data_2H03
# 
_entry.id   2H03 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2H03         
RCSB  RCSB037761   
WWPDB D_1000037761 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HO2 'Structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors' unspecified 
PDB 2HO4 'Structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors' unspecified 
# 
_pdbx_database_status.entry_id                        2H03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-05-13 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Evdokimov, A.G.'   1  
'Pokross, M.E.'     2  
'Walter, R.L.'      3  
'Mekel, M.'         4  
'Gray, J.L.'        5  
'Peters, K.G.'      6  
'Maier, M.B.'       7  
'Amarasinghe, K.D.' 8  
'Clark, C.M.'       9  
'Nichols, R.'       10 
# 
_citation.id                        primary 
_citation.title                     'Design and synthesis of potent, non-peptidic inhibitors of HPTPbeta.' 
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_volume            16 
_citation.page_first                4252 
_citation.page_last                 4256 
_citation.year                      2006 
_citation.journal_id_ASTM           BMCLE8 
_citation.country                   UK 
_citation.journal_id_ISSN           0960-894X 
_citation.journal_id_CSD            1127 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16759857 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2006.05.074 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Amarasinghe, K.K.' 1  
primary 'Evdokimov, A.G.'   2  
primary 'Xu, K.'            3  
primary 'Clark, C.M.'       4  
primary 'Maier, M.B.'       5  
primary 'Srivastava, A.'    6  
primary 'Colson, A.O.'      7  
primary 'Gerwe, G.S.'       8  
primary 'Stake, G.E.'       9  
primary 'Howard, B.W.'      10 
primary 'Pokross, M.E.'     11 
primary 'Gray, J.L.'        12 
primary 'Peters, K.G.'      13 
# 
_cell.entry_id           2H03 
_cell.length_a           112.316 
_cell.length_b           38.934 
_cell.length_c           66.062 
_cell.angle_alpha        90.00 
_cell.angle_beta         103.91 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2H03 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein tyrosine phosphatase, receptor type, B,'                                      33780.340 1   3.1.3.48 
'P1748G, C1749G' 'catalytic domain, 1676-1970' ? 
2 non-polymer syn 'CHLORIDE ION'                                                                         35.453    2   ?        ? 
?                             ? 
3 non-polymer syn 'MAGNESIUM ION'                                                                        24.305    2   ?        ? 
?                             ? 
4 non-polymer syn '(4-{4-[(TERT-BUTOXYCARBONYL)AMINO]-2,2-BIS(ETHOXYCARBONYL)BUTYL}PHENYL)SULFAMIC ACID' 488.552   1   ?        ? 
?                             ? 
5 water       nat water                                                                                  18.015    202 ?        ? 
?                             ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSGGSDYIN
ASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLP
EWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDR
ILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSGGSDYIN
ASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLP
EWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDR
ILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ARG n 
1 4   LYS n 
1 5   THR n 
1 6   SER n 
1 7   CYS n 
1 8   PRO n 
1 9   ILE n 
1 10  LYS n 
1 11  ILE n 
1 12  ASN n 
1 13  GLN n 
1 14  PHE n 
1 15  GLU n 
1 16  GLY n 
1 17  HIS n 
1 18  PHE n 
1 19  MET n 
1 20  LYS n 
1 21  LEU n 
1 22  GLN n 
1 23  ALA n 
1 24  ASP n 
1 25  SER n 
1 26  ASN n 
1 27  TYR n 
1 28  LEU n 
1 29  LEU n 
1 30  SER n 
1 31  LYS n 
1 32  GLU n 
1 33  TYR n 
1 34  GLU n 
1 35  GLU n 
1 36  LEU n 
1 37  LYS n 
1 38  ASP n 
1 39  VAL n 
1 40  GLY n 
1 41  ARG n 
1 42  ASN n 
1 43  GLN n 
1 44  SER n 
1 45  CYS n 
1 46  ASP n 
1 47  ILE n 
1 48  ALA n 
1 49  LEU n 
1 50  LEU n 
1 51  PRO n 
1 52  GLU n 
1 53  ASN n 
1 54  ARG n 
1 55  GLY n 
1 56  LYS n 
1 57  ASN n 
1 58  ARG n 
1 59  TYR n 
1 60  ASN n 
1 61  ASN n 
1 62  ILE n 
1 63  LEU n 
1 64  PRO n 
1 65  TYR n 
1 66  ASP n 
1 67  ALA n 
1 68  THR n 
1 69  ARG n 
1 70  VAL n 
1 71  LYS n 
1 72  LEU n 
1 73  SER n 
1 74  GLY n 
1 75  GLY n 
1 76  SER n 
1 77  ASP n 
1 78  TYR n 
1 79  ILE n 
1 80  ASN n 
1 81  ALA n 
1 82  SER n 
1 83  TYR n 
1 84  ILE n 
1 85  PRO n 
1 86  GLY n 
1 87  ASN n 
1 88  ASN n 
1 89  PHE n 
1 90  ARG n 
1 91  ARG n 
1 92  GLU n 
1 93  TYR n 
1 94  ILE n 
1 95  VAL n 
1 96  THR n 
1 97  GLN n 
1 98  GLY n 
1 99  PRO n 
1 100 LEU n 
1 101 PRO n 
1 102 GLY n 
1 103 THR n 
1 104 LYS n 
1 105 ASP n 
1 106 ASP n 
1 107 PHE n 
1 108 TRP n 
1 109 LYS n 
1 110 MET n 
1 111 VAL n 
1 112 TRP n 
1 113 GLU n 
1 114 GLN n 
1 115 ASN n 
1 116 VAL n 
1 117 HIS n 
1 118 ASN n 
1 119 ILE n 
1 120 VAL n 
1 121 MET n 
1 122 VAL n 
1 123 THR n 
1 124 GLN n 
1 125 CYS n 
1 126 VAL n 
1 127 GLU n 
1 128 LYS n 
1 129 GLY n 
1 130 ARG n 
1 131 VAL n 
1 132 LYS n 
1 133 CYS n 
1 134 ASP n 
1 135 HIS n 
1 136 TYR n 
1 137 TRP n 
1 138 PRO n 
1 139 ALA n 
1 140 ASP n 
1 141 GLN n 
1 142 ASP n 
1 143 SER n 
1 144 LEU n 
1 145 TYR n 
1 146 TYR n 
1 147 GLY n 
1 148 ASP n 
1 149 LEU n 
1 150 ILE n 
1 151 LEU n 
1 152 GLN n 
1 153 MET n 
1 154 LEU n 
1 155 SER n 
1 156 GLU n 
1 157 SER n 
1 158 VAL n 
1 159 LEU n 
1 160 PRO n 
1 161 GLU n 
1 162 TRP n 
1 163 THR n 
1 164 ILE n 
1 165 ARG n 
1 166 GLU n 
1 167 PHE n 
1 168 LYS n 
1 169 ILE n 
1 170 CYS n 
1 171 GLY n 
1 172 GLU n 
1 173 GLU n 
1 174 GLN n 
1 175 LEU n 
1 176 ASP n 
1 177 ALA n 
1 178 HIS n 
1 179 ARG n 
1 180 LEU n 
1 181 ILE n 
1 182 ARG n 
1 183 HIS n 
1 184 PHE n 
1 185 HIS n 
1 186 TYR n 
1 187 THR n 
1 188 VAL n 
1 189 TRP n 
1 190 PRO n 
1 191 ASP n 
1 192 HIS n 
1 193 GLY n 
1 194 VAL n 
1 195 PRO n 
1 196 GLU n 
1 197 THR n 
1 198 THR n 
1 199 GLN n 
1 200 SER n 
1 201 LEU n 
1 202 ILE n 
1 203 GLN n 
1 204 PHE n 
1 205 VAL n 
1 206 ARG n 
1 207 THR n 
1 208 VAL n 
1 209 ARG n 
1 210 ASP n 
1 211 TYR n 
1 212 ILE n 
1 213 ASN n 
1 214 ARG n 
1 215 SER n 
1 216 PRO n 
1 217 GLY n 
1 218 ALA n 
1 219 GLY n 
1 220 PRO n 
1 221 THR n 
1 222 VAL n 
1 223 VAL n 
1 224 HIS n 
1 225 CYS n 
1 226 SER n 
1 227 ALA n 
1 228 GLY n 
1 229 VAL n 
1 230 GLY n 
1 231 ARG n 
1 232 THR n 
1 233 GLY n 
1 234 THR n 
1 235 PHE n 
1 236 ILE n 
1 237 ALA n 
1 238 LEU n 
1 239 ASP n 
1 240 ARG n 
1 241 ILE n 
1 242 LEU n 
1 243 GLN n 
1 244 GLN n 
1 245 LEU n 
1 246 ASP n 
1 247 SER n 
1 248 LYS n 
1 249 ASP n 
1 250 SER n 
1 251 VAL n 
1 252 ASP n 
1 253 ILE n 
1 254 TYR n 
1 255 GLY n 
1 256 ALA n 
1 257 VAL n 
1 258 HIS n 
1 259 ASP n 
1 260 LEU n 
1 261 ARG n 
1 262 LEU n 
1 263 HIS n 
1 264 ARG n 
1 265 VAL n 
1 266 HIS n 
1 267 MET n 
1 268 VAL n 
1 269 GLN n 
1 270 THR n 
1 271 GLU n 
1 272 CYS n 
1 273 GLN n 
1 274 TYR n 
1 275 VAL n 
1 276 TYR n 
1 277 LEU n 
1 278 HIS n 
1 279 GLN n 
1 280 CYS n 
1 281 VAL n 
1 282 ARG n 
1 283 ASP n 
1 284 VAL n 
1 285 LEU n 
1 286 ARG n 
1 287 ALA n 
1 288 ARG n 
1 289 LYS n 
1 290 LEU n 
1 291 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PTPRB 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               TOP10 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pDEST-HisMBP 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q3MIV7_HUMAN 
_struct_ref.pdbx_db_accession          Q3MIV7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCS
DYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSE
SVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFI
ALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLR
;
_struct_ref.pdbx_align_begin           1676 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2H03 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 291 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q3MIV7 
_struct_ref_seq.db_align_beg                  1676 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1970 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1676 
_struct_ref_seq.pdbx_auth_seq_align_end       1970 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2H03 SER A 1  ? UNP Q3MIV7 ?   ?    'CLONING ARTIFACT' 1675 1 
1 2H03 ?   A ?  ? UNP Q3MIV7 ASN 1748 DELETION           ?    2 
1 2H03 ?   A ?  ? UNP Q3MIV7 VAL 1749 DELETION           ?    3 
1 2H03 ?   A ?  ? UNP Q3MIV7 ASP 1750 DELETION           ?    4 
1 2H03 ?   A ?  ? UNP Q3MIV7 ASP 1751 DELETION           ?    5 
1 2H03 ?   A ?  ? UNP Q3MIV7 ASP 1752 DELETION           ?    6 
1 2H03 GLY A 74 ? UNP Q3MIV7 PRO 1753 ENGINEERED         1748 7 
1 2H03 GLY A 75 ? UNP Q3MIV7 CYS 1754 ENGINEERED         1749 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3UN non-polymer         . '(4-{4-[(TERT-BUTOXYCARBONYL)AMINO]-2,2-BIS(ETHOXYCARBONYL)BUTYL}PHENYL)SULFAMIC ACID' ? 
'C21 H32 N2 O9 S' 488.552 
ALA 'L-peptide linking' y ALANINE                                                                                ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                               ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                             ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                        ? 'C4 H7 N O4' 
133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                                         ? 'Cl -1' 35.453  
CYS 'L-peptide linking' y CYSTEINE                                                                               ? 'C3 H7 N O2 S' 
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                              ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                        ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                              ? 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                  ? 'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                             ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                                 ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                             ? 'C5 H11 N O2 S' 
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                        ? 'Mg 2' 24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                          ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                 ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                              ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                             ? 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                               ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                                 ? 'C5 H11 N O2' 
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2H03 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.07 
_exptl_crystal.density_percent_sol   40.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'21% PEG 8000, 220 mM MgCl2, 1% BME, 0.1% BOG, 5mM DTT, pH 8.0, vapor diffusion, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-02-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
# 
_reflns.entry_id                     2H03 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.65 
_reflns.d_resolution_low             27.6 
_reflns.number_all                   32934 
_reflns.number_obs                   32934 
_reflns.percent_possible_obs         97.7 
_reflns.pdbx_Rmerge_I_obs            0.028 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.89 
_reflns.B_iso_Wilson_estimate        23 
_reflns.pdbx_redundancy              2.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.65 
_reflns_shell.d_res_low              1.75 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   91.1 
_reflns_shell.Rmerge_I_obs           0.254 
_reflns_shell.meanI_over_sigI_obs    3.89 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        2.2 
_reflns_shell.number_unique_all      4904 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2H03 
_refine.ls_d_res_high                            1.650 
_refine.ls_d_res_low                             27.6 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    97.700 
_refine.ls_number_reflns_obs                     32933 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.182 
_refine.ls_R_factor_R_work                       0.18 
_refine.ls_R_factor_R_free                       0.217 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1681 
_refine.B_iso_mean                               24.400 
_refine.aniso_B[1][1]                            -0.040 
_refine.aniso_B[2][2]                            0.250 
_refine.aniso_B[3][3]                            -0.580 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -0.790 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.946 
_refine.pdbx_overall_ESU_R                       0.108 
_refine.pdbx_overall_ESU_R_Free                  0.107 
_refine.overall_SU_ML                            0.067 
_refine.overall_SU_B                             3.801 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     32933 
_refine.ls_R_factor_obs                          0.18 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1RPM' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2350 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             202 
_refine_hist.number_atoms_total               2589 
_refine_hist.d_res_high                       1.650 
_refine_hist.d_res_low                        27.6 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         2483 0.012  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      3378 1.717  1.956  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   301  7.031  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   129  33.720 23.488 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   428  13.313 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   22   13.480 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           360  0.138  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1925 0.006  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1097 0.228  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1669 0.321  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    172  0.226  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      1    0.022  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   56   0.258  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 15   0.217  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1489 1.684  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2376 2.591  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1121 4.051  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             995  6.012  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.650 
_refine_ls_shell.d_res_low                        1.693 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               85.490 
_refine_ls_shell.number_reflns_R_work             2019 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.238 
_refine_ls_shell.R_factor_R_free                  0.322 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             108 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                2127 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2H03 
_struct.title                     
'Structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors' 
_struct.pdbx_descriptor           'protein tyrosine phosphatase beta catalytic domain, inhibitors' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2H03 
_struct_keywords.text            
'protein tyrosine phosphatase, WPD-loop, sulfamic acid, phosphatase, inhibitor, drug design, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 13  ? LEU A 36  ? GLN A 1687 LEU A 1710 1 ? 24 
HELX_P HELX_P2 2 CYS A 45  ? LEU A 50  ? CYS A 1719 LEU A 1724 1 ? 6  
HELX_P HELX_P3 3 PRO A 51  ? ASN A 57  ? PRO A 1725 ASN A 1731 5 ? 7  
HELX_P HELX_P4 4 LEU A 100 ? GLY A 102 ? LEU A 1779 GLY A 1781 5 ? 3  
HELX_P HELX_P5 5 THR A 103 ? GLN A 114 ? THR A 1782 GLN A 1793 1 ? 12 
HELX_P HELX_P6 6 THR A 197 ? ARG A 214 ? THR A 1876 ARG A 1893 1 ? 18 
HELX_P HELX_P7 7 VAL A 229 ? LYS A 248 ? VAL A 1908 LYS A 1927 1 ? 20 
HELX_P HELX_P8 8 ASP A 252 ? LEU A 262 ? ASP A 1931 LEU A 1941 1 ? 11 
HELX_P HELX_P9 9 THR A 270 ? LEU A 290 ? THR A 1949 LEU A 1969 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 303 A HOH 56   1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc2  metalc ? ? C MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 303 A HOH 57   1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc3  metalc ? ? C MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 303 A HOH 74   1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc4  metalc ? ? C MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 303 A HOH 76   1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc5  metalc ? ? D MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 304 A HOH 59   1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc6  metalc ? ? D MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 304 A HOH 203  1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc7  metalc ? ? D MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 304 A HOH 213  1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc8  metalc ? ? D MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 304 A HOH 227  1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc9  metalc ? ? C MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 303 A HOH 56   2_656 ? ? ? ? ? ? ? 2.089 ? 
metalc10 metalc ? ? C MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 303 A HOH 76   2_656 ? ? ? ? ? ? ? 2.173 ? 
metalc11 metalc ? ? C MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 303 A HOH 57   2_656 ? ? ? ? ? ? ? 2.063 ? 
metalc12 metalc ? ? C MG . MG ? ? ? 1_555 G HOH .   O   ? ? A MG 303 A HOH 74   2_656 ? ? ? ? ? ? ? 2.061 ? 
metalc13 metalc ? ? D MG . MG ? ? ? 1_555 A GLU 172 OE2 ? ? A MG 304 A GLU 1851 2_656 ? ? ? ? ? ? ? 2.072 ? 
metalc14 metalc ? ? D MG . MG ? ? ? 1_555 A ASP 148 OD1 ? ? A MG 304 A ASP 1827 2_656 ? ? ? ? ? ? ? 1.988 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
B 8 9 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 9   ? LYS A 10  ? ILE A 1683 LYS A 1684 
A 2 SER A 250 ? VAL A 251 ? SER A 1929 VAL A 1930 
B 1 ARG A 69  ? LYS A 71  ? ARG A 1743 LYS A 1745 
B 2 TYR A 78  ? ILE A 84  ? TYR A 1757 ILE A 1763 
B 3 TYR A 93  ? THR A 96  ? TYR A 1772 THR A 1775 
B 4 THR A 221 ? HIS A 224 ? THR A 1900 HIS A 1903 
B 5 ASN A 118 ? MET A 121 ? ASN A 1797 MET A 1800 
B 6 GLN A 174 ? TYR A 186 ? GLN A 1853 TYR A 1865 
B 7 TRP A 162 ? GLY A 171 ? TRP A 1841 GLY A 1850 
B 8 LEU A 149 ? VAL A 158 ? LEU A 1828 VAL A 1837 
B 9 LEU A 144 ? TYR A 146 ? LEU A 1823 TYR A 1825 
C 1 VAL A 126 ? GLU A 127 ? VAL A 1805 GLU A 1806 
C 2 ARG A 130 ? VAL A 131 ? ARG A 1809 VAL A 1810 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 9   ? N ILE A 1683 O VAL A 251 ? O VAL A 1930 
B 1 2 N VAL A 70  ? N VAL A 1744 O ALA A 81  ? O ALA A 1760 
B 2 3 N ILE A 84  ? N ILE A 1763 O TYR A 93  ? O TYR A 1772 
B 3 4 N ILE A 94  ? N ILE A 1773 O VAL A 223 ? O VAL A 1902 
B 4 5 O VAL A 222 ? O VAL A 1901 N VAL A 120 ? N VAL A 1799 
B 5 6 N ILE A 119 ? N ILE A 1798 O PHE A 184 ? O PHE A 1863 
B 6 7 O HIS A 183 ? O HIS A 1862 N ARG A 165 ? N ARG A 1844 
B 7 8 O GLU A 166 ? O GLU A 1845 N LEU A 154 ? N LEU A 1833 
B 8 9 O LEU A 149 ? O LEU A 1828 N TYR A 146 ? N TYR A 1825 
C 1 2 N GLU A 127 ? N GLU A 1806 O ARG A 130 ? O ARG A 1809 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL A 302'  
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MG A 303'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 304'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL A 305'  
AC5 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE 3UN A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  GLY A 86  ? GLY A 1765 . ? 1_555 ? 
2  AC1 5  ASN A 87  ? ASN A 1766 . ? 1_555 ? 
3  AC1 5  ASN A 88  ? ASN A 1767 . ? 1_555 ? 
4  AC1 5  PHE A 89  ? PHE A 1768 . ? 1_555 ? 
5  AC1 5  ARG A 291 ? ARG A 1970 . ? 4_545 ? 
6  AC2 8  HOH G .   ? HOH A 56   . ? 2_656 ? 
7  AC2 8  HOH G .   ? HOH A 56   . ? 1_555 ? 
8  AC2 8  HOH G .   ? HOH A 57   . ? 1_555 ? 
9  AC2 8  HOH G .   ? HOH A 57   . ? 2_656 ? 
10 AC2 8  HOH G .   ? HOH A 74   . ? 1_555 ? 
11 AC2 8  HOH G .   ? HOH A 74   . ? 2_656 ? 
12 AC2 8  HOH G .   ? HOH A 76   . ? 1_555 ? 
13 AC2 8  HOH G .   ? HOH A 76   . ? 2_656 ? 
14 AC3 6  HOH G .   ? HOH A 59   . ? 1_555 ? 
15 AC3 6  HOH G .   ? HOH A 203  . ? 1_555 ? 
16 AC3 6  HOH G .   ? HOH A 213  . ? 1_555 ? 
17 AC3 6  HOH G .   ? HOH A 227  . ? 1_555 ? 
18 AC3 6  ASP A 148 ? ASP A 1827 . ? 2_656 ? 
19 AC3 6  GLU A 172 ? GLU A 1851 . ? 2_656 ? 
20 AC4 4  TYR A 83  ? TYR A 1762 . ? 1_555 ? 
21 AC4 4  PRO A 85  ? PRO A 1764 . ? 1_555 ? 
22 AC4 4  ARG A 90  ? ARG A 1769 . ? 1_555 ? 
23 AC4 4  ARG A 91  ? ARG A 1770 . ? 1_555 ? 
24 AC5 18 HOH G .   ? HOH A 22   . ? 1_555 ? 
25 AC5 18 ASP A 46  ? ASP A 1720 . ? 4_556 ? 
26 AC5 18 LEU A 49  ? LEU A 1723 . ? 4_556 ? 
27 AC5 18 TYR A 59  ? TYR A 1733 . ? 1_555 ? 
28 AC5 18 ASN A 60  ? ASN A 1734 . ? 1_555 ? 
29 AC5 18 ASN A 61  ? ASN A 1735 . ? 1_555 ? 
30 AC5 18 LYS A 132 ? LYS A 1811 . ? 1_555 ? 
31 AC5 18 ASP A 191 ? ASP A 1870 . ? 1_555 ? 
32 AC5 18 HIS A 192 ? HIS A 1871 . ? 1_555 ? 
33 AC5 18 CYS A 225 ? CYS A 1904 . ? 1_555 ? 
34 AC5 18 SER A 226 ? SER A 1905 . ? 1_555 ? 
35 AC5 18 ALA A 227 ? ALA A 1906 . ? 1_555 ? 
36 AC5 18 GLY A 228 ? GLY A 1907 . ? 1_555 ? 
37 AC5 18 VAL A 229 ? VAL A 1908 . ? 1_555 ? 
38 AC5 18 GLY A 230 ? GLY A 1909 . ? 1_555 ? 
39 AC5 18 ARG A 231 ? ARG A 1910 . ? 1_555 ? 
40 AC5 18 HIS A 266 ? HIS A 1945 . ? 1_555 ? 
41 AC5 18 GLN A 269 ? GLN A 1948 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2H03 
_atom_sites.fract_transf_matrix[1][1]   0.008903 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002205 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.025684 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015595 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 4   ? 8.290  -14.358 14.168  1.00 39.97 ? 1678 LYS A N   1 
ATOM   2    C  CA  . LYS A 1 4   ? 9.028  -13.677 13.060  1.00 39.05 ? 1678 LYS A CA  1 
ATOM   3    C  C   . LYS A 1 4   ? 10.537 -13.679 13.325  1.00 37.23 ? 1678 LYS A C   1 
ATOM   4    O  O   . LYS A 1 4   ? 10.988 -13.234 14.376  1.00 37.50 ? 1678 LYS A O   1 
ATOM   5    C  CB  . LYS A 1 4   ? 8.611  -12.204 12.949  1.00 40.12 ? 1678 LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 4   ? 7.157  -11.882 12.658  1.00 42.77 ? 1678 LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 4   ? 6.870  -10.461 13.151  1.00 45.77 ? 1678 LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 4   ? 5.467  -9.969  12.808  1.00 48.29 ? 1678 LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 4   ? 5.239  -8.619  13.420  1.00 51.30 ? 1678 LYS A NZ  1 
ATOM   10   N  N   . THR A 1 5   ? 11.313 -14.137 12.351  1.00 35.24 ? 1679 THR A N   1 
ATOM   11   C  CA  . THR A 1 5   ? 12.771 -14.028 12.369  1.00 32.65 ? 1679 THR A CA  1 
ATOM   12   C  C   . THR A 1 5   ? 13.209 -13.001 11.289  1.00 29.42 ? 1679 THR A C   1 
ATOM   13   O  O   . THR A 1 5   ? 14.305 -12.419 11.341  1.00 27.87 ? 1679 THR A O   1 
ATOM   14   C  CB  . THR A 1 5   ? 13.319 -15.458 12.187  1.00 35.31 ? 1679 THR A CB  1 
ATOM   15   O  OG1 . THR A 1 5   ? 13.747 -15.978 13.456  1.00 35.87 ? 1679 THR A OG1 1 
ATOM   16   C  CG2 . THR A 1 5   ? 14.369 -15.619 11.091  1.00 32.74 ? 1679 THR A CG2 1 
ATOM   17   N  N   . SER A 1 6   ? 12.308 -12.765 10.337  1.00 27.26 ? 1680 SER A N   1 
ATOM   18   C  CA  . SER A 1 6   ? 12.605 -12.005 9.117   1.00 25.75 ? 1680 SER A CA  1 
ATOM   19   C  C   . SER A 1 6   ? 11.304 -11.433 8.557   1.00 25.36 ? 1680 SER A C   1 
ATOM   20   O  O   . SER A 1 6   ? 10.282 -12.101 8.610   1.00 25.62 ? 1680 SER A O   1 
ATOM   21   C  CB  . SER A 1 6   ? 13.282 -12.946 8.108   1.00 26.64 ? 1680 SER A CB  1 
ATOM   22   O  OG  . SER A 1 6   ? 13.369 -12.380 6.808   1.00 29.10 ? 1680 SER A OG  1 
ATOM   23   N  N   . CYS A 1 7   ? 11.306 -10.203 8.040   1.00 23.87 ? 1681 CYS A N   1 
ATOM   24   C  CA  . CYS A 1 7   ? 10.155 -9.641  7.334   1.00 23.60 ? 1681 CYS A CA  1 
ATOM   25   C  C   . CYS A 1 7   ? 10.609 -8.939  6.046   1.00 21.36 ? 1681 CYS A C   1 
ATOM   26   O  O   . CYS A 1 7   ? 10.677 -7.713  6.002   1.00 21.38 ? 1681 CYS A O   1 
ATOM   27   C  CB  . CYS A 1 7   ? 9.408  -8.606  8.167   1.00 23.91 ? 1681 CYS A CB  1 
ATOM   28   S  SG  . CYS A 1 7   ? 8.770  -9.234  9.713   1.00 36.47 ? 1681 CYS A SG  1 
ATOM   29   N  N   . PRO A 1 8   ? 10.935 -9.714  5.014   1.00 21.77 ? 1682 PRO A N   1 
ATOM   30   C  CA  . PRO A 1 8   ? 11.442 -9.093  3.785   1.00 20.65 ? 1682 PRO A CA  1 
ATOM   31   C  C   . PRO A 1 8   ? 10.334 -8.314  3.075   1.00 21.54 ? 1682 PRO A C   1 
ATOM   32   O  O   . PRO A 1 8   ? 9.137  -8.718  3.100   1.00 20.61 ? 1682 PRO A O   1 
ATOM   33   C  CB  . PRO A 1 8   ? 11.932 -10.271 2.942   1.00 22.32 ? 1682 PRO A CB  1 
ATOM   34   C  CG  . PRO A 1 8   ? 11.834 -11.504 3.835   1.00 26.60 ? 1682 PRO A CG  1 
ATOM   35   C  CD  . PRO A 1 8   ? 10.832 -11.181 4.910   1.00 23.48 ? 1682 PRO A CD  1 
ATOM   36   N  N   . ILE A 1 9   ? 10.747 -7.214  2.459   1.00 18.65 ? 1683 ILE A N   1 
ATOM   37   C  CA  . ILE A 1 9   ? 9.882  -6.344  1.682   1.00 19.25 ? 1683 ILE A CA  1 
ATOM   38   C  C   . ILE A 1 9   ? 10.489 -6.212  0.291   1.00 20.90 ? 1683 ILE A C   1 
ATOM   39   O  O   . ILE A 1 9   ? 11.683 -5.916  0.181   1.00 19.62 ? 1683 ILE A O   1 
ATOM   40   C  CB  . ILE A 1 9   ? 9.762  -4.971  2.349   1.00 17.99 ? 1683 ILE A CB  1 
ATOM   41   C  CG1 . ILE A 1 9   ? 9.288  -5.118  3.808   1.00 21.94 ? 1683 ILE A CG1 1 
ATOM   42   C  CG2 . ILE A 1 9   ? 8.856  -4.055  1.487   1.00 20.82 ? 1683 ILE A CG2 1 
ATOM   43   C  CD1 . ILE A 1 9   ? 9.581  -3.866  4.669   1.00 25.18 ? 1683 ILE A CD1 1 
ATOM   44   N  N   . LYS A 1 10  ? 9.695  -6.450  -0.751  1.00 19.93 ? 1684 LYS A N   1 
ATOM   45   C  CA  . LYS A 1 10  ? 10.225 -6.332  -2.133  1.00 18.68 ? 1684 LYS A CA  1 
ATOM   46   C  C   . LYS A 1 10  ? 10.505 -4.857  -2.334  1.00 18.04 ? 1684 LYS A C   1 
ATOM   47   O  O   . LYS A 1 10  ? 9.711  -4.021  -1.884  1.00 18.72 ? 1684 LYS A O   1 
ATOM   48   C  CB  . LYS A 1 10  ? 9.159  -6.804  -3.126  1.00 19.56 ? 1684 LYS A CB  1 
ATOM   49   C  CG  . LYS A 1 10  ? 9.117  -8.329  -3.123  1.00 23.71 ? 1684 LYS A CG  1 
ATOM   50   C  CD  . LYS A 1 10  ? 10.259 -8.871  -3.997  1.00 32.53 ? 1684 LYS A CD  1 
ATOM   51   C  CE  . LYS A 1 10  ? 9.762  -9.403  -5.339  1.00 45.16 ? 1684 LYS A CE  1 
ATOM   52   N  NZ  . LYS A 1 10  ? 9.921  -8.429  -6.468  1.00 51.61 ? 1684 LYS A NZ  1 
ATOM   53   N  N   . ILE A 1 11  ? 11.635 -4.518  -2.946  1.00 17.50 ? 1685 ILE A N   1 
ATOM   54   C  CA  . ILE A 1 11  ? 11.945 -3.089  -2.994  1.00 20.82 ? 1685 ILE A CA  1 
ATOM   55   C  C   . ILE A 1 11  ? 10.893 -2.267  -3.731  1.00 20.65 ? 1685 ILE A C   1 
ATOM   56   O  O   . ILE A 1 11  ? 10.659 -1.104  -3.383  1.00 21.36 ? 1685 ILE A O   1 
ATOM   57   C  CB  . ILE A 1 11  ? 13.355 -2.752  -3.456  1.00 20.67 ? 1685 ILE A CB  1 
ATOM   58   C  CG1 . ILE A 1 11  ? 13.556 -3.120  -4.919  1.00 19.18 ? 1685 ILE A CG1 1 
ATOM   59   C  CG2 . ILE A 1 11  ? 14.370 -3.317  -2.493  1.00 19.63 ? 1685 ILE A CG2 1 
ATOM   60   C  CD1 . ILE A 1 11  ? 14.899 -2.623  -5.444  1.00 22.69 ? 1685 ILE A CD1 1 
ATOM   61   N  N   . ASN A 1 12  ? 10.257 -2.862  -4.742  1.00 22.25 ? 1686 ASN A N   1 
ATOM   62   C  CA  . ASN A 1 12  ? 9.243  -2.129  -5.493  1.00 26.87 ? 1686 ASN A CA  1 
ATOM   63   C  C   . ASN A 1 12  ? 7.982  -1.867  -4.669  1.00 28.08 ? 1686 ASN A C   1 
ATOM   64   O  O   . ASN A 1 12  ? 7.144  -1.036  -5.042  1.00 31.80 ? 1686 ASN A O   1 
ATOM   65   C  CB  . ASN A 1 12  ? 8.977  -2.792  -6.859  1.00 28.10 ? 1686 ASN A CB  1 
ATOM   66   C  CG  . ASN A 1 12  ? 8.190  -4.118  -6.775  1.00 36.97 ? 1686 ASN A CG  1 
ATOM   67   O  OD1 . ASN A 1 12  ? 8.084  -4.768  -5.728  1.00 40.41 ? 1686 ASN A OD1 1 
ATOM   68   N  ND2 . ASN A 1 12  ? 7.624  -4.522  -7.914  1.00 43.60 ? 1686 ASN A ND2 1 
ATOM   69   N  N   . GLN A 1 13  ? 7.843  -2.577  -3.554  1.00 24.31 ? 1687 GLN A N   1 
ATOM   70   C  CA  . GLN A 1 13  ? 6.719  -2.398  -2.644  1.00 25.23 ? 1687 GLN A CA  1 
ATOM   71   C  C   . GLN A 1 13  ? 7.041  -1.554  -1.423  1.00 24.91 ? 1687 GLN A C   1 
ATOM   72   O  O   . GLN A 1 13  ? 6.168  -1.291  -0.594  1.00 22.86 ? 1687 GLN A O   1 
ATOM   73   C  CB  . GLN A 1 13  ? 6.175  -3.745  -2.168  1.00 24.25 ? 1687 GLN A CB  1 
ATOM   74   C  CG  . GLN A 1 13  ? 5.779  -4.654  -3.310  1.00 33.46 ? 1687 GLN A CG  1 
ATOM   75   C  CD  . GLN A 1 13  ? 4.925  -5.821  -2.861  1.00 41.56 ? 1687 GLN A CD  1 
ATOM   76   O  OE1 . GLN A 1 13  ? 5.385  -6.694  -2.129  1.00 42.56 ? 1687 GLN A OE1 1 
ATOM   77   N  NE2 . GLN A 1 13  ? 3.663  -5.843  -3.301  1.00 49.40 ? 1687 GLN A NE2 1 
ATOM   78   N  N   . PHE A 1 14  ? 8.297  -1.132  -1.292  1.00 21.25 ? 1688 PHE A N   1 
ATOM   79   C  CA  . PHE A 1 14  ? 8.713  -0.527  -0.036  1.00 22.23 ? 1688 PHE A CA  1 
ATOM   80   C  C   . PHE A 1 14  ? 7.988  0.775   0.310   1.00 21.31 ? 1688 PHE A C   1 
ATOM   81   O  O   . PHE A 1 14  ? 7.577  0.971   1.453   1.00 20.39 ? 1688 PHE A O   1 
ATOM   82   C  CB  . PHE A 1 14  ? 10.240 -0.332  0.040   1.00 21.13 ? 1688 PHE A CB  1 
ATOM   83   C  CG  . PHE A 1 14  ? 10.686 0.052   1.424   1.00 21.99 ? 1688 PHE A CG  1 
ATOM   84   C  CD1 . PHE A 1 14  ? 10.980 -0.936  2.365   1.00 18.99 ? 1688 PHE A CD1 1 
ATOM   85   C  CD2 . PHE A 1 14  ? 10.729 1.402   1.821   1.00 20.53 ? 1688 PHE A CD2 1 
ATOM   86   C  CE1 . PHE A 1 14  ? 11.359 -0.608  3.656   1.00 20.66 ? 1688 PHE A CE1 1 
ATOM   87   C  CE2 . PHE A 1 14  ? 11.121 1.738   3.131   1.00 16.69 ? 1688 PHE A CE2 1 
ATOM   88   C  CZ  . PHE A 1 14  ? 11.408 0.734   4.055   1.00 17.68 ? 1688 PHE A CZ  1 
ATOM   89   N  N   . GLU A 1 15  ? 7.868  1.658   -0.672  1.00 21.36 ? 1689 GLU A N   1 
ATOM   90   C  CA  . GLU A 1 15  ? 7.262  2.957   -0.443  1.00 24.30 ? 1689 GLU A CA  1 
ATOM   91   C  C   . GLU A 1 15  ? 5.873  2.765   0.192   1.00 25.37 ? 1689 GLU A C   1 
ATOM   92   O  O   . GLU A 1 15  ? 5.607  3.300   1.272   1.00 25.87 ? 1689 GLU A O   1 
ATOM   93   C  CB  . GLU A 1 15  ? 7.209  3.754   -1.749  1.00 26.01 ? 1689 GLU A CB  1 
ATOM   94   C  CG  . GLU A 1 15  ? 6.420  5.075   -1.676  1.00 28.06 ? 1689 GLU A CG  1 
ATOM   95   C  CD  . GLU A 1 15  ? 7.191  6.219   -1.044  1.00 35.02 ? 1689 GLU A CD  1 
ATOM   96   O  OE1 . GLU A 1 15  ? 8.436  6.156   -0.928  1.00 32.89 ? 1689 GLU A OE1 1 
ATOM   97   O  OE2 . GLU A 1 15  ? 6.546  7.213   -0.653  1.00 35.51 ? 1689 GLU A OE2 1 
ATOM   98   N  N   . GLY A 1 16  ? 5.024  1.980   -0.466  1.00 24.48 ? 1690 GLY A N   1 
ATOM   99   C  CA  . GLY A 1 16  ? 3.662  1.758   0.030   1.00 25.30 ? 1690 GLY A CA  1 
ATOM   100  C  C   . GLY A 1 16  ? 3.648  0.988   1.338   1.00 24.74 ? 1690 GLY A C   1 
ATOM   101  O  O   . GLY A 1 16  ? 2.889  1.302   2.258   1.00 23.90 ? 1690 GLY A O   1 
ATOM   102  N  N   . HIS A 1 17  ? 4.495  -0.035  1.437   1.00 23.37 ? 1691 HIS A N   1 
ATOM   103  C  CA  . HIS A 1 17  ? 4.580  -0.796  2.686   1.00 23.80 ? 1691 HIS A CA  1 
ATOM   104  C  C   . HIS A 1 17  ? 4.944  0.107   3.866   1.00 22.46 ? 1691 HIS A C   1 
ATOM   105  O  O   . HIS A 1 17  ? 4.350  0.022   4.939   1.00 21.62 ? 1691 HIS A O   1 
ATOM   106  C  CB  . HIS A 1 17  ? 5.624  -1.905  2.582   1.00 25.37 ? 1691 HIS A CB  1 
ATOM   107  C  CG  . HIS A 1 17  ? 5.615  -2.814  3.769   1.00 31.57 ? 1691 HIS A CG  1 
ATOM   108  N  ND1 . HIS A 1 17  ? 4.539  -3.622  4.068   1.00 41.34 ? 1691 HIS A ND1 1 
ATOM   109  C  CD2 . HIS A 1 17  ? 6.528  -3.018  4.747   1.00 34.54 ? 1691 HIS A CD2 1 
ATOM   110  C  CE1 . HIS A 1 17  ? 4.803  -4.305  5.169   1.00 42.29 ? 1691 HIS A CE1 1 
ATOM   111  N  NE2 . HIS A 1 17  ? 6.003  -3.957  5.600   1.00 33.49 ? 1691 HIS A NE2 1 
ATOM   112  N  N   . PHE A 1 18  ? 5.924  0.989   3.674   1.00 21.39 ? 1692 PHE A N   1 
ATOM   113  C  CA  . PHE A 1 18  ? 6.267  1.952   4.711   1.00 21.96 ? 1692 PHE A CA  1 
ATOM   114  C  C   . PHE A 1 18  ? 5.111  2.901   5.102   1.00 22.99 ? 1692 PHE A C   1 
ATOM   115  O  O   . PHE A 1 18  ? 4.948  3.196   6.278   1.00 23.64 ? 1692 PHE A O   1 
ATOM   116  C  CB  . PHE A 1 18  ? 7.573  2.702   4.347   1.00 24.06 ? 1692 PHE A CB  1 
ATOM   117  C  CG  . PHE A 1 18  ? 8.129  3.512   5.473   1.00 23.73 ? 1692 PHE A CG  1 
ATOM   118  C  CD1 . PHE A 1 18  ? 8.109  3.023   6.773   1.00 22.17 ? 1692 PHE A CD1 1 
ATOM   119  C  CD2 . PHE A 1 18  ? 8.650  4.770   5.241   1.00 23.78 ? 1692 PHE A CD2 1 
ATOM   120  C  CE1 . PHE A 1 18  ? 8.599  3.776   7.831   1.00 24.99 ? 1692 PHE A CE1 1 
ATOM   121  C  CE2 . PHE A 1 18  ? 9.155  5.527   6.293   1.00 23.91 ? 1692 PHE A CE2 1 
ATOM   122  C  CZ  . PHE A 1 18  ? 9.127  5.028   7.587   1.00 23.84 ? 1692 PHE A CZ  1 
ATOM   123  N  N   . MET A 1 19  ? 4.324  3.353   4.127   1.00 24.86 ? 1693 MET A N   1 
ATOM   124  C  CA  A MET A 1 19  ? 3.162  4.179   4.433   0.50 25.82 ? 1693 MET A CA  1 
ATOM   125  C  CA  B MET A 1 19  ? 3.146  4.173   4.408   0.50 24.24 ? 1693 MET A CA  1 
ATOM   126  C  C   . MET A 1 19  ? 2.148  3.393   5.265   1.00 24.25 ? 1693 MET A C   1 
ATOM   127  O  O   . MET A 1 19  ? 1.588  3.924   6.231   1.00 24.83 ? 1693 MET A O   1 
ATOM   128  C  CB  A MET A 1 19  ? 2.538  4.755   3.162   0.50 26.51 ? 1693 MET A CB  1 
ATOM   129  C  CB  B MET A 1 19  ? 2.492  4.664   3.112   0.50 25.68 ? 1693 MET A CB  1 
ATOM   130  C  CG  A MET A 1 19  ? 3.291  5.935   2.561   0.50 26.03 ? 1693 MET A CG  1 
ATOM   131  C  CG  B MET A 1 19  ? 3.302  5.683   2.319   0.50 25.92 ? 1693 MET A CG  1 
ATOM   132  S  SD  A MET A 1 19  ? 2.875  6.114   0.822   0.50 32.98 ? 1693 MET A SD  1 
ATOM   133  S  SD  B MET A 1 19  ? 3.678  7.175   3.251   0.50 31.29 ? 1693 MET A SD  1 
ATOM   134  C  CE  A MET A 1 19  ? 3.751  7.624   0.378   0.50 29.69 ? 1693 MET A CE  1 
ATOM   135  C  CE  B MET A 1 19  ? 2.288  8.202   2.754   0.50 28.33 ? 1693 MET A CE  1 
ATOM   136  N  N   . LYS A 1 20  ? 1.937  2.131   4.928   1.00 22.13 ? 1694 LYS A N   1 
ATOM   137  C  CA  . LYS A 1 20  ? 1.123  1.236   5.757   1.00 25.31 ? 1694 LYS A CA  1 
ATOM   138  C  C   . LYS A 1 20  ? 1.669  1.024   7.171   1.00 23.34 ? 1694 LYS A C   1 
ATOM   139  O  O   . LYS A 1 20  ? 0.924  1.028   8.142   1.00 24.94 ? 1694 LYS A O   1 
ATOM   140  C  CB  . LYS A 1 20  ? 0.862  -0.099  5.047   1.00 23.85 ? 1694 LYS A CB  1 
ATOM   141  C  CG  . LYS A 1 20  ? 0.227  -1.184  5.912   1.00 31.39 ? 1694 LYS A CG  1 
ATOM   142  C  CD  . LYS A 1 20  ? 0.169  -2.530  5.160   1.00 33.31 ? 1694 LYS A CD  1 
ATOM   143  C  CE  . LYS A 1 20  ? -0.760 -3.535  5.859   1.00 45.75 ? 1694 LYS A CE  1 
ATOM   144  N  NZ  . LYS A 1 20  ? -0.906 -4.807  5.074   1.00 47.87 ? 1694 LYS A NZ  1 
ATOM   145  N  N   . LEU A 1 21  ? 2.984  0.856   7.311   1.00 23.74 ? 1695 LEU A N   1 
ATOM   146  C  CA  . LEU A 1 21  ? 3.583  0.703   8.626   1.00 25.01 ? 1695 LEU A CA  1 
ATOM   147  C  C   . LEU A 1 21  ? 3.400  1.947   9.504   1.00 24.24 ? 1695 LEU A C   1 
ATOM   148  O  O   . LEU A 1 21  ? 3.347  1.850   10.734  1.00 26.26 ? 1695 LEU A O   1 
ATOM   149  C  CB  . LEU A 1 21  ? 5.083  0.451   8.432   1.00 24.35 ? 1695 LEU A CB  1 
ATOM   150  C  CG  . LEU A 1 21  ? 5.734  -0.902  8.734   1.00 32.66 ? 1695 LEU A CG  1 
ATOM   151  C  CD1 . LEU A 1 21  ? 4.839  -2.142  8.889   1.00 27.80 ? 1695 LEU A CD1 1 
ATOM   152  C  CD2 . LEU A 1 21  ? 6.970  -1.142  7.858   1.00 25.10 ? 1695 LEU A CD2 1 
ATOM   153  N  N   . GLN A 1 22  ? 3.324  3.115   8.868   1.00 24.70 ? 1696 GLN A N   1 
ATOM   154  C  CA  . GLN A 1 22  ? 3.227  4.385   9.580   1.00 23.79 ? 1696 GLN A CA  1 
ATOM   155  C  C   . GLN A 1 22  ? 1.769  4.747   9.879   1.00 25.02 ? 1696 GLN A C   1 
ATOM   156  O  O   . GLN A 1 22  ? 1.513  5.614   10.704  1.00 27.29 ? 1696 GLN A O   1 
ATOM   157  C  CB  . GLN A 1 22  ? 3.856  5.521   8.774   1.00 23.33 ? 1696 GLN A CB  1 
ATOM   158  C  CG  . GLN A 1 22  ? 5.372  5.396   8.647   1.00 24.08 ? 1696 GLN A CG  1 
ATOM   159  C  CD  . GLN A 1 22  ? 5.949  6.477   7.756   1.00 28.47 ? 1696 GLN A CD  1 
ATOM   160  O  OE1 . GLN A 1 22  ? 5.962  6.353   6.534   1.00 30.91 ? 1696 GLN A OE1 1 
ATOM   161  N  NE2 . GLN A 1 22  ? 6.434  7.537   8.367   1.00 29.84 ? 1696 GLN A NE2 1 
ATOM   162  N  N   . ALA A 1 23  ? 0.840  4.084   9.204   1.00 25.40 ? 1697 ALA A N   1 
ATOM   163  C  CA  . ALA A 1 23  ? -0.595 4.394   9.365   1.00 27.54 ? 1697 ALA A CA  1 
ATOM   164  C  C   . ALA A 1 23  ? -1.018 4.253   10.830  1.00 28.94 ? 1697 ALA A C   1 
ATOM   165  O  O   . ALA A 1 23  ? -0.412 3.512   11.614  1.00 28.93 ? 1697 ALA A O   1 
ATOM   166  C  CB  . ALA A 1 23  ? -1.426 3.477   8.456   1.00 27.05 ? 1697 ALA A CB  1 
ATOM   167  N  N   . ASP A 1 24  ? -2.061 4.990   11.213  1.00 31.92 ? 1698 ASP A N   1 
ATOM   168  C  CA  A ASP A 1 24  ? -2.604 4.915   12.563  0.50 32.80 ? 1698 ASP A CA  1 
ATOM   169  C  CA  B ASP A 1 24  ? -2.604 4.913   12.569  0.50 32.58 ? 1698 ASP A CA  1 
ATOM   170  C  C   . ASP A 1 24  ? -1.522 5.093   13.635  1.00 32.56 ? 1698 ASP A C   1 
ATOM   171  O  O   . ASP A 1 24  ? -1.369 4.263   14.538  1.00 32.24 ? 1698 ASP A O   1 
ATOM   172  C  CB  A ASP A 1 24  ? -3.386 3.608   12.726  0.50 33.94 ? 1698 ASP A CB  1 
ATOM   173  C  CB  B ASP A 1 24  ? -3.376 3.603   12.782  0.50 33.53 ? 1698 ASP A CB  1 
ATOM   174  C  CG  A ASP A 1 24  ? -4.218 3.279   11.497  0.50 36.28 ? 1698 ASP A CG  1 
ATOM   175  C  CG  B ASP A 1 24  ? -4.082 3.549   14.130  0.50 34.88 ? 1698 ASP A CG  1 
ATOM   176  O  OD1 A ASP A 1 24  ? -3.967 2.227   10.872  0.50 39.51 ? 1698 ASP A OD1 1 
ATOM   177  O  OD1 B ASP A 1 24  ? -4.498 4.615   14.639  0.50 37.73 ? 1698 ASP A OD1 1 
ATOM   178  O  OD2 A ASP A 1 24  ? -5.119 4.078   11.146  0.50 40.05 ? 1698 ASP A OD2 1 
ATOM   179  O  OD2 B ASP A 1 24  ? -4.221 2.437   14.684  0.50 35.45 ? 1698 ASP A OD2 1 
ATOM   180  N  N   . SER A 1 25  ? -0.773 6.187   13.524  1.00 31.46 ? 1699 SER A N   1 
ATOM   181  C  CA  . SER A 1 25  ? 0.302  6.509   14.458  1.00 33.56 ? 1699 SER A CA  1 
ATOM   182  C  C   . SER A 1 25  ? 1.358  5.418   14.617  1.00 33.52 ? 1699 SER A C   1 
ATOM   183  O  O   . SER A 1 25  ? 1.647  4.975   15.731  1.00 32.53 ? 1699 SER A O   1 
ATOM   184  C  CB  . SER A 1 25  ? -0.291 6.871   15.816  1.00 34.68 ? 1699 SER A CB  1 
ATOM   185  O  OG  . SER A 1 25  ? -1.250 7.890   15.611  1.00 39.30 ? 1699 SER A OG  1 
ATOM   186  N  N   . ASN A 1 26  ? 1.936  4.997   13.494  1.00 32.39 ? 1700 ASN A N   1 
ATOM   187  C  CA  . ASN A 1 26  ? 2.961  3.955   13.495  1.00 32.00 ? 1700 ASN A CA  1 
ATOM   188  C  C   . ASN A 1 26  ? 2.465  2.653   14.149  1.00 30.53 ? 1700 ASN A C   1 
ATOM   189  O  O   . ASN A 1 26  ? 3.247  1.934   14.760  1.00 31.77 ? 1700 ASN A O   1 
ATOM   190  C  CB  . ASN A 1 26  ? 4.289  4.454   14.138  1.00 30.86 ? 1700 ASN A CB  1 
ATOM   191  C  CG  . ASN A 1 26  ? 5.020  5.522   13.301  1.00 30.26 ? 1700 ASN A CG  1 
ATOM   192  O  OD1 . ASN A 1 26  ? 5.991  6.131   13.753  1.00 35.03 ? 1700 ASN A OD1 1 
ATOM   193  N  ND2 . ASN A 1 26  ? 4.554  5.769   12.093  1.00 29.07 ? 1700 ASN A ND2 1 
ATOM   194  N  N   . TYR A 1 27  ? 1.179  2.323   14.028  1.00 30.36 ? 1701 TYR A N   1 
ATOM   195  C  CA  . TYR A 1 27  ? 0.666  1.128   14.713  1.00 31.78 ? 1701 TYR A CA  1 
ATOM   196  C  C   . TYR A 1 27  ? 1.405  -0.175  14.355  1.00 31.02 ? 1701 TYR A C   1 
ATOM   197  O  O   . TYR A 1 27  ? 1.806  -0.943  15.234  1.00 30.67 ? 1701 TYR A O   1 
ATOM   198  C  CB  . TYR A 1 27  ? -0.851 0.938   14.542  1.00 32.95 ? 1701 TYR A CB  1 
ATOM   199  C  CG  . TYR A 1 27  ? -1.257 -0.435  15.050  1.00 36.38 ? 1701 TYR A CG  1 
ATOM   200  C  CD1 . TYR A 1 27  ? -1.338 -0.695  16.417  1.00 38.64 ? 1701 TYR A CD1 1 
ATOM   201  C  CD2 . TYR A 1 27  ? -1.495 -1.484  14.167  1.00 37.10 ? 1701 TYR A CD2 1 
ATOM   202  C  CE1 . TYR A 1 27  ? -1.670 -1.952  16.887  1.00 39.59 ? 1701 TYR A CE1 1 
ATOM   203  C  CE2 . TYR A 1 27  ? -1.821 -2.743  14.626  1.00 38.48 ? 1701 TYR A CE2 1 
ATOM   204  C  CZ  . TYR A 1 27  ? -1.911 -2.971  15.990  1.00 40.70 ? 1701 TYR A CZ  1 
ATOM   205  O  OH  . TYR A 1 27  ? -2.236 -4.226  16.455  1.00 42.35 ? 1701 TYR A OH  1 
ATOM   206  N  N   . LEU A 1 28  ? 1.590  -0.445  13.065  1.00 29.43 ? 1702 LEU A N   1 
ATOM   207  C  CA  . LEU A 1 28  ? 2.234  -1.696  12.668  1.00 27.75 ? 1702 LEU A CA  1 
ATOM   208  C  C   . LEU A 1 28  ? 3.738  -1.687  12.896  1.00 26.34 ? 1702 LEU A C   1 
ATOM   209  O  O   . LEU A 1 28  ? 4.334  -2.732  13.196  1.00 26.37 ? 1702 LEU A O   1 
ATOM   210  C  CB  . LEU A 1 28  ? 1.914  -2.062  11.227  1.00 27.68 ? 1702 LEU A CB  1 
ATOM   211  C  CG  . LEU A 1 28  ? 0.527  -2.684  11.033  1.00 30.02 ? 1702 LEU A CG  1 
ATOM   212  C  CD1 . LEU A 1 28  ? 0.343  -3.035  9.569   1.00 35.24 ? 1702 LEU A CD1 1 
ATOM   213  C  CD2 . LEU A 1 28  ? 0.400  -3.921  11.910  1.00 33.71 ? 1702 LEU A CD2 1 
ATOM   214  N  N   . LEU A 1 29  ? 4.352  -0.518  12.745  1.00 25.63 ? 1703 LEU A N   1 
ATOM   215  C  CA  A LEU A 1 29  ? 5.759  -0.393  13.088  0.50 24.77 ? 1703 LEU A CA  1 
ATOM   216  C  CA  B LEU A 1 29  ? 5.768  -0.361  13.094  0.50 24.66 ? 1703 LEU A CA  1 
ATOM   217  C  C   . LEU A 1 29  ? 5.977  -0.659  14.579  1.00 24.64 ? 1703 LEU A C   1 
ATOM   218  O  O   . LEU A 1 29  ? 6.923  -1.342  14.967  1.00 23.96 ? 1703 LEU A O   1 
ATOM   219  C  CB  A LEU A 1 29  ? 6.267  0.985   12.685  0.50 24.84 ? 1703 LEU A CB  1 
ATOM   220  C  CB  B LEU A 1 29  ? 6.276  1.050   12.764  0.50 24.58 ? 1703 LEU A CB  1 
ATOM   221  C  CG  A LEU A 1 29  ? 7.777  1.143   12.777  0.50 24.37 ? 1703 LEU A CG  1 
ATOM   222  C  CG  B LEU A 1 29  ? 6.822  1.372   11.367  0.50 23.73 ? 1703 LEU A CG  1 
ATOM   223  C  CD1 A LEU A 1 29  ? 8.280  1.869   11.530  0.50 26.64 ? 1703 LEU A CD1 1 
ATOM   224  C  CD1 B LEU A 1 29  ? 6.772  2.871   11.086  0.50 21.96 ? 1703 LEU A CD1 1 
ATOM   225  C  CD2 A LEU A 1 29  ? 8.089  1.871   14.076  0.50 21.99 ? 1703 LEU A CD2 1 
ATOM   226  C  CD2 B LEU A 1 29  ? 8.242  0.872   11.185  0.50 22.58 ? 1703 LEU A CD2 1 
ATOM   227  N  N   . SER A 1 30  ? 5.098  -0.145  15.435  1.00 23.40 ? 1704 SER A N   1 
ATOM   228  C  CA  . SER A 1 30  ? 5.270  -0.386  16.869  1.00 24.44 ? 1704 SER A CA  1 
ATOM   229  C  C   . SER A 1 30  ? 5.110  -1.858  17.205  1.00 26.34 ? 1704 SER A C   1 
ATOM   230  O  O   . SER A 1 30  ? 5.853  -2.394  18.025  1.00 26.33 ? 1704 SER A O   1 
ATOM   231  C  CB  . SER A 1 30  ? 4.286  0.452   17.689  1.00 26.26 ? 1704 SER A CB  1 
ATOM   232  O  OG  . SER A 1 30  ? 4.554  1.811   17.419  1.00 29.36 ? 1704 SER A OG  1 
ATOM   233  N  N   . LYS A 1 31  ? 4.125  -2.499  16.580  1.00 25.72 ? 1705 LYS A N   1 
ATOM   234  C  CA  . LYS A 1 31  ? 3.871  -3.930  16.776  1.00 26.69 ? 1705 LYS A CA  1 
ATOM   235  C  C   . LYS A 1 31  ? 5.122  -4.745  16.428  1.00 24.85 ? 1705 LYS A C   1 
ATOM   236  O  O   . LYS A 1 31  ? 5.533  -5.639  17.167  1.00 25.57 ? 1705 LYS A O   1 
ATOM   237  C  CB  . LYS A 1 31  ? 2.672  -4.363  15.913  1.00 28.06 ? 1705 LYS A CB  1 
ATOM   238  C  CG  . LYS A 1 31  ? 2.175  -5.787  16.167  1.00 31.79 ? 1705 LYS A CG  1 
ATOM   239  C  CD  . LYS A 1 31  ? 1.097  -6.218  15.141  1.00 31.39 ? 1705 LYS A CD  1 
ATOM   240  C  CE  . LYS A 1 31  ? 0.603  -7.660  15.371  1.00 37.42 ? 1705 LYS A CE  1 
ATOM   241  N  NZ  . LYS A 1 31  ? 0.062  -8.332  14.138  1.00 39.81 ? 1705 LYS A NZ  1 
ATOM   242  N  N   . GLU A 1 32  ? 5.744  -4.430  15.298  1.00 24.96 ? 1706 GLU A N   1 
ATOM   243  C  CA  . GLU A 1 32  ? 6.992  -5.078  14.920  1.00 23.93 ? 1706 GLU A CA  1 
ATOM   244  C  C   . GLU A 1 32  ? 8.112  -4.867  15.925  1.00 22.14 ? 1706 GLU A C   1 
ATOM   245  O  O   . GLU A 1 32  ? 8.796  -5.802  16.351  1.00 22.82 ? 1706 GLU A O   1 
ATOM   246  C  CB  . GLU A 1 32  ? 7.483  -4.480  13.593  1.00 26.66 ? 1706 GLU A CB  1 
ATOM   247  C  CG  . GLU A 1 32  ? 7.295  -5.379  12.429  1.00 28.77 ? 1706 GLU A CG  1 
ATOM   248  C  CD  . GLU A 1 32  ? 7.696  -4.746  11.104  1.00 32.24 ? 1706 GLU A CD  1 
ATOM   249  O  OE1 . GLU A 1 32  ? 6.834  -4.818  10.209  1.00 29.03 ? 1706 GLU A OE1 1 
ATOM   250  O  OE2 . GLU A 1 32  ? 8.831  -4.207  10.946  1.00 26.74 ? 1706 GLU A OE2 1 
ATOM   251  N  N   . TYR A 1 33  ? 8.338  -3.604  16.279  1.00 22.08 ? 1707 TYR A N   1 
ATOM   252  C  CA  . TYR A 1 33  ? 9.432  -3.274  17.179  1.00 22.49 ? 1707 TYR A CA  1 
ATOM   253  C  C   . TYR A 1 33  ? 9.279  -4.041  18.508  1.00 22.60 ? 1707 TYR A C   1 
ATOM   254  O  O   . TYR A 1 33  ? 10.243 -4.538  19.092  1.00 22.95 ? 1707 TYR A O   1 
ATOM   255  C  CB  . TYR A 1 33  ? 9.559  -1.744  17.366  1.00 21.85 ? 1707 TYR A CB  1 
ATOM   256  C  CG  . TYR A 1 33  ? 10.780 -1.401  18.171  1.00 22.09 ? 1707 TYR A CG  1 
ATOM   257  C  CD1 . TYR A 1 33  ? 12.047 -1.555  17.607  1.00 19.95 ? 1707 TYR A CD1 1 
ATOM   258  C  CD2 . TYR A 1 33  ? 10.688 -0.969  19.489  1.00 22.18 ? 1707 TYR A CD2 1 
ATOM   259  C  CE1 . TYR A 1 33  ? 13.177 -1.280  18.321  1.00 22.56 ? 1707 TYR A CE1 1 
ATOM   260  C  CE2 . TYR A 1 33  ? 11.840 -0.694  20.229  1.00 25.15 ? 1707 TYR A CE2 1 
ATOM   261  C  CZ  . TYR A 1 33  ? 13.077 -0.847  19.623  1.00 25.25 ? 1707 TYR A CZ  1 
ATOM   262  O  OH  . TYR A 1 33  ? 14.230 -0.588  20.331  1.00 23.50 ? 1707 TYR A OH  1 
ATOM   263  N  N   . GLU A 1 34  ? 8.038  -4.162  18.964  1.00 24.21 ? 1708 GLU A N   1 
ATOM   264  C  CA  . GLU A 1 34  ? 7.744  -4.813  20.221  1.00 27.23 ? 1708 GLU A CA  1 
ATOM   265  C  C   . GLU A 1 34  ? 7.997  -6.326  20.171  1.00 25.83 ? 1708 GLU A C   1 
ATOM   266  O  O   . GLU A 1 34  ? 8.429  -6.926  21.159  1.00 25.53 ? 1708 GLU A O   1 
ATOM   267  C  CB  . GLU A 1 34  ? 6.334  -4.405  20.649  1.00 28.49 ? 1708 GLU A CB  1 
ATOM   268  C  CG  . GLU A 1 34  ? 6.368  -2.910  21.012  1.00 36.38 ? 1708 GLU A CG  1 
ATOM   269  C  CD  . GLU A 1 34  ? 5.009  -2.310  21.344  1.00 49.44 ? 1708 GLU A CD  1 
ATOM   270  O  OE1 . GLU A 1 34  ? 3.979  -2.789  20.814  1.00 55.93 ? 1708 GLU A OE1 1 
ATOM   271  O  OE2 . GLU A 1 34  ? 4.978  -1.344  22.140  1.00 53.07 ? 1708 GLU A OE2 1 
ATOM   272  N  N   . GLU A 1 35  ? 7.790  -6.906  18.991  1.00 25.11 ? 1709 GLU A N   1 
ATOM   273  C  CA  . GLU A 1 35  ? 8.045  -8.331  18.738  1.00 24.52 ? 1709 GLU A CA  1 
ATOM   274  C  C   . GLU A 1 35  ? 9.542  -8.628  18.890  1.00 24.43 ? 1709 GLU A C   1 
ATOM   275  O  O   . GLU A 1 35  ? 9.929  -9.756  19.182  1.00 25.34 ? 1709 GLU A O   1 
ATOM   276  C  CB  . GLU A 1 35  ? 7.595  -8.672  17.311  1.00 25.24 ? 1709 GLU A CB  1 
ATOM   277  C  CG  . GLU A 1 35  ? 7.305  -10.138 17.040  1.00 35.30 ? 1709 GLU A CG  1 
ATOM   278  C  CD  . GLU A 1 35  ? 6.417  -10.772 18.107  1.00 42.54 ? 1709 GLU A CD  1 
ATOM   279  O  OE1 . GLU A 1 35  ? 5.329  -10.230 18.394  1.00 43.12 ? 1709 GLU A OE1 1 
ATOM   280  O  OE2 . GLU A 1 35  ? 6.824  -11.806 18.676  1.00 44.27 ? 1709 GLU A OE2 1 
ATOM   281  N  N   . LEU A 1 36  ? 10.391 -7.623  18.669  1.00 22.11 ? 1710 LEU A N   1 
ATOM   282  C  CA  . LEU A 1 36  ? 11.842 -7.782  18.834  1.00 21.37 ? 1710 LEU A CA  1 
ATOM   283  C  C   . LEU A 1 36  ? 12.272 -7.722  20.308  1.00 21.57 ? 1710 LEU A C   1 
ATOM   284  O  O   . LEU A 1 36  ? 13.414 -8.015  20.650  1.00 22.10 ? 1710 LEU A O   1 
ATOM   285  C  CB  . LEU A 1 36  ? 12.591 -6.666  18.068  1.00 21.63 ? 1710 LEU A CB  1 
ATOM   286  C  CG  . LEU A 1 36  ? 12.468 -6.745  16.540  1.00 25.95 ? 1710 LEU A CG  1 
ATOM   287  C  CD1 . LEU A 1 36  ? 12.881 -5.410  15.935  1.00 24.54 ? 1710 LEU A CD1 1 
ATOM   288  C  CD2 . LEU A 1 36  ? 13.365 -7.835  15.962  1.00 23.79 ? 1710 LEU A CD2 1 
ATOM   289  N  N   . LYS A 1 37  ? 11.347 -7.341  21.194  1.00 23.25 ? 1711 LYS A N   1 
ATOM   290  C  CA  . LYS A 1 37  ? 11.749 -7.005  22.560  1.00 25.18 ? 1711 LYS A CA  1 
ATOM   291  C  C   . LYS A 1 37  ? 12.555 -8.090  23.282  1.00 22.12 ? 1711 LYS A C   1 
ATOM   292  O  O   . LYS A 1 37  ? 13.557 -7.796  23.945  1.00 24.05 ? 1711 LYS A O   1 
ATOM   293  C  CB  . LYS A 1 37  ? 10.557 -6.514  23.399  1.00 24.36 ? 1711 LYS A CB  1 
ATOM   294  C  CG  . LYS A 1 37  ? 10.844 -6.381  24.889  1.00 30.74 ? 1711 LYS A CG  1 
ATOM   295  C  CD  . LYS A 1 37  ? 9.607  -5.894  25.637  1.00 33.80 ? 1711 LYS A CD  1 
ATOM   296  C  CE  . LYS A 1 37  ? 9.489  -4.368  25.547  1.00 42.27 ? 1711 LYS A CE  1 
ATOM   297  N  NZ  . LYS A 1 37  ? 8.107  -3.926  25.174  1.00 46.35 ? 1711 LYS A NZ  1 
ATOM   298  N  N   . ASP A 1 38  ? 12.160 -9.350  23.144  1.00 21.14 ? 1712 ASP A N   1 
ATOM   299  C  CA  . ASP A 1 38  ? 12.788 -10.436 23.896  1.00 22.40 ? 1712 ASP A CA  1 
ATOM   300  C  C   . ASP A 1 38  ? 13.770 -11.272 23.071  1.00 21.93 ? 1712 ASP A C   1 
ATOM   301  O  O   . ASP A 1 38  ? 14.305 -12.271 23.546  1.00 22.50 ? 1712 ASP A O   1 
ATOM   302  C  CB  . ASP A 1 38  ? 11.717 -11.368 24.496  1.00 22.53 ? 1712 ASP A CB  1 
ATOM   303  C  CG  . ASP A 1 38  ? 10.942 -10.723 25.648  1.00 29.69 ? 1712 ASP A CG  1 
ATOM   304  O  OD1 . ASP A 1 38  ? 11.538 -9.968  26.452  1.00 34.79 ? 1712 ASP A OD1 1 
ATOM   305  O  OD2 . ASP A 1 38  ? 9.716  -10.990 25.753  1.00 33.04 ? 1712 ASP A OD2 1 
ATOM   306  N  N   . VAL A 1 39  ? 14.041 -10.856 21.839  1.00 22.12 ? 1713 VAL A N   1 
ATOM   307  C  CA  . VAL A 1 39  ? 14.980 -11.618 21.018  1.00 21.56 ? 1713 VAL A CA  1 
ATOM   308  C  C   . VAL A 1 39  ? 16.370 -11.636 21.649  1.00 22.96 ? 1713 VAL A C   1 
ATOM   309  O  O   . VAL A 1 39  ? 16.907 -10.607 22.074  1.00 22.07 ? 1713 VAL A O   1 
ATOM   310  C  CB  . VAL A 1 39  ? 15.102 -11.046 19.584  1.00 20.09 ? 1713 VAL A CB  1 
ATOM   311  C  CG1 . VAL A 1 39  ? 16.255 -11.746 18.822  1.00 23.06 ? 1713 VAL A CG1 1 
ATOM   312  C  CG2 . VAL A 1 39  ? 13.760 -11.105 18.835  1.00 21.21 ? 1713 VAL A CG2 1 
ATOM   313  N  N   . GLY A 1 40  ? 16.952 -12.826 21.700  1.00 24.08 ? 1714 GLY A N   1 
ATOM   314  C  CA  . GLY A 1 40  ? 18.294 -13.000 22.231  1.00 23.39 ? 1714 GLY A CA  1 
ATOM   315  C  C   . GLY A 1 40  ? 18.349 -13.171 23.740  1.00 25.89 ? 1714 GLY A C   1 
ATOM   316  O  O   . GLY A 1 40  ? 19.384 -13.590 24.268  1.00 24.38 ? 1714 GLY A O   1 
ATOM   317  N  N   . ARG A 1 41  ? 17.263 -12.844 24.443  1.00 25.61 ? 1715 ARG A N   1 
ATOM   318  C  CA  . ARG A 1 41  ? 17.326 -12.687 25.896  1.00 28.56 ? 1715 ARG A CA  1 
ATOM   319  C  C   . ARG A 1 41  ? 17.364 -14.028 26.637  1.00 31.00 ? 1715 ARG A C   1 
ATOM   320  O  O   . ARG A 1 41  ? 17.435 -14.072 27.868  1.00 32.72 ? 1715 ARG A O   1 
ATOM   321  C  CB  . ARG A 1 41  ? 16.178 -11.813 26.411  1.00 27.01 ? 1715 ARG A CB  1 
ATOM   322  C  CG  . ARG A 1 41  ? 16.306 -10.354 26.085  1.00 28.84 ? 1715 ARG A CG  1 
ATOM   323  C  CD  . ARG A 1 41  ? 17.347 -9.749  26.984  1.00 35.03 ? 1715 ARG A CD  1 
ATOM   324  N  NE  . ARG A 1 41  ? 17.204 -8.307  26.941  1.00 41.98 ? 1715 ARG A NE  1 
ATOM   325  C  CZ  . ARG A 1 41  ? 17.633 -7.474  27.877  1.00 43.26 ? 1715 ARG A CZ  1 
ATOM   326  N  NH1 . ARG A 1 41  ? 18.242 -7.935  28.963  1.00 43.87 ? 1715 ARG A NH1 1 
ATOM   327  N  NH2 . ARG A 1 41  ? 17.443 -6.173  27.707  1.00 44.76 ? 1715 ARG A NH2 1 
ATOM   328  N  N   . ASN A 1 42  ? 17.349 -15.112 25.873  1.00 31.52 ? 1716 ASN A N   1 
ATOM   329  C  CA  . ASN A 1 42  ? 17.487 -16.464 26.405  1.00 34.26 ? 1716 ASN A CA  1 
ATOM   330  C  C   . ASN A 1 42  ? 18.948 -16.924 26.471  1.00 32.99 ? 1716 ASN A C   1 
ATOM   331  O  O   . ASN A 1 42  ? 19.246 -18.103 26.270  1.00 34.62 ? 1716 ASN A O   1 
ATOM   332  C  CB  . ASN A 1 42  ? 16.676 -17.426 25.536  1.00 34.59 ? 1716 ASN A CB  1 
ATOM   333  C  CG  . ASN A 1 42  ? 17.146 -17.469 24.075  1.00 40.38 ? 1716 ASN A CG  1 
ATOM   334  O  OD1 . ASN A 1 42  ? 17.789 -16.540 23.552  1.00 40.50 ? 1716 ASN A OD1 1 
ATOM   335  N  ND2 . ASN A 1 42  ? 16.804 -18.565 23.401  1.00 42.64 ? 1716 ASN A ND2 1 
ATOM   336  N  N   . GLN A 1 43  ? 19.837 -15.978 26.733  1.00 29.37 ? 1717 GLN A N   1 
ATOM   337  C  CA  . GLN A 1 43  ? 21.241 -16.269 26.836  1.00 28.84 ? 1717 GLN A CA  1 
ATOM   338  C  C   . GLN A 1 43  ? 21.775 -15.739 28.148  1.00 27.30 ? 1717 GLN A C   1 
ATOM   339  O  O   . GLN A 1 43  ? 21.271 -14.768 28.676  1.00 28.16 ? 1717 GLN A O   1 
ATOM   340  C  CB  . GLN A 1 43  ? 21.997 -15.653 25.662  1.00 25.97 ? 1717 GLN A CB  1 
ATOM   341  C  CG  . GLN A 1 43  ? 21.707 -16.312 24.369  1.00 30.84 ? 1717 GLN A CG  1 
ATOM   342  C  CD  . GLN A 1 43  ? 22.304 -15.596 23.202  1.00 31.69 ? 1717 GLN A CD  1 
ATOM   343  O  OE1 . GLN A 1 43  ? 23.278 -16.049 22.619  1.00 35.59 ? 1717 GLN A OE1 1 
ATOM   344  N  NE2 . GLN A 1 43  ? 21.719 -14.476 22.847  1.00 27.26 ? 1717 GLN A NE2 1 
ATOM   345  N  N   . SER A 1 44  ? 22.801 -16.407 28.666  1.00 28.58 ? 1718 SER A N   1 
ATOM   346  C  CA  . SER A 1 44  ? 23.418 -16.021 29.924  1.00 27.55 ? 1718 SER A CA  1 
ATOM   347  C  C   . SER A 1 44  ? 24.330 -14.794 29.811  1.00 27.64 ? 1718 SER A C   1 
ATOM   348  O  O   . SER A 1 44  ? 24.986 -14.600 28.812  1.00 26.77 ? 1718 SER A O   1 
ATOM   349  C  CB  . SER A 1 44  ? 24.180 -17.183 30.554  1.00 29.67 ? 1718 SER A CB  1 
ATOM   350  O  OG  . SER A 1 44  ? 24.833 -17.975 29.591  1.00 32.74 ? 1718 SER A OG  1 
ATOM   351  N  N   . CYS A 1 45  ? 24.322 -13.967 30.853  1.00 26.80 ? 1719 CYS A N   1 
ATOM   352  C  CA  . CYS A 1 45  ? 25.311 -12.907 31.018  1.00 28.67 ? 1719 CYS A CA  1 
ATOM   353  C  C   . CYS A 1 45  ? 26.136 -13.144 32.278  1.00 28.95 ? 1719 CYS A C   1 
ATOM   354  O  O   . CYS A 1 45  ? 26.325 -12.242 33.094  1.00 29.06 ? 1719 CYS A O   1 
ATOM   355  C  CB  . CYS A 1 45  ? 24.625 -11.541 31.087  1.00 23.10 ? 1719 CYS A CB  1 
ATOM   356  S  SG  . CYS A 1 45  ? 23.000 -11.480 30.298  1.00 33.21 ? 1719 CYS A SG  1 
ATOM   357  N  N   . ASP A 1 46  ? 26.623 -14.371 32.422  1.00 29.84 ? 1720 ASP A N   1 
ATOM   358  C  CA  . ASP A 1 46  ? 27.224 -14.851 33.680  1.00 29.59 ? 1720 ASP A CA  1 
ATOM   359  C  C   . ASP A 1 46  ? 28.595 -14.230 33.977  1.00 28.97 ? 1720 ASP A C   1 
ATOM   360  O  O   . ASP A 1 46  ? 28.804 -13.693 35.048  1.00 29.55 ? 1720 ASP A O   1 
ATOM   361  C  CB  . ASP A 1 46  ? 27.381 -16.372 33.692  1.00 30.51 ? 1720 ASP A CB  1 
ATOM   362  C  CG  . ASP A 1 46  ? 26.107 -17.090 34.077  1.00 32.91 ? 1720 ASP A CG  1 
ATOM   363  O  OD1 . ASP A 1 46  ? 25.227 -16.450 34.666  1.00 34.81 ? 1720 ASP A OD1 1 
ATOM   364  O  OD2 . ASP A 1 46  ? 26.004 -18.294 33.783  1.00 39.90 ? 1720 ASP A OD2 1 
ATOM   365  N  N   . ILE A 1 47  ? 29.527 -14.344 33.037  1.00 26.72 ? 1721 ILE A N   1 
ATOM   366  C  CA  . ILE A 1 47  ? 30.858 -13.756 33.234  1.00 24.71 ? 1721 ILE A CA  1 
ATOM   367  C  C   . ILE A 1 47  ? 30.755 -12.254 33.508  1.00 25.33 ? 1721 ILE A C   1 
ATOM   368  O  O   . ILE A 1 47  ? 31.384 -11.704 34.431  1.00 23.63 ? 1721 ILE A O   1 
ATOM   369  C  CB  . ILE A 1 47  ? 31.764 -14.037 32.033  1.00 27.05 ? 1721 ILE A CB  1 
ATOM   370  C  CG1 . ILE A 1 47  ? 31.805 -15.541 31.739  1.00 28.59 ? 1721 ILE A CG1 1 
ATOM   371  C  CG2 . ILE A 1 47  ? 33.148 -13.466 32.274  1.00 29.05 ? 1721 ILE A CG2 1 
ATOM   372  C  CD1 . ILE A 1 47  ? 32.523 -16.358 32.811  1.00 27.54 ? 1721 ILE A CD1 1 
ATOM   373  N  N   . ALA A 1 48  ? 29.941 -11.571 32.706  1.00 23.29 ? 1722 ALA A N   1 
ATOM   374  C  CA  . ALA A 1 48  ? 29.685 -10.155 32.943  1.00 23.02 ? 1722 ALA A CA  1 
ATOM   375  C  C   . ALA A 1 48  ? 29.121 -9.765  34.307  1.00 23.13 ? 1722 ALA A C   1 
ATOM   376  O  O   . ALA A 1 48  ? 29.318 -8.634  34.753  1.00 21.30 ? 1722 ALA A O   1 
ATOM   377  C  CB  . ALA A 1 48  ? 28.813 -9.558  31.805  1.00 20.89 ? 1722 ALA A CB  1 
ATOM   378  N  N   . LEU A 1 49  ? 28.421 -10.692 34.968  1.00 25.06 ? 1723 LEU A N   1 
ATOM   379  C  CA  . LEU A 1 49  ? 27.745 -10.407 36.233  1.00 25.55 ? 1723 LEU A CA  1 
ATOM   380  C  C   . LEU A 1 49  ? 28.632 -10.726 37.452  1.00 26.74 ? 1723 LEU A C   1 
ATOM   381  O  O   . LEU A 1 49  ? 28.267 -10.411 38.587  1.00 28.44 ? 1723 LEU A O   1 
ATOM   382  C  CB  . LEU A 1 49  ? 26.436 -11.210 36.334  1.00 27.74 ? 1723 LEU A CB  1 
ATOM   383  C  CG  . LEU A 1 49  ? 25.170 -10.667 35.658  1.00 26.76 ? 1723 LEU A CG  1 
ATOM   384  C  CD1 . LEU A 1 49  ? 24.112 -11.745 35.540  1.00 30.99 ? 1723 LEU A CD1 1 
ATOM   385  C  CD2 . LEU A 1 49  ? 24.642 -9.476  36.443  1.00 32.48 ? 1723 LEU A CD2 1 
ATOM   386  N  N   . LEU A 1 50  ? 29.792 -11.342 37.214  1.00 25.80 ? 1724 LEU A N   1 
ATOM   387  C  CA  . LEU A 1 50  ? 30.775 -11.557 38.297  1.00 25.39 ? 1724 LEU A CA  1 
ATOM   388  C  C   . LEU A 1 50  ? 31.151 -10.286 39.046  1.00 26.80 ? 1724 LEU A C   1 
ATOM   389  O  O   . LEU A 1 50  ? 31.401 -9.228  38.456  1.00 26.71 ? 1724 LEU A O   1 
ATOM   390  C  CB  . LEU A 1 50  ? 32.004 -12.339 37.823  1.00 26.01 ? 1724 LEU A CB  1 
ATOM   391  C  CG  . LEU A 1 50  ? 31.729 -13.783 37.372  1.00 27.24 ? 1724 LEU A CG  1 
ATOM   392  C  CD1 . LEU A 1 50  ? 32.827 -14.376 36.517  1.00 26.96 ? 1724 LEU A CD1 1 
ATOM   393  C  CD2 . LEU A 1 50  ? 31.403 -14.721 38.536  1.00 27.21 ? 1724 LEU A CD2 1 
ATOM   394  N  N   . PRO A 1 51  ? 31.200 -10.356 40.380  1.00 26.83 ? 1725 PRO A N   1 
ATOM   395  C  CA  . PRO A 1 51  ? 31.558 -9.166  41.140  1.00 26.67 ? 1725 PRO A CA  1 
ATOM   396  C  C   . PRO A 1 51  ? 32.878 -8.549  40.665  1.00 25.59 ? 1725 PRO A C   1 
ATOM   397  O  O   . PRO A 1 51  ? 33.018 -7.330  40.705  1.00 26.99 ? 1725 PRO A O   1 
ATOM   398  C  CB  . PRO A 1 51  ? 31.688 -9.683  42.583  1.00 28.09 ? 1725 PRO A CB  1 
ATOM   399  C  CG  . PRO A 1 51  ? 30.889 -10.909 42.627  1.00 28.91 ? 1725 PRO A CG  1 
ATOM   400  C  CD  . PRO A 1 51  ? 30.905 -11.517 41.244  1.00 27.63 ? 1725 PRO A CD  1 
ATOM   401  N  N   . GLU A 1 52  ? 33.822 -9.367  40.211  1.00 25.68 ? 1726 GLU A N   1 
ATOM   402  C  CA  . GLU A 1 52  ? 35.128 -8.849  39.812  1.00 26.91 ? 1726 GLU A CA  1 
ATOM   403  C  C   . GLU A 1 52  ? 35.051 -8.073  38.495  1.00 26.21 ? 1726 GLU A C   1 
ATOM   404  O  O   . GLU A 1 52  ? 35.985 -7.339  38.153  1.00 28.07 ? 1726 GLU A O   1 
ATOM   405  C  CB  . GLU A 1 52  ? 36.161 -9.968  39.682  1.00 27.93 ? 1726 GLU A CB  1 
ATOM   406  C  CG  . GLU A 1 52  ? 36.017 -10.840 38.463  1.00 31.75 ? 1726 GLU A CG  1 
ATOM   407  C  CD  . GLU A 1 52  ? 36.142 -12.311 38.770  1.00 42.85 ? 1726 GLU A CD  1 
ATOM   408  O  OE1 . GLU A 1 52  ? 36.837 -13.017 38.001  1.00 46.03 ? 1726 GLU A OE1 1 
ATOM   409  O  OE2 . GLU A 1 52  ? 35.531 -12.753 39.769  1.00 45.88 ? 1726 GLU A OE2 1 
ATOM   410  N  N   . ASN A 1 53  ? 33.941 -8.244  37.773  1.00 25.35 ? 1727 ASN A N   1 
ATOM   411  C  CA  . ASN A 1 53  ? 33.762 -7.574  36.481  1.00 24.52 ? 1727 ASN A CA  1 
ATOM   412  C  C   . ASN A 1 53  ? 32.791 -6.402  36.540  1.00 25.30 ? 1727 ASN A C   1 
ATOM   413  O  O   . ASN A 1 53  ? 32.613 -5.665  35.560  1.00 24.83 ? 1727 ASN A O   1 
ATOM   414  C  CB  . ASN A 1 53  ? 33.288 -8.601  35.458  1.00 24.54 ? 1727 ASN A CB  1 
ATOM   415  C  CG  . ASN A 1 53  ? 34.394 -9.559  35.060  1.00 24.28 ? 1727 ASN A CG  1 
ATOM   416  O  OD1 . ASN A 1 53  ? 35.565 -9.177  35.061  1.00 23.10 ? 1727 ASN A OD1 1 
ATOM   417  N  ND2 . ASN A 1 53  ? 34.034 -10.791 34.700  1.00 22.47 ? 1727 ASN A ND2 1 
ATOM   418  N  N   . ARG A 1 54  ? 32.160 -6.240  37.698  1.00 27.46 ? 1728 ARG A N   1 
ATOM   419  C  CA  . ARG A 1 54  ? 31.154 -5.198  37.921  1.00 29.72 ? 1728 ARG A CA  1 
ATOM   420  C  C   . ARG A 1 54  ? 31.638 -3.803  37.516  1.00 27.35 ? 1728 ARG A C   1 
ATOM   421  O  O   . ARG A 1 54  ? 30.937 -3.084  36.801  1.00 29.21 ? 1728 ARG A O   1 
ATOM   422  C  CB  . ARG A 1 54  ? 30.740 -5.224  39.402  1.00 30.31 ? 1728 ARG A CB  1 
ATOM   423  C  CG  . ARG A 1 54  ? 29.290 -4.938  39.745  1.00 35.07 ? 1728 ARG A CG  1 
ATOM   424  C  CD  . ARG A 1 54  ? 29.103 -5.094  41.270  1.00 37.25 ? 1728 ARG A CD  1 
ATOM   425  N  NE  . ARG A 1 54  ? 27.815 -4.620  41.781  1.00 49.38 ? 1728 ARG A NE  1 
ATOM   426  C  CZ  . ARG A 1 54  ? 27.320 -4.928  42.979  1.00 53.98 ? 1728 ARG A CZ  1 
ATOM   427  N  NH1 . ARG A 1 54  ? 26.136 -4.456  43.354  1.00 54.22 ? 1728 ARG A NH1 1 
ATOM   428  N  NH2 . ARG A 1 54  ? 28.004 -5.711  43.809  1.00 57.96 ? 1728 ARG A NH2 1 
ATOM   429  N  N   . GLY A 1 55  ? 32.836 -3.421  37.957  1.00 24.39 ? 1729 GLY A N   1 
ATOM   430  C  CA  . GLY A 1 55  ? 33.366 -2.085  37.695  1.00 24.99 ? 1729 GLY A CA  1 
ATOM   431  C  C   . GLY A 1 55  ? 33.864 -1.895  36.259  1.00 22.76 ? 1729 GLY A C   1 
ATOM   432  O  O   . GLY A 1 55  ? 34.243 -0.783  35.885  1.00 24.99 ? 1729 GLY A O   1 
ATOM   433  N  N   . LYS A 1 56  ? 33.855 -2.970  35.470  1.00 22.20 ? 1730 LYS A N   1 
ATOM   434  C  CA  . LYS A 1 56  ? 34.241 -2.918  34.054  1.00 19.55 ? 1730 LYS A CA  1 
ATOM   435  C  C   . LYS A 1 56  ? 33.038 -2.653  33.130  1.00 19.46 ? 1730 LYS A C   1 
ATOM   436  O  O   . LYS A 1 56  ? 33.205 -2.517  31.926  1.00 18.62 ? 1730 LYS A O   1 
ATOM   437  C  CB  . LYS A 1 56  ? 34.972 -4.203  33.633  1.00 19.89 ? 1730 LYS A CB  1 
ATOM   438  C  CG  . LYS A 1 56  ? 36.331 -4.373  34.352  1.00 19.91 ? 1730 LYS A CG  1 
ATOM   439  C  CD  . LYS A 1 56  ? 36.898 -5.757  34.076  1.00 27.80 ? 1730 LYS A CD  1 
ATOM   440  C  CE  . LYS A 1 56  ? 38.038 -6.037  35.052  1.00 35.37 ? 1730 LYS A CE  1 
ATOM   441  N  NZ  . LYS A 1 56  ? 38.479 -7.461  34.989  1.00 43.07 ? 1730 LYS A NZ  1 
ATOM   442  N  N   . ASN A 1 57  ? 31.838 -2.570  33.693  1.00 18.79 ? 1731 ASN A N   1 
ATOM   443  C  CA  . ASN A 1 57  ? 30.625 -2.292  32.930  1.00 18.54 ? 1731 ASN A CA  1 
ATOM   444  C  C   . ASN A 1 57  ? 30.150 -0.851  33.132  1.00 19.98 ? 1731 ASN A C   1 
ATOM   445  O  O   . ASN A 1 57  ? 30.008 -0.383  34.262  1.00 21.59 ? 1731 ASN A O   1 
ATOM   446  C  CB  . ASN A 1 57  ? 29.512 -3.285  33.334  1.00 19.75 ? 1731 ASN A CB  1 
ATOM   447  C  CG  . ASN A 1 57  ? 29.889 -4.726  33.024  1.00 18.74 ? 1731 ASN A CG  1 
ATOM   448  O  OD1 . ASN A 1 57  ? 30.354 -5.022  31.937  1.00 20.23 ? 1731 ASN A OD1 1 
ATOM   449  N  ND2 . ASN A 1 57  ? 29.686 -5.628  33.979  1.00 20.07 ? 1731 ASN A ND2 1 
ATOM   450  N  N   . ARG A 1 58  ? 29.966 -0.097  32.047  1.00 18.74 ? 1732 ARG A N   1 
ATOM   451  C  CA  . ARG A 1 58  ? 29.525 1.282   32.212  1.00 20.14 ? 1732 ARG A CA  1 
ATOM   452  C  C   . ARG A 1 58  ? 28.095 1.358   32.761  1.00 21.41 ? 1732 ARG A C   1 
ATOM   453  O  O   . ARG A 1 58  ? 27.811 2.214   33.613  1.00 20.92 ? 1732 ARG A O   1 
ATOM   454  C  CB  . ARG A 1 58  ? 29.667 2.039   30.885  1.00 19.85 ? 1732 ARG A CB  1 
ATOM   455  C  CG  . ARG A 1 58  ? 29.159 3.463   30.888  1.00 18.66 ? 1732 ARG A CG  1 
ATOM   456  C  CD  . ARG A 1 58  ? 29.505 4.182   29.553  1.00 18.69 ? 1732 ARG A CD  1 
ATOM   457  N  NE  . ARG A 1 58  ? 30.928 4.452   29.376  1.00 17.20 ? 1732 ARG A NE  1 
ATOM   458  C  CZ  . ARG A 1 58  ? 31.567 5.467   29.956  1.00 17.50 ? 1732 ARG A CZ  1 
ATOM   459  N  NH1 . ARG A 1 58  ? 30.916 6.304   30.772  1.00 21.30 ? 1732 ARG A NH1 1 
ATOM   460  N  NH2 . ARG A 1 58  ? 32.858 5.671   29.743  1.00 18.82 ? 1732 ARG A NH2 1 
ATOM   461  N  N   . TYR A 1 59  ? 27.236 0.463   32.270  1.00 21.02 ? 1733 TYR A N   1 
ATOM   462  C  CA  . TYR A 1 59  ? 25.822 0.407   32.608  1.00 22.98 ? 1733 TYR A CA  1 
ATOM   463  C  C   . TYR A 1 59  ? 25.565 -1.036  33.053  1.00 25.35 ? 1733 TYR A C   1 
ATOM   464  O  O   . TYR A 1 59  ? 25.780 -1.974  32.281  1.00 26.79 ? 1733 TYR A O   1 
ATOM   465  C  CB  . TYR A 1 59  ? 24.963 0.734   31.384  1.00 21.94 ? 1733 TYR A CB  1 
ATOM   466  C  CG  . TYR A 1 59  ? 25.247 2.104   30.816  1.00 21.13 ? 1733 TYR A CG  1 
ATOM   467  C  CD1 . TYR A 1 59  ? 24.885 3.248   31.516  1.00 22.48 ? 1733 TYR A CD1 1 
ATOM   468  C  CD2 . TYR A 1 59  ? 25.896 2.258   29.591  1.00 18.90 ? 1733 TYR A CD2 1 
ATOM   469  C  CE1 . TYR A 1 59  ? 25.145 4.517   31.026  1.00 22.66 ? 1733 TYR A CE1 1 
ATOM   470  C  CE2 . TYR A 1 59  ? 26.162 3.532   29.079  1.00 19.80 ? 1733 TYR A CE2 1 
ATOM   471  C  CZ  . TYR A 1 59  ? 25.780 4.654   29.800  1.00 21.53 ? 1733 TYR A CZ  1 
ATOM   472  O  OH  . TYR A 1 59  ? 26.027 5.938   29.314  1.00 21.22 ? 1733 TYR A OH  1 
ATOM   473  N  N   . ASN A 1 60  ? 25.137 -1.217  34.299  1.00 26.91 ? 1734 ASN A N   1 
ATOM   474  C  CA  A ASN A 1 60  ? 25.020 -2.575  34.813  0.50 29.00 ? 1734 ASN A CA  1 
ATOM   475  C  CA  B ASN A 1 60  ? 24.924 -2.539  34.895  0.50 28.40 ? 1734 ASN A CA  1 
ATOM   476  C  C   . ASN A 1 60  ? 23.890 -3.420  34.195  1.00 29.60 ? 1734 ASN A C   1 
ATOM   477  O  O   . ASN A 1 60  ? 23.914 -4.649  34.320  1.00 29.48 ? 1734 ASN A O   1 
ATOM   478  C  CB  A ASN A 1 60  ? 25.032 -2.581  36.349  0.50 30.40 ? 1734 ASN A CB  1 
ATOM   479  C  CB  B ASN A 1 60  ? 24.594 -2.423  36.400  0.50 28.59 ? 1734 ASN A CB  1 
ATOM   480  C  CG  A ASN A 1 60  ? 26.371 -2.122  36.922  0.50 31.02 ? 1734 ASN A CG  1 
ATOM   481  C  CG  B ASN A 1 60  ? 23.283 -1.695  36.690  0.50 26.69 ? 1734 ASN A CG  1 
ATOM   482  O  OD1 A ASN A 1 60  ? 27.422 -2.701  36.634  0.50 31.44 ? 1734 ASN A OD1 1 
ATOM   483  O  OD1 B ASN A 1 60  ? 22.469 -1.447  35.805  0.50 28.84 ? 1734 ASN A OD1 1 
ATOM   484  N  ND2 A ASN A 1 60  ? 26.340 -1.068  37.736  0.50 36.53 ? 1734 ASN A ND2 1 
ATOM   485  N  ND2 B ASN A 1 60  ? 23.077 -1.354  37.958  0.50 30.62 ? 1734 ASN A ND2 1 
ATOM   486  N  N   . ASN A 1 61  ? 22.946 -2.790  33.490  1.00 29.23 ? 1735 ASN A N   1 
ATOM   487  C  CA  . ASN A 1 61  ? 21.924 -3.516  32.708  1.00 30.32 ? 1735 ASN A CA  1 
ATOM   488  C  C   . ASN A 1 61  ? 22.356 -3.913  31.290  1.00 28.58 ? 1735 ASN A C   1 
ATOM   489  O  O   . ASN A 1 61  ? 21.716 -4.730  30.627  1.00 29.70 ? 1735 ASN A O   1 
ATOM   490  C  CB  . ASN A 1 61  ? 20.594 -2.745  32.693  1.00 30.42 ? 1735 ASN A CB  1 
ATOM   491  C  CG  . ASN A 1 61  ? 20.671 -1.427  31.924  1.00 36.58 ? 1735 ASN A CG  1 
ATOM   492  O  OD1 . ASN A 1 61  ? 21.695 -0.742  31.947  1.00 39.15 ? 1735 ASN A OD1 1 
ATOM   493  N  ND2 . ASN A 1 61  ? 19.576 -1.060  31.251  1.00 42.54 ? 1735 ASN A ND2 1 
ATOM   494  N  N   . ILE A 1 62  ? 23.458 -3.333  30.820  1.00 25.15 ? 1736 ILE A N   1 
ATOM   495  C  CA  . ILE A 1 62  ? 23.913 -3.562  29.450  1.00 23.31 ? 1736 ILE A CA  1 
ATOM   496  C  C   . ILE A 1 62  ? 25.195 -4.400  29.456  1.00 23.75 ? 1736 ILE A C   1 
ATOM   497  O  O   . ILE A 1 62  ? 26.296 -3.855  29.585  1.00 23.55 ? 1736 ILE A O   1 
ATOM   498  C  CB  . ILE A 1 62  ? 24.154 -2.218  28.690  1.00 22.96 ? 1736 ILE A CB  1 
ATOM   499  C  CG1 . ILE A 1 62  ? 22.936 -1.284  28.753  1.00 23.15 ? 1736 ILE A CG1 1 
ATOM   500  C  CG2 . ILE A 1 62  ? 24.556 -2.481  27.243  1.00 21.91 ? 1736 ILE A CG2 1 
ATOM   501  C  CD1 . ILE A 1 62  ? 21.794 -1.652  27.788  1.00 23.01 ? 1736 ILE A CD1 1 
ATOM   502  N  N   . LEU A 1 63  ? 25.027 -5.717  29.315  1.00 19.51 ? 1737 LEU A N   1 
ATOM   503  C  CA  . LEU A 1 63  ? 26.076 -6.717  29.499  1.00 18.63 ? 1737 LEU A CA  1 
ATOM   504  C  C   . LEU A 1 63  ? 26.178 -7.649  28.309  1.00 17.12 ? 1737 LEU A C   1 
ATOM   505  O  O   . LEU A 1 63  ? 25.145 -7.953  27.681  1.00 20.68 ? 1737 LEU A O   1 
ATOM   506  C  CB  . LEU A 1 63  ? 25.741 -7.593  30.722  1.00 17.43 ? 1737 LEU A CB  1 
ATOM   507  C  CG  . LEU A 1 63  ? 25.483 -6.824  32.016  1.00 19.72 ? 1737 LEU A CG  1 
ATOM   508  C  CD1 . LEU A 1 63  ? 25.263 -7.890  33.097  1.00 21.34 ? 1737 LEU A CD1 1 
ATOM   509  C  CD2 . LEU A 1 63  ? 26.652 -5.898  32.391  1.00 19.09 ? 1737 LEU A CD2 1 
ATOM   510  N  N   . PRO A 1 64  ? 27.389 -8.098  27.953  1.00 19.58 ? 1738 PRO A N   1 
ATOM   511  C  CA  . PRO A 1 64  ? 27.559 -8.997  26.817  1.00 19.01 ? 1738 PRO A CA  1 
ATOM   512  C  C   . PRO A 1 64  ? 27.145 -10.409 27.219  1.00 21.04 ? 1738 PRO A C   1 
ATOM   513  O  O   . PRO A 1 64  ? 27.402 -10.827 28.347  1.00 21.29 ? 1738 PRO A O   1 
ATOM   514  C  CB  . PRO A 1 64  ? 29.069 -9.033  26.599  1.00 19.08 ? 1738 PRO A CB  1 
ATOM   515  C  CG  . PRO A 1 64  ? 29.631 -8.781  28.016  1.00 19.85 ? 1738 PRO A CG  1 
ATOM   516  C  CD  . PRO A 1 64  ? 28.688 -7.756  28.573  1.00 17.77 ? 1738 PRO A CD  1 
ATOM   517  N  N   . TYR A 1 65  ? 26.534 -11.121 26.286  1.00 21.84 ? 1739 TYR A N   1 
ATOM   518  C  CA  . TYR A 1 65  ? 26.230 -12.546 26.500  1.00 19.77 ? 1739 TYR A CA  1 
ATOM   519  C  C   . TYR A 1 65  ? 27.488 -13.402 26.540  1.00 22.30 ? 1739 TYR A C   1 
ATOM   520  O  O   . TYR A 1 65  ? 28.476 -13.139 25.852  1.00 20.93 ? 1739 TYR A O   1 
ATOM   521  C  CB  . TYR A 1 65  ? 25.277 -13.048 25.405  1.00 21.98 ? 1739 TYR A CB  1 
ATOM   522  C  CG  . TYR A 1 65  ? 23.932 -12.350 25.322  1.00 18.63 ? 1739 TYR A CG  1 
ATOM   523  C  CD1 . TYR A 1 65  ? 23.092 -12.286 26.430  1.00 22.76 ? 1739 TYR A CD1 1 
ATOM   524  C  CD2 . TYR A 1 65  ? 23.452 -11.833 24.103  1.00 21.69 ? 1739 TYR A CD2 1 
ATOM   525  C  CE1 . TYR A 1 65  ? 21.855 -11.667 26.374  1.00 23.84 ? 1739 TYR A CE1 1 
ATOM   526  C  CE2 . TYR A 1 65  ? 22.192 -11.218 24.031  1.00 19.75 ? 1739 TYR A CE2 1 
ATOM   527  C  CZ  . TYR A 1 65  ? 21.396 -11.135 25.181  1.00 23.87 ? 1739 TYR A CZ  1 
ATOM   528  O  OH  . TYR A 1 65  ? 20.139 -10.562 25.205  1.00 22.09 ? 1739 TYR A OH  1 
ATOM   529  N  N   . ASP A 1 66  ? 27.466 -14.482 27.322  1.00 22.40 ? 1740 ASP A N   1 
ATOM   530  C  CA  . ASP A 1 66  ? 28.650 -15.318 27.400  1.00 24.37 ? 1740 ASP A CA  1 
ATOM   531  C  C   . ASP A 1 66  ? 29.049 -15.887 26.050  1.00 26.21 ? 1740 ASP A C   1 
ATOM   532  O  O   . ASP A 1 66  ? 30.247 -16.005 25.754  1.00 28.30 ? 1740 ASP A O   1 
ATOM   533  C  CB  . ASP A 1 66  ? 28.366 -16.499 28.348  1.00 25.00 ? 1740 ASP A CB  1 
ATOM   534  C  CG  . ASP A 1 66  ? 28.185 -16.061 29.796  1.00 31.80 ? 1740 ASP A CG  1 
ATOM   535  O  OD1 . ASP A 1 66  ? 28.833 -15.091 30.253  1.00 29.64 ? 1740 ASP A OD1 1 
ATOM   536  O  OD2 . ASP A 1 66  ? 27.389 -16.719 30.503  1.00 35.68 ? 1740 ASP A OD2 1 
ATOM   537  N  N   . ALA A 1 67  ? 28.046 -16.274 25.262  1.00 24.91 ? 1741 ALA A N   1 
ATOM   538  C  CA  . ALA A 1 67  ? 28.264 -16.966 23.999  1.00 28.13 ? 1741 ALA A CA  1 
ATOM   539  C  C   . ALA A 1 67  ? 28.865 -16.079 22.923  1.00 26.82 ? 1741 ALA A C   1 
ATOM   540  O  O   . ALA A 1 67  ? 29.370 -16.580 21.931  1.00 31.08 ? 1741 ALA A O   1 
ATOM   541  C  CB  . ALA A 1 67  ? 26.967 -17.568 23.506  1.00 28.42 ? 1741 ALA A CB  1 
ATOM   542  N  N   . THR A 1 68  ? 28.819 -14.764 23.124  1.00 24.85 ? 1742 THR A N   1 
ATOM   543  C  CA  . THR A 1 68  ? 29.278 -13.860 22.075  1.00 24.55 ? 1742 THR A CA  1 
ATOM   544  C  C   . THR A 1 68  ? 30.259 -12.806 22.572  1.00 22.49 ? 1742 THR A C   1 
ATOM   545  O  O   . THR A 1 68  ? 30.680 -11.963 21.773  1.00 20.68 ? 1742 THR A O   1 
ATOM   546  C  CB  . THR A 1 68  ? 28.104 -13.166 21.361  1.00 25.58 ? 1742 THR A CB  1 
ATOM   547  O  OG1 . THR A 1 68  ? 27.366 -12.388 22.309  1.00 31.13 ? 1742 THR A OG1 1 
ATOM   548  C  CG2 . THR A 1 68  ? 27.177 -14.215 20.746  1.00 26.76 ? 1742 THR A CG2 1 
ATOM   549  N  N   . ARG A 1 69  ? 30.642 -12.858 23.851  1.00 21.83 ? 1743 ARG A N   1 
ATOM   550  C  CA  . ARG A 1 69  ? 31.599 -11.881 24.404  1.00 20.34 ? 1743 ARG A CA  1 
ATOM   551  C  C   . ARG A 1 69  ? 33.000 -11.991 23.829  1.00 21.68 ? 1743 ARG A C   1 
ATOM   552  O  O   . ARG A 1 69  ? 33.413 -13.065 23.377  1.00 22.36 ? 1743 ARG A O   1 
ATOM   553  C  CB  . ARG A 1 69  ? 31.635 -11.959 25.928  1.00 20.29 ? 1743 ARG A CB  1 
ATOM   554  C  CG  . ARG A 1 69  ? 32.310 -13.199 26.490  1.00 21.36 ? 1743 ARG A CG  1 
ATOM   555  C  CD  . ARG A 1 69  ? 32.329 -13.100 28.007  1.00 25.11 ? 1743 ARG A CD  1 
ATOM   556  N  NE  . ARG A 1 69  ? 33.104 -14.181 28.608  1.00 24.55 ? 1743 ARG A NE  1 
ATOM   557  C  CZ  . ARG A 1 69  ? 34.356 -14.066 29.029  1.00 26.50 ? 1743 ARG A CZ  1 
ATOM   558  N  NH1 . ARG A 1 69  ? 35.015 -12.909 28.947  1.00 22.53 ? 1743 ARG A NH1 1 
ATOM   559  N  NH2 . ARG A 1 69  ? 34.940 -15.135 29.552  1.00 27.72 ? 1743 ARG A NH2 1 
ATOM   560  N  N   . VAL A 1 70  ? 33.722 -10.871 23.823  1.00 18.04 ? 1744 VAL A N   1 
ATOM   561  C  CA  . VAL A 1 70  ? 35.099 -10.873 23.350  1.00 20.92 ? 1744 VAL A CA  1 
ATOM   562  C  C   . VAL A 1 70  ? 35.973 -11.142 24.576  1.00 22.55 ? 1744 VAL A C   1 
ATOM   563  O  O   . VAL A 1 70  ? 35.828 -10.484 25.618  1.00 22.46 ? 1744 VAL A O   1 
ATOM   564  C  CB  . VAL A 1 70  ? 35.484 -9.495  22.724  1.00 21.09 ? 1744 VAL A CB  1 
ATOM   565  C  CG1 . VAL A 1 70  ? 36.942 -9.470  22.300  1.00 21.11 ? 1744 VAL A CG1 1 
ATOM   566  C  CG2 . VAL A 1 70  ? 34.563 -9.181  21.522  1.00 20.93 ? 1744 VAL A CG2 1 
ATOM   567  N  N   . LYS A 1 71  ? 36.881 -12.104 24.417  1.00 22.55 ? 1745 LYS A N   1 
ATOM   568  C  CA  . LYS A 1 71  ? 37.801 -12.464 25.484  1.00 22.96 ? 1745 LYS A CA  1 
ATOM   569  C  C   . LYS A 1 71  ? 39.178 -11.893 25.297  1.00 24.70 ? 1745 LYS A C   1 
ATOM   570  O  O   . LYS A 1 71  ? 39.783 -12.075 24.247  1.00 26.04 ? 1745 LYS A O   1 
ATOM   571  C  CB  . LYS A 1 71  ? 37.894 -13.995 25.575  1.00 23.61 ? 1745 LYS A CB  1 
ATOM   572  C  CG  . LYS A 1 71  ? 36.517 -14.627 25.664  1.00 25.34 ? 1745 LYS A CG  1 
ATOM   573  C  CD  . LYS A 1 71  ? 36.511 -16.045 26.212  1.00 30.09 ? 1745 LYS A CD  1 
ATOM   574  C  CE  . LYS A 1 71  ? 35.137 -16.640 25.968  1.00 34.50 ? 1745 LYS A CE  1 
ATOM   575  N  NZ  . LYS A 1 71  ? 35.135 -18.130 26.106  1.00 41.55 ? 1745 LYS A NZ  1 
ATOM   576  N  N   . LEU A 1 72  ? 39.685 -11.241 26.339  1.00 24.57 ? 1746 LEU A N   1 
ATOM   577  C  CA  . LEU A 1 72  ? 41.071 -10.781 26.317  1.00 24.63 ? 1746 LEU A CA  1 
ATOM   578  C  C   . LEU A 1 72  ? 41.990 -11.937 26.717  1.00 26.44 ? 1746 LEU A C   1 
ATOM   579  O  O   . LEU A 1 72  ? 41.587 -12.828 27.486  1.00 25.59 ? 1746 LEU A O   1 
ATOM   580  C  CB  . LEU A 1 72  ? 41.264 -9.604  27.267  1.00 24.20 ? 1746 LEU A CB  1 
ATOM   581  C  CG  . LEU A 1 72  ? 40.257 -8.450  27.144  1.00 26.52 ? 1746 LEU A CG  1 
ATOM   582  C  CD1 . LEU A 1 72  ? 40.386 -7.484  28.328  1.00 25.20 ? 1746 LEU A CD1 1 
ATOM   583  C  CD2 . LEU A 1 72  ? 40.477 -7.732  25.838  1.00 29.10 ? 1746 LEU A CD2 1 
ATOM   584  N  N   . SER A 1 73  ? 43.210 -11.915 26.188  1.00 28.06 ? 1747 SER A N   1 
ATOM   585  C  CA  . SER A 1 73  ? 44.202 -12.909 26.577  1.00 29.99 ? 1747 SER A CA  1 
ATOM   586  C  C   . SER A 1 73  ? 44.558 -12.707 28.042  1.00 32.17 ? 1747 SER A C   1 
ATOM   587  O  O   . SER A 1 73  ? 44.456 -11.598 28.570  1.00 31.75 ? 1747 SER A O   1 
ATOM   588  C  CB  . SER A 1 73  ? 45.456 -12.795 25.706  1.00 31.06 ? 1747 SER A CB  1 
ATOM   589  O  OG  . SER A 1 73  ? 46.212 -11.649 26.061  1.00 30.98 ? 1747 SER A OG  1 
ATOM   590  N  N   . GLY A 1 74  ? 44.981 -13.795 28.692  1.00 36.27 ? 1748 GLY A N   1 
ATOM   591  C  CA  . GLY A 1 74  ? 45.556 -13.723 30.028  1.00 37.30 ? 1748 GLY A CA  1 
ATOM   592  C  C   . GLY A 1 74  ? 44.522 -13.920 31.121  1.00 39.58 ? 1748 GLY A C   1 
ATOM   593  O  O   . GLY A 1 74  ? 43.427 -14.447 30.878  1.00 40.73 ? 1748 GLY A O   1 
ATOM   594  N  N   . GLY A 1 75  ? 44.875 -13.477 32.326  1.00 40.40 ? 1749 GLY A N   1 
ATOM   595  C  CA  . GLY A 1 75  ? 44.189 -13.892 33.546  1.00 40.29 ? 1749 GLY A CA  1 
ATOM   596  C  C   . GLY A 1 75  ? 42.903 -13.159 33.891  1.00 39.81 ? 1749 GLY A C   1 
ATOM   597  O  O   . GLY A 1 75  ? 42.032 -13.719 34.550  1.00 40.08 ? 1749 GLY A O   1 
ATOM   598  N  N   . SER A 1 76  ? 42.770 -11.906 33.465  1.00 38.77 ? 1755 SER A N   1 
ATOM   599  C  CA  . SER A 1 76  ? 41.447 -11.289 33.436  1.00 35.43 ? 1755 SER A CA  1 
ATOM   600  C  C   . SER A 1 76  ? 41.006 -11.015 32.002  1.00 31.94 ? 1755 SER A C   1 
ATOM   601  O  O   . SER A 1 76  ? 41.415 -10.048 31.350  1.00 32.03 ? 1755 SER A O   1 
ATOM   602  C  CB  . SER A 1 76  ? 41.343 -10.028 34.292  1.00 37.81 ? 1755 SER A CB  1 
ATOM   603  O  OG  . SER A 1 76  ? 40.042 -9.476  34.128  1.00 42.03 ? 1755 SER A OG  1 
ATOM   604  N  N   . ASP A 1 77  ? 40.145 -11.903 31.538  1.00 28.18 ? 1756 ASP A N   1 
ATOM   605  C  CA  . ASP A 1 77  ? 39.744 -11.974 30.137  1.00 26.45 ? 1756 ASP A CA  1 
ATOM   606  C  C   . ASP A 1 77  ? 38.548 -11.075 29.773  1.00 26.18 ? 1756 ASP A C   1 
ATOM   607  O  O   . ASP A 1 77  ? 38.130 -11.060 28.607  1.00 24.69 ? 1756 ASP A O   1 
ATOM   608  C  CB  . ASP A 1 77  ? 39.487 -13.450 29.795  1.00 27.79 ? 1756 ASP A CB  1 
ATOM   609  C  CG  . ASP A 1 77  ? 38.113 -13.948 30.247  1.00 30.00 ? 1756 ASP A CG  1 
ATOM   610  O  OD1 . ASP A 1 77  ? 37.308 -13.181 30.835  1.00 26.61 ? 1756 ASP A OD1 1 
ATOM   611  O  OD2 . ASP A 1 77  ? 37.841 -15.153 30.011  1.00 30.03 ? 1756 ASP A OD2 1 
ATOM   612  N  N   . TYR A 1 78  ? 38.018 -10.320 30.737  1.00 23.63 ? 1757 TYR A N   1 
ATOM   613  C  CA  . TYR A 1 78  ? 36.727 -9.640  30.552  1.00 21.90 ? 1757 TYR A CA  1 
ATOM   614  C  C   . TYR A 1 78  ? 36.786 -8.223  29.967  1.00 21.51 ? 1757 TYR A C   1 
ATOM   615  O  O   . TYR A 1 78  ? 37.493 -7.372  30.477  1.00 20.67 ? 1757 TYR A O   1 
ATOM   616  C  CB  . TYR A 1 78  ? 35.938 -9.527  31.861  1.00 22.60 ? 1757 TYR A CB  1 
ATOM   617  C  CG  . TYR A 1 78  ? 34.572 -8.950  31.605  1.00 17.50 ? 1757 TYR A CG  1 
ATOM   618  C  CD1 . TYR A 1 78  ? 33.567 -9.720  31.007  1.00 17.51 ? 1757 TYR A CD1 1 
ATOM   619  C  CD2 . TYR A 1 78  ? 34.310 -7.597  31.876  1.00 20.14 ? 1757 TYR A CD2 1 
ATOM   620  C  CE1 . TYR A 1 78  ? 32.314 -9.175  30.742  1.00 19.65 ? 1757 TYR A CE1 1 
ATOM   621  C  CE2 . TYR A 1 78  ? 33.056 -7.036  31.610  1.00 21.95 ? 1757 TYR A CE2 1 
ATOM   622  C  CZ  . TYR A 1 78  ? 32.083 -7.822  31.032  1.00 19.05 ? 1757 TYR A CZ  1 
ATOM   623  O  OH  . TYR A 1 78  ? 30.861 -7.257  30.762  1.00 19.87 ? 1757 TYR A OH  1 
ATOM   624  N  N   . ILE A 1 79  ? 35.969 -7.990  28.940  1.00 19.45 ? 1758 ILE A N   1 
ATOM   625  C  CA  . ILE A 1 79  ? 35.643 -6.629  28.458  1.00 17.10 ? 1758 ILE A CA  1 
ATOM   626  C  C   . ILE A 1 79  ? 34.157 -6.638  28.056  1.00 15.99 ? 1758 ILE A C   1 
ATOM   627  O  O   . ILE A 1 79  ? 33.646 -7.667  27.593  1.00 17.29 ? 1758 ILE A O   1 
ATOM   628  C  CB  . ILE A 1 79  ? 36.560 -6.232  27.286  1.00 18.62 ? 1758 ILE A CB  1 
ATOM   629  C  CG1 . ILE A 1 79  ? 36.361 -4.763  26.876  1.00 20.82 ? 1758 ILE A CG1 1 
ATOM   630  C  CG2 . ILE A 1 79  ? 36.483 -7.226  26.113  1.00 19.19 ? 1758 ILE A CG2 1 
ATOM   631  C  CD1 . ILE A 1 79  ? 37.524 -4.251  25.999  1.00 17.04 ? 1758 ILE A CD1 1 
ATOM   632  N  N   . ASN A 1 80  ? 33.486 -5.507  28.274  1.00 15.96 ? 1759 ASN A N   1 
ATOM   633  C  CA  . ASN A 1 80  ? 32.106 -5.381  27.838  1.00 16.21 ? 1759 ASN A CA  1 
ATOM   634  C  C   . ASN A 1 80  ? 32.121 -5.127  26.324  1.00 15.13 ? 1759 ASN A C   1 
ATOM   635  O  O   . ASN A 1 80  ? 32.140 -3.993  25.837  1.00 16.54 ? 1759 ASN A O   1 
ATOM   636  C  CB  . ASN A 1 80  ? 31.383 -4.257  28.602  1.00 15.17 ? 1759 ASN A CB  1 
ATOM   637  C  CG  . ASN A 1 80  ? 29.897 -4.282  28.361  1.00 18.74 ? 1759 ASN A CG  1 
ATOM   638  O  OD1 . ASN A 1 80  ? 29.462 -4.482  27.229  1.00 17.95 ? 1759 ASN A OD1 1 
ATOM   639  N  ND2 . ASN A 1 80  ? 29.112 -4.097  29.421  1.00 17.73 ? 1759 ASN A ND2 1 
ATOM   640  N  N   . ALA A 1 81  ? 32.130 -6.211  25.555  1.00 16.90 ? 1760 ALA A N   1 
ATOM   641  C  CA  . ALA A 1 81  ? 32.224 -6.154  24.114  1.00 15.82 ? 1760 ALA A CA  1 
ATOM   642  C  C   . ALA A 1 81  ? 31.694 -7.466  23.572  1.00 18.51 ? 1760 ALA A C   1 
ATOM   643  O  O   . ALA A 1 81  ? 31.844 -8.520  24.220  1.00 18.08 ? 1760 ALA A O   1 
ATOM   644  C  CB  . ALA A 1 81  ? 33.669 -5.953  23.673  1.00 16.33 ? 1760 ALA A CB  1 
ATOM   645  N  N   . SER A 1 82  ? 31.072 -7.408  22.400  1.00 15.05 ? 1761 SER A N   1 
ATOM   646  C  CA  . SER A 1 82  ? 30.406 -8.588  21.824  1.00 16.29 ? 1761 SER A CA  1 
ATOM   647  C  C   . SER A 1 82  ? 30.783 -8.714  20.358  1.00 16.93 ? 1761 SER A C   1 
ATOM   648  O  O   . SER A 1 82  ? 30.837 -7.710  19.636  1.00 15.68 ? 1761 SER A O   1 
ATOM   649  C  CB  . SER A 1 82  ? 28.889 -8.439  21.900  1.00 17.95 ? 1761 SER A CB  1 
ATOM   650  O  OG  . SER A 1 82  ? 28.471 -8.202  23.253  1.00 20.58 ? 1761 SER A OG  1 
ATOM   651  N  N   . TYR A 1 83  ? 30.969 -9.943  19.894  1.00 16.72 ? 1762 TYR A N   1 
ATOM   652  C  CA  . TYR A 1 83  ? 31.196 -10.162 18.483  1.00 16.91 ? 1762 TYR A CA  1 
ATOM   653  C  C   . TYR A 1 83  ? 29.846 -10.185 17.746  1.00 18.78 ? 1762 TYR A C   1 
ATOM   654  O  O   . TYR A 1 83  ? 28.878 -10.811 18.210  1.00 22.31 ? 1762 TYR A O   1 
ATOM   655  C  CB  . TYR A 1 83  ? 31.852 -11.530 18.248  1.00 18.09 ? 1762 TYR A CB  1 
ATOM   656  C  CG  . TYR A 1 83  ? 33.282 -11.705 18.704  1.00 19.50 ? 1762 TYR A CG  1 
ATOM   657  C  CD1 . TYR A 1 83  ? 34.326 -11.036 18.056  1.00 22.28 ? 1762 TYR A CD1 1 
ATOM   658  C  CD2 . TYR A 1 83  ? 33.598 -12.586 19.754  1.00 18.86 ? 1762 TYR A CD2 1 
ATOM   659  C  CE1 . TYR A 1 83  ? 35.632 -11.233 18.445  1.00 21.79 ? 1762 TYR A CE1 1 
ATOM   660  C  CE2 . TYR A 1 83  ? 34.925 -12.793 20.137  1.00 18.22 ? 1762 TYR A CE2 1 
ATOM   661  C  CZ  . TYR A 1 83  ? 35.927 -12.108 19.473  1.00 23.02 ? 1762 TYR A CZ  1 
ATOM   662  O  OH  . TYR A 1 83  ? 37.233 -12.283 19.860  1.00 26.31 ? 1762 TYR A OH  1 
ATOM   663  N  N   . ILE A 1 84  ? 29.786 -9.537  16.581  1.00 16.66 ? 1763 ILE A N   1 
ATOM   664  C  CA  . ILE A 1 84  ? 28.671 -9.674  15.671  1.00 18.56 ? 1763 ILE A CA  1 
ATOM   665  C  C   . ILE A 1 84  ? 29.146 -10.431 14.418  1.00 20.40 ? 1763 ILE A C   1 
ATOM   666  O  O   . ILE A 1 84  ? 30.038 -9.980  13.702  1.00 19.62 ? 1763 ILE A O   1 
ATOM   667  C  CB  . ILE A 1 84  ? 28.143 -8.277  15.271  1.00 20.63 ? 1763 ILE A CB  1 
ATOM   668  C  CG1 . ILE A 1 84  ? 27.879 -7.407  16.500  1.00 21.12 ? 1763 ILE A CG1 1 
ATOM   669  C  CG2 . ILE A 1 84  ? 26.878 -8.380  14.392  1.00 21.13 ? 1763 ILE A CG2 1 
ATOM   670  C  CD1 . ILE A 1 84  ? 26.857 -8.011  17.542  1.00 19.97 ? 1763 ILE A CD1 1 
ATOM   671  N  N   . PRO A 1 85  ? 28.559 -11.611 14.145  1.00 19.86 ? 1764 PRO A N   1 
ATOM   672  C  CA  . PRO A 1 85  ? 29.007 -12.339 12.968  1.00 21.54 ? 1764 PRO A CA  1 
ATOM   673  C  C   . PRO A 1 85  ? 28.493 -11.621 11.725  1.00 20.44 ? 1764 PRO A C   1 
ATOM   674  O  O   . PRO A 1 85  ? 27.488 -10.875 11.812  1.00 20.27 ? 1764 PRO A O   1 
ATOM   675  C  CB  . PRO A 1 85  ? 28.295 -13.690 13.110  1.00 21.36 ? 1764 PRO A CB  1 
ATOM   676  C  CG  . PRO A 1 85  ? 27.063 -13.368 13.877  1.00 22.66 ? 1764 PRO A CG  1 
ATOM   677  C  CD  . PRO A 1 85  ? 27.464 -12.289 14.852  1.00 22.42 ? 1764 PRO A CD  1 
ATOM   678  N  N   . GLY A 1 86  ? 29.195 -11.821 10.607  1.00 17.11 ? 1765 GLY A N   1 
ATOM   679  C  CA  . GLY A 1 86  ? 28.806 -11.369 9.300   1.00 18.86 ? 1765 GLY A CA  1 
ATOM   680  C  C   . GLY A 1 86  ? 27.954 -12.408 8.592   1.00 21.65 ? 1765 GLY A C   1 
ATOM   681  O  O   . GLY A 1 86  ? 27.800 -13.548 9.072   1.00 23.29 ? 1765 GLY A O   1 
ATOM   682  N  N   . ASN A 1 87  ? 27.440 -12.040 7.430   1.00 22.98 ? 1766 ASN A N   1 
ATOM   683  C  CA  . ASN A 1 87  ? 26.657 -13.006 6.647   1.00 22.71 ? 1766 ASN A CA  1 
ATOM   684  C  C   . ASN A 1 87  ? 27.519 -14.130 6.088   1.00 21.56 ? 1766 ASN A C   1 
ATOM   685  O  O   . ASN A 1 87  ? 27.016 -15.201 5.736   1.00 23.10 ? 1766 ASN A O   1 
ATOM   686  C  CB  . ASN A 1 87  ? 26.006 -12.257 5.479   1.00 24.06 ? 1766 ASN A CB  1 
ATOM   687  C  CG  . ASN A 1 87  ? 24.785 -11.489 5.914   1.00 33.27 ? 1766 ASN A CG  1 
ATOM   688  O  OD1 . ASN A 1 87  ? 24.133 -11.858 6.898   1.00 36.40 ? 1766 ASN A OD1 1 
ATOM   689  N  ND2 . ASN A 1 87  ? 24.454 -10.429 5.177   1.00 38.42 ? 1766 ASN A ND2 1 
ATOM   690  N  N   . ASN A 1 88  ? 28.819 -13.867 5.970   1.00 19.73 ? 1767 ASN A N   1 
ATOM   691  C  CA  . ASN A 1 88  ? 29.704 -14.802 5.310   1.00 19.98 ? 1767 ASN A CA  1 
ATOM   692  C  C   . ASN A 1 88  ? 30.762 -15.437 6.226   1.00 19.93 ? 1767 ASN A C   1 
ATOM   693  O  O   . ASN A 1 88  ? 31.296 -16.492 5.922   1.00 18.38 ? 1767 ASN A O   1 
ATOM   694  C  CB  . ASN A 1 88  ? 30.331 -14.097 4.129   1.00 20.88 ? 1767 ASN A CB  1 
ATOM   695  C  CG  . ASN A 1 88  ? 29.292 -13.804 3.079   1.00 23.56 ? 1767 ASN A CG  1 
ATOM   696  O  OD1 . ASN A 1 88  ? 28.596 -14.722 2.649   1.00 31.79 ? 1767 ASN A OD1 1 
ATOM   697  N  ND2 . ASN A 1 88  ? 29.176 -12.565 2.677   1.00 29.82 ? 1767 ASN A ND2 1 
ATOM   698  N  N   . PHE A 1 89  ? 31.025 -14.790 7.354   1.00 18.86 ? 1768 PHE A N   1 
ATOM   699  C  CA  . PHE A 1 89  ? 32.077 -15.275 8.254   1.00 17.57 ? 1768 PHE A CA  1 
ATOM   700  C  C   . PHE A 1 89  ? 31.894 -14.573 9.598   1.00 18.33 ? 1768 PHE A C   1 
ATOM   701  O  O   . PHE A 1 89  ? 31.280 -13.504 9.648   1.00 20.52 ? 1768 PHE A O   1 
ATOM   702  C  CB  . PHE A 1 89  ? 33.450 -14.893 7.684   1.00 19.77 ? 1768 PHE A CB  1 
ATOM   703  C  CG  . PHE A 1 89  ? 34.589 -15.691 8.264   1.00 15.02 ? 1768 PHE A CG  1 
ATOM   704  C  CD1 . PHE A 1 89  ? 34.780 -17.013 7.865   1.00 16.49 ? 1768 PHE A CD1 1 
ATOM   705  C  CD2 . PHE A 1 89  ? 35.471 -15.139 9.187   1.00 16.32 ? 1768 PHE A CD2 1 
ATOM   706  C  CE1 . PHE A 1 89  ? 35.817 -17.750 8.399   1.00 17.61 ? 1768 PHE A CE1 1 
ATOM   707  C  CE2 . PHE A 1 89  ? 36.542 -15.888 9.725   1.00 19.24 ? 1768 PHE A CE2 1 
ATOM   708  C  CZ  . PHE A 1 89  ? 36.703 -17.210 9.338   1.00 16.78 ? 1768 PHE A CZ  1 
ATOM   709  N  N   . ARG A 1 90  ? 32.436 -15.174 10.662  1.00 18.83 ? 1769 ARG A N   1 
ATOM   710  C  CA  . ARG A 1 90  ? 32.277 -14.658 12.027  1.00 16.77 ? 1769 ARG A CA  1 
ATOM   711  C  C   . ARG A 1 90  ? 32.967 -13.310 12.187  1.00 19.27 ? 1769 ARG A C   1 
ATOM   712  O  O   . ARG A 1 90  ? 33.782 -12.923 11.343  1.00 17.94 ? 1769 ARG A O   1 
ATOM   713  C  CB  . ARG A 1 90  ? 32.903 -15.619 13.058  1.00 18.61 ? 1769 ARG A CB  1 
ATOM   714  C  CG  . ARG A 1 90  ? 34.425 -15.765 12.890  1.00 15.66 ? 1769 ARG A CG  1 
ATOM   715  C  CD  . ARG A 1 90  ? 35.017 -16.567 14.031  1.00 21.19 ? 1769 ARG A CD  1 
ATOM   716  N  NE  . ARG A 1 90  ? 36.473 -16.476 13.993  1.00 17.13 ? 1769 ARG A NE  1 
ATOM   717  C  CZ  . ARG A 1 90  ? 37.323 -17.092 14.814  1.00 20.61 ? 1769 ARG A CZ  1 
ATOM   718  N  NH1 . ARG A 1 90  ? 36.883 -17.885 15.790  1.00 23.16 ? 1769 ARG A NH1 1 
ATOM   719  N  NH2 . ARG A 1 90  ? 38.621 -16.905 14.641  1.00 22.22 ? 1769 ARG A NH2 1 
ATOM   720  N  N   . ARG A 1 91  ? 32.637 -12.624 13.281  1.00 18.56 ? 1770 ARG A N   1 
ATOM   721  C  CA  . ARG A 1 91  ? 33.402 -11.479 13.758  1.00 17.89 ? 1770 ARG A CA  1 
ATOM   722  C  C   . ARG A 1 91  ? 33.514 -10.377 12.707  1.00 15.68 ? 1770 ARG A C   1 
ATOM   723  O  O   . ARG A 1 91  ? 34.598 -9.829  12.509  1.00 18.32 ? 1770 ARG A O   1 
ATOM   724  C  CB  . ARG A 1 91  ? 34.797 -11.915 14.235  1.00 16.49 ? 1770 ARG A CB  1 
ATOM   725  C  CG  . ARG A 1 91  ? 34.735 -12.988 15.308  1.00 18.82 ? 1770 ARG A CG  1 
ATOM   726  C  CD  . ARG A 1 91  ? 36.097 -13.394 15.868  1.00 18.48 ? 1770 ARG A CD  1 
ATOM   727  N  NE  . ARG A 1 91  ? 35.846 -14.342 16.966  1.00 21.93 ? 1770 ARG A NE  1 
ATOM   728  C  CZ  . ARG A 1 91  ? 36.803 -14.870 17.736  1.00 25.09 ? 1770 ARG A CZ  1 
ATOM   729  N  NH1 . ARG A 1 91  ? 38.068 -14.529 17.531  1.00 27.74 ? 1770 ARG A NH1 1 
ATOM   730  N  NH2 . ARG A 1 91  ? 36.509 -15.724 18.710  1.00 23.39 ? 1770 ARG A NH2 1 
ATOM   731  N  N   . GLU A 1 92  ? 32.408 -10.018 12.049  1.00 14.91 ? 1771 GLU A N   1 
ATOM   732  C  CA  . GLU A 1 92  ? 32.460 -8.848  11.154  1.00 16.36 ? 1771 GLU A CA  1 
ATOM   733  C  C   . GLU A 1 92  ? 32.658 -7.557  11.945  1.00 16.44 ? 1771 GLU A C   1 
ATOM   734  O  O   . GLU A 1 92  ? 33.413 -6.666  11.521  1.00 15.81 ? 1771 GLU A O   1 
ATOM   735  C  CB  . GLU A 1 92  ? 31.213 -8.748  10.267  1.00 16.72 ? 1771 GLU A CB  1 
ATOM   736  C  CG  . GLU A 1 92  ? 31.335 -7.623  9.274   1.00 17.42 ? 1771 GLU A CG  1 
ATOM   737  C  CD  . GLU A 1 92  ? 30.164 -7.517  8.325   1.00 22.02 ? 1771 GLU A CD  1 
ATOM   738  O  OE1 . GLU A 1 92  ? 30.312 -6.799  7.305   1.00 26.78 ? 1771 GLU A OE1 1 
ATOM   739  O  OE2 . GLU A 1 92  ? 29.092 -8.134  8.567   1.00 22.77 ? 1771 GLU A OE2 1 
ATOM   740  N  N   . TYR A 1 93  ? 31.982 -7.489  13.085  1.00 16.06 ? 1772 TYR A N   1 
ATOM   741  C  CA  . TYR A 1 93  ? 32.128 -6.347  13.994  1.00 15.42 ? 1772 TYR A CA  1 
ATOM   742  C  C   . TYR A 1 93  ? 32.414 -6.799  15.418  1.00 16.24 ? 1772 TYR A C   1 
ATOM   743  O  O   . TYR A 1 93  ? 32.028 -7.898  15.845  1.00 14.98 ? 1772 TYR A O   1 
ATOM   744  C  CB  . TYR A 1 93  ? 30.823 -5.554  14.054  1.00 15.32 ? 1772 TYR A CB  1 
ATOM   745  C  CG  . TYR A 1 93  ? 30.310 -5.039  12.741  1.00 15.26 ? 1772 TYR A CG  1 
ATOM   746  C  CD1 . TYR A 1 93  ? 29.375 -5.795  12.063  1.00 21.57 ? 1772 TYR A CD1 1 
ATOM   747  C  CD2 . TYR A 1 93  ? 30.708 -3.811  12.197  1.00 20.67 ? 1772 TYR A CD2 1 
ATOM   748  C  CE1 . TYR A 1 93  ? 28.812 -5.396  10.881  1.00 23.51 ? 1772 TYR A CE1 1 
ATOM   749  C  CE2 . TYR A 1 93  ? 30.130 -3.394  10.967  1.00 20.59 ? 1772 TYR A CE2 1 
ATOM   750  C  CZ  . TYR A 1 93  ? 29.195 -4.218  10.326  1.00 21.22 ? 1772 TYR A CZ  1 
ATOM   751  O  OH  . TYR A 1 93  ? 28.516 -3.975  9.127   1.00 32.28 ? 1772 TYR A OH  1 
ATOM   752  N  N   . ILE A 1 94  ? 33.025 -5.904  16.188  1.00 15.53 ? 1773 ILE A N   1 
ATOM   753  C  CA  . ILE A 1 94  ? 32.970 -5.978  17.647  1.00 15.33 ? 1773 ILE A CA  1 
ATOM   754  C  C   . ILE A 1 94  ? 32.245 -4.740  18.127  1.00 17.02 ? 1773 ILE A C   1 
ATOM   755  O  O   . ILE A 1 94  ? 32.608 -3.615  17.738  1.00 18.12 ? 1773 ILE A O   1 
ATOM   756  C  CB  . ILE A 1 94  ? 34.411 -5.957  18.221  1.00 17.74 ? 1773 ILE A CB  1 
ATOM   757  C  CG1 . ILE A 1 94  ? 35.075 -7.308  17.919  1.00 19.54 ? 1773 ILE A CG1 1 
ATOM   758  C  CG2 . ILE A 1 94  ? 34.412 -5.658  19.719  1.00 17.57 ? 1773 ILE A CG2 1 
ATOM   759  C  CD1 . ILE A 1 94  ? 36.590 -7.326  18.160  1.00 21.20 ? 1773 ILE A CD1 1 
ATOM   760  N  N   . VAL A 1 95  ? 31.197 -4.941  18.923  1.00 14.82 ? 1774 VAL A N   1 
ATOM   761  C  CA  . VAL A 1 95  ? 30.452 -3.839  19.462  1.00 15.37 ? 1774 VAL A CA  1 
ATOM   762  C  C   . VAL A 1 95  ? 30.833 -3.701  20.934  1.00 17.39 ? 1774 VAL A C   1 
ATOM   763  O  O   . VAL A 1 95  ? 30.953 -4.697  21.646  1.00 16.45 ? 1774 VAL A O   1 
ATOM   764  C  CB  . VAL A 1 95  ? 28.950 -4.044  19.237  1.00 16.92 ? 1774 VAL A CB  1 
ATOM   765  C  CG1 . VAL A 1 95  ? 28.119 -3.115  20.086  1.00 25.47 ? 1774 VAL A CG1 1 
ATOM   766  C  CG2 . VAL A 1 95  ? 28.609 -3.931  17.762  1.00 18.69 ? 1774 VAL A CG2 1 
ATOM   767  N  N   . THR A 1 96  ? 31.055 -2.477  21.397  1.00 16.47 ? 1775 THR A N   1 
ATOM   768  C  CA  . THR A 1 96  ? 31.497 -2.326  22.780  1.00 17.24 ? 1775 THR A CA  1 
ATOM   769  C  C   . THR A 1 96  ? 30.958 -0.999  23.338  1.00 17.23 ? 1775 THR A C   1 
ATOM   770  O  O   . THR A 1 96  ? 30.420 -0.177  22.589  1.00 15.96 ? 1775 THR A O   1 
ATOM   771  C  CB  . THR A 1 96  ? 33.069 -2.425  22.865  1.00 20.41 ? 1775 THR A CB  1 
ATOM   772  O  OG1 . THR A 1 96  ? 33.545 -2.531  24.222  1.00 17.50 ? 1775 THR A OG1 1 
ATOM   773  C  CG2 . THR A 1 96  ? 33.749 -1.222  22.204  1.00 19.22 ? 1775 THR A CG2 1 
ATOM   774  N  N   . GLN A 1 97  ? 31.071 -0.842  24.655  1.00 17.45 ? 1776 GLN A N   1 
ATOM   775  C  CA  . GLN A 1 97  ? 30.636 0.395   25.317  1.00 16.34 ? 1776 GLN A CA  1 
ATOM   776  C  C   . GLN A 1 97  ? 31.747 1.441   25.165  1.00 15.85 ? 1776 GLN A C   1 
ATOM   777  O  O   . GLN A 1 97  ? 32.907 1.121   24.814  1.00 16.37 ? 1776 GLN A O   1 
ATOM   778  C  CB  . GLN A 1 97  ? 30.419 0.086   26.812  1.00 15.89 ? 1776 GLN A CB  1 
ATOM   779  C  CG  . GLN A 1 97  ? 31.752 -0.307  27.499  1.00 15.77 ? 1776 GLN A CG  1 
ATOM   780  C  CD  . GLN A 1 97  ? 31.602 -0.699  28.973  1.00 17.86 ? 1776 GLN A CD  1 
ATOM   781  O  OE1 . GLN A 1 97  ? 30.495 -0.971  29.459  1.00 19.62 ? 1776 GLN A OE1 1 
ATOM   782  N  NE2 . GLN A 1 97  ? 32.722 -0.756  29.674  1.00 17.04 ? 1776 GLN A NE2 1 
ATOM   783  N  N   . GLY A 1 98  ? 31.436 2.711   25.440  1.00 17.69 ? 1777 GLY A N   1 
ATOM   784  C  CA  . GLY A 1 98  ? 32.502 3.705   25.533  1.00 16.80 ? 1777 GLY A CA  1 
ATOM   785  C  C   . GLY A 1 98  ? 33.434 3.345   26.684  1.00 17.04 ? 1777 GLY A C   1 
ATOM   786  O  O   . GLY A 1 98  ? 32.985 3.108   27.807  1.00 17.05 ? 1777 GLY A O   1 
ATOM   787  N  N   . PRO A 1 99  ? 34.743 3.231   26.414  1.00 17.51 ? 1778 PRO A N   1 
ATOM   788  C  CA  . PRO A 1 99  ? 35.641 2.844   27.498  1.00 18.11 ? 1778 PRO A CA  1 
ATOM   789  C  C   . PRO A 1 99  ? 35.587 3.740   28.740  1.00 19.47 ? 1778 PRO A C   1 
ATOM   790  O  O   . PRO A 1 99  ? 35.341 4.942   28.631  1.00 17.77 ? 1778 PRO A O   1 
ATOM   791  C  CB  . PRO A 1 99  ? 37.030 2.954   26.847  1.00 19.37 ? 1778 PRO A CB  1 
ATOM   792  C  CG  . PRO A 1 99  ? 36.774 2.715   25.398  1.00 19.62 ? 1778 PRO A CG  1 
ATOM   793  C  CD  . PRO A 1 99  ? 35.466 3.383   25.137  1.00 19.54 ? 1778 PRO A CD  1 
ATOM   794  N  N   . LEU A 1 100 ? 35.814 3.125   29.900  1.00 18.59 ? 1779 LEU A N   1 
ATOM   795  C  CA  . LEU A 1 100 ? 35.889 3.809   31.197  1.00 17.60 ? 1779 LEU A CA  1 
ATOM   796  C  C   . LEU A 1 100 ? 37.388 4.075   31.522  1.00 18.04 ? 1779 LEU A C   1 
ATOM   797  O  O   . LEU A 1 100 ? 38.283 3.481   30.911  1.00 18.48 ? 1779 LEU A O   1 
ATOM   798  C  CB  . LEU A 1 100 ? 35.287 2.908   32.287  1.00 16.88 ? 1779 LEU A CB  1 
ATOM   799  C  CG  . LEU A 1 100 ? 33.809 2.527   32.108  1.00 18.91 ? 1779 LEU A CG  1 
ATOM   800  C  CD1 . LEU A 1 100 ? 33.564 1.260   32.930  1.00 20.41 ? 1779 LEU A CD1 1 
ATOM   801  C  CD2 . LEU A 1 100 ? 32.960 3.677   32.661  1.00 21.84 ? 1779 LEU A CD2 1 
ATOM   802  N  N   . PRO A 1 101 ? 37.673 4.963   32.491  1.00 19.05 ? 1780 PRO A N   1 
ATOM   803  C  CA  . PRO A 1 101 ? 39.071 5.161   32.883  1.00 19.68 ? 1780 PRO A CA  1 
ATOM   804  C  C   . PRO A 1 101 ? 39.802 3.838   33.118  1.00 19.54 ? 1780 PRO A C   1 
ATOM   805  O  O   . PRO A 1 101 ? 40.937 3.660   32.673  1.00 20.07 ? 1780 PRO A O   1 
ATOM   806  C  CB  . PRO A 1 101 ? 38.935 5.983   34.165  1.00 21.86 ? 1780 PRO A CB  1 
ATOM   807  C  CG  . PRO A 1 101 ? 37.690 6.793   33.926  1.00 21.54 ? 1780 PRO A CG  1 
ATOM   808  C  CD  . PRO A 1 101 ? 36.755 5.827   33.254  1.00 21.58 ? 1780 PRO A CD  1 
ATOM   809  N  N   . GLY A 1 102 ? 39.109 2.895   33.755  1.00 18.74 ? 1781 GLY A N   1 
ATOM   810  C  CA  . GLY A 1 102 ? 39.673 1.594   34.119  1.00 18.49 ? 1781 GLY A CA  1 
ATOM   811  C  C   . GLY A 1 102 ? 39.607 0.529   33.048  1.00 22.40 ? 1781 GLY A C   1 
ATOM   812  O  O   . GLY A 1 102 ? 39.999 -0.612  33.309  1.00 22.67 ? 1781 GLY A O   1 
ATOM   813  N  N   . THR A 1 103 ? 39.100 0.882   31.862  1.00 19.84 ? 1782 THR A N   1 
ATOM   814  C  CA  . THR A 1 103 ? 39.032 -0.065  30.734  1.00 18.74 ? 1782 THR A CA  1 
ATOM   815  C  C   . THR A 1 103 ? 39.683 0.451   29.442  1.00 17.31 ? 1782 THR A C   1 
ATOM   816  O  O   . THR A 1 103 ? 39.652 -0.224  28.424  1.00 17.84 ? 1782 THR A O   1 
ATOM   817  C  CB  . THR A 1 103 ? 37.582 -0.606  30.443  1.00 21.11 ? 1782 THR A CB  1 
ATOM   818  O  OG1 . THR A 1 103 ? 36.749 0.424   29.876  1.00 20.80 ? 1782 THR A OG1 1 
ATOM   819  C  CG2 . THR A 1 103 ? 36.932 -1.120  31.731  1.00 20.16 ? 1782 THR A CG2 1 
ATOM   820  N  N   . LYS A 1 104 ? 40.293 1.631   29.473  1.00 17.20 ? 1783 LYS A N   1 
ATOM   821  C  CA  . LYS A 1 104 ? 41.043 2.099   28.311  1.00 18.59 ? 1783 LYS A CA  1 
ATOM   822  C  C   . LYS A 1 104 ? 42.097 1.085   27.845  1.00 18.33 ? 1783 LYS A C   1 
ATOM   823  O  O   . LYS A 1 104 ? 42.207 0.817   26.643  1.00 18.73 ? 1783 LYS A O   1 
ATOM   824  C  CB  . LYS A 1 104 ? 41.752 3.414   28.650  1.00 19.54 ? 1783 LYS A CB  1 
ATOM   825  C  CG  . LYS A 1 104 ? 40.833 4.615   28.809  1.00 22.18 ? 1783 LYS A CG  1 
ATOM   826  C  CD  . LYS A 1 104 ? 41.654 5.865   29.121  1.00 24.52 ? 1783 LYS A CD  1 
ATOM   827  C  CE  . LYS A 1 104 ? 40.803 7.083   29.543  1.00 25.79 ? 1783 LYS A CE  1 
ATOM   828  N  NZ  . LYS A 1 104 ? 41.603 8.298   29.972  1.00 26.74 ? 1783 LYS A NZ  1 
ATOM   829  N  N   . ASP A 1 105 ? 42.890 0.526   28.773  1.00 18.52 ? 1784 ASP A N   1 
ATOM   830  C  CA  . ASP A 1 105 ? 43.925 -0.431  28.341  1.00 17.42 ? 1784 ASP A CA  1 
ATOM   831  C  C   . ASP A 1 105 ? 43.297 -1.663  27.729  1.00 17.80 ? 1784 ASP A C   1 
ATOM   832  O  O   . ASP A 1 105 ? 43.819 -2.188  26.741  1.00 17.73 ? 1784 ASP A O   1 
ATOM   833  C  CB  . ASP A 1 105 ? 44.793 -0.932  29.512  1.00 18.86 ? 1784 ASP A CB  1 
ATOM   834  C  CG  . ASP A 1 105 ? 45.658 0.150   30.103  1.00 20.25 ? 1784 ASP A CG  1 
ATOM   835  O  OD1 . ASP A 1 105 ? 45.747 1.236   29.493  1.00 22.01 ? 1784 ASP A OD1 1 
ATOM   836  O  OD2 . ASP A 1 105 ? 46.240 -0.103  31.196  1.00 20.06 ? 1784 ASP A OD2 1 
ATOM   837  N  N   . ASP A 1 106 ? 42.193 -2.119  28.324  1.00 19.62 ? 1785 ASP A N   1 
ATOM   838  C  CA  . ASP A 1 106 ? 41.479 -3.294  27.819  1.00 18.72 ? 1785 ASP A CA  1 
ATOM   839  C  C   . ASP A 1 106 ? 40.954 -3.039  26.412  1.00 15.98 ? 1785 ASP A C   1 
ATOM   840  O  O   . ASP A 1 106 ? 40.999 -3.922  25.558  1.00 17.31 ? 1785 ASP A O   1 
ATOM   841  C  CB  . ASP A 1 106 ? 40.313 -3.698  28.721  1.00 17.73 ? 1785 ASP A CB  1 
ATOM   842  C  CG  . ASP A 1 106 ? 40.731 -4.082  30.116  1.00 25.63 ? 1785 ASP A CG  1 
ATOM   843  O  OD1 . ASP A 1 106 ? 41.896 -4.533  30.324  1.00 25.38 ? 1785 ASP A OD1 1 
ATOM   844  O  OD2 . ASP A 1 106 ? 39.851 -3.925  31.011  1.00 22.31 ? 1785 ASP A OD2 1 
ATOM   845  N  N   . PHE A 1 107 ? 40.480 -1.823  26.166  1.00 15.67 ? 1786 PHE A N   1 
ATOM   846  C  CA  . PHE A 1 107 ? 39.934 -1.497  24.841  1.00 14.83 ? 1786 PHE A CA  1 
ATOM   847  C  C   . PHE A 1 107 ? 41.072 -1.631  23.818  1.00 15.46 ? 1786 PHE A C   1 
ATOM   848  O  O   . PHE A 1 107 ? 40.896 -2.236  22.774  1.00 16.99 ? 1786 PHE A O   1 
ATOM   849  C  CB  . PHE A 1 107 ? 39.392 -0.056  24.857  1.00 16.89 ? 1786 PHE A CB  1 
ATOM   850  C  CG  . PHE A 1 107 ? 38.934 0.394   23.491  1.00 17.30 ? 1786 PHE A CG  1 
ATOM   851  C  CD1 . PHE A 1 107 ? 37.638 0.125   23.056  1.00 17.41 ? 1786 PHE A CD1 1 
ATOM   852  C  CD2 . PHE A 1 107 ? 39.805 1.044   22.635  1.00 17.13 ? 1786 PHE A CD2 1 
ATOM   853  C  CE1 . PHE A 1 107 ? 37.214 0.551   21.769  1.00 15.97 ? 1786 PHE A CE1 1 
ATOM   854  C  CE2 . PHE A 1 107 ? 39.400 1.459   21.335  1.00 14.28 ? 1786 PHE A CE2 1 
ATOM   855  C  CZ  . PHE A 1 107 ? 38.098 1.210   20.913  1.00 18.94 ? 1786 PHE A CZ  1 
ATOM   856  N  N   . TRP A 1 108 ? 42.258 -1.090  24.114  1.00 14.13 ? 1787 TRP A N   1 
ATOM   857  C  CA  . TRP A 1 108 ? 43.326 -1.090  23.108  1.00 14.66 ? 1787 TRP A CA  1 
ATOM   858  C  C   . TRP A 1 108 ? 43.937 -2.483  23.003  1.00 15.63 ? 1787 TRP A C   1 
ATOM   859  O  O   . TRP A 1 108 ? 44.385 -2.874  21.909  1.00 14.59 ? 1787 TRP A O   1 
ATOM   860  C  CB  . TRP A 1 108 ? 44.375 -0.021  23.397  1.00 15.44 ? 1787 TRP A CB  1 
ATOM   861  C  CG  . TRP A 1 108 ? 43.882 1.359   23.131  1.00 15.72 ? 1787 TRP A CG  1 
ATOM   862  C  CD1 . TRP A 1 108 ? 43.659 2.336   24.056  1.00 16.16 ? 1787 TRP A CD1 1 
ATOM   863  C  CD2 . TRP A 1 108 ? 43.501 1.909   21.859  1.00 14.95 ? 1787 TRP A CD2 1 
ATOM   864  N  NE1 . TRP A 1 108 ? 43.222 3.477   23.425  1.00 17.62 ? 1787 TRP A NE1 1 
ATOM   865  C  CE2 . TRP A 1 108 ? 43.125 3.250   22.078  1.00 16.73 ? 1787 TRP A CE2 1 
ATOM   866  C  CE3 . TRP A 1 108 ? 43.518 1.421   20.542  1.00 18.22 ? 1787 TRP A CE3 1 
ATOM   867  C  CZ2 . TRP A 1 108 ? 42.685 4.101   21.027  1.00 17.10 ? 1787 TRP A CZ2 1 
ATOM   868  C  CZ3 . TRP A 1 108 ? 43.126 2.275   19.494  1.00 17.99 ? 1787 TRP A CZ3 1 
ATOM   869  C  CH2 . TRP A 1 108 ? 42.696 3.595   19.749  1.00 17.95 ? 1787 TRP A CH2 1 
ATOM   870  N  N   . LYS A 1 109 ? 43.888 -3.226  24.106  1.00 16.96 ? 1788 LYS A N   1 
ATOM   871  C  CA  . LYS A 1 109 ? 44.358 -4.626  24.086  1.00 18.06 ? 1788 LYS A CA  1 
ATOM   872  C  C   . LYS A 1 109 ? 43.458 -5.435  23.145  1.00 17.90 ? 1788 LYS A C   1 
ATOM   873  O  O   . LYS A 1 109 ? 43.928 -6.231  22.344  1.00 18.12 ? 1788 LYS A O   1 
ATOM   874  C  CB  . LYS A 1 109 ? 44.375 -5.226  25.506  1.00 20.43 ? 1788 LYS A CB  1 
ATOM   875  C  CG  . LYS A 1 109 ? 44.921 -6.660  25.588  1.00 25.21 ? 1788 LYS A CG  1 
ATOM   876  C  CD  . LYS A 1 109 ? 45.030 -7.127  27.064  1.00 22.02 ? 1788 LYS A CD  1 
ATOM   877  C  CE  . LYS A 1 109 ? 45.386 -8.597  27.194  1.00 33.15 ? 1788 LYS A CE  1 
ATOM   878  N  NZ  . LYS A 1 109 ? 45.012 -9.102  28.556  1.00 40.97 ? 1788 LYS A NZ  1 
ATOM   879  N  N   . MET A 1 110 ? 42.153 -5.195  23.234  1.00 16.28 ? 1789 MET A N   1 
ATOM   880  C  CA  . MET A 1 110 ? 41.208 -5.855  22.348  1.00 17.76 ? 1789 MET A CA  1 
ATOM   881  C  C   . MET A 1 110 ? 41.478 -5.468  20.895  1.00 18.45 ? 1789 MET A C   1 
ATOM   882  O  O   . MET A 1 110 ? 41.536 -6.329  20.003  1.00 19.25 ? 1789 MET A O   1 
ATOM   883  C  CB  . MET A 1 110 ? 39.797 -5.482  22.733  1.00 17.48 ? 1789 MET A CB  1 
ATOM   884  C  CG  . MET A 1 110 ? 38.778 -6.157  21.832  1.00 15.70 ? 1789 MET A CG  1 
ATOM   885  S  SD  . MET A 1 110 ? 37.099 -5.725  22.302  1.00 21.56 ? 1789 MET A SD  1 
ATOM   886  C  CE  . MET A 1 110 ? 37.009 -3.978  21.870  1.00 22.82 ? 1789 MET A CE  1 
ATOM   887  N  N   . VAL A 1 111 ? 41.653 -4.176  20.654  1.00 16.19 ? 1790 VAL A N   1 
ATOM   888  C  CA  . VAL A 1 111 ? 42.024 -3.701  19.316  1.00 17.33 ? 1790 VAL A CA  1 
ATOM   889  C  C   . VAL A 1 111 ? 43.227 -4.431  18.722  1.00 19.10 ? 1790 VAL A C   1 
ATOM   890  O  O   . VAL A 1 111 ? 43.223 -4.903  17.573  1.00 17.94 ? 1790 VAL A O   1 
ATOM   891  C  CB  . VAL A 1 111 ? 42.193 -2.149  19.312  1.00 17.23 ? 1790 VAL A CB  1 
ATOM   892  C  CG1 . VAL A 1 111 ? 42.812 -1.718  17.979  1.00 18.81 ? 1790 VAL A CG1 1 
ATOM   893  C  CG2 . VAL A 1 111 ? 40.784 -1.488  19.507  1.00 17.76 ? 1790 VAL A CG2 1 
ATOM   894  N  N   . TRP A 1 112 ? 44.260 -4.570  19.541  1.00 17.30 ? 1791 TRP A N   1 
ATOM   895  C  CA  . TRP A 1 112 ? 45.506 -5.162  19.057  1.00 17.60 ? 1791 TRP A CA  1 
ATOM   896  C  C   . TRP A 1 112 ? 45.318 -6.672  18.820  1.00 19.65 ? 1791 TRP A C   1 
ATOM   897  O  O   . TRP A 1 112 ? 45.661 -7.201  17.747  1.00 19.76 ? 1791 TRP A O   1 
ATOM   898  C  CB  . TRP A 1 112 ? 46.556 -4.918  20.135  1.00 21.36 ? 1791 TRP A CB  1 
ATOM   899  C  CG  . TRP A 1 112 ? 47.898 -5.461  19.782  1.00 19.83 ? 1791 TRP A CG  1 
ATOM   900  C  CD1 . TRP A 1 112 ? 48.493 -6.569  20.331  1.00 27.74 ? 1791 TRP A CD1 1 
ATOM   901  C  CD2 . TRP A 1 112 ? 48.837 -4.938  18.826  1.00 20.08 ? 1791 TRP A CD2 1 
ATOM   902  N  NE1 . TRP A 1 112 ? 49.735 -6.763  19.776  1.00 27.93 ? 1791 TRP A NE1 1 
ATOM   903  C  CE2 . TRP A 1 112 ? 49.972 -5.780  18.851  1.00 24.40 ? 1791 TRP A CE2 1 
ATOM   904  C  CE3 . TRP A 1 112 ? 48.846 -3.839  17.969  1.00 21.19 ? 1791 TRP A CE3 1 
ATOM   905  C  CZ2 . TRP A 1 112 ? 51.093 -5.553  18.038  1.00 27.91 ? 1791 TRP A CZ2 1 
ATOM   906  C  CZ3 . TRP A 1 112 ? 49.941 -3.620  17.154  1.00 26.96 ? 1791 TRP A CZ3 1 
ATOM   907  C  CH2 . TRP A 1 112 ? 51.070 -4.468  17.201  1.00 24.04 ? 1791 TRP A CH2 1 
ATOM   908  N  N   . GLU A 1 113 ? 44.768 -7.353  19.820  1.00 19.23 ? 1792 GLU A N   1 
ATOM   909  C  CA  . GLU A 1 113 ? 44.633 -8.816  19.789  1.00 19.62 ? 1792 GLU A CA  1 
ATOM   910  C  C   . GLU A 1 113 ? 43.671 -9.298  18.715  1.00 19.83 ? 1792 GLU A C   1 
ATOM   911  O  O   . GLU A 1 113 ? 43.823 -10.415 18.187  1.00 19.78 ? 1792 GLU A O   1 
ATOM   912  C  CB  . GLU A 1 113 ? 44.157 -9.322  21.149  1.00 20.47 ? 1792 GLU A CB  1 
ATOM   913  C  CG  . GLU A 1 113 ? 45.230 -9.138  22.205  1.00 22.93 ? 1792 GLU A CG  1 
ATOM   914  C  CD  . GLU A 1 113 ? 44.892 -9.855  23.493  1.00 28.16 ? 1792 GLU A CD  1 
ATOM   915  O  OE1 . GLU A 1 113 ? 43.732 -10.297 23.633  1.00 26.81 ? 1792 GLU A OE1 1 
ATOM   916  O  OE2 . GLU A 1 113 ? 45.790 -9.973  24.350  1.00 31.82 ? 1792 GLU A OE2 1 
ATOM   917  N  N   . GLN A 1 114 ? 42.650 -8.484  18.439  1.00 17.79 ? 1793 GLN A N   1 
ATOM   918  C  CA  . GLN A 1 114 ? 41.654 -8.856  17.450  1.00 18.93 ? 1793 GLN A CA  1 
ATOM   919  C  C   . GLN A 1 114 ? 41.973 -8.313  16.065  1.00 17.32 ? 1793 GLN A C   1 
ATOM   920  O  O   . GLN A 1 114 ? 41.154 -8.447  15.150  1.00 19.44 ? 1793 GLN A O   1 
ATOM   921  C  CB  . GLN A 1 114 ? 40.271 -8.424  17.939  1.00 20.18 ? 1793 GLN A CB  1 
ATOM   922  C  CG  . GLN A 1 114 ? 39.877 -9.047  19.252  1.00 22.48 ? 1793 GLN A CG  1 
ATOM   923  C  CD  . GLN A 1 114 ? 39.649 -10.544 19.136  1.00 27.82 ? 1793 GLN A CD  1 
ATOM   924  O  OE1 . GLN A 1 114 ? 38.933 -10.998 18.242  1.00 28.90 ? 1793 GLN A OE1 1 
ATOM   925  N  NE2 . GLN A 1 114 ? 40.289 -11.314 20.013  1.00 25.76 ? 1793 GLN A NE2 1 
ATOM   926  N  N   . ASN A 1 115 ? 43.160 -7.746  15.876  1.00 17.12 ? 1794 ASN A N   1 
ATOM   927  C  CA  A ASN A 1 115 ? 43.619 -7.235  14.573  0.50 18.01 ? 1794 ASN A CA  1 
ATOM   928  C  CA  B ASN A 1 115 ? 43.545 -7.325  14.527  0.50 17.33 ? 1794 ASN A CA  1 
ATOM   929  C  C   . ASN A 1 115 ? 42.687 -6.201  13.949  1.00 17.96 ? 1794 ASN A C   1 
ATOM   930  O  O   . ASN A 1 115 ? 42.543 -6.106  12.733  1.00 18.13 ? 1794 ASN A O   1 
ATOM   931  C  CB  A ASN A 1 115 ? 43.996 -8.328  13.559  0.50 18.50 ? 1794 ASN A CB  1 
ATOM   932  C  CB  B ASN A 1 115 ? 43.491 -8.526  13.573  0.50 17.14 ? 1794 ASN A CB  1 
ATOM   933  C  CG  A ASN A 1 115 ? 45.242 -9.097  13.970  0.50 21.20 ? 1794 ASN A CG  1 
ATOM   934  C  CG  B ASN A 1 115 ? 44.172 -9.748  14.164  0.50 17.11 ? 1794 ASN A CG  1 
ATOM   935  O  OD1 A ASN A 1 115 ? 46.361 -8.755  13.578  0.50 27.42 ? 1794 ASN A OD1 1 
ATOM   936  O  OD1 B ASN A 1 115 ? 45.352 -9.682  14.537  0.50 21.50 ? 1794 ASN A OD1 1 
ATOM   937  N  ND2 A ASN A 1 115 ? 45.049 -10.147 14.769  0.50 26.35 ? 1794 ASN A ND2 1 
ATOM   938  N  ND2 B ASN A 1 115 ? 43.443 -10.849 14.277  0.50 17.91 ? 1794 ASN A ND2 1 
ATOM   939  N  N   . VAL A 1 116 ? 42.106 -5.380  14.819  1.00 16.81 ? 1795 VAL A N   1 
ATOM   940  C  CA  . VAL A 1 116 ? 41.239 -4.275  14.372  1.00 18.09 ? 1795 VAL A CA  1 
ATOM   941  C  C   . VAL A 1 116 ? 42.064 -3.164  13.713  1.00 18.16 ? 1795 VAL A C   1 
ATOM   942  O  O   . VAL A 1 116 ? 43.114 -2.763  14.223  1.00 19.87 ? 1795 VAL A O   1 
ATOM   943  C  CB  . VAL A 1 116 ? 40.500 -3.706  15.597  1.00 14.72 ? 1795 VAL A CB  1 
ATOM   944  C  CG1 . VAL A 1 116 ? 39.729 -2.415  15.208  1.00 17.25 ? 1795 VAL A CG1 1 
ATOM   945  C  CG2 . VAL A 1 116 ? 39.585 -4.758  16.168  1.00 17.21 ? 1795 VAL A CG2 1 
ATOM   946  N  N   . HIS A 1 117 ? 41.556 -2.679  12.583  1.00 17.36 ? 1796 HIS A N   1 
ATOM   947  C  CA  . HIS A 1 117 ? 42.154 -1.562  11.866  1.00 17.71 ? 1796 HIS A CA  1 
ATOM   948  C  C   . HIS A 1 117 ? 41.235 -0.377  11.767  1.00 18.51 ? 1796 HIS A C   1 
ATOM   949  O  O   . HIS A 1 117 ? 41.720 0.707   11.464  1.00 20.43 ? 1796 HIS A O   1 
ATOM   950  C  CB  . HIS A 1 117 ? 42.557 -1.964  10.445  1.00 20.28 ? 1796 HIS A CB  1 
ATOM   951  C  CG  . HIS A 1 117 ? 43.747 -2.874  10.408  1.00 23.07 ? 1796 HIS A CG  1 
ATOM   952  N  ND1 . HIS A 1 117 ? 43.715 -4.146  10.930  1.00 22.49 ? 1796 HIS A ND1 1 
ATOM   953  C  CD2 . HIS A 1 117 ? 45.003 -2.692  9.934   1.00 29.43 ? 1796 HIS A CD2 1 
ATOM   954  C  CE1 . HIS A 1 117 ? 44.898 -4.716  10.779  1.00 25.21 ? 1796 HIS A CE1 1 
ATOM   955  N  NE2 . HIS A 1 117 ? 45.695 -3.859  10.165  1.00 31.23 ? 1796 HIS A NE2 1 
ATOM   956  N  N   . ASN A 1 118 ? 39.939 -0.578  12.001  1.00 17.02 ? 1797 ASN A N   1 
ATOM   957  C  CA  . ASN A 1 118 ? 38.985 0.531   11.895  1.00 16.53 ? 1797 ASN A CA  1 
ATOM   958  C  C   . ASN A 1 118 ? 38.058 0.563   13.101  1.00 13.71 ? 1797 ASN A C   1 
ATOM   959  O  O   . ASN A 1 118 ? 37.528 -0.476  13.509  1.00 15.26 ? 1797 ASN A O   1 
ATOM   960  C  CB  . ASN A 1 118 ? 38.094 0.330   10.655  1.00 17.32 ? 1797 ASN A CB  1 
ATOM   961  C  CG  . ASN A 1 118 ? 38.882 0.397   9.352   1.00 19.51 ? 1797 ASN A CG  1 
ATOM   962  O  OD1 . ASN A 1 118 ? 39.017 -0.605  8.624   1.00 23.04 ? 1797 ASN A OD1 1 
ATOM   963  N  ND2 . ASN A 1 118 ? 39.419 1.558   9.066   1.00 16.53 ? 1797 ASN A ND2 1 
ATOM   964  N  N   . ILE A 1 119 ? 37.900 1.760   13.674  1.00 12.48 ? 1798 ILE A N   1 
ATOM   965  C  CA  . ILE A 1 119 ? 37.018 1.998   14.816  1.00 13.70 ? 1798 ILE A CA  1 
ATOM   966  C  C   . ILE A 1 119 ? 36.006 3.053   14.438  1.00 15.20 ? 1798 ILE A C   1 
ATOM   967  O  O   . ILE A 1 119 ? 36.381 4.102   13.890  1.00 15.80 ? 1798 ILE A O   1 
ATOM   968  C  CB  . ILE A 1 119 ? 37.827 2.477   16.058  1.00 14.35 ? 1798 ILE A CB  1 
ATOM   969  C  CG1 . ILE A 1 119 ? 38.865 1.420   16.448  1.00 14.11 ? 1798 ILE A CG1 1 
ATOM   970  C  CG2 . ILE A 1 119 ? 36.918 2.848   17.239  1.00 14.71 ? 1798 ILE A CG2 1 
ATOM   971  C  CD1 . ILE A 1 119 ? 39.874 2.040   17.410  1.00 16.67 ? 1798 ILE A CD1 1 
ATOM   972  N  N   . VAL A 1 120 ? 34.737 2.769   14.743  1.00 13.49 ? 1799 VAL A N   1 
ATOM   973  C  CA  . VAL A 1 120 ? 33.643 3.710   14.474  1.00 13.60 ? 1799 VAL A CA  1 
ATOM   974  C  C   . VAL A 1 120 ? 33.085 4.115   15.840  1.00 14.19 ? 1799 VAL A C   1 
ATOM   975  O  O   . VAL A 1 120 ? 32.683 3.263   16.644  1.00 14.79 ? 1799 VAL A O   1 
ATOM   976  C  CB  . VAL A 1 120 ? 32.498 3.057   13.628  1.00 13.75 ? 1799 VAL A CB  1 
ATOM   977  C  CG1 . VAL A 1 120 ? 31.326 4.035   13.492  1.00 16.05 ? 1799 VAL A CG1 1 
ATOM   978  C  CG2 . VAL A 1 120 ? 33.074 2.672   12.247  1.00 16.25 ? 1799 VAL A CG2 1 
ATOM   979  N  N   . MET A 1 121 ? 33.054 5.416   16.126  1.00 13.06 ? 1800 MET A N   1 
ATOM   980  C  CA  . MET A 1 121 ? 32.532 5.943   17.395  1.00 13.43 ? 1800 MET A CA  1 
ATOM   981  C  C   . MET A 1 121 ? 31.335 6.829   17.052  1.00 15.69 ? 1800 MET A C   1 
ATOM   982  O  O   . MET A 1 121 ? 31.477 7.789   16.290  1.00 16.22 ? 1800 MET A O   1 
ATOM   983  C  CB  . MET A 1 121 ? 33.612 6.783   18.097  1.00 15.42 ? 1800 MET A CB  1 
ATOM   984  C  CG  . MET A 1 121 ? 33.124 7.561   19.299  1.00 16.54 ? 1800 MET A CG  1 
ATOM   985  S  SD  . MET A 1 121 ? 34.630 8.153   20.138  1.00 17.87 ? 1800 MET A SD  1 
ATOM   986  C  CE  . MET A 1 121 ? 33.969 9.088   21.499  1.00 20.26 ? 1800 MET A CE  1 
ATOM   987  N  N   . VAL A 1 122 ? 30.169 6.498   17.602  1.00 14.18 ? 1801 VAL A N   1 
ATOM   988  C  CA  . VAL A 1 122 ? 28.928 7.202   17.285  1.00 16.31 ? 1801 VAL A CA  1 
ATOM   989  C  C   . VAL A 1 122 ? 28.325 7.831   18.538  1.00 20.55 ? 1801 VAL A C   1 
ATOM   990  O  O   . VAL A 1 122 ? 27.105 7.892   18.685  1.00 26.15 ? 1801 VAL A O   1 
ATOM   991  C  CB  . VAL A 1 122 ? 27.914 6.354   16.446  1.00 16.73 ? 1801 VAL A CB  1 
ATOM   992  C  CG1 . VAL A 1 122 ? 28.453 6.141   15.033  1.00 18.27 ? 1801 VAL A CG1 1 
ATOM   993  C  CG2 . VAL A 1 122 ? 27.668 4.980   17.073  1.00 22.42 ? 1801 VAL A CG2 1 
ATOM   994  N  N   . THR A 1 123 ? 29.180 8.304   19.439  1.00 20.97 ? 1802 THR A N   1 
ATOM   995  C  CA  . THR A 1 123 ? 28.736 9.099   20.585  1.00 20.47 ? 1802 THR A CA  1 
ATOM   996  C  C   . THR A 1 123 ? 29.691 10.285  20.664  1.00 23.73 ? 1802 THR A C   1 
ATOM   997  O  O   . THR A 1 123 ? 30.843 10.236  20.195  1.00 22.41 ? 1802 THR A O   1 
ATOM   998  C  CB  . THR A 1 123 ? 28.744 8.266   21.924  1.00 20.83 ? 1802 THR A CB  1 
ATOM   999  O  OG1 . THR A 1 123 ? 28.186 9.029   23.018  1.00 23.12 ? 1802 THR A OG1 1 
ATOM   1000 C  CG2 . THR A 1 123 ? 30.174 7.777   22.261  1.00 19.62 ? 1802 THR A CG2 1 
ATOM   1001 N  N   . GLN A 1 124 ? 29.230 11.367  21.287  1.00 23.55 ? 1803 GLN A N   1 
ATOM   1002 C  CA  . GLN A 1 124 ? 30.149 12.294  21.952  1.00 24.44 ? 1803 GLN A CA  1 
ATOM   1003 C  C   . GLN A 1 124 ? 30.645 11.852  23.324  1.00 24.37 ? 1803 GLN A C   1 
ATOM   1004 O  O   . GLN A 1 124 ? 30.017 11.010  23.949  1.00 24.79 ? 1803 GLN A O   1 
ATOM   1005 C  CB  . GLN A 1 124 ? 29.487 13.664  22.022  1.00 24.20 ? 1803 GLN A CB  1 
ATOM   1006 C  CG  . GLN A 1 124 ? 29.333 14.231  20.626  1.00 29.87 ? 1803 GLN A CG  1 
ATOM   1007 C  CD  . GLN A 1 124 ? 30.702 14.686  20.116  1.00 41.27 ? 1803 GLN A CD  1 
ATOM   1008 O  OE1 . GLN A 1 124 ? 31.710 14.591  20.827  1.00 47.57 ? 1803 GLN A OE1 1 
ATOM   1009 N  NE2 . GLN A 1 124 ? 30.744 15.183  18.889  1.00 46.73 ? 1803 GLN A NE2 1 
ATOM   1010 N  N   . CYS A 1 125 ? 31.788 12.374  23.779  1.00 26.02 ? 1804 CYS A N   1 
ATOM   1011 C  CA  . CYS A 1 125 ? 32.304 11.991  25.092  1.00 24.97 ? 1804 CYS A CA  1 
ATOM   1012 C  C   . CYS A 1 125 ? 31.416 12.507  26.216  1.00 25.84 ? 1804 CYS A C   1 
ATOM   1013 O  O   . CYS A 1 125 ? 31.234 11.845  27.227  1.00 23.41 ? 1804 CYS A O   1 
ATOM   1014 C  CB  . CYS A 1 125 ? 33.739 12.479  25.297  1.00 24.54 ? 1804 CYS A CB  1 
ATOM   1015 S  SG  . CYS A 1 125 ? 34.968 11.466  24.341  1.00 30.11 ? 1804 CYS A SG  1 
ATOM   1016 N  N   . VAL A 1 126 ? 30.889 13.710  26.044  1.00 26.43 ? 1805 VAL A N   1 
ATOM   1017 C  CA  . VAL A 1 126 ? 30.040 14.311  27.066  1.00 26.77 ? 1805 VAL A CA  1 
ATOM   1018 C  C   . VAL A 1 126 ? 28.759 14.724  26.385  1.00 27.45 ? 1805 VAL A C   1 
ATOM   1019 O  O   . VAL A 1 126 ? 28.798 15.394  25.348  1.00 28.00 ? 1805 VAL A O   1 
ATOM   1020 C  CB  . VAL A 1 126 ? 30.705 15.593  27.649  1.00 27.19 ? 1805 VAL A CB  1 
ATOM   1021 C  CG1 . VAL A 1 126 ? 29.712 16.392  28.496  1.00 27.16 ? 1805 VAL A CG1 1 
ATOM   1022 C  CG2 . VAL A 1 126 ? 31.990 15.257  28.378  1.00 28.79 ? 1805 VAL A CG2 1 
ATOM   1023 N  N   . GLU A 1 127 ? 27.623 14.328  26.955  1.00 27.29 ? 1806 GLU A N   1 
ATOM   1024 C  CA  . GLU A 1 127 ? 26.321 14.653  26.380  1.00 28.23 ? 1806 GLU A CA  1 
ATOM   1025 C  C   . GLU A 1 127 ? 25.403 15.043  27.521  1.00 30.64 ? 1806 GLU A C   1 
ATOM   1026 O  O   . GLU A 1 127 ? 25.410 14.382  28.569  1.00 27.77 ? 1806 GLU A O   1 
ATOM   1027 C  CB  . GLU A 1 127 ? 25.717 13.457  25.645  1.00 28.68 ? 1806 GLU A CB  1 
ATOM   1028 C  CG  . GLU A 1 127 ? 26.670 12.935  24.562  1.00 29.03 ? 1806 GLU A CG  1 
ATOM   1029 C  CD  . GLU A 1 127 ? 26.150 11.729  23.793  1.00 30.34 ? 1806 GLU A CD  1 
ATOM   1030 O  OE1 . GLU A 1 127 ? 25.542 10.838  24.423  1.00 33.44 ? 1806 GLU A OE1 1 
ATOM   1031 O  OE2 . GLU A 1 127 ? 26.386 11.669  22.566  1.00 29.05 ? 1806 GLU A OE2 1 
ATOM   1032 N  N   . LYS A 1 128 ? 24.624 16.103  27.303  1.00 32.56 ? 1807 LYS A N   1 
ATOM   1033 C  CA  . LYS A 1 128 ? 23.728 16.633  28.330  1.00 34.77 ? 1807 LYS A CA  1 
ATOM   1034 C  C   . LYS A 1 128 ? 24.418 16.624  29.700  1.00 35.14 ? 1807 LYS A C   1 
ATOM   1035 O  O   . LYS A 1 128 ? 23.830 16.170  30.691  1.00 36.75 ? 1807 LYS A O   1 
ATOM   1036 C  CB  . LYS A 1 128 ? 22.441 15.801  28.392  1.00 34.95 ? 1807 LYS A CB  1 
ATOM   1037 C  CG  . LYS A 1 128 ? 21.608 15.785  27.102  1.00 35.86 ? 1807 LYS A CG  1 
ATOM   1038 C  CD  . LYS A 1 128 ? 20.248 15.102  27.315  1.00 37.93 ? 1807 LYS A CD  1 
ATOM   1039 C  CE  . LYS A 1 128 ? 19.448 15.018  26.014  1.00 41.31 ? 1807 LYS A CE  1 
ATOM   1040 N  NZ  . LYS A 1 128 ? 18.231 14.136  26.107  1.00 46.17 ? 1807 LYS A NZ  1 
ATOM   1041 N  N   . GLY A 1 129 ? 25.662 17.104  29.738  1.00 34.90 ? 1808 GLY A N   1 
ATOM   1042 C  CA  . GLY A 1 129 ? 26.438 17.246  30.963  1.00 32.47 ? 1808 GLY A CA  1 
ATOM   1043 C  C   . GLY A 1 129 ? 26.957 15.993  31.650  1.00 32.86 ? 1808 GLY A C   1 
ATOM   1044 O  O   . GLY A 1 129 ? 27.557 16.085  32.727  1.00 32.20 ? 1808 GLY A O   1 
ATOM   1045 N  N   . ARG A 1 130 ? 26.738 14.826  31.049  1.00 31.45 ? 1809 ARG A N   1 
ATOM   1046 C  CA  . ARG A 1 130 ? 27.188 13.536  31.598  1.00 31.80 ? 1809 ARG A CA  1 
ATOM   1047 C  C   . ARG A 1 130 ? 28.346 12.967  30.764  1.00 30.35 ? 1809 ARG A C   1 
ATOM   1048 O  O   . ARG A 1 130 ? 28.330 13.095  29.534  1.00 28.63 ? 1809 ARG A O   1 
ATOM   1049 C  CB  . ARG A 1 130 ? 26.033 12.526  31.590  1.00 31.96 ? 1809 ARG A CB  1 
ATOM   1050 C  CG  . ARG A 1 130 ? 24.976 12.768  32.671  1.00 38.72 ? 1809 ARG A CG  1 
ATOM   1051 C  CD  . ARG A 1 130 ? 25.552 12.653  34.097  1.00 43.40 ? 1809 ARG A CD  1 
ATOM   1052 N  NE  . ARG A 1 130 ? 25.890 11.274  34.454  1.00 49.85 ? 1809 ARG A NE  1 
ATOM   1053 C  CZ  . ARG A 1 130 ? 26.491 10.907  35.587  1.00 52.65 ? 1809 ARG A CZ  1 
ATOM   1054 N  NH1 . ARG A 1 130 ? 26.831 11.813  36.498  1.00 51.60 ? 1809 ARG A NH1 1 
ATOM   1055 N  NH2 . ARG A 1 130 ? 26.757 9.622   35.811  1.00 52.10 ? 1809 ARG A NH2 1 
ATOM   1056 N  N   . VAL A 1 131 ? 29.337 12.353  31.413  1.00 28.58 ? 1810 VAL A N   1 
ATOM   1057 C  CA  . VAL A 1 131 ? 30.364 11.618  30.665  1.00 29.84 ? 1810 VAL A CA  1 
ATOM   1058 C  C   . VAL A 1 131 ? 29.744 10.336  30.095  1.00 29.18 ? 1810 VAL A C   1 
ATOM   1059 O  O   . VAL A 1 131 ? 29.206 9.509   30.837  1.00 29.84 ? 1810 VAL A O   1 
ATOM   1060 C  CB  . VAL A 1 131 ? 31.609 11.281  31.538  1.00 31.02 ? 1810 VAL A CB  1 
ATOM   1061 C  CG1 . VAL A 1 131 ? 31.199 10.525  32.806  1.00 36.91 ? 1810 VAL A CG1 1 
ATOM   1062 C  CG2 . VAL A 1 131 ? 32.640 10.474  30.746  1.00 33.65 ? 1810 VAL A CG2 1 
ATOM   1063 N  N   . LYS A 1 132 ? 29.837 10.172  28.775  1.00 25.78 ? 1811 LYS A N   1 
ATOM   1064 C  CA  . LYS A 1 132 ? 29.254 9.013   28.086  1.00 23.13 ? 1811 LYS A CA  1 
ATOM   1065 C  C   . LYS A 1 132 ? 30.346 8.078   27.575  1.00 22.60 ? 1811 LYS A C   1 
ATOM   1066 O  O   . LYS A 1 132 ? 30.099 6.908   27.263  1.00 20.32 ? 1811 LYS A O   1 
ATOM   1067 C  CB  . LYS A 1 132 ? 28.416 9.473   26.885  1.00 22.52 ? 1811 LYS A CB  1 
ATOM   1068 C  CG  . LYS A 1 132 ? 27.264 10.424  27.195  1.00 25.31 ? 1811 LYS A CG  1 
ATOM   1069 C  CD  . LYS A 1 132 ? 26.249 9.800   28.151  1.00 30.25 ? 1811 LYS A CD  1 
ATOM   1070 C  CE  . LYS A 1 132 ? 24.885 10.469  27.972  1.00 31.89 ? 1811 LYS A CE  1 
ATOM   1071 N  NZ  . LYS A 1 132 ? 24.054 9.795   26.935  1.00 32.20 ? 1811 LYS A NZ  1 
ATOM   1072 N  N   . CYS A 1 133 ? 31.563 8.596   27.451  1.00 21.80 ? 1812 CYS A N   1 
ATOM   1073 C  CA  . CYS A 1 133 ? 32.654 7.776   26.920  1.00 23.08 ? 1812 CYS A CA  1 
ATOM   1074 C  C   . CYS A 1 133 ? 33.903 8.526   27.301  1.00 23.81 ? 1812 CYS A C   1 
ATOM   1075 O  O   . CYS A 1 133 ? 33.953 9.756   27.128  1.00 23.77 ? 1812 CYS A O   1 
ATOM   1076 C  CB  . CYS A 1 133 ? 32.589 7.680   25.395  1.00 23.09 ? 1812 CYS A CB  1 
ATOM   1077 S  SG  . CYS A 1 133 ? 33.997 6.766   24.708  1.00 23.13 ? 1812 CYS A SG  1 
ATOM   1078 N  N   . ASP A 1 134 ? 34.888 7.815   27.835  1.00 23.66 ? 1813 ASP A N   1 
ATOM   1079 C  CA  . ASP A 1 134 ? 36.075 8.526   28.294  1.00 25.05 ? 1813 ASP A CA  1 
ATOM   1080 C  C   . ASP A 1 134 ? 36.994 8.800   27.098  1.00 25.35 ? 1813 ASP A C   1 
ATOM   1081 O  O   . ASP A 1 134 ? 36.817 8.197   26.036  1.00 27.70 ? 1813 ASP A O   1 
ATOM   1082 C  CB  . ASP A 1 134 ? 36.709 7.860   29.523  1.00 27.69 ? 1813 ASP A CB  1 
ATOM   1083 C  CG  . ASP A 1 134 ? 35.862 8.106   30.782  1.00 32.27 ? 1813 ASP A CG  1 
ATOM   1084 O  OD1 . ASP A 1 134 ? 36.085 9.139   31.469  1.00 31.69 ? 1813 ASP A OD1 1 
ATOM   1085 O  OD2 . ASP A 1 134 ? 34.929 7.312   31.066  1.00 34.63 ? 1813 ASP A OD2 1 
ATOM   1086 N  N   . HIS A 1 135 ? 37.915 9.748   27.221  1.00 24.69 ? 1814 HIS A N   1 
ATOM   1087 C  CA  . HIS A 1 135 ? 38.685 10.178  26.034  1.00 25.21 ? 1814 HIS A CA  1 
ATOM   1088 C  C   . HIS A 1 135 ? 39.890 9.261   25.982  1.00 24.72 ? 1814 HIS A C   1 
ATOM   1089 O  O   . HIS A 1 135 ? 40.902 9.509   26.634  1.00 25.15 ? 1814 HIS A O   1 
ATOM   1090 C  CB  . HIS A 1 135 ? 39.141 11.634  26.196  1.00 25.21 ? 1814 HIS A CB  1 
ATOM   1091 C  CG  . HIS A 1 135 ? 39.864 12.190  25.009  1.00 30.27 ? 1814 HIS A CG  1 
ATOM   1092 N  ND1 . HIS A 1 135 ? 40.973 11.590  24.447  1.00 33.90 ? 1814 HIS A ND1 1 
ATOM   1093 C  CD2 . HIS A 1 135 ? 39.640 13.312  24.283  1.00 36.20 ? 1814 HIS A CD2 1 
ATOM   1094 C  CE1 . HIS A 1 135 ? 41.400 12.316  23.429  1.00 33.74 ? 1814 HIS A CE1 1 
ATOM   1095 N  NE2 . HIS A 1 135 ? 40.608 13.367  23.307  1.00 36.80 ? 1814 HIS A NE2 1 
ATOM   1096 N  N   . TYR A 1 136 ? 39.752 8.172   25.231  1.00 18.86 ? 1815 TYR A N   1 
ATOM   1097 C  CA  . TYR A 1 136 ? 40.606 7.020   25.417  1.00 18.96 ? 1815 TYR A CA  1 
ATOM   1098 C  C   . TYR A 1 136 ? 41.783 7.033   24.441  1.00 17.49 ? 1815 TYR A C   1 
ATOM   1099 O  O   . TYR A 1 136 ? 42.525 6.076   24.335  1.00 19.66 ? 1815 TYR A O   1 
ATOM   1100 C  CB  . TYR A 1 136 ? 39.794 5.727   25.312  1.00 18.23 ? 1815 TYR A CB  1 
ATOM   1101 C  CG  . TYR A 1 136 ? 39.050 5.585   23.991  1.00 16.43 ? 1815 TYR A CG  1 
ATOM   1102 C  CD1 . TYR A 1 136 ? 39.680 5.005   22.873  1.00 18.32 ? 1815 TYR A CD1 1 
ATOM   1103 C  CD2 . TYR A 1 136 ? 37.720 6.000   23.884  1.00 18.09 ? 1815 TYR A CD2 1 
ATOM   1104 C  CE1 . TYR A 1 136 ? 39.027 4.885   21.640  1.00 17.39 ? 1815 TYR A CE1 1 
ATOM   1105 C  CE2 . TYR A 1 136 ? 37.033 5.871   22.661  1.00 16.42 ? 1815 TYR A CE2 1 
ATOM   1106 C  CZ  . TYR A 1 136 ? 37.699 5.301   21.550  1.00 16.49 ? 1815 TYR A CZ  1 
ATOM   1107 O  OH  . TYR A 1 136 ? 37.052 5.153   20.330  1.00 17.48 ? 1815 TYR A OH  1 
ATOM   1108 N  N   . TRP A 1 137 ? 41.964 8.115   23.697  1.00 18.61 ? 1816 TRP A N   1 
ATOM   1109 C  CA  . TRP A 1 137 ? 43.150 8.224   22.823  1.00 20.84 ? 1816 TRP A CA  1 
ATOM   1110 C  C   . TRP A 1 137 ? 43.941 9.462   23.212  1.00 23.65 ? 1816 TRP A C   1 
ATOM   1111 O  O   . TRP A 1 137 ? 43.465 10.318  23.958  1.00 23.27 ? 1816 TRP A O   1 
ATOM   1112 C  CB  . TRP A 1 137 ? 42.718 8.260   21.344  1.00 21.12 ? 1816 TRP A CB  1 
ATOM   1113 C  CG  . TRP A 1 137 ? 41.867 9.470   20.981  1.00 20.75 ? 1816 TRP A CG  1 
ATOM   1114 C  CD1 . TRP A 1 137 ? 42.310 10.690  20.557  1.00 24.72 ? 1816 TRP A CD1 1 
ATOM   1115 C  CD2 . TRP A 1 137 ? 40.437 9.554   21.014  1.00 20.45 ? 1816 TRP A CD2 1 
ATOM   1116 N  NE1 . TRP A 1 137 ? 41.248 11.532  20.317  1.00 22.33 ? 1816 TRP A NE1 1 
ATOM   1117 C  CE2 . TRP A 1 137 ? 40.082 10.862  20.604  1.00 19.62 ? 1816 TRP A CE2 1 
ATOM   1118 C  CE3 . TRP A 1 137 ? 39.426 8.663   21.366  1.00 22.10 ? 1816 TRP A CE3 1 
ATOM   1119 C  CZ2 . TRP A 1 137 ? 38.755 11.277  20.516  1.00 25.57 ? 1816 TRP A CZ2 1 
ATOM   1120 C  CZ3 . TRP A 1 137 ? 38.089 9.076   21.275  1.00 23.45 ? 1816 TRP A CZ3 1 
ATOM   1121 C  CH2 . TRP A 1 137 ? 37.768 10.374  20.866  1.00 23.76 ? 1816 TRP A CH2 1 
ATOM   1122 N  N   . PRO A 1 138 ? 45.182 9.571   22.726  1.00 24.89 ? 1817 PRO A N   1 
ATOM   1123 C  CA  . PRO A 1 138 ? 45.985 10.708  23.162  1.00 27.85 ? 1817 PRO A CA  1 
ATOM   1124 C  C   . PRO A 1 138 ? 45.341 12.057  22.837  1.00 30.35 ? 1817 PRO A C   1 
ATOM   1125 O  O   . PRO A 1 138 ? 44.639 12.192  21.828  1.00 30.18 ? 1817 PRO A O   1 
ATOM   1126 C  CB  . PRO A 1 138 ? 47.292 10.519  22.378  1.00 27.31 ? 1817 PRO A CB  1 
ATOM   1127 C  CG  . PRO A 1 138 ? 47.358 9.090   22.109  1.00 26.14 ? 1817 PRO A CG  1 
ATOM   1128 C  CD  . PRO A 1 138 ? 45.931 8.688   21.818  1.00 26.09 ? 1817 PRO A CD  1 
ATOM   1129 N  N   . ALA A 1 139 ? 45.575 13.031  23.710  1.00 34.25 ? 1818 ALA A N   1 
ATOM   1130 C  CA  . ALA A 1 139 ? 44.979 14.356  23.565  1.00 38.35 ? 1818 ALA A CA  1 
ATOM   1131 C  C   . ALA A 1 139 ? 45.800 15.181  22.573  1.00 40.36 ? 1818 ALA A C   1 
ATOM   1132 O  O   . ALA A 1 139 ? 45.282 16.072  21.895  1.00 43.87 ? 1818 ALA A O   1 
ATOM   1133 C  CB  . ALA A 1 139 ? 44.884 15.035  24.925  1.00 39.06 ? 1818 ALA A CB  1 
ATOM   1134 N  N   . ASP A 1 140 ? 47.083 14.869  22.462  1.00 39.03 ? 1819 ASP A N   1 
ATOM   1135 C  CA  . ASP A 1 140 ? 47.946 15.656  21.591  1.00 39.30 ? 1819 ASP A CA  1 
ATOM   1136 C  C   . ASP A 1 140 ? 48.734 14.738  20.667  1.00 37.92 ? 1819 ASP A C   1 
ATOM   1137 O  O   . ASP A 1 140 ? 48.294 13.636  20.354  1.00 35.85 ? 1819 ASP A O   1 
ATOM   1138 C  CB  . ASP A 1 140 ? 48.900 16.516  22.426  1.00 39.15 ? 1819 ASP A CB  1 
ATOM   1139 C  CG  . ASP A 1 140 ? 49.658 15.709  23.467  1.00 44.05 ? 1819 ASP A CG  1 
ATOM   1140 O  OD1 . ASP A 1 140 ? 50.034 16.281  24.516  1.00 47.87 ? 1819 ASP A OD1 1 
ATOM   1141 O  OD2 . ASP A 1 140 ? 49.890 14.499  23.241  1.00 46.09 ? 1819 ASP A OD2 1 
ATOM   1142 N  N   . GLN A 1 141 ? 49.909 15.185  20.238  1.00 36.43 ? 1820 GLN A N   1 
ATOM   1143 C  CA  . GLN A 1 141 ? 50.689 14.354  19.335  1.00 35.78 ? 1820 GLN A CA  1 
ATOM   1144 C  C   . GLN A 1 141 ? 51.759 13.513  20.030  1.00 33.17 ? 1820 GLN A C   1 
ATOM   1145 O  O   . GLN A 1 141 ? 52.522 12.835  19.354  1.00 33.30 ? 1820 GLN A O   1 
ATOM   1146 C  CB  . GLN A 1 141 ? 51.300 15.193  18.209  1.00 38.13 ? 1820 GLN A CB  1 
ATOM   1147 C  CG  . GLN A 1 141 ? 50.281 16.079  17.495  1.00 42.83 ? 1820 GLN A CG  1 
ATOM   1148 C  CD  . GLN A 1 141 ? 50.932 17.231  16.751  1.00 49.78 ? 1820 GLN A CD  1 
ATOM   1149 O  OE1 . GLN A 1 141 ? 51.321 17.093  15.587  1.00 53.72 ? 1820 GLN A OE1 1 
ATOM   1150 N  NE2 . GLN A 1 141 ? 51.061 18.374  17.421  1.00 50.68 ? 1820 GLN A NE2 1 
ATOM   1151 N  N   . ASP A 1 142 ? 51.826 13.525  21.358  1.00 30.32 ? 1821 ASP A N   1 
ATOM   1152 C  CA  . ASP A 1 142 ? 52.824 12.695  22.052  1.00 31.20 ? 1821 ASP A CA  1 
ATOM   1153 C  C   . ASP A 1 142 ? 52.341 11.232  22.190  1.00 29.94 ? 1821 ASP A C   1 
ATOM   1154 O  O   . ASP A 1 142 ? 51.156 10.992  22.423  1.00 29.49 ? 1821 ASP A O   1 
ATOM   1155 C  CB  . ASP A 1 142 ? 53.172 13.282  23.436  1.00 32.06 ? 1821 ASP A CB  1 
ATOM   1156 C  CG  . ASP A 1 142 ? 53.950 14.610  23.350  1.00 39.81 ? 1821 ASP A CG  1 
ATOM   1157 O  OD1 . ASP A 1 142 ? 54.749 14.798  22.398  1.00 43.04 ? 1821 ASP A OD1 1 
ATOM   1158 O  OD2 . ASP A 1 142 ? 53.756 15.480  24.237  1.00 44.92 ? 1821 ASP A OD2 1 
ATOM   1159 N  N   . SER A 1 143 ? 53.262 10.281  22.042  1.00 28.64 ? 1822 SER A N   1 
ATOM   1160 C  CA  . SER A 1 143 ? 53.006 8.854   22.310  1.00 27.82 ? 1822 SER A CA  1 
ATOM   1161 C  C   . SER A 1 143 ? 52.537 8.661   23.754  1.00 27.93 ? 1822 SER A C   1 
ATOM   1162 O  O   . SER A 1 143 ? 52.995 9.378   24.641  1.00 29.04 ? 1822 SER A O   1 
ATOM   1163 C  CB  . SER A 1 143 ? 54.295 8.038   22.103  1.00 28.68 ? 1822 SER A CB  1 
ATOM   1164 O  OG  . SER A 1 143 ? 54.538 7.818   20.729  1.00 38.42 ? 1822 SER A OG  1 
ATOM   1165 N  N   . LEU A 1 144 ? 51.636 7.712   23.995  1.00 24.61 ? 1823 LEU A N   1 
ATOM   1166 C  CA  . LEU A 1 144 ? 51.293 7.266   25.360  1.00 23.36 ? 1823 LEU A CA  1 
ATOM   1167 C  C   . LEU A 1 144 ? 51.310 5.741   25.381  1.00 20.54 ? 1823 LEU A C   1 
ATOM   1168 O  O   . LEU A 1 144 ? 50.909 5.100   24.412  1.00 20.36 ? 1823 LEU A O   1 
ATOM   1169 C  CB  . LEU A 1 144 ? 49.883 7.709   25.800  1.00 23.26 ? 1823 LEU A CB  1 
ATOM   1170 C  CG  . LEU A 1 144 ? 49.565 9.148   26.200  1.00 26.49 ? 1823 LEU A CG  1 
ATOM   1171 C  CD1 . LEU A 1 144 ? 48.117 9.225   26.628  1.00 28.01 ? 1823 LEU A CD1 1 
ATOM   1172 C  CD2 . LEU A 1 144 ? 50.480 9.621   27.301  1.00 32.94 ? 1823 LEU A CD2 1 
ATOM   1173 N  N   . TYR A 1 145 ? 51.742 5.155   26.493  1.00 18.85 ? 1824 TYR A N   1 
ATOM   1174 C  CA  . TYR A 1 145 ? 51.455 3.747   26.762  1.00 19.02 ? 1824 TYR A CA  1 
ATOM   1175 C  C   . TYR A 1 145 ? 50.034 3.571   27.279  1.00 18.78 ? 1824 TYR A C   1 
ATOM   1176 O  O   . TYR A 1 145 ? 49.566 4.355   28.124  1.00 18.53 ? 1824 TYR A O   1 
ATOM   1177 C  CB  . TYR A 1 145 ? 52.367 3.232   27.887  1.00 18.23 ? 1824 TYR A CB  1 
ATOM   1178 C  CG  . TYR A 1 145 ? 53.786 2.956   27.449  1.00 19.30 ? 1824 TYR A CG  1 
ATOM   1179 C  CD1 . TYR A 1 145 ? 54.704 3.985   27.360  1.00 22.08 ? 1824 TYR A CD1 1 
ATOM   1180 C  CD2 . TYR A 1 145 ? 54.181 1.674   27.117  1.00 23.90 ? 1824 TYR A CD2 1 
ATOM   1181 C  CE1 . TYR A 1 145 ? 56.009 3.747   26.967  1.00 23.50 ? 1824 TYR A CE1 1 
ATOM   1182 C  CE2 . TYR A 1 145 ? 55.494 1.428   26.719  1.00 23.52 ? 1824 TYR A CE2 1 
ATOM   1183 C  CZ  . TYR A 1 145 ? 56.385 2.485   26.646  1.00 25.81 ? 1824 TYR A CZ  1 
ATOM   1184 O  OH  . TYR A 1 145 ? 57.698 2.330   26.263  1.00 27.69 ? 1824 TYR A OH  1 
ATOM   1185 N  N   . TYR A 1 146 ? 49.378 2.525   26.782  1.00 17.50 ? 1825 TYR A N   1 
ATOM   1186 C  CA  . TYR A 1 146 ? 48.136 2.045   27.372  1.00 18.70 ? 1825 TYR A CA  1 
ATOM   1187 C  C   . TYR A 1 146 ? 48.436 0.585   27.658  1.00 18.67 ? 1825 TYR A C   1 
ATOM   1188 O  O   . TYR A 1 146 ? 48.392 -0.250  26.756  1.00 19.29 ? 1825 TYR A O   1 
ATOM   1189 C  CB  . TYR A 1 146 ? 47.016 2.140   26.331  1.00 20.66 ? 1825 TYR A CB  1 
ATOM   1190 C  CG  . TYR A 1 146 ? 46.543 3.554   26.098  1.00 19.62 ? 1825 TYR A CG  1 
ATOM   1191 C  CD1 . TYR A 1 146 ? 45.500 4.087   26.845  1.00 22.83 ? 1825 TYR A CD1 1 
ATOM   1192 C  CD2 . TYR A 1 146 ? 47.135 4.345   25.127  1.00 20.79 ? 1825 TYR A CD2 1 
ATOM   1193 C  CE1 . TYR A 1 146 ? 45.069 5.395   26.625  1.00 24.17 ? 1825 TYR A CE1 1 
ATOM   1194 C  CE2 . TYR A 1 146 ? 46.703 5.638   24.880  1.00 22.63 ? 1825 TYR A CE2 1 
ATOM   1195 C  CZ  . TYR A 1 146 ? 45.667 6.157   25.648  1.00 23.43 ? 1825 TYR A CZ  1 
ATOM   1196 O  OH  . TYR A 1 146 ? 45.275 7.465   25.396  1.00 23.78 ? 1825 TYR A OH  1 
ATOM   1197 N  N   . GLY A 1 147 ? 48.802 0.286   28.900  1.00 19.62 ? 1826 GLY A N   1 
ATOM   1198 C  CA  . GLY A 1 147 ? 49.195 -1.081  29.226  1.00 18.74 ? 1826 GLY A CA  1 
ATOM   1199 C  C   . GLY A 1 147 ? 50.475 -1.393  28.477  1.00 19.17 ? 1826 GLY A C   1 
ATOM   1200 O  O   . GLY A 1 147 ? 51.459 -0.676  28.648  1.00 20.12 ? 1826 GLY A O   1 
ATOM   1201 N  N   . ASP A 1 148 ? 50.458 -2.458  27.680  1.00 21.26 ? 1827 ASP A N   1 
ATOM   1202 C  CA  . ASP A 1 148 ? 51.663 -2.889  26.960  1.00 20.96 ? 1827 ASP A CA  1 
ATOM   1203 C  C   . ASP A 1 148 ? 51.755 -2.400  25.513  1.00 21.94 ? 1827 ASP A C   1 
ATOM   1204 O  O   . ASP A 1 148 ? 52.588 -2.856  24.728  1.00 24.07 ? 1827 ASP A O   1 
ATOM   1205 C  CB  . ASP A 1 148 ? 51.719 -4.414  26.973  1.00 22.87 ? 1827 ASP A CB  1 
ATOM   1206 C  CG  . ASP A 1 148 ? 51.843 -4.975  28.389  1.00 26.65 ? 1827 ASP A CG  1 
ATOM   1207 O  OD1 . ASP A 1 148 ? 52.459 -4.311  29.246  1.00 28.36 ? 1827 ASP A OD1 1 
ATOM   1208 O  OD2 . ASP A 1 148 ? 51.311 -6.074  28.649  1.00 37.13 ? 1827 ASP A OD2 1 
ATOM   1209 N  N   . LEU A 1 149 ? 50.870 -1.479  25.152  1.00 19.71 ? 1828 LEU A N   1 
ATOM   1210 C  CA  . LEU A 1 149 ? 50.827 -0.910  23.805  1.00 19.68 ? 1828 LEU A CA  1 
ATOM   1211 C  C   . LEU A 1 149 ? 51.166 0.562   23.842  1.00 18.77 ? 1828 LEU A C   1 
ATOM   1212 O  O   . LEU A 1 149 ? 50.851 1.276   24.811  1.00 19.55 ? 1828 LEU A O   1 
ATOM   1213 C  CB  . LEU A 1 149 ? 49.408 -1.063  23.229  1.00 20.19 ? 1828 LEU A CB  1 
ATOM   1214 C  CG  . LEU A 1 149 ? 49.029 -2.527  23.047  1.00 21.16 ? 1828 LEU A CG  1 
ATOM   1215 C  CD1 . LEU A 1 149 ? 47.531 -2.691  22.864  1.00 23.27 ? 1828 LEU A CD1 1 
ATOM   1216 C  CD2 . LEU A 1 149 ? 49.822 -3.097  21.845  1.00 26.38 ? 1828 LEU A CD2 1 
ATOM   1217 N  N   . ILE A 1 150 ? 51.801 1.024   22.773  1.00 16.79 ? 1829 ILE A N   1 
ATOM   1218 C  CA  . ILE A 1 150 ? 52.105 2.445   22.616  1.00 18.83 ? 1829 ILE A CA  1 
ATOM   1219 C  C   . ILE A 1 150 ? 51.217 2.996   21.507  1.00 18.85 ? 1829 ILE A C   1 
ATOM   1220 O  O   . ILE A 1 150 ? 51.103 2.366   20.463  1.00 18.66 ? 1829 ILE A O   1 
ATOM   1221 C  CB  . ILE A 1 150 ? 53.566 2.665   22.219  1.00 19.82 ? 1829 ILE A CB  1 
ATOM   1222 C  CG1 . ILE A 1 150 ? 54.462 2.007   23.284  1.00 22.46 ? 1829 ILE A CG1 1 
ATOM   1223 C  CG2 . ILE A 1 150 ? 53.815 4.144   22.188  1.00 21.49 ? 1829 ILE A CG2 1 
ATOM   1224 C  CD1 . ILE A 1 150 ? 55.943 1.875   22.853  1.00 21.84 ? 1829 ILE A CD1 1 
ATOM   1225 N  N   . LEU A 1 151 ? 50.583 4.137   21.766  1.00 18.22 ? 1830 LEU A N   1 
ATOM   1226 C  CA  . LEU A 1 151 ? 49.603 4.725   20.832  1.00 19.33 ? 1830 LEU A CA  1 
ATOM   1227 C  C   . LEU A 1 151 ? 50.064 6.132   20.525  1.00 18.66 ? 1830 LEU A C   1 
ATOM   1228 O  O   . LEU A 1 151 ? 50.409 6.881   21.428  1.00 19.44 ? 1830 LEU A O   1 
ATOM   1229 C  CB  . LEU A 1 151 ? 48.242 4.875   21.516  1.00 21.55 ? 1830 LEU A CB  1 
ATOM   1230 C  CG  . LEU A 1 151 ? 47.125 3.893   21.221  1.00 29.12 ? 1830 LEU A CG  1 
ATOM   1231 C  CD1 . LEU A 1 151 ? 46.687 3.945   19.744  1.00 27.03 ? 1830 LEU A CD1 1 
ATOM   1232 C  CD2 . LEU A 1 151 ? 47.671 2.545   21.664  1.00 24.99 ? 1830 LEU A CD2 1 
ATOM   1233 N  N   . GLN A 1 152 ? 50.112 6.481   19.249  1.00 18.06 ? 1831 GLN A N   1 
ATOM   1234 C  CA  . GLN A 1 152 ? 50.414 7.849   18.809  1.00 18.69 ? 1831 GLN A CA  1 
ATOM   1235 C  C   . GLN A 1 152 ? 49.369 8.315   17.771  1.00 20.87 ? 1831 GLN A C   1 
ATOM   1236 O  O   . GLN A 1 152 ? 49.069 7.591   16.828  1.00 20.83 ? 1831 GLN A O   1 
ATOM   1237 C  CB  . GLN A 1 152 ? 51.779 7.858   18.114  1.00 20.41 ? 1831 GLN A CB  1 
ATOM   1238 C  CG  . GLN A 1 152 ? 52.200 9.284   17.761  1.00 29.71 ? 1831 GLN A CG  1 
ATOM   1239 C  CD  . GLN A 1 152 ? 53.658 9.492   18.014  1.00 32.27 ? 1831 GLN A CD  1 
ATOM   1240 O  OE1 . GLN A 1 152 ? 54.466 8.659   17.612  1.00 41.19 ? 1831 GLN A OE1 1 
ATOM   1241 N  NE2 . GLN A 1 152 ? 54.012 10.584  18.684  1.00 37.45 ? 1831 GLN A NE2 1 
ATOM   1242 N  N   . MET A 1 153 ? 48.832 9.520   17.944  1.00 20.13 ? 1832 MET A N   1 
ATOM   1243 C  CA  . MET A 1 153 ? 47.959 10.072  16.916  1.00 22.14 ? 1832 MET A CA  1 
ATOM   1244 C  C   . MET A 1 153 ? 48.783 10.623  15.762  1.00 21.72 ? 1832 MET A C   1 
ATOM   1245 O  O   . MET A 1 153 ? 49.752 11.375  15.990  1.00 24.38 ? 1832 MET A O   1 
ATOM   1246 C  CB  . MET A 1 153 ? 46.970 11.108  17.476  1.00 22.51 ? 1832 MET A CB  1 
ATOM   1247 C  CG  . MET A 1 153 ? 45.849 11.432  16.466  1.00 23.50 ? 1832 MET A CG  1 
ATOM   1248 S  SD  . MET A 1 153 ? 44.502 12.379  17.230  1.00 30.58 ? 1832 MET A SD  1 
ATOM   1249 C  CE  . MET A 1 153 ? 45.371 13.923  17.442  1.00 31.91 ? 1832 MET A CE  1 
ATOM   1250 N  N   . LEU A 1 154 ? 48.429 10.263  14.529  1.00 18.63 ? 1833 LEU A N   1 
ATOM   1251 C  CA  . LEU A 1 154 ? 49.188 10.712  13.345  1.00 20.63 ? 1833 LEU A CA  1 
ATOM   1252 C  C   . LEU A 1 154 ? 48.471 11.853  12.628  1.00 21.45 ? 1833 LEU A C   1 
ATOM   1253 O  O   . LEU A 1 154 ? 49.102 12.710  12.001  1.00 23.37 ? 1833 LEU A O   1 
ATOM   1254 C  CB  . LEU A 1 154 ? 49.403 9.550   12.376  1.00 21.76 ? 1833 LEU A CB  1 
ATOM   1255 C  CG  . LEU A 1 154 ? 50.101 8.293   12.898  1.00 22.86 ? 1833 LEU A CG  1 
ATOM   1256 C  CD1 . LEU A 1 154 ? 50.158 7.225   11.808  1.00 25.52 ? 1833 LEU A CD1 1 
ATOM   1257 C  CD2 . LEU A 1 154 ? 51.513 8.634   13.356  1.00 27.89 ? 1833 LEU A CD2 1 
ATOM   1258 N  N   . SER A 1 155 ? 47.142 11.831  12.671  1.00 20.14 ? 1834 SER A N   1 
ATOM   1259 C  CA  . SER A 1 155 ? 46.363 12.861  11.986  1.00 21.36 ? 1834 SER A CA  1 
ATOM   1260 C  C   . SER A 1 155 ? 44.989 12.976  12.625  1.00 20.46 ? 1834 SER A C   1 
ATOM   1261 O  O   . SER A 1 155 ? 44.476 12.024  13.223  1.00 19.37 ? 1834 SER A O   1 
ATOM   1262 C  CB  . SER A 1 155 ? 46.234 12.621  10.488  1.00 23.00 ? 1834 SER A CB  1 
ATOM   1263 O  OG  . SER A 1 155 ? 45.398 11.515  10.181  1.00 24.96 ? 1834 SER A OG  1 
ATOM   1264 N  N   . GLU A 1 156 ? 44.425 14.171  12.504  1.00 17.78 ? 1835 GLU A N   1 
ATOM   1265 C  CA  . GLU A 1 156 ? 43.050 14.433  12.902  1.00 18.93 ? 1835 GLU A CA  1 
ATOM   1266 C  C   . GLU A 1 156 ? 42.412 15.376  11.902  1.00 19.34 ? 1835 GLU A C   1 
ATOM   1267 O  O   . GLU A 1 156 ? 42.842 16.540  11.772  1.00 20.36 ? 1835 GLU A O   1 
ATOM   1268 C  CB  . GLU A 1 156 ? 43.010 15.056  14.288  1.00 19.25 ? 1835 GLU A CB  1 
ATOM   1269 C  CG  . GLU A 1 156 ? 41.633 15.422  14.802  1.00 20.22 ? 1835 GLU A CG  1 
ATOM   1270 C  CD  . GLU A 1 156 ? 41.701 15.992  16.208  1.00 31.76 ? 1835 GLU A CD  1 
ATOM   1271 O  OE1 . GLU A 1 156 ? 41.853 17.230  16.288  1.00 38.33 ? 1835 GLU A OE1 1 
ATOM   1272 O  OE2 . GLU A 1 156 ? 41.627 15.244  17.222  1.00 26.28 ? 1835 GLU A OE2 1 
ATOM   1273 N  N   . SER A 1 157 ? 41.393 14.878  11.213  1.00 16.48 ? 1836 SER A N   1 
ATOM   1274 C  CA  . SER A 1 157 ? 40.758 15.601  10.095  1.00 17.00 ? 1836 SER A CA  1 
ATOM   1275 C  C   . SER A 1 157 ? 39.313 15.849  10.494  1.00 16.49 ? 1836 SER A C   1 
ATOM   1276 O  O   . SER A 1 157 ? 38.492 14.927  10.492  1.00 15.93 ? 1836 SER A O   1 
ATOM   1277 C  CB  . SER A 1 157 ? 40.847 14.804  8.782   1.00 18.41 ? 1836 SER A CB  1 
ATOM   1278 O  OG  . SER A 1 157 ? 42.211 14.583  8.447   1.00 21.84 ? 1836 SER A OG  1 
ATOM   1279 N  N   . VAL A 1 158 ? 38.981 17.088  10.845  1.00 16.30 ? 1837 VAL A N   1 
ATOM   1280 C  CA  . VAL A 1 158 ? 37.629 17.400  11.249  1.00 15.53 ? 1837 VAL A CA  1 
ATOM   1281 C  C   . VAL A 1 158 ? 36.853 17.720  9.975   1.00 15.90 ? 1837 VAL A C   1 
ATOM   1282 O  O   . VAL A 1 158 ? 37.239 18.627  9.213   1.00 17.12 ? 1837 VAL A O   1 
ATOM   1283 C  CB  . VAL A 1 158 ? 37.603 18.617  12.225  1.00 16.11 ? 1837 VAL A CB  1 
ATOM   1284 C  CG1 . VAL A 1 158 ? 36.162 19.019  12.557  1.00 18.53 ? 1837 VAL A CG1 1 
ATOM   1285 C  CG2 . VAL A 1 158 ? 38.396 18.295  13.477  1.00 18.46 ? 1837 VAL A CG2 1 
ATOM   1286 N  N   . LEU A 1 159 ? 35.782 16.965  9.745   1.00 16.08 ? 1838 LEU A N   1 
ATOM   1287 C  CA  . LEU A 1 159 ? 34.895 17.201  8.616   1.00 15.68 ? 1838 LEU A CA  1 
ATOM   1288 C  C   . LEU A 1 159 ? 33.542 17.689  9.172   1.00 16.93 ? 1838 LEU A C   1 
ATOM   1289 O  O   . LEU A 1 159 ? 33.352 17.693  10.383  1.00 16.55 ? 1838 LEU A O   1 
ATOM   1290 C  CB  . LEU A 1 159 ? 34.741 15.915  7.770   1.00 14.08 ? 1838 LEU A CB  1 
ATOM   1291 C  CG  . LEU A 1 159 ? 36.005 15.049  7.582   1.00 15.18 ? 1838 LEU A CG  1 
ATOM   1292 C  CD1 . LEU A 1 159 ? 35.722 13.814  6.730   1.00 19.56 ? 1838 LEU A CD1 1 
ATOM   1293 C  CD2 . LEU A 1 159 ? 37.081 15.871  6.835   1.00 18.71 ? 1838 LEU A CD2 1 
ATOM   1294 N  N   . PRO A 1 160 ? 32.603 18.125  8.308   1.00 14.90 ? 1839 PRO A N   1 
ATOM   1295 C  CA  . PRO A 1 160 ? 31.353 18.728  8.808   1.00 16.99 ? 1839 PRO A CA  1 
ATOM   1296 C  C   . PRO A 1 160 ? 30.591 17.934  9.843   1.00 17.13 ? 1839 PRO A C   1 
ATOM   1297 O  O   . PRO A 1 160 ? 30.115 18.514  10.830  1.00 19.56 ? 1839 PRO A O   1 
ATOM   1298 C  CB  . PRO A 1 160 ? 30.540 19.000  7.532   1.00 16.62 ? 1839 PRO A CB  1 
ATOM   1299 C  CG  . PRO A 1 160 ? 31.624 19.252  6.524   1.00 16.47 ? 1839 PRO A CG  1 
ATOM   1300 C  CD  . PRO A 1 160 ? 32.717 18.257  6.846   1.00 17.98 ? 1839 PRO A CD  1 
ATOM   1301 N  N   . GLU A 1 161 ? 30.469 16.624  9.641   1.00 15.27 ? 1840 GLU A N   1 
ATOM   1302 C  CA  . GLU A 1 161 ? 29.636 15.816  10.552  1.00 15.89 ? 1840 GLU A CA  1 
ATOM   1303 C  C   . GLU A 1 161 ? 30.346 14.611  11.151  1.00 16.30 ? 1840 GLU A C   1 
ATOM   1304 O  O   . GLU A 1 161 ? 29.737 13.844  11.917  1.00 17.49 ? 1840 GLU A O   1 
ATOM   1305 C  CB  . GLU A 1 161 ? 28.407 15.304  9.817   1.00 16.33 ? 1840 GLU A CB  1 
ATOM   1306 C  CG  . GLU A 1 161 ? 27.511 16.465  9.445   1.00 19.78 ? 1840 GLU A CG  1 
ATOM   1307 C  CD  . GLU A 1 161 ? 26.312 16.028  8.662   1.00 30.64 ? 1840 GLU A CD  1 
ATOM   1308 O  OE1 . GLU A 1 161 ? 26.469 15.281  7.674   1.00 32.63 ? 1840 GLU A OE1 1 
ATOM   1309 O  OE2 . GLU A 1 161 ? 25.204 16.465  9.050   1.00 41.25 ? 1840 GLU A OE2 1 
ATOM   1310 N  N   . TRP A 1 162 ? 31.606 14.406  10.770  1.00 15.44 ? 1841 TRP A N   1 
ATOM   1311 C  CA  . TRP A 1 162 ? 32.429 13.410  11.460  1.00 13.10 ? 1841 TRP A CA  1 
ATOM   1312 C  C   . TRP A 1 162 ? 33.899 13.783  11.389  1.00 14.22 ? 1841 TRP A C   1 
ATOM   1313 O  O   . TRP A 1 162 ? 34.289 14.642  10.587  1.00 14.58 ? 1841 TRP A O   1 
ATOM   1314 C  CB  . TRP A 1 162 ? 32.249 12.009  10.859  1.00 14.76 ? 1841 TRP A CB  1 
ATOM   1315 C  CG  . TRP A 1 162 ? 32.276 11.811  9.361   1.00 13.89 ? 1841 TRP A CG  1 
ATOM   1316 C  CD1 . TRP A 1 162 ? 33.360 11.453  8.610   1.00 15.25 ? 1841 TRP A CD1 1 
ATOM   1317 C  CD2 . TRP A 1 162 ? 31.155 11.896  8.448   1.00 12.59 ? 1841 TRP A CD2 1 
ATOM   1318 N  NE1 . TRP A 1 162 ? 32.998 11.303  7.301   1.00 13.01 ? 1841 TRP A NE1 1 
ATOM   1319 C  CE2 . TRP A 1 162 ? 31.656 11.560  7.155   1.00 12.46 ? 1841 TRP A CE2 1 
ATOM   1320 C  CE3 . TRP A 1 162 ? 29.770 12.177  8.603   1.00 14.72 ? 1841 TRP A CE3 1 
ATOM   1321 C  CZ2 . TRP A 1 162 ? 30.840 11.501  6.027   1.00 14.26 ? 1841 TRP A CZ2 1 
ATOM   1322 C  CZ3 . TRP A 1 162 ? 28.956 12.145  7.476   1.00 13.53 ? 1841 TRP A CZ3 1 
ATOM   1323 C  CH2 . TRP A 1 162 ? 29.502 11.818  6.196   1.00 16.11 ? 1841 TRP A CH2 1 
ATOM   1324 N  N   . THR A 1 163 ? 34.708 13.175  12.246  1.00 13.76 ? 1842 THR A N   1 
ATOM   1325 C  CA  . THR A 1 163 ? 36.141 13.491  12.274  1.00 14.32 ? 1842 THR A CA  1 
ATOM   1326 C  C   . THR A 1 163 ? 36.871 12.183  12.084  1.00 15.43 ? 1842 THR A C   1 
ATOM   1327 O  O   . THR A 1 163 ? 36.489 11.187  12.708  1.00 15.86 ? 1842 THR A O   1 
ATOM   1328 C  CB  . THR A 1 163 ? 36.469 14.064  13.654  1.00 16.17 ? 1842 THR A CB  1 
ATOM   1329 O  OG1 . THR A 1 163 ? 35.829 15.361  13.724  1.00 18.39 ? 1842 THR A OG1 1 
ATOM   1330 C  CG2 . THR A 1 163 ? 37.953 14.208  13.891  1.00 15.51 ? 1842 THR A CG2 1 
ATOM   1331 N  N   . ILE A 1 164 ? 37.891 12.198  11.227  1.00 13.62 ? 1843 ILE A N   1 
ATOM   1332 C  CA  . ILE A 1 164 ? 38.661 10.963  11.003  1.00 14.37 ? 1843 ILE A CA  1 
ATOM   1333 C  C   . ILE A 1 164 ? 40.062 11.129  11.603  1.00 13.49 ? 1843 ILE A C   1 
ATOM   1334 O  O   . ILE A 1 164 ? 40.783 12.085  11.281  1.00 16.64 ? 1843 ILE A O   1 
ATOM   1335 C  CB  . ILE A 1 164 ? 38.789 10.662  9.505   1.00 14.10 ? 1843 ILE A CB  1 
ATOM   1336 C  CG1 . ILE A 1 164 ? 37.389 10.523  8.894   1.00 16.07 ? 1843 ILE A CG1 1 
ATOM   1337 C  CG2 . ILE A 1 164 ? 39.709 9.425   9.301   1.00 16.63 ? 1843 ILE A CG2 1 
ATOM   1338 C  CD1 . ILE A 1 164 ? 37.448 10.285  7.347   1.00 17.08 ? 1843 ILE A CD1 1 
ATOM   1339 N  N   . ARG A 1 165 ? 40.444 10.188  12.464  1.00 13.92 ? 1844 ARG A N   1 
ATOM   1340 C  CA  . ARG A 1 165 ? 41.787 10.238  13.103  1.00 15.58 ? 1844 ARG A CA  1 
ATOM   1341 C  C   . ARG A 1 165 ? 42.549 9.006   12.677  1.00 18.14 ? 1844 ARG A C   1 
ATOM   1342 O  O   . ARG A 1 165 ? 41.935 7.954   12.441  1.00 20.00 ? 1844 ARG A O   1 
ATOM   1343 C  CB  . ARG A 1 165 ? 41.635 10.300  14.623  1.00 16.91 ? 1844 ARG A CB  1 
ATOM   1344 C  CG  . ARG A 1 165 ? 40.952 11.587  15.103  1.00 16.74 ? 1844 ARG A CG  1 
ATOM   1345 C  CD  . ARG A 1 165 ? 40.683 11.545  16.550  1.00 19.18 ? 1844 ARG A CD  1 
ATOM   1346 N  NE  . ARG A 1 165 ? 40.173 12.777  17.173  1.00 20.05 ? 1844 ARG A NE  1 
ATOM   1347 C  CZ  . ARG A 1 165 ? 38.885 13.051  17.360  1.00 19.23 ? 1844 ARG A CZ  1 
ATOM   1348 N  NH1 . ARG A 1 165 ? 37.924 12.233  16.959  1.00 20.21 ? 1844 ARG A NH1 1 
ATOM   1349 N  NH2 . ARG A 1 165 ? 38.536 14.163  18.000  1.00 22.76 ? 1844 ARG A NH2 1 
ATOM   1350 N  N   . GLU A 1 166 ? 43.868 9.124   12.575  1.00 15.87 ? 1845 GLU A N   1 
ATOM   1351 C  CA  . GLU A 1 166 ? 44.694 7.957   12.275  1.00 17.76 ? 1845 GLU A CA  1 
ATOM   1352 C  C   . GLU A 1 166 ? 45.689 7.851   13.416  1.00 18.24 ? 1845 GLU A C   1 
ATOM   1353 O  O   . GLU A 1 166 ? 46.239 8.843   13.883  1.00 18.14 ? 1845 GLU A O   1 
ATOM   1354 C  CB  . GLU A 1 166 ? 45.434 8.107   10.949  1.00 21.30 ? 1845 GLU A CB  1 
ATOM   1355 C  CG  . GLU A 1 166 ? 46.097 6.781   10.560  1.00 29.68 ? 1845 GLU A CG  1 
ATOM   1356 C  CD  . GLU A 1 166 ? 46.103 6.502   9.058   1.00 42.51 ? 1845 GLU A CD  1 
ATOM   1357 O  OE1 . GLU A 1 166 ? 45.646 7.354   8.257   1.00 42.02 ? 1845 GLU A OE1 1 
ATOM   1358 O  OE2 . GLU A 1 166 ? 46.567 5.398   8.688   1.00 48.78 ? 1845 GLU A OE2 1 
ATOM   1359 N  N   . PHE A 1 167 ? 45.852 6.634   13.891  1.00 17.43 ? 1846 PHE A N   1 
ATOM   1360 C  CA  . PHE A 1 167 ? 46.790 6.350   14.983  1.00 17.84 ? 1846 PHE A CA  1 
ATOM   1361 C  C   . PHE A 1 167 ? 47.777 5.305   14.513  1.00 19.89 ? 1846 PHE A C   1 
ATOM   1362 O  O   . PHE A 1 167 ? 47.493 4.502   13.644  1.00 18.80 ? 1846 PHE A O   1 
ATOM   1363 C  CB  . PHE A 1 167 ? 46.070 5.781   16.203  1.00 17.37 ? 1846 PHE A CB  1 
ATOM   1364 C  CG  . PHE A 1 167 ? 44.986 6.683   16.740  1.00 17.48 ? 1846 PHE A CG  1 
ATOM   1365 C  CD1 . PHE A 1 167 ? 43.669 6.496   16.376  1.00 22.41 ? 1846 PHE A CD1 1 
ATOM   1366 C  CD2 . PHE A 1 167 ? 45.296 7.686   17.635  1.00 17.00 ? 1846 PHE A CD2 1 
ATOM   1367 C  CE1 . PHE A 1 167 ? 42.667 7.331   16.894  1.00 24.16 ? 1846 PHE A CE1 1 
ATOM   1368 C  CE2 . PHE A 1 167 ? 44.292 8.535   18.146  1.00 21.04 ? 1846 PHE A CE2 1 
ATOM   1369 C  CZ  . PHE A 1 167 ? 42.990 8.344   17.765  1.00 22.14 ? 1846 PHE A CZ  1 
ATOM   1370 N  N   . LYS A 1 168 ? 48.954 5.302   15.130  1.00 18.99 ? 1847 LYS A N   1 
ATOM   1371 C  CA  . LYS A 1 168 ? 49.847 4.157   14.967  1.00 19.58 ? 1847 LYS A CA  1 
ATOM   1372 C  C   . LYS A 1 168 ? 49.848 3.446   16.319  1.00 19.24 ? 1847 LYS A C   1 
ATOM   1373 O  O   . LYS A 1 168 ? 49.886 4.088   17.355  1.00 19.11 ? 1847 LYS A O   1 
ATOM   1374 C  CB  . LYS A 1 168 ? 51.249 4.695   14.653  1.00 21.48 ? 1847 LYS A CB  1 
ATOM   1375 C  CG  . LYS A 1 168 ? 52.370 3.657   14.611  1.00 28.80 ? 1847 LYS A CG  1 
ATOM   1376 C  CD  . LYS A 1 168 ? 53.579 4.178   13.801  1.00 25.61 ? 1847 LYS A CD  1 
ATOM   1377 C  CE  . LYS A 1 168 ? 54.335 5.280   14.532  1.00 36.25 ? 1847 LYS A CE  1 
ATOM   1378 N  NZ  . LYS A 1 168 ? 55.686 5.588   13.938  1.00 41.34 ? 1847 LYS A NZ  1 
ATOM   1379 N  N   . ILE A 1 169 ? 49.797 2.124   16.317  1.00 18.53 ? 1848 ILE A N   1 
ATOM   1380 C  CA  . ILE A 1 169 ? 49.877 1.404   17.582  1.00 20.03 ? 1848 ILE A CA  1 
ATOM   1381 C  C   . ILE A 1 169 ? 51.012 0.389   17.463  1.00 21.62 ? 1848 ILE A C   1 
ATOM   1382 O  O   . ILE A 1 169 ? 51.125 -0.230  16.393  1.00 21.01 ? 1848 ILE A O   1 
ATOM   1383 C  CB  . ILE A 1 169 ? 48.527 0.754   17.928  1.00 20.31 ? 1848 ILE A CB  1 
ATOM   1384 C  CG1 . ILE A 1 169 ? 48.599 0.056   19.276  1.00 22.58 ? 1848 ILE A CG1 1 
ATOM   1385 C  CG2 . ILE A 1 169 ? 47.997 -0.180  16.829  1.00 21.56 ? 1848 ILE A CG2 1 
ATOM   1386 C  CD1 . ILE A 1 169 ? 47.156 -0.210  19.782  1.00 21.74 ? 1848 ILE A CD1 1 
ATOM   1387 N  N   . CYS A 1 170 ? 51.837 0.253   18.514  1.00 21.79 ? 1849 CYS A N   1 
ATOM   1388 C  CA  . CYS A 1 170 ? 53.040 -0.635  18.558  1.00 25.14 ? 1849 CYS A CA  1 
ATOM   1389 C  C   . CYS A 1 170 ? 52.824 -1.523  19.810  1.00 23.69 ? 1849 CYS A C   1 
ATOM   1390 O  O   . CYS A 1 170 ? 52.423 -0.996  20.845  1.00 21.10 ? 1849 CYS A O   1 
ATOM   1391 C  CB  . CYS A 1 170 ? 54.380 0.193   18.771  1.00 22.08 ? 1849 CYS A CB  1 
ATOM   1392 S  SG  . CYS A 1 170 ? 54.609 1.663   17.665  1.00 42.56 ? 1849 CYS A SG  1 
ATOM   1393 N  N   . GLY A 1 171 ? 53.099 -2.831  19.760  1.00 24.13 ? 1850 GLY A N   1 
ATOM   1394 C  CA  . GLY A 1 171 ? 53.398 -3.574  20.999  1.00 24.53 ? 1850 GLY A CA  1 
ATOM   1395 C  C   . GLY A 1 171 ? 54.766 -3.186  21.529  1.00 28.07 ? 1850 GLY A C   1 
ATOM   1396 O  O   . GLY A 1 171 ? 55.723 -3.120  20.758  1.00 29.02 ? 1850 GLY A O   1 
ATOM   1397 N  N   . GLU A 1 172 ? 54.872 -2.921  22.834  1.00 28.23 ? 1851 GLU A N   1 
ATOM   1398 C  CA  . GLU A 1 172 ? 56.124 -2.397  23.409  1.00 31.16 ? 1851 GLU A CA  1 
ATOM   1399 C  C   . GLU A 1 172 ? 57.327 -3.325  23.218  1.00 32.28 ? 1851 GLU A C   1 
ATOM   1400 O  O   . GLU A 1 172 ? 58.468 -2.870  23.281  1.00 34.40 ? 1851 GLU A O   1 
ATOM   1401 C  CB  . GLU A 1 172 ? 55.967 -2.077  24.909  1.00 29.37 ? 1851 GLU A CB  1 
ATOM   1402 C  CG  . GLU A 1 172 ? 55.789 -3.330  25.742  1.00 31.20 ? 1851 GLU A CG  1 
ATOM   1403 C  CD  . GLU A 1 172 ? 55.499 -3.061  27.220  1.00 32.68 ? 1851 GLU A CD  1 
ATOM   1404 O  OE1 . GLU A 1 172 ? 55.738 -1.925  27.706  1.00 34.06 ? 1851 GLU A OE1 1 
ATOM   1405 O  OE2 . GLU A 1 172 ? 55.016 -4.011  27.882  1.00 28.50 ? 1851 GLU A OE2 1 
ATOM   1406 N  N   . GLU A 1 173 ? 57.088 -4.613  22.997  1.00 33.44 ? 1852 GLU A N   1 
ATOM   1407 C  CA  . GLU A 1 173 ? 58.188 -5.574  22.878  1.00 36.75 ? 1852 GLU A CA  1 
ATOM   1408 C  C   . GLU A 1 173 ? 58.696 -5.727  21.449  1.00 38.65 ? 1852 GLU A C   1 
ATOM   1409 O  O   . GLU A 1 173 ? 59.663 -6.457  21.190  1.00 37.73 ? 1852 GLU A O   1 
ATOM   1410 C  CB  . GLU A 1 173 ? 57.758 -6.923  23.441  1.00 36.52 ? 1852 GLU A CB  1 
ATOM   1411 C  CG  . GLU A 1 173 ? 57.609 -6.847  24.946  1.00 40.08 ? 1852 GLU A CG  1 
ATOM   1412 C  CD  . GLU A 1 173 ? 57.156 -8.142  25.574  1.00 42.93 ? 1852 GLU A CD  1 
ATOM   1413 O  OE1 . GLU A 1 173 ? 56.952 -8.138  26.805  1.00 46.27 ? 1852 GLU A OE1 1 
ATOM   1414 O  OE2 . GLU A 1 173 ? 57.005 -9.155  24.853  1.00 46.19 ? 1852 GLU A OE2 1 
ATOM   1415 N  N   . GLN A 1 174 ? 58.039 -5.028  20.524  1.00 39.37 ? 1853 GLN A N   1 
ATOM   1416 C  CA  . GLN A 1 174 ? 58.325 -5.174  19.103  1.00 40.99 ? 1853 GLN A CA  1 
ATOM   1417 C  C   . GLN A 1 174 ? 57.846 -3.912  18.393  1.00 41.67 ? 1853 GLN A C   1 
ATOM   1418 O  O   . GLN A 1 174 ? 56.767 -3.887  17.791  1.00 40.48 ? 1853 GLN A O   1 
ATOM   1419 C  CB  . GLN A 1 174 ? 57.605 -6.411  18.578  1.00 41.17 ? 1853 GLN A CB  1 
ATOM   1420 C  CG  . GLN A 1 174 ? 58.063 -6.933  17.228  1.00 47.39 ? 1853 GLN A CG  1 
ATOM   1421 C  CD  . GLN A 1 174 ? 57.451 -8.296  16.937  1.00 52.68 ? 1853 GLN A CD  1 
ATOM   1422 O  OE1 . GLN A 1 174 ? 57.834 -9.305  17.539  1.00 55.44 ? 1853 GLN A OE1 1 
ATOM   1423 N  NE2 . GLN A 1 174 ? 56.484 -8.329  16.024  1.00 54.80 ? 1853 GLN A NE2 1 
ATOM   1424 N  N   . LEU A 1 175 ? 58.674 -2.874  18.490  1.00 41.90 ? 1854 LEU A N   1 
ATOM   1425 C  CA  . LEU A 1 175 ? 58.333 -1.517  18.077  1.00 43.78 ? 1854 LEU A CA  1 
ATOM   1426 C  C   . LEU A 1 175 ? 58.300 -1.403  16.557  1.00 43.60 ? 1854 LEU A C   1 
ATOM   1427 O  O   . LEU A 1 175 ? 57.655 -0.506  16.007  1.00 42.06 ? 1854 LEU A O   1 
ATOM   1428 C  CB  . LEU A 1 175 ? 59.371 -0.528  18.625  1.00 43.40 ? 1854 LEU A CB  1 
ATOM   1429 C  CG  . LEU A 1 175 ? 59.427 -0.305  20.141  1.00 47.51 ? 1854 LEU A CG  1 
ATOM   1430 C  CD1 . LEU A 1 175 ? 60.523 0.699   20.521  1.00 49.31 ? 1854 LEU A CD1 1 
ATOM   1431 C  CD2 . LEU A 1 175 ? 58.080 0.139   20.698  1.00 44.05 ? 1854 LEU A CD2 1 
ATOM   1432 N  N   . ASP A 1 176 ? 59.008 -2.317  15.896  1.00 43.34 ? 1855 ASP A N   1 
ATOM   1433 C  CA  . ASP A 1 176 ? 59.009 -2.413  14.438  1.00 44.02 ? 1855 ASP A CA  1 
ATOM   1434 C  C   . ASP A 1 176 ? 57.669 -2.837  13.848  1.00 42.06 ? 1855 ASP A C   1 
ATOM   1435 O  O   . ASP A 1 176 ? 57.343 -2.485  12.711  1.00 42.10 ? 1855 ASP A O   1 
ATOM   1436 C  CB  . ASP A 1 176 ? 60.074 -3.411  13.990  1.00 46.18 ? 1855 ASP A CB  1 
ATOM   1437 C  CG  . ASP A 1 176 ? 61.469 -2.942  14.321  1.00 51.66 ? 1855 ASP A CG  1 
ATOM   1438 O  OD1 . ASP A 1 176 ? 62.310 -3.792  14.686  1.00 57.12 ? 1855 ASP A OD1 1 
ATOM   1439 O  OD2 . ASP A 1 176 ? 61.718 -1.718  14.218  1.00 58.41 ? 1855 ASP A OD2 1 
ATOM   1440 N  N   . ALA A 1 177 ? 56.897 -3.603  14.612  1.00 38.65 ? 1856 ALA A N   1 
ATOM   1441 C  CA  . ALA A 1 177 ? 55.694 -4.208  14.070  1.00 34.59 ? 1856 ALA A CA  1 
ATOM   1442 C  C   . ALA A 1 177 ? 54.459 -3.357  14.338  1.00 32.46 ? 1856 ALA A C   1 
ATOM   1443 O  O   . ALA A 1 177 ? 53.572 -3.802  15.063  1.00 33.23 ? 1856 ALA A O   1 
ATOM   1444 C  CB  . ALA A 1 177 ? 55.487 -5.574  14.680  1.00 35.88 ? 1856 ALA A CB  1 
ATOM   1445 N  N   . HIS A 1 178 ? 54.392 -2.164  13.760  1.00 28.42 ? 1857 HIS A N   1 
ATOM   1446 C  CA  . HIS A 1 178 ? 53.264 -1.285  14.084  1.00 25.06 ? 1857 HIS A CA  1 
ATOM   1447 C  C   . HIS A 1 178 ? 52.072 -1.529  13.177  1.00 23.58 ? 1857 HIS A C   1 
ATOM   1448 O  O   . HIS A 1 178 ? 52.152 -2.245  12.167  1.00 23.01 ? 1857 HIS A O   1 
ATOM   1449 C  CB  . HIS A 1 178 ? 53.674 0.177   14.024  1.00 24.14 ? 1857 HIS A CB  1 
ATOM   1450 C  CG  . HIS A 1 178 ? 54.062 0.627   12.652  1.00 33.31 ? 1857 HIS A CG  1 
ATOM   1451 N  ND1 . HIS A 1 178 ? 55.378 0.727   12.248  1.00 39.81 ? 1857 HIS A ND1 1 
ATOM   1452 C  CD2 . HIS A 1 178 ? 53.312 1.005   11.590  1.00 38.70 ? 1857 HIS A CD2 1 
ATOM   1453 C  CE1 . HIS A 1 178 ? 55.421 1.148   10.997  1.00 40.39 ? 1857 HIS A CE1 1 
ATOM   1454 N  NE2 . HIS A 1 178 ? 54.181 1.323   10.574  1.00 42.72 ? 1857 HIS A NE2 1 
ATOM   1455 N  N   . ARG A 1 179 ? 50.948 -0.916  13.550  1.00 20.14 ? 1858 ARG A N   1 
ATOM   1456 C  CA  A ARG A 1 179 ? 49.706 -1.017  12.778  0.50 18.12 ? 1858 ARG A CA  1 
ATOM   1457 C  CA  B ARG A 1 179 ? 49.729 -1.007  12.762  0.50 19.74 ? 1858 ARG A CA  1 
ATOM   1458 C  C   . ARG A 1 179 ? 49.113 0.374   12.698  1.00 19.18 ? 1858 ARG A C   1 
ATOM   1459 O  O   . ARG A 1 179 ? 49.194 1.128   13.668  1.00 20.16 ? 1858 ARG A O   1 
ATOM   1460 C  CB  A ARG A 1 179 ? 48.678 -1.909  13.482  0.50 17.80 ? 1858 ARG A CB  1 
ATOM   1461 C  CB  B ARG A 1 179 ? 48.764 -1.960  13.455  0.50 20.05 ? 1858 ARG A CB  1 
ATOM   1462 C  CG  A ARG A 1 179 ? 47.427 -2.164  12.631  0.50 14.42 ? 1858 ARG A CG  1 
ATOM   1463 C  CG  B ARG A 1 179 ? 49.321 -3.369  13.530  0.50 21.12 ? 1858 ARG A CG  1 
ATOM   1464 C  CD  A ARG A 1 179 ? 46.316 -2.911  13.382  0.50 15.74 ? 1858 ARG A CD  1 
ATOM   1465 C  CD  B ARG A 1 179 ? 48.362 -4.278  14.245  0.50 28.19 ? 1858 ARG A CD  1 
ATOM   1466 N  NE  A ARG A 1 179 ? 46.826 -4.146  13.977  0.50 15.73 ? 1858 ARG A NE  1 
ATOM   1467 N  NE  B ARG A 1 179 ? 48.969 -5.591  14.437  0.50 30.86 ? 1858 ARG A NE  1 
ATOM   1468 C  CZ  A ARG A 1 179 ? 46.259 -4.757  15.010  0.50 16.92 ? 1858 ARG A CZ  1 
ATOM   1469 C  CZ  B ARG A 1 179 ? 48.403 -6.562  15.140  0.50 32.00 ? 1858 ARG A CZ  1 
ATOM   1470 N  NH1 A ARG A 1 179 ? 45.169 -4.242  15.569  0.50 11.34 ? 1858 ARG A NH1 1 
ATOM   1471 N  NH1 B ARG A 1 179 ? 47.216 -6.363  15.704  0.50 29.83 ? 1858 ARG A NH1 1 
ATOM   1472 N  NH2 A ARG A 1 179 ? 46.804 -5.868  15.489  0.50 15.29 ? 1858 ARG A NH2 1 
ATOM   1473 N  NH2 B ARG A 1 179 ? 49.020 -7.726  15.271  0.50 27.58 ? 1858 ARG A NH2 1 
ATOM   1474 N  N   . LEU A 1 180 ? 48.483 0.684   11.562  1.00 20.61 ? 1859 LEU A N   1 
ATOM   1475 C  CA  . LEU A 1 180 ? 47.790 1.958   11.449  1.00 17.29 ? 1859 LEU A CA  1 
ATOM   1476 C  C   . LEU A 1 180 ? 46.309 1.667   11.739  1.00 19.32 ? 1859 LEU A C   1 
ATOM   1477 O  O   . LEU A 1 180 ? 45.749 0.702   11.219  1.00 20.53 ? 1859 LEU A O   1 
ATOM   1478 C  CB  . LEU A 1 180 ? 47.912 2.545   10.055  1.00 21.02 ? 1859 LEU A CB  1 
ATOM   1479 C  CG  . LEU A 1 180 ? 49.371 2.759   9.634   1.00 24.86 ? 1859 LEU A CG  1 
ATOM   1480 C  CD1 . LEU A 1 180 ? 49.427 3.210   8.163   1.00 33.72 ? 1859 LEU A CD1 1 
ATOM   1481 C  CD2 . LEU A 1 180 ? 50.075 3.777   10.512  1.00 30.86 ? 1859 LEU A CD2 1 
ATOM   1482 N  N   . ILE A 1 181 ? 45.714 2.504   12.570  1.00 17.94 ? 1860 ILE A N   1 
ATOM   1483 C  CA  . ILE A 1 181 ? 44.313 2.360   12.984  1.00 17.43 ? 1860 ILE A CA  1 
ATOM   1484 C  C   . ILE A 1 181 ? 43.601 3.626   12.479  1.00 18.47 ? 1860 ILE A C   1 
ATOM   1485 O  O   . ILE A 1 181 ? 44.106 4.742   12.621  1.00 17.56 ? 1860 ILE A O   1 
ATOM   1486 C  CB  . ILE A 1 181 ? 44.180 2.397   14.550  1.00 20.68 ? 1860 ILE A CB  1 
ATOM   1487 C  CG1 . ILE A 1 181 ? 44.915 1.282   15.297  1.00 25.30 ? 1860 ILE A CG1 1 
ATOM   1488 C  CG2 . ILE A 1 181 ? 42.700 2.423   14.960  1.00 22.70 ? 1860 ILE A CG2 1 
ATOM   1489 C  CD1 . ILE A 1 181 ? 44.929 -0.017  14.565  1.00 24.79 ? 1860 ILE A CD1 1 
ATOM   1490 N  N   . ARG A 1 182 ? 42.447 3.454   11.848  1.00 15.84 ? 1861 ARG A N   1 
ATOM   1491 C  CA  . ARG A 1 182 ? 41.662 4.615   11.441  1.00 17.88 ? 1861 ARG A CA  1 
ATOM   1492 C  C   . ARG A 1 182 ? 40.433 4.674   12.336  1.00 16.17 ? 1861 ARG A C   1 
ATOM   1493 O  O   . ARG A 1 182 ? 39.830 3.661   12.635  1.00 16.34 ? 1861 ARG A O   1 
ATOM   1494 C  CB  . ARG A 1 182 ? 41.314 4.555   9.945   1.00 17.61 ? 1861 ARG A CB  1 
ATOM   1495 C  CG  . ARG A 1 182 ? 42.670 4.754   9.189   1.00 25.77 ? 1861 ARG A CG  1 
ATOM   1496 C  CD  . ARG A 1 182 ? 42.657 4.823   7.657   1.00 28.56 ? 1861 ARG A CD  1 
ATOM   1497 N  NE  . ARG A 1 182 ? 41.534 5.580   7.152   1.00 29.31 ? 1861 ARG A NE  1 
ATOM   1498 C  CZ  . ARG A 1 182 ? 41.537 6.901   7.020   1.00 33.26 ? 1861 ARG A CZ  1 
ATOM   1499 N  NH1 . ARG A 1 182 ? 42.604 7.624   7.347   1.00 31.24 ? 1861 ARG A NH1 1 
ATOM   1500 N  NH2 . ARG A 1 182 ? 40.452 7.499   6.554   1.00 36.48 ? 1861 ARG A NH2 1 
ATOM   1501 N  N   . HIS A 1 183 ? 40.068 5.869   12.783  1.00 14.47 ? 1862 HIS A N   1 
ATOM   1502 C  CA  . HIS A 1 183 ? 39.018 6.047   13.780  1.00 14.76 ? 1862 HIS A CA  1 
ATOM   1503 C  C   . HIS A 1 183 ? 38.021 7.063   13.196  1.00 14.41 ? 1862 HIS A C   1 
ATOM   1504 O  O   . HIS A 1 183 ? 38.416 8.161   12.790  1.00 14.26 ? 1862 HIS A O   1 
ATOM   1505 C  CB  . HIS A 1 183 ? 39.685 6.560   15.052  1.00 13.93 ? 1862 HIS A CB  1 
ATOM   1506 C  CG  . HIS A 1 183 ? 38.758 6.772   16.201  1.00 14.89 ? 1862 HIS A CG  1 
ATOM   1507 N  ND1 . HIS A 1 183 ? 38.021 7.930   16.332  1.00 16.96 ? 1862 HIS A ND1 1 
ATOM   1508 C  CD2 . HIS A 1 183 ? 38.479 6.012   17.290  1.00 16.98 ? 1862 HIS A CD2 1 
ATOM   1509 C  CE1 . HIS A 1 183 ? 37.322 7.870   17.458  1.00 18.34 ? 1862 HIS A CE1 1 
ATOM   1510 N  NE2 . HIS A 1 183 ? 37.586 6.720   18.057  1.00 17.76 ? 1862 HIS A NE2 1 
ATOM   1511 N  N   . PHE A 1 184 ? 36.747 6.660   13.082  1.00 13.43 ? 1863 PHE A N   1 
ATOM   1512 C  CA  . PHE A 1 184 ? 35.712 7.466   12.418  1.00 14.37 ? 1863 PHE A CA  1 
ATOM   1513 C  C   . PHE A 1 184 ? 34.704 7.908   13.482  1.00 15.54 ? 1863 PHE A C   1 
ATOM   1514 O  O   . PHE A 1 184 ? 33.993 7.083   14.031  1.00 17.20 ? 1863 PHE A O   1 
ATOM   1515 C  CB  . PHE A 1 184 ? 34.988 6.615   11.371  1.00 15.20 ? 1863 PHE A CB  1 
ATOM   1516 C  CG  . PHE A 1 184 ? 35.900 6.082   10.283  1.00 15.09 ? 1863 PHE A CG  1 
ATOM   1517 C  CD1 . PHE A 1 184 ? 36.565 4.871   10.444  1.00 16.40 ? 1863 PHE A CD1 1 
ATOM   1518 C  CD2 . PHE A 1 184 ? 36.093 6.832   9.123   1.00 18.82 ? 1863 PHE A CD2 1 
ATOM   1519 C  CE1 . PHE A 1 184 ? 37.413 4.376   9.427   1.00 17.78 ? 1863 PHE A CE1 1 
ATOM   1520 C  CE2 . PHE A 1 184 ? 36.935 6.356   8.105   1.00 21.52 ? 1863 PHE A CE2 1 
ATOM   1521 C  CZ  . PHE A 1 184 ? 37.610 5.149   8.276   1.00 18.96 ? 1863 PHE A CZ  1 
ATOM   1522 N  N   . HIS A 1 185 ? 34.671 9.211   13.766  1.00 13.95 ? 1864 HIS A N   1 
ATOM   1523 C  CA  . HIS A 1 185 ? 33.915 9.700   14.912  1.00 13.90 ? 1864 HIS A CA  1 
ATOM   1524 C  C   . HIS A 1 185 ? 32.769 10.565  14.384  1.00 14.34 ? 1864 HIS A C   1 
ATOM   1525 O  O   . HIS A 1 185 ? 32.987 11.680  13.915  1.00 13.74 ? 1864 HIS A O   1 
ATOM   1526 C  CB  . HIS A 1 185 ? 34.825 10.519  15.805  1.00 16.71 ? 1864 HIS A CB  1 
ATOM   1527 C  CG  . HIS A 1 185 ? 34.141 11.035  17.018  1.00 16.53 ? 1864 HIS A CG  1 
ATOM   1528 N  ND1 . HIS A 1 185 ? 34.683 11.976  17.872  1.00 19.65 ? 1864 HIS A ND1 1 
ATOM   1529 C  CD2 . HIS A 1 185 ? 32.944 10.682  17.540  1.00 17.88 ? 1864 HIS A CD2 1 
ATOM   1530 C  CE1 . HIS A 1 185 ? 33.833 12.193  18.863  1.00 20.74 ? 1864 HIS A CE1 1 
ATOM   1531 N  NE2 . HIS A 1 185 ? 32.777 11.412  18.692  1.00 18.62 ? 1864 HIS A NE2 1 
ATOM   1532 N  N   . TYR A 1 186 ? 31.547 10.059  14.495  1.00 13.67 ? 1865 TYR A N   1 
ATOM   1533 C  CA  . TYR A 1 186 ? 30.389 10.765  13.912  1.00 14.06 ? 1865 TYR A CA  1 
ATOM   1534 C  C   . TYR A 1 186 ? 29.929 11.676  15.063  1.00 15.65 ? 1865 TYR A C   1 
ATOM   1535 O  O   . TYR A 1 186 ? 29.688 11.207  16.172  1.00 18.85 ? 1865 TYR A O   1 
ATOM   1536 C  CB  . TYR A 1 186 ? 29.300 9.720   13.596  1.00 15.50 ? 1865 TYR A CB  1 
ATOM   1537 C  CG  . TYR A 1 186 ? 28.071 10.291  12.952  1.00 15.85 ? 1865 TYR A CG  1 
ATOM   1538 C  CD1 . TYR A 1 186 ? 28.065 10.617  11.599  1.00 15.95 ? 1865 TYR A CD1 1 
ATOM   1539 C  CD2 . TYR A 1 186 ? 26.928 10.533  13.694  1.00 18.32 ? 1865 TYR A CD2 1 
ATOM   1540 C  CE1 . TYR A 1 186 ? 26.958 11.147  10.984  1.00 18.34 ? 1865 TYR A CE1 1 
ATOM   1541 C  CE2 . TYR A 1 186 ? 25.786 11.064  13.080  1.00 21.99 ? 1865 TYR A CE2 1 
ATOM   1542 C  CZ  . TYR A 1 186 ? 25.818 11.376  11.728  1.00 17.58 ? 1865 TYR A CZ  1 
ATOM   1543 O  OH  . TYR A 1 186 ? 24.703 11.925  11.120  1.00 22.25 ? 1865 TYR A OH  1 
ATOM   1544 N  N   . THR A 1 187 ? 29.822 12.968  14.788  1.00 17.38 ? 1866 THR A N   1 
ATOM   1545 C  CA  . THR A 1 187 ? 29.784 13.901  15.911  1.00 20.74 ? 1866 THR A CA  1 
ATOM   1546 C  C   . THR A 1 187 ? 28.399 14.474  16.188  1.00 21.51 ? 1866 THR A C   1 
ATOM   1547 O  O   . THR A 1 187 ? 28.266 15.298  17.109  1.00 23.52 ? 1866 THR A O   1 
ATOM   1548 C  CB  . THR A 1 187 ? 30.806 15.009  15.744  1.00 21.21 ? 1866 THR A CB  1 
ATOM   1549 O  OG1 . THR A 1 187 ? 30.687 15.571  14.436  1.00 25.04 ? 1866 THR A OG1 1 
ATOM   1550 C  CG2 . THR A 1 187 ? 32.222 14.424  15.914  1.00 23.85 ? 1866 THR A CG2 1 
ATOM   1551 N  N   . VAL A 1 188 ? 27.407 14.055  15.415  1.00 20.34 ? 1867 VAL A N   1 
ATOM   1552 C  CA  . VAL A 1 188 ? 26.080 14.684  15.401  1.00 22.02 ? 1867 VAL A CA  1 
ATOM   1553 C  C   . VAL A 1 188 ? 24.892 13.727  15.641  1.00 20.47 ? 1867 VAL A C   1 
ATOM   1554 O  O   . VAL A 1 188 ? 23.831 13.871  15.006  1.00 23.70 ? 1867 VAL A O   1 
ATOM   1555 C  CB  . VAL A 1 188 ? 25.858 15.466  14.059  1.00 22.33 ? 1867 VAL A CB  1 
ATOM   1556 C  CG1 . VAL A 1 188 ? 26.888 16.573  13.866  1.00 27.90 ? 1867 VAL A CG1 1 
ATOM   1557 C  CG2 . VAL A 1 188 ? 25.812 14.539  12.824  1.00 26.17 ? 1867 VAL A CG2 1 
ATOM   1558 N  N   . TRP A 1 189 ? 25.028 12.790  16.574  1.00 20.66 ? 1868 TRP A N   1 
ATOM   1559 C  CA  . TRP A 1 189 ? 23.960 11.823  16.889  1.00 19.92 ? 1868 TRP A CA  1 
ATOM   1560 C  C   . TRP A 1 189 ? 23.542 11.825  18.366  1.00 21.36 ? 1868 TRP A C   1 
ATOM   1561 O  O   . TRP A 1 189 ? 24.243 11.281  19.226  1.00 21.49 ? 1868 TRP A O   1 
ATOM   1562 C  CB  . TRP A 1 189 ? 24.488 10.425  16.579  1.00 18.84 ? 1868 TRP A CB  1 
ATOM   1563 C  CG  . TRP A 1 189 ? 23.414 9.359   16.429  1.00 18.62 ? 1868 TRP A CG  1 
ATOM   1564 C  CD1 . TRP A 1 189 ? 22.142 9.329   16.980  1.00 20.54 ? 1868 TRP A CD1 1 
ATOM   1565 C  CD2 . TRP A 1 189 ? 23.565 8.147   15.684  1.00 17.40 ? 1868 TRP A CD2 1 
ATOM   1566 N  NE1 . TRP A 1 189 ? 21.491 8.169   16.567  1.00 17.63 ? 1868 TRP A NE1 1 
ATOM   1567 C  CE2 . TRP A 1 189 ? 22.345 7.428   15.788  1.00 19.38 ? 1868 TRP A CE2 1 
ATOM   1568 C  CE3 . TRP A 1 189 ? 24.615 7.610   14.916  1.00 17.94 ? 1868 TRP A CE3 1 
ATOM   1569 C  CZ2 . TRP A 1 189 ? 22.149 6.195   15.156  1.00 19.21 ? 1868 TRP A CZ2 1 
ATOM   1570 C  CZ3 . TRP A 1 189 ? 24.431 6.370   14.290  1.00 17.79 ? 1868 TRP A CZ3 1 
ATOM   1571 C  CH2 . TRP A 1 189 ? 23.191 5.684   14.422  1.00 20.08 ? 1868 TRP A CH2 1 
ATOM   1572 N  N   . PRO A 1 190 ? 22.405 12.454  18.705  1.00 21.27 ? 1869 PRO A N   1 
ATOM   1573 C  CA  . PRO A 1 190 ? 22.006 12.480  20.124  1.00 23.23 ? 1869 PRO A CA  1 
ATOM   1574 C  C   . PRO A 1 190 ? 21.674 11.130  20.738  1.00 22.90 ? 1869 PRO A C   1 
ATOM   1575 O  O   . PRO A 1 190 ? 21.080 10.269  20.070  1.00 22.95 ? 1869 PRO A O   1 
ATOM   1576 C  CB  . PRO A 1 190 ? 20.784 13.401  20.130  1.00 23.54 ? 1869 PRO A CB  1 
ATOM   1577 C  CG  . PRO A 1 190 ? 20.299 13.463  18.774  1.00 24.89 ? 1869 PRO A CG  1 
ATOM   1578 C  CD  . PRO A 1 190 ? 21.465 13.194  17.845  1.00 24.10 ? 1869 PRO A CD  1 
ATOM   1579 N  N   . ASP A 1 191 ? 22.060 10.941  22.001  1.00 22.90 ? 1870 ASP A N   1 
ATOM   1580 C  CA  . ASP A 1 191 ? 21.770 9.667   22.652  1.00 22.76 ? 1870 ASP A CA  1 
ATOM   1581 C  C   . ASP A 1 191 ? 20.266 9.419   22.687  1.00 23.64 ? 1870 ASP A C   1 
ATOM   1582 O  O   . ASP A 1 191 ? 19.506 10.380  22.823  1.00 23.49 ? 1870 ASP A O   1 
ATOM   1583 C  CB  . ASP A 1 191 ? 22.376 9.628   24.045  1.00 22.03 ? 1870 ASP A CB  1 
ATOM   1584 C  CG  . ASP A 1 191 ? 22.554 8.221   24.547  1.00 22.38 ? 1870 ASP A CG  1 
ATOM   1585 O  OD1 . ASP A 1 191 ? 23.102 8.054   25.658  1.00 25.99 ? 1870 ASP A OD1 1 
ATOM   1586 O  OD2 . ASP A 1 191 ? 22.122 7.299   23.814  1.00 25.09 ? 1870 ASP A OD2 1 
ATOM   1587 N  N   . HIS A 1 192 ? 19.854 8.159   22.527  1.00 20.71 ? 1871 HIS A N   1 
ATOM   1588 C  CA  . HIS A 1 192 ? 18.431 7.766   22.448  1.00 23.41 ? 1871 HIS A CA  1 
ATOM   1589 C  C   . HIS A 1 192 ? 17.657 8.372   21.287  1.00 25.06 ? 1871 HIS A C   1 
ATOM   1590 O  O   . HIS A 1 192 ? 16.430 8.365   21.289  1.00 26.09 ? 1871 HIS A O   1 
ATOM   1591 C  CB  . HIS A 1 192 ? 17.682 8.075   23.748  1.00 23.21 ? 1871 HIS A CB  1 
ATOM   1592 C  CG  . HIS A 1 192 ? 18.359 7.533   24.956  1.00 27.12 ? 1871 HIS A CG  1 
ATOM   1593 N  ND1 . HIS A 1 192 ? 18.621 6.189   25.113  1.00 23.75 ? 1871 HIS A ND1 1 
ATOM   1594 C  CD2 . HIS A 1 192 ? 18.832 8.146   26.067  1.00 28.17 ? 1871 HIS A CD2 1 
ATOM   1595 C  CE1 . HIS A 1 192 ? 19.228 5.995   26.269  1.00 26.33 ? 1871 HIS A CE1 1 
ATOM   1596 N  NE2 . HIS A 1 192 ? 19.375 7.168   26.865  1.00 31.36 ? 1871 HIS A NE2 1 
ATOM   1597 N  N   . GLY A 1 193 ? 18.367 8.890   20.287  1.00 21.88 ? 1872 GLY A N   1 
ATOM   1598 C  CA  . GLY A 1 193 ? 17.725 9.659   19.237  1.00 22.13 ? 1872 GLY A CA  1 
ATOM   1599 C  C   . GLY A 1 193 ? 18.294 9.247   17.904  1.00 21.03 ? 1872 GLY A C   1 
ATOM   1600 O  O   . GLY A 1 193 ? 18.869 8.148   17.781  1.00 21.71 ? 1872 GLY A O   1 
ATOM   1601 N  N   . VAL A 1 194 ? 18.127 10.133  16.927  1.00 21.10 ? 1873 VAL A N   1 
ATOM   1602 C  CA  . VAL A 1 194 ? 18.537 9.836   15.565  1.00 21.62 ? 1873 VAL A CA  1 
ATOM   1603 C  C   . VAL A 1 194 ? 19.232 11.082  15.034  1.00 22.76 ? 1873 VAL A C   1 
ATOM   1604 O  O   . VAL A 1 194 ? 19.043 12.181  15.553  1.00 22.68 ? 1873 VAL A O   1 
ATOM   1605 C  CB  . VAL A 1 194 ? 17.273 9.535   14.696  1.00 20.32 ? 1873 VAL A CB  1 
ATOM   1606 C  CG1 . VAL A 1 194 ? 16.550 8.262   15.190  1.00 27.50 ? 1873 VAL A CG1 1 
ATOM   1607 C  CG2 . VAL A 1 194 ? 16.303 10.690  14.724  1.00 24.61 ? 1873 VAL A CG2 1 
ATOM   1608 N  N   . PRO A 1 195 ? 20.081 10.924  14.020  1.00 23.08 ? 1874 PRO A N   1 
ATOM   1609 C  CA  . PRO A 1 195 ? 20.630 12.081  13.337  1.00 23.64 ? 1874 PRO A CA  1 
ATOM   1610 C  C   . PRO A 1 195 ? 19.555 12.923  12.655  1.00 24.16 ? 1874 PRO A C   1 
ATOM   1611 O  O   . PRO A 1 195 ? 18.447 12.450  12.373  1.00 21.88 ? 1874 PRO A O   1 
ATOM   1612 C  CB  . PRO A 1 195 ? 21.623 11.456  12.327  1.00 22.50 ? 1874 PRO A CB  1 
ATOM   1613 C  CG  . PRO A 1 195 ? 21.849 10.056  12.779  1.00 24.96 ? 1874 PRO A CG  1 
ATOM   1614 C  CD  . PRO A 1 195 ? 20.570 9.650   13.466  1.00 23.33 ? 1874 PRO A CD  1 
ATOM   1615 N  N   . GLU A 1 196 ? 19.889 14.186  12.401  1.00 25.52 ? 1875 GLU A N   1 
ATOM   1616 C  CA  . GLU A 1 196 ? 18.947 15.148  11.848  1.00 25.93 ? 1875 GLU A CA  1 
ATOM   1617 C  C   . GLU A 1 196 ? 18.443 14.799  10.465  1.00 22.84 ? 1875 GLU A C   1 
ATOM   1618 O  O   . GLU A 1 196 ? 17.306 15.116  10.160  1.00 24.10 ? 1875 GLU A O   1 
ATOM   1619 C  CB  . GLU A 1 196 ? 19.587 16.541  11.780  1.00 27.95 ? 1875 GLU A CB  1 
ATOM   1620 C  CG  . GLU A 1 196 ? 19.479 17.381  13.034  1.00 37.94 ? 1875 GLU A CG  1 
ATOM   1621 C  CD  . GLU A 1 196 ? 19.593 18.862  12.705  1.00 44.68 ? 1875 GLU A CD  1 
ATOM   1622 O  OE1 . GLU A 1 196 ? 20.539 19.243  11.981  1.00 44.56 ? 1875 GLU A OE1 1 
ATOM   1623 O  OE2 . GLU A 1 196 ? 18.726 19.644  13.158  1.00 52.96 ? 1875 GLU A OE2 1 
ATOM   1624 N  N   . THR A 1 197 ? 19.273 14.133  9.655   1.00 21.98 ? 1876 THR A N   1 
ATOM   1625 C  CA  . THR A 1 197 ? 18.869 13.719  8.311   1.00 21.08 ? 1876 THR A CA  1 
ATOM   1626 C  C   . THR A 1 197 ? 19.193 12.238  8.111   1.00 19.01 ? 1876 THR A C   1 
ATOM   1627 O  O   . THR A 1 197 ? 20.110 11.706  8.735   1.00 21.07 ? 1876 THR A O   1 
ATOM   1628 C  CB  . THR A 1 197 ? 19.564 14.535  7.185   1.00 22.47 ? 1876 THR A CB  1 
ATOM   1629 O  OG1 . THR A 1 197 ? 20.982 14.300  7.203   1.00 20.40 ? 1876 THR A OG1 1 
ATOM   1630 C  CG2 . THR A 1 197 ? 19.266 16.039  7.309   1.00 25.12 ? 1876 THR A CG2 1 
ATOM   1631 N  N   . THR A 1 198 ? 18.465 11.599  7.197   1.00 17.95 ? 1877 THR A N   1 
ATOM   1632 C  CA  . THR A 1 198 ? 18.904 10.278  6.714   1.00 17.00 ? 1877 THR A CA  1 
ATOM   1633 C  C   . THR A 1 198 ? 20.192 10.411  5.899   1.00 18.52 ? 1877 THR A C   1 
ATOM   1634 O  O   . THR A 1 198 ? 21.062 9.531   5.939   1.00 18.69 ? 1877 THR A O   1 
ATOM   1635 C  CB  . THR A 1 198 ? 17.828 9.625   5.807   1.00 17.91 ? 1877 THR A CB  1 
ATOM   1636 O  OG1 . THR A 1 198 ? 17.566 10.462  4.674   1.00 20.31 ? 1877 THR A OG1 1 
ATOM   1637 C  CG2 . THR A 1 198 ? 16.557 9.372   6.613   1.00 18.04 ? 1877 THR A CG2 1 
ATOM   1638 N  N   . GLN A 1 199 ? 20.361 11.515  5.165   1.00 18.38 ? 1878 GLN A N   1 
ATOM   1639 C  CA  . GLN A 1 199 ? 21.460 11.620  4.184   1.00 16.44 ? 1878 GLN A CA  1 
ATOM   1640 C  C   . GLN A 1 199 ? 22.817 11.509  4.885   1.00 17.78 ? 1878 GLN A C   1 
ATOM   1641 O  O   . GLN A 1 199 ? 23.756 10.854  4.402   1.00 17.30 ? 1878 GLN A O   1 
ATOM   1642 C  CB  . GLN A 1 199 ? 21.380 12.993  3.525   1.00 20.31 ? 1878 GLN A CB  1 
ATOM   1643 C  CG  . GLN A 1 199 ? 22.458 13.221  2.496   1.00 29.67 ? 1878 GLN A CG  1 
ATOM   1644 C  CD  . GLN A 1 199 ? 22.360 14.642  1.983   1.00 43.07 ? 1878 GLN A CD  1 
ATOM   1645 O  OE1 . GLN A 1 199 ? 21.327 15.298  2.159   1.00 45.51 ? 1878 GLN A OE1 1 
ATOM   1646 N  NE2 . GLN A 1 199 ? 23.431 15.131  1.365   1.00 46.89 ? 1878 GLN A NE2 1 
ATOM   1647 N  N   . SER A 1 200 ? 22.885 12.178  6.032   1.00 17.59 ? 1879 SER A N   1 
ATOM   1648 C  CA  . SER A 1 200 ? 24.128 12.243  6.791   1.00 17.87 ? 1879 SER A CA  1 
ATOM   1649 C  C   . SER A 1 200 ? 24.614 10.858  7.216   1.00 16.11 ? 1879 SER A C   1 
ATOM   1650 O  O   . SER A 1 200 ? 25.772 10.510  6.933   1.00 18.08 ? 1879 SER A O   1 
ATOM   1651 C  CB  . SER A 1 200 ? 23.914 13.107  8.032   1.00 19.09 ? 1879 SER A CB  1 
ATOM   1652 O  OG  . SER A 1 200 ? 25.132 13.222  8.712   1.00 24.65 ? 1879 SER A OG  1 
ATOM   1653 N  N   . LEU A 1 201 ? 23.754 10.065  7.863   1.00 15.25 ? 1880 LEU A N   1 
ATOM   1654 C  CA  . LEU A 1 201 ? 24.194 8.742   8.340   1.00 15.62 ? 1880 LEU A CA  1 
ATOM   1655 C  C   . LEU A 1 201 ? 24.406 7.788   7.173   1.00 17.08 ? 1880 LEU A C   1 
ATOM   1656 O  O   . LEU A 1 201 ? 25.324 6.964   7.202   1.00 17.96 ? 1880 LEU A O   1 
ATOM   1657 C  CB  . LEU A 1 201 ? 23.281 8.126   9.410   1.00 18.16 ? 1880 LEU A CB  1 
ATOM   1658 C  CG  . LEU A 1 201 ? 24.008 7.000   10.142  1.00 18.97 ? 1880 LEU A CG  1 
ATOM   1659 C  CD1 . LEU A 1 201 ? 25.152 7.562   10.962  1.00 20.67 ? 1880 LEU A CD1 1 
ATOM   1660 C  CD2 . LEU A 1 201 ? 23.007 6.137   10.962  1.00 18.91 ? 1880 LEU A CD2 1 
ATOM   1661 N  N   . ILE A 1 202 ? 23.565 7.893   6.134   1.00 14.76 ? 1881 ILE A N   1 
ATOM   1662 C  CA  . ILE A 1 202 ? 23.779 7.051   4.958   1.00 15.61 ? 1881 ILE A CA  1 
ATOM   1663 C  C   . ILE A 1 202 ? 25.166 7.315   4.385   1.00 15.31 ? 1881 ILE A C   1 
ATOM   1664 O  O   . ILE A 1 202 ? 25.902 6.392   4.031   1.00 14.98 ? 1881 ILE A O   1 
ATOM   1665 C  CB  . ILE A 1 202 ? 22.662 7.326   3.881   1.00 15.74 ? 1881 ILE A CB  1 
ATOM   1666 C  CG1 . ILE A 1 202 ? 21.308 6.792   4.384   1.00 16.91 ? 1881 ILE A CG1 1 
ATOM   1667 C  CG2 . ILE A 1 202 ? 23.071 6.695   2.542   1.00 16.40 ? 1881 ILE A CG2 1 
ATOM   1668 C  CD1 . ILE A 1 202 ? 20.139 7.273   3.539   1.00 16.44 ? 1881 ILE A CD1 1 
ATOM   1669 N  N   . GLN A 1 203 ? 25.554 8.584   4.269   1.00 16.19 ? 1882 GLN A N   1 
ATOM   1670 C  CA  . GLN A 1 203 ? 26.847 8.888   3.671   1.00 16.36 ? 1882 GLN A CA  1 
ATOM   1671 C  C   . GLN A 1 203 ? 27.983 8.477   4.601   1.00 15.01 ? 1882 GLN A C   1 
ATOM   1672 O  O   . GLN A 1 203 ? 29.004 8.009   4.135   1.00 15.94 ? 1882 GLN A O   1 
ATOM   1673 C  CB  . GLN A 1 203 ? 26.938 10.373  3.368   1.00 17.24 ? 1882 GLN A CB  1 
ATOM   1674 C  CG  . GLN A 1 203 ? 28.337 10.734  2.818   1.00 19.51 ? 1882 GLN A CG  1 
ATOM   1675 C  CD  . GLN A 1 203 ? 28.634 10.192  1.432   1.00 31.83 ? 1882 GLN A CD  1 
ATOM   1676 O  OE1 . GLN A 1 203 ? 27.763 9.627   0.766   1.00 30.10 ? 1882 GLN A OE1 1 
ATOM   1677 N  NE2 . GLN A 1 203 ? 29.868 10.387  0.975   1.00 33.20 ? 1882 GLN A NE2 1 
ATOM   1678 N  N   . PHE A 1 204 ? 27.779 8.605   5.896   1.00 15.33 ? 1883 PHE A N   1 
ATOM   1679 C  CA  . PHE A 1 204 ? 28.813 8.178   6.866   1.00 14.96 ? 1883 PHE A CA  1 
ATOM   1680 C  C   . PHE A 1 204 ? 29.010 6.675   6.764   1.00 15.62 ? 1883 PHE A C   1 
ATOM   1681 O  O   . PHE A 1 204 ? 30.136 6.205   6.630   1.00 15.40 ? 1883 PHE A O   1 
ATOM   1682 C  CB  . PHE A 1 204 ? 28.412 8.555   8.295   1.00 13.59 ? 1883 PHE A CB  1 
ATOM   1683 C  CG  . PHE A 1 204 ? 29.418 8.119   9.347   1.00 11.95 ? 1883 PHE A CG  1 
ATOM   1684 C  CD1 . PHE A 1 204 ? 30.718 8.612   9.386   1.00 14.65 ? 1883 PHE A CD1 1 
ATOM   1685 C  CD2 . PHE A 1 204 ? 29.013 7.199   10.334  1.00 14.78 ? 1883 PHE A CD2 1 
ATOM   1686 C  CE1 . PHE A 1 204 ? 31.608 8.199   10.389  1.00 14.21 ? 1883 PHE A CE1 1 
ATOM   1687 C  CE2 . PHE A 1 204 ? 29.901 6.761   11.339  1.00 15.34 ? 1883 PHE A CE2 1 
ATOM   1688 C  CZ  . PHE A 1 204 ? 31.201 7.261   11.367  1.00 13.88 ? 1883 PHE A CZ  1 
ATOM   1689 N  N   . VAL A 1 205 ? 27.912 5.919   6.796   1.00 13.79 ? 1884 VAL A N   1 
ATOM   1690 C  CA  . VAL A 1 205 ? 28.017 4.461   6.652   1.00 13.99 ? 1884 VAL A CA  1 
ATOM   1691 C  C   . VAL A 1 205 ? 28.686 4.067   5.335   1.00 14.57 ? 1884 VAL A C   1 
ATOM   1692 O  O   . VAL A 1 205 ? 29.573 3.221   5.348   1.00 16.39 ? 1884 VAL A O   1 
ATOM   1693 C  CB  . VAL A 1 205 ? 26.597 3.796   6.801   1.00 15.20 ? 1884 VAL A CB  1 
ATOM   1694 C  CG1 . VAL A 1 205 ? 26.626 2.320   6.329   1.00 16.70 ? 1884 VAL A CG1 1 
ATOM   1695 C  CG2 . VAL A 1 205 ? 26.068 3.951   8.220   1.00 14.20 ? 1884 VAL A CG2 1 
ATOM   1696 N  N   . ARG A 1 206 ? 28.265 4.649   4.204   1.00 14.53 ? 1885 ARG A N   1 
ATOM   1697 C  CA  . ARG A 1 206 ? 28.917 4.361   2.916   1.00 16.01 ? 1885 ARG A CA  1 
ATOM   1698 C  C   . ARG A 1 206 ? 30.392 4.680   2.891   1.00 16.86 ? 1885 ARG A C   1 
ATOM   1699 O  O   . ARG A 1 206 ? 31.171 3.914   2.313   1.00 19.30 ? 1885 ARG A O   1 
ATOM   1700 C  CB  . ARG A 1 206 ? 28.183 5.103   1.797   1.00 16.61 ? 1885 ARG A CB  1 
ATOM   1701 C  CG  . ARG A 1 206 ? 26.832 4.420   1.521   1.00 18.18 ? 1885 ARG A CG  1 
ATOM   1702 C  CD  . ARG A 1 206 ? 25.945 5.272   0.614   1.00 19.85 ? 1885 ARG A CD  1 
ATOM   1703 N  NE  . ARG A 1 206 ? 24.884 4.429   0.040   1.00 20.56 ? 1885 ARG A NE  1 
ATOM   1704 C  CZ  . ARG A 1 206 ? 23.922 4.908   -0.742  1.00 22.61 ? 1885 ARG A CZ  1 
ATOM   1705 N  NH1 . ARG A 1 206 ? 23.871 6.199   -1.027  1.00 20.06 ? 1885 ARG A NH1 1 
ATOM   1706 N  NH2 . ARG A 1 206 ? 23.020 4.079   -1.269  1.00 21.66 ? 1885 ARG A NH2 1 
ATOM   1707 N  N   . THR A 1 207 ? 30.764 5.801   3.510   1.00 15.74 ? 1886 THR A N   1 
ATOM   1708 C  CA  . THR A 1 207 ? 32.153 6.215   3.610   1.00 16.99 ? 1886 THR A CA  1 
ATOM   1709 C  C   . THR A 1 207 ? 32.978 5.171   4.373   1.00 16.07 ? 1886 THR A C   1 
ATOM   1710 O  O   . THR A 1 207 ? 34.019 4.751   3.915   1.00 17.72 ? 1886 THR A O   1 
ATOM   1711 C  CB  . THR A 1 207 ? 32.258 7.629   4.248   1.00 17.19 ? 1886 THR A CB  1 
ATOM   1712 O  OG1 . THR A 1 207 ? 31.636 8.565   3.353   1.00 18.82 ? 1886 THR A OG1 1 
ATOM   1713 C  CG2 . THR A 1 207 ? 33.735 8.012   4.393   1.00 18.03 ? 1886 THR A CG2 1 
ATOM   1714 N  N   . VAL A 1 208 ? 32.507 4.745   5.542   1.00 15.55 ? 1887 VAL A N   1 
ATOM   1715 C  CA  . VAL A 1 208 ? 33.237 3.798   6.364   1.00 15.61 ? 1887 VAL A CA  1 
ATOM   1716 C  C   . VAL A 1 208 ? 33.330 2.465   5.579   1.00 16.48 ? 1887 VAL A C   1 
ATOM   1717 O  O   . VAL A 1 208 ? 34.391 1.870   5.476   1.00 18.66 ? 1887 VAL A O   1 
ATOM   1718 C  CB  . VAL A 1 208 ? 32.515 3.594   7.713   1.00 15.67 ? 1887 VAL A CB  1 
ATOM   1719 C  CG1 . VAL A 1 208 ? 33.164 2.468   8.520   1.00 18.63 ? 1887 VAL A CG1 1 
ATOM   1720 C  CG2 . VAL A 1 208 ? 32.581 4.861   8.529   1.00 15.09 ? 1887 VAL A CG2 1 
ATOM   1721 N  N   . ARG A 1 209 ? 32.205 2.056   4.993   1.00 17.10 ? 1888 ARG A N   1 
ATOM   1722 C  CA  . ARG A 1 209 ? 32.143 0.807   4.211   1.00 18.83 ? 1888 ARG A CA  1 
ATOM   1723 C  C   . ARG A 1 209 ? 33.147 0.861   3.069   1.00 19.77 ? 1888 ARG A C   1 
ATOM   1724 O  O   . ARG A 1 209 ? 33.867 -0.115  2.863   1.00 20.72 ? 1888 ARG A O   1 
ATOM   1725 C  CB  . ARG A 1 209 ? 30.710 0.555   3.741   1.00 19.54 ? 1888 ARG A CB  1 
ATOM   1726 C  CG  . ARG A 1 209 ? 30.510 -0.660  2.800   1.00 23.26 ? 1888 ARG A CG  1 
ATOM   1727 C  CD  . ARG A 1 209 ? 31.043 -1.949  3.322   1.00 27.21 ? 1888 ARG A CD  1 
ATOM   1728 N  NE  . ARG A 1 209 ? 30.661 -2.256  4.702   1.00 21.32 ? 1888 ARG A NE  1 
ATOM   1729 C  CZ  . ARG A 1 209 ? 31.214 -3.224  5.416   1.00 25.47 ? 1888 ARG A CZ  1 
ATOM   1730 N  NH1 . ARG A 1 209 ? 32.161 -3.995  4.892   1.00 26.81 ? 1888 ARG A NH1 1 
ATOM   1731 N  NH2 . ARG A 1 209 ? 30.814 -3.431  6.659   1.00 24.82 ? 1888 ARG A NH2 1 
ATOM   1732 N  N   . ASP A 1 210 ? 33.241 2.000   2.378   1.00 20.11 ? 1889 ASP A N   1 
ATOM   1733 C  CA  . ASP A 1 210 ? 34.263 2.115   1.355   1.00 23.28 ? 1889 ASP A CA  1 
ATOM   1734 C  C   . ASP A 1 210 ? 35.669 1.976   1.911   1.00 23.52 ? 1889 ASP A C   1 
ATOM   1735 O  O   . ASP A 1 210 ? 36.501 1.313   1.297   1.00 24.10 ? 1889 ASP A O   1 
ATOM   1736 C  CB  . ASP A 1 210 ? 34.100 3.408   0.568   1.00 23.86 ? 1889 ASP A CB  1 
ATOM   1737 C  CG  . ASP A 1 210 ? 32.870 3.430   -0.317  1.00 30.04 ? 1889 ASP A CG  1 
ATOM   1738 O  OD1 . ASP A 1 210 ? 32.196 2.394   -0.530  1.00 33.11 ? 1889 ASP A OD1 1 
ATOM   1739 O  OD2 . ASP A 1 210 ? 32.577 4.525   -0.838  1.00 34.46 ? 1889 ASP A OD2 1 
ATOM   1740 N  N   . TYR A 1 211 ? 35.963 2.570   3.066   1.00 22.67 ? 1890 TYR A N   1 
ATOM   1741 C  CA  . TYR A 1 211 ? 37.285 2.432   3.672   1.00 22.32 ? 1890 TYR A CA  1 
ATOM   1742 C  C   . TYR A 1 211 ? 37.564 0.986   4.081   1.00 23.98 ? 1890 TYR A C   1 
ATOM   1743 O  O   . TYR A 1 211 ? 38.694 0.486   3.890   1.00 27.58 ? 1890 TYR A O   1 
ATOM   1744 C  CB  . TYR A 1 211 ? 37.426 3.299   4.924   1.00 22.05 ? 1890 TYR A CB  1 
ATOM   1745 C  CG  . TYR A 1 211 ? 37.886 4.713   4.658   1.00 23.04 ? 1890 TYR A CG  1 
ATOM   1746 C  CD1 . TYR A 1 211 ? 37.006 5.792   4.748   1.00 18.18 ? 1890 TYR A CD1 1 
ATOM   1747 C  CD2 . TYR A 1 211 ? 39.209 4.973   4.319   1.00 24.56 ? 1890 TYR A CD2 1 
ATOM   1748 C  CE1 . TYR A 1 211 ? 37.445 7.105   4.493   1.00 19.52 ? 1890 TYR A CE1 1 
ATOM   1749 C  CE2 . TYR A 1 211 ? 39.647 6.282   4.072   1.00 25.97 ? 1890 TYR A CE2 1 
ATOM   1750 C  CZ  . TYR A 1 211 ? 38.763 7.329   4.169   1.00 23.10 ? 1890 TYR A CZ  1 
ATOM   1751 O  OH  . TYR A 1 211 ? 39.214 8.608   3.926   1.00 25.40 ? 1890 TYR A OH  1 
ATOM   1752 N  N   . ILE A 1 212 ? 36.549 0.328   4.641   1.00 24.33 ? 1891 ILE A N   1 
ATOM   1753 C  CA  . ILE A 1 212 ? 36.705 -1.090  4.990   1.00 27.19 ? 1891 ILE A CA  1 
ATOM   1754 C  C   . ILE A 1 212 ? 37.071 -1.909  3.768   1.00 29.44 ? 1891 ILE A C   1 
ATOM   1755 O  O   . ILE A 1 212 ? 37.947 -2.783  3.833   1.00 31.56 ? 1891 ILE A O   1 
ATOM   1756 C  CB  . ILE A 1 212 ? 35.452 -1.670  5.696   1.00 25.72 ? 1891 ILE A CB  1 
ATOM   1757 C  CG1 . ILE A 1 212 ? 35.303 -1.050  7.074   1.00 23.39 ? 1891 ILE A CG1 1 
ATOM   1758 C  CG2 . ILE A 1 212 ? 35.585 -3.197  5.863   1.00 25.96 ? 1891 ILE A CG2 1 
ATOM   1759 C  CD1 . ILE A 1 212 ? 33.896 -1.296  7.652   1.00 20.54 ? 1891 ILE A CD1 1 
ATOM   1760 N  N   . ASN A 1 213 ? 36.412 -1.619  2.654   1.00 29.96 ? 1892 ASN A N   1 
ATOM   1761 C  CA  . ASN A 1 213 ? 36.526 -2.466  1.483   1.00 33.28 ? 1892 ASN A CA  1 
ATOM   1762 C  C   . ASN A 1 213 ? 37.915 -2.333  0.850   1.00 35.91 ? 1892 ASN A C   1 
ATOM   1763 O  O   . ASN A 1 213 ? 38.346 -3.209  0.096   1.00 36.93 ? 1892 ASN A O   1 
ATOM   1764 C  CB  . ASN A 1 213 ? 35.378 -2.193  0.527   1.00 31.18 ? 1892 ASN A CB  1 
ATOM   1765 C  CG  . ASN A 1 213 ? 34.054 -2.779  1.022   1.00 31.64 ? 1892 ASN A CG  1 
ATOM   1766 O  OD1 . ASN A 1 213 ? 34.015 -3.624  1.920   1.00 38.31 ? 1892 ASN A OD1 1 
ATOM   1767 N  ND2 . ASN A 1 213 ? 32.964 -2.334  0.435   1.00 38.70 ? 1892 ASN A ND2 1 
ATOM   1768 N  N   . ARG A 1 214 ? 38.609 -1.247  1.186   1.00 38.56 ? 1893 ARG A N   1 
ATOM   1769 C  CA  . ARG A 1 214 ? 40.008 -1.022  0.812   1.00 42.42 ? 1893 ARG A CA  1 
ATOM   1770 C  C   . ARG A 1 214 ? 41.025 -1.360  1.922   1.00 44.45 ? 1893 ARG A C   1 
ATOM   1771 O  O   . ARG A 1 214 ? 42.221 -1.167  1.728   1.00 46.33 ? 1893 ARG A O   1 
ATOM   1772 C  CB  . ARG A 1 214 ? 40.199 0.434   0.331   1.00 42.20 ? 1893 ARG A CB  1 
ATOM   1773 C  CG  . ARG A 1 214 ? 39.171 0.951   -0.701  1.00 41.65 ? 1893 ARG A CG  1 
ATOM   1774 C  CD  . ARG A 1 214 ? 39.501 2.367   -1.221  1.00 44.29 ? 1893 ARG A CD  1 
ATOM   1775 N  NE  . ARG A 1 214 ? 39.516 3.408   -0.183  1.00 43.80 ? 1893 ARG A NE  1 
ATOM   1776 C  CZ  . ARG A 1 214 ? 38.561 4.321   -0.007  1.00 43.26 ? 1893 ARG A CZ  1 
ATOM   1777 N  NH1 . ARG A 1 214 ? 37.495 4.347   -0.800  1.00 45.54 ? 1893 ARG A NH1 1 
ATOM   1778 N  NH2 . ARG A 1 214 ? 38.662 5.220   0.971   1.00 41.63 ? 1893 ARG A NH2 1 
ATOM   1779 N  N   . SER A 1 215 ? 40.575 -1.853  3.079   1.00 46.46 ? 1894 SER A N   1 
ATOM   1780 C  CA  . SER A 1 215 ? 41.472 -2.246  4.185   1.00 46.35 ? 1894 SER A CA  1 
ATOM   1781 C  C   . SER A 1 215 ? 41.919 -3.706  4.044   1.00 48.15 ? 1894 SER A C   1 
ATOM   1782 O  O   . SER A 1 215 ? 41.464 -4.548  4.816   1.00 47.95 ? 1894 SER A O   1 
ATOM   1783 C  CB  . SER A 1 215 ? 40.776 -2.105  5.563   1.00 46.62 ? 1894 SER A CB  1 
ATOM   1784 O  OG  . SER A 1 215 ? 40.456 -0.778  5.986   1.00 36.90 ? 1894 SER A OG  1 
ATOM   1785 N  N   . PRO A 1 216 ? 42.840 -4.021  3.110   1.00 49.18 ? 1895 PRO A N   1 
ATOM   1786 C  CA  . PRO A 1 216 ? 42.772 -5.326  2.442   1.00 48.84 ? 1895 PRO A CA  1 
ATOM   1787 C  C   . PRO A 1 216 ? 42.460 -6.398  3.481   1.00 47.50 ? 1895 PRO A C   1 
ATOM   1788 O  O   . PRO A 1 216 ? 43.351 -6.785  4.248   1.00 47.93 ? 1895 PRO A O   1 
ATOM   1789 C  CB  . PRO A 1 216 ? 44.198 -5.531  1.906   1.00 47.95 ? 1895 PRO A CB  1 
ATOM   1790 C  CG  . PRO A 1 216 ? 45.017 -4.370  2.455   1.00 50.09 ? 1895 PRO A CG  1 
ATOM   1791 C  CD  . PRO A 1 216 ? 44.033 -3.269  2.688   1.00 49.17 ? 1895 PRO A CD  1 
ATOM   1792 N  N   . GLY A 1 217 ? 41.209 -6.859  3.500   1.00 45.21 ? 1896 GLY A N   1 
ATOM   1793 C  CA  . GLY A 1 217 ? 40.621 -7.477  4.685   1.00 42.25 ? 1896 GLY A CA  1 
ATOM   1794 C  C   . GLY A 1 217 ? 41.371 -7.034  5.929   1.00 41.66 ? 1896 GLY A C   1 
ATOM   1795 O  O   . GLY A 1 217 ? 42.572 -7.253  6.051   1.00 41.52 ? 1896 GLY A O   1 
ATOM   1796 N  N   . ALA A 1 218 ? 40.683 -6.385  6.853   1.00 37.42 ? 1897 ALA A N   1 
ATOM   1797 C  CA  . ALA A 1 218 ? 41.197 -6.325  8.208   1.00 37.06 ? 1897 ALA A CA  1 
ATOM   1798 C  C   . ALA A 1 218 ? 40.507 -7.384  9.067   1.00 34.34 ? 1897 ALA A C   1 
ATOM   1799 O  O   . ALA A 1 218 ? 39.839 -8.335  8.593   1.00 37.85 ? 1897 ALA A O   1 
ATOM   1800 C  CB  . ALA A 1 218 ? 40.975 -4.967  8.793   1.00 35.30 ? 1897 ALA A CB  1 
ATOM   1801 N  N   . GLY A 1 219 ? 40.725 -7.197  10.354  1.00 31.36 ? 1898 GLY A N   1 
ATOM   1802 C  CA  . GLY A 1 219 ? 39.919 -7.795  11.372  1.00 25.52 ? 1898 GLY A CA  1 
ATOM   1803 C  C   . GLY A 1 219 ? 38.550 -7.151  11.462  1.00 20.03 ? 1898 GLY A C   1 
ATOM   1804 O  O   . GLY A 1 219 ? 38.067 -6.422  10.600  1.00 21.30 ? 1898 GLY A O   1 
ATOM   1805 N  N   . PRO A 1 220 ? 37.887 -7.484  12.557  1.00 18.59 ? 1899 PRO A N   1 
ATOM   1806 C  CA  . PRO A 1 220 ? 36.554 -6.985  12.834  1.00 15.80 ? 1899 PRO A CA  1 
ATOM   1807 C  C   . PRO A 1 220 ? 36.634 -5.458  12.909  1.00 16.78 ? 1899 PRO A C   1 
ATOM   1808 O  O   . PRO A 1 220 ? 37.644 -4.892  13.361  1.00 18.25 ? 1899 PRO A O   1 
ATOM   1809 C  CB  . PRO A 1 220 ? 36.274 -7.558  14.216  1.00 19.05 ? 1899 PRO A CB  1 
ATOM   1810 C  CG  . PRO A 1 220 ? 37.150 -8.757  14.328  1.00 20.79 ? 1899 PRO A CG  1 
ATOM   1811 C  CD  . PRO A 1 220 ? 38.390 -8.365  13.613  1.00 16.82 ? 1899 PRO A CD  1 
ATOM   1812 N  N   . THR A 1 221 ? 35.575 -4.811  12.451  1.00 16.30 ? 1900 THR A N   1 
ATOM   1813 C  CA  . THR A 1 221 ? 35.447 -3.369  12.694  1.00 15.97 ? 1900 THR A CA  1 
ATOM   1814 C  C   . THR A 1 221 ? 34.859 -3.168  14.080  1.00 15.54 ? 1900 THR A C   1 
ATOM   1815 O  O   . THR A 1 221 ? 33.813 -3.718  14.388  1.00 17.34 ? 1900 THR A O   1 
ATOM   1816 C  CB  . THR A 1 221 ? 34.474 -2.772  11.641  1.00 14.95 ? 1900 THR A CB  1 
ATOM   1817 O  OG1 . THR A 1 221 ? 35.050 -2.965  10.326  1.00 17.77 ? 1900 THR A OG1 1 
ATOM   1818 C  CG2 . THR A 1 221 ? 34.262 -1.257  11.894  1.00 14.07 ? 1900 THR A CG2 1 
ATOM   1819 N  N   . VAL A 1 222 ? 35.479 -2.328  14.909  1.00 15.30 ? 1901 VAL A N   1 
ATOM   1820 C  CA  . VAL A 1 222 ? 34.893 -1.974  16.206  1.00 14.27 ? 1901 VAL A CA  1 
ATOM   1821 C  C   . VAL A 1 222 ? 33.916 -0.823  16.027  1.00 16.98 ? 1901 VAL A C   1 
ATOM   1822 O  O   . VAL A 1 222 ? 34.222 0.140   15.310  1.00 17.03 ? 1901 VAL A O   1 
ATOM   1823 C  CB  . VAL A 1 222 ? 36.010 -1.547  17.231  1.00 14.05 ? 1901 VAL A CB  1 
ATOM   1824 C  CG1 . VAL A 1 222 ? 35.392 -0.760  18.405  1.00 16.38 ? 1901 VAL A CG1 1 
ATOM   1825 C  CG2 . VAL A 1 222 ? 36.775 -2.782  17.675  1.00 16.86 ? 1901 VAL A CG2 1 
ATOM   1826 N  N   . VAL A 1 223 ? 32.738 -0.943  16.629  1.00 15.61 ? 1902 VAL A N   1 
ATOM   1827 C  CA  . VAL A 1 223 ? 31.779 0.154   16.630  1.00 14.56 ? 1902 VAL A CA  1 
ATOM   1828 C  C   . VAL A 1 223 ? 31.332 0.331   18.076  1.00 15.10 ? 1902 VAL A C   1 
ATOM   1829 O  O   . VAL A 1 223 ? 31.059 -0.610  18.813  1.00 15.55 ? 1902 VAL A O   1 
ATOM   1830 C  CB  . VAL A 1 223 ? 30.525 -0.180  15.763  1.00 15.77 ? 1902 VAL A CB  1 
ATOM   1831 C  CG1 . VAL A 1 223 ? 29.564 1.030   15.729  1.00 16.71 ? 1902 VAL A CG1 1 
ATOM   1832 C  CG2 . VAL A 1 223 ? 30.914 -0.605  14.392  1.00 16.86 ? 1902 VAL A CG2 1 
ATOM   1833 N  N   . HIS A 1 224 ? 31.314 1.572   18.547  1.00 14.58 ? 1903 HIS A N   1 
ATOM   1834 C  CA  . HIS A 1 224 ? 30.882 1.836   19.922  1.00 14.98 ? 1903 HIS A CA  1 
ATOM   1835 C  C   . HIS A 1 224 ? 30.195 3.174   20.026  1.00 16.84 ? 1903 HIS A C   1 
ATOM   1836 O  O   . HIS A 1 224 ? 30.413 4.069   19.193  1.00 15.89 ? 1903 HIS A O   1 
ATOM   1837 C  CB  . HIS A 1 224 ? 32.023 1.745   20.951  1.00 15.05 ? 1903 HIS A CB  1 
ATOM   1838 C  CG  . HIS A 1 224 ? 32.924 2.956   20.988  1.00 15.80 ? 1903 HIS A CG  1 
ATOM   1839 N  ND1 . HIS A 1 224 ? 32.638 4.084   21.726  1.00 17.65 ? 1903 HIS A ND1 1 
ATOM   1840 C  CD2 . HIS A 1 224 ? 34.123 3.187   20.403  1.00 16.06 ? 1903 HIS A CD2 1 
ATOM   1841 C  CE1 . HIS A 1 224 ? 33.617 4.965   21.570  1.00 17.23 ? 1903 HIS A CE1 1 
ATOM   1842 N  NE2 . HIS A 1 224 ? 34.532 4.446   20.766  1.00 17.64 ? 1903 HIS A NE2 1 
ATOM   1843 N  N   . CYS A 1 225 ? 29.363 3.292   21.062  1.00 15.66 ? 1904 CYS A N   1 
ATOM   1844 C  CA  . CYS A 1 225 ? 28.741 4.550   21.398  1.00 16.69 ? 1904 CYS A CA  1 
ATOM   1845 C  C   . CYS A 1 225 ? 28.972 4.702   22.893  1.00 16.27 ? 1904 CYS A C   1 
ATOM   1846 O  O   . CYS A 1 225 ? 30.111 4.586   23.365  1.00 17.63 ? 1904 CYS A O   1 
ATOM   1847 C  CB  . CYS A 1 225 ? 27.273 4.597   20.943  1.00 17.43 ? 1904 CYS A CB  1 
ATOM   1848 S  SG  . CYS A 1 225 ? 26.338 3.057   21.265  1.00 19.37 ? 1904 CYS A SG  1 
ATOM   1849 N  N   . SER A 1 226 ? 27.922 4.908   23.674  1.00 17.87 ? 1905 SER A N   1 
ATOM   1850 C  CA  . SER A 1 226 ? 28.145 4.970   25.119  1.00 16.92 ? 1905 SER A CA  1 
ATOM   1851 C  C   . SER A 1 226 ? 27.880 3.579   25.728  1.00 18.09 ? 1905 SER A C   1 
ATOM   1852 O  O   . SER A 1 226 ? 28.752 3.012   26.390  1.00 16.63 ? 1905 SER A O   1 
ATOM   1853 C  CB  . SER A 1 226 ? 27.202 6.016   25.740  1.00 17.72 ? 1905 SER A CB  1 
ATOM   1854 O  OG  . SER A 1 226 ? 27.434 6.110   27.135  1.00 19.04 ? 1905 SER A OG  1 
ATOM   1855 N  N   . ALA A 1 227 ? 26.696 3.020   25.486  1.00 17.20 ? 1906 ALA A N   1 
ATOM   1856 C  CA  . ALA A 1 227 ? 26.402 1.665   25.963  1.00 17.72 ? 1906 ALA A CA  1 
ATOM   1857 C  C   . ALA A 1 227 ? 26.755 0.574   24.936  1.00 19.86 ? 1906 ALA A C   1 
ATOM   1858 O  O   . ALA A 1 227 ? 26.798 -0.625  25.268  1.00 21.41 ? 1906 ALA A O   1 
ATOM   1859 C  CB  . ALA A 1 227 ? 24.926 1.566   26.307  1.00 18.97 ? 1906 ALA A CB  1 
ATOM   1860 N  N   . GLY A 1 228 ? 26.978 0.975   23.683  1.00 18.01 ? 1907 GLY A N   1 
ATOM   1861 C  CA  . GLY A 1 228 ? 27.275 0.018   22.615  1.00 18.93 ? 1907 GLY A CA  1 
ATOM   1862 C  C   . GLY A 1 228 ? 26.059 -0.770  22.160  1.00 19.89 ? 1907 GLY A C   1 
ATOM   1863 O  O   . GLY A 1 228 ? 26.194 -1.918  21.765  1.00 20.88 ? 1907 GLY A O   1 
ATOM   1864 N  N   . VAL A 1 229 ? 24.879 -0.156  22.222  1.00 17.21 ? 1908 VAL A N   1 
ATOM   1865 C  CA  . VAL A 1 229 ? 23.654 -0.781  21.722  1.00 17.67 ? 1908 VAL A CA  1 
ATOM   1866 C  C   . VAL A 1 229 ? 22.732 0.034   20.823  1.00 17.60 ? 1908 VAL A C   1 
ATOM   1867 O  O   . VAL A 1 229 ? 22.312 -0.467  19.782  1.00 16.59 ? 1908 VAL A O   1 
ATOM   1868 C  CB  . VAL A 1 229 ? 22.827 -1.411  22.902  1.00 18.44 ? 1908 VAL A CB  1 
ATOM   1869 C  CG1 . VAL A 1 229 ? 23.652 -2.465  23.646  1.00 20.92 ? 1908 VAL A CG1 1 
ATOM   1870 C  CG2 . VAL A 1 229 ? 22.257 -0.354  23.869  1.00 22.57 ? 1908 VAL A CG2 1 
ATOM   1871 N  N   . GLY A 1 230 ? 22.390 1.259   21.215  1.00 17.25 ? 1909 GLY A N   1 
ATOM   1872 C  CA  . GLY A 1 230 ? 21.418 2.055   20.453  1.00 18.05 ? 1909 GLY A CA  1 
ATOM   1873 C  C   . GLY A 1 230 ? 21.997 2.566   19.142  1.00 18.44 ? 1909 GLY A C   1 
ATOM   1874 O  O   . GLY A 1 230 ? 21.606 2.150   18.053  1.00 16.07 ? 1909 GLY A O   1 
ATOM   1875 N  N   . ARG A 1 231 ? 22.955 3.464   19.276  1.00 16.81 ? 1910 ARG A N   1 
ATOM   1876 C  CA  . ARG A 1 231 ? 23.512 4.134   18.124  1.00 15.60 ? 1910 ARG A CA  1 
ATOM   1877 C  C   . ARG A 1 231 ? 24.412 3.120   17.396  1.00 15.18 ? 1910 ARG A C   1 
ATOM   1878 O  O   . ARG A 1 231 ? 24.424 3.071   16.173  1.00 15.61 ? 1910 ARG A O   1 
ATOM   1879 C  CB  . ARG A 1 231 ? 24.201 5.433   18.540  1.00 16.11 ? 1910 ARG A CB  1 
ATOM   1880 C  CG  . ARG A 1 231 ? 23.170 6.456   19.017  1.00 17.14 ? 1910 ARG A CG  1 
ATOM   1881 C  CD  . ARG A 1 231 ? 23.784 7.677   19.687  1.00 16.70 ? 1910 ARG A CD  1 
ATOM   1882 N  NE  . ARG A 1 231 ? 24.361 7.331   20.983  1.00 19.69 ? 1910 ARG A NE  1 
ATOM   1883 C  CZ  . ARG A 1 231 ? 24.999 8.198   21.779  1.00 17.69 ? 1910 ARG A CZ  1 
ATOM   1884 N  NH1 . ARG A 1 231 ? 25.175 9.459   21.376  1.00 18.14 ? 1910 ARG A NH1 1 
ATOM   1885 N  NH2 . ARG A 1 231 ? 25.499 7.795   22.947  1.00 21.06 ? 1910 ARG A NH2 1 
ATOM   1886 N  N   . THR A 1 232 ? 25.164 2.337   18.162  1.00 13.89 ? 1911 THR A N   1 
ATOM   1887 C  CA  . THR A 1 232 ? 25.983 1.261   17.566  1.00 15.99 ? 1911 THR A CA  1 
ATOM   1888 C  C   . THR A 1 232 ? 25.129 0.294   16.749  1.00 14.88 ? 1911 THR A C   1 
ATOM   1889 O  O   . THR A 1 232 ? 25.429 -0.028  15.593  1.00 15.03 ? 1911 THR A O   1 
ATOM   1890 C  CB  . THR A 1 232 ? 26.782 0.509   18.654  1.00 17.03 ? 1911 THR A CB  1 
ATOM   1891 O  OG1 . THR A 1 232 ? 27.774 1.400   19.176  1.00 18.39 ? 1911 THR A OG1 1 
ATOM   1892 C  CG2 . THR A 1 232 ? 27.457 -0.728  18.076  1.00 19.21 ? 1911 THR A CG2 1 
ATOM   1893 N  N   . GLY A 1 233 ? 24.034 -0.166  17.325  1.00 14.74 ? 1912 GLY A N   1 
ATOM   1894 C  CA  . GLY A 1 233 ? 23.123 -1.054  16.599  1.00 15.84 ? 1912 GLY A CA  1 
ATOM   1895 C  C   . GLY A 1 233 ? 22.508 -0.447  15.349  1.00 16.12 ? 1912 GLY A C   1 
ATOM   1896 O  O   . GLY A 1 233 ? 22.387 -1.123  14.329  1.00 14.67 ? 1912 GLY A O   1 
ATOM   1897 N  N   . THR A 1 234 ? 22.100 0.815   15.446  1.00 13.65 ? 1913 THR A N   1 
ATOM   1898 C  CA  . THR A 1 234 ? 21.505 1.483   14.300  1.00 14.70 ? 1913 THR A CA  1 
ATOM   1899 C  C   . THR A 1 234 ? 22.507 1.653   13.163  1.00 14.58 ? 1913 THR A C   1 
ATOM   1900 O  O   . THR A 1 234 ? 22.204 1.480   11.980  1.00 15.20 ? 1913 THR A O   1 
ATOM   1901 C  CB  . THR A 1 234 ? 20.865 2.820   14.740  1.00 17.00 ? 1913 THR A CB  1 
ATOM   1902 O  OG1 . THR A 1 234 ? 19.914 2.545   15.784  1.00 15.51 ? 1913 THR A OG1 1 
ATOM   1903 C  CG2 . THR A 1 234 ? 20.169 3.522   13.550  1.00 16.63 ? 1913 THR A CG2 1 
ATOM   1904 N  N   . PHE A 1 235 ? 23.747 1.976   13.536  1.00 12.24 ? 1914 PHE A N   1 
ATOM   1905 C  CA  . PHE A 1 235 ? 24.815 2.087   12.562  1.00 13.18 ? 1914 PHE A CA  1 
ATOM   1906 C  C   . PHE A 1 235 ? 25.033 0.755   11.809  1.00 12.33 ? 1914 PHE A C   1 
ATOM   1907 O  O   . PHE A 1 235 ? 25.070 0.713   10.580  1.00 13.75 ? 1914 PHE A O   1 
ATOM   1908 C  CB  . PHE A 1 235 ? 26.119 2.514   13.227  1.00 12.31 ? 1914 PHE A CB  1 
ATOM   1909 C  CG  . PHE A 1 235 ? 27.280 2.510   12.276  1.00 16.91 ? 1914 PHE A CG  1 
ATOM   1910 C  CD1 . PHE A 1 235 ? 27.592 3.634   11.509  1.00 15.03 ? 1914 PHE A CD1 1 
ATOM   1911 C  CD2 . PHE A 1 235 ? 28.055 1.352   12.124  1.00 15.21 ? 1914 PHE A CD2 1 
ATOM   1912 C  CE1 . PHE A 1 235 ? 28.664 3.612   10.594  1.00 13.40 ? 1914 PHE A CE1 1 
ATOM   1913 C  CE2 . PHE A 1 235 ? 29.138 1.327   11.213  1.00 15.40 ? 1914 PHE A CE2 1 
ATOM   1914 C  CZ  . PHE A 1 235 ? 29.411 2.471   10.442  1.00 15.34 ? 1914 PHE A CZ  1 
ATOM   1915 N  N   . ILE A 1 236 ? 25.147 -0.329  12.567  1.00 12.54 ? 1915 ILE A N   1 
ATOM   1916 C  CA  . ILE A 1 236 ? 25.475 -1.619  11.952  1.00 13.32 ? 1915 ILE A CA  1 
ATOM   1917 C  C   . ILE A 1 236 ? 24.246 -2.085  11.144  1.00 15.85 ? 1915 ILE A C   1 
ATOM   1918 O  O   . ILE A 1 236 ? 24.373 -2.545  10.018  1.00 13.62 ? 1915 ILE A O   1 
ATOM   1919 C  CB  . ILE A 1 236 ? 25.870 -2.625  13.015  1.00 13.13 ? 1915 ILE A CB  1 
ATOM   1920 C  CG1 . ILE A 1 236 ? 27.260 -2.322  13.575  1.00 13.86 ? 1915 ILE A CG1 1 
ATOM   1921 C  CG2 . ILE A 1 236 ? 25.811 -4.043  12.446  1.00 15.23 ? 1915 ILE A CG2 1 
ATOM   1922 C  CD1 . ILE A 1 236 ? 27.571 -3.186  14.816  1.00 16.65 ? 1915 ILE A CD1 1 
ATOM   1923 N  N   . ALA A 1 237 ? 23.048 -1.952  11.712  1.00 13.77 ? 1916 ALA A N   1 
ATOM   1924 C  CA  . ALA A 1 237 ? 21.836 -2.231  10.930  1.00 15.62 ? 1916 ALA A CA  1 
ATOM   1925 C  C   . ALA A 1 237 ? 21.800 -1.499  9.593   1.00 16.26 ? 1916 ALA A C   1 
ATOM   1926 O  O   . ALA A 1 237 ? 21.525 -2.116  8.566   1.00 15.05 ? 1916 ALA A O   1 
ATOM   1927 C  CB  . ALA A 1 237 ? 20.575 -2.009  11.741  1.00 14.78 ? 1916 ALA A CB  1 
ATOM   1928 N  N   . LEU A 1 238 ? 22.103 -0.207  9.605   1.00 12.48 ? 1917 LEU A N   1 
ATOM   1929 C  CA  . LEU A 1 238 ? 22.095 0.565   8.369   1.00 12.86 ? 1917 LEU A CA  1 
ATOM   1930 C  C   . LEU A 1 238 ? 23.189 0.076   7.405   1.00 12.76 ? 1917 LEU A C   1 
ATOM   1931 O  O   . LEU A 1 238 ? 22.953 -0.041  6.224   1.00 14.20 ? 1917 LEU A O   1 
ATOM   1932 C  CB  . LEU A 1 238 ? 22.192 2.061   8.683   1.00 13.27 ? 1917 LEU A CB  1 
ATOM   1933 C  CG  . LEU A 1 238 ? 22.112 2.951   7.432   1.00 13.83 ? 1917 LEU A CG  1 
ATOM   1934 C  CD1 . LEU A 1 238 ? 20.837 2.698   6.623   1.00 16.73 ? 1917 LEU A CD1 1 
ATOM   1935 C  CD2 . LEU A 1 238 ? 22.164 4.419   7.891   1.00 17.54 ? 1917 LEU A CD2 1 
ATOM   1936 N  N   . ASP A 1 239 ? 24.384 -0.210  7.906   1.00 13.13 ? 1918 ASP A N   1 
ATOM   1937 C  CA  . ASP A 1 239 ? 25.408 -0.821  7.047   1.00 14.05 ? 1918 ASP A CA  1 
ATOM   1938 C  C   . ASP A 1 239 ? 24.879 -2.095  6.358   1.00 15.72 ? 1918 ASP A C   1 
ATOM   1939 O  O   . ASP A 1 239 ? 25.044 -2.256  5.151   1.00 14.80 ? 1918 ASP A O   1 
ATOM   1940 C  CB  . ASP A 1 239 ? 26.595 -1.177  7.943   1.00 15.68 ? 1918 ASP A CB  1 
ATOM   1941 C  CG  . ASP A 1 239 ? 27.919 -1.430  7.176   1.00 22.38 ? 1918 ASP A CG  1 
ATOM   1942 O  OD1 . ASP A 1 239 ? 28.191 -0.955  6.040   1.00 20.62 ? 1918 ASP A OD1 1 
ATOM   1943 O  OD2 . ASP A 1 239 ? 28.789 -2.088  7.792   1.00 32.90 ? 1918 ASP A OD2 1 
ATOM   1944 N  N   . ARG A 1 240 ? 24.219 -2.975  7.107   1.00 15.42 ? 1919 ARG A N   1 
ATOM   1945 C  CA  . ARG A 1 240 ? 23.740 -4.216  6.516   1.00 14.93 ? 1919 ARG A CA  1 
ATOM   1946 C  C   . ARG A 1 240 ? 22.621 -3.945  5.508   1.00 15.15 ? 1919 ARG A C   1 
ATOM   1947 O  O   . ARG A 1 240 ? 22.603 -4.557  4.446   1.00 15.74 ? 1919 ARG A O   1 
ATOM   1948 C  CB  . ARG A 1 240 ? 23.259 -5.152  7.623   1.00 15.49 ? 1919 ARG A CB  1 
ATOM   1949 C  CG  . ARG A 1 240 ? 24.457 -5.538  8.517   1.00 20.70 ? 1919 ARG A CG  1 
ATOM   1950 C  CD  . ARG A 1 240 ? 24.407 -6.957  8.828   1.00 39.78 ? 1919 ARG A CD  1 
ATOM   1951 N  NE  . ARG A 1 240 ? 25.753 -7.366  9.213   1.00 40.34 ? 1919 ARG A NE  1 
ATOM   1952 C  CZ  . ARG A 1 240 ? 25.976 -8.004  10.349  1.00 40.79 ? 1919 ARG A CZ  1 
ATOM   1953 N  NH1 . ARG A 1 240 ? 24.939 -8.251  11.140  1.00 40.20 ? 1919 ARG A NH1 1 
ATOM   1954 N  NH2 . ARG A 1 240 ? 27.199 -8.393  10.671  1.00 29.79 ? 1919 ARG A NH2 1 
ATOM   1955 N  N   . ILE A 1 241 ? 21.690 -3.062  5.861   1.00 14.40 ? 1920 ILE A N   1 
ATOM   1956 C  CA  . ILE A 1 241 ? 20.530 -2.786  5.009   1.00 16.67 ? 1920 ILE A CA  1 
ATOM   1957 C  C   . ILE A 1 241 ? 20.972 -2.140  3.681   1.00 15.53 ? 1920 ILE A C   1 
ATOM   1958 O  O   . ILE A 1 241 ? 20.464 -2.463  2.595   1.00 16.10 ? 1920 ILE A O   1 
ATOM   1959 C  CB  . ILE A 1 241 ? 19.548 -1.895  5.802   1.00 18.64 ? 1920 ILE A CB  1 
ATOM   1960 C  CG1 . ILE A 1 241 ? 18.873 -2.741  6.895   1.00 16.60 ? 1920 ILE A CG1 1 
ATOM   1961 C  CG2 . ILE A 1 241 ? 18.614 -1.119  4.895   1.00 22.99 ? 1920 ILE A CG2 1 
ATOM   1962 C  CD1 . ILE A 1 241 ? 18.298 -1.826  7.994   1.00 26.21 ? 1920 ILE A CD1 1 
ATOM   1963 N  N   . LEU A 1 242 ? 21.937 -1.234  3.755   1.00 15.26 ? 1921 LEU A N   1 
ATOM   1964 C  CA  . LEU A 1 242 ? 22.463 -0.585  2.562   1.00 15.61 ? 1921 LEU A CA  1 
ATOM   1965 C  C   . LEU A 1 242 ? 23.159 -1.596  1.653   1.00 14.26 ? 1921 LEU A C   1 
ATOM   1966 O  O   . LEU A 1 242 ? 23.081 -1.466  0.431   1.00 17.14 ? 1921 LEU A O   1 
ATOM   1967 C  CB  . LEU A 1 242 ? 23.385 0.611   2.849   1.00 14.76 ? 1921 LEU A CB  1 
ATOM   1968 C  CG  . LEU A 1 242 ? 22.653 1.790   3.505   1.00 14.70 ? 1921 LEU A CG  1 
ATOM   1969 C  CD1 . LEU A 1 242 ? 23.677 2.839   3.972   1.00 21.31 ? 1921 LEU A CD1 1 
ATOM   1970 C  CD2 . LEU A 1 242 ? 21.637 2.393   2.513   1.00 19.75 ? 1921 LEU A CD2 1 
ATOM   1971 N  N   . GLN A 1 243 ? 23.850 -2.566  2.248   1.00 14.86 ? 1922 GLN A N   1 
ATOM   1972 C  CA  . GLN A 1 243 ? 24.447 -3.660  1.448   1.00 15.28 ? 1922 GLN A CA  1 
ATOM   1973 C  C   . GLN A 1 243 ? 23.350 -4.516  0.806   1.00 16.27 ? 1922 GLN A C   1 
ATOM   1974 O  O   . GLN A 1 243 ? 23.514 -4.936  -0.365  1.00 16.45 ? 1922 GLN A O   1 
ATOM   1975 C  CB  . GLN A 1 243 ? 25.411 -4.493  2.284   1.00 17.62 ? 1922 GLN A CB  1 
ATOM   1976 C  CG  . GLN A 1 243 ? 26.722 -3.708  2.535   1.00 18.48 ? 1922 GLN A CG  1 
ATOM   1977 C  CD  . GLN A 1 243 ? 27.727 -4.527  3.327   1.00 24.63 ? 1922 GLN A CD  1 
ATOM   1978 O  OE1 . GLN A 1 243 ? 28.370 -5.420  2.793   1.00 34.06 ? 1922 GLN A OE1 1 
ATOM   1979 N  NE2 . GLN A 1 243 ? 27.806 -4.274  4.618   1.00 26.06 ? 1922 GLN A NE2 1 
ATOM   1980 N  N   . GLN A 1 244 ? 22.250 -4.747  1.536   1.00 15.70 ? 1923 GLN A N   1 
ATOM   1981 C  CA  . GLN A 1 244 ? 21.118 -5.503  0.930   1.00 17.40 ? 1923 GLN A CA  1 
ATOM   1982 C  C   . GLN A 1 244 ? 20.589 -4.752  -0.270  1.00 17.44 ? 1923 GLN A C   1 
ATOM   1983 O  O   . GLN A 1 244 ? 20.277 -5.354  -1.288  1.00 18.80 ? 1923 GLN A O   1 
ATOM   1984 C  CB  . GLN A 1 244 ? 19.938 -5.716  1.884   1.00 16.48 ? 1923 GLN A CB  1 
ATOM   1985 C  CG  . GLN A 1 244 ? 20.314 -6.572  3.061   1.00 20.09 ? 1923 GLN A CG  1 
ATOM   1986 C  CD  . GLN A 1 244 ? 19.167 -6.712  4.033   1.00 23.44 ? 1923 GLN A CD  1 
ATOM   1987 O  OE1 . GLN A 1 244 ? 18.074 -6.221  3.798   1.00 22.83 ? 1923 GLN A OE1 1 
ATOM   1988 N  NE2 . GLN A 1 244 ? 19.429 -7.363  5.153   1.00 25.38 ? 1923 GLN A NE2 1 
ATOM   1989 N  N   . LEU A 1 245 ? 20.451 -3.438  -0.149  1.00 15.48 ? 1924 LEU A N   1 
ATOM   1990 C  CA  . LEU A 1 245 ? 19.847 -2.670  -1.234  1.00 14.65 ? 1924 LEU A CA  1 
ATOM   1991 C  C   . LEU A 1 245 ? 20.764 -2.717  -2.465  1.00 16.08 ? 1924 LEU A C   1 
ATOM   1992 O  O   . LEU A 1 245 ? 20.318 -2.475  -3.578  1.00 15.34 ? 1924 LEU A O   1 
ATOM   1993 C  CB  . LEU A 1 245 ? 19.621 -1.206  -0.815  1.00 17.58 ? 1924 LEU A CB  1 
ATOM   1994 C  CG  . LEU A 1 245 ? 18.538 -1.038  0.233   1.00 14.82 ? 1924 LEU A CG  1 
ATOM   1995 C  CD1 . LEU A 1 245 ? 18.280 0.438   0.443   1.00 19.68 ? 1924 LEU A CD1 1 
ATOM   1996 C  CD2 . LEU A 1 245 ? 17.233 -1.688  -0.233  1.00 20.90 ? 1924 LEU A CD2 1 
ATOM   1997 N  N   . ASP A 1 246 ? 22.062 -2.942  -2.273  1.00 15.19 ? 1925 ASP A N   1 
ATOM   1998 C  CA  . ASP A 1 246 ? 22.961 -3.026  -3.398  1.00 16.33 ? 1925 ASP A CA  1 
ATOM   1999 C  C   . ASP A 1 246 ? 23.054 -4.423  -3.988  1.00 16.09 ? 1925 ASP A C   1 
ATOM   2000 O  O   . ASP A 1 246 ? 23.684 -4.595  -5.049  1.00 19.40 ? 1925 ASP A O   1 
ATOM   2001 C  CB  . ASP A 1 246 ? 24.355 -2.518  -3.054  1.00 17.29 ? 1925 ASP A CB  1 
ATOM   2002 C  CG  . ASP A 1 246 ? 24.383 -1.007  -2.885  1.00 22.27 ? 1925 ASP A CG  1 
ATOM   2003 O  OD1 . ASP A 1 246 ? 23.367 -0.363  -3.213  1.00 24.88 ? 1925 ASP A OD1 1 
ATOM   2004 O  OD2 . ASP A 1 246 ? 25.422 -0.486  -2.422  1.00 25.21 ? 1925 ASP A OD2 1 
ATOM   2005 N  N   . SER A 1 247 ? 22.439 -5.403  -3.326  1.00 14.77 ? 1926 SER A N   1 
ATOM   2006 C  CA  . SER A 1 247 ? 22.609 -6.777  -3.774  1.00 15.85 ? 1926 SER A CA  1 
ATOM   2007 C  C   . SER A 1 247 ? 21.339 -7.510  -4.142  1.00 14.48 ? 1926 SER A C   1 
ATOM   2008 O  O   . SER A 1 247 ? 21.386 -8.424  -4.972  1.00 15.33 ? 1926 SER A O   1 
ATOM   2009 C  CB  . SER A 1 247 ? 23.251 -7.618  -2.691  1.00 15.25 ? 1926 SER A CB  1 
ATOM   2010 O  OG  . SER A 1 247 ? 24.550 -7.112  -2.437  1.00 24.84 ? 1926 SER A OG  1 
ATOM   2011 N  N   . LYS A 1 248 ? 20.240 -7.142  -3.491  1.00 15.56 ? 1927 LYS A N   1 
ATOM   2012 C  CA  . LYS A 1 248 ? 18.999 -7.906  -3.584  1.00 15.85 ? 1927 LYS A CA  1 
ATOM   2013 C  C   . LYS A 1 248 ? 17.830 -7.046  -4.042  1.00 16.37 ? 1927 LYS A C   1 
ATOM   2014 O  O   . LYS A 1 248 ? 17.878 -5.801  -3.957  1.00 16.88 ? 1927 LYS A O   1 
ATOM   2015 C  CB  . LYS A 1 248 ? 18.597 -8.463  -2.218  1.00 16.27 ? 1927 LYS A CB  1 
ATOM   2016 C  CG  . LYS A 1 248 ? 19.583 -9.502  -1.673  1.00 19.23 ? 1927 LYS A CG  1 
ATOM   2017 C  CD  . LYS A 1 248 ? 19.308 -9.875  -0.225  1.00 22.84 ? 1927 LYS A CD  1 
ATOM   2018 C  CE  . LYS A 1 248 ? 18.050 -10.685 -0.050  1.00 28.11 ? 1927 LYS A CE  1 
ATOM   2019 N  NZ  . LYS A 1 248 ? 17.972 -11.021 1.405   1.00 31.81 ? 1927 LYS A NZ  1 
ATOM   2020 N  N   . ASP A 1 249 ? 16.751 -7.702  -4.460  1.00 16.37 ? 1928 ASP A N   1 
ATOM   2021 C  CA  . ASP A 1 249 ? 15.546 -6.931  -4.776  1.00 17.53 ? 1928 ASP A CA  1 
ATOM   2022 C  C   . ASP A 1 249 ? 14.494 -6.952  -3.662  1.00 17.99 ? 1928 ASP A C   1 
ATOM   2023 O  O   . ASP A 1 249 ? 13.328 -6.616  -3.902  1.00 17.92 ? 1928 ASP A O   1 
ATOM   2024 C  CB  . ASP A 1 249 ? 14.981 -7.303  -6.145  1.00 19.52 ? 1928 ASP A CB  1 
ATOM   2025 C  CG  . ASP A 1 249 ? 14.519 -8.739  -6.220  1.00 19.45 ? 1928 ASP A CG  1 
ATOM   2026 O  OD1 . ASP A 1 249 ? 14.770 -9.530  -5.283  1.00 23.67 ? 1928 ASP A OD1 1 
ATOM   2027 O  OD2 . ASP A 1 249 ? 13.839 -9.067  -7.238  1.00 24.23 ? 1928 ASP A OD2 1 
ATOM   2028 N  N   . SER A 1 250 ? 14.937 -7.282  -2.448  1.00 17.08 ? 1929 SER A N   1 
ATOM   2029 C  CA  . SER A 1 250 ? 14.126 -7.191  -1.236  1.00 16.46 ? 1929 SER A CA  1 
ATOM   2030 C  C   . SER A 1 250 ? 15.028 -6.672  -0.134  1.00 18.67 ? 1929 SER A C   1 
ATOM   2031 O  O   . SER A 1 250 ? 16.256 -6.851  -0.204  1.00 19.15 ? 1929 SER A O   1 
ATOM   2032 C  CB  . SER A 1 250 ? 13.611 -8.567  -0.795  1.00 19.55 ? 1929 SER A CB  1 
ATOM   2033 O  OG  . SER A 1 250 ? 12.594 -9.034  -1.681  1.00 24.42 ? 1929 SER A OG  1 
ATOM   2034 N  N   . VAL A 1 251 ? 14.413 -6.072  0.886   1.00 16.04 ? 1930 VAL A N   1 
ATOM   2035 C  CA  . VAL A 1 251 ? 15.185 -5.548  2.008   1.00 16.82 ? 1930 VAL A CA  1 
ATOM   2036 C  C   . VAL A 1 251 ? 14.522 -6.067  3.286   1.00 16.55 ? 1930 VAL A C   1 
ATOM   2037 O  O   . VAL A 1 251 ? 13.309 -6.238  3.302   1.00 17.68 ? 1930 VAL A O   1 
ATOM   2038 C  CB  . VAL A 1 251 ? 15.238 -3.989  1.936   1.00 17.83 ? 1930 VAL A CB  1 
ATOM   2039 C  CG1 . VAL A 1 251 ? 13.859 -3.389  1.967   1.00 20.57 ? 1930 VAL A CG1 1 
ATOM   2040 C  CG2 . VAL A 1 251 ? 16.117 -3.435  3.050   1.00 17.92 ? 1930 VAL A CG2 1 
ATOM   2041 N  N   . ASP A 1 252 ? 15.285 -6.345  4.345   1.00 16.36 ? 1931 ASP A N   1 
ATOM   2042 C  CA  . ASP A 1 252 ? 14.722 -6.995  5.543   1.00 16.90 ? 1931 ASP A CA  1 
ATOM   2043 C  C   . ASP A 1 252 ? 15.268 -6.263  6.764   1.00 18.45 ? 1931 ASP A C   1 
ATOM   2044 O  O   . ASP A 1 252 ? 16.258 -6.676  7.392   1.00 19.25 ? 1931 ASP A O   1 
ATOM   2045 C  CB  . ASP A 1 252 ? 15.108 -8.476  5.590   1.00 17.13 ? 1931 ASP A CB  1 
ATOM   2046 C  CG  . ASP A 1 252 ? 14.469 -9.219  6.734   1.00 18.83 ? 1931 ASP A CG  1 
ATOM   2047 O  OD1 . ASP A 1 252 ? 13.620 -8.625  7.422   1.00 17.94 ? 1931 ASP A OD1 1 
ATOM   2048 O  OD2 . ASP A 1 252 ? 14.853 -10.399 6.932   1.00 25.26 ? 1931 ASP A OD2 1 
ATOM   2049 N  N   . ILE A 1 253 ? 14.613 -5.153  7.084   1.00 18.19 ? 1932 ILE A N   1 
ATOM   2050 C  CA  . ILE A 1 253 ? 15.007 -4.354  8.237   1.00 17.84 ? 1932 ILE A CA  1 
ATOM   2051 C  C   . ILE A 1 253 ? 14.731 -5.085  9.547   1.00 17.94 ? 1932 ILE A C   1 
ATOM   2052 O  O   . ILE A 1 253 ? 15.569 -5.126  10.446  1.00 17.27 ? 1932 ILE A O   1 
ATOM   2053 C  CB  . ILE A 1 253 ? 14.292 -3.007  8.221   1.00 16.23 ? 1932 ILE A CB  1 
ATOM   2054 C  CG1 . ILE A 1 253 ? 14.671 -2.251  6.927   1.00 17.41 ? 1932 ILE A CG1 1 
ATOM   2055 C  CG2 . ILE A 1 253 ? 14.637 -2.224  9.518   1.00 18.28 ? 1932 ILE A CG2 1 
ATOM   2056 C  CD1 . ILE A 1 253 ? 13.889 -0.938  6.733   1.00 19.56 ? 1932 ILE A CD1 1 
ATOM   2057 N  N   . TYR A 1 254 ? 13.556 -5.703  9.657   1.00 16.09 ? 1933 TYR A N   1 
ATOM   2058 C  CA  . TYR A 1 254 ? 13.263 -6.488  10.849  1.00 18.29 ? 1933 TYR A CA  1 
ATOM   2059 C  C   . TYR A 1 254 ? 14.299 -7.587  11.077  1.00 17.35 ? 1933 TYR A C   1 
ATOM   2060 O  O   . TYR A 1 254 ? 14.766 -7.739  12.200  1.00 18.32 ? 1933 TYR A O   1 
ATOM   2061 C  CB  . TYR A 1 254 ? 11.864 -7.099  10.705  1.00 17.36 ? 1933 TYR A CB  1 
ATOM   2062 C  CG  . TYR A 1 254 ? 11.428 -7.906  11.901  1.00 18.46 ? 1933 TYR A CG  1 
ATOM   2063 C  CD1 . TYR A 1 254 ? 10.694 -7.312  12.925  1.00 21.77 ? 1933 TYR A CD1 1 
ATOM   2064 C  CD2 . TYR A 1 254 ? 11.743 -9.261  11.989  1.00 22.46 ? 1933 TYR A CD2 1 
ATOM   2065 C  CE1 . TYR A 1 254 ? 10.297 -8.056  14.026  1.00 23.70 ? 1933 TYR A CE1 1 
ATOM   2066 C  CE2 . TYR A 1 254 ? 11.347 -10.019 13.068  1.00 25.32 ? 1933 TYR A CE2 1 
ATOM   2067 C  CZ  . TYR A 1 254 ? 10.628 -9.402  14.078  1.00 25.18 ? 1933 TYR A CZ  1 
ATOM   2068 O  OH  . TYR A 1 254 ? 10.230 -10.159 15.149  1.00 28.73 ? 1933 TYR A OH  1 
ATOM   2069 N  N   . GLY A 1 255 ? 14.681 -8.303  10.013  1.00 16.89 ? 1934 GLY A N   1 
ATOM   2070 C  CA  . GLY A 1 255 ? 15.627 -9.418  10.103  1.00 19.05 ? 1934 GLY A CA  1 
ATOM   2071 C  C   . GLY A 1 255 ? 16.998 -8.884  10.508  1.00 19.32 ? 1934 GLY A C   1 
ATOM   2072 O  O   . GLY A 1 255 ? 17.696 -9.524  11.301  1.00 19.61 ? 1934 GLY A O   1 
ATOM   2073 N  N   . ALA A 1 256 ? 17.385 -7.708  10.008  1.00 17.62 ? 1935 ALA A N   1 
ATOM   2074 C  CA  . ALA A 1 256 ? 18.688 -7.131  10.365  1.00 19.55 ? 1935 ALA A CA  1 
ATOM   2075 C  C   . ALA A 1 256 ? 18.758 -6.831  11.856  1.00 18.66 ? 1935 ALA A C   1 
ATOM   2076 O  O   . ALA A 1 256 ? 19.736 -7.150  12.520  1.00 19.47 ? 1935 ALA A O   1 
ATOM   2077 C  CB  . ALA A 1 256 ? 18.988 -5.883  9.527   1.00 18.45 ? 1935 ALA A CB  1 
ATOM   2078 N  N   . VAL A 1 257 ? 17.698 -6.249  12.413  1.00 19.31 ? 1936 VAL A N   1 
ATOM   2079 C  CA  . VAL A 1 257 ? 17.695 -5.895  13.817  1.00 18.83 ? 1936 VAL A CA  1 
ATOM   2080 C  C   . VAL A 1 257 ? 17.566 -7.174  14.641  1.00 19.23 ? 1936 VAL A C   1 
ATOM   2081 O  O   . VAL A 1 257 ? 18.277 -7.339  15.636  1.00 19.08 ? 1936 VAL A O   1 
ATOM   2082 C  CB  . VAL A 1 257 ? 16.551 -4.895  14.117  1.00 19.36 ? 1936 VAL A CB  1 
ATOM   2083 C  CG1 . VAL A 1 257 ? 16.514 -4.567  15.624  1.00 19.48 ? 1936 VAL A CG1 1 
ATOM   2084 C  CG2 . VAL A 1 257 ? 16.791 -3.637  13.262  1.00 17.49 ? 1936 VAL A CG2 1 
ATOM   2085 N  N   . HIS A 1 258 ? 16.685 -8.083  14.226  1.00 18.13 ? 1937 HIS A N   1 
ATOM   2086 C  CA  . HIS A 1 258 ? 16.599 -9.385  14.889  1.00 18.63 ? 1937 HIS A CA  1 
ATOM   2087 C  C   . HIS A 1 258 ? 17.958 -10.067 15.027  1.00 18.79 ? 1937 HIS A C   1 
ATOM   2088 O  O   . HIS A 1 258 ? 18.351 -10.514 16.113  1.00 19.35 ? 1937 HIS A O   1 
ATOM   2089 C  CB  . HIS A 1 258 ? 15.658 -10.293 14.112  1.00 16.39 ? 1937 HIS A CB  1 
ATOM   2090 C  CG  . HIS A 1 258 ? 15.403 -11.605 14.780  1.00 18.16 ? 1937 HIS A CG  1 
ATOM   2091 N  ND1 . HIS A 1 258 ? 16.249 -12.681 14.650  1.00 23.83 ? 1937 HIS A ND1 1 
ATOM   2092 C  CD2 . HIS A 1 258 ? 14.391 -12.006 15.584  1.00 20.56 ? 1937 HIS A CD2 1 
ATOM   2093 C  CE1 . HIS A 1 258 ? 15.762 -13.699 15.344  1.00 24.27 ? 1937 HIS A CE1 1 
ATOM   2094 N  NE2 . HIS A 1 258 ? 14.640 -13.313 15.924  1.00 25.19 ? 1937 HIS A NE2 1 
ATOM   2095 N  N   . ASP A 1 259 ? 18.692 -10.139 13.922  1.00 19.28 ? 1938 ASP A N   1 
ATOM   2096 C  CA  . ASP A 1 259 ? 19.995 -10.787 13.971  1.00 20.14 ? 1938 ASP A CA  1 
ATOM   2097 C  C   . ASP A 1 259 ? 20.992 -10.081 14.887  1.00 20.29 ? 1938 ASP A C   1 
ATOM   2098 O  O   . ASP A 1 259 ? 21.808 -10.735 15.528  1.00 22.79 ? 1938 ASP A O   1 
ATOM   2099 C  CB  . ASP A 1 259 ? 20.552 -11.001 12.571  1.00 21.88 ? 1938 ASP A CB  1 
ATOM   2100 C  CG  . ASP A 1 259 ? 19.668 -11.918 11.736  1.00 32.16 ? 1938 ASP A CG  1 
ATOM   2101 O  OD1 . ASP A 1 259 ? 18.842 -12.675 12.316  1.00 41.64 ? 1938 ASP A OD1 1 
ATOM   2102 O  OD2 . ASP A 1 259 ? 19.790 -11.869 10.495  1.00 43.80 ? 1938 ASP A OD2 1 
ATOM   2103 N  N   . LEU A 1 260 ? 20.929 -8.758  14.988  1.00 16.98 ? 1939 LEU A N   1 
ATOM   2104 C  CA  . LEU A 1 260 ? 21.793 -8.099  15.938  1.00 17.37 ? 1939 LEU A CA  1 
ATOM   2105 C  C   . LEU A 1 260 ? 21.377 -8.404  17.394  1.00 17.39 ? 1939 LEU A C   1 
ATOM   2106 O  O   . LEU A 1 260 ? 22.224 -8.600  18.266  1.00 17.93 ? 1939 LEU A O   1 
ATOM   2107 C  CB  . LEU A 1 260 ? 21.769 -6.588  15.687  1.00 18.03 ? 1939 LEU A CB  1 
ATOM   2108 C  CG  . LEU A 1 260 ? 22.394 -6.197  14.355  1.00 19.20 ? 1939 LEU A CG  1 
ATOM   2109 C  CD1 . LEU A 1 260 ? 22.206 -4.675  14.147  1.00 18.50 ? 1939 LEU A CD1 1 
ATOM   2110 C  CD2 . LEU A 1 260 ? 23.877 -6.545  14.378  1.00 24.99 ? 1939 LEU A CD2 1 
ATOM   2111 N  N   . ARG A 1 261 ? 20.073 -8.389  17.667  1.00 18.57 ? 1940 ARG A N   1 
ATOM   2112 C  CA  . ARG A 1 261 ? 19.599 -8.708  19.016  1.00 18.84 ? 1940 ARG A CA  1 
ATOM   2113 C  C   . ARG A 1 261 ? 19.995 -10.102 19.487  1.00 20.20 ? 1940 ARG A C   1 
ATOM   2114 O  O   . ARG A 1 261 ? 20.174 -10.308 20.682  1.00 21.76 ? 1940 ARG A O   1 
ATOM   2115 C  CB  . ARG A 1 261 ? 18.074 -8.573  19.085  1.00 20.57 ? 1940 ARG A CB  1 
ATOM   2116 C  CG  . ARG A 1 261 ? 17.614 -7.151  18.945  1.00 21.32 ? 1940 ARG A CG  1 
ATOM   2117 C  CD  . ARG A 1 261 ? 17.712 -6.362  20.258  1.00 25.10 ? 1940 ARG A CD  1 
ATOM   2118 N  NE  . ARG A 1 261 ? 17.103 -5.060  19.993  1.00 26.91 ? 1940 ARG A NE  1 
ATOM   2119 C  CZ  . ARG A 1 261 ? 15.835 -4.748  20.238  1.00 26.59 ? 1940 ARG A CZ  1 
ATOM   2120 N  NH1 . ARG A 1 261 ? 14.995 -5.637  20.780  1.00 24.00 ? 1940 ARG A NH1 1 
ATOM   2121 N  NH2 . ARG A 1 261 ? 15.417 -3.533  19.937  1.00 22.33 ? 1940 ARG A NH2 1 
ATOM   2122 N  N   . LEU A 1 262 ? 20.143 -11.052 18.563  1.00 18.80 ? 1941 LEU A N   1 
ATOM   2123 C  CA  . LEU A 1 262 ? 20.637 -12.381 18.935  1.00 20.06 ? 1941 LEU A CA  1 
ATOM   2124 C  C   . LEU A 1 262 ? 22.034 -12.324 19.571  1.00 20.44 ? 1941 LEU A C   1 
ATOM   2125 O  O   . LEU A 1 262 ? 22.420 -13.247 20.303  1.00 22.50 ? 1941 LEU A O   1 
ATOM   2126 C  CB  . LEU A 1 262 ? 20.639 -13.332 17.728  1.00 20.68 ? 1941 LEU A CB  1 
ATOM   2127 C  CG  . LEU A 1 262 ? 19.254 -13.774 17.223  1.00 24.48 ? 1941 LEU A CG  1 
ATOM   2128 C  CD1 . LEU A 1 262 ? 19.391 -14.532 15.897  1.00 27.47 ? 1941 LEU A CD1 1 
ATOM   2129 C  CD2 . LEU A 1 262 ? 18.530 -14.604 18.274  1.00 27.44 ? 1941 LEU A CD2 1 
ATOM   2130 N  N   . HIS A 1 263 ? 22.772 -11.250 19.297  1.00 17.80 ? 1942 HIS A N   1 
ATOM   2131 C  CA  . HIS A 1 263 ? 24.181 -11.167 19.712  1.00 17.61 ? 1942 HIS A CA  1 
ATOM   2132 C  C   . HIS A 1 263 ? 24.478 -10.202 20.848  1.00 19.27 ? 1942 HIS A C   1 
ATOM   2133 O  O   . HIS A 1 263 ? 25.506 -10.358 21.520  1.00 19.32 ? 1942 HIS A O   1 
ATOM   2134 C  CB  . HIS A 1 263 ? 25.094 -10.951 18.501  1.00 20.06 ? 1942 HIS A CB  1 
ATOM   2135 C  CG  . HIS A 1 263 ? 24.986 -12.080 17.534  1.00 23.18 ? 1942 HIS A CG  1 
ATOM   2136 N  ND1 . HIS A 1 263 ? 24.156 -12.045 16.439  1.00 26.58 ? 1942 HIS A ND1 1 
ATOM   2137 C  CD2 . HIS A 1 263 ? 25.535 -13.316 17.557  1.00 28.84 ? 1942 HIS A CD2 1 
ATOM   2138 C  CE1 . HIS A 1 263 ? 24.231 -13.197 15.799  1.00 27.47 ? 1942 HIS A CE1 1 
ATOM   2139 N  NE2 . HIS A 1 263 ? 25.053 -13.989 16.461  1.00 30.15 ? 1942 HIS A NE2 1 
ATOM   2140 N  N   . ARG A 1 264 ? 23.591 -9.231  21.062  1.00 16.91 ? 1943 ARG A N   1 
ATOM   2141 C  CA  . ARG A 1 264 ? 23.729 -8.234  22.149  1.00 19.36 ? 1943 ARG A CA  1 
ATOM   2142 C  C   . ARG A 1 264 ? 22.387 -7.576  22.469  1.00 18.47 ? 1943 ARG A C   1 
ATOM   2143 O  O   . ARG A 1 264 ? 21.584 -7.288  21.564  1.00 17.27 ? 1943 ARG A O   1 
ATOM   2144 C  CB  . ARG A 1 264 ? 24.684 -7.104  21.725  1.00 19.33 ? 1943 ARG A CB  1 
ATOM   2145 C  CG  . ARG A 1 264 ? 25.147 -6.188  22.874  1.00 19.53 ? 1943 ARG A CG  1 
ATOM   2146 C  CD  . ARG A 1 264 ? 26.410 -5.428  22.482  1.00 20.02 ? 1943 ARG A CD  1 
ATOM   2147 N  NE  . ARG A 1 264 ? 26.733 -4.320  23.381  1.00 18.11 ? 1943 ARG A NE  1 
ATOM   2148 C  CZ  . ARG A 1 264 ? 27.549 -4.412  24.435  1.00 16.83 ? 1943 ARG A CZ  1 
ATOM   2149 N  NH1 . ARG A 1 264 ? 28.089 -5.589  24.739  1.00 19.00 ? 1943 ARG A NH1 1 
ATOM   2150 N  NH2 . ARG A 1 264 ? 27.802 -3.368  25.206  1.00 17.54 ? 1943 ARG A NH2 1 
ATOM   2151 N  N   . VAL A 1 265 ? 22.159 -7.323  23.750  1.00 17.77 ? 1944 VAL A N   1 
ATOM   2152 C  CA  . VAL A 1 265 ? 20.905 -6.692  24.189  1.00 18.46 ? 1944 VAL A CA  1 
ATOM   2153 C  C   . VAL A 1 265 ? 20.715 -5.326  23.525  1.00 17.98 ? 1944 VAL A C   1 
ATOM   2154 O  O   . VAL A 1 265 ? 21.696 -4.642  23.235  1.00 20.52 ? 1944 VAL A O   1 
ATOM   2155 C  CB  . VAL A 1 265 ? 20.874 -6.468  25.724  1.00 19.48 ? 1944 VAL A CB  1 
ATOM   2156 C  CG1 . VAL A 1 265 ? 20.809 -7.791  26.453  1.00 23.32 ? 1944 VAL A CG1 1 
ATOM   2157 C  CG2 . VAL A 1 265 ? 22.079 -5.663  26.198  1.00 18.01 ? 1944 VAL A CG2 1 
ATOM   2158 N  N   . HIS A 1 266 ? 19.443 -4.968  23.297  1.00 17.77 ? 1945 HIS A N   1 
ATOM   2159 C  CA  . HIS A 1 266 ? 19.049 -3.591  22.969  1.00 19.38 ? 1945 HIS A CA  1 
ATOM   2160 C  C   . HIS A 1 266 ? 19.578 -3.029  21.661  1.00 19.92 ? 1945 HIS A C   1 
ATOM   2161 O  O   . HIS A 1 266 ? 19.445 -1.824  21.424  1.00 20.05 ? 1945 HIS A O   1 
ATOM   2162 C  CB  . HIS A 1 266 ? 19.393 -2.614  24.095  1.00 20.60 ? 1945 HIS A CB  1 
ATOM   2163 C  CG  . HIS A 1 266 ? 18.544 -2.790  25.315  1.00 25.96 ? 1945 HIS A CG  1 
ATOM   2164 N  ND1 . HIS A 1 266 ? 17.168 -2.846  25.260  1.00 29.58 ? 1945 HIS A ND1 1 
ATOM   2165 C  CD2 . HIS A 1 266 ? 18.877 -2.898  26.623  1.00 29.84 ? 1945 HIS A CD2 1 
ATOM   2166 C  CE1 . HIS A 1 266 ? 16.693 -3.003  26.485  1.00 31.58 ? 1945 HIS A CE1 1 
ATOM   2167 N  NE2 . HIS A 1 266 ? 17.707 -3.039  27.331  1.00 28.04 ? 1945 HIS A NE2 1 
ATOM   2168 N  N   . MET A 1 267 ? 20.196 -3.848  20.814  1.00 17.43 ? 1946 MET A N   1 
ATOM   2169 C  CA  . MET A 1 267 ? 20.667 -3.301  19.536  1.00 16.94 ? 1946 MET A CA  1 
ATOM   2170 C  C   . MET A 1 267 ? 19.519 -2.644  18.750  1.00 17.98 ? 1946 MET A C   1 
ATOM   2171 O  O   . MET A 1 267 ? 18.516 -3.303  18.474  1.00 17.99 ? 1946 MET A O   1 
ATOM   2172 C  CB  . MET A 1 267 ? 21.272 -4.423  18.678  1.00 17.62 ? 1946 MET A CB  1 
ATOM   2173 C  CG  . MET A 1 267 ? 22.482 -5.097  19.324  1.00 15.83 ? 1946 MET A CG  1 
ATOM   2174 S  SD  . MET A 1 267 ? 23.928 -3.981  19.423  1.00 24.52 ? 1946 MET A SD  1 
ATOM   2175 C  CE  . MET A 1 267 ? 24.731 -4.347  17.861  1.00 23.43 ? 1946 MET A CE  1 
ATOM   2176 N  N   . VAL A 1 268 ? 19.681 -1.359  18.402  1.00 16.44 ? 1947 VAL A N   1 
ATOM   2177 C  CA  . VAL A 1 268 ? 18.616 -0.478  17.942  1.00 16.00 ? 1947 VAL A CA  1 
ATOM   2178 C  C   . VAL A 1 268 ? 17.662 -0.277  19.115  1.00 17.55 ? 1947 VAL A C   1 
ATOM   2179 O  O   . VAL A 1 268 ? 16.690 -1.000  19.286  1.00 19.57 ? 1947 VAL A O   1 
ATOM   2180 C  CB  . VAL A 1 268 ? 17.863 -0.993  16.682  1.00 15.93 ? 1947 VAL A CB  1 
ATOM   2181 C  CG1 . VAL A 1 268 ? 16.907 0.083   16.117  1.00 17.32 ? 1947 VAL A CG1 1 
ATOM   2182 C  CG2 . VAL A 1 268 ? 18.885 -1.304  15.586  1.00 18.48 ? 1947 VAL A CG2 1 
ATOM   2183 N  N   . GLN A 1 269 ? 17.981 0.696   19.950  1.00 16.18 ? 1948 GLN A N   1 
ATOM   2184 C  CA  . GLN A 1 269 ? 17.495 0.678   21.311  1.00 18.97 ? 1948 GLN A CA  1 
ATOM   2185 C  C   . GLN A 1 269 ? 16.145 1.382   21.463  1.00 19.37 ? 1948 GLN A C   1 
ATOM   2186 O  O   . GLN A 1 269 ? 15.514 1.241   22.506  1.00 18.92 ? 1948 GLN A O   1 
ATOM   2187 C  CB  . GLN A 1 269 ? 18.552 1.347   22.192  1.00 19.35 ? 1948 GLN A CB  1 
ATOM   2188 C  CG  . GLN A 1 269 ? 18.229 1.384   23.678  1.00 21.17 ? 1948 GLN A CG  1 
ATOM   2189 C  CD  . GLN A 1 269 ? 17.812 2.755   24.147  1.00 25.22 ? 1948 GLN A CD  1 
ATOM   2190 O  OE1 . GLN A 1 269 ? 18.401 3.763   23.737  1.00 25.52 ? 1948 GLN A OE1 1 
ATOM   2191 N  NE2 . GLN A 1 269 ? 16.788 2.808   25.013  1.00 23.06 ? 1948 GLN A NE2 1 
ATOM   2192 N  N   . THR A 1 270 ? 15.759 2.198   20.482  1.00 18.76 ? 1949 THR A N   1 
ATOM   2193 C  CA  . THR A 1 270 ? 14.475 2.919   20.550  1.00 20.72 ? 1949 THR A CA  1 
ATOM   2194 C  C   . THR A 1 270 ? 13.640 2.737   19.288  1.00 19.67 ? 1949 THR A C   1 
ATOM   2195 O  O   . THR A 1 270 ? 14.143 2.456   18.192  1.00 19.66 ? 1949 THR A O   1 
ATOM   2196 C  CB  . THR A 1 270 ? 14.645 4.441   20.789  1.00 21.65 ? 1949 THR A CB  1 
ATOM   2197 O  OG1 . THR A 1 270 ? 15.234 5.085   19.635  1.00 21.99 ? 1949 THR A OG1 1 
ATOM   2198 C  CG2 . THR A 1 270 ? 15.421 4.728   22.079  1.00 19.82 ? 1949 THR A CG2 1 
ATOM   2199 N  N   . GLU A 1 271 ? 12.330 2.892   19.420  1.00 18.86 ? 1950 GLU A N   1 
ATOM   2200 C  CA  . GLU A 1 271 ? 11.452 2.752   18.273  1.00 21.99 ? 1950 GLU A CA  1 
ATOM   2201 C  C   . GLU A 1 271 ? 11.766 3.817   17.236  1.00 22.02 ? 1950 GLU A C   1 
ATOM   2202 O  O   . GLU A 1 271 ? 11.717 3.512   16.050  1.00 20.52 ? 1950 GLU A O   1 
ATOM   2203 C  CB  . GLU A 1 271 ? 9.976  2.792   18.699  1.00 22.89 ? 1950 GLU A CB  1 
ATOM   2204 C  CG  . GLU A 1 271 ? 8.984  2.687   17.542  1.00 24.82 ? 1950 GLU A CG  1 
ATOM   2205 C  CD  . GLU A 1 271 ? 7.539  2.595   18.059  1.00 29.92 ? 1950 GLU A CD  1 
ATOM   2206 O  OE1 . GLU A 1 271 ? 6.671  3.336   17.537  1.00 36.50 ? 1950 GLU A OE1 1 
ATOM   2207 O  OE2 . GLU A 1 271 ? 7.300  1.800   18.993  1.00 35.81 ? 1950 GLU A OE2 1 
ATOM   2208 N  N   . CYS A 1 272 ? 12.121 5.039   17.663  1.00 22.57 ? 1951 CYS A N   1 
ATOM   2209 C  CA  A CYS A 1 272 ? 12.560 6.110   16.769  0.50 21.01 ? 1951 CYS A CA  1 
ATOM   2210 C  CA  B CYS A 1 272 ? 12.486 6.053   16.672  0.50 20.91 ? 1951 CYS A CA  1 
ATOM   2211 C  C   . CYS A 1 272 ? 13.716 5.664   15.866  1.00 18.99 ? 1951 CYS A C   1 
ATOM   2212 O  O   . CYS A 1 272 ? 13.772 5.987   14.694  1.00 19.12 ? 1951 CYS A O   1 
ATOM   2213 C  CB  A CYS A 1 272 ? 13.002 7.298   17.625  0.50 21.53 ? 1951 CYS A CB  1 
ATOM   2214 C  CB  B CYS A 1 272 ? 12.627 7.471   17.224  0.50 20.93 ? 1951 CYS A CB  1 
ATOM   2215 S  SG  A CYS A 1 272 ? 13.420 8.806   16.749  0.50 30.96 ? 1951 CYS A SG  1 
ATOM   2216 S  SG  B CYS A 1 272 ? 14.063 7.780   18.268  0.50 29.12 ? 1951 CYS A SG  1 
ATOM   2217 N  N   . GLN A 1 273 ? 14.655 4.952   16.474  1.00 16.38 ? 1952 GLN A N   1 
ATOM   2218 C  CA  . GLN A 1 273 ? 15.793 4.433   15.695  1.00 15.99 ? 1952 GLN A CA  1 
ATOM   2219 C  C   . GLN A 1 273 ? 15.328 3.411   14.657  1.00 16.57 ? 1952 GLN A C   1 
ATOM   2220 O  O   . GLN A 1 273 ? 15.818 3.378   13.519  1.00 17.89 ? 1952 GLN A O   1 
ATOM   2221 C  CB  . GLN A 1 273 ? 16.837 3.811   16.617  1.00 16.64 ? 1952 GLN A CB  1 
ATOM   2222 C  CG  . GLN A 1 273 ? 17.660 4.903   17.333  1.00 16.00 ? 1952 GLN A CG  1 
ATOM   2223 C  CD  . GLN A 1 273 ? 18.421 4.412   18.538  1.00 15.62 ? 1952 GLN A CD  1 
ATOM   2224 O  OE1 . GLN A 1 273 ? 18.339 3.236   18.960  1.00 21.36 ? 1952 GLN A OE1 1 
ATOM   2225 N  NE2 . GLN A 1 273 ? 19.167 5.347   19.153  1.00 15.62 ? 1952 GLN A NE2 1 
ATOM   2226 N  N   . TYR A 1 274 ? 14.388 2.564   15.049  1.00 17.33 ? 1953 TYR A N   1 
ATOM   2227 C  CA  . TYR A 1 274 ? 13.817 1.589   14.098  1.00 17.03 ? 1953 TYR A CA  1 
ATOM   2228 C  C   . TYR A 1 274 ? 13.076 2.283   12.941  1.00 17.36 ? 1953 TYR A C   1 
ATOM   2229 O  O   . TYR A 1 274 ? 13.215 1.947   11.762  1.00 18.61 ? 1953 TYR A O   1 
ATOM   2230 C  CB  . TYR A 1 274 ? 12.864 0.664   14.858  1.00 16.84 ? 1953 TYR A CB  1 
ATOM   2231 C  CG  . TYR A 1 274 ? 12.423 -0.562  14.107  1.00 16.84 ? 1953 TYR A CG  1 
ATOM   2232 C  CD1 . TYR A 1 274 ? 13.340 -1.558  13.747  1.00 18.64 ? 1953 TYR A CD1 1 
ATOM   2233 C  CD2 . TYR A 1 274 ? 11.073 -0.754  13.778  1.00 17.62 ? 1953 TYR A CD2 1 
ATOM   2234 C  CE1 . TYR A 1 274 ? 12.923 -2.697  13.064  1.00 20.02 ? 1953 TYR A CE1 1 
ATOM   2235 C  CE2 . TYR A 1 274 ? 10.656 -1.907  13.110  1.00 19.79 ? 1953 TYR A CE2 1 
ATOM   2236 C  CZ  . TYR A 1 274 ? 11.569 -2.868  12.760  1.00 18.79 ? 1953 TYR A CZ  1 
ATOM   2237 O  OH  . TYR A 1 274 ? 11.154 -3.987  12.069  1.00 20.99 ? 1953 TYR A OH  1 
ATOM   2238 N  N   . VAL A 1 275 ? 12.319 3.321   13.267  1.00 18.65 ? 1954 VAL A N   1 
ATOM   2239 C  CA  . VAL A 1 275 ? 11.646 4.124   12.246  1.00 19.20 ? 1954 VAL A CA  1 
ATOM   2240 C  C   . VAL A 1 275 ? 12.659 4.792   11.340  1.00 17.70 ? 1954 VAL A C   1 
ATOM   2241 O  O   . VAL A 1 275 ? 12.519 4.780   10.122  1.00 16.81 ? 1954 VAL A O   1 
ATOM   2242 C  CB  . VAL A 1 275 ? 10.741 5.188   12.879  1.00 20.30 ? 1954 VAL A CB  1 
ATOM   2243 C  CG1 . VAL A 1 275 ? 10.148 6.075   11.794  1.00 24.46 ? 1954 VAL A CG1 1 
ATOM   2244 C  CG2 . VAL A 1 275 ? 9.648  4.481   13.711  1.00 25.72 ? 1954 VAL A CG2 1 
ATOM   2245 N  N   . TYR A 1 276 ? 13.730 5.317   11.925  1.00 17.94 ? 1955 TYR A N   1 
ATOM   2246 C  CA  . TYR A 1 276 ? 14.767 5.963   11.151  1.00 17.28 ? 1955 TYR A CA  1 
ATOM   2247 C  C   . TYR A 1 276 ? 15.373 5.042   10.099  1.00 16.54 ? 1955 TYR A C   1 
ATOM   2248 O  O   . TYR A 1 276 ? 15.685 5.489   8.995   1.00 17.36 ? 1955 TYR A O   1 
ATOM   2249 C  CB  . TYR A 1 276 ? 15.861 6.489   12.073  1.00 17.31 ? 1955 TYR A CB  1 
ATOM   2250 C  CG  . TYR A 1 276 ? 17.010 7.231   11.409  1.00 16.23 ? 1955 TYR A CG  1 
ATOM   2251 C  CD1 . TYR A 1 276 ? 16.885 8.532   10.949  1.00 17.26 ? 1955 TYR A CD1 1 
ATOM   2252 C  CD2 . TYR A 1 276 ? 18.224 6.599   11.221  1.00 19.23 ? 1955 TYR A CD2 1 
ATOM   2253 C  CE1 . TYR A 1 276 ? 17.962 9.208   10.349  1.00 21.44 ? 1955 TYR A CE1 1 
ATOM   2254 C  CE2 . TYR A 1 276 ? 19.305 7.248   10.610  1.00 23.88 ? 1955 TYR A CE2 1 
ATOM   2255 C  CZ  . TYR A 1 276 ? 19.174 8.564   10.192  1.00 21.26 ? 1955 TYR A CZ  1 
ATOM   2256 O  OH  . TYR A 1 276 ? 20.212 9.243   9.562   1.00 22.90 ? 1955 TYR A OH  1 
ATOM   2257 N  N   . LEU A 1 277 ? 15.604 3.775   10.444  1.00 14.61 ? 1956 LEU A N   1 
ATOM   2258 C  CA  . LEU A 1 277 ? 16.147 2.819   9.466   1.00 16.05 ? 1956 LEU A CA  1 
ATOM   2259 C  C   . LEU A 1 277 ? 15.202 2.727   8.283   1.00 15.85 ? 1956 LEU A C   1 
ATOM   2260 O  O   . LEU A 1 277 ? 15.647 2.667   7.147   1.00 16.86 ? 1956 LEU A O   1 
ATOM   2261 C  CB  . LEU A 1 277 ? 16.314 1.451   10.132  1.00 15.90 ? 1956 LEU A CB  1 
ATOM   2262 C  CG  . LEU A 1 277 ? 17.475 1.452   11.161  1.00 15.64 ? 1956 LEU A CG  1 
ATOM   2263 C  CD1 . LEU A 1 277 ? 17.475 0.114   11.902  1.00 19.94 ? 1956 LEU A CD1 1 
ATOM   2264 C  CD2 . LEU A 1 277 ? 18.845 1.654   10.477  1.00 18.47 ? 1956 LEU A CD2 1 
ATOM   2265 N  N   . HIS A 1 278 ? 13.891 2.689   8.550   1.00 15.29 ? 1957 HIS A N   1 
ATOM   2266 C  CA  . HIS A 1 278 ? 12.909 2.671   7.446   1.00 17.40 ? 1957 HIS A CA  1 
ATOM   2267 C  C   . HIS A 1 278 ? 12.952 3.937   6.605   1.00 15.78 ? 1957 HIS A C   1 
ATOM   2268 O  O   . HIS A 1 278 ? 12.845 3.832   5.384   1.00 16.27 ? 1957 HIS A O   1 
ATOM   2269 C  CB  . HIS A 1 278 ? 11.476 2.420   7.942   1.00 15.31 ? 1957 HIS A CB  1 
ATOM   2270 C  CG  . HIS A 1 278 ? 11.237 1.028   8.430   1.00 17.68 ? 1957 HIS A CG  1 
ATOM   2271 N  ND1 . HIS A 1 278 ? 11.682 0.571   9.653   1.00 16.62 ? 1957 HIS A ND1 1 
ATOM   2272 C  CD2 . HIS A 1 278 ? 10.619 -0.020  7.835   1.00 19.07 ? 1957 HIS A CD2 1 
ATOM   2273 C  CE1 . HIS A 1 278 ? 11.345 -0.702  9.795   1.00 18.39 ? 1957 HIS A CE1 1 
ATOM   2274 N  NE2 . HIS A 1 278 ? 10.691 -1.080  8.709   1.00 17.35 ? 1957 HIS A NE2 1 
ATOM   2275 N  N   . GLN A 1 279 ? 13.101 5.103   7.242   1.00 16.57 ? 1958 GLN A N   1 
ATOM   2276 C  CA  . GLN A 1 279 ? 13.224 6.353   6.494   1.00 17.00 ? 1958 GLN A CA  1 
ATOM   2277 C  C   . GLN A 1 279 ? 14.465 6.381   5.590   1.00 16.31 ? 1958 GLN A C   1 
ATOM   2278 O  O   . GLN A 1 279 ? 14.399 6.862   4.461   1.00 16.70 ? 1958 GLN A O   1 
ATOM   2279 C  CB  . GLN A 1 279 ? 13.202 7.545   7.436   1.00 16.98 ? 1958 GLN A CB  1 
ATOM   2280 C  CG  . GLN A 1 279 ? 11.953 7.570   8.279   1.00 21.07 ? 1958 GLN A CG  1 
ATOM   2281 C  CD  . GLN A 1 279 ? 12.031 8.735   9.237   1.00 25.44 ? 1958 GLN A CD  1 
ATOM   2282 O  OE1 . GLN A 1 279 ? 13.130 9.108   9.688   1.00 26.21 ? 1958 GLN A OE1 1 
ATOM   2283 N  NE2 . GLN A 1 279 ? 10.876 9.319   9.552   1.00 28.55 ? 1958 GLN A NE2 1 
ATOM   2284 N  N   . CYS A 1 280 ? 15.592 5.831   6.055   1.00 16.31 ? 1959 CYS A N   1 
ATOM   2285 C  CA  . CYS A 1 280 ? 16.797 5.773   5.227   1.00 17.55 ? 1959 CYS A CA  1 
ATOM   2286 C  C   . CYS A 1 280 ? 16.541 4.902   3.995   1.00 16.01 ? 1959 CYS A C   1 
ATOM   2287 O  O   . CYS A 1 280 ? 16.881 5.291   2.896   1.00 16.49 ? 1959 CYS A O   1 
ATOM   2288 C  CB  . CYS A 1 280 ? 17.943 5.131   6.044   1.00 16.93 ? 1959 CYS A CB  1 
ATOM   2289 S  SG  . CYS A 1 280 ? 18.602 6.211   7.345   1.00 19.05 ? 1959 CYS A SG  1 
ATOM   2290 N  N   . VAL A 1 281 ? 15.948 3.719   4.190   1.00 15.01 ? 1960 VAL A N   1 
ATOM   2291 C  CA  . VAL A 1 281 ? 15.638 2.870   3.051   1.00 16.28 ? 1960 VAL A CA  1 
ATOM   2292 C  C   . VAL A 1 281 ? 14.678 3.568   2.075   1.00 14.98 ? 1960 VAL A C   1 
ATOM   2293 O  O   . VAL A 1 281 ? 14.886 3.567   0.845   1.00 15.80 ? 1960 VAL A O   1 
ATOM   2294 C  CB  . VAL A 1 281 ? 15.115 1.514   3.493   1.00 15.83 ? 1960 VAL A CB  1 
ATOM   2295 C  CG1 . VAL A 1 281 ? 14.568 0.714   2.312   1.00 15.39 ? 1960 VAL A CG1 1 
ATOM   2296 C  CG2 . VAL A 1 281 ? 16.213 0.745   4.272   1.00 16.88 ? 1960 VAL A CG2 1 
ATOM   2297 N  N   . ARG A 1 282 ? 13.652 4.210   2.640   1.00 15.80 ? 1961 ARG A N   1 
ATOM   2298 C  CA  . ARG A 1 282 ? 12.674 4.898   1.832   1.00 17.55 ? 1961 ARG A CA  1 
ATOM   2299 C  C   . ARG A 1 282 ? 13.381 5.912   0.943   1.00 15.65 ? 1961 ARG A C   1 
ATOM   2300 O  O   . ARG A 1 282 ? 13.141 5.993   -0.277  1.00 17.96 ? 1961 ARG A O   1 
ATOM   2301 C  CB  . ARG A 1 282 ? 11.711 5.662   2.731   1.00 17.34 ? 1961 ARG A CB  1 
ATOM   2302 C  CG  . ARG A 1 282 ? 10.681 6.386   1.843   1.00 14.87 ? 1961 ARG A CG  1 
ATOM   2303 C  CD  . ARG A 1 282 ? 9.906  7.380   2.681   1.00 18.01 ? 1961 ARG A CD  1 
ATOM   2304 N  NE  . ARG A 1 282 ? 10.808 8.373   3.251   1.00 20.15 ? 1961 ARG A NE  1 
ATOM   2305 C  CZ  . ARG A 1 282 ? 10.501 9.206   4.237   1.00 25.23 ? 1961 ARG A CZ  1 
ATOM   2306 N  NH1 . ARG A 1 282 ? 9.279  9.185   4.755   1.00 30.05 ? 1961 ARG A NH1 1 
ATOM   2307 N  NH2 . ARG A 1 282 ? 11.420 10.061  4.684   1.00 32.40 ? 1961 ARG A NH2 1 
ATOM   2308 N  N   . ASP A 1 283 ? 14.257 6.677   1.582   1.00 18.12 ? 1962 ASP A N   1 
ATOM   2309 C  CA  . ASP A 1 283 ? 14.966 7.732   0.861   1.00 17.72 ? 1962 ASP A CA  1 
ATOM   2310 C  C   . ASP A 1 283 ? 15.913 7.230   -0.241  1.00 16.53 ? 1962 ASP A C   1 
ATOM   2311 O  O   . ASP A 1 283 ? 15.891 7.767   -1.348  1.00 19.52 ? 1962 ASP A O   1 
ATOM   2312 C  CB  . ASP A 1 283 ? 15.648 8.659   1.843   1.00 19.06 ? 1962 ASP A CB  1 
ATOM   2313 C  CG  . ASP A 1 283 ? 14.660 9.469   2.669   1.00 22.35 ? 1962 ASP A CG  1 
ATOM   2314 O  OD1 . ASP A 1 283 ? 13.423 9.493   2.380   1.00 22.71 ? 1962 ASP A OD1 1 
ATOM   2315 O  OD2 . ASP A 1 283 ? 15.155 10.093  3.620   1.00 24.85 ? 1962 ASP A OD2 1 
ATOM   2316 N  N   . VAL A 1 284 ? 16.691 6.184   0.024   1.00 16.97 ? 1963 VAL A N   1 
ATOM   2317 C  CA  . VAL A 1 284 ? 17.517 5.589   -1.013  1.00 17.26 ? 1963 VAL A CA  1 
ATOM   2318 C  C   . VAL A 1 284 ? 16.668 5.102   -2.180  1.00 15.17 ? 1963 VAL A C   1 
ATOM   2319 O  O   . VAL A 1 284 ? 16.990 5.334   -3.359  1.00 16.51 ? 1963 VAL A O   1 
ATOM   2320 C  CB  . VAL A 1 284 ? 18.298 4.408   -0.409  1.00 16.74 ? 1963 VAL A CB  1 
ATOM   2321 C  CG1 . VAL A 1 284 ? 19.011 3.600   -1.513  1.00 18.20 ? 1963 VAL A CG1 1 
ATOM   2322 C  CG2 . VAL A 1 284 ? 19.297 4.909   0.663   1.00 21.25 ? 1963 VAL A CG2 1 
ATOM   2323 N  N   . LEU A 1 285 ? 15.575 4.412   -1.863  1.00 17.14 ? 1964 LEU A N   1 
ATOM   2324 C  CA  . LEU A 1 285 ? 14.757 3.799   -2.902  1.00 16.67 ? 1964 LEU A CA  1 
ATOM   2325 C  C   . LEU A 1 285 ? 14.014 4.824   -3.760  1.00 17.99 ? 1964 LEU A C   1 
ATOM   2326 O  O   . LEU A 1 285 ? 13.872 4.615   -4.960  1.00 18.38 ? 1964 LEU A O   1 
ATOM   2327 C  CB  . LEU A 1 285 ? 13.814 2.774   -2.314  1.00 16.30 ? 1964 LEU A CB  1 
ATOM   2328 C  CG  . LEU A 1 285 ? 14.550 1.542   -1.803  1.00 15.50 ? 1964 LEU A CG  1 
ATOM   2329 C  CD1 . LEU A 1 285 ? 13.499 0.606   -1.214  1.00 14.54 ? 1964 LEU A CD1 1 
ATOM   2330 C  CD2 . LEU A 1 285 ? 15.365 0.811   -2.935  1.00 15.50 ? 1964 LEU A CD2 1 
ATOM   2331 N  N   . ARG A 1 286 ? 13.597 5.922   -3.141  1.00 18.30 ? 1965 ARG A N   1 
ATOM   2332 C  CA  . ARG A 1 286 ? 12.941 7.011   -3.860  1.00 19.64 ? 1965 ARG A CA  1 
ATOM   2333 C  C   . ARG A 1 286 ? 13.870 7.577   -4.924  1.00 21.23 ? 1965 ARG A C   1 
ATOM   2334 O  O   . ARG A 1 286 ? 13.418 7.871   -6.039  1.00 24.46 ? 1965 ARG A O   1 
ATOM   2335 C  CB  . ARG A 1 286 ? 12.555 8.110   -2.882  1.00 20.02 ? 1965 ARG A CB  1 
ATOM   2336 C  CG  . ARG A 1 286 ? 11.246 7.816   -2.165  1.00 18.91 ? 1965 ARG A CG  1 
ATOM   2337 C  CD  . ARG A 1 286 ? 10.976 8.938   -1.160  1.00 20.62 ? 1965 ARG A CD  1 
ATOM   2338 N  NE  . ARG A 1 286 ? 9.628  8.782   -0.630  1.00 23.43 ? 1965 ARG A NE  1 
ATOM   2339 C  CZ  . ARG A 1 286 ? 9.035  9.696   0.135   1.00 29.70 ? 1965 ARG A CZ  1 
ATOM   2340 N  NH1 . ARG A 1 286 ? 9.685  10.805  0.455   1.00 28.95 ? 1965 ARG A NH1 1 
ATOM   2341 N  NH2 . ARG A 1 286 ? 7.802  9.505   0.587   1.00 26.07 ? 1965 ARG A NH2 1 
ATOM   2342 N  N   . ALA A 1 287 ? 15.143 7.704   -4.582  1.00 20.66 ? 1966 ALA A N   1 
ATOM   2343 C  CA  . ALA A 1 287 ? 16.117 8.264   -5.506  1.00 23.43 ? 1966 ALA A CA  1 
ATOM   2344 C  C   . ALA A 1 287 ? 16.310 7.296   -6.644  1.00 23.20 ? 1966 ALA A C   1 
ATOM   2345 O  O   . ALA A 1 287 ? 16.302 7.670   -7.826  1.00 24.97 ? 1966 ALA A O   1 
ATOM   2346 C  CB  . ALA A 1 287 ? 17.424 8.540   -4.809  1.00 23.02 ? 1966 ALA A CB  1 
ATOM   2347 N  N   . ARG A 1 288 ? 16.420 6.024   -6.275  1.00 18.77 ? 1967 ARG A N   1 
ATOM   2348 C  CA  . ARG A 1 288 ? 16.751 5.007   -7.240  1.00 18.84 ? 1967 ARG A CA  1 
ATOM   2349 C  C   . ARG A 1 288 ? 15.629 4.801   -8.245  1.00 18.79 ? 1967 ARG A C   1 
ATOM   2350 O  O   . ARG A 1 288 ? 15.903 4.508   -9.390  1.00 20.95 ? 1967 ARG A O   1 
ATOM   2351 C  CB  . ARG A 1 288 ? 17.089 3.701   -6.506  1.00 19.74 ? 1967 ARG A CB  1 
ATOM   2352 C  CG  . ARG A 1 288 ? 18.461 3.842   -5.856  1.00 18.38 ? 1967 ARG A CG  1 
ATOM   2353 C  CD  . ARG A 1 288 ? 18.870 2.541   -5.182  1.00 22.58 ? 1967 ARG A CD  1 
ATOM   2354 N  NE  . ARG A 1 288 ? 20.244 2.674   -4.721  1.00 18.75 ? 1967 ARG A NE  1 
ATOM   2355 C  CZ  . ARG A 1 288 ? 21.052 1.673   -4.378  1.00 24.53 ? 1967 ARG A CZ  1 
ATOM   2356 N  NH1 . ARG A 1 288 ? 22.300 1.961   -3.980  1.00 23.20 ? 1967 ARG A NH1 1 
ATOM   2357 N  NH2 . ARG A 1 288 ? 20.608 0.422   -4.459  1.00 21.33 ? 1967 ARG A NH2 1 
ATOM   2358 N  N   . LYS A 1 289 ? 14.388 4.963   -7.802  1.00 19.69 ? 1968 LYS A N   1 
ATOM   2359 C  CA  . LYS A 1 289 ? 13.243 4.760   -8.677  1.00 21.53 ? 1968 LYS A CA  1 
ATOM   2360 C  C   . LYS A 1 289 ? 13.319 5.646   -9.925  1.00 22.13 ? 1968 LYS A C   1 
ATOM   2361 O  O   . LYS A 1 289 ? 12.855 5.266   -10.995 1.00 23.30 ? 1968 LYS A O   1 
ATOM   2362 C  CB  . LYS A 1 289 ? 11.964 5.103   -7.907  1.00 22.81 ? 1968 LYS A CB  1 
ATOM   2363 C  CG  . LYS A 1 289 ? 10.711 4.790   -8.709  1.00 29.43 ? 1968 LYS A CG  1 
ATOM   2364 C  CD  . LYS A 1 289 ? 9.465  4.954   -7.862  1.00 36.57 ? 1968 LYS A CD  1 
ATOM   2365 C  CE  . LYS A 1 289 ? 8.207  4.973   -8.737  1.00 46.69 ? 1968 LYS A CE  1 
ATOM   2366 N  NZ  . LYS A 1 289 ? 7.896  3.637   -9.342  1.00 51.71 ? 1968 LYS A NZ  1 
ATOM   2367 N  N   . LEU A 1 290 ? 13.788 6.809   -9.865  1.00 22.50 ? 1969 LEU A N   1 
ATOM   2368 C  CA  . LEU A 1 290 ? 13.886 7.791   -10.939 1.00 20.60 ? 1969 LEU A CA  1 
ATOM   2369 C  C   . LEU A 1 290 ? 15.233 7.704   -11.647 1.00 20.10 ? 1969 LEU A C   1 
ATOM   2370 O  O   . LEU A 1 290 ? 15.435 8.415   -12.677 1.00 23.10 ? 1969 LEU A O   1 
ATOM   2371 C  CB  . LEU A 1 290 ? 13.669 9.205   -10.393 1.00 22.70 ? 1969 LEU A CB  1 
ATOM   2372 C  CG  . LEU A 1 290 ? 12.551 9.368   -9.361  1.00 24.30 ? 1969 LEU A CG  1 
ATOM   2373 C  CD1 . LEU A 1 290 ? 12.594 10.755  -8.739  1.00 22.80 ? 1969 LEU A CD1 1 
ATOM   2374 C  CD2 . LEU A 1 290 ? 11.193 9.100   -9.992  1.00 23.70 ? 1969 LEU A CD2 1 
ATOM   2375 N  N   . ARG A 1 291 ? 16.182 6.935   -11.254 1.00 22.50 ? 1970 ARG A N   1 
ATOM   2376 C  CA  . ARG A 1 291 ? 17.485 6.847   -11.909 1.00 24.98 ? 1970 ARG A CA  1 
ATOM   2377 C  C   . ARG A 1 291 ? 17.745 5.504   -12.601 1.00 29.35 ? 1970 ARG A C   1 
ATOM   2378 O  O   . ARG A 1 291 ? 16.840 4.747   -12.995 1.00 32.90 ? 1970 ARG A O   1 
ATOM   2379 C  CB  . ARG A 1 291 ? 18.583 7.187   -10.892 1.00 24.29 ? 1970 ARG A CB  1 
ATOM   2380 C  CG  . ARG A 1 291 ? 18.579 8.689   -10.594 1.00 21.01 ? 1970 ARG A CG  1 
ATOM   2381 C  CD  . ARG A 1 291 ? 19.445 9.146   -9.411  1.00 22.16 ? 1970 ARG A CD  1 
ATOM   2382 N  NE  . ARG A 1 291 ? 20.783 8.573   -9.519  1.00 24.34 ? 1970 ARG A NE  1 
ATOM   2383 C  CZ  . ARG A 1 291 ? 21.718 8.721   -8.596  1.00 23.20 ? 1970 ARG A CZ  1 
ATOM   2384 N  NH1 . ARG A 1 291 ? 22.921 8.168   -8.759  1.00 20.02 ? 1970 ARG A NH1 1 
ATOM   2385 N  NH2 . ARG A 1 291 ? 21.430 9.436   -7.516  1.00 23.31 ? 1970 ARG A NH2 1 
ATOM   2386 O  OXT . ARG A 1 291 ? 18.895 5.119   -12.819 1.00 32.75 ? 1970 ARG A OXT 1 
HETATM 2387 CL CL  . CL  B 2 .   ? 30.903 -11.402 6.528   1.00 24.91 ? 302  CL  A CL  1 
HETATM 2388 MG MG  . MG  C 3 .   ? 48.225 3.385   32.139  0.50 17.77 ? 303  MG  A MG  1 
HETATM 2389 MG MG  . MG  D 3 .   ? 42.113 -3.938  34.292  1.00 27.11 ? 304  MG  A MG  1 
HETATM 2390 CL CL  . CL  E 2 .   ? 30.946 -13.824 15.596  1.00 26.10 ? 305  CL  A CL  1 
HETATM 2391 N  N   . 3UN F 4 .   ? 22.476 4.629   24.229  1.00 20.67 ? 401  3UN A N   1 
HETATM 2392 O  O48 . 3UN F 4 .   ? 19.527 1.763   31.665  1.00 46.93 ? 401  3UN A O48 1 
HETATM 2393 C  C36 . 3UN F 4 .   ? 20.413 2.595   31.511  1.00 40.07 ? 401  3UN A C36 1 
HETATM 2394 O  O49 . 3UN F 4 .   ? 21.276 2.843   32.638  1.00 45.12 ? 401  3UN A O49 1 
HETATM 2395 C  C51 . 3UN F 4 .   ? 21.200 2.015   33.798  1.00 45.87 ? 401  3UN A C51 1 
HETATM 2396 C  C54 . 3UN F 4 .   ? 22.608 1.644   34.197  1.00 44.05 ? 401  3UN A C54 1 
HETATM 2397 C  C11 . 3UN F 4 .   ? 20.655 3.349   30.222  1.00 33.03 ? 401  3UN A C11 1 
HETATM 2398 C  C15 . 3UN F 4 .   ? 20.927 4.833   30.491  1.00 34.48 ? 401  3UN A C15 1 
HETATM 2399 C  C44 . 3UN F 4 .   ? 19.778 5.661   31.080  1.00 43.65 ? 401  3UN A C44 1 
HETATM 2400 N  N39 . 3UN F 4 .   ? 20.206 7.042   31.338  1.00 46.69 ? 401  3UN A N39 1 
HETATM 2401 C  C37 . 3UN F 4 .   ? 20.061 8.128   30.567  1.00 47.84 ? 401  3UN A C37 1 
HETATM 2402 O  O38 . 3UN F 4 .   ? 19.532 8.082   29.467  1.00 45.00 ? 401  3UN A O38 1 
HETATM 2403 O  O19 . 3UN F 4 .   ? 20.537 9.443   30.998  1.00 50.83 ? 401  3UN A O19 1 
HETATM 2404 C  C20 . 3UN F 4 .   ? 20.251 10.657  30.285  1.00 52.13 ? 401  3UN A C20 1 
HETATM 2405 C  C23 . 3UN F 4 .   ? 18.842 10.633  29.699  1.00 50.06 ? 401  3UN A C23 1 
HETATM 2406 C  C22 . 3UN F 4 .   ? 20.331 11.861  31.223  1.00 52.33 ? 401  3UN A C22 1 
HETATM 2407 C  C21 . 3UN F 4 .   ? 21.285 10.813  29.167  1.00 52.52 ? 401  3UN A C21 1 
HETATM 2408 C  C14 . 3UN F 4 .   ? 19.445 3.189   29.338  1.00 31.05 ? 401  3UN A C14 1 
HETATM 2409 O  O47 . 3UN F 4 .   ? 19.026 1.838   29.028  1.00 28.23 ? 401  3UN A O47 1 
HETATM 2410 C  C50 . 3UN F 4 .   ? 18.014 1.670   28.020  1.00 28.31 ? 401  3UN A C50 1 
HETATM 2411 C  C60 . 3UN F 4 .   ? 17.843 0.195   27.759  1.00 35.04 ? 401  3UN A C60 1 
HETATM 2412 O  O46 . 3UN F 4 .   ? 18.830 4.149   28.891  1.00 31.67 ? 401  3UN A O46 1 
HETATM 2413 C  C35 . 3UN F 4 .   ? 21.849 2.630   29.548  1.00 24.53 ? 401  3UN A C35 1 
HETATM 2414 C  C2  . 3UN F 4 .   ? 22.022 3.140   28.124  1.00 23.48 ? 401  3UN A C2  1 
HETATM 2415 C  C5  . 3UN F 4 .   ? 21.508 2.432   27.028  1.00 23.36 ? 401  3UN A C5  1 
HETATM 2416 C  C4  . 3UN F 4 .   ? 21.670 2.915   25.718  1.00 20.29 ? 401  3UN A C4  1 
HETATM 2417 C  C6  . 3UN F 4 .   ? 22.703 4.343   27.898  1.00 22.96 ? 401  3UN A C6  1 
HETATM 2418 C  C3  . 3UN F 4 .   ? 22.851 4.838   26.594  1.00 23.34 ? 401  3UN A C3  1 
HETATM 2419 C  C1  . 3UN F 4 .   ? 22.335 4.130   25.495  1.00 24.30 ? 401  3UN A C1  1 
HETATM 2420 S  S12 . 3UN F 4 .   ? 23.676 4.123   23.251  1.00 19.42 ? 401  3UN A S12 1 
HETATM 2421 O  O17 . 3UN F 4 .   ? 24.850 4.734   23.897  1.00 19.68 ? 401  3UN A O17 1 
HETATM 2422 O  O18 . 3UN F 4 .   ? 23.303 4.716   21.952  1.00 18.96 ? 401  3UN A O18 1 
HETATM 2423 O  O34 . 3UN F 4 .   ? 23.746 2.660   23.372  1.00 18.43 ? 401  3UN A O34 1 
HETATM 2424 O  O   . HOH G 5 .   ? 15.598 -9.904  1.970   1.00 16.65 ? 3    HOH A O   1 
HETATM 2425 O  O   . HOH G 5 .   ? 38.117 10.256  15.010  1.00 16.06 ? 4    HOH A O   1 
HETATM 2426 O  O   . HOH G 5 .   ? 34.821 -3.436  29.773  1.00 16.84 ? 5    HOH A O   1 
HETATM 2427 O  O   . HOH G 5 .   ? 39.055 -3.373  11.576  1.00 18.41 ? 6    HOH A O   1 
HETATM 2428 O  O   . HOH G 5 .   ? 27.822 -5.711  7.190   1.00 17.11 ? 7    HOH A O   1 
HETATM 2429 O  O   . HOH G 5 .   ? 25.083 -4.512  -7.339  1.00 17.88 ? 8    HOH A O   1 
HETATM 2430 O  O   . HOH G 5 .   ? 34.350 -10.305 27.831  1.00 23.92 ? 9    HOH A O   1 
HETATM 2431 O  O   . HOH G 5 .   ? 37.242 -4.566  30.538  1.00 21.22 ? 10   HOH A O   1 
HETATM 2432 O  O   . HOH G 5 .   ? 11.554 -5.469  7.481   1.00 18.45 ? 11   HOH A O   1 
HETATM 2433 O  O   . HOH G 5 .   ? 26.783 -0.263  3.881   1.00 18.65 ? 12   HOH A O   1 
HETATM 2434 O  O   . HOH G 5 .   ? 36.888 3.054   35.627  1.00 21.27 ? 13   HOH A O   1 
HETATM 2435 O  O   . HOH G 5 .   ? 12.555 0.327   -5.768  1.00 19.26 ? 14   HOH A O   1 
HETATM 2436 O  O   . HOH G 5 .   ? 17.851 -0.532  -4.766  1.00 23.12 ? 15   HOH A O   1 
HETATM 2437 O  O   . HOH G 5 .   ? 21.753 5.069   -3.784  1.00 18.82 ? 16   HOH A O   1 
HETATM 2438 O  O   . HOH G 5 .   ? 52.760 6.898   28.949  1.00 21.46 ? 17   HOH A O   1 
HETATM 2439 O  O   . HOH G 5 .   ? 22.716 0.898   -0.929  1.00 22.82 ? 18   HOH A O   1 
HETATM 2440 O  O   . HOH G 5 .   ? 42.834 12.073  9.327   1.00 20.69 ? 19   HOH A O   1 
HETATM 2441 O  O   . HOH G 5 .   ? 35.144 -0.965  28.266  1.00 18.79 ? 20   HOH A O   1 
HETATM 2442 O  O   . HOH G 5 .   ? 42.043 -1.492  31.249  1.00 21.58 ? 21   HOH A O   1 
HETATM 2443 O  O   . HOH G 5 .   ? 20.323 4.996   21.937  1.00 21.89 ? 22   HOH A O   1 
HETATM 2444 O  O   . HOH G 5 .   ? 22.332 -8.557  5.939   1.00 24.60 ? 23   HOH A O   1 
HETATM 2445 O  O   . HOH G 5 .   ? 33.264 -17.898 10.692  1.00 23.90 ? 24   HOH A O   1 
HETATM 2446 O  O   . HOH G 5 .   ? 49.594 11.061  20.157  1.00 24.55 ? 25   HOH A O   1 
HETATM 2447 O  O   . HOH G 5 .   ? 34.990 -0.602  25.537  1.00 18.37 ? 26   HOH A O   1 
HETATM 2448 O  O   . HOH G 5 .   ? 9.136  1.286   -3.327  1.00 25.22 ? 27   HOH A O   1 
HETATM 2449 O  O   . HOH G 5 .   ? 37.591 -3.066  9.239   1.00 19.99 ? 28   HOH A O   1 
HETATM 2450 O  O   . HOH G 5 .   ? 46.419 -2.057  26.209  1.00 28.43 ? 29   HOH A O   1 
HETATM 2451 O  O   . HOH G 5 .   ? 25.590 1.606   -0.258  1.00 23.75 ? 31   HOH A O   1 
HETATM 2452 O  O   . HOH G 5 .   ? 42.655 1.435   31.715  1.00 21.58 ? 32   HOH A O   1 
HETATM 2453 O  O   . HOH G 5 .   ? 17.788 -10.969 3.958   1.00 26.71 ? 33   HOH A O   1 
HETATM 2454 O  O   . HOH G 5 .   ? 10.643 4.555   -0.958  1.00 23.11 ? 34   HOH A O   1 
HETATM 2455 O  O   . HOH G 5 .   ? 40.306 9.022   31.755  1.00 29.21 ? 35   HOH A O   1 
HETATM 2456 O  O   . HOH G 5 .   ? 27.617 -1.235  29.923  1.00 23.85 ? 36   HOH A O   1 
HETATM 2457 O  O   . HOH G 5 .   ? 24.043 -8.685  25.485  1.00 22.47 ? 37   HOH A O   1 
HETATM 2458 O  O   . HOH G 5 .   ? 33.282 16.374  13.050  1.00 19.01 ? 38   HOH A O   1 
HETATM 2459 O  O   . HOH G 5 .   ? 48.946 -1.029  9.366   1.00 29.19 ? 40   HOH A O   1 
HETATM 2460 O  O   . HOH G 5 .   ? 34.328 -5.511  9.221   1.00 23.92 ? 41   HOH A O   1 
HETATM 2461 O  O   . HOH G 5 .   ? 29.926 -7.021  4.561   1.00 23.71 ? 42   HOH A O   1 
HETATM 2462 O  O   . HOH G 5 .   ? 11.289 6.032   20.251  1.00 26.54 ? 43   HOH A O   1 
HETATM 2463 O  O   . HOH G 5 .   ? 16.256 2.405   -11.289 1.00 27.22 ? 44   HOH A O   1 
HETATM 2464 O  O   . HOH G 5 .   ? 25.076 1.214   36.109  1.00 33.14 ? 45   HOH A O   1 
HETATM 2465 O  O   . HOH G 5 .   ? 19.286 -9.517  23.001  1.00 24.60 ? 46   HOH A O   1 
HETATM 2466 O  O   . HOH G 5 .   ? 7.005  5.522   2.213   1.00 25.38 ? 47   HOH A O   1 
HETATM 2467 O  O   . HOH G 5 .   ? 26.693 -9.800  23.841  1.00 33.15 ? 48   HOH A O   1 
HETATM 2468 O  O   . HOH G 5 .   ? 44.887 1.140   33.345  1.00 23.44 ? 49   HOH A O   1 
HETATM 2469 O  O   . HOH G 5 .   ? 32.335 15.470  23.975  1.00 31.99 ? 50   HOH A O   1 
HETATM 2470 O  O   . HOH G 5 .   ? 32.783 -5.738  6.839   1.00 26.97 ? 51   HOH A O   1 
HETATM 2471 O  O   . HOH G 5 .   ? 7.497  -4.876  7.714   1.00 25.66 ? 52   HOH A O   1 
HETATM 2472 O  O   . HOH G 5 .   ? 23.921 -6.967  4.313   1.00 21.56 ? 53   HOH A O   1 
HETATM 2473 O  O   . HOH G 5 .   ? 39.143 19.421  7.378   1.00 28.85 ? 54   HOH A O   1 
HETATM 2474 O  O   . HOH G 5 .   ? 9.732  -3.745  8.347   1.00 22.96 ? 55   HOH A O   1 
HETATM 2475 O  O   . HOH G 5 .   ? 49.618 3.456   33.527  1.00 23.26 ? 56   HOH A O   1 
HETATM 2476 O  O   . HOH G 5 .   ? 48.218 1.323   32.063  0.50 23.13 ? 57   HOH A O   1 
HETATM 2477 O  O   . HOH G 5 .   ? 23.717 10.165  1.496   1.00 27.64 ? 58   HOH A O   1 
HETATM 2478 O  O   . HOH G 5 .   ? 42.504 -1.713  34.425  1.00 26.58 ? 59   HOH A O   1 
HETATM 2479 O  O   . HOH G 5 .   ? 11.090 3.159   22.198  1.00 29.84 ? 60   HOH A O   1 
HETATM 2480 O  O   . HOH G 5 .   ? 21.980 -7.570  10.893  1.00 31.39 ? 61   HOH A O   1 
HETATM 2481 O  O   . HOH G 5 .   ? 18.200 13.606  4.073   1.00 24.88 ? 62   HOH A O   1 
HETATM 2482 O  O   . HOH G 5 .   ? 43.267 5.084   32.895  1.00 25.99 ? 63   HOH A O   1 
HETATM 2483 O  O   . HOH G 5 .   ? 12.444 -4.079  20.366  1.00 32.49 ? 64   HOH A O   1 
HETATM 2484 O  O   . HOH G 5 .   ? 15.907 -8.162  22.566  1.00 29.87 ? 65   HOH A O   1 
HETATM 2485 O  O   . HOH G 5 .   ? 25.317 8.582   0.178   1.00 23.48 ? 67   HOH A O   1 
HETATM 2486 O  O   . HOH G 5 .   ? 16.698 12.610  17.895  1.00 33.85 ? 68   HOH A O   1 
HETATM 2487 O  O   . HOH G 5 .   ? 27.425 11.658  17.744  1.00 25.91 ? 69   HOH A O   1 
HETATM 2488 O  O   . HOH G 5 .   ? 12.693 11.393  0.508   1.00 24.08 ? 71   HOH A O   1 
HETATM 2489 O  O   . HOH G 5 .   ? 11.306 -5.829  -5.908  1.00 33.85 ? 73   HOH A O   1 
HETATM 2490 O  O   . HOH G 5 .   ? 48.206 5.444   32.066  0.50 22.02 ? 74   HOH A O   1 
HETATM 2491 O  O   . HOH G 5 .   ? 16.128 13.277  6.226   1.00 26.06 ? 75   HOH A O   1 
HETATM 2492 O  O   . HOH G 5 .   ? 46.541 3.451   33.376  1.00 24.74 ? 76   HOH A O   1 
HETATM 2493 O  O   . HOH G 5 .   ? 39.401 -11.087 15.518  1.00 30.99 ? 77   HOH A O   1 
HETATM 2494 O  O   . HOH G 5 .   ? 17.702 -2.970  -3.729  1.00 26.61 ? 78   HOH A O   1 
HETATM 2495 O  O   . HOH G 5 .   ? 17.073 -6.280  24.251  1.00 25.92 ? 79   HOH A O   1 
HETATM 2496 O  O   . HOH G 5 .   ? 28.043 6.678   31.417  1.00 30.86 ? 80   HOH A O   1 
HETATM 2497 O  O   . HOH G 5 .   ? 37.639 -13.723 21.948  1.00 30.35 ? 81   HOH A O   1 
HETATM 2498 O  O   . HOH G 5 .   ? 33.058 -15.389 17.319  1.00 25.54 ? 82   HOH A O   1 
HETATM 2499 O  O   . HOH G 5 .   ? 39.580 -7.494  32.274  1.00 36.92 ? 83   HOH A O   1 
HETATM 2500 O  O   . HOH G 5 .   ? 46.008 16.146  11.027  1.00 28.45 ? 84   HOH A O   1 
HETATM 2501 O  O   . HOH G 5 .   ? 35.814 14.570  17.825  1.00 27.61 ? 85   HOH A O   1 
HETATM 2502 O  O   . HOH G 5 .   ? 54.572 5.725   10.606  1.00 42.98 ? 86   HOH A O   1 
HETATM 2503 O  O   . HOH G 5 .   ? 6.931  -7.117  -0.323  1.00 26.01 ? 87   HOH A O   1 
HETATM 2504 O  O   . HOH G 5 .   ? 23.591 -15.543 32.805  1.00 40.31 ? 88   HOH A O   1 
HETATM 2505 O  O   . HOH G 5 .   ? 36.654 0.267   34.930  1.00 27.21 ? 89   HOH A O   1 
HETATM 2506 O  O   . HOH G 5 .   ? 6.897  7.548   4.135   1.00 32.63 ? 90   HOH A O   1 
HETATM 2507 O  O   . HOH G 5 .   ? 19.099 11.021  -6.587  1.00 30.45 ? 91   HOH A O   1 
HETATM 2508 O  O   . HOH G 5 .   ? 29.799 1.985   0.676   1.00 25.52 ? 92   HOH A O   1 
HETATM 2509 O  O   . HOH G 5 .   ? 14.001 11.850  5.255   1.00 30.89 ? 93   HOH A O   1 
HETATM 2510 O  O   . HOH G 5 .   ? 41.214 -10.210 22.522  1.00 32.89 ? 94   HOH A O   1 
HETATM 2511 O  O   . HOH G 5 .   ? 27.228 -9.099  7.029   1.00 32.52 ? 95   HOH A O   1 
HETATM 2512 O  O   . HOH G 5 .   ? 35.514 6.313   1.724   1.00 29.55 ? 96   HOH A O   1 
HETATM 2513 O  O   . HOH G 5 .   ? 15.798 5.452   25.992  1.00 31.78 ? 97   HOH A O   1 
HETATM 2514 O  O   . HOH G 5 .   ? 18.274 -8.571  7.290   1.00 32.07 ? 98   HOH A O   1 
HETATM 2515 O  O   . HOH G 5 .   ? 36.125 16.662  16.205  1.00 26.41 ? 99   HOH A O   1 
HETATM 2516 O  O   . HOH G 5 .   ? 25.787 1.813   -3.695  1.00 30.54 ? 100  HOH A O   1 
HETATM 2517 O  O   . HOH G 5 .   ? 12.515 -4.211  5.309   1.00 29.81 ? 101  HOH A O   1 
HETATM 2518 O  O   . HOH G 5 .   ? 29.125 -12.414 29.924  1.00 30.24 ? 102  HOH A O   1 
HETATM 2519 O  O   . HOH G 5 .   ? 27.484 0.476   1.376   1.00 26.96 ? 103  HOH A O   1 
HETATM 2520 O  O   . HOH G 5 .   ? 43.061 9.936   30.927  1.00 26.78 ? 104  HOH A O   1 
HETATM 2521 O  O   . HOH G 5 .   ? 22.343 15.259  13.416  1.00 31.91 ? 105  HOH A O   1 
HETATM 2522 O  O   . HOH G 5 .   ? 20.859 9.837   0.714   1.00 32.79 ? 106  HOH A O   1 
HETATM 2523 O  O   . HOH G 5 .   ? 42.549 1.197   8.565   1.00 32.71 ? 107  HOH A O   1 
HETATM 2524 O  O   . HOH G 5 .   ? 48.209 -4.035  26.907  1.00 28.65 ? 108  HOH A O   1 
HETATM 2525 O  O   . HOH G 5 .   ? 14.460 -5.166  24.701  1.00 32.55 ? 109  HOH A O   1 
HETATM 2526 O  O   . HOH G 5 .   ? 5.352  0.946   -3.250  1.00 29.44 ? 110  HOH A O   1 
HETATM 2527 O  O   . HOH G 5 .   ? 43.681 8.537   27.385  1.00 29.04 ? 111  HOH A O   1 
HETATM 2528 O  O   . HOH G 5 .   ? 50.307 7.214   30.217  1.00 34.27 ? 112  HOH A O   1 
HETATM 2529 O  O   . HOH G 5 .   ? 25.242 -16.603 26.405  1.00 34.67 ? 113  HOH A O   1 
HETATM 2530 O  O   . HOH G 5 .   ? 54.684 -6.137  22.573  1.00 41.00 ? 114  HOH A O   1 
HETATM 2531 O  O   . HOH G 5 .   ? 41.865 14.424  19.962  1.00 39.80 ? 116  HOH A O   1 
HETATM 2532 O  O   . HOH G 5 .   ? 40.161 2.907   6.709   1.00 35.01 ? 117  HOH A O   1 
HETATM 2533 O  O   . HOH G 5 .   ? 44.407 15.993  8.579   1.00 37.02 ? 118  HOH A O   1 
HETATM 2534 O  O   . HOH G 5 .   ? 15.318 10.382  -1.527  1.00 30.85 ? 119  HOH A O   1 
HETATM 2535 O  O   . HOH G 5 .   ? 33.988 6.807   -0.037  1.00 28.99 ? 120  HOH A O   1 
HETATM 2536 O  O   . HOH G 5 .   ? 45.494 7.775   29.434  1.00 31.92 ? 121  HOH A O   1 
HETATM 2537 O  O   . HOH G 5 .   ? 49.640 9.996   31.142  1.00 38.99 ? 122  HOH A O   1 
HETATM 2538 O  O   . HOH G 5 .   ? 26.442 -7.475  5.030   1.00 29.77 ? 123  HOH A O   1 
HETATM 2539 O  O   . HOH G 5 .   ? 28.664 15.643  5.766   1.00 30.88 ? 125  HOH A O   1 
HETATM 2540 O  O   . HOH G 5 .   ? 54.267 -4.650  17.856  1.00 34.33 ? 126  HOH A O   1 
HETATM 2541 O  O   . HOH G 5 .   ? 49.662 12.342  24.588  1.00 34.45 ? 127  HOH A O   1 
HETATM 2542 O  O   . HOH G 5 .   ? 26.989 -1.634  -0.696  1.00 29.98 ? 128  HOH A O   1 
HETATM 2543 O  O   . HOH G 5 .   ? 37.000 -5.827  8.390   1.00 30.91 ? 129  HOH A O   1 
HETATM 2544 O  O   . HOH G 5 .   ? 48.050 6.314   29.244  1.00 33.81 ? 130  HOH A O   1 
HETATM 2545 O  O   . HOH G 5 .   ? 15.790 12.244  11.504  1.00 33.82 ? 131  HOH A O   1 
HETATM 2546 O  O   . HOH G 5 .   ? 22.501 13.695  23.350  1.00 30.97 ? 132  HOH A O   1 
HETATM 2547 O  O   . HOH G 5 .   ? 26.931 -5.177  -3.615  1.00 39.91 ? 133  HOH A O   1 
HETATM 2548 O  O   . HOH G 5 .   ? 19.060 11.751  25.865  1.00 42.77 ? 134  HOH A O   1 
HETATM 2549 O  O   . HOH G 5 .   ? 0.916  6.532   6.675   1.00 37.66 ? 136  HOH A O   1 
HETATM 2550 O  O   . HOH G 5 .   ? 15.810 -15.340 20.496  1.00 34.95 ? 137  HOH A O   1 
HETATM 2551 O  O   . HOH G 5 .   ? 57.282 6.222   12.177  1.00 40.77 ? 138  HOH A O   1 
HETATM 2552 O  O   . HOH G 5 .   ? 32.842 -15.389 22.150  1.00 36.95 ? 139  HOH A O   1 
HETATM 2553 O  O   . HOH G 5 .   ? 19.374 -12.628 29.181  1.00 41.58 ? 141  HOH A O   1 
HETATM 2554 O  O   . HOH G 5 .   ? 41.120 1.524   4.655   1.00 37.61 ? 143  HOH A O   1 
HETATM 2555 O  O   . HOH G 5 .   ? 48.391 -3.778  9.496   1.00 34.60 ? 144  HOH A O   1 
HETATM 2556 O  O   . HOH G 5 .   ? 10.614 -10.653 -0.582  1.00 33.78 ? 145  HOH A O   1 
HETATM 2557 O  O   . HOH G 5 .   ? 12.609 8.582   13.691  1.00 32.80 ? 146  HOH A O   1 
HETATM 2558 O  O   . HOH G 5 .   ? 24.834 -10.404 12.702  1.00 32.29 ? 147  HOH A O   1 
HETATM 2559 O  O   . HOH G 5 .   ? 24.114 -18.834 26.703  1.00 43.02 ? 148  HOH A O   1 
HETATM 2560 O  O   . HOH G 5 .   ? 15.521 -1.789  23.002  1.00 30.08 ? 150  HOH A O   1 
HETATM 2561 O  O   . HOH G 5 .   ? 0.191  0.912   10.980  1.00 32.57 ? 151  HOH A O   1 
HETATM 2562 O  O   . HOH G 5 .   ? 18.764 10.588  1.995   1.00 35.38 ? 152  HOH A O   1 
HETATM 2563 O  O   . HOH G 5 .   ? 42.226 18.997  13.798  1.00 38.00 ? 153  HOH A O   1 
HETATM 2564 O  O   . HOH G 5 .   ? 29.303 12.784  34.222  1.00 42.26 ? 155  HOH A O   1 
HETATM 2565 O  O   . HOH G 5 .   ? 9.934  -10.509 21.631  1.00 38.69 ? 156  HOH A O   1 
HETATM 2566 O  O   . HOH G 5 .   ? 29.844 0.943   7.239   1.00 39.38 ? 157  HOH A O   1 
HETATM 2567 O  O   . HOH G 5 .   ? 43.936 11.340  26.704  1.00 39.15 ? 158  HOH A O   1 
HETATM 2568 O  O   . HOH G 5 .   ? 23.798 -15.790 19.934  1.00 41.56 ? 159  HOH A O   1 
HETATM 2569 O  O   . HOH G 5 .   ? 16.873 -12.649 10.121  1.00 35.92 ? 160  HOH A O   1 
HETATM 2570 O  O   . HOH G 5 .   ? 34.215 -4.809  39.805  1.00 46.23 ? 161  HOH A O   1 
HETATM 2571 O  O   . HOH G 5 .   ? 36.935 13.710  22.608  1.00 45.35 ? 163  HOH A O   1 
HETATM 2572 O  O   . HOH G 5 .   ? 14.984 0.808   25.940  1.00 41.07 ? 164  HOH A O   1 
HETATM 2573 O  O   . HOH G 5 .   ? 55.008 -6.624  27.601  1.00 41.47 ? 165  HOH A O   1 
HETATM 2574 O  O   . HOH G 5 .   ? 28.355 17.965  4.900   1.00 42.36 ? 167  HOH A O   1 
HETATM 2575 O  O   . HOH G 5 .   ? 2.376  -1.731  19.680  1.00 41.85 ? 168  HOH A O   1 
HETATM 2576 O  O   . HOH G 5 .   ? 45.770 -2.582  32.160  1.00 39.42 ? 169  HOH A O   1 
HETATM 2577 O  O   . HOH G 5 .   ? 32.379 19.725  12.540  1.00 43.63 ? 170  HOH A O   1 
HETATM 2578 O  O   . HOH G 5 .   ? 47.015 -6.989  11.742  1.00 46.93 ? 172  HOH A O   1 
HETATM 2579 O  O   . HOH G 5 .   ? 27.490 -7.471  39.759  1.00 44.57 ? 173  HOH A O   1 
HETATM 2580 O  O   . HOH G 5 .   ? 35.993 -12.849 33.909  1.00 40.31 ? 174  HOH A O   1 
HETATM 2581 O  O   . HOH G 5 .   ? 50.853 11.938  30.188  1.00 44.68 ? 175  HOH A O   1 
HETATM 2582 O  O   . HOH G 5 .   ? 11.057 11.769  11.410  1.00 41.81 ? 176  HOH A O   1 
HETATM 2583 O  O   . HOH G 5 .   ? 14.175 -11.038 -2.906  1.00 38.44 ? 177  HOH A O   1 
HETATM 2584 O  O   . HOH G 5 .   ? 42.170 13.217  27.743  1.00 47.46 ? 178  HOH A O   1 
HETATM 2585 O  O   . HOH G 5 .   ? 53.263 3.983   18.316  1.00 38.38 ? 179  HOH A O   1 
HETATM 2586 O  O   . HOH G 5 .   ? 14.215 -0.123  -8.338  1.00 34.65 ? 180  HOH A O   1 
HETATM 2587 O  O   . HOH G 5 .   ? 46.930 -4.198  29.410  1.00 39.88 ? 182  HOH A O   1 
HETATM 2588 O  O   . HOH G 5 .   ? 16.502 -12.227 2.674   1.00 49.40 ? 183  HOH A O   1 
HETATM 2589 O  O   . HOH G 5 .   ? 2.945  -2.275  -0.553  1.00 40.36 ? 184  HOH A O   1 
HETATM 2590 O  O   . HOH G 5 .   ? 10.559 8.260   -6.069  1.00 43.12 ? 185  HOH A O   1 
HETATM 2591 O  O   . HOH G 5 .   ? 10.872 8.267   18.033  1.00 42.04 ? 187  HOH A O   1 
HETATM 2592 O  O   . HOH G 5 .   ? 38.184 -20.871 17.020  1.00 43.45 ? 188  HOH A O   1 
HETATM 2593 O  O   . HOH G 5 .   ? -2.523 -7.782  14.673  1.00 45.78 ? 189  HOH A O   1 
HETATM 2594 O  O   . HOH G 5 .   ? 26.706 -11.834 1.221   1.00 32.11 ? 190  HOH A O   1 
HETATM 2595 O  O   . HOH G 5 .   ? 44.268 -5.179  29.896  1.00 54.26 ? 191  HOH A O   1 
HETATM 2596 O  O   . HOH G 5 .   ? 58.156 -1.142  27.540  1.00 36.42 ? 192  HOH A O   1 
HETATM 2597 O  O   . HOH G 5 .   ? 42.565 -12.742 17.373  1.00 43.54 ? 193  HOH A O   1 
HETATM 2598 O  O   . HOH G 5 .   ? 11.986 -12.859 0.598   1.00 53.88 ? 194  HOH A O   1 
HETATM 2599 O  O   . HOH G 5 .   ? 9.021  6.065   -4.476  1.00 36.00 ? 195  HOH A O   1 
HETATM 2600 O  O   . HOH G 5 .   ? 41.009 -16.616 31.613  1.00 57.80 ? 196  HOH A O   1 
HETATM 2601 O  O   . HOH G 5 .   ? 39.646 -16.563 28.718  1.00 41.22 ? 197  HOH A O   1 
HETATM 2602 O  O   . HOH G 5 .   ? 0.063  1.725   1.477   1.00 45.28 ? 198  HOH A O   1 
HETATM 2603 O  O   . HOH G 5 .   ? 31.255 -15.595 19.505  1.00 36.92 ? 199  HOH A O   1 
HETATM 2604 O  O   . HOH G 5 .   ? 17.362 -11.327 7.294   1.00 30.75 ? 200  HOH A O   1 
HETATM 2605 O  O   . HOH G 5 .   ? 41.608 -15.308 27.823  1.00 45.05 ? 202  HOH A O   1 
HETATM 2606 O  O   . HOH G 5 .   ? 41.678 -5.935  34.052  1.00 31.81 ? 203  HOH A O   1 
HETATM 2607 O  O   . HOH G 5 .   ? 17.297 -9.533  2.570   1.00 35.03 ? 204  HOH A O   1 
HETATM 2608 O  O   . HOH G 5 .   ? 13.708 1.763   -6.711  1.00 34.33 ? 205  HOH A O   1 
HETATM 2609 O  O   . HOH G 5 .   ? 11.333 -13.538 20.632  1.00 44.65 ? 206  HOH A O   1 
HETATM 2610 O  O   . HOH G 5 .   ? 24.849 15.215  4.854   1.00 46.11 ? 209  HOH A O   1 
HETATM 2611 O  O   . HOH G 5 .   ? 25.309 12.643  0.680   1.00 34.13 ? 211  HOH A O   1 
HETATM 2612 O  O   . HOH G 5 .   ? 19.431 15.965  3.496   1.00 41.69 ? 212  HOH A O   1 
HETATM 2613 O  O   . HOH G 5 .   ? 43.017 -3.599  32.299  1.00 29.71 ? 213  HOH A O   1 
HETATM 2614 O  O   . HOH G 5 .   ? 13.867 -14.845 24.301  1.00 41.20 ? 214  HOH A O   1 
HETATM 2615 O  O   . HOH G 5 .   ? 14.181 4.768   -13.478 1.00 44.26 ? 219  HOH A O   1 
HETATM 2616 O  O   . HOH G 5 .   ? 29.247 -16.373 9.770   1.00 45.91 ? 220  HOH A O   1 
HETATM 2617 O  O   . HOH G 5 .   ? 19.283 9.033   -0.277  1.00 37.76 ? 221  HOH A O   1 
HETATM 2618 O  O   . HOH G 5 .   ? 41.923 10.674  29.981  1.00 33.71 ? 222  HOH A O   1 
HETATM 2619 O  O   . HOH G 5 .   ? 8.256  -10.073 0.505   1.00 41.00 ? 223  HOH A O   1 
HETATM 2620 O  O   . HOH G 5 .   ? 48.610 -6.055  24.864  1.00 35.65 ? 224  HOH A O   1 
HETATM 2621 O  O   . HOH G 5 .   ? 35.471 -16.200 22.247  1.00 47.93 ? 225  HOH A O   1 
HETATM 2622 O  O   . HOH G 5 .   ? 40.261 -3.419  33.616  1.00 26.43 ? 227  HOH A O   1 
HETATM 2623 O  O   . HOH G 5 .   ? 10.898 1.571   -6.141  1.00 32.11 ? 228  HOH A O   1 
HETATM 2624 O  O   . HOH G 5 .   ? 22.633 -8.691  0.905   1.00 27.67 ? 229  HOH A O   1 
HETATM 2625 O  O   . HOH G 5 .   ? 35.587 12.505  28.565  1.00 26.41 ? 230  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1675 ?    ?   ?   A . n 
A 1 2   ASN 2   1676 ?    ?   ?   A . n 
A 1 3   ARG 3   1677 ?    ?   ?   A . n 
A 1 4   LYS 4   1678 1678 LYS LYS A . n 
A 1 5   THR 5   1679 1679 THR THR A . n 
A 1 6   SER 6   1680 1680 SER SER A . n 
A 1 7   CYS 7   1681 1681 CYS CYS A . n 
A 1 8   PRO 8   1682 1682 PRO PRO A . n 
A 1 9   ILE 9   1683 1683 ILE ILE A . n 
A 1 10  LYS 10  1684 1684 LYS LYS A . n 
A 1 11  ILE 11  1685 1685 ILE ILE A . n 
A 1 12  ASN 12  1686 1686 ASN ASN A . n 
A 1 13  GLN 13  1687 1687 GLN GLN A . n 
A 1 14  PHE 14  1688 1688 PHE PHE A . n 
A 1 15  GLU 15  1689 1689 GLU GLU A . n 
A 1 16  GLY 16  1690 1690 GLY GLY A . n 
A 1 17  HIS 17  1691 1691 HIS HIS A . n 
A 1 18  PHE 18  1692 1692 PHE PHE A . n 
A 1 19  MET 19  1693 1693 MET MET A . n 
A 1 20  LYS 20  1694 1694 LYS LYS A . n 
A 1 21  LEU 21  1695 1695 LEU LEU A . n 
A 1 22  GLN 22  1696 1696 GLN GLN A . n 
A 1 23  ALA 23  1697 1697 ALA ALA A . n 
A 1 24  ASP 24  1698 1698 ASP ASP A . n 
A 1 25  SER 25  1699 1699 SER SER A . n 
A 1 26  ASN 26  1700 1700 ASN ASN A . n 
A 1 27  TYR 27  1701 1701 TYR TYR A . n 
A 1 28  LEU 28  1702 1702 LEU LEU A . n 
A 1 29  LEU 29  1703 1703 LEU LEU A . n 
A 1 30  SER 30  1704 1704 SER SER A . n 
A 1 31  LYS 31  1705 1705 LYS LYS A . n 
A 1 32  GLU 32  1706 1706 GLU GLU A . n 
A 1 33  TYR 33  1707 1707 TYR TYR A . n 
A 1 34  GLU 34  1708 1708 GLU GLU A . n 
A 1 35  GLU 35  1709 1709 GLU GLU A . n 
A 1 36  LEU 36  1710 1710 LEU LEU A . n 
A 1 37  LYS 37  1711 1711 LYS LYS A . n 
A 1 38  ASP 38  1712 1712 ASP ASP A . n 
A 1 39  VAL 39  1713 1713 VAL VAL A . n 
A 1 40  GLY 40  1714 1714 GLY GLY A . n 
A 1 41  ARG 41  1715 1715 ARG ARG A . n 
A 1 42  ASN 42  1716 1716 ASN ASN A . n 
A 1 43  GLN 43  1717 1717 GLN GLN A . n 
A 1 44  SER 44  1718 1718 SER SER A . n 
A 1 45  CYS 45  1719 1719 CYS CYS A . n 
A 1 46  ASP 46  1720 1720 ASP ASP A . n 
A 1 47  ILE 47  1721 1721 ILE ILE A . n 
A 1 48  ALA 48  1722 1722 ALA ALA A . n 
A 1 49  LEU 49  1723 1723 LEU LEU A . n 
A 1 50  LEU 50  1724 1724 LEU LEU A . n 
A 1 51  PRO 51  1725 1725 PRO PRO A . n 
A 1 52  GLU 52  1726 1726 GLU GLU A . n 
A 1 53  ASN 53  1727 1727 ASN ASN A . n 
A 1 54  ARG 54  1728 1728 ARG ARG A . n 
A 1 55  GLY 55  1729 1729 GLY GLY A . n 
A 1 56  LYS 56  1730 1730 LYS LYS A . n 
A 1 57  ASN 57  1731 1731 ASN ASN A . n 
A 1 58  ARG 58  1732 1732 ARG ARG A . n 
A 1 59  TYR 59  1733 1733 TYR TYR A . n 
A 1 60  ASN 60  1734 1734 ASN ASN A . n 
A 1 61  ASN 61  1735 1735 ASN ASN A . n 
A 1 62  ILE 62  1736 1736 ILE ILE A . n 
A 1 63  LEU 63  1737 1737 LEU LEU A . n 
A 1 64  PRO 64  1738 1738 PRO PRO A . n 
A 1 65  TYR 65  1739 1739 TYR TYR A . n 
A 1 66  ASP 66  1740 1740 ASP ASP A . n 
A 1 67  ALA 67  1741 1741 ALA ALA A . n 
A 1 68  THR 68  1742 1742 THR THR A . n 
A 1 69  ARG 69  1743 1743 ARG ARG A . n 
A 1 70  VAL 70  1744 1744 VAL VAL A . n 
A 1 71  LYS 71  1745 1745 LYS LYS A . n 
A 1 72  LEU 72  1746 1746 LEU LEU A . n 
A 1 73  SER 73  1747 1747 SER SER A . n 
A 1 74  GLY 74  1748 1748 GLY GLY A . n 
A 1 75  GLY 75  1749 1749 GLY GLY A . n 
A 1 76  SER 76  1755 1755 SER SER A . n 
A 1 77  ASP 77  1756 1756 ASP ASP A . n 
A 1 78  TYR 78  1757 1757 TYR TYR A . n 
A 1 79  ILE 79  1758 1758 ILE ILE A . n 
A 1 80  ASN 80  1759 1759 ASN ASN A . n 
A 1 81  ALA 81  1760 1760 ALA ALA A . n 
A 1 82  SER 82  1761 1761 SER SER A . n 
A 1 83  TYR 83  1762 1762 TYR TYR A . n 
A 1 84  ILE 84  1763 1763 ILE ILE A . n 
A 1 85  PRO 85  1764 1764 PRO PRO A . n 
A 1 86  GLY 86  1765 1765 GLY GLY A . n 
A 1 87  ASN 87  1766 1766 ASN ASN A . n 
A 1 88  ASN 88  1767 1767 ASN ASN A . n 
A 1 89  PHE 89  1768 1768 PHE PHE A . n 
A 1 90  ARG 90  1769 1769 ARG ARG A . n 
A 1 91  ARG 91  1770 1770 ARG ARG A . n 
A 1 92  GLU 92  1771 1771 GLU GLU A . n 
A 1 93  TYR 93  1772 1772 TYR TYR A . n 
A 1 94  ILE 94  1773 1773 ILE ILE A . n 
A 1 95  VAL 95  1774 1774 VAL VAL A . n 
A 1 96  THR 96  1775 1775 THR THR A . n 
A 1 97  GLN 97  1776 1776 GLN GLN A . n 
A 1 98  GLY 98  1777 1777 GLY GLY A . n 
A 1 99  PRO 99  1778 1778 PRO PRO A . n 
A 1 100 LEU 100 1779 1779 LEU LEU A . n 
A 1 101 PRO 101 1780 1780 PRO PRO A . n 
A 1 102 GLY 102 1781 1781 GLY GLY A . n 
A 1 103 THR 103 1782 1782 THR THR A . n 
A 1 104 LYS 104 1783 1783 LYS LYS A . n 
A 1 105 ASP 105 1784 1784 ASP ASP A . n 
A 1 106 ASP 106 1785 1785 ASP ASP A . n 
A 1 107 PHE 107 1786 1786 PHE PHE A . n 
A 1 108 TRP 108 1787 1787 TRP TRP A . n 
A 1 109 LYS 109 1788 1788 LYS LYS A . n 
A 1 110 MET 110 1789 1789 MET MET A . n 
A 1 111 VAL 111 1790 1790 VAL VAL A . n 
A 1 112 TRP 112 1791 1791 TRP TRP A . n 
A 1 113 GLU 113 1792 1792 GLU GLU A . n 
A 1 114 GLN 114 1793 1793 GLN GLN A . n 
A 1 115 ASN 115 1794 1794 ASN ASN A . n 
A 1 116 VAL 116 1795 1795 VAL VAL A . n 
A 1 117 HIS 117 1796 1796 HIS HIS A . n 
A 1 118 ASN 118 1797 1797 ASN ASN A . n 
A 1 119 ILE 119 1798 1798 ILE ILE A . n 
A 1 120 VAL 120 1799 1799 VAL VAL A . n 
A 1 121 MET 121 1800 1800 MET MET A . n 
A 1 122 VAL 122 1801 1801 VAL VAL A . n 
A 1 123 THR 123 1802 1802 THR THR A . n 
A 1 124 GLN 124 1803 1803 GLN GLN A . n 
A 1 125 CYS 125 1804 1804 CYS CYS A . n 
A 1 126 VAL 126 1805 1805 VAL VAL A . n 
A 1 127 GLU 127 1806 1806 GLU GLU A . n 
A 1 128 LYS 128 1807 1807 LYS LYS A . n 
A 1 129 GLY 129 1808 1808 GLY GLY A . n 
A 1 130 ARG 130 1809 1809 ARG ARG A . n 
A 1 131 VAL 131 1810 1810 VAL VAL A . n 
A 1 132 LYS 132 1811 1811 LYS LYS A . n 
A 1 133 CYS 133 1812 1812 CYS CYS A . n 
A 1 134 ASP 134 1813 1813 ASP ASP A . n 
A 1 135 HIS 135 1814 1814 HIS HIS A . n 
A 1 136 TYR 136 1815 1815 TYR TYR A . n 
A 1 137 TRP 137 1816 1816 TRP TRP A . n 
A 1 138 PRO 138 1817 1817 PRO PRO A . n 
A 1 139 ALA 139 1818 1818 ALA ALA A . n 
A 1 140 ASP 140 1819 1819 ASP ASP A . n 
A 1 141 GLN 141 1820 1820 GLN GLN A . n 
A 1 142 ASP 142 1821 1821 ASP ASP A . n 
A 1 143 SER 143 1822 1822 SER SER A . n 
A 1 144 LEU 144 1823 1823 LEU LEU A . n 
A 1 145 TYR 145 1824 1824 TYR TYR A . n 
A 1 146 TYR 146 1825 1825 TYR TYR A . n 
A 1 147 GLY 147 1826 1826 GLY GLY A . n 
A 1 148 ASP 148 1827 1827 ASP ASP A . n 
A 1 149 LEU 149 1828 1828 LEU LEU A . n 
A 1 150 ILE 150 1829 1829 ILE ILE A . n 
A 1 151 LEU 151 1830 1830 LEU LEU A . n 
A 1 152 GLN 152 1831 1831 GLN GLN A . n 
A 1 153 MET 153 1832 1832 MET MET A . n 
A 1 154 LEU 154 1833 1833 LEU LEU A . n 
A 1 155 SER 155 1834 1834 SER SER A . n 
A 1 156 GLU 156 1835 1835 GLU GLU A . n 
A 1 157 SER 157 1836 1836 SER SER A . n 
A 1 158 VAL 158 1837 1837 VAL VAL A . n 
A 1 159 LEU 159 1838 1838 LEU LEU A . n 
A 1 160 PRO 160 1839 1839 PRO PRO A . n 
A 1 161 GLU 161 1840 1840 GLU GLU A . n 
A 1 162 TRP 162 1841 1841 TRP TRP A . n 
A 1 163 THR 163 1842 1842 THR THR A . n 
A 1 164 ILE 164 1843 1843 ILE ILE A . n 
A 1 165 ARG 165 1844 1844 ARG ARG A . n 
A 1 166 GLU 166 1845 1845 GLU GLU A . n 
A 1 167 PHE 167 1846 1846 PHE PHE A . n 
A 1 168 LYS 168 1847 1847 LYS LYS A . n 
A 1 169 ILE 169 1848 1848 ILE ILE A . n 
A 1 170 CYS 170 1849 1849 CYS CYS A . n 
A 1 171 GLY 171 1850 1850 GLY GLY A . n 
A 1 172 GLU 172 1851 1851 GLU GLU A . n 
A 1 173 GLU 173 1852 1852 GLU GLU A . n 
A 1 174 GLN 174 1853 1853 GLN GLN A . n 
A 1 175 LEU 175 1854 1854 LEU LEU A . n 
A 1 176 ASP 176 1855 1855 ASP ASP A . n 
A 1 177 ALA 177 1856 1856 ALA ALA A . n 
A 1 178 HIS 178 1857 1857 HIS HIS A . n 
A 1 179 ARG 179 1858 1858 ARG ARG A . n 
A 1 180 LEU 180 1859 1859 LEU LEU A . n 
A 1 181 ILE 181 1860 1860 ILE ILE A . n 
A 1 182 ARG 182 1861 1861 ARG ARG A . n 
A 1 183 HIS 183 1862 1862 HIS HIS A . n 
A 1 184 PHE 184 1863 1863 PHE PHE A . n 
A 1 185 HIS 185 1864 1864 HIS HIS A . n 
A 1 186 TYR 186 1865 1865 TYR TYR A . n 
A 1 187 THR 187 1866 1866 THR THR A . n 
A 1 188 VAL 188 1867 1867 VAL VAL A . n 
A 1 189 TRP 189 1868 1868 TRP TRP A . n 
A 1 190 PRO 190 1869 1869 PRO PRO A . n 
A 1 191 ASP 191 1870 1870 ASP ASP A . n 
A 1 192 HIS 192 1871 1871 HIS HIS A . n 
A 1 193 GLY 193 1872 1872 GLY GLY A . n 
A 1 194 VAL 194 1873 1873 VAL VAL A . n 
A 1 195 PRO 195 1874 1874 PRO PRO A . n 
A 1 196 GLU 196 1875 1875 GLU GLU A . n 
A 1 197 THR 197 1876 1876 THR THR A . n 
A 1 198 THR 198 1877 1877 THR THR A . n 
A 1 199 GLN 199 1878 1878 GLN GLN A . n 
A 1 200 SER 200 1879 1879 SER SER A . n 
A 1 201 LEU 201 1880 1880 LEU LEU A . n 
A 1 202 ILE 202 1881 1881 ILE ILE A . n 
A 1 203 GLN 203 1882 1882 GLN GLN A . n 
A 1 204 PHE 204 1883 1883 PHE PHE A . n 
A 1 205 VAL 205 1884 1884 VAL VAL A . n 
A 1 206 ARG 206 1885 1885 ARG ARG A . n 
A 1 207 THR 207 1886 1886 THR THR A . n 
A 1 208 VAL 208 1887 1887 VAL VAL A . n 
A 1 209 ARG 209 1888 1888 ARG ARG A . n 
A 1 210 ASP 210 1889 1889 ASP ASP A . n 
A 1 211 TYR 211 1890 1890 TYR TYR A . n 
A 1 212 ILE 212 1891 1891 ILE ILE A . n 
A 1 213 ASN 213 1892 1892 ASN ASN A . n 
A 1 214 ARG 214 1893 1893 ARG ARG A . n 
A 1 215 SER 215 1894 1894 SER SER A . n 
A 1 216 PRO 216 1895 1895 PRO PRO A . n 
A 1 217 GLY 217 1896 1896 GLY GLY A . n 
A 1 218 ALA 218 1897 1897 ALA ALA A . n 
A 1 219 GLY 219 1898 1898 GLY GLY A . n 
A 1 220 PRO 220 1899 1899 PRO PRO A . n 
A 1 221 THR 221 1900 1900 THR THR A . n 
A 1 222 VAL 222 1901 1901 VAL VAL A . n 
A 1 223 VAL 223 1902 1902 VAL VAL A . n 
A 1 224 HIS 224 1903 1903 HIS HIS A . n 
A 1 225 CYS 225 1904 1904 CYS CYS A . n 
A 1 226 SER 226 1905 1905 SER SER A . n 
A 1 227 ALA 227 1906 1906 ALA ALA A . n 
A 1 228 GLY 228 1907 1907 GLY GLY A . n 
A 1 229 VAL 229 1908 1908 VAL VAL A . n 
A 1 230 GLY 230 1909 1909 GLY GLY A . n 
A 1 231 ARG 231 1910 1910 ARG ARG A . n 
A 1 232 THR 232 1911 1911 THR THR A . n 
A 1 233 GLY 233 1912 1912 GLY GLY A . n 
A 1 234 THR 234 1913 1913 THR THR A . n 
A 1 235 PHE 235 1914 1914 PHE PHE A . n 
A 1 236 ILE 236 1915 1915 ILE ILE A . n 
A 1 237 ALA 237 1916 1916 ALA ALA A . n 
A 1 238 LEU 238 1917 1917 LEU LEU A . n 
A 1 239 ASP 239 1918 1918 ASP ASP A . n 
A 1 240 ARG 240 1919 1919 ARG ARG A . n 
A 1 241 ILE 241 1920 1920 ILE ILE A . n 
A 1 242 LEU 242 1921 1921 LEU LEU A . n 
A 1 243 GLN 243 1922 1922 GLN GLN A . n 
A 1 244 GLN 244 1923 1923 GLN GLN A . n 
A 1 245 LEU 245 1924 1924 LEU LEU A . n 
A 1 246 ASP 246 1925 1925 ASP ASP A . n 
A 1 247 SER 247 1926 1926 SER SER A . n 
A 1 248 LYS 248 1927 1927 LYS LYS A . n 
A 1 249 ASP 249 1928 1928 ASP ASP A . n 
A 1 250 SER 250 1929 1929 SER SER A . n 
A 1 251 VAL 251 1930 1930 VAL VAL A . n 
A 1 252 ASP 252 1931 1931 ASP ASP A . n 
A 1 253 ILE 253 1932 1932 ILE ILE A . n 
A 1 254 TYR 254 1933 1933 TYR TYR A . n 
A 1 255 GLY 255 1934 1934 GLY GLY A . n 
A 1 256 ALA 256 1935 1935 ALA ALA A . n 
A 1 257 VAL 257 1936 1936 VAL VAL A . n 
A 1 258 HIS 258 1937 1937 HIS HIS A . n 
A 1 259 ASP 259 1938 1938 ASP ASP A . n 
A 1 260 LEU 260 1939 1939 LEU LEU A . n 
A 1 261 ARG 261 1940 1940 ARG ARG A . n 
A 1 262 LEU 262 1941 1941 LEU LEU A . n 
A 1 263 HIS 263 1942 1942 HIS HIS A . n 
A 1 264 ARG 264 1943 1943 ARG ARG A . n 
A 1 265 VAL 265 1944 1944 VAL VAL A . n 
A 1 266 HIS 266 1945 1945 HIS HIS A . n 
A 1 267 MET 267 1946 1946 MET MET A . n 
A 1 268 VAL 268 1947 1947 VAL VAL A . n 
A 1 269 GLN 269 1948 1948 GLN GLN A . n 
A 1 270 THR 270 1949 1949 THR THR A . n 
A 1 271 GLU 271 1950 1950 GLU GLU A . n 
A 1 272 CYS 272 1951 1951 CYS CYS A . n 
A 1 273 GLN 273 1952 1952 GLN GLN A . n 
A 1 274 TYR 274 1953 1953 TYR TYR A . n 
A 1 275 VAL 275 1954 1954 VAL VAL A . n 
A 1 276 TYR 276 1955 1955 TYR TYR A . n 
A 1 277 LEU 277 1956 1956 LEU LEU A . n 
A 1 278 HIS 278 1957 1957 HIS HIS A . n 
A 1 279 GLN 279 1958 1958 GLN GLN A . n 
A 1 280 CYS 280 1959 1959 CYS CYS A . n 
A 1 281 VAL 281 1960 1960 VAL VAL A . n 
A 1 282 ARG 282 1961 1961 ARG ARG A . n 
A 1 283 ASP 283 1962 1962 ASP ASP A . n 
A 1 284 VAL 284 1963 1963 VAL VAL A . n 
A 1 285 LEU 285 1964 1964 LEU LEU A . n 
A 1 286 ARG 286 1965 1965 ARG ARG A . n 
A 1 287 ALA 287 1966 1966 ALA ALA A . n 
A 1 288 ARG 288 1967 1967 ARG ARG A . n 
A 1 289 LYS 289 1968 1968 LYS LYS A . n 
A 1 290 LEU 290 1969 1969 LEU LEU A . n 
A 1 291 ARG 291 1970 1970 ARG ARG A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1   302 302 CL  CL  A . 
C 3 MG  1   303 303 MG  MG  A . 
D 3 MG  1   304 304 MG  MG  A . 
E 2 CL  1   305 305 CL  CL  A . 
F 4 3UN 1   401 401 3UN 3UN A . 
G 5 HOH 1   3   3   HOH HOH A . 
G 5 HOH 2   4   4   HOH HOH A . 
G 5 HOH 3   5   5   HOH HOH A . 
G 5 HOH 4   6   6   HOH HOH A . 
G 5 HOH 5   7   7   HOH HOH A . 
G 5 HOH 6   8   8   HOH HOH A . 
G 5 HOH 7   9   9   HOH HOH A . 
G 5 HOH 8   10  10  HOH HOH A . 
G 5 HOH 9   11  11  HOH HOH A . 
G 5 HOH 10  12  12  HOH HOH A . 
G 5 HOH 11  13  13  HOH HOH A . 
G 5 HOH 12  14  14  HOH HOH A . 
G 5 HOH 13  15  15  HOH HOH A . 
G 5 HOH 14  16  16  HOH HOH A . 
G 5 HOH 15  17  17  HOH HOH A . 
G 5 HOH 16  18  18  HOH HOH A . 
G 5 HOH 17  19  19  HOH HOH A . 
G 5 HOH 18  20  20  HOH HOH A . 
G 5 HOH 19  21  21  HOH HOH A . 
G 5 HOH 20  22  22  HOH HOH A . 
G 5 HOH 21  23  23  HOH HOH A . 
G 5 HOH 22  24  24  HOH HOH A . 
G 5 HOH 23  25  25  HOH HOH A . 
G 5 HOH 24  26  26  HOH HOH A . 
G 5 HOH 25  27  27  HOH HOH A . 
G 5 HOH 26  28  28  HOH HOH A . 
G 5 HOH 27  29  29  HOH HOH A . 
G 5 HOH 28  31  31  HOH HOH A . 
G 5 HOH 29  32  32  HOH HOH A . 
G 5 HOH 30  33  33  HOH HOH A . 
G 5 HOH 31  34  34  HOH HOH A . 
G 5 HOH 32  35  35  HOH HOH A . 
G 5 HOH 33  36  36  HOH HOH A . 
G 5 HOH 34  37  37  HOH HOH A . 
G 5 HOH 35  38  38  HOH HOH A . 
G 5 HOH 36  40  40  HOH HOH A . 
G 5 HOH 37  41  41  HOH HOH A . 
G 5 HOH 38  42  42  HOH HOH A . 
G 5 HOH 39  43  43  HOH HOH A . 
G 5 HOH 40  44  44  HOH HOH A . 
G 5 HOH 41  45  45  HOH HOH A . 
G 5 HOH 42  46  46  HOH HOH A . 
G 5 HOH 43  47  47  HOH HOH A . 
G 5 HOH 44  48  48  HOH HOH A . 
G 5 HOH 45  49  49  HOH HOH A . 
G 5 HOH 46  50  50  HOH HOH A . 
G 5 HOH 47  51  51  HOH HOH A . 
G 5 HOH 48  52  52  HOH HOH A . 
G 5 HOH 49  53  53  HOH HOH A . 
G 5 HOH 50  54  54  HOH HOH A . 
G 5 HOH 51  55  55  HOH HOH A . 
G 5 HOH 52  56  56  HOH HOH A . 
G 5 HOH 53  57  57  HOH HOH A . 
G 5 HOH 54  58  58  HOH HOH A . 
G 5 HOH 55  59  59  HOH HOH A . 
G 5 HOH 56  60  60  HOH HOH A . 
G 5 HOH 57  61  61  HOH HOH A . 
G 5 HOH 58  62  62  HOH HOH A . 
G 5 HOH 59  63  63  HOH HOH A . 
G 5 HOH 60  64  64  HOH HOH A . 
G 5 HOH 61  65  65  HOH HOH A . 
G 5 HOH 62  67  67  HOH HOH A . 
G 5 HOH 63  68  68  HOH HOH A . 
G 5 HOH 64  69  69  HOH HOH A . 
G 5 HOH 65  71  71  HOH HOH A . 
G 5 HOH 66  73  73  HOH HOH A . 
G 5 HOH 67  74  74  HOH HOH A . 
G 5 HOH 68  75  75  HOH HOH A . 
G 5 HOH 69  76  76  HOH HOH A . 
G 5 HOH 70  77  77  HOH HOH A . 
G 5 HOH 71  78  78  HOH HOH A . 
G 5 HOH 72  79  79  HOH HOH A . 
G 5 HOH 73  80  80  HOH HOH A . 
G 5 HOH 74  81  81  HOH HOH A . 
G 5 HOH 75  82  82  HOH HOH A . 
G 5 HOH 76  83  83  HOH HOH A . 
G 5 HOH 77  84  84  HOH HOH A . 
G 5 HOH 78  85  85  HOH HOH A . 
G 5 HOH 79  86  86  HOH HOH A . 
G 5 HOH 80  87  87  HOH HOH A . 
G 5 HOH 81  88  88  HOH HOH A . 
G 5 HOH 82  89  89  HOH HOH A . 
G 5 HOH 83  90  90  HOH HOH A . 
G 5 HOH 84  91  91  HOH HOH A . 
G 5 HOH 85  92  92  HOH HOH A . 
G 5 HOH 86  93  93  HOH HOH A . 
G 5 HOH 87  94  94  HOH HOH A . 
G 5 HOH 88  95  95  HOH HOH A . 
G 5 HOH 89  96  96  HOH HOH A . 
G 5 HOH 90  97  97  HOH HOH A . 
G 5 HOH 91  98  98  HOH HOH A . 
G 5 HOH 92  99  99  HOH HOH A . 
G 5 HOH 93  100 100 HOH HOH A . 
G 5 HOH 94  101 101 HOH HOH A . 
G 5 HOH 95  102 102 HOH HOH A . 
G 5 HOH 96  103 103 HOH HOH A . 
G 5 HOH 97  104 104 HOH HOH A . 
G 5 HOH 98  105 105 HOH HOH A . 
G 5 HOH 99  106 106 HOH HOH A . 
G 5 HOH 100 107 107 HOH HOH A . 
G 5 HOH 101 108 108 HOH HOH A . 
G 5 HOH 102 109 109 HOH HOH A . 
G 5 HOH 103 110 110 HOH HOH A . 
G 5 HOH 104 111 111 HOH HOH A . 
G 5 HOH 105 112 112 HOH HOH A . 
G 5 HOH 106 113 113 HOH HOH A . 
G 5 HOH 107 114 114 HOH HOH A . 
G 5 HOH 108 116 116 HOH HOH A . 
G 5 HOH 109 117 117 HOH HOH A . 
G 5 HOH 110 118 118 HOH HOH A . 
G 5 HOH 111 119 119 HOH HOH A . 
G 5 HOH 112 120 120 HOH HOH A . 
G 5 HOH 113 121 121 HOH HOH A . 
G 5 HOH 114 122 122 HOH HOH A . 
G 5 HOH 115 123 123 HOH HOH A . 
G 5 HOH 116 125 125 HOH HOH A . 
G 5 HOH 117 126 126 HOH HOH A . 
G 5 HOH 118 127 127 HOH HOH A . 
G 5 HOH 119 128 128 HOH HOH A . 
G 5 HOH 120 129 129 HOH HOH A . 
G 5 HOH 121 130 130 HOH HOH A . 
G 5 HOH 122 131 131 HOH HOH A . 
G 5 HOH 123 132 132 HOH HOH A . 
G 5 HOH 124 133 133 HOH HOH A . 
G 5 HOH 125 134 134 HOH HOH A . 
G 5 HOH 126 136 136 HOH HOH A . 
G 5 HOH 127 137 137 HOH HOH A . 
G 5 HOH 128 138 138 HOH HOH A . 
G 5 HOH 129 139 139 HOH HOH A . 
G 5 HOH 130 141 141 HOH HOH A . 
G 5 HOH 131 143 143 HOH HOH A . 
G 5 HOH 132 144 144 HOH HOH A . 
G 5 HOH 133 145 145 HOH HOH A . 
G 5 HOH 134 146 146 HOH HOH A . 
G 5 HOH 135 147 147 HOH HOH A . 
G 5 HOH 136 148 148 HOH HOH A . 
G 5 HOH 137 150 150 HOH HOH A . 
G 5 HOH 138 151 151 HOH HOH A . 
G 5 HOH 139 152 152 HOH HOH A . 
G 5 HOH 140 153 153 HOH HOH A . 
G 5 HOH 141 155 155 HOH HOH A . 
G 5 HOH 142 156 156 HOH HOH A . 
G 5 HOH 143 157 157 HOH HOH A . 
G 5 HOH 144 158 158 HOH HOH A . 
G 5 HOH 145 159 159 HOH HOH A . 
G 5 HOH 146 160 160 HOH HOH A . 
G 5 HOH 147 161 161 HOH HOH A . 
G 5 HOH 148 163 163 HOH HOH A . 
G 5 HOH 149 164 164 HOH HOH A . 
G 5 HOH 150 165 165 HOH HOH A . 
G 5 HOH 151 167 167 HOH HOH A . 
G 5 HOH 152 168 168 HOH HOH A . 
G 5 HOH 153 169 169 HOH HOH A . 
G 5 HOH 154 170 170 HOH HOH A . 
G 5 HOH 155 172 172 HOH HOH A . 
G 5 HOH 156 173 173 HOH HOH A . 
G 5 HOH 157 174 174 HOH HOH A . 
G 5 HOH 158 175 175 HOH HOH A . 
G 5 HOH 159 176 176 HOH HOH A . 
G 5 HOH 160 177 177 HOH HOH A . 
G 5 HOH 161 178 178 HOH HOH A . 
G 5 HOH 162 179 179 HOH HOH A . 
G 5 HOH 163 180 180 HOH HOH A . 
G 5 HOH 164 182 182 HOH HOH A . 
G 5 HOH 165 183 183 HOH HOH A . 
G 5 HOH 166 184 184 HOH HOH A . 
G 5 HOH 167 185 185 HOH HOH A . 
G 5 HOH 168 187 187 HOH HOH A . 
G 5 HOH 169 188 188 HOH HOH A . 
G 5 HOH 170 189 189 HOH HOH A . 
G 5 HOH 171 190 190 HOH HOH A . 
G 5 HOH 172 191 191 HOH HOH A . 
G 5 HOH 173 192 192 HOH HOH A . 
G 5 HOH 174 193 193 HOH HOH A . 
G 5 HOH 175 194 194 HOH HOH A . 
G 5 HOH 176 195 195 HOH HOH A . 
G 5 HOH 177 196 196 HOH HOH A . 
G 5 HOH 178 197 197 HOH HOH A . 
G 5 HOH 179 198 198 HOH HOH A . 
G 5 HOH 180 199 199 HOH HOH A . 
G 5 HOH 181 200 200 HOH HOH A . 
G 5 HOH 182 202 202 HOH HOH A . 
G 5 HOH 183 203 203 HOH HOH A . 
G 5 HOH 184 204 204 HOH HOH A . 
G 5 HOH 185 205 205 HOH HOH A . 
G 5 HOH 186 206 206 HOH HOH A . 
G 5 HOH 187 209 209 HOH HOH A . 
G 5 HOH 188 211 211 HOH HOH A . 
G 5 HOH 189 212 212 HOH HOH A . 
G 5 HOH 190 213 213 HOH HOH A . 
G 5 HOH 191 214 214 HOH HOH A . 
G 5 HOH 192 219 219 HOH HOH A . 
G 5 HOH 193 220 220 HOH HOH A . 
G 5 HOH 194 221 221 HOH HOH A . 
G 5 HOH 195 222 222 HOH HOH A . 
G 5 HOH 196 223 223 HOH HOH A . 
G 5 HOH 197 224 224 HOH HOH A . 
G 5 HOH 198 225 225 HOH HOH A . 
G 5 HOH 199 227 227 HOH HOH A . 
G 5 HOH 200 228 228 HOH HOH A . 
G 5 HOH 201 229 229 HOH HOH A . 
G 5 HOH 202 230 230 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric 1 
2 software_defined_assembly            PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G 
2 1,2 A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 3660  ? 
2 MORE         -88   ? 
2 'SSA (A^2)'  26120 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 96.4348629443 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 64.1247014014 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A MG  303 ? C MG  . 
2 1 A HOH 57  ? G HOH . 
3 1 A HOH 74  ? G HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? G HOH .   ? A HOH 56   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 57   ? 1_555 93.7  ? 
2  O   ? G HOH .   ? A HOH 56   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 74   ? 1_555 89.7  ? 
3  O   ? G HOH .   ? A HOH 57   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 74   ? 1_555 175.8 ? 
4  O   ? G HOH .   ? A HOH 56   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 76   ? 1_555 98.7  ? 
5  O   ? G HOH .   ? A HOH 57   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 76   ? 1_555 92.9  ? 
6  O   ? G HOH .   ? A HOH 74   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 76   ? 1_555 89.0  ? 
7  O   ? G HOH .   ? A HOH 56   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 56   ? 2_656 175.2 ? 
8  O   ? G HOH .   ? A HOH 57   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 56   ? 2_656 90.3  ? 
9  O   ? G HOH .   ? A HOH 74   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 56   ? 2_656 86.2  ? 
10 O   ? G HOH .   ? A HOH 76   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 56   ? 2_656 83.8  ? 
11 O   ? G HOH .   ? A HOH 56   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 76   ? 2_656 84.6  ? 
12 O   ? G HOH .   ? A HOH 57   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 76   ? 2_656 90.5  ? 
13 O   ? G HOH .   ? A HOH 74   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 76   ? 2_656 87.4  ? 
14 O   ? G HOH .   ? A HOH 76   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 76   ? 2_656 175.0 ? 
15 O   ? G HOH .   ? A HOH 56   ? 2_656 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 76   ? 2_656 92.6  ? 
16 O   ? G HOH .   ? A HOH 56   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 57   ? 2_656 93.7  ? 
17 O   ? G HOH .   ? A HOH 57   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 57   ? 2_656 0.0   ? 
18 O   ? G HOH .   ? A HOH 74   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 57   ? 2_656 175.8 ? 
19 O   ? G HOH .   ? A HOH 76   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 57   ? 2_656 92.9  ? 
20 O   ? G HOH .   ? A HOH 56   ? 2_656 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 57   ? 2_656 90.2  ? 
21 O   ? G HOH .   ? A HOH 76   ? 2_656 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 57   ? 2_656 90.5  ? 
22 O   ? G HOH .   ? A HOH 56   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 74   ? 2_656 89.4  ? 
23 O   ? G HOH .   ? A HOH 57   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 74   ? 2_656 175.7 ? 
24 O   ? G HOH .   ? A HOH 74   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 74   ? 2_656 0.7   ? 
25 O   ? G HOH .   ? A HOH 76   ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 74   ? 2_656 89.6  ? 
26 O   ? G HOH .   ? A HOH 56   ? 2_656 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 74   ? 2_656 86.5  ? 
27 O   ? G HOH .   ? A HOH 76   ? 2_656 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 74   ? 2_656 86.7  ? 
28 O   ? G HOH .   ? A HOH 57   ? 2_656 MG ? C MG . ? A MG 303 ? 1_555 O   ? G HOH .   ? A HOH 74   ? 2_656 175.6 ? 
29 O   ? G HOH .   ? A HOH 59   ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 O   ? G HOH .   ? A HOH 203  ? 1_555 175.9 ? 
30 O   ? G HOH .   ? A HOH 59   ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 O   ? G HOH .   ? A HOH 213  ? 1_555 80.3  ? 
31 O   ? G HOH .   ? A HOH 203  ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 O   ? G HOH .   ? A HOH 213  ? 1_555 97.5  ? 
32 O   ? G HOH .   ? A HOH 59   ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 O   ? G HOH .   ? A HOH 227  ? 1_555 85.8  ? 
33 O   ? G HOH .   ? A HOH 203  ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 O   ? G HOH .   ? A HOH 227  ? 1_555 90.9  ? 
34 O   ? G HOH .   ? A HOH 213  ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 O   ? G HOH .   ? A HOH 227  ? 1_555 91.9  ? 
35 O   ? G HOH .   ? A HOH 59   ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 OE2 ? A GLU 172 ? A GLU 1851 ? 2_656 92.1  ? 
36 O   ? G HOH .   ? A HOH 203  ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 OE2 ? A GLU 172 ? A GLU 1851 ? 2_656 90.3  ? 
37 O   ? G HOH .   ? A HOH 213  ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 OE2 ? A GLU 172 ? A GLU 1851 ? 2_656 171.7 ? 
38 O   ? G HOH .   ? A HOH 227  ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 OE2 ? A GLU 172 ? A GLU 1851 ? 2_656 91.0  ? 
39 O   ? G HOH .   ? A HOH 59   ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 OD1 ? A ASP 148 ? A ASP 1827 ? 2_656 90.3  ? 
40 O   ? G HOH .   ? A HOH 203  ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 OD1 ? A ASP 148 ? A ASP 1827 ? 2_656 92.9  ? 
41 O   ? G HOH .   ? A HOH 213  ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 OD1 ? A ASP 148 ? A ASP 1827 ? 2_656 84.9  ? 
42 O   ? G HOH .   ? A HOH 227  ? 1_555 MG ? D MG . ? A MG 304 ? 1_555 OD1 ? A ASP 148 ? A ASP 1827 ? 2_656 175.3 ? 
43 OE2 ? A GLU 172 ? A GLU 1851 ? 2_656 MG ? D MG . ? A MG 304 ? 1_555 OD1 ? A ASP 148 ? A ASP 1827 ? 2_656 91.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-13 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      .     ?                program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran_77 ? 1 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++        ? 2 
MAR345      .     ?                ?       ?                 ?                        'data collection' ? ?          ? 3 
HKL-2000    .     ?                ?       ?                 ?                        'data scaling'    ? ?          ? 4 
AMoRE       .     ?                ?       ?                 ?                        phasing           ? ?          ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  A HOH 104  ? ? O A HOH 222 ? ? 1.65 
2 1 O  A HOH 3    ? ? O A HOH 204 ? ? 1.84 
3 1 NZ A LYS 1927 ? ? O A HOH 204 ? ? 2.01 
4 1 O  A HOH 106  ? ? O A HOH 221 ? ? 2.03 
5 1 O  A HOH 33   ? ? O A HOH 204 ? ? 2.06 
6 1 O  A HOH 14   ? ? O A HOH 205 ? ? 2.07 
7 1 CB A CYS 1951 ? B O A HOH 187 ? ? 2.09 
8 1 O  A HOH 14   ? ? O A HOH 228 ? ? 2.11 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              1918 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              1918 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              1918 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                124.63 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            6.33 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 1716 ? ? -90.01  33.64   
2 1 ASP A 1819 ? ? -129.95 -152.55 
3 1 GLN A 1853 ? ? -157.95 79.62   
4 1 PRO A 1895 ? ? -42.60  103.67  
5 1 CYS A 1904 ? ? -131.55 -125.56 
6 1 VAL A 1908 ? ? -132.34 -49.09  
7 1 VAL A 1947 ? ? 66.09   86.16   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   SER 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    1894 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    1895 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -146.71 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 1675 ? A SER 1 
2 1 Y 1 A ASN 1676 ? A ASN 2 
3 1 Y 1 A ARG 1677 ? A ARG 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION'                                                                         CL  
3 'MAGNESIUM ION'                                                                        MG  
4 '(4-{4-[(TERT-BUTOXYCARBONYL)AMINO]-2,2-BIS(ETHOXYCARBONYL)BUTYL}PHENYL)SULFAMIC ACID' 3UN 
5 water                                                                                  HOH 
#