data_2H04
# 
_entry.id   2H04 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2H04         
RCSB  RCSB037762   
WWPDB D_1000037762 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HO2 'Structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors' unspecified 
PDB 2HO3 'Structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors' unspecified 
# 
_pdbx_database_status.entry_id                        2H04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-05-13 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Evdokimov, A.G.'   1  
'Pokross, M.E.'     2  
'Walter, R.L.'      3  
'Mekel, M.'         4  
'Gray, J.L.'        5  
'Peters, K.G.'      6  
'Maier, M.B.'       7  
'Amarasinghe, K.D.' 8  
'Clark, C.M.'       9  
'Nichols, R.'       10 
# 
_citation.id                        primary 
_citation.title                     'Design and synthesis of potent, non-peptidic inhibitors of HPTPbeta.' 
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_volume            16 
_citation.page_first                4252 
_citation.page_last                 4256 
_citation.year                      2006 
_citation.journal_id_ASTM           BMCLE8 
_citation.country                   UK 
_citation.journal_id_ISSN           0960-894X 
_citation.journal_id_CSD            1127 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16759857 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2006.05.074 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Amarasinghe, K.K.' 1  
primary 'Evdokimov, A.G.'   2  
primary 'Xu, K.'            3  
primary 'Clark, C.M.'       4  
primary 'Maier, M.B.'       5  
primary 'Srivastava, A.'    6  
primary 'Colson, A.O.'      7  
primary 'Gerwe, G.S.'       8  
primary 'Stake, G.E.'       9  
primary 'Howard, B.W.'      10 
primary 'Pokross, M.E.'     11 
primary 'Gray, J.L.'        12 
primary 'Peters, K.G.'      13 
# 
_cell.entry_id           2H04 
_cell.length_a           44.803 
_cell.length_b           70.120 
_cell.length_c           90.722 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2H04 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein tyrosine phosphatase, receptor type, B,'                                36288.035 1   3.1.3.48 ? 
'catalytic domain, residues 1662-1973' ? 
2 non-polymer syn '{4-[2,2-BIS(5-METHYL-1,2,4-OXADIAZOL-3-YL)-3-PHENYLPROPYL]PHENYL}SULFAMIC ACID' 455.487   1   ?        ? ? ? 
3 water       nat water                                                                            18.015    141 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYD
ATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQ
DSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPT
VVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYD
ATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQ
DSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPT
VVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASP n 
1 3   ARG n 
1 4   PRO n 
1 5   LEU n 
1 6   SER n 
1 7   VAL n 
1 8   HIS n 
1 9   LEU n 
1 10  ASN n 
1 11  LEU n 
1 12  GLY n 
1 13  GLN n 
1 14  LYS n 
1 15  GLY n 
1 16  ASN n 
1 17  ARG n 
1 18  LYS n 
1 19  THR n 
1 20  SER n 
1 21  CYS n 
1 22  PRO n 
1 23  ILE n 
1 24  LYS n 
1 25  ILE n 
1 26  ASN n 
1 27  GLN n 
1 28  PHE n 
1 29  GLU n 
1 30  GLY n 
1 31  HIS n 
1 32  PHE n 
1 33  MET n 
1 34  LYS n 
1 35  LEU n 
1 36  GLN n 
1 37  ALA n 
1 38  ASP n 
1 39  SER n 
1 40  ASN n 
1 41  TYR n 
1 42  LEU n 
1 43  LEU n 
1 44  SER n 
1 45  LYS n 
1 46  GLU n 
1 47  TYR n 
1 48  GLU n 
1 49  GLU n 
1 50  LEU n 
1 51  LYS n 
1 52  ASP n 
1 53  VAL n 
1 54  GLY n 
1 55  ARG n 
1 56  ASN n 
1 57  GLN n 
1 58  SER n 
1 59  CYS n 
1 60  ASP n 
1 61  ILE n 
1 62  ALA n 
1 63  LEU n 
1 64  LEU n 
1 65  PRO n 
1 66  GLU n 
1 67  ASN n 
1 68  ARG n 
1 69  GLY n 
1 70  LYS n 
1 71  ASN n 
1 72  ARG n 
1 73  TYR n 
1 74  ASN n 
1 75  ASN n 
1 76  ILE n 
1 77  LEU n 
1 78  PRO n 
1 79  TYR n 
1 80  ASP n 
1 81  ALA n 
1 82  THR n 
1 83  ARG n 
1 84  VAL n 
1 85  LYS n 
1 86  LEU n 
1 87  SER n 
1 88  ASN n 
1 89  VAL n 
1 90  ASP n 
1 91  ASP n 
1 92  ASP n 
1 93  PRO n 
1 94  CYS n 
1 95  SER n 
1 96  ASP n 
1 97  TYR n 
1 98  ILE n 
1 99  ASN n 
1 100 ALA n 
1 101 SER n 
1 102 TYR n 
1 103 ILE n 
1 104 PRO n 
1 105 GLY n 
1 106 ASN n 
1 107 ASN n 
1 108 PHE n 
1 109 ARG n 
1 110 ARG n 
1 111 GLU n 
1 112 TYR n 
1 113 ILE n 
1 114 VAL n 
1 115 THR n 
1 116 GLN n 
1 117 GLY n 
1 118 PRO n 
1 119 LEU n 
1 120 PRO n 
1 121 GLY n 
1 122 THR n 
1 123 LYS n 
1 124 ASP n 
1 125 ASP n 
1 126 PHE n 
1 127 TRP n 
1 128 LYS n 
1 129 MET n 
1 130 VAL n 
1 131 TRP n 
1 132 GLU n 
1 133 GLN n 
1 134 ASN n 
1 135 VAL n 
1 136 HIS n 
1 137 ASN n 
1 138 ILE n 
1 139 VAL n 
1 140 MET n 
1 141 VAL n 
1 142 THR n 
1 143 GLN n 
1 144 CYS n 
1 145 VAL n 
1 146 GLU n 
1 147 LYS n 
1 148 GLY n 
1 149 ARG n 
1 150 VAL n 
1 151 LYS n 
1 152 CYS n 
1 153 ASP n 
1 154 HIS n 
1 155 TYR n 
1 156 TRP n 
1 157 PRO n 
1 158 ALA n 
1 159 ASP n 
1 160 GLN n 
1 161 ASP n 
1 162 SER n 
1 163 LEU n 
1 164 TYR n 
1 165 TYR n 
1 166 GLY n 
1 167 ASP n 
1 168 LEU n 
1 169 ILE n 
1 170 LEU n 
1 171 GLN n 
1 172 MET n 
1 173 LEU n 
1 174 SER n 
1 175 GLU n 
1 176 SER n 
1 177 VAL n 
1 178 LEU n 
1 179 PRO n 
1 180 GLU n 
1 181 TRP n 
1 182 THR n 
1 183 ILE n 
1 184 ARG n 
1 185 GLU n 
1 186 PHE n 
1 187 LYS n 
1 188 ILE n 
1 189 CYS n 
1 190 GLY n 
1 191 GLU n 
1 192 GLU n 
1 193 GLN n 
1 194 LEU n 
1 195 ASP n 
1 196 ALA n 
1 197 HIS n 
1 198 ARG n 
1 199 LEU n 
1 200 ILE n 
1 201 ARG n 
1 202 HIS n 
1 203 PHE n 
1 204 HIS n 
1 205 TYR n 
1 206 THR n 
1 207 VAL n 
1 208 TRP n 
1 209 PRO n 
1 210 ASP n 
1 211 HIS n 
1 212 GLY n 
1 213 VAL n 
1 214 PRO n 
1 215 GLU n 
1 216 THR n 
1 217 THR n 
1 218 GLN n 
1 219 SER n 
1 220 LEU n 
1 221 ILE n 
1 222 GLN n 
1 223 PHE n 
1 224 VAL n 
1 225 ARG n 
1 226 THR n 
1 227 VAL n 
1 228 ARG n 
1 229 ASP n 
1 230 TYR n 
1 231 ILE n 
1 232 ASN n 
1 233 ARG n 
1 234 SER n 
1 235 PRO n 
1 236 GLY n 
1 237 ALA n 
1 238 GLY n 
1 239 PRO n 
1 240 THR n 
1 241 VAL n 
1 242 VAL n 
1 243 HIS n 
1 244 CYS n 
1 245 SER n 
1 246 ALA n 
1 247 GLY n 
1 248 VAL n 
1 249 GLY n 
1 250 ARG n 
1 251 THR n 
1 252 GLY n 
1 253 THR n 
1 254 PHE n 
1 255 ILE n 
1 256 ALA n 
1 257 LEU n 
1 258 ASP n 
1 259 ARG n 
1 260 ILE n 
1 261 LEU n 
1 262 GLN n 
1 263 GLN n 
1 264 LEU n 
1 265 ASP n 
1 266 SER n 
1 267 LYS n 
1 268 ASP n 
1 269 SER n 
1 270 VAL n 
1 271 ASP n 
1 272 ILE n 
1 273 TYR n 
1 274 GLY n 
1 275 ALA n 
1 276 VAL n 
1 277 HIS n 
1 278 ASP n 
1 279 LEU n 
1 280 ARG n 
1 281 LEU n 
1 282 HIS n 
1 283 ARG n 
1 284 VAL n 
1 285 HIS n 
1 286 MET n 
1 287 VAL n 
1 288 GLN n 
1 289 THR n 
1 290 GLU n 
1 291 CYS n 
1 292 GLN n 
1 293 TYR n 
1 294 VAL n 
1 295 TYR n 
1 296 LEU n 
1 297 HIS n 
1 298 GLN n 
1 299 CYS n 
1 300 VAL n 
1 301 ARG n 
1 302 ASP n 
1 303 VAL n 
1 304 LEU n 
1 305 ARG n 
1 306 ALA n 
1 307 ARG n 
1 308 LYS n 
1 309 LEU n 
1 310 ARG n 
1 311 SER n 
1 312 GLU n 
1 313 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PTPRB 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               TOP10 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pDEST-HisMBP 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q3MIV7_HUMAN 
_struct_ref.pdbx_db_accession          Q3MIV7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDA
TRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQD
SLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTV
VHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQ
;
_struct_ref.pdbx_align_begin           1662 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2H04 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 313 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q3MIV7 
_struct_ref_seq.db_align_beg                  1662 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1973 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1662 
_struct_ref_seq.pdbx_auth_seq_align_end       1973 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4UN non-polymer         . '{4-[2,2-BIS(5-METHYL-1,2,4-OXADIAZOL-3-YL)-3-PHENYLPROPYL]PHENYL}SULFAMIC ACID' ? 'C21 H21 N5 O5 S' 
455.487 
ALA 'L-peptide linking' y ALANINE                                                                          ? 'C3 H7 N O2'      
89.093  
ARG 'L-peptide linking' y ARGININE                                                                         ? 'C6 H15 N4 O2 1'  
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                       ? 'C4 H8 N2 O3'     
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                  ? 'C4 H7 N O4'      
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                         ? 'C3 H7 N O2 S'    
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                        ? 'C5 H10 N2 O3'    
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                  ? 'C5 H9 N O4'      
147.129 
GLY 'peptide linking'   y GLYCINE                                                                          ? 'C2 H5 N O2'      
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                        ? 'C6 H10 N3 O2 1'  
156.162 
HOH non-polymer         . WATER                                                                            ? 'H2 O'            
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                       ? 'C6 H13 N O2'     
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                          ? 'C6 H13 N O2'     
131.173 
LYS 'L-peptide linking' y LYSINE                                                                           ? 'C6 H15 N2 O2 1'  
147.195 
MET 'L-peptide linking' y METHIONINE                                                                       ? 'C5 H11 N O2 S'   
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                    ? 'C9 H11 N O2'     
165.189 
PRO 'L-peptide linking' y PROLINE                                                                          ? 'C5 H9 N O2'      
115.130 
SER 'L-peptide linking' y SERINE                                                                           ? 'C3 H7 N O3'      
105.093 
THR 'L-peptide linking' y THREONINE                                                                        ? 'C4 H9 N O3'      
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                       ? 'C11 H12 N2 O2'   
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                         ? 'C9 H11 N O3'     
181.189 
VAL 'L-peptide linking' y VALINE                                                                           ? 'C5 H11 N O2'     
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2H04 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.96 
_exptl_crystal.density_percent_sol   37.28 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'21% PEG 8000, 220 mM MgCl2, 1% BME, 0.1% BOG, 5mM DTT, pH 8.0, vapor diffusion, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-03-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
# 
_reflns.entry_id                     2H04 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.3 
_reflns.d_resolution_low             34.86 
_reflns.number_all                   13248 
_reflns.number_obs                   13248 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.88 
_reflns.B_iso_Wilson_estimate        22 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   98.3 
_reflns_shell.Rmerge_I_obs           0.37 
_reflns_shell.meanI_over_sigI_obs    2.83 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.number_unique_all      1529 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2H04 
_refine.ls_d_res_high                            2.300 
_refine.ls_d_res_low                             34.86 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.650 
_refine.ls_number_reflns_obs                     13207 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.172 
_refine.ls_R_factor_R_work                       0.169 
_refine.ls_R_factor_R_free                       0.238 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_number_reflns_R_free                  649 
_refine.B_iso_mean                               16.455 
_refine.aniso_B[1][1]                            0.120 
_refine.aniso_B[2][2]                            -0.230 
_refine.aniso_B[3][3]                            0.110 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.906 
_refine.pdbx_overall_ESU_R                       0.381 
_refine.pdbx_overall_ESU_R_Free                  0.248 
_refine.overall_SU_ML                            0.157 
_refine.overall_SU_B                             11.831 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     13207 
_refine.ls_R_factor_obs                          0.17 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1RPM (WITH MODIFICATIONS)' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2300 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             141 
_refine_hist.number_atoms_total               2473 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        34.86 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         2391 0.009  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      3246 2.155  1.955  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   281  8.347  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   123  36.525 23.496 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   406  19.278 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   20   18.391 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           344  0.145  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1843 0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1078 0.222  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1589 0.319  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    168  0.193  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   35   0.257  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 19   0.329  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1425 1.702  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2276 2.793  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1090 4.613  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             968  6.463  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               97.830 
_refine_ls_shell.number_reflns_R_work             899 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.175 
_refine_ls_shell.R_factor_R_free                  0.374 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             49 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                948 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2H04 
_struct.title                     
'Structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors' 
_struct.pdbx_descriptor           'protein tyrosine phosphatase beta catalytic domain, inhibitors' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2H04 
_struct_keywords.text            
'protein tyrosine phosphatase, WPD-loop, sulfamic acid, phosphatase, inhibitor, drug design, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 27  ? GLN A 36  ? GLN A 1687 GLN A 1696 1 ? 10 
HELX_P HELX_P2 2 GLN A 36  ? LEU A 50  ? GLN A 1696 LEU A 1710 1 ? 15 
HELX_P HELX_P3 3 LEU A 64  ? ASN A 71  ? LEU A 1724 ASN A 1731 5 ? 8  
HELX_P HELX_P4 4 THR A 122 ? GLN A 133 ? THR A 1782 GLN A 1793 1 ? 12 
HELX_P HELX_P5 5 THR A 216 ? ARG A 233 ? THR A 1876 ARG A 1893 1 ? 18 
HELX_P HELX_P6 6 VAL A 248 ? LEU A 264 ? VAL A 1908 LEU A 1924 1 ? 17 
HELX_P HELX_P7 7 ASP A 271 ? ARG A 283 ? ASP A 1931 ARG A 1943 1 ? 13 
HELX_P HELX_P8 8 THR A 289 ? LYS A 308 ? THR A 1949 LYS A 1968 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
B 8 9 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 23  ? LYS A 24  ? ILE A 1683 LYS A 1684 
A 2 SER A 269 ? VAL A 270 ? SER A 1929 VAL A 1930 
B 1 ARG A 83  ? LYS A 85  ? ARG A 1743 LYS A 1745 
B 2 TYR A 97  ? ILE A 103 ? TYR A 1757 ILE A 1763 
B 3 TYR A 112 ? THR A 115 ? TYR A 1772 THR A 1775 
B 4 THR A 240 ? HIS A 243 ? THR A 1900 HIS A 1903 
B 5 ASN A 137 ? MET A 140 ? ASN A 1797 MET A 1800 
B 6 ARG A 198 ? TYR A 205 ? ARG A 1858 TYR A 1865 
B 7 TRP A 181 ? CYS A 189 ? TRP A 1841 CYS A 1849 
B 8 LEU A 168 ? VAL A 177 ? LEU A 1828 VAL A 1837 
B 9 LEU A 163 ? TYR A 165 ? LEU A 1823 TYR A 1825 
C 1 VAL A 145 ? GLU A 146 ? VAL A 1805 GLU A 1806 
C 2 ARG A 149 ? VAL A 150 ? ARG A 1809 VAL A 1810 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 23  ? N ILE A 1683 O VAL A 270 ? O VAL A 1930 
B 1 2 N VAL A 84  ? N VAL A 1744 O ALA A 100 ? O ALA A 1760 
B 2 3 N SER A 101 ? N SER A 1761 O VAL A 114 ? O VAL A 1774 
B 3 4 N ILE A 113 ? N ILE A 1773 O THR A 240 ? O THR A 1900 
B 4 5 O VAL A 241 ? O VAL A 1901 N VAL A 139 ? N VAL A 1799 
B 5 6 N ILE A 138 ? N ILE A 1798 O PHE A 203 ? O PHE A 1863 
B 6 7 O ILE A 200 ? O ILE A 1860 N PHE A 186 ? N PHE A 1846 
B 7 8 O GLU A 185 ? O GLU A 1845 N LEU A 173 ? N LEU A 1833 
B 8 9 O LEU A 170 ? O LEU A 1830 N LEU A 163 ? N LEU A 1823 
C 1 2 N GLU A 146 ? N GLU A 1806 O ARG A 149 ? O ARG A 1809 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    18 
_struct_site.details              'BINDING SITE FOR RESIDUE 4UN A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 HOH C .   ? HOH A 15   . ? 1_555 ? 
2  AC1 18 TYR A 73  ? TYR A 1733 . ? 1_555 ? 
3  AC1 18 ASN A 74  ? ASN A 1734 . ? 1_555 ? 
4  AC1 18 ASN A 75  ? ASN A 1735 . ? 1_555 ? 
5  AC1 18 TYR A 164 ? TYR A 1824 . ? 3_555 ? 
6  AC1 18 ASP A 167 ? ASP A 1827 . ? 3_555 ? 
7  AC1 18 GLU A 191 ? GLU A 1851 . ? 3_555 ? 
8  AC1 18 ASP A 210 ? ASP A 1870 . ? 1_555 ? 
9  AC1 18 HIS A 211 ? HIS A 1871 . ? 1_555 ? 
10 AC1 18 CYS A 244 ? CYS A 1904 . ? 1_555 ? 
11 AC1 18 SER A 245 ? SER A 1905 . ? 1_555 ? 
12 AC1 18 ALA A 246 ? ALA A 1906 . ? 1_555 ? 
13 AC1 18 GLY A 247 ? GLY A 1907 . ? 1_555 ? 
14 AC1 18 VAL A 248 ? VAL A 1908 . ? 1_555 ? 
15 AC1 18 GLY A 249 ? GLY A 1909 . ? 1_555 ? 
16 AC1 18 ARG A 250 ? ARG A 1910 . ? 1_555 ? 
17 AC1 18 HIS A 285 ? HIS A 1945 . ? 1_555 ? 
18 AC1 18 GLN A 288 ? GLN A 1948 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2H04 
_atom_sites.fract_transf_matrix[1][1]   0.022320 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014261 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011023 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 18  ? -5.099  38.291 -4.341 1.00 32.57 ? 1678 LYS A N   1 
ATOM   2    C CA  . LYS A 1 18  ? -3.686  38.494 -3.884 1.00 35.19 ? 1678 LYS A CA  1 
ATOM   3    C C   . LYS A 1 18  ? -3.107  37.227 -3.245 1.00 32.41 ? 1678 LYS A C   1 
ATOM   4    O O   . LYS A 1 18  ? -3.508  36.801 -2.159 1.00 32.23 ? 1678 LYS A O   1 
ATOM   5    C CB  . LYS A 1 18  ? -3.634  39.664 -2.894 1.00 36.95 ? 1678 LYS A CB  1 
ATOM   6    C CG  . LYS A 1 18  ? -2.304  40.421 -2.759 1.00 38.67 ? 1678 LYS A CG  1 
ATOM   7    C CD  . LYS A 1 18  ? -2.440  41.510 -1.671 1.00 38.99 ? 1678 LYS A CD  1 
ATOM   8    C CE  . LYS A 1 18  ? -1.427  42.642 -1.795 1.00 44.36 ? 1678 LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 18  ? -1.206  43.362 -0.506 1.00 46.21 ? 1678 LYS A NZ  1 
ATOM   10   N N   . THR A 1 19  ? -2.158  36.605 -3.933 1.00 31.24 ? 1679 THR A N   1 
ATOM   11   C CA  . THR A 1 19  ? -1.473  35.443 -3.377 1.00 29.64 ? 1679 THR A CA  1 
ATOM   12   C C   . THR A 1 19  ? -0.014  35.673 -2.961 1.00 26.64 ? 1679 THR A C   1 
ATOM   13   O O   . THR A 1 19  ? 0.581   34.820 -2.308 1.00 25.40 ? 1679 THR A O   1 
ATOM   14   C CB  . THR A 1 19  ? -1.579  34.253 -4.335 1.00 28.66 ? 1679 THR A CB  1 
ATOM   15   O OG1 . THR A 1 19  ? -0.810  34.561 -5.502 1.00 35.64 ? 1679 THR A OG1 1 
ATOM   16   C CG2 . THR A 1 19  ? -3.030  34.031 -4.738 1.00 26.34 ? 1679 THR A CG2 1 
ATOM   17   N N   . SER A 1 20  ? 0.549   36.826 -3.310 1.00 26.42 ? 1680 SER A N   1 
ATOM   18   C CA  . SER A 1 20  ? 1.982   37.051 -3.273 1.00 27.47 ? 1680 SER A CA  1 
ATOM   19   C C   . SER A 1 20  ? 2.243   38.558 -3.307 1.00 29.52 ? 1680 SER A C   1 
ATOM   20   O O   . SER A 1 20  ? 1.609   39.261 -4.087 1.00 29.71 ? 1680 SER A O   1 
ATOM   21   C CB  . SER A 1 20  ? 2.608   36.329 -4.473 1.00 29.20 ? 1680 SER A CB  1 
ATOM   22   O OG  . SER A 1 20  ? 3.768   36.961 -4.987 1.00 28.75 ? 1680 SER A OG  1 
ATOM   23   N N   . CYS A 1 21  ? 3.138   39.066 -2.455 1.00 29.66 ? 1681 CYS A N   1 
ATOM   24   C CA  . CYS A 1 21  ? 3.619   40.447 -2.531 1.00 29.28 ? 1681 CYS A CA  1 
ATOM   25   C C   . CYS A 1 21  ? 5.131   40.468 -2.340 1.00 27.20 ? 1681 CYS A C   1 
ATOM   26   O O   . CYS A 1 21  ? 5.607   40.734 -1.232 1.00 23.21 ? 1681 CYS A O   1 
ATOM   27   C CB  . CYS A 1 21  ? 3.011   41.350 -1.456 1.00 30.90 ? 1681 CYS A CB  1 
ATOM   28   S SG  . CYS A 1 21  ? 1.306   41.882 -1.723 1.00 44.99 ? 1681 CYS A SG  1 
ATOM   29   N N   . PRO A 1 22  ? 5.880   40.198 -3.425 1.00 26.76 ? 1682 PRO A N   1 
ATOM   30   C CA  . PRO A 1 22  ? 7.340   40.138 -3.379 1.00 26.57 ? 1682 PRO A CA  1 
ATOM   31   C C   . PRO A 1 22  ? 7.891   41.541 -3.142 1.00 25.79 ? 1682 PRO A C   1 
ATOM   32   O O   . PRO A 1 22  ? 7.316   42.518 -3.622 1.00 25.60 ? 1682 PRO A O   1 
ATOM   33   C CB  . PRO A 1 22  ? 7.724   39.653 -4.779 1.00 26.47 ? 1682 PRO A CB  1 
ATOM   34   C CG  . PRO A 1 22  ? 6.462   39.160 -5.405 1.00 26.58 ? 1682 PRO A CG  1 
ATOM   35   C CD  . PRO A 1 22  ? 5.365   39.961 -4.787 1.00 26.69 ? 1682 PRO A CD  1 
ATOM   36   N N   . ILE A 1 23  ? 8.977   41.643 -2.386 1.00 25.62 ? 1683 ILE A N   1 
ATOM   37   C CA  . ILE A 1 23  ? 9.604   42.934 -2.128 1.00 25.62 ? 1683 ILE A CA  1 
ATOM   38   C C   . ILE A 1 23  ? 11.081  42.750 -2.420 1.00 25.44 ? 1683 ILE A C   1 
ATOM   39   O O   . ILE A 1 23  ? 11.733  41.928 -1.779 1.00 23.74 ? 1683 ILE A O   1 
ATOM   40   C CB  . ILE A 1 23  ? 9.410   43.367 -0.661 1.00 26.94 ? 1683 ILE A CB  1 
ATOM   41   C CG1 . ILE A 1 23  ? 7.973   43.106 -0.204 1.00 23.19 ? 1683 ILE A CG1 1 
ATOM   42   C CG2 . ILE A 1 23  ? 9.761   44.843 -0.446 1.00 27.78 ? 1683 ILE A CG2 1 
ATOM   43   C CD1 . ILE A 1 23  ? 7.806   43.189 1.290  1.00 27.70 ? 1683 ILE A CD1 1 
ATOM   44   N N   . LYS A 1 24  ? 11.586  43.488 -3.407 1.00 26.17 ? 1684 LYS A N   1 
ATOM   45   C CA  . LYS A 1 24  ? 13.026  43.578 -3.669 1.00 26.03 ? 1684 LYS A CA  1 
ATOM   46   C C   . LYS A 1 24  ? 13.896  43.893 -2.447 1.00 25.58 ? 1684 LYS A C   1 
ATOM   47   O O   . LYS A 1 24  ? 13.685  44.857 -1.705 1.00 25.03 ? 1684 LYS A O   1 
ATOM   48   C CB  . LYS A 1 24  ? 13.316  44.581 -4.788 1.00 26.88 ? 1684 LYS A CB  1 
ATOM   49   C CG  . LYS A 1 24  ? 12.438  44.462 -6.030 1.00 30.26 ? 1684 LYS A CG  1 
ATOM   50   C CD  . LYS A 1 24  ? 13.128  43.658 -7.134 1.00 38.96 ? 1684 LYS A CD  1 
ATOM   51   C CE  . LYS A 1 24  ? 12.235  42.563 -7.748 1.00 43.05 ? 1684 LYS A CE  1 
ATOM   52   N NZ  . LYS A 1 24  ? 12.579  42.229 -9.168 1.00 36.50 ? 1684 LYS A NZ  1 
ATOM   53   N N   . ILE A 1 25  ? 14.893  43.042 -2.243 1.00 27.47 ? 1685 ILE A N   1 
ATOM   54   C CA  . ILE A 1 25  ? 15.912  43.214 -1.216 1.00 28.68 ? 1685 ILE A CA  1 
ATOM   55   C C   . ILE A 1 25  ? 16.350  44.661 -1.054 1.00 29.70 ? 1685 ILE A C   1 
ATOM   56   O O   . ILE A 1 25  ? 16.447  45.159 0.068  1.00 30.18 ? 1685 ILE A O   1 
ATOM   57   C CB  . ILE A 1 25  ? 17.118  42.296 -1.504 1.00 28.76 ? 1685 ILE A CB  1 
ATOM   58   C CG1 . ILE A 1 25  ? 16.945  40.973 -0.760 1.00 28.92 ? 1685 ILE A CG1 1 
ATOM   59   C CG2 . ILE A 1 25  ? 18.429  42.939 -1.112 1.00 34.88 ? 1685 ILE A CG2 1 
ATOM   60   C CD1 . ILE A 1 25  ? 15.519  40.540 -0.788 1.00 21.61 ? 1685 ILE A CD1 1 
ATOM   61   N N   . ASN A 1 26  ? 16.610  45.337 -2.168 1.00 31.51 ? 1686 ASN A N   1 
ATOM   62   C CA  . ASN A 1 26  ? 17.029  46.745 -2.146 1.00 33.31 ? 1686 ASN A CA  1 
ATOM   63   C C   . ASN A 1 26  ? 15.930  47.764 -1.821 1.00 33.25 ? 1686 ASN A C   1 
ATOM   64   O O   . ASN A 1 26  ? 16.242  48.923 -1.522 1.00 32.23 ? 1686 ASN A O   1 
ATOM   65   C CB  . ASN A 1 26  ? 17.666  47.112 -3.487 1.00 34.24 ? 1686 ASN A CB  1 
ATOM   66   C CG  . ASN A 1 26  ? 16.913  46.497 -4.645 1.00 38.09 ? 1686 ASN A CG  1 
ATOM   67   O OD1 . ASN A 1 26  ? 16.186  47.182 -5.367 1.00 43.72 ? 1686 ASN A OD1 1 
ATOM   68   N ND2 . ASN A 1 26  ? 17.051  45.181 -4.803 1.00 42.59 ? 1686 ASN A ND2 1 
ATOM   69   N N   . GLN A 1 27  ? 14.664  47.344 -1.885 1.00 32.38 ? 1687 GLN A N   1 
ATOM   70   C CA  . GLN A 1 27  ? 13.525  48.212 -1.581 1.00 32.27 ? 1687 GLN A CA  1 
ATOM   71   C C   . GLN A 1 27  ? 12.972  48.026 -0.164 1.00 30.21 ? 1687 GLN A C   1 
ATOM   72   O O   . GLN A 1 27  ? 12.117  48.797 0.281  1.00 28.39 ? 1687 GLN A O   1 
ATOM   73   C CB  . GLN A 1 27  ? 12.381  48.005 -2.580 1.00 33.65 ? 1687 GLN A CB  1 
ATOM   74   C CG  . GLN A 1 27  ? 12.759  48.096 -4.059 1.00 39.33 ? 1687 GLN A CG  1 
ATOM   75   C CD  . GLN A 1 27  ? 13.100  49.504 -4.501 1.00 47.32 ? 1687 GLN A CD  1 
ATOM   76   O OE1 . GLN A 1 27  ? 12.747  50.487 -3.844 1.00 46.57 ? 1687 GLN A OE1 1 
ATOM   77   N NE2 . GLN A 1 27  ? 13.801  49.605 -5.626 1.00 52.03 ? 1687 GLN A NE2 1 
ATOM   78   N N   . PHE A 1 28  ? 13.467  47.001 0.528  1.00 27.34 ? 1688 PHE A N   1 
ATOM   79   C CA  . PHE A 1 28  ? 12.850  46.503 1.751  1.00 23.80 ? 1688 PHE A CA  1 
ATOM   80   C C   . PHE A 1 28  ? 12.792  47.462 2.937  1.00 25.17 ? 1688 PHE A C   1 
ATOM   81   O O   . PHE A 1 28  ? 11.737  47.644 3.556  1.00 25.20 ? 1688 PHE A O   1 
ATOM   82   C CB  . PHE A 1 28  ? 13.481  45.165 2.153  1.00 23.70 ? 1688 PHE A CB  1 
ATOM   83   C CG  . PHE A 1 28  ? 12.662  44.400 3.151  1.00 16.72 ? 1688 PHE A CG  1 
ATOM   84   C CD1 . PHE A 1 28  ? 11.774  43.437 2.731  1.00 15.50 ? 1688 PHE A CD1 1 
ATOM   85   C CD2 . PHE A 1 28  ? 12.756  44.681 4.498  1.00 18.89 ? 1688 PHE A CD2 1 
ATOM   86   C CE1 . PHE A 1 28  ? 11.014  42.750 3.643  1.00 20.92 ? 1688 PHE A CE1 1 
ATOM   87   C CE2 . PHE A 1 28  ? 11.990  44.006 5.425  1.00 20.89 ? 1688 PHE A CE2 1 
ATOM   88   C CZ  . PHE A 1 28  ? 11.124  43.031 4.996  1.00 22.68 ? 1688 PHE A CZ  1 
ATOM   89   N N   . GLU A 1 29  ? 13.923  48.080 3.257  1.00 25.51 ? 1689 GLU A N   1 
ATOM   90   C CA  . GLU A 1 29  ? 13.989  49.016 4.371  1.00 27.08 ? 1689 GLU A CA  1 
ATOM   91   C C   . GLU A 1 29  ? 12.922  50.119 4.258  1.00 28.83 ? 1689 GLU A C   1 
ATOM   92   O O   . GLU A 1 29  ? 12.155  50.375 5.206  1.00 29.00 ? 1689 GLU A O   1 
ATOM   93   C CB  . GLU A 1 29  ? 15.412  49.577 4.470  1.00 27.22 ? 1689 GLU A CB  1 
ATOM   94   C CG  . GLU A 1 29  ? 15.642  50.613 5.567  1.00 32.11 ? 1689 GLU A CG  1 
ATOM   95   C CD  . GLU A 1 29  ? 15.821  49.983 6.938  1.00 35.41 ? 1689 GLU A CD  1 
ATOM   96   O OE1 . GLU A 1 29  ? 16.640  49.041 7.053  1.00 37.25 ? 1689 GLU A OE1 1 
ATOM   97   O OE2 . GLU A 1 29  ? 15.156  50.437 7.896  1.00 32.36 ? 1689 GLU A OE2 1 
ATOM   98   N N   . GLY A 1 30  ? 12.869  50.768 3.095  1.00 27.05 ? 1690 GLY A N   1 
ATOM   99   C CA  . GLY A 1 30  ? 11.865  51.792 2.852  1.00 25.39 ? 1690 GLY A CA  1 
ATOM   100  C C   . GLY A 1 30  ? 10.460  51.223 2.782  1.00 24.81 ? 1690 GLY A C   1 
ATOM   101  O O   . GLY A 1 30  ? 9.521   51.784 3.352  1.00 24.41 ? 1690 GLY A O   1 
ATOM   102  N N   . HIS A 1 31  ? 10.294  50.106 2.079  1.00 24.28 ? 1691 HIS A N   1 
ATOM   103  C CA  . HIS A 1 31  ? 9.005   49.427 2.067  1.00 24.14 ? 1691 HIS A CA  1 
ATOM   104  C C   . HIS A 1 31  ? 8.457   49.114 3.467  1.00 23.98 ? 1691 HIS A C   1 
ATOM   105  O O   . HIS A 1 31  ? 7.277   49.350 3.749  1.00 24.86 ? 1691 HIS A O   1 
ATOM   106  C CB  . HIS A 1 31  ? 9.067   48.145 1.248  1.00 23.77 ? 1691 HIS A CB  1 
ATOM   107  C CG  . HIS A 1 31  ? 7.755   47.430 1.180  1.00 28.20 ? 1691 HIS A CG  1 
ATOM   108  N ND1 . HIS A 1 31  ? 6.692   47.902 0.439  1.00 32.01 ? 1691 HIS A ND1 1 
ATOM   109  C CD2 . HIS A 1 31  ? 7.319   46.299 1.787  1.00 30.69 ? 1691 HIS A CD2 1 
ATOM   110  C CE1 . HIS A 1 31  ? 5.669   47.075 0.571  1.00 31.18 ? 1691 HIS A CE1 1 
ATOM   111  N NE2 . HIS A 1 31  ? 6.018   46.101 1.393  1.00 28.86 ? 1691 HIS A NE2 1 
ATOM   112  N N   . PHE A 1 32  ? 9.303   48.557 4.330  1.00 22.59 ? 1692 PHE A N   1 
ATOM   113  C CA  . PHE A 1 32  ? 8.871   48.115 5.650  1.00 20.84 ? 1692 PHE A CA  1 
ATOM   114  C C   . PHE A 1 32  ? 8.570   49.303 6.556  1.00 20.71 ? 1692 PHE A C   1 
ATOM   115  O O   . PHE A 1 32  ? 7.606   49.247 7.331  1.00 20.06 ? 1692 PHE A O   1 
ATOM   116  C CB  . PHE A 1 32  ? 9.867   47.106 6.242  1.00 20.59 ? 1692 PHE A CB  1 
ATOM   117  C CG  . PHE A 1 32  ? 9.561   46.661 7.648  1.00 17.60 ? 1692 PHE A CG  1 
ATOM   118  C CD1 . PHE A 1 32  ? 8.303   46.179 7.993  1.00 12.87 ? 1692 PHE A CD1 1 
ATOM   119  C CD2 . PHE A 1 32  ? 10.550  46.719 8.626  1.00 16.68 ? 1692 PHE A CD2 1 
ATOM   120  C CE1 . PHE A 1 32  ? 8.034   45.762 9.290  1.00 13.28 ? 1692 PHE A CE1 1 
ATOM   121  C CE2 . PHE A 1 32  ? 10.295  46.314 9.930  1.00 13.74 ? 1692 PHE A CE2 1 
ATOM   122  C CZ  . PHE A 1 32  ? 9.029   45.832 10.263 1.00 13.13 ? 1692 PHE A CZ  1 
ATOM   123  N N   . MET A 1 33  ? 9.372   50.362 6.419  1.00 21.17 ? 1693 MET A N   1 
ATOM   124  C CA  . MET A 1 33  ? 9.116   51.672 7.022  1.00 22.61 ? 1693 MET A CA  1 
ATOM   125  C C   . MET A 1 33  ? 7.686   52.096 6.722  1.00 20.84 ? 1693 MET A C   1 
ATOM   126  O O   . MET A 1 33  ? 6.935   52.495 7.614  1.00 20.02 ? 1693 MET A O   1 
ATOM   127  C CB  . MET A 1 33  ? 10.044  52.754 6.453  1.00 24.76 ? 1693 MET A CB  1 
ATOM   128  C CG  . MET A 1 33  ? 11.479  52.762 6.945  1.00 31.30 ? 1693 MET A CG  1 
ATOM   129  S SD  . MET A 1 33  ? 11.681  52.922 8.740  1.00 50.74 ? 1693 MET A SD  1 
ATOM   130  C CE  . MET A 1 33  ? 13.322  53.669 8.859  1.00 38.41 ? 1693 MET A CE  1 
ATOM   131  N N   . LYS A 1 34  ? 7.332   51.981 5.448  1.00 19.70 ? 1694 LYS A N   1 
ATOM   132  C CA  . LYS A 1 34  ? 6.015   52.324 4.923  1.00 21.00 ? 1694 LYS A CA  1 
ATOM   133  C C   . LYS A 1 34  ? 4.861   51.470 5.450  1.00 19.78 ? 1694 LYS A C   1 
ATOM   134  O O   . LYS A 1 34  ? 3.815   52.002 5.831  1.00 17.76 ? 1694 LYS A O   1 
ATOM   135  C CB  . LYS A 1 34  ? 6.042   52.248 3.391  1.00 21.91 ? 1694 LYS A CB  1 
ATOM   136  C CG  . LYS A 1 34  ? 5.192   53.304 2.709  1.00 29.61 ? 1694 LYS A CG  1 
ATOM   137  C CD  . LYS A 1 34  ? 4.226   52.769 1.634  1.00 39.72 ? 1694 LYS A CD  1 
ATOM   138  C CE  . LYS A 1 34  ? 3.004   53.705 1.530  1.00 43.25 ? 1694 LYS A CE  1 
ATOM   139  N NZ  . LYS A 1 34  ? 2.247   53.781 0.234  1.00 45.36 ? 1694 LYS A NZ  1 
ATOM   140  N N   . LEU A 1 35  ? 5.048   50.152 5.437  1.00 17.84 ? 1695 LEU A N   1 
ATOM   141  C CA  . LEU A 1 35  ? 4.216   49.223 6.212  1.00 19.87 ? 1695 LEU A CA  1 
ATOM   142  C C   . LEU A 1 35  ? 3.924   49.587 7.678  1.00 17.79 ? 1695 LEU A C   1 
ATOM   143  O O   . LEU A 1 35  ? 2.783   49.452 8.135  1.00 17.59 ? 1695 LEU A O   1 
ATOM   144  C CB  . LEU A 1 35  ? 4.789   47.798 6.138  1.00 20.30 ? 1695 LEU A CB  1 
ATOM   145  C CG  . LEU A 1 35  ? 4.808   47.176 4.739  1.00 22.25 ? 1695 LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 35  ? 5.693   45.945 4.732  1.00 22.20 ? 1695 LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 35  ? 3.391   46.849 4.230  1.00 14.78 ? 1695 LEU A CD2 1 
ATOM   148  N N   . GLN A 1 36  ? 4.939   50.039 8.408  1.00 16.35 ? 1696 GLN A N   1 
ATOM   149  C CA  . GLN A 1 36  ? 4.796   50.316 9.839  1.00 17.23 ? 1696 GLN A CA  1 
ATOM   150  C C   . GLN A 1 36  ? 4.190   51.675 10.134 1.00 17.31 ? 1696 GLN A C   1 
ATOM   151  O O   . GLN A 1 36  ? 3.967   52.005 11.297 1.00 18.50 ? 1696 GLN A O   1 
ATOM   152  C CB  . GLN A 1 36  ? 6.144   50.272 10.564 1.00 17.67 ? 1696 GLN A CB  1 
ATOM   153  C CG  . GLN A 1 36  ? 6.779   48.908 10.712 1.00 18.10 ? 1696 GLN A CG  1 
ATOM   154  C CD  . GLN A 1 36  ? 8.238   49.056 11.067 1.00 20.66 ? 1696 GLN A CD  1 
ATOM   155  O OE1 . GLN A 1 36  ? 8.653   48.795 12.198 1.00 21.88 ? 1696 GLN A OE1 1 
ATOM   156  N NE2 . GLN A 1 36  ? 9.032   49.486 10.094 1.00 19.77 ? 1696 GLN A NE2 1 
ATOM   157  N N   . ALA A 1 37  ? 3.931   52.461 9.099  1.00 17.39 ? 1697 ALA A N   1 
ATOM   158  C CA  . ALA A 1 37  ? 3.498   53.840 9.277  1.00 20.01 ? 1697 ALA A CA  1 
ATOM   159  C C   . ALA A 1 37  ? 2.052   53.843 9.791  1.00 22.23 ? 1697 ALA A C   1 
ATOM   160  O O   . ALA A 1 37  ? 1.339   52.849 9.647  1.00 21.04 ? 1697 ALA A O   1 
ATOM   161  C CB  . ALA A 1 37  ? 3.630   54.641 7.959  1.00 17.71 ? 1697 ALA A CB  1 
ATOM   162  N N   . ASP A 1 38  ? 1.640   54.953 10.405 1.00 21.08 ? 1698 ASP A N   1 
ATOM   163  C CA  . ASP A 1 38  ? 0.322   55.064 11.004 1.00 22.48 ? 1698 ASP A CA  1 
ATOM   164  C C   . ASP A 1 38  ? -0.135  53.869 11.849 1.00 21.70 ? 1698 ASP A C   1 
ATOM   165  O O   . ASP A 1 38  ? -1.239  53.336 11.679 1.00 22.82 ? 1698 ASP A O   1 
ATOM   166  C CB  . ASP A 1 38  ? -0.659  55.593 9.954  1.00 24.00 ? 1698 ASP A CB  1 
ATOM   167  C CG  . ASP A 1 38  ? -0.126  56.875 9.301  1.00 31.81 ? 1698 ASP A CG  1 
ATOM   168  O OD1 . ASP A 1 38  ? 0.365   56.833 8.149  1.00 33.93 ? 1698 ASP A OD1 1 
ATOM   169  O OD2 . ASP A 1 38  ? -0.146  57.942 9.960  1.00 34.61 ? 1698 ASP A OD2 1 
ATOM   170  N N   . SER A 1 39  ? 0.739   53.469 12.777 1.00 19.78 ? 1699 SER A N   1 
ATOM   171  C CA  . SER A 1 39  ? 0.500   52.354 13.685 1.00 17.45 ? 1699 SER A CA  1 
ATOM   172  C C   . SER A 1 39  ? 0.399   51.019 12.924 1.00 18.22 ? 1699 SER A C   1 
ATOM   173  O O   . SER A 1 39  ? -0.550  50.246 13.119 1.00 16.38 ? 1699 SER A O   1 
ATOM   174  C CB  . SER A 1 39  ? -0.778  52.631 14.486 1.00 17.36 ? 1699 SER A CB  1 
ATOM   175  O OG  . SER A 1 39  ? -0.546  52.624 15.879 1.00 15.46 ? 1699 SER A OG  1 
ATOM   176  N N   . ASN A 1 40  ? 1.369   50.735 12.056 1.00 16.00 ? 1700 ASN A N   1 
ATOM   177  C CA  . ASN A 1 40  ? 1.350   49.471 11.312 1.00 17.59 ? 1700 ASN A CA  1 
ATOM   178  C C   . ASN A 1 40  ? 0.128   49.341 10.396 1.00 18.92 ? 1700 ASN A C   1 
ATOM   179  O O   . ASN A 1 40  ? -0.433  48.254 10.189 1.00 19.21 ? 1700 ASN A O   1 
ATOM   180  C CB  . ASN A 1 40  ? 1.357   48.301 12.286 1.00 14.38 ? 1700 ASN A CB  1 
ATOM   181  C CG  . ASN A 1 40  ? 2.709   48.037 12.876 1.00 11.92 ? 1700 ASN A CG  1 
ATOM   182  O OD1 . ASN A 1 40  ? 2.884   47.075 13.620 1.00 18.83 ? 1700 ASN A OD1 1 
ATOM   183  N ND2 . ASN A 1 40  ? 3.681   48.871 12.547 1.00 14.81 ? 1700 ASN A ND2 1 
ATOM   184  N N   . TYR A 1 41  ? -0.312  50.476 9.865  1.00 20.26 ? 1701 TYR A N   1 
ATOM   185  C CA  . TYR A 1 41  ? -1.554  50.475 9.111  1.00 22.62 ? 1701 TYR A CA  1 
ATOM   186  C C   . TYR A 1 41  ? -1.526  49.601 7.868  1.00 21.66 ? 1701 TYR A C   1 
ATOM   187  O O   . TYR A 1 41  ? -2.446  48.820 7.699  1.00 21.44 ? 1701 TYR A O   1 
ATOM   188  C CB  . TYR A 1 41  ? -2.035  51.889 8.780  1.00 26.36 ? 1701 TYR A CB  1 
ATOM   189  C CG  . TYR A 1 41  ? -3.268  51.920 7.901  1.00 28.33 ? 1701 TYR A CG  1 
ATOM   190  C CD1 . TYR A 1 41  ? -4.541  51.784 8.441  1.00 30.00 ? 1701 TYR A CD1 1 
ATOM   191  C CD2 . TYR A 1 41  ? -3.146  52.079 6.529  1.00 29.56 ? 1701 TYR A CD2 1 
ATOM   192  C CE1 . TYR A 1 41  ? -5.661  51.807 7.630  1.00 35.77 ? 1701 TYR A CE1 1 
ATOM   193  C CE2 . TYR A 1 41  ? -4.252  52.107 5.714  1.00 35.84 ? 1701 TYR A CE2 1 
ATOM   194  C CZ  . TYR A 1 41  ? -5.511  51.972 6.265  1.00 36.52 ? 1701 TYR A CZ  1 
ATOM   195  O OH  . TYR A 1 41  ? -6.608  52.003 5.424  1.00 37.48 ? 1701 TYR A OH  1 
ATOM   196  N N   . LEU A 1 42  ? -0.530  49.724 6.993  1.00 22.36 ? 1702 LEU A N   1 
ATOM   197  C CA  . LEU A 1 42  ? -0.525  48.875 5.802  1.00 22.71 ? 1702 LEU A CA  1 
ATOM   198  C C   . LEU A 1 42  ? -0.263  47.404 6.134  1.00 21.98 ? 1702 LEU A C   1 
ATOM   199  O O   . LEU A 1 42  ? -0.739  46.500 5.456  1.00 22.48 ? 1702 LEU A O   1 
ATOM   200  C CB  . LEU A 1 42  ? 0.484   49.362 4.754  1.00 23.38 ? 1702 LEU A CB  1 
ATOM   201  C CG  . LEU A 1 42  ? 0.068   50.329 3.640  1.00 25.09 ? 1702 LEU A CG  1 
ATOM   202  C CD1 . LEU A 1 42  ? -1.346  50.880 3.812  1.00 26.15 ? 1702 LEU A CD1 1 
ATOM   203  C CD2 . LEU A 1 42  ? 1.079   51.463 3.592  1.00 21.44 ? 1702 LEU A CD2 1 
ATOM   204  N N   . LEU A 1 43  ? 0.515   47.162 7.181  1.00 22.10 ? 1703 LEU A N   1 
ATOM   205  C CA  . LEU A 1 43  ? 0.698   45.825 7.720  1.00 21.83 ? 1703 LEU A CA  1 
ATOM   206  C C   . LEU A 1 43  ? -0.623  45.150 8.117  1.00 20.82 ? 1703 LEU A C   1 
ATOM   207  O O   . LEU A 1 43  ? -0.866  44.004 7.765  1.00 20.57 ? 1703 LEU A O   1 
ATOM   208  C CB  . LEU A 1 43  ? 1.635   45.922 8.923  1.00 21.59 ? 1703 LEU A CB  1 
ATOM   209  C CG  . LEU A 1 43  ? 2.616   44.749 8.889  1.00 27.34 ? 1703 LEU A CG  1 
ATOM   210  C CD1 . LEU A 1 43  ? 4.054   45.243 8.999  1.00 25.06 ? 1703 LEU A CD1 1 
ATOM   211  C CD2 . LEU A 1 43  ? 2.201   43.715 9.947  1.00 23.56 ? 1703 LEU A CD2 1 
ATOM   212  N N   . SER A 1 44  ? -1.481  45.858 8.846  1.00 20.78 ? 1704 SER A N   1 
ATOM   213  C CA  . SER A 1 44  ? -2.737  45.319 9.356  1.00 20.68 ? 1704 SER A CA  1 
ATOM   214  C C   . SER A 1 44  ? -3.647  44.975 8.207  1.00 19.10 ? 1704 SER A C   1 
ATOM   215  O O   . SER A 1 44  ? -4.424  44.035 8.319  1.00 18.05 ? 1704 SER A O   1 
ATOM   216  C CB  . SER A 1 44  ? -3.518  46.353 10.175 1.00 21.48 ? 1704 SER A CB  1 
ATOM   217  O OG  . SER A 1 44  ? -3.004  46.448 11.481 1.00 26.27 ? 1704 SER A OG  1 
ATOM   218  N N   . LYS A 1 45  ? -3.562  45.764 7.141  1.00 18.45 ? 1705 LYS A N   1 
ATOM   219  C CA  . LYS A 1 45  ? -4.318  45.487 5.928  1.00 18.99 ? 1705 LYS A CA  1 
ATOM   220  C C   . LYS A 1 45  ? -3.872  44.209 5.224  1.00 17.90 ? 1705 LYS A C   1 
ATOM   221  O O   . LYS A 1 45  ? -4.736  43.402 4.882  1.00 18.89 ? 1705 LYS A O   1 
ATOM   222  C CB  . LYS A 1 45  ? -4.279  46.679 4.967  1.00 19.27 ? 1705 LYS A CB  1 
ATOM   223  C CG  . LYS A 1 45  ? -5.003  47.907 5.513  1.00 27.06 ? 1705 LYS A CG  1 
ATOM   224  C CD  . LYS A 1 45  ? -6.439  48.051 5.014  1.00 35.43 ? 1705 LYS A CD  1 
ATOM   225  C CE  . LYS A 1 45  ? -7.454  47.735 6.110  1.00 42.42 ? 1705 LYS A CE  1 
ATOM   226  N NZ  . LYS A 1 45  ? -8.501  48.797 6.196  1.00 42.16 ? 1705 LYS A NZ  1 
ATOM   227  N N   . GLU A 1 46  ? -2.570  44.019 4.994  1.00 17.50 ? 1706 GLU A N   1 
ATOM   228  C CA  . GLU A 1 46  ? -2.064  42.751 4.443  1.00 16.02 ? 1706 GLU A CA  1 
ATOM   229  C C   . GLU A 1 46  ? -2.442  41.571 5.331  1.00 17.57 ? 1706 GLU A C   1 
ATOM   230  O O   . GLU A 1 46  ? -2.955  40.572 4.841  1.00 20.41 ? 1706 GLU A O   1 
ATOM   231  C CB  . GLU A 1 46  ? -0.543  42.722 4.308  1.00 15.29 ? 1706 GLU A CB  1 
ATOM   232  C CG  . GLU A 1 46  ? 0.048   43.663 3.304  1.00 14.38 ? 1706 GLU A CG  1 
ATOM   233  C CD  . GLU A 1 46  ? 1.489   43.351 2.955  1.00 19.08 ? 1706 GLU A CD  1 
ATOM   234  O OE1 . GLU A 1 46  ? 2.067   44.180 2.225  1.00 24.86 ? 1706 GLU A OE1 1 
ATOM   235  O OE2 . GLU A 1 46  ? 2.063   42.324 3.379  1.00 14.58 ? 1706 GLU A OE2 1 
ATOM   236  N N   . TYR A 1 47  ? -2.185  41.680 6.629  1.00 17.64 ? 1707 TYR A N   1 
ATOM   237  C CA  . TYR A 1 47  ? -2.543  40.619 7.564  1.00 19.46 ? 1707 TYR A CA  1 
ATOM   238  C C   . TYR A 1 47  ? -4.035  40.279 7.520  1.00 19.32 ? 1707 TYR A C   1 
ATOM   239  O O   . TYR A 1 47  ? -4.451  39.119 7.613  1.00 18.07 ? 1707 TYR A O   1 
ATOM   240  C CB  . TYR A 1 47  ? -2.136  40.986 8.999  1.00 18.01 ? 1707 TYR A CB  1 
ATOM   241  C CG  . TYR A 1 47  ? -2.117  39.751 9.884  1.00 19.99 ? 1707 TYR A CG  1 
ATOM   242  C CD1 . TYR A 1 47  ? -1.187  38.747 9.657  1.00 15.69 ? 1707 TYR A CD1 1 
ATOM   243  C CD2 . TYR A 1 47  ? -3.053  39.561 10.902 1.00 13.74 ? 1707 TYR A CD2 1 
ATOM   244  C CE1 . TYR A 1 47  ? -1.177  37.612 10.422 1.00 16.40 ? 1707 TYR A CE1 1 
ATOM   245  C CE2 . TYR A 1 47  ? -3.044  38.419 11.680 1.00 10.24 ? 1707 TYR A CE2 1 
ATOM   246  C CZ  . TYR A 1 47  ? -2.104  37.459 11.433 1.00 16.15 ? 1707 TYR A CZ  1 
ATOM   247  O OH  . TYR A 1 47  ? -2.054  36.325 12.207 1.00 19.49 ? 1707 TYR A OH  1 
ATOM   248  N N   . GLU A 1 48  ? -4.838  41.327 7.387  1.00 18.96 ? 1708 GLU A N   1 
ATOM   249  C CA  . GLU A 1 48  ? -6.281  41.184 7.283  1.00 20.50 ? 1708 GLU A CA  1 
ATOM   250  C C   . GLU A 1 48  ? -6.668  40.488 5.975  1.00 17.95 ? 1708 GLU A C   1 
ATOM   251  O O   . GLU A 1 48  ? -7.531  39.609 5.937  1.00 15.69 ? 1708 GLU A O   1 
ATOM   252  C CB  . GLU A 1 48  ? -6.937  42.567 7.413  1.00 21.12 ? 1708 GLU A CB  1 
ATOM   253  C CG  . GLU A 1 48  ? -8.446  42.590 7.230  1.00 32.67 ? 1708 GLU A CG  1 
ATOM   254  C CD  . GLU A 1 48  ? -9.196  41.650 8.172  1.00 46.25 ? 1708 GLU A CD  1 
ATOM   255  O OE1 . GLU A 1 48  ? -8.573  41.082 9.107  1.00 47.35 ? 1708 GLU A OE1 1 
ATOM   256  O OE2 . GLU A 1 48  ? -10.425 41.491 7.963  1.00 48.55 ? 1708 GLU A OE2 1 
ATOM   257  N N   . GLU A 1 49  ? -6.001  40.862 4.893  1.00 14.94 ? 1709 GLU A N   1 
ATOM   258  C CA  . GLU A 1 49  ? -6.190  40.128 3.658  1.00 17.79 ? 1709 GLU A CA  1 
ATOM   259  C C   . GLU A 1 49  ? -5.919  38.621 3.656  1.00 15.82 ? 1709 GLU A C   1 
ATOM   260  O O   . GLU A 1 49  ? -6.553  37.902 2.894  1.00 15.19 ? 1709 GLU A O   1 
ATOM   261  C CB  . GLU A 1 49  ? -5.453  40.808 2.510  1.00 19.58 ? 1709 GLU A CB  1 
ATOM   262  C CG  . GLU A 1 49  ? -6.383  41.066 1.352  1.00 31.29 ? 1709 GLU A CG  1 
ATOM   263  C CD  . GLU A 1 49  ? -5.638  41.710 0.209  1.00 45.46 ? 1709 GLU A CD  1 
ATOM   264  O OE1 . GLU A 1 49  ? -5.870  41.306 -0.957 1.00 48.68 ? 1709 GLU A OE1 1 
ATOM   265  O OE2 . GLU A 1 49  ? -4.812  42.602 0.518  1.00 49.93 ? 1709 GLU A OE2 1 
ATOM   266  N N   . LEU A 1 50  ? -4.998  38.147 4.491  1.00 14.15 ? 1710 LEU A N   1 
ATOM   267  C CA  . LEU A 1 50  ? -4.711  36.716 4.664  1.00 13.50 ? 1710 LEU A CA  1 
ATOM   268  C C   . LEU A 1 50  ? -5.798  35.945 5.420  1.00 13.62 ? 1710 LEU A C   1 
ATOM   269  O O   . LEU A 1 50  ? -5.748  34.713 5.469  1.00 12.86 ? 1710 LEU A O   1 
ATOM   270  C CB  . LEU A 1 50  ? -3.376  36.522 5.409  1.00 7.66  ? 1710 LEU A CB  1 
ATOM   271  C CG  . LEU A 1 50  ? -2.190  37.029 4.606  1.00 13.29 ? 1710 LEU A CG  1 
ATOM   272  C CD1 . LEU A 1 50  ? -0.871  37.306 5.381  1.00 7.08  ? 1710 LEU A CD1 1 
ATOM   273  C CD2 . LEU A 1 50  ? -2.030  36.107 3.392  1.00 11.24 ? 1710 LEU A CD2 1 
ATOM   274  N N   . LYS A 1 51  ? -6.757  36.652 6.017  1.00 14.76 ? 1711 LYS A N   1 
ATOM   275  C CA  . LYS A 1 51  ? -7.545  36.123 7.134  1.00 17.30 ? 1711 LYS A CA  1 
ATOM   276  C C   . LYS A 1 51  ? -8.358  34.883 6.770  1.00 19.14 ? 1711 LYS A C   1 
ATOM   277  O O   . LYS A 1 51  ? -8.486  33.931 7.566  1.00 16.66 ? 1711 LYS A O   1 
ATOM   278  C CB  . LYS A 1 51  ? -8.506  37.201 7.637  1.00 19.58 ? 1711 LYS A CB  1 
ATOM   279  C CG  . LYS A 1 51  ? -9.416  36.812 8.788  1.00 24.40 ? 1711 LYS A CG  1 
ATOM   280  C CD  . LYS A 1 51  ? -10.243 38.025 9.208  1.00 32.71 ? 1711 LYS A CD  1 
ATOM   281  C CE  . LYS A 1 51  ? -11.344 38.329 8.184  1.00 39.96 ? 1711 LYS A CE  1 
ATOM   282  N NZ  . LYS A 1 51  ? -12.667 37.845 8.682  1.00 37.19 ? 1711 LYS A NZ  1 
ATOM   283  N N   . ASP A 1 52  ? -8.916  34.929 5.560  1.00 17.71 ? 1712 ASP A N   1 
ATOM   284  C CA  . ASP A 1 52  ? -9.829  33.886 5.098  1.00 18.33 ? 1712 ASP A CA  1 
ATOM   285  C C   . ASP A 1 52  ? -9.173  32.852 4.201  1.00 17.06 ? 1712 ASP A C   1 
ATOM   286  O O   . ASP A 1 52  ? -9.872  31.941 3.761  1.00 15.76 ? 1712 ASP A O   1 
ATOM   287  C CB  . ASP A 1 52  ? -10.965 34.473 4.259  1.00 20.53 ? 1712 ASP A CB  1 
ATOM   288  C CG  . ASP A 1 52  ? -11.963 35.235 5.094  1.00 23.55 ? 1712 ASP A CG  1 
ATOM   289  O OD1 . ASP A 1 52  ? -12.551 36.187 4.541  1.00 30.55 ? 1712 ASP A OD1 1 
ATOM   290  O OD2 . ASP A 1 52  ? -12.120 34.901 6.286  1.00 19.58 ? 1712 ASP A OD2 1 
ATOM   291  N N   . VAL A 1 53  ? -7.876  33.014 3.924  1.00 15.41 ? 1713 VAL A N   1 
ATOM   292  C CA  . VAL A 1 53  ? -7.119  32.073 3.099  1.00 13.25 ? 1713 VAL A CA  1 
ATOM   293  C C   . VAL A 1 53  ? -7.192  30.631 3.604  1.00 13.78 ? 1713 VAL A C   1 
ATOM   294  O O   . VAL A 1 53  ? -6.955  30.353 4.795  1.00 14.95 ? 1713 VAL A O   1 
ATOM   295  C CB  . VAL A 1 53  ? -5.673  32.533 2.781  1.00 12.92 ? 1713 VAL A CB  1 
ATOM   296  C CG1 . VAL A 1 53  ? -4.962  31.435 2.015  1.00 6.15  ? 1713 VAL A CG1 1 
ATOM   297  C CG2 . VAL A 1 53  ? -5.692  33.829 1.956  1.00 12.66 ? 1713 VAL A CG2 1 
ATOM   298  N N   . GLY A 1 54  ? -7.581  29.749 2.683  1.00 11.14 ? 1714 GLY A N   1 
ATOM   299  C CA  . GLY A 1 54  ? -7.688  28.312 2.912  1.00 9.38  ? 1714 GLY A CA  1 
ATOM   300  C C   . GLY A 1 54  ? -8.953  27.898 3.647  1.00 11.43 ? 1714 GLY A C   1 
ATOM   301  O O   . GLY A 1 54  ? -9.236  26.700 3.725  1.00 11.39 ? 1714 GLY A O   1 
ATOM   302  N N   . ARG A 1 55  ? -9.715  28.853 4.184  1.00 11.30 ? 1715 ARG A N   1 
ATOM   303  C CA  . ARG A 1 55  ? -10.723 28.574 5.217  1.00 14.00 ? 1715 ARG A CA  1 
ATOM   304  C C   . ARG A 1 55  ? -12.023 28.025 4.645  1.00 15.98 ? 1715 ARG A C   1 
ATOM   305  O O   . ARG A 1 55  ? -13.003 27.795 5.370  1.00 18.17 ? 1715 ARG A O   1 
ATOM   306  C CB  . ARG A 1 55  ? -11.024 29.800 6.091  1.00 13.78 ? 1715 ARG A CB  1 
ATOM   307  C CG  . ARG A 1 55  ? -9.935  30.037 7.143  1.00 14.88 ? 1715 ARG A CG  1 
ATOM   308  C CD  . ARG A 1 55  ? -10.259 31.176 8.095  1.00 16.82 ? 1715 ARG A CD  1 
ATOM   309  N NE  . ARG A 1 55  ? -10.263 30.804 9.511  1.00 32.76 ? 1715 ARG A NE  1 
ATOM   310  C CZ  . ARG A 1 55  ? -10.671 29.636 10.005 1.00 34.98 ? 1715 ARG A CZ  1 
ATOM   311  N NH1 . ARG A 1 55  ? -11.106 28.657 9.219  1.00 46.23 ? 1715 ARG A NH1 1 
ATOM   312  N NH2 . ARG A 1 55  ? -10.630 29.420 11.305 1.00 33.01 ? 1715 ARG A NH2 1 
ATOM   313  N N   . ASN A 1 56  ? -12.018 27.828 3.332  1.00 16.56 ? 1716 ASN A N   1 
ATOM   314  C CA  . ASN A 1 56  ? -13.158 27.270 2.628  1.00 19.24 ? 1716 ASN A CA  1 
ATOM   315  C C   . ASN A 1 56  ? -13.080 25.743 2.664  1.00 18.74 ? 1716 ASN A C   1 
ATOM   316  O O   . ASN A 1 56  ? -13.960 25.049 2.147  1.00 18.75 ? 1716 ASN A O   1 
ATOM   317  C CB  . ASN A 1 56  ? -13.127 27.751 1.170  1.00 20.85 ? 1716 ASN A CB  1 
ATOM   318  C CG  . ASN A 1 56  ? -11.840 27.343 0.462  1.00 25.11 ? 1716 ASN A CG  1 
ATOM   319  O OD1 . ASN A 1 56  ? -10.755 27.875 0.720  1.00 26.51 ? 1716 ASN A OD1 1 
ATOM   320  N ND2 . ASN A 1 56  ? -11.955 26.364 -0.418 1.00 31.93 ? 1716 ASN A ND2 1 
ATOM   321  N N   . GLN A 1 57  ? -12.013 25.215 3.260  1.00 16.74 ? 1717 GLN A N   1 
ATOM   322  C CA  . GLN A 1 57  ? -11.767 23.781 3.175  1.00 15.81 ? 1717 GLN A CA  1 
ATOM   323  C C   . GLN A 1 57  ? -12.334 22.995 4.360  1.00 13.69 ? 1717 GLN A C   1 
ATOM   324  O O   . GLN A 1 57  ? -12.348 23.470 5.484  1.00 14.65 ? 1717 GLN A O   1 
ATOM   325  C CB  . GLN A 1 57  ? -10.269 23.539 3.069  1.00 16.06 ? 1717 GLN A CB  1 
ATOM   326  C CG  . GLN A 1 57  ? -9.656  24.055 1.784  1.00 15.15 ? 1717 GLN A CG  1 
ATOM   327  C CD  . GLN A 1 57  ? -8.149  23.935 1.830  1.00 13.62 ? 1717 GLN A CD  1 
ATOM   328  O OE1 . GLN A 1 57  ? -7.612  22.997 1.263  1.00 18.05 ? 1717 GLN A OE1 1 
ATOM   329  N NE2 . GLN A 1 57  ? -7.464  24.840 2.540  1.00 11.26 ? 1717 GLN A NE2 1 
ATOM   330  N N   . SER A 1 58  ? -12.802 21.778 4.126  1.00 12.07 ? 1718 SER A N   1 
ATOM   331  C CA  . SER A 1 58  ? -13.335 20.971 5.223  1.00 10.61 ? 1718 SER A CA  1 
ATOM   332  C C   . SER A 1 58  ? -12.319 20.398 6.231  1.00 7.30  ? 1718 SER A C   1 
ATOM   333  O O   . SER A 1 58  ? -11.147 20.122 5.915  1.00 7.98  ? 1718 SER A O   1 
ATOM   334  C CB  . SER A 1 58  ? -14.277 19.912 4.648  1.00 9.21  ? 1718 SER A CB  1 
ATOM   335  O OG  . SER A 1 58  ? -13.544 18.970 3.883  1.00 13.21 ? 1718 SER A OG  1 
ATOM   336  N N   . CYS A 1 59  ? -12.806 20.260 7.459  1.00 4.60  ? 1719 CYS A N   1 
ATOM   337  C CA  A CYS A 1 59  ? -12.106 19.877 8.679  0.50 4.75  ? 1719 CYS A CA  1 
ATOM   338  C CA  B CYS A 1 59  ? -12.005 19.636 8.524  0.50 3.98  ? 1719 CYS A CA  1 
ATOM   339  C C   . CYS A 1 59  ? -12.962 18.686 9.236  1.00 5.79  ? 1719 CYS A C   1 
ATOM   340  O O   . CYS A 1 59  ? -13.055 18.533 10.464 1.00 5.58  ? 1719 CYS A O   1 
ATOM   341  C CB  A CYS A 1 59  ? -11.942 21.103 9.657  0.50 4.88  ? 1719 CYS A CB  1 
ATOM   342  C CB  B CYS A 1 59  ? -11.378 20.645 9.493  0.50 2.00  ? 1719 CYS A CB  1 
ATOM   343  S SG  A CYS A 1 59  ? -12.068 23.019 9.390  0.50 2.00  ? 1719 CYS A SG  1 
ATOM   344  S SG  B CYS A 1 59  ? -12.642 21.560 10.426 0.50 2.00  ? 1719 CYS A SG  1 
ATOM   345  N N   . ASP A 1 60  ? -13.664 17.916 8.394  1.00 6.38  ? 1720 ASP A N   1 
ATOM   346  C CA  . ASP A 1 60  ? -14.683 16.964 8.842  1.00 8.16  ? 1720 ASP A CA  1 
ATOM   347  C C   . ASP A 1 60  ? -14.174 15.788 9.674  1.00 9.98  ? 1720 ASP A C   1 
ATOM   348  O O   . ASP A 1 60  ? -14.819 15.405 10.656 1.00 9.67  ? 1720 ASP A O   1 
ATOM   349  C CB  . ASP A 1 60  ? -15.502 16.354 7.694  1.00 6.64  ? 1720 ASP A CB  1 
ATOM   350  C CG  . ASP A 1 60  ? -16.321 17.375 6.928  1.00 9.23  ? 1720 ASP A CG  1 
ATOM   351  O OD1 . ASP A 1 60  ? -16.604 18.480 7.439  1.00 8.73  ? 1720 ASP A OD1 1 
ATOM   352  O OD2 . ASP A 1 60  ? -16.693 17.059 5.784  1.00 7.66  ? 1720 ASP A OD2 1 
ATOM   353  N N   . ILE A 1 61  ? -13.053 15.186 9.272  1.00 8.47  ? 1721 ILE A N   1 
ATOM   354  C CA  . ILE A 1 61  ? -12.461 14.105 10.076 1.00 6.89  ? 1721 ILE A CA  1 
ATOM   355  C C   . ILE A 1 61  ? -12.011 14.585 11.457 1.00 8.33  ? 1721 ILE A C   1 
ATOM   356  O O   . ILE A 1 61  ? -12.288 13.922 12.466 1.00 9.92  ? 1721 ILE A O   1 
ATOM   357  C CB  . ILE A 1 61  ? -11.327 13.376 9.320  1.00 9.30  ? 1721 ILE A CB  1 
ATOM   358  C CG1 . ILE A 1 61  ? -11.840 12.882 7.962  1.00 7.04  ? 1721 ILE A CG1 1 
ATOM   359  C CG2 . ILE A 1 61  ? -10.685 12.276 10.165 1.00 7.48  ? 1721 ILE A CG2 1 
ATOM   360  C CD1 . ILE A 1 61  ? -12.700 11.597 8.105  1.00 10.30 ? 1721 ILE A CD1 1 
ATOM   361  N N   . ALA A 1 62  ? -11.352 15.738 11.522 1.00 8.21  ? 1722 ALA A N   1 
ATOM   362  C CA  . ALA A 1 62  ? -10.970 16.349 12.809 1.00 9.40  ? 1722 ALA A CA  1 
ATOM   363  C C   . ALA A 1 62  ? -12.173 16.614 13.715 1.00 11.63 ? 1722 ALA A C   1 
ATOM   364  O O   . ALA A 1 62  ? -12.062 16.672 14.942 1.00 13.30 ? 1722 ALA A O   1 
ATOM   365  C CB  . ALA A 1 62  ? -10.156 17.628 12.605 1.00 4.22  ? 1722 ALA A CB  1 
ATOM   366  N N   . LEU A 1 63  ? -13.334 16.760 13.091 1.00 12.80 ? 1723 LEU A N   1 
ATOM   367  C CA  . LEU A 1 63  ? -14.558 16.970 13.837 1.00 13.82 ? 1723 LEU A CA  1 
ATOM   368  C C   . LEU A 1 63  ? -15.340 15.730 14.266 1.00 13.64 ? 1723 LEU A C   1 
ATOM   369  O O   . LEU A 1 63  ? -16.272 15.904 15.043 1.00 15.03 ? 1723 LEU A O   1 
ATOM   370  C CB  . LEU A 1 63  ? -15.488 17.924 13.073 1.00 13.08 ? 1723 LEU A CB  1 
ATOM   371  C CG  . LEU A 1 63  ? -15.056 19.393 13.080 1.00 12.58 ? 1723 LEU A CG  1 
ATOM   372  C CD1 . LEU A 1 63  ? -15.720 20.142 11.928 1.00 8.85  ? 1723 LEU A CD1 1 
ATOM   373  C CD2 . LEU A 1 63  ? -15.361 20.039 14.431 1.00 6.55  ? 1723 LEU A CD2 1 
ATOM   374  N N   . LEU A 1 64  ? -15.019 14.523 13.794 1.00 13.81 ? 1724 LEU A N   1 
ATOM   375  C CA  . LEU A 1 64  ? -15.708 13.303 14.252 1.00 13.11 ? 1724 LEU A CA  1 
ATOM   376  C C   . LEU A 1 64  ? -15.647 13.170 15.779 1.00 14.68 ? 1724 LEU A C   1 
ATOM   377  O O   . LEU A 1 64  ? -14.647 13.538 16.399 1.00 15.18 ? 1724 LEU A O   1 
ATOM   378  C CB  . LEU A 1 64  ? -15.190 12.041 13.558 1.00 10.10 ? 1724 LEU A CB  1 
ATOM   379  C CG  . LEU A 1 64  ? -15.276 11.962 12.019 1.00 13.59 ? 1724 LEU A CG  1 
ATOM   380  C CD1 . LEU A 1 64  ? -14.537 10.760 11.440 1.00 5.72  ? 1724 LEU A CD1 1 
ATOM   381  C CD2 . LEU A 1 64  ? -16.735 11.931 11.517 1.00 17.27 ? 1724 LEU A CD2 1 
ATOM   382  N N   . PRO A 1 65  ? -16.740 12.708 16.407 1.00 14.65 ? 1725 PRO A N   1 
ATOM   383  C CA  . PRO A 1 65  ? -16.737 12.374 17.839 1.00 14.41 ? 1725 PRO A CA  1 
ATOM   384  C C   . PRO A 1 65  ? -15.566 11.549 18.377 1.00 15.60 ? 1725 PRO A C   1 
ATOM   385  O O   . PRO A 1 65  ? -14.992 11.910 19.402 1.00 16.15 ? 1725 PRO A O   1 
ATOM   386  C CB  . PRO A 1 65  ? -18.105 11.726 18.085 1.00 14.94 ? 1725 PRO A CB  1 
ATOM   387  C CG  . PRO A 1 65  ? -18.951 12.054 16.868 1.00 15.74 ? 1725 PRO A CG  1 
ATOM   388  C CD  . PRO A 1 65  ? -18.063 12.564 15.765 1.00 13.72 ? 1725 PRO A CD  1 
ATOM   389  N N   . GLU A 1 66  ? -15.257 10.454 17.688 1.00 16.98 ? 1726 GLU A N   1 
ATOM   390  C CA  A GLU A 1 66  ? -14.022 9.655  17.667 0.50 16.96 ? 1726 GLU A CA  1 
ATOM   391  C CA  B GLU A 1 66  ? -14.080 9.651  18.003 0.50 16.81 ? 1726 GLU A CA  1 
ATOM   392  C C   . GLU A 1 66  ? -12.757 10.415 18.077 1.00 16.65 ? 1726 GLU A C   1 
ATOM   393  O O   . GLU A 1 66  ? -11.867 9.976  18.820 1.00 16.67 ? 1726 GLU A O   1 
ATOM   394  C CB  A GLU A 1 66  ? -13.841 9.318  16.176 0.50 16.60 ? 1726 GLU A CB  1 
ATOM   395  C CB  B GLU A 1 66  ? -13.981 8.469  17.041 0.50 15.69 ? 1726 GLU A CB  1 
ATOM   396  C CG  A GLU A 1 66  ? -13.733 7.883  15.687 0.50 18.58 ? 1726 GLU A CG  1 
ATOM   397  C CG  B GLU A 1 66  ? -15.346 7.916  16.673 0.50 20.10 ? 1726 GLU A CG  1 
ATOM   398  C CD  A GLU A 1 66  ? -13.715 7.788  14.155 0.50 15.99 ? 1726 GLU A CD  1 
ATOM   399  C CD  B GLU A 1 66  ? -15.966 8.583  15.459 0.50 20.33 ? 1726 GLU A CD  1 
ATOM   400  O OE1 A GLU A 1 66  ? -14.738 8.062  13.504 0.50 16.72 ? 1726 GLU A OE1 1 
ATOM   401  O OE1 B GLU A 1 66  ? -15.551 8.273  14.325 0.50 24.46 ? 1726 GLU A OE1 1 
ATOM   402  O OE2 A GLU A 1 66  ? -12.686 7.434  13.556 0.50 9.51  ? 1726 GLU A OE2 1 
ATOM   403  O OE2 B GLU A 1 66  ? -16.893 9.400  15.631 0.50 22.75 ? 1726 GLU A OE2 1 
ATOM   404  N N   . ASN A 1 67  ? -12.642 11.566 17.425 1.00 16.04 ? 1727 ASN A N   1 
ATOM   405  C CA  . ASN A 1 67  ? -11.414 12.345 17.385 1.00 14.75 ? 1727 ASN A CA  1 
ATOM   406  C C   . ASN A 1 67  ? -11.313 13.510 18.367 1.00 15.41 ? 1727 ASN A C   1 
ATOM   407  O O   . ASN A 1 67  ? -10.312 14.236 18.409 1.00 15.90 ? 1727 ASN A O   1 
ATOM   408  C CB  . ASN A 1 67  ? -11.188 12.787 15.950 1.00 13.36 ? 1727 ASN A CB  1 
ATOM   409  C CG  . ASN A 1 67  ? -10.911 11.597 15.057 1.00 17.19 ? 1727 ASN A CG  1 
ATOM   410  O OD1 . ASN A 1 67  ? -10.376 10.586 15.532 1.00 11.94 ? 1727 ASN A OD1 1 
ATOM   411  N ND2 . ASN A 1 67  ? -11.278 11.695 13.775 1.00 22.05 ? 1727 ASN A ND2 1 
ATOM   412  N N   . ARG A 1 68  ? -12.346 13.649 19.185 1.00 14.22 ? 1728 ARG A N   1 
ATOM   413  C CA  . ARG A 1 68  ? -12.545 14.838 20.002 1.00 16.20 ? 1728 ARG A CA  1 
ATOM   414  C C   . ARG A 1 68  ? -11.465 15.032 21.071 1.00 15.64 ? 1728 ARG A C   1 
ATOM   415  O O   . ARG A 1 68  ? -11.035 16.155 21.383 1.00 13.93 ? 1728 ARG A O   1 
ATOM   416  C CB  . ARG A 1 68  ? -13.914 14.697 20.670 1.00 16.03 ? 1728 ARG A CB  1 
ATOM   417  C CG  . ARG A 1 68  ? -14.772 15.923 20.538 1.00 18.41 ? 1728 ARG A CG  1 
ATOM   418  C CD  . ARG A 1 68  ? -16.189 15.618 20.966 1.00 21.98 ? 1728 ARG A CD  1 
ATOM   419  N NE  . ARG A 1 68  ? -17.057 15.822 19.815 1.00 25.26 ? 1728 ARG A NE  1 
ATOM   420  C CZ  . ARG A 1 68  ? -18.300 15.367 19.700 1.00 24.71 ? 1728 ARG A CZ  1 
ATOM   421  N NH1 . ARG A 1 68  ? -18.864 14.662 20.673 1.00 17.07 ? 1728 ARG A NH1 1 
ATOM   422  N NH2 . ARG A 1 68  ? -18.964 15.623 18.582 1.00 25.29 ? 1728 ARG A NH2 1 
ATOM   423  N N   . GLY A 1 69  ? -11.059 13.906 21.651 1.00 14.95 ? 1729 GLY A N   1 
ATOM   424  C CA  . GLY A 1 69  ? -10.022 13.899 22.666 1.00 14.19 ? 1729 GLY A CA  1 
ATOM   425  C C   . GLY A 1 69  ? -8.638  13.950 22.039 1.00 15.23 ? 1729 GLY A C   1 
ATOM   426  O O   . GLY A 1 69  ? -7.654  13.961 22.778 1.00 15.00 ? 1729 GLY A O   1 
ATOM   427  N N   . LYS A 1 70  ? -8.565  14.001 20.704 1.00 12.05 ? 1730 LYS A N   1 
ATOM   428  C CA  . LYS A 1 70  ? -7.301  13.974 19.982 1.00 10.08 ? 1730 LYS A CA  1 
ATOM   429  C C   . LYS A 1 70  ? -6.871  15.394 19.642 1.00 10.33 ? 1730 LYS A C   1 
ATOM   430  O O   . LYS A 1 70  ? -5.755  15.676 19.180 1.00 10.02 ? 1730 LYS A O   1 
ATOM   431  C CB  . LYS A 1 70  ? -7.437  13.076 18.742 1.00 10.25 ? 1730 LYS A CB  1 
ATOM   432  C CG  . LYS A 1 70  ? -7.592  11.590 19.081 1.00 6.66  ? 1730 LYS A CG  1 
ATOM   433  C CD  . LYS A 1 70  ? -8.199  10.821 17.946 1.00 14.42 ? 1730 LYS A CD  1 
ATOM   434  C CE  . LYS A 1 70  ? -8.324  9.340  18.261 1.00 19.77 ? 1730 LYS A CE  1 
ATOM   435  N NZ  . LYS A 1 70  ? -8.495  8.660  16.959 1.00 19.81 ? 1730 LYS A NZ  1 
ATOM   436  N N   . ASN A 1 71  ? -7.791  16.306 19.920 1.00 10.68 ? 1731 ASN A N   1 
ATOM   437  C CA  . ASN A 1 71  ? -7.590  17.709 19.588 1.00 11.00 ? 1731 ASN A CA  1 
ATOM   438  C C   . ASN A 1 71  ? -7.332  18.500 20.850 1.00 10.28 ? 1731 ASN A C   1 
ATOM   439  O O   . ASN A 1 71  ? -8.161  18.485 21.745 1.00 9.07  ? 1731 ASN A O   1 
ATOM   440  C CB  . ASN A 1 71  ? -8.786  18.265 18.790 1.00 10.09 ? 1731 ASN A CB  1 
ATOM   441  C CG  . ASN A 1 71  ? -8.903  17.579 17.463 1.00 9.45  ? 1731 ASN A CG  1 
ATOM   442  O OD1 . ASN A 1 71  ? -7.866  17.314 16.849 1.00 14.17 ? 1731 ASN A OD1 1 
ATOM   443  N ND2 . ASN A 1 71  ? -10.115 17.237 17.032 1.00 4.30  ? 1731 ASN A ND2 1 
ATOM   444  N N   . ARG A 1 72  ? -6.180  19.160 20.924 1.00 10.52 ? 1732 ARG A N   1 
ATOM   445  C CA  . ARG A 1 72  ? -5.917  20.049 22.054 1.00 8.22  ? 1732 ARG A CA  1 
ATOM   446  C C   . ARG A 1 72  ? -6.903  21.220 22.081 1.00 7.46  ? 1732 ARG A C   1 
ATOM   447  O O   . ARG A 1 72  ? -7.445  21.544 23.137 1.00 8.17  ? 1732 ARG A O   1 
ATOM   448  C CB  . ARG A 1 72  ? -4.468  20.561 22.016 1.00 7.11  ? 1732 ARG A CB  1 
ATOM   449  C CG  . ARG A 1 72  ? -4.072  21.414 23.198 1.00 4.28  ? 1732 ARG A CG  1 
ATOM   450  C CD  . ARG A 1 72  ? -2.599  21.744 23.076 1.00 10.35 ? 1732 ARG A CD  1 
ATOM   451  N NE  . ARG A 1 72  ? -1.751  20.626 23.490 1.00 6.58  ? 1732 ARG A NE  1 
ATOM   452  C CZ  . ARG A 1 72  ? -1.570  20.231 24.750 1.00 11.71 ? 1732 ARG A CZ  1 
ATOM   453  N NH1 . ARG A 1 72  ? -2.146  20.824 25.807 1.00 4.42  ? 1732 ARG A NH1 1 
ATOM   454  N NH2 . ARG A 1 72  ? -0.748  19.220 24.948 1.00 5.52  ? 1732 ARG A NH2 1 
ATOM   455  N N   . TYR A 1 73  ? -7.102  21.868 20.939 1.00 8.12  ? 1733 TYR A N   1 
ATOM   456  C CA  . TYR A 1 73  ? -7.993  23.024 20.819 1.00 10.43 ? 1733 TYR A CA  1 
ATOM   457  C C   . TYR A 1 73  ? -9.039  22.789 19.737 1.00 9.97  ? 1733 TYR A C   1 
ATOM   458  O O   . TYR A 1 73  ? -8.752  22.462 18.582 1.00 11.70 ? 1733 TYR A O   1 
ATOM   459  C CB  . TYR A 1 73  ? -7.201  24.283 20.431 1.00 8.79  ? 1733 TYR A CB  1 
ATOM   460  C CG  . TYR A 1 73  ? -6.079  24.577 21.398 1.00 11.29 ? 1733 TYR A CG  1 
ATOM   461  C CD1 . TYR A 1 73  ? -6.345  24.987 22.706 1.00 5.33  ? 1733 TYR A CD1 1 
ATOM   462  C CD2 . TYR A 1 73  ? -4.753  24.422 21.000 1.00 6.06  ? 1733 TYR A CD2 1 
ATOM   463  C CE1 . TYR A 1 73  ? -5.315  25.274 23.592 1.00 3.62  ? 1733 TYR A CE1 1 
ATOM   464  C CE2 . TYR A 1 73  ? -3.737  24.691 21.890 1.00 9.71  ? 1733 TYR A CE2 1 
ATOM   465  C CZ  . TYR A 1 73  ? -4.010  25.131 23.170 1.00 7.44  ? 1733 TYR A CZ  1 
ATOM   466  O OH  . TYR A 1 73  ? -2.934  25.382 24.011 1.00 7.94  ? 1733 TYR A OH  1 
ATOM   467  N N   . ASN A 1 74  ? -10.284 22.979 20.123 1.00 10.84 ? 1734 ASN A N   1 
ATOM   468  C CA  . ASN A 1 74  ? -11.351 22.571 19.236 1.00 11.87 ? 1734 ASN A CA  1 
ATOM   469  C C   . ASN A 1 74  ? -11.520 23.421 17.977 1.00 9.50  ? 1734 ASN A C   1 
ATOM   470  O O   . ASN A 1 74  ? -12.215 23.002 17.069 1.00 10.44 ? 1734 ASN A O   1 
ATOM   471  C CB  . ASN A 1 74  ? -12.651 22.317 20.004 1.00 13.71 ? 1734 ASN A CB  1 
ATOM   472  C CG  . ASN A 1 74  ? -13.308 23.587 20.500 1.00 15.56 ? 1734 ASN A CG  1 
ATOM   473  O OD1 . ASN A 1 74  ? -12.753 24.675 20.441 1.00 28.80 ? 1734 ASN A OD1 1 
ATOM   474  N ND2 . ASN A 1 74  ? -14.518 23.444 21.008 1.00 25.00 ? 1734 ASN A ND2 1 
ATOM   475  N N   . ASN A 1 75  ? -10.869 24.574 17.902 1.00 8.16  ? 1735 ASN A N   1 
ATOM   476  C CA  . ASN A 1 75  ? -10.912 25.396 16.697 1.00 8.72  ? 1735 ASN A CA  1 
ATOM   477  C C   . ASN A 1 75  ? -9.665  25.281 15.814 1.00 8.85  ? 1735 ASN A C   1 
ATOM   478  O O   . ASN A 1 75  ? -9.612  25.875 14.742 1.00 9.86  ? 1735 ASN A O   1 
ATOM   479  C CB  . ASN A 1 75  ? -11.190 26.859 17.074 1.00 10.27 ? 1735 ASN A CB  1 
ATOM   480  C CG  . ASN A 1 75  ? -10.014 27.497 17.797 1.00 8.66  ? 1735 ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 75  ? -9.470  26.891 18.705 1.00 7.53  ? 1735 ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 75  ? -9.604  28.693 17.384 1.00 11.89 ? 1735 ASN A ND2 1 
ATOM   483  N N   . ILE A 1 76  ? -8.669  24.503 16.236 1.00 7.99  ? 1736 ILE A N   1 
ATOM   484  C CA  . ILE A 1 76  ? -7.446  24.319 15.469 1.00 6.49  ? 1736 ILE A CA  1 
ATOM   485  C C   . ILE A 1 76  ? -7.356  22.855 15.033 1.00 9.93  ? 1736 ILE A C   1 
ATOM   486  O O   . ILE A 1 76  ? -6.817  21.997 15.758 1.00 10.22 ? 1736 ILE A O   1 
ATOM   487  C CB  . ILE A 1 76  ? -6.196  24.697 16.294 1.00 5.99  ? 1736 ILE A CB  1 
ATOM   488  C CG1 . ILE A 1 76  ? -6.377  26.025 17.055 1.00 4.39  ? 1736 ILE A CG1 1 
ATOM   489  C CG2 . ILE A 1 76  ? -4.949  24.623 15.432 1.00 5.94  ? 1736 ILE A CG2 1 
ATOM   490  C CD1 . ILE A 1 76  ? -6.366  27.310 16.181 1.00 8.00  ? 1736 ILE A CD1 1 
ATOM   491  N N   . LEU A 1 77  ? -7.895  22.612 13.841 1.00 7.97  ? 1737 LEU A N   1 
ATOM   492  C CA  . LEU A 1 77  ? -8.055  21.294 13.234 1.00 11.25 ? 1737 LEU A CA  1 
ATOM   493  C C   . LEU A 1 77  ? -7.387  21.270 11.863 1.00 11.09 ? 1737 LEU A C   1 
ATOM   494  O O   . LEU A 1 77  ? -7.378  22.276 11.151 1.00 13.77 ? 1737 LEU A O   1 
ATOM   495  C CB  . LEU A 1 77  ? -9.542  20.944 13.096 1.00 11.14 ? 1737 LEU A CB  1 
ATOM   496  C CG  . LEU A 1 77  ? -10.445 21.234 14.311 1.00 15.45 ? 1737 LEU A CG  1 
ATOM   497  C CD1 . LEU A 1 77  ? -11.881 20.999 13.926 1.00 13.07 ? 1737 LEU A CD1 1 
ATOM   498  C CD2 . LEU A 1 77  ? -10.078 20.390 15.522 1.00 8.50  ? 1737 LEU A CD2 1 
ATOM   499  N N   . PRO A 1 78  ? -6.789  20.131 11.493 1.00 9.54  ? 1738 PRO A N   1 
ATOM   500  C CA  . PRO A 1 78  ? -6.185  20.006 10.169 1.00 7.70  ? 1738 PRO A CA  1 
ATOM   501  C C   . PRO A 1 78  ? -7.284  20.016 9.107  1.00 8.88  ? 1738 PRO A C   1 
ATOM   502  O O   . PRO A 1 78  ? -8.356  19.460 9.354  1.00 8.53  ? 1738 PRO A O   1 
ATOM   503  C CB  . PRO A 1 78  ? -5.477  18.636 10.225 1.00 5.76  ? 1738 PRO A CB  1 
ATOM   504  C CG  . PRO A 1 78  ? -6.141  17.883 11.301 1.00 6.93  ? 1738 PRO A CG  1 
ATOM   505  C CD  . PRO A 1 78  ? -6.648  18.904 12.304 1.00 9.70  ? 1738 PRO A CD  1 
ATOM   506  N N   . TYR A 1 79  ? -7.021  20.590 7.931  1.00 7.22  ? 1739 TYR A N   1 
ATOM   507  C CA  . TYR A 1 79  ? -7.832  20.295 6.745  1.00 6.69  ? 1739 TYR A CA  1 
ATOM   508  C C   . TYR A 1 79  ? -7.842  18.830 6.285  1.00 7.70  ? 1739 TYR A C   1 
ATOM   509  O O   . TYR A 1 79  ? -6.810  18.171 6.301  1.00 7.25  ? 1739 TYR A O   1 
ATOM   510  C CB  . TYR A 1 79  ? -7.500  21.241 5.577  1.00 5.90  ? 1739 TYR A CB  1 
ATOM   511  C CG  . TYR A 1 79  ? -7.731  22.699 5.924  1.00 7.85  ? 1739 TYR A CG  1 
ATOM   512  C CD1 . TYR A 1 79  ? -8.951  23.116 6.444  1.00 6.06  ? 1739 TYR A CD1 1 
ATOM   513  C CD2 . TYR A 1 79  ? -6.729  23.652 5.752  1.00 2.00  ? 1739 TYR A CD2 1 
ATOM   514  C CE1 . TYR A 1 79  ? -9.178  24.449 6.766  1.00 10.37 ? 1739 TYR A CE1 1 
ATOM   515  C CE2 . TYR A 1 79  ? -6.943  24.984 6.058  1.00 6.68  ? 1739 TYR A CE2 1 
ATOM   516  C CZ  . TYR A 1 79  ? -8.169  25.374 6.576  1.00 10.23 ? 1739 TYR A CZ  1 
ATOM   517  O OH  . TYR A 1 79  ? -8.403  26.687 6.901  1.00 9.15  ? 1739 TYR A OH  1 
ATOM   518  N N   . ASP A 1 80  ? -8.996  18.312 5.857  1.00 8.64  ? 1740 ASP A N   1 
ATOM   519  C CA  . ASP A 1 80  ? -9.035  16.940 5.366  1.00 8.37  ? 1740 ASP A CA  1 
ATOM   520  C C   . ASP A 1 80  ? -8.047  16.763 4.222  1.00 8.87  ? 1740 ASP A C   1 
ATOM   521  O O   . ASP A 1 80  ? -7.442  15.692 4.069  1.00 9.13  ? 1740 ASP A O   1 
ATOM   522  C CB  . ASP A 1 80  ? -10.438 16.530 4.931  1.00 6.66  ? 1740 ASP A CB  1 
ATOM   523  C CG  . ASP A 1 80  ? -11.431 16.527 6.083  1.00 7.45  ? 1740 ASP A CG  1 
ATOM   524  O OD1 . ASP A 1 80  ? -11.054 16.099 7.204  1.00 8.88  ? 1740 ASP A OD1 1 
ATOM   525  O OD2 . ASP A 1 80  ? -12.598 16.930 5.854  1.00 4.32  ? 1740 ASP A OD2 1 
ATOM   526  N N   . ALA A 1 81  ? -7.869  17.814 3.426  1.00 9.28  ? 1741 ALA A N   1 
ATOM   527  C CA  . ALA A 1 81  ? -7.049  17.673 2.227  1.00 10.31 ? 1741 ALA A CA  1 
ATOM   528  C C   . ALA A 1 81  ? -5.540  17.491 2.473  1.00 11.44 ? 1741 ALA A C   1 
ATOM   529  O O   . ALA A 1 81  ? -4.871  16.849 1.657  1.00 10.30 ? 1741 ALA A O   1 
ATOM   530  C CB  . ALA A 1 81  ? -7.328  18.792 1.260  1.00 11.30 ? 1741 ALA A CB  1 
ATOM   531  N N   . THR A 1 82  ? -5.037  18.008 3.598  1.00 11.08 ? 1742 THR A N   1 
ATOM   532  C CA  . THR A 1 82  ? -3.597  18.096 3.904  1.00 11.81 ? 1742 THR A CA  1 
ATOM   533  C C   . THR A 1 82  ? -3.181  17.467 5.243  1.00 10.11 ? 1742 THR A C   1 
ATOM   534  O O   . THR A 1 82  ? -2.027  17.541 5.669  1.00 10.10 ? 1742 THR A O   1 
ATOM   535  C CB  . THR A 1 82  ? -3.177  19.586 3.934  1.00 13.79 ? 1742 THR A CB  1 
ATOM   536  O OG1 . THR A 1 82  ? -3.843  20.265 5.011  1.00 14.04 ? 1742 THR A OG1 1 
ATOM   537  C CG2 . THR A 1 82  ? -3.519  20.269 2.605  1.00 13.46 ? 1742 THR A CG2 1 
ATOM   538  N N   . ARG A 1 83  ? -4.128  16.857 5.941  1.00 9.84  ? 1743 ARG A N   1 
ATOM   539  C CA  . ARG A 1 83  ? -3.832  16.157 7.186  1.00 9.11  ? 1743 ARG A CA  1 
ATOM   540  C C   . ARG A 1 83  ? -2.923  14.931 6.993  1.00 11.69 ? 1743 ARG A C   1 
ATOM   541  O O   . ARG A 1 83  ? -3.062  14.141 6.026  1.00 6.96  ? 1743 ARG A O   1 
ATOM   542  C CB  . ARG A 1 83  ? -5.144  15.761 7.875  1.00 9.43  ? 1743 ARG A CB  1 
ATOM   543  C CG  . ARG A 1 83  ? -5.809  14.540 7.280  1.00 6.14  ? 1743 ARG A CG  1 
ATOM   544  C CD  . ARG A 1 83  ? -7.107  14.216 8.003  1.00 7.49  ? 1743 ARG A CD  1 
ATOM   545  N NE  . ARG A 1 83  ? -7.779  13.063 7.402  1.00 7.07  ? 1743 ARG A NE  1 
ATOM   546  C CZ  . ARG A 1 83  ? -7.748  11.844 7.932  1.00 12.23 ? 1743 ARG A CZ  1 
ATOM   547  N NH1 . ARG A 1 83  ? -7.101  11.618 9.067  1.00 3.27  ? 1743 ARG A NH1 1 
ATOM   548  N NH2 . ARG A 1 83  ? -8.358  10.843 7.312  1.00 11.99 ? 1743 ARG A NH2 1 
ATOM   549  N N   . VAL A 1 84  ? -1.996  14.801 7.945  1.00 9.84  ? 1744 VAL A N   1 
ATOM   550  C CA  . VAL A 1 84  ? -1.187  13.599 8.074  1.00 8.43  ? 1744 VAL A CA  1 
ATOM   551  C C   . VAL A 1 84  ? -1.993  12.440 8.656  1.00 10.73 ? 1744 VAL A C   1 
ATOM   552  O O   . VAL A 1 84  ? -2.766  12.630 9.599  1.00 9.88  ? 1744 VAL A O   1 
ATOM   553  C CB  . VAL A 1 84  ? 0.057   13.831 8.936  1.00 8.52  ? 1744 VAL A CB  1 
ATOM   554  C CG1 . VAL A 1 84  ? 0.941   12.569 8.847  1.00 3.24  ? 1744 VAL A CG1 1 
ATOM   555  C CG2 . VAL A 1 84  ? 0.811   15.080 8.414  1.00 3.10  ? 1744 VAL A CG2 1 
ATOM   556  N N   . LYS A 1 85  ? -1.806  11.238 8.105  1.00 11.18 ? 1745 LYS A N   1 
ATOM   557  C CA  . LYS A 1 85  ? -2.568  10.062 8.529  1.00 7.63  ? 1745 LYS A CA  1 
ATOM   558  C C   . LYS A 1 85  ? -1.688  8.987  9.179  1.00 8.17  ? 1745 LYS A C   1 
ATOM   559  O O   . LYS A 1 85  ? -0.659  8.603  8.627  1.00 5.22  ? 1745 LYS A O   1 
ATOM   560  C CB  . LYS A 1 85  ? -3.356  9.480  7.344  1.00 7.36  ? 1745 LYS A CB  1 
ATOM   561  C CG  . LYS A 1 85  ? -4.385  10.447 6.775  1.00 6.04  ? 1745 LYS A CG  1 
ATOM   562  C CD  . LYS A 1 85  ? -4.943  10.058 5.406  1.00 5.59  ? 1745 LYS A CD  1 
ATOM   563  C CE  . LYS A 1 85  ? -5.527  11.288 4.714  1.00 4.08  ? 1745 LYS A CE  1 
ATOM   564  N NZ  . LYS A 1 85  ? -6.467  10.911 3.589  1.00 12.08 ? 1745 LYS A NZ  1 
ATOM   565  N N   . LEU A 1 86  ? -2.112  8.501  10.345 1.00 8.15  ? 1746 LEU A N   1 
ATOM   566  C CA  . LEU A 1 86  ? -1.565  7.290  10.948 1.00 10.74 ? 1746 LEU A CA  1 
ATOM   567  C C   . LEU A 1 86  ? -1.809  6.113  10.010 1.00 13.33 ? 1746 LEU A C   1 
ATOM   568  O O   . LEU A 1 86  ? -2.925  5.941  9.517  1.00 14.44 ? 1746 LEU A O   1 
ATOM   569  C CB  . LEU A 1 86  ? -2.229  7.032  12.302 1.00 5.38  ? 1746 LEU A CB  1 
ATOM   570  C CG  . LEU A 1 86  ? -2.001  8.171  13.308 1.00 10.58 ? 1746 LEU A CG  1 
ATOM   571  C CD1 . LEU A 1 86  ? -2.659  7.753  14.610 1.00 9.39  ? 1746 LEU A CD1 1 
ATOM   572  C CD2 . LEU A 1 86  ? -0.509  8.512  13.533 1.00 6.06  ? 1746 LEU A CD2 1 
ATOM   573  N N   . SER A 1 87  ? -0.783  5.318  9.722  1.00 17.82 ? 1747 SER A N   1 
ATOM   574  C CA  . SER A 1 87  ? -1.044  4.183  8.838  1.00 24.88 ? 1747 SER A CA  1 
ATOM   575  C C   . SER A 1 87  ? -1.946  3.246  9.626  1.00 28.36 ? 1747 SER A C   1 
ATOM   576  O O   . SER A 1 87  ? -1.916  3.234  10.857 1.00 31.81 ? 1747 SER A O   1 
ATOM   577  C CB  . SER A 1 87  ? 0.215   3.381  8.579  1.00 25.27 ? 1747 SER A CB  1 
ATOM   578  O OG  . SER A 1 87  ? 0.117   2.348  9.539  1.00 23.22 ? 1747 SER A OG  1 
ATOM   579  N N   . ASN A 1 88  ? -2.759  2.437  8.960  1.00 33.37 ? 1748 ASN A N   1 
ATOM   580  C CA  . ASN A 1 88  ? -3.859  1.863  9.730  1.00 35.83 ? 1748 ASN A CA  1 
ATOM   581  C C   . ASN A 1 88  ? -4.550  0.642  9.133  1.00 35.46 ? 1748 ASN A C   1 
ATOM   582  O O   . ASN A 1 88  ? -5.742  0.697  8.828  1.00 35.91 ? 1748 ASN A O   1 
ATOM   583  C CB  . ASN A 1 88  ? -4.861  2.984  10.041 1.00 36.87 ? 1748 ASN A CB  1 
ATOM   584  C CG  . ASN A 1 88  ? -5.706  2.690  11.255 1.00 40.88 ? 1748 ASN A CG  1 
ATOM   585  O OD1 . ASN A 1 88  ? -5.231  2.074  12.210 1.00 50.21 ? 1748 ASN A OD1 1 
ATOM   586  N ND2 . ASN A 1 88  ? -6.966  3.114  11.222 1.00 40.45 ? 1748 ASN A ND2 1 
ATOM   587  N N   . SER A 1 95  ? -9.581  6.477  13.268 1.00 23.06 ? 1755 SER A N   1 
ATOM   588  C CA  . SER A 1 95  ? -8.374  5.822  13.816 1.00 22.44 ? 1755 SER A CA  1 
ATOM   589  C C   . SER A 1 95  ? -7.024  6.013  13.098 1.00 18.24 ? 1755 SER A C   1 
ATOM   590  O O   . SER A 1 95  ? -5.964  5.638  13.591 1.00 18.01 ? 1755 SER A O   1 
ATOM   591  C CB  . SER A 1 95  ? -8.658  4.392  14.286 1.00 22.56 ? 1755 SER A CB  1 
ATOM   592  O OG  . SER A 1 95  ? -7.710  3.430  13.846 1.00 28.21 ? 1755 SER A OG  1 
ATOM   593  N N   . ASP A 1 96  ? -7.051  6.654  11.936 1.00 14.99 ? 1756 ASP A N   1 
ATOM   594  C CA  . ASP A 1 96  ? -5.828  7.127  11.310 1.00 12.38 ? 1756 ASP A CA  1 
ATOM   595  C C   . ASP A 1 96  ? -5.542  8.551  11.733 1.00 9.59  ? 1756 ASP A C   1 
ATOM   596  O O   . ASP A 1 96  ? -4.604  9.162  11.239 1.00 9.43  ? 1756 ASP A O   1 
ATOM   597  C CB  . ASP A 1 96  ? -5.902  7.064  9.782  1.00 12.65 ? 1756 ASP A CB  1 
ATOM   598  C CG  . ASP A 1 96  ? -6.983  7.954  9.180  1.00 15.30 ? 1756 ASP A CG  1 
ATOM   599  O OD1 . ASP A 1 96  ? -7.701  8.701  9.873  1.00 18.86 ? 1756 ASP A OD1 1 
ATOM   600  O OD2 . ASP A 1 96  ? -7.140  7.923  7.941  1.00 24.99 ? 1756 ASP A OD2 1 
ATOM   601  N N   . TYR A 1 97  ? -6.348  9.067  12.650 1.00 10.04 ? 1757 TYR A N   1 
ATOM   602  C CA  . TYR A 1 97  ? -6.367  10.507 12.908 1.00 10.20 ? 1757 TYR A CA  1 
ATOM   603  C C   . TYR A 1 97  ? -5.300  11.056 13.858 1.00 10.07 ? 1757 TYR A C   1 
ATOM   604  O O   . TYR A 1 97  ? -5.237  10.676 15.026 1.00 10.01 ? 1757 TYR A O   1 
ATOM   605  C CB  . TYR A 1 97  ? -7.718  10.971 13.454 1.00 7.27  ? 1757 TYR A CB  1 
ATOM   606  C CG  . TYR A 1 97  ? -7.688  12.467 13.693 1.00 4.70  ? 1757 TYR A CG  1 
ATOM   607  C CD1 . TYR A 1 97  ? -7.827  13.326 12.615 1.00 2.00  ? 1757 TYR A CD1 1 
ATOM   608  C CD2 . TYR A 1 97  ? -7.448  13.014 14.961 1.00 7.67  ? 1757 TYR A CD2 1 
ATOM   609  C CE1 . TYR A 1 97  ? -7.803  14.696 12.769 1.00 5.55  ? 1757 TYR A CE1 1 
ATOM   610  C CE2 . TYR A 1 97  ? -7.403  14.416 15.147 1.00 11.40 ? 1757 TYR A CE2 1 
ATOM   611  C CZ  . TYR A 1 97  ? -7.599  15.227 14.022 1.00 4.15  ? 1757 TYR A CZ  1 
ATOM   612  O OH  . TYR A 1 97  ? -7.594  16.582 14.055 1.00 6.22  ? 1757 TYR A OH  1 
ATOM   613  N N   . ILE A 1 98  ? -4.489  11.983 13.357 1.00 9.48  ? 1758 ILE A N   1 
ATOM   614  C CA  . ILE A 1 98  ? -3.665  12.827 14.214 1.00 8.44  ? 1758 ILE A CA  1 
ATOM   615  C C   . ILE A 1 98  ? -3.885  14.283 13.830 1.00 7.55  ? 1758 ILE A C   1 
ATOM   616  O O   . ILE A 1 98  ? -4.082  14.582 12.656 1.00 9.94  ? 1758 ILE A O   1 
ATOM   617  C CB  . ILE A 1 98  ? -2.172  12.386 14.217 1.00 9.50  ? 1758 ILE A CB  1 
ATOM   618  C CG1 . ILE A 1 98  ? -1.323  13.297 15.120 1.00 8.68  ? 1758 ILE A CG1 1 
ATOM   619  C CG2 . ILE A 1 98  ? -1.635  12.241 12.787 1.00 11.08 ? 1758 ILE A CG2 1 
ATOM   620  C CD1 . ILE A 1 98  ? -0.061  12.644 15.686 1.00 9.77  ? 1758 ILE A CD1 1 
ATOM   621  N N   . ASN A 1 99  ? -3.919  15.186 14.806 1.00 8.48  ? 1759 ASN A N   1 
ATOM   622  C CA  . ASN A 1 99  ? -3.868  16.616 14.521 1.00 7.79  ? 1759 ASN A CA  1 
ATOM   623  C C   . ASN A 1 99  ? -2.499  17.114 14.052 1.00 10.20 ? 1759 ASN A C   1 
ATOM   624  O O   . ASN A 1 99  ? -1.663  17.575 14.852 1.00 11.00 ? 1759 ASN A O   1 
ATOM   625  C CB  . ASN A 1 99  ? -4.303  17.441 15.735 1.00 7.96  ? 1759 ASN A CB  1 
ATOM   626  C CG  . ASN A 1 99  ? -4.673  18.865 15.354 1.00 8.96  ? 1759 ASN A CG  1 
ATOM   627  O OD1 . ASN A 1 99  ? -3.968  19.527 14.579 1.00 8.67  ? 1759 ASN A OD1 1 
ATOM   628  N ND2 . ASN A 1 99  ? -5.770  19.351 15.912 1.00 2.86  ? 1759 ASN A ND2 1 
ATOM   629  N N   . ALA A 1 100 ? -2.292  17.034 12.738 1.00 8.57  ? 1760 ALA A N   1 
ATOM   630  C CA  . ALA A 1 100 ? -0.985  17.216 12.109 1.00 6.69  ? 1760 ALA A CA  1 
ATOM   631  C C   . ALA A 1 100 ? -1.271  17.498 10.646 1.00 7.80  ? 1760 ALA A C   1 
ATOM   632  O O   . ALA A 1 100 ? -2.184  16.897 10.073 1.00 7.48  ? 1760 ALA A O   1 
ATOM   633  C CB  . ALA A 1 100 ? -0.144  15.973 12.217 1.00 2.00  ? 1760 ALA A CB  1 
ATOM   634  N N   . SER A 1 101 ? -0.505  18.404 10.041 1.00 8.53  ? 1761 SER A N   1 
ATOM   635  C CA  . SER A 1 101 ? -0.746  18.766 8.651  1.00 8.21  ? 1761 SER A CA  1 
ATOM   636  C C   . SER A 1 101 ? 0.565   18.742 7.890  1.00 9.27  ? 1761 SER A C   1 
ATOM   637  O O   . SER A 1 101 ? 1.605   19.084 8.462  1.00 6.53  ? 1761 SER A O   1 
ATOM   638  C CB  . SER A 1 101 ? -1.245  20.212 8.549  1.00 7.42  ? 1761 SER A CB  1 
ATOM   639  O OG  . SER A 1 101 ? -2.349  20.487 9.390  1.00 11.25 ? 1761 SER A OG  1 
ATOM   640  N N   . TYR A 1 102 ? 0.492   18.420 6.595  1.00 9.15  ? 1762 TYR A N   1 
ATOM   641  C CA  . TYR A 1 102 ? 1.653   18.499 5.719  1.00 8.68  ? 1762 TYR A CA  1 
ATOM   642  C C   . TYR A 1 102 ? 1.867   19.944 5.296  1.00 10.64 ? 1762 TYR A C   1 
ATOM   643  O O   . TYR A 1 102 ? 0.897   20.619 4.984  1.00 11.62 ? 1762 TYR A O   1 
ATOM   644  C CB  . TYR A 1 102 ? 1.412   17.671 4.463  1.00 9.48  ? 1762 TYR A CB  1 
ATOM   645  C CG  . TYR A 1 102 ? 1.538   16.188 4.671  1.00 5.99  ? 1762 TYR A CG  1 
ATOM   646  C CD1 . TYR A 1 102 ? 2.729   15.616 5.111  1.00 6.48  ? 1762 TYR A CD1 1 
ATOM   647  C CD2 . TYR A 1 102 ? 0.460   15.366 4.413  1.00 3.80  ? 1762 TYR A CD2 1 
ATOM   648  C CE1 . TYR A 1 102 ? 2.836   14.253 5.288  1.00 7.49  ? 1762 TYR A CE1 1 
ATOM   649  C CE2 . TYR A 1 102 ? 0.556   13.991 4.570  1.00 4.34  ? 1762 TYR A CE2 1 
ATOM   650  C CZ  . TYR A 1 102 ? 1.739   13.449 5.015  1.00 9.96  ? 1762 TYR A CZ  1 
ATOM   651  O OH  . TYR A 1 102 ? 1.787   12.082 5.176  1.00 5.45  ? 1762 TYR A OH  1 
ATOM   652  N N   . ILE A 1 103 ? 3.108   20.426 5.289  1.00 11.05 ? 1763 ILE A N   1 
ATOM   653  C CA  . ILE A 1 103 ? 3.374   21.813 4.893  1.00 10.25 ? 1763 ILE A CA  1 
ATOM   654  C C   . ILE A 1 103 ? 4.481   21.903 3.832  1.00 10.82 ? 1763 ILE A C   1 
ATOM   655  O O   . ILE A 1 103 ? 5.593   21.387 4.023  1.00 8.06  ? 1763 ILE A O   1 
ATOM   656  C CB  . ILE A 1 103 ? 3.671   22.753 6.101  1.00 9.66  ? 1763 ILE A CB  1 
ATOM   657  C CG1 . ILE A 1 103 ? 2.648   22.563 7.229  1.00 7.35  ? 1763 ILE A CG1 1 
ATOM   658  C CG2 . ILE A 1 103 ? 3.662   24.251 5.691  1.00 4.56  ? 1763 ILE A CG2 1 
ATOM   659  C CD1 . ILE A 1 103 ? 1.242   23.146 6.960  1.00 7.32  ? 1763 ILE A CD1 1 
ATOM   660  N N   . PRO A 1 104 ? 4.160   22.513 2.678  1.00 11.61 ? 1764 PRO A N   1 
ATOM   661  C CA  . PRO A 1 104 ? 5.203   22.890 1.704  1.00 12.17 ? 1764 PRO A CA  1 
ATOM   662  C C   . PRO A 1 104 ? 6.220   23.908 2.205  1.00 10.84 ? 1764 PRO A C   1 
ATOM   663  O O   . PRO A 1 104 ? 5.922   24.748 3.063  1.00 12.34 ? 1764 PRO A O   1 
ATOM   664  C CB  . PRO A 1 104 ? 4.424   23.398 0.480  1.00 10.80 ? 1764 PRO A CB  1 
ATOM   665  C CG  . PRO A 1 104 ? 3.072   23.758 1.034  1.00 14.19 ? 1764 PRO A CG  1 
ATOM   666  C CD  . PRO A 1 104 ? 2.804   22.834 2.198  1.00 12.26 ? 1764 PRO A CD  1 
ATOM   667  N N   . GLY A 1 105 ? 7.435   23.806 1.671  1.00 9.78  ? 1765 GLY A N   1 
ATOM   668  C CA  . GLY A 1 105 ? 8.543   24.627 2.130  1.00 7.68  ? 1765 GLY A CA  1 
ATOM   669  C C   . GLY A 1 105 ? 9.201   25.291 0.935  1.00 11.07 ? 1765 GLY A C   1 
ATOM   670  O O   . GLY A 1 105 ? 8.648   25.389 -0.166 1.00 10.85 ? 1765 GLY A O   1 
ATOM   671  N N   . ASN A 1 106 ? 10.417  25.776 1.146  1.00 10.04 ? 1766 ASN A N   1 
ATOM   672  C CA  . ASN A 1 106 ? 11.071  26.459 0.064  1.00 9.59  ? 1766 ASN A CA  1 
ATOM   673  C C   . ASN A 1 106 ? 11.511  25.479 -1.037 1.00 9.08  ? 1766 ASN A C   1 
ATOM   674  O O   . ASN A 1 106 ? 11.706  25.853 -2.190 1.00 8.22  ? 1766 ASN A O   1 
ATOM   675  C CB  . ASN A 1 106 ? 12.199  27.273 0.685  1.00 10.61 ? 1766 ASN A CB  1 
ATOM   676  C CG  . ASN A 1 106 ? 12.378  28.610 -0.007 1.00 18.73 ? 1766 ASN A CG  1 
ATOM   677  O OD1 . ASN A 1 106 ? 11.592  29.548 0.177  1.00 32.48 ? 1766 ASN A OD1 1 
ATOM   678  N ND2 . ASN A 1 106 ? 13.391  28.686 -0.839 1.00 2.00  ? 1766 ASN A ND2 1 
ATOM   679  N N   . ASN A 1 107 ? 11.605  24.201 -0.689 1.00 8.48  ? 1767 ASN A N   1 
ATOM   680  C CA  . ASN A 1 107 ? 12.280  23.186 -1.478 1.00 8.55  ? 1767 ASN A CA  1 
ATOM   681  C C   . ASN A 1 107 ? 11.354  22.059 -1.976 1.00 9.82  ? 1767 ASN A C   1 
ATOM   682  O O   . ASN A 1 107 ? 11.479  21.579 -3.113 1.00 10.49 ? 1767 ASN A O   1 
ATOM   683  C CB  . ASN A 1 107 ? 13.436  22.626 -0.643 1.00 7.25  ? 1767 ASN A CB  1 
ATOM   684  C CG  . ASN A 1 107 ? 14.382  23.713 -0.181 1.00 7.58  ? 1767 ASN A CG  1 
ATOM   685  O OD1 . ASN A 1 107 ? 14.961  24.415 -1.006 1.00 12.03 ? 1767 ASN A OD1 1 
ATOM   686  N ND2 . ASN A 1 107 ? 14.541  23.876 1.117  1.00 2.67  ? 1767 ASN A ND2 1 
ATOM   687  N N   . PHE A 1 108 ? 10.425  21.616 -1.138 1.00 10.31 ? 1768 PHE A N   1 
ATOM   688  C CA  . PHE A 1 108 ? 9.463   20.608 -1.597 1.00 13.78 ? 1768 PHE A CA  1 
ATOM   689  C C   . PHE A 1 108 ? 8.078   20.668 -0.946 1.00 14.43 ? 1768 PHE A C   1 
ATOM   690  O O   . PHE A 1 108 ? 7.860   21.367 0.044  1.00 15.65 ? 1768 PHE A O   1 
ATOM   691  C CB  . PHE A 1 108 ? 10.011  19.168 -1.656 1.00 8.71  ? 1768 PHE A CB  1 
ATOM   692  C CG  . PHE A 1 108 ? 10.871  18.765 -0.488 1.00 9.13  ? 1768 PHE A CG  1 
ATOM   693  C CD1 . PHE A 1 108 ? 10.348  17.962 0.531  1.00 11.94 ? 1768 PHE A CD1 1 
ATOM   694  C CD2 . PHE A 1 108 ? 12.210  19.154 -0.420 1.00 7.67  ? 1768 PHE A CD2 1 
ATOM   695  C CE1 . PHE A 1 108 ? 11.133  17.570 1.609  1.00 9.40  ? 1768 PHE A CE1 1 
ATOM   696  C CE2 . PHE A 1 108 ? 13.011  18.774 0.659  1.00 6.53  ? 1768 PHE A CE2 1 
ATOM   697  C CZ  . PHE A 1 108 ? 12.472  17.984 1.669  1.00 3.65  ? 1768 PHE A CZ  1 
ATOM   698  N N   . ARG A 1 109 ? 7.155   19.903 -1.512 1.00 15.60 ? 1769 ARG A N   1 
ATOM   699  C CA  . ARG A 1 109 ? 5.760   19.913 -1.071 1.00 18.72 ? 1769 ARG A CA  1 
ATOM   700  C C   . ARG A 1 109 ? 5.507   19.168 0.248  1.00 15.94 ? 1769 ARG A C   1 
ATOM   701  O O   . ARG A 1 109 ? 4.623   19.536 1.036  1.00 16.99 ? 1769 ARG A O   1 
ATOM   702  C CB  . ARG A 1 109 ? 4.835   19.593 -2.258 1.00 18.99 ? 1769 ARG A CB  1 
ATOM   703  C CG  . ARG A 1 109 ? 3.504   18.891 -2.030 1.00 25.58 ? 1769 ARG A CG  1 
ATOM   704  C CD  . ARG A 1 109 ? 2.865   18.438 -3.370 1.00 22.82 ? 1769 ARG A CD  1 
ATOM   705  N NE  . ARG A 1 109 ? 3.452   17.157 -3.758 1.00 28.74 ? 1769 ARG A NE  1 
ATOM   706  C CZ  . ARG A 1 109 ? 3.061   15.962 -3.315 1.00 34.56 ? 1769 ARG A CZ  1 
ATOM   707  N NH1 . ARG A 1 109 ? 2.032   15.823 -2.488 1.00 34.51 ? 1769 ARG A NH1 1 
ATOM   708  N NH2 . ARG A 1 109 ? 3.700   14.870 -3.714 1.00 39.73 ? 1769 ARG A NH2 1 
ATOM   709  N N   . ARG A 1 110 ? 6.292   18.159 0.608  1.00 14.49 ? 1770 ARG A N   1 
ATOM   710  C CA  . ARG A 1 110 ? 5.967   17.690 1.969  1.00 13.76 ? 1770 ARG A CA  1 
ATOM   711  C C   . ARG A 1 110 ? 7.156   17.848 2.881  1.00 13.26 ? 1770 ARG A C   1 
ATOM   712  O O   . ARG A 1 110 ? 7.725   16.855 3.346  1.00 14.11 ? 1770 ARG A O   1 
ATOM   713  C CB  . ARG A 1 110 ? 5.446   16.263 2.016  1.00 10.77 ? 1770 ARG A CB  1 
ATOM   714  C CG  . ARG A 1 110 ? 4.051   16.111 1.456  1.00 10.04 ? 1770 ARG A CG  1 
ATOM   715  C CD  . ARG A 1 110 ? 3.769   14.629 1.320  1.00 13.69 ? 1770 ARG A CD  1 
ATOM   716  N NE  . ARG A 1 110 ? 2.332   14.398 1.301  1.00 14.57 ? 1770 ARG A NE  1 
ATOM   717  C CZ  . ARG A 1 110 ? 1.750   13.230 1.565  1.00 28.48 ? 1770 ARG A CZ  1 
ATOM   718  N NH1 . ARG A 1 110 ? 2.477   12.168 1.883  1.00 27.19 ? 1770 ARG A NH1 1 
ATOM   719  N NH2 . ARG A 1 110 ? 0.425   13.118 1.522  1.00 32.16 ? 1770 ARG A NH2 1 
ATOM   720  N N   . GLU A 1 111 ? 7.523   19.112 3.071  1.00 10.52 ? 1771 GLU A N   1 
ATOM   721  C CA  . GLU A 1 111 ? 8.830   19.451 3.586  1.00 8.91  ? 1771 GLU A CA  1 
ATOM   722  C C   . GLU A 1 111 ? 8.756   19.423 5.108  1.00 8.32  ? 1771 GLU A C   1 
ATOM   723  O O   . GLU A 1 111 ? 9.713   19.018 5.785  1.00 8.70  ? 1771 GLU A O   1 
ATOM   724  C CB  . GLU A 1 111 ? 9.305   20.782 3.000  1.00 8.58  ? 1771 GLU A CB  1 
ATOM   725  C CG  . GLU A 1 111 ? 10.761  21.083 3.380  1.00 12.50 ? 1771 GLU A CG  1 
ATOM   726  C CD  . GLU A 1 111 ? 11.359  22.206 2.548  1.00 12.27 ? 1771 GLU A CD  1 
ATOM   727  O OE1 . GLU A 1 111 ? 12.464  22.692 2.889  1.00 11.30 ? 1771 GLU A OE1 1 
ATOM   728  O OE2 . GLU A 1 111 ? 10.712  22.574 1.541  1.00 12.74 ? 1771 GLU A OE2 1 
ATOM   729  N N   . TYR A 1 112 ? 7.590   19.808 5.628  1.00 6.07  ? 1772 TYR A N   1 
ATOM   730  C CA  . TYR A 1 112 ? 7.360   19.844 7.078  1.00 7.24  ? 1772 TYR A CA  1 
ATOM   731  C C   . TYR A 1 112 ? 6.115   19.016 7.351  1.00 8.29  ? 1772 TYR A C   1 
ATOM   732  O O   . TYR A 1 112 ? 5.233   18.901 6.507  1.00 8.08  ? 1772 TYR A O   1 
ATOM   733  C CB  . TYR A 1 112 ? 7.100   21.254 7.635  1.00 4.33  ? 1772 TYR A CB  1 
ATOM   734  C CG  . TYR A 1 112 ? 8.094   22.295 7.203  1.00 4.30  ? 1772 TYR A CG  1 
ATOM   735  C CD1 . TYR A 1 112 ? 7.846   23.096 6.101  1.00 7.14  ? 1772 TYR A CD1 1 
ATOM   736  C CD2 . TYR A 1 112 ? 9.312   22.460 7.873  1.00 4.84  ? 1772 TYR A CD2 1 
ATOM   737  C CE1 . TYR A 1 112 ? 8.777   24.051 5.687  1.00 6.16  ? 1772 TYR A CE1 1 
ATOM   738  C CE2 . TYR A 1 112 ? 10.241  23.410 7.478  1.00 2.00  ? 1772 TYR A CE2 1 
ATOM   739  C CZ  . TYR A 1 112 ? 9.960   24.213 6.379  1.00 7.17  ? 1772 TYR A CZ  1 
ATOM   740  O OH  . TYR A 1 112 ? 10.839  25.200 5.964  1.00 7.63  ? 1772 TYR A OH  1 
ATOM   741  N N   . ILE A 1 113 ? 6.069   18.443 8.545  1.00 9.57  ? 1773 ILE A N   1 
ATOM   742  C CA  . ILE A 1 113 ? 4.800   18.057 9.135  1.00 8.96  ? 1773 ILE A CA  1 
ATOM   743  C C   . ILE A 1 113 ? 4.631   18.961 10.346 1.00 8.30  ? 1773 ILE A C   1 
ATOM   744  O O   . ILE A 1 113 ? 5.548   19.131 11.152 1.00 9.42  ? 1773 ILE A O   1 
ATOM   745  C CB  . ILE A 1 113 ? 4.831   16.611 9.658  1.00 9.76  ? 1773 ILE A CB  1 
ATOM   746  C CG1 . ILE A 1 113 ? 4.604   15.595 8.531  1.00 12.25 ? 1773 ILE A CG1 1 
ATOM   747  C CG2 . ILE A 1 113 ? 3.849   16.462 10.806 1.00 2.23  ? 1773 ILE A CG2 1 
ATOM   748  C CD1 . ILE A 1 113 ? 5.075   14.167 8.938  1.00 9.48  ? 1773 ILE A CD1 1 
ATOM   749  N N   . VAL A 1 114 ? 3.437   19.513 10.477 1.00 6.35  ? 1774 VAL A N   1 
ATOM   750  C CA  . VAL A 1 114 ? 3.141   20.467 11.538 1.00 9.58  ? 1774 VAL A CA  1 
ATOM   751  C C   . VAL A 1 114 ? 2.034   19.835 12.391 1.00 7.65  ? 1774 VAL A C   1 
ATOM   752  O O   . VAL A 1 114 ? 1.115   19.215 11.855 1.00 7.81  ? 1774 VAL A O   1 
ATOM   753  C CB  . VAL A 1 114 ? 2.799   21.835 10.865 1.00 10.33 ? 1774 VAL A CB  1 
ATOM   754  C CG1 . VAL A 1 114 ? 1.780   22.626 11.602 1.00 9.91  ? 1774 VAL A CG1 1 
ATOM   755  C CG2 . VAL A 1 114 ? 4.084   22.631 10.590 1.00 9.00  ? 1774 VAL A CG2 1 
ATOM   756  N N   . THR A 1 115 ? 2.139   19.956 13.709 1.00 7.41  ? 1775 THR A N   1 
ATOM   757  C CA  . THR A 1 115 ? 1.229   19.279 14.633 1.00 7.03  ? 1775 THR A CA  1 
ATOM   758  C C   . THR A 1 115 ? 1.087   20.148 15.897 1.00 7.53  ? 1775 THR A C   1 
ATOM   759  O O   . THR A 1 115 ? 1.927   21.010 16.181 1.00 6.48  ? 1775 THR A O   1 
ATOM   760  C CB  . THR A 1 115 ? 1.725   17.830 14.920 1.00 7.20  ? 1775 THR A CB  1 
ATOM   761  O OG1 . THR A 1 115 ? 0.722   17.029 15.579 1.00 7.91  ? 1775 THR A OG1 1 
ATOM   762  C CG2 . THR A 1 115 ? 3.030   17.830 15.689 1.00 3.11  ? 1775 THR A CG2 1 
ATOM   763  N N   . GLN A 1 116 ? 0.010   19.923 16.641 1.00 5.17  ? 1776 GLN A N   1 
ATOM   764  C CA  . GLN A 1 116 ? -0.164  20.466 17.988 1.00 7.01  ? 1776 GLN A CA  1 
ATOM   765  C C   . GLN A 1 116 ? 0.851   19.839 18.969 1.00 9.87  ? 1776 GLN A C   1 
ATOM   766  O O   . GLN A 1 116 ? 1.427   18.764 18.710 1.00 10.78 ? 1776 GLN A O   1 
ATOM   767  C CB  . GLN A 1 116 ? -1.621  20.229 18.429 1.00 3.92  ? 1776 GLN A CB  1 
ATOM   768  C CG  . GLN A 1 116 ? -1.900  18.774 18.718 1.00 7.91  ? 1776 GLN A CG  1 
ATOM   769  C CD  . GLN A 1 116 ? -3.328  18.442 19.080 1.00 7.26  ? 1776 GLN A CD  1 
ATOM   770  O OE1 . GLN A 1 116 ? -4.242  19.243 18.895 1.00 6.57  ? 1776 GLN A OE1 1 
ATOM   771  N NE2 . GLN A 1 116 ? -3.528  17.228 19.592 1.00 7.64  ? 1776 GLN A NE2 1 
ATOM   772  N N   . GLY A 1 117 ? 1.102   20.509 20.090 1.00 8.37  ? 1777 GLY A N   1 
ATOM   773  C CA  . GLY A 1 117 ? 1.905   19.896 21.133 1.00 7.99  ? 1777 GLY A CA  1 
ATOM   774  C C   . GLY A 1 117 ? 1.157   18.648 21.582 1.00 8.48  ? 1777 GLY A C   1 
ATOM   775  O O   . GLY A 1 117 ? -0.031  18.726 21.904 1.00 9.23  ? 1777 GLY A O   1 
ATOM   776  N N   . PRO A 1 118 ? 1.824   17.476 21.545 1.00 7.17  ? 1778 PRO A N   1 
ATOM   777  C CA  . PRO A 1 118 ? 1.198   16.246 22.039 1.00 4.90  ? 1778 PRO A CA  1 
ATOM   778  C C   . PRO A 1 118 ? 0.454   16.321 23.376 1.00 8.25  ? 1778 PRO A C   1 
ATOM   779  O O   . PRO A 1 118 ? 0.832   17.041 24.314 1.00 10.74 ? 1778 PRO A O   1 
ATOM   780  C CB  . PRO A 1 118 ? 2.348   15.225 22.020 1.00 3.47  ? 1778 PRO A CB  1 
ATOM   781  C CG  . PRO A 1 118 ? 3.298   15.764 20.920 1.00 2.00  ? 1778 PRO A CG  1 
ATOM   782  C CD  . PRO A 1 118 ? 3.159   17.252 20.948 1.00 3.07  ? 1778 PRO A CD  1 
ATOM   783  N N   . LEU A 1 119 ? -0.614  15.534 23.468 1.00 8.85  ? 1779 LEU A N   1 
ATOM   784  C CA  . LEU A 1 119 ? -1.382  15.387 24.697 1.00 7.86  ? 1779 LEU A CA  1 
ATOM   785  C C   . LEU A 1 119 ? -0.953  14.109 25.417 1.00 7.83  ? 1779 LEU A C   1 
ATOM   786  O O   . LEU A 1 119 ? -0.414  13.191 24.814 1.00 7.66  ? 1779 LEU A O   1 
ATOM   787  C CB  . LEU A 1 119 ? -2.875  15.310 24.344 1.00 8.58  ? 1779 LEU A CB  1 
ATOM   788  C CG  . LEU A 1 119 ? -3.586  16.530 23.745 1.00 6.40  ? 1779 LEU A CG  1 
ATOM   789  C CD1 . LEU A 1 119 ? -4.863  16.010 23.163 1.00 5.70  ? 1779 LEU A CD1 1 
ATOM   790  C CD2 . LEU A 1 119 ? -3.895  17.503 24.867 1.00 7.45  ? 1779 LEU A CD2 1 
ATOM   791  N N   . PRO A 1 120 ? -1.190  14.018 26.730 1.00 8.65  ? 1780 PRO A N   1 
ATOM   792  C CA  . PRO A 1 120 ? -0.845  12.710 27.300 1.00 7.81  ? 1780 PRO A CA  1 
ATOM   793  C C   . PRO A 1 120 ? -1.456  11.574 26.502 1.00 8.42  ? 1780 PRO A C   1 
ATOM   794  O O   . PRO A 1 120 ? -0.852  10.513 26.357 1.00 9.62  ? 1780 PRO A O   1 
ATOM   795  C CB  . PRO A 1 120 ? -1.431  12.766 28.714 1.00 6.29  ? 1780 PRO A CB  1 
ATOM   796  C CG  . PRO A 1 120 ? -1.471  14.243 29.025 1.00 9.85  ? 1780 PRO A CG  1 
ATOM   797  C CD  . PRO A 1 120 ? -1.652  14.989 27.735 1.00 5.55  ? 1780 PRO A CD  1 
ATOM   798  N N   . GLY A 1 121 ? -2.668  11.771 25.996 1.00 10.08 ? 1781 GLY A N   1 
ATOM   799  C CA  . GLY A 1 121 ? -3.338  10.666 25.320 1.00 8.92  ? 1781 GLY A CA  1 
ATOM   800  C C   . GLY A 1 121 ? -3.045  10.561 23.840 1.00 8.45  ? 1781 GLY A C   1 
ATOM   801  O O   . GLY A 1 121 ? -3.571  9.657  23.213 1.00 11.39 ? 1781 GLY A O   1 
ATOM   802  N N   . THR A 1 122 ? -2.233  11.452 23.276 1.00 8.51  ? 1782 THR A N   1 
ATOM   803  C CA  . THR A 1 122 ? -1.742  11.302 21.891 1.00 9.65  ? 1782 THR A CA  1 
ATOM   804  C C   . THR A 1 122 ? -0.220  11.232 21.727 1.00 9.28  ? 1782 THR A C   1 
ATOM   805  O O   . THR A 1 122 ? 0.264   11.269 20.613 1.00 11.48 ? 1782 THR A O   1 
ATOM   806  C CB  . THR A 1 122 ? -2.230  12.431 20.954 1.00 8.01  ? 1782 THR A CB  1 
ATOM   807  O OG1 . THR A 1 122 ? -1.561  13.665 21.277 1.00 11.47 ? 1782 THR A OG1 1 
ATOM   808  C CG2 . THR A 1 122 ? -3.730  12.617 21.095 1.00 2.00  ? 1782 THR A CG2 1 
ATOM   809  N N   . LYS A 1 123 ? 0.570   11.128 22.787 1.00 8.78  ? 1783 LYS A N   1 
ATOM   810  C CA  . LYS A 1 123 ? 2.004   11.076 22.547 1.00 9.81  ? 1783 LYS A CA  1 
ATOM   811  C C   . LYS A 1 123 ? 2.470   9.793  21.847 1.00 10.02 ? 1783 LYS A C   1 
ATOM   812  O O   . LYS A 1 123 ? 3.400   9.869  21.064 1.00 9.40  ? 1783 LYS A O   1 
ATOM   813  C CB  . LYS A 1 123 ? 2.812   11.428 23.797 1.00 10.69 ? 1783 LYS A CB  1 
ATOM   814  C CG  . LYS A 1 123 ? 2.758   10.397 24.919 1.00 12.15 ? 1783 LYS A CG  1 
ATOM   815  C CD  . LYS A 1 123 ? 3.351   10.947 26.196 1.00 13.02 ? 1783 LYS A CD  1 
ATOM   816  C CE  . LYS A 1 123 ? 3.157   9.957  27.333 1.00 19.77 ? 1783 LYS A CE  1 
ATOM   817  N NZ  . LYS A 1 123 ? 3.995   10.396 28.474 1.00 30.43 ? 1783 LYS A NZ  1 
ATOM   818  N N   . ASP A 1 124 ? 1.848   8.635  22.086 1.00 10.85 ? 1784 ASP A N   1 
ATOM   819  C CA  . ASP A 1 124 ? 2.170   7.415  21.328 1.00 8.75  ? 1784 ASP A CA  1 
ATOM   820  C C   . ASP A 1 124 ? 1.882   7.632  19.845 1.00 8.88  ? 1784 ASP A C   1 
ATOM   821  O O   . ASP A 1 124 ? 2.658   7.211  18.994 1.00 10.79 ? 1784 ASP A O   1 
ATOM   822  C CB  . ASP A 1 124 ? 1.361   6.203  21.822 1.00 8.29  ? 1784 ASP A CB  1 
ATOM   823  C CG  . ASP A 1 124 ? 1.744   5.763  23.243 1.00 13.11 ? 1784 ASP A CG  1 
ATOM   824  O OD1 . ASP A 1 124 ? 2.695   6.345  23.810 1.00 4.52  ? 1784 ASP A OD1 1 
ATOM   825  O OD2 . ASP A 1 124 ? 1.117   4.835  23.820 1.00 16.58 ? 1784 ASP A OD2 1 
ATOM   826  N N   . ASP A 1 125 ? 0.766   8.280  19.530 1.00 8.37  ? 1785 ASP A N   1 
ATOM   827  C CA  . ASP A 1 125 ? 0.392   8.625  18.157 1.00 9.57  ? 1785 ASP A CA  1 
ATOM   828  C C   . ASP A 1 125 ? 1.465   9.485  17.510 1.00 10.42 ? 1785 ASP A C   1 
ATOM   829  O O   . ASP A 1 125 ? 1.774   9.343  16.321 1.00 11.84 ? 1785 ASP A O   1 
ATOM   830  C CB  . ASP A 1 125 ? -0.901  9.447  18.127 1.00 8.99  ? 1785 ASP A CB  1 
ATOM   831  C CG  . ASP A 1 125 ? -2.138  8.627  18.451 1.00 10.97 ? 1785 ASP A CG  1 
ATOM   832  O OD1 . ASP A 1 125 ? -2.100  7.374  18.365 1.00 5.92  ? 1785 ASP A OD1 1 
ATOM   833  O OD2 . ASP A 1 125 ? -3.154  9.282  18.790 1.00 15.35 ? 1785 ASP A OD2 1 
ATOM   834  N N   . PHE A 1 126 ? 2.024   10.381 18.316 1.00 9.25  ? 1786 PHE A N   1 
ATOM   835  C CA  . PHE A 1 126 ? 2.932   11.372 17.780 1.00 8.44  ? 1786 PHE A CA  1 
ATOM   836  C C   . PHE A 1 126 ? 4.230   10.694 17.365 1.00 8.12  ? 1786 PHE A C   1 
ATOM   837  O O   . PHE A 1 126 ? 4.703   10.903 16.246 1.00 8.63  ? 1786 PHE A O   1 
ATOM   838  C CB  . PHE A 1 126 ? 3.182   12.489 18.799 1.00 7.81  ? 1786 PHE A CB  1 
ATOM   839  C CG  . PHE A 1 126 ? 4.409   13.314 18.473 1.00 10.76 ? 1786 PHE A CG  1 
ATOM   840  C CD1 . PHE A 1 126 ? 4.311   14.444 17.672 1.00 9.54  ? 1786 PHE A CD1 1 
ATOM   841  C CD2 . PHE A 1 126 ? 5.659   12.933 18.935 1.00 5.91  ? 1786 PHE A CD2 1 
ATOM   842  C CE1 . PHE A 1 126 ? 5.428   15.205 17.371 1.00 9.58  ? 1786 PHE A CE1 1 
ATOM   843  C CE2 . PHE A 1 126 ? 6.786   13.660 18.611 1.00 7.23  ? 1786 PHE A CE2 1 
ATOM   844  C CZ  . PHE A 1 126 ? 6.679   14.803 17.846 1.00 10.41 ? 1786 PHE A CZ  1 
ATOM   845  N N   . TRP A 1 127 ? 4.816   9.905  18.267 1.00 8.83  ? 1787 TRP A N   1 
ATOM   846  C CA  . TRP A 1 127 ? 5.935   9.028  17.917 1.00 6.44  ? 1787 TRP A CA  1 
ATOM   847  C C   . TRP A 1 127 ? 5.627   7.998  16.832 1.00 6.11  ? 1787 TRP A C   1 
ATOM   848  O O   . TRP A 1 127 ? 6.487   7.653  16.024 1.00 8.52  ? 1787 TRP A O   1 
ATOM   849  C CB  . TRP A 1 127 ? 6.517   8.350  19.160 1.00 7.08  ? 1787 TRP A CB  1 
ATOM   850  C CG  . TRP A 1 127 ? 7.104   9.320  20.140 1.00 5.70  ? 1787 TRP A CG  1 
ATOM   851  C CD1 . TRP A 1 127 ? 6.629   9.620  21.391 1.00 12.47 ? 1787 TRP A CD1 1 
ATOM   852  C CD2 . TRP A 1 127 ? 8.251   10.164 19.940 1.00 5.82  ? 1787 TRP A CD2 1 
ATOM   853  N NE1 . TRP A 1 127 ? 7.427   10.575 21.994 1.00 8.19  ? 1787 TRP A NE1 1 
ATOM   854  C CE2 . TRP A 1 127 ? 8.425   10.929 21.127 1.00 2.00  ? 1787 TRP A CE2 1 
ATOM   855  C CE3 . TRP A 1 127 ? 9.150   10.343 18.875 1.00 4.17  ? 1787 TRP A CE3 1 
ATOM   856  C CZ2 . TRP A 1 127 ? 9.475   11.841 21.295 1.00 4.98  ? 1787 TRP A CZ2 1 
ATOM   857  C CZ3 . TRP A 1 127 ? 10.182  11.278 19.035 1.00 10.47 ? 1787 TRP A CZ3 1 
ATOM   858  C CH2 . TRP A 1 127 ? 10.337  12.001 20.237 1.00 6.22  ? 1787 TRP A CH2 1 
ATOM   859  N N   . LYS A 1 128 ? 4.398   7.506  16.768 1.00 8.33  ? 1788 LYS A N   1 
ATOM   860  C CA  . LYS A 1 128 ? 4.057   6.603  15.678 1.00 9.78  ? 1788 LYS A CA  1 
ATOM   861  C C   . LYS A 1 128 ? 4.212   7.305  14.318 1.00 8.97  ? 1788 LYS A C   1 
ATOM   862  O O   . LYS A 1 128 ? 4.733   6.743  13.354 1.00 6.56  ? 1788 LYS A O   1 
ATOM   863  C CB  . LYS A 1 128 ? 2.647   6.042  15.854 1.00 8.58  ? 1788 LYS A CB  1 
ATOM   864  C CG  . LYS A 1 128 ? 2.281   5.100  14.728 1.00 7.93  ? 1788 LYS A CG  1 
ATOM   865  C CD  . LYS A 1 128 ? 0.862   4.547  14.967 1.00 24.85 ? 1788 LYS A CD  1 
ATOM   866  C CE  . LYS A 1 128 ? 0.281   3.667  13.834 1.00 29.62 ? 1788 LYS A CE  1 
ATOM   867  N NZ  . LYS A 1 128 ? -1.223  3.610  13.876 1.00 29.02 ? 1788 LYS A NZ  1 
ATOM   868  N N   . MET A 1 129 ? 3.750   8.550  14.259 1.00 10.38 ? 1789 MET A N   1 
ATOM   869  C CA  . MET A 1 129 ? 3.776   9.356  13.041 1.00 7.54  ? 1789 MET A CA  1 
ATOM   870  C C   . MET A 1 129 ? 5.232   9.631  12.664 1.00 6.97  ? 1789 MET A C   1 
ATOM   871  O O   . MET A 1 129 ? 5.605   9.594  11.483 1.00 8.12  ? 1789 MET A O   1 
ATOM   872  C CB  . MET A 1 129 ? 3.042   10.679 13.299 1.00 6.34  ? 1789 MET A CB  1 
ATOM   873  C CG  . MET A 1 129 ? 3.198   11.663 12.131 1.00 6.82  ? 1789 MET A CG  1 
ATOM   874  S SD  . MET A 1 129 ? 2.306   13.210 12.360 1.00 8.41  ? 1789 MET A SD  1 
ATOM   875  C CE  . MET A 1 129 ? 3.174   13.887 13.783 1.00 8.54  ? 1789 MET A CE  1 
ATOM   876  N N   . VAL A 1 130 ? 6.042   9.903  13.685 1.00 8.01  ? 1790 VAL A N   1 
ATOM   877  C CA  . VAL A 1 130 ? 7.480   10.230 13.566 1.00 9.44  ? 1790 VAL A CA  1 
ATOM   878  C C   . VAL A 1 130 ? 8.241   9.064  12.919 1.00 9.78  ? 1790 VAL A C   1 
ATOM   879  O O   . VAL A 1 130 ? 9.036   9.230  11.996 1.00 11.27 ? 1790 VAL A O   1 
ATOM   880  C CB  . VAL A 1 130 ? 8.117   10.671 14.934 1.00 8.65  ? 1790 VAL A CB  1 
ATOM   881  C CG1 . VAL A 1 130 ? 9.653   10.587 14.892 1.00 6.10  ? 1790 VAL A CG1 1 
ATOM   882  C CG2 . VAL A 1 130 ? 7.730   12.122 15.270 1.00 5.88  ? 1790 VAL A CG2 1 
ATOM   883  N N   . TRP A 1 131 ? 7.955   7.867  13.407 1.00 12.42 ? 1791 TRP A N   1 
ATOM   884  C CA  . TRP A 1 131 ? 8.470   6.633  12.840 1.00 11.70 ? 1791 TRP A CA  1 
ATOM   885  C C   . TRP A 1 131 ? 8.011   6.383  11.397 1.00 11.38 ? 1791 TRP A C   1 
ATOM   886  O O   . TRP A 1 131 ? 8.840   6.175  10.516 1.00 13.31 ? 1791 TRP A O   1 
ATOM   887  C CB  . TRP A 1 131 ? 8.045   5.490  13.760 1.00 12.64 ? 1791 TRP A CB  1 
ATOM   888  C CG  . TRP A 1 131 ? 8.594   4.150  13.392 1.00 15.67 ? 1791 TRP A CG  1 
ATOM   889  C CD1 . TRP A 1 131 ? 7.913   3.096  12.829 1.00 15.03 ? 1791 TRP A CD1 1 
ATOM   890  C CD2 . TRP A 1 131 ? 9.952   3.723  13.549 1.00 13.43 ? 1791 TRP A CD2 1 
ATOM   891  N NE1 . TRP A 1 131 ? 8.773   2.042  12.631 1.00 14.67 ? 1791 TRP A NE1 1 
ATOM   892  C CE2 . TRP A 1 131 ? 10.027  2.395  13.067 1.00 18.88 ? 1791 TRP A CE2 1 
ATOM   893  C CE3 . TRP A 1 131 ? 11.108  4.333  14.055 1.00 11.34 ? 1791 TRP A CE3 1 
ATOM   894  C CZ2 . TRP A 1 131 ? 11.229  1.663  13.081 1.00 21.46 ? 1791 TRP A CZ2 1 
ATOM   895  C CZ3 . TRP A 1 131 ? 12.300  3.605  14.074 1.00 15.87 ? 1791 TRP A CZ3 1 
ATOM   896  C CH2 . TRP A 1 131 ? 12.353  2.287  13.583 1.00 12.78 ? 1791 TRP A CH2 1 
ATOM   897  N N   . GLU A 1 132 ? 6.705   6.405  11.154 1.00 10.65 ? 1792 GLU A N   1 
ATOM   898  C CA  . GLU A 1 132 ? 6.120   6.065  9.858  1.00 13.33 ? 1792 GLU A CA  1 
ATOM   899  C C   . GLU A 1 132 ? 6.469   7.054  8.740  1.00 12.81 ? 1792 GLU A C   1 
ATOM   900  O O   . GLU A 1 132 ? 6.565   6.672  7.567  1.00 12.70 ? 1792 GLU A O   1 
ATOM   901  C CB  . GLU A 1 132 ? 4.591   6.003  9.963  1.00 12.48 ? 1792 GLU A CB  1 
ATOM   902  C CG  . GLU A 1 132 ? 4.098   4.924  10.905 1.00 15.43 ? 1792 GLU A CG  1 
ATOM   903  C CD  . GLU A 1 132 ? 2.596   4.877  10.966 1.00 15.09 ? 1792 GLU A CD  1 
ATOM   904  O OE1 . GLU A 1 132 ? 1.936   5.907  10.684 1.00 18.79 ? 1792 GLU A OE1 1 
ATOM   905  O OE2 . GLU A 1 132 ? 2.083   3.787  11.290 1.00 22.69 ? 1792 GLU A OE2 1 
ATOM   906  N N   . GLN A 1 133 ? 6.649   8.318  9.121  1.00 11.51 ? 1793 GLN A N   1 
ATOM   907  C CA  . GLN A 1 133 ? 6.912   9.380  8.166  1.00 10.12 ? 1793 GLN A CA  1 
ATOM   908  C C   . GLN A 1 133 ? 8.400   9.576  7.977  1.00 11.37 ? 1793 GLN A C   1 
ATOM   909  O O   . GLN A 1 133 ? 8.766   10.476 7.230  1.00 11.04 ? 1793 GLN A O   1 
ATOM   910  C CB  . GLN A 1 133 ? 6.255   10.696 8.586  1.00 9.84  ? 1793 GLN A CB  1 
ATOM   911  C CG  . GLN A 1 133 ? 4.722   10.628 8.654  1.00 8.13  ? 1793 GLN A CG  1 
ATOM   912  C CD  . GLN A 1 133 ? 4.066   10.459 7.304  1.00 17.01 ? 1793 GLN A CD  1 
ATOM   913  O OE1 . GLN A 1 133 ? 4.348   11.193 6.344  1.00 16.46 ? 1793 GLN A OE1 1 
ATOM   914  N NE2 . GLN A 1 133 ? 3.162   9.485  7.229  1.00 12.82 ? 1793 GLN A NE2 1 
ATOM   915  N N   . ASN A 1 134 ? 9.228   8.753  8.627  1.00 11.17 ? 1794 ASN A N   1 
ATOM   916  C CA  . ASN A 1 134 ? 10.689  8.834  8.506  1.00 12.37 ? 1794 ASN A CA  1 
ATOM   917  C C   . ASN A 1 134 ? 11.243  10.189 8.946  1.00 13.39 ? 1794 ASN A C   1 
ATOM   918  O O   . ASN A 1 134 ? 12.145  10.731 8.322  1.00 15.16 ? 1794 ASN A O   1 
ATOM   919  C CB  . ASN A 1 134 ? 11.167  8.446  7.098  1.00 11.08 ? 1794 ASN A CB  1 
ATOM   920  C CG  . ASN A 1 134 ? 12.650  8.138  7.025  1.00 14.59 ? 1794 ASN A CG  1 
ATOM   921  O OD1 . ASN A 1 134 ? 13.246  7.541  7.932  1.00 14.68 ? 1794 ASN A OD1 1 
ATOM   922  N ND2 . ASN A 1 134 ? 13.266  8.546  5.917  1.00 14.89 ? 1794 ASN A ND2 1 
ATOM   923  N N   . VAL A 1 135 ? 10.711  10.741 10.033 1.00 14.29 ? 1795 VAL A N   1 
ATOM   924  C CA  . VAL A 1 135 ? 11.184  12.025 10.552 1.00 11.21 ? 1795 VAL A CA  1 
ATOM   925  C C   . VAL A 1 135 ? 12.500  11.871 11.324 1.00 13.32 ? 1795 VAL A C   1 
ATOM   926  O O   . VAL A 1 135 ? 12.613  10.993 12.181 1.00 14.94 ? 1795 VAL A O   1 
ATOM   927  C CB  . VAL A 1 135 ? 10.036  12.589 11.437 1.00 12.64 ? 1795 VAL A CB  1 
ATOM   928  C CG1 . VAL A 1 135 ? 10.470  13.793 12.270 1.00 4.32  ? 1795 VAL A CG1 1 
ATOM   929  C CG2 . VAL A 1 135 ? 8.783   12.878 10.572 1.00 2.19  ? 1795 VAL A CG2 1 
ATOM   930  N N   . HIS A 1 136 ? 13.508  12.693 11.035 1.00 12.94 ? 1796 HIS A N   1 
ATOM   931  C CA  . HIS A 1 136 ? 14.772  12.690 11.770 1.00 13.70 ? 1796 HIS A CA  1 
ATOM   932  C C   . HIS A 1 136 ? 15.020  13.947 12.609 1.00 12.47 ? 1796 HIS A C   1 
ATOM   933  O O   . HIS A 1 136 ? 15.955  14.009 13.393 1.00 10.45 ? 1796 HIS A O   1 
ATOM   934  C CB  . HIS A 1 136 ? 15.924  12.625 10.762 1.00 15.63 ? 1796 HIS A CB  1 
ATOM   935  C CG  . HIS A 1 136 ? 16.031  11.317 10.041 1.00 24.82 ? 1796 HIS A CG  1 
ATOM   936  N ND1 . HIS A 1 136 ? 15.061  10.865 9.173  1.00 28.13 ? 1796 HIS A ND1 1 
ATOM   937  C CD2 . HIS A 1 136 ? 16.992  10.362 10.068 1.00 31.54 ? 1796 HIS A CD2 1 
ATOM   938  C CE1 . HIS A 1 136 ? 15.427  9.690  8.691  1.00 33.99 ? 1796 HIS A CE1 1 
ATOM   939  N NE2 . HIS A 1 136 ? 16.589  9.357  9.222  1.00 30.21 ? 1796 HIS A NE2 1 
ATOM   940  N N   . ASN A 1 137 ? 14.221  14.987 12.407 1.00 12.33 ? 1797 ASN A N   1 
ATOM   941  C CA  . ASN A 1 137 ? 14.409  16.256 13.089 1.00 11.09 ? 1797 ASN A CA  1 
ATOM   942  C C   . ASN A 1 137 ? 13.043  16.711 13.577 1.00 10.75 ? 1797 ASN A C   1 
ATOM   943  O O   . ASN A 1 137 ? 12.093  16.737 12.787 1.00 13.16 ? 1797 ASN A O   1 
ATOM   944  C CB  . ASN A 1 137 ? 15.049  17.310 12.162 1.00 11.12 ? 1797 ASN A CB  1 
ATOM   945  C CG  . ASN A 1 137 ? 16.401  16.872 11.646 1.00 9.25  ? 1797 ASN A CG  1 
ATOM   946  O OD1 . ASN A 1 137 ? 16.600  16.640 10.446 1.00 11.44 ? 1797 ASN A OD1 1 
ATOM   947  N ND2 . ASN A 1 137 ? 17.345  16.727 12.566 1.00 7.77  ? 1797 ASN A ND2 1 
ATOM   948  N N   . ILE A 1 138 ? 12.957  17.066 14.856 1.00 10.62 ? 1798 ILE A N   1 
ATOM   949  C CA  . ILE A 1 138 ? 11.775  17.705 15.435 1.00 10.47 ? 1798 ILE A CA  1 
ATOM   950  C C   . ILE A 1 138 ? 12.155  19.087 15.980 1.00 11.56 ? 1798 ILE A C   1 
ATOM   951  O O   . ILE A 1 138 ? 13.156  19.265 16.689 1.00 13.80 ? 1798 ILE A O   1 
ATOM   952  C CB  . ILE A 1 138 ? 11.206  16.820 16.594 1.00 11.46 ? 1798 ILE A CB  1 
ATOM   953  C CG1 . ILE A 1 138 ? 10.863  15.397 16.123 1.00 11.76 ? 1798 ILE A CG1 1 
ATOM   954  C CG2 . ILE A 1 138 ? 9.987   17.435 17.309 1.00 4.36  ? 1798 ILE A CG2 1 
ATOM   955  C CD1 . ILE A 1 138 ? 10.587  14.437 17.290 1.00 9.75  ? 1798 ILE A CD1 1 
ATOM   956  N N   . VAL A 1 139 ? 11.333  20.076 15.655 1.00 11.31 ? 1799 VAL A N   1 
ATOM   957  C CA  . VAL A 1 139 ? 11.442  21.426 16.192 1.00 10.94 ? 1799 VAL A CA  1 
ATOM   958  C C   . VAL A 1 139 ? 10.256  21.761 17.091 1.00 11.08 ? 1799 VAL A C   1 
ATOM   959  O O   . VAL A 1 139 ? 9.096   21.723 16.662 1.00 10.83 ? 1799 VAL A O   1 
ATOM   960  C CB  . VAL A 1 139 ? 11.471  22.501 15.072 1.00 10.74 ? 1799 VAL A CB  1 
ATOM   961  C CG1 . VAL A 1 139 ? 11.717  23.863 15.679 1.00 9.25  ? 1799 VAL A CG1 1 
ATOM   962  C CG2 . VAL A 1 139 ? 12.501  22.191 14.032 1.00 4.80  ? 1799 VAL A CG2 1 
ATOM   963  N N   . MET A 1 140 ? 10.570  22.103 18.336 1.00 11.84 ? 1800 MET A N   1 
ATOM   964  C CA  . MET A 1 140 ? 9.562   22.452 19.323 1.00 11.60 ? 1800 MET A CA  1 
ATOM   965  C C   . MET A 1 140 ? 9.785   23.907 19.728 1.00 13.88 ? 1800 MET A C   1 
ATOM   966  O O   . MET A 1 140 ? 10.877  24.251 20.164 1.00 13.37 ? 1800 MET A O   1 
ATOM   967  C CB  . MET A 1 140 ? 9.732   21.571 20.548 1.00 8.27  ? 1800 MET A CB  1 
ATOM   968  C CG  . MET A 1 140 ? 8.692   21.845 21.625 1.00 8.22  ? 1800 MET A CG  1 
ATOM   969  S SD  . MET A 1 140 ? 8.816   20.572 22.893 1.00 10.76 ? 1800 MET A SD  1 
ATOM   970  C CE  . MET A 1 140 ? 7.748   21.240 24.162 1.00 2.00  ? 1800 MET A CE  1 
ATOM   971  N N   . VAL A 1 141 ? 8.773   24.762 19.595 1.00 14.44 ? 1801 VAL A N   1 
ATOM   972  C CA  . VAL A 1 141 ? 8.942   26.189 19.892 1.00 14.00 ? 1801 VAL A CA  1 
ATOM   973  C C   . VAL A 1 141 ? 7.838   26.623 20.851 1.00 16.14 ? 1801 VAL A C   1 
ATOM   974  O O   . VAL A 1 141 ? 7.255   27.708 20.726 1.00 19.31 ? 1801 VAL A O   1 
ATOM   975  C CB  . VAL A 1 141 ? 8.885   27.089 18.634 1.00 12.56 ? 1801 VAL A CB  1 
ATOM   976  C CG1 . VAL A 1 141 ? 10.156  26.897 17.800 1.00 12.62 ? 1801 VAL A CG1 1 
ATOM   977  C CG2 . VAL A 1 141 ? 7.603   26.874 17.809 1.00 4.53  ? 1801 VAL A CG2 1 
ATOM   978  N N   . THR A 1 142 ? 7.541   25.744 21.799 1.00 14.36 ? 1802 THR A N   1 
ATOM   979  C CA  . THR A 1 142 ? 6.692   26.105 22.924 1.00 14.25 ? 1802 THR A CA  1 
ATOM   980  C C   . THR A 1 142 ? 7.380   25.551 24.162 1.00 14.22 ? 1802 THR A C   1 
ATOM   981  O O   . THR A 1 142 ? 8.148   24.599 24.080 1.00 14.57 ? 1802 THR A O   1 
ATOM   982  C CB  . THR A 1 142 ? 5.262   25.528 22.777 1.00 15.28 ? 1802 THR A CB  1 
ATOM   983  O OG1 . THR A 1 142 ? 4.416   26.048 23.812 1.00 12.26 ? 1802 THR A OG1 1 
ATOM   984  C CG2 . THR A 1 142 ? 5.254   23.998 22.750 1.00 9.96  ? 1802 THR A CG2 1 
ATOM   985  N N   . GLN A 1 143 ? 7.131   26.124 25.330 1.00 14.51 ? 1803 GLN A N   1 
ATOM   986  C CA  . GLN A 1 143 ? 7.369   25.321 26.525 1.00 13.51 ? 1803 GLN A CA  1 
ATOM   987  C C   . GLN A 1 143 ? 6.171   24.459 26.888 1.00 13.15 ? 1803 GLN A C   1 
ATOM   988  O O   . GLN A 1 143 ? 5.085   24.616 26.333 1.00 12.46 ? 1803 GLN A O   1 
ATOM   989  C CB  . GLN A 1 143 ? 7.711   26.219 27.703 1.00 16.13 ? 1803 GLN A CB  1 
ATOM   990  C CG  . GLN A 1 143 ? 9.196   26.409 27.901 1.00 22.98 ? 1803 GLN A CG  1 
ATOM   991  C CD  . GLN A 1 143 ? 9.369   27.701 28.657 1.00 42.13 ? 1803 GLN A CD  1 
ATOM   992  O OE1 . GLN A 1 143 ? 9.686   27.708 29.850 1.00 48.80 ? 1803 GLN A OE1 1 
ATOM   993  N NE2 . GLN A 1 143 ? 9.098   28.811 27.974 1.00 42.03 ? 1803 GLN A NE2 1 
ATOM   994  N N   . CYS A 1 144 ? 6.370   23.552 27.836 1.00 11.67 ? 1804 CYS A N   1 
ATOM   995  C CA  . CYS A 1 144 ? 5.314   22.658 28.275 1.00 12.99 ? 1804 CYS A CA  1 
ATOM   996  C C   . CYS A 1 144 ? 4.182   23.322 29.054 1.00 11.98 ? 1804 CYS A C   1 
ATOM   997  O O   . CYS A 1 144 ? 3.018   22.973 28.882 1.00 12.18 ? 1804 CYS A O   1 
ATOM   998  C CB  . CYS A 1 144 ? 5.890   21.455 29.024 1.00 12.57 ? 1804 CYS A CB  1 
ATOM   999  S SG  . CYS A 1 144 ? 6.759   20.314 27.924 1.00 13.92 ? 1804 CYS A SG  1 
ATOM   1000 N N   . VAL A 1 145 ? 4.535   24.301 29.874 1.00 12.39 ? 1805 VAL A N   1 
ATOM   1001 C CA  . VAL A 1 145 ? 3.619   24.999 30.764 1.00 14.61 ? 1805 VAL A CA  1 
ATOM   1002 C C   . VAL A 1 145 ? 4.169   26.415 30.713 1.00 14.39 ? 1805 VAL A C   1 
ATOM   1003 O O   . VAL A 1 145 ? 5.373   26.616 30.891 1.00 14.40 ? 1805 VAL A O   1 
ATOM   1004 C CB  . VAL A 1 145 ? 3.766   24.520 32.249 1.00 15.63 ? 1805 VAL A CB  1 
ATOM   1005 C CG1 . VAL A 1 145 ? 2.957   25.409 33.184 1.00 15.30 ? 1805 VAL A CG1 1 
ATOM   1006 C CG2 . VAL A 1 145 ? 3.394   23.030 32.430 1.00 17.39 ? 1805 VAL A CG2 1 
ATOM   1007 N N   . GLU A 1 146 ? 3.297   27.386 30.486 1.00 14.58 ? 1806 GLU A N   1 
ATOM   1008 C CA  . GLU A 1 146 ? 3.733   28.775 30.478 1.00 16.74 ? 1806 GLU A CA  1 
ATOM   1009 C C   . GLU A 1 146 ? 2.722   29.565 31.299 1.00 18.32 ? 1806 GLU A C   1 
ATOM   1010 O O   . GLU A 1 146 ? 1.522   29.434 31.092 1.00 16.06 ? 1806 GLU A O   1 
ATOM   1011 C CB  . GLU A 1 146 ? 3.897   29.358 29.071 1.00 15.39 ? 1806 GLU A CB  1 
ATOM   1012 C CG  . GLU A 1 146 ? 4.502   28.400 28.027 1.00 19.00 ? 1806 GLU A CG  1 
ATOM   1013 C CD  . GLU A 1 146 ? 4.601   29.010 26.632 1.00 17.67 ? 1806 GLU A CD  1 
ATOM   1014 O OE1 . GLU A 1 146 ? 3.875   29.972 26.286 1.00 17.66 ? 1806 GLU A OE1 1 
ATOM   1015 O OE2 . GLU A 1 146 ? 5.445   28.523 25.863 1.00 17.81 ? 1806 GLU A OE2 1 
ATOM   1016 N N   . LYS A 1 147 ? 3.216   30.367 32.243 1.00 21.62 ? 1807 LYS A N   1 
ATOM   1017 C CA  . LYS A 1 147 ? 2.345   31.142 33.127 1.00 23.07 ? 1807 LYS A CA  1 
ATOM   1018 C C   . LYS A 1 147 ? 1.260   30.258 33.725 1.00 20.30 ? 1807 LYS A C   1 
ATOM   1019 O O   . LYS A 1 147 ? 0.107   30.666 33.751 1.00 18.08 ? 1807 LYS A O   1 
ATOM   1020 C CB  . LYS A 1 147 ? 1.662   32.288 32.366 1.00 24.27 ? 1807 LYS A CB  1 
ATOM   1021 C CG  . LYS A 1 147 ? 2.581   33.080 31.429 1.00 34.07 ? 1807 LYS A CG  1 
ATOM   1022 C CD  . LYS A 1 147 ? 1.810   33.705 30.258 1.00 38.25 ? 1807 LYS A CD  1 
ATOM   1023 C CE  . LYS A 1 147 ? 2.675   34.746 29.557 1.00 43.05 ? 1807 LYS A CE  1 
ATOM   1024 N NZ  . LYS A 1 147 ? 3.786   35.274 30.410 1.00 47.39 ? 1807 LYS A NZ  1 
ATOM   1025 N N   . GLY A 1 148 ? 1.636   29.064 34.176 1.00 20.84 ? 1808 GLY A N   1 
ATOM   1026 C CA  . GLY A 1 148 ? 0.697   28.104 34.731 1.00 21.03 ? 1808 GLY A CA  1 
ATOM   1027 C C   . GLY A 1 148 ? -0.310  27.477 33.785 1.00 22.44 ? 1808 GLY A C   1 
ATOM   1028 O O   . GLY A 1 148 ? -1.132  26.657 34.200 1.00 26.32 ? 1808 GLY A O   1 
ATOM   1029 N N   . ARG A 1 149 ? -0.271  27.815 32.505 1.00 21.79 ? 1809 ARG A N   1 
ATOM   1030 C CA  . ARG A 1 149 ? -1.146  27.145 31.544 1.00 21.95 ? 1809 ARG A CA  1 
ATOM   1031 C C   . ARG A 1 149 ? -0.430  26.059 30.733 1.00 19.84 ? 1809 ARG A C   1 
ATOM   1032 O O   . ARG A 1 149 ? 0.577   26.344 30.083 1.00 20.62 ? 1809 ARG A O   1 
ATOM   1033 C CB  . ARG A 1 149 ? -1.817  28.168 30.624 1.00 22.47 ? 1809 ARG A CB  1 
ATOM   1034 C CG  . ARG A 1 149 ? -2.883  27.560 29.680 1.00 31.05 ? 1809 ARG A CG  1 
ATOM   1035 C CD  . ARG A 1 149 ? -4.278  28.179 29.817 1.00 36.98 ? 1809 ARG A CD  1 
ATOM   1036 N NE  . ARG A 1 149 ? -4.288  29.558 29.336 1.00 46.80 ? 1809 ARG A NE  1 
ATOM   1037 C CZ  . ARG A 1 149 ? -4.669  30.604 30.061 1.00 50.73 ? 1809 ARG A CZ  1 
ATOM   1038 N NH1 . ARG A 1 149 ? -5.088  30.428 31.307 1.00 54.44 ? 1809 ARG A NH1 1 
ATOM   1039 N NH2 . ARG A 1 149 ? -4.634  31.825 29.543 1.00 50.28 ? 1809 ARG A NH2 1 
ATOM   1040 N N   . VAL A 1 150 ? -0.946  24.831 30.775 1.00 19.04 ? 1810 VAL A N   1 
ATOM   1041 C CA  . VAL A 1 150 ? -0.478  23.709 29.949 1.00 17.60 ? 1810 VAL A CA  1 
ATOM   1042 C C   . VAL A 1 150 ? -0.533  24.003 28.457 1.00 16.63 ? 1810 VAL A C   1 
ATOM   1043 O O   . VAL A 1 150 ? -1.581  24.394 27.952 1.00 14.73 ? 1810 VAL A O   1 
ATOM   1044 C CB  . VAL A 1 150 ? -1.306  22.429 30.215 1.00 19.66 ? 1810 VAL A CB  1 
ATOM   1045 C CG1 . VAL A 1 150 ? -0.774  21.272 29.387 1.00 17.21 ? 1810 VAL A CG1 1 
ATOM   1046 C CG2 . VAL A 1 150 ? -1.218  22.065 31.690 1.00 18.28 ? 1810 VAL A CG2 1 
ATOM   1047 N N   . LYS A 1 151 ? 0.591   23.805 27.771 1.00 15.33 ? 1811 LYS A N   1 
ATOM   1048 C CA  . LYS A 1 151 ? 0.741   24.085 26.346 1.00 13.11 ? 1811 LYS A CA  1 
ATOM   1049 C C   . LYS A 1 151 ? 1.079   22.810 25.564 1.00 13.18 ? 1811 LYS A C   1 
ATOM   1050 O O   . LYS A 1 151 ? 0.718   22.660 24.394 1.00 10.27 ? 1811 LYS A O   1 
ATOM   1051 C CB  . LYS A 1 151 ? 1.878   25.096 26.138 1.00 12.60 ? 1811 LYS A CB  1 
ATOM   1052 C CG  . LYS A 1 151 ? 1.619   26.494 26.687 1.00 14.57 ? 1811 LYS A CG  1 
ATOM   1053 C CD  . LYS A 1 151 ? 0.285   27.077 26.229 1.00 11.78 ? 1811 LYS A CD  1 
ATOM   1054 C CE  . LYS A 1 151 ? 0.099   28.452 26.842 1.00 15.04 ? 1811 LYS A CE  1 
ATOM   1055 N NZ  . LYS A 1 151 ? -0.864  29.331 26.101 1.00 14.17 ? 1811 LYS A NZ  1 
ATOM   1056 N N   . CYS A 1 152 ? 1.802   21.895 26.206 1.00 15.26 ? 1812 CYS A N   1 
ATOM   1057 C CA  . CYS A 1 152 ? 2.293   20.685 25.521 1.00 15.27 ? 1812 CYS A CA  1 
ATOM   1058 C C   . CYS A 1 152 ? 2.671   19.664 26.573 1.00 15.56 ? 1812 CYS A C   1 
ATOM   1059 O O   . CYS A 1 152 ? 3.239   20.031 27.605 1.00 16.40 ? 1812 CYS A O   1 
ATOM   1060 C CB  . CYS A 1 152 ? 3.489   21.010 24.623 1.00 14.36 ? 1812 CYS A CB  1 
ATOM   1061 S SG  . CYS A 1 152 ? 4.208   19.652 23.663 1.00 12.00 ? 1812 CYS A SG  1 
ATOM   1062 N N   . ASP A 1 153 ? 2.351   18.395 26.332 1.00 16.13 ? 1813 ASP A N   1 
ATOM   1063 C CA  . ASP A 1 153 ? 2.830   17.358 27.247 1.00 14.60 ? 1813 ASP A CA  1 
ATOM   1064 C C   . ASP A 1 153 ? 4.346   17.197 27.125 1.00 14.65 ? 1813 ASP A C   1 
ATOM   1065 O O   . ASP A 1 153 ? 4.902   17.485 26.061 1.00 11.88 ? 1813 ASP A O   1 
ATOM   1066 C CB  . ASP A 1 153 ? 2.112   16.051 26.943 1.00 15.83 ? 1813 ASP A CB  1 
ATOM   1067 C CG  . ASP A 1 153 ? 2.543   14.927 27.846 1.00 13.90 ? 1813 ASP A CG  1 
ATOM   1068 O OD1 . ASP A 1 153 ? 3.177   14.010 27.305 1.00 18.03 ? 1813 ASP A OD1 1 
ATOM   1069 O OD2 . ASP A 1 153 ? 2.272   14.947 29.064 1.00 16.22 ? 1813 ASP A OD2 1 
ATOM   1070 N N   . HIS A 1 154 ? 4.994   16.751 28.202 1.00 14.04 ? 1814 HIS A N   1 
ATOM   1071 C CA  . HIS A 1 154 ? 6.425   16.394 28.212 1.00 16.91 ? 1814 HIS A CA  1 
ATOM   1072 C C   . HIS A 1 154 ? 6.590   14.991 27.634 1.00 16.38 ? 1814 HIS A C   1 
ATOM   1073 O O   . HIS A 1 154 ? 6.789   14.025 28.367 1.00 17.12 ? 1814 HIS A O   1 
ATOM   1074 C CB  . HIS A 1 154 ? 7.053   16.456 29.629 1.00 16.11 ? 1814 HIS A CB  1 
ATOM   1075 C CG  . HIS A 1 154 ? 8.550   16.350 29.637 1.00 19.44 ? 1814 HIS A CG  1 
ATOM   1076 N ND1 . HIS A 1 154 ? 9.226   15.229 29.203 1.00 20.69 ? 1814 HIS A ND1 1 
ATOM   1077 C CD2 . HIS A 1 154 ? 9.510   17.223 30.038 1.00 23.56 ? 1814 HIS A CD2 1 
ATOM   1078 C CE1 . HIS A 1 154 ? 10.529  15.413 29.335 1.00 17.68 ? 1814 HIS A CE1 1 
ATOM   1079 N NE2 . HIS A 1 154 ? 10.729  16.622 29.827 1.00 24.22 ? 1814 HIS A NE2 1 
ATOM   1080 N N   . TYR A 1 155 ? 6.543   14.910 26.307 1.00 14.90 ? 1815 TYR A N   1 
ATOM   1081 C CA  . TYR A 1 155 ? 6.262   13.693 25.581 1.00 13.10 ? 1815 TYR A CA  1 
ATOM   1082 C C   . TYR A 1 155 ? 7.514   12.897 25.225 1.00 14.39 ? 1815 TYR A C   1 
ATOM   1083 O O   . TYR A 1 155 ? 7.403   11.887 24.541 1.00 14.16 ? 1815 TYR A O   1 
ATOM   1084 C CB  . TYR A 1 155 ? 5.498   14.040 24.290 1.00 13.33 ? 1815 TYR A CB  1 
ATOM   1085 C CG  . TYR A 1 155 ? 6.254   14.943 23.330 1.00 8.77  ? 1815 TYR A CG  1 
ATOM   1086 C CD1 . TYR A 1 155 ? 7.111   14.399 22.374 1.00 3.88  ? 1815 TYR A CD1 1 
ATOM   1087 C CD2 . TYR A 1 155 ? 6.113   16.329 23.375 1.00 8.06  ? 1815 TYR A CD2 1 
ATOM   1088 C CE1 . TYR A 1 155 ? 7.825   15.201 21.478 1.00 3.18  ? 1815 TYR A CE1 1 
ATOM   1089 C CE2 . TYR A 1 155 ? 6.831   17.147 22.490 1.00 8.87  ? 1815 TYR A CE2 1 
ATOM   1090 C CZ  . TYR A 1 155 ? 7.664   16.576 21.536 1.00 9.26  ? 1815 TYR A CZ  1 
ATOM   1091 O OH  . TYR A 1 155 ? 8.378   17.376 20.669 1.00 8.47  ? 1815 TYR A OH  1 
ATOM   1092 N N   . TRP A 1 156 ? 8.696   13.326 25.663 1.00 13.22 ? 1816 TRP A N   1 
ATOM   1093 C CA  . TRP A 1 156 ? 9.913   12.538 25.449 1.00 13.12 ? 1816 TRP A CA  1 
ATOM   1094 C C   . TRP A 1 156 ? 10.467  12.122 26.822 1.00 14.66 ? 1816 TRP A C   1 
ATOM   1095 O O   . TRP A 1 156 ? 10.061  12.713 27.813 1.00 11.80 ? 1816 TRP A O   1 
ATOM   1096 C CB  . TRP A 1 156 ? 10.931  13.375 24.657 1.00 12.02 ? 1816 TRP A CB  1 
ATOM   1097 C CG  . TRP A 1 156 ? 11.348  14.643 25.357 1.00 11.40 ? 1816 TRP A CG  1 
ATOM   1098 C CD1 . TRP A 1 156 ? 12.457  14.817 26.130 1.00 12.02 ? 1816 TRP A CD1 1 
ATOM   1099 C CD2 . TRP A 1 156 ? 10.645  15.899 25.369 1.00 8.39  ? 1816 TRP A CD2 1 
ATOM   1100 N NE1 . TRP A 1 156 ? 12.495  16.107 26.616 1.00 9.31  ? 1816 TRP A NE1 1 
ATOM   1101 C CE2 . TRP A 1 156 ? 11.397  16.790 26.163 1.00 10.85 ? 1816 TRP A CE2 1 
ATOM   1102 C CE3 . TRP A 1 156 ? 9.451   16.349 24.787 1.00 6.65  ? 1816 TRP A CE3 1 
ATOM   1103 C CZ2 . TRP A 1 156 ? 11.013  18.119 26.375 1.00 13.53 ? 1816 TRP A CZ2 1 
ATOM   1104 C CZ3 . TRP A 1 156 ? 9.061   17.667 24.997 1.00 12.33 ? 1816 TRP A CZ3 1 
ATOM   1105 C CH2 . TRP A 1 156 ? 9.845   18.539 25.788 1.00 13.43 ? 1816 TRP A CH2 1 
ATOM   1106 N N   . PRO A 1 157 ? 11.387  11.134 26.896 1.00 17.16 ? 1817 PRO A N   1 
ATOM   1107 C CA  . PRO A 1 157 ? 11.887  10.690 28.207 1.00 19.90 ? 1817 PRO A CA  1 
ATOM   1108 C C   . PRO A 1 157 ? 12.521  11.800 29.056 1.00 25.30 ? 1817 PRO A C   1 
ATOM   1109 O O   . PRO A 1 157 ? 13.080  12.778 28.537 1.00 26.54 ? 1817 PRO A O   1 
ATOM   1110 C CB  . PRO A 1 157 ? 12.989  9.686  27.839 1.00 18.84 ? 1817 PRO A CB  1 
ATOM   1111 C CG  . PRO A 1 157 ? 12.588  9.173  26.469 1.00 17.94 ? 1817 PRO A CG  1 
ATOM   1112 C CD  . PRO A 1 157 ? 12.052  10.405 25.796 1.00 13.48 ? 1817 PRO A CD  1 
ATOM   1113 N N   . ALA A 1 158 ? 12.447  11.648 30.375 1.00 28.41 ? 1818 ALA A N   1 
ATOM   1114 C CA  . ALA A 1 158 ? 12.913  12.712 31.256 1.00 30.56 ? 1818 ALA A CA  1 
ATOM   1115 C C   . ALA A 1 158 ? 14.384  12.511 31.608 1.00 32.17 ? 1818 ALA A C   1 
ATOM   1116 O O   . ALA A 1 158 ? 14.985  13.357 32.275 1.00 34.26 ? 1818 ALA A O   1 
ATOM   1117 C CB  . ALA A 1 158 ? 12.042  12.760 32.516 1.00 29.77 ? 1818 ALA A CB  1 
ATOM   1118 N N   . ASP A 1 159 ? 14.955  11.394 31.156 1.00 31.84 ? 1819 ASP A N   1 
ATOM   1119 C CA  . ASP A 1 159 ? 16.321  10.992 31.504 1.00 31.25 ? 1819 ASP A CA  1 
ATOM   1120 C C   . ASP A 1 159 ? 16.754  9.886  30.552 1.00 29.96 ? 1819 ASP A C   1 
ATOM   1121 O O   . ASP A 1 159 ? 16.080  9.642  29.556 1.00 29.24 ? 1819 ASP A O   1 
ATOM   1122 C CB  . ASP A 1 159 ? 16.401  10.472 32.945 1.00 29.59 ? 1819 ASP A CB  1 
ATOM   1123 C CG  . ASP A 1 159 ? 15.513  9.261  33.164 1.00 31.72 ? 1819 ASP A CG  1 
ATOM   1124 O OD1 . ASP A 1 159 ? 15.045  9.062  34.299 1.00 31.90 ? 1819 ASP A OD1 1 
ATOM   1125 O OD2 . ASP A 1 159 ? 15.247  8.502  32.205 1.00 35.96 ? 1819 ASP A OD2 1 
ATOM   1126 N N   . GLN A 1 160 ? 17.853  9.208  30.873 1.00 30.26 ? 1820 GLN A N   1 
ATOM   1127 C CA  . GLN A 1 160 ? 18.493  8.285  29.939 1.00 31.26 ? 1820 GLN A CA  1 
ATOM   1128 C C   . GLN A 1 160 ? 17.895  6.872  29.881 1.00 30.22 ? 1820 GLN A C   1 
ATOM   1129 O O   . GLN A 1 160 ? 18.310  6.053  29.047 1.00 30.37 ? 1820 GLN A O   1 
ATOM   1130 C CB  . GLN A 1 160 ? 20.017  8.272  30.128 1.00 33.40 ? 1820 GLN A CB  1 
ATOM   1131 C CG  . GLN A 1 160 ? 20.781  8.909  28.962 1.00 38.40 ? 1820 GLN A CG  1 
ATOM   1132 C CD  . GLN A 1 160 ? 21.468  10.239 29.288 1.00 45.12 ? 1820 GLN A CD  1 
ATOM   1133 O OE1 . GLN A 1 160 ? 22.499  10.248 29.960 1.00 41.35 ? 1820 GLN A OE1 1 
ATOM   1134 N NE2 . GLN A 1 160 ? 20.925  11.357 28.789 1.00 45.25 ? 1820 GLN A NE2 1 
ATOM   1135 N N   . ASP A 1 161 ? 16.918  6.602  30.747 1.00 26.65 ? 1821 ASP A N   1 
ATOM   1136 C CA  . ASP A 1 161 ? 16.194  5.342  30.753 1.00 26.64 ? 1821 ASP A CA  1 
ATOM   1137 C C   . ASP A 1 161 ? 15.238  5.241  29.556 1.00 26.53 ? 1821 ASP A C   1 
ATOM   1138 O O   . ASP A 1 161 ? 14.511  6.188  29.203 1.00 23.27 ? 1821 ASP A O   1 
ATOM   1139 C CB  . ASP A 1 161 ? 15.382  5.181  32.040 1.00 27.68 ? 1821 ASP A CB  1 
ATOM   1140 C CG  . ASP A 1 161 ? 16.198  4.655  33.216 1.00 33.03 ? 1821 ASP A CG  1 
ATOM   1141 O OD1 . ASP A 1 161 ? 17.417  4.398  33.068 1.00 37.77 ? 1821 ASP A OD1 1 
ATOM   1142 O OD2 . ASP A 1 161 ? 15.599  4.492  34.306 1.00 36.03 ? 1821 ASP A OD2 1 
ATOM   1143 N N   . SER A 1 162 ? 15.229  4.061  28.941 1.00 24.16 ? 1822 SER A N   1 
ATOM   1144 C CA  . SER A 1 162 ? 14.409  3.912  27.753 1.00 22.69 ? 1822 SER A CA  1 
ATOM   1145 C C   . SER A 1 162 ? 12.932  3.753  28.122 1.00 21.98 ? 1822 SER A C   1 
ATOM   1146 O O   . SER A 1 162 ? 12.605  3.235  29.191 1.00 22.69 ? 1822 SER A O   1 
ATOM   1147 C CB  . SER A 1 162 ? 15.034  2.901  26.793 1.00 23.18 ? 1822 SER A CB  1 
ATOM   1148 O OG  . SER A 1 162 ? 14.756  1.564  27.141 1.00 26.76 ? 1822 SER A OG  1 
ATOM   1149 N N   . LEU A 1 163 ? 12.038  4.271  27.286 1.00 19.51 ? 1823 LEU A N   1 
ATOM   1150 C CA  . LEU A 1 163 ? 10.600  4.246  27.537 1.00 18.00 ? 1823 LEU A CA  1 
ATOM   1151 C C   . LEU A 1 163 ? 9.857   3.640  26.348 1.00 14.63 ? 1823 LEU A C   1 
ATOM   1152 O O   . LEU A 1 163 ? 10.308  3.810  25.225 1.00 16.67 ? 1823 LEU A O   1 
ATOM   1153 C CB  . LEU A 1 163 ? 10.081  5.671  27.721 1.00 18.07 ? 1823 LEU A CB  1 
ATOM   1154 C CG  . LEU A 1 163 ? 10.075  6.226  29.137 1.00 20.84 ? 1823 LEU A CG  1 
ATOM   1155 C CD1 . LEU A 1 163 ? 9.467   7.642  29.196 1.00 12.03 ? 1823 LEU A CD1 1 
ATOM   1156 C CD2 . LEU A 1 163 ? 9.359   5.189  29.999 1.00 21.69 ? 1823 LEU A CD2 1 
ATOM   1157 N N   . TYR A 1 164 ? 8.744   2.963  26.594 1.00 11.25 ? 1824 TYR A N   1 
ATOM   1158 C CA  . TYR A 1 164 ? 7.811   2.469  25.569 1.00 12.11 ? 1824 TYR A CA  1 
ATOM   1159 C C   . TYR A 1 164 ? 6.774   3.525  25.181 1.00 12.08 ? 1824 TYR A C   1 
ATOM   1160 O O   . TYR A 1 164 ? 6.173   4.156  26.049 1.00 9.33  ? 1824 TYR A O   1 
ATOM   1161 C CB  . TYR A 1 164 ? 7.033   1.254  26.113 1.00 12.12 ? 1824 TYR A CB  1 
ATOM   1162 C CG  . TYR A 1 164 ? 7.874   -0.006 26.132 1.00 11.77 ? 1824 TYR A CG  1 
ATOM   1163 C CD1 . TYR A 1 164 ? 8.682   -0.313 27.222 1.00 10.82 ? 1824 TYR A CD1 1 
ATOM   1164 C CD2 . TYR A 1 164 ? 7.893   -0.863 25.039 1.00 5.55  ? 1824 TYR A CD2 1 
ATOM   1165 C CE1 . TYR A 1 164 ? 9.469   -1.463 27.227 1.00 11.53 ? 1824 TYR A CE1 1 
ATOM   1166 C CE2 . TYR A 1 164 ? 8.703   -1.996 25.033 1.00 9.84  ? 1824 TYR A CE2 1 
ATOM   1167 C CZ  . TYR A 1 164 ? 9.481   -2.301 26.128 1.00 5.86  ? 1824 TYR A CZ  1 
ATOM   1168 O OH  . TYR A 1 164 ? 10.256  -3.448 26.127 1.00 7.65  ? 1824 TYR A OH  1 
ATOM   1169 N N   . TYR A 1 165 ? 6.566   3.705  23.875 1.00 13.23 ? 1825 TYR A N   1 
ATOM   1170 C CA  . TYR A 1 165 ? 5.555   4.615  23.345 1.00 11.44 ? 1825 TYR A CA  1 
ATOM   1171 C C   . TYR A 1 165 ? 4.788   3.783  22.326 1.00 10.35 ? 1825 TYR A C   1 
ATOM   1172 O O   . TYR A 1 165 ? 5.134   3.725  21.148 1.00 9.51  ? 1825 TYR A O   1 
ATOM   1173 C CB  . TYR A 1 165 ? 6.210   5.852  22.689 1.00 12.61 ? 1825 TYR A CB  1 
ATOM   1174 C CG  . TYR A 1 165 ? 6.889   6.816  23.643 1.00 7.81  ? 1825 TYR A CG  1 
ATOM   1175 C CD1 . TYR A 1 165 ? 6.157   7.806  24.274 1.00 10.08 ? 1825 TYR A CD1 1 
ATOM   1176 C CD2 . TYR A 1 165 ? 8.256   6.748  23.908 1.00 8.26  ? 1825 TYR A CD2 1 
ATOM   1177 C CE1 . TYR A 1 165 ? 6.751   8.696  25.149 1.00 7.58  ? 1825 TYR A CE1 1 
ATOM   1178 C CE2 . TYR A 1 165 ? 8.862   7.627  24.796 1.00 6.03  ? 1825 TYR A CE2 1 
ATOM   1179 C CZ  . TYR A 1 165 ? 8.093   8.596  25.429 1.00 11.72 ? 1825 TYR A CZ  1 
ATOM   1180 O OH  . TYR A 1 165 ? 8.616   9.522  26.324 1.00 8.38  ? 1825 TYR A OH  1 
ATOM   1181 N N   . GLY A 1 166 ? 3.724   3.125  22.757 1.00 11.95 ? 1826 GLY A N   1 
ATOM   1182 C CA  . GLY A 1 166 ? 3.058   2.154  21.874 1.00 12.65 ? 1826 GLY A CA  1 
ATOM   1183 C C   . GLY A 1 166 ? 3.955   0.976  21.525 1.00 12.04 ? 1826 GLY A C   1 
ATOM   1184 O O   . GLY A 1 166 ? 4.566   0.386  22.424 1.00 10.10 ? 1826 GLY A O   1 
ATOM   1185 N N   . ASP A 1 167 ? 4.040   0.679  20.229 1.00 11.29 ? 1827 ASP A N   1 
ATOM   1186 C CA  . ASP A 1 167 ? 4.988   -0.256 19.618 1.00 14.55 ? 1827 ASP A CA  1 
ATOM   1187 C C   . ASP A 1 167 ? 6.435   0.226  19.406 1.00 13.65 ? 1827 ASP A C   1 
ATOM   1188 O O   . ASP A 1 167 ? 7.224   -0.483 18.772 1.00 13.41 ? 1827 ASP A O   1 
ATOM   1189 C CB  . ASP A 1 167 ? 4.499   -0.663 18.226 1.00 16.46 ? 1827 ASP A CB  1 
ATOM   1190 C CG  . ASP A 1 167 ? 3.065   -1.115 18.197 1.00 25.36 ? 1827 ASP A CG  1 
ATOM   1191 O OD1 . ASP A 1 167 ? 2.700   -1.978 19.018 1.00 39.37 ? 1827 ASP A OD1 1 
ATOM   1192 O OD2 . ASP A 1 167 ? 2.296   -0.614 17.347 1.00 33.55 ? 1827 ASP A OD2 1 
ATOM   1193 N N   . LEU A 1 168 ? 6.793   1.405  19.907 1.00 10.70 ? 1828 LEU A N   1 
ATOM   1194 C CA  . LEU A 1 168 ? 8.140   1.962  19.737 1.00 8.74  ? 1828 LEU A CA  1 
ATOM   1195 C C   . LEU A 1 168 ? 8.864   2.015  21.088 1.00 8.01  ? 1828 LEU A C   1 
ATOM   1196 O O   . LEU A 1 168 ? 8.221   2.150  22.128 1.00 7.76  ? 1828 LEU A O   1 
ATOM   1197 C CB  . LEU A 1 168 ? 8.055   3.390  19.163 1.00 2.81  ? 1828 LEU A CB  1 
ATOM   1198 C CG  . LEU A 1 168 ? 7.379   3.416  17.797 1.00 8.61  ? 1828 LEU A CG  1 
ATOM   1199 C CD1 . LEU A 1 168 ? 7.302   4.810  17.191 1.00 14.52 ? 1828 LEU A CD1 1 
ATOM   1200 C CD2 . LEU A 1 168 ? 8.226   2.512  16.889 1.00 11.95 ? 1828 LEU A CD2 1 
ATOM   1201 N N   . ILE A 1 169 ? 10.188  1.920  21.079 1.00 8.35  ? 1829 ILE A N   1 
ATOM   1202 C CA  . ILE A 1 169 ? 10.987  2.229  22.260 1.00 11.32 ? 1829 ILE A CA  1 
ATOM   1203 C C   . ILE A 1 169 ? 11.853  3.429  21.936 1.00 12.37 ? 1829 ILE A C   1 
ATOM   1204 O O   . ILE A 1 169 ? 12.462  3.527  20.857 1.00 13.72 ? 1829 ILE A O   1 
ATOM   1205 C CB  . ILE A 1 169 ? 11.975  1.098  22.618 1.00 11.90 ? 1829 ILE A CB  1 
ATOM   1206 C CG1 . ILE A 1 169 ? 11.223  -0.150 23.051 1.00 12.42 ? 1829 ILE A CG1 1 
ATOM   1207 C CG2 . ILE A 1 169 ? 12.938  1.486  23.749 1.00 11.19 ? 1829 ILE A CG2 1 
ATOM   1208 C CD1 . ILE A 1 169 ? 12.104  -1.396 22.956 1.00 15.05 ? 1829 ILE A CD1 1 
ATOM   1209 N N   . LEU A 1 170 ? 11.915  4.331  22.908 1.00 12.31 ? 1830 LEU A N   1 
ATOM   1210 C CA  . LEU A 1 170 ? 12.641  5.574  22.723 1.00 10.38 ? 1830 LEU A CA  1 
ATOM   1211 C C   . LEU A 1 170 ? 13.597  5.765  23.886 1.00 12.51 ? 1830 LEU A C   1 
ATOM   1212 O O   . LEU A 1 170 ? 13.219  5.589  25.045 1.00 9.45  ? 1830 LEU A O   1 
ATOM   1213 C CB  . LEU A 1 170 ? 11.654  6.747  22.589 1.00 12.43 ? 1830 LEU A CB  1 
ATOM   1214 C CG  . LEU A 1 170 ? 12.294  8.079  22.215 1.00 12.08 ? 1830 LEU A CG  1 
ATOM   1215 C CD1 . LEU A 1 170 ? 12.506  8.084  20.745 1.00 10.85 ? 1830 LEU A CD1 1 
ATOM   1216 C CD2 . LEU A 1 170 ? 11.429  9.254  22.593 1.00 23.15 ? 1830 LEU A CD2 1 
ATOM   1217 N N   . GLN A 1 171 ? 14.837  6.146  23.578 1.00 14.49 ? 1831 GLN A N   1 
ATOM   1218 C CA  . GLN A 1 171 ? 15.764  6.513  24.636 1.00 16.20 ? 1831 GLN A CA  1 
ATOM   1219 C C   . GLN A 1 171 ? 16.485  7.827  24.346 1.00 15.95 ? 1831 GLN A C   1 
ATOM   1220 O O   . GLN A 1 171 ? 16.997  7.978  23.246 1.00 16.56 ? 1831 GLN A O   1 
ATOM   1221 C CB  . GLN A 1 171 ? 16.797  5.401  24.737 1.00 16.72 ? 1831 GLN A CB  1 
ATOM   1222 C CG  . GLN A 1 171 ? 17.746  5.540  25.900 1.00 22.90 ? 1831 GLN A CG  1 
ATOM   1223 C CD  . GLN A 1 171 ? 18.786  4.428  25.846 1.00 29.76 ? 1831 GLN A CD  1 
ATOM   1224 O OE1 . GLN A 1 171 ? 19.202  4.007  24.760 1.00 23.27 ? 1831 GLN A OE1 1 
ATOM   1225 N NE2 . GLN A 1 171 ? 19.195  3.945  27.019 1.00 25.57 ? 1831 GLN A NE2 1 
ATOM   1226 N N   . MET A 1 172 ? 16.529  8.761  25.298 1.00 16.94 ? 1832 MET A N   1 
ATOM   1227 C CA  . MET A 1 172 ? 17.332  9.981  25.163 1.00 18.08 ? 1832 MET A CA  1 
ATOM   1228 C C   . MET A 1 172 ? 18.827  9.701  25.239 1.00 18.81 ? 1832 MET A C   1 
ATOM   1229 O O   . MET A 1 172 ? 19.293  9.182  26.257 1.00 17.33 ? 1832 MET A O   1 
ATOM   1230 C CB  . MET A 1 172 ? 16.992  10.971 26.276 1.00 19.29 ? 1832 MET A CB  1 
ATOM   1231 C CG  . MET A 1 172 ? 17.618  12.336 26.074 1.00 19.68 ? 1832 MET A CG  1 
ATOM   1232 S SD  . MET A 1 172 ? 16.679  13.680 26.828 1.00 18.88 ? 1832 MET A SD  1 
ATOM   1233 C CE  . MET A 1 172 ? 16.903  13.319 28.576 1.00 21.76 ? 1832 MET A CE  1 
ATOM   1234 N N   . LEU A 1 173 ? 19.579  10.027 24.188 1.00 17.88 ? 1833 LEU A N   1 
ATOM   1235 C CA  . LEU A 1 173 ? 21.023  9.831  24.239 1.00 17.02 ? 1833 LEU A CA  1 
ATOM   1236 C C   . LEU A 1 173 ? 21.843  10.996 24.799 1.00 18.03 ? 1833 LEU A C   1 
ATOM   1237 O O   . LEU A 1 173 ? 22.974  10.804 25.245 1.00 16.91 ? 1833 LEU A O   1 
ATOM   1238 C CB  . LEU A 1 173 ? 21.556  9.500  22.854 1.00 18.50 ? 1833 LEU A CB  1 
ATOM   1239 C CG  . LEU A 1 173 ? 20.868  8.285  22.266 1.00 18.84 ? 1833 LEU A CG  1 
ATOM   1240 C CD1 . LEU A 1 173 ? 21.331  8.261  20.827 1.00 20.09 ? 1833 LEU A CD1 1 
ATOM   1241 C CD2 . LEU A 1 173 ? 21.246  7.034  23.023 1.00 16.95 ? 1833 LEU A CD2 1 
ATOM   1242 N N   . SER A 1 174 ? 21.275  12.199 24.773 1.00 18.43 ? 1834 SER A N   1 
ATOM   1243 C CA  . SER A 1 174 ? 21.983  13.419 25.152 1.00 18.42 ? 1834 SER A CA  1 
ATOM   1244 C C   . SER A 1 174 ? 20.979  14.552 25.143 1.00 16.23 ? 1834 SER A C   1 
ATOM   1245 O O   . SER A 1 174 ? 19.973  14.477 24.445 1.00 14.69 ? 1834 SER A O   1 
ATOM   1246 C CB  . SER A 1 174 ? 23.127  13.762 24.192 1.00 18.75 ? 1834 SER A CB  1 
ATOM   1247 O OG  . SER A 1 174 ? 22.645  14.197 22.932 1.00 24.95 ? 1834 SER A OG  1 
ATOM   1248 N N   . GLU A 1 175 ? 21.285  15.575 25.935 1.00 17.63 ? 1835 GLU A N   1 
ATOM   1249 C CA  . GLU A 1 175 ? 20.506  16.800 26.098 1.00 18.54 ? 1835 GLU A CA  1 
ATOM   1250 C C   . GLU A 1 175 ? 21.556  17.879 26.287 1.00 19.83 ? 1835 GLU A C   1 
ATOM   1251 O O   . GLU A 1 175 ? 22.390  17.745 27.186 1.00 20.78 ? 1835 GLU A O   1 
ATOM   1252 C CB  . GLU A 1 175 ? 19.707  16.673 27.388 1.00 19.40 ? 1835 GLU A CB  1 
ATOM   1253 C CG  . GLU A 1 175 ? 18.698  17.785 27.688 1.00 22.22 ? 1835 GLU A CG  1 
ATOM   1254 C CD  . GLU A 1 175 ? 17.853  17.396 28.886 1.00 26.34 ? 1835 GLU A CD  1 
ATOM   1255 O OE1 . GLU A 1 175 ? 18.453  17.264 29.979 1.00 33.13 ? 1835 GLU A OE1 1 
ATOM   1256 O OE2 . GLU A 1 175 ? 16.622  17.205 28.743 1.00 21.82 ? 1835 GLU A OE2 1 
ATOM   1257 N N   . SER A 1 176 ? 21.540  18.920 25.455 1.00 20.10 ? 1836 SER A N   1 
ATOM   1258 C CA  . SER A 1 176 ? 22.430  20.069 25.607 1.00 18.07 ? 1836 SER A CA  1 
ATOM   1259 C C   . SER A 1 176 ? 21.618  21.338 25.747 1.00 17.26 ? 1836 SER A C   1 
ATOM   1260 O O   . SER A 1 176 ? 20.914  21.755 24.827 1.00 16.15 ? 1836 SER A O   1 
ATOM   1261 C CB  . SER A 1 176 ? 23.358  20.228 24.411 1.00 18.41 ? 1836 SER A CB  1 
ATOM   1262 O OG  . SER A 1 176 ? 23.987  18.982 24.179 1.00 28.39 ? 1836 SER A OG  1 
ATOM   1263 N N   . VAL A 1 177 ? 21.730  21.950 26.916 1.00 17.28 ? 1837 VAL A N   1 
ATOM   1264 C CA  . VAL A 1 177 ? 20.910  23.104 27.247 1.00 18.03 ? 1837 VAL A CA  1 
ATOM   1265 C C   . VAL A 1 177 ? 21.686  24.366 26.941 1.00 20.67 ? 1837 VAL A C   1 
ATOM   1266 O O   . VAL A 1 177 ? 22.763  24.559 27.488 1.00 23.07 ? 1837 VAL A O   1 
ATOM   1267 C CB  . VAL A 1 177 ? 20.545  23.040 28.717 1.00 17.10 ? 1837 VAL A CB  1 
ATOM   1268 C CG1 . VAL A 1 177 ? 19.828  24.312 29.138 1.00 19.94 ? 1837 VAL A CG1 1 
ATOM   1269 C CG2 . VAL A 1 177 ? 19.737  21.771 28.959 1.00 11.08 ? 1837 VAL A CG2 1 
ATOM   1270 N N   . LEU A 1 178 ? 21.176  25.204 26.040 1.00 23.52 ? 1838 LEU A N   1 
ATOM   1271 C CA  . LEU A 1 178 ? 21.774  26.517 25.790 1.00 21.52 ? 1838 LEU A CA  1 
ATOM   1272 C C   . LEU A 1 178 ? 20.753  27.505 26.326 1.00 21.82 ? 1838 LEU A C   1 
ATOM   1273 O O   . LEU A 1 178 ? 19.632  27.099 26.657 1.00 21.25 ? 1838 LEU A O   1 
ATOM   1274 C CB  . LEU A 1 178 ? 22.091  26.724 24.308 1.00 21.58 ? 1838 LEU A CB  1 
ATOM   1275 C CG  . LEU A 1 178 ? 22.836  25.516 23.718 1.00 25.94 ? 1838 LEU A CG  1 
ATOM   1276 C CD1 . LEU A 1 178 ? 23.409  25.788 22.339 1.00 33.87 ? 1838 LEU A CD1 1 
ATOM   1277 C CD2 . LEU A 1 178 ? 23.978  25.089 24.632 1.00 30.92 ? 1838 LEU A CD2 1 
ATOM   1278 N N   . PRO A 1 179 ? 21.146  28.781 26.452 1.00 23.27 ? 1839 PRO A N   1 
ATOM   1279 C CA  . PRO A 1 179 ? 20.279  29.838 26.996 1.00 24.59 ? 1839 PRO A CA  1 
ATOM   1280 C C   . PRO A 1 179 ? 18.922  29.935 26.308 1.00 22.64 ? 1839 PRO A C   1 
ATOM   1281 O O   . PRO A 1 179 ? 17.917  30.218 26.951 1.00 21.78 ? 1839 PRO A O   1 
ATOM   1282 C CB  . PRO A 1 179 ? 21.086  31.126 26.746 1.00 24.10 ? 1839 PRO A CB  1 
ATOM   1283 C CG  . PRO A 1 179 ? 22.522  30.648 26.822 1.00 27.23 ? 1839 PRO A CG  1 
ATOM   1284 C CD  . PRO A 1 179 ? 22.487  29.301 26.115 1.00 24.20 ? 1839 PRO A CD  1 
ATOM   1285 N N   . GLU A 1 180 ? 18.878  29.696 25.002 1.00 21.48 ? 1840 GLU A N   1 
ATOM   1286 C CA  . GLU A 1 180 ? 17.612  29.924 24.331 1.00 19.29 ? 1840 GLU A CA  1 
ATOM   1287 C C   . GLU A 1 180 ? 17.037  28.695 23.651 1.00 17.00 ? 1840 GLU A C   1 
ATOM   1288 O O   . GLU A 1 180 ? 15.904  28.720 23.196 1.00 14.04 ? 1840 GLU A O   1 
ATOM   1289 C CB  . GLU A 1 180 ? 17.735  31.112 23.387 1.00 18.63 ? 1840 GLU A CB  1 
ATOM   1290 C CG  . GLU A 1 180 ? 18.259  32.325 24.124 1.00 22.45 ? 1840 GLU A CG  1 
ATOM   1291 C CD  . GLU A 1 180 ? 18.553  33.427 23.137 1.00 30.62 ? 1840 GLU A CD  1 
ATOM   1292 O OE1 . GLU A 1 180 ? 19.535  33.294 22.370 1.00 34.99 ? 1840 GLU A OE1 1 
ATOM   1293 O OE2 . GLU A 1 180 ? 17.771  34.397 23.115 1.00 30.59 ? 1840 GLU A OE2 1 
ATOM   1294 N N   . TRP A 1 181 ? 17.840  27.638 23.600 1.00 16.56 ? 1841 TRP A N   1 
ATOM   1295 C CA  . TRP A 1 181 ? 17.360  26.343 23.155 1.00 16.22 ? 1841 TRP A CA  1 
ATOM   1296 C C   . TRP A 1 181 ? 18.211  25.186 23.644 1.00 15.41 ? 1841 TRP A C   1 
ATOM   1297 O O   . TRP A 1 181 ? 19.318  25.390 24.152 1.00 13.38 ? 1841 TRP A O   1 
ATOM   1298 C CB  . TRP A 1 181 ? 17.309  26.307 21.642 1.00 15.36 ? 1841 TRP A CB  1 
ATOM   1299 C CG  . TRP A 1 181 ? 18.587  26.623 20.929 1.00 14.50 ? 1841 TRP A CG  1 
ATOM   1300 C CD1 . TRP A 1 181 ? 19.587  25.743 20.617 1.00 10.65 ? 1841 TRP A CD1 1 
ATOM   1301 C CD2 . TRP A 1 181 ? 18.986  27.897 20.407 1.00 10.80 ? 1841 TRP A CD2 1 
ATOM   1302 N NE1 . TRP A 1 181 ? 20.582  26.394 19.932 1.00 10.89 ? 1841 TRP A NE1 1 
ATOM   1303 C CE2 . TRP A 1 181 ? 20.241  27.713 19.779 1.00 9.73  ? 1841 TRP A CE2 1 
ATOM   1304 C CE3 . TRP A 1 181 ? 18.407  29.174 20.404 1.00 10.85 ? 1841 TRP A CE3 1 
ATOM   1305 C CZ2 . TRP A 1 181 ? 20.924  28.760 19.131 1.00 11.77 ? 1841 TRP A CZ2 1 
ATOM   1306 C CZ3 . TRP A 1 181 ? 19.096  30.230 19.772 1.00 11.90 ? 1841 TRP A CZ3 1 
ATOM   1307 C CH2 . TRP A 1 181 ? 20.350  30.014 19.162 1.00 11.68 ? 1841 TRP A CH2 1 
ATOM   1308 N N   . THR A 1 182 ? 17.657  23.988 23.472 1.00 12.44 ? 1842 THR A N   1 
ATOM   1309 C CA  . THR A 1 182 ? 18.148  22.773 24.114 1.00 12.44 ? 1842 THR A CA  1 
ATOM   1310 C C   . THR A 1 182 ? 18.039  21.755 22.993 1.00 10.54 ? 1842 THR A C   1 
ATOM   1311 O O   . THR A 1 182 ? 16.983  21.581 22.388 1.00 11.66 ? 1842 THR A O   1 
ATOM   1312 C CB  . THR A 1 182 ? 17.232  22.280 25.275 1.00 11.63 ? 1842 THR A CB  1 
ATOM   1313 O OG1 . THR A 1 182 ? 17.296  23.147 26.415 1.00 15.40 ? 1842 THR A OG1 1 
ATOM   1314 C CG2 . THR A 1 182 ? 17.642  20.877 25.712 1.00 13.33 ? 1842 THR A CG2 1 
ATOM   1315 N N   . ILE A 1 183 ? 19.140  21.078 22.702 1.00 12.41 ? 1843 ILE A N   1 
ATOM   1316 C CA  . ILE A 1 183 ? 19.169  20.063 21.652 1.00 11.62 ? 1843 ILE A CA  1 
ATOM   1317 C C   . ILE A 1 183 ? 19.306  18.681 22.284 1.00 12.88 ? 1843 ILE A C   1 
ATOM   1318 O O   . ILE A 1 183 ? 20.167  18.479 23.134 1.00 13.68 ? 1843 ILE A O   1 
ATOM   1319 C CB  . ILE A 1 183 ? 20.255  20.381 20.602 1.00 10.43 ? 1843 ILE A CB  1 
ATOM   1320 C CG1 . ILE A 1 183 ? 19.922  21.751 19.976 1.00 9.57  ? 1843 ILE A CG1 1 
ATOM   1321 C CG2 . ILE A 1 183 ? 20.399  19.218 19.609 1.00 6.04  ? 1843 ILE A CG2 1 
ATOM   1322 C CD1 . ILE A 1 183 ? 21.036  22.357 19.116 1.00 10.41 ? 1843 ILE A CD1 1 
ATOM   1323 N N   . ARG A 1 184 ? 18.432  17.758 21.881 1.00 12.25 ? 1844 ARG A N   1 
ATOM   1324 C CA  . ARG A 1 184 ? 18.368  16.428 22.466 1.00 12.78 ? 1844 ARG A CA  1 
ATOM   1325 C C   . ARG A 1 184 ? 18.440  15.441 21.326 1.00 12.35 ? 1844 ARG A C   1 
ATOM   1326 O O   . ARG A 1 184 ? 17.958  15.726 20.239 1.00 13.13 ? 1844 ARG A O   1 
ATOM   1327 C CB  . ARG A 1 184 ? 17.073  16.193 23.252 1.00 12.24 ? 1844 ARG A CB  1 
ATOM   1328 C CG  . ARG A 1 184 ? 16.881  17.201 24.370 1.00 12.30 ? 1844 ARG A CG  1 
ATOM   1329 C CD  . ARG A 1 184 ? 15.633  16.878 25.156 1.00 15.86 ? 1844 ARG A CD  1 
ATOM   1330 N NE  . ARG A 1 184 ? 15.401  17.718 26.334 1.00 11.12 ? 1844 ARG A NE  1 
ATOM   1331 C CZ  . ARG A 1 184 ? 14.810  18.911 26.321 1.00 13.31 ? 1844 ARG A CZ  1 
ATOM   1332 N NH1 . ARG A 1 184 ? 14.408  19.495 25.193 1.00 13.35 ? 1844 ARG A NH1 1 
ATOM   1333 N NH2 . ARG A 1 184 ? 14.634  19.548 27.462 1.00 11.49 ? 1844 ARG A NH2 1 
ATOM   1334 N N   . GLU A 1 185 ? 19.042  14.288 21.595 1.00 13.30 ? 1845 GLU A N   1 
ATOM   1335 C CA  . GLU A 1 185 ? 19.218  13.229 20.615 1.00 14.17 ? 1845 GLU A CA  1 
ATOM   1336 C C   . GLU A 1 185 ? 18.565  12.010 21.223 1.00 13.16 ? 1845 GLU A C   1 
ATOM   1337 O O   . GLU A 1 185 ? 18.883  11.625 22.350 1.00 13.03 ? 1845 GLU A O   1 
ATOM   1338 C CB  . GLU A 1 185 ? 20.713  12.932 20.412 1.00 14.27 ? 1845 GLU A CB  1 
ATOM   1339 C CG  . GLU A 1 185 ? 21.359  14.121 19.743 1.00 19.45 ? 1845 GLU A CG  1 
ATOM   1340 C CD  . GLU A 1 185 ? 22.841  13.990 19.482 1.00 27.98 ? 1845 GLU A CD  1 
ATOM   1341 O OE1 . GLU A 1 185 ? 23.260  14.600 18.462 1.00 23.71 ? 1845 GLU A OE1 1 
ATOM   1342 O OE2 . GLU A 1 185 ? 23.531  13.325 20.298 1.00 26.34 ? 1845 GLU A OE2 1 
ATOM   1343 N N   . PHE A 1 186 ? 17.653  11.430 20.451 1.00 13.70 ? 1846 PHE A N   1 
ATOM   1344 C CA  . PHE A 1 186 ? 16.984  10.204 20.837 1.00 14.41 ? 1846 PHE A CA  1 
ATOM   1345 C C   . PHE A 1 186 ? 17.322  9.039  19.907 1.00 16.28 ? 1846 PHE A C   1 
ATOM   1346 O O   . PHE A 1 186 ? 17.586  9.160  18.711 1.00 17.37 ? 1846 PHE A O   1 
ATOM   1347 C CB  . PHE A 1 186 ? 15.477  10.398 20.810 1.00 13.95 ? 1846 PHE A CB  1 
ATOM   1348 C CG  . PHE A 1 186 ? 14.982  11.583 21.587 1.00 14.07 ? 1846 PHE A CG  1 
ATOM   1349 C CD1 . PHE A 1 186 ? 14.415  12.661 20.919 1.00 11.04 ? 1846 PHE A CD1 1 
ATOM   1350 C CD2 . PHE A 1 186 ? 15.020  11.592 22.970 1.00 12.61 ? 1846 PHE A CD2 1 
ATOM   1351 C CE1 . PHE A 1 186 ? 13.916  13.758 21.599 1.00 7.81  ? 1846 PHE A CE1 1 
ATOM   1352 C CE2 . PHE A 1 186 ? 14.528  12.693 23.665 1.00 9.61  ? 1846 PHE A CE2 1 
ATOM   1353 C CZ  . PHE A 1 186 ? 13.980  13.775 22.978 1.00 9.54  ? 1846 PHE A CZ  1 
ATOM   1354 N N   . LYS A 1 187 ? 17.310  7.854  20.481 1.00 17.17 ? 1847 LYS A N   1 
ATOM   1355 C CA  . LYS A 1 187 ? 17.251  6.703  19.609 1.00 19.73 ? 1847 LYS A CA  1 
ATOM   1356 C C   . LYS A 1 187 ? 15.902  6.024  19.790 1.00 17.39 ? 1847 LYS A C   1 
ATOM   1357 O O   . LYS A 1 187 ? 15.462  5.798  20.923 1.00 17.69 ? 1847 LYS A O   1 
ATOM   1358 C CB  . LYS A 1 187 ? 18.455  5.807  19.904 1.00 20.34 ? 1847 LYS A CB  1 
ATOM   1359 C CG  . LYS A 1 187 ? 18.317  4.382  19.477 1.00 20.75 ? 1847 LYS A CG  1 
ATOM   1360 C CD  . LYS A 1 187 ? 19.701  3.750  19.574 1.00 30.85 ? 1847 LYS A CD  1 
ATOM   1361 C CE  . LYS A 1 187 ? 19.883  2.963  20.866 1.00 36.16 ? 1847 LYS A CE  1 
ATOM   1362 N NZ  . LYS A 1 187 ? 20.729  1.744  20.634 1.00 36.51 ? 1847 LYS A NZ  1 
ATOM   1363 N N   . ILE A 1 188 ? 15.276  5.757  18.645 1.00 17.88 ? 1848 ILE A N   1 
ATOM   1364 C CA  . ILE A 1 188 ? 13.994  5.070  18.514 1.00 18.55 ? 1848 ILE A CA  1 
ATOM   1365 C C   . ILE A 1 188 ? 14.125  3.731  17.776 1.00 19.19 ? 1848 ILE A C   1 
ATOM   1366 O O   . ILE A 1 188 ? 14.831  3.630  16.774 1.00 19.31 ? 1848 ILE A O   1 
ATOM   1367 C CB  . ILE A 1 188 ? 12.946  5.992  17.831 1.00 18.47 ? 1848 ILE A CB  1 
ATOM   1368 C CG1 . ILE A 1 188 ? 11.522  5.462  17.959 1.00 14.71 ? 1848 ILE A CG1 1 
ATOM   1369 C CG2 . ILE A 1 188 ? 13.253  6.264  16.357 1.00 23.45 ? 1848 ILE A CG2 1 
ATOM   1370 C CD1 . ILE A 1 188 ? 10.511  6.643  17.911 1.00 18.33 ? 1848 ILE A CD1 1 
ATOM   1371 N N   . CYS A 1 189 ? 13.447  2.705  18.280 1.00 20.01 ? 1849 CYS A N   1 
ATOM   1372 C CA  . CYS A 1 189 ? 13.412  1.374  17.676 1.00 22.31 ? 1849 CYS A CA  1 
ATOM   1373 C C   . CYS A 1 189 ? 11.948  0.929  17.678 1.00 21.13 ? 1849 CYS A C   1 
ATOM   1374 O O   . CYS A 1 189 ? 11.233  1.237  18.636 1.00 16.51 ? 1849 CYS A O   1 
ATOM   1375 C CB  . CYS A 1 189 ? 14.172  0.331  18.525 1.00 20.94 ? 1849 CYS A CB  1 
ATOM   1376 S SG  . CYS A 1 189 ? 15.487  0.909  19.578 1.00 35.43 ? 1849 CYS A SG  1 
ATOM   1377 N N   . GLY A 1 190 ? 11.555  0.182  16.648 1.00 21.07 ? 1850 GLY A N   1 
ATOM   1378 C CA  . GLY A 1 190 ? 10.270  -0.525 16.603 1.00 25.25 ? 1850 GLY A CA  1 
ATOM   1379 C C   . GLY A 1 190 ? 10.281  -2.016 16.918 1.00 29.84 ? 1850 GLY A C   1 
ATOM   1380 O O   . GLY A 1 190 ? 11.299  -2.592 17.316 1.00 29.29 ? 1850 GLY A O   1 
ATOM   1381 N N   . GLU A 1 191 ? 9.134   -2.671 16.743 1.00 32.89 ? 1851 GLU A N   1 
ATOM   1382 C CA  . GLU A 1 191 ? 9.005   -4.080 17.126 1.00 34.27 ? 1851 GLU A CA  1 
ATOM   1383 C C   . GLU A 1 191 ? 9.383   -5.178 16.111 1.00 33.93 ? 1851 GLU A C   1 
ATOM   1384 O O   . GLU A 1 191 ? 9.428   -4.969 14.888 1.00 34.31 ? 1851 GLU A O   1 
ATOM   1385 C CB  . GLU A 1 191 ? 7.623   -4.296 17.733 1.00 33.50 ? 1851 GLU A CB  1 
ATOM   1386 C CG  . GLU A 1 191 ? 7.305   -5.744 18.032 1.00 36.14 ? 1851 GLU A CG  1 
ATOM   1387 C CD  . GLU A 1 191 ? 5.997   -5.892 18.788 1.00 35.79 ? 1851 GLU A CD  1 
ATOM   1388 O OE1 . GLU A 1 191 ? 5.118   -5.015 18.651 1.00 33.31 ? 1851 GLU A OE1 1 
ATOM   1389 O OE2 . GLU A 1 191 ? 5.854   -6.894 19.516 1.00 37.52 ? 1851 GLU A OE2 1 
ATOM   1390 N N   . HIS A 1 197 ? 16.952  0.790  14.656 1.00 31.82 ? 1857 HIS A N   1 
ATOM   1391 C CA  . HIS A 1 197 ? 17.058  2.056  15.380 1.00 31.23 ? 1857 HIS A CA  1 
ATOM   1392 C C   . HIS A 1 197 ? 17.359  3.236  14.468 1.00 28.82 ? 1857 HIS A C   1 
ATOM   1393 O O   . HIS A 1 197 ? 18.262  3.170  13.643 1.00 28.73 ? 1857 HIS A O   1 
ATOM   1394 C CB  . HIS A 1 197 ? 18.070  1.973  16.529 1.00 31.54 ? 1857 HIS A CB  1 
ATOM   1395 C CG  . HIS A 1 197 ? 19.501  2.004  16.089 1.00 41.06 ? 1857 HIS A CG  1 
ATOM   1396 N ND1 . HIS A 1 197 ? 20.168  3.179  15.805 1.00 49.90 ? 1857 HIS A ND1 1 
ATOM   1397 C CD2 . HIS A 1 197 ? 20.397  1.006  15.896 1.00 44.94 ? 1857 HIS A CD2 1 
ATOM   1398 C CE1 . HIS A 1 197 ? 21.411  2.905  15.450 1.00 49.45 ? 1857 HIS A CE1 1 
ATOM   1399 N NE2 . HIS A 1 197 ? 21.574  1.594  15.493 1.00 51.11 ? 1857 HIS A NE2 1 
ATOM   1400 N N   . ARG A 1 198 ? 16.598  4.315  14.626 1.00 26.83 ? 1858 ARG A N   1 
ATOM   1401 C CA  . ARG A 1 198 ? 16.877  5.605  13.996 1.00 23.20 ? 1858 ARG A CA  1 
ATOM   1402 C C   . ARG A 1 198 ? 17.293  6.620  15.050 1.00 20.54 ? 1858 ARG A C   1 
ATOM   1403 O O   . ARG A 1 198 ? 16.792  6.592  16.178 1.00 19.79 ? 1858 ARG A O   1 
ATOM   1404 C CB  . ARG A 1 198 ? 15.626  6.114  13.259 1.00 24.33 ? 1858 ARG A CB  1 
ATOM   1405 C CG  . ARG A 1 198 ? 15.793  7.474  12.558 1.00 24.72 ? 1858 ARG A CG  1 
ATOM   1406 C CD  . ARG A 1 198 ? 14.470  8.029  12.058 1.00 23.63 ? 1858 ARG A CD  1 
ATOM   1407 N NE  . ARG A 1 198 ? 13.631  7.002  11.426 1.00 25.71 ? 1858 ARG A NE  1 
ATOM   1408 C CZ  . ARG A 1 198 ? 12.301  7.018  11.458 1.00 16.78 ? 1858 ARG A CZ  1 
ATOM   1409 N NH1 . ARG A 1 198 ? 11.674  8.004  12.099 1.00 8.63  ? 1858 ARG A NH1 1 
ATOM   1410 N NH2 . ARG A 1 198 ? 11.614  6.048  10.864 1.00 10.11 ? 1858 ARG A NH2 1 
ATOM   1411 N N   . LEU A 1 199 ? 18.202  7.512  14.670 1.00 19.62 ? 1859 LEU A N   1 
ATOM   1412 C CA  . LEU A 1 199 ? 18.537  8.687  15.476 1.00 19.70 ? 1859 LEU A CA  1 
ATOM   1413 C C   . LEU A 1 199 ? 17.632  9.888  15.191 1.00 19.94 ? 1859 LEU A C   1 
ATOM   1414 O O   . LEU A 1 199 ? 17.476  10.307 14.036 1.00 19.63 ? 1859 LEU A O   1 
ATOM   1415 C CB  . LEU A 1 199 ? 20.019  9.085  15.364 1.00 21.11 ? 1859 LEU A CB  1 
ATOM   1416 C CG  . LEU A 1 199 ? 20.296  10.330 16.235 1.00 24.70 ? 1859 LEU A CG  1 
ATOM   1417 C CD1 . LEU A 1 199 ? 20.295  10.012 17.732 1.00 23.27 ? 1859 LEU A CD1 1 
ATOM   1418 C CD2 . LEU A 1 199 ? 21.576  11.079 15.883 1.00 31.59 ? 1859 LEU A CD2 1 
ATOM   1419 N N   . ILE A 1 200 ? 17.028  10.430 16.247 1.00 17.33 ? 1860 ILE A N   1 
ATOM   1420 C CA  . ILE A 1 200 ? 16.231  11.644 16.099 1.00 16.50 ? 1860 ILE A CA  1 
ATOM   1421 C C   . ILE A 1 200 ? 16.823  12.828 16.847 1.00 15.02 ? 1860 ILE A C   1 
ATOM   1422 O O   . ILE A 1 200 ? 17.246  12.705 18.003 1.00 15.06 ? 1860 ILE A O   1 
ATOM   1423 C CB  . ILE A 1 200 ? 14.766  11.417 16.528 1.00 17.35 ? 1860 ILE A CB  1 
ATOM   1424 C CG1 . ILE A 1 200 ? 14.140  10.364 15.612 1.00 16.06 ? 1860 ILE A CG1 1 
ATOM   1425 C CG2 . ILE A 1 200 ? 14.010  12.721 16.510 1.00 12.71 ? 1860 ILE A CG2 1 
ATOM   1426 C CD1 . ILE A 1 200 ? 13.046  9.592  16.276 1.00 20.36 ? 1860 ILE A CD1 1 
ATOM   1427 N N   . ARG A 1 201 ? 16.862  13.972 16.174 1.00 13.84 ? 1861 ARG A N   1 
ATOM   1428 C CA  . ARG A 1 201 ? 17.266  15.203 16.850 1.00 16.16 ? 1861 ARG A CA  1 
ATOM   1429 C C   . ARG A 1 201 ? 16.087  16.127 17.111 1.00 14.37 ? 1861 ARG A C   1 
ATOM   1430 O O   . ARG A 1 201 ? 15.204  16.283 16.265 1.00 14.01 ? 1861 ARG A O   1 
ATOM   1431 C CB  . ARG A 1 201 ? 18.333  15.986 16.072 1.00 16.43 ? 1861 ARG A CB  1 
ATOM   1432 C CG  . ARG A 1 201 ? 19.639  15.251 15.943 1.00 25.76 ? 1861 ARG A CG  1 
ATOM   1433 C CD  . ARG A 1 201 ? 20.867  16.156 15.933 1.00 28.28 ? 1861 ARG A CD  1 
ATOM   1434 N NE  . ARG A 1 201 ? 22.056  15.314 15.779 1.00 29.94 ? 1861 ARG A NE  1 
ATOM   1435 C CZ  . ARG A 1 201 ? 22.464  14.797 14.622 1.00 33.90 ? 1861 ARG A CZ  1 
ATOM   1436 N NH1 . ARG A 1 201 ? 21.787  15.020 13.502 1.00 34.88 ? 1861 ARG A NH1 1 
ATOM   1437 N NH2 . ARG A 1 201 ? 23.558  14.048 14.572 1.00 41.71 ? 1861 ARG A NH2 1 
ATOM   1438 N N   . HIS A 1 202 ? 16.107  16.763 18.275 1.00 12.47 ? 1862 HIS A N   1 
ATOM   1439 C CA  . HIS A 1 202 ? 14.946  17.497 18.750 1.00 12.37 ? 1862 HIS A CA  1 
ATOM   1440 C C   . HIS A 1 202 ? 15.493  18.868 19.118 1.00 10.73 ? 1862 HIS A C   1 
ATOM   1441 O O   . HIS A 1 202 ? 16.392  18.996 19.953 1.00 12.30 ? 1862 HIS A O   1 
ATOM   1442 C CB  . HIS A 1 202 ? 14.371  16.743 19.938 1.00 11.23 ? 1862 HIS A CB  1 
ATOM   1443 C CG  . HIS A 1 202 ? 13.144  17.352 20.531 1.00 14.39 ? 1862 HIS A CG  1 
ATOM   1444 N ND1 . HIS A 1 202 ? 13.188  18.308 21.522 1.00 19.24 ? 1862 HIS A ND1 1 
ATOM   1445 C CD2 . HIS A 1 202 ? 11.834  17.092 20.324 1.00 9.29  ? 1862 HIS A CD2 1 
ATOM   1446 C CE1 . HIS A 1 202 ? 11.958  18.644 21.871 1.00 12.78 ? 1862 HIS A CE1 1 
ATOM   1447 N NE2 . HIS A 1 202 ? 11.117  17.916 21.160 1.00 11.11 ? 1862 HIS A NE2 1 
ATOM   1448 N N   . PHE A 1 203 ? 14.993  19.899 18.444 1.00 9.85  ? 1863 PHE A N   1 
ATOM   1449 C CA  . PHE A 1 203 ? 15.522  21.241 18.657 1.00 9.23  ? 1863 PHE A CA  1 
ATOM   1450 C C   . PHE A 1 203 ? 14.478  22.047 19.408 1.00 10.32 ? 1863 PHE A C   1 
ATOM   1451 O O   . PHE A 1 203 ? 13.440  22.398 18.876 1.00 12.67 ? 1863 PHE A O   1 
ATOM   1452 C CB  . PHE A 1 203 ? 15.806  21.931 17.325 1.00 10.08 ? 1863 PHE A CB  1 
ATOM   1453 C CG  . PHE A 1 203 ? 16.767  21.188 16.456 1.00 10.89 ? 1863 PHE A CG  1 
ATOM   1454 C CD1 . PHE A 1 203 ? 16.314  20.191 15.606 1.00 12.39 ? 1863 PHE A CD1 1 
ATOM   1455 C CD2 . PHE A 1 203 ? 18.119  21.476 16.487 1.00 12.76 ? 1863 PHE A CD2 1 
ATOM   1456 C CE1 . PHE A 1 203 ? 17.186  19.502 14.809 1.00 6.51  ? 1863 PHE A CE1 1 
ATOM   1457 C CE2 . PHE A 1 203 ? 19.009  20.778 15.677 1.00 11.59 ? 1863 PHE A CE2 1 
ATOM   1458 C CZ  . PHE A 1 203 ? 18.543  19.802 14.839 1.00 9.39  ? 1863 PHE A CZ  1 
ATOM   1459 N N   . HIS A 1 204 ? 14.738  22.342 20.668 1.00 11.58 ? 1864 HIS A N   1 
ATOM   1460 C CA  . HIS A 1 204 ? 13.695  22.911 21.493 1.00 11.30 ? 1864 HIS A CA  1 
ATOM   1461 C C   . HIS A 1 204 ? 14.023  24.378 21.815 1.00 11.91 ? 1864 HIS A C   1 
ATOM   1462 O O   . HIS A 1 204 ? 14.913  24.678 22.614 1.00 13.64 ? 1864 HIS A O   1 
ATOM   1463 C CB  . HIS A 1 204 ? 13.512  22.025 22.735 1.00 10.60 ? 1864 HIS A CB  1 
ATOM   1464 C CG  . HIS A 1 204 ? 12.424  22.490 23.645 1.00 8.13  ? 1864 HIS A CG  1 
ATOM   1465 N ND1 . HIS A 1 204 ? 12.287  22.030 24.938 1.00 12.25 ? 1864 HIS A ND1 1 
ATOM   1466 C CD2 . HIS A 1 204 ? 11.446  23.411 23.461 1.00 10.63 ? 1864 HIS A CD2 1 
ATOM   1467 C CE1 . HIS A 1 204 ? 11.261  22.637 25.509 1.00 10.96 ? 1864 HIS A CE1 1 
ATOM   1468 N NE2 . HIS A 1 204 ? 10.731  23.477 24.635 1.00 16.01 ? 1864 HIS A NE2 1 
ATOM   1469 N N   . TYR A 1 205 ? 13.316  25.309 21.179 1.00 12.83 ? 1865 TYR A N   1 
ATOM   1470 C CA  . TYR A 1 205 ? 13.461  26.733 21.496 1.00 12.84 ? 1865 TYR A CA  1 
ATOM   1471 C C   . TYR A 1 205 ? 12.574  27.093 22.681 1.00 12.34 ? 1865 TYR A C   1 
ATOM   1472 O O   . TYR A 1 205 ? 11.357  26.935 22.636 1.00 9.70  ? 1865 TYR A O   1 
ATOM   1473 C CB  . TYR A 1 205 ? 13.125  27.599 20.283 1.00 14.90 ? 1865 TYR A CB  1 
ATOM   1474 C CG  . TYR A 1 205 ? 13.469  29.070 20.347 1.00 13.18 ? 1865 TYR A CG  1 
ATOM   1475 C CD1 . TYR A 1 205 ? 14.718  29.516 19.928 1.00 11.72 ? 1865 TYR A CD1 1 
ATOM   1476 C CD2 . TYR A 1 205 ? 12.521  30.017 20.756 1.00 16.80 ? 1865 TYR A CD2 1 
ATOM   1477 C CE1 . TYR A 1 205 ? 15.037  30.862 19.927 1.00 10.06 ? 1865 TYR A CE1 1 
ATOM   1478 C CE2 . TYR A 1 205 ? 12.828  31.377 20.773 1.00 10.64 ? 1865 TYR A CE2 1 
ATOM   1479 C CZ  . TYR A 1 205 ? 14.092  31.775 20.358 1.00 12.25 ? 1865 TYR A CZ  1 
ATOM   1480 O OH  . TYR A 1 205 ? 14.455  33.094 20.347 1.00 11.90 ? 1865 TYR A OH  1 
ATOM   1481 N N   . THR A 1 206 ? 13.217  27.563 23.748 1.00 13.20 ? 1866 THR A N   1 
ATOM   1482 C CA  . THR A 1 206 ? 12.569  27.696 25.048 1.00 13.78 ? 1866 THR A CA  1 
ATOM   1483 C C   . THR A 1 206 ? 12.042  29.094 25.410 1.00 13.65 ? 1866 THR A C   1 
ATOM   1484 O O   . THR A 1 206 ? 11.331  29.243 26.390 1.00 12.98 ? 1866 THR A O   1 
ATOM   1485 C CB  . THR A 1 206 ? 13.433  27.083 26.163 1.00 15.84 ? 1866 THR A CB  1 
ATOM   1486 O OG1 . THR A 1 206 ? 14.788  27.556 26.045 1.00 8.49  ? 1866 THR A OG1 1 
ATOM   1487 C CG2 . THR A 1 206 ? 13.352  25.529 26.081 1.00 12.65 ? 1866 THR A CG2 1 
ATOM   1488 N N   . VAL A 1 207 ? 12.358  30.105 24.607 1.00 11.23 ? 1867 VAL A N   1 
ATOM   1489 C CA  . VAL A 1 207 ? 12.108  31.497 24.979 1.00 12.25 ? 1867 VAL A CA  1 
ATOM   1490 C C   . VAL A 1 207 ? 11.166  32.233 24.023 1.00 10.73 ? 1867 VAL A C   1 
ATOM   1491 O O   . VAL A 1 207 ? 11.375  33.402 23.764 1.00 10.94 ? 1867 VAL A O   1 
ATOM   1492 C CB  . VAL A 1 207 ? 13.424  32.310 25.243 1.00 12.11 ? 1867 VAL A CB  1 
ATOM   1493 C CG1 . VAL A 1 207 ? 14.187  31.726 26.432 1.00 11.74 ? 1867 VAL A CG1 1 
ATOM   1494 C CG2 . VAL A 1 207 ? 14.370  32.285 24.029 1.00 15.70 ? 1867 VAL A CG2 1 
ATOM   1495 N N   . TRP A 1 208 ? 10.140  31.552 23.516 1.00 11.88 ? 1868 TRP A N   1 
ATOM   1496 C CA  . TRP A 1 208 ? 9.166   32.117 22.580 1.00 12.02 ? 1868 TRP A CA  1 
ATOM   1497 C C   . TRP A 1 208 ? 7.791   31.987 23.249 1.00 13.22 ? 1868 TRP A C   1 
ATOM   1498 O O   . TRP A 1 208 ? 7.185   30.914 23.177 1.00 13.05 ? 1868 TRP A O   1 
ATOM   1499 C CB  . TRP A 1 208 ? 9.177   31.317 21.270 1.00 10.24 ? 1868 TRP A CB  1 
ATOM   1500 C CG  . TRP A 1 208 ? 8.431   31.979 20.156 1.00 7.76  ? 1868 TRP A CG  1 
ATOM   1501 C CD1 . TRP A 1 208 ? 7.511   32.972 20.282 1.00 4.40  ? 1868 TRP A CD1 1 
ATOM   1502 C CD2 . TRP A 1 208 ? 8.552   31.716 18.740 1.00 9.45  ? 1868 TRP A CD2 1 
ATOM   1503 N NE1 . TRP A 1 208 ? 7.056   33.349 19.043 1.00 6.64  ? 1868 TRP A NE1 1 
ATOM   1504 C CE2 . TRP A 1 208 ? 7.672   32.592 18.079 1.00 10.43 ? 1868 TRP A CE2 1 
ATOM   1505 C CE3 . TRP A 1 208 ? 9.314   30.823 17.970 1.00 6.90  ? 1868 TRP A CE3 1 
ATOM   1506 C CZ2 . TRP A 1 208 ? 7.532   32.600 16.684 1.00 11.17 ? 1868 TRP A CZ2 1 
ATOM   1507 C CZ3 . TRP A 1 208 ? 9.170   30.831 16.598 1.00 4.33  ? 1868 TRP A CZ3 1 
ATOM   1508 C CH2 . TRP A 1 208 ? 8.285   31.710 15.962 1.00 8.49  ? 1868 TRP A CH2 1 
ATOM   1509 N N   . PRO A 1 209 ? 7.278   33.068 23.878 1.00 13.41 ? 1869 PRO A N   1 
ATOM   1510 C CA  . PRO A 1 209 ? 6.048   32.930 24.659 1.00 13.63 ? 1869 PRO A CA  1 
ATOM   1511 C C   . PRO A 1 209 ? 4.857   32.812 23.715 1.00 12.67 ? 1869 PRO A C   1 
ATOM   1512 O O   . PRO A 1 209 ? 4.861   33.368 22.607 1.00 9.20  ? 1869 PRO A O   1 
ATOM   1513 C CB  . PRO A 1 209 ? 5.977   34.239 25.464 1.00 14.01 ? 1869 PRO A CB  1 
ATOM   1514 C CG  . PRO A 1 209 ? 6.699   35.204 24.637 1.00 15.81 ? 1869 PRO A CG  1 
ATOM   1515 C CD  . PRO A 1 209 ? 7.763   34.461 23.865 1.00 13.08 ? 1869 PRO A CD  1 
ATOM   1516 N N   . ASP A 1 210 ? 3.850   32.060 24.153 1.00 12.04 ? 1870 ASP A N   1 
ATOM   1517 C CA  . ASP A 1 210 ? 2.713   31.785 23.282 1.00 11.03 ? 1870 ASP A CA  1 
ATOM   1518 C C   . ASP A 1 210 ? 2.038   33.097 22.848 1.00 12.44 ? 1870 ASP A C   1 
ATOM   1519 O O   . ASP A 1 210 ? 2.004   34.087 23.606 1.00 11.34 ? 1870 ASP A O   1 
ATOM   1520 C CB  . ASP A 1 210 ? 1.731   30.875 24.009 1.00 9.42  ? 1870 ASP A CB  1 
ATOM   1521 C CG  . ASP A 1 210 ? 0.743   30.209 23.065 1.00 11.40 ? 1870 ASP A CG  1 
ATOM   1522 O OD1 . ASP A 1 210 ? -0.186  29.559 23.568 1.00 6.62  ? 1870 ASP A OD1 1 
ATOM   1523 O OD2 . ASP A 1 210 ? 0.860   30.338 21.830 1.00 11.94 ? 1870 ASP A OD2 1 
ATOM   1524 N N   . HIS A 1 211 ? 1.486   33.086 21.637 1.00 10.16 ? 1871 HIS A N   1 
ATOM   1525 C CA  . HIS A 1 211 ? 0.859   34.281 21.042 1.00 10.67 ? 1871 HIS A CA  1 
ATOM   1526 C C   . HIS A 1 211 ? 1.825   35.472 20.988 1.00 11.69 ? 1871 HIS A C   1 
ATOM   1527 O O   . HIS A 1 211 ? 1.396   36.612 20.811 1.00 15.09 ? 1871 HIS A O   1 
ATOM   1528 C CB  . HIS A 1 211 ? -0.435  34.673 21.787 1.00 9.26  ? 1871 HIS A CB  1 
ATOM   1529 C CG  . HIS A 1 211 ? -1.363  33.527 22.079 1.00 8.90  ? 1871 HIS A CG  1 
ATOM   1530 N ND1 . HIS A 1 211 ? -2.035  32.834 21.094 1.00 7.70  ? 1871 HIS A ND1 1 
ATOM   1531 C CD2 . HIS A 1 211 ? -1.742  32.963 23.254 1.00 5.10  ? 1871 HIS A CD2 1 
ATOM   1532 C CE1 . HIS A 1 211 ? -2.770  31.881 21.643 1.00 8.16  ? 1871 HIS A CE1 1 
ATOM   1533 N NE2 . HIS A 1 211 ? -2.604  31.933 22.955 1.00 6.17  ? 1871 HIS A NE2 1 
ATOM   1534 N N   . GLY A 1 212 ? 3.124   35.256 21.184 1.00 12.52 ? 1872 GLY A N   1 
ATOM   1535 C CA  . GLY A 1 212 ? 4.086   36.366 21.226 1.00 9.78  ? 1872 GLY A CA  1 
ATOM   1536 C C   . GLY A 1 212 ? 5.212   36.177 20.231 1.00 9.94  ? 1872 GLY A C   1 
ATOM   1537 O O   . GLY A 1 212 ? 5.053   35.423 19.260 1.00 11.79 ? 1872 GLY A O   1 
ATOM   1538 N N   . VAL A 1 213 ? 6.331   36.859 20.470 1.00 9.95  ? 1873 VAL A N   1 
ATOM   1539 C CA  . VAL A 1 213 ? 7.484   36.853 19.559 1.00 10.96 ? 1873 VAL A CA  1 
ATOM   1540 C C   . VAL A 1 213 ? 8.743   36.706 20.415 1.00 11.98 ? 1873 VAL A C   1 
ATOM   1541 O O   . VAL A 1 213 ? 8.758   37.128 21.560 1.00 13.87 ? 1873 VAL A O   1 
ATOM   1542 C CB  . VAL A 1 213 ? 7.580   38.084 18.593 1.00 9.66  ? 1873 VAL A CB  1 
ATOM   1543 C CG1 . VAL A 1 213 ? 6.395   38.141 17.659 1.00 5.98  ? 1873 VAL A CG1 1 
ATOM   1544 C CG2 . VAL A 1 213 ? 7.760   39.417 19.327 1.00 11.35 ? 1873 VAL A CG2 1 
ATOM   1545 N N   . PRO A 1 214 ? 9.810   36.079 19.907 1.00 12.82 ? 1874 PRO A N   1 
ATOM   1546 C CA  . PRO A 1 214 ? 11.011  36.148 20.757 1.00 15.28 ? 1874 PRO A CA  1 
ATOM   1547 C C   . PRO A 1 214 ? 11.493  37.584 21.011 1.00 17.11 ? 1874 PRO A C   1 
ATOM   1548 O O   . PRO A 1 214 ? 11.162  38.509 20.266 1.00 18.69 ? 1874 PRO A O   1 
ATOM   1549 C CB  . PRO A 1 214 ? 12.079  35.377 19.970 1.00 14.74 ? 1874 PRO A CB  1 
ATOM   1550 C CG  . PRO A 1 214 ? 11.350  34.714 18.815 1.00 14.92 ? 1874 PRO A CG  1 
ATOM   1551 C CD  . PRO A 1 214 ? 10.001  35.334 18.654 1.00 10.66 ? 1874 PRO A CD  1 
ATOM   1552 N N   . GLU A 1 215 ? 12.299  37.750 22.050 1.00 18.02 ? 1875 GLU A N   1 
ATOM   1553 C CA  . GLU A 1 215 ? 12.832  39.046 22.443 1.00 23.69 ? 1875 GLU A CA  1 
ATOM   1554 C C   . GLU A 1 215 ? 13.721  39.688 21.386 1.00 19.84 ? 1875 GLU A C   1 
ATOM   1555 O O   . GLU A 1 215 ? 13.753  40.915 21.257 1.00 17.53 ? 1875 GLU A O   1 
ATOM   1556 C CB  . GLU A 1 215 ? 13.616  38.878 23.747 1.00 23.54 ? 1875 GLU A CB  1 
ATOM   1557 C CG  . GLU A 1 215 ? 13.114  39.699 24.926 1.00 34.60 ? 1875 GLU A CG  1 
ATOM   1558 C CD  . GLU A 1 215 ? 14.044  39.563 26.132 1.00 36.48 ? 1875 GLU A CD  1 
ATOM   1559 O OE1 . GLU A 1 215 ? 13.664  40.079 27.210 1.00 49.30 ? 1875 GLU A OE1 1 
ATOM   1560 O OE2 . GLU A 1 215 ? 15.133  38.942 26.003 1.00 44.35 ? 1875 GLU A OE2 1 
ATOM   1561 N N   . THR A 1 216 ? 14.451  38.874 20.628 1.00 18.31 ? 1876 THR A N   1 
ATOM   1562 C CA  . THR A 1 216 ? 15.246  39.425 19.529 1.00 17.71 ? 1876 THR A CA  1 
ATOM   1563 C C   . THR A 1 216 ? 14.995  38.732 18.191 1.00 16.95 ? 1876 THR A C   1 
ATOM   1564 O O   . THR A 1 216 ? 14.558  37.574 18.166 1.00 18.91 ? 1876 THR A O   1 
ATOM   1565 C CB  . THR A 1 216 ? 16.753  39.403 19.837 1.00 16.26 ? 1876 THR A CB  1 
ATOM   1566 O OG1 . THR A 1 216 ? 17.200  38.047 19.818 1.00 18.59 ? 1876 THR A OG1 1 
ATOM   1567 C CG2 . THR A 1 216 ? 17.053  40.016 21.202 1.00 17.87 ? 1876 THR A CG2 1 
ATOM   1568 N N   . THR A 1 217 ? 15.257  39.422 17.084 1.00 15.07 ? 1877 THR A N   1 
ATOM   1569 C CA  . THR A 1 217 ? 15.387  38.715 15.806 1.00 15.80 ? 1877 THR A CA  1 
ATOM   1570 C C   . THR A 1 217 ? 16.578  37.743 15.726 1.00 17.36 ? 1877 THR A C   1 
ATOM   1571 O O   . THR A 1 217 ? 16.494  36.666 15.117 1.00 18.04 ? 1877 THR A O   1 
ATOM   1572 C CB  . THR A 1 217 ? 15.458  39.663 14.597 1.00 14.56 ? 1877 THR A CB  1 
ATOM   1573 O OG1 . THR A 1 217 ? 16.631  40.472 14.707 1.00 14.49 ? 1877 THR A OG1 1 
ATOM   1574 C CG2 . THR A 1 217 ? 14.225  40.548 14.522 1.00 10.56 ? 1877 THR A CG2 1 
ATOM   1575 N N   . GLN A 1 218 ? 17.687  38.112 16.357 1.00 17.54 ? 1878 GLN A N   1 
ATOM   1576 C CA  . GLN A 1 218 ? 18.956  37.436 16.127 1.00 18.79 ? 1878 GLN A CA  1 
ATOM   1577 C C   . GLN A 1 218 ? 18.891  36.004 16.622 1.00 18.49 ? 1878 GLN A C   1 
ATOM   1578 O O   . GLN A 1 218 ? 19.460  35.089 16.024 1.00 17.82 ? 1878 GLN A O   1 
ATOM   1579 C CB  . GLN A 1 218 ? 20.099  38.147 16.851 1.00 20.86 ? 1878 GLN A CB  1 
ATOM   1580 C CG  . GLN A 1 218 ? 21.427  37.688 16.267 1.00 30.35 ? 1878 GLN A CG  1 
ATOM   1581 C CD  . GLN A 1 218 ? 22.624  37.973 17.154 1.00 37.18 ? 1878 GLN A CD  1 
ATOM   1582 O OE1 . GLN A 1 218 ? 22.745  37.421 18.250 1.00 43.74 ? 1878 GLN A OE1 1 
ATOM   1583 N NE2 . GLN A 1 218 ? 23.523  38.826 16.674 1.00 35.33 ? 1878 GLN A NE2 1 
ATOM   1584 N N   . SER A 1 219 ? 18.189  35.841 17.740 1.00 19.02 ? 1879 SER A N   1 
ATOM   1585 C CA  . SER A 1 219 ? 18.014  34.552 18.398 1.00 18.26 ? 1879 SER A CA  1 
ATOM   1586 C C   . SER A 1 219 ? 17.312  33.555 17.480 1.00 16.62 ? 1879 SER A C   1 
ATOM   1587 O O   . SER A 1 219 ? 17.801  32.445 17.297 1.00 16.98 ? 1879 SER A O   1 
ATOM   1588 C CB  . SER A 1 219 ? 17.165  34.758 19.651 1.00 18.40 ? 1879 SER A CB  1 
ATOM   1589 O OG  . SER A 1 219 ? 17.208  33.590 20.444 1.00 22.96 ? 1879 SER A OG  1 
ATOM   1590 N N   . LEU A 1 220 ? 16.168  33.931 16.911 1.00 14.53 ? 1880 LEU A N   1 
ATOM   1591 C CA  . LEU A 1 220 ? 15.398  32.962 16.143 1.00 12.11 ? 1880 LEU A CA  1 
ATOM   1592 C C   . LEU A 1 220 ? 16.078  32.779 14.799 1.00 13.67 ? 1880 LEU A C   1 
ATOM   1593 O O   . LEU A 1 220 ? 16.110  31.674 14.273 1.00 14.29 ? 1880 LEU A O   1 
ATOM   1594 C CB  . LEU A 1 220 ? 13.928  33.372 15.968 1.00 13.42 ? 1880 LEU A CB  1 
ATOM   1595 C CG  . LEU A 1 220 ? 12.997  32.224 15.548 1.00 12.00 ? 1880 LEU A CG  1 
ATOM   1596 C CD1 . LEU A 1 220 ? 12.838  31.144 16.630 1.00 6.11  ? 1880 LEU A CD1 1 
ATOM   1597 C CD2 . LEU A 1 220 ? 11.686  32.635 14.852 1.00 6.93  ? 1880 LEU A CD2 1 
ATOM   1598 N N   . ILE A 1 221 ? 16.633  33.846 14.234 1.00 12.81 ? 1881 ILE A N   1 
ATOM   1599 C CA  . ILE A 1 221 ? 17.352  33.682 12.984 1.00 12.60 ? 1881 ILE A CA  1 
ATOM   1600 C C   . ILE A 1 221 ? 18.437  32.613 13.181 1.00 14.16 ? 1881 ILE A C   1 
ATOM   1601 O O   . ILE A 1 221 ? 18.640  31.732 12.339 1.00 13.95 ? 1881 ILE A O   1 
ATOM   1602 C CB  . ILE A 1 221 ? 17.969  35.028 12.495 1.00 14.11 ? 1881 ILE A CB  1 
ATOM   1603 C CG1 . ILE A 1 221 ? 16.877  35.981 12.010 1.00 8.86  ? 1881 ILE A CG1 1 
ATOM   1604 C CG2 . ILE A 1 221 ? 18.963  34.812 11.356 1.00 8.06  ? 1881 ILE A CG2 1 
ATOM   1605 C CD1 . ILE A 1 221 ? 17.284  37.432 12.132 1.00 13.69 ? 1881 ILE A CD1 1 
ATOM   1606 N N   . GLN A 1 222 ? 19.151  32.689 14.298 1.00 15.33 ? 1882 GLN A N   1 
ATOM   1607 C CA  . GLN A 1 222 ? 20.295  31.821 14.461 1.00 16.22 ? 1882 GLN A CA  1 
ATOM   1608 C C   . GLN A 1 222 ? 19.852  30.379 14.734 1.00 14.89 ? 1882 GLN A C   1 
ATOM   1609 O O   . GLN A 1 222 ? 20.505  29.415 14.339 1.00 15.75 ? 1882 GLN A O   1 
ATOM   1610 C CB  . GLN A 1 222 ? 21.267  32.387 15.505 1.00 18.15 ? 1882 GLN A CB  1 
ATOM   1611 C CG  . GLN A 1 222 ? 21.739  31.339 16.495 1.00 26.75 ? 1882 GLN A CG  1 
ATOM   1612 C CD  . GLN A 1 222 ? 23.211  31.400 16.859 1.00 41.86 ? 1882 GLN A CD  1 
ATOM   1613 O OE1 . GLN A 1 222 ? 23.682  32.409 17.380 1.00 47.44 ? 1882 GLN A OE1 1 
ATOM   1614 N NE2 . GLN A 1 222 ? 23.936  30.302 16.629 1.00 45.83 ? 1882 GLN A NE2 1 
ATOM   1615 N N   . PHE A 1 223 ? 18.736  30.238 15.434 1.00 14.31 ? 1883 PHE A N   1 
ATOM   1616 C CA  . PHE A 1 223 ? 18.138  28.944 15.692 1.00 12.72 ? 1883 PHE A CA  1 
ATOM   1617 C C   . PHE A 1 223 ? 17.617  28.310 14.387 1.00 11.36 ? 1883 PHE A C   1 
ATOM   1618 O O   . PHE A 1 223 ? 17.873  27.133 14.080 1.00 7.06  ? 1883 PHE A O   1 
ATOM   1619 C CB  . PHE A 1 223 ? 17.047  29.138 16.747 1.00 12.20 ? 1883 PHE A CB  1 
ATOM   1620 C CG  . PHE A 1 223 ? 16.266  27.894 17.029 1.00 11.97 ? 1883 PHE A CG  1 
ATOM   1621 C CD1 . PHE A 1 223 ? 16.800  26.888 17.815 1.00 13.67 ? 1883 PHE A CD1 1 
ATOM   1622 C CD2 . PHE A 1 223 ? 15.011  27.717 16.480 1.00 14.60 ? 1883 PHE A CD2 1 
ATOM   1623 C CE1 . PHE A 1 223 ? 16.079  25.741 18.072 1.00 9.96  ? 1883 PHE A CE1 1 
ATOM   1624 C CE2 . PHE A 1 223 ? 14.303  26.553 16.717 1.00 8.51  ? 1883 PHE A CE2 1 
ATOM   1625 C CZ  . PHE A 1 223 ? 14.836  25.587 17.514 1.00 10.97 ? 1883 PHE A CZ  1 
ATOM   1626 N N   . VAL A 1 224 ? 16.883  29.097 13.607 1.00 11.17 ? 1884 VAL A N   1 
ATOM   1627 C CA  . VAL A 1 224 ? 16.452  28.659 12.279 1.00 12.27 ? 1884 VAL A CA  1 
ATOM   1628 C C   . VAL A 1 224 ? 17.630  28.154 11.433 1.00 12.28 ? 1884 VAL A C   1 
ATOM   1629 O O   . VAL A 1 224 ? 17.517  27.127 10.790 1.00 13.56 ? 1884 VAL A O   1 
ATOM   1630 C CB  . VAL A 1 224 ? 15.654  29.766 11.546 1.00 13.26 ? 1884 VAL A CB  1 
ATOM   1631 C CG1 . VAL A 1 224 ? 15.418  29.386 10.077 1.00 17.26 ? 1884 VAL A CG1 1 
ATOM   1632 C CG2 . VAL A 1 224 ? 14.330  30.055 12.230 1.00 8.28  ? 1884 VAL A CG2 1 
ATOM   1633 N N   . ARG A 1 225 ? 18.768  28.849 11.429 1.00 14.12 ? 1885 ARG A N   1 
ATOM   1634 C CA  . ARG A 1 225 ? 19.918  28.474 10.612 1.00 11.60 ? 1885 ARG A CA  1 
ATOM   1635 C C   . ARG A 1 225 ? 20.612  27.223 11.101 1.00 12.40 ? 1885 ARG A C   1 
ATOM   1636 O O   . ARG A 1 225 ? 21.095  26.409 10.314 1.00 11.77 ? 1885 ARG A O   1 
ATOM   1637 C CB  . ARG A 1 225 ? 20.942  29.606 10.593 1.00 12.72 ? 1885 ARG A CB  1 
ATOM   1638 C CG  . ARG A 1 225 ? 20.711  30.588 9.451  1.00 12.21 ? 1885 ARG A CG  1 
ATOM   1639 C CD  . ARG A 1 225 ? 21.241  31.986 9.769  1.00 17.76 ? 1885 ARG A CD  1 
ATOM   1640 N NE  . ARG A 1 225 ? 20.940  32.901 8.670  1.00 20.53 ? 1885 ARG A NE  1 
ATOM   1641 C CZ  . ARG A 1 225 ? 21.269  34.190 8.632  1.00 21.34 ? 1885 ARG A CZ  1 
ATOM   1642 N NH1 . ARG A 1 225 ? 21.931  34.778 9.628  1.00 22.64 ? 1885 ARG A NH1 1 
ATOM   1643 N NH2 . ARG A 1 225 ? 20.934  34.897 7.562  1.00 17.08 ? 1885 ARG A NH2 1 
ATOM   1644 N N   . THR A 1 226 ? 20.675  27.086 12.419 1.00 14.49 ? 1886 THR A N   1 
ATOM   1645 C CA  . THR A 1 226 ? 21.111  25.848 13.046 1.00 16.69 ? 1886 THR A CA  1 
ATOM   1646 C C   . THR A 1 226 ? 20.298  24.630 12.596 1.00 16.80 ? 1886 THR A C   1 
ATOM   1647 O O   . THR A 1 226 ? 20.870  23.701 12.012 1.00 19.95 ? 1886 THR A O   1 
ATOM   1648 C CB  . THR A 1 226 ? 21.032  25.999 14.573 1.00 18.92 ? 1886 THR A CB  1 
ATOM   1649 O OG1 . THR A 1 226 ? 21.607  27.262 14.926 1.00 20.90 ? 1886 THR A OG1 1 
ATOM   1650 C CG2 . THR A 1 226 ? 21.791  24.876 15.246 1.00 21.12 ? 1886 THR A CG2 1 
ATOM   1651 N N   . VAL A 1 227 ? 18.993  24.618 12.863 1.00 13.25 ? 1887 VAL A N   1 
ATOM   1652 C CA  . VAL A 1 227 ? 18.109  23.545 12.406 1.00 10.68 ? 1887 VAL A CA  1 
ATOM   1653 C C   . VAL A 1 227 ? 18.330  23.192 10.923 1.00 11.90 ? 1887 VAL A C   1 
ATOM   1654 O O   . VAL A 1 227 ? 18.418  22.005 10.559 1.00 10.44 ? 1887 VAL A O   1 
ATOM   1655 C CB  . VAL A 1 227 ? 16.613  23.928 12.590 1.00 8.56  ? 1887 VAL A CB  1 
ATOM   1656 C CG1 . VAL A 1 227 ? 15.656  22.867 11.955 1.00 7.50  ? 1887 VAL A CG1 1 
ATOM   1657 C CG2 . VAL A 1 227 ? 16.292  24.200 14.054 1.00 11.89 ? 1887 VAL A CG2 1 
ATOM   1658 N N   . ARG A 1 228 ? 18.400  24.215 10.068 1.00 10.51 ? 1888 ARG A N   1 
ATOM   1659 C CA  . ARG A 1 228 ? 18.461  23.962 8.629  1.00 11.49 ? 1888 ARG A CA  1 
ATOM   1660 C C   . ARG A 1 228 ? 19.776  23.298 8.224  1.00 14.41 ? 1888 ARG A C   1 
ATOM   1661 O O   . ARG A 1 228 ? 19.844  22.407 7.369  1.00 15.95 ? 1888 ARG A O   1 
ATOM   1662 C CB  . ARG A 1 228 ? 18.272  25.276 7.878  1.00 11.26 ? 1888 ARG A CB  1 
ATOM   1663 C CG  . ARG A 1 228 ? 18.698  25.205 6.416  1.00 9.05  ? 1888 ARG A CG  1 
ATOM   1664 C CD  . ARG A 1 228 ? 17.568  25.384 5.413  1.00 12.04 ? 1888 ARG A CD  1 
ATOM   1665 N NE  . ARG A 1 228 ? 16.221  25.009 5.840  1.00 14.35 ? 1888 ARG A NE  1 
ATOM   1666 C CZ  . ARG A 1 228 ? 15.550  23.968 5.358  1.00 11.84 ? 1888 ARG A CZ  1 
ATOM   1667 N NH1 . ARG A 1 228 ? 16.101  23.180 4.438  1.00 7.50  ? 1888 ARG A NH1 1 
ATOM   1668 N NH2 . ARG A 1 228 ? 14.317  23.727 5.782  1.00 2.00  ? 1888 ARG A NH2 1 
ATOM   1669 N N   . ASP A 1 229 ? 20.849  23.774 8.841  1.00 16.72 ? 1889 ASP A N   1 
ATOM   1670 C CA  . ASP A 1 229 ? 22.131  23.082 8.797  1.00 19.72 ? 1889 ASP A CA  1 
ATOM   1671 C C   . ASP A 1 229 ? 22.044  21.572 9.072  1.00 18.39 ? 1889 ASP A C   1 
ATOM   1672 O O   . ASP A 1 229 ? 22.607  20.739 8.349  1.00 19.35 ? 1889 ASP A O   1 
ATOM   1673 C CB  . ASP A 1 229 ? 23.055  23.781 9.790  1.00 21.11 ? 1889 ASP A CB  1 
ATOM   1674 C CG  . ASP A 1 229 ? 24.500  23.591 9.460  1.00 24.76 ? 1889 ASP A CG  1 
ATOM   1675 O OD1 . ASP A 1 229 ? 25.091  24.534 8.899  1.00 38.04 ? 1889 ASP A OD1 1 
ATOM   1676 O OD2 . ASP A 1 229 ? 25.042  22.517 9.773  1.00 28.45 ? 1889 ASP A OD2 1 
ATOM   1677 N N   . TYR A 1 230 ? 21.314  21.199 10.112 1.00 17.67 ? 1890 TYR A N   1 
ATOM   1678 C CA  . TYR A 1 230 ? 21.175  19.794 10.454 1.00 16.85 ? 1890 TYR A CA  1 
ATOM   1679 C C   . TYR A 1 230 ? 20.259  19.070 9.470  1.00 17.05 ? 1890 TYR A C   1 
ATOM   1680 O O   . TYR A 1 230 ? 20.422  17.869 9.221  1.00 14.65 ? 1890 TYR A O   1 
ATOM   1681 C CB  . TYR A 1 230 ? 20.546  19.686 11.836 1.00 20.37 ? 1890 TYR A CB  1 
ATOM   1682 C CG  . TYR A 1 230 ? 21.537  19.653 12.969 1.00 22.67 ? 1890 TYR A CG  1 
ATOM   1683 C CD1 . TYR A 1 230 ? 21.802  20.793 13.716 1.00 21.91 ? 1890 TYR A CD1 1 
ATOM   1684 C CD2 . TYR A 1 230 ? 22.213  18.472 13.271 1.00 23.92 ? 1890 TYR A CD2 1 
ATOM   1685 C CE1 . TYR A 1 230 ? 22.715  20.764 14.760 1.00 27.04 ? 1890 TYR A CE1 1 
ATOM   1686 C CE2 . TYR A 1 230 ? 23.126  18.422 14.296 1.00 24.90 ? 1890 TYR A CE2 1 
ATOM   1687 C CZ  . TYR A 1 230 ? 23.356  19.562 15.037 1.00 29.99 ? 1890 TYR A CZ  1 
ATOM   1688 O OH  . TYR A 1 230 ? 24.269  19.469 16.052 1.00 34.94 ? 1890 TYR A OH  1 
ATOM   1689 N N   . ILE A 1 231 ? 19.258  19.794 8.970  1.00 15.10 ? 1891 ILE A N   1 
ATOM   1690 C CA  . ILE A 1 231 ? 18.371  19.248 7.960  1.00 15.41 ? 1891 ILE A CA  1 
ATOM   1691 C C   . ILE A 1 231 ? 19.204  18.873 6.743  1.00 18.06 ? 1891 ILE A C   1 
ATOM   1692 O O   . ILE A 1 231 ? 19.075  17.764 6.241  1.00 19.92 ? 1891 ILE A O   1 
ATOM   1693 C CB  . ILE A 1 231 ? 17.249  20.220 7.540  1.00 15.63 ? 1891 ILE A CB  1 
ATOM   1694 C CG1 . ILE A 1 231 ? 16.259  20.464 8.687  1.00 10.08 ? 1891 ILE A CG1 1 
ATOM   1695 C CG2 . ILE A 1 231 ? 16.553  19.629 6.335  1.00 10.30 ? 1891 ILE A CG2 1 
ATOM   1696 C CD1 . ILE A 1 231 ? 15.264  21.571 8.415  1.00 13.76 ? 1891 ILE A CD1 1 
ATOM   1697 N N   . ASN A 1 232 ? 20.054  19.787 6.280  1.00 20.36 ? 1892 ASN A N   1 
ATOM   1698 C CA  . ASN A 1 232 ? 20.998  19.501 5.212  1.00 22.19 ? 1892 ASN A CA  1 
ATOM   1699 C C   . ASN A 1 232 ? 21.885  18.298 5.510  1.00 24.36 ? 1892 ASN A C   1 
ATOM   1700 O O   . ASN A 1 232 ? 22.369  17.617 4.615  1.00 27.03 ? 1892 ASN A O   1 
ATOM   1701 C CB  . ASN A 1 232 ? 21.939  20.686 5.025  1.00 21.68 ? 1892 ASN A CB  1 
ATOM   1702 C CG  . ASN A 1 232 ? 21.246  21.922 4.520  1.00 22.20 ? 1892 ASN A CG  1 
ATOM   1703 O OD1 . ASN A 1 232 ? 20.124  21.869 3.999  1.00 17.35 ? 1892 ASN A OD1 1 
ATOM   1704 N ND2 . ASN A 1 232 ? 21.938  23.059 4.660  1.00 16.59 ? 1892 ASN A ND2 1 
ATOM   1705 N N   . ARG A 1 233 ? 22.129  18.046 6.784  1.00 27.15 ? 1893 ARG A N   1 
ATOM   1706 C CA  . ARG A 1 233 ? 23.002  16.952 7.169  1.00 28.95 ? 1893 ARG A CA  1 
ATOM   1707 C C   . ARG A 1 233 ? 22.198  15.671 7.379  1.00 30.84 ? 1893 ARG A C   1 
ATOM   1708 O O   . ARG A 1 233 ? 22.716  14.682 7.906  1.00 31.94 ? 1893 ARG A O   1 
ATOM   1709 C CB  . ARG A 1 233 ? 23.863  17.351 8.371  1.00 26.74 ? 1893 ARG A CB  1 
ATOM   1710 C CG  . ARG A 1 233 ? 24.982  18.281 7.897  1.00 30.15 ? 1893 ARG A CG  1 
ATOM   1711 C CD  . ARG A 1 233 ? 25.510  19.282 8.919  1.00 26.01 ? 1893 ARG A CD  1 
ATOM   1712 N NE  . ARG A 1 233 ? 25.716  18.530 10.144 1.00 28.76 ? 1893 ARG A NE  1 
ATOM   1713 C CZ  . ARG A 1 233 ? 25.575  19.011 11.372 1.00 28.73 ? 1893 ARG A CZ  1 
ATOM   1714 N NH1 . ARG A 1 233 ? 25.237  20.283 11.549 1.00 22.66 ? 1893 ARG A NH1 1 
ATOM   1715 N NH2 . ARG A 1 233 ? 25.799  18.195 12.402 1.00 21.98 ? 1893 ARG A NH2 1 
ATOM   1716 N N   . SER A 1 234 ? 20.946  15.669 6.927  1.00 30.97 ? 1894 SER A N   1 
ATOM   1717 C CA  . SER A 1 234 ? 20.094  14.516 7.184  1.00 32.33 ? 1894 SER A CA  1 
ATOM   1718 C C   . SER A 1 234 ? 19.653  13.859 5.888  1.00 33.09 ? 1894 SER A C   1 
ATOM   1719 O O   . SER A 1 234 ? 18.520  14.027 5.464  1.00 32.41 ? 1894 SER A O   1 
ATOM   1720 C CB  . SER A 1 234 ? 18.912  14.843 8.106  1.00 31.84 ? 1894 SER A CB  1 
ATOM   1721 O OG  . SER A 1 234 ? 19.341  15.557 9.256  1.00 29.46 ? 1894 SER A OG  1 
ATOM   1722 N N   . PRO A 1 235 ? 20.561  13.095 5.261  1.00 36.27 ? 1895 PRO A N   1 
ATOM   1723 C CA  . PRO A 1 235 ? 20.321  12.562 3.916  1.00 36.78 ? 1895 PRO A CA  1 
ATOM   1724 C C   . PRO A 1 235 ? 19.111  11.626 3.927  1.00 36.58 ? 1895 PRO A C   1 
ATOM   1725 O O   . PRO A 1 235 ? 18.933  10.874 4.890  1.00 35.89 ? 1895 PRO A O   1 
ATOM   1726 C CB  . PRO A 1 235 ? 21.608  11.788 3.594  1.00 37.04 ? 1895 PRO A CB  1 
ATOM   1727 C CG  . PRO A 1 235 ? 22.633  12.282 4.586  1.00 38.03 ? 1895 PRO A CG  1 
ATOM   1728 C CD  . PRO A 1 235 ? 21.872  12.691 5.807  1.00 36.63 ? 1895 PRO A CD  1 
ATOM   1729 N N   . GLY A 1 236 ? 18.291  11.696 2.879  1.00 35.29 ? 1896 GLY A N   1 
ATOM   1730 C CA  . GLY A 1 236 ? 16.992  11.016 2.846  1.00 32.93 ? 1896 GLY A CA  1 
ATOM   1731 C C   . GLY A 1 236 ? 15.905  11.278 3.889  1.00 29.91 ? 1896 GLY A C   1 
ATOM   1732 O O   . GLY A 1 236 ? 14.863  10.617 3.861  1.00 29.72 ? 1896 GLY A O   1 
ATOM   1733 N N   . ALA A 1 237 ? 16.094  12.211 4.817  1.00 24.00 ? 1897 ALA A N   1 
ATOM   1734 C CA  . ALA A 1 237 ? 15.065  12.411 5.834  1.00 22.06 ? 1897 ALA A CA  1 
ATOM   1735 C C   . ALA A 1 237 ? 13.652  12.555 5.262  1.00 19.46 ? 1897 ALA A C   1 
ATOM   1736 O O   . ALA A 1 237 ? 13.470  13.135 4.199  1.00 18.23 ? 1897 ALA A O   1 
ATOM   1737 C CB  . ALA A 1 237 ? 15.415  13.591 6.724  1.00 21.33 ? 1897 ALA A CB  1 
ATOM   1738 N N   . GLY A 1 238 ? 12.630  12.055 5.955  1.00 17.64 ? 1898 GLY A N   1 
ATOM   1739 C CA  . GLY A 1 238 ? 11.270  12.536 5.690  1.00 12.20 ? 1898 GLY A CA  1 
ATOM   1740 C C   . GLY A 1 238 ? 11.028  14.004 6.043  1.00 10.93 ? 1898 GLY A C   1 
ATOM   1741 O O   . GLY A 1 238 ? 11.969  14.779 6.231  1.00 10.01 ? 1898 GLY A O   1 
ATOM   1742 N N   . PRO A 1 239 ? 9.750   14.401 6.178  1.00 8.96  ? 1899 PRO A N   1 
ATOM   1743 C CA  . PRO A 1 239 ? 9.435   15.751 6.629  1.00 8.20  ? 1899 PRO A CA  1 
ATOM   1744 C C   . PRO A 1 239 ? 10.101  16.131 7.956  1.00 9.63  ? 1899 PRO A C   1 
ATOM   1745 O O   . PRO A 1 239 ? 10.269  15.283 8.825  1.00 13.41 ? 1899 PRO A O   1 
ATOM   1746 C CB  . PRO A 1 239 ? 7.917   15.698 6.828  1.00 7.67  ? 1899 PRO A CB  1 
ATOM   1747 C CG  . PRO A 1 239 ? 7.468   14.645 5.883  1.00 6.07  ? 1899 PRO A CG  1 
ATOM   1748 C CD  . PRO A 1 239 ? 8.538   13.582 5.991  1.00 3.25  ? 1899 PRO A CD  1 
ATOM   1749 N N   . THR A 1 240 ? 10.456  17.402 8.124  1.00 9.40  ? 1900 THR A N   1 
ATOM   1750 C CA  . THR A 1 240 ? 10.770  17.983 9.425  1.00 6.76  ? 1900 THR A CA  1 
ATOM   1751 C C   . THR A 1 240 ? 9.495   18.227 10.215 1.00 8.37  ? 1900 THR A C   1 
ATOM   1752 O O   . THR A 1 240 ? 8.585   18.880 9.710  1.00 11.22 ? 1900 THR A O   1 
ATOM   1753 C CB  . THR A 1 240 ? 11.569  19.290 9.263  1.00 5.71  ? 1900 THR A CB  1 
ATOM   1754 O OG1 . THR A 1 240 ? 12.727  19.047 8.459  1.00 6.86  ? 1900 THR A OG1 1 
ATOM   1755 C CG2 . THR A 1 240 ? 11.969  19.959 10.585 1.00 3.22  ? 1900 THR A CG2 1 
ATOM   1756 N N   . VAL A 1 241 ? 9.419   17.694 11.437 1.00 8.35  ? 1901 VAL A N   1 
ATOM   1757 C CA  . VAL A 1 241 ? 8.347   18.049 12.360 1.00 7.49  ? 1901 VAL A CA  1 
ATOM   1758 C C   . VAL A 1 241 ? 8.588   19.434 12.987 1.00 9.13  ? 1901 VAL A C   1 
ATOM   1759 O O   . VAL A 1 241 ? 9.659   19.716 13.487 1.00 9.84  ? 1901 VAL A O   1 
ATOM   1760 C CB  . VAL A 1 241 ? 8.044   16.929 13.402 1.00 7.37  ? 1901 VAL A CB  1 
ATOM   1761 C CG1 . VAL A 1 241 ? 7.075   17.393 14.471 1.00 6.37  ? 1901 VAL A CG1 1 
ATOM   1762 C CG2 . VAL A 1 241 ? 7.382   15.725 12.749 1.00 8.80  ? 1901 VAL A CG2 1 
ATOM   1763 N N   . VAL A 1 242 ? 7.595   20.318 12.943 1.00 10.22 ? 1902 VAL A N   1 
ATOM   1764 C CA  . VAL A 1 242 ? 7.604   21.561 13.702 1.00 8.49  ? 1902 VAL A CA  1 
ATOM   1765 C C   . VAL A 1 242 ? 6.299   21.554 14.505 1.00 8.78  ? 1902 VAL A C   1 
ATOM   1766 O O   . VAL A 1 242 ? 5.233   21.211 13.985 1.00 7.35  ? 1902 VAL A O   1 
ATOM   1767 C CB  . VAL A 1 242 ? 7.681   22.782 12.742 1.00 8.69  ? 1902 VAL A CB  1 
ATOM   1768 C CG1 . VAL A 1 242 ? 7.946   24.111 13.490 1.00 6.06  ? 1902 VAL A CG1 1 
ATOM   1769 C CG2 . VAL A 1 242 ? 8.766   22.550 11.698 1.00 3.29  ? 1902 VAL A CG2 1 
ATOM   1770 N N   . HIS A 1 243 ? 6.371   21.915 15.782 1.00 8.83  ? 1903 HIS A N   1 
ATOM   1771 C CA  . HIS A 1 243 ? 5.145   22.083 16.571 1.00 8.29  ? 1903 HIS A CA  1 
ATOM   1772 C C   . HIS A 1 243 ? 5.326   23.103 17.685 1.00 9.67  ? 1903 HIS A C   1 
ATOM   1773 O O   . HIS A 1 243 ? 6.445   23.410 18.117 1.00 9.23  ? 1903 HIS A O   1 
ATOM   1774 C CB  . HIS A 1 243 ? 4.644   20.756 17.163 1.00 9.75  ? 1903 HIS A CB  1 
ATOM   1775 C CG  . HIS A 1 243 ? 5.440   20.281 18.339 1.00 7.62  ? 1903 HIS A CG  1 
ATOM   1776 N ND1 . HIS A 1 243 ? 5.203   20.707 19.627 1.00 2.00  ? 1903 HIS A ND1 1 
ATOM   1777 C CD2 . HIS A 1 243 ? 6.498   19.443 18.406 1.00 9.71  ? 1903 HIS A CD2 1 
ATOM   1778 C CE1 . HIS A 1 243 ? 6.065   20.131 20.443 1.00 9.07  ? 1903 HIS A CE1 1 
ATOM   1779 N NE2 . HIS A 1 243 ? 6.873   19.372 19.723 1.00 5.72  ? 1903 HIS A NE2 1 
ATOM   1780 N N   . CYS A 1 244 ? 4.202   23.639 18.145 1.00 10.20 ? 1904 CYS A N   1 
ATOM   1781 C CA  . CYS A 1 244 ? 4.240   24.469 19.336 1.00 9.03  ? 1904 CYS A CA  1 
ATOM   1782 C C   . CYS A 1 244 ? 3.105   23.995 20.226 1.00 8.90  ? 1904 CYS A C   1 
ATOM   1783 O O   . CYS A 1 244 ? 3.018   22.795 20.558 1.00 11.76 ? 1904 CYS A O   1 
ATOM   1784 C CB  . CYS A 1 244 ? 4.174   25.957 18.985 1.00 6.84  ? 1904 CYS A CB  1 
ATOM   1785 S SG  . CYS A 1 244 ? 2.940   26.275 17.714 1.00 10.80 ? 1904 CYS A SG  1 
ATOM   1786 N N   . SER A 1 245 ? 2.229   24.900 20.640 1.00 8.28  ? 1905 SER A N   1 
ATOM   1787 C CA  . SER A 1 245 ? 1.031   24.411 21.342 1.00 10.24 ? 1905 SER A CA  1 
ATOM   1788 C C   . SER A 1 245 ? -0.127  23.979 20.435 1.00 9.76  ? 1905 SER A C   1 
ATOM   1789 O O   . SER A 1 245 ? -0.580  22.827 20.496 1.00 8.84  ? 1905 SER A O   1 
ATOM   1790 C CB  . SER A 1 245 ? 0.526   25.400 22.395 1.00 10.32 ? 1905 SER A CB  1 
ATOM   1791 O OG  . SER A 1 245 ? -0.400  24.749 23.258 1.00 10.60 ? 1905 SER A OG  1 
ATOM   1792 N N   . ALA A 1 246 ? -0.637  24.912 19.633 1.00 11.25 ? 1906 ALA A N   1 
ATOM   1793 C CA  . ALA A 1 246 ? -1.701  24.611 18.663 1.00 10.93 ? 1906 ALA A CA  1 
ATOM   1794 C C   . ALA A 1 246 ? -1.138  24.154 17.308 1.00 9.62  ? 1906 ALA A C   1 
ATOM   1795 O O   . ALA A 1 246 ? -1.851  23.587 16.475 1.00 8.57  ? 1906 ALA A O   1 
ATOM   1796 C CB  . ALA A 1 246 ? -2.613  25.820 18.464 1.00 10.34 ? 1906 ALA A CB  1 
ATOM   1797 N N   . GLY A 1 247 ? 0.152   24.402 17.096 1.00 9.02  ? 1907 GLY A N   1 
ATOM   1798 C CA  . GLY A 1 247 ? 0.772   24.116 15.805 1.00 9.93  ? 1907 GLY A CA  1 
ATOM   1799 C C   . GLY A 1 247 ? 0.480   25.141 14.730 1.00 10.17 ? 1907 GLY A C   1 
ATOM   1800 O O   . GLY A 1 247 ? 0.492   24.804 13.552 1.00 11.93 ? 1907 GLY A O   1 
ATOM   1801 N N   . VAL A 1 248 ? 0.241   26.403 15.086 1.00 11.86 ? 1908 VAL A N   1 
ATOM   1802 C CA  . VAL A 1 248 ? -0.118  27.397 14.054 1.00 9.49  ? 1908 VAL A CA  1 
ATOM   1803 C C   . VAL A 1 248 ? 0.686   28.689 14.165 1.00 8.84  ? 1908 VAL A C   1 
ATOM   1804 O O   . VAL A 1 248 ? 1.315   29.136 13.205 1.00 8.58  ? 1908 VAL A O   1 
ATOM   1805 C CB  . VAL A 1 248 ? -1.660  27.640 13.909 1.00 7.61  ? 1908 VAL A CB  1 
ATOM   1806 C CG1 . VAL A 1 248 ? -2.377  26.353 13.546 1.00 8.62  ? 1908 VAL A CG1 1 
ATOM   1807 C CG2 . VAL A 1 248 ? -2.287  28.192 15.176 1.00 5.16  ? 1908 VAL A CG2 1 
ATOM   1808 N N   . GLY A 1 249 ? 0.715   29.306 15.338 1.00 9.04  ? 1909 GLY A N   1 
ATOM   1809 C CA  . GLY A 1 249 ? 1.378   30.613 15.402 1.00 7.58  ? 1909 GLY A CA  1 
ATOM   1810 C C   . GLY A 1 249 ? 2.888   30.585 15.406 1.00 5.64  ? 1909 GLY A C   1 
ATOM   1811 O O   . GLY A 1 249 ? 3.543   30.982 14.445 1.00 8.98  ? 1909 GLY A O   1 
ATOM   1812 N N   . ARG A 1 250 ? 3.460   30.111 16.501 1.00 6.02  ? 1910 ARG A N   1 
ATOM   1813 C CA  . ARG A 1 250 ? 4.903   29.974 16.583 1.00 6.95  ? 1910 ARG A CA  1 
ATOM   1814 C C   . ARG A 1 250 ? 5.379   28.961 15.555 1.00 8.45  ? 1910 ARG A C   1 
ATOM   1815 O O   . ARG A 1 250 ? 6.440   29.116 14.956 1.00 8.05  ? 1910 ARG A O   1 
ATOM   1816 C CB  . ARG A 1 250 ? 5.297   29.627 18.021 1.00 6.79  ? 1910 ARG A CB  1 
ATOM   1817 C CG  . ARG A 1 250 ? 4.822   30.698 19.019 1.00 4.73  ? 1910 ARG A CG  1 
ATOM   1818 C CD  . ARG A 1 250 ? 5.017   30.217 20.443 1.00 11.32 ? 1910 ARG A CD  1 
ATOM   1819 N NE  . ARG A 1 250 ? 3.927   29.354 20.902 1.00 8.94  ? 1910 ARG A NE  1 
ATOM   1820 C CZ  . ARG A 1 250 ? 3.902   28.778 22.102 1.00 13.48 ? 1910 ARG A CZ  1 
ATOM   1821 N NH1 . ARG A 1 250 ? 4.922   28.988 22.938 1.00 2.00  ? 1910 ARG A NH1 1 
ATOM   1822 N NH2 . ARG A 1 250 ? 2.879   27.985 22.439 1.00 6.49  ? 1910 ARG A NH2 1 
ATOM   1823 N N   . THR A 1 251 ? 4.576   27.931 15.303 1.00 8.79  ? 1911 THR A N   1 
ATOM   1824 C CA  . THR A 1 251 ? 4.999   26.955 14.309 1.00 9.54  ? 1911 THR A CA  1 
ATOM   1825 C C   . THR A 1 251 ? 5.030   27.552 12.904 1.00 10.54 ? 1911 THR A C   1 
ATOM   1826 O O   . THR A 1 251 ? 6.029   27.366 12.198 1.00 12.12 ? 1911 THR A O   1 
ATOM   1827 C CB  . THR A 1 251 ? 4.134   25.693 14.309 1.00 9.25  ? 1911 THR A CB  1 
ATOM   1828 O OG1 . THR A 1 251 ? 4.489   24.894 15.439 1.00 3.75  ? 1911 THR A OG1 1 
ATOM   1829 C CG2 . THR A 1 251 ? 4.308   24.946 12.985 1.00 6.22  ? 1911 THR A CG2 1 
ATOM   1830 N N   . GLY A 1 252 ? 3.962   28.262 12.540 1.00 8.30  ? 1912 GLY A N   1 
ATOM   1831 C CA  . GLY A 1 252 ? 3.851   28.971 11.272 1.00 7.92  ? 1912 GLY A CA  1 
ATOM   1832 C C   . GLY A 1 252 ? 4.880   30.066 11.107 1.00 9.09  ? 1912 GLY A C   1 
ATOM   1833 O O   . GLY A 1 252 ? 5.482   30.196 10.035 1.00 12.12 ? 1912 GLY A O   1 
ATOM   1834 N N   . THR A 1 253 ? 5.110   30.861 12.148 1.00 9.50  ? 1913 THR A N   1 
ATOM   1835 C CA  . THR A 1 253 ? 6.198   31.846 12.096 1.00 9.85  ? 1913 THR A CA  1 
ATOM   1836 C C   . THR A 1 253 ? 7.581   31.212 11.890 1.00 9.77  ? 1913 THR A C   1 
ATOM   1837 O O   . THR A 1 253 ? 8.386   31.651 11.043 1.00 8.20  ? 1913 THR A O   1 
ATOM   1838 C CB  . THR A 1 253 ? 6.194   32.734 13.353 1.00 11.35 ? 1913 THR A CB  1 
ATOM   1839 O OG1 . THR A 1 253 ? 4.849   33.135 13.654 1.00 14.24 ? 1913 THR A OG1 1 
ATOM   1840 C CG2 . THR A 1 253 ? 7.082   33.957 13.187 1.00 12.75 ? 1913 THR A CG2 1 
ATOM   1841 N N   . PHE A 1 254 ? 7.852   30.160 12.658 1.00 9.44  ? 1914 PHE A N   1 
ATOM   1842 C CA  . PHE A 1 254 ? 9.112   29.426 12.491 1.00 10.77 ? 1914 PHE A CA  1 
ATOM   1843 C C   . PHE A 1 254 ? 9.353   29.071 11.027 1.00 10.83 ? 1914 PHE A C   1 
ATOM   1844 O O   . PHE A 1 254 ? 10.436  29.293 10.484 1.00 12.82 ? 1914 PHE A O   1 
ATOM   1845 C CB  . PHE A 1 254 ? 9.224   28.142 13.326 1.00 7.09  ? 1914 PHE A CB  1 
ATOM   1846 C CG  . PHE A 1 254 ? 10.477  27.367 13.019 1.00 12.32 ? 1914 PHE A CG  1 
ATOM   1847 C CD1 . PHE A 1 254 ? 11.652  27.597 13.723 1.00 7.72  ? 1914 PHE A CD1 1 
ATOM   1848 C CD2 . PHE A 1 254 ? 10.512  26.448 11.970 1.00 15.58 ? 1914 PHE A CD2 1 
ATOM   1849 C CE1 . PHE A 1 254 ? 12.808  26.895 13.418 1.00 4.11  ? 1914 PHE A CE1 1 
ATOM   1850 C CE2 . PHE A 1 254 ? 11.696  25.757 11.640 1.00 10.81 ? 1914 PHE A CE2 1 
ATOM   1851 C CZ  . PHE A 1 254 ? 12.836  25.984 12.372 1.00 4.21  ? 1914 PHE A CZ  1 
ATOM   1852 N N   . ILE A 1 255 ? 8.341   28.503 10.389 1.00 10.77 ? 1915 ILE A N   1 
ATOM   1853 C CA  . ILE A 1 255 ? 8.514   27.909 9.056  1.00 9.53  ? 1915 ILE A CA  1 
ATOM   1854 C C   . ILE A 1 255 ? 8.604   29.010 7.988  1.00 9.63  ? 1915 ILE A C   1 
ATOM   1855 O O   . ILE A 1 255 ? 9.387   28.912 7.039  1.00 9.90  ? 1915 ILE A O   1 
ATOM   1856 C CB  . ILE A 1 255 ? 7.330   26.965 8.708  1.00 7.45  ? 1915 ILE A CB  1 
ATOM   1857 C CG1 . ILE A 1 255 ? 7.400   25.644 9.479  1.00 4.89  ? 1915 ILE A CG1 1 
ATOM   1858 C CG2 . ILE A 1 255 ? 7.225   26.727 7.192  1.00 2.78  ? 1915 ILE A CG2 1 
ATOM   1859 C CD1 . ILE A 1 255 ? 6.145   24.795 9.282  1.00 4.55  ? 1915 ILE A CD1 1 
ATOM   1860 N N   . ALA A 1 256 ? 7.760   30.031 8.129  1.00 10.33 ? 1916 ALA A N   1 
ATOM   1861 C CA  . ALA A 1 256 ? 7.814   31.244 7.304  1.00 8.26  ? 1916 ALA A CA  1 
ATOM   1862 C C   . ALA A 1 256 ? 9.189   31.871 7.418  1.00 7.81  ? 1916 ALA A C   1 
ATOM   1863 O O   . ALA A 1 256 ? 9.722   32.293 6.414  1.00 9.42  ? 1916 ALA A O   1 
ATOM   1864 C CB  . ALA A 1 256 ? 6.705   32.254 7.671  1.00 4.46  ? 1916 ALA A CB  1 
ATOM   1865 N N   . LEU A 1 257 ? 9.781   31.916 8.610  1.00 10.82 ? 1917 LEU A N   1 
ATOM   1866 C CA  . LEU A 1 257 ? 11.157  32.401 8.728  1.00 10.09 ? 1917 LEU A CA  1 
ATOM   1867 C C   . LEU A 1 257 ? 12.192  31.527 8.027  1.00 10.59 ? 1917 LEU A C   1 
ATOM   1868 O O   . LEU A 1 257 ? 13.034  32.051 7.289  1.00 12.29 ? 1917 LEU A O   1 
ATOM   1869 C CB  . LEU A 1 257 ? 11.571  32.739 10.172 1.00 7.10  ? 1917 LEU A CB  1 
ATOM   1870 C CG  . LEU A 1 257 ? 12.944  33.390 10.445 1.00 10.39 ? 1917 LEU A CG  1 
ATOM   1871 C CD1 . LEU A 1 257 ? 13.090  34.700 9.665  1.00 8.96  ? 1917 LEU A CD1 1 
ATOM   1872 C CD2 . LEU A 1 257 ? 13.255  33.666 11.949 1.00 8.20  ? 1917 LEU A CD2 1 
ATOM   1873 N N   . ASP A 1 258 ? 12.148  30.224 8.287  1.00 11.36 ? 1918 ASP A N   1 
ATOM   1874 C CA  . ASP A 1 258 ? 12.928  29.225 7.548  1.00 13.57 ? 1918 ASP A CA  1 
ATOM   1875 C C   . ASP A 1 258 ? 12.843  29.442 6.025  1.00 13.51 ? 1918 ASP A C   1 
ATOM   1876 O O   . ASP A 1 258 ? 13.863  29.450 5.315  1.00 14.50 ? 1918 ASP A O   1 
ATOM   1877 C CB  . ASP A 1 258 ? 12.478  27.809 7.963  1.00 12.60 ? 1918 ASP A CB  1 
ATOM   1878 C CG  . ASP A 1 258 ? 13.435  26.692 7.519  1.00 14.35 ? 1918 ASP A CG  1 
ATOM   1879 O OD1 . ASP A 1 258 ? 14.665  26.904 7.465  1.00 12.14 ? 1918 ASP A OD1 1 
ATOM   1880 O OD2 . ASP A 1 258 ? 12.968  25.561 7.244  1.00 5.15  ? 1918 ASP A OD2 1 
ATOM   1881 N N   . ARG A 1 259 ? 11.635  29.622 5.503  1.00 11.05 ? 1919 ARG A N   1 
ATOM   1882 C CA  . ARG A 1 259 ? 11.496  29.836 4.061  1.00 13.21 ? 1919 ARG A CA  1 
ATOM   1883 C C   . ARG A 1 259 ? 12.077  31.162 3.537  1.00 12.67 ? 1919 ARG A C   1 
ATOM   1884 O O   . ARG A 1 259 ? 12.769  31.173 2.520  1.00 9.56  ? 1919 ARG A O   1 
ATOM   1885 C CB  . ARG A 1 259 ? 10.018  29.754 3.673  1.00 13.20 ? 1919 ARG A CB  1 
ATOM   1886 C CG  . ARG A 1 259 ? 9.391   28.378 3.820  1.00 18.42 ? 1919 ARG A CG  1 
ATOM   1887 C CD  . ARG A 1 259 ? 8.062   28.350 3.086  1.00 24.28 ? 1919 ARG A CD  1 
ATOM   1888 N NE  . ARG A 1 259 ? 8.146   28.894 1.726  1.00 29.52 ? 1919 ARG A NE  1 
ATOM   1889 C CZ  . ARG A 1 259 ? 7.106   28.943 0.894  1.00 29.97 ? 1919 ARG A CZ  1 
ATOM   1890 N NH1 . ARG A 1 259 ? 5.916   28.490 1.283  1.00 28.87 ? 1919 ARG A NH1 1 
ATOM   1891 N NH2 . ARG A 1 259 ? 7.257   29.434 -0.326 1.00 28.60 ? 1919 ARG A NH2 1 
ATOM   1892 N N   . ILE A 1 260 ? 11.806  32.284 4.206  1.00 13.12 ? 1920 ILE A N   1 
ATOM   1893 C CA  . ILE A 1 260 ? 12.323  33.555 3.710  1.00 16.99 ? 1920 ILE A CA  1 
ATOM   1894 C C   . ILE A 1 260 ? 13.847  33.702 3.879  1.00 15.15 ? 1920 ILE A C   1 
ATOM   1895 O O   . ILE A 1 260 ? 14.540  34.370 3.104  1.00 11.58 ? 1920 ILE A O   1 
ATOM   1896 C CB  . ILE A 1 260 ? 11.526  34.783 4.211  1.00 16.93 ? 1920 ILE A CB  1 
ATOM   1897 C CG1 . ILE A 1 260 ? 11.849  35.104 5.668  1.00 20.78 ? 1920 ILE A CG1 1 
ATOM   1898 C CG2 . ILE A 1 260 ? 10.024  34.525 4.136  1.00 16.95 ? 1920 ILE A CG2 1 
ATOM   1899 C CD1 . ILE A 1 260 ? 10.601  35.631 6.406  1.00 24.51 ? 1920 ILE A CD1 1 
ATOM   1900 N N   . LEU A 1 261 ? 14.372  33.055 4.910  1.00 14.83 ? 1921 LEU A N   1 
ATOM   1901 C CA  . LEU A 1 261 ? 15.787  33.198 5.140  1.00 15.32 ? 1921 LEU A CA  1 
ATOM   1902 C C   . LEU A 1 261 ? 16.496  32.495 3.996  1.00 14.84 ? 1921 LEU A C   1 
ATOM   1903 O O   . LEU A 1 261 ? 17.550  32.967 3.550  1.00 15.73 ? 1921 LEU A O   1 
ATOM   1904 C CB  . LEU A 1 261 ? 16.209  32.656 6.503  1.00 17.04 ? 1921 LEU A CB  1 
ATOM   1905 C CG  . LEU A 1 261 ? 16.007  33.529 7.738  1.00 13.67 ? 1921 LEU A CG  1 
ATOM   1906 C CD1 . LEU A 1 261 ? 16.715  32.768 8.831  1.00 9.32  ? 1921 LEU A CD1 1 
ATOM   1907 C CD2 . LEU A 1 261 ? 16.645  34.881 7.520  1.00 16.63 ? 1921 LEU A CD2 1 
ATOM   1908 N N   . GLN A 1 262 ? 15.918  31.399 3.511  1.00 11.49 ? 1922 GLN A N   1 
ATOM   1909 C CA  . GLN A 1 262 ? 16.420  30.830 2.261  1.00 14.51 ? 1922 GLN A CA  1 
ATOM   1910 C C   . GLN A 1 262 ? 16.277  31.663 0.973  1.00 14.87 ? 1922 GLN A C   1 
ATOM   1911 O O   . GLN A 1 262 ? 17.149  31.619 0.108  1.00 14.40 ? 1922 GLN A O   1 
ATOM   1912 C CB  . GLN A 1 262 ? 15.834  29.446 2.020  1.00 14.22 ? 1922 GLN A CB  1 
ATOM   1913 C CG  . GLN A 1 262 ? 16.292  28.396 3.000  1.00 14.77 ? 1922 GLN A CG  1 
ATOM   1914 C CD  . GLN A 1 262 ? 15.445  27.156 2.868  1.00 16.17 ? 1922 GLN A CD  1 
ATOM   1915 O OE1 . GLN A 1 262 ? 15.777  26.246 2.100  1.00 16.73 ? 1922 GLN A OE1 1 
ATOM   1916 N NE2 . GLN A 1 262 ? 14.343  27.117 3.609  1.00 3.83  ? 1922 GLN A NE2 1 
ATOM   1917 N N   . GLN A 1 263 ? 15.156  32.372 0.836  1.00 16.02 ? 1923 GLN A N   1 
ATOM   1918 C CA  . GLN A 1 263 ? 14.915  33.335 -0.229 1.00 15.59 ? 1923 GLN A CA  1 
ATOM   1919 C C   . GLN A 1 263 ? 15.926  34.483 -0.159 1.00 18.91 ? 1923 GLN A C   1 
ATOM   1920 O O   . GLN A 1 263 ? 16.361  34.970 -1.195 1.00 19.15 ? 1923 GLN A O   1 
ATOM   1921 C CB  . GLN A 1 263 ? 13.490  33.893 -0.161 1.00 14.92 ? 1923 GLN A CB  1 
ATOM   1922 C CG  . GLN A 1 263 ? 12.314  32.983 -0.552 1.00 11.33 ? 1923 GLN A CG  1 
ATOM   1923 C CD  . GLN A 1 263 ? 10.955  33.664 -0.358 1.00 15.79 ? 1923 GLN A CD  1 
ATOM   1924 O OE1 . GLN A 1 263 ? 10.848  34.894 -0.238 1.00 12.50 ? 1923 GLN A OE1 1 
ATOM   1925 N NE2 . GLN A 1 263 ? 9.898   32.854 -0.305 1.00 21.19 ? 1923 GLN A NE2 1 
ATOM   1926 N N   . LEU A 1 264 ? 16.304  34.929 1.038  1.00 21.12 ? 1924 LEU A N   1 
ATOM   1927 C CA  . LEU A 1 264 ? 17.269  36.016 1.168  1.00 23.76 ? 1924 LEU A CA  1 
ATOM   1928 C C   . LEU A 1 264 ? 18.638  35.593 0.670  1.00 26.82 ? 1924 LEU A C   1 
ATOM   1929 O O   . LEU A 1 264 ? 19.479  36.447 0.396  1.00 29.78 ? 1924 LEU A O   1 
ATOM   1930 C CB  . LEU A 1 264 ? 17.361  36.570 2.599  1.00 25.05 ? 1924 LEU A CB  1 
ATOM   1931 C CG  . LEU A 1 264 ? 16.223  37.446 3.151  1.00 23.25 ? 1924 LEU A CG  1 
ATOM   1932 C CD1 . LEU A 1 264 ? 16.470  37.896 4.572  1.00 20.25 ? 1924 LEU A CD1 1 
ATOM   1933 C CD2 . LEU A 1 264 ? 15.990  38.686 2.291  1.00 23.39 ? 1924 LEU A CD2 1 
ATOM   1934 N N   . ASP A 1 265 ? 18.870  34.289 0.553  1.00 29.07 ? 1925 ASP A N   1 
ATOM   1935 C CA  . ASP A 1 265 ? 20.129  33.779 0.023  1.00 28.96 ? 1925 ASP A CA  1 
ATOM   1936 C C   . ASP A 1 265 ? 20.150  33.390 -1.449 1.00 31.31 ? 1925 ASP A C   1 
ATOM   1937 O O   . ASP A 1 265 ? 21.186  32.948 -1.936 1.00 32.72 ? 1925 ASP A O   1 
ATOM   1938 C CB  . ASP A 1 265 ? 20.547  32.554 0.817  1.00 29.36 ? 1925 ASP A CB  1 
ATOM   1939 C CG  . ASP A 1 265 ? 20.905  32.902 2.227  1.00 29.69 ? 1925 ASP A CG  1 
ATOM   1940 O OD1 . ASP A 1 265 ? 21.087  34.106 2.487  1.00 40.16 ? 1925 ASP A OD1 1 
ATOM   1941 O OD2 . ASP A 1 265 ? 21.012  31.988 3.062  1.00 32.23 ? 1925 ASP A OD2 1 
ATOM   1942 N N   . SER A 1 266 ? 19.036  33.523 -2.162 1.00 32.82 ? 1926 SER A N   1 
ATOM   1943 C CA  . SER A 1 266 ? 18.882  32.869 -3.464 1.00 34.80 ? 1926 SER A CA  1 
ATOM   1944 C C   . SER A 1 266 ? 18.236  33.808 -4.463 1.00 36.06 ? 1926 SER A C   1 
ATOM   1945 O O   . SER A 1 266 ? 18.223  33.523 -5.665 1.00 37.82 ? 1926 SER A O   1 
ATOM   1946 C CB  . SER A 1 266 ? 17.929  31.679 -3.352 1.00 34.08 ? 1926 SER A CB  1 
ATOM   1947 O OG  . SER A 1 266 ? 18.546  30.621 -2.650 1.00 38.83 ? 1926 SER A OG  1 
ATOM   1948 N N   . LYS A 1 267 ? 17.681  34.896 -3.934 1.00 35.41 ? 1927 LYS A N   1 
ATOM   1949 C CA  . LYS A 1 267 ? 16.778  35.761 -4.671 1.00 35.20 ? 1927 LYS A CA  1 
ATOM   1950 C C   . LYS A 1 267 ? 17.100  37.237 -4.428 1.00 35.21 ? 1927 LYS A C   1 
ATOM   1951 O O   . LYS A 1 267 ? 17.481  37.636 -3.330 1.00 32.90 ? 1927 LYS A O   1 
ATOM   1952 C CB  . LYS A 1 267 ? 15.330  35.457 -4.281 1.00 35.35 ? 1927 LYS A CB  1 
ATOM   1953 C CG  . LYS A 1 267 ? 14.795  34.101 -4.725 1.00 38.26 ? 1927 LYS A CG  1 
ATOM   1954 C CD  . LYS A 1 267 ? 13.409  34.208 -5.368 1.00 47.15 ? 1927 LYS A CD  1 
ATOM   1955 C CE  . LYS A 1 267 ? 12.234  34.173 -4.375 1.00 51.90 ? 1927 LYS A CE  1 
ATOM   1956 N NZ  . LYS A 1 267 ? 11.612  35.500 -4.015 1.00 51.70 ? 1927 LYS A NZ  1 
ATOM   1957 N N   . ASP A 1 268 ? 16.942  38.022 -5.491 1.00 36.39 ? 1928 ASP A N   1 
ATOM   1958 C CA  . ASP A 1 268 ? 16.749  39.479 -5.495 1.00 37.47 ? 1928 ASP A CA  1 
ATOM   1959 C C   . ASP A 1 268 ? 15.708  40.005 -4.497 1.00 35.14 ? 1928 ASP A C   1 
ATOM   1960 O O   . ASP A 1 268 ? 15.554  41.216 -4.301 1.00 34.40 ? 1928 ASP A O   1 
ATOM   1961 C CB  . ASP A 1 268 ? 16.266  39.873 -6.908 1.00 38.53 ? 1928 ASP A CB  1 
ATOM   1962 C CG  . ASP A 1 268 ? 15.158  38.941 -7.428 1.00 46.57 ? 1928 ASP A CG  1 
ATOM   1963 O OD1 . ASP A 1 268 ? 15.448  37.756 -7.745 1.00 49.61 ? 1928 ASP A OD1 1 
ATOM   1964 O OD2 . ASP A 1 268 ? 13.986  39.388 -7.508 1.00 48.02 ? 1928 ASP A OD2 1 
ATOM   1965 N N   . SER A 1 269 ? 14.941  39.105 -3.896 1.00 34.03 ? 1929 SER A N   1 
ATOM   1966 C CA  . SER A 1 269 ? 13.647  39.515 -3.362 1.00 32.77 ? 1929 SER A CA  1 
ATOM   1967 C C   . SER A 1 269 ? 12.908  38.473 -2.538 1.00 30.64 ? 1929 SER A C   1 
ATOM   1968 O O   . SER A 1 269 ? 12.956  37.276 -2.816 1.00 31.86 ? 1929 SER A O   1 
ATOM   1969 C CB  . SER A 1 269 ? 12.733  40.091 -4.448 1.00 32.88 ? 1929 SER A CB  1 
ATOM   1970 O OG  . SER A 1 269 ? 12.109  39.061 -5.185 1.00 30.81 ? 1929 SER A OG  1 
ATOM   1971 N N   . VAL A 1 270 ? 12.216  38.975 -1.522 1.00 27.60 ? 1930 VAL A N   1 
ATOM   1972 C CA  . VAL A 1 270 ? 11.624  38.150 -0.477 1.00 23.47 ? 1930 VAL A CA  1 
ATOM   1973 C C   . VAL A 1 270 ? 10.101  38.318 -0.560 1.00 20.76 ? 1930 VAL A C   1 
ATOM   1974 O O   . VAL A 1 270 ? 9.619   39.395 -0.931 1.00 15.48 ? 1930 VAL A O   1 
ATOM   1975 C CB  . VAL A 1 270 ? 12.219  38.532 0.889  1.00 25.03 ? 1930 VAL A CB  1 
ATOM   1976 C CG1 . VAL A 1 270 ? 11.731  39.900 1.352  1.00 21.71 ? 1930 VAL A CG1 1 
ATOM   1977 C CG2 . VAL A 1 270 ? 11.969  37.437 1.902  1.00 26.32 ? 1930 VAL A CG2 1 
ATOM   1978 N N   . ASP A 1 271 ? 9.364   37.245 -0.274 1.00 15.31 ? 1931 ASP A N   1 
ATOM   1979 C CA  . ASP A 1 271 ? 7.913   37.310 -0.364 1.00 16.70 ? 1931 ASP A CA  1 
ATOM   1980 C C   . ASP A 1 271 ? 7.241   36.836 0.930  1.00 15.70 ? 1931 ASP A C   1 
ATOM   1981 O O   . ASP A 1 271 ? 6.717   35.724 1.002  1.00 19.79 ? 1931 ASP A O   1 
ATOM   1982 C CB  . ASP A 1 271 ? 7.422   36.570 -1.616 1.00 15.97 ? 1931 ASP A CB  1 
ATOM   1983 C CG  . ASP A 1 271 ? 5.919   36.639 -1.817 1.00 17.99 ? 1931 ASP A CG  1 
ATOM   1984 O OD1 . ASP A 1 271 ? 5.237   37.551 -1.290 1.00 16.30 ? 1931 ASP A OD1 1 
ATOM   1985 O OD2 . ASP A 1 271 ? 5.422   35.756 -2.554 1.00 21.26 ? 1931 ASP A OD2 1 
ATOM   1986 N N   . ILE A 1 272 ? 7.250   37.675 1.959  1.00 13.36 ? 1932 ILE A N   1 
ATOM   1987 C CA  . ILE A 1 272 ? 6.677   37.311 3.240  1.00 12.66 ? 1932 ILE A CA  1 
ATOM   1988 C C   . ILE A 1 272 ? 5.179   37.035 3.109  1.00 15.01 ? 1932 ILE A C   1 
ATOM   1989 O O   . ILE A 1 272 ? 4.672   36.057 3.666  1.00 16.80 ? 1932 ILE A O   1 
ATOM   1990 C CB  . ILE A 1 272 ? 7.032   38.342 4.343  1.00 11.55 ? 1932 ILE A CB  1 
ATOM   1991 C CG1 . ILE A 1 272 ? 8.561   38.460 4.479  1.00 10.96 ? 1932 ILE A CG1 1 
ATOM   1992 C CG2 . ILE A 1 272 ? 6.433   37.950 5.699  1.00 4.78  ? 1932 ILE A CG2 1 
ATOM   1993 C CD1 . ILE A 1 272 ? 9.072   39.714 5.249  1.00 10.19 ? 1932 ILE A CD1 1 
ATOM   1994 N N   . TYR A 1 273 ? 4.458   37.872 2.367  1.00 17.17 ? 1933 TYR A N   1 
ATOM   1995 C CA  . TYR A 1 273 ? 3.011   37.665 2.159  1.00 16.35 ? 1933 TYR A CA  1 
ATOM   1996 C C   . TYR A 1 273 ? 2.633   36.317 1.540  1.00 15.61 ? 1933 TYR A C   1 
ATOM   1997 O O   . TYR A 1 273 ? 1.795   35.570 2.059  1.00 14.38 ? 1933 TYR A O   1 
ATOM   1998 C CB  . TYR A 1 273 ? 2.399   38.821 1.338  1.00 16.31 ? 1933 TYR A CB  1 
ATOM   1999 C CG  . TYR A 1 273 ? 0.896   38.694 1.120  1.00 16.76 ? 1933 TYR A CG  1 
ATOM   2000 C CD1 . TYR A 1 273 ? -0.010  39.413 1.897  1.00 15.35 ? 1933 TYR A CD1 1 
ATOM   2001 C CD2 . TYR A 1 273 ? 0.388   37.856 0.134  1.00 13.48 ? 1933 TYR A CD2 1 
ATOM   2002 C CE1 . TYR A 1 273 ? -1.374  39.306 1.700  1.00 17.28 ? 1933 TYR A CE1 1 
ATOM   2003 C CE2 . TYR A 1 273 ? -0.970  37.721 -0.062 1.00 14.95 ? 1933 TYR A CE2 1 
ATOM   2004 C CZ  . TYR A 1 273 ? -1.843  38.449 0.723  1.00 19.10 ? 1933 TYR A CZ  1 
ATOM   2005 O OH  . TYR A 1 273 ? -3.201  38.307 0.521  1.00 20.08 ? 1933 TYR A OH  1 
ATOM   2006 N N   . GLY A 1 274 ? 3.255   36.040 0.396  1.00 15.39 ? 1934 GLY A N   1 
ATOM   2007 C CA  . GLY A 1 274 ? 3.248   34.743 -0.251 1.00 12.18 ? 1934 GLY A CA  1 
ATOM   2008 C C   . GLY A 1 274 ? 3.508   33.535 0.635  1.00 14.26 ? 1934 GLY A C   1 
ATOM   2009 O O   . GLY A 1 274 ? 2.740   32.560 0.579  1.00 13.73 ? 1934 GLY A O   1 
ATOM   2010 N N   . ALA A 1 275 ? 4.569   33.564 1.443  1.00 13.10 ? 1935 ALA A N   1 
ATOM   2011 C CA  . ALA A 1 275 ? 4.842   32.458 2.383  1.00 12.37 ? 1935 ALA A CA  1 
ATOM   2012 C C   . ALA A 1 275 ? 3.684   32.196 3.336  1.00 10.45 ? 1935 ALA A C   1 
ATOM   2013 O O   . ALA A 1 275 ? 3.297   31.063 3.545  1.00 12.20 ? 1935 ALA A O   1 
ATOM   2014 C CB  . ALA A 1 275 ? 6.132   32.697 3.195  1.00 13.32 ? 1935 ALA A CB  1 
ATOM   2015 N N   . VAL A 1 276 ? 3.085   33.235 3.893  1.00 10.82 ? 1936 VAL A N   1 
ATOM   2016 C CA  . VAL A 1 276 ? 2.083   33.045 4.937  1.00 12.82 ? 1936 VAL A CA  1 
ATOM   2017 C C   . VAL A 1 276 ? 0.784   32.596 4.284  1.00 14.39 ? 1936 VAL A C   1 
ATOM   2018 O O   . VAL A 1 276 ? 0.106   31.691 4.765  1.00 16.03 ? 1936 VAL A O   1 
ATOM   2019 C CB  . VAL A 1 276 ? 1.919   34.330 5.797  1.00 13.12 ? 1936 VAL A CB  1 
ATOM   2020 C CG1 . VAL A 1 276 ? 0.800   34.145 6.815  1.00 14.57 ? 1936 VAL A CG1 1 
ATOM   2021 C CG2 . VAL A 1 276 ? 3.234   34.610 6.551  1.00 11.28 ? 1936 VAL A CG2 1 
ATOM   2022 N N   . HIS A 1 277 ? 0.457   33.230 3.164  1.00 12.48 ? 1937 HIS A N   1 
ATOM   2023 C CA  . HIS A 1 277 ? -0.567  32.731 2.277  1.00 11.76 ? 1937 HIS A CA  1 
ATOM   2024 C C   . HIS A 1 277 ? -0.517  31.223 2.030  1.00 12.51 ? 1937 HIS A C   1 
ATOM   2025 O O   . HIS A 1 277 ? -1.510  30.531 2.232  1.00 11.85 ? 1937 HIS A O   1 
ATOM   2026 C CB  . HIS A 1 277 ? -0.474  33.450 0.927  1.00 11.13 ? 1937 HIS A CB  1 
ATOM   2027 C CG  . HIS A 1 277 ? -1.603  33.107 0.014  1.00 8.91  ? 1937 HIS A CG  1 
ATOM   2028 N ND1 . HIS A 1 277 ? -1.630  31.937 -0.714 1.00 6.85  ? 1937 HIS A ND1 1 
ATOM   2029 C CD2 . HIS A 1 277 ? -2.754  33.760 -0.271 1.00 10.90 ? 1937 HIS A CD2 1 
ATOM   2030 C CE1 . HIS A 1 277 ? -2.751  31.881 -1.410 1.00 2.13  ? 1937 HIS A CE1 1 
ATOM   2031 N NE2 . HIS A 1 277 ? -3.449  32.975 -1.160 1.00 12.43 ? 1937 HIS A NE2 1 
ATOM   2032 N N   . ASP A 1 278 ? 0.638   30.744 1.575  1.00 12.71 ? 1938 ASP A N   1 
ATOM   2033 C CA  . ASP A 1 278 ? 0.891   29.342 1.299  1.00 14.72 ? 1938 ASP A CA  1 
ATOM   2034 C C   . ASP A 1 278 ? 0.652   28.492 2.549  1.00 13.38 ? 1938 ASP A C   1 
ATOM   2035 O O   . ASP A 1 278 ? 0.044   27.433 2.492  1.00 13.94 ? 1938 ASP A O   1 
ATOM   2036 C CB  . ASP A 1 278 ? 2.304   29.180 0.699  1.00 17.17 ? 1938 ASP A CB  1 
ATOM   2037 C CG  . ASP A 1 278 ? 2.437   27.940 -0.192 1.00 24.86 ? 1938 ASP A CG  1 
ATOM   2038 O OD1 . ASP A 1 278 ? 1.417   27.566 -0.803 1.00 33.83 ? 1938 ASP A OD1 1 
ATOM   2039 O OD2 . ASP A 1 278 ? 3.519   27.307 -0.302 1.00 26.73 ? 1938 ASP A OD2 1 
ATOM   2040 N N   . LEU A 1 279 ? 1.116   28.945 3.706  1.00 13.67 ? 1939 LEU A N   1 
ATOM   2041 C CA  . LEU A 1 279 ? 0.983   28.133 4.909  1.00 12.85 ? 1939 LEU A CA  1 
ATOM   2042 C C   . LEU A 1 279 ? -0.500  28.000 5.188  1.00 12.78 ? 1939 LEU A C   1 
ATOM   2043 O O   . LEU A 1 279 ? -0.911  26.935 5.636  1.00 10.22 ? 1939 LEU A O   1 
ATOM   2044 C CB  . LEU A 1 279 ? 1.709   28.754 6.113  1.00 14.50 ? 1939 LEU A CB  1 
ATOM   2045 C CG  . LEU A 1 279 ? 3.201   29.068 6.026  1.00 10.77 ? 1939 LEU A CG  1 
ATOM   2046 C CD1 . LEU A 1 279 ? 3.692   29.551 7.371  1.00 11.37 ? 1939 LEU A CD1 1 
ATOM   2047 C CD2 . LEU A 1 279 ? 3.903   27.791 5.622  1.00 13.86 ? 1939 LEU A CD2 1 
ATOM   2048 N N   . ARG A 1 280 ? -1.275  29.061 4.920  1.00 13.08 ? 1940 ARG A N   1 
ATOM   2049 C CA  . ARG A 1 280 ? -2.717  29.108 5.199  1.00 10.35 ? 1940 ARG A CA  1 
ATOM   2050 C C   . ARG A 1 280 ? -3.546  28.208 4.290  1.00 11.37 ? 1940 ARG A C   1 
ATOM   2051 O O   . ARG A 1 280 ? -4.618  27.718 4.680  1.00 9.92  ? 1940 ARG A O   1 
ATOM   2052 C CB  . ARG A 1 280 ? -3.267  30.542 5.129  1.00 12.69 ? 1940 ARG A CB  1 
ATOM   2053 C CG  . ARG A 1 280 ? -2.771  31.511 6.219  1.00 9.64  ? 1940 ARG A CG  1 
ATOM   2054 C CD  . ARG A 1 280 ? -3.366  31.289 7.622  1.00 11.93 ? 1940 ARG A CD  1 
ATOM   2055 N NE  . ARG A 1 280 ? -2.809  32.324 8.496  1.00 9.87  ? 1940 ARG A NE  1 
ATOM   2056 C CZ  . ARG A 1 280 ? -3.342  33.523 8.716  1.00 10.77 ? 1940 ARG A CZ  1 
ATOM   2057 N NH1 . ARG A 1 280 ? -4.496  33.833 8.154  1.00 9.99  ? 1940 ARG A NH1 1 
ATOM   2058 N NH2 . ARG A 1 280 ? -2.733  34.421 9.500  1.00 6.16  ? 1940 ARG A NH2 1 
ATOM   2059 N N   . LEU A 1 281 ? -3.064  27.988 3.068  1.00 11.29 ? 1941 LEU A N   1 
ATOM   2060 C CA  . LEU A 1 281 ? -3.740  27.041 2.171  1.00 11.52 ? 1941 LEU A CA  1 
ATOM   2061 C C   . LEU A 1 281 ? -3.738  25.662 2.793  1.00 9.64  ? 1941 LEU A C   1 
ATOM   2062 O O   . LEU A 1 281 ? -4.585  24.853 2.424  1.00 11.85 ? 1941 LEU A O   1 
ATOM   2063 C CB  . LEU A 1 281 ? -3.106  26.958 0.774  1.00 9.48  ? 1941 LEU A CB  1 
ATOM   2064 C CG  . LEU A 1 281 ? -3.371  28.205 -0.078 1.00 13.42 ? 1941 LEU A CG  1 
ATOM   2065 C CD1 . LEU A 1 281 ? -2.659  28.107 -1.427 1.00 21.20 ? 1941 LEU A CD1 1 
ATOM   2066 C CD2 . LEU A 1 281 ? -4.835  28.549 -0.290 1.00 10.27 ? 1941 LEU A CD2 1 
ATOM   2067 N N   . HIS A 1 282 ? -2.813  25.427 3.727  1.00 8.79  ? 1942 HIS A N   1 
ATOM   2068 C CA  . HIS A 1 282 ? -2.529  24.116 4.308  1.00 8.15  ? 1942 HIS A CA  1 
ATOM   2069 C C   . HIS A 1 282 ? -2.956  23.904 5.763  1.00 8.73  ? 1942 HIS A C   1 
ATOM   2070 O O   . HIS A 1 282 ? -3.240  22.770 6.159  1.00 7.02  ? 1942 HIS A O   1 
ATOM   2071 C CB  . HIS A 1 282 ? -1.059  23.743 4.113  1.00 6.91  ? 1942 HIS A CB  1 
ATOM   2072 C CG  . HIS A 1 282 ? -0.669  23.664 2.673  1.00 7.65  ? 1942 HIS A CG  1 
ATOM   2073 N ND1 . HIS A 1 282 ? -0.230  24.758 1.960  1.00 11.91 ? 1942 HIS A ND1 1 
ATOM   2074 C CD2 . HIS A 1 282 ? -0.679  22.627 1.801  1.00 13.57 ? 1942 HIS A CD2 1 
ATOM   2075 C CE1 . HIS A 1 282 ? 0.004   24.402 0.708  1.00 4.60  ? 1942 HIS A CE1 1 
ATOM   2076 N NE2 . HIS A 1 282 ? -0.248  23.110 0.588  1.00 10.65 ? 1942 HIS A NE2 1 
ATOM   2077 N N   . ARG A 1 283 ? -3.023  24.969 6.559  1.00 8.15  ? 1943 ARG A N   1 
ATOM   2078 C CA  . ARG A 1 283 ? -3.450  24.865 7.973  1.00 7.69  ? 1943 ARG A CA  1 
ATOM   2079 C C   . ARG A 1 283 ? -3.997  26.209 8.492  1.00 7.67  ? 1943 ARG A C   1 
ATOM   2080 O O   . ARG A 1 283 ? -3.466  27.262 8.129  1.00 7.62  ? 1943 ARG A O   1 
ATOM   2081 C CB  . ARG A 1 283 ? -2.291  24.346 8.847  1.00 4.05  ? 1943 ARG A CB  1 
ATOM   2082 C CG  . ARG A 1 283 ? -2.699  23.826 10.250 1.00 6.14  ? 1943 ARG A CG  1 
ATOM   2083 C CD  . ARG A 1 283 ? -1.491  23.346 11.048 1.00 7.05  ? 1943 ARG A CD  1 
ATOM   2084 N NE  . ARG A 1 283 ? -1.704  23.073 12.470 1.00 5.66  ? 1943 ARG A NE  1 
ATOM   2085 C CZ  . ARG A 1 283 ? -2.310  21.989 12.972 1.00 11.61 ? 1943 ARG A CZ  1 
ATOM   2086 N NH1 . ARG A 1 283 ? -2.812  21.025 12.192 1.00 7.83  ? 1943 ARG A NH1 1 
ATOM   2087 N NH2 . ARG A 1 283 ? -2.429  21.850 14.287 1.00 4.42  ? 1943 ARG A NH2 1 
ATOM   2088 N N   . VAL A 1 284 ? -5.054  26.210 9.306  1.00 9.40  ? 1944 VAL A N   1 
ATOM   2089 C CA  . VAL A 1 284 ? -5.612  27.464 9.852  1.00 9.21  ? 1944 VAL A CA  1 
ATOM   2090 C C   . VAL A 1 284 ? -4.524  28.244 10.588 1.00 9.78  ? 1944 VAL A C   1 
ATOM   2091 O O   . VAL A 1 284 ? -3.610  27.624 11.111 1.00 7.71  ? 1944 VAL A O   1 
ATOM   2092 C CB  . VAL A 1 284 ? -6.777  27.213 10.860 1.00 10.27 ? 1944 VAL A CB  1 
ATOM   2093 C CG1 . VAL A 1 284 ? -8.009  26.732 10.149 1.00 8.65  ? 1944 VAL A CG1 1 
ATOM   2094 C CG2 . VAL A 1 284 ? -6.433  26.192 11.946 1.00 7.85  ? 1944 VAL A CG2 1 
ATOM   2095 N N   . HIS A 1 285 ? -4.617  29.575 10.643 1.00 9.82  ? 1945 HIS A N   1 
ATOM   2096 C CA  . HIS A 1 285 ? -3.903  30.400 11.627 1.00 8.66  ? 1945 HIS A CA  1 
ATOM   2097 C C   . HIS A 1 285 ? -2.378  30.418 11.669 1.00 9.45  ? 1945 HIS A C   1 
ATOM   2098 O O   . HIS A 1 285 ? -1.769  30.946 12.615 1.00 8.47  ? 1945 HIS A O   1 
ATOM   2099 C CB  . HIS A 1 285 ? -4.432  30.194 13.040 1.00 7.75  ? 1945 HIS A CB  1 
ATOM   2100 C CG  . HIS A 1 285 ? -5.862  30.595 13.223 1.00 8.77  ? 1945 HIS A CG  1 
ATOM   2101 N ND1 . HIS A 1 285 ? -6.304  31.887 13.039 1.00 12.27 ? 1945 HIS A ND1 1 
ATOM   2102 C CD2 . HIS A 1 285 ? -6.946  29.874 13.605 1.00 5.50  ? 1945 HIS A CD2 1 
ATOM   2103 C CE1 . HIS A 1 285 ? -7.598  31.946 13.308 1.00 5.95  ? 1945 HIS A CE1 1 
ATOM   2104 N NE2 . HIS A 1 285 ? -8.013  30.736 13.643 1.00 9.90  ? 1945 HIS A NE2 1 
ATOM   2105 N N   . MET A 1 286 ? -1.779  29.846 10.627 1.00 11.32 ? 1946 MET A N   1 
ATOM   2106 C CA  . MET A 1 286 ? -0.336  29.829 10.473 1.00 9.27  ? 1946 MET A CA  1 
ATOM   2107 C C   . MET A 1 286 ? 0.210   31.257 10.465 1.00 10.44 ? 1946 MET A C   1 
ATOM   2108 O O   . MET A 1 286 ? -0.120  32.060 9.587  1.00 9.32  ? 1946 MET A O   1 
ATOM   2109 C CB  . MET A 1 286 ? 0.018   29.123 9.170  1.00 9.82  ? 1946 MET A CB  1 
ATOM   2110 C CG  . MET A 1 286 ? -0.334  27.625 9.130  1.00 10.76 ? 1946 MET A CG  1 
ATOM   2111 S SD  . MET A 1 286 ? 0.445   26.601 10.404 1.00 15.11 ? 1946 MET A SD  1 
ATOM   2112 C CE  . MET A 1 286 ? 2.036   26.253 9.628  1.00 6.00  ? 1946 MET A CE  1 
ATOM   2113 N N   . VAL A 1 287 ? 1.050   31.565 11.451 1.00 10.61 ? 1947 VAL A N   1 
ATOM   2114 C CA  . VAL A 1 287 ? 1.403   32.945 11.826 1.00 10.66 ? 1947 VAL A CA  1 
ATOM   2115 C C   . VAL A 1 287 ? 0.140   33.611 12.373 1.00 11.77 ? 1947 VAL A C   1 
ATOM   2116 O O   . VAL A 1 287 ? -0.636  34.184 11.596 1.00 16.07 ? 1947 VAL A O   1 
ATOM   2117 C CB  . VAL A 1 287 ? 2.017   33.749 10.657 1.00 8.97  ? 1947 VAL A CB  1 
ATOM   2118 C CG1 . VAL A 1 287 ? 2.588   35.077 11.127 1.00 5.30  ? 1947 VAL A CG1 1 
ATOM   2119 C CG2 . VAL A 1 287 ? 3.076   32.912 9.958  1.00 8.51  ? 1947 VAL A CG2 1 
ATOM   2120 N N   . GLN A 1 288 ? -0.062  33.519 13.686 1.00 10.72 ? 1948 GLN A N   1 
ATOM   2121 C CA  . GLN A 1 288 ? -1.410  33.661 14.255 1.00 12.45 ? 1948 GLN A CA  1 
ATOM   2122 C C   . GLN A 1 288 ? -1.694  35.097 14.741 1.00 12.45 ? 1948 GLN A C   1 
ATOM   2123 O O   . GLN A 1 288 ? -2.848  35.466 14.976 1.00 11.93 ? 1948 GLN A O   1 
ATOM   2124 C CB  . GLN A 1 288 ? -1.628  32.653 15.396 1.00 10.40 ? 1948 GLN A CB  1 
ATOM   2125 C CG  . GLN A 1 288 ? -2.954  32.751 16.132 1.00 9.54  ? 1948 GLN A CG  1 
ATOM   2126 C CD  . GLN A 1 288 ? -2.767  33.386 17.505 1.00 12.65 ? 1948 GLN A CD  1 
ATOM   2127 O OE1 . GLN A 1 288 ? -1.728  33.201 18.155 1.00 9.78  ? 1948 GLN A OE1 1 
ATOM   2128 N NE2 . GLN A 1 288 ? -3.774  34.132 17.954 1.00 2.00  ? 1948 GLN A NE2 1 
ATOM   2129 N N   . THR A 1 289 ? -0.648  35.908 14.884 1.00 9.33  ? 1949 THR A N   1 
ATOM   2130 C CA  . THR A 1 289 ? -0.842  37.271 15.371 1.00 11.04 ? 1949 THR A CA  1 
ATOM   2131 C C   . THR A 1 289 ? -0.250  38.242 14.357 1.00 11.88 ? 1949 THR A C   1 
ATOM   2132 O O   . THR A 1 289 ? 0.672   37.890 13.629 1.00 11.27 ? 1949 THR A O   1 
ATOM   2133 C CB  . THR A 1 289 ? -0.257  37.556 16.786 1.00 11.39 ? 1949 THR A CB  1 
ATOM   2134 O OG1 . THR A 1 289 ? 1.180   37.656 16.728 1.00 12.85 ? 1949 THR A OG1 1 
ATOM   2135 C CG2 . THR A 1 289 ? -0.702  36.505 17.830 1.00 3.58  ? 1949 THR A CG2 1 
ATOM   2136 N N   . GLU A 1 290 ? -0.793  39.454 14.311 1.00 13.07 ? 1950 GLU A N   1 
ATOM   2137 C CA  . GLU A 1 290 ? -0.199  40.539 13.544 1.00 13.49 ? 1950 GLU A CA  1 
ATOM   2138 C C   . GLU A 1 290 ? 1.265   40.769 13.893 1.00 11.50 ? 1950 GLU A C   1 
ATOM   2139 O O   . GLU A 1 290 ? 2.090   40.984 13.000 1.00 11.90 ? 1950 GLU A O   1 
ATOM   2140 C CB  . GLU A 1 290 ? -0.974  41.842 13.759 1.00 14.59 ? 1950 GLU A CB  1 
ATOM   2141 C CG  . GLU A 1 290 ? -1.132  42.653 12.482 1.00 17.66 ? 1950 GLU A CG  1 
ATOM   2142 C CD  . GLU A 1 290 ? -1.978  43.903 12.650 1.00 18.57 ? 1950 GLU A CD  1 
ATOM   2143 O OE1 . GLU A 1 290 ? -1.380  45.008 12.670 1.00 15.65 ? 1950 GLU A OE1 1 
ATOM   2144 O OE2 . GLU A 1 290 ? -3.222  43.753 12.735 1.00 21.10 ? 1950 GLU A OE2 1 
ATOM   2145 N N   . CYS A 1 291 ? 1.583   40.739 15.184 1.00 9.24  ? 1951 CYS A N   1 
ATOM   2146 C CA  . CYS A 1 291 ? 2.957   40.925 15.645 1.00 9.79  ? 1951 CYS A CA  1 
ATOM   2147 C C   . CYS A 1 291 ? 3.956   39.877 15.145 1.00 9.47  ? 1951 CYS A C   1 
ATOM   2148 O O   . CYS A 1 291 ? 5.120   40.195 14.886 1.00 7.28  ? 1951 CYS A O   1 
ATOM   2149 C CB  . CYS A 1 291 ? 3.008   41.118 17.164 1.00 11.33 ? 1951 CYS A CB  1 
ATOM   2150 S SG  . CYS A 1 291 ? 2.562   42.836 17.729 1.00 11.69 ? 1951 CYS A SG  1 
ATOM   2151 N N   . GLN A 1 292 ? 3.495   38.637 14.986 1.00 8.94  ? 1952 GLN A N   1 
ATOM   2152 C CA  . GLN A 1 292 ? 4.345   37.567 14.475 1.00 9.98  ? 1952 GLN A CA  1 
ATOM   2153 C C   . GLN A 1 292 ? 4.649   37.875 13.020 1.00 11.97 ? 1952 GLN A C   1 
ATOM   2154 O O   . GLN A 1 292 ? 5.788   37.729 12.586 1.00 11.47 ? 1952 GLN A O   1 
ATOM   2155 C CB  . GLN A 1 292 ? 3.662   36.206 14.621 1.00 12.90 ? 1952 GLN A CB  1 
ATOM   2156 C CG  . GLN A 1 292 ? 3.628   35.730 16.088 1.00 10.16 ? 1952 GLN A CG  1 
ATOM   2157 C CD  . GLN A 1 292 ? 2.713   34.565 16.386 1.00 5.03  ? 1952 GLN A CD  1 
ATOM   2158 O OE1 . GLN A 1 292 ? 1.911   34.144 15.555 1.00 6.34  ? 1952 GLN A OE1 1 
ATOM   2159 N NE2 . GLN A 1 292 ? 2.839   34.028 17.597 1.00 4.36  ? 1952 GLN A NE2 1 
ATOM   2160 N N   . TYR A 1 293 ? 3.635   38.344 12.293 1.00 12.48 ? 1953 TYR A N   1 
ATOM   2161 C CA  . TYR A 1 293 ? 3.794   38.789 10.919 1.00 13.28 ? 1953 TYR A CA  1 
ATOM   2162 C C   . TYR A 1 293 ? 4.740   39.994 10.843 1.00 14.82 ? 1953 TYR A C   1 
ATOM   2163 O O   . TYR A 1 293 ? 5.596   40.044 9.955  1.00 17.15 ? 1953 TYR A O   1 
ATOM   2164 C CB  . TYR A 1 293 ? 2.417   39.050 10.304 1.00 11.91 ? 1953 TYR A CB  1 
ATOM   2165 C CG  . TYR A 1 293 ? 2.369   39.358 8.817  1.00 13.54 ? 1953 TYR A CG  1 
ATOM   2166 C CD1 . TYR A 1 293 ? 2.556   38.355 7.872  1.00 9.17  ? 1953 TYR A CD1 1 
ATOM   2167 C CD2 . TYR A 1 293 ? 2.107   40.652 8.354  1.00 9.56  ? 1953 TYR A CD2 1 
ATOM   2168 C CE1 . TYR A 1 293 ? 2.484   38.621 6.516  1.00 9.71  ? 1953 TYR A CE1 1 
ATOM   2169 C CE2 . TYR A 1 293 ? 2.053   40.928 6.994  1.00 6.76  ? 1953 TYR A CE2 1 
ATOM   2170 C CZ  . TYR A 1 293 ? 2.234   39.905 6.083  1.00 10.18 ? 1953 TYR A CZ  1 
ATOM   2171 O OH  . TYR A 1 293 ? 2.176   40.133 4.726  1.00 6.80  ? 1953 TYR A OH  1 
ATOM   2172 N N   . VAL A 1 294 ? 4.620   40.940 11.775 1.00 12.74 ? 1954 VAL A N   1 
ATOM   2173 C CA  . VAL A 1 294 ? 5.520   42.090 11.829 1.00 10.84 ? 1954 VAL A CA  1 
ATOM   2174 C C   . VAL A 1 294 ? 6.931   41.603 12.068 1.00 10.74 ? 1954 VAL A C   1 
ATOM   2175 O O   . VAL A 1 294 ? 7.878   42.054 11.436 1.00 11.91 ? 1954 VAL A O   1 
ATOM   2176 C CB  . VAL A 1 294 ? 5.144   43.115 12.941 1.00 11.14 ? 1954 VAL A CB  1 
ATOM   2177 C CG1 . VAL A 1 294 ? 6.290   44.065 13.220 1.00 13.37 ? 1954 VAL A CG1 1 
ATOM   2178 C CG2 . VAL A 1 294 ? 3.889   43.884 12.591 1.00 7.62  ? 1954 VAL A CG2 1 
ATOM   2179 N N   . TYR A 1 295 ? 7.077   40.660 12.990 1.00 13.15 ? 1955 TYR A N   1 
ATOM   2180 C CA  . TYR A 1 295 ? 8.390   40.138 13.362 1.00 11.58 ? 1955 TYR A CA  1 
ATOM   2181 C C   . TYR A 1 295 ? 9.156   39.474 12.220 1.00 12.14 ? 1955 TYR A C   1 
ATOM   2182 O O   . TYR A 1 295 ? 10.394  39.602 12.139 1.00 11.85 ? 1955 TYR A O   1 
ATOM   2183 C CB  . TYR A 1 295 ? 8.189   39.152 14.496 1.00 10.12 ? 1955 TYR A CB  1 
ATOM   2184 C CG  . TYR A 1 295 ? 9.419   38.463 15.032 1.00 11.02 ? 1955 TYR A CG  1 
ATOM   2185 C CD1 . TYR A 1 295 ? 10.285  39.100 15.932 1.00 9.82  ? 1955 TYR A CD1 1 
ATOM   2186 C CD2 . TYR A 1 295 ? 9.686   37.146 14.669 1.00 11.95 ? 1955 TYR A CD2 1 
ATOM   2187 C CE1 . TYR A 1 295 ? 11.407  38.438 16.449 1.00 7.49  ? 1955 TYR A CE1 1 
ATOM   2188 C CE2 . TYR A 1 295 ? 10.790  36.480 15.167 1.00 13.56 ? 1955 TYR A CE2 1 
ATOM   2189 C CZ  . TYR A 1 295 ? 11.650  37.119 16.055 1.00 14.09 ? 1955 TYR A CZ  1 
ATOM   2190 O OH  . TYR A 1 295 ? 12.732  36.387 16.517 1.00 8.83  ? 1955 TYR A OH  1 
ATOM   2191 N N   . LEU A 1 296 ? 8.426   38.772 11.351 1.00 11.20 ? 1956 LEU A N   1 
ATOM   2192 C CA  . LEU A 1 296 ? 9.026   38.241 10.119 1.00 12.15 ? 1956 LEU A CA  1 
ATOM   2193 C C   . LEU A 1 296 ? 9.719   39.305 9.274  1.00 11.55 ? 1956 LEU A C   1 
ATOM   2194 O O   . LEU A 1 296 ? 10.850  39.060 8.829  1.00 8.53  ? 1956 LEU A O   1 
ATOM   2195 C CB  . LEU A 1 296 ? 8.049   37.430 9.259  1.00 11.92 ? 1956 LEU A CB  1 
ATOM   2196 C CG  . LEU A 1 296 ? 7.441   36.208 9.966  1.00 14.86 ? 1956 LEU A CG  1 
ATOM   2197 C CD1 . LEU A 1 296 ? 6.201   35.650 9.214  1.00 12.45 ? 1956 LEU A CD1 1 
ATOM   2198 C CD2 . LEU A 1 296 ? 8.529   35.144 10.171 1.00 8.31  ? 1956 LEU A CD2 1 
ATOM   2199 N N   . HIS A 1 297 ? 9.038   40.441 9.070  1.00 11.37 ? 1957 HIS A N   1 
ATOM   2200 C CA  . HIS A 1 297 ? 9.635   41.669 8.503  1.00 13.63 ? 1957 HIS A CA  1 
ATOM   2201 C C   . HIS A 1 297 ? 10.808  42.229 9.325  1.00 15.58 ? 1957 HIS A C   1 
ATOM   2202 O O   . HIS A 1 297 ? 11.802  42.649 8.731  1.00 14.28 ? 1957 HIS A O   1 
ATOM   2203 C CB  . HIS A 1 297 ? 8.600   42.782 8.264  1.00 12.32 ? 1957 HIS A CB  1 
ATOM   2204 C CG  . HIS A 1 297 ? 7.519   42.417 7.291  1.00 15.45 ? 1957 HIS A CG  1 
ATOM   2205 N ND1 . HIS A 1 297 ? 6.510   41.526 7.591  1.00 14.49 ? 1957 HIS A ND1 1 
ATOM   2206 C CD2 . HIS A 1 297 ? 7.293   42.816 6.017  1.00 16.29 ? 1957 HIS A CD2 1 
ATOM   2207 C CE1 . HIS A 1 297 ? 5.707   41.395 6.553  1.00 7.89  ? 1957 HIS A CE1 1 
ATOM   2208 N NE2 . HIS A 1 297 ? 6.166   42.161 5.580  1.00 15.97 ? 1957 HIS A NE2 1 
ATOM   2209 N N   . GLN A 1 298 ? 10.706  42.251 10.657 1.00 14.28 ? 1958 GLN A N   1 
ATOM   2210 C CA  . GLN A 1 298 ? 11.808  42.736 11.478 1.00 15.68 ? 1958 GLN A CA  1 
ATOM   2211 C C   . GLN A 1 298 ? 13.056  41.880 11.279 1.00 15.59 ? 1958 GLN A C   1 
ATOM   2212 O O   . GLN A 1 298 ? 14.164  42.399 11.182 1.00 16.46 ? 1958 GLN A O   1 
ATOM   2213 C CB  . GLN A 1 298 ? 11.430  42.825 12.954 1.00 12.79 ? 1958 GLN A CB  1 
ATOM   2214 C CG  . GLN A 1 298 ? 10.283  43.774 13.197 1.00 20.16 ? 1958 GLN A CG  1 
ATOM   2215 C CD  . GLN A 1 298 ? 9.833   43.895 14.655 1.00 22.65 ? 1958 GLN A CD  1 
ATOM   2216 O OE1 . GLN A 1 298 ? 9.632   45.010 15.167 1.00 32.96 ? 1958 GLN A OE1 1 
ATOM   2217 N NE2 . GLN A 1 298 ? 9.640   42.760 15.317 1.00 20.69 ? 1958 GLN A NE2 1 
ATOM   2218 N N   . CYS A 1 299 ? 12.873  40.565 11.232 1.00 14.96 ? 1959 CYS A N   1 
ATOM   2219 C CA  . CYS A 1 299 ? 13.935  39.634 10.880 1.00 14.61 ? 1959 CYS A CA  1 
ATOM   2220 C C   . CYS A 1 299 ? 14.580  39.895 9.528  1.00 16.54 ? 1959 CYS A C   1 
ATOM   2221 O O   . CYS A 1 299 ? 15.810  39.908 9.433  1.00 17.66 ? 1959 CYS A O   1 
ATOM   2222 C CB  . CYS A 1 299 ? 13.406  38.193 10.880 1.00 13.63 ? 1959 CYS A CB  1 
ATOM   2223 S SG  . CYS A 1 299 ? 13.046  37.498 12.505 1.00 11.39 ? 1959 CYS A SG  1 
ATOM   2224 N N   . VAL A 1 300 ? 13.775  40.048 8.474  1.00 16.77 ? 1960 VAL A N   1 
ATOM   2225 C CA  . VAL A 1 300 ? 14.333  40.213 7.130  1.00 14.46 ? 1960 VAL A CA  1 
ATOM   2226 C C   . VAL A 1 300 ? 15.106  41.537 7.109  1.00 16.22 ? 1960 VAL A C   1 
ATOM   2227 O O   . VAL A 1 300 ? 16.243  41.580 6.642  1.00 17.61 ? 1960 VAL A O   1 
ATOM   2228 C CB  . VAL A 1 300 ? 13.223  40.150 6.041  1.00 14.48 ? 1960 VAL A CB  1 
ATOM   2229 C CG1 . VAL A 1 300 ? 13.673  40.761 4.730  1.00 12.84 ? 1960 VAL A CG1 1 
ATOM   2230 C CG2 . VAL A 1 300 ? 12.717  38.722 5.809  1.00 10.45 ? 1960 VAL A CG2 1 
ATOM   2231 N N   . ARG A 1 301 ? 14.495  42.596 7.642  1.00 15.50 ? 1961 ARG A N   1 
ATOM   2232 C CA  . ARG A 1 301 ? 15.100  43.925 7.795  1.00 16.10 ? 1961 ARG A CA  1 
ATOM   2233 C C   . ARG A 1 301 ? 16.484  43.914 8.418  1.00 17.52 ? 1961 ARG A C   1 
ATOM   2234 O O   . ARG A 1 301 ? 17.357  44.641 7.963  1.00 16.55 ? 1961 ARG A O   1 
ATOM   2235 C CB  . ARG A 1 301 ? 14.225  44.860 8.635  1.00 14.25 ? 1961 ARG A CB  1 
ATOM   2236 C CG  . ARG A 1 301 ? 14.826  46.251 8.840  1.00 16.25 ? 1961 ARG A CG  1 
ATOM   2237 C CD  . ARG A 1 301 ? 14.128  46.993 9.953  1.00 13.48 ? 1961 ARG A CD  1 
ATOM   2238 N NE  . ARG A 1 301 ? 14.391  46.332 11.238 1.00 20.62 ? 1961 ARG A NE  1 
ATOM   2239 C CZ  . ARG A 1 301 ? 13.835  46.661 12.406 1.00 17.09 ? 1961 ARG A CZ  1 
ATOM   2240 N NH1 . ARG A 1 301 ? 12.962  47.661 12.511 1.00 9.35  ? 1961 ARG A NH1 1 
ATOM   2241 N NH2 . ARG A 1 301 ? 14.178  45.987 13.496 1.00 19.56 ? 1961 ARG A NH2 1 
ATOM   2242 N N   . ASP A 1 302 ? 16.664  43.116 9.470  1.00 20.71 ? 1962 ASP A N   1 
ATOM   2243 C CA  . ASP A 1 302 ? 17.872  43.165 10.287 1.00 21.47 ? 1962 ASP A CA  1 
ATOM   2244 C C   . ASP A 1 302 ? 18.966  42.386 9.567  1.00 21.00 ? 1962 ASP A C   1 
ATOM   2245 O O   . ASP A 1 302 ? 20.136  42.745 9.644  1.00 22.55 ? 1962 ASP A O   1 
ATOM   2246 C CB  . ASP A 1 302 ? 17.632  42.544 11.668 1.00 22.41 ? 1962 ASP A CB  1 
ATOM   2247 C CG  . ASP A 1 302 ? 16.846  43.445 12.602 1.00 23.10 ? 1962 ASP A CG  1 
ATOM   2248 O OD1 . ASP A 1 302 ? 16.451  44.562 12.194 1.00 24.42 ? 1962 ASP A OD1 1 
ATOM   2249 O OD2 . ASP A 1 302 ? 16.624  43.015 13.757 1.00 19.67 ? 1962 ASP A OD2 1 
ATOM   2250 N N   . VAL A 1 303 ? 18.575  41.316 8.884  1.00 20.87 ? 1963 VAL A N   1 
ATOM   2251 C CA  . VAL A 1 303 ? 19.500  40.479 8.117  1.00 19.23 ? 1963 VAL A CA  1 
ATOM   2252 C C   . VAL A 1 303 ? 20.135  41.335 7.026  1.00 18.17 ? 1963 VAL A C   1 
ATOM   2253 O O   . VAL A 1 303 ? 21.340  41.335 6.864  1.00 19.49 ? 1963 VAL A O   1 
ATOM   2254 C CB  . VAL A 1 303 ? 18.790  39.245 7.483  1.00 18.08 ? 1963 VAL A CB  1 
ATOM   2255 C CG1 . VAL A 1 303 ? 19.640  38.574 6.416  1.00 17.69 ? 1963 VAL A CG1 1 
ATOM   2256 C CG2 . VAL A 1 303 ? 18.435  38.215 8.520  1.00 12.75 ? 1963 VAL A CG2 1 
ATOM   2257 N N   . LEU A 1 304 ? 19.304  42.065 6.291  1.00 19.33 ? 1964 LEU A N   1 
ATOM   2258 C CA  . LEU A 1 304 ? 19.696  42.984 5.237  1.00 18.00 ? 1964 LEU A CA  1 
ATOM   2259 C C   . LEU A 1 304 ? 20.462  44.200 5.747  1.00 20.23 ? 1964 LEU A C   1 
ATOM   2260 O O   . LEU A 1 304 ? 21.453  44.597 5.141  1.00 20.49 ? 1964 LEU A O   1 
ATOM   2261 C CB  . LEU A 1 304 ? 18.451  43.426 4.465  1.00 18.05 ? 1964 LEU A CB  1 
ATOM   2262 C CG  . LEU A 1 304 ? 17.715  42.276 3.761  1.00 14.64 ? 1964 LEU A CG  1 
ATOM   2263 C CD1 . LEU A 1 304 ? 16.511  42.863 3.058  1.00 7.30  ? 1964 LEU A CD1 1 
ATOM   2264 C CD2 . LEU A 1 304 ? 18.684  41.634 2.770  1.00 15.57 ? 1964 LEU A CD2 1 
ATOM   2265 N N   . ARG A 1 305 ? 20.012  44.797 6.848  1.00 21.50 ? 1965 ARG A N   1 
ATOM   2266 C CA  . ARG A 1 305 ? 20.830  45.766 7.566  1.00 22.19 ? 1965 ARG A CA  1 
ATOM   2267 C C   . ARG A 1 305 ? 22.226  45.210 7.865  1.00 24.42 ? 1965 ARG A C   1 
ATOM   2268 O O   . ARG A 1 305 ? 23.220  45.918 7.693  1.00 23.94 ? 1965 ARG A O   1 
ATOM   2269 C CB  . ARG A 1 305 ? 20.160  46.223 8.865  1.00 22.03 ? 1965 ARG A CB  1 
ATOM   2270 C CG  . ARG A 1 305 ? 19.149  47.356 8.709  1.00 16.09 ? 1965 ARG A CG  1 
ATOM   2271 C CD  . ARG A 1 305 ? 18.495  47.653 10.054 1.00 17.69 ? 1965 ARG A CD  1 
ATOM   2272 N NE  . ARG A 1 305 ? 17.373  48.581 9.920  1.00 24.63 ? 1965 ARG A NE  1 
ATOM   2273 C CZ  . ARG A 1 305 ? 16.810  49.248 10.924 1.00 22.59 ? 1965 ARG A CZ  1 
ATOM   2274 N NH1 . ARG A 1 305 ? 17.259  49.110 12.163 1.00 25.54 ? 1965 ARG A NH1 1 
ATOM   2275 N NH2 . ARG A 1 305 ? 15.804  50.075 10.688 1.00 17.59 ? 1965 ARG A NH2 1 
ATOM   2276 N N   . ALA A 1 306 ? 22.311  43.959 8.312  1.00 25.91 ? 1966 ALA A N   1 
ATOM   2277 C CA  . ALA A 1 306 ? 23.597  43.382 8.690  1.00 27.28 ? 1966 ALA A CA  1 
ATOM   2278 C C   . ALA A 1 306 ? 24.465  43.210 7.454  1.00 29.76 ? 1966 ALA A C   1 
ATOM   2279 O O   . ALA A 1 306 ? 25.673  43.428 7.510  1.00 31.48 ? 1966 ALA A O   1 
ATOM   2280 C CB  . ALA A 1 306 ? 23.428  42.055 9.420  1.00 27.68 ? 1966 ALA A CB  1 
ATOM   2281 N N   . ARG A 1 307 ? 23.854  42.849 6.331  1.00 30.95 ? 1967 ARG A N   1 
ATOM   2282 C CA  . ARG A 1 307 ? 24.590  42.668 5.090  1.00 33.88 ? 1967 ARG A CA  1 
ATOM   2283 C C   . ARG A 1 307 ? 25.200  43.960 4.533  1.00 36.73 ? 1967 ARG A C   1 
ATOM   2284 O O   . ARG A 1 307 ? 26.297  43.943 3.960  1.00 38.36 ? 1967 ARG A O   1 
ATOM   2285 C CB  . ARG A 1 307 ? 23.658  42.102 4.026  1.00 33.41 ? 1967 ARG A CB  1 
ATOM   2286 C CG  . ARG A 1 307 ? 23.472  40.616 4.079  1.00 34.91 ? 1967 ARG A CG  1 
ATOM   2287 C CD  . ARG A 1 307 ? 22.562  40.212 2.946  1.00 37.22 ? 1967 ARG A CD  1 
ATOM   2288 N NE  . ARG A 1 307 ? 22.077  38.858 3.186  1.00 43.49 ? 1967 ARG A NE  1 
ATOM   2289 C CZ  . ARG A 1 307 ? 21.410  38.129 2.296  1.00 42.89 ? 1967 ARG A CZ  1 
ATOM   2290 N NH1 . ARG A 1 307 ? 21.142  38.639 1.091  1.00 35.57 ? 1967 ARG A NH1 1 
ATOM   2291 N NH2 . ARG A 1 307 ? 21.033  36.897 2.637  1.00 37.33 ? 1967 ARG A NH2 1 
ATOM   2292 N N   . LYS A 1 308 ? 24.481  45.068 4.693  1.00 36.88 ? 1968 LYS A N   1 
ATOM   2293 C CA  . LYS A 1 308 ? 24.706  46.270 3.901  1.00 38.11 ? 1968 LYS A CA  1 
ATOM   2294 C C   . LYS A 1 308 ? 25.932  47.135 4.254  1.00 37.98 ? 1968 LYS A C   1 
ATOM   2295 O O   . LYS A 1 308 ? 26.531  47.064 5.336  1.00 37.85 ? 1968 LYS A O   1 
ATOM   2296 C CB  . LYS A 1 308 ? 23.408  47.081 3.836  1.00 37.40 ? 1968 LYS A CB  1 
ATOM   2297 C CG  . LYS A 1 308 ? 23.620  48.574 3.704  1.00 41.14 ? 1968 LYS A CG  1 
ATOM   2298 C CD  . LYS A 1 308 ? 22.319  49.292 3.404  1.00 46.96 ? 1968 LYS A CD  1 
ATOM   2299 C CE  . LYS A 1 308 ? 22.465  50.046 2.087  1.00 51.72 ? 1968 LYS A CE  1 
ATOM   2300 N NZ  . LYS A 1 308 ? 21.467  51.145 1.935  1.00 54.14 ? 1968 LYS A NZ  1 
HETATM 2301 O O16 . 4UN B 2 .   ? -0.025  27.830 17.937 1.00 12.17 ? 401  4UN A O16 1 
HETATM 2302 S S13 . 4UN B 2 .   ? 0.514   28.503 19.128 1.00 6.71  ? 401  4UN A S13 1 
HETATM 2303 O O14 . 4UN B 2 .   ? 0.822   27.544 20.196 1.00 8.39  ? 401  4UN A O14 1 
HETATM 2304 O O15 . 4UN B 2 .   ? 1.762   29.247 18.877 1.00 5.27  ? 401  4UN A O15 1 
HETATM 2305 N N8  . 4UN B 2 .   ? -0.592  29.525 19.691 1.00 6.82  ? 401  4UN A N8  1 
HETATM 2306 C C4  . 4UN B 2 .   ? -1.872  29.125 19.927 1.00 5.49  ? 401  4UN A C4  1 
HETATM 2307 C C5  . 4UN B 2 .   ? -2.262  28.548 21.137 1.00 8.10  ? 401  4UN A C5  1 
HETATM 2308 C C2  . 4UN B 2 .   ? -3.576  28.173 21.390 1.00 7.71  ? 401  4UN A C2  1 
HETATM 2309 C C6  . 4UN B 2 .   ? -4.553  28.362 20.412 1.00 7.38  ? 401  4UN A C6  1 
HETATM 2310 C C3  . 4UN B 2 .   ? -4.163  28.923 19.206 1.00 2.07  ? 401  4UN A C3  1 
HETATM 2311 C C1  . 4UN B 2 .   ? -2.849  29.311 18.959 1.00 2.00  ? 401  4UN A C1  1 
HETATM 2312 C C49 . 4UN B 2 .   ? -6.011  27.973 20.635 1.00 7.04  ? 401  4UN A C49 1 
HETATM 2313 C C10 . 4UN B 2 .   ? -6.867  29.130 21.183 1.00 11.71 ? 401  4UN A C10 1 
HETATM 2314 C C17 . 4UN B 2 .   ? -8.326  28.724 21.228 1.00 10.42 ? 401  4UN A C17 1 
HETATM 2315 N N22 . 4UN B 2 .   ? -9.269  29.463 20.637 1.00 10.06 ? 401  4UN A N22 1 
HETATM 2316 O O29 . 4UN B 2 .   ? -10.520 28.810 20.844 1.00 16.29 ? 401  4UN A O29 1 
HETATM 2317 C C27 . 4UN B 2 .   ? -10.210 27.640 21.613 1.00 12.84 ? 401  4UN A C27 1 
HETATM 2318 C C28 . 4UN B 2 .   ? -11.186 26.581 22.112 1.00 15.80 ? 401  4UN A C28 1 
HETATM 2319 N N23 . 4UN B 2 .   ? -8.786  27.620 21.831 1.00 8.82  ? 401  4UN A N23 1 
HETATM 2320 C C18 . 4UN B 2 .   ? -6.665  30.184 20.106 1.00 11.19 ? 401  4UN A C18 1 
HETATM 2321 N N20 . 4UN B 2 .   ? -5.859  31.237 20.243 1.00 11.36 ? 401  4UN A N20 1 
HETATM 2322 O O25 . 4UN B 2 .   ? -5.842  31.963 19.090 1.00 10.28 ? 401  4UN A O25 1 
HETATM 2323 C C26 . 4UN B 2 .   ? -6.728  31.312 18.209 1.00 7.32  ? 401  4UN A C26 1 
HETATM 2324 C C24 . 4UN B 2 .   ? -7.044  31.799 16.812 1.00 8.46  ? 401  4UN A C24 1 
HETATM 2325 N N21 . 4UN B 2 .   ? -7.233  30.145 18.900 1.00 7.49  ? 401  4UN A N21 1 
HETATM 2326 C C19 . 4UN B 2 .   ? -6.416  29.546 22.600 1.00 10.68 ? 401  4UN A C19 1 
HETATM 2327 C C36 . 4UN B 2 .   ? -7.212  30.701 23.187 1.00 11.24 ? 401  4UN A C36 1 
HETATM 2328 C C40 . 4UN B 2 .   ? -6.655  31.980 23.192 1.00 8.16  ? 401  4UN A C40 1 
HETATM 2329 C C43 . 4UN B 2 .   ? -7.364  33.062 23.721 1.00 9.05  ? 401  4UN A C43 1 
HETATM 2330 C C39 . 4UN B 2 .   ? -8.642  32.910 24.255 1.00 4.71  ? 401  4UN A C39 1 
HETATM 2331 C C42 . 4UN B 2 .   ? -9.193  31.619 24.251 1.00 11.08 ? 401  4UN A C42 1 
HETATM 2332 C C41 . 4UN B 2 .   ? -8.493  30.527 23.732 1.00 6.33  ? 401  4UN A C41 1 
HETATM 2333 O O   . HOH C 3 .   ? 13.934  21.113 4.231  1.00 8.58  ? 1    HOH A O   1 
HETATM 2334 O O   . HOH C 3 .   ? 0.754   16.098 18.158 1.00 2.00  ? 2    HOH A O   1 
HETATM 2335 O O   . HOH C 3 .   ? 11.889  25.329 3.381  1.00 5.41  ? 3    HOH A O   1 
HETATM 2336 O O   . HOH C 3 .   ? -0.467  10.789 5.521  1.00 5.89  ? 4    HOH A O   1 
HETATM 2337 O O   . HOH C 3 .   ? -0.571  5.893  25.588 1.00 12.93 ? 5    HOH A O   1 
HETATM 2338 O O   . HOH C 3 .   ? 12.621  19.240 5.777  1.00 11.60 ? 6    HOH A O   1 
HETATM 2339 O O   . HOH C 3 .   ? -1.329  15.282 19.080 1.00 5.06  ? 7    HOH A O   1 
HETATM 2340 O O   . HOH C 3 .   ? 16.249  29.060 6.854  1.00 6.86  ? 8    HOH A O   1 
HETATM 2341 O O   . HOH C 3 .   ? -9.884  19.718 3.342  1.00 6.68  ? 9    HOH A O   1 
HETATM 2342 O O   . HOH C 3 .   ? 7.062   11.162 27.880 1.00 11.49 ? 10   HOH A O   1 
HETATM 2343 O O   . HOH C 3 .   ? -6.805  30.996 9.610  1.00 11.32 ? 11   HOH A O   1 
HETATM 2344 O O   . HOH C 3 .   ? -9.763  16.879 9.360  1.00 2.00  ? 12   HOH A O   1 
HETATM 2345 O O   . HOH C 3 .   ? -5.104  13.331 26.936 1.00 10.15 ? 13   HOH A O   1 
HETATM 2346 O O   . HOH C 3 .   ? -1.273  7.942  21.886 1.00 9.49  ? 14   HOH A O   1 
HETATM 2347 O O   . HOH C 3 .   ? 0.758   32.165 18.652 1.00 8.46  ? 15   HOH A O   1 
HETATM 2348 O O   . HOH C 3 .   ? -6.363  23.698 9.066  1.00 8.05  ? 16   HOH A O   1 
HETATM 2349 O O   . HOH C 3 .   ? -0.523  8.438  24.234 1.00 6.24  ? 17   HOH A O   1 
HETATM 2350 O O   . HOH C 3 .   ? -4.904  13.333 10.605 1.00 2.97  ? 18   HOH A O   1 
HETATM 2351 O O   . HOH C 3 .   ? -14.754 15.854 4.045  1.00 15.67 ? 19   HOH A O   1 
HETATM 2352 O O   . HOH C 3 .   ? 18.859  40.752 17.249 1.00 18.33 ? 20   HOH A O   1 
HETATM 2353 O O   . HOH C 3 .   ? 1.048   53.473 17.702 1.00 6.77  ? 21   HOH A O   1 
HETATM 2354 O O   . HOH C 3 .   ? 9.371   28.374 23.484 1.00 12.04 ? 22   HOH A O   1 
HETATM 2355 O O   . HOH C 3 .   ? 0.382   9.060  28.519 1.00 10.27 ? 23   HOH A O   1 
HETATM 2356 O O   . HOH C 3 .   ? -6.284  8.277  15.963 1.00 10.85 ? 24   HOH A O   1 
HETATM 2357 O O   . HOH C 3 .   ? 4.488   3.159  28.153 1.00 13.84 ? 25   HOH A O   1 
HETATM 2358 O O   . HOH C 3 .   ? -8.635  13.062 4.846  1.00 7.86  ? 26   HOH A O   1 
HETATM 2359 O O   . HOH C 3 .   ? -0.430  41.363 17.279 1.00 7.77  ? 27   HOH A O   1 
HETATM 2360 O O   . HOH C 3 .   ? 13.159  35.512 23.707 1.00 19.84 ? 28   HOH A O   1 
HETATM 2361 O O   . HOH C 3 .   ? -4.587  36.823 8.965  1.00 22.12 ? 29   HOH A O   1 
HETATM 2362 O O   . HOH C 3 .   ? -3.923  14.161 17.695 1.00 11.67 ? 30   HOH A O   1 
HETATM 2363 O O   . HOH C 3 .   ? -3.992  11.498 17.410 1.00 4.40  ? 31   HOH A O   1 
HETATM 2364 O O   . HOH C 3 .   ? -6.071  13.819 2.473  1.00 11.98 ? 32   HOH A O   1 
HETATM 2365 O O   . HOH C 3 .   ? -6.406  31.822 6.925  1.00 9.45  ? 33   HOH A O   1 
HETATM 2366 O O   . HOH C 3 .   ? -3.353  14.092 3.401  1.00 9.76  ? 34   HOH A O   1 
HETATM 2367 O O   . HOH C 3 .   ? 12.826  14.914 9.515  1.00 6.64  ? 35   HOH A O   1 
HETATM 2368 O O   . HOH C 3 .   ? 2.664   3.355  25.417 1.00 8.01  ? 36   HOH A O   1 
HETATM 2369 O O   . HOH C 3 .   ? -3.313  27.724 25.957 1.00 11.56 ? 37   HOH A O   1 
HETATM 2370 O O   . HOH C 3 .   ? 1.884   8.465  9.588  1.00 14.14 ? 38   HOH A O   1 
HETATM 2371 O O   . HOH C 3 .   ? 15.478  19.343 23.101 1.00 9.71  ? 40   HOH A O   1 
HETATM 2372 O O   . HOH C 3 .   ? 15.779  8.060  27.776 1.00 16.81 ? 41   HOH A O   1 
HETATM 2373 O O   . HOH C 3 .   ? -6.305  28.548 6.575  1.00 15.91 ? 42   HOH A O   1 
HETATM 2374 O O   . HOH C 3 .   ? -17.812 19.381 4.893  1.00 30.94 ? 43   HOH A O   1 
HETATM 2375 O O   . HOH C 3 .   ? -12.004 18.370 18.504 1.00 13.90 ? 44   HOH A O   1 
HETATM 2376 O O   . HOH C 3 .   ? -4.873  7.485  24.178 1.00 14.22 ? 45   HOH A O   1 
HETATM 2377 O O   . HOH C 3 .   ? -10.826 23.203 23.080 1.00 11.09 ? 46   HOH A O   1 
HETATM 2378 O O   . HOH C 3 .   ? 1.187   52.067 7.230  1.00 21.03 ? 47   HOH A O   1 
HETATM 2379 O O   . HOH C 3 .   ? -13.553 16.184 17.134 1.00 14.24 ? 48   HOH A O   1 
HETATM 2380 O O   . HOH C 3 .   ? 7.463   24.150 30.533 1.00 16.22 ? 49   HOH A O   1 
HETATM 2381 O O   . HOH C 3 .   ? 0.581   45.570 14.053 1.00 22.87 ? 50   HOH A O   1 
HETATM 2382 O O   . HOH C 3 .   ? 14.642  16.919 8.156  1.00 15.86 ? 51   HOH A O   1 
HETATM 2383 O O   . HOH C 3 .   ? -4.109  20.705 7.344  1.00 15.38 ? 52   HOH A O   1 
HETATM 2384 O O   . HOH C 3 .   ? -15.596 20.919 7.995  1.00 15.64 ? 53   HOH A O   1 
HETATM 2385 O O   . HOH C 3 .   ? 13.966  16.874 5.593  1.00 14.17 ? 54   HOH A O   1 
HETATM 2386 O O   . HOH C 3 .   ? 5.568   6.459  27.231 1.00 18.74 ? 55   HOH A O   1 
HETATM 2387 O O   . HOH C 3 .   ? 3.343   53.055 16.575 1.00 26.98 ? 56   HOH A O   1 
HETATM 2388 O O   . HOH C 3 .   ? -5.149  9.001  20.639 1.00 13.92 ? 57   HOH A O   1 
HETATM 2389 O O   . HOH C 3 .   ? 21.057  29.478 22.847 1.00 21.58 ? 58   HOH A O   1 
HETATM 2390 O O   . HOH C 3 .   ? 3.657   0.420  24.994 1.00 10.33 ? 59   HOH A O   1 
HETATM 2391 O O   . HOH C 3 .   ? -5.499  36.033 15.898 1.00 14.22 ? 60   HOH A O   1 
HETATM 2392 O O   . HOH C 3 .   ? 3.795   4.893  19.139 1.00 11.35 ? 61   HOH A O   1 
HETATM 2393 O O   . HOH C 3 .   ? 6.284   40.927 22.650 1.00 20.88 ? 62   HOH A O   1 
HETATM 2394 O O   . HOH C 3 .   ? 8.536   21.440 28.243 1.00 15.64 ? 63   HOH A O   1 
HETATM 2395 O O   . HOH C 3 .   ? 7.634   2.658  29.499 1.00 17.29 ? 64   HOH A O   1 
HETATM 2396 O O   . HOH C 3 .   ? 0.994   20.832 -0.995 1.00 29.82 ? 65   HOH A O   1 
HETATM 2397 O O   . HOH C 3 .   ? 15.829  2.562  21.430 1.00 31.99 ? 66   HOH A O   1 
HETATM 2398 O O   . HOH C 3 .   ? -5.702  21.338 18.578 1.00 15.14 ? 68   HOH A O   1 
HETATM 2399 O O   . HOH C 3 .   ? 9.994   47.447 13.832 1.00 19.95 ? 70   HOH A O   1 
HETATM 2400 O O   . HOH C 3 .   ? 1.172   16.728 0.424  1.00 32.58 ? 71   HOH A O   1 
HETATM 2401 O O   . HOH C 3 .   ? 16.734  46.322 5.831  1.00 15.09 ? 72   HOH A O   1 
HETATM 2402 O O   . HOH C 3 .   ? 4.939   12.921 30.973 1.00 15.95 ? 73   HOH A O   1 
HETATM 2403 O O   . HOH C 3 .   ? 5.977   38.608 23.149 1.00 9.32  ? 74   HOH A O   1 
HETATM 2404 O O   . HOH C 3 .   ? -10.785 24.664 11.469 1.00 22.23 ? 75   HOH A O   1 
HETATM 2405 O O   . HOH C 3 .   ? 19.343  34.507 4.709  1.00 19.48 ? 76   HOH A O   1 
HETATM 2406 O O   . HOH C 3 .   ? -9.627  6.125  10.316 1.00 24.05 ? 77   HOH A O   1 
HETATM 2407 O O   . HOH C 3 .   ? 1.716   12.541 29.984 1.00 31.83 ? 78   HOH A O   1 
HETATM 2408 O O   . HOH C 3 .   ? 5.703   40.439 1.502  1.00 17.08 ? 79   HOH A O   1 
HETATM 2409 O O   . HOH C 3 .   ? -3.633  23.091 25.995 1.00 23.40 ? 80   HOH A O   1 
HETATM 2410 O O   . HOH C 3 .   ? 15.290  44.212 15.817 1.00 20.52 ? 81   HOH A O   1 
HETATM 2411 O O   . HOH C 3 .   ? -12.025 18.581 21.215 1.00 21.37 ? 82   HOH A O   1 
HETATM 2412 O O   . HOH C 3 .   ? -14.955 19.735 21.064 1.00 24.87 ? 83   HOH A O   1 
HETATM 2413 O O   . HOH C 3 .   ? -5.933  14.712 -0.266 1.00 12.45 ? 84   HOH A O   1 
HETATM 2414 O O   . HOH C 3 .   ? 4.976   42.312 3.233  1.00 19.99 ? 85   HOH A O   1 
HETATM 2415 O O   . HOH C 3 .   ? 5.966   49.040 14.308 1.00 22.93 ? 86   HOH A O   1 
HETATM 2416 O O   . HOH C 3 .   ? 0.510   -2.750 18.735 1.00 33.27 ? 87   HOH A O   1 
HETATM 2417 O O   . HOH C 3 .   ? 5.653   47.136 15.833 1.00 14.71 ? 88   HOH A O   1 
HETATM 2418 O O   . HOH C 3 .   ? -3.728  30.473 24.725 1.00 17.08 ? 89   HOH A O   1 
HETATM 2419 O O   . HOH C 3 .   ? -8.398  9.396  4.092  1.00 14.68 ? 90   HOH A O   1 
HETATM 2420 O O   . HOH C 3 .   ? 14.731  35.553 26.021 1.00 24.22 ? 91   HOH A O   1 
HETATM 2421 O O   . HOH C 3 .   ? 7.886   29.498 25.609 1.00 16.40 ? 92   HOH A O   1 
HETATM 2422 O O   . HOH C 3 .   ? 11.998  49.535 10.561 1.00 25.49 ? 93   HOH A O   1 
HETATM 2423 O O   . HOH C 3 .   ? 1.986   34.114 26.004 1.00 23.08 ? 94   HOH A O   1 
HETATM 2424 O O   . HOH C 3 .   ? -8.208  30.131 -0.002 1.00 20.07 ? 95   HOH A O   1 
HETATM 2425 O O   . HOH C 3 .   ? 12.862  49.130 7.973  1.00 22.43 ? 96   HOH A O   1 
HETATM 2426 O O   . HOH C 3 .   ? 7.547   21.883 -5.107 1.00 20.18 ? 97   HOH A O   1 
HETATM 2427 O O   . HOH C 3 .   ? -17.347 15.532 10.875 1.00 20.60 ? 98   HOH A O   1 
HETATM 2428 O O   . HOH C 3 .   ? -10.775 30.087 15.363 1.00 16.13 ? 100  HOH A O   1 
HETATM 2429 O O   . HOH C 3 .   ? -8.971  21.268 -0.282 1.00 27.70 ? 101  HOH A O   1 
HETATM 2430 O O   . HOH C 3 .   ? 15.741  19.916 2.766  1.00 17.10 ? 102  HOH A O   1 
HETATM 2431 O O   . HOH C 3 .   ? 19.058  39.909 13.731 1.00 25.29 ? 103  HOH A O   1 
HETATM 2432 O O   . HOH C 3 .   ? -10.476 10.129 5.439  1.00 15.18 ? 105  HOH A O   1 
HETATM 2433 O O   . HOH C 3 .   ? -1.801  15.588 1.580  1.00 16.77 ? 106  HOH A O   1 
HETATM 2434 O O   . HOH C 3 .   ? -0.846  5.211  17.797 1.00 23.16 ? 108  HOH A O   1 
HETATM 2435 O O   . HOH C 3 .   ? 3.346   40.496 20.428 1.00 12.74 ? 109  HOH A O   1 
HETATM 2436 O O   . HOH C 3 .   ? 12.870  7.530  31.404 1.00 29.65 ? 110  HOH A O   1 
HETATM 2437 O O   . HOH C 3 .   ? 15.491  14.530 2.318  1.00 21.19 ? 111  HOH A O   1 
HETATM 2438 O O   . HOH C 3 .   ? 0.594   9.722  1.935  1.00 17.17 ? 112  HOH A O   1 
HETATM 2439 O O   . HOH C 3 .   ? 6.874   25.346 -1.934 1.00 25.26 ? 113  HOH A O   1 
HETATM 2440 O O   . HOH C 3 .   ? -0.081  54.226 6.248  1.00 22.66 ? 114  HOH A O   1 
HETATM 2441 O O   . HOH C 3 .   ? 4.450   37.771 25.446 1.00 27.48 ? 115  HOH A O   1 
HETATM 2442 O O   . HOH C 3 .   ? -5.749  48.653 8.882  1.00 38.00 ? 116  HOH A O   1 
HETATM 2443 O O   . HOH C 3 .   ? 2.528   38.449 18.912 1.00 18.41 ? 117  HOH A O   1 
HETATM 2444 O O   . HOH C 3 .   ? 6.391   42.854 16.812 1.00 28.09 ? 118  HOH A O   1 
HETATM 2445 O O   . HOH C 3 .   ? -11.283 8.548  7.321  1.00 26.64 ? 120  HOH A O   1 
HETATM 2446 O O   . HOH C 3 .   ? 3.269   54.032 13.676 1.00 18.77 ? 121  HOH A O   1 
HETATM 2447 O O   . HOH C 3 .   ? -18.693 14.427 6.256  1.00 31.72 ? 122  HOH A O   1 
HETATM 2448 O O   . HOH C 3 .   ? -3.221  39.868 15.818 1.00 14.31 ? 123  HOH A O   1 
HETATM 2449 O O   . HOH C 3 .   ? -0.681  37.480 -6.184 1.00 27.83 ? 124  HOH A O   1 
HETATM 2450 O O   . HOH C 3 .   ? 22.394  16.949 22.411 1.00 18.55 ? 125  HOH A O   1 
HETATM 2451 O O   . HOH C 3 .   ? -0.136  7.934  5.887  1.00 20.83 ? 126  HOH A O   1 
HETATM 2452 O O   . HOH C 3 .   ? 6.540   23.106 -2.888 1.00 35.91 ? 127  HOH A O   1 
HETATM 2453 O O   . HOH C 3 .   ? -0.336  3.309  22.699 1.00 12.12 ? 128  HOH A O   1 
HETATM 2454 O O   . HOH C 3 .   ? 9.840   45.669 -4.465 1.00 25.58 ? 129  HOH A O   1 
HETATM 2455 O O   . HOH C 3 .   ? 20.044  37.184 21.057 1.00 23.48 ? 130  HOH A O   1 
HETATM 2456 O O   . HOH C 3 .   ? 5.839   37.358 27.750 1.00 22.09 ? 131  HOH A O   1 
HETATM 2457 O O   . HOH C 3 .   ? 7.443   33.291 -0.083 1.00 19.14 ? 132  HOH A O   1 
HETATM 2458 O O   . HOH C 3 .   ? -7.580  33.500 10.065 1.00 20.83 ? 133  HOH A O   1 
HETATM 2459 O O   . HOH C 3 .   ? -10.616 10.836 21.657 1.00 25.71 ? 134  HOH A O   1 
HETATM 2460 O O   . HOH C 3 .   ? 3.703   44.213 16.647 1.00 2.00  ? 139  HOH A O   1 
HETATM 2461 O O   . HOH C 3 .   ? 2.245   19.469 1.205  1.00 11.14 ? 140  HOH A O   1 
HETATM 2462 O O   . HOH C 3 .   ? 9.467   23.583 28.727 1.00 20.86 ? 141  HOH A O   1 
HETATM 2463 O O   . HOH C 3 .   ? 23.783  27.073 16.552 1.00 23.75 ? 142  HOH A O   1 
HETATM 2464 O O   . HOH C 3 .   ? -6.288  22.102 25.645 1.00 21.47 ? 143  HOH A O   1 
HETATM 2465 O O   . HOH C 3 .   ? 12.727  43.769 18.108 1.00 23.55 ? 144  HOH A O   1 
HETATM 2466 O O   . HOH C 3 .   ? 4.681   4.040  7.058  1.00 34.88 ? 145  HOH A O   1 
HETATM 2467 O O   . HOH C 3 .   ? -4.855  45.667 13.683 1.00 15.15 ? 146  HOH A O   1 
HETATM 2468 O O   . HOH C 3 .   ? 18.879  29.427 6.393  1.00 21.89 ? 147  HOH A O   1 
HETATM 2469 O O   . HOH C 3 .   ? -1.995  11.712 3.198  1.00 14.34 ? 148  HOH A O   1 
HETATM 2470 O O   . HOH C 3 .   ? -6.456  6.540  19.840 1.00 30.48 ? 149  HOH A O   1 
HETATM 2471 O O   . HOH C 3 .   ? 23.782  10.849 20.345 1.00 25.46 ? 151  HOH A O   1 
HETATM 2472 O O   . HOH C 3 .   ? 17.081  25.769 26.659 1.00 19.73 ? 152  HOH A O   1 
HETATM 2473 O O   . HOH C 3 .   ? 9.583   41.395 21.707 1.00 31.66 ? 153  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1661 ?    ?   ?   A . n 
A 1 2   ASP 2   1662 ?    ?   ?   A . n 
A 1 3   ARG 3   1663 ?    ?   ?   A . n 
A 1 4   PRO 4   1664 ?    ?   ?   A . n 
A 1 5   LEU 5   1665 ?    ?   ?   A . n 
A 1 6   SER 6   1666 ?    ?   ?   A . n 
A 1 7   VAL 7   1667 ?    ?   ?   A . n 
A 1 8   HIS 8   1668 ?    ?   ?   A . n 
A 1 9   LEU 9   1669 ?    ?   ?   A . n 
A 1 10  ASN 10  1670 ?    ?   ?   A . n 
A 1 11  LEU 11  1671 ?    ?   ?   A . n 
A 1 12  GLY 12  1672 ?    ?   ?   A . n 
A 1 13  GLN 13  1673 ?    ?   ?   A . n 
A 1 14  LYS 14  1674 ?    ?   ?   A . n 
A 1 15  GLY 15  1675 ?    ?   ?   A . n 
A 1 16  ASN 16  1676 ?    ?   ?   A . n 
A 1 17  ARG 17  1677 ?    ?   ?   A . n 
A 1 18  LYS 18  1678 1678 LYS LYS A . n 
A 1 19  THR 19  1679 1679 THR THR A . n 
A 1 20  SER 20  1680 1680 SER SER A . n 
A 1 21  CYS 21  1681 1681 CYS CYS A . n 
A 1 22  PRO 22  1682 1682 PRO PRO A . n 
A 1 23  ILE 23  1683 1683 ILE ILE A . n 
A 1 24  LYS 24  1684 1684 LYS LYS A . n 
A 1 25  ILE 25  1685 1685 ILE ILE A . n 
A 1 26  ASN 26  1686 1686 ASN ASN A . n 
A 1 27  GLN 27  1687 1687 GLN GLN A . n 
A 1 28  PHE 28  1688 1688 PHE PHE A . n 
A 1 29  GLU 29  1689 1689 GLU GLU A . n 
A 1 30  GLY 30  1690 1690 GLY GLY A . n 
A 1 31  HIS 31  1691 1691 HIS HIS A . n 
A 1 32  PHE 32  1692 1692 PHE PHE A . n 
A 1 33  MET 33  1693 1693 MET MET A . n 
A 1 34  LYS 34  1694 1694 LYS LYS A . n 
A 1 35  LEU 35  1695 1695 LEU LEU A . n 
A 1 36  GLN 36  1696 1696 GLN GLN A . n 
A 1 37  ALA 37  1697 1697 ALA ALA A . n 
A 1 38  ASP 38  1698 1698 ASP ASP A . n 
A 1 39  SER 39  1699 1699 SER SER A . n 
A 1 40  ASN 40  1700 1700 ASN ASN A . n 
A 1 41  TYR 41  1701 1701 TYR TYR A . n 
A 1 42  LEU 42  1702 1702 LEU LEU A . n 
A 1 43  LEU 43  1703 1703 LEU LEU A . n 
A 1 44  SER 44  1704 1704 SER SER A . n 
A 1 45  LYS 45  1705 1705 LYS LYS A . n 
A 1 46  GLU 46  1706 1706 GLU GLU A . n 
A 1 47  TYR 47  1707 1707 TYR TYR A . n 
A 1 48  GLU 48  1708 1708 GLU GLU A . n 
A 1 49  GLU 49  1709 1709 GLU GLU A . n 
A 1 50  LEU 50  1710 1710 LEU LEU A . n 
A 1 51  LYS 51  1711 1711 LYS LYS A . n 
A 1 52  ASP 52  1712 1712 ASP ASP A . n 
A 1 53  VAL 53  1713 1713 VAL VAL A . n 
A 1 54  GLY 54  1714 1714 GLY GLY A . n 
A 1 55  ARG 55  1715 1715 ARG ARG A . n 
A 1 56  ASN 56  1716 1716 ASN ASN A . n 
A 1 57  GLN 57  1717 1717 GLN GLN A . n 
A 1 58  SER 58  1718 1718 SER SER A . n 
A 1 59  CYS 59  1719 1719 CYS CYS A . n 
A 1 60  ASP 60  1720 1720 ASP ASP A . n 
A 1 61  ILE 61  1721 1721 ILE ILE A . n 
A 1 62  ALA 62  1722 1722 ALA ALA A . n 
A 1 63  LEU 63  1723 1723 LEU LEU A . n 
A 1 64  LEU 64  1724 1724 LEU LEU A . n 
A 1 65  PRO 65  1725 1725 PRO PRO A . n 
A 1 66  GLU 66  1726 1726 GLU GLU A . n 
A 1 67  ASN 67  1727 1727 ASN ASN A . n 
A 1 68  ARG 68  1728 1728 ARG ARG A . n 
A 1 69  GLY 69  1729 1729 GLY GLY A . n 
A 1 70  LYS 70  1730 1730 LYS LYS A . n 
A 1 71  ASN 71  1731 1731 ASN ASN A . n 
A 1 72  ARG 72  1732 1732 ARG ARG A . n 
A 1 73  TYR 73  1733 1733 TYR TYR A . n 
A 1 74  ASN 74  1734 1734 ASN ASN A . n 
A 1 75  ASN 75  1735 1735 ASN ASN A . n 
A 1 76  ILE 76  1736 1736 ILE ILE A . n 
A 1 77  LEU 77  1737 1737 LEU LEU A . n 
A 1 78  PRO 78  1738 1738 PRO PRO A . n 
A 1 79  TYR 79  1739 1739 TYR TYR A . n 
A 1 80  ASP 80  1740 1740 ASP ASP A . n 
A 1 81  ALA 81  1741 1741 ALA ALA A . n 
A 1 82  THR 82  1742 1742 THR THR A . n 
A 1 83  ARG 83  1743 1743 ARG ARG A . n 
A 1 84  VAL 84  1744 1744 VAL VAL A . n 
A 1 85  LYS 85  1745 1745 LYS LYS A . n 
A 1 86  LEU 86  1746 1746 LEU LEU A . n 
A 1 87  SER 87  1747 1747 SER SER A . n 
A 1 88  ASN 88  1748 1748 ASN ASN A . n 
A 1 89  VAL 89  1749 ?    ?   ?   A . n 
A 1 90  ASP 90  1750 ?    ?   ?   A . n 
A 1 91  ASP 91  1751 ?    ?   ?   A . n 
A 1 92  ASP 92  1752 ?    ?   ?   A . n 
A 1 93  PRO 93  1753 ?    ?   ?   A . n 
A 1 94  CYS 94  1754 ?    ?   ?   A . n 
A 1 95  SER 95  1755 1755 SER SER A . n 
A 1 96  ASP 96  1756 1756 ASP ASP A . n 
A 1 97  TYR 97  1757 1757 TYR TYR A . n 
A 1 98  ILE 98  1758 1758 ILE ILE A . n 
A 1 99  ASN 99  1759 1759 ASN ASN A . n 
A 1 100 ALA 100 1760 1760 ALA ALA A . n 
A 1 101 SER 101 1761 1761 SER SER A . n 
A 1 102 TYR 102 1762 1762 TYR TYR A . n 
A 1 103 ILE 103 1763 1763 ILE ILE A . n 
A 1 104 PRO 104 1764 1764 PRO PRO A . n 
A 1 105 GLY 105 1765 1765 GLY GLY A . n 
A 1 106 ASN 106 1766 1766 ASN ASN A . n 
A 1 107 ASN 107 1767 1767 ASN ASN A . n 
A 1 108 PHE 108 1768 1768 PHE PHE A . n 
A 1 109 ARG 109 1769 1769 ARG ARG A . n 
A 1 110 ARG 110 1770 1770 ARG ARG A . n 
A 1 111 GLU 111 1771 1771 GLU GLU A . n 
A 1 112 TYR 112 1772 1772 TYR TYR A . n 
A 1 113 ILE 113 1773 1773 ILE ILE A . n 
A 1 114 VAL 114 1774 1774 VAL VAL A . n 
A 1 115 THR 115 1775 1775 THR THR A . n 
A 1 116 GLN 116 1776 1776 GLN GLN A . n 
A 1 117 GLY 117 1777 1777 GLY GLY A . n 
A 1 118 PRO 118 1778 1778 PRO PRO A . n 
A 1 119 LEU 119 1779 1779 LEU LEU A . n 
A 1 120 PRO 120 1780 1780 PRO PRO A . n 
A 1 121 GLY 121 1781 1781 GLY GLY A . n 
A 1 122 THR 122 1782 1782 THR THR A . n 
A 1 123 LYS 123 1783 1783 LYS LYS A . n 
A 1 124 ASP 124 1784 1784 ASP ASP A . n 
A 1 125 ASP 125 1785 1785 ASP ASP A . n 
A 1 126 PHE 126 1786 1786 PHE PHE A . n 
A 1 127 TRP 127 1787 1787 TRP TRP A . n 
A 1 128 LYS 128 1788 1788 LYS LYS A . n 
A 1 129 MET 129 1789 1789 MET MET A . n 
A 1 130 VAL 130 1790 1790 VAL VAL A . n 
A 1 131 TRP 131 1791 1791 TRP TRP A . n 
A 1 132 GLU 132 1792 1792 GLU GLU A . n 
A 1 133 GLN 133 1793 1793 GLN GLN A . n 
A 1 134 ASN 134 1794 1794 ASN ASN A . n 
A 1 135 VAL 135 1795 1795 VAL VAL A . n 
A 1 136 HIS 136 1796 1796 HIS HIS A . n 
A 1 137 ASN 137 1797 1797 ASN ASN A . n 
A 1 138 ILE 138 1798 1798 ILE ILE A . n 
A 1 139 VAL 139 1799 1799 VAL VAL A . n 
A 1 140 MET 140 1800 1800 MET MET A . n 
A 1 141 VAL 141 1801 1801 VAL VAL A . n 
A 1 142 THR 142 1802 1802 THR THR A . n 
A 1 143 GLN 143 1803 1803 GLN GLN A . n 
A 1 144 CYS 144 1804 1804 CYS CYS A . n 
A 1 145 VAL 145 1805 1805 VAL VAL A . n 
A 1 146 GLU 146 1806 1806 GLU GLU A . n 
A 1 147 LYS 147 1807 1807 LYS LYS A . n 
A 1 148 GLY 148 1808 1808 GLY GLY A . n 
A 1 149 ARG 149 1809 1809 ARG ARG A . n 
A 1 150 VAL 150 1810 1810 VAL VAL A . n 
A 1 151 LYS 151 1811 1811 LYS LYS A . n 
A 1 152 CYS 152 1812 1812 CYS CYS A . n 
A 1 153 ASP 153 1813 1813 ASP ASP A . n 
A 1 154 HIS 154 1814 1814 HIS HIS A . n 
A 1 155 TYR 155 1815 1815 TYR TYR A . n 
A 1 156 TRP 156 1816 1816 TRP TRP A . n 
A 1 157 PRO 157 1817 1817 PRO PRO A . n 
A 1 158 ALA 158 1818 1818 ALA ALA A . n 
A 1 159 ASP 159 1819 1819 ASP ASP A . n 
A 1 160 GLN 160 1820 1820 GLN GLN A . n 
A 1 161 ASP 161 1821 1821 ASP ASP A . n 
A 1 162 SER 162 1822 1822 SER SER A . n 
A 1 163 LEU 163 1823 1823 LEU LEU A . n 
A 1 164 TYR 164 1824 1824 TYR TYR A . n 
A 1 165 TYR 165 1825 1825 TYR TYR A . n 
A 1 166 GLY 166 1826 1826 GLY GLY A . n 
A 1 167 ASP 167 1827 1827 ASP ASP A . n 
A 1 168 LEU 168 1828 1828 LEU LEU A . n 
A 1 169 ILE 169 1829 1829 ILE ILE A . n 
A 1 170 LEU 170 1830 1830 LEU LEU A . n 
A 1 171 GLN 171 1831 1831 GLN GLN A . n 
A 1 172 MET 172 1832 1832 MET MET A . n 
A 1 173 LEU 173 1833 1833 LEU LEU A . n 
A 1 174 SER 174 1834 1834 SER SER A . n 
A 1 175 GLU 175 1835 1835 GLU GLU A . n 
A 1 176 SER 176 1836 1836 SER SER A . n 
A 1 177 VAL 177 1837 1837 VAL VAL A . n 
A 1 178 LEU 178 1838 1838 LEU LEU A . n 
A 1 179 PRO 179 1839 1839 PRO PRO A . n 
A 1 180 GLU 180 1840 1840 GLU GLU A . n 
A 1 181 TRP 181 1841 1841 TRP TRP A . n 
A 1 182 THR 182 1842 1842 THR THR A . n 
A 1 183 ILE 183 1843 1843 ILE ILE A . n 
A 1 184 ARG 184 1844 1844 ARG ARG A . n 
A 1 185 GLU 185 1845 1845 GLU GLU A . n 
A 1 186 PHE 186 1846 1846 PHE PHE A . n 
A 1 187 LYS 187 1847 1847 LYS LYS A . n 
A 1 188 ILE 188 1848 1848 ILE ILE A . n 
A 1 189 CYS 189 1849 1849 CYS CYS A . n 
A 1 190 GLY 190 1850 1850 GLY GLY A . n 
A 1 191 GLU 191 1851 1851 GLU GLU A . n 
A 1 192 GLU 192 1852 ?    ?   ?   A . n 
A 1 193 GLN 193 1853 ?    ?   ?   A . n 
A 1 194 LEU 194 1854 ?    ?   ?   A . n 
A 1 195 ASP 195 1855 ?    ?   ?   A . n 
A 1 196 ALA 196 1856 ?    ?   ?   A . n 
A 1 197 HIS 197 1857 1857 HIS HIS A . n 
A 1 198 ARG 198 1858 1858 ARG ARG A . n 
A 1 199 LEU 199 1859 1859 LEU LEU A . n 
A 1 200 ILE 200 1860 1860 ILE ILE A . n 
A 1 201 ARG 201 1861 1861 ARG ARG A . n 
A 1 202 HIS 202 1862 1862 HIS HIS A . n 
A 1 203 PHE 203 1863 1863 PHE PHE A . n 
A 1 204 HIS 204 1864 1864 HIS HIS A . n 
A 1 205 TYR 205 1865 1865 TYR TYR A . n 
A 1 206 THR 206 1866 1866 THR THR A . n 
A 1 207 VAL 207 1867 1867 VAL VAL A . n 
A 1 208 TRP 208 1868 1868 TRP TRP A . n 
A 1 209 PRO 209 1869 1869 PRO PRO A . n 
A 1 210 ASP 210 1870 1870 ASP ASP A . n 
A 1 211 HIS 211 1871 1871 HIS HIS A . n 
A 1 212 GLY 212 1872 1872 GLY GLY A . n 
A 1 213 VAL 213 1873 1873 VAL VAL A . n 
A 1 214 PRO 214 1874 1874 PRO PRO A . n 
A 1 215 GLU 215 1875 1875 GLU GLU A . n 
A 1 216 THR 216 1876 1876 THR THR A . n 
A 1 217 THR 217 1877 1877 THR THR A . n 
A 1 218 GLN 218 1878 1878 GLN GLN A . n 
A 1 219 SER 219 1879 1879 SER SER A . n 
A 1 220 LEU 220 1880 1880 LEU LEU A . n 
A 1 221 ILE 221 1881 1881 ILE ILE A . n 
A 1 222 GLN 222 1882 1882 GLN GLN A . n 
A 1 223 PHE 223 1883 1883 PHE PHE A . n 
A 1 224 VAL 224 1884 1884 VAL VAL A . n 
A 1 225 ARG 225 1885 1885 ARG ARG A . n 
A 1 226 THR 226 1886 1886 THR THR A . n 
A 1 227 VAL 227 1887 1887 VAL VAL A . n 
A 1 228 ARG 228 1888 1888 ARG ARG A . n 
A 1 229 ASP 229 1889 1889 ASP ASP A . n 
A 1 230 TYR 230 1890 1890 TYR TYR A . n 
A 1 231 ILE 231 1891 1891 ILE ILE A . n 
A 1 232 ASN 232 1892 1892 ASN ASN A . n 
A 1 233 ARG 233 1893 1893 ARG ARG A . n 
A 1 234 SER 234 1894 1894 SER SER A . n 
A 1 235 PRO 235 1895 1895 PRO PRO A . n 
A 1 236 GLY 236 1896 1896 GLY GLY A . n 
A 1 237 ALA 237 1897 1897 ALA ALA A . n 
A 1 238 GLY 238 1898 1898 GLY GLY A . n 
A 1 239 PRO 239 1899 1899 PRO PRO A . n 
A 1 240 THR 240 1900 1900 THR THR A . n 
A 1 241 VAL 241 1901 1901 VAL VAL A . n 
A 1 242 VAL 242 1902 1902 VAL VAL A . n 
A 1 243 HIS 243 1903 1903 HIS HIS A . n 
A 1 244 CYS 244 1904 1904 CYS CYS A . n 
A 1 245 SER 245 1905 1905 SER SER A . n 
A 1 246 ALA 246 1906 1906 ALA ALA A . n 
A 1 247 GLY 247 1907 1907 GLY GLY A . n 
A 1 248 VAL 248 1908 1908 VAL VAL A . n 
A 1 249 GLY 249 1909 1909 GLY GLY A . n 
A 1 250 ARG 250 1910 1910 ARG ARG A . n 
A 1 251 THR 251 1911 1911 THR THR A . n 
A 1 252 GLY 252 1912 1912 GLY GLY A . n 
A 1 253 THR 253 1913 1913 THR THR A . n 
A 1 254 PHE 254 1914 1914 PHE PHE A . n 
A 1 255 ILE 255 1915 1915 ILE ILE A . n 
A 1 256 ALA 256 1916 1916 ALA ALA A . n 
A 1 257 LEU 257 1917 1917 LEU LEU A . n 
A 1 258 ASP 258 1918 1918 ASP ASP A . n 
A 1 259 ARG 259 1919 1919 ARG ARG A . n 
A 1 260 ILE 260 1920 1920 ILE ILE A . n 
A 1 261 LEU 261 1921 1921 LEU LEU A . n 
A 1 262 GLN 262 1922 1922 GLN GLN A . n 
A 1 263 GLN 263 1923 1923 GLN GLN A . n 
A 1 264 LEU 264 1924 1924 LEU LEU A . n 
A 1 265 ASP 265 1925 1925 ASP ASP A . n 
A 1 266 SER 266 1926 1926 SER SER A . n 
A 1 267 LYS 267 1927 1927 LYS LYS A . n 
A 1 268 ASP 268 1928 1928 ASP ASP A . n 
A 1 269 SER 269 1929 1929 SER SER A . n 
A 1 270 VAL 270 1930 1930 VAL VAL A . n 
A 1 271 ASP 271 1931 1931 ASP ASP A . n 
A 1 272 ILE 272 1932 1932 ILE ILE A . n 
A 1 273 TYR 273 1933 1933 TYR TYR A . n 
A 1 274 GLY 274 1934 1934 GLY GLY A . n 
A 1 275 ALA 275 1935 1935 ALA ALA A . n 
A 1 276 VAL 276 1936 1936 VAL VAL A . n 
A 1 277 HIS 277 1937 1937 HIS HIS A . n 
A 1 278 ASP 278 1938 1938 ASP ASP A . n 
A 1 279 LEU 279 1939 1939 LEU LEU A . n 
A 1 280 ARG 280 1940 1940 ARG ARG A . n 
A 1 281 LEU 281 1941 1941 LEU LEU A . n 
A 1 282 HIS 282 1942 1942 HIS HIS A . n 
A 1 283 ARG 283 1943 1943 ARG ARG A . n 
A 1 284 VAL 284 1944 1944 VAL VAL A . n 
A 1 285 HIS 285 1945 1945 HIS HIS A . n 
A 1 286 MET 286 1946 1946 MET MET A . n 
A 1 287 VAL 287 1947 1947 VAL VAL A . n 
A 1 288 GLN 288 1948 1948 GLN GLN A . n 
A 1 289 THR 289 1949 1949 THR THR A . n 
A 1 290 GLU 290 1950 1950 GLU GLU A . n 
A 1 291 CYS 291 1951 1951 CYS CYS A . n 
A 1 292 GLN 292 1952 1952 GLN GLN A . n 
A 1 293 TYR 293 1953 1953 TYR TYR A . n 
A 1 294 VAL 294 1954 1954 VAL VAL A . n 
A 1 295 TYR 295 1955 1955 TYR TYR A . n 
A 1 296 LEU 296 1956 1956 LEU LEU A . n 
A 1 297 HIS 297 1957 1957 HIS HIS A . n 
A 1 298 GLN 298 1958 1958 GLN GLN A . n 
A 1 299 CYS 299 1959 1959 CYS CYS A . n 
A 1 300 VAL 300 1960 1960 VAL VAL A . n 
A 1 301 ARG 301 1961 1961 ARG ARG A . n 
A 1 302 ASP 302 1962 1962 ASP ASP A . n 
A 1 303 VAL 303 1963 1963 VAL VAL A . n 
A 1 304 LEU 304 1964 1964 LEU LEU A . n 
A 1 305 ARG 305 1965 1965 ARG ARG A . n 
A 1 306 ALA 306 1966 1966 ALA ALA A . n 
A 1 307 ARG 307 1967 1967 ARG ARG A . n 
A 1 308 LYS 308 1968 1968 LYS LYS A . n 
A 1 309 LEU 309 1969 ?    ?   ?   A . n 
A 1 310 ARG 310 1970 ?    ?   ?   A . n 
A 1 311 SER 311 1971 ?    ?   ?   A . n 
A 1 312 GLU 312 1972 ?    ?   ?   A . n 
A 1 313 GLN 313 1973 ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 4UN 1   401 401 4UN 4UN A . 
C 3 HOH 1   1   1   HOH HOH A . 
C 3 HOH 2   2   2   HOH HOH A . 
C 3 HOH 3   3   3   HOH HOH A . 
C 3 HOH 4   4   4   HOH HOH A . 
C 3 HOH 5   5   5   HOH HOH A . 
C 3 HOH 6   6   6   HOH HOH A . 
C 3 HOH 7   7   7   HOH HOH A . 
C 3 HOH 8   8   8   HOH HOH A . 
C 3 HOH 9   9   9   HOH HOH A . 
C 3 HOH 10  10  10  HOH HOH A . 
C 3 HOH 11  11  11  HOH HOH A . 
C 3 HOH 12  12  12  HOH HOH A . 
C 3 HOH 13  13  13  HOH HOH A . 
C 3 HOH 14  14  14  HOH HOH A . 
C 3 HOH 15  15  15  HOH HOH A . 
C 3 HOH 16  16  16  HOH HOH A . 
C 3 HOH 17  17  17  HOH HOH A . 
C 3 HOH 18  18  18  HOH HOH A . 
C 3 HOH 19  19  19  HOH HOH A . 
C 3 HOH 20  20  20  HOH HOH A . 
C 3 HOH 21  21  21  HOH HOH A . 
C 3 HOH 22  22  22  HOH HOH A . 
C 3 HOH 23  23  23  HOH HOH A . 
C 3 HOH 24  24  24  HOH HOH A . 
C 3 HOH 25  25  25  HOH HOH A . 
C 3 HOH 26  26  26  HOH HOH A . 
C 3 HOH 27  27  27  HOH HOH A . 
C 3 HOH 28  28  28  HOH HOH A . 
C 3 HOH 29  29  29  HOH HOH A . 
C 3 HOH 30  30  30  HOH HOH A . 
C 3 HOH 31  31  31  HOH HOH A . 
C 3 HOH 32  32  32  HOH HOH A . 
C 3 HOH 33  33  33  HOH HOH A . 
C 3 HOH 34  34  34  HOH HOH A . 
C 3 HOH 35  35  35  HOH HOH A . 
C 3 HOH 36  36  36  HOH HOH A . 
C 3 HOH 37  37  37  HOH HOH A . 
C 3 HOH 38  38  38  HOH HOH A . 
C 3 HOH 39  40  40  HOH HOH A . 
C 3 HOH 40  41  41  HOH HOH A . 
C 3 HOH 41  42  42  HOH HOH A . 
C 3 HOH 42  43  43  HOH HOH A . 
C 3 HOH 43  44  44  HOH HOH A . 
C 3 HOH 44  45  45  HOH HOH A . 
C 3 HOH 45  46  46  HOH HOH A . 
C 3 HOH 46  47  47  HOH HOH A . 
C 3 HOH 47  48  48  HOH HOH A . 
C 3 HOH 48  49  49  HOH HOH A . 
C 3 HOH 49  50  50  HOH HOH A . 
C 3 HOH 50  51  51  HOH HOH A . 
C 3 HOH 51  52  52  HOH HOH A . 
C 3 HOH 52  53  53  HOH HOH A . 
C 3 HOH 53  54  54  HOH HOH A . 
C 3 HOH 54  55  55  HOH HOH A . 
C 3 HOH 55  56  56  HOH HOH A . 
C 3 HOH 56  57  57  HOH HOH A . 
C 3 HOH 57  58  58  HOH HOH A . 
C 3 HOH 58  59  59  HOH HOH A . 
C 3 HOH 59  60  60  HOH HOH A . 
C 3 HOH 60  61  61  HOH HOH A . 
C 3 HOH 61  62  62  HOH HOH A . 
C 3 HOH 62  63  63  HOH HOH A . 
C 3 HOH 63  64  64  HOH HOH A . 
C 3 HOH 64  65  65  HOH HOH A . 
C 3 HOH 65  66  66  HOH HOH A . 
C 3 HOH 66  68  68  HOH HOH A . 
C 3 HOH 67  70  70  HOH HOH A . 
C 3 HOH 68  71  71  HOH HOH A . 
C 3 HOH 69  72  72  HOH HOH A . 
C 3 HOH 70  73  73  HOH HOH A . 
C 3 HOH 71  74  74  HOH HOH A . 
C 3 HOH 72  75  75  HOH HOH A . 
C 3 HOH 73  76  76  HOH HOH A . 
C 3 HOH 74  77  77  HOH HOH A . 
C 3 HOH 75  78  78  HOH HOH A . 
C 3 HOH 76  79  79  HOH HOH A . 
C 3 HOH 77  80  80  HOH HOH A . 
C 3 HOH 78  81  81  HOH HOH A . 
C 3 HOH 79  82  82  HOH HOH A . 
C 3 HOH 80  83  83  HOH HOH A . 
C 3 HOH 81  84  84  HOH HOH A . 
C 3 HOH 82  85  85  HOH HOH A . 
C 3 HOH 83  86  86  HOH HOH A . 
C 3 HOH 84  87  87  HOH HOH A . 
C 3 HOH 85  88  88  HOH HOH A . 
C 3 HOH 86  89  89  HOH HOH A . 
C 3 HOH 87  90  90  HOH HOH A . 
C 3 HOH 88  91  91  HOH HOH A . 
C 3 HOH 89  92  92  HOH HOH A . 
C 3 HOH 90  93  93  HOH HOH A . 
C 3 HOH 91  94  94  HOH HOH A . 
C 3 HOH 92  95  95  HOH HOH A . 
C 3 HOH 93  96  96  HOH HOH A . 
C 3 HOH 94  97  97  HOH HOH A . 
C 3 HOH 95  98  98  HOH HOH A . 
C 3 HOH 96  100 100 HOH HOH A . 
C 3 HOH 97  101 101 HOH HOH A . 
C 3 HOH 98  102 102 HOH HOH A . 
C 3 HOH 99  103 103 HOH HOH A . 
C 3 HOH 100 105 105 HOH HOH A . 
C 3 HOH 101 106 106 HOH HOH A . 
C 3 HOH 102 108 108 HOH HOH A . 
C 3 HOH 103 109 109 HOH HOH A . 
C 3 HOH 104 110 110 HOH HOH A . 
C 3 HOH 105 111 111 HOH HOH A . 
C 3 HOH 106 112 112 HOH HOH A . 
C 3 HOH 107 113 113 HOH HOH A . 
C 3 HOH 108 114 114 HOH HOH A . 
C 3 HOH 109 115 115 HOH HOH A . 
C 3 HOH 110 116 116 HOH HOH A . 
C 3 HOH 111 117 117 HOH HOH A . 
C 3 HOH 112 118 118 HOH HOH A . 
C 3 HOH 113 120 120 HOH HOH A . 
C 3 HOH 114 121 121 HOH HOH A . 
C 3 HOH 115 122 122 HOH HOH A . 
C 3 HOH 116 123 123 HOH HOH A . 
C 3 HOH 117 124 124 HOH HOH A . 
C 3 HOH 118 125 125 HOH HOH A . 
C 3 HOH 119 126 126 HOH HOH A . 
C 3 HOH 120 127 127 HOH HOH A . 
C 3 HOH 121 128 128 HOH HOH A . 
C 3 HOH 122 129 129 HOH HOH A . 
C 3 HOH 123 130 130 HOH HOH A . 
C 3 HOH 124 131 131 HOH HOH A . 
C 3 HOH 125 132 132 HOH HOH A . 
C 3 HOH 126 133 133 HOH HOH A . 
C 3 HOH 127 134 134 HOH HOH A . 
C 3 HOH 128 139 139 HOH HOH A . 
C 3 HOH 129 140 140 HOH HOH A . 
C 3 HOH 130 141 141 HOH HOH A . 
C 3 HOH 131 142 142 HOH HOH A . 
C 3 HOH 132 143 143 HOH HOH A . 
C 3 HOH 133 144 144 HOH HOH A . 
C 3 HOH 134 145 145 HOH HOH A . 
C 3 HOH 135 146 146 HOH HOH A . 
C 3 HOH 136 147 147 HOH HOH A . 
C 3 HOH 137 148 148 HOH HOH A . 
C 3 HOH 138 149 149 HOH HOH A . 
C 3 HOH 139 151 151 HOH HOH A . 
C 3 HOH 140 152 152 HOH HOH A . 
C 3 HOH 141 153 153 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-13 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      .     ?                program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran_77 ? 1 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++        ? 2 
MAR345      .     ?                ?       ?                 ?                        'data collection' ? ?          ? 3 
HKL-2000    .     ?                ?       ?                 ?                        'data scaling'    ? ?          ? 4 
AMoRE       .     ?                ?       ?                 ?                        phasing           ? ?          ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SG A CYS 1951 ? ? O A HOH 139 ? ? 2.09 
2 1 SG A CYS 1804 ? ? O A HOH 63  ? ? 2.13 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 NH2 A ARG 1769 ? ? 1_555 O A HOH 43 ? ? 4_555 1.68 
2 1 NE  A ARG 1769 ? ? 1_555 O A HOH 43 ? ? 4_555 2.18 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1719 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            A 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1719 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            A 
_pdbx_validate_rmsd_bond.bond_value                1.939 
_pdbx_validate_rmsd_bond.bond_target_value         1.818 
_pdbx_validate_rmsd_bond.bond_deviation            0.121 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.017 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A CYS 1719 ? A CB A CYS 1719 ? A SG  A CYS 1719 ? A 132.55 114.20 18.35 1.10 N 
2 1 NE A ARG 1732 ? ? CZ A ARG 1732 ? ? NH1 A ARG 1732 ? ? 123.74 120.30 3.44  0.50 N 
3 1 NE A ARG 1732 ? ? CZ A ARG 1732 ? ? NH2 A ARG 1732 ? ? 117.00 120.30 -3.30 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 1726 ? ? -24.45  -49.58  
2  1 ARG A 1770 ? ? -119.05 64.19   
3  1 ASP A 1819 ? ? -165.82 -166.89 
4  1 HIS A 1871 ? ? 56.03   14.10   
5  1 SER A 1894 ? ? -118.37 76.83   
6  1 CYS A 1904 ? ? -133.14 -125.86 
7  1 VAL A 1908 ? ? -131.82 -52.55  
8  1 ASP A 1928 ? ? -46.81  -10.60  
9  1 SER A 1929 ? ? -172.59 144.71  
10 1 VAL A 1947 ? ? 65.94   91.01   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 1661 ? A SER 1   
2  1 Y 1 A ASP 1662 ? A ASP 2   
3  1 Y 1 A ARG 1663 ? A ARG 3   
4  1 Y 1 A PRO 1664 ? A PRO 4   
5  1 Y 1 A LEU 1665 ? A LEU 5   
6  1 Y 1 A SER 1666 ? A SER 6   
7  1 Y 1 A VAL 1667 ? A VAL 7   
8  1 Y 1 A HIS 1668 ? A HIS 8   
9  1 Y 1 A LEU 1669 ? A LEU 9   
10 1 Y 1 A ASN 1670 ? A ASN 10  
11 1 Y 1 A LEU 1671 ? A LEU 11  
12 1 Y 1 A GLY 1672 ? A GLY 12  
13 1 Y 1 A GLN 1673 ? A GLN 13  
14 1 Y 1 A LYS 1674 ? A LYS 14  
15 1 Y 1 A GLY 1675 ? A GLY 15  
16 1 Y 1 A ASN 1676 ? A ASN 16  
17 1 Y 1 A ARG 1677 ? A ARG 17  
18 1 Y 1 A VAL 1749 ? A VAL 89  
19 1 Y 1 A ASP 1750 ? A ASP 90  
20 1 Y 1 A ASP 1751 ? A ASP 91  
21 1 Y 1 A ASP 1752 ? A ASP 92  
22 1 Y 1 A PRO 1753 ? A PRO 93  
23 1 Y 1 A CYS 1754 ? A CYS 94  
24 1 Y 1 A GLU 1852 ? A GLU 192 
25 1 Y 1 A GLN 1853 ? A GLN 193 
26 1 Y 1 A LEU 1854 ? A LEU 194 
27 1 Y 1 A ASP 1855 ? A ASP 195 
28 1 Y 1 A ALA 1856 ? A ALA 196 
29 1 Y 1 A LEU 1969 ? A LEU 309 
30 1 Y 1 A ARG 1970 ? A ARG 310 
31 1 Y 1 A SER 1971 ? A SER 311 
32 1 Y 1 A GLU 1972 ? A GLU 312 
33 1 Y 1 A GLN 1973 ? A GLN 313 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '{4-[2,2-BIS(5-METHYL-1,2,4-OXADIAZOL-3-YL)-3-PHENYLPROPYL]PHENYL}SULFAMIC ACID' 4UN 
3 water                                                                            HOH 
#