  ? -1.240  -4.591  3.502   1.00 0.00 ? 53  TYR A O    6  
ATOM 10003 C CB   . TYR A 1 53  ? -1.833  -5.737  0.348   1.00 0.00 ? 53  TYR A CB   6  
ATOM 10004 C CG   . TYR A 1 53  ? -1.614  -6.758  -0.745  1.00 0.00 ? 53  TYR A CG   6  
ATOM 10005 C CD1  . TYR A 1 53  ? -2.056  -8.067  -0.600  1.00 0.00 ? 53  TYR A CD1  6  
ATOM 10006 C CD2  . TYR A 1 53  ? -0.966  -6.413  -1.925  1.00 0.00 ? 53  TYR A CD2  6  
ATOM 10007 C CE1  . TYR A 1 53  ? -1.857  -9.003  -1.596  1.00 0.00 ? 53  TYR A CE1  6  
ATOM 10008 C CE2  . TYR A 1 53  ? -0.764  -7.342  -2.927  1.00 0.00 ? 53  TYR A CE2  6  
ATOM 10009 C CZ   . TYR A 1 53  ? -1.211  -8.635  -2.758  1.00 0.00 ? 53  TYR A CZ   6  
ATOM 10010 O OH   . TYR A 1 53  ? -1.012  -9.565  -3.753  1.00 0.00 ? 53  TYR A OH   6  
ATOM 10011 H H    . TYR A 1 53  ? -1.952  -7.082  2.769   1.00 0.00 ? 53  TYR A H    6  
ATOM 10012 H HA   . TYR A 1 53  ? 0.170   -5.942  1.070   1.00 0.00 ? 53  TYR A HA   6  
ATOM 10013 H HB2  . TYR A 1 53  ? -2.826  -5.884  0.744   1.00 0.00 ? 53  TYR A HB2  6  
ATOM 10014 H HB3  . TYR A 1 53  ? -1.771  -4.755  -0.097  1.00 0.00 ? 53  TYR A HB3  6  
ATOM 10015 H HD1  . TYR A 1 53  ? -2.563  -8.351  0.311   1.00 0.00 ? 53  TYR A HD1  6  
ATOM 10016 H HD2  . TYR A 1 53  ? -0.616  -5.398  -2.054  1.00 0.00 ? 53  TYR A HD2  6  
ATOM 10017 H HE1  . TYR A 1 53  ? -2.208  -10.016 -1.464  1.00 0.00 ? 53  TYR A HE1  6  
ATOM 10018 H HE2  . TYR A 1 53  ? -0.257  -7.055  -3.837  1.00 0.00 ? 53  TYR A HE2  6  
ATOM 10019 H HH   . TYR A 1 53  ? -0.981  -10.444 -3.368  1.00 0.00 ? 53  TYR A HH   6  
ATOM 10020 N N    . SER A 1 54  ? -0.468  -3.446  1.725   1.00 0.00 ? 54  SER A N    6  
ATOM 10021 C CA   . SER A 1 54  ? -0.457  -2.164  2.419   1.00 0.00 ? 54  SER A CA   6  
ATOM 10022 C C    . SER A 1 54  ? -0.384  -1.009  1.424   1.00 0.00 ? 54  SER A C    6  
ATOM 10023 O O    . SER A 1 54  ? 0.503   -0.964  0.570   1.00 0.00 ? 54  SER A O    6  
ATOM 10024 C CB   . SER A 1 54  ? 0.727   -2.093  3.386   1.00 0.00 ? 54  SER A CB   6  
ATOM 10025 O OG   . SER A 1 54  ? 0.393   -2.657  4.642   1.00 0.00 ? 54  SER A OG   6  
ATOM 10026 H H    . SER A 1 54  ? -0.176  -3.488  0.790   1.00 0.00 ? 54  SER A H    6  
ATOM 10027 H HA   . SER A 1 54  ? -1.375  -2.082  2.980   1.00 0.00 ? 54  SER A HA   6  
ATOM 10028 H HB2  . SER A 1 54  ? 1.561   -2.638  2.971   1.00 0.00 ? 54  SER A HB2  6  
ATOM 10029 H HB3  . SER A 1 54  ? 1.008   -1.060  3.532   1.00 0.00 ? 54  SER A HB3  6  
ATOM 10030 H HG   . SER A 1 54  ? -0.016  -1.988  5.196   1.00 0.00 ? 54  SER A HG   6  
ATOM 10031 N N    . LEU A 1 55  ? -1.324  -0.077  1.540   1.00 0.00 ? 55  LEU A N    6  
ATOM 10032 C CA   . LEU A 1 55  ? -1.368  1.079   0.652   1.00 0.00 ? 55  LEU A CA   6  
ATOM 10033 C C    . LEU A 1 55  ? -0.471  2.199   1.170   1.00 0.00 ? 55  LEU A C    6  
ATOM 10034 O O    . LEU A 1 55  ? -0.300  2.362   2.378   1.00 0.00 ? 55  LEU A O    6  
ATOM 10035 C CB   . LEU A 1 55  ? -2.805  1.585   0.512   1.00 0.00 ? 55  LEU A CB   6  
ATOM 10036 C CG   . LEU A 1 55  ? -3.088  2.478   -0.697  1.00 0.00 ? 55  LEU A CG   6  
ATOM 10037 C CD1  . LEU A 1 55  ? -4.533  2.328   -1.145  1.00 0.00 ? 55  LEU A CD1  6  
ATOM 10038 C CD2  . LEU A 1 55  ? -2.777  3.931   -0.370  1.00 0.00 ? 55  LEU A CD2  6  
ATOM 10039 H H    . LEU A 1 55  ? -2.004  -0.167  2.239   1.00 0.00 ? 55  LEU A H    6  
ATOM 10040 H HA   . LEU A 1 55  ? -1.009  0.766   -0.318  1.00 0.00 ? 55  LEU A HA   6  
ATOM 10041 H HB2  . LEU A 1 55  ? -3.453  0.724   0.446   1.00 0.00 ? 55  LEU A HB2  6  
ATOM 10042 H HB3  . LEU A 1 55  ? -3.045  2.147   1.403   1.00 0.00 ? 55  LEU A HB3  6  
ATOM 10043 H HG   . LEU A 1 55  ? -2.452  2.175   -1.517  1.00 0.00 ? 55  LEU A HG   6  
ATOM 10044 H HD11 . LEU A 1 55  ? -4.757  3.073   -1.893  1.00 0.00 ? 55  LEU A HD11 6  
ATOM 10045 H HD12 . LEU A 1 55  ? -5.189  2.461   -0.296  1.00 0.00 ? 55  LEU A HD12 6  
ATOM 10046 H HD13 . LEU A 1 55  ? -4.681  1.342   -1.561  1.00 0.00 ? 55  LEU A HD13 6  
ATOM 10047 H HD21 . LEU A 1 55  ? -3.005  4.123   0.668   1.00 0.00 ? 55  LEU A HD21 6  
ATOM 10048 H HD22 . LEU A 1 55  ? -3.376  4.577   -0.996  1.00 0.00 ? 55  LEU A HD22 6  
ATOM 10049 H HD23 . LEU A 1 55  ? -1.730  4.124   -0.551  1.00 0.00 ? 55  LEU A HD23 6  
ATOM 10050 N N    . TYR A 1 56  ? 0.097   2.969   0.248   1.00 0.00 ? 56  TYR A N    6  
ATOM 10051 C CA   . TYR A 1 56  ? 0.976   4.074   0.612   1.00 0.00 ? 56  TYR A CA   6  
ATOM 10052 C C    . TYR A 1 56  ? 0.493   5.381   -0.008  1.00 0.00 ? 56  TYR A C    6  
ATOM 10053 O O    . TYR A 1 56  ? 0.612   5.590   -1.216  1.00 0.00 ? 56  TYR A O    6  
ATOM 10054 C CB   . TYR A 1 56  ? 2.409   3.782   0.163   1.00 0.00 ? 56  TYR A CB   6  
ATOM 10055 C CG   . TYR A 1 56  ? 3.074   2.670   0.943   1.00 0.00 ? 56  TYR A CG   6  
ATOM 10056 C CD1  . TYR A 1 56  ? 3.754   2.935   2.125   1.00 0.00 ? 56  TYR A CD1  6  
ATOM 10057 C CD2  . TYR A 1 56  ? 3.020   1.355   0.498   1.00 0.00 ? 56  TYR A CD2  6  
ATOM 10058 C CE1  . TYR A 1 56  ? 4.363   1.922   2.841   1.00 0.00 ? 56  TYR A CE1  6  
ATOM 10059 C CE2  . TYR A 1 56  ? 3.625   0.336   1.208   1.00 0.00 ? 56  TYR A CE2  6  
ATOM 10060 C CZ   . TYR A 1 56  ? 4.296   0.625   2.378   1.00 0.00 ? 56  TYR A CZ   6  
ATOM 10061 O OH   . TYR A 1 56  ? 4.900   -0.387  3.089   1.00 0.00 ? 56  TYR A OH   6  
ATOM 10062 H H    . TYR A 1 56  ? -0.078  2.789   -0.699  1.00 0.00 ? 56  TYR A H    6  
ATOM 10063 H HA   . TYR A 1 56  ? 0.959   4.171   1.688   1.00 0.00 ? 56  TYR A HA   6  
ATOM 10064 H HB2  . TYR A 1 56  ? 2.402   3.497   -0.878  1.00 0.00 ? 56  TYR A HB2  6  
ATOM 10065 H HB3  . TYR A 1 56  ? 3.005   4.674   0.283   1.00 0.00 ? 56  TYR A HB3  6  
ATOM 10066 H HD1  . TYR A 1 56  ? 3.804   3.952   2.485   1.00 0.00 ? 56  TYR A HD1  6  
ATOM 10067 H HD2  . TYR A 1 56  ? 2.494   1.132   -0.419  1.00 0.00 ? 56  TYR A HD2  6  
ATOM 10068 H HE1  . TYR A 1 56  ? 4.888   2.148   3.757   1.00 0.00 ? 56  TYR A HE1  6  
ATOM 10069 H HE2  . TYR A 1 56  ? 3.573   -0.681  0.846   1.00 0.00 ? 56  TYR A HE2  6  
ATOM 10070 H HH   . TYR A 1 56  ? 4.746   -0.255  4.027   1.00 0.00 ? 56  TYR A HH   6  
ATOM 10071 N N    . PHE A 1 57  ? -0.051  6.259   0.828   1.00 0.00 ? 57  PHE A N    6  
ATOM 10072 C CA   . PHE A 1 57  ? -0.553  7.547   0.364   1.00 0.00 ? 57  PHE A CA   6  
ATOM 10073 C C    . PHE A 1 57  ? 0.209   8.696   1.018   1.00 0.00 ? 57  PHE A C    6  
ATOM 10074 O O    . PHE A 1 57  ? 0.644   8.592   2.165   1.00 0.00 ? 57  PHE A O    6  
ATOM 10075 C CB   . PHE A 1 57  ? -2.048  7.675   0.665   1.00 0.00 ? 57  PHE A CB   6  
ATOM 10076 C CG   . PHE A 1 57  ? -2.684  8.884   0.041   1.00 0.00 ? 57  PHE A CG   6  
ATOM 10077 C CD1  . PHE A 1 57  ? -2.527  9.146   -1.311  1.00 0.00 ? 57  PHE A CD1  6  
ATOM 10078 C CD2  . PHE A 1 57  ? -3.437  9.759   0.807   1.00 0.00 ? 57  PHE A CD2  6  
ATOM 10079 C CE1  . PHE A 1 57  ? -3.112  10.258  -1.888  1.00 0.00 ? 57  PHE A CE1  6  
ATOM 10080 C CE2  . PHE A 1 57  ? -4.024  10.872  0.235   1.00 0.00 ? 57  PHE A CE2  6  
ATOM 10081 C CZ   . PHE A 1 57  ? -3.860  11.123  -1.113  1.00 0.00 ? 57  PHE A CZ   6  
ATOM 10082 H H    . PHE A 1 57  ? -0.117  6.035   1.780   1.00 0.00 ? 57  PHE A H    6  
ATOM 10083 H HA   . PHE A 1 57  ? -0.404  7.595   -0.704  1.00 0.00 ? 57  PHE A HA   6  
ATOM 10084 H HB2  . PHE A 1 57  ? -2.559  6.801   0.290   1.00 0.00 ? 57  PHE A HB2  6  
ATOM 10085 H HB3  . PHE A 1 57  ? -2.188  7.738   1.733   1.00 0.00 ? 57  PHE A HB3  6  
ATOM 10086 H HD1  . PHE A 1 57  ? -1.941  8.470   -1.917  1.00 0.00 ? 57  PHE A HD1  6  
ATOM 10087 H HD2  . PHE A 1 57  ? -3.566  9.566   1.861   1.00 0.00 ? 57  PHE A HD2  6  
ATOM 10088 H HE1  . PHE A 1 57  ? -2.981  10.451  -2.942  1.00 0.00 ? 57  PHE A HE1  6  
ATOM 10089 H HE2  . PHE A 1 57  ? -4.609  11.547  0.842   1.00 0.00 ? 57  PHE A HE2  6  
ATOM 10090 H HZ   . PHE A 1 57  ? -4.318  11.991  -1.562  1.00 0.00 ? 57  PHE A HZ   6  
ATOM 10091 N N    . ARG A 1 58  ? 0.368   9.790   0.280   1.00 0.00 ? 58  ARG A N    6  
ATOM 10092 C CA   . ARG A 1 58  ? 1.078   10.957  0.787   1.00 0.00 ? 58  ARG A CA   6  
ATOM 10093 C C    . ARG A 1 58  ? 0.099   12.014  1.289   1.00 0.00 ? 58  ARG A C    6  
ATOM 10094 O O    . ARG A 1 58  ? -0.910  12.299  0.644   1.00 0.00 ? 58  ARG A O    6  
ATOM 10095 C CB   . ARG A 1 58  ? 1.971   11.551  -0.305  1.00 0.00 ? 58  ARG A CB   6  
ATOM 10096 C CG   . ARG A 1 58  ? 2.557   12.906  0.058   1.00 0.00 ? 58  ARG A CG   6  
ATOM 10097 C CD   . ARG A 1 58  ? 3.835   12.761  0.869   1.00 0.00 ? 58  ARG A CD   6  
ATOM 10098 N NE   . ARG A 1 58  ? 4.060   13.906  1.747   1.00 0.00 ? 58  ARG A NE   6  
ATOM 10099 C CZ   . ARG A 1 58  ? 5.104   14.015  2.560   1.00 0.00 ? 58  ARG A CZ   6  
ATOM 10100 N NH1  . ARG A 1 58  ? 6.015   13.053  2.607   1.00 0.00 ? 58  ARG A NH1  6  
ATOM 10101 N NH2  . ARG A 1 58  ? 5.239   15.089  3.328   1.00 0.00 ? 58  ARG A NH2  6  
ATOM 10102 H H    . ARG A 1 58  ? -0.002  9.812   -0.628  1.00 0.00 ? 58  ARG A H    6  
ATOM 10103 H HA   . ARG A 1 58  ? 1.698   10.637  1.611   1.00 0.00 ? 58  ARG A HA   6  
ATOM 10104 H HB2  . ARG A 1 58  ? 2.787   10.870  -0.496  1.00 0.00 ? 58  ARG A HB2  6  
ATOM 10105 H HB3  . ARG A 1 58  ? 1.388   11.665  -1.206  1.00 0.00 ? 58  ARG A HB3  6  
ATOM 10106 H HG2  . ARG A 1 58  ? 2.779   13.447  -0.850  1.00 0.00 ? 58  ARG A HG2  6  
ATOM 10107 H HG3  . ARG A 1 58  ? 1.832   13.457  0.639   1.00 0.00 ? 58  ARG A HG3  6  
ATOM 10108 H HD2  . ARG A 1 58  ? 3.764   11.867  1.471   1.00 0.00 ? 58  ARG A HD2  6  
ATOM 10109 H HD3  . ARG A 1 58  ? 4.669   12.671  0.189   1.00 0.00 ? 58  ARG A HD3  6  
ATOM 10110 H HE   . ARG A 1 58  ? 3.398   14.629  1.728   1.00 0.00 ? 58  ARG A HE   6  
ATOM 10111 H HH11 . ARG A 1 58  ? 5.917   12.244  2.028   1.00 0.00 ? 58  ARG A HH11 6  
ATOM 10112 H HH12 . ARG A 1 58  ? 6.802   13.138  3.219   1.00 0.00 ? 58  ARG A HH12 6  
ATOM 10113 H HH21 . ARG A 1 58  ? 4.554   15.816  3.296   1.00 0.00 ? 58  ARG A HH21 6  
ATOM 10114 H HH22 . ARG A 1 58  ? 6.025   15.170  3.940   1.00 0.00 ? 58  ARG A HH22 6  
ATOM 10115 N N    . THR A 1 59  ? 0.403   12.593  2.447   1.00 0.00 ? 59  THR A N    6  
ATOM 10116 C CA   . THR A 1 59  ? -0.450  13.616  3.037   1.00 0.00 ? 59  THR A CA   6  
ATOM 10117 C C    . THR A 1 59  ? 0.356   14.855  3.412   1.00 0.00 ? 59  THR A C    6  
ATOM 10118 O O    . THR A 1 59  ? 1.586   14.839  3.381   1.00 0.00 ? 59  THR A O    6  
ATOM 10119 C CB   . THR A 1 59  ? -1.173  13.090  4.291   1.00 0.00 ? 59  THR A CB   6  
ATOM 10120 O OG1  . THR A 1 59  ? -0.251  12.987  5.382   1.00 0.00 ? 59  THR A OG1  6  
ATOM 10121 C CG2  . THR A 1 59  ? -1.802  11.731  4.023   1.00 0.00 ? 59  THR A CG2  6  
ATOM 10122 H H    . THR A 1 59  ? 1.221   12.323  2.914   1.00 0.00 ? 59  THR A H    6  
ATOM 10123 H HA   . THR A 1 59  ? -1.196  13.891  2.306   1.00 0.00 ? 59  THR A HA   6  
ATOM 10124 H HB   . THR A 1 59  ? -1.956  13.787  4.556   1.00 0.00 ? 59  THR A HB   6  
ATOM 10125 H HG1  . THR A 1 59  ? -0.321  13.770  5.934   1.00 0.00 ? 59  THR A HG1  6  
ATOM 10126 H HG21 . THR A 1 59  ? -1.199  10.959  4.477   1.00 0.00 ? 59  THR A HG21 6  
ATOM 10127 H HG22 . THR A 1 59  ? -1.858  11.564  2.957   1.00 0.00 ? 59  THR A HG22 6  
ATOM 10128 H HG23 . THR A 1 59  ? -2.796  11.706  4.443   1.00 0.00 ? 59  THR A HG23 6  
ATOM 10129 N N    . ASN A 1 60  ? -0.345  15.927  3.767   1.00 0.00 ? 60  ASN A N    6  
ATOM 10130 C CA   . ASN A 1 60  ? 0.306   17.175  4.148   1.00 0.00 ? 60  ASN A CA   6  
ATOM 10131 C C    . ASN A 1 60  ? 1.309   16.943  5.274   1.00 0.00 ? 60  ASN A C    6  
ATOM 10132 O O    . ASN A 1 60  ? 2.404   17.504  5.268   1.00 0.00 ? 60  ASN A O    6  
ATOM 10133 C CB   . ASN A 1 60  ? -0.737  18.206  4.582   1.00 0.00 ? 60  ASN A CB   6  
ATOM 10134 C CG   . ASN A 1 60  ? -1.405  18.886  3.402   1.00 0.00 ? 60  ASN A CG   6  
ATOM 10135 O OD1  . ASN A 1 60  ? -2.632  18.938  3.315   1.00 0.00 ? 60  ASN A OD1  6  
ATOM 10136 N ND2  . ASN A 1 60  ? -0.598  19.410  2.487   1.00 0.00 ? 60  ASN A ND2  6  
ATOM 10137 H H    . ASN A 1 60  ? -1.324  15.878  3.772   1.00 0.00 ? 60  ASN A H    6  
ATOM 10138 H HA   . ASN A 1 60  ? 0.833   17.551  3.284   1.00 0.00 ? 60  ASN A HA   6  
ATOM 10139 H HB2  . ASN A 1 60  ? -1.499  17.714  5.168   1.00 0.00 ? 60  ASN A HB2  6  
ATOM 10140 H HB3  . ASN A 1 60  ? -0.257  18.962  5.186   1.00 0.00 ? 60  ASN A HB3  6  
ATOM 10141 H HD21 . ASN A 1 60  ? 0.370   19.330  2.623   1.00 0.00 ? 60  ASN A HD21 6  
ATOM 10142 H HD22 . ASN A 1 60  ? -1.003  19.856  1.714   1.00 0.00 ? 60  ASN A HD22 6  
ATOM 10143 N N    . GLU A 1 61  ? 0.925   16.113  6.239   1.00 0.00 ? 61  GLU A N    6  
ATOM 10144 C CA   . GLU A 1 61  ? 1.791   15.808  7.372   1.00 0.00 ? 61  GLU A CA   6  
ATOM 10145 C C    . GLU A 1 61  ? 2.920   14.869  6.956   1.00 0.00 ? 61  GLU A C    6  
ATOM 10146 O O    . GLU A 1 61  ? 4.093   15.235  6.998   1.00 0.00 ? 61  GLU A O    6  
ATOM 10147 C CB   . GLU A 1 61  ? 0.981   15.178  8.507   1.00 0.00 ? 61  GLU A CB   6  
ATOM 10148 C CG   . GLU A 1 61  ? 0.185   16.186  9.319   1.00 0.00 ? 61  GLU A CG   6  
ATOM 10149 C CD   . GLU A 1 61  ? 1.066   17.221  9.990   1.00 0.00 ? 61  GLU A CD   6  
ATOM 10150 O OE1  . GLU A 1 61  ? 2.058   16.826  10.637  1.00 0.00 ? 61  GLU A OE1  6  
ATOM 10151 O OE2  . GLU A 1 61  ? 0.764   18.426  9.867   1.00 0.00 ? 61  GLU A OE2  6  
ATOM 10152 H H    . GLU A 1 61  ? 0.040   15.697  6.188   1.00 0.00 ? 61  GLU A H    6  
ATOM 10153 H HA   . GLU A 1 61  ? 2.220   16.735  7.720   1.00 0.00 ? 61  GLU A HA   6  
ATOM 10154 H HB2  . GLU A 1 61  ? 0.291   14.460  8.086   1.00 0.00 ? 61  GLU A HB2  6  
ATOM 10155 H HB3  . GLU A 1 61  ? 1.657   14.664  9.174   1.00 0.00 ? 61  GLU A HB3  6  
ATOM 10156 H HG2  . GLU A 1 61  ? -0.504  16.695  8.661   1.00 0.00 ? 61  GLU A HG2  6  
ATOM 10157 H HG3  . GLU A 1 61  ? -0.370  15.658  10.080  1.00 0.00 ? 61  GLU A HG3  6  
ATOM 10158 N N    . ASN A 1 62  ? 2.555   13.655  6.556   1.00 0.00 ? 62  ASN A N    6  
ATOM 10159 C CA   . ASN A 1 62  ? 3.536   12.662  6.134   1.00 0.00 ? 62  ASN A CA   6  
ATOM 10160 C C    . ASN A 1 62  ? 2.852   11.459  5.492   1.00 0.00 ? 62  ASN A C    6  
ATOM 10161 O O    . ASN A 1 62  ? 1.643   11.272  5.633   1.00 0.00 ? 62  ASN A O    6  
ATOM 10162 C CB   . ASN A 1 62  ? 4.378   12.207  7.328   1.00 0.00 ? 62  ASN A CB   6  
ATOM 10163 C CG   . ASN A 1 62  ? 3.571   12.136  8.610   1.00 0.00 ? 62  ASN A CG   6  
ATOM 10164 O OD1  . ASN A 1 62  ? 3.704   12.990  9.488   1.00 0.00 ? 62  ASN A OD1  6  
ATOM 10165 N ND2  . ASN A 1 62  ? 2.730   11.115  8.725   1.00 0.00 ? 62  ASN A ND2  6  
ATOM 10166 H H    . ASN A 1 62  ? 1.603   13.421  6.545   1.00 0.00 ? 62  ASN A H    6  
ATOM 10167 H HA   . ASN A 1 62  ? 4.184   13.125  5.405   1.00 0.00 ? 62  ASN A HA   6  
ATOM 10168 H HB2  . ASN A 1 62  ? 4.780   11.225  7.124   1.00 0.00 ? 62  ASN A HB2  6  
ATOM 10169 H HB3  . ASN A 1 62  ? 5.192   12.901  7.473   1.00 0.00 ? 62  ASN A HB3  6  
ATOM 10170 H HD21 . ASN A 1 62  ? 2.677   10.473  7.986   1.00 0.00 ? 62  ASN A HD21 6  
ATOM 10171 H HD22 . ASN A 1 62  ? 2.196   11.046  9.543   1.00 0.00 ? 62  ASN A HD22 6  
ATOM 10172 N N    . ILE A 1 63  ? 3.633   10.648  4.787   1.00 0.00 ? 63  ILE A N    6  
ATOM 10173 C CA   . ILE A 1 63  ? 3.102   9.463   4.124   1.00 0.00 ? 63  ILE A CA   6  
ATOM 10174 C C    . ILE A 1 63  ? 2.473   8.506   5.131   1.00 0.00 ? 63  ILE A C    6  
ATOM 10175 O O    . ILE A 1 63  ? 3.120   8.085   6.090   1.00 0.00 ? 63  ILE A O    6  
ATOM 10176 C CB   . ILE A 1 63  ? 4.199   8.717   3.341   1.00 0.00 ? 63  ILE A CB   6  
ATOM 10177 C CG1  . ILE A 1 63  ? 4.770   9.615   2.242   1.00 0.00 ? 63  ILE A CG1  6  
ATOM 10178 C CG2  . ILE A 1 63  ? 3.644   7.431   2.747   1.00 0.00 ? 63  ILE A CG2  6  
ATOM 10179 C CD1  . ILE A 1 63  ? 6.132   9.176   1.751   1.00 0.00 ? 63  ILE A CD1  6  
ATOM 10180 H H    . ILE A 1 63  ? 4.588   10.851  4.711   1.00 0.00 ? 63  ILE A H    6  
ATOM 10181 H HA   . ILE A 1 63  ? 2.343   9.784   3.426   1.00 0.00 ? 63  ILE A HA   6  
ATOM 10182 H HB   . ILE A 1 63  ? 4.988   8.456   4.030   1.00 0.00 ? 63  ILE A HB   6  
ATOM 10183 H HG12 . ILE A 1 63  ? 4.098   9.613   1.398   1.00 0.00 ? 63  ILE A HG12 6  
ATOM 10184 H HG13 . ILE A 1 63  ? 4.862   10.622  2.622   1.00 0.00 ? 63  ILE A HG13 6  
ATOM 10185 H HG21 . ILE A 1 63  ? 4.279   6.603   3.026   1.00 0.00 ? 63  ILE A HG21 6  
ATOM 10186 H HG22 . ILE A 1 63  ? 2.647   7.262   3.125   1.00 0.00 ? 63  ILE A HG22 6  
ATOM 10187 H HG23 . ILE A 1 63  ? 3.613   7.515   1.671   1.00 0.00 ? 63  ILE A HG23 6  
ATOM 10188 H HD11 . ILE A 1 63  ? 6.896   9.580   2.399   1.00 0.00 ? 63  ILE A HD11 6  
ATOM 10189 H HD12 . ILE A 1 63  ? 6.187   8.098   1.755   1.00 0.00 ? 63  ILE A HD12 6  
ATOM 10190 H HD13 . ILE A 1 63  ? 6.286   9.540   0.745   1.00 0.00 ? 63  ILE A HD13 6  
ATOM 10191 N N    . GLN A 1 64  ? 1.208   8.166   4.905   1.00 0.00 ? 64  GLN A N    6  
ATOM 10192 C CA   . GLN A 1 64  ? 0.491   7.257   5.792   1.00 0.00 ? 64  GLN A CA   6  
ATOM 10193 C C    . GLN A 1 64  ? 0.734   5.805   5.395   1.00 0.00 ? 64  GLN A C    6  
ATOM 10194 O O    . GLN A 1 64  ? 1.425   5.526   4.415   1.00 0.00 ? 64  GLN A O    6  
ATOM 10195 C CB   . GLN A 1 64  ? -1.007  7.562   5.767   1.00 0.00 ? 64  GLN A CB   6  
ATOM 10196 C CG   . GLN A 1 64  ? -1.417  8.677   6.715   1.00 0.00 ? 64  GLN A CG   6  
ATOM 10197 C CD   . GLN A 1 64  ? -2.868  8.575   7.143   1.00 0.00 ? 64  GLN A CD   6  
ATOM 10198 O OE1  . GLN A 1 64  ? -3.295  7.560   7.694   1.00 0.00 ? 64  GLN A OE1  6  
ATOM 10199 N NE2  . GLN A 1 64  ? -3.635  9.629   6.892   1.00 0.00 ? 64  GLN A NE2  6  
ATOM 10200 H H    . GLN A 1 64  ? 0.746   8.534   4.124   1.00 0.00 ? 64  GLN A H    6  
ATOM 10201 H HA   . GLN A 1 64  ? 0.864   7.410   6.794   1.00 0.00 ? 64  GLN A HA   6  
ATOM 10202 H HB2  . GLN A 1 64  ? -1.287  7.850   4.765   1.00 0.00 ? 64  GLN A HB2  6  
ATOM 10203 H HB3  . GLN A 1 64  ? -1.549  6.669   6.041   1.00 0.00 ? 64  GLN A HB3  6  
ATOM 10204 H HG2  . GLN A 1 64  ? -0.795  8.630   7.597   1.00 0.00 ? 64  GLN A HG2  6  
ATOM 10205 H HG3  . GLN A 1 64  ? -1.269  9.625   6.221   1.00 0.00 ? 64  GLN A HG3  6  
ATOM 10206 H HE21 . GLN A 1 64  ? -3.227  10.403  6.449   1.00 0.00 ? 64  GLN A HE21 6  
ATOM 10207 H HE22 . GLN A 1 64  ? -4.577  9.590   7.157   1.00 0.00 ? 64  GLN A HE22 6  
ATOM 10208 N N    . ARG A 1 65  ? 0.160   4.883   6.162   1.00 0.00 ? 65  ARG A N    6  
ATOM 10209 C CA   . ARG A 1 65  ? 0.315   3.459   5.891   1.00 0.00 ? 65  ARG A CA   6  
ATOM 10210 C C    . ARG A 1 65  ? -0.962  2.698   6.234   1.00 0.00 ? 65  ARG A C    6  
ATOM 10211 O O    . ARG A 1 65  ? -1.364  2.631   7.396   1.00 0.00 ? 65  ARG A O    6  
ATOM 10212 C CB   . ARG A 1 65  ? 1.490   2.891   6.689   1.00 0.00 ? 65  ARG A CB   6  
ATOM 10213 C CG   . ARG A 1 65  ? 1.856   1.467   6.305   1.00 0.00 ? 65  ARG A CG   6  
ATOM 10214 C CD   . ARG A 1 65  ? 2.692   0.796   7.383   1.00 0.00 ? 65  ARG A CD   6  
ATOM 10215 N NE   . ARG A 1 65  ? 2.525   -0.655  7.382   1.00 0.00 ? 65  ARG A NE   6  
ATOM 10216 C CZ   . ARG A 1 65  ? 3.410   -1.497  7.903   1.00 0.00 ? 65  ARG A CZ   6  
ATOM 10217 N NH1  . ARG A 1 65  ? 4.519   -1.035  8.464   1.00 0.00 ? 65  ARG A NH1  6  
ATOM 10218 N NH2  . ARG A 1 65  ? 3.186   -2.805  7.864   1.00 0.00 ? 65  ARG A NH2  6  
ATOM 10219 H H    . ARG A 1 65  ? -0.379  5.167   6.929   1.00 0.00 ? 65  ARG A H    6  
ATOM 10220 H HA   . ARG A 1 65  ? 0.518   3.342   4.837   1.00 0.00 ? 65  ARG A HA   6  
ATOM 10221 H HB2  . ARG A 1 65  ? 2.356   3.517   6.529   1.00 0.00 ? 65  ARG A HB2  6  
ATOM 10222 H HB3  . ARG A 1 65  ? 1.236   2.904   7.738   1.00 0.00 ? 65  ARG A HB3  6  
ATOM 10223 H HG2  . ARG A 1 65  ? 0.949   0.898   6.162   1.00 0.00 ? 65  ARG A HG2  6  
ATOM 10224 H HG3  . ARG A 1 65  ? 2.420   1.486   5.384   1.00 0.00 ? 65  ARG A HG3  6  
ATOM 10225 H HD2  . ARG A 1 65  ? 3.732   1.028   7.211   1.00 0.00 ? 65  ARG A HD2  6  
ATOM 10226 H HD3  . ARG A 1 65  ? 2.391   1.183   8.345   1.00 0.00 ? 65  ARG A HD3  6  
ATOM 10227 H HE   . ARG A 1 65  ? 1.712   -1.018  6.973   1.00 0.00 ? 65  ARG A HE   6  
ATOM 10228 H HH11 . ARG A 1 65  ? 4.689   -0.051  8.496   1.00 0.00 ? 65  ARG A HH11 6  
ATOM 10229 H HH12 . ARG A 1 65  ? 5.183   -1.672  8.857   1.00 0.00 ? 65  ARG A HH12 6  
ATOM 10230 H HH21 . ARG A 1 65  ? 2.351   -3.157  7.442   1.00 0.00 ? 65  ARG A HH21 6  
ATOM 10231 H HH22 . ARG A 1 65  ? 3.853   -3.438  8.256   1.00 0.00 ? 65  ARG A HH22 6  
ATOM 10232 N N    . PHE A 1 66  ? -1.596  2.127   5.215   1.00 0.00 ? 66  PHE A N    6  
ATOM 10233 C CA   . PHE A 1 66  ? -2.828  1.372   5.409   1.00 0.00 ? 66  PHE A CA   6  
ATOM 10234 C C    . PHE A 1 66  ? -2.555  -0.129  5.389   1.00 0.00 ? 66  PHE A C    6  
ATOM 10235 O O    . PHE A 1 66  ? -1.566  -0.585  4.815   1.00 0.00 ? 66  PHE A O    6  
ATOM 10236 C CB   . PHE A 1 66  ? -3.847  1.730   4.324   1.00 0.00 ? 66  PHE A CB   6  
ATOM 10237 C CG   . PHE A 1 66  ? -4.023  3.210   4.133   1.00 0.00 ? 66  PHE A CG   6  
ATOM 10238 C CD1  . PHE A 1 66  ? -3.135  3.931   3.350   1.00 0.00 ? 66  PHE A CD1  6  
ATOM 10239 C CD2  . PHE A 1 66  ? -5.076  3.879   4.736   1.00 0.00 ? 66  PHE A CD2  6  
ATOM 10240 C CE1  . PHE A 1 66  ? -3.295  5.293   3.174   1.00 0.00 ? 66  PHE A CE1  6  
ATOM 10241 C CE2  . PHE A 1 66  ? -5.240  5.240   4.562   1.00 0.00 ? 66  PHE A CE2  6  
ATOM 10242 C CZ   . PHE A 1 66  ? -4.349  5.948   3.779   1.00 0.00 ? 66  PHE A CZ   6  
ATOM 10243 H H    . PHE A 1 66  ? -1.226  2.216   4.312   1.00 0.00 ? 66  PHE A H    6  
ATOM 10244 H HA   . PHE A 1 66  ? -3.232  1.640   6.372   1.00 0.00 ? 66  PHE A HA   6  
ATOM 10245 H HB2  . PHE A 1 66  ? -3.523  1.311   3.383   1.00 0.00 ? 66  PHE A HB2  6  
ATOM 10246 H HB3  . PHE A 1 66  ? -4.806  1.312   4.589   1.00 0.00 ? 66  PHE A HB3  6  
ATOM 10247 H HD1  . PHE A 1 66  ? -2.311  3.420   2.875   1.00 0.00 ? 66  PHE A HD1  6  
ATOM 10248 H HD2  . PHE A 1 66  ? -5.774  3.326   5.348   1.00 0.00 ? 66  PHE A HD2  6  
ATOM 10249 H HE1  . PHE A 1 66  ? -2.597  5.843   2.561   1.00 0.00 ? 66  PHE A HE1  6  
ATOM 10250 H HE2  . PHE A 1 66  ? -6.066  5.749   5.037   1.00 0.00 ? 66  PHE A HE2  6  
ATOM 10251 H HZ   . PHE A 1 66  ? -4.476  7.011   3.643   1.00 0.00 ? 66  PHE A HZ   6  
ATOM 10252 N N    . LYS A 1 67  ? -3.439  -0.894  6.022   1.00 0.00 ? 67  LYS A N    6  
ATOM 10253 C CA   . LYS A 1 67  ? -3.296  -2.344  6.078   1.00 0.00 ? 67  LYS A CA   6  
ATOM 10254 C C    . LYS A 1 67  ? -4.499  -3.034  5.441   1.00 0.00 ? 67  LYS A C    6  
ATOM 10255 O O    . LYS A 1 67  ? -5.635  -2.849  5.879   1.00 0.00 ? 67  LYS A O    6  
ATOM 10256 C CB   . LYS A 1 67  ? -3.138  -2.805  7.528   1.00 0.00 ? 67  LYS A CB   6  
ATOM 10257 C CG   . LYS A 1 67  ? -4.397  -2.636  8.361   1.00 0.00 ? 67  LYS A CG   6  
ATOM 10258 C CD   . LYS A 1 67  ? -4.097  -2.718  9.848   1.00 0.00 ? 67  LYS A CD   6  
ATOM 10259 C CE   . LYS A 1 67  ? -3.736  -4.135  10.266  1.00 0.00 ? 67  LYS A CE   6  
ATOM 10260 N NZ   . LYS A 1 67  ? -4.916  -5.043  10.227  1.00 0.00 ? 67  LYS A NZ   6  
ATOM 10261 H H    . LYS A 1 67  ? -4.208  -0.472  6.461   1.00 0.00 ? 67  LYS A H    6  
ATOM 10262 H HA   . LYS A 1 67  ? -2.409  -2.611  5.525   1.00 0.00 ? 67  LYS A HA   6  
ATOM 10263 H HB2  . LYS A 1 67  ? -2.866  -3.850  7.533   1.00 0.00 ? 67  LYS A HB2  6  
ATOM 10264 H HB3  . LYS A 1 67  ? -2.347  -2.234  7.991   1.00 0.00 ? 67  LYS A HB3  6  
ATOM 10265 H HG2  . LYS A 1 67  ? -4.834  -1.672  8.146   1.00 0.00 ? 67  LYS A HG2  6  
ATOM 10266 H HG3  . LYS A 1 67  ? -5.098  -3.416  8.100   1.00 0.00 ? 67  LYS A HG3  6  
ATOM 10267 H HD2  . LYS A 1 67  ? -3.268  -2.065  10.076  1.00 0.00 ? 67  LYS A HD2  6  
ATOM 10268 H HD3  . LYS A 1 67  ? -4.970  -2.401  10.401  1.00 0.00 ? 67  LYS A HD3  6  
ATOM 10269 H HE2  . LYS A 1 67  ? -2.980  -4.513  9.595   1.00 0.00 ? 67  LYS A HE2  6  
ATOM 10270 H HE3  . LYS A 1 67  ? -3.344  -4.111  11.272  1.00 0.00 ? 67  LYS A HE3  6  
ATOM 10271 H HZ1  . LYS A 1 67  ? -5.716  -4.568  9.763   1.00 0.00 ? 67  LYS A HZ1  6  
ATOM 10272 H HZ2  . LYS A 1 67  ? -5.197  -5.306  11.193  1.00 0.00 ? 67  LYS A HZ2  6  
ATOM 10273 H HZ3  . LYS A 1 67  ? -4.685  -5.908  9.698   1.00 0.00 ? 67  LYS A HZ3  6  
ATOM 10274 N N    . ILE A 1 68  ? -4.240  -3.830  4.409   1.00 0.00 ? 68  ILE A N    6  
ATOM 10275 C CA   . ILE A 1 68  ? -5.302  -4.549  3.716   1.00 0.00 ? 68  ILE A CA   6  
ATOM 10276 C C    . ILE A 1 68  ? -5.170  -6.054  3.920   1.00 0.00 ? 68  ILE A C    6  
ATOM 10277 O O    . ILE A 1 68  ? -4.170  -6.659  3.529   1.00 0.00 ? 68  ILE A O    6  
ATOM 10278 C CB   . ILE A 1 68  ? -5.294  -4.245  2.206   1.00 0.00 ? 68  ILE A CB   6  
ATOM 10279 C CG1  . ILE A 1 68  ? -5.302  -2.733  1.968   1.00 0.00 ? 68  ILE A CG1  6  
ATOM 10280 C CG2  . ILE A 1 68  ? -6.489  -4.899  1.528   1.00 0.00 ? 68  ILE A CG2  6  
ATOM 10281 C CD1  . ILE A 1 68  ? -4.808  -2.335  0.595   1.00 0.00 ? 68  ILE A CD1  6  
ATOM 10282 H H    . ILE A 1 68  ? -3.314  -3.936  4.108   1.00 0.00 ? 68  ILE A H    6  
ATOM 10283 H HA   . ILE A 1 68  ? -6.247  -4.222  4.124   1.00 0.00 ? 68  ILE A HA   6  
ATOM 10284 H HB   . ILE A 1 68  ? -4.396  -4.664  1.781   1.00 0.00 ? 68  ILE A HB   6  
ATOM 10285 H HG12 . ILE A 1 68  ? -6.309  -2.363  2.078   1.00 0.00 ? 68  ILE A HG12 6  
ATOM 10286 H HG13 . ILE A 1 68  ? -4.666  -2.258  2.701   1.00 0.00 ? 68  ILE A HG13 6  
ATOM 10287 H HG21 . ILE A 1 68  ? -6.220  -5.184  0.522   1.00 0.00 ? 68  ILE A HG21 6  
ATOM 10288 H HG22 . ILE A 1 68  ? -6.781  -5.777  2.084   1.00 0.00 ? 68  ILE A HG22 6  
ATOM 10289 H HG23 . ILE A 1 68  ? -7.312  -4.201  1.497   1.00 0.00 ? 68  ILE A HG23 6  
ATOM 10290 H HD11 . ILE A 1 68  ? -5.473  -1.597  0.173   1.00 0.00 ? 68  ILE A HD11 6  
ATOM 10291 H HD12 . ILE A 1 68  ? -3.814  -1.922  0.675   1.00 0.00 ? 68  ILE A HD12 6  
ATOM 10292 H HD13 . ILE A 1 68  ? -4.785  -3.206  -0.045  1.00 0.00 ? 68  ILE A HD13 6  
ATOM 10293 N N    . CYS A 1 69  ? -6.185  -6.654  4.533   1.00 0.00 ? 69  CYS A N    6  
ATOM 10294 C CA   . CYS A 1 69  ? -6.183  -8.090  4.789   1.00 0.00 ? 69  CYS A CA   6  
ATOM 10295 C C    . CYS A 1 69  ? -7.207  -8.799  3.909   1.00 0.00 ? 69  CYS A C    6  
ATOM 10296 O O    . CYS A 1 69  ? -8.301  -8.294  3.655   1.00 0.00 ? 69  CYS A O    6  
ATOM 10297 C CB   . CYS A 1 69  ? -6.480  -8.367  6.263   1.00 0.00 ? 69  CYS A CB   6  
ATOM 10298 S SG   . CYS A 1 69  ? -5.056  -8.149  7.356   1.00 0.00 ? 69  CYS A SG   6  
ATOM 10299 H H    . CYS A 1 69  ? -6.953  -6.118  4.821   1.00 0.00 ? 69  CYS A H    6  
ATOM 10300 H HA   . CYS A 1 69  ? -5.200  -8.467  4.551   1.00 0.00 ? 69  CYS A HA   6  
ATOM 10301 H HB2  . CYS A 1 69  ? -7.256  -7.695  6.599   1.00 0.00 ? 69  CYS A HB2  6  
ATOM 10302 H HB3  . CYS A 1 69  ? -6.824  -9.385  6.368   1.00 0.00 ? 69  CYS A HB3  6  
ATOM 10303 H HG   . CYS A 1 69  ? -5.281  -8.840  8.463   1.00 0.00 ? 69  CYS A HG   6  
ATOM 10304 N N    . PRO A 1 70  ? -6.846  -10.000 3.431   1.00 0.00 ? 70  PRO A N    6  
ATOM 10305 C CA   . PRO A 1 70  ? -7.720  -10.804 2.571   1.00 0.00 ? 70  PRO A CA   6  
ATOM 10306 C C    . PRO A 1 70  ? -8.924  -11.358 3.325   1.00 0.00 ? 70  PRO A C    6  
ATOM 10307 O O    . PRO A 1 70  ? -8.959  -11.348 4.556   1.00 0.00 ? 70  PRO A O    6  
ATOM 10308 C CB   . PRO A 1 70  ? -6.809  -11.944 2.109   1.00 0.00 ? 70  PRO A CB   6  
ATOM 10309 C CG   . PRO A 1 70  ? -5.774  -12.058 3.174   1.00 0.00 ? 70  PRO A CG   6  
ATOM 10310 C CD   . PRO A 1 70  ? -5.559  -10.664 3.693   1.00 0.00 ? 70  PRO A CD   6  
ATOM 10311 H HA   . PRO A 1 70  ? -8.060  -10.242 1.714   1.00 0.00 ? 70  PRO A HA   6  
ATOM 10312 H HB2  . PRO A 1 70  ? -7.385  -12.854 2.017   1.00 0.00 ? 70  PRO A HB2  6  
ATOM 10313 H HB3  . PRO A 1 70  ? -6.368  -11.694 1.156   1.00 0.00 ? 70  PRO A HB3  6  
ATOM 10314 H HG2  . PRO A 1 70  ? -6.129  -12.702 3.964   1.00 0.00 ? 70  PRO A HG2  6  
ATOM 10315 H HG3  . PRO A 1 70  ? -4.857  -12.447 2.755   1.00 0.00 ? 70  PRO A HG3  6  
ATOM 10316 H HD2  . PRO A 1 70  ? -5.344  -10.684 4.751   1.00 0.00 ? 70  PRO A HD2  6  
ATOM 10317 H HD3  . PRO A 1 70  ? -4.759  -10.179 3.153   1.00 0.00 ? 70  PRO A HD3  6  
ATOM 10318 N N    . THR A 1 71  ? -9.913  -11.841 2.578   1.00 0.00 ? 71  THR A N    6  
ATOM 10319 C CA   . THR A 1 71  ? -11.120 -12.397 3.175   1.00 0.00 ? 71  THR A CA   6  
ATOM 10320 C C    . THR A 1 71  ? -11.557 -13.666 2.452   1.00 0.00 ? 71  THR A C    6  
ATOM 10321 O O    . THR A 1 71  ? -11.406 -13.800 1.237   1.00 0.00 ? 71  THR A O    6  
ATOM 10322 C CB   . THR A 1 71  ? -12.278 -11.382 3.152   1.00 0.00 ? 71  THR A CB   6  
ATOM 10323 O OG1  . THR A 1 71  ? -12.698 -11.149 1.803   1.00 0.00 ? 71  THR A OG1  6  
ATOM 10324 C CG2  . THR A 1 71  ? -11.859 -10.068 3.792   1.00 0.00 ? 71  THR A CG2  6  
ATOM 10325 H H    . THR A 1 71  ? -9.827  -11.820 1.602   1.00 0.00 ? 71  THR A H    6  
ATOM 10326 H HA   . THR A 1 71  ? -10.902 -12.639 4.205   1.00 0.00 ? 71  THR A HA   6  
ATOM 10327 H HB   . THR A 1 71  ? -13.106 -11.791 3.713   1.00 0.00 ? 71  THR A HB   6  
ATOM 10328 H HG1  . THR A 1 71  ? -11.927 -11.087 1.234   1.00 0.00 ? 71  THR A HG1  6  
ATOM 10329 H HG21 . THR A 1 71  ? -11.094 -10.255 4.532   1.00 0.00 ? 71  THR A HG21 6  
ATOM 10330 H HG22 . THR A 1 71  ? -12.714 -9.609  4.265   1.00 0.00 ? 71  THR A HG22 6  
ATOM 10331 H HG23 . THR A 1 71  ? -11.469 -9.406  3.033   1.00 0.00 ? 71  THR A HG23 6  
ATOM 10332 N N    . PRO A 1 72  ? -12.112 -14.621 3.212   1.00 0.00 ? 72  PRO A N    6  
ATOM 10333 C CA   . PRO A 1 72  ? -12.583 -15.896 2.664   1.00 0.00 ? 72  PRO A CA   6  
ATOM 10334 C C    . PRO A 1 72  ? -13.825 -15.729 1.794   1.00 0.00 ? 72  PRO A C    6  
ATOM 10335 O O    . PRO A 1 72  ? -14.374 -16.706 1.287   1.00 0.00 ? 72  PRO A O    6  
ATOM 10336 C CB   . PRO A 1 72  ? -12.911 -16.720 3.912   1.00 0.00 ? 72  PRO A CB   6  
ATOM 10337 C CG   . PRO A 1 72  ? -13.206 -15.709 4.966   1.00 0.00 ? 72  PRO A CG   6  
ATOM 10338 C CD   . PRO A 1 72  ? -12.323 -14.529 4.667   1.00 0.00 ? 72  PRO A CD   6  
ATOM 10339 H HA   . PRO A 1 72  ? -11.811 -16.393 2.095   1.00 0.00 ? 72  PRO A HA   6  
ATOM 10340 H HB2  . PRO A 1 72  ? -13.767 -17.349 3.716   1.00 0.00 ? 72  PRO A HB2  6  
ATOM 10341 H HB3  . PRO A 1 72  ? -12.061 -17.331 4.177   1.00 0.00 ? 72  PRO A HB3  6  
ATOM 10342 H HG2  . PRO A 1 72  ? -14.245 -15.422 4.919   1.00 0.00 ? 72  PRO A HG2  6  
ATOM 10343 H HG3  . PRO A 1 72  ? -12.971 -16.115 5.939   1.00 0.00 ? 72  PRO A HG3  6  
ATOM 10344 H HD2  . PRO A 1 72  ? -12.824 -13.608 4.926   1.00 0.00 ? 72  PRO A HD2  6  
ATOM 10345 H HD3  . PRO A 1 72  ? -11.386 -14.614 5.198   1.00 0.00 ? 72  PRO A HD3  6  
ATOM 10346 N N    . ASN A 1 73  ? -14.262 -14.485 1.627   1.00 0.00 ? 73  ASN A N    6  
ATOM 10347 C CA   . ASN A 1 73  ? -15.439 -14.191 0.818   1.00 0.00 ? 73  ASN A CA   6  
ATOM 10348 C C    . ASN A 1 73  ? -15.038 -13.676 -0.561  1.00 0.00 ? 73  ASN A C    6  
ATOM 10349 O O    . ASN A 1 73  ? -15.844 -13.073 -1.268  1.00 0.00 ? 73  ASN A O    6  
ATOM 10350 C CB   . ASN A 1 73  ? -16.323 -13.160 1.523   1.00 0.00 ? 73  ASN A CB   6  
ATOM 10351 C CG   . ASN A 1 73  ? -17.777 -13.262 1.105   1.00 0.00 ? 73  ASN A CG   6  
ATOM 10352 O OD1  . ASN A 1 73  ? -18.090 -13.310 -0.085  1.00 0.00 ? 73  ASN A OD1  6  
ATOM 10353 N ND2  . ASN A 1 73  ? -18.673 -13.296 2.084   1.00 0.00 ? 73  ASN A ND2  6  
ATOM 10354 H H    . ASN A 1 73  ? -13.781 -13.748 2.057   1.00 0.00 ? 73  ASN A H    6  
ATOM 10355 H HA   . ASN A 1 73  ? -15.997 -15.108 0.699   1.00 0.00 ? 73  ASN A HA   6  
ATOM 10356 H HB2  . ASN A 1 73  ? -16.264 -13.314 2.591   1.00 0.00 ? 73  ASN A HB2  6  
ATOM 10357 H HB3  . ASN A 1 73  ? -15.968 -12.168 1.286   1.00 0.00 ? 73  ASN A HB3  6  
ATOM 10358 H HD21 . ASN A 1 73  ? -18.351 -13.254 3.009   1.00 0.00 ? 73  ASN A HD21 6  
ATOM 10359 H HD22 . ASN A 1 73  ? -19.620 -13.362 1.842   1.00 0.00 ? 73  ASN A HD22 6  
ATOM 10360 N N    . ASN A 1 74  ? -13.786 -13.920 -0.936  1.00 0.00 ? 74  ASN A N    6  
ATOM 10361 C CA   . ASN A 1 74  ? -13.277 -13.481 -2.230  1.00 0.00 ? 74  ASN A CA   6  
ATOM 10362 C C    . ASN A 1 74  ? -13.274 -11.958 -2.325  1.00 0.00 ? 74  ASN A C    6  
ATOM 10363 O O    . ASN A 1 74  ? -13.483 -11.394 -3.399  1.00 0.00 ? 74  ASN A O    6  
ATOM 10364 C CB   . ASN A 1 74  ? -14.122 -14.072 -3.361  1.00 0.00 ? 74  ASN A CB   6  
ATOM 10365 C CG   . ASN A 1 74  ? -13.435 -13.969 -4.709  1.00 0.00 ? 74  ASN A CG   6  
ATOM 10366 O OD1  . ASN A 1 74  ? -12.220 -14.137 -4.814  1.00 0.00 ? 74  ASN A OD1  6  
ATOM 10367 N ND2  . ASN A 1 74  ? -14.214 -13.692 -5.749  1.00 0.00 ? 74  ASN A ND2  6  
ATOM 10368 H H    . ASN A 1 74  ? -13.190 -14.406 -0.328  1.00 0.00 ? 74  ASN A H    6  
ATOM 10369 H HA   . ASN A 1 74  ? -12.263 -13.838 -2.325  1.00 0.00 ? 74  ASN A HA   6  
ATOM 10370 H HB2  . ASN A 1 74  ? -14.310 -15.116 -3.153  1.00 0.00 ? 74  ASN A HB2  6  
ATOM 10371 H HB3  . ASN A 1 74  ? -15.062 -13.544 -3.414  1.00 0.00 ? 74  ASN A HB3  6  
ATOM 10372 H HD21 . ASN A 1 74  ? -15.173 -13.571 -5.590  1.00 0.00 ? 74  ASN A HD21 6  
ATOM 10373 H HD22 . ASN A 1 74  ? -13.796 -13.620 -6.633  1.00 0.00 ? 74  ASN A HD22 6  
ATOM 10374 N N    . GLN A 1 75  ? -13.034 -11.301 -1.195  1.00 0.00 ? 75  GLN A N    6  
ATOM 10375 C CA   . GLN A 1 75  ? -13.004 -9.843  -1.152  1.00 0.00 ? 75  GLN A CA   6  
ATOM 10376 C C    . GLN A 1 75  ? -11.745 -9.346  -0.449  1.00 0.00 ? 75  GLN A C    6  
ATOM 10377 O O    . GLN A 1 75  ? -10.901 -10.138 -0.031  1.00 0.00 ? 75  GLN A O    6  
ATOM 10378 C CB   . GLN A 1 75  ? -14.246 -9.307  -0.438  1.00 0.00 ? 75  GLN A CB   6  
ATOM 10379 C CG   . GLN A 1 75  ? -15.499 -9.330  -1.299  1.00 0.00 ? 75  GLN A CG   6  
ATOM 10380 C CD   . GLN A 1 75  ? -16.767 -9.146  -0.488  1.00 0.00 ? 75  GLN A CD   6  
ATOM 10381 O OE1  . GLN A 1 75  ? -17.254 -8.027  -0.321  1.00 0.00 ? 75  GLN A OE1  6  
ATOM 10382 N NE2  . GLN A 1 75  ? -17.310 -10.246 0.020   1.00 0.00 ? 75  GLN A NE2  6  
ATOM 10383 H H    . GLN A 1 75  ? -12.875 -11.807 -0.372  1.00 0.00 ? 75  GLN A H    6  
ATOM 10384 H HA   . GLN A 1 75  ? -13.000 -9.482  -2.169  1.00 0.00 ? 75  GLN A HA   6  
ATOM 10385 H HB2  . GLN A 1 75  ? -14.428 -9.907  0.441   1.00 0.00 ? 75  GLN A HB2  6  
ATOM 10386 H HB3  . GLN A 1 75  ? -14.061 -8.287  -0.137  1.00 0.00 ? 75  GLN A HB3  6  
ATOM 10387 H HG2  . GLN A 1 75  ? -15.436 -8.533  -2.025  1.00 0.00 ? 75  GLN A HG2  6  
ATOM 10388 H HG3  . GLN A 1 75  ? -15.551 -10.279 -1.811  1.00 0.00 ? 75  GLN A HG3  6  
ATOM 10389 H HE21 . GLN A 1 75  ? -16.866 -11.103 -0.153  1.00 0.00 ? 75  GLN A HE21 6  
ATOM 10390 H HE22 . GLN A 1 75  ? -18.129 -10.157 0.549   1.00 0.00 ? 75  GLN A HE22 6  
ATOM 10391 N N    . PHE A 1 76  ? -11.625 -8.028  -0.323  1.00 0.00 ? 76  PHE A N    6  
ATOM 10392 C CA   . PHE A 1 76  ? -10.468 -7.425  0.327   1.00 0.00 ? 76  PHE A CA   6  
ATOM 10393 C C    . PHE A 1 76  ? -10.904 -6.435  1.404   1.00 0.00 ? 76  PHE A C    6  
ATOM 10394 O O    . PHE A 1 76  ? -11.759 -5.582  1.168   1.00 0.00 ? 76  PHE A O    6  
ATOM 10395 C CB   . PHE A 1 76  ? -9.587  -6.717  -0.704  1.00 0.00 ? 76  PHE A CB   6  
ATOM 10396 C CG   . PHE A 1 76  ? -8.936  -7.655  -1.680  1.00 0.00 ? 76  PHE A CG   6  
ATOM 10397 C CD1  . PHE A 1 76  ? -9.693  -8.331  -2.623  1.00 0.00 ? 76  PHE A CD1  6  
ATOM 10398 C CD2  . PHE A 1 76  ? -7.566  -7.860  -1.655  1.00 0.00 ? 76  PHE A CD2  6  
ATOM 10399 C CE1  . PHE A 1 76  ? -9.096  -9.195  -3.521  1.00 0.00 ? 76  PHE A CE1  6  
ATOM 10400 C CE2  . PHE A 1 76  ? -6.963  -8.722  -2.551  1.00 0.00 ? 76  PHE A CE2  6  
ATOM 10401 C CZ   . PHE A 1 76  ? -7.729  -9.390  -3.486  1.00 0.00 ? 76  PHE A CZ   6  
ATOM 10402 H H    . PHE A 1 76  ? -12.332 -7.448  -0.677  1.00 0.00 ? 76  PHE A H    6  
ATOM 10403 H HA   . PHE A 1 76  ? -9.900  -8.216  0.791   1.00 0.00 ? 76  PHE A HA   6  
ATOM 10404 H HB2  . PHE A 1 76  ? -10.192 -6.021  -1.267  1.00 0.00 ? 76  PHE A HB2  6  
ATOM 10405 H HB3  . PHE A 1 76  ? -8.807  -6.176  -0.190  1.00 0.00 ? 76  PHE A HB3  6  
ATOM 10406 H HD1  . PHE A 1 76  ? -10.762 -8.178  -2.653  1.00 0.00 ? 76  PHE A HD1  6  
ATOM 10407 H HD2  . PHE A 1 76  ? -6.965  -7.337  -0.924  1.00 0.00 ? 76  PHE A HD2  6  
ATOM 10408 H HE1  . PHE A 1 76  ? -9.698  -9.715  -4.252  1.00 0.00 ? 76  PHE A HE1  6  
ATOM 10409 H HE2  . PHE A 1 76  ? -5.894  -8.872  -2.521  1.00 0.00 ? 76  PHE A HE2  6  
ATOM 10410 H HZ   . PHE A 1 76  ? -7.261  -10.064 -4.187  1.00 0.00 ? 76  PHE A HZ   6  
ATOM 10411 N N    . MET A 1 77  ? -10.312 -6.558  2.587   1.00 0.00 ? 77  MET A N    6  
ATOM 10412 C CA   . MET A 1 77  ? -10.638 -5.675  3.701   1.00 0.00 ? 77  MET A CA   6  
ATOM 10413 C C    . MET A 1 77  ? -9.626  -4.539  3.809   1.00 0.00 ? 77  MET A C    6  
ATOM 10414 O O    . MET A 1 77  ? -8.427  -4.776  3.947   1.00 0.00 ? 77  MET A O    6  
ATOM 10415 C CB   . MET A 1 77  ? -10.679 -6.464  5.011   1.00 0.00 ? 77  MET A CB   6  
ATOM 10416 C CG   . MET A 1 77  ? -12.048 -7.044  5.329   1.00 0.00 ? 77  MET A CG   6  
ATOM 10417 S SD   . MET A 1 77  ? -11.984 -8.310  6.611   1.00 0.00 ? 77  MET A SD   6  
ATOM 10418 C CE   . MET A 1 77  ? -11.038 -7.466  7.875   1.00 0.00 ? 77  MET A CE   6  
ATOM 10419 H H    . MET A 1 77  ? -9.638  -7.259  2.715   1.00 0.00 ? 77  MET A H    6  
ATOM 10420 H HA   . MET A 1 77  ? -11.615 -5.255  3.514   1.00 0.00 ? 77  MET A HA   6  
ATOM 10421 H HB2  . MET A 1 77  ? -9.973  -7.278  4.949   1.00 0.00 ? 77  MET A HB2  6  
ATOM 10422 H HB3  . MET A 1 77  ? -10.392 -5.810  5.821   1.00 0.00 ? 77  MET A HB3  6  
ATOM 10423 H HG2  . MET A 1 77  ? -12.693 -6.245  5.664   1.00 0.00 ? 77  MET A HG2  6  
ATOM 10424 H HG3  . MET A 1 77  ? -12.456 -7.480  4.430   1.00 0.00 ? 77  MET A HG3  6  
ATOM 10425 H HE1  . MET A 1 77  ? -11.495 -6.511  8.091   1.00 0.00 ? 77  MET A HE1  6  
ATOM 10426 H HE2  . MET A 1 77  ? -11.020 -8.067  8.772   1.00 0.00 ? 77  MET A HE2  6  
ATOM 10427 H HE3  . MET A 1 77  ? -10.028 -7.310  7.525   1.00 0.00 ? 77  MET A HE3  6  
ATOM 10428 N N    . MET A 1 78  ? -10.118 -3.306  3.744   1.00 0.00 ? 78  MET A N    6  
ATOM 10429 C CA   . MET A 1 78  ? -9.255  -2.134  3.836   1.00 0.00 ? 78  MET A CA   6  
ATOM 10430 C C    . MET A 1 78  ? -9.453  -1.416  5.167   1.00 0.00 ? 78  MET A C    6  
ATOM 10431 O O    . MET A 1 78  ? -8.516  -1.274  5.952   1.00 0.00 ? 78  MET A O    6  
ATOM 10432 C CB   . MET A 1 78  ? -9.538  -1.174  2.679   1.00 0.00 ? 78  MET A CB   6  
ATOM 10433 C CG   . MET A 1 78  ? -8.394  -0.217  2.390   1.00 0.00 ? 78  MET A CG   6  
ATOM 10434 S SD   . MET A 1 78  ? -8.404  1.225   3.473   1.00 0.00 ? 78  MET A SD   6  
ATOM 10435 C CE   . MET A 1 78  ? -7.437  2.382   2.505   1.00 0.00 ? 78  MET A CE   6  
ATOM 10436 H H    . MET A 1 78  ? -11.084 -3.181  3.634   1.00 0.00 ? 78  MET A H    6  
ATOM 10437 H HA   . MET A 1 78  ? -8.231  -2.471  3.770   1.00 0.00 ? 78  MET A HA   6  
ATOM 10438 H HB2  . MET A 1 78  ? -9.730  -1.751  1.787   1.00 0.00 ? 78  MET A HB2  6  
ATOM 10439 H HB3  . MET A 1 78  ? -10.415 -0.591  2.916   1.00 0.00 ? 78  MET A HB3  6  
ATOM 10440 H HG2  . MET A 1 78  ? -7.459  -0.742  2.523   1.00 0.00 ? 78  MET A HG2  6  
ATOM 10441 H HG3  . MET A 1 78  ? -8.473  0.118   1.366   1.00 0.00 ? 78  MET A HG3  6  
ATOM 10442 H HE1  . MET A 1 78  ? -6.461  1.963   2.313   1.00 0.00 ? 78  MET A HE1  6  
ATOM 10443 H HE2  . MET A 1 78  ? -7.939  2.574   1.568   1.00 0.00 ? 78  MET A HE2  6  
ATOM 10444 H HE3  . MET A 1 78  ? -7.331  3.307   3.053   1.00 0.00 ? 78  MET A HE3  6  
ATOM 10445 N N    . GLY A 1 79  ? -10.679 -0.965  5.415   1.00 0.00 ? 79  GLY A N    6  
ATOM 10446 C CA   . GLY A 1 79  ? -10.976 -0.267  6.652   1.00 0.00 ? 79  GLY A CA   6  
ATOM 10447 C C    . GLY A 1 79  ? -12.327 -0.650  7.224   1.00 0.00 ? 79  GLY A C    6  
ATOM 10448 O O    . GLY A 1 79  ? -13.205 0.197   7.381   1.00 0.00 ? 79  GLY A O    6  
ATOM 10449 H H    . GLY A 1 79  ? -11.387 -1.108  4.753   1.00 0.00 ? 79  GLY A H    6  
ATOM 10450 H HA2  . GLY A 1 79  ? -10.211 -0.500  7.378   1.00 0.00 ? 79  GLY A HA2  6  
ATOM 10451 H HA3  . GLY A 1 79  ? -10.967 0.796   6.463   1.00 0.00 ? 79  GLY A HA3  6  
ATOM 10452 N N    . GLY A 1 80  ? -12.495 -1.932  7.534   1.00 0.00 ? 80  GLY A N    6  
ATOM 10453 C CA   . GLY A 1 80  ? -13.752 -2.403  8.086   1.00 0.00 ? 80  GLY A CA   6  
ATOM 10454 C C    . GLY A 1 80  ? -14.808 -2.618  7.021   1.00 0.00 ? 80  GLY A C    6  
ATOM 10455 O O    . GLY A 1 80  ? -16.005 -2.530  7.297   1.00 0.00 ? 80  GLY A O    6  
ATOM 10456 H H    . GLY A 1 80  ? -11.759 -2.563  7.388   1.00 0.00 ? 80  GLY A H    6  
ATOM 10457 H HA2  . GLY A 1 80  ? -13.579 -3.336  8.601   1.00 0.00 ? 80  GLY A HA2  6  
ATOM 10458 H HA3  . GLY A 1 80  ? -14.116 -1.674  8.795   1.00 0.00 ? 80  GLY A HA3  6  
ATOM 10459 N N    . ARG A 1 81  ? -14.366 -2.900  5.800   1.00 0.00 ? 81  ARG A N    6  
ATOM 10460 C CA   . ARG A 1 81  ? -15.282 -3.125  4.688   1.00 0.00 ? 81  ARG A CA   6  
ATOM 10461 C C    . ARG A 1 81  ? -14.798 -4.274  3.809   1.00 0.00 ? 81  ARG A C    6  
ATOM 10462 O O    . ARG A 1 81  ? -13.736 -4.848  4.049   1.00 0.00 ? 81  ARG A O    6  
ATOM 10463 C CB   . ARG A 1 81  ? -15.425 -1.853  3.851   1.00 0.00 ? 81  ARG A CB   6  
ATOM 10464 C CG   . ARG A 1 81  ? -16.290 -0.787  4.505   1.00 0.00 ? 81  ARG A CG   6  
ATOM 10465 C CD   . ARG A 1 81  ? -15.487 0.060   5.481   1.00 0.00 ? 81  ARG A CD   6  
ATOM 10466 N NE   . ARG A 1 81  ? -16.312 0.566   6.574   1.00 0.00 ? 81  ARG A NE   6  
ATOM 10467 C CZ   . ARG A 1 81  ? -17.288 1.452   6.409   1.00 0.00 ? 81  ARG A CZ   6  
ATOM 10468 N NH1  . ARG A 1 81  ? -17.560 1.926   5.201   1.00 0.00 ? 81  ARG A NH1  6  
ATOM 10469 N NH2  . ARG A 1 81  ? -17.996 1.864   7.453   1.00 0.00 ? 81  ARG A NH2  6  
ATOM 10470 H H    . ARG A 1 81  ? -13.400 -2.956  5.642   1.00 0.00 ? 81  ARG A H    6  
ATOM 10471 H HA   . ARG A 1 81  ? -16.246 -3.384  5.100   1.00 0.00 ? 81  ARG A HA   6  
ATOM 10472 H HB2  . ARG A 1 81  ? -14.444 -1.435  3.682   1.00 0.00 ? 81  ARG A HB2  6  
ATOM 10473 H HB3  . ARG A 1 81  ? -15.867 -2.110  2.900   1.00 0.00 ? 81  ARG A HB3  6  
ATOM 10474 H HG2  . ARG A 1 81  ? -16.695 -0.144  3.738   1.00 0.00 ? 81  ARG A HG2  6  
ATOM 10475 H HG3  . ARG A 1 81  ? -17.096 -1.268  5.038   1.00 0.00 ? 81  ARG A HG3  6  
ATOM 10476 H HD2  . ARG A 1 81  ? -14.693 -0.545  5.893   1.00 0.00 ? 81  ARG A HD2  6  
ATOM 10477 H HD3  . ARG A 1 81  ? -15.062 0.896   4.946   1.00 0.00 ? 81  ARG A HD3  6  
ATOM 10478 H HE   . ARG A 1 81  ? -16.129 0.228   7.475   1.00 0.00 ? 81  ARG A HE   6  
ATOM 10479 H HH11 . ARG A 1 81  ? -17.029 1.617   4.412   1.00 0.00 ? 81  ARG A HH11 6  
ATOM 10480 H HH12 . ARG A 1 81  ? -18.296 2.592   5.079   1.00 0.00 ? 81  ARG A HH12 6  
ATOM 10481 H HH21 . ARG A 1 81  ? -17.794 1.508   8.365   1.00 0.00 ? 81  ARG A HH21 6  
ATOM 10482 H HH22 . ARG A 1 81  ? -18.730 2.531   7.328   1.00 0.00 ? 81  ARG A HH22 6  
ATOM 10483 N N    . TYR A 1 82  ? -15.584 -4.603  2.789   1.00 0.00 ? 82  TYR A N    6  
ATOM 10484 C CA   . TYR A 1 82  ? -15.236 -5.685  1.875   1.00 0.00 ? 82  TYR A CA   6  
ATOM 10485 C C    . TYR A 1 82  ? -15.378 -5.238  0.424   1.00 0.00 ? 82  TYR A C    6  
ATOM 10486 O O    . TYR A 1 82  ? -16.398 -4.669  0.034   1.00 0.00 ? 82  TYR A O    6  
ATOM 10487 C CB   . TYR A 1 82  ? -16.123 -6.904  2.135   1.00 0.00 ? 82  TYR A CB   6  
ATOM 10488 C CG   . TYR A 1 82  ? -16.465 -7.105  3.594   1.00 0.00 ? 82  TYR A CG   6  
ATOM 10489 C CD1  . TYR A 1 82  ? -15.467 -7.168  4.559   1.00 0.00 ? 82  TYR A CD1  6  
ATOM 10490 C CD2  . TYR A 1 82  ? -17.785 -7.233  4.007   1.00 0.00 ? 82  TYR A CD2  6  
ATOM 10491 C CE1  . TYR A 1 82  ? -15.774 -7.352  5.893   1.00 0.00 ? 82  TYR A CE1  6  
ATOM 10492 C CE2  . TYR A 1 82  ? -18.102 -7.416  5.340   1.00 0.00 ? 82  TYR A CE2  6  
ATOM 10493 C CZ   . TYR A 1 82  ? -17.093 -7.475  6.278   1.00 0.00 ? 82  TYR A CZ   6  
ATOM 10494 O OH   . TYR A 1 82  ? -17.404 -7.659  7.606   1.00 0.00 ? 82  TYR A OH   6  
ATOM 10495 H H    . TYR A 1 82  ? -16.418 -4.108  2.649   1.00 0.00 ? 82  TYR A H    6  
ATOM 10496 H HA   . TYR A 1 82  ? -14.207 -5.956  2.058   1.00 0.00 ? 82  TYR A HA   6  
ATOM 10497 H HB2  . TYR A 1 82  ? -17.048 -6.790  1.591   1.00 0.00 ? 82  TYR A HB2  6  
ATOM 10498 H HB3  . TYR A 1 82  ? -15.614 -7.791  1.788   1.00 0.00 ? 82  TYR A HB3  6  
ATOM 10499 H HD1  . TYR A 1 82  ? -14.435 -7.071  4.254   1.00 0.00 ? 82  TYR A HD1  6  
ATOM 10500 H HD2  . TYR A 1 82  ? -18.573 -7.187  3.269   1.00 0.00 ? 82  TYR A HD2  6  
ATOM 10501 H HE1  . TYR A 1 82  ? -14.985 -7.398  6.629   1.00 0.00 ? 82  TYR A HE1  6  
ATOM 10502 H HE2  . TYR A 1 82  ? -19.134 -7.513  5.642   1.00 0.00 ? 82  TYR A HE2  6  
ATOM 10503 H HH   . TYR A 1 82  ? -18.096 -8.320  7.684   1.00 0.00 ? 82  TYR A HH   6  
ATOM 10504 N N    . TYR A 1 83  ? -14.348 -5.502  -0.373  1.00 0.00 ? 83  TYR A N    6  
ATOM 10505 C CA   . TYR A 1 83  ? -14.356 -5.126  -1.782  1.00 0.00 ? 83  TYR A CA   6  
ATOM 10506 C C    . TYR A 1 83  ? -13.867 -6.278  -2.655  1.00 0.00 ? 83  TYR A C    6  
ATOM 10507 O O    . TYR A 1 83  ? -12.842 -6.896  -2.370  1.00 0.00 ? 83  TYR A O    6  
ATOM 10508 C CB   . TYR A 1 83  ? -13.479 -3.893  -2.007  1.00 0.00 ? 83  TYR A CB   6  
ATOM 10509 C CG   . TYR A 1 83  ? -14.012 -2.643  -1.344  1.00 0.00 ? 83  TYR A CG   6  
ATOM 10510 C CD1  . TYR A 1 83  ? -13.680 -2.334  -0.030  1.00 0.00 ? 83  TYR A CD1  6  
ATOM 10511 C CD2  . TYR A 1 83  ? -14.847 -1.770  -2.030  1.00 0.00 ? 83  TYR A CD2  6  
ATOM 10512 C CE1  . TYR A 1 83  ? -14.164 -1.193  0.580   1.00 0.00 ? 83  TYR A CE1  6  
ATOM 10513 C CE2  . TYR A 1 83  ? -15.335 -0.627  -1.429  1.00 0.00 ? 83  TYR A CE2  6  
ATOM 10514 C CZ   . TYR A 1 83  ? -14.991 -0.343  -0.124  1.00 0.00 ? 83  TYR A CZ   6  
ATOM 10515 O OH   . TYR A 1 83  ? -15.476 0.795   0.480   1.00 0.00 ? 83  TYR A OH   6  
ATOM 10516 H H    . TYR A 1 83  ? -13.563 -5.959  -0.004  1.00 0.00 ? 83  TYR A H    6  
ATOM 10517 H HA   . TYR A 1 83  ? -15.373 -4.888  -2.056  1.00 0.00 ? 83  TYR A HA   6  
ATOM 10518 H HB2  . TYR A 1 83  ? -12.494 -4.083  -1.611  1.00 0.00 ? 83  TYR A HB2  6  
ATOM 10519 H HB3  . TYR A 1 83  ? -13.406 -3.701  -3.067  1.00 0.00 ? 83  TYR A HB3  6  
ATOM 10520 H HD1  . TYR A 1 83  ? -13.032 -3.003  0.518   1.00 0.00 ? 83  TYR A HD1  6  
ATOM 10521 H HD2  . TYR A 1 83  ? -15.115 -1.996  -3.052  1.00 0.00 ? 83  TYR A HD2  6  
ATOM 10522 H HE1  . TYR A 1 83  ? -13.895 -0.970  1.602   1.00 0.00 ? 83  TYR A HE1  6  
ATOM 10523 H HE2  . TYR A 1 83  ? -15.983 0.039   -1.979  1.00 0.00 ? 83  TYR A HE2  6  
ATOM 10524 H HH   . TYR A 1 83  ? -15.221 0.800   1.405   1.00 0.00 ? 83  TYR A HH   6  
ATOM 10525 N N    . ASN A 1 84  ? -14.609 -6.559  -3.721  1.00 0.00 ? 84  ASN A N    6  
ATOM 10526 C CA   . ASN A 1 84  ? -14.252 -7.636  -4.638  1.00 0.00 ? 84  ASN A CA   6  
ATOM 10527 C C    . ASN A 1 84  ? -12.739 -7.716  -4.821  1.00 0.00 ? 84  ASN A C    6  
ATOM 10528 O O    . ASN A 1 84  ? -12.127 -8.753  -4.568  1.00 0.00 ? 84  ASN A O    6  
ATOM 10529 C CB   . ASN A 1 84  ? -14.931 -7.426  -5.993  1.00 0.00 ? 84  ASN A CB   6  
ATOM 10530 C CG   . ASN A 1 84  ? -14.420 -8.386  -7.050  1.00 0.00 ? 84  ASN A CG   6  
ATOM 10531 O OD1  . ASN A 1 84  ? -13.970 -7.969  -8.117  1.00 0.00 ? 84  ASN A OD1  6  
ATOM 10532 N ND2  . ASN A 1 84  ? -14.489 -9.680  -6.757  1.00 0.00 ? 84  ASN A ND2  6  
ATOM 10533 H H    . ASN A 1 84  ? -15.415 -6.030  -3.896  1.00 0.00 ? 84  ASN A H    6  
ATOM 10534 H HA   . ASN A 1 84  ? -14.600 -8.564  -4.210  1.00 0.00 ? 84  ASN A HA   6  
ATOM 10535 H HB2  . ASN A 1 84  ? -15.995 -7.576  -5.882  1.00 0.00 ? 84  ASN A HB2  6  
ATOM 10536 H HB3  . ASN A 1 84  ? -14.746 -6.417  -6.329  1.00 0.00 ? 84  ASN A HB3  6  
ATOM 10537 H HD21 . ASN A 1 84  ? -14.860 -9.939  -5.888  1.00 0.00 ? 84  ASN A HD21 6  
ATOM 10538 H HD22 . ASN A 1 84  ? -14.165 -10.322 -7.422  1.00 0.00 ? 84  ASN A HD22 6  
ATOM 10539 N N    . SER A 1 85  ? -12.143 -6.613  -5.263  1.00 0.00 ? 85  SER A N    6  
ATOM 10540 C CA   . SER A 1 85  ? -10.703 -6.558  -5.483  1.00 0.00 ? 85  SER A CA   6  
ATOM 10541 C C    . SER A 1 85  ? -10.173 -5.145  -5.261  1.00 0.00 ? 85  SER A C    6  
ATOM 10542 O O    . SER A 1 85  ? -10.933 -4.176  -5.271  1.00 0.00 ? 85  SER A O    6  
ATOM 10543 C CB   . SER A 1 85  ? -10.365 -7.025  -6.901  1.00 0.00 ? 85  SER A CB   6  
ATOM 10544 O OG   . SER A 1 85  ? -8.963  -7.064  -7.104  1.00 0.00 ? 85  SER A OG   6  
ATOM 10545 H H    . SER A 1 85  ? -12.686 -5.818  -5.447  1.00 0.00 ? 85  SER A H    6  
ATOM 10546 H HA   . SER A 1 85  ? -10.234 -7.222  -4.773  1.00 0.00 ? 85  SER A HA   6  
ATOM 10547 H HB2  . SER A 1 85  ? -10.767 -8.014  -7.057  1.00 0.00 ? 85  SER A HB2  6  
ATOM 10548 H HB3  . SER A 1 85  ? -10.801 -6.342  -7.615  1.00 0.00 ? 85  SER A HB3  6  
ATOM 10549 H HG   . SER A 1 85  ? -8.776  -7.368  -7.995  1.00 0.00 ? 85  SER A HG   6  
ATOM 10550 N N    . ILE A 1 86  ? -8.864  -5.036  -5.060  1.00 0.00 ? 86  ILE A N    6  
ATOM 10551 C CA   . ILE A 1 86  ? -8.231  -3.743  -4.836  1.00 0.00 ? 86  ILE A CA   6  
ATOM 10552 C C    . ILE A 1 86  ? -8.735  -2.704  -5.832  1.00 0.00 ? 86  ILE A C    6  
ATOM 10553 O O    . ILE A 1 86  ? -9.115  -1.598  -5.453  1.00 0.00 ? 86  ILE A O    6  
ATOM 10554 C CB   . ILE A 1 86  ? -6.697  -3.840  -4.944  1.00 0.00 ? 86  ILE A CB   6  
ATOM 10555 C CG1  . ILE A 1 86  ? -6.149  -4.795  -3.882  1.00 0.00 ? 86  ILE A CG1  6  
ATOM 10556 C CG2  . ILE A 1 86  ? -6.068  -2.462  -4.801  1.00 0.00 ? 86  ILE A CG2  6  
ATOM 10557 C CD1  . ILE A 1 86  ? -4.707  -5.189  -4.111  1.00 0.00 ? 86  ILE A CD1  6  
ATOM 10558 H H    . ILE A 1 86  ? -8.311  -5.845  -5.063  1.00 0.00 ? 86  ILE A H    6  
ATOM 10559 H HA   . ILE A 1 86  ? -8.481  -3.418  -3.836  1.00 0.00 ? 86  ILE A HA   6  
ATOM 10560 H HB   . ILE A 1 86  ? -6.451  -4.221  -5.923  1.00 0.00 ? 86  ILE A HB   6  
ATOM 10561 H HG12 . ILE A 1 86  ? -6.214  -4.323  -2.914  1.00 0.00 ? 86  ILE A HG12 6  
ATOM 10562 H HG13 . ILE A 1 86  ? -6.744  -5.697  -3.879  1.00 0.00 ? 86  ILE A HG13 6  
ATOM 10563 H HG21 . ILE A 1 86  ? -5.098  -2.556  -4.335  1.00 0.00 ? 86  ILE A HG21 6  
ATOM 10564 H HG22 . ILE A 1 86  ? -5.955  -2.015  -5.777  1.00 0.00 ? 86  ILE A HG22 6  
ATOM 10565 H HG23 . ILE A 1 86  ? -6.702  -1.838  -4.190  1.00 0.00 ? 86  ILE A HG23 6  
ATOM 10566 H HD11 . ILE A 1 86  ? -4.303  -4.618  -4.934  1.00 0.00 ? 86  ILE A HD11 6  
ATOM 10567 H HD12 . ILE A 1 86  ? -4.133  -4.991  -3.218  1.00 0.00 ? 86  ILE A HD12 6  
ATOM 10568 H HD13 . ILE A 1 86  ? -4.655  -6.243  -4.346  1.00 0.00 ? 86  ILE A HD13 6  
ATOM 10569 N N    . GLY A 1 87  ? -8.735  -3.070  -7.111  1.00 0.00 ? 87  GLY A N    6  
ATOM 10570 C CA   . GLY A 1 87  ? -9.196  -2.159  -8.143  1.00 0.00 ? 87  GLY A CA   6  
ATOM 10571 C C    . GLY A 1 87  ? -10.436 -1.393  -7.727  1.00 0.00 ? 87  GLY A C    6  
ATOM 10572 O O    . GLY A 1 87  ? -10.504 -0.174  -7.890  1.00 0.00 ? 87  GLY A O    6  
ATOM 10573 H H    . GLY A 1 87  ? -8.420  -3.965  -7.355  1.00 0.00 ? 87  GLY A H    6  
ATOM 10574 H HA2  . GLY A 1 87  ? -8.408  -1.456  -8.365  1.00 0.00 ? 87  GLY A HA2  6  
ATOM 10575 H HA3  . GLY A 1 87  ? -9.420  -2.727  -9.034  1.00 0.00 ? 87  GLY A HA3  6  
ATOM 10576 N N    . ASP A 1 88  ? -11.420 -2.107  -7.192  1.00 0.00 ? 88  ASP A N    6  
ATOM 10577 C CA   . ASP A 1 88  ? -12.664 -1.486  -6.753  1.00 0.00 ? 88  ASP A CA   6  
ATOM 10578 C C    . ASP A 1 88  ? -12.409 -0.504  -5.614  1.00 0.00 ? 88  ASP A C    6  
ATOM 10579 O O    . ASP A 1 88  ? -12.754 0.675   -5.708  1.00 0.00 ? 88  ASP A O    6  
ATOM 10580 C CB   . ASP A 1 88  ? -13.663 -2.555  -6.306  1.00 0.00 ? 88  ASP A CB   6  
ATOM 10581 C CG   . ASP A 1 88  ? -15.102 -2.129  -6.521  1.00 0.00 ? 88  ASP A CG   6  
ATOM 10582 O OD1  . ASP A 1 88  ? -15.345 -1.286  -7.410  1.00 0.00 ? 88  ASP A OD1  6  
ATOM 10583 O OD2  . ASP A 1 88  ? -15.985 -2.639  -5.800  1.00 0.00 ? 88  ASP A OD2  6  
ATOM 10584 H H    . ASP A 1 88  ? -11.306 -3.075  -7.088  1.00 0.00 ? 88  ASP A H    6  
ATOM 10585 H HA   . ASP A 1 88  ? -13.079 -0.946  -7.590  1.00 0.00 ? 88  ASP A HA   6  
ATOM 10586 H HB2  . ASP A 1 88  ? -13.487 -3.460  -6.870  1.00 0.00 ? 88  ASP A HB2  6  
ATOM 10587 H HB3  . ASP A 1 88  ? -13.518 -2.757  -5.255  1.00 0.00 ? 88  ASP A HB3  6  
ATOM 10588 N N    . ILE A 1 89  ? -11.804 -0.996  -4.539  1.00 0.00 ? 89  ILE A N    6  
ATOM 10589 C CA   . ILE A 1 89  ? -11.503 -0.162  -3.382  1.00 0.00 ? 89  ILE A CA   6  
ATOM 10590 C C    . ILE A 1 89  ? -11.090 1.243   -3.810  1.00 0.00 ? 89  ILE A C    6  
ATOM 10591 O O    . ILE A 1 89  ? -11.429 2.227   -3.152  1.00 0.00 ? 89  ILE A O    6  
ATOM 10592 C CB   . ILE A 1 89  ? -10.381 -0.774  -2.523  1.00 0.00 ? 89  ILE A CB   6  
ATOM 10593 C CG1  . ILE A 1 89  ? -10.875 -2.046  -1.831  1.00 0.00 ? 89  ILE A CG1  6  
ATOM 10594 C CG2  . ILE A 1 89  ? -9.888  0.236   -1.497  1.00 0.00 ? 89  ILE A CG2  6  
ATOM 10595 C CD1  . ILE A 1 89  ? -9.759  -2.924  -1.310  1.00 0.00 ? 89  ILE A CD1  6  
ATOM 10596 H H    . ILE A 1 89  ? -11.553 -1.943  -4.523  1.00 0.00 ? 89  ILE A H    6  
ATOM 10597 H HA   . ILE A 1 89  ? -12.396 -0.095  -2.778  1.00 0.00 ? 89  ILE A HA   6  
ATOM 10598 H HB   . ILE A 1 89  ? -9.556  -1.024  -3.172  1.00 0.00 ? 89  ILE A HB   6  
ATOM 10599 H HG12 . ILE A 1 89  ? -11.500 -1.774  -0.994  1.00 0.00 ? 89  ILE A HG12 6  
ATOM 10600 H HG13 . ILE A 1 89  ? -11.455 -2.627  -2.533  1.00 0.00 ? 89  ILE A HG13 6  
ATOM 10601 H HG21 . ILE A 1 89  ? -9.819  -0.238  -0.529  1.00 0.00 ? 89  ILE A HG21 6  
ATOM 10602 H HG22 . ILE A 1 89  ? -8.913  0.598   -1.789  1.00 0.00 ? 89  ILE A HG22 6  
ATOM 10603 H HG23 . ILE A 1 89  ? -10.579 1.063   -1.445  1.00 0.00 ? 89  ILE A HG23 6  
ATOM 10604 H HD11 . ILE A 1 89  ? -9.963  -3.954  -1.562  1.00 0.00 ? 89  ILE A HD11 6  
ATOM 10605 H HD12 . ILE A 1 89  ? -8.824  -2.621  -1.757  1.00 0.00 ? 89  ILE A HD12 6  
ATOM 10606 H HD13 . ILE A 1 89  ? -9.693  -2.824  -0.236  1.00 0.00 ? 89  ILE A HD13 6  
ATOM 10607 N N    . ILE A 1 90  ? -10.360 1.328   -4.917  1.00 0.00 ? 90  ILE A N    6  
ATOM 10608 C CA   . ILE A 1 90  ? -9.905  2.612   -5.434  1.00 0.00 ? 90  ILE A CA   6  
ATOM 10609 C C    . ILE A 1 90  ? -11.067 3.418   -6.004  1.00 0.00 ? 90  ILE A C    6  
ATOM 10610 O O    . ILE A 1 90  ? -11.463 4.439   -5.441  1.00 0.00 ? 90  ILE A O    6  
ATOM 10611 C CB   . ILE A 1 90  ? -8.835  2.431   -6.527  1.00 0.00 ? 90  ILE A CB   6  
ATOM 10612 C CG1  . ILE A 1 90  ? -7.659  1.612   -5.990  1.00 0.00 ? 90  ILE A CG1  6  
ATOM 10613 C CG2  . ILE A 1 90  ? -8.358  3.785   -7.031  1.00 0.00 ? 90  ILE A CG2  6  
ATOM 10614 C CD1  . ILE A 1 90  ? -6.690  1.170   -7.064  1.00 0.00 ? 90  ILE A CD1  6  
ATOM 10615 H H    . ILE A 1 90  ? -10.122 0.507   -5.397  1.00 0.00 ? 90  ILE A H    6  
ATOM 10616 H HA   . ILE A 1 90  ? -9.465  3.164   -4.616  1.00 0.00 ? 90  ILE A HA   6  
ATOM 10617 H HB   . ILE A 1 90  ? -9.283  1.904   -7.355  1.00 0.00 ? 90  ILE A HB   6  
ATOM 10618 H HG12 . ILE A 1 90  ? -7.112  2.205   -5.275  1.00 0.00 ? 90  ILE A HG12 6  
ATOM 10619 H HG13 . ILE A 1 90  ? -8.040  0.727   -5.501  1.00 0.00 ? 90  ILE A HG13 6  
ATOM 10620 H HG21 . ILE A 1 90  ? -7.637  4.194   -6.337  1.00 0.00 ? 90  ILE A HG21 6  
ATOM 10621 H HG22 . ILE A 1 90  ? -7.896  3.667   -7.999  1.00 0.00 ? 90  ILE A HG22 6  
ATOM 10622 H HG23 . ILE A 1 90  ? -9.200  4.456   -7.112  1.00 0.00 ? 90  ILE A HG23 6  
ATOM 10623 H HD11 . ILE A 1 90  ? -5.680  1.239   -6.689  1.00 0.00 ? 90  ILE A HD11 6  
ATOM 10624 H HD12 . ILE A 1 90  ? -6.903  0.149   -7.343  1.00 0.00 ? 90  ILE A HD12 6  
ATOM 10625 H HD13 . ILE A 1 90  ? -6.796  1.809   -7.930  1.00 0.00 ? 90  ILE A HD13 6  
ATOM 10626 N N    . ASP A 1 91  ? -11.609 2.952   -7.123  1.00 0.00 ? 91  ASP A N    6  
ATOM 10627 C CA   . ASP A 1 91  ? -12.729 3.628   -7.769  1.00 0.00 ? 91  ASP A CA   6  
ATOM 10628 C C    . ASP A 1 91  ? -13.741 4.112   -6.735  1.00 0.00 ? 91  ASP A C    6  
ATOM 10629 O O    . ASP A 1 91  ? -14.308 5.197   -6.867  1.00 0.00 ? 91  ASP A O    6  
ATOM 10630 C CB   . ASP A 1 91  ? -13.410 2.692   -8.769  1.00 0.00 ? 91  ASP A CB   6  
ATOM 10631 C CG   . ASP A 1 91  ? -12.467 2.226   -9.861  1.00 0.00 ? 91  ASP A CG   6  
ATOM 10632 O OD1  . ASP A 1 91  ? -11.277 1.999   -9.559  1.00 0.00 ? 91  ASP A OD1  6  
ATOM 10633 O OD2  . ASP A 1 91  ? -12.918 2.090   -11.017 1.00 0.00 ? 91  ASP A OD2  6  
ATOM 10634 H H    . ASP A 1 91  ? -11.249 2.134   -7.525  1.00 0.00 ? 91  ASP A H    6  
ATOM 10635 H HA   . ASP A 1 91  ? -12.339 4.484   -8.300  1.00 0.00 ? 91  ASP A HA   6  
ATOM 10636 H HB2  . ASP A 1 91  ? -13.780 1.823   -8.244  1.00 0.00 ? 91  ASP A HB2  6  
ATOM 10637 H HB3  . ASP A 1 91  ? -14.238 3.209   -9.230  1.00 0.00 ? 91  ASP A HB3  6  
ATOM 10638 N N    . HIS A 1 92  ? -13.964 3.299   -5.708  1.00 0.00 ? 92  HIS A N    6  
ATOM 10639 C CA   . HIS A 1 92  ? -14.909 3.644   -4.651  1.00 0.00 ? 92  HIS A CA   6  
ATOM 10640 C C    . HIS A 1 92  ? -14.402 4.828   -3.834  1.00 0.00 ? 92  HIS A C    6  
ATOM 10641 O O    . HIS A 1 92  ? -15.154 5.756   -3.536  1.00 0.00 ? 92  HIS A O    6  
ATOM 10642 C CB   . HIS A 1 92  ? -15.144 2.442   -3.736  1.00 0.00 ? 92  HIS A CB   6  
ATOM 10643 C CG   . HIS A 1 92  ? -16.257 2.644   -2.755  1.00 0.00 ? 92  HIS A CG   6  
ATOM 10644 N ND1  . HIS A 1 92  ? -16.050 2.781   -1.399  1.00 0.00 ? 92  HIS A ND1  6  
ATOM 10645 C CD2  . HIS A 1 92  ? -17.595 2.735   -2.941  1.00 0.00 ? 92  HIS A CD2  6  
ATOM 10646 C CE1  . HIS A 1 92  ? -17.212 2.945   -0.792  1.00 0.00 ? 92  HIS A CE1  6  
ATOM 10647 N NE2  . HIS A 1 92  ? -18.166 2.922   -1.706  1.00 0.00 ? 92  HIS A NE2  6  
ATOM 10648 H H    . HIS A 1 92  ? -13.482 2.448   -5.658  1.00 0.00 ? 92  HIS A H    6  
ATOM 10649 H HA   . HIS A 1 92  ? -15.843 3.918   -5.118  1.00 0.00 ? 92  HIS A HA   6  
ATOM 10650 H HB2  . HIS A 1 92  ? -15.387 1.580   -4.340  1.00 0.00 ? 92  HIS A HB2  6  
ATOM 10651 H HB3  . HIS A 1 92  ? -14.241 2.241   -3.177  1.00 0.00 ? 92  HIS A HB3  6  
ATOM 10652 H HD1  . HIS A 1 92  ? -15.181 2.760   -0.948  1.00 0.00 ? 92  HIS A HD1  6  
ATOM 10653 H HD2  . HIS A 1 92  ? -18.118 2.671   -3.885  1.00 0.00 ? 92  HIS A HD2  6  
ATOM 10654 H HE1  . HIS A 1 92  ? -17.358 3.077   0.269   1.00 0.00 ? 92  HIS A HE1  6  
ATOM 10655 N N    . TYR A 1 93  ? -13.123 4.790   -3.476  1.00 0.00 ? 93  TYR A N    6  
ATOM 10656 C CA   . TYR A 1 93  ? -12.517 5.858   -2.691  1.00 0.00 ? 93  TYR A CA   6  
ATOM 10657 C C    . TYR A 1 93  ? -12.451 7.154   -3.494  1.00 0.00 ? 93  TYR A C    6  
ATOM 10658 O O    . TYR A 1 93  ? -12.647 8.243   -2.953  1.00 0.00 ? 93  TYR A O    6  
ATOM 10659 C CB   . TYR A 1 93  ? -11.113 5.454   -2.239  1.00 0.00 ? 93  TYR A CB   6  
ATOM 10660 C CG   . TYR A 1 93  ? -11.088 4.738   -0.907  1.00 0.00 ? 93  TYR A CG   6  
ATOM 10661 C CD1  . TYR A 1 93  ? -11.696 5.292   0.213   1.00 0.00 ? 93  TYR A CD1  6  
ATOM 10662 C CD2  . TYR A 1 93  ? -10.458 3.508   -0.769  1.00 0.00 ? 93  TYR A CD2  6  
ATOM 10663 C CE1  . TYR A 1 93  ? -11.675 4.643   1.432   1.00 0.00 ? 93  TYR A CE1  6  
ATOM 10664 C CE2  . TYR A 1 93  ? -10.434 2.850   0.446   1.00 0.00 ? 93  TYR A CE2  6  
ATOM 10665 C CZ   . TYR A 1 93  ? -11.043 3.422   1.543   1.00 0.00 ? 93  TYR A CZ   6  
ATOM 10666 O OH   . TYR A 1 93  ? -11.021 2.770   2.755   1.00 0.00 ? 93  TYR A OH   6  
ATOM 10667 H H    . TYR A 1 93  ? -12.574 4.024   -3.744  1.00 0.00 ? 93  TYR A H    6  
ATOM 10668 H HA   . TYR A 1 93  ? -13.133 6.020   -1.818  1.00 0.00 ? 93  TYR A HA   6  
ATOM 10669 H HB2  . TYR A 1 93  ? -10.680 4.795   -2.976  1.00 0.00 ? 93  TYR A HB2  6  
ATOM 10670 H HB3  . TYR A 1 93  ? -10.501 6.340   -2.151  1.00 0.00 ? 93  TYR A HB3  6  
ATOM 10671 H HD1  . TYR A 1 93  ? -12.190 6.249   0.122   1.00 0.00 ? 93  TYR A HD1  6  
ATOM 10672 H HD2  . TYR A 1 93  ? -9.982  3.062   -1.631  1.00 0.00 ? 93  TYR A HD2  6  
ATOM 10673 H HE1  . TYR A 1 93  ? -12.152 5.090   2.291   1.00 0.00 ? 93  TYR A HE1  6  
ATOM 10674 H HE2  . TYR A 1 93  ? -9.939  1.894   0.533   1.00 0.00 ? 93  TYR A HE2  6  
ATOM 10675 H HH   . TYR A 1 93  ? -11.193 3.400   3.459   1.00 0.00 ? 93  TYR A HH   6  
ATOM 10676 N N    . ARG A 1 94  ? -12.175 7.028   -4.787  1.00 0.00 ? 94  ARG A N    6  
ATOM 10677 C CA   . ARG A 1 94  ? -12.083 8.187   -5.666  1.00 0.00 ? 94  ARG A CA   6  
ATOM 10678 C C    . ARG A 1 94  ? -13.293 9.100   -5.490  1.00 0.00 ? 94  ARG A C    6  
ATOM 10679 O O    . ARG A 1 94  ? -13.205 10.312  -5.690  1.00 0.00 ? 94  ARG A O    6  
ATOM 10680 C CB   . ARG A 1 94  ? -11.975 7.741   -7.125  1.00 0.00 ? 94  ARG A CB   6  
ATOM 10681 C CG   . ARG A 1 94  ? -10.764 6.868   -7.407  1.00 0.00 ? 94  ARG A CG   6  
ATOM 10682 C CD   . ARG A 1 94  ? -10.340 6.956   -8.865  1.00 0.00 ? 94  ARG A CD   6  
ATOM 10683 N NE   . ARG A 1 94  ? -11.007 5.952   -9.690  1.00 0.00 ? 94  ARG A NE   6  
ATOM 10684 C CZ   . ARG A 1 94  ? -12.213 6.120   -10.222 1.00 0.00 ? 94  ARG A CZ   6  
ATOM 10685 N NH1  . ARG A 1 94  ? -12.880 7.247   -10.016 1.00 0.00 ? 94  ARG A NH1  6  
ATOM 10686 N NH2  . ARG A 1 94  ? -12.753 5.159   -10.961 1.00 0.00 ? 94  ARG A NH2  6  
ATOM 10687 H H    . ARG A 1 94  ? -12.029 6.133   -5.160  1.00 0.00 ? 94  ARG A H    6  
ATOM 10688 H HA   . ARG A 1 94  ? -11.192 8.735   -5.400  1.00 0.00 ? 94  ARG A HA   6  
ATOM 10689 H HB2  . ARG A 1 94  ? -12.862 7.182   -7.385  1.00 0.00 ? 94  ARG A HB2  6  
ATOM 10690 H HB3  . ARG A 1 94  ? -11.914 8.617   -7.753  1.00 0.00 ? 94  ARG A HB3  6  
ATOM 10691 H HG2  . ARG A 1 94  ? -9.943  7.195   -6.786  1.00 0.00 ? 94  ARG A HG2  6  
ATOM 10692 H HG3  . ARG A 1 94  ? -11.009 5.842   -7.173  1.00 0.00 ? 94  ARG A HG3  6  
ATOM 10693 H HD2  . ARG A 1 94  ? -10.589 7.938   -9.240  1.00 0.00 ? 94  ARG A HD2  6  
ATOM 10694 H HD3  . ARG A 1 94  ? -9.273  6.807   -8.925  1.00 0.00 ? 94  ARG A HD3  6  
ATOM 10695 H HE   . ARG A 1 94  ? -10.531 5.111   -9.855  1.00 0.00 ? 94  ARG A HE   6  
ATOM 10696 H HH11 . ARG A 1 94  ? -12.475 7.972   -9.460  1.00 0.00 ? 94  ARG A HH11 6  
ATOM 10697 H HH12 . ARG A 1 94  ? -13.787 7.371   -10.419 1.00 0.00 ? 94  ARG A HH12 6  
ATOM 10698 H HH21 . ARG A 1 94  ? -12.252 4.309   -11.119 1.00 0.00 ? 94  ARG A HH21 6  
ATOM 10699 H HH22 . ARG A 1 94  ? -13.660 5.287   -11.361 1.00 0.00 ? 94  ARG A HH22 6  
ATOM 10700 N N    . LYS A 1 95  ? -14.423 8.510   -5.115  1.00 0.00 ? 95  LYS A N    6  
ATOM 10701 C CA   . LYS A 1 95  ? -15.652 9.269   -4.911  1.00 0.00 ? 95  LYS A CA   6  
ATOM 10702 C C    . LYS A 1 95  ? -15.872 9.560   -3.430  1.00 0.00 ? 95  LYS A C    6  
ATOM 10703 O O    . LYS A 1 95  ? -16.663 10.431  -3.071  1.00 0.00 ? 95  LYS A O    6  
ATOM 10704 C CB   . LYS A 1 95  ? -16.849 8.500   -5.474  1.00 0.00 ? 95  LYS A CB   6  
ATOM 10705 C CG   . LYS A 1 95  ? -16.905 8.487   -6.992  1.00 0.00 ? 95  LYS A CG   6  
ATOM 10706 C CD   . LYS A 1 95  ? -18.097 7.694   -7.500  1.00 0.00 ? 95  LYS A CD   6  
ATOM 10707 C CE   . LYS A 1 95  ? -18.344 7.944   -8.979  1.00 0.00 ? 95  LYS A CE   6  
ATOM 10708 N NZ   . LYS A 1 95  ? -17.538 7.033   -9.838  1.00 0.00 ? 95  LYS A NZ   6  
ATOM 10709 H H    . LYS A 1 95  ? -14.431 7.540   -4.971  1.00 0.00 ? 95  LYS A H    6  
ATOM 10710 H HA   . LYS A 1 95  ? -15.555 10.205  -5.440  1.00 0.00 ? 95  LYS A HA   6  
ATOM 10711 H HB2  . LYS A 1 95  ? -16.801 7.478   -5.128  1.00 0.00 ? 95  LYS A HB2  6  
ATOM 10712 H HB3  . LYS A 1 95  ? -17.758 8.953   -5.105  1.00 0.00 ? 95  LYS A HB3  6  
ATOM 10713 H HG2  . LYS A 1 95  ? -16.984 9.503   -7.349  1.00 0.00 ? 95  LYS A HG2  6  
ATOM 10714 H HG3  . LYS A 1 95  ? -15.998 8.040   -7.373  1.00 0.00 ? 95  LYS A HG3  6  
ATOM 10715 H HD2  . LYS A 1 95  ? -17.908 6.641   -7.351  1.00 0.00 ? 95  LYS A HD2  6  
ATOM 10716 H HD3  . LYS A 1 95  ? -18.976 7.985   -6.942  1.00 0.00 ? 95  LYS A HD3  6  
ATOM 10717 H HE2  . LYS A 1 95  ? -19.392 7.788   -9.188  1.00 0.00 ? 95  LYS A HE2  6  
ATOM 10718 H HE3  . LYS A 1 95  ? -18.080 8.966   -9.207  1.00 0.00 ? 95  LYS A HE3  6  
ATOM 10719 H HZ1  . LYS A 1 95  ? -17.443 7.434   -10.793 1.00 0.00 ? 95  LYS A HZ1  6  
ATOM 10720 H HZ2  . LYS A 1 95  ? -18.003 6.105   -9.909  1.00 0.00 ? 95  LYS A HZ2  6  
ATOM 10721 H HZ3  . LYS A 1 95  ? -16.590 6.904   -9.431  1.00 0.00 ? 95  LYS A HZ3  6  
ATOM 10722 N N    . GLU A 1 96  ? -15.165 8.827   -2.576  1.00 0.00 ? 96  GLU A N    6  
ATOM 10723 C CA   . GLU A 1 96  ? -15.284 9.009   -1.134  1.00 0.00 ? 96  GLU A CA   6  
ATOM 10724 C C    . GLU A 1 96  ? -13.920 9.282   -0.506  1.00 0.00 ? 96  GLU A C    6  
ATOM 10725 O O    . GLU A 1 96  ? -13.012 8.455   -0.585  1.00 0.00 ? 96  GLU A O    6  
ATOM 10726 C CB   . GLU A 1 96  ? -15.914 7.771   -0.492  1.00 0.00 ? 96  GLU A CB   6  
ATOM 10727 C CG   . GLU A 1 96  ? -17.411 7.657   -0.731  1.00 0.00 ? 96  GLU A CG   6  
ATOM 10728 C CD   . GLU A 1 96  ? -18.227 8.356   0.339   1.00 0.00 ? 96  GLU A CD   6  
ATOM 10729 O OE1  . GLU A 1 96  ? -17.894 8.202   1.533   1.00 0.00 ? 96  GLU A OE1  6  
ATOM 10730 O OE2  . GLU A 1 96  ? -19.198 9.055   -0.017  1.00 0.00 ? 96  GLU A OE2  6  
ATOM 10731 H H    . GLU A 1 96  ? -14.550 8.148   -2.923  1.00 0.00 ? 96  GLU A H    6  
ATOM 10732 H HA   . GLU A 1 96  ? -15.924 9.860   -0.959  1.00 0.00 ? 96  GLU A HA   6  
ATOM 10733 H HB2  . GLU A 1 96  ? -15.438 6.889   -0.894  1.00 0.00 ? 96  GLU A HB2  6  
ATOM 10734 H HB3  . GLU A 1 96  ? -15.743 7.807   0.574   1.00 0.00 ? 96  GLU A HB3  6  
ATOM 10735 H HG2  . GLU A 1 96  ? -17.645 8.101   -1.687  1.00 0.00 ? 96  GLU A HG2  6  
ATOM 10736 H HG3  . GLU A 1 96  ? -17.682 6.612   -0.745  1.00 0.00 ? 96  GLU A HG3  6  
ATOM 10737 N N    . GLN A 1 97  ? -13.785 10.448  0.117   1.00 0.00 ? 97  GLN A N    6  
ATOM 10738 C CA   . GLN A 1 97  ? -12.533 10.831  0.757   1.00 0.00 ? 97  GLN A CA   6  
ATOM 10739 C C    . GLN A 1 97  ? -11.958 9.672   1.565   1.00 0.00 ? 97  GLN A C    6  
ATOM 10740 O O    . GLN A 1 97  ? -12.555 9.232   2.548   1.00 0.00 ? 97  GLN A O    6  
ATOM 10741 C CB   . GLN A 1 97  ? -12.749 12.043  1.665   1.00 0.00 ? 97  GLN A CB   6  
ATOM 10742 C CG   . GLN A 1 97  ? -14.080 12.023  2.399   1.00 0.00 ? 97  GLN A CG   6  
ATOM 10743 C CD   . GLN A 1 97  ? -14.181 13.108  3.454   1.00 0.00 ? 97  GLN A CD   6  
ATOM 10744 O OE1  . GLN A 1 97  ? -14.521 12.840  4.606   1.00 0.00 ? 97  GLN A OE1  6  
ATOM 10745 N NE2  . GLN A 1 97  ? -13.885 14.343  3.064   1.00 0.00 ? 97  GLN A NE2  6  
ATOM 10746 H H    . GLN A 1 97  ? -14.545 11.065  0.146   1.00 0.00 ? 97  GLN A H    6  
ATOM 10747 H HA   . GLN A 1 97  ? -11.831 11.095  -0.019  1.00 0.00 ? 97  GLN A HA   6  
ATOM 10748 H HB2  . GLN A 1 97  ? -11.958 12.075  2.399   1.00 0.00 ? 97  GLN A HB2  6  
ATOM 10749 H HB3  . GLN A 1 97  ? -12.708 12.940  1.064   1.00 0.00 ? 97  GLN A HB3  6  
ATOM 10750 H HG2  . GLN A 1 97  ? -14.875 12.166  1.682   1.00 0.00 ? 97  GLN A HG2  6  
ATOM 10751 H HG3  . GLN A 1 97  ? -14.197 11.063  2.879   1.00 0.00 ? 97  GLN A HG3  6  
ATOM 10752 H HE21 . GLN A 1 97  ? -13.623 14.482  2.129   1.00 0.00 ? 97  GLN A HE21 6  
ATOM 10753 H HE22 . GLN A 1 97  ? -13.943 15.063  3.724   1.00 0.00 ? 97  GLN A HE22 6  
ATOM 10754 N N    . ILE A 1 98  ? -10.796 9.183   1.145   1.00 0.00 ? 98  ILE A N    6  
ATOM 10755 C CA   . ILE A 1 98  ? -10.141 8.076   1.830   1.00 0.00 ? 98  ILE A CA   6  
ATOM 10756 C C    . ILE A 1 98  ? -9.528  8.532   3.150   1.00 0.00 ? 98  ILE A C    6  
ATOM 10757 O O    . ILE A 1 98  ? -9.332  7.732   4.065   1.00 0.00 ? 98  ILE A O    6  
ATOM 10758 C CB   . ILE A 1 98  ? -9.040  7.446   0.956   1.00 0.00 ? 98  ILE A CB   6  
ATOM 10759 C CG1  . ILE A 1 98  ? -8.233  6.431   1.769   1.00 0.00 ? 98  ILE A CG1  6  
ATOM 10760 C CG2  . ILE A 1 98  ? -8.130  8.525   0.391   1.00 0.00 ? 98  ILE A CG2  6  
ATOM 10761 C CD1  . ILE A 1 98  ? -7.244  5.643   0.939   1.00 0.00 ? 98  ILE A CD1  6  
ATOM 10762 H H    . ILE A 1 98  ? -10.370 9.577   0.355   1.00 0.00 ? 98  ILE A H    6  
ATOM 10763 H HA   . ILE A 1 98  ? -10.887 7.322   2.033   1.00 0.00 ? 98  ILE A HA   6  
ATOM 10764 H HB   . ILE A 1 98  ? -9.514  6.939   0.130   1.00 0.00 ? 98  ILE A HB   6  
ATOM 10765 H HG12 . ILE A 1 98  ? -7.681  6.951   2.536   1.00 0.00 ? 98  ILE A HG12 6  
ATOM 10766 H HG13 . ILE A 1 98  ? -8.912  5.730   2.232   1.00 0.00 ? 98  ILE A HG13 6  
ATOM 10767 H HG21 . ILE A 1 98  ? -8.487  9.496   0.701   1.00 0.00 ? 98  ILE A HG21 6  
ATOM 10768 H HG22 . ILE A 1 98  ? -7.125  8.377   0.759   1.00 0.00 ? 98  ILE A HG22 6  
ATOM 10769 H HG23 . ILE A 1 98  ? -8.131  8.469   -0.687  1.00 0.00 ? 98  ILE A HG23 6  
ATOM 10770 H HD11 . ILE A 1 98  ? -6.590  6.324   0.414   1.00 0.00 ? 98  ILE A HD11 6  
ATOM 10771 H HD12 . ILE A 1 98  ? -6.658  5.006   1.584   1.00 0.00 ? 98  ILE A HD12 6  
ATOM 10772 H HD13 . ILE A 1 98  ? -7.779  5.035   0.223   1.00 0.00 ? 98  ILE A HD13 6  
ATOM 10773 N N    . VAL A 1 99  ? -9.228  9.824   3.242   1.00 0.00 ? 99  VAL A N    6  
ATOM 10774 C CA   . VAL A 1 99  ? -8.640  10.388  4.451   1.00 0.00 ? 99  VAL A CA   6  
ATOM 10775 C C    . VAL A 1 99  ? -9.551  11.446  5.063   1.00 0.00 ? 99  VAL A C    6  
ATOM 10776 O O    . VAL A 1 99  ? -10.668 11.663  4.594   1.00 0.00 ? 99  VAL A O    6  
ATOM 10777 C CB   . VAL A 1 99  ? -7.263  11.016  4.165   1.00 0.00 ? 99  VAL A CB   6  
ATOM 10778 C CG1  . VAL A 1 99  ? -6.368  10.922  5.391   1.00 0.00 ? 99  VAL A CG1  6  
ATOM 10779 C CG2  . VAL A 1 99  ? -6.610  10.344  2.966   1.00 0.00 ? 99  VAL A CG2  6  
ATOM 10780 H H    . VAL A 1 99  ? -9.408  10.412  2.478   1.00 0.00 ? 99  VAL A H    6  
ATOM 10781 H HA   . VAL A 1 99  ? -8.506  9.586   5.162   1.00 0.00 ? 99  VAL A HA   6  
ATOM 10782 H HB   . VAL A 1 99  ? -7.407  12.060  3.931   1.00 0.00 ? 99  VAL A HB   6  
ATOM 10783 H HG11 . VAL A 1 99  ? -6.871  10.355  6.161   1.00 0.00 ? 99  VAL A HG11 6  
ATOM 10784 H HG12 . VAL A 1 99  ? -5.444  10.430  5.126   1.00 0.00 ? 99  VAL A HG12 6  
ATOM 10785 H HG13 . VAL A 1 99  ? -6.156  11.915  5.758   1.00 0.00 ? 99  VAL A HG13 6  
ATOM 10786 H HG21 . VAL A 1 99  ? -5.662  10.817  2.762   1.00 0.00 ? 99  VAL A HG21 6  
ATOM 10787 H HG22 . VAL A 1 99  ? -6.451  9.297   3.182   1.00 0.00 ? 99  VAL A HG22 6  
ATOM 10788 H HG23 . VAL A 1 99  ? -7.254  10.439  2.105   1.00 0.00 ? 99  VAL A HG23 6  
ATOM 10789 N N    . GLU A 1 100 ? -9.066  12.102  6.113   1.00 0.00 ? 100 GLU A N    6  
ATOM 10790 C CA   . GLU A 1 100 ? -9.838  13.137  6.789   1.00 0.00 ? 100 GLU A CA   6  
ATOM 10791 C C    . GLU A 1 100 ? -9.713  14.472  6.061   1.00 0.00 ? 100 GLU A C    6  
ATOM 10792 O O    . GLU A 1 100 ? -9.638  15.529  6.686   1.00 0.00 ? 100 GLU A O    6  
ATOM 10793 C CB   . GLU A 1 100 ? -9.369  13.289  8.238   1.00 0.00 ? 100 GLU A CB   6  
ATOM 10794 C CG   . GLU A 1 100 ? -8.003  13.940  8.371   1.00 0.00 ? 100 GLU A CG   6  
ATOM 10795 C CD   . GLU A 1 100 ? -7.281  13.529  9.640   1.00 0.00 ? 100 GLU A CD   6  
ATOM 10796 O OE1  . GLU A 1 100 ? -7.783  13.847  10.738  1.00 0.00 ? 100 GLU A OE1  6  
ATOM 10797 O OE2  . GLU A 1 100 ? -6.214  12.889  9.533   1.00 0.00 ? 100 GLU A OE2  6  
ATOM 10798 H H    . GLU A 1 100 ? -8.168  11.883  6.440   1.00 0.00 ? 100 GLU A H    6  
ATOM 10799 H HA   . GLU A 1 100 ? -10.874 12.834  6.786   1.00 0.00 ? 100 GLU A HA   6  
ATOM 10800 H HB2  . GLU A 1 100 ? -10.087 13.892  8.775   1.00 0.00 ? 100 GLU A HB2  6  
ATOM 10801 H HB3  . GLU A 1 100 ? -9.324  12.310  8.693   1.00 0.00 ? 100 GLU A HB3  6  
ATOM 10802 H HG2  . GLU A 1 100 ? -7.398  13.656  7.523   1.00 0.00 ? 100 GLU A HG2  6  
ATOM 10803 H HG3  . GLU A 1 100 ? -8.129  15.013  8.378   1.00 0.00 ? 100 GLU A HG3  6  
ATOM 10804 N N    . GLY A 1 101 ? -9.692  14.415  4.732   1.00 0.00 ? 101 GLY A N    6  
ATOM 10805 C CA   . GLY A 1 101 ? -9.575  15.625  3.940   1.00 0.00 ? 101 GLY A CA   6  
ATOM 10806 C C    . GLY A 1 101 ? -8.701  15.435  2.716   1.00 0.00 ? 101 GLY A C    6  
ATOM 10807 O O    . GLY A 1 101 ? -7.977  16.345  2.314   1.00 0.00 ? 101 GLY A O    6  
ATOM 10808 H H    . GLY A 1 101 ? -9.755  13.544  4.287   1.00 0.00 ? 101 GLY A H    6  
ATOM 10809 H HA2  . GLY A 1 101 ? -10.561 15.930  3.621   1.00 0.00 ? 101 GLY A HA2  6  
ATOM 10810 H HA3  . GLY A 1 101 ? -9.149  16.404  4.554   1.00 0.00 ? 101 GLY A HA3  6  
ATOM 10811 N N    . TYR A 1 102 ? -8.767  14.248  2.123   1.00 0.00 ? 102 TYR A N    6  
ATOM 10812 C CA   . TYR A 1 102 ? -7.973  13.939  0.940   1.00 0.00 ? 102 TYR A CA   6  
ATOM 10813 C C    . TYR A 1 102 ? -8.686  12.923  0.054   1.00 0.00 ? 102 TYR A C    6  
ATOM 10814 O O    . TYR A 1 102 ? -9.420  12.063  0.542   1.00 0.00 ? 102 TYR A O    6  
ATOM 10815 C CB   . TYR A 1 102 ? -6.600  13.402  1.348   1.00 0.00 ? 102 TYR A CB   6  
ATOM 10816 C CG   . TYR A 1 102 ? -5.798  14.367  2.191   1.00 0.00 ? 102 TYR A CG   6  
ATOM 10817 C CD1  . TYR A 1 102 ? -6.177  14.663  3.494   1.00 0.00 ? 102 TYR A CD1  6  
ATOM 10818 C CD2  . TYR A 1 102 ? -4.660  14.983  1.684   1.00 0.00 ? 102 TYR A CD2  6  
ATOM 10819 C CE1  . TYR A 1 102 ? -5.447  15.545  4.267   1.00 0.00 ? 102 TYR A CE1  6  
ATOM 10820 C CE2  . TYR A 1 102 ? -3.923  15.865  2.450   1.00 0.00 ? 102 TYR A CE2  6  
ATOM 10821 C CZ   . TYR A 1 102 ? -4.321  16.143  3.741   1.00 0.00 ? 102 TYR A CZ   6  
ATOM 10822 O OH   . TYR A 1 102 ? -3.590  17.022  4.508   1.00 0.00 ? 102 TYR A OH   6  
ATOM 10823 H H    . TYR A 1 102 ? -9.364  13.562  2.490   1.00 0.00 ? 102 TYR A H    6  
ATOM 10824 H HA   . TYR A 1 102 ? -7.838  14.855  0.382   1.00 0.00 ? 102 TYR A HA   6  
ATOM 10825 H HB2  . TYR A 1 102 ? -6.731  12.495  1.918   1.00 0.00 ? 102 TYR A HB2  6  
ATOM 10826 H HB3  . TYR A 1 102 ? -6.028  13.183  0.458   1.00 0.00 ? 102 TYR A HB3  6  
ATOM 10827 H HD1  . TYR A 1 102 ? -7.059  14.193  3.903   1.00 0.00 ? 102 TYR A HD1  6  
ATOM 10828 H HD2  . TYR A 1 102 ? -4.351  14.762  0.672   1.00 0.00 ? 102 TYR A HD2  6  
ATOM 10829 H HE1  . TYR A 1 102 ? -5.758  15.763  5.278   1.00 0.00 ? 102 TYR A HE1  6  
ATOM 10830 H HE2  . TYR A 1 102 ? -3.041  16.334  2.038   1.00 0.00 ? 102 TYR A HE2  6  
ATOM 10831 H HH   . TYR A 1 102 ? -4.184  17.645  4.934   1.00 0.00 ? 102 TYR A HH   6  
ATOM 10832 N N    . TYR A 1 103 ? -8.465  13.028  -1.252  1.00 0.00 ? 103 TYR A N    6  
ATOM 10833 C CA   . TYR A 1 103 ? -9.088  12.121  -2.208  1.00 0.00 ? 103 TYR A CA   6  
ATOM 10834 C C    . TYR A 1 103 ? -8.039  11.474  -3.108  1.00 0.00 ? 103 TYR A C    6  
ATOM 10835 O O    . TYR A 1 103 ? -6.880  11.890  -3.129  1.00 0.00 ? 103 TYR A O    6  
ATOM 10836 C CB   . TYR A 1 103 ? -10.115 12.869  -3.060  1.00 0.00 ? 103 TYR A CB   6  
ATOM 10837 C CG   . TYR A 1 103 ? -11.406 13.164  -2.331  1.00 0.00 ? 103 TYR A CG   6  
ATOM 10838 C CD1  . TYR A 1 103 ? -11.522 14.277  -1.506  1.00 0.00 ? 103 TYR A CD1  6  
ATOM 10839 C CD2  . TYR A 1 103 ? -12.509 12.331  -2.466  1.00 0.00 ? 103 TYR A CD2  6  
ATOM 10840 C CE1  . TYR A 1 103 ? -12.700 14.550  -0.838  1.00 0.00 ? 103 TYR A CE1  6  
ATOM 10841 C CE2  . TYR A 1 103 ? -13.691 12.597  -1.803  1.00 0.00 ? 103 TYR A CE2  6  
ATOM 10842 C CZ   . TYR A 1 103 ? -13.782 13.708  -0.989  1.00 0.00 ? 103 TYR A CZ   6  
ATOM 10843 O OH   . TYR A 1 103 ? -14.957 13.976  -0.326  1.00 0.00 ? 103 TYR A OH   6  
ATOM 10844 H H    . TYR A 1 103 ? -7.871  13.734  -1.581  1.00 0.00 ? 103 TYR A H    6  
ATOM 10845 H HA   . TYR A 1 103 ? -9.594  11.346  -1.650  1.00 0.00 ? 103 TYR A HA   6  
ATOM 10846 H HB2  . TYR A 1 103 ? -9.692  13.809  -3.378  1.00 0.00 ? 103 TYR A HB2  6  
ATOM 10847 H HB3  . TYR A 1 103 ? -10.353 12.274  -3.930  1.00 0.00 ? 103 TYR A HB3  6  
ATOM 10848 H HD1  . TYR A 1 103 ? -10.673 14.934  -1.389  1.00 0.00 ? 103 TYR A HD1  6  
ATOM 10849 H HD2  . TYR A 1 103 ? -12.435 11.461  -3.103  1.00 0.00 ? 103 TYR A HD2  6  
ATOM 10850 H HE1  . TYR A 1 103 ? -12.771 15.420  -0.201  1.00 0.00 ? 103 TYR A HE1  6  
ATOM 10851 H HE2  . TYR A 1 103 ? -14.538 11.938  -1.921  1.00 0.00 ? 103 TYR A HE2  6  
ATOM 10852 H HH   . TYR A 1 103 ? -15.497 14.565  -0.857  1.00 0.00 ? 103 TYR A HH   6  
ATOM 10853 N N    . LEU A 1 104 ? -8.454  10.453  -3.850  1.00 0.00 ? 104 LEU A N    6  
ATOM 10854 C CA   . LEU A 1 104 ? -7.552  9.747   -4.753  1.00 0.00 ? 104 LEU A CA   6  
ATOM 10855 C C    . LEU A 1 104 ? -7.647  10.310  -6.167  1.00 0.00 ? 104 LEU A C    6  
ATOM 10856 O O    . LEU A 1 104 ? -8.436  9.835   -6.985  1.00 0.00 ? 104 LEU A O    6  
ATOM 10857 C CB   . LEU A 1 104 ? -7.876  8.252   -4.764  1.00 0.00 ? 104 LEU A CB   6  
ATOM 10858 C CG   . LEU A 1 104 ? -7.528  7.480   -3.491  1.00 0.00 ? 104 LEU A CG   6  
ATOM 10859 C CD1  . LEU A 1 104 ? -7.894  6.012   -3.640  1.00 0.00 ? 104 LEU A CD1  6  
ATOM 10860 C CD2  . LEU A 1 104 ? -6.049  7.632   -3.163  1.00 0.00 ? 104 LEU A CD2  6  
ATOM 10861 H H    . LEU A 1 104 ? -9.389  10.167  -3.789  1.00 0.00 ? 104 LEU A H    6  
ATOM 10862 H HA   . LEU A 1 104 ? -6.545  9.886   -4.390  1.00 0.00 ? 104 LEU A HA   6  
ATOM 10863 H HB2  . LEU A 1 104 ? -8.936  8.145   -4.935  1.00 0.00 ? 104 LEU A HB2  6  
ATOM 10864 H HB3  . LEU A 1 104 ? -7.334  7.803   -5.584  1.00 0.00 ? 104 LEU A HB3  6  
ATOM 10865 H HG   . LEU A 1 104 ? -8.097  7.884   -2.665  1.00 0.00 ? 104 LEU A HG   6  
ATOM 10866 H HD11 . LEU A 1 104 ? -7.216  5.410   -3.053  1.00 0.00 ? 104 LEU A HD11 6  
ATOM 10867 H HD12 . LEU A 1 104 ? -7.822  5.726   -4.679  1.00 0.00 ? 104 LEU A HD12 6  
ATOM 10868 H HD13 . LEU A 1 104 ? -8.905  5.856   -3.294  1.00 0.00 ? 104 LEU A HD13 6  
ATOM 10869 H HD21 . LEU A 1 104 ? -5.502  7.856   -4.067  1.00 0.00 ? 104 LEU A HD21 6  
ATOM 10870 H HD22 . LEU A 1 104 ? -5.679  6.712   -2.736  1.00 0.00 ? 104 LEU A HD22 6  
ATOM 10871 H HD23 . LEU A 1 104 ? -5.919  8.437   -2.455  1.00 0.00 ? 104 LEU A HD23 6  
ATOM 10872 N N    . LYS A 1 105 ? -6.837  11.325  -6.450  1.00 0.00 ? 105 LYS A N    6  
ATOM 10873 C CA   . LYS A 1 105 ? -6.826  11.951  -7.767  1.00 0.00 ? 105 LYS A CA   6  
ATOM 10874 C C    . LYS A 1 105 ? -6.321  10.979  -8.828  1.00 0.00 ? 105 LYS A C    6  
ATOM 10875 O O    . LYS A 1 105 ? -7.058  10.605  -9.740  1.00 0.00 ? 105 LYS A O    6  
ATOM 10876 C CB   . LYS A 1 105 ? -5.949  13.205  -7.750  1.00 0.00 ? 105 LYS A CB   6  
ATOM 10877 C CG   . LYS A 1 105 ? -6.654  14.433  -7.201  1.00 0.00 ? 105 LYS A CG   6  
ATOM 10878 C CD   . LYS A 1 105 ? -7.417  15.171  -8.289  1.00 0.00 ? 105 LYS A CD   6  
ATOM 10879 C CE   . LYS A 1 105 ? -7.965  16.497  -7.784  1.00 0.00 ? 105 LYS A CE   6  
ATOM 10880 N NZ   . LYS A 1 105 ? -9.107  16.976  -8.612  1.00 0.00 ? 105 LYS A NZ   6  
ATOM 10881 H H    . LYS A 1 105 ? -6.231  11.660  -5.756  1.00 0.00 ? 105 LYS A H    6  
ATOM 10882 H HA   . LYS A 1 105 ? -7.839  12.234  -8.008  1.00 0.00 ? 105 LYS A HA   6  
ATOM 10883 H HB2  . LYS A 1 105 ? -5.079  13.013  -7.140  1.00 0.00 ? 105 LYS A HB2  6  
ATOM 10884 H HB3  . LYS A 1 105 ? -5.630  13.420  -8.760  1.00 0.00 ? 105 LYS A HB3  6  
ATOM 10885 H HG2  . LYS A 1 105 ? -7.350  14.126  -6.435  1.00 0.00 ? 105 LYS A HG2  6  
ATOM 10886 H HG3  . LYS A 1 105 ? -5.918  15.100  -6.775  1.00 0.00 ? 105 LYS A HG3  6  
ATOM 10887 H HD2  . LYS A 1 105 ? -6.751  15.362  -9.118  1.00 0.00 ? 105 LYS A HD2  6  
ATOM 10888 H HD3  . LYS A 1 105 ? -8.240  14.554  -8.622  1.00 0.00 ? 105 LYS A HD3  6  
ATOM 10889 H HE2  . LYS A 1 105 ? -8.298  16.369  -6.766  1.00 0.00 ? 105 LYS A HE2  6  
ATOM 10890 H HE3  . LYS A 1 105 ? -7.175  17.233  -7.815  1.00 0.00 ? 105 LYS A HE3  6  
ATOM 10891 H HZ1  . LYS A 1 105 ? -8.769  17.271  -9.550  1.00 0.00 ? 105 LYS A HZ1  6  
ATOM 10892 H HZ2  . LYS A 1 105 ? -9.567  17.787  -8.151  1.00 0.00 ? 105 LYS A HZ2  6  
ATOM 10893 H HZ3  . LYS A 1 105 ? -9.806  16.216  -8.730  1.00 0.00 ? 105 LYS A HZ3  6  
ATOM 10894 N N    . GLU A 1 106 ? -5.062  10.573  -8.701  1.00 0.00 ? 106 GLU A N    6  
ATOM 10895 C CA   . GLU A 1 106 ? -4.460  9.643   -9.650  1.00 0.00 ? 106 GLU A CA   6  
ATOM 10896 C C    . GLU A 1 106 ? -3.324  8.860   -8.998  1.00 0.00 ? 106 GLU A C    6  
ATOM 10897 O O    . GLU A 1 106 ? -2.553  9.387   -8.197  1.00 0.00 ? 106 GLU A O    6  
ATOM 10898 C CB   . GLU A 1 106 ? -3.938  10.397  -10.875 1.00 0.00 ? 106 GLU A CB   6  
ATOM 10899 C CG   . GLU A 1 106 ? -3.165  11.659  -10.529 1.00 0.00 ? 106 GLU A CG   6  
ATOM 10900 C CD   . GLU A 1 106 ? -2.401  12.218  -11.713 1.00 0.00 ? 106 GLU A CD   6  
ATOM 10901 O OE1  . GLU A 1 106 ? -1.878  11.414  -12.514 1.00 0.00 ? 106 GLU A OE1  6  
ATOM 10902 O OE2  . GLU A 1 106 ? -2.325  13.457  -11.840 1.00 0.00 ? 106 GLU A OE2  6  
ATOM 10903 H H    . GLU A 1 106 ? -4.525  10.906  -7.952  1.00 0.00 ? 106 GLU A H    6  
ATOM 10904 H HA   . GLU A 1 106 ? -5.225  8.950   -9.965  1.00 0.00 ? 106 GLU A HA   6  
ATOM 10905 H HB2  . GLU A 1 106 ? -3.286  9.742   -11.434 1.00 0.00 ? 106 GLU A HB2  6  
ATOM 10906 H HB3  . GLU A 1 106 ? -4.776  10.673  -11.497 1.00 0.00 ? 106 GLU A HB3  6  
ATOM 10907 H HG2  . GLU A 1 106 ? -3.861  12.408  -10.183 1.00 0.00 ? 106 GLU A HG2  6  
ATOM 10908 H HG3  . GLU A 1 106 ? -2.462  11.431  -9.741  1.00 0.00 ? 106 GLU A HG3  6  
ATOM 10909 N N    . PRO A 1 107 ? -3.219  7.569   -9.349  1.00 0.00 ? 107 PRO A N    6  
ATOM 10910 C CA   . PRO A 1 107 ? -2.181  6.685   -8.811  1.00 0.00 ? 107 PRO A CA   6  
ATOM 10911 C C    . PRO A 1 107 ? -0.791  7.041   -9.327  1.00 0.00 ? 107 PRO A C    6  
ATOM 10912 O O    . PRO A 1 107 ? -0.648  7.639   -10.393 1.00 0.00 ? 107 PRO A O    6  
ATOM 10913 C CB   . PRO A 1 107 ? -2.600  5.301   -9.312  1.00 0.00 ? 107 PRO A CB   6  
ATOM 10914 C CG   . PRO A 1 107 ? -3.399  5.568   -10.540 1.00 0.00 ? 107 PRO A CG   6  
ATOM 10915 C CD   . PRO A 1 107 ? -4.104  6.875   -10.299 1.00 0.00 ? 107 PRO A CD   6  
ATOM 10916 H HA   . PRO A 1 107 ? -2.175  6.692   -7.730  1.00 0.00 ? 107 PRO A HA   6  
ATOM 10917 H HB2  . PRO A 1 107 ? -1.719  4.714   -9.533  1.00 0.00 ? 107 PRO A HB2  6  
ATOM 10918 H HB3  . PRO A 1 107 ? -3.190  4.804   -8.557  1.00 0.00 ? 107 PRO A HB3  6  
ATOM 10919 H HG2  . PRO A 1 107 ? -2.744  5.647   -11.395 1.00 0.00 ? 107 PRO A HG2  6  
ATOM 10920 H HG3  . PRO A 1 107 ? -4.119  4.777   -10.689 1.00 0.00 ? 107 PRO A HG3  6  
ATOM 10921 H HD2  . PRO A 1 107 ? -4.193  7.431   -11.220 1.00 0.00 ? 107 PRO A HD2  6  
ATOM 10922 H HD3  . PRO A 1 107 ? -5.077  6.703   -9.863  1.00 0.00 ? 107 PRO A HD3  6  
ATOM 10923 N N    . VAL A 1 108 ? 0.232   6.668   -8.564  1.00 0.00 ? 108 VAL A N    6  
ATOM 10924 C CA   . VAL A 1 108 ? 1.611   6.946   -8.946  1.00 0.00 ? 108 VAL A CA   6  
ATOM 10925 C C    . VAL A 1 108 ? 2.016   6.138   -10.174 1.00 0.00 ? 108 VAL A C    6  
ATOM 10926 O O    . VAL A 1 108 ? 1.916   4.911   -10.201 1.00 0.00 ? 108 VAL A O    6  
ATOM 10927 C CB   . VAL A 1 108 ? 2.586   6.634   -7.795  1.00 0.00 ? 108 VAL A CB   6  
ATOM 10928 C CG1  . VAL A 1 108 ? 4.016   6.567   -8.309  1.00 0.00 ? 108 VAL A CG1  6  
ATOM 10929 C CG2  . VAL A 1 108 ? 2.456   7.671   -6.690  1.00 0.00 ? 108 VAL A CG2  6  
ATOM 10930 H H    . VAL A 1 108 ? 0.055   6.193   -7.726  1.00 0.00 ? 108 VAL A H    6  
ATOM 10931 H HA   . VAL A 1 108 ? 1.688   7.999   -9.179  1.00 0.00 ? 108 VAL A HA   6  
ATOM 10932 H HB   . VAL A 1 108 ? 2.330   5.668   -7.385  1.00 0.00 ? 108 VAL A HB   6  
ATOM 10933 H HG11 . VAL A 1 108 ? 4.187   5.608   -8.776  1.00 0.00 ? 108 VAL A HG11 6  
ATOM 10934 H HG12 . VAL A 1 108 ? 4.176   7.354   -9.033  1.00 0.00 ? 108 VAL A HG12 6  
ATOM 10935 H HG13 . VAL A 1 108 ? 4.701   6.692   -7.484  1.00 0.00 ? 108 VAL A HG13 6  
ATOM 10936 H HG21 . VAL A 1 108 ? 1.491   7.572   -6.216  1.00 0.00 ? 108 VAL A HG21 6  
ATOM 10937 H HG22 . VAL A 1 108 ? 3.234   7.517   -5.957  1.00 0.00 ? 108 VAL A HG22 6  
ATOM 10938 H HG23 . VAL A 1 108 ? 2.550   8.661   -7.112  1.00 0.00 ? 108 VAL A HG23 6  
ATOM 10939 N N    . PRO A 1 109 ? 2.485   6.840   -11.216 1.00 0.00 ? 109 PRO A N    6  
ATOM 10940 C CA   . PRO A 1 109 ? 2.915   6.207   -12.467 1.00 0.00 ? 109 PRO A CA   6  
ATOM 10941 C C    . PRO A 1 109 ? 4.203   5.409   -12.299 1.00 0.00 ? 109 PRO A C    6  
ATOM 10942 O O    . PRO A 1 109 ? 5.011   5.694   -11.415 1.00 0.00 ? 109 PRO A O    6  
ATOM 10943 C CB   . PRO A 1 109 ? 3.140   7.395   -13.405 1.00 0.00 ? 109 PRO A CB   6  
ATOM 10944 C CG   . PRO A 1 109 ? 3.437   8.542   -12.501 1.00 0.00 ? 109 PRO A CG   6  
ATOM 10945 C CD   . PRO A 1 109 ? 2.631   8.304   -11.254 1.00 0.00 ? 109 PRO A CD   6  
ATOM 10946 H HA   . PRO A 1 109 ? 2.146   5.567   -12.873 1.00 0.00 ? 109 PRO A HA   6  
ATOM 10947 H HB2  . PRO A 1 109 ? 3.972   7.185   -14.063 1.00 0.00 ? 109 PRO A HB2  6  
ATOM 10948 H HB3  . PRO A 1 109 ? 2.249   7.572   -13.988 1.00 0.00 ? 109 PRO A HB3  6  
ATOM 10949 H HG2  . PRO A 1 109 ? 4.491   8.563   -12.269 1.00 0.00 ? 109 PRO A HG2  6  
ATOM 10950 H HG3  . PRO A 1 109 ? 3.136   9.466   -12.971 1.00 0.00 ? 109 PRO A HG3  6  
ATOM 10951 H HD2  . PRO A 1 109 ? 3.166   8.661   -10.386 1.00 0.00 ? 109 PRO A HD2  6  
ATOM 10952 H HD3  . PRO A 1 109 ? 1.667   8.786   -11.330 1.00 0.00 ? 109 PRO A HD3  6  
ATOM 10953 N N    . MET A 1 110 ? 4.389   4.408   -13.154 1.00 0.00 ? 110 MET A N    6  
ATOM 10954 C CA   . MET A 1 110 ? 5.581   3.570   -13.101 1.00 0.00 ? 110 MET A CA   6  
ATOM 10955 C C    . MET A 1 110 ? 6.749   4.239   -13.820 1.00 0.00 ? 110 MET A C    6  
ATOM 10956 O O    . MET A 1 110 ? 6.598   5.313   -14.401 1.00 0.00 ? 110 MET A O    6  
ATOM 10957 C CB   . MET A 1 110 ? 5.298   2.203   -13.726 1.00 0.00 ? 110 MET A CB   6  
ATOM 10958 C CG   . MET A 1 110 ? 3.931   1.642   -13.367 1.00 0.00 ? 110 MET A CG   6  
ATOM 10959 S SD   . MET A 1 110 ? 3.275   0.546   -14.639 1.00 0.00 ? 110 MET A SD   6  
ATOM 10960 C CE   . MET A 1 110 ? 3.441   1.577   -16.094 1.00 0.00 ? 110 MET A CE   6  
ATOM 10961 H H    . MET A 1 110 ? 3.710   4.230   -13.837 1.00 0.00 ? 110 MET A H    6  
ATOM 10962 H HA   . MET A 1 110 ? 5.844   3.433   -12.062 1.00 0.00 ? 110 MET A HA   6  
ATOM 10963 H HB2  . MET A 1 110 ? 5.355   2.293   -14.800 1.00 0.00 ? 110 MET A HB2  6  
ATOM 10964 H HB3  . MET A 1 110 ? 6.049   1.503   -13.390 1.00 0.00 ? 110 MET A HB3  6  
ATOM 10965 H HG2  . MET A 1 110 ? 4.015   1.089   -12.444 1.00 0.00 ? 110 MET A HG2  6  
ATOM 10966 H HG3  . MET A 1 110 ? 3.245   2.465   -13.231 1.00 0.00 ? 110 MET A HG3  6  
ATOM 10967 H HE1  . MET A 1 110 ? 3.558   2.607   -15.793 1.00 0.00 ? 110 MET A HE1  6  
ATOM 10968 H HE2  . MET A 1 110 ? 4.307   1.266   -16.658 1.00 0.00 ? 110 MET A HE2  6  
ATOM 10969 H HE3  . MET A 1 110 ? 2.556   1.479   -16.707 1.00 0.00 ? 110 MET A HE3  6  
ATOM 10970 N N    . GLN A 1 111 ? 7.912   3.596   -13.775 1.00 0.00 ? 111 GLN A N    6  
ATOM 10971 C CA   . GLN A 1 111 ? 9.104   4.130   -14.422 1.00 0.00 ? 111 GLN A CA   6  
ATOM 10972 C C    . GLN A 1 111 ? 9.550   3.231   -15.570 1.00 0.00 ? 111 GLN A C    6  
ATOM 10973 O O    . GLN A 1 111 ? 10.389  2.348   -15.391 1.00 0.00 ? 111 GLN A O    6  
ATOM 10974 C CB   . GLN A 1 111 ? 10.238  4.280   -13.406 1.00 0.00 ? 111 GLN A CB   6  
ATOM 10975 C CG   . GLN A 1 111 ? 10.214  3.227   -12.309 1.00 0.00 ? 111 GLN A CG   6  
ATOM 10976 C CD   . GLN A 1 111 ? 9.008   3.357   -11.401 1.00 0.00 ? 111 GLN A CD   6  
ATOM 10977 O OE1  . GLN A 1 111 ? 8.266   2.396   -11.193 1.00 0.00 ? 111 GLN A OE1  6  
ATOM 10978 N NE2  . GLN A 1 111 ? 8.805   4.549   -10.853 1.00 0.00 ? 111 GLN A NE2  6  
ATOM 10979 H H    . GLN A 1 111 ? 7.969   2.744   -13.296 1.00 0.00 ? 111 GLN A H    6  
ATOM 10980 H HA   . GLN A 1 111 ? 8.858   5.104   -14.818 1.00 0.00 ? 111 GLN A HA   6  
ATOM 10981 H HB2  . GLN A 1 111 ? 11.182  4.208   -13.924 1.00 0.00 ? 111 GLN A HB2  6  
ATOM 10982 H HB3  . GLN A 1 111 ? 10.164  5.252   -12.942 1.00 0.00 ? 111 GLN A HB3  6  
ATOM 10983 H HG2  . GLN A 1 111 ? 10.197  2.249   -12.767 1.00 0.00 ? 111 GLN A HG2  6  
ATOM 10984 H HG3  . GLN A 1 111 ? 11.109  3.327   -11.713 1.00 0.00 ? 111 GLN A HG3  6  
ATOM 10985 H HE21 . GLN A 1 111 ? 9.436   5.269   -11.065 1.00 0.00 ? 111 GLN A HE21 6  
ATOM 10986 H HE22 . GLN A 1 111 ? 8.032   4.662   -10.262 1.00 0.00 ? 111 GLN A HE22 6  
ATOM 10987 N N    . ASP A 1 112 ? 8.983   3.461   -16.749 1.00 0.00 ? 112 ASP A N    6  
ATOM 10988 C CA   . ASP A 1 112 ? 9.322   2.672   -17.928 1.00 0.00 ? 112 ASP A CA   6  
ATOM 10989 C C    . ASP A 1 112 ? 10.832  2.639   -18.143 1.00 0.00 ? 112 ASP A C    6  
ATOM 10990 O O    . ASP A 1 112 ? 11.476  3.683   -18.251 1.00 0.00 ? 112 ASP A O    6  
ATOM 10991 C CB   . ASP A 1 112 ? 8.630   3.243   -19.167 1.00 0.00 ? 112 ASP A CB   6  
ATOM 10992 C CG   . ASP A 1 112 ? 8.616   2.264   -20.324 1.00 0.00 ? 112 ASP A CG   6  
ATOM 10993 O OD1  . ASP A 1 112 ? 9.631   1.564   -20.523 1.00 0.00 ? 112 ASP A OD1  6  
ATOM 10994 O OD2  . ASP A 1 112 ? 7.588   2.196   -21.031 1.00 0.00 ? 112 ASP A OD2  6  
ATOM 10995 H H    . ASP A 1 112 ? 8.321   4.179   -16.829 1.00 0.00 ? 112 ASP A H    6  
ATOM 10996 H HA   . ASP A 1 112 ? 8.973   1.664   -17.764 1.00 0.00 ? 112 ASP A HA   6  
ATOM 10997 H HB2  . ASP A 1 112 ? 7.609   3.492   -18.918 1.00 0.00 ? 112 ASP A HB2  6  
ATOM 10998 H HB3  . ASP A 1 112 ? 9.148   4.137   -19.481 1.00 0.00 ? 112 ASP A HB3  6  
ATOM 10999 N N    . GLN A 1 113 ? 11.390  1.434   -18.204 1.00 0.00 ? 113 GLN A N    6  
ATOM 11000 C CA   . GLN A 1 113 ? 12.825  1.267   -18.404 1.00 0.00 ? 113 GLN A CA   6  
ATOM 11001 C C    . GLN A 1 113 ? 13.198  1.475   -19.868 1.00 0.00 ? 113 GLN A C    6  
ATOM 11002 O O    . GLN A 1 113 ? 13.899  0.656   -20.463 1.00 0.00 ? 113 GLN A O    6  
ATOM 11003 C CB   . GLN A 1 113 ? 13.266  -0.125  -17.946 1.00 0.00 ? 113 GLN A CB   6  
ATOM 11004 C CG   . GLN A 1 113 ? 14.754  -0.225  -17.653 1.00 0.00 ? 113 GLN A CG   6  
ATOM 11005 C CD   . GLN A 1 113 ? 15.150  0.505   -16.386 1.00 0.00 ? 113 GLN A CD   6  
ATOM 11006 O OE1  . GLN A 1 113 ? 14.399  1.337   -15.874 1.00 0.00 ? 113 GLN A OE1  6  
ATOM 11007 N NE2  . GLN A 1 113 ? 16.335  0.199   -15.871 1.00 0.00 ? 113 GLN A NE2  6  
ATOM 11008 H H    . GLN A 1 113 ? 10.824  0.640   -18.111 1.00 0.00 ? 113 GLN A H    6  
ATOM 11009 H HA   . GLN A 1 113 ? 13.332  2.009   -17.807 1.00 0.00 ? 113 GLN A HA   6  
ATOM 11010 H HB2  . GLN A 1 113 ? 12.725  -0.383  -17.048 1.00 0.00 ? 113 GLN A HB2  6  
ATOM 11011 H HB3  . GLN A 1 113 ? 13.024  -0.839  -18.720 1.00 0.00 ? 113 GLN A HB3  6  
ATOM 11012 H HG2  . GLN A 1 113 ? 15.017  -1.267  -17.546 1.00 0.00 ? 113 GLN A HG2  6  
ATOM 11013 H HG3  . GLN A 1 113 ? 15.300  0.200   -18.482 1.00 0.00 ? 113 GLN A HG3  6  
ATOM 11014 H HE21 . GLN A 1 113 ? 16.880  -0.472  -16.333 1.00 0.00 ? 113 GLN A HE21 6  
ATOM 11015 H HE22 . GLN A 1 113 ? 16.616  0.657   -15.052 1.00 0.00 ? 113 GLN A HE22 6  
ATOM 11016 N N    . SER A 1 114 ? 12.724  2.575   -20.444 1.00 0.00 ? 114 SER A N    6  
ATOM 11017 C CA   . SER A 1 114 ? 13.004  2.889   -21.840 1.00 0.00 ? 114 SER A CA   6  
ATOM 11018 C C    . SER A 1 114 ? 13.733  4.224   -21.961 1.00 0.00 ? 114 SER A C    6  
ATOM 11019 O O    . SER A 1 114 ? 13.657  5.069   -21.070 1.00 0.00 ? 114 SER A O    6  
ATOM 11020 C CB   . SER A 1 114 ? 11.705  2.930   -22.646 1.00 0.00 ? 114 SER A CB   6  
ATOM 11021 O OG   . SER A 1 114 ? 11.963  2.824   -24.036 1.00 0.00 ? 114 SER A OG   6  
ATOM 11022 H H    . SER A 1 114 ? 12.170  3.189   -19.917 1.00 0.00 ? 114 SER A H    6  
ATOM 11023 H HA   . SER A 1 114 ? 13.638  2.109   -22.234 1.00 0.00 ? 114 SER A HA   6  
ATOM 11024 H HB2  . SER A 1 114 ? 11.072  2.108   -22.347 1.00 0.00 ? 114 SER A HB2  6  
ATOM 11025 H HB3  . SER A 1 114 ? 11.196  3.864   -22.457 1.00 0.00 ? 114 SER A HB3  6  
ATOM 11026 H HG   . SER A 1 114 ? 11.132  2.827   -24.517 1.00 0.00 ? 114 SER A HG   6  
ATOM 11027 N N    . GLY A 1 115 ? 14.440  4.407   -23.072 1.00 0.00 ? 115 GLY A N    6  
ATOM 11028 C CA   . GLY A 1 115 ? 15.173  5.640   -23.291 1.00 0.00 ? 115 GLY A CA   6  
ATOM 11029 C C    . GLY A 1 115 ? 16.436  5.720   -22.455 1.00 0.00 ? 115 GLY A C    6  
ATOM 11030 O O    . GLY A 1 115 ? 16.842  4.752   -21.812 1.00 0.00 ? 115 GLY A O    6  
ATOM 11031 H H    . GLY A 1 115 ? 14.464  3.698   -23.749 1.00 0.00 ? 115 GLY A H    6  
ATOM 11032 H HA2  . GLY A 1 115 ? 15.440  5.708   -24.335 1.00 0.00 ? 115 GLY A HA2  6  
ATOM 11033 H HA3  . GLY A 1 115 ? 14.535  6.474   -23.038 1.00 0.00 ? 115 GLY A HA3  6  
ATOM 11034 N N    . PRO A 1 116 ? 17.080  6.896   -22.461 1.00 0.00 ? 116 PRO A N    6  
ATOM 11035 C CA   . PRO A 1 116 ? 18.314  7.127   -21.704 1.00 0.00 ? 116 PRO A CA   6  
ATOM 11036 C C    . PRO A 1 116 ? 18.074  7.153   -20.198 1.00 0.00 ? 116 PRO A C    6  
ATOM 11037 O O    . PRO A 1 116 ? 16.959  7.409   -19.742 1.00 0.00 ? 116 PRO A O    6  
ATOM 11038 C CB   . PRO A 1 116 ? 18.781  8.499   -22.195 1.00 0.00 ? 116 PRO A CB   6  
ATOM 11039 C CG   . PRO A 1 116 ? 17.538  9.178   -22.659 1.00 0.00 ? 116 PRO A CG   6  
ATOM 11040 C CD   . PRO A 1 116 ? 16.653  8.093   -23.205 1.00 0.00 ? 116 PRO A CD   6  
ATOM 11041 H HA   . PRO A 1 116 ? 19.065  6.385   -21.934 1.00 0.00 ? 116 PRO A HA   6  
ATOM 11042 H HB2  . PRO A 1 116 ? 19.245  9.037   -21.381 1.00 0.00 ? 116 PRO A HB2  6  
ATOM 11043 H HB3  . PRO A 1 116 ? 19.487  8.375   -23.002 1.00 0.00 ? 116 PRO A HB3  6  
ATOM 11044 H HG2  . PRO A 1 116 ? 17.058  9.672   -21.828 1.00 0.00 ? 116 PRO A HG2  6  
ATOM 11045 H HG3  . PRO A 1 116 ? 17.778  9.892   -23.433 1.00 0.00 ? 116 PRO A HG3  6  
ATOM 11046 H HD2  . PRO A 1 116 ? 15.615  8.319   -23.010 1.00 0.00 ? 116 PRO A HD2  6  
ATOM 11047 H HD3  . PRO A 1 116 ? 16.820  7.967   -24.265 1.00 0.00 ? 116 PRO A HD3  6  
ATOM 11048 N N    . SER A 1 117 ? 19.126  6.888   -19.431 1.00 0.00 ? 117 SER A N    6  
ATOM 11049 C CA   . SER A 1 117 ? 19.029  6.878   -17.976 1.00 0.00 ? 117 SER A CA   6  
ATOM 11050 C C    . SER A 1 117 ? 20.033  7.847   -17.358 1.00 0.00 ? 117 SER A C    6  
ATOM 11051 O O    . SER A 1 117 ? 20.054  8.044   -16.143 1.00 0.00 ? 117 SER A O    6  
ATOM 11052 C CB   . SER A 1 117 ? 19.266  5.466   -17.437 1.00 0.00 ? 117 SER A CB   6  
ATOM 11053 O OG   . SER A 1 117 ? 20.646  5.230   -17.216 1.00 0.00 ? 117 SER A OG   6  
ATOM 11054 H H    . SER A 1 117 ? 19.988  6.691   -19.854 1.00 0.00 ? 117 SER A H    6  
ATOM 11055 H HA   . SER A 1 117 ? 18.031  7.193   -17.708 1.00 0.00 ? 117 SER A HA   6  
ATOM 11056 H HB2  . SER A 1 117 ? 18.739  5.347   -16.503 1.00 0.00 ? 117 SER A HB2  6  
ATOM 11057 H HB3  . SER A 1 117 ? 18.900  4.744   -18.152 1.00 0.00 ? 117 SER A HB3  6  
ATOM 11058 H HG   . SER A 1 117 ? 21.122  5.311   -18.046 1.00 0.00 ? 117 SER A HG   6  
ATOM 11059 N N    . SER A 1 118 ? 20.863  8.448   -18.203 1.00 0.00 ? 118 SER A N    6  
ATOM 11060 C CA   . SER A 1 118 ? 21.873  9.393   -17.741 1.00 0.00 ? 118 SER A CA   6  
ATOM 11061 C C    . SER A 1 118 ? 21.869  10.654  -18.599 1.00 0.00 ? 118 SER A C    6  
ATOM 11062 O O    . SER A 1 118 ? 22.721  10.828  -19.471 1.00 0.00 ? 118 SER A O    6  
ATOM 11063 C CB   . SER A 1 118 ? 23.259  8.746   -17.771 1.00 0.00 ? 118 SER A CB   6  
ATOM 11064 O OG   . SER A 1 118 ? 24.229  9.591   -17.177 1.00 0.00 ? 118 SER A OG   6  
ATOM 11065 H H    . SER A 1 118 ? 20.797  8.249   -19.161 1.00 0.00 ? 118 SER A H    6  
ATOM 11066 H HA   . SER A 1 118 ? 21.633  9.663   -16.724 1.00 0.00 ? 118 SER A HA   6  
ATOM 11067 H HB2  . SER A 1 118 ? 23.230  7.814   -17.228 1.00 0.00 ? 118 SER A HB2  6  
ATOM 11068 H HB3  . SER A 1 118 ? 23.543  8.557   -18.796 1.00 0.00 ? 118 SER A HB3  6  
ATOM 11069 H HG   . SER A 1 118 ? 24.256  9.432   -16.230 1.00 0.00 ? 118 SER A HG   6  
ATOM 11070 N N    . GLY A 1 119 ? 20.904  11.533  -18.346 1.00 0.00 ? 119 GLY A N    6  
ATOM 11071 C CA   . GLY A 1 119 ? 20.806  12.767  -19.103 1.00 0.00 ? 119 GLY A CA   6  
ATOM 11072 C C    . GLY A 1 119 ? 19.980  13.820  -18.391 1.00 0.00 ? 119 GLY A C    6  
ATOM 11073 O O    . GLY A 1 119 ? 19.687  13.689  -17.202 1.00 0.00 ? 119 GLY A O    6  
ATOM 11074 H H    . GLY A 1 119 ? 20.252  11.341  -17.639 1.00 0.00 ? 119 GLY A H    6  
ATOM 11075 H HA2  . GLY A 1 119 ? 21.800  13.155  -19.267 1.00 0.00 ? 119 GLY A HA2  6  
ATOM 11076 H HA3  . GLY A 1 119 ? 20.351  12.555  -20.059 1.00 0.00 ? 119 GLY A HA3  6  
ATOM 11077 N N    . GLY A 1 1   ? 23.775  -17.081 -13.575 1.00 0.00 ? 1   GLY A N    7  
ATOM 11078 C CA   . GLY A 1 1   ? 23.613  -17.885 -14.772 1.00 0.00 ? 1   GLY A CA   7  
ATOM 11079 C C    . GLY A 1 1   ? 22.430  -18.828 -14.682 1.00 0.00 ? 1   GLY A C    7  
ATOM 11080 O O    . GLY A 1 1   ? 21.483  -18.723 -15.461 1.00 0.00 ? 1   GLY A O    7  
ATOM 11081 H H1   . GLY A 1 1   ? 24.410  -17.360 -12.882 1.00 0.00 ? 1   GLY A H1   7  
ATOM 11082 H HA2  . GLY A 1 1   ? 23.473  -17.228 -15.618 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 11083 H HA3  . GLY A 1 1   ? 24.510  -18.466 -14.926 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 11084 N N    . SER A 1 2   ? 22.483  -19.752 -13.728 1.00 0.00 ? 2   SER A N    7  
ATOM 11085 C CA   . SER A 1 2   ? 21.409  -20.721 -13.542 1.00 0.00 ? 2   SER A CA   7  
ATOM 11086 C C    . SER A 1 2   ? 20.875  -20.672 -12.114 1.00 0.00 ? 2   SER A C    7  
ATOM 11087 O O    . SER A 1 2   ? 21.342  -21.400 -11.238 1.00 0.00 ? 2   SER A O    7  
ATOM 11088 C CB   . SER A 1 2   ? 21.906  -22.132 -13.864 1.00 0.00 ? 2   SER A CB   7  
ATOM 11089 O OG   . SER A 1 2   ? 20.832  -22.978 -14.236 1.00 0.00 ? 2   SER A OG   7  
ATOM 11090 H H    . SER A 1 2   ? 23.265  -19.785 -13.138 1.00 0.00 ? 2   SER A H    7  
ATOM 11091 H HA   . SER A 1 2   ? 20.611  -20.466 -14.222 1.00 0.00 ? 2   SER A HA   7  
ATOM 11092 H HB2  . SER A 1 2   ? 22.611  -22.085 -14.680 1.00 0.00 ? 2   SER A HB2  7  
ATOM 11093 H HB3  . SER A 1 2   ? 22.391  -22.548 -12.992 1.00 0.00 ? 2   SER A HB3  7  
ATOM 11094 H HG   . SER A 1 2   ? 20.965  -23.288 -15.135 1.00 0.00 ? 2   SER A HG   7  
ATOM 11095 N N    . SER A 1 3   ? 19.891  -19.807 -11.887 1.00 0.00 ? 3   SER A N    7  
ATOM 11096 C CA   . SER A 1 3   ? 19.294  -19.658 -10.565 1.00 0.00 ? 3   SER A CA   7  
ATOM 11097 C C    . SER A 1 3   ? 17.877  -19.104 -10.668 1.00 0.00 ? 3   SER A C    7  
ATOM 11098 O O    . SER A 1 3   ? 17.509  -18.492 -11.670 1.00 0.00 ? 3   SER A O    7  
ATOM 11099 C CB   . SER A 1 3   ? 20.152  -18.736 -9.695  1.00 0.00 ? 3   SER A CB   7  
ATOM 11100 O OG   . SER A 1 3   ? 21.446  -19.279 -9.499  1.00 0.00 ? 3   SER A OG   7  
ATOM 11101 H H    . SER A 1 3   ? 19.562  -19.253 -12.626 1.00 0.00 ? 3   SER A H    7  
ATOM 11102 H HA   . SER A 1 3   ? 19.254  -20.635 -10.107 1.00 0.00 ? 3   SER A HA   7  
ATOM 11103 H HB2  . SER A 1 3   ? 20.248  -17.776 -10.178 1.00 0.00 ? 3   SER A HB2  7  
ATOM 11104 H HB3  . SER A 1 3   ? 19.678  -18.610 -8.733  1.00 0.00 ? 3   SER A HB3  7  
ATOM 11105 H HG   . SER A 1 3   ? 21.947  -18.709 -8.911  1.00 0.00 ? 3   SER A HG   7  
ATOM 11106 N N    . GLY A 1 4   ? 17.084  -19.324 -9.623  1.00 0.00 ? 4   GLY A N    7  
ATOM 11107 C CA   . GLY A 1 4   ? 15.716  -18.841 -9.615  1.00 0.00 ? 4   GLY A CA   7  
ATOM 11108 C C    . GLY A 1 4   ? 14.720  -19.913 -10.010 1.00 0.00 ? 4   GLY A C    7  
ATOM 11109 O O    . GLY A 1 4   ? 14.485  -20.145 -11.196 1.00 0.00 ? 4   GLY A O    7  
ATOM 11110 H H    . GLY A 1 4   ? 17.432  -19.818 -8.851  1.00 0.00 ? 4   GLY A H    7  
ATOM 11111 H HA2  . GLY A 1 4   ? 15.475  -18.489 -8.623  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 11112 H HA3  . GLY A 1 4   ? 15.633  -18.017 -10.308 1.00 0.00 ? 4   GLY A HA3  7  
ATOM 11113 N N    . SER A 1 5   ? 14.135  -20.571 -9.015  1.00 0.00 ? 5   SER A N    7  
ATOM 11114 C CA   . SER A 1 5   ? 13.163  -21.629 -9.265  1.00 0.00 ? 5   SER A CA   7  
ATOM 11115 C C    . SER A 1 5   ? 12.133  -21.188 -10.300 1.00 0.00 ? 5   SER A C    7  
ATOM 11116 O O    . SER A 1 5   ? 11.783  -20.010 -10.381 1.00 0.00 ? 5   SER A O    7  
ATOM 11117 C CB   . SER A 1 5   ? 12.459  -22.022 -7.964  1.00 0.00 ? 5   SER A CB   7  
ATOM 11118 O OG   . SER A 1 5   ? 11.778  -20.915 -7.398  1.00 0.00 ? 5   SER A OG   7  
ATOM 11119 H H    . SER A 1 5   ? 14.364  -20.340 -8.090  1.00 0.00 ? 5   SER A H    7  
ATOM 11120 H HA   . SER A 1 5   ? 13.697  -22.486 -9.648  1.00 0.00 ? 5   SER A HA   7  
ATOM 11121 H HB2  . SER A 1 5   ? 11.743  -22.804 -8.167  1.00 0.00 ? 5   SER A HB2  7  
ATOM 11122 H HB3  . SER A 1 5   ? 13.192  -22.379 -7.255  1.00 0.00 ? 5   SER A HB3  7  
ATOM 11123 H HG   . SER A 1 5   ? 11.484  -20.328 -8.099  1.00 0.00 ? 5   SER A HG   7  
ATOM 11124 N N    . SER A 1 6   ? 11.652  -22.141 -11.091 1.00 0.00 ? 6   SER A N    7  
ATOM 11125 C CA   . SER A 1 6   ? 10.665  -21.852 -12.125 1.00 0.00 ? 6   SER A CA   7  
ATOM 11126 C C    . SER A 1 6   ? 9.268   -21.731 -11.523 1.00 0.00 ? 6   SER A C    7  
ATOM 11127 O O    . SER A 1 6   ? 8.967   -22.337 -10.496 1.00 0.00 ? 6   SER A O    7  
ATOM 11128 C CB   . SER A 1 6   ? 10.679  -22.946 -13.194 1.00 0.00 ? 6   SER A CB   7  
ATOM 11129 O OG   . SER A 1 6   ? 11.977  -23.110 -13.739 1.00 0.00 ? 6   SER A OG   7  
ATOM 11130 H H    . SER A 1 6   ? 11.971  -23.062 -10.978 1.00 0.00 ? 6   SER A H    7  
ATOM 11131 H HA   . SER A 1 6   ? 10.931  -20.910 -12.582 1.00 0.00 ? 6   SER A HA   7  
ATOM 11132 H HB2  . SER A 1 6   ? 10.367  -23.881 -12.753 1.00 0.00 ? 6   SER A HB2  7  
ATOM 11133 H HB3  . SER A 1 6   ? 9.999   -22.677 -13.989 1.00 0.00 ? 6   SER A HB3  7  
ATOM 11134 H HG   . SER A 1 6   ? 12.535  -23.568 -13.107 1.00 0.00 ? 6   SER A HG   7  
ATOM 11135 N N    . GLY A 1 7   ? 8.418   -20.941 -12.172 1.00 0.00 ? 7   GLY A N    7  
ATOM 11136 C CA   . GLY A 1 7   ? 7.063   -20.753 -11.688 1.00 0.00 ? 7   GLY A CA   7  
ATOM 11137 C C    . GLY A 1 7   ? 6.570   -19.332 -11.880 1.00 0.00 ? 7   GLY A C    7  
ATOM 11138 O O    . GLY A 1 7   ? 6.179   -18.669 -10.920 1.00 0.00 ? 7   GLY A O    7  
ATOM 11139 H H    . GLY A 1 7   ? 8.713   -20.482 -12.987 1.00 0.00 ? 7   GLY A H    7  
ATOM 11140 H HA2  . GLY A 1 7   ? 6.406   -21.426 -12.219 1.00 0.00 ? 7   GLY A HA2  7  
ATOM 11141 H HA3  . GLY A 1 7   ? 7.033   -20.992 -10.635 1.00 0.00 ? 7   GLY A HA3  7  
ATOM 11142 N N    . ARG A 1 8   ? 6.590   -18.864 -13.124 1.00 0.00 ? 8   ARG A N    7  
ATOM 11143 C CA   . ARG A 1 8   ? 6.144   -17.512 -13.439 1.00 0.00 ? 8   ARG A CA   7  
ATOM 11144 C C    . ARG A 1 8   ? 4.761   -17.531 -14.082 1.00 0.00 ? 8   ARG A C    7  
ATOM 11145 O O    . ARG A 1 8   ? 4.592   -18.024 -15.197 1.00 0.00 ? 8   ARG A O    7  
ATOM 11146 C CB   . ARG A 1 8   ? 7.143   -16.827 -14.373 1.00 0.00 ? 8   ARG A CB   7  
ATOM 11147 C CG   . ARG A 1 8   ? 6.513   -15.780 -15.276 1.00 0.00 ? 8   ARG A CG   7  
ATOM 11148 C CD   . ARG A 1 8   ? 7.524   -14.722 -15.692 1.00 0.00 ? 8   ARG A CD   7  
ATOM 11149 N NE   . ARG A 1 8   ? 7.601   -13.629 -14.727 1.00 0.00 ? 8   ARG A NE   7  
ATOM 11150 C CZ   . ARG A 1 8   ? 8.371   -12.559 -14.889 1.00 0.00 ? 8   ARG A CZ   7  
ATOM 11151 N NH1  . ARG A 1 8   ? 9.126   -12.439 -15.972 1.00 0.00 ? 8   ARG A NH1  7  
ATOM 11152 N NH2  . ARG A 1 8   ? 8.386   -11.605 -13.966 1.00 0.00 ? 8   ARG A NH2  7  
ATOM 11153 H H    . ARG A 1 8   ? 6.913   -19.441 -13.848 1.00 0.00 ? 8   ARG A H    7  
ATOM 11154 H HA   . ARG A 1 8   ? 6.091   -16.957 -12.514 1.00 0.00 ? 8   ARG A HA   7  
ATOM 11155 H HB2  . ARG A 1 8   ? 7.905   -16.346 -13.777 1.00 0.00 ? 8   ARG A HB2  7  
ATOM 11156 H HB3  . ARG A 1 8   ? 7.607   -17.577 -14.997 1.00 0.00 ? 8   ARG A HB3  7  
ATOM 11157 H HG2  . ARG A 1 8   ? 6.131   -16.264 -16.162 1.00 0.00 ? 8   ARG A HG2  7  
ATOM 11158 H HG3  . ARG A 1 8   ? 5.703   -15.302 -14.746 1.00 0.00 ? 8   ARG A HG3  7  
ATOM 11159 H HD2  . ARG A 1 8   ? 8.496   -15.185 -15.775 1.00 0.00 ? 8   ARG A HD2  7  
ATOM 11160 H HD3  . ARG A 1 8   ? 7.233   -14.323 -16.652 1.00 0.00 ? 8   ARG A HD3  7  
ATOM 11161 H HE   . ARG A 1 8   ? 7.051   -13.697 -13.919 1.00 0.00 ? 8   ARG A HE   7  
ATOM 11162 H HH11 . ARG A 1 8   ? 9.116   -13.155 -16.669 1.00 0.00 ? 8   ARG A HH11 7  
ATOM 11163 H HH12 . ARG A 1 8   ? 9.704   -11.631 -16.092 1.00 0.00 ? 8   ARG A HH12 7  
ATOM 11164 H HH21 . ARG A 1 8   ? 7.818   -11.692 -13.148 1.00 0.00 ? 8   ARG A HH21 7  
ATOM 11165 H HH22 . ARG A 1 8   ? 8.966   -10.800 -14.088 1.00 0.00 ? 8   ARG A HH22 7  
ATOM 11166 N N    . GLU A 1 9   ? 3.775   -16.992 -13.371 1.00 0.00 ? 9   GLU A N    7  
ATOM 11167 C CA   . GLU A 1 9   ? 2.407   -16.949 -13.873 1.00 0.00 ? 9   GLU A CA   7  
ATOM 11168 C C    . GLU A 1 9   ? 1.956   -15.510 -14.101 1.00 0.00 ? 9   GLU A C    7  
ATOM 11169 O O    . GLU A 1 9   ? 2.327   -14.607 -13.351 1.00 0.00 ? 9   GLU A O    7  
ATOM 11170 C CB   . GLU A 1 9   ? 1.459   -17.644 -12.893 1.00 0.00 ? 9   GLU A CB   7  
ATOM 11171 C CG   . GLU A 1 9   ? 1.509   -19.160 -12.968 1.00 0.00 ? 9   GLU A CG   7  
ATOM 11172 C CD   . GLU A 1 9   ? 1.023   -19.824 -11.695 1.00 0.00 ? 9   GLU A CD   7  
ATOM 11173 O OE1  . GLU A 1 9   ? -0.208  -19.928 -11.513 1.00 0.00 ? 9   GLU A OE1  7  
ATOM 11174 O OE2  . GLU A 1 9   ? 1.873   -20.239 -10.880 1.00 0.00 ? 9   GLU A OE2  7  
ATOM 11175 H H    . GLU A 1 9   ? 3.973   -16.615 -12.488 1.00 0.00 ? 9   GLU A H    7  
ATOM 11176 H HA   . GLU A 1 9   ? 2.383   -17.475 -14.815 1.00 0.00 ? 9   GLU A HA   7  
ATOM 11177 H HB2  . GLU A 1 9   ? 1.717   -17.345 -11.887 1.00 0.00 ? 9   GLU A HB2  7  
ATOM 11178 H HB3  . GLU A 1 9   ? 0.448   -17.327 -13.104 1.00 0.00 ? 9   GLU A HB3  7  
ATOM 11179 H HG2  . GLU A 1 9   ? 0.885   -19.488 -13.787 1.00 0.00 ? 9   GLU A HG2  7  
ATOM 11180 H HG3  . GLU A 1 9   ? 2.529   -19.466 -13.150 1.00 0.00 ? 9   GLU A HG3  7  
ATOM 11181 N N    . GLU A 1 10  ? 1.154   -15.304 -15.141 1.00 0.00 ? 10  GLU A N    7  
ATOM 11182 C CA   . GLU A 1 10  ? 0.654   -13.974 -15.468 1.00 0.00 ? 10  GLU A CA   7  
ATOM 11183 C C    . GLU A 1 10  ? -0.571  -13.631 -14.625 1.00 0.00 ? 10  GLU A C    7  
ATOM 11184 O O    . GLU A 1 10  ? -1.563  -14.359 -14.627 1.00 0.00 ? 10  GLU A O    7  
ATOM 11185 C CB   . GLU A 1 10  ? 0.303   -13.889 -16.955 1.00 0.00 ? 10  GLU A CB   7  
ATOM 11186 C CG   . GLU A 1 10  ? -0.492  -15.080 -17.462 1.00 0.00 ? 10  GLU A CG   7  
ATOM 11187 C CD   . GLU A 1 10  ? -1.403  -14.723 -18.620 1.00 0.00 ? 10  GLU A CD   7  
ATOM 11188 O OE1  . GLU A 1 10  ? -0.988  -13.909 -19.472 1.00 0.00 ? 10  GLU A OE1  7  
ATOM 11189 O OE2  . GLU A 1 10  ? -2.531  -15.257 -18.675 1.00 0.00 ? 10  GLU A OE2  7  
ATOM 11190 H H    . GLU A 1 10  ? 0.894   -16.065 -15.701 1.00 0.00 ? 10  GLU A H    7  
ATOM 11191 H HA   . GLU A 1 10  ? 1.436   -13.263 -15.251 1.00 0.00 ? 10  GLU A HA   7  
ATOM 11192 H HB2  . GLU A 1 10  ? -0.279  -12.995 -17.124 1.00 0.00 ? 10  GLU A HB2  7  
ATOM 11193 H HB3  . GLU A 1 10  ? 1.218   -13.824 -17.525 1.00 0.00 ? 10  GLU A HB3  7  
ATOM 11194 H HG2  . GLU A 1 10  ? 0.198   -15.844 -17.790 1.00 0.00 ? 10  GLU A HG2  7  
ATOM 11195 H HG3  . GLU A 1 10  ? -1.095  -15.465 -16.654 1.00 0.00 ? 10  GLU A HG3  7  
ATOM 11196 N N    . ASP A 1 11  ? -0.492  -12.518 -13.904 1.00 0.00 ? 11  ASP A N    7  
ATOM 11197 C CA   . ASP A 1 11  ? -1.593  -12.076 -13.056 1.00 0.00 ? 11  ASP A CA   7  
ATOM 11198 C C    . ASP A 1 11  ? -2.126  -10.724 -13.518 1.00 0.00 ? 11  ASP A C    7  
ATOM 11199 O O    . ASP A 1 11  ? -1.432  -9.946  -14.173 1.00 0.00 ? 11  ASP A O    7  
ATOM 11200 C CB   . ASP A 1 11  ? -1.138  -11.989 -11.598 1.00 0.00 ? 11  ASP A CB   7  
ATOM 11201 C CG   . ASP A 1 11  ? -1.164  -13.335 -10.901 1.00 0.00 ? 11  ASP A CG   7  
ATOM 11202 O OD1  . ASP A 1 11  ? -2.257  -13.757 -10.467 1.00 0.00 ? 11  ASP A OD1  7  
ATOM 11203 O OD2  . ASP A 1 11  ? -0.093  -13.966 -10.791 1.00 0.00 ? 11  ASP A OD2  7  
ATOM 11204 H H    . ASP A 1 11  ? 0.327   -11.979 -13.944 1.00 0.00 ? 11  ASP A H    7  
ATOM 11205 H HA   . ASP A 1 11  ? -2.384  -12.807 -13.133 1.00 0.00 ? 11  ASP A HA   7  
ATOM 11206 H HB2  . ASP A 1 11  ? -0.128  -11.607 -11.565 1.00 0.00 ? 11  ASP A HB2  7  
ATOM 11207 H HB3  . ASP A 1 11  ? -1.791  -11.314 -11.064 1.00 0.00 ? 11  ASP A HB3  7  
ATOM 11208 N N    . PRO A 1 12  ? -3.389  -10.435 -13.170 1.00 0.00 ? 12  PRO A N    7  
ATOM 11209 C CA   . PRO A 1 12  ? -4.044  -9.177  -13.538 1.00 0.00 ? 12  PRO A CA   7  
ATOM 11210 C C    . PRO A 1 12  ? -3.461  -7.980  -12.794 1.00 0.00 ? 12  PRO A C    7  
ATOM 11211 O O    . PRO A 1 12  ? -3.163  -6.948  -13.395 1.00 0.00 ? 12  PRO A O    7  
ATOM 11212 C CB   . PRO A 1 12  ? -5.502  -9.402  -13.130 1.00 0.00 ? 12  PRO A CB   7  
ATOM 11213 C CG   . PRO A 1 12  ? -5.438  -10.425 -12.049 1.00 0.00 ? 12  PRO A CG   7  
ATOM 11214 C CD   . PRO A 1 12  ? -4.275  -11.315 -12.389 1.00 0.00 ? 12  PRO A CD   7  
ATOM 11215 H HA   . PRO A 1 12  ? -3.990  -8.998  -14.602 1.00 0.00 ? 12  PRO A HA   7  
ATOM 11216 H HB2  . PRO A 1 12  ? -5.926  -8.475  -12.773 1.00 0.00 ? 12  PRO A HB2  7  
ATOM 11217 H HB3  . PRO A 1 12  ? -6.066  -9.760  -13.979 1.00 0.00 ? 12  PRO A HB3  7  
ATOM 11218 H HG2  . PRO A 1 12  ? -5.277  -9.944  -11.097 1.00 0.00 ? 12  PRO A HG2  7  
ATOM 11219 H HG3  . PRO A 1 12  ? -6.354  -10.998 -12.031 1.00 0.00 ? 12  PRO A HG3  7  
ATOM 11220 H HD2  . PRO A 1 12  ? -3.784  -11.655 -11.488 1.00 0.00 ? 12  PRO A HD2  7  
ATOM 11221 H HD3  . PRO A 1 12  ? -4.603  -12.156 -12.982 1.00 0.00 ? 12  PRO A HD3  7  
ATOM 11222 N N    . HIS A 1 13  ? -3.301  -8.126  -11.482 1.00 0.00 ? 13  HIS A N    7  
ATOM 11223 C CA   . HIS A 1 13  ? -2.753  -7.057  -10.656 1.00 0.00 ? 13  HIS A CA   7  
ATOM 11224 C C    . HIS A 1 13  ? -1.450  -6.526  -11.247 1.00 0.00 ? 13  HIS A C    7  
ATOM 11225 O O    . HIS A 1 13  ? -1.207  -5.320  -11.253 1.00 0.00 ? 13  HIS A O    7  
ATOM 11226 C CB   . HIS A 1 13  ? -2.513  -7.557  -9.231  1.00 0.00 ? 13  HIS A CB   7  
ATOM 11227 C CG   . HIS A 1 13  ? -3.775  -7.835  -8.473  1.00 0.00 ? 13  HIS A CG   7  
ATOM 11228 N ND1  . HIS A 1 13  ? -4.153  -9.102  -8.080  1.00 0.00 ? 13  HIS A ND1  7  
ATOM 11229 C CD2  . HIS A 1 13  ? -4.747  -7.001  -8.035  1.00 0.00 ? 13  HIS A CD2  7  
ATOM 11230 C CE1  . HIS A 1 13  ? -5.303  -9.035  -7.435  1.00 0.00 ? 13  HIS A CE1  7  
ATOM 11231 N NE2  . HIS A 1 13  ? -5.685  -7.771  -7.393  1.00 0.00 ? 13  HIS A NE2  7  
ATOM 11232 H H    . HIS A 1 13  ? -3.558  -8.972  -11.061 1.00 0.00 ? 13  HIS A H    7  
ATOM 11233 H HA   . HIS A 1 13  ? -3.475  -6.254  -10.629 1.00 0.00 ? 13  HIS A HA   7  
ATOM 11234 H HB2  . HIS A 1 13  ? -1.941  -8.472  -9.269  1.00 0.00 ? 13  HIS A HB2  7  
ATOM 11235 H HB3  . HIS A 1 13  ? -1.954  -6.811  -8.684  1.00 0.00 ? 13  HIS A HB3  7  
ATOM 11236 H HD1  . HIS A 1 13  ? -3.652  -9.927  -8.251  1.00 0.00 ? 13  HIS A HD1  7  
ATOM 11237 H HD2  . HIS A 1 13  ? -4.779  -5.929  -8.166  1.00 0.00 ? 13  HIS A HD2  7  
ATOM 11238 H HE1  . HIS A 1 13  ? -5.840  -9.871  -7.012  1.00 0.00 ? 13  HIS A HE1  7  
ATOM 11239 N N    . GLU A 1 14  ? -0.618  -7.436  -11.744 1.00 0.00 ? 14  GLU A N    7  
ATOM 11240 C CA   . GLU A 1 14  ? 0.660   -7.058  -12.336 1.00 0.00 ? 14  GLU A CA   7  
ATOM 11241 C C    . GLU A 1 14  ? 0.452   -6.314  -13.651 1.00 0.00 ? 14  GLU A C    7  
ATOM 11242 O O    . GLU A 1 14  ? -0.309  -6.754  -14.513 1.00 0.00 ? 14  GLU A O    7  
ATOM 11243 C CB   . GLU A 1 14  ? 1.525   -8.298  -12.570 1.00 0.00 ? 14  GLU A CB   7  
ATOM 11244 C CG   . GLU A 1 14  ? 1.765   -9.119  -11.314 1.00 0.00 ? 14  GLU A CG   7  
ATOM 11245 C CD   . GLU A 1 14  ? 2.979   -10.021 -11.430 1.00 0.00 ? 14  GLU A CD   7  
ATOM 11246 O OE1  . GLU A 1 14  ? 3.950   -9.624  -12.108 1.00 0.00 ? 14  GLU A OE1  7  
ATOM 11247 O OE2  . GLU A 1 14  ? 2.959   -11.123 -10.843 1.00 0.00 ? 14  GLU A OE2  7  
ATOM 11248 H H    . GLU A 1 14  ? -0.868  -8.382  -11.710 1.00 0.00 ? 14  GLU A H    7  
ATOM 11249 H HA   . GLU A 1 14  ? 1.166   -6.404  -11.642 1.00 0.00 ? 14  GLU A HA   7  
ATOM 11250 H HB2  . GLU A 1 14  ? 1.040   -8.928  -13.300 1.00 0.00 ? 14  GLU A HB2  7  
ATOM 11251 H HB3  . GLU A 1 14  ? 2.483   -7.985  -12.959 1.00 0.00 ? 14  GLU A HB3  7  
ATOM 11252 H HG2  . GLU A 1 14  ? 1.914   -8.447  -10.483 1.00 0.00 ? 14  GLU A HG2  7  
ATOM 11253 H HG3  . GLU A 1 14  ? 0.896   -9.733  -11.129 1.00 0.00 ? 14  GLU A HG3  7  
ATOM 11254 N N    . GLY A 1 15  ? 1.133   -5.181  -13.799 1.00 0.00 ? 15  GLY A N    7  
ATOM 11255 C CA   . GLY A 1 15  ? 1.008   -4.393  -15.011 1.00 0.00 ? 15  GLY A CA   7  
ATOM 11256 C C    . GLY A 1 15  ? 0.345   -3.052  -14.765 1.00 0.00 ? 15  GLY A C    7  
ATOM 11257 O O    . GLY A 1 15  ? 0.607   -2.082  -15.476 1.00 0.00 ? 15  GLY A O    7  
ATOM 11258 H H    . GLY A 1 15  ? 1.724   -4.879  -13.078 1.00 0.00 ? 15  GLY A H    7  
ATOM 11259 H HA2  . GLY A 1 15  ? 1.993   -4.227  -15.422 1.00 0.00 ? 15  GLY A HA2  7  
ATOM 11260 H HA3  . GLY A 1 15  ? 0.419   -4.947  -15.728 1.00 0.00 ? 15  GLY A HA3  7  
ATOM 11261 N N    . LYS A 1 16  ? -0.517  -2.997  -13.756 1.00 0.00 ? 16  LYS A N    7  
ATOM 11262 C CA   . LYS A 1 16  ? -1.221  -1.766  -13.418 1.00 0.00 ? 16  LYS A CA   7  
ATOM 11263 C C    . LYS A 1 16  ? -0.238  -0.623  -13.184 1.00 0.00 ? 16  LYS A C    7  
ATOM 11264 O O    . LYS A 1 16  ? 0.932   -0.853  -12.876 1.00 0.00 ? 16  LYS A O    7  
ATOM 11265 C CB   . LYS A 1 16  ? -2.084  -1.973  -12.171 1.00 0.00 ? 16  LYS A CB   7  
ATOM 11266 C CG   . LYS A 1 16  ? -3.045  -3.144  -12.284 1.00 0.00 ? 16  LYS A CG   7  
ATOM 11267 C CD   . LYS A 1 16  ? -4.297  -2.764  -13.057 1.00 0.00 ? 16  LYS A CD   7  
ATOM 11268 C CE   . LYS A 1 16  ? -5.264  -3.933  -13.160 1.00 0.00 ? 16  LYS A CE   7  
ATOM 11269 N NZ   . LYS A 1 16  ? -4.990  -4.777  -14.356 1.00 0.00 ? 16  LYS A NZ   7  
ATOM 11270 H H    . LYS A 1 16  ? -0.684  -3.804  -13.225 1.00 0.00 ? 16  LYS A H    7  
ATOM 11271 H HA   . LYS A 1 16  ? -1.861  -1.510  -14.249 1.00 0.00 ? 16  LYS A HA   7  
ATOM 11272 H HB2  . LYS A 1 16  ? -1.436  -2.147  -11.324 1.00 0.00 ? 16  LYS A HB2  7  
ATOM 11273 H HB3  . LYS A 1 16  ? -2.660  -1.077  -11.993 1.00 0.00 ? 16  LYS A HB3  7  
ATOM 11274 H HG2  . LYS A 1 16  ? -2.551  -3.956  -12.797 1.00 0.00 ? 16  LYS A HG2  7  
ATOM 11275 H HG3  . LYS A 1 16  ? -3.329  -3.462  -11.291 1.00 0.00 ? 16  LYS A HG3  7  
ATOM 11276 H HD2  . LYS A 1 16  ? -4.790  -1.948  -12.549 1.00 0.00 ? 16  LYS A HD2  7  
ATOM 11277 H HD3  . LYS A 1 16  ? -4.015  -2.453  -14.052 1.00 0.00 ? 16  LYS A HD3  7  
ATOM 11278 H HE2  . LYS A 1 16  ? -5.171  -4.541  -12.273 1.00 0.00 ? 16  LYS A HE2  7  
ATOM 11279 H HE3  . LYS A 1 16  ? -6.271  -3.546  -13.226 1.00 0.00 ? 16  LYS A HE3  7  
ATOM 11280 H HZ1  . LYS A 1 16  ? -4.046  -4.560  -14.736 1.00 0.00 ? 16  LYS A HZ1  7  
ATOM 11281 H HZ2  . LYS A 1 16  ? -5.699  -4.592  -15.094 1.00 0.00 ? 16  LYS A HZ2  7  
ATOM 11282 H HZ3  . LYS A 1 16  ? -5.026  -5.784  -14.099 1.00 0.00 ? 16  LYS A HZ3  7  
ATOM 11283 N N    . ILE A 1 17  ? -0.720  0.606   -13.331 1.00 0.00 ? 17  ILE A N    7  
ATOM 11284 C CA   . ILE A 1 17  ? 0.117   1.783   -13.133 1.00 0.00 ? 17  ILE A CA   7  
ATOM 11285 C C    . ILE A 1 17  ? 0.218   2.143   -11.655 1.00 0.00 ? 17  ILE A C    7  
ATOM 11286 O O    . ILE A 1 17  ? 1.254   2.621   -11.192 1.00 0.00 ? 17  ILE A O    7  
ATOM 11287 C CB   . ILE A 1 17  ? -0.427  2.997   -13.910 1.00 0.00 ? 17  ILE A CB   7  
ATOM 11288 C CG1  . ILE A 1 17  ? 0.536   4.180   -13.788 1.00 0.00 ? 17  ILE A CG1  7  
ATOM 11289 C CG2  . ILE A 1 17  ? -1.809  3.377   -13.399 1.00 0.00 ? 17  ILE A CG2  7  
ATOM 11290 C CD1  . ILE A 1 17  ? 0.260   5.288   -14.780 1.00 0.00 ? 17  ILE A CD1  7  
ATOM 11291 H H    . ILE A 1 17  ? -1.661  0.724   -13.578 1.00 0.00 ? 17  ILE A H    7  
ATOM 11292 H HA   . ILE A 1 17  ? 1.105   1.555   -13.506 1.00 0.00 ? 17  ILE A HA   7  
ATOM 11293 H HB   . ILE A 1 17  ? -0.517  2.720   -14.949 1.00 0.00 ? 17  ILE A HB   7  
ATOM 11294 H HG12 . ILE A 1 17  ? 0.460   4.597   -12.797 1.00 0.00 ? 17  ILE A HG12 7  
ATOM 11295 H HG13 . ILE A 1 17  ? 1.545   3.831   -13.952 1.00 0.00 ? 17  ILE A HG13 7  
ATOM 11296 H HG21 . ILE A 1 17  ? -2.500  2.572   -13.600 1.00 0.00 ? 17  ILE A HG21 7  
ATOM 11297 H HG22 . ILE A 1 17  ? -1.763  3.553   -12.335 1.00 0.00 ? 17  ILE A HG22 7  
ATOM 11298 H HG23 . ILE A 1 17  ? -2.144  4.273   -13.900 1.00 0.00 ? 17  ILE A HG23 7  
ATOM 11299 H HD11 . ILE A 1 17  ? 0.995   6.070   -14.662 1.00 0.00 ? 17  ILE A HD11 7  
ATOM 11300 H HD12 . ILE A 1 17  ? 0.310   4.894   -15.784 1.00 0.00 ? 17  ILE A HD12 7  
ATOM 11301 H HD13 . ILE A 1 17  ? -0.726  5.693   -14.601 1.00 0.00 ? 17  ILE A HD13 7  
ATOM 11302 N N    . TRP A 1 18  ? -0.862  1.909   -10.920 1.00 0.00 ? 18  TRP A N    7  
ATOM 11303 C CA   . TRP A 1 18  ? -0.894  2.207   -9.492  1.00 0.00 ? 18  TRP A CA   7  
ATOM 11304 C C    . TRP A 1 18  ? -0.165  1.131   -8.695  1.00 0.00 ? 18  TRP A C    7  
ATOM 11305 O O    . TRP A 1 18  ? 0.352   1.393   -7.609  1.00 0.00 ? 18  TRP A O    7  
ATOM 11306 C CB   . TRP A 1 18  ? -2.340  2.327   -9.008  1.00 0.00 ? 18  TRP A CB   7  
ATOM 11307 C CG   . TRP A 1 18  ? -3.218  1.206   -9.476  1.00 0.00 ? 18  TRP A CG   7  
ATOM 11308 C CD1  . TRP A 1 18  ? -4.119  1.245   -10.502 1.00 0.00 ? 18  TRP A CD1  7  
ATOM 11309 C CD2  . TRP A 1 18  ? -3.280  -0.118  -8.935  1.00 0.00 ? 18  TRP A CD2  7  
ATOM 11310 N NE1  . TRP A 1 18  ? -4.738  0.024   -10.631 1.00 0.00 ? 18  TRP A NE1  7  
ATOM 11311 C CE2  . TRP A 1 18  ? -4.239  -0.829  -9.682  1.00 0.00 ? 18  TRP A CE2  7  
ATOM 11312 C CE3  . TRP A 1 18  ? -2.616  -0.773  -7.894  1.00 0.00 ? 18  TRP A CE3  7  
ATOM 11313 C CZ2  . TRP A 1 18  ? -4.551  -2.160  -9.418  1.00 0.00 ? 18  TRP A CZ2  7  
ATOM 11314 C CZ3  . TRP A 1 18  ? -2.927  -2.094  -7.633  1.00 0.00 ? 18  TRP A CZ3  7  
ATOM 11315 C CH2  . TRP A 1 18  ? -3.886  -2.777  -8.393  1.00 0.00 ? 18  TRP A CH2  7  
ATOM 11316 H H    . TRP A 1 18  ? -1.658  1.526   -11.346 1.00 0.00 ? 18  TRP A H    7  
ATOM 11317 H HA   . TRP A 1 18  ? -0.394  3.152   -9.341  1.00 0.00 ? 18  TRP A HA   7  
ATOM 11318 H HB2  . TRP A 1 18  ? -2.353  2.331   -7.928  1.00 0.00 ? 18  TRP A HB2  7  
ATOM 11319 H HB3  . TRP A 1 18  ? -2.759  3.254   -9.372  1.00 0.00 ? 18  TRP A HB3  7  
ATOM 11320 H HD1  . TRP A 1 18  ? -4.309  2.115   -11.112 1.00 0.00 ? 18  TRP A HD1  7  
ATOM 11321 H HE1  . TRP A 1 18  ? -5.423  -0.199  -11.295 1.00 0.00 ? 18  TRP A HE1  7  
ATOM 11322 H HE3  . TRP A 1 18  ? -1.874  -0.264  -7.297  1.00 0.00 ? 18  TRP A HE3  7  
ATOM 11323 H HZ2  . TRP A 1 18  ? -5.287  -2.701  -9.995  1.00 0.00 ? 18  TRP A HZ2  7  
ATOM 11324 H HZ3  . TRP A 1 18  ? -2.424  -2.617  -6.832  1.00 0.00 ? 18  TRP A HZ3  7  
ATOM 11325 H HH2  . TRP A 1 18  ? -4.096  -3.808  -8.154  1.00 0.00 ? 18  TRP A HH2  7  
ATOM 11326 N N    . PHE A 1 19  ? -0.128  -0.080  -9.240  1.00 0.00 ? 19  PHE A N    7  
ATOM 11327 C CA   . PHE A 1 19  ? 0.538   -1.196  -8.578  1.00 0.00 ? 19  PHE A CA   7  
ATOM 11328 C C    . PHE A 1 19  ? 2.054   -1.060  -8.675  1.00 0.00 ? 19  PHE A C    7  
ATOM 11329 O O    . PHE A 1 19  ? 2.573   -0.388  -9.568  1.00 0.00 ? 19  PHE A O    7  
ATOM 11330 C CB   . PHE A 1 19  ? 0.093   -2.523  -9.198  1.00 0.00 ? 19  PHE A CB   7  
ATOM 11331 C CG   . PHE A 1 19  ? 0.827   -3.715  -8.652  1.00 0.00 ? 19  PHE A CG   7  
ATOM 11332 C CD1  . PHE A 1 19  ? 0.853   -3.965  -7.290  1.00 0.00 ? 19  PHE A CD1  7  
ATOM 11333 C CD2  . PHE A 1 19  ? 1.489   -4.585  -9.502  1.00 0.00 ? 19  PHE A CD2  7  
ATOM 11334 C CE1  . PHE A 1 19  ? 1.528   -5.060  -6.786  1.00 0.00 ? 19  PHE A CE1  7  
ATOM 11335 C CE2  . PHE A 1 19  ? 2.166   -5.683  -9.004  1.00 0.00 ? 19  PHE A CE2  7  
ATOM 11336 C CZ   . PHE A 1 19  ? 2.184   -5.921  -7.644  1.00 0.00 ? 19  PHE A CZ   7  
ATOM 11337 H H    . PHE A 1 19  ? -0.559  -0.227  -10.108 1.00 0.00 ? 19  PHE A H    7  
ATOM 11338 H HA   . PHE A 1 19  ? 0.253   -1.181  -7.538  1.00 0.00 ? 19  PHE A HA   7  
ATOM 11339 H HB2  . PHE A 1 19  ? -0.960  -2.666  -9.007  1.00 0.00 ? 19  PHE A HB2  7  
ATOM 11340 H HB3  . PHE A 1 19  ? 0.260   -2.488  -10.264 1.00 0.00 ? 19  PHE A HB3  7  
ATOM 11341 H HD1  . PHE A 1 19  ? 0.339   -3.293  -6.618  1.00 0.00 ? 19  PHE A HD1  7  
ATOM 11342 H HD2  . PHE A 1 19  ? 1.475   -4.400  -10.567 1.00 0.00 ? 19  PHE A HD2  7  
ATOM 11343 H HE1  . PHE A 1 19  ? 1.540   -5.245  -5.722  1.00 0.00 ? 19  PHE A HE1  7  
ATOM 11344 H HE2  . PHE A 1 19  ? 2.678   -6.354  -9.678  1.00 0.00 ? 19  PHE A HE2  7  
ATOM 11345 H HZ   . PHE A 1 19  ? 2.712   -6.777  -7.252  1.00 0.00 ? 19  PHE A HZ   7  
ATOM 11346 N N    . HIS A 1 20  ? 2.761   -1.701  -7.750  1.00 0.00 ? 20  HIS A N    7  
ATOM 11347 C CA   . HIS A 1 20  ? 4.218   -1.652  -7.730  1.00 0.00 ? 20  HIS A CA   7  
ATOM 11348 C C    . HIS A 1 20  ? 4.796   -2.917  -7.102  1.00 0.00 ? 20  HIS A C    7  
ATOM 11349 O O    . HIS A 1 20  ? 4.415   -3.303  -5.998  1.00 0.00 ? 20  HIS A O    7  
ATOM 11350 C CB   . HIS A 1 20  ? 4.698   -0.421  -6.960  1.00 0.00 ? 20  HIS A CB   7  
ATOM 11351 C CG   . HIS A 1 20  ? 4.692   0.835   -7.775  1.00 0.00 ? 20  HIS A CG   7  
ATOM 11352 N ND1  . HIS A 1 20  ? 5.782   1.265   -8.504  1.00 0.00 ? 20  HIS A ND1  7  
ATOM 11353 C CD2  . HIS A 1 20  ? 3.720   1.755   -7.976  1.00 0.00 ? 20  HIS A CD2  7  
ATOM 11354 C CE1  . HIS A 1 20  ? 5.481   2.396   -9.116  1.00 0.00 ? 20  HIS A CE1  7  
ATOM 11355 N NE2  . HIS A 1 20  ? 4.235   2.715   -8.813  1.00 0.00 ? 20  HIS A NE2  7  
ATOM 11356 H H    . HIS A 1 20  ? 2.291   -2.220  -7.065  1.00 0.00 ? 20  HIS A H    7  
ATOM 11357 H HA   . HIS A 1 20  ? 4.562   -1.583  -8.751  1.00 0.00 ? 20  HIS A HA   7  
ATOM 11358 H HB2  . HIS A 1 20  ? 4.054   -0.265  -6.107  1.00 0.00 ? 20  HIS A HB2  7  
ATOM 11359 H HB3  . HIS A 1 20  ? 5.708   -0.591  -6.617  1.00 0.00 ? 20  HIS A HB3  7  
ATOM 11360 H HD1  . HIS A 1 20  ? 6.647   0.809   -8.561  1.00 0.00 ? 20  HIS A HD1  7  
ATOM 11361 H HD2  . HIS A 1 20  ? 2.724   1.739   -7.557  1.00 0.00 ? 20  HIS A HD2  7  
ATOM 11362 H HE1  . HIS A 1 20  ? 6.140   2.963   -9.756  1.00 0.00 ? 20  HIS A HE1  7  
ATOM 11363 N N    . GLY A 1 21  ? 5.718   -3.558  -7.814  1.00 0.00 ? 21  GLY A N    7  
ATOM 11364 C CA   . GLY A 1 21  ? 6.332   -4.772  -7.311  1.00 0.00 ? 21  GLY A CA   7  
ATOM 11365 C C    . GLY A 1 21  ? 7.840   -4.766  -7.465  1.00 0.00 ? 21  GLY A C    7  
ATOM 11366 O O    . GLY A 1 21  ? 8.565   -5.218  -6.578  1.00 0.00 ? 21  GLY A O    7  
ATOM 11367 H H    . GLY A 1 21  ? 5.983   -3.203  -8.689  1.00 0.00 ? 21  GLY A H    7  
ATOM 11368 H HA2  . GLY A 1 21  ? 6.089   -4.879  -6.264  1.00 0.00 ? 21  GLY A HA2  7  
ATOM 11369 H HA3  . GLY A 1 21  ? 5.930   -5.616  -7.852  1.00 0.00 ? 21  GLY A HA3  7  
ATOM 11370 N N    . LYS A 1 22  ? 8.316   -4.255  -8.596  1.00 0.00 ? 22  LYS A N    7  
ATOM 11371 C CA   . LYS A 1 22  ? 9.747   -4.192  -8.865  1.00 0.00 ? 22  LYS A CA   7  
ATOM 11372 C C    . LYS A 1 22  ? 10.469  -3.388  -7.788  1.00 0.00 ? 22  LYS A C    7  
ATOM 11373 O O    . LYS A 1 22  ? 11.561  -3.756  -7.354  1.00 0.00 ? 22  LYS A O    7  
ATOM 11374 C CB   . LYS A 1 22  ? 10.001  -3.567  -10.239 1.00 0.00 ? 22  LYS A CB   7  
ATOM 11375 C CG   . LYS A 1 22  ? 9.375   -2.194  -10.408 1.00 0.00 ? 22  LYS A CG   7  
ATOM 11376 C CD   . LYS A 1 22  ? 9.655   -1.619  -11.786 1.00 0.00 ? 22  LYS A CD   7  
ATOM 11377 C CE   . LYS A 1 22  ? 11.016  -0.943  -11.842 1.00 0.00 ? 22  LYS A CE   7  
ATOM 11378 N NZ   . LYS A 1 22  ? 12.099  -1.903  -12.192 1.00 0.00 ? 22  LYS A NZ   7  
ATOM 11379 H H    . LYS A 1 22  ? 7.688   -3.911  -9.266  1.00 0.00 ? 22  LYS A H    7  
ATOM 11380 H HA   . LYS A 1 22  ? 10.130  -5.201  -8.862  1.00 0.00 ? 22  LYS A HA   7  
ATOM 11381 H HB2  . LYS A 1 22  ? 11.067  -3.475  -10.387 1.00 0.00 ? 22  LYS A HB2  7  
ATOM 11382 H HB3  . LYS A 1 22  ? 9.596   -4.221  -10.999 1.00 0.00 ? 22  LYS A HB3  7  
ATOM 11383 H HG2  . LYS A 1 22  ? 8.306   -2.277  -10.274 1.00 0.00 ? 22  LYS A HG2  7  
ATOM 11384 H HG3  . LYS A 1 22  ? 9.783   -1.528  -9.661  1.00 0.00 ? 22  LYS A HG3  7  
ATOM 11385 H HD2  . LYS A 1 22  ? 9.633   -2.419  -12.512 1.00 0.00 ? 22  LYS A HD2  7  
ATOM 11386 H HD3  . LYS A 1 22  ? 8.891   -0.893  -12.026 1.00 0.00 ? 22  LYS A HD3  7  
ATOM 11387 H HE2  . LYS A 1 22  ? 10.985  -0.162  -12.586 1.00 0.00 ? 22  LYS A HE2  7  
ATOM 11388 H HE3  . LYS A 1 22  ? 11.228  -0.510  -10.876 1.00 0.00 ? 22  LYS A HE3  7  
ATOM 11389 H HZ1  . LYS A 1 22  ? 12.392  -2.434  -11.347 1.00 0.00 ? 22  LYS A HZ1  7  
ATOM 11390 H HZ2  . LYS A 1 22  ? 12.922  -1.391  -12.569 1.00 0.00 ? 22  LYS A HZ2  7  
ATOM 11391 H HZ3  . LYS A 1 22  ? 11.762  -2.575  -12.911 1.00 0.00 ? 22  LYS A HZ3  7  
ATOM 11392 N N    . ILE A 1 23  ? 9.851   -2.292  -7.361  1.00 0.00 ? 23  ILE A N    7  
ATOM 11393 C CA   . ILE A 1 23  ? 10.434  -1.439  -6.333  1.00 0.00 ? 23  ILE A CA   7  
ATOM 11394 C C    . ILE A 1 23  ? 10.451  -2.142  -4.980  1.00 0.00 ? 23  ILE A C    7  
ATOM 11395 O O    . ILE A 1 23  ? 10.024  -3.291  -4.860  1.00 0.00 ? 23  ILE A O    7  
ATOM 11396 C CB   . ILE A 1 23  ? 9.664   -0.112  -6.200  1.00 0.00 ? 23  ILE A CB   7  
ATOM 11397 C CG1  . ILE A 1 23  ? 8.257   -0.365  -5.655  1.00 0.00 ? 23  ILE A CG1  7  
ATOM 11398 C CG2  . ILE A 1 23  ? 9.598   0.599   -7.543  1.00 0.00 ? 23  ILE A CG2  7  
ATOM 11399 C CD1  . ILE A 1 23  ? 7.516   0.900   -5.285  1.00 0.00 ? 23  ILE A CD1  7  
ATOM 11400 H H    . ILE A 1 23  ? 8.983   -2.052  -7.746  1.00 0.00 ? 23  ILE A H    7  
ATOM 11401 H HA   . ILE A 1 23  ? 11.451  -1.215  -6.623  1.00 0.00 ? 23  ILE A HA   7  
ATOM 11402 H HB   . ILE A 1 23  ? 10.201  0.522   -5.510  1.00 0.00 ? 23  ILE A HB   7  
ATOM 11403 H HG12 . ILE A 1 23  ? 7.677   -0.883  -6.402  1.00 0.00 ? 23  ILE A HG12 7  
ATOM 11404 H HG13 . ILE A 1 23  ? 8.328   -0.981  -4.770  1.00 0.00 ? 23  ILE A HG13 7  
ATOM 11405 H HG21 . ILE A 1 23  ? 9.094   -0.032  -8.260  1.00 0.00 ? 23  ILE A HG21 7  
ATOM 11406 H HG22 . ILE A 1 23  ? 9.053   1.525   -7.434  1.00 0.00 ? 23  ILE A HG22 7  
ATOM 11407 H HG23 . ILE A 1 23  ? 10.599  0.808   -7.890  1.00 0.00 ? 23  ILE A HG23 7  
ATOM 11408 H HD11 . ILE A 1 23  ? 7.199   1.408   -6.184  1.00 0.00 ? 23  ILE A HD11 7  
ATOM 11409 H HD12 . ILE A 1 23  ? 6.652   0.650   -4.688  1.00 0.00 ? 23  ILE A HD12 7  
ATOM 11410 H HD13 . ILE A 1 23  ? 8.169   1.547   -4.718  1.00 0.00 ? 23  ILE A HD13 7  
ATOM 11411 N N    . SER A 1 24  ? 10.944  -1.444  -3.962  1.00 0.00 ? 24  SER A N    7  
ATOM 11412 C CA   . SER A 1 24  ? 11.018  -2.001  -2.617  1.00 0.00 ? 24  SER A CA   7  
ATOM 11413 C C    . SER A 1 24  ? 10.260  -1.126  -1.624  1.00 0.00 ? 24  SER A C    7  
ATOM 11414 O O    . SER A 1 24  ? 9.937   0.026   -1.913  1.00 0.00 ? 24  SER A O    7  
ATOM 11415 C CB   . SER A 1 24  ? 12.478  -2.141  -2.179  1.00 0.00 ? 24  SER A CB   7  
ATOM 11416 O OG   . SER A 1 24  ? 13.056  -3.324  -2.703  1.00 0.00 ? 24  SER A OG   7  
ATOM 11417 H H    . SER A 1 24  ? 11.269  -0.532  -4.121  1.00 0.00 ? 24  SER A H    7  
ATOM 11418 H HA   . SER A 1 24  ? 10.563  -2.980  -2.638  1.00 0.00 ? 24  SER A HA   7  
ATOM 11419 H HB2  . SER A 1 24  ? 13.041  -1.292  -2.536  1.00 0.00 ? 24  SER A HB2  7  
ATOM 11420 H HB3  . SER A 1 24  ? 12.525  -2.177  -1.101  1.00 0.00 ? 24  SER A HB3  7  
ATOM 11421 H HG   . SER A 1 24  ? 12.707  -3.490  -3.581  1.00 0.00 ? 24  SER A HG   7  
ATOM 11422 N N    . LYS A 1 25  ? 9.978   -1.682  -0.450  1.00 0.00 ? 25  LYS A N    7  
ATOM 11423 C CA   . LYS A 1 25  ? 9.258   -0.955  0.588   1.00 0.00 ? 25  LYS A CA   7  
ATOM 11424 C C    . LYS A 1 25  ? 9.837   0.444   0.774   1.00 0.00 ? 25  LYS A C    7  
ATOM 11425 O O    . LYS A 1 25  ? 9.112   1.437   0.726   1.00 0.00 ? 25  LYS A O    7  
ATOM 11426 C CB   . LYS A 1 25  ? 9.317   -1.722  1.911   1.00 0.00 ? 25  LYS A CB   7  
ATOM 11427 C CG   . LYS A 1 25  ? 8.633   -1.004  3.062   1.00 0.00 ? 25  LYS A CG   7  
ATOM 11428 C CD   . LYS A 1 25  ? 8.534   -1.890  4.292   1.00 0.00 ? 25  LYS A CD   7  
ATOM 11429 C CE   . LYS A 1 25  ? 7.983   -1.126  5.487   1.00 0.00 ? 25  LYS A CE   7  
ATOM 11430 N NZ   . LYS A 1 25  ? 7.788   -2.011  6.669   1.00 0.00 ? 25  LYS A NZ   7  
ATOM 11431 H H    . LYS A 1 25  ? 10.262  -2.605  -0.278  1.00 0.00 ? 25  LYS A H    7  
ATOM 11432 H HA   . LYS A 1 25  ? 8.228   -0.867  0.279   1.00 0.00 ? 25  LYS A HA   7  
ATOM 11433 H HB2  . LYS A 1 25  ? 8.839   -2.682  1.778   1.00 0.00 ? 25  LYS A HB2  7  
ATOM 11434 H HB3  . LYS A 1 25  ? 10.352  -1.879  2.177   1.00 0.00 ? 25  LYS A HB3  7  
ATOM 11435 H HG2  . LYS A 1 25  ? 9.202   -0.121  3.313   1.00 0.00 ? 25  LYS A HG2  7  
ATOM 11436 H HG3  . LYS A 1 25  ? 7.637   -0.717  2.754   1.00 0.00 ? 25  LYS A HG3  7  
ATOM 11437 H HD2  . LYS A 1 25  ? 7.876   -2.720  4.076   1.00 0.00 ? 25  LYS A HD2  7  
ATOM 11438 H HD3  . LYS A 1 25  ? 9.518   -2.263  4.537   1.00 0.00 ? 25  LYS A HD3  7  
ATOM 11439 H HE2  . LYS A 1 25  ? 8.677   -0.341  5.746   1.00 0.00 ? 25  LYS A HE2  7  
ATOM 11440 H HE3  . LYS A 1 25  ? 7.033   -0.691  5.212   1.00 0.00 ? 25  LYS A HE3  7  
ATOM 11441 H HZ1  . LYS A 1 25  ? 6.790   -2.001  6.961   1.00 0.00 ? 25  LYS A HZ1  7  
ATOM 11442 H HZ2  . LYS A 1 25  ? 8.373   -1.680  7.462   1.00 0.00 ? 25  LYS A HZ2  7  
ATOM 11443 H HZ3  . LYS A 1 25  ? 8.061   -2.986  6.434   1.00 0.00 ? 25  LYS A HZ3  7  
ATOM 11444 N N    . GLN A 1 26  ? 11.148  0.514   0.984   1.00 0.00 ? 26  GLN A N    7  
ATOM 11445 C CA   . GLN A 1 26  ? 11.823  1.792   1.175   1.00 0.00 ? 26  GLN A CA   7  
ATOM 11446 C C    . GLN A 1 26  ? 11.551  2.732   0.006   1.00 0.00 ? 26  GLN A C    7  
ATOM 11447 O O    . GLN A 1 26  ? 10.950  3.792   0.178   1.00 0.00 ? 26  GLN A O    7  
ATOM 11448 C CB   . GLN A 1 26  ? 13.330  1.578   1.333   1.00 0.00 ? 26  GLN A CB   7  
ATOM 11449 C CG   . GLN A 1 26  ? 13.744  1.176   2.739   1.00 0.00 ? 26  GLN A CG   7  
ATOM 11450 C CD   . GLN A 1 26  ? 15.226  0.879   2.849   1.00 0.00 ? 26  GLN A CD   7  
ATOM 11451 O OE1  . GLN A 1 26  ? 15.784  0.135   2.041   1.00 0.00 ? 26  GLN A OE1  7  
ATOM 11452 N NE2  . GLN A 1 26  ? 15.874  1.459   3.852   1.00 0.00 ? 26  GLN A NE2  7  
ATOM 11453 H H    . GLN A 1 26  ? 11.672  -0.313  1.011   1.00 0.00 ? 26  GLN A H    7  
ATOM 11454 H HA   . GLN A 1 26  ? 11.437  2.239   2.079   1.00 0.00 ? 26  GLN A HA   7  
ATOM 11455 H HB2  . GLN A 1 26  ? 13.644  0.801   0.652   1.00 0.00 ? 26  GLN A HB2  7  
ATOM 11456 H HB3  . GLN A 1 26  ? 13.840  2.495   1.080   1.00 0.00 ? 26  GLN A HB3  7  
ATOM 11457 H HG2  . GLN A 1 26  ? 13.503  1.982   3.416   1.00 0.00 ? 26  GLN A HG2  7  
ATOM 11458 H HG3  . GLN A 1 26  ? 13.192  0.292   3.024   1.00 0.00 ? 26  GLN A HG3  7  
ATOM 11459 H HE21 . GLN A 1 26  ? 15.365  2.038   4.458   1.00 0.00 ? 26  GLN A HE21 7  
ATOM 11460 H HE22 . GLN A 1 26  ? 16.833  1.284   3.947   1.00 0.00 ? 26  GLN A HE22 7  
ATOM 11461 N N    . GLU A 1 27  ? 11.997  2.336   -1.182  1.00 0.00 ? 27  GLU A N    7  
ATOM 11462 C CA   . GLU A 1 27  ? 11.801  3.146   -2.379  1.00 0.00 ? 27  GLU A CA   7  
ATOM 11463 C C    . GLU A 1 27  ? 10.413  3.779   -2.387  1.00 0.00 ? 27  GLU A C    7  
ATOM 11464 O O    . GLU A 1 27  ? 10.276  4.998   -2.473  1.00 0.00 ? 27  GLU A O    7  
ATOM 11465 C CB   . GLU A 1 27  ? 11.993  2.293   -3.635  1.00 0.00 ? 27  GLU A CB   7  
ATOM 11466 C CG   . GLU A 1 27  ? 13.450  2.022   -3.971  1.00 0.00 ? 27  GLU A CG   7  
ATOM 11467 C CD   . GLU A 1 27  ? 14.270  1.650   -2.751  1.00 0.00 ? 27  GLU A CD   7  
ATOM 11468 O OE1  . GLU A 1 27  ? 14.554  2.547   -1.930  1.00 0.00 ? 27  GLU A OE1  7  
ATOM 11469 O OE2  . GLU A 1 27  ? 14.628  0.461   -2.618  1.00 0.00 ? 27  GLU A OE2  7  
ATOM 11470 H H    . GLU A 1 27  ? 12.469  1.481   -1.255  1.00 0.00 ? 27  GLU A H    7  
ATOM 11471 H HA   . GLU A 1 27  ? 12.542  3.931   -2.373  1.00 0.00 ? 27  GLU A HA   7  
ATOM 11472 H HB2  . GLU A 1 27  ? 11.495  1.345   -3.491  1.00 0.00 ? 27  GLU A HB2  7  
ATOM 11473 H HB3  . GLU A 1 27  ? 11.541  2.803   -4.473  1.00 0.00 ? 27  GLU A HB3  7  
ATOM 11474 H HG2  . GLU A 1 27  ? 13.497  1.208   -4.679  1.00 0.00 ? 27  GLU A HG2  7  
ATOM 11475 H HG3  . GLU A 1 27  ? 13.874  2.910   -4.415  1.00 0.00 ? 27  GLU A HG3  7  
ATOM 11476 N N    . ALA A 1 28  ? 9.386   2.939   -2.297  1.00 0.00 ? 28  ALA A N    7  
ATOM 11477 C CA   . ALA A 1 28  ? 8.009   3.416   -2.293  1.00 0.00 ? 28  ALA A CA   7  
ATOM 11478 C C    . ALA A 1 28  ? 7.896   4.764   -1.590  1.00 0.00 ? 28  ALA A C    7  
ATOM 11479 O O    . ALA A 1 28  ? 7.326   5.712   -2.131  1.00 0.00 ? 28  ALA A O    7  
ATOM 11480 C CB   . ALA A 1 28  ? 7.099   2.394   -1.627  1.00 0.00 ? 28  ALA A CB   7  
ATOM 11481 H H    . ALA A 1 28  ? 9.560   1.977   -2.231  1.00 0.00 ? 28  ALA A H    7  
ATOM 11482 H HA   . ALA A 1 28  ? 7.691   3.529   -3.319  1.00 0.00 ? 28  ALA A HA   7  
ATOM 11483 H HB1  . ALA A 1 28  ? 7.701   1.643   -1.135  1.00 0.00 ? 28  ALA A HB1  7  
ATOM 11484 H HB2  . ALA A 1 28  ? 6.475   2.889   -0.898  1.00 0.00 ? 28  ALA A HB2  7  
ATOM 11485 H HB3  . ALA A 1 28  ? 6.478   1.924   -2.374  1.00 0.00 ? 28  ALA A HB3  7  
ATOM 11486 N N    . TYR A 1 29  ? 8.443   4.844   -0.382  1.00 0.00 ? 29  TYR A N    7  
ATOM 11487 C CA   . TYR A 1 29  ? 8.401   6.076   0.397   1.00 0.00 ? 29  TYR A CA   7  
ATOM 11488 C C    . TYR A 1 29  ? 8.982   7.242   -0.397  1.00 0.00 ? 29  TYR A C    7  
ATOM 11489 O O    . TYR A 1 29  ? 8.355   8.292   -0.527  1.00 0.00 ? 29  TYR A O    7  
ATOM 11490 C CB   . TYR A 1 29  ? 9.171   5.903   1.707   1.00 0.00 ? 29  TYR A CB   7  
ATOM 11491 C CG   . TYR A 1 29  ? 8.317   5.402   2.850   1.00 0.00 ? 29  TYR A CG   7  
ATOM 11492 C CD1  . TYR A 1 29  ? 7.254   6.156   3.331   1.00 0.00 ? 29  TYR A CD1  7  
ATOM 11493 C CD2  . TYR A 1 29  ? 8.573   4.175   3.449   1.00 0.00 ? 29  TYR A CD2  7  
ATOM 11494 C CE1  . TYR A 1 29  ? 6.471   5.703   4.375   1.00 0.00 ? 29  TYR A CE1  7  
ATOM 11495 C CE2  . TYR A 1 29  ? 7.795   3.713   4.492   1.00 0.00 ? 29  TYR A CE2  7  
ATOM 11496 C CZ   . TYR A 1 29  ? 6.745   4.481   4.952   1.00 0.00 ? 29  TYR A CZ   7  
ATOM 11497 O OH   . TYR A 1 29  ? 5.969   4.025   5.993   1.00 0.00 ? 29  TYR A OH   7  
ATOM 11498 H H    . TYR A 1 29  ? 8.883   4.055   -0.003  1.00 0.00 ? 29  TYR A H    7  
ATOM 11499 H HA   . TYR A 1 29  ? 7.367   6.290   0.624   1.00 0.00 ? 29  TYR A HA   7  
ATOM 11500 H HB2  . TYR A 1 29  ? 9.970   5.194   1.556   1.00 0.00 ? 29  TYR A HB2  7  
ATOM 11501 H HB3  . TYR A 1 29  ? 9.591   6.855   1.998   1.00 0.00 ? 29  TYR A HB3  7  
ATOM 11502 H HD1  . TYR A 1 29  ? 7.042   7.113   2.876   1.00 0.00 ? 29  TYR A HD1  7  
ATOM 11503 H HD2  . TYR A 1 29  ? 9.397   3.576   3.086   1.00 0.00 ? 29  TYR A HD2  7  
ATOM 11504 H HE1  . TYR A 1 29  ? 5.649   6.304   4.735   1.00 0.00 ? 29  TYR A HE1  7  
ATOM 11505 H HE2  . TYR A 1 29  ? 8.010   2.756   4.945   1.00 0.00 ? 29  TYR A HE2  7  
ATOM 11506 H HH   . TYR A 1 29  ? 6.535   3.697   6.695   1.00 0.00 ? 29  TYR A HH   7  
ATOM 11507 N N    . ASN A 1 30  ? 10.185  7.047   -0.928  1.00 0.00 ? 30  ASN A N    7  
ATOM 11508 C CA   . ASN A 1 30  ? 10.852  8.081   -1.710  1.00 0.00 ? 30  ASN A CA   7  
ATOM 11509 C C    . ASN A 1 30  ? 10.049  8.420   -2.962  1.00 0.00 ? 30  ASN A C    7  
ATOM 11510 O O    . ASN A 1 30  ? 9.805   9.591   -3.258  1.00 0.00 ? 30  ASN A O    7  
ATOM 11511 C CB   . ASN A 1 30  ? 12.260  7.626   -2.101  1.00 0.00 ? 30  ASN A CB   7  
ATOM 11512 C CG   . ASN A 1 30  ? 13.269  7.848   -0.991  1.00 0.00 ? 30  ASN A CG   7  
ATOM 11513 O OD1  . ASN A 1 30  ? 12.923  7.828   0.190   1.00 0.00 ? 30  ASN A OD1  7  
ATOM 11514 N ND2  . ASN A 1 30  ? 14.524  8.060   -1.367  1.00 0.00 ? 30  ASN A ND2  7  
ATOM 11515 H H    . ASN A 1 30  ? 10.635  6.188   -0.790  1.00 0.00 ? 30  ASN A H    7  
ATOM 11516 H HA   . ASN A 1 30  ? 10.928  8.965   -1.094  1.00 0.00 ? 30  ASN A HA   7  
ATOM 11517 H HB2  . ASN A 1 30  ? 12.238  6.572   -2.336  1.00 0.00 ? 30  ASN A HB2  7  
ATOM 11518 H HB3  . ASN A 1 30  ? 12.582  8.178   -2.971  1.00 0.00 ? 30  ASN A HB3  7  
ATOM 11519 H HD21 . ASN A 1 30  ? 14.727  8.063   -2.326  1.00 0.00 ? 30  ASN A HD21 7  
ATOM 11520 H HD22 . ASN A 1 30  ? 15.197  8.206   -0.670  1.00 0.00 ? 30  ASN A HD22 7  
ATOM 11521 N N    . LEU A 1 31  ? 9.640   7.389   -3.692  1.00 0.00 ? 31  LEU A N    7  
ATOM 11522 C CA   . LEU A 1 31  ? 8.863   7.576   -4.913  1.00 0.00 ? 31  LEU A CA   7  
ATOM 11523 C C    . LEU A 1 31  ? 7.716   8.556   -4.683  1.00 0.00 ? 31  LEU A C    7  
ATOM 11524 O O    . LEU A 1 31  ? 7.575   9.543   -5.407  1.00 0.00 ? 31  LEU A O    7  
ATOM 11525 C CB   . LEU A 1 31  ? 8.312   6.235   -5.401  1.00 0.00 ? 31  LEU A CB   7  
ATOM 11526 C CG   . LEU A 1 31  ? 9.326   5.288   -6.044  1.00 0.00 ? 31  LEU A CG   7  
ATOM 11527 C CD1  . LEU A 1 31  ? 8.915   3.840   -5.827  1.00 0.00 ? 31  LEU A CD1  7  
ATOM 11528 C CD2  . LEU A 1 31  ? 9.468   5.587   -7.529  1.00 0.00 ? 31  LEU A CD2  7  
ATOM 11529 H H    . LEU A 1 31  ? 9.865   6.480   -3.405  1.00 0.00 ? 31  LEU A H    7  
ATOM 11530 H HA   . LEU A 1 31  ? 9.521   7.981   -5.666  1.00 0.00 ? 31  LEU A HA   7  
ATOM 11531 H HB2  . LEU A 1 31  ? 7.877   5.728   -4.554  1.00 0.00 ? 31  LEU A HB2  7  
ATOM 11532 H HB3  . LEU A 1 31  ? 7.541   6.441   -6.130  1.00 0.00 ? 31  LEU A HB3  7  
ATOM 11533 H HG   . LEU A 1 31  ? 10.291  5.433   -5.578  1.00 0.00 ? 31  LEU A HG   7  
ATOM 11534 H HD11 . LEU A 1 31  ? 9.528   3.196   -6.439  1.00 0.00 ? 31  LEU A HD11 7  
ATOM 11535 H HD12 . LEU A 1 31  ? 7.877   3.715   -6.101  1.00 0.00 ? 31  LEU A HD12 7  
ATOM 11536 H HD13 . LEU A 1 31  ? 9.045   3.580   -4.786  1.00 0.00 ? 31  LEU A HD13 7  
ATOM 11537 H HD21 . LEU A 1 31  ? 9.571   4.660   -8.074  1.00 0.00 ? 31  LEU A HD21 7  
ATOM 11538 H HD22 . LEU A 1 31  ? 10.344  6.199   -7.691  1.00 0.00 ? 31  LEU A HD22 7  
ATOM 11539 H HD23 . LEU A 1 31  ? 8.591   6.113   -7.876  1.00 0.00 ? 31  LEU A HD23 7  
ATOM 11540 N N    . LEU A 1 32  ? 6.902   8.279   -3.671  1.00 0.00 ? 32  LEU A N    7  
ATOM 11541 C CA   . LEU A 1 32  ? 5.768   9.137   -3.344  1.00 0.00 ? 32  LEU A CA   7  
ATOM 11542 C C    . LEU A 1 32  ? 6.235   10.549  -3.003  1.00 0.00 ? 32  LEU A C    7  
ATOM 11543 O O    . LEU A 1 32  ? 5.443   11.491  -2.998  1.00 0.00 ? 32  LEU A O    7  
ATOM 11544 C CB   . LEU A 1 32  ? 4.981   8.551   -2.172  1.00 0.00 ? 32  LEU A CB   7  
ATOM 11545 C CG   . LEU A 1 32  ? 3.960   7.467   -2.523  1.00 0.00 ? 32  LEU A CG   7  
ATOM 11546 C CD1  . LEU A 1 32  ? 3.518   6.725   -1.272  1.00 0.00 ? 32  LEU A CD1  7  
ATOM 11547 C