data_2H3W
# 
_entry.id   2H3W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2H3W         pdb_00002h3w 10.2210/pdb2h3w/pdb 
RCSB  RCSB037897   ?            ?                   
WWPDB D_1000037897 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1NDF . unspecified 
PDB 1NDI . unspecified 
PDB 1NDB . unspecified 
PDB 1T7Q . unspecified 
PDB 1T7N . unspecified 
PDB 1T7O . unspecified 
PDB 2H3P . unspecified 
PDB 2H3U . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2H3W 
_pdbx_database_status.recvd_initial_deposition_date   2006-05-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hsiao, Y.S.' 1 
'Jogl, G.'    2 
'Tong, L.'    3 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures of murine carnitine acetyltransferase in ternary complexes with its substrates' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                28480 
_citation.page_last                 28487 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16870616 
_citation.pdbx_database_id_DOI      10.1074/jbc.M602622200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hsiao, Y.-S.' 1 ? 
primary 'Jogl, G.'     2 ? 
primary 'Tong, L.'     3 ? 
# 
_cell.entry_id           2H3W 
_cell.length_a           164.060 
_cell.length_b           89.070 
_cell.length_c           122.780 
_cell.angle_alpha        90.00 
_cell.angle_beta         128.97 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2H3W 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'carnitine acetyltransferase'                                   67947.742 2    ? S554A:M564G 'Residues 30-625' ? 
2 non-polymer syn 'COENZYME A'                                                    767.534   2    ? ?           ?                 ? 
3 non-polymer syn '(R)-3-CARBOXY-2-(HEXANOYLOXY)-N,N,N-TRIMETHYLPROPAN-1-AMINIUM' 260.350   2    ? ?           ?                 ? 
4 water       nat water                                                           18.015    1500 ? ?           ?                 ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SHMAHQDALPRLPVPPLQQSLDYYLKALQPIVSEEEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTA
YLQFRQPVVIYSSPGVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLGGQPLCMNQYYQILSSCRVPGPK
QDSVVNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWNSSLQSNKEPVGILTSNHRNTWAKAYNNL
IKDKVNRESVNSIQKSIFTVCLDKQVPRVSDDVYRNHVAGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAA
EGPPIVALVDHVMEYTKKPELVRSPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQDLDIMMLTFHHFGKDFPKSEK
LSPDAFIQVALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASIDSLAFVKGMGDSTVPEQQKVELLRKAVQAHRAY
TDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTAQVPAKTDCVGFFGPVVPDGYGICYNPMEAHIN
FSVSAYNSCAETNAARMAHYLEKALLDMRTLLQNHPRAK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SHMAHQDALPRLPVPPLQQSLDYYLKALQPIVSEEEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTA
YLQFRQPVVIYSSPGVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLGGQPLCMNQYYQILSSCRVPGPK
QDSVVNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWNSSLQSNKEPVGILTSNHRNTWAKAYNNL
IKDKVNRESVNSIQKSIFTVCLDKQVPRVSDDVYRNHVAGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAA
EGPPIVALVDHVMEYTKKPELVRSPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQDLDIMMLTFHHFGKDFPKSEK
LSPDAFIQVALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASIDSLAFVKGMGDSTVPEQQKVELLRKAVQAHRAY
TDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTAQVPAKTDCVGFFGPVVPDGYGICYNPMEAHIN
FSVSAYNSCAETNAARMAHYLEKALLDMRTLLQNHPRAK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   HIS n 
1 3   MET n 
1 4   ALA n 
1 5   HIS n 
1 6   GLN n 
1 7   ASP n 
1 8   ALA n 
1 9   LEU n 
1 10  PRO n 
1 11  ARG n 
1 12  LEU n 
1 13  PRO n 
1 14  VAL n 
1 15  PRO n 
1 16  PRO n 
1 17  LEU n 
1 18  GLN n 
1 19  GLN n 
1 20  SER n 
1 21  LEU n 
1 22  ASP n 
1 23  TYR n 
1 24  TYR n 
1 25  LEU n 
1 26  LYS n 
1 27  ALA n 
1 28  LEU n 
1 29  GLN n 
1 30  PRO n 
1 31  ILE n 
1 32  VAL n 
1 33  SER n 
1 34  GLU n 
1 35  GLU n 
1 36  GLU n 
1 37  TRP n 
1 38  ALA n 
1 39  HIS n 
1 40  THR n 
1 41  LYS n 
1 42  GLN n 
1 43  LEU n 
1 44  VAL n 
1 45  ASP n 
1 46  GLU n 
1 47  PHE n 
1 48  GLN n 
1 49  THR n 
1 50  SER n 
1 51  GLY n 
1 52  GLY n 
1 53  VAL n 
1 54  GLY n 
1 55  GLU n 
1 56  ARG n 
1 57  LEU n 
1 58  GLN n 
1 59  LYS n 
1 60  GLY n 
1 61  LEU n 
1 62  GLU n 
1 63  ARG n 
1 64  ARG n 
1 65  ALA n 
1 66  LYS n 
1 67  LYS n 
1 68  MET n 
1 69  GLU n 
1 70  ASN n 
1 71  TRP n 
1 72  LEU n 
1 73  SER n 
1 74  GLU n 
1 75  TRP n 
1 76  TRP n 
1 77  LEU n 
1 78  LYS n 
1 79  THR n 
1 80  ALA n 
1 81  TYR n 
1 82  LEU n 
1 83  GLN n 
1 84  PHE n 
1 85  ARG n 
1 86  GLN n 
1 87  PRO n 
1 88  VAL n 
1 89  VAL n 
1 90  ILE n 
1 91  TYR n 
1 92  SER n 
1 93  SER n 
1 94  PRO n 
1 95  GLY n 
1 96  VAL n 
1 97  ILE n 
1 98  LEU n 
1 99  PRO n 
1 100 LYS n 
1 101 GLN n 
1 102 ASP n 
1 103 PHE n 
1 104 VAL n 
1 105 ASP n 
1 106 LEU n 
1 107 GLN n 
1 108 GLY n 
1 109 GLN n 
1 110 LEU n 
1 111 ARG n 
1 112 PHE n 
1 113 ALA n 
1 114 ALA n 
1 115 LYS n 
1 116 LEU n 
1 117 ILE n 
1 118 GLU n 
1 119 GLY n 
1 120 VAL n 
1 121 LEU n 
1 122 ASP n 
1 123 PHE n 
1 124 LYS n 
1 125 SER n 
1 126 MET n 
1 127 ILE n 
1 128 ASP n 
1 129 ASN n 
1 130 GLU n 
1 131 THR n 
1 132 LEU n 
1 133 PRO n 
1 134 VAL n 
1 135 GLU n 
1 136 PHE n 
1 137 LEU n 
1 138 GLY n 
1 139 GLY n 
1 140 GLN n 
1 141 PRO n 
1 142 LEU n 
1 143 CYS n 
1 144 MET n 
1 145 ASN n 
1 146 GLN n 
1 147 TYR n 
1 148 TYR n 
1 149 GLN n 
1 150 ILE n 
1 151 LEU n 
1 152 SER n 
1 153 SER n 
1 154 CYS n 
1 155 ARG n 
1 156 VAL n 
1 157 PRO n 
1 158 GLY n 
1 159 PRO n 
1 160 LYS n 
1 161 GLN n 
1 162 ASP n 
1 163 SER n 
1 164 VAL n 
1 165 VAL n 
1 166 ASN n 
1 167 PHE n 
1 168 LEU n 
1 169 LYS n 
1 170 SER n 
1 171 LYS n 
1 172 ARG n 
1 173 PRO n 
1 174 PRO n 
1 175 THR n 
1 176 HIS n 
1 177 ILE n 
1 178 THR n 
1 179 VAL n 
1 180 VAL n 
1 181 HIS n 
1 182 ASN n 
1 183 TYR n 
1 184 GLN n 
1 185 PHE n 
1 186 PHE n 
1 187 GLU n 
1 188 LEU n 
1 189 ASP n 
1 190 VAL n 
1 191 TYR n 
1 192 HIS n 
1 193 SER n 
1 194 ASP n 
1 195 GLY n 
1 196 THR n 
1 197 PRO n 
1 198 LEU n 
1 199 THR n 
1 200 SER n 
1 201 ASP n 
1 202 GLN n 
1 203 ILE n 
1 204 PHE n 
1 205 VAL n 
1 206 GLN n 
1 207 LEU n 
1 208 GLU n 
1 209 LYS n 
1 210 ILE n 
1 211 TRP n 
1 212 ASN n 
1 213 SER n 
1 214 SER n 
1 215 LEU n 
1 216 GLN n 
1 217 SER n 
1 218 ASN n 
1 219 LYS n 
1 220 GLU n 
1 221 PRO n 
1 222 VAL n 
1 223 GLY n 
1 224 ILE n 
1 225 LEU n 
1 226 THR n 
1 227 SER n 
1 228 ASN n 
1 229 HIS n 
1 230 ARG n 
1 231 ASN n 
1 232 THR n 
1 233 TRP n 
1 234 ALA n 
1 235 LYS n 
1 236 ALA n 
1 237 TYR n 
1 238 ASN n 
1 239 ASN n 
1 240 LEU n 
1 241 ILE n 
1 242 LYS n 
1 243 ASP n 
1 244 LYS n 
1 245 VAL n 
1 246 ASN n 
1 247 ARG n 
1 248 GLU n 
1 249 SER n 
1 250 VAL n 
1 251 ASN n 
1 252 SER n 
1 253 ILE n 
1 254 GLN n 
1 255 LYS n 
1 256 SER n 
1 257 ILE n 
1 258 PHE n 
1 259 THR n 
1 260 VAL n 
1 261 CYS n 
1 262 LEU n 
1 263 ASP n 
1 264 LYS n 
1 265 GLN n 
1 266 VAL n 
1 267 PRO n 
1 268 ARG n 
1 269 VAL n 
1 270 SER n 
1 271 ASP n 
1 272 ASP n 
1 273 VAL n 
1 274 TYR n 
1 275 ARG n 
1 276 ASN n 
1 277 HIS n 
1 278 VAL n 
1 279 ALA n 
1 280 GLY n 
1 281 GLN n 
1 282 MET n 
1 283 LEU n 
1 284 HIS n 
1 285 GLY n 
1 286 GLY n 
1 287 GLY n 
1 288 SER n 
1 289 LYS n 
1 290 PHE n 
1 291 ASN n 
1 292 SER n 
1 293 GLY n 
1 294 ASN n 
1 295 ARG n 
1 296 TRP n 
1 297 PHE n 
1 298 ASP n 
1 299 LYS n 
1 300 THR n 
1 301 LEU n 
1 302 GLN n 
1 303 PHE n 
1 304 ILE n 
1 305 VAL n 
1 306 ALA n 
1 307 GLU n 
1 308 ASP n 
1 309 GLY n 
1 310 SER n 
1 311 CYS n 
1 312 GLY n 
1 313 MET n 
1 314 VAL n 
1 315 TYR n 
1 316 GLU n 
1 317 HIS n 
1 318 ALA n 
1 319 ALA n 
1 320 ALA n 
1 321 GLU n 
1 322 GLY n 
1 323 PRO n 
1 324 PRO n 
1 325 ILE n 
1 326 VAL n 
1 327 ALA n 
1 328 LEU n 
1 329 VAL n 
1 330 ASP n 
1 331 HIS n 
1 332 VAL n 
1 333 MET n 
1 334 GLU n 
1 335 TYR n 
1 336 THR n 
1 337 LYS n 
1 338 LYS n 
1 339 PRO n 
1 340 GLU n 
1 341 LEU n 
1 342 VAL n 
1 343 ARG n 
1 344 SER n 
1 345 PRO n 
1 346 MET n 
1 347 VAL n 
1 348 PRO n 
1 349 LEU n 
1 350 PRO n 
1 351 MET n 
1 352 PRO n 
1 353 LYS n 
1 354 LYS n 
1 355 LEU n 
1 356 ARG n 
1 357 PHE n 
1 358 ASN n 
1 359 ILE n 
1 360 THR n 
1 361 PRO n 
1 362 GLU n 
1 363 ILE n 
1 364 LYS n 
1 365 ASN n 
1 366 ASP n 
1 367 ILE n 
1 368 GLU n 
1 369 LYS n 
1 370 ALA n 
1 371 LYS n 
1 372 GLN n 
1 373 ASN n 
1 374 LEU n 
1 375 SER n 
1 376 ILE n 
1 377 MET n 
1 378 ILE n 
1 379 GLN n 
1 380 ASP n 
1 381 LEU n 
1 382 ASP n 
1 383 ILE n 
1 384 MET n 
1 385 MET n 
1 386 LEU n 
1 387 THR n 
1 388 PHE n 
1 389 HIS n 
1 390 HIS n 
1 391 PHE n 
1 392 GLY n 
1 393 LYS n 
1 394 ASP n 
1 395 PHE n 
1 396 PRO n 
1 397 LYS n 
1 398 SER n 
1 399 GLU n 
1 400 LYS n 
1 401 LEU n 
1 402 SER n 
1 403 PRO n 
1 404 ASP n 
1 405 ALA n 
1 406 PHE n 
1 407 ILE n 
1 408 GLN n 
1 409 VAL n 
1 410 ALA n 
1 411 LEU n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 TYR n 
1 416 TYR n 
1 417 ARG n 
1 418 ILE n 
1 419 TYR n 
1 420 GLY n 
1 421 GLN n 
1 422 ALA n 
1 423 CYS n 
1 424 ALA n 
1 425 THR n 
1 426 TYR n 
1 427 GLU n 
1 428 SER n 
1 429 ALA n 
1 430 SER n 
1 431 LEU n 
1 432 ARG n 
1 433 MET n 
1 434 PHE n 
1 435 HIS n 
1 436 LEU n 
1 437 GLY n 
1 438 ARG n 
1 439 THR n 
1 440 ASP n 
1 441 THR n 
1 442 ILE n 
1 443 ARG n 
1 444 SER n 
1 445 ALA n 
1 446 SER n 
1 447 ILE n 
1 448 ASP n 
1 449 SER n 
1 450 LEU n 
1 451 ALA n 
1 452 PHE n 
1 453 VAL n 
1 454 LYS n 
1 455 GLY n 
1 456 MET n 
1 457 GLY n 
1 458 ASP n 
1 459 SER n 
1 460 THR n 
1 461 VAL n 
1 462 PRO n 
1 463 GLU n 
1 464 GLN n 
1 465 GLN n 
1 466 LYS n 
1 467 VAL n 
1 468 GLU n 
1 469 LEU n 
1 470 LEU n 
1 471 ARG n 
1 472 LYS n 
1 473 ALA n 
1 474 VAL n 
1 475 GLN n 
1 476 ALA n 
1 477 HIS n 
1 478 ARG n 
1 479 ALA n 
1 480 TYR n 
1 481 THR n 
1 482 ASP n 
1 483 ARG n 
1 484 ALA n 
1 485 ILE n 
1 486 ARG n 
1 487 GLY n 
1 488 GLU n 
1 489 ALA n 
1 490 PHE n 
1 491 ASP n 
1 492 ARG n 
1 493 HIS n 
1 494 LEU n 
1 495 LEU n 
1 496 GLY n 
1 497 LEU n 
1 498 LYS n 
1 499 LEU n 
1 500 GLN n 
1 501 ALA n 
1 502 ILE n 
1 503 GLU n 
1 504 ASP n 
1 505 LEU n 
1 506 VAL n 
1 507 SER n 
1 508 MET n 
1 509 PRO n 
1 510 ASP n 
1 511 ILE n 
1 512 PHE n 
1 513 MET n 
1 514 ASP n 
1 515 THR n 
1 516 SER n 
1 517 TYR n 
1 518 ALA n 
1 519 ILE n 
1 520 ALA n 
1 521 MET n 
1 522 HIS n 
1 523 PHE n 
1 524 ASN n 
1 525 LEU n 
1 526 SER n 
1 527 THR n 
1 528 ALA n 
1 529 GLN n 
1 530 VAL n 
1 531 PRO n 
1 532 ALA n 
1 533 LYS n 
1 534 THR n 
1 535 ASP n 
1 536 CYS n 
1 537 VAL n 
1 538 GLY n 
1 539 PHE n 
1 540 PHE n 
1 541 GLY n 
1 542 PRO n 
1 543 VAL n 
1 544 VAL n 
1 545 PRO n 
1 546 ASP n 
1 547 GLY n 
1 548 TYR n 
1 549 GLY n 
1 550 ILE n 
1 551 CYS n 
1 552 TYR n 
1 553 ASN n 
1 554 PRO n 
1 555 MET n 
1 556 GLU n 
1 557 ALA n 
1 558 HIS n 
1 559 ILE n 
1 560 ASN n 
1 561 PHE n 
1 562 SER n 
1 563 VAL n 
1 564 SER n 
1 565 ALA n 
1 566 TYR n 
1 567 ASN n 
1 568 SER n 
1 569 CYS n 
1 570 ALA n 
1 571 GLU n 
1 572 THR n 
1 573 ASN n 
1 574 ALA n 
1 575 ALA n 
1 576 ARG n 
1 577 MET n 
1 578 ALA n 
1 579 HIS n 
1 580 TYR n 
1 581 LEU n 
1 582 GLU n 
1 583 LYS n 
1 584 ALA n 
1 585 LEU n 
1 586 LEU n 
1 587 ASP n 
1 588 MET n 
1 589 ARG n 
1 590 THR n 
1 591 LEU n 
1 592 LEU n 
1 593 GLN n 
1 594 ASN n 
1 595 HIS n 
1 596 PRO n 
1 597 ARG n 
1 598 ALA n 
1 599 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 Crat 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q3V1Y3_MOUSE 
_struct_ref.pdbx_db_accession          Q3V1Y3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AHQDALPRLPVPPLQQSLDYYLKALQPIVSEEEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTAYLQ
FRQPVVIYSSPGVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLGGQPLCMNQYYQILSSCRVPGPKQDS
VVNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWNSSLQSNKEPVGILTSNHRNTWAKAYNNLIKD
KVNRESVNSIQKSIFTVCLDKQVPRVSDDVYRNHVAGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAAEGP
PIVALVDHVMEYTKKPELVRSPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQDLDIMMLTFHHFGKDFPKSEKLSP
DAFIQVALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASIDSLAFVKGMGDSTVPEQQKVELLRKAVQAHRAYTDR
AIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMFFGPVVPDGYGICYNPMEAHINFSV
SAYNSCAETNAARMAHYLEKALLDMRTLLQNHPRAK
;
_struct_ref.pdbx_align_begin           30 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2H3W A 4 ? 599 ? Q3V1Y3 30 ? 625 ? 30 625 
2 1 2H3W B 4 ? 599 ? Q3V1Y3 30 ? 625 ? 30 625 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2H3W SER A 1   ? UNP Q3V1Y3 ?   ?   'cloning artifact'    27  1  
1 2H3W HIS A 2   ? UNP Q3V1Y3 ?   ?   'cloning artifact'    28  2  
1 2H3W MET A 3   ? UNP Q3V1Y3 ?   ?   'cloning artifact'    29  3  
1 2H3W ALA A 528 ? UNP Q3V1Y3 SER 554 'engineered mutation' 554 4  
1 2H3W GLY A 538 ? UNP Q3V1Y3 MET 564 'engineered mutation' 564 5  
2 2H3W SER B 1   ? UNP Q3V1Y3 ?   ?   'cloning artifact'    27  6  
2 2H3W HIS B 2   ? UNP Q3V1Y3 ?   ?   'cloning artifact'    28  7  
2 2H3W MET B 3   ? UNP Q3V1Y3 ?   ?   'cloning artifact'    29  8  
2 2H3W ALA B 528 ? UNP Q3V1Y3 SER 554 'engineered mutation' 554 9  
2 2H3W GLY B 538 ? UNP Q3V1Y3 MET 564 'engineered mutation' 564 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                         ?                 'C3 H7 N O2'          
89.093  
ARG 'L-peptide linking' y ARGININE                                                        ?                 'C6 H15 N4 O2 1'      
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                      ?                 'C4 H8 N2 O3'         
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                 ?                 'C4 H7 N O4'          
133.103 
COA non-polymer         . 'COENZYME A'                                                    ?                 'C21 H36 N7 O16 P3 S' 
767.534 
CYS 'L-peptide linking' y CYSTEINE                                                        ?                 'C3 H7 N O2 S'        
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                       ?                 'C5 H10 N2 O3'        
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                 ?                 'C5 H9 N O4'          
147.129 
GLY 'peptide linking'   y GLYCINE                                                         ?                 'C2 H5 N O2'          
75.067  
HC5 non-polymer         . '(R)-3-CARBOXY-2-(HEXANOYLOXY)-N,N,N-TRIMETHYLPROPAN-1-AMINIUM' HEXANOYLCARNITINE 'C13 H26 N O4 1'      
260.350 
HIS 'L-peptide linking' y HISTIDINE                                                       ?                 'C6 H10 N3 O2 1'      
156.162 
HOH non-polymer         . WATER                                                           ?                 'H2 O'                
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                      ?                 'C6 H13 N O2'         
131.173 
LEU 'L-peptide linking' y LEUCINE                                                         ?                 'C6 H13 N O2'         
131.173 
LYS 'L-peptide linking' y LYSINE                                                          ?                 'C6 H15 N2 O2 1'      
147.195 
MET 'L-peptide linking' y METHIONINE                                                      ?                 'C5 H11 N O2 S'       
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                   ?                 'C9 H11 N O2'         
165.189 
PRO 'L-peptide linking' y PROLINE                                                         ?                 'C5 H9 N O2'          
115.130 
SER 'L-peptide linking' y SERINE                                                          ?                 'C3 H7 N O3'          
105.093 
THR 'L-peptide linking' y THREONINE                                                       ?                 'C4 H9 N O3'          
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                      ?                 'C11 H12 N2 O2'       
204.225 
TYR 'L-peptide linking' y TYROSINE                                                        ?                 'C9 H11 N O3'         
181.189 
VAL 'L-peptide linking' y VALINE                                                          ?                 'C5 H11 N O2'         
117.146 
# 
_exptl.entry_id          2H3W 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.density_percent_sol   52.04 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    '100 mM Tris, 18% PEG 3350, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9798 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             0.9798 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2H3W 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.100 
_reflns.number_obs                   76084 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.1 
_reflns.pdbx_Rmerge_I_obs            0.045 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.3494 
_reflns.B_iso_Wilson_estimate        11.4 
_reflns.pdbx_redundancy              3.000 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   77.6 
_reflns_shell.Rmerge_I_obs           0.108 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.515 
_reflns_shell.pdbx_redundancy        2.10 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2H3W 
_refine.ls_number_reflns_obs                     75758 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               377280.35 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.91 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    94.3 
_refine.ls_R_factor_obs                          0.177 
_refine.ls_R_factor_all                          0.177 
_refine.ls_R_factor_R_work                       0.177 
_refine.ls_R_factor_R_free                       0.219 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.6 
_refine.ls_number_reflns_R_free                  5768 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               23.2 
_refine.aniso_B[1][1]                            5.33 
_refine.aniso_B[2][2]                            -2.41 
_refine.aniso_B[3][3]                            -2.92 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.21 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.340981 
_refine.solvent_model_param_bsol                 52.9734 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2H3W 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             0.17 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.26 
_refine_analyze.Luzzati_sigma_a_free            0.23 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9552 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         132 
_refine_hist.number_atoms_solvent             1500 
_refine_hist.number_atoms_total               11184 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        29.91 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.1   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.78  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.27  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.99  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.10  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.00  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.18 
_refine_ls_shell.number_reflns_R_work             5912 
_refine_ls_shell.R_factor_R_work                  0.211 
_refine_ls_shell.percent_reflns_obs               79.6 
_refine_ls_shell.R_factor_R_free                  0.255 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            7.5 
_refine_ls_shell.number_reflns_R_free             478 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 oca.par           hca.top     'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top     'X-RAY DIFFRACTION' 
5 coa.par           coa.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2H3W 
_struct.title                     
'Crystal structure of the S554A/M564G mutant of murine carnitine acetyltransferase in complex with hexanoylcarnitine and CoA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2H3W 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'carnitine acyltransferase, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 2   ? ALA A 8   ? HIS A 28  ALA A 34  1 ? 7  
HELX_P HELX_P2  2  PRO A 16  ? GLN A 29  ? PRO A 42  GLN A 55  1 ? 14 
HELX_P HELX_P3  3  SER A 33  ? GLN A 48  ? SER A 59  GLN A 74  1 ? 16 
HELX_P HELX_P4  4  GLY A 52  ? LYS A 67  ? GLY A 78  LYS A 93  1 ? 16 
HELX_P HELX_P5  5  LEU A 72  ? TYR A 81  ? LEU A 98  TYR A 107 1 ? 10 
HELX_P HELX_P6  6  ASP A 105 ? ASN A 129 ? ASP A 131 ASN A 155 1 ? 25 
HELX_P HELX_P7  7  MET A 144 ? GLN A 149 ? MET A 170 GLN A 175 5 ? 6  
HELX_P HELX_P8  8  THR A 199 ? SER A 213 ? THR A 225 SER A 239 1 ? 15 
HELX_P HELX_P9  9  PRO A 221 ? ASN A 228 ? PRO A 247 ASN A 254 5 ? 8  
HELX_P HELX_P10 10 HIS A 229 ? ILE A 241 ? HIS A 255 ILE A 267 1 ? 13 
HELX_P HELX_P11 11 ASP A 243 ? SER A 256 ? ASP A 269 SER A 282 1 ? 14 
HELX_P HELX_P12 12 VAL A 273 ? HIS A 284 ? VAL A 299 HIS A 310 1 ? 12 
HELX_P HELX_P13 13 GLU A 321 ? LYS A 337 ? GLU A 347 LYS A 363 1 ? 17 
HELX_P HELX_P14 14 THR A 360 ? ASP A 380 ? THR A 386 ASP A 406 1 ? 21 
HELX_P HELX_P15 15 LYS A 393 ? GLU A 399 ? LYS A 419 GLU A 425 1 ? 7  
HELX_P HELX_P16 16 SER A 402 ? GLY A 420 ? SER A 428 GLY A 446 1 ? 19 
HELX_P HELX_P17 17 SER A 446 ? GLY A 457 ? SER A 472 GLY A 483 1 ? 12 
HELX_P HELX_P18 18 PRO A 462 ? ARG A 486 ? PRO A 488 ARG A 512 1 ? 25 
HELX_P HELX_P19 19 PHE A 490 ? ASP A 504 ? PHE A 516 ASP A 530 1 ? 15 
HELX_P HELX_P20 20 PRO A 509 ? ASP A 514 ? PRO A 535 ASP A 540 1 ? 6  
HELX_P HELX_P21 21 ASP A 514 ? HIS A 522 ? ASP A 540 HIS A 548 1 ? 9  
HELX_P HELX_P22 22 ASN A 573 ? HIS A 595 ? ASN A 599 HIS A 621 1 ? 23 
HELX_P HELX_P23 23 SER B 1   ? ALA B 8   ? SER B 27  ALA B 34  1 ? 8  
HELX_P HELX_P24 24 PRO B 16  ? GLN B 29  ? PRO B 42  GLN B 55  1 ? 14 
HELX_P HELX_P25 25 SER B 33  ? GLN B 48  ? SER B 59  GLN B 74  1 ? 16 
HELX_P HELX_P26 26 GLY B 52  ? LYS B 67  ? GLY B 78  LYS B 93  1 ? 16 
HELX_P HELX_P27 27 LEU B 72  ? TYR B 81  ? LEU B 98  TYR B 107 1 ? 10 
HELX_P HELX_P28 28 ASP B 105 ? ASN B 129 ? ASP B 131 ASN B 155 1 ? 25 
HELX_P HELX_P29 29 MET B 144 ? GLN B 149 ? MET B 170 GLN B 175 5 ? 6  
HELX_P HELX_P30 30 THR B 199 ? SER B 213 ? THR B 225 SER B 239 1 ? 15 
HELX_P HELX_P31 31 PRO B 221 ? ASN B 228 ? PRO B 247 ASN B 254 5 ? 8  
HELX_P HELX_P32 32 HIS B 229 ? ILE B 241 ? HIS B 255 ILE B 267 1 ? 13 
HELX_P HELX_P33 33 ASP B 243 ? SER B 256 ? ASP B 269 SER B 282 1 ? 14 
HELX_P HELX_P34 34 SER B 270 ? HIS B 284 ? SER B 296 HIS B 310 1 ? 15 
HELX_P HELX_P35 35 GLU B 321 ? LYS B 338 ? GLU B 347 LYS B 364 1 ? 18 
HELX_P HELX_P36 36 THR B 360 ? ASP B 380 ? THR B 386 ASP B 406 1 ? 21 
HELX_P HELX_P37 37 LYS B 393 ? GLU B 399 ? LYS B 419 GLU B 425 1 ? 7  
HELX_P HELX_P38 38 SER B 402 ? GLY B 420 ? SER B 428 GLY B 446 1 ? 19 
HELX_P HELX_P39 39 SER B 446 ? GLY B 457 ? SER B 472 GLY B 483 1 ? 12 
HELX_P HELX_P40 40 PRO B 462 ? ARG B 486 ? PRO B 488 ARG B 512 1 ? 25 
HELX_P HELX_P41 41 PHE B 490 ? ASP B 504 ? PHE B 516 ASP B 530 1 ? 15 
HELX_P HELX_P42 42 PRO B 509 ? ASP B 514 ? PRO B 535 ASP B 540 1 ? 6  
HELX_P HELX_P43 43 ASP B 514 ? MET B 521 ? ASP B 540 MET B 547 1 ? 8  
HELX_P HELX_P44 44 ASN B 573 ? ASN B 594 ? ASN B 599 ASN B 620 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 2 ? 
C ? 2 ? 
D ? 6 ? 
E ? 8 ? 
F ? 2 ? 
G ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? anti-parallel 
E 6 7 ? anti-parallel 
E 7 8 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 353 ? LEU A 355 ? LYS A 379 LEU A 381 
A 2 GLN A 184 ? ASP A 189 ? GLN A 210 ASP A 215 
A 3 HIS A 176 ? HIS A 181 ? HIS A 202 HIS A 207 
A 4 THR A 259 ? LEU A 262 ? THR A 285 LEU A 288 
A 5 LEU A 301 ? VAL A 305 ? LEU A 327 VAL A 331 
A 6 CYS A 311 ? TYR A 315 ? CYS A 337 TYR A 341 
A 7 GLY A 95  ? ILE A 97  ? GLY A 121 ILE A 123 
A 8 VAL A 537 ? PHE A 539 ? VAL A 563 PHE A 565 
B 1 PHE A 136 ? LEU A 137 ? PHE A 162 LEU A 163 
B 2 GLN A 140 ? PRO A 141 ? GLN A 166 PRO A 167 
C 1 SER A 153 ? VAL A 156 ? SER A 179 VAL A 182 
C 2 SER A 163 ? ASN A 166 ? SER A 189 ASN A 192 
D 1 LEU A 381 ? PHE A 388 ? LEU A 407 PHE A 414 
D 2 ILE A 559 ? TYR A 566 ? ILE A 585 TYR A 592 
D 3 TYR A 548 ? PRO A 554 ? TYR A 574 PRO A 580 
D 4 LEU A 525 ? GLN A 529 ? LEU A 551 GLN A 555 
D 5 THR A 425 ? SER A 430 ? THR A 451 SER A 456 
D 6 THR A 439 ? ILE A 442 ? THR A 465 ILE A 468 
E 1 LYS B 353 ? LEU B 355 ? LYS B 379 LEU B 381 
E 2 GLN B 184 ? ASP B 189 ? GLN B 210 ASP B 215 
E 3 HIS B 176 ? HIS B 181 ? HIS B 202 HIS B 207 
E 4 THR B 259 ? LEU B 262 ? THR B 285 LEU B 288 
E 5 LEU B 301 ? VAL B 305 ? LEU B 327 VAL B 331 
E 6 CYS B 311 ? TYR B 315 ? CYS B 337 TYR B 341 
E 7 GLY B 95  ? ILE B 97  ? GLY B 121 ILE B 123 
E 8 VAL B 537 ? PHE B 539 ? VAL B 563 PHE B 565 
F 1 SER B 153 ? VAL B 156 ? SER B 179 VAL B 182 
F 2 SER B 163 ? ASN B 166 ? SER B 189 ASN B 192 
G 1 LEU B 381 ? PHE B 388 ? LEU B 407 PHE B 414 
G 2 ILE B 559 ? TYR B 566 ? ILE B 585 TYR B 592 
G 3 TYR B 548 ? PRO B 554 ? TYR B 574 PRO B 580 
G 4 LEU B 525 ? GLN B 529 ? LEU B 551 GLN B 555 
G 5 THR B 425 ? SER B 430 ? THR B 451 SER B 456 
G 6 THR B 439 ? ILE B 442 ? THR B 465 ILE B 468 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 353 ? O LYS A 379 N GLU A 187 ? N GLU A 213 
A 2 3 O LEU A 188 ? O LEU A 214 N ILE A 177 ? N ILE A 203 
A 3 4 N VAL A 180 ? N VAL A 206 O LEU A 262 ? O LEU A 288 
A 4 5 N CYS A 261 ? N CYS A 287 O PHE A 303 ? O PHE A 329 
A 5 6 N ILE A 304 ? N ILE A 330 O GLY A 312 ? O GLY A 338 
A 6 7 O MET A 313 ? O MET A 339 N VAL A 96  ? N VAL A 122 
A 7 8 N ILE A 97  ? N ILE A 123 O VAL A 537 ? O VAL A 563 
B 1 2 N LEU A 137 ? N LEU A 163 O GLN A 140 ? O GLN A 166 
C 1 2 N VAL A 156 ? N VAL A 182 O SER A 163 ? O SER A 189 
D 1 2 N ASP A 382 ? N ASP A 408 O ALA A 565 ? O ALA A 591 
D 2 3 O ASN A 560 ? O ASN A 586 N ASN A 553 ? N ASN A 579 
D 3 4 O ILE A 550 ? O ILE A 576 N SER A 526 ? N SER A 552 
D 4 5 O THR A 527 ? O THR A 553 N TYR A 426 ? N TYR A 452 
D 5 6 N GLU A 427 ? N GLU A 453 O ILE A 442 ? O ILE A 468 
E 1 2 O LEU B 355 ? O LEU B 381 N PHE B 185 ? N PHE B 211 
E 2 3 O LEU B 188 ? O LEU B 214 N ILE B 177 ? N ILE B 203 
E 3 4 N VAL B 180 ? N VAL B 206 O LEU B 262 ? O LEU B 288 
E 4 5 N CYS B 261 ? N CYS B 287 O PHE B 303 ? O PHE B 329 
E 5 6 N ILE B 304 ? N ILE B 330 O GLY B 312 ? O GLY B 338 
E 6 7 O MET B 313 ? O MET B 339 N VAL B 96  ? N VAL B 122 
E 7 8 N GLY B 95  ? N GLY B 121 O PHE B 539 ? O PHE B 565 
F 1 2 N VAL B 156 ? N VAL B 182 O SER B 163 ? O SER B 189 
G 1 2 N ASP B 382 ? N ASP B 408 O ALA B 565 ? O ALA B 591 
G 2 3 O ASN B 560 ? O ASN B 586 N ASN B 553 ? N ASN B 579 
G 3 4 O ILE B 550 ? O ILE B 576 N SER B 526 ? N SER B 552 
G 4 5 O THR B 527 ? O THR B 553 N TYR B 426 ? N TYR B 452 
G 5 6 N GLU B 427 ? N GLU B 453 O ILE B 442 ? O ILE B 468 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A COA 1601 ? 28 'BINDING SITE FOR RESIDUE COA A 1601' 
AC2 Software B COA 1701 ? 27 'BINDING SITE FOR RESIDUE COA B 1701' 
AC3 Software A HC5 1602 ? 16 'BINDING SITE FOR RESIDUE HC5 A 1602' 
AC4 Software B HC5 1702 ? 15 'BINDING SITE FOR RESIDUE HC5 B 1702' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 28 LEU A 137 ? LEU A 163  . ? 1_555 ? 
2  AC1 28 HIS A 317 ? HIS A 343  . ? 1_555 ? 
3  AC1 28 GLU A 321 ? GLU A 347  . ? 1_555 ? 
4  AC1 28 GLY A 322 ? GLY A 348  . ? 1_555 ? 
5  AC1 28 PRO A 323 ? PRO A 349  . ? 1_555 ? 
6  AC1 28 LYS A 393 ? LYS A 419  . ? 1_555 ? 
7  AC1 28 LYS A 397 ? LYS A 423  . ? 1_555 ? 
8  AC1 28 LYS A 400 ? LYS A 426  . ? 1_555 ? 
9  AC1 28 LEU A 401 ? LEU A 427  . ? 1_555 ? 
10 AC1 28 SER A 402 ? SER A 428  . ? 1_555 ? 
11 AC1 28 PRO A 403 ? PRO A 429  . ? 1_555 ? 
12 AC1 28 ASP A 404 ? ASP A 430  . ? 1_555 ? 
13 AC1 28 ALA A 429 ? ALA A 455  . ? 1_555 ? 
14 AC1 28 SER A 430 ? SER A 456  . ? 1_555 ? 
15 AC1 28 ARG A 478 ? ARG A 504  . ? 1_555 ? 
16 AC1 28 THR A 481 ? THR A 507  . ? 1_555 ? 
17 AC1 28 ILE A 485 ? ILE A 511  . ? 1_555 ? 
18 AC1 28 GLN A 529 ? GLN A 555  . ? 1_555 ? 
19 AC1 28 HC5 D .   ? HC5 A 1602 . ? 1_555 ? 
20 AC1 28 HOH G .   ? HOH A 1690 . ? 1_555 ? 
21 AC1 28 HOH G .   ? HOH A 1769 . ? 1_555 ? 
22 AC1 28 HOH G .   ? HOH A 1777 . ? 1_555 ? 
23 AC1 28 HOH G .   ? HOH A 1789 . ? 1_555 ? 
24 AC1 28 HOH G .   ? HOH A 1811 . ? 1_555 ? 
25 AC1 28 HOH G .   ? HOH A 1816 . ? 1_555 ? 
26 AC1 28 HOH G .   ? HOH A 1925 . ? 1_555 ? 
27 AC1 28 HOH G .   ? HOH A 1951 . ? 1_555 ? 
28 AC1 28 HOH G .   ? HOH A 2165 . ? 1_555 ? 
29 AC2 27 LEU B 137 ? LEU B 163  . ? 1_555 ? 
30 AC2 27 GLU B 321 ? GLU B 347  . ? 1_555 ? 
31 AC2 27 GLY B 322 ? GLY B 348  . ? 1_555 ? 
32 AC2 27 PRO B 323 ? PRO B 349  . ? 1_555 ? 
33 AC2 27 LYS B 393 ? LYS B 419  . ? 1_555 ? 
34 AC2 27 LYS B 397 ? LYS B 423  . ? 1_555 ? 
35 AC2 27 LYS B 400 ? LYS B 426  . ? 1_555 ? 
36 AC2 27 LEU B 401 ? LEU B 427  . ? 1_555 ? 
37 AC2 27 SER B 402 ? SER B 428  . ? 1_555 ? 
38 AC2 27 PRO B 403 ? PRO B 429  . ? 1_555 ? 
39 AC2 27 ASP B 404 ? ASP B 430  . ? 1_555 ? 
40 AC2 27 SER B 428 ? SER B 454  . ? 1_555 ? 
41 AC2 27 ALA B 429 ? ALA B 455  . ? 1_555 ? 
42 AC2 27 SER B 430 ? SER B 456  . ? 1_555 ? 
43 AC2 27 ARG B 478 ? ARG B 504  . ? 1_555 ? 
44 AC2 27 THR B 481 ? THR B 507  . ? 1_555 ? 
45 AC2 27 ILE B 485 ? ILE B 511  . ? 1_555 ? 
46 AC2 27 GLN B 529 ? GLN B 555  . ? 1_555 ? 
47 AC2 27 HC5 F .   ? HC5 B 1702 . ? 1_555 ? 
48 AC2 27 HOH H .   ? HOH B 1798 . ? 1_555 ? 
49 AC2 27 HOH H .   ? HOH B 1902 . ? 1_555 ? 
50 AC2 27 HOH H .   ? HOH B 1942 . ? 1_555 ? 
51 AC2 27 HOH H .   ? HOH B 2012 . ? 1_555 ? 
52 AC2 27 HOH H .   ? HOH B 2094 . ? 1_555 ? 
53 AC2 27 HOH H .   ? HOH B 2156 . ? 1_555 ? 
54 AC2 27 HOH H .   ? HOH B 2220 . ? 1_555 ? 
55 AC2 27 HOH H .   ? HOH B 2229 . ? 1_555 ? 
56 AC3 16 TRP A 76  ? TRP A 102  . ? 1_555 ? 
57 AC3 16 PRO A 94  ? PRO A 120  . ? 1_555 ? 
58 AC3 16 VAL A 96  ? VAL A 122  . ? 1_555 ? 
59 AC3 16 TYR A 315 ? TYR A 341  . ? 1_555 ? 
60 AC3 16 HIS A 317 ? HIS A 343  . ? 1_555 ? 
61 AC3 16 GLU A 321 ? GLU A 347  . ? 1_555 ? 
62 AC3 16 TYR A 426 ? TYR A 452  . ? 1_555 ? 
63 AC3 16 SER A 428 ? SER A 454  . ? 1_555 ? 
64 AC3 16 THR A 439 ? THR A 465  . ? 1_555 ? 
65 AC3 16 SER A 526 ? SER A 552  . ? 1_555 ? 
66 AC3 16 ALA A 528 ? ALA A 554  . ? 1_555 ? 
67 AC3 16 VAL A 530 ? VAL A 556  . ? 1_555 ? 
68 AC3 16 PHE A 540 ? PHE A 566  . ? 1_555 ? 
69 AC3 16 VAL A 543 ? VAL A 569  . ? 1_555 ? 
70 AC3 16 COA C .   ? COA A 1601 . ? 1_555 ? 
71 AC3 16 HOH G .   ? HOH A 1603 . ? 1_555 ? 
72 AC4 15 TRP B 76  ? TRP B 102  . ? 1_555 ? 
73 AC4 15 VAL B 96  ? VAL B 122  . ? 1_555 ? 
74 AC4 15 TYR B 315 ? TYR B 341  . ? 1_555 ? 
75 AC4 15 HIS B 317 ? HIS B 343  . ? 1_555 ? 
76 AC4 15 GLU B 321 ? GLU B 347  . ? 1_555 ? 
77 AC4 15 TYR B 426 ? TYR B 452  . ? 1_555 ? 
78 AC4 15 SER B 428 ? SER B 454  . ? 1_555 ? 
79 AC4 15 THR B 439 ? THR B 465  . ? 1_555 ? 
80 AC4 15 SER B 526 ? SER B 552  . ? 1_555 ? 
81 AC4 15 ALA B 528 ? ALA B 554  . ? 1_555 ? 
82 AC4 15 VAL B 530 ? VAL B 556  . ? 1_555 ? 
83 AC4 15 PHE B 540 ? PHE B 566  . ? 1_555 ? 
84 AC4 15 VAL B 543 ? VAL B 569  . ? 1_555 ? 
85 AC4 15 COA E .   ? COA B 1701 . ? 1_555 ? 
86 AC4 15 HOH H .   ? HOH B 1712 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2H3W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2H3W 
_atom_sites.fract_transf_matrix[1][1]   0.006095 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004931 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011227 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010476 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . SER A 1 1   ? 67.130  7.488   18.055  1.00 45.59 ? 27   SER A N   1 
ATOM   2     C CA  . SER A 1 1   ? 67.296  6.013   18.200  1.00 45.82 ? 27   SER A CA  1 
ATOM   3     C C   . SER A 1 1   ? 68.209  5.705   19.379  1.00 45.13 ? 27   SER A C   1 
ATOM   4     O O   . SER A 1 1   ? 68.130  6.352   20.420  1.00 46.28 ? 27   SER A O   1 
ATOM   5     C CB  . SER A 1 1   ? 67.910  5.431   16.931  1.00 45.91 ? 27   SER A CB  1 
ATOM   6     O OG  . SER A 1 1   ? 69.223  5.920   16.748  1.00 48.93 ? 27   SER A OG  1 
ATOM   7     N N   . HIS A 1 2   ? 69.071  4.709   19.207  1.00 44.67 ? 28   HIS A N   1 
ATOM   8     C CA  . HIS A 1 2   ? 70.027  4.330   20.242  1.00 44.10 ? 28   HIS A CA  1 
ATOM   9     C C   . HIS A 1 2   ? 70.934  5.547   20.408  1.00 43.36 ? 28   HIS A C   1 
ATOM   10    O O   . HIS A 1 2   ? 71.884  5.717   19.646  1.00 43.06 ? 28   HIS A O   1 
ATOM   11    C CB  . HIS A 1 2   ? 70.848  3.134   19.761  1.00 45.69 ? 28   HIS A CB  1 
ATOM   12    C CG  . HIS A 1 2   ? 71.714  2.525   20.817  1.00 47.67 ? 28   HIS A CG  1 
ATOM   13    N ND1 . HIS A 1 2   ? 72.643  1.545   20.539  1.00 48.87 ? 28   HIS A ND1 1 
ATOM   14    C CD2 . HIS A 1 2   ? 71.762  2.721   22.156  1.00 49.08 ? 28   HIS A CD2 1 
ATOM   15    C CE1 . HIS A 1 2   ? 73.227  1.160   21.661  1.00 48.78 ? 28   HIS A CE1 1 
ATOM   16    N NE2 . HIS A 1 2   ? 72.708  1.858   22.658  1.00 49.57 ? 28   HIS A NE2 1 
ATOM   17    N N   . MET A 1 3   ? 70.632  6.388   21.394  1.00 42.73 ? 29   MET A N   1 
ATOM   18    C CA  . MET A 1 3   ? 71.391  7.616   21.640  1.00 43.04 ? 29   MET A CA  1 
ATOM   19    C C   . MET A 1 3   ? 72.905  7.558   21.458  1.00 41.35 ? 29   MET A C   1 
ATOM   20    O O   . MET A 1 3   ? 73.516  8.569   21.121  1.00 41.62 ? 29   MET A O   1 
ATOM   21    C CB  . MET A 1 3   ? 71.087  8.172   23.039  1.00 45.53 ? 29   MET A CB  1 
ATOM   22    C CG  . MET A 1 3   ? 69.906  9.150   23.120  1.00 50.09 ? 29   MET A CG  1 
ATOM   23    S SD  . MET A 1 3   ? 68.258  8.421   22.910  1.00 56.35 ? 29   MET A SD  1 
ATOM   24    C CE  . MET A 1 3   ? 67.645  9.299   21.435  1.00 54.40 ? 29   MET A CE  1 
ATOM   25    N N   . ALA A 1 4   ? 73.521  6.402   21.685  1.00 40.22 ? 30   ALA A N   1 
ATOM   26    C CA  . ALA A 1 4   ? 74.972  6.300   21.525  1.00 39.09 ? 30   ALA A CA  1 
ATOM   27    C C   . ALA A 1 4   ? 75.311  6.549   20.060  1.00 38.14 ? 30   ALA A C   1 
ATOM   28    O O   . ALA A 1 4   ? 76.115  7.425   19.725  1.00 37.21 ? 30   ALA A O   1 
ATOM   29    C CB  . ALA A 1 4   ? 75.457  4.917   21.955  1.00 38.35 ? 30   ALA A CB  1 
ATOM   30    N N   . HIS A 1 5   ? 74.671  5.769   19.195  1.00 36.73 ? 31   HIS A N   1 
ATOM   31    C CA  . HIS A 1 5   ? 74.853  5.864   17.754  1.00 35.05 ? 31   HIS A CA  1 
ATOM   32    C C   . HIS A 1 5   ? 74.576  7.278   17.240  1.00 33.88 ? 31   HIS A C   1 
ATOM   33    O O   . HIS A 1 5   ? 75.383  7.846   16.502  1.00 33.41 ? 31   HIS A O   1 
ATOM   34    C CB  . HIS A 1 5   ? 73.909  4.879   17.062  1.00 35.26 ? 31   HIS A CB  1 
ATOM   35    C CG  . HIS A 1 5   ? 73.823  5.056   15.580  1.00 35.17 ? 31   HIS A CG  1 
ATOM   36    N ND1 . HIS A 1 5   ? 74.867  4.746   14.734  1.00 34.33 ? 31   HIS A ND1 1 
ATOM   37    C CD2 . HIS A 1 5   ? 72.826  5.519   14.793  1.00 35.28 ? 31   HIS A CD2 1 
ATOM   38    C CE1 . HIS A 1 5   ? 74.512  5.013   13.487  1.00 35.15 ? 31   HIS A CE1 1 
ATOM   39    N NE2 . HIS A 1 5   ? 73.278  5.484   13.498  1.00 34.46 ? 31   HIS A NE2 1 
ATOM   40    N N   . GLN A 1 6   ? 73.434  7.835   17.629  1.00 32.80 ? 32   GLN A N   1 
ATOM   41    C CA  . GLN A 1 6   ? 73.041  9.172   17.197  1.00 32.79 ? 32   GLN A CA  1 
ATOM   42    C C   . GLN A 1 6   ? 74.044  10.261  17.569  1.00 32.67 ? 32   GLN A C   1 
ATOM   43    O O   . GLN A 1 6   ? 74.307  11.164  16.771  1.00 31.64 ? 32   GLN A O   1 
ATOM   44    C CB  . GLN A 1 6   ? 71.670  9.538   17.776  1.00 32.83 ? 32   GLN A CB  1 
ATOM   45    C CG  . GLN A 1 6   ? 70.508  8.693   17.261  1.00 34.49 ? 32   GLN A CG  1 
ATOM   46    C CD  . GLN A 1 6   ? 70.314  8.815   15.761  1.00 34.23 ? 32   GLN A CD  1 
ATOM   47    O OE1 . GLN A 1 6   ? 70.218  9.919   15.224  1.00 34.07 ? 32   GLN A OE1 1 
ATOM   48    N NE2 . GLN A 1 6   ? 70.248  7.677   15.077  1.00 31.90 ? 32   GLN A NE2 1 
ATOM   49    N N   . ASP A 1 7   ? 74.598  10.184  18.779  1.00 32.20 ? 33   ASP A N   1 
ATOM   50    C CA  . ASP A 1 7   ? 75.552  11.191  19.239  1.00 31.66 ? 33   ASP A CA  1 
ATOM   51    C C   . ASP A 1 7   ? 76.846  11.208  18.440  1.00 29.65 ? 33   ASP A C   1 
ATOM   52    O O   . ASP A 1 7   ? 77.496  12.246  18.325  1.00 29.72 ? 33   ASP A O   1 
ATOM   53    C CB  . ASP A 1 7   ? 75.872  10.996  20.728  1.00 34.55 ? 33   ASP A CB  1 
ATOM   54    C CG  . ASP A 1 7   ? 74.722  11.406  21.630  1.00 37.51 ? 33   ASP A CG  1 
ATOM   55    O OD1 . ASP A 1 7   ? 74.131  12.481  21.393  1.00 38.25 ? 33   ASP A OD1 1 
ATOM   56    O OD2 . ASP A 1 7   ? 74.416  10.665  22.590  1.00 41.27 ? 33   ASP A OD2 1 
ATOM   57    N N   . ALA A 1 8   ? 77.220  10.064  17.885  1.00 27.43 ? 34   ALA A N   1 
ATOM   58    C CA  . ALA A 1 8   ? 78.445  9.980   17.105  1.00 26.98 ? 34   ALA A CA  1 
ATOM   59    C C   . ALA A 1 8   ? 78.230  10.448  15.666  1.00 26.32 ? 34   ALA A C   1 
ATOM   60    O O   . ALA A 1 8   ? 79.169  10.512  14.877  1.00 26.20 ? 34   ALA A O   1 
ATOM   61    C CB  . ALA A 1 8   ? 78.974  8.554   17.125  1.00 28.20 ? 34   ALA A CB  1 
ATOM   62    N N   . LEU A 1 9   ? 76.992  10.785  15.330  1.00 25.15 ? 35   LEU A N   1 
ATOM   63    C CA  . LEU A 1 9   ? 76.676  11.245  13.980  1.00 24.91 ? 35   LEU A CA  1 
ATOM   64    C C   . LEU A 1 9   ? 76.928  12.741  13.822  1.00 22.73 ? 35   LEU A C   1 
ATOM   65    O O   . LEU A 1 9   ? 76.680  13.520  14.740  1.00 23.39 ? 35   LEU A O   1 
ATOM   66    C CB  . LEU A 1 9   ? 75.214  10.934  13.644  1.00 23.88 ? 35   LEU A CB  1 
ATOM   67    C CG  . LEU A 1 9   ? 74.841  9.453   13.527  1.00 24.29 ? 35   LEU A CG  1 
ATOM   68    C CD1 . LEU A 1 9   ? 73.332  9.342   13.380  1.00 24.82 ? 35   LEU A CD1 1 
ATOM   69    C CD2 . LEU A 1 9   ? 75.554  8.814   12.339  1.00 22.12 ? 35   LEU A CD2 1 
ATOM   70    N N   . PRO A 1 10  ? 77.437  13.159  12.653  1.00 21.85 ? 36   PRO A N   1 
ATOM   71    C CA  . PRO A 1 10  ? 77.705  14.579  12.405  1.00 20.55 ? 36   PRO A CA  1 
ATOM   72    C C   . PRO A 1 10  ? 76.390  15.355  12.275  1.00 20.10 ? 36   PRO A C   1 
ATOM   73    O O   . PRO A 1 10  ? 75.388  14.808  11.821  1.00 20.01 ? 36   PRO A O   1 
ATOM   74    C CB  . PRO A 1 10  ? 78.503  14.550  11.108  1.00 21.37 ? 36   PRO A CB  1 
ATOM   75    C CG  . PRO A 1 10  ? 77.912  13.376  10.391  1.00 21.26 ? 36   PRO A CG  1 
ATOM   76    C CD  . PRO A 1 10  ? 77.827  12.342  11.490  1.00 20.62 ? 36   PRO A CD  1 
ATOM   77    N N   . ARG A 1 11  ? 76.401  16.620  12.691  1.00 18.97 ? 37   ARG A N   1 
ATOM   78    C CA  . ARG A 1 11  ? 75.219  17.487  12.638  1.00 20.17 ? 37   ARG A CA  1 
ATOM   79    C C   . ARG A 1 11  ? 75.036  18.067  11.241  1.00 17.50 ? 37   ARG A C   1 
ATOM   80    O O   . ARG A 1 11  ? 76.008  18.311  10.533  1.00 17.46 ? 37   ARG A O   1 
ATOM   81    C CB  . ARG A 1 11  ? 75.351  18.624  13.662  1.00 22.25 ? 37   ARG A CB  1 
ATOM   82    C CG  . ARG A 1 11  ? 74.742  18.321  15.030  1.00 24.66 ? 37   ARG A CG  1 
ATOM   83    C CD  . ARG A 1 11  ? 75.208  16.992  15.585  1.00 27.24 ? 37   ARG A CD  1 
ATOM   84    N NE  . ARG A 1 11  ? 74.440  16.609  16.766  1.00 28.31 ? 37   ARG A NE  1 
ATOM   85    C CZ  . ARG A 1 11  ? 74.367  15.368  17.236  1.00 28.27 ? 37   ARG A CZ  1 
ATOM   86    N NH1 . ARG A 1 11  ? 75.020  14.389  16.625  1.00 27.17 ? 37   ARG A NH1 1 
ATOM   87    N NH2 . ARG A 1 11  ? 73.620  15.103  18.300  1.00 28.98 ? 37   ARG A NH2 1 
ATOM   88    N N   . LEU A 1 12  ? 73.784  18.285  10.850  1.00 18.30 ? 38   LEU A N   1 
ATOM   89    C CA  . LEU A 1 12  ? 73.481  18.828  9.531   1.00 17.49 ? 38   LEU A CA  1 
ATOM   90    C C   . LEU A 1 12  ? 74.252  20.127  9.348   1.00 17.74 ? 38   LEU A C   1 
ATOM   91    O O   . LEU A 1 12  ? 74.101  21.078  10.116  1.00 16.87 ? 38   LEU A O   1 
ATOM   92    C CB  . LEU A 1 12  ? 71.974  19.074  9.377   1.00 18.16 ? 38   LEU A CB  1 
ATOM   93    C CG  . LEU A 1 12  ? 71.495  19.433  7.965   1.00 18.46 ? 38   LEU A CG  1 
ATOM   94    C CD1 . LEU A 1 12  ? 71.749  18.264  7.029   1.00 16.77 ? 38   LEU A CD1 1 
ATOM   95    C CD2 . LEU A 1 12  ? 70.017  19.781  7.984   1.00 17.52 ? 38   LEU A CD2 1 
ATOM   96    N N   . PRO A 1 13  ? 75.112  20.175  8.323   1.00 17.37 ? 39   PRO A N   1 
ATOM   97    C CA  . PRO A 1 13  ? 75.897  21.384  8.084   1.00 16.92 ? 39   PRO A CA  1 
ATOM   98    C C   . PRO A 1 13  ? 75.138  22.467  7.334   1.00 16.56 ? 39   PRO A C   1 
ATOM   99    O O   . PRO A 1 13  ? 74.039  22.242  6.820   1.00 14.48 ? 39   PRO A O   1 
ATOM   100   C CB  . PRO A 1 13  ? 77.085  20.859  7.285   1.00 18.08 ? 39   PRO A CB  1 
ATOM   101   C CG  . PRO A 1 13  ? 76.445  19.789  6.443   1.00 19.61 ? 39   PRO A CG  1 
ATOM   102   C CD  . PRO A 1 13  ? 75.524  19.083  7.421   1.00 16.57 ? 39   PRO A CD  1 
ATOM   103   N N   . VAL A 1 14  ? 75.730  23.654  7.301   1.00 16.20 ? 40   VAL A N   1 
ATOM   104   C CA  . VAL A 1 14  ? 75.156  24.773  6.579   1.00 17.52 ? 40   VAL A CA  1 
ATOM   105   C C   . VAL A 1 14  ? 76.174  25.055  5.485   1.00 17.32 ? 40   VAL A C   1 
ATOM   106   O O   . VAL A 1 14  ? 77.280  25.516  5.758   1.00 17.05 ? 40   VAL A O   1 
ATOM   107   C CB  . VAL A 1 14  ? 74.998  26.015  7.475   1.00 18.75 ? 40   VAL A CB  1 
ATOM   108   C CG1 . VAL A 1 14  ? 74.473  27.184  6.659   1.00 18.85 ? 40   VAL A CG1 1 
ATOM   109   C CG2 . VAL A 1 14  ? 74.042  25.715  8.606   1.00 17.27 ? 40   VAL A CG2 1 
ATOM   110   N N   . PRO A 1 15  ? 75.820  24.740  4.230   1.00 16.79 ? 41   PRO A N   1 
ATOM   111   C CA  . PRO A 1 15  ? 76.722  24.964  3.096   1.00 16.48 ? 41   PRO A CA  1 
ATOM   112   C C   . PRO A 1 15  ? 77.138  26.427  3.004   1.00 16.21 ? 41   PRO A C   1 
ATOM   113   O O   . PRO A 1 15  ? 76.423  27.312  3.471   1.00 16.49 ? 41   PRO A O   1 
ATOM   114   C CB  . PRO A 1 15  ? 75.874  24.552  1.893   1.00 16.32 ? 41   PRO A CB  1 
ATOM   115   C CG  . PRO A 1 15  ? 74.954  23.517  2.462   1.00 18.84 ? 41   PRO A CG  1 
ATOM   116   C CD  . PRO A 1 15  ? 74.561  24.118  3.785   1.00 18.57 ? 41   PRO A CD  1 
ATOM   117   N N   . PRO A 1 16  ? 78.313  26.695  2.413   1.00 16.02 ? 42   PRO A N   1 
ATOM   118   C CA  . PRO A 1 16  ? 78.808  28.064  2.258   1.00 15.96 ? 42   PRO A CA  1 
ATOM   119   C C   . PRO A 1 16  ? 77.814  28.811  1.381   1.00 16.57 ? 42   PRO A C   1 
ATOM   120   O O   . PRO A 1 16  ? 77.300  28.245  0.409   1.00 15.00 ? 42   PRO A O   1 
ATOM   121   C CB  . PRO A 1 16  ? 80.142  27.872  1.540   1.00 16.56 ? 42   PRO A CB  1 
ATOM   122   C CG  . PRO A 1 16  ? 80.594  26.545  2.019   1.00 17.57 ? 42   PRO A CG  1 
ATOM   123   C CD  . PRO A 1 16  ? 79.330  25.723  1.980   1.00 15.21 ? 42   PRO A CD  1 
ATOM   124   N N   . LEU A 1 17  ? 77.551  30.073  1.716   1.00 15.55 ? 43   LEU A N   1 
ATOM   125   C CA  . LEU A 1 17  ? 76.618  30.900  0.955   1.00 17.32 ? 43   LEU A CA  1 
ATOM   126   C C   . LEU A 1 17  ? 76.985  31.048  -0.514  1.00 18.26 ? 43   LEU A C   1 
ATOM   127   O O   . LEU A 1 17  ? 76.161  30.814  -1.391  1.00 18.71 ? 43   LEU A O   1 
ATOM   128   C CB  . LEU A 1 17  ? 76.524  32.300  1.574   1.00 16.54 ? 43   LEU A CB  1 
ATOM   129   C CG  . LEU A 1 17  ? 75.584  33.292  0.883   1.00 17.34 ? 43   LEU A CG  1 
ATOM   130   C CD1 . LEU A 1 17  ? 74.172  32.739  0.916   1.00 17.11 ? 43   LEU A CD1 1 
ATOM   131   C CD2 . LEU A 1 17  ? 75.633  34.652  1.564   1.00 18.42 ? 43   LEU A CD2 1 
ATOM   132   N N   . GLN A 1 18  ? 78.223  31.450  -0.787  1.00 19.87 ? 44   GLN A N   1 
ATOM   133   C CA  . GLN A 1 18  ? 78.644  31.659  -2.167  1.00 20.98 ? 44   GLN A CA  1 
ATOM   134   C C   . GLN A 1 18  ? 78.671  30.372  -2.981  1.00 20.83 ? 44   GLN A C   1 
ATOM   135   O O   . GLN A 1 18  ? 78.482  30.391  -4.196  1.00 20.05 ? 44   GLN A O   1 
ATOM   136   C CB  . GLN A 1 18  ? 80.012  32.353  -2.207  1.00 23.31 ? 44   GLN A CB  1 
ATOM   137   C CG  . GLN A 1 18  ? 80.089  33.579  -1.300  1.00 26.00 ? 44   GLN A CG  1 
ATOM   138   C CD  . GLN A 1 18  ? 81.299  34.458  -1.575  1.00 27.97 ? 44   GLN A CD  1 
ATOM   139   O OE1 . GLN A 1 18  ? 82.429  33.976  -1.665  1.00 26.49 ? 44   GLN A OE1 1 
ATOM   140   N NE2 . GLN A 1 18  ? 81.066  35.761  -1.693  1.00 29.30 ? 44   GLN A NE2 1 
ATOM   141   N N   . GLN A 1 19  ? 78.904  29.254  -2.311  1.00 20.20 ? 45   GLN A N   1 
ATOM   142   C CA  . GLN A 1 19  ? 78.929  27.972  -2.993  1.00 20.74 ? 45   GLN A CA  1 
ATOM   143   C C   . GLN A 1 19  ? 77.530  27.585  -3.473  1.00 19.23 ? 45   GLN A C   1 
ATOM   144   O O   . GLN A 1 19  ? 77.344  27.243  -4.639  1.00 18.42 ? 45   GLN A O   1 
ATOM   145   C CB  . GLN A 1 19  ? 79.474  26.882  -2.062  1.00 24.30 ? 45   GLN A CB  1 
ATOM   146   C CG  . GLN A 1 19  ? 79.293  25.469  -2.602  1.00 30.37 ? 45   GLN A CG  1 
ATOM   147   C CD  . GLN A 1 19  ? 79.677  24.398  -1.595  1.00 33.24 ? 45   GLN A CD  1 
ATOM   148   O OE1 . GLN A 1 19  ? 80.855  24.213  -1.282  1.00 36.05 ? 45   GLN A OE1 1 
ATOM   149   N NE2 . GLN A 1 19  ? 78.680  23.690  -1.074  1.00 33.22 ? 45   GLN A NE2 1 
ATOM   150   N N   . SER A 1 20  ? 76.554  27.638  -2.572  1.00 17.03 ? 46   SER A N   1 
ATOM   151   C CA  . SER A 1 20  ? 75.171  27.283  -2.904  1.00 16.88 ? 46   SER A CA  1 
ATOM   152   C C   . SER A 1 20  ? 74.565  28.183  -3.973  1.00 17.24 ? 46   SER A C   1 
ATOM   153   O O   . SER A 1 20  ? 73.794  27.727  -4.814  1.00 16.39 ? 46   SER A O   1 
ATOM   154   C CB  . SER A 1 20  ? 74.280  27.324  -1.655  1.00 14.59 ? 46   SER A CB  1 
ATOM   155   O OG  . SER A 1 20  ? 74.501  26.197  -0.821  1.00 15.11 ? 46   SER A OG  1 
ATOM   156   N N   . LEU A 1 21  ? 74.913  29.463  -3.934  1.00 16.20 ? 47   LEU A N   1 
ATOM   157   C CA  . LEU A 1 21  ? 74.385  30.413  -4.903  1.00 18.14 ? 47   LEU A CA  1 
ATOM   158   C C   . LEU A 1 21  ? 74.960  30.111  -6.285  1.00 18.88 ? 47   LEU A C   1 
ATOM   159   O O   . LEU A 1 21  ? 74.282  30.294  -7.304  1.00 19.08 ? 47   LEU A O   1 
ATOM   160   C CB  . LEU A 1 21  ? 74.722  31.844  -4.478  1.00 18.62 ? 47   LEU A CB  1 
ATOM   161   C CG  . LEU A 1 21  ? 74.070  32.319  -3.175  1.00 20.09 ? 47   LEU A CG  1 
ATOM   162   C CD1 . LEU A 1 21  ? 74.598  33.701  -2.775  1.00 20.56 ? 47   LEU A CD1 1 
ATOM   163   C CD2 . LEU A 1 21  ? 72.565  32.353  -3.374  1.00 19.13 ? 47   LEU A CD2 1 
ATOM   164   N N   . ASP A 1 22  ? 76.204  29.654  -6.319  1.00 19.00 ? 48   ASP A N   1 
ATOM   165   C CA  . ASP A 1 22  ? 76.837  29.297  -7.580  1.00 20.60 ? 48   ASP A CA  1 
ATOM   166   C C   . ASP A 1 22  ? 76.132  28.069  -8.157  1.00 19.96 ? 48   ASP A C   1 
ATOM   167   O O   . ASP A 1 22  ? 75.817  28.022  -9.347  1.00 18.01 ? 48   ASP A O   1 
ATOM   168   C CB  . ASP A 1 22  ? 78.310  28.970  -7.369  1.00 23.44 ? 48   ASP A CB  1 
ATOM   169   C CG  . ASP A 1 22  ? 78.998  28.566  -8.655  1.00 27.43 ? 48   ASP A CG  1 
ATOM   170   O OD1 . ASP A 1 22  ? 79.047  29.409  -9.574  1.00 31.15 ? 48   ASP A OD1 1 
ATOM   171   O OD2 . ASP A 1 22  ? 79.474  27.416  -8.756  1.00 27.35 ? 48   ASP A OD2 1 
ATOM   172   N N   . TYR A 1 23  ? 75.885  27.065  -7.315  1.00 20.19 ? 49   TYR A N   1 
ATOM   173   C CA  . TYR A 1 23  ? 75.214  25.859  -7.788  1.00 19.16 ? 49   TYR A CA  1 
ATOM   174   C C   . TYR A 1 23  ? 73.808  26.193  -8.251  1.00 17.67 ? 49   TYR A C   1 
ATOM   175   O O   . TYR A 1 23  ? 73.304  25.609  -9.207  1.00 17.90 ? 49   TYR A O   1 
ATOM   176   C CB  . TYR A 1 23  ? 75.144  24.793  -6.687  1.00 19.05 ? 49   TYR A CB  1 
ATOM   177   C CG  . TYR A 1 23  ? 76.464  24.114  -6.382  1.00 21.43 ? 49   TYR A CG  1 
ATOM   178   C CD1 . TYR A 1 23  ? 77.343  23.740  -7.406  1.00 21.42 ? 49   TYR A CD1 1 
ATOM   179   C CD2 . TYR A 1 23  ? 76.808  23.789  -5.074  1.00 20.86 ? 49   TYR A CD2 1 
ATOM   180   C CE1 . TYR A 1 23  ? 78.530  23.058  -7.125  1.00 23.02 ? 49   TYR A CE1 1 
ATOM   181   C CE2 . TYR A 1 23  ? 77.992  23.106  -4.785  1.00 23.04 ? 49   TYR A CE2 1 
ATOM   182   C CZ  . TYR A 1 23  ? 78.847  22.743  -5.811  1.00 24.74 ? 49   TYR A CZ  1 
ATOM   183   O OH  . TYR A 1 23  ? 80.003  22.047  -5.517  1.00 26.11 ? 49   TYR A OH  1 
ATOM   184   N N   . TYR A 1 24  ? 73.185  27.142  -7.564  1.00 16.46 ? 50   TYR A N   1 
ATOM   185   C CA  . TYR A 1 24  ? 71.836  27.574  -7.889  1.00 16.39 ? 50   TYR A CA  1 
ATOM   186   C C   . TYR A 1 24  ? 71.788  28.171  -9.296  1.00 16.82 ? 50   TYR A C   1 
ATOM   187   O O   . TYR A 1 24  ? 70.918  27.820  -10.100 1.00 16.43 ? 50   TYR A O   1 
ATOM   188   C CB  . TYR A 1 24  ? 71.371  28.588  -6.840  1.00 16.54 ? 50   TYR A CB  1 
ATOM   189   C CG  . TYR A 1 24  ? 70.054  29.256  -7.131  1.00 16.41 ? 50   TYR A CG  1 
ATOM   190   C CD1 . TYR A 1 24  ? 68.896  28.508  -7.369  1.00 16.92 ? 50   TYR A CD1 1 
ATOM   191   C CD2 . TYR A 1 24  ? 69.959  30.645  -7.170  1.00 19.28 ? 50   TYR A CD2 1 
ATOM   192   C CE1 . TYR A 1 24  ? 67.679  29.137  -7.641  1.00 16.37 ? 50   TYR A CE1 1 
ATOM   193   C CE2 . TYR A 1 24  ? 68.751  31.279  -7.435  1.00 18.07 ? 50   TYR A CE2 1 
ATOM   194   C CZ  . TYR A 1 24  ? 67.616  30.525  -7.672  1.00 17.71 ? 50   TYR A CZ  1 
ATOM   195   O OH  . TYR A 1 24  ? 66.435  31.184  -7.943  1.00 16.01 ? 50   TYR A OH  1 
ATOM   196   N N   . LEU A 1 25  ? 72.731  29.057  -9.591  1.00 17.00 ? 51   LEU A N   1 
ATOM   197   C CA  . LEU A 1 25  ? 72.800  29.694  -10.902 1.00 18.63 ? 51   LEU A CA  1 
ATOM   198   C C   . LEU A 1 25  ? 73.031  28.668  -12.008 1.00 18.68 ? 51   LEU A C   1 
ATOM   199   O O   . LEU A 1 25  ? 72.514  28.813  -13.112 1.00 20.43 ? 51   LEU A O   1 
ATOM   200   C CB  . LEU A 1 25  ? 73.911  30.754  -10.920 1.00 17.21 ? 51   LEU A CB  1 
ATOM   201   C CG  . LEU A 1 25  ? 73.622  32.020  -10.099 1.00 18.10 ? 51   LEU A CG  1 
ATOM   202   C CD1 . LEU A 1 25  ? 74.868  32.883  -10.003 1.00 19.05 ? 51   LEU A CD1 1 
ATOM   203   C CD2 . LEU A 1 25  ? 72.493  32.798  -10.748 1.00 18.04 ? 51   LEU A CD2 1 
ATOM   204   N N   . LYS A 1 26  ? 73.797  27.629  -11.712 1.00 18.04 ? 52   LYS A N   1 
ATOM   205   C CA  . LYS A 1 26  ? 74.069  26.598  -12.712 1.00 19.50 ? 52   LYS A CA  1 
ATOM   206   C C   . LYS A 1 26  ? 72.821  25.773  -12.994 1.00 19.50 ? 52   LYS A C   1 
ATOM   207   O O   . LYS A 1 26  ? 72.535  25.458  -14.148 1.00 19.87 ? 52   LYS A O   1 
ATOM   208   C CB  . LYS A 1 26  ? 75.198  25.672  -12.249 1.00 19.46 ? 52   LYS A CB  1 
ATOM   209   C CG  . LYS A 1 26  ? 76.586  26.293  -12.317 1.00 21.60 ? 52   LYS A CG  1 
ATOM   210   C CD  . LYS A 1 26  ? 77.631  25.357  -11.716 1.00 24.68 ? 52   LYS A CD  1 
ATOM   211   C CE  . LYS A 1 26  ? 79.049  25.784  -12.081 1.00 24.46 ? 52   LYS A CE  1 
ATOM   212   N NZ  . LYS A 1 26  ? 79.340  27.193  -11.705 1.00 26.18 ? 52   LYS A NZ  1 
ATOM   213   N N   . ALA A 1 27  ? 72.084  25.431  -11.934 1.00 17.14 ? 53   ALA A N   1 
ATOM   214   C CA  . ALA A 1 27  ? 70.873  24.629  -12.059 1.00 16.88 ? 53   ALA A CA  1 
ATOM   215   C C   . ALA A 1 27  ? 69.738  25.397  -12.722 1.00 16.74 ? 53   ALA A C   1 
ATOM   216   O O   . ALA A 1 27  ? 68.776  24.795  -13.206 1.00 16.41 ? 53   ALA A O   1 
ATOM   217   C CB  . ALA A 1 27  ? 70.431  24.124  -10.683 1.00 13.97 ? 53   ALA A CB  1 
ATOM   218   N N   . LEU A 1 28  ? 69.844  26.726  -12.741 1.00 16.93 ? 54   LEU A N   1 
ATOM   219   C CA  . LEU A 1 28  ? 68.821  27.559  -13.363 1.00 17.61 ? 54   LEU A CA  1 
ATOM   220   C C   . LEU A 1 28  ? 69.015  27.713  -14.868 1.00 17.74 ? 54   LEU A C   1 
ATOM   221   O O   . LEU A 1 28  ? 68.042  27.833  -15.605 1.00 19.23 ? 54   LEU A O   1 
ATOM   222   C CB  . LEU A 1 28  ? 68.820  28.963  -12.751 1.00 17.86 ? 54   LEU A CB  1 
ATOM   223   C CG  . LEU A 1 28  ? 68.171  29.191  -11.388 1.00 16.21 ? 54   LEU A CG  1 
ATOM   224   C CD1 . LEU A 1 28  ? 68.479  30.607  -10.940 1.00 17.58 ? 54   LEU A CD1 1 
ATOM   225   C CD2 . LEU A 1 28  ? 66.666  28.968  -11.468 1.00 14.44 ? 54   LEU A CD2 1 
ATOM   226   N N   . GLN A 1 29  ? 70.265  27.721  -15.317 1.00 18.75 ? 55   GLN A N   1 
ATOM   227   C CA  . GLN A 1 29  ? 70.563  27.933  -16.731 1.00 21.06 ? 55   GLN A CA  1 
ATOM   228   C C   . GLN A 1 29  ? 69.694  27.123  -17.700 1.00 20.43 ? 55   GLN A C   1 
ATOM   229   O O   . GLN A 1 29  ? 69.197  27.657  -18.694 1.00 19.95 ? 55   GLN A O   1 
ATOM   230   C CB  . GLN A 1 29  ? 72.047  27.667  -16.996 1.00 24.05 ? 55   GLN A CB  1 
ATOM   231   C CG  . GLN A 1 29  ? 72.536  28.168  -18.350 1.00 29.97 ? 55   GLN A CG  1 
ATOM   232   C CD  . GLN A 1 29  ? 73.980  27.802  -18.616 1.00 32.58 ? 55   GLN A CD  1 
ATOM   233   O OE1 . GLN A 1 29  ? 74.880  28.194  -17.870 1.00 33.50 ? 55   GLN A OE1 1 
ATOM   234   N NE2 . GLN A 1 29  ? 74.210  27.044  -19.680 1.00 34.27 ? 55   GLN A NE2 1 
ATOM   235   N N   . PRO A 1 30  ? 69.478  25.832  -17.416 1.00 18.81 ? 56   PRO A N   1 
ATOM   236   C CA  . PRO A 1 30  ? 68.655  25.002  -18.303 1.00 19.11 ? 56   PRO A CA  1 
ATOM   237   C C   . PRO A 1 30  ? 67.139  25.154  -18.183 1.00 19.91 ? 56   PRO A C   1 
ATOM   238   O O   . PRO A 1 30  ? 66.403  24.643  -19.027 1.00 21.57 ? 56   PRO A O   1 
ATOM   239   C CB  . PRO A 1 30  ? 69.115  23.588  -17.964 1.00 18.42 ? 56   PRO A CB  1 
ATOM   240   C CG  . PRO A 1 30  ? 69.433  23.694  -16.501 1.00 19.63 ? 56   PRO A CG  1 
ATOM   241   C CD  . PRO A 1 30  ? 70.181  24.999  -16.424 1.00 17.91 ? 56   PRO A CD  1 
ATOM   242   N N   . ILE A 1 31  ? 66.662  25.856  -17.149 1.00 18.22 ? 57   ILE A N   1 
ATOM   243   C CA  . ILE A 1 31  ? 65.224  26.015  -16.976 1.00 17.06 ? 57   ILE A CA  1 
ATOM   244   C C   . ILE A 1 31  ? 64.685  27.443  -17.033 1.00 17.80 ? 57   ILE A C   1 
ATOM   245   O O   . ILE A 1 31  ? 63.479  27.646  -16.889 1.00 17.12 ? 57   ILE A O   1 
ATOM   246   C CB  . ILE A 1 31  ? 64.743  25.398  -15.651 1.00 19.20 ? 57   ILE A CB  1 
ATOM   247   C CG1 . ILE A 1 31  ? 65.487  26.041  -14.479 1.00 18.58 ? 57   ILE A CG1 1 
ATOM   248   C CG2 . ILE A 1 31  ? 64.942  23.892  -15.677 1.00 18.93 ? 57   ILE A CG2 1 
ATOM   249   C CD1 . ILE A 1 31  ? 64.987  25.611  -13.130 1.00 19.67 ? 57   ILE A CD1 1 
ATOM   250   N N   . VAL A 1 32  ? 65.556  28.431  -17.224 1.00 18.46 ? 58   VAL A N   1 
ATOM   251   C CA  . VAL A 1 32  ? 65.105  29.829  -17.318 1.00 20.68 ? 58   VAL A CA  1 
ATOM   252   C C   . VAL A 1 32  ? 65.680  30.485  -18.565 1.00 21.14 ? 58   VAL A C   1 
ATOM   253   O O   . VAL A 1 32  ? 66.631  29.982  -19.154 1.00 21.73 ? 58   VAL A O   1 
ATOM   254   C CB  . VAL A 1 32  ? 65.523  30.680  -16.075 1.00 19.89 ? 58   VAL A CB  1 
ATOM   255   C CG1 . VAL A 1 32  ? 65.007  30.031  -14.811 1.00 19.13 ? 58   VAL A CG1 1 
ATOM   256   C CG2 . VAL A 1 32  ? 67.036  30.856  -16.032 1.00 18.18 ? 58   VAL A CG2 1 
ATOM   257   N N   . SER A 1 33  ? 65.107  31.617  -18.959 1.00 23.82 ? 59   SER A N   1 
ATOM   258   C CA  . SER A 1 33  ? 65.584  32.329  -20.141 1.00 26.31 ? 59   SER A CA  1 
ATOM   259   C C   . SER A 1 33  ? 66.860  33.080  -19.825 1.00 28.56 ? 59   SER A C   1 
ATOM   260   O O   . SER A 1 33  ? 67.212  33.277  -18.661 1.00 27.68 ? 59   SER A O   1 
ATOM   261   C CB  . SER A 1 33  ? 64.540  33.333  -20.644 1.00 26.97 ? 59   SER A CB  1 
ATOM   262   O OG  . SER A 1 33  ? 64.568  34.517  -19.869 1.00 28.46 ? 59   SER A OG  1 
ATOM   263   N N   . GLU A 1 34  ? 67.552  33.505  -20.876 1.00 30.26 ? 60   GLU A N   1 
ATOM   264   C CA  . GLU A 1 34  ? 68.788  34.242  -20.701 1.00 32.71 ? 60   GLU A CA  1 
ATOM   265   C C   . GLU A 1 34  ? 68.540  35.551  -19.971 1.00 31.90 ? 60   GLU A C   1 
ATOM   266   O O   . GLU A 1 34  ? 69.347  35.954  -19.140 1.00 32.26 ? 60   GLU A O   1 
ATOM   267   C CB  . GLU A 1 34  ? 69.446  34.517  -22.054 1.00 36.16 ? 60   GLU A CB  1 
ATOM   268   C CG  . GLU A 1 34  ? 70.108  33.296  -22.665 1.00 42.67 ? 60   GLU A CG  1 
ATOM   269   C CD  . GLU A 1 34  ? 70.824  33.606  -23.964 1.00 46.58 ? 60   GLU A CD  1 
ATOM   270   O OE1 . GLU A 1 34  ? 71.665  34.531  -23.979 1.00 48.71 ? 60   GLU A OE1 1 
ATOM   271   O OE2 . GLU A 1 34  ? 70.552  32.921  -24.973 1.00 47.58 ? 60   GLU A OE2 1 
ATOM   272   N N   . GLU A 1 35  ? 67.428  36.210  -20.279 1.00 31.71 ? 61   GLU A N   1 
ATOM   273   C CA  . GLU A 1 35  ? 67.099  37.482  -19.638 1.00 31.92 ? 61   GLU A CA  1 
ATOM   274   C C   . GLU A 1 35  ? 66.844  37.286  -18.149 1.00 29.88 ? 61   GLU A C   1 
ATOM   275   O O   . GLU A 1 35  ? 67.314  38.064  -17.320 1.00 30.34 ? 61   GLU A O   1 
ATOM   276   C CB  . GLU A 1 35  ? 65.860  38.113  -20.286 1.00 34.75 ? 61   GLU A CB  1 
ATOM   277   C CG  . GLU A 1 35  ? 66.022  38.505  -21.757 1.00 39.47 ? 61   GLU A CG  1 
ATOM   278   C CD  . GLU A 1 35  ? 66.085  37.310  -22.697 1.00 42.55 ? 61   GLU A CD  1 
ATOM   279   O OE1 . GLU A 1 35  ? 65.146  36.483  -22.682 1.00 43.40 ? 61   GLU A OE1 1 
ATOM   280   O OE2 . GLU A 1 35  ? 67.069  37.200  -23.462 1.00 42.74 ? 61   GLU A OE2 1 
ATOM   281   N N   . GLU A 1 36  ? 66.101  36.239  -17.820 1.00 28.93 ? 62   GLU A N   1 
ATOM   282   C CA  . GLU A 1 36  ? 65.780  35.929  -16.433 1.00 26.84 ? 62   GLU A CA  1 
ATOM   283   C C   . GLU A 1 36  ? 67.033  35.520  -15.678 1.00 26.01 ? 62   GLU A C   1 
ATOM   284   O O   . GLU A 1 36  ? 67.237  35.928  -14.538 1.00 27.13 ? 62   GLU A O   1 
ATOM   285   C CB  . GLU A 1 36  ? 64.745  34.804  -16.369 1.00 26.51 ? 62   GLU A CB  1 
ATOM   286   C CG  . GLU A 1 36  ? 63.495  35.088  -17.188 1.00 25.91 ? 62   GLU A CG  1 
ATOM   287   C CD  . GLU A 1 36  ? 62.577  33.888  -17.286 1.00 25.76 ? 62   GLU A CD  1 
ATOM   288   O OE1 . GLU A 1 36  ? 63.093  32.758  -17.414 1.00 25.09 ? 62   GLU A OE1 1 
ATOM   289   O OE2 . GLU A 1 36  ? 61.342  34.074  -17.260 1.00 23.40 ? 62   GLU A OE2 1 
ATOM   290   N N   . TRP A 1 37  ? 67.876  34.723  -16.316 1.00 24.57 ? 63   TRP A N   1 
ATOM   291   C CA  . TRP A 1 37  ? 69.106  34.273  -15.680 1.00 23.57 ? 63   TRP A CA  1 
ATOM   292   C C   . TRP A 1 37  ? 70.032  35.448  -15.409 1.00 23.52 ? 63   TRP A C   1 
ATOM   293   O O   . TRP A 1 37  ? 70.668  35.519  -14.354 1.00 23.67 ? 63   TRP A O   1 
ATOM   294   C CB  . TRP A 1 37  ? 69.840  33.261  -16.558 1.00 20.86 ? 63   TRP A CB  1 
ATOM   295   C CG  . TRP A 1 37  ? 70.960  32.572  -15.846 1.00 19.13 ? 63   TRP A CG  1 
ATOM   296   C CD1 . TRP A 1 37  ? 70.896  31.377  -15.190 1.00 19.38 ? 63   TRP A CD1 1 
ATOM   297   C CD2 . TRP A 1 37  ? 72.312  33.033  -15.708 1.00 18.23 ? 63   TRP A CD2 1 
ATOM   298   N NE1 . TRP A 1 37  ? 72.121  31.062  -14.658 1.00 17.23 ? 63   TRP A NE1 1 
ATOM   299   C CE2 . TRP A 1 37  ? 73.009  32.061  -14.959 1.00 18.32 ? 63   TRP A CE2 1 
ATOM   300   C CE3 . TRP A 1 37  ? 73.002  34.173  -16.146 1.00 17.53 ? 63   TRP A CE3 1 
ATOM   301   C CZ2 . TRP A 1 37  ? 74.366  32.189  -14.636 1.00 19.52 ? 63   TRP A CZ2 1 
ATOM   302   C CZ3 . TRP A 1 37  ? 74.358  34.300  -15.824 1.00 19.14 ? 63   TRP A CZ3 1 
ATOM   303   C CH2 . TRP A 1 37  ? 75.021  33.310  -15.077 1.00 18.71 ? 63   TRP A CH2 1 
ATOM   304   N N   . ALA A 1 38  ? 70.116  36.364  -16.374 1.00 23.28 ? 64   ALA A N   1 
ATOM   305   C CA  . ALA A 1 38  ? 70.968  37.540  -16.243 1.00 23.75 ? 64   ALA A CA  1 
ATOM   306   C C   . ALA A 1 38  ? 70.526  38.376  -15.042 1.00 23.73 ? 64   ALA A C   1 
ATOM   307   O O   . ALA A 1 38  ? 71.364  38.864  -14.284 1.00 24.95 ? 64   ALA A O   1 
ATOM   308   C CB  . ALA A 1 38  ? 70.912  38.377  -17.519 1.00 22.47 ? 64   ALA A CB  1 
ATOM   309   N N   . HIS A 1 39  ? 69.218  38.534  -14.874 1.00 23.11 ? 65   HIS A N   1 
ATOM   310   C CA  . HIS A 1 39  ? 68.663  39.292  -13.753 1.00 23.93 ? 65   HIS A CA  1 
ATOM   311   C C   . HIS A 1 39  ? 68.962  38.582  -12.426 1.00 24.31 ? 65   HIS A C   1 
ATOM   312   O O   . HIS A 1 39  ? 69.364  39.215  -11.443 1.00 23.04 ? 65   HIS A O   1 
ATOM   313   C CB  . HIS A 1 39  ? 67.150  39.437  -13.926 1.00 25.64 ? 65   HIS A CB  1 
ATOM   314   C CG  . HIS A 1 39  ? 66.486  40.226  -12.840 1.00 28.90 ? 65   HIS A CG  1 
ATOM   315   N ND1 . HIS A 1 39  ? 65.503  39.700  -12.030 1.00 30.35 ? 65   HIS A ND1 1 
ATOM   316   C CD2 . HIS A 1 39  ? 66.666  41.505  -12.431 1.00 29.96 ? 65   HIS A CD2 1 
ATOM   317   C CE1 . HIS A 1 39  ? 65.107  40.619  -11.165 1.00 30.70 ? 65   HIS A CE1 1 
ATOM   318   N NE2 . HIS A 1 39  ? 65.797  41.725  -11.388 1.00 31.78 ? 65   HIS A NE2 1 
ATOM   319   N N   . THR A 1 40  ? 68.758  37.262  -12.394 1.00 22.91 ? 66   THR A N   1 
ATOM   320   C CA  . THR A 1 40  ? 69.009  36.496  -11.181 1.00 22.75 ? 66   THR A CA  1 
ATOM   321   C C   . THR A 1 40  ? 70.475  36.635  -10.802 1.00 23.50 ? 66   THR A C   1 
ATOM   322   O O   . THR A 1 40  ? 70.811  36.835  -9.633  1.00 22.95 ? 66   THR A O   1 
ATOM   323   C CB  . THR A 1 40  ? 68.674  35.006  -11.382 1.00 21.38 ? 66   THR A CB  1 
ATOM   324   O OG1 . THR A 1 40  ? 67.282  34.874  -11.693 1.00 20.64 ? 66   THR A OG1 1 
ATOM   325   C CG2 . THR A 1 40  ? 68.970  34.215  -10.116 1.00 18.23 ? 66   THR A CG2 1 
ATOM   326   N N   . LYS A 1 41  ? 71.341  36.534  -11.804 1.00 23.41 ? 67   LYS A N   1 
ATOM   327   C CA  . LYS A 1 41  ? 72.777  36.659  -11.606 1.00 24.47 ? 67   LYS A CA  1 
ATOM   328   C C   . LYS A 1 41  ? 73.108  37.952  -10.866 1.00 25.09 ? 67   LYS A C   1 
ATOM   329   O O   . LYS A 1 41  ? 73.991  37.974  -10.005 1.00 24.67 ? 67   LYS A O   1 
ATOM   330   C CB  . LYS A 1 41  ? 73.477  36.629  -12.969 1.00 27.05 ? 67   LYS A CB  1 
ATOM   331   C CG  . LYS A 1 41  ? 74.916  37.121  -12.968 1.00 30.42 ? 67   LYS A CG  1 
ATOM   332   C CD  . LYS A 1 41  ? 75.828  36.256  -12.119 1.00 31.86 ? 67   LYS A CD  1 
ATOM   333   C CE  . LYS A 1 41  ? 77.238  36.828  -12.101 1.00 34.09 ? 67   LYS A CE  1 
ATOM   334   N NZ  . LYS A 1 41  ? 78.178  35.953  -11.349 1.00 38.23 ? 67   LYS A NZ  1 
ATOM   335   N N   . GLN A 1 42  ? 72.400  39.020  -11.203 1.00 24.66 ? 68   GLN A N   1 
ATOM   336   C CA  . GLN A 1 42  ? 72.614  40.313  -10.568 1.00 25.68 ? 68   GLN A CA  1 
ATOM   337   C C   . GLN A 1 42  ? 72.100  40.283  -9.135  1.00 23.71 ? 68   GLN A C   1 
ATOM   338   O O   . GLN A 1 42  ? 72.734  40.829  -8.233  1.00 23.31 ? 68   GLN A O   1 
ATOM   339   C CB  . GLN A 1 42  ? 71.899  41.413  -11.354 1.00 28.13 ? 68   GLN A CB  1 
ATOM   340   C CG  . GLN A 1 42  ? 72.466  41.640  -12.748 1.00 35.30 ? 68   GLN A CG  1 
ATOM   341   C CD  . GLN A 1 42  ? 73.884  42.176  -12.729 1.00 38.25 ? 68   GLN A CD  1 
ATOM   342   O OE1 . GLN A 1 42  ? 74.133  43.285  -12.251 1.00 41.76 ? 68   GLN A OE1 1 
ATOM   343   N NE2 . GLN A 1 42  ? 74.825  41.395  -13.246 1.00 39.59 ? 68   GLN A NE2 1 
ATOM   344   N N   . LEU A 1 43  ? 70.951  39.647  -8.927  1.00 22.86 ? 69   LEU A N   1 
ATOM   345   C CA  . LEU A 1 43  ? 70.379  39.557  -7.590  1.00 23.85 ? 69   LEU A CA  1 
ATOM   346   C C   . LEU A 1 43  ? 71.295  38.757  -6.682  1.00 24.39 ? 69   LEU A C   1 
ATOM   347   O O   . LEU A 1 43  ? 71.456  39.083  -5.508  1.00 25.30 ? 69   LEU A O   1 
ATOM   348   C CB  . LEU A 1 43  ? 69.005  38.895  -7.634  1.00 22.18 ? 69   LEU A CB  1 
ATOM   349   C CG  . LEU A 1 43  ? 67.927  39.679  -8.379  1.00 22.06 ? 69   LEU A CG  1 
ATOM   350   C CD1 . LEU A 1 43  ? 66.639  38.884  -8.366  1.00 20.06 ? 69   LEU A CD1 1 
ATOM   351   C CD2 . LEU A 1 43  ? 67.725  41.047  -7.734  1.00 23.69 ? 69   LEU A CD2 1 
ATOM   352   N N   . VAL A 1 44  ? 71.904  37.712  -7.236  1.00 23.92 ? 70   VAL A N   1 
ATOM   353   C CA  . VAL A 1 44  ? 72.813  36.870  -6.476  1.00 23.43 ? 70   VAL A CA  1 
ATOM   354   C C   . VAL A 1 44  ? 74.042  37.647  -6.010  1.00 24.02 ? 70   VAL A C   1 
ATOM   355   O O   . VAL A 1 44  ? 74.406  37.584  -4.836  1.00 23.50 ? 70   VAL A O   1 
ATOM   356   C CB  . VAL A 1 44  ? 73.269  35.653  -7.311  1.00 22.10 ? 70   VAL A CB  1 
ATOM   357   C CG1 . VAL A 1 44  ? 74.408  34.935  -6.614  1.00 21.29 ? 70   VAL A CG1 1 
ATOM   358   C CG2 . VAL A 1 44  ? 72.104  34.701  -7.499  1.00 23.20 ? 70   VAL A CG2 1 
ATOM   359   N N   . ASP A 1 45  ? 74.676  38.375  -6.920  1.00 25.66 ? 71   ASP A N   1 
ATOM   360   C CA  . ASP A 1 45  ? 75.867  39.148  -6.565  1.00 27.03 ? 71   ASP A CA  1 
ATOM   361   C C   . ASP A 1 45  ? 75.577  40.124  -5.429  1.00 27.10 ? 71   ASP A C   1 
ATOM   362   O O   . ASP A 1 45  ? 76.350  40.227  -4.475  1.00 28.05 ? 71   ASP A O   1 
ATOM   363   C CB  . ASP A 1 45  ? 76.393  39.922  -7.777  1.00 29.11 ? 71   ASP A CB  1 
ATOM   364   C CG  . ASP A 1 45  ? 76.912  39.011  -8.874  1.00 32.03 ? 71   ASP A CG  1 
ATOM   365   O OD1 . ASP A 1 45  ? 77.614  38.022  -8.559  1.00 32.32 ? 71   ASP A OD1 1 
ATOM   366   O OD2 . ASP A 1 45  ? 76.631  39.292  -10.058 1.00 34.38 ? 71   ASP A OD2 1 
ATOM   367   N N   . GLU A 1 46  ? 74.464  40.838  -5.534  1.00 26.42 ? 72   GLU A N   1 
ATOM   368   C CA  . GLU A 1 46  ? 74.082  41.805  -4.513  1.00 28.56 ? 72   GLU A CA  1 
ATOM   369   C C   . GLU A 1 46  ? 73.777  41.089  -3.204  1.00 26.78 ? 72   GLU A C   1 
ATOM   370   O O   . GLU A 1 46  ? 74.234  41.492  -2.134  1.00 25.44 ? 72   GLU A O   1 
ATOM   371   C CB  . GLU A 1 46  ? 72.851  42.587  -4.966  1.00 31.55 ? 72   GLU A CB  1 
ATOM   372   C CG  . GLU A 1 46  ? 72.294  43.529  -3.914  1.00 38.50 ? 72   GLU A CG  1 
ATOM   373   C CD  . GLU A 1 46  ? 73.149  44.764  -3.705  1.00 41.96 ? 72   GLU A CD  1 
ATOM   374   O OE1 . GLU A 1 46  ? 74.345  44.627  -3.364  1.00 43.23 ? 72   GLU A OE1 1 
ATOM   375   O OE2 . GLU A 1 46  ? 72.617  45.880  -3.882  1.00 44.38 ? 72   GLU A OE2 1 
ATOM   376   N N   . PHE A 1 47  ? 72.998  40.018  -3.310  1.00 24.96 ? 73   PHE A N   1 
ATOM   377   C CA  . PHE A 1 47  ? 72.597  39.222  -2.161  1.00 23.09 ? 73   PHE A CA  1 
ATOM   378   C C   . PHE A 1 47  ? 73.776  38.720  -1.332  1.00 22.62 ? 73   PHE A C   1 
ATOM   379   O O   . PHE A 1 47  ? 73.694  38.676  -0.106  1.00 23.93 ? 73   PHE A O   1 
ATOM   380   C CB  . PHE A 1 47  ? 71.757  38.030  -2.638  1.00 22.24 ? 73   PHE A CB  1 
ATOM   381   C CG  . PHE A 1 47  ? 71.174  37.202  -1.523  1.00 19.44 ? 73   PHE A CG  1 
ATOM   382   C CD1 . PHE A 1 47  ? 70.224  37.740  -0.657  1.00 20.74 ? 73   PHE A CD1 1 
ATOM   383   C CD2 . PHE A 1 47  ? 71.554  35.876  -1.355  1.00 19.07 ? 73   PHE A CD2 1 
ATOM   384   C CE1 . PHE A 1 47  ? 69.655  36.968  0.356   1.00 17.48 ? 73   PHE A CE1 1 
ATOM   385   C CE2 . PHE A 1 47  ? 70.991  35.095  -0.344  1.00 17.89 ? 73   PHE A CE2 1 
ATOM   386   C CZ  . PHE A 1 47  ? 70.041  35.642  0.509   1.00 17.61 ? 73   PHE A CZ  1 
ATOM   387   N N   . GLN A 1 48  ? 74.870  38.356  -1.985  1.00 22.64 ? 74   GLN A N   1 
ATOM   388   C CA  . GLN A 1 48  ? 76.023  37.822  -1.262  1.00 23.54 ? 74   GLN A CA  1 
ATOM   389   C C   . GLN A 1 48  ? 77.171  38.804  -1.043  1.00 23.77 ? 74   GLN A C   1 
ATOM   390   O O   . GLN A 1 48  ? 78.234  38.413  -0.568  1.00 22.77 ? 74   GLN A O   1 
ATOM   391   C CB  . GLN A 1 48  ? 76.569  36.590  -1.989  1.00 24.56 ? 74   GLN A CB  1 
ATOM   392   C CG  . GLN A 1 48  ? 77.235  36.912  -3.328  1.00 28.70 ? 74   GLN A CG  1 
ATOM   393   C CD  . GLN A 1 48  ? 77.781  35.678  -4.037  1.00 31.34 ? 74   GLN A CD  1 
ATOM   394   O OE1 . GLN A 1 48  ? 78.440  35.786  -5.071  1.00 32.71 ? 74   GLN A OE1 1 
ATOM   395   N NE2 . GLN A 1 48  ? 77.503  34.503  -3.484  1.00 32.93 ? 74   GLN A NE2 1 
ATOM   396   N N   . THR A 1 49  ? 76.968  40.070  -1.378  1.00 25.22 ? 75   THR A N   1 
ATOM   397   C CA  . THR A 1 49  ? 78.029  41.059  -1.215  1.00 27.59 ? 75   THR A CA  1 
ATOM   398   C C   . THR A 1 49  ? 78.402  41.215  0.261   1.00 29.08 ? 75   THR A C   1 
ATOM   399   O O   . THR A 1 49  ? 77.582  40.958  1.143   1.00 30.34 ? 75   THR A O   1 
ATOM   400   C CB  . THR A 1 49  ? 77.599  42.432  -1.766  1.00 27.21 ? 75   THR A CB  1 
ATOM   401   O OG1 . THR A 1 49  ? 78.746  43.280  -1.884  1.00 28.85 ? 75   THR A OG1 1 
ATOM   402   C CG2 . THR A 1 49  ? 76.593  43.087  -0.842  1.00 28.24 ? 75   THR A CG2 1 
ATOM   403   N N   . SER A 1 50  ? 79.636  41.626  0.532   1.00 29.56 ? 76   SER A N   1 
ATOM   404   C CA  . SER A 1 50  ? 80.084  41.817  1.911   1.00 30.21 ? 76   SER A CA  1 
ATOM   405   C C   . SER A 1 50  ? 79.202  42.815  2.644   1.00 29.77 ? 76   SER A C   1 
ATOM   406   O O   . SER A 1 50  ? 78.969  43.918  2.152   1.00 29.94 ? 76   SER A O   1 
ATOM   407   C CB  . SER A 1 50  ? 81.527  42.316  1.946   1.00 30.22 ? 76   SER A CB  1 
ATOM   408   O OG  . SER A 1 50  ? 82.419  41.298  1.550   1.00 27.98 ? 76   SER A OG  1 
ATOM   409   N N   . GLY A 1 51  ? 78.729  42.422  3.822   1.00 30.87 ? 77   GLY A N   1 
ATOM   410   C CA  . GLY A 1 51  ? 77.869  43.286  4.610   1.00 29.68 ? 77   GLY A CA  1 
ATOM   411   C C   . GLY A 1 51  ? 76.447  43.341  4.083   1.00 28.73 ? 77   GLY A C   1 
ATOM   412   O O   . GLY A 1 51  ? 75.654  44.188  4.500   1.00 29.31 ? 77   GLY A O   1 
ATOM   413   N N   . GLY A 1 52  ? 76.115  42.436  3.172   1.00 26.43 ? 78   GLY A N   1 
ATOM   414   C CA  . GLY A 1 52  ? 74.778  42.428  2.608   1.00 24.63 ? 78   GLY A CA  1 
ATOM   415   C C   . GLY A 1 52  ? 73.768  41.608  3.388   1.00 22.78 ? 78   GLY A C   1 
ATOM   416   O O   . GLY A 1 52  ? 74.026  41.189  4.520   1.00 22.62 ? 78   GLY A O   1 
ATOM   417   N N   . VAL A 1 53  ? 72.610  41.384  2.770   1.00 21.97 ? 79   VAL A N   1 
ATOM   418   C CA  . VAL A 1 53  ? 71.514  40.628  3.367   1.00 20.67 ? 79   VAL A CA  1 
ATOM   419   C C   . VAL A 1 53  ? 71.841  39.141  3.504   1.00 20.33 ? 79   VAL A C   1 
ATOM   420   O O   . VAL A 1 53  ? 71.684  38.561  4.582   1.00 20.19 ? 79   VAL A O   1 
ATOM   421   C CB  . VAL A 1 53  ? 70.226  40.776  2.518   1.00 21.32 ? 79   VAL A CB  1 
ATOM   422   C CG1 . VAL A 1 53  ? 69.063  40.020  3.171   1.00 17.77 ? 79   VAL A CG1 1 
ATOM   423   C CG2 . VAL A 1 53  ? 69.888  42.252  2.346   1.00 20.22 ? 79   VAL A CG2 1 
ATOM   424   N N   . GLY A 1 54  ? 72.292  38.532  2.409   1.00 20.22 ? 80   GLY A N   1 
ATOM   425   C CA  . GLY A 1 54  ? 72.622  37.117  2.424   1.00 19.12 ? 80   GLY A CA  1 
ATOM   426   C C   . GLY A 1 54  ? 73.625  36.743  3.497   1.00 18.95 ? 80   GLY A C   1 
ATOM   427   O O   . GLY A 1 54  ? 73.483  35.715  4.160   1.00 17.92 ? 80   GLY A O   1 
ATOM   428   N N   . GLU A 1 55  ? 74.643  37.575  3.672   1.00 18.46 ? 81   GLU A N   1 
ATOM   429   C CA  . GLU A 1 55  ? 75.657  37.314  4.680   1.00 19.02 ? 81   GLU A CA  1 
ATOM   430   C C   . GLU A 1 55  ? 75.037  37.268  6.079   1.00 17.69 ? 81   GLU A C   1 
ATOM   431   O O   . GLU A 1 55  ? 75.384  36.396  6.882   1.00 17.10 ? 81   GLU A O   1 
ATOM   432   C CB  . GLU A 1 55  ? 76.729  38.392  4.621   1.00 22.30 ? 81   GLU A CB  1 
ATOM   433   C CG  . GLU A 1 55  ? 77.951  38.115  5.468   1.00 24.68 ? 81   GLU A CG  1 
ATOM   434   C CD  . GLU A 1 55  ? 79.076  39.074  5.152   1.00 27.92 ? 81   GLU A CD  1 
ATOM   435   O OE1 . GLU A 1 55  ? 78.867  40.295  5.293   1.00 27.90 ? 81   GLU A OE1 1 
ATOM   436   O OE2 . GLU A 1 55  ? 80.165  38.608  4.757   1.00 29.31 ? 81   GLU A OE2 1 
ATOM   437   N N   . ARG A 1 56  ? 74.131  38.196  6.371   1.00 16.92 ? 82   ARG A N   1 
ATOM   438   C CA  . ARG A 1 56  ? 73.476  38.230  7.681   1.00 17.98 ? 82   ARG A CA  1 
ATOM   439   C C   . ARG A 1 56  ? 72.579  37.010  7.869   1.00 15.97 ? 82   ARG A C   1 
ATOM   440   O O   . ARG A 1 56  ? 72.539  36.419  8.945   1.00 16.29 ? 82   ARG A O   1 
ATOM   441   C CB  . ARG A 1 56  ? 72.656  39.513  7.846   1.00 18.06 ? 82   ARG A CB  1 
ATOM   442   C CG  . ARG A 1 56  ? 73.481  40.750  8.176   1.00 21.12 ? 82   ARG A CG  1 
ATOM   443   C CD  . ARG A 1 56  ? 72.584  41.916  8.563   1.00 24.96 ? 82   ARG A CD  1 
ATOM   444   N NE  . ARG A 1 56  ? 71.857  42.467  7.423   1.00 28.51 ? 82   ARG A NE  1 
ATOM   445   C CZ  . ARG A 1 56  ? 72.409  43.228  6.482   1.00 30.34 ? 82   ARG A CZ  1 
ATOM   446   N NH1 . ARG A 1 56  ? 73.699  43.535  6.542   1.00 32.15 ? 82   ARG A NH1 1 
ATOM   447   N NH2 . ARG A 1 56  ? 71.670  43.688  5.482   1.00 29.86 ? 82   ARG A NH2 1 
ATOM   448   N N   . LEU A 1 57  ? 71.857  36.632  6.824   1.00 15.74 ? 83   LEU A N   1 
ATOM   449   C CA  . LEU A 1 57  ? 70.987  35.469  6.917   1.00 14.42 ? 83   LEU A CA  1 
ATOM   450   C C   . LEU A 1 57  ? 71.840  34.217  7.137   1.00 13.48 ? 83   LEU A C   1 
ATOM   451   O O   . LEU A 1 57  ? 71.503  33.359  7.953   1.00 15.18 ? 83   LEU A O   1 
ATOM   452   C CB  . LEU A 1 57  ? 70.149  35.336  5.636   1.00 13.60 ? 83   LEU A CB  1 
ATOM   453   C CG  . LEU A 1 57  ? 69.231  36.529  5.336   1.00 13.99 ? 83   LEU A CG  1 
ATOM   454   C CD1 . LEU A 1 57  ? 68.473  36.298  4.039   1.00 12.36 ? 83   LEU A CD1 1 
ATOM   455   C CD2 . LEU A 1 57  ? 68.259  36.721  6.486   1.00 13.29 ? 83   LEU A CD2 1 
ATOM   456   N N   . GLN A 1 58  ? 72.950  34.127  6.421   1.00 12.74 ? 84   GLN A N   1 
ATOM   457   C CA  . GLN A 1 58  ? 73.854  32.986  6.539   1.00 14.47 ? 84   GLN A CA  1 
ATOM   458   C C   . GLN A 1 58  ? 74.371  32.876  7.974   1.00 15.87 ? 84   GLN A C   1 
ATOM   459   O O   . GLN A 1 58  ? 74.410  31.789  8.552   1.00 14.71 ? 84   GLN A O   1 
ATOM   460   C CB  . GLN A 1 58  ? 75.023  33.143  5.565   1.00 10.88 ? 84   GLN A CB  1 
ATOM   461   C CG  . GLN A 1 58  ? 76.100  32.080  5.681   1.00 12.03 ? 84   GLN A CG  1 
ATOM   462   C CD  . GLN A 1 58  ? 75.701  30.730  5.112   1.00 14.76 ? 84   GLN A CD  1 
ATOM   463   O OE1 . GLN A 1 58  ? 76.477  29.771  5.162   1.00 16.81 ? 84   GLN A OE1 1 
ATOM   464   N NE2 . GLN A 1 58  ? 74.491  30.641  4.570   1.00 12.04 ? 84   GLN A NE2 1 
ATOM   465   N N   . LYS A 1 59  ? 74.771  34.015  8.545   1.00 18.79 ? 85   LYS A N   1 
ATOM   466   C CA  . LYS A 1 59  ? 75.260  34.046  9.917   1.00 18.52 ? 85   LYS A CA  1 
ATOM   467   C C   . LYS A 1 59  ? 74.155  33.520  10.832  1.00 17.13 ? 85   LYS A C   1 
ATOM   468   O O   . LYS A 1 59  ? 74.429  32.788  11.782  1.00 16.72 ? 85   LYS A O   1 
ATOM   469   C CB  . LYS A 1 59  ? 75.612  35.483  10.321  1.00 22.38 ? 85   LYS A CB  1 
ATOM   470   C CG  . LYS A 1 59  ? 76.817  36.079  9.608   1.00 26.22 ? 85   LYS A CG  1 
ATOM   471   C CD  . LYS A 1 59  ? 78.103  35.406  10.053  1.00 30.91 ? 85   LYS A CD  1 
ATOM   472   C CE  . LYS A 1 59  ? 79.325  36.103  9.477   1.00 33.20 ? 85   LYS A CE  1 
ATOM   473   N NZ  . LYS A 1 59  ? 80.585  35.391  9.830   1.00 36.28 ? 85   LYS A NZ  1 
ATOM   474   N N   . GLY A 1 60  ? 72.912  33.903  10.547  1.00 15.76 ? 86   GLY A N   1 
ATOM   475   C CA  . GLY A 1 60  ? 71.786  33.448  11.352  1.00 15.98 ? 86   GLY A CA  1 
ATOM   476   C C   . GLY A 1 60  ? 71.622  31.936  11.323  1.00 16.97 ? 86   GLY A C   1 
ATOM   477   O O   . GLY A 1 60  ? 71.357  31.310  12.356  1.00 16.56 ? 86   GLY A O   1 
ATOM   478   N N   . LEU A 1 61  ? 71.768  31.340  10.137  1.00 16.23 ? 87   LEU A N   1 
ATOM   479   C CA  . LEU A 1 61  ? 71.660  29.892  9.996   1.00 15.85 ? 87   LEU A CA  1 
ATOM   480   C C   . LEU A 1 61  ? 72.768  29.188  10.772  1.00 14.63 ? 87   LEU A C   1 
ATOM   481   O O   . LEU A 1 61  ? 72.539  28.172  11.410  1.00 14.12 ? 87   LEU A O   1 
ATOM   482   C CB  . LEU A 1 61  ? 71.726  29.491  8.518   1.00 14.87 ? 87   LEU A CB  1 
ATOM   483   C CG  . LEU A 1 61  ? 70.528  29.859  7.638   1.00 14.66 ? 87   LEU A CG  1 
ATOM   484   C CD1 . LEU A 1 61  ? 70.806  29.447  6.195   1.00 14.80 ? 87   LEU A CD1 1 
ATOM   485   C CD2 . LEU A 1 61  ? 69.279  29.170  8.166   1.00 14.42 ? 87   LEU A CD2 1 
ATOM   486   N N   . GLU A 1 62  ? 73.976  29.723  10.708  1.00 16.92 ? 88   GLU A N   1 
ATOM   487   C CA  . GLU A 1 62  ? 75.088  29.118  11.430  1.00 18.57 ? 88   GLU A CA  1 
ATOM   488   C C   . GLU A 1 62  ? 74.854  29.189  12.942  1.00 17.99 ? 88   GLU A C   1 
ATOM   489   O O   . GLU A 1 62  ? 75.260  28.292  13.682  1.00 17.44 ? 88   GLU A O   1 
ATOM   490   C CB  . GLU A 1 62  ? 76.400  29.800  11.031  1.00 21.44 ? 88   GLU A CB  1 
ATOM   491   C CG  . GLU A 1 62  ? 76.608  29.780  9.526   1.00 23.88 ? 88   GLU A CG  1 
ATOM   492   C CD  . GLU A 1 62  ? 77.901  30.426  9.094   1.00 28.12 ? 88   GLU A CD  1 
ATOM   493   O OE1 . GLU A 1 62  ? 78.216  31.530  9.590   1.00 29.18 ? 88   GLU A OE1 1 
ATOM   494   O OE2 . GLU A 1 62  ? 78.600  29.838  8.241   1.00 30.71 ? 88   GLU A OE2 1 
ATOM   495   N N   . ARG A 1 63  ? 74.184  30.242  13.409  1.00 17.24 ? 89   ARG A N   1 
ATOM   496   C CA  . ARG A 1 63  ? 73.892  30.351  14.837  1.00 16.73 ? 89   ARG A CA  1 
ATOM   497   C C   . ARG A 1 63  ? 72.804  29.339  15.185  1.00 16.17 ? 89   ARG A C   1 
ATOM   498   O O   . ARG A 1 63  ? 72.830  28.716  16.251  1.00 15.18 ? 89   ARG A O   1 
ATOM   499   C CB  . ARG A 1 63  ? 73.392  31.751  15.209  1.00 16.61 ? 89   ARG A CB  1 
ATOM   500   C CG  . ARG A 1 63  ? 74.443  32.849  15.157  1.00 20.89 ? 89   ARG A CG  1 
ATOM   501   C CD  . ARG A 1 63  ? 73.968  34.068  15.942  1.00 22.92 ? 89   ARG A CD  1 
ATOM   502   N NE  . ARG A 1 63  ? 72.704  34.599  15.432  1.00 24.44 ? 89   ARG A NE  1 
ATOM   503   C CZ  . ARG A 1 63  ? 72.596  35.391  14.374  1.00 25.44 ? 89   ARG A CZ  1 
ATOM   504   N NH1 . ARG A 1 63  ? 73.678  35.758  13.706  1.00 27.65 ? 89   ARG A NH1 1 
ATOM   505   N NH2 . ARG A 1 63  ? 71.403  35.809  13.975  1.00 25.44 ? 89   ARG A NH2 1 
ATOM   506   N N   . ARG A 1 64  ? 71.848  29.184  14.273  1.00 14.17 ? 90   ARG A N   1 
ATOM   507   C CA  . ARG A 1 64  ? 70.738  28.258  14.466  1.00 14.90 ? 90   ARG A CA  1 
ATOM   508   C C   . ARG A 1 64  ? 71.267  26.838  14.612  1.00 14.43 ? 90   ARG A C   1 
ATOM   509   O O   . ARG A 1 64  ? 70.764  26.057  15.415  1.00 13.44 ? 90   ARG A O   1 
ATOM   510   C CB  . ARG A 1 64  ? 69.773  28.340  13.275  1.00 14.25 ? 90   ARG A CB  1 
ATOM   511   C CG  . ARG A 1 64  ? 68.501  27.517  13.436  1.00 13.68 ? 90   ARG A CG  1 
ATOM   512   C CD  . ARG A 1 64  ? 67.610  27.636  12.195  1.00 13.91 ? 90   ARG A CD  1 
ATOM   513   N NE  . ARG A 1 64  ? 66.321  26.979  12.382  1.00 12.90 ? 90   ARG A NE  1 
ATOM   514   C CZ  . ARG A 1 64  ? 65.288  27.514  13.038  1.00 16.88 ? 90   ARG A CZ  1 
ATOM   515   N NH1 . ARG A 1 64  ? 65.372  28.734  13.575  1.00 15.10 ? 90   ARG A NH1 1 
ATOM   516   N NH2 . ARG A 1 64  ? 64.166  26.818  13.177  1.00 14.68 ? 90   ARG A NH2 1 
ATOM   517   N N   . ALA A 1 65  ? 72.293  26.514  13.829  1.00 14.41 ? 91   ALA A N   1 
ATOM   518   C CA  . ALA A 1 65  ? 72.897  25.192  13.867  1.00 16.04 ? 91   ALA A CA  1 
ATOM   519   C C   . ALA A 1 65  ? 73.620  24.944  15.180  1.00 18.32 ? 91   ALA A C   1 
ATOM   520   O O   . ALA A 1 65  ? 73.799  23.800  15.594  1.00 18.60 ? 91   ALA A O   1 
ATOM   521   C CB  . ALA A 1 65  ? 73.867  25.028  12.716  1.00 15.28 ? 91   ALA A CB  1 
ATOM   522   N N   . LYS A 1 66  ? 74.051  26.022  15.835  1.00 21.43 ? 92   LYS A N   1 
ATOM   523   C CA  . LYS A 1 66  ? 74.760  25.895  17.101  1.00 23.36 ? 92   LYS A CA  1 
ATOM   524   C C   . LYS A 1 66  ? 73.836  25.776  18.300  1.00 23.23 ? 92   LYS A C   1 
ATOM   525   O O   . LYS A 1 66  ? 74.266  25.360  19.370  1.00 26.32 ? 92   LYS A O   1 
ATOM   526   C CB  . LYS A 1 66  ? 75.709  27.086  17.306  1.00 26.08 ? 92   LYS A CB  1 
ATOM   527   C CG  . LYS A 1 66  ? 76.804  27.169  16.260  1.00 29.54 ? 92   LYS A CG  1 
ATOM   528   C CD  . LYS A 1 66  ? 77.900  28.153  16.645  1.00 31.82 ? 92   LYS A CD  1 
ATOM   529   C CE  . LYS A 1 66  ? 77.381  29.576  16.746  1.00 34.06 ? 92   LYS A CE  1 
ATOM   530   N NZ  . LYS A 1 66  ? 78.473  30.536  17.067  1.00 35.36 ? 92   LYS A NZ  1 
ATOM   531   N N   . LYS A 1 67  ? 72.567  26.139  18.138  1.00 22.48 ? 93   LYS A N   1 
ATOM   532   C CA  . LYS A 1 67  ? 71.649  26.045  19.263  1.00 24.46 ? 93   LYS A CA  1 
ATOM   533   C C   . LYS A 1 67  ? 70.561  24.989  19.084  1.00 24.23 ? 93   LYS A C   1 
ATOM   534   O O   . LYS A 1 67  ? 69.609  24.923  19.866  1.00 25.89 ? 93   LYS A O   1 
ATOM   535   C CB  . LYS A 1 67  ? 71.025  27.416  19.552  1.00 23.89 ? 93   LYS A CB  1 
ATOM   536   C CG  . LYS A 1 67  ? 70.304  28.044  18.382  1.00 24.81 ? 93   LYS A CG  1 
ATOM   537   C CD  . LYS A 1 67  ? 69.916  29.479  18.706  1.00 24.78 ? 93   LYS A CD  1 
ATOM   538   C CE  . LYS A 1 67  ? 69.091  30.104  17.592  1.00 24.94 ? 93   LYS A CE  1 
ATOM   539   N NZ  . LYS A 1 67  ? 68.802  31.545  17.851  1.00 23.79 ? 93   LYS A NZ  1 
ATOM   540   N N   . MET A 1 68  ? 70.721  24.154  18.060  1.00 24.29 ? 94   MET A N   1 
ATOM   541   C CA  . MET A 1 68  ? 69.764  23.087  17.770  1.00 22.76 ? 94   MET A CA  1 
ATOM   542   C C   . MET A 1 68  ? 70.498  21.828  17.322  1.00 20.50 ? 94   MET A C   1 
ATOM   543   O O   . MET A 1 68  ? 71.635  21.889  16.855  1.00 20.47 ? 94   MET A O   1 
ATOM   544   C CB  . MET A 1 68  ? 68.803  23.498  16.643  1.00 26.18 ? 94   MET A CB  1 
ATOM   545   C CG  . MET A 1 68  ? 68.009  24.768  16.868  1.00 29.28 ? 94   MET A CG  1 
ATOM   546   S SD  . MET A 1 68  ? 66.801  25.000  15.545  1.00 30.89 ? 94   MET A SD  1 
ATOM   547   C CE  . MET A 1 68  ? 65.262  25.167  16.541  1.00 33.22 ? 94   MET A CE  1 
ATOM   548   N N   . GLU A 1 69  ? 69.839  20.682  17.435  1.00 19.27 ? 95   GLU A N   1 
ATOM   549   C CA  . GLU A 1 69  ? 70.456  19.436  17.000  1.00 19.40 ? 95   GLU A CA  1 
ATOM   550   C C   . GLU A 1 69  ? 70.525  19.409  15.474  1.00 15.33 ? 95   GLU A C   1 
ATOM   551   O O   . GLU A 1 69  ? 71.461  18.865  14.899  1.00 15.46 ? 95   GLU A O   1 
ATOM   552   C CB  . GLU A 1 69  ? 69.648  18.235  17.508  1.00 20.52 ? 95   GLU A CB  1 
ATOM   553   C CG  . GLU A 1 69  ? 69.602  18.137  19.019  1.00 27.01 ? 95   GLU A CG  1 
ATOM   554   C CD  . GLU A 1 69  ? 68.519  17.201  19.514  1.00 29.56 ? 95   GLU A CD  1 
ATOM   555   O OE1 . GLU A 1 69  ? 68.619  15.975  19.286  1.00 30.08 ? 95   GLU A OE1 1 
ATOM   556   O OE2 . GLU A 1 69  ? 67.556  17.701  20.132  1.00 33.96 ? 95   GLU A OE2 1 
ATOM   557   N N   . ASN A 1 70  ? 69.530  20.013  14.834  1.00 13.63 ? 96   ASN A N   1 
ATOM   558   C CA  . ASN A 1 70  ? 69.440  20.063  13.373  1.00 11.88 ? 96   ASN A CA  1 
ATOM   559   C C   . ASN A 1 70  ? 68.735  21.371  13.049  1.00 10.12 ? 96   ASN A C   1 
ATOM   560   O O   . ASN A 1 70  ? 67.562  21.561  13.383  1.00 9.86  ? 96   ASN A O   1 
ATOM   561   C CB  . ASN A 1 70  ? 68.621  18.871  12.867  1.00 10.37 ? 96   ASN A CB  1 
ATOM   562   C CG  . ASN A 1 70  ? 68.585  18.784  11.354  1.00 10.74 ? 96   ASN A CG  1 
ATOM   563   O OD1 . ASN A 1 70  ? 68.356  19.777  10.665  1.00 10.20 ? 96   ASN A OD1 1 
ATOM   564   N ND2 . ASN A 1 70  ? 68.790  17.576  10.831  1.00 10.84 ? 96   ASN A ND2 1 
ATOM   565   N N   . TRP A 1 71  ? 69.452  22.277  12.400  1.00 11.53 ? 97   TRP A N   1 
ATOM   566   C CA  . TRP A 1 71  ? 68.886  23.577  12.097  1.00 12.99 ? 97   TRP A CA  1 
ATOM   567   C C   . TRP A 1 71  ? 67.721  23.528  11.137  1.00 14.05 ? 97   TRP A C   1 
ATOM   568   O O   . TRP A 1 71  ? 66.937  24.474  11.062  1.00 15.57 ? 97   TRP A O   1 
ATOM   569   C CB  . TRP A 1 71  ? 69.955  24.510  11.530  1.00 12.59 ? 97   TRP A CB  1 
ATOM   570   C CG  . TRP A 1 71  ? 70.447  24.112  10.176  1.00 13.26 ? 97   TRP A CG  1 
ATOM   571   C CD1 . TRP A 1 71  ? 71.571  23.401  9.893   1.00 13.58 ? 97   TRP A CD1 1 
ATOM   572   C CD2 . TRP A 1 71  ? 69.829  24.409  8.918   1.00 12.39 ? 97   TRP A CD2 1 
ATOM   573   N NE1 . TRP A 1 71  ? 71.698  23.238  8.538   1.00 13.55 ? 97   TRP A NE1 1 
ATOM   574   C CE2 . TRP A 1 71  ? 70.642  23.844  7.913   1.00 13.79 ? 97   TRP A CE2 1 
ATOM   575   C CE3 . TRP A 1 71  ? 68.667  25.098  8.540   1.00 11.84 ? 97   TRP A CE3 1 
ATOM   576   C CZ2 . TRP A 1 71  ? 70.334  23.943  6.553   1.00 12.71 ? 97   TRP A CZ2 1 
ATOM   577   C CZ3 . TRP A 1 71  ? 68.358  25.198  7.182   1.00 13.22 ? 97   TRP A CZ3 1 
ATOM   578   C CH2 . TRP A 1 71  ? 69.192  24.620  6.207   1.00 11.54 ? 97   TRP A CH2 1 
ATOM   579   N N   . LEU A 1 72  ? 67.600  22.422  10.412  1.00 14.36 ? 98   LEU A N   1 
ATOM   580   C CA  . LEU A 1 72  ? 66.548  22.285  9.421   1.00 13.97 ? 98   LEU A CA  1 
ATOM   581   C C   . LEU A 1 72  ? 65.308  21.501  9.857   1.00 16.28 ? 98   LEU A C   1 
ATOM   582   O O   . LEU A 1 72  ? 64.204  21.777  9.384   1.00 14.27 ? 98   LEU A O   1 
ATOM   583   C CB  . LEU A 1 72  ? 67.141  21.634  8.172   1.00 13.15 ? 98   LEU A CB  1 
ATOM   584   C CG  . LEU A 1 72  ? 66.211  21.295  7.007   1.00 12.88 ? 98   LEU A CG  1 
ATOM   585   C CD1 . LEU A 1 72  ? 65.641  22.586  6.394   1.00 10.18 ? 98   LEU A CD1 1 
ATOM   586   C CD2 . LEU A 1 72  ? 66.991  20.468  5.976   1.00 9.35  ? 98   LEU A CD2 1 
ATOM   587   N N   . SER A 1 73  ? 65.504  20.527  10.754  1.00 17.29 ? 99   SER A N   1 
ATOM   588   C CA  . SER A 1 73  ? 64.438  19.645  11.235  1.00 17.75 ? 99   SER A CA  1 
ATOM   589   C C   . SER A 1 73  ? 63.043  20.209  11.357  1.00 17.51 ? 99   SER A C   1 
ATOM   590   O O   . SER A 1 73  ? 62.148  19.838  10.600  1.00 17.57 ? 99   SER A O   1 
ATOM   591   C CB  . SER A 1 73  ? 64.803  19.025  12.586  1.00 19.59 ? 99   SER A CB  1 
ATOM   592   O OG  . SER A 1 73  ? 65.654  17.911  12.433  1.00 23.86 ? 99   SER A OG  1 
ATOM   593   N N   . GLU A 1 74  ? 62.847  21.079  12.339  1.00 14.80 ? 100  GLU A N   1 
ATOM   594   C CA  . GLU A 1 74  ? 61.531  21.644  12.571  1.00 14.45 ? 100  GLU A CA  1 
ATOM   595   C C   . GLU A 1 74  ? 61.015  22.465  11.400  1.00 12.05 ? 100  GLU A C   1 
ATOM   596   O O   . GLU A 1 74  ? 59.838  22.368  11.051  1.00 12.56 ? 100  GLU A O   1 
ATOM   597   C CB  . GLU A 1 74  ? 61.528  22.478  13.860  1.00 15.96 ? 100  GLU A CB  1 
ATOM   598   C CG  . GLU A 1 74  ? 60.177  23.077  14.199  1.00 22.47 ? 100  GLU A CG  1 
ATOM   599   C CD  . GLU A 1 74  ? 60.184  23.813  15.527  1.00 26.35 ? 100  GLU A CD  1 
ATOM   600   O OE1 . GLU A 1 74  ? 59.222  24.555  15.811  1.00 28.81 ? 100  GLU A OE1 1 
ATOM   601   O OE2 . GLU A 1 74  ? 61.158  23.642  16.289  1.00 27.29 ? 100  GLU A OE2 1 
ATOM   602   N N   . TRP A 1 75  ? 61.875  23.271  10.791  1.00 10.88 ? 101  TRP A N   1 
ATOM   603   C CA  . TRP A 1 75  ? 61.445  24.079  9.660   1.00 10.86 ? 101  TRP A CA  1 
ATOM   604   C C   . TRP A 1 75  ? 60.883  23.186  8.552   1.00 10.97 ? 101  TRP A C   1 
ATOM   605   O O   . TRP A 1 75  ? 59.783  23.421  8.044   1.00 9.51  ? 101  TRP A O   1 
ATOM   606   C CB  . TRP A 1 75  ? 62.612  24.900  9.109   1.00 10.28 ? 101  TRP A CB  1 
ATOM   607   C CG  . TRP A 1 75  ? 62.803  26.236  9.777   1.00 9.89  ? 101  TRP A CG  1 
ATOM   608   C CD1 . TRP A 1 75  ? 61.891  26.908  10.546  1.00 10.12 ? 101  TRP A CD1 1 
ATOM   609   C CD2 . TRP A 1 75  ? 63.927  27.118  9.634   1.00 10.59 ? 101  TRP A CD2 1 
ATOM   610   N NE1 . TRP A 1 75  ? 62.372  28.154  10.881  1.00 13.39 ? 101  TRP A NE1 1 
ATOM   611   C CE2 . TRP A 1 75  ? 63.620  28.308  10.334  1.00 11.96 ? 101  TRP A CE2 1 
ATOM   612   C CE3 . TRP A 1 75  ? 65.162  27.019  8.976   1.00 10.75 ? 101  TRP A CE3 1 
ATOM   613   C CZ2 . TRP A 1 75  ? 64.503  29.393  10.393  1.00 10.51 ? 101  TRP A CZ2 1 
ATOM   614   C CZ3 . TRP A 1 75  ? 66.039  28.102  9.034   1.00 10.69 ? 101  TRP A CZ3 1 
ATOM   615   C CH2 . TRP A 1 75  ? 65.702  29.271  9.737   1.00 9.65  ? 101  TRP A CH2 1 
ATOM   616   N N   . TRP A 1 76  ? 61.636  22.152  8.188   1.00 10.51 ? 102  TRP A N   1 
ATOM   617   C CA  . TRP A 1 76  ? 61.203  21.258  7.130   1.00 10.65 ? 102  TRP A CA  1 
ATOM   618   C C   . TRP A 1 76  ? 59.884  20.580  7.425   1.00 12.62 ? 102  TRP A C   1 
ATOM   619   O O   . TRP A 1 76  ? 58.947  20.640  6.627   1.00 12.73 ? 102  TRP A O   1 
ATOM   620   C CB  . TRP A 1 76  ? 62.254  20.184  6.856   1.00 10.83 ? 102  TRP A CB  1 
ATOM   621   C CG  . TRP A 1 76  ? 61.849  19.274  5.732   1.00 12.22 ? 102  TRP A CG  1 
ATOM   622   C CD1 . TRP A 1 76  ? 61.549  17.948  5.819   1.00 12.36 ? 102  TRP A CD1 1 
ATOM   623   C CD2 . TRP A 1 76  ? 61.685  19.633  4.351   1.00 11.04 ? 102  TRP A CD2 1 
ATOM   624   N NE1 . TRP A 1 76  ? 61.211  17.450  4.576   1.00 12.39 ? 102  TRP A NE1 1 
ATOM   625   C CE2 . TRP A 1 76  ? 61.289  18.465  3.659   1.00 9.95  ? 102  TRP A CE2 1 
ATOM   626   C CE3 . TRP A 1 76  ? 61.831  20.828  3.630   1.00 11.21 ? 102  TRP A CE3 1 
ATOM   627   C CZ2 . TRP A 1 76  ? 61.042  18.456  2.279   1.00 10.38 ? 102  TRP A CZ2 1 
ATOM   628   C CZ3 . TRP A 1 76  ? 61.580  20.818  2.250   1.00 11.41 ? 102  TRP A CZ3 1 
ATOM   629   C CH2 . TRP A 1 76  ? 61.191  19.638  1.596   1.00 11.00 ? 102  TRP A CH2 1 
ATOM   630   N N   . LEU A 1 77  ? 59.820  19.913  8.570   1.00 13.24 ? 103  LEU A N   1 
ATOM   631   C CA  . LEU A 1 77  ? 58.615  19.208  8.960   1.00 15.97 ? 103  LEU A CA  1 
ATOM   632   C C   . LEU A 1 77  ? 57.400  20.122  8.922   1.00 16.56 ? 103  LEU A C   1 
ATOM   633   O O   . LEU A 1 77  ? 56.314  19.718  8.517   1.00 15.70 ? 103  LEU A O   1 
ATOM   634   C CB  . LEU A 1 77  ? 58.790  18.635  10.366  1.00 16.27 ? 103  LEU A CB  1 
ATOM   635   C CG  . LEU A 1 77  ? 57.518  18.196  11.086  1.00 20.87 ? 103  LEU A CG  1 
ATOM   636   C CD1 . LEU A 1 77  ? 56.804  17.099  10.304  1.00 20.68 ? 103  LEU A CD1 1 
ATOM   637   C CD2 . LEU A 1 77  ? 57.892  17.718  12.476  1.00 21.69 ? 103  LEU A CD2 1 
ATOM   638   N N   . LYS A 1 78  ? 57.603  21.363  9.337   1.00 17.42 ? 104  LYS A N   1 
ATOM   639   C CA  . LYS A 1 78  ? 56.537  22.350  9.384   1.00 17.98 ? 104  LYS A CA  1 
ATOM   640   C C   . LYS A 1 78  ? 56.085  22.841  8.003   1.00 17.87 ? 104  LYS A C   1 
ATOM   641   O O   . LYS A 1 78  ? 54.894  22.778  7.670   1.00 16.84 ? 104  LYS A O   1 
ATOM   642   C CB  . LYS A 1 78  ? 57.003  23.540  10.233  1.00 21.85 ? 104  LYS A CB  1 
ATOM   643   C CG  . LYS A 1 78  ? 55.912  24.484  10.688  1.00 26.82 ? 104  LYS A CG  1 
ATOM   644   C CD  . LYS A 1 78  ? 56.481  25.801  11.255  1.00 30.05 ? 104  LYS A CD  1 
ATOM   645   C CE  . LYS A 1 78  ? 57.178  26.646  10.180  1.00 29.72 ? 104  LYS A CE  1 
ATOM   646   N NZ  . LYS A 1 78  ? 57.643  27.974  10.695  1.00 29.69 ? 104  LYS A NZ  1 
ATOM   647   N N   . THR A 1 79  ? 57.024  23.330  7.199   1.00 15.94 ? 105  THR A N   1 
ATOM   648   C CA  . THR A 1 79  ? 56.670  23.862  5.885   1.00 18.06 ? 105  THR A CA  1 
ATOM   649   C C   . THR A 1 79  ? 56.292  22.783  4.878   1.00 18.76 ? 105  THR A C   1 
ATOM   650   O O   . THR A 1 79  ? 55.434  22.991  4.019   1.00 17.83 ? 105  THR A O   1 
ATOM   651   C CB  . THR A 1 79  ? 57.818  24.735  5.289   1.00 18.58 ? 105  THR A CB  1 
ATOM   652   O OG1 . THR A 1 79  ? 58.957  23.918  4.975   1.00 18.66 ? 105  THR A OG1 1 
ATOM   653   C CG2 . THR A 1 79  ? 58.237  25.807  6.287   1.00 16.42 ? 105  THR A CG2 1 
ATOM   654   N N   . ALA A 1 80  ? 56.911  21.617  4.996   1.00 17.76 ? 106  ALA A N   1 
ATOM   655   C CA  . ALA A 1 80  ? 56.624  20.549  4.061   1.00 17.47 ? 106  ALA A CA  1 
ATOM   656   C C   . ALA A 1 80  ? 55.380  19.731  4.387   1.00 18.37 ? 106  ALA A C   1 
ATOM   657   O O   . ALA A 1 80  ? 54.743  19.208  3.478   1.00 18.82 ? 106  ALA A O   1 
ATOM   658   C CB  . ALA A 1 80  ? 57.820  19.635  3.949   1.00 18.98 ? 106  ALA A CB  1 
ATOM   659   N N   . TYR A 1 81  ? 55.016  19.622  5.666   1.00 17.32 ? 107  TYR A N   1 
ATOM   660   C CA  . TYR A 1 81  ? 53.862  18.811  6.024   1.00 15.30 ? 107  TYR A CA  1 
ATOM   661   C C   . TYR A 1 81  ? 52.844  19.420  6.984   1.00 15.54 ? 107  TYR A C   1 
ATOM   662   O O   . TYR A 1 81  ? 51.682  19.631  6.618   1.00 14.19 ? 107  TYR A O   1 
ATOM   663   C CB  . TYR A 1 81  ? 54.350  17.467  6.591   1.00 14.94 ? 107  TYR A CB  1 
ATOM   664   C CG  . TYR A 1 81  ? 55.336  16.757  5.683   1.00 16.75 ? 107  TYR A CG  1 
ATOM   665   C CD1 . TYR A 1 81  ? 56.662  16.550  6.074   1.00 13.91 ? 107  TYR A CD1 1 
ATOM   666   C CD2 . TYR A 1 81  ? 54.959  16.343  4.404   1.00 17.28 ? 107  TYR A CD2 1 
ATOM   667   C CE1 . TYR A 1 81  ? 57.588  15.956  5.204   1.00 15.12 ? 107  TYR A CE1 1 
ATOM   668   C CE2 . TYR A 1 81  ? 55.875  15.747  3.536   1.00 15.88 ? 107  TYR A CE2 1 
ATOM   669   C CZ  . TYR A 1 81  ? 57.180  15.557  3.934   1.00 16.73 ? 107  TYR A CZ  1 
ATOM   670   O OH  . TYR A 1 81  ? 58.071  14.993  3.046   1.00 14.67 ? 107  TYR A OH  1 
ATOM   671   N N   . LEU A 1 82  ? 53.281  19.692  8.212   1.00 14.96 ? 108  LEU A N   1 
ATOM   672   C CA  . LEU A 1 82  ? 52.393  20.224  9.242   1.00 15.20 ? 108  LEU A CA  1 
ATOM   673   C C   . LEU A 1 82  ? 51.643  21.478  8.828   1.00 15.69 ? 108  LEU A C   1 
ATOM   674   O O   . LEU A 1 82  ? 50.518  21.698  9.268   1.00 15.91 ? 108  LEU A O   1 
ATOM   675   C CB  . LEU A 1 82  ? 53.165  20.467  10.549  1.00 15.65 ? 108  LEU A CB  1 
ATOM   676   C CG  . LEU A 1 82  ? 53.883  19.250  11.159  1.00 18.05 ? 108  LEU A CG  1 
ATOM   677   C CD1 . LEU A 1 82  ? 54.516  19.617  12.496  1.00 19.12 ? 108  LEU A CD1 1 
ATOM   678   C CD2 . LEU A 1 82  ? 52.895  18.119  11.358  1.00 17.10 ? 108  LEU A CD2 1 
ATOM   679   N N   . GLN A 1 83  ? 52.258  22.300  7.983   1.00 15.77 ? 109  GLN A N   1 
ATOM   680   C CA  . GLN A 1 83  ? 51.604  23.515  7.513   1.00 17.49 ? 109  GLN A CA  1 
ATOM   681   C C   . GLN A 1 83  ? 50.955  23.308  6.145   1.00 16.78 ? 109  GLN A C   1 
ATOM   682   O O   . GLN A 1 83  ? 50.214  24.165  5.673   1.00 17.40 ? 109  GLN A O   1 
ATOM   683   C CB  . GLN A 1 83  ? 52.598  24.675  7.458   1.00 18.35 ? 109  GLN A CB  1 
ATOM   684   C CG  . GLN A 1 83  ? 53.081  25.081  8.838   1.00 23.40 ? 109  GLN A CG  1 
ATOM   685   C CD  . GLN A 1 83  ? 53.912  26.351  8.840   1.00 23.68 ? 109  GLN A CD  1 
ATOM   686   O OE1 . GLN A 1 83  ? 54.116  26.951  9.889   1.00 28.01 ? 109  GLN A OE1 1 
ATOM   687   N NE2 . GLN A 1 83  ? 54.406  26.749  7.673   1.00 25.97 ? 109  GLN A NE2 1 
ATOM   688   N N   . PHE A 1 84  ? 51.228  22.173  5.510   1.00 15.21 ? 110  PHE A N   1 
ATOM   689   C CA  . PHE A 1 84  ? 50.627  21.881  4.210   1.00 14.52 ? 110  PHE A CA  1 
ATOM   690   C C   . PHE A 1 84  ? 49.172  21.546  4.516   1.00 13.28 ? 110  PHE A C   1 
ATOM   691   O O   . PHE A 1 84  ? 48.880  20.540  5.165   1.00 13.70 ? 110  PHE A O   1 
ATOM   692   C CB  . PHE A 1 84  ? 51.352  20.699  3.549   1.00 12.97 ? 110  PHE A CB  1 
ATOM   693   C CG  . PHE A 1 84  ? 50.935  20.445  2.126   1.00 16.09 ? 110  PHE A CG  1 
ATOM   694   C CD1 . PHE A 1 84  ? 50.545  21.496  1.294   1.00 14.49 ? 110  PHE A CD1 1 
ATOM   695   C CD2 . PHE A 1 84  ? 50.978  19.158  1.600   1.00 15.04 ? 110  PHE A CD2 1 
ATOM   696   C CE1 . PHE A 1 84  ? 50.206  21.271  -0.038  1.00 14.63 ? 110  PHE A CE1 1 
ATOM   697   C CE2 . PHE A 1 84  ? 50.639  18.923  0.262   1.00 16.09 ? 110  PHE A CE2 1 
ATOM   698   C CZ  . PHE A 1 84  ? 50.256  19.974  -0.554  1.00 12.51 ? 110  PHE A CZ  1 
ATOM   699   N N   . ARG A 1 85  ? 48.259  22.395  4.047   1.00 12.80 ? 111  ARG A N   1 
ATOM   700   C CA  . ARG A 1 85  ? 46.841  22.226  4.336   1.00 13.00 ? 111  ARG A CA  1 
ATOM   701   C C   . ARG A 1 85  ? 46.020  21.391  3.376   1.00 14.32 ? 111  ARG A C   1 
ATOM   702   O O   . ARG A 1 85  ? 44.850  21.118  3.627   1.00 14.65 ? 111  ARG A O   1 
ATOM   703   C CB  . ARG A 1 85  ? 46.194  23.602  4.498   1.00 12.77 ? 111  ARG A CB  1 
ATOM   704   C CG  . ARG A 1 85  ? 46.930  24.500  5.490   1.00 13.93 ? 111  ARG A CG  1 
ATOM   705   C CD  . ARG A 1 85  ? 47.063  23.830  6.863   1.00 12.04 ? 111  ARG A CD  1 
ATOM   706   N NE  . ARG A 1 85  ? 45.793  23.789  7.591   1.00 13.00 ? 111  ARG A NE  1 
ATOM   707   C CZ  . ARG A 1 85  ? 45.556  23.049  8.666   1.00 14.58 ? 111  ARG A CZ  1 
ATOM   708   N NH1 . ARG A 1 85  ? 46.499  22.258  9.167   1.00 16.89 ? 111  ARG A NH1 1 
ATOM   709   N NH2 . ARG A 1 85  ? 44.377  23.116  9.266   1.00 15.63 ? 111  ARG A NH2 1 
ATOM   710   N N   . GLN A 1 86  ? 46.614  20.987  2.267   1.00 16.30 ? 112  GLN A N   1 
ATOM   711   C CA  . GLN A 1 86  ? 45.876  20.171  1.326   1.00 16.18 ? 112  GLN A CA  1 
ATOM   712   C C   . GLN A 1 86  ? 45.676  18.794  1.949   1.00 15.47 ? 112  GLN A C   1 
ATOM   713   O O   . GLN A 1 86  ? 46.372  18.417  2.892   1.00 14.50 ? 112  GLN A O   1 
ATOM   714   C CB  . GLN A 1 86  ? 46.648  20.055  0.010   1.00 17.34 ? 112  GLN A CB  1 
ATOM   715   C CG  . GLN A 1 86  ? 46.623  21.330  -0.824  1.00 20.50 ? 112  GLN A CG  1 
ATOM   716   C CD  . GLN A 1 86  ? 45.226  21.679  -1.297  1.00 24.90 ? 112  GLN A CD  1 
ATOM   717   O OE1 . GLN A 1 86  ? 44.794  22.829  -1.212  1.00 27.64 ? 112  GLN A OE1 1 
ATOM   718   N NE2 . GLN A 1 86  ? 44.513  20.683  -1.809  1.00 23.97 ? 112  GLN A NE2 1 
ATOM   719   N N   . PRO A 1 87  ? 44.701  18.027  1.450   1.00 15.02 ? 113  PRO A N   1 
ATOM   720   C CA  . PRO A 1 87  ? 44.478  16.691  2.008   1.00 12.65 ? 113  PRO A CA  1 
ATOM   721   C C   . PRO A 1 87  ? 45.779  15.875  1.999   1.00 11.56 ? 113  PRO A C   1 
ATOM   722   O O   . PRO A 1 87  ? 46.598  16.028  1.095   1.00 11.61 ? 113  PRO A O   1 
ATOM   723   C CB  . PRO A 1 87  ? 43.429  16.106  1.064   1.00 13.20 ? 113  PRO A CB  1 
ATOM   724   C CG  . PRO A 1 87  ? 42.630  17.321  0.662   1.00 13.41 ? 113  PRO A CG  1 
ATOM   725   C CD  . PRO A 1 87  ? 43.713  18.337  0.397   1.00 12.56 ? 113  PRO A CD  1 
ATOM   726   N N   . VAL A 1 88  ? 45.986  15.023  2.998   1.00 10.10 ? 114  VAL A N   1 
ATOM   727   C CA  . VAL A 1 88  ? 47.191  14.204  3.017   1.00 12.03 ? 114  VAL A CA  1 
ATOM   728   C C   . VAL A 1 88  ? 47.058  13.105  1.952   1.00 12.13 ? 114  VAL A C   1 
ATOM   729   O O   . VAL A 1 88  ? 48.057  12.617  1.406   1.00 13.16 ? 114  VAL A O   1 
ATOM   730   C CB  . VAL A 1 88  ? 47.402  13.553  4.394   1.00 12.28 ? 114  VAL A CB  1 
ATOM   731   C CG1 . VAL A 1 88  ? 47.641  14.636  5.449   1.00 13.22 ? 114  VAL A CG1 1 
ATOM   732   C CG2 . VAL A 1 88  ? 46.189  12.705  4.761   1.00 13.05 ? 114  VAL A CG2 1 
ATOM   733   N N   . VAL A 1 89  ? 45.828  12.729  1.648   1.00 11.25 ? 115  VAL A N   1 
ATOM   734   C CA  . VAL A 1 89  ? 45.594  11.689  0.648   1.00 12.98 ? 115  VAL A CA  1 
ATOM   735   C C   . VAL A 1 89  ? 46.036  12.161  -0.729  1.00 12.69 ? 115  VAL A C   1 
ATOM   736   O O   . VAL A 1 89  ? 45.713  13.275  -1.149  1.00 12.58 ? 115  VAL A O   1 
ATOM   737   C CB  . VAL A 1 89  ? 44.113  11.292  0.623   1.00 12.91 ? 115  VAL A CB  1 
ATOM   738   C CG1 . VAL A 1 89  ? 43.839  10.304  -0.495  1.00 15.85 ? 115  VAL A CG1 1 
ATOM   739   C CG2 . VAL A 1 89  ? 43.742  10.685  1.955   1.00 14.27 ? 115  VAL A CG2 1 
ATOM   740   N N   . ILE A 1 90  ? 46.802  11.312  -1.405  1.00 13.04 ? 116  ILE A N   1 
ATOM   741   C CA  . ILE A 1 90  ? 47.319  11.597  -2.736  1.00 12.59 ? 116  ILE A CA  1 
ATOM   742   C C   . ILE A 1 90  ? 48.387  12.680  -2.797  1.00 13.60 ? 116  ILE A C   1 
ATOM   743   O O   . ILE A 1 90  ? 49.432  12.499  -3.418  1.00 12.61 ? 116  ILE A O   1 
ATOM   744   C CB  . ILE A 1 90  ? 46.179  11.997  -3.700  1.00 14.30 ? 116  ILE A CB  1 
ATOM   745   C CG1 . ILE A 1 90  ? 45.206  10.825  -3.865  1.00 13.54 ? 116  ILE A CG1 1 
ATOM   746   C CG2 . ILE A 1 90  ? 46.751  12.401  -5.046  1.00 10.72 ? 116  ILE A CG2 1 
ATOM   747   C CD1 . ILE A 1 90  ? 43.965  11.177  -4.645  1.00 17.53 ? 116  ILE A CD1 1 
ATOM   748   N N   . TYR A 1 91  ? 48.128  13.806  -2.154  1.00 14.50 ? 117  TYR A N   1 
ATOM   749   C CA  . TYR A 1 91  ? 49.070  14.918  -2.207  1.00 14.00 ? 117  TYR A CA  1 
ATOM   750   C C   . TYR A 1 91  ? 50.239  14.844  -1.230  1.00 14.31 ? 117  TYR A C   1 
ATOM   751   O O   . TYR A 1 91  ? 51.222  15.578  -1.388  1.00 14.49 ? 117  TYR A O   1 
ATOM   752   C CB  . TYR A 1 91  ? 48.322  16.231  -1.996  1.00 15.00 ? 117  TYR A CB  1 
ATOM   753   C CG  . TYR A 1 91  ? 47.053  16.325  -2.806  1.00 14.68 ? 117  TYR A CG  1 
ATOM   754   C CD1 . TYR A 1 91  ? 45.821  16.510  -2.182  1.00 15.25 ? 117  TYR A CD1 1 
ATOM   755   C CD2 . TYR A 1 91  ? 47.076  16.197  -4.194  1.00 15.93 ? 117  TYR A CD2 1 
ATOM   756   C CE1 . TYR A 1 91  ? 44.640  16.559  -2.918  1.00 16.30 ? 117  TYR A CE1 1 
ATOM   757   C CE2 . TYR A 1 91  ? 45.905  16.246  -4.940  1.00 15.78 ? 117  TYR A CE2 1 
ATOM   758   C CZ  . TYR A 1 91  ? 44.696  16.422  -4.301  1.00 17.33 ? 117  TYR A CZ  1 
ATOM   759   O OH  . TYR A 1 91  ? 43.541  16.417  -5.042  1.00 16.44 ? 117  TYR A OH  1 
ATOM   760   N N   . SER A 1 92  ? 50.159  13.957  -0.239  1.00 11.89 ? 118  SER A N   1 
ATOM   761   C CA  . SER A 1 92  ? 51.226  13.859  0.750   1.00 12.86 ? 118  SER A CA  1 
ATOM   762   C C   . SER A 1 92  ? 51.585  12.427  1.154   1.00 12.25 ? 118  SER A C   1 
ATOM   763   O O   . SER A 1 92  ? 52.738  12.022  1.059   1.00 13.65 ? 118  SER A O   1 
ATOM   764   C CB  . SER A 1 92  ? 50.830  14.661  1.989   1.00 13.75 ? 118  SER A CB  1 
ATOM   765   O OG  . SER A 1 92  ? 51.834  14.588  2.978   1.00 17.61 ? 118  SER A OG  1 
ATOM   766   N N   . SER A 1 93  ? 50.596  11.671  1.615   1.00 11.48 ? 119  SER A N   1 
ATOM   767   C CA  . SER A 1 93  ? 50.815  10.293  2.033   1.00 12.00 ? 119  SER A CA  1 
ATOM   768   C C   . SER A 1 93  ? 51.178  9.353   0.881   1.00 12.72 ? 119  SER A C   1 
ATOM   769   O O   . SER A 1 93  ? 50.327  8.990   0.070   1.00 12.44 ? 119  SER A O   1 
ATOM   770   C CB  . SER A 1 93  ? 49.568  9.774   2.741   1.00 10.70 ? 119  SER A CB  1 
ATOM   771   O OG  . SER A 1 93  ? 49.329  10.520  3.918   1.00 12.27 ? 119  SER A OG  1 
ATOM   772   N N   . PRO A 1 94  ? 52.449  8.930   0.807   1.00 13.18 ? 120  PRO A N   1 
ATOM   773   C CA  . PRO A 1 94  ? 52.894  8.026   -0.260  1.00 15.35 ? 120  PRO A CA  1 
ATOM   774   C C   . PRO A 1 94  ? 52.221  6.666   -0.154  1.00 16.46 ? 120  PRO A C   1 
ATOM   775   O O   . PRO A 1 94  ? 51.924  6.201   0.947   1.00 17.34 ? 120  PRO A O   1 
ATOM   776   C CB  . PRO A 1 94  ? 54.402  7.915   -0.020  1.00 14.64 ? 120  PRO A CB  1 
ATOM   777   C CG  . PRO A 1 94  ? 54.730  9.171   0.707   1.00 13.75 ? 120  PRO A CG  1 
ATOM   778   C CD  . PRO A 1 94  ? 53.586  9.290   1.666   1.00 14.16 ? 120  PRO A CD  1 
ATOM   779   N N   . GLY A 1 95  ? 51.984  6.037   -1.303  1.00 16.68 ? 121  GLY A N   1 
ATOM   780   C CA  . GLY A 1 95  ? 51.368  4.724   -1.322  1.00 16.71 ? 121  GLY A CA  1 
ATOM   781   C C   . GLY A 1 95  ? 52.391  3.704   -1.789  1.00 17.24 ? 121  GLY A C   1 
ATOM   782   O O   . GLY A 1 95  ? 53.329  4.047   -2.504  1.00 17.25 ? 121  GLY A O   1 
ATOM   783   N N   . VAL A 1 96  ? 52.221  2.451   -1.388  1.00 18.17 ? 122  VAL A N   1 
ATOM   784   C CA  . VAL A 1 96  ? 53.161  1.400   -1.767  1.00 18.43 ? 122  VAL A CA  1 
ATOM   785   C C   . VAL A 1 96  ? 52.407  0.156   -2.235  1.00 18.50 ? 122  VAL A C   1 
ATOM   786   O O   . VAL A 1 96  ? 51.446  -0.275  -1.589  1.00 17.77 ? 122  VAL A O   1 
ATOM   787   C CB  . VAL A 1 96  ? 54.082  1.023   -0.565  1.00 19.51 ? 122  VAL A CB  1 
ATOM   788   C CG1 . VAL A 1 96  ? 55.112  -0.023  -0.975  1.00 17.19 ? 122  VAL A CG1 1 
ATOM   789   C CG2 . VAL A 1 96  ? 54.783  2.272   -0.043  1.00 19.94 ? 122  VAL A CG2 1 
ATOM   790   N N   . ILE A 1 97  ? 52.825  -0.396  -3.368  1.00 18.23 ? 123  ILE A N   1 
ATOM   791   C CA  . ILE A 1 97  ? 52.213  -1.607  -3.909  1.00 18.86 ? 123  ILE A CA  1 
ATOM   792   C C   . ILE A 1 97  ? 53.175  -2.760  -3.672  1.00 16.53 ? 123  ILE A C   1 
ATOM   793   O O   . ILE A 1 97  ? 54.292  -2.758  -4.187  1.00 15.97 ? 123  ILE A O   1 
ATOM   794   C CB  . ILE A 1 97  ? 51.940  -1.477  -5.423  1.00 22.19 ? 123  ILE A CB  1 
ATOM   795   C CG1 . ILE A 1 97  ? 50.523  -0.957  -5.645  1.00 26.80 ? 123  ILE A CG1 1 
ATOM   796   C CG2 . ILE A 1 97  ? 52.080  -2.823  -6.113  1.00 25.65 ? 123  ILE A CG2 1 
ATOM   797   C CD1 . ILE A 1 97  ? 50.131  -0.858  -7.096  1.00 27.14 ? 123  ILE A CD1 1 
ATOM   798   N N   . LEU A 1 98  ? 52.749  -3.740  -2.883  1.00 16.27 ? 124  LEU A N   1 
ATOM   799   C CA  . LEU A 1 98  ? 53.597  -4.884  -2.576  1.00 18.05 ? 124  LEU A CA  1 
ATOM   800   C C   . LEU A 1 98  ? 53.254  -6.036  -3.515  1.00 20.27 ? 124  LEU A C   1 
ATOM   801   O O   . LEU A 1 98  ? 52.242  -5.989  -4.212  1.00 19.00 ? 124  LEU A O   1 
ATOM   802   C CB  . LEU A 1 98  ? 53.384  -5.312  -1.118  1.00 19.05 ? 124  LEU A CB  1 
ATOM   803   C CG  . LEU A 1 98  ? 53.597  -4.220  -0.062  1.00 19.16 ? 124  LEU A CG  1 
ATOM   804   C CD1 . LEU A 1 98  ? 53.242  -4.766  1.321   1.00 20.91 ? 124  LEU A CD1 1 
ATOM   805   C CD2 . LEU A 1 98  ? 55.044  -3.733  -0.112  1.00 17.45 ? 124  LEU A CD2 1 
ATOM   806   N N   . PRO A 1 99  ? 54.107  -7.077  -3.561  1.00 21.72 ? 125  PRO A N   1 
ATOM   807   C CA  . PRO A 1 99  ? 53.843  -8.227  -4.435  1.00 23.13 ? 125  PRO A CA  1 
ATOM   808   C C   . PRO A 1 99  ? 52.521  -8.877  -4.048  1.00 23.33 ? 125  PRO A C   1 
ATOM   809   O O   . PRO A 1 99  ? 52.263  -9.109  -2.868  1.00 22.80 ? 125  PRO A O   1 
ATOM   810   C CB  . PRO A 1 99  ? 55.037  -9.142  -4.170  1.00 23.39 ? 125  PRO A CB  1 
ATOM   811   C CG  . PRO A 1 99  ? 56.140  -8.166  -3.895  1.00 22.62 ? 125  PRO A CG  1 
ATOM   812   C CD  . PRO A 1 99  ? 55.455  -7.173  -2.975  1.00 22.43 ? 125  PRO A CD  1 
ATOM   813   N N   . LYS A 1 100 ? 51.682  -9.154  -5.041  1.00 24.12 ? 126  LYS A N   1 
ATOM   814   C CA  . LYS A 1 100 ? 50.386  -9.777  -4.790  1.00 25.84 ? 126  LYS A CA  1 
ATOM   815   C C   . LYS A 1 100 ? 50.585  -11.141 -4.125  1.00 25.80 ? 126  LYS A C   1 
ATOM   816   O O   . LYS A 1 100 ? 51.464  -11.902 -4.524  1.00 25.88 ? 126  LYS A O   1 
ATOM   817   C CB  . LYS A 1 100 ? 49.622  -9.927  -6.113  1.00 27.56 ? 126  LYS A CB  1 
ATOM   818   C CG  . LYS A 1 100 ? 48.177  -10.376 -5.959  1.00 29.49 ? 126  LYS A CG  1 
ATOM   819   C CD  . LYS A 1 100 ? 47.455  -10.387 -7.301  1.00 31.65 ? 126  LYS A CD  1 
ATOM   820   C CE  . LYS A 1 100 ? 45.983  -10.733 -7.131  1.00 32.16 ? 126  LYS A CE  1 
ATOM   821   N NZ  . LYS A 1 100 ? 45.239  -10.695 -8.422  1.00 32.16 ? 126  LYS A NZ  1 
ATOM   822   N N   . GLN A 1 101 ? 49.780  -11.441 -3.109  1.00 25.55 ? 127  GLN A N   1 
ATOM   823   C CA  . GLN A 1 101 ? 49.885  -12.712 -2.403  1.00 26.39 ? 127  GLN A CA  1 
ATOM   824   C C   . GLN A 1 101 ? 49.036  -13.772 -3.085  1.00 27.73 ? 127  GLN A C   1 
ATOM   825   O O   . GLN A 1 101 ? 48.197  -13.450 -3.922  1.00 26.78 ? 127  GLN A O   1 
ATOM   826   C CB  . GLN A 1 101 ? 49.455  -12.542 -0.950  1.00 25.96 ? 127  GLN A CB  1 
ATOM   827   C CG  . GLN A 1 101 ? 50.267  -11.479 -0.224  1.00 26.33 ? 127  GLN A CG  1 
ATOM   828   C CD  . GLN A 1 101 ? 51.764  -11.760 -0.245  1.00 25.56 ? 127  GLN A CD  1 
ATOM   829   O OE1 . GLN A 1 101 ? 52.245  -12.686 0.408   1.00 23.96 ? 127  GLN A OE1 1 
ATOM   830   N NE2 . GLN A 1 101 ? 52.509  -10.959 -1.001  1.00 24.00 ? 127  GLN A NE2 1 
ATOM   831   N N   . ASP A 1 102 ? 49.247  -15.032 -2.717  1.00 29.41 ? 128  ASP A N   1 
ATOM   832   C CA  . ASP A 1 102 ? 48.519  -16.132 -3.345  1.00 31.36 ? 128  ASP A CA  1 
ATOM   833   C C   . ASP A 1 102 ? 47.270  -16.658 -2.654  1.00 31.43 ? 128  ASP A C   1 
ATOM   834   O O   . ASP A 1 102 ? 46.673  -17.621 -3.133  1.00 32.34 ? 128  ASP A O   1 
ATOM   835   C CB  . ASP A 1 102 ? 49.461  -17.315 -3.593  1.00 33.34 ? 128  ASP A CB  1 
ATOM   836   C CG  . ASP A 1 102 ? 49.987  -17.934 -2.306  1.00 34.25 ? 128  ASP A CG  1 
ATOM   837   O OD1 . ASP A 1 102 ? 49.291  -17.885 -1.265  1.00 36.55 ? 128  ASP A OD1 1 
ATOM   838   O OD2 . ASP A 1 102 ? 51.100  -18.498 -2.343  1.00 36.42 ? 128  ASP A OD2 1 
ATOM   839   N N   . PHE A 1 103 ? 46.862  -16.055 -1.540  1.00 30.89 ? 129  PHE A N   1 
ATOM   840   C CA  . PHE A 1 103 ? 45.664  -16.539 -0.866  1.00 30.37 ? 129  PHE A CA  1 
ATOM   841   C C   . PHE A 1 103 ? 44.443  -16.383 -1.775  1.00 30.73 ? 129  PHE A C   1 
ATOM   842   O O   . PHE A 1 103 ? 44.329  -15.402 -2.512  1.00 30.66 ? 129  PHE A O   1 
ATOM   843   C CB  . PHE A 1 103 ? 45.457  -15.821 0.484   1.00 26.82 ? 129  PHE A CB  1 
ATOM   844   C CG  . PHE A 1 103 ? 45.291  -14.324 0.380   1.00 25.85 ? 129  PHE A CG  1 
ATOM   845   C CD1 . PHE A 1 103 ? 44.092  -13.767 -0.058  1.00 23.52 ? 129  PHE A CD1 1 
ATOM   846   C CD2 . PHE A 1 103 ? 46.331  -13.470 0.743   1.00 24.61 ? 129  PHE A CD2 1 
ATOM   847   C CE1 . PHE A 1 103 ? 43.932  -12.381 -0.133  1.00 24.15 ? 129  PHE A CE1 1 
ATOM   848   C CE2 . PHE A 1 103 ? 46.182  -12.082 0.672   1.00 24.95 ? 129  PHE A CE2 1 
ATOM   849   C CZ  . PHE A 1 103 ? 44.980  -11.537 0.233   1.00 24.62 ? 129  PHE A CZ  1 
ATOM   850   N N   . VAL A 1 104 ? 43.542  -17.364 -1.724  1.00 31.71 ? 130  VAL A N   1 
ATOM   851   C CA  . VAL A 1 104 ? 42.338  -17.366 -2.554  1.00 31.58 ? 130  VAL A CA  1 
ATOM   852   C C   . VAL A 1 104 ? 41.017  -17.370 -1.779  1.00 32.30 ? 130  VAL A C   1 
ATOM   853   O O   . VAL A 1 104 ? 39.942  -17.403 -2.380  1.00 32.88 ? 130  VAL A O   1 
ATOM   854   C CB  . VAL A 1 104 ? 42.332  -18.583 -3.494  1.00 31.50 ? 130  VAL A CB  1 
ATOM   855   C CG1 . VAL A 1 104 ? 43.467  -18.473 -4.496  1.00 30.99 ? 130  VAL A CG1 1 
ATOM   856   C CG2 . VAL A 1 104 ? 42.467  -19.858 -2.676  1.00 30.92 ? 130  VAL A CG2 1 
ATOM   857   N N   . ASP A 1 105 ? 41.091  -17.354 -0.454  1.00 31.93 ? 131  ASP A N   1 
ATOM   858   C CA  . ASP A 1 105 ? 39.887  -17.337 0.370   1.00 32.61 ? 131  ASP A CA  1 
ATOM   859   C C   . ASP A 1 105 ? 40.096  -16.490 1.615   1.00 32.93 ? 131  ASP A C   1 
ATOM   860   O O   . ASP A 1 105 ? 41.222  -16.087 1.916   1.00 32.17 ? 131  ASP A O   1 
ATOM   861   C CB  . ASP A 1 105 ? 39.490  -18.755 0.786   1.00 33.52 ? 131  ASP A CB  1 
ATOM   862   C CG  . ASP A 1 105 ? 40.657  -19.554 1.333   1.00 35.21 ? 131  ASP A CG  1 
ATOM   863   O OD1 . ASP A 1 105 ? 41.610  -18.943 1.860   1.00 35.15 ? 131  ASP A OD1 1 
ATOM   864   O OD2 . ASP A 1 105 ? 40.615  -20.799 1.241   1.00 37.04 ? 131  ASP A OD2 1 
ATOM   865   N N   . LEU A 1 106 ? 39.007  -16.233 2.334   1.00 33.43 ? 132  LEU A N   1 
ATOM   866   C CA  . LEU A 1 106 ? 39.042  -15.436 3.558   1.00 34.53 ? 132  LEU A CA  1 
ATOM   867   C C   . LEU A 1 106 ? 40.106  -15.900 4.545   1.00 34.92 ? 132  LEU A C   1 
ATOM   868   O O   . LEU A 1 106 ? 40.871  -15.091 5.068   1.00 34.08 ? 132  LEU A O   1 
ATOM   869   C CB  . LEU A 1 106 ? 37.676  -15.470 4.246   1.00 35.01 ? 132  LEU A CB  1 
ATOM   870   C CG  . LEU A 1 106 ? 37.037  -14.108 4.510   1.00 37.65 ? 132  LEU A CG  1 
ATOM   871   C CD1 . LEU A 1 106 ? 37.962  -13.249 5.360   1.00 38.16 ? 132  LEU A CD1 1 
ATOM   872   C CD2 . LEU A 1 106 ? 36.759  -13.428 3.181   1.00 39.66 ? 132  LEU A CD2 1 
ATOM   873   N N   . GLN A 1 107 ? 40.150  -17.202 4.808   1.00 36.14 ? 133  GLN A N   1 
ATOM   874   C CA  . GLN A 1 107 ? 41.133  -17.740 5.739   1.00 37.17 ? 133  GLN A CA  1 
ATOM   875   C C   . GLN A 1 107 ? 42.539  -17.398 5.268   1.00 35.94 ? 133  GLN A C   1 
ATOM   876   O O   . GLN A 1 107 ? 43.412  -17.090 6.076   1.00 36.37 ? 133  GLN A O   1 
ATOM   877   C CB  . GLN A 1 107 ? 40.980  -19.261 5.870   1.00 40.00 ? 133  GLN A CB  1 
ATOM   878   C CG  . GLN A 1 107 ? 41.145  -20.024 4.568   1.00 45.40 ? 133  GLN A CG  1 
ATOM   879   C CD  . GLN A 1 107 ? 42.258  -21.052 4.627   1.00 48.21 ? 133  GLN A CD  1 
ATOM   880   O OE1 . GLN A 1 107 ? 42.291  -21.897 5.524   1.00 50.36 ? 133  GLN A OE1 1 
ATOM   881   N NE2 . GLN A 1 107 ? 43.173  -20.990 3.667   1.00 48.20 ? 133  GLN A NE2 1 
ATOM   882   N N   . GLY A 1 108 ? 42.750  -17.443 3.958   1.00 34.19 ? 134  GLY A N   1 
ATOM   883   C CA  . GLY A 1 108 ? 44.058  -17.123 3.419   1.00 32.98 ? 134  GLY A CA  1 
ATOM   884   C C   . GLY A 1 108 ? 44.384  -15.656 3.622   1.00 32.32 ? 134  GLY A C   1 
ATOM   885   O O   . GLY A 1 108 ? 45.492  -15.304 4.036   1.00 32.92 ? 134  GLY A O   1 
ATOM   886   N N   . GLN A 1 109 ? 43.413  -14.797 3.327   1.00 30.05 ? 135  GLN A N   1 
ATOM   887   C CA  . GLN A 1 109 ? 43.592  -13.363 3.486   1.00 29.27 ? 135  GLN A CA  1 
ATOM   888   C C   . GLN A 1 109 ? 43.946  -13.055 4.934   1.00 27.46 ? 135  GLN A C   1 
ATOM   889   O O   . GLN A 1 109 ? 44.952  -12.403 5.208   1.00 26.76 ? 135  GLN A O   1 
ATOM   890   C CB  . GLN A 1 109 ? 42.311  -12.619 3.093   1.00 30.11 ? 135  GLN A CB  1 
ATOM   891   C CG  . GLN A 1 109 ? 42.411  -11.105 3.225   1.00 30.66 ? 135  GLN A CG  1 
ATOM   892   C CD  . GLN A 1 109 ? 41.108  -10.400 2.917   1.00 31.50 ? 135  GLN A CD  1 
ATOM   893   O OE1 . GLN A 1 109 ? 41.022  -9.172  2.968   1.00 33.48 ? 135  GLN A OE1 1 
ATOM   894   N NE2 . GLN A 1 109 ? 40.079  -11.174 2.589   1.00 30.39 ? 135  GLN A NE2 1 
ATOM   895   N N   . LEU A 1 110 ? 43.121  -13.534 5.855   1.00 26.34 ? 136  LEU A N   1 
ATOM   896   C CA  . LEU A 1 110 ? 43.357  -13.305 7.274   1.00 26.05 ? 136  LEU A CA  1 
ATOM   897   C C   . LEU A 1 110 ? 44.644  -13.994 7.721   1.00 26.39 ? 136  LEU A C   1 
ATOM   898   O O   . LEU A 1 110 ? 45.290  -13.573 8.679   1.00 27.13 ? 136  LEU A O   1 
ATOM   899   C CB  . LEU A 1 110 ? 42.166  -13.814 8.096   1.00 27.49 ? 136  LEU A CB  1 
ATOM   900   C CG  . LEU A 1 110 ? 40.790  -13.278 7.685   1.00 27.43 ? 136  LEU A CG  1 
ATOM   901   C CD1 . LEU A 1 110 ? 39.731  -13.821 8.628   1.00 27.43 ? 136  LEU A CD1 1 
ATOM   902   C CD2 . LEU A 1 110 ? 40.789  -11.757 7.715   1.00 27.76 ? 136  LEU A CD2 1 
ATOM   903   N N   . ARG A 1 111 ? 45.024  -15.053 7.011   1.00 26.02 ? 137  ARG A N   1 
ATOM   904   C CA  . ARG A 1 111 ? 46.239  -15.785 7.338   1.00 25.60 ? 137  ARG A CA  1 
ATOM   905   C C   . ARG A 1 111 ? 47.446  -14.899 7.051   1.00 24.79 ? 137  ARG A C   1 
ATOM   906   O O   . ARG A 1 111 ? 48.371  -14.798 7.861   1.00 24.02 ? 137  ARG A O   1 
ATOM   907   C CB  . ARG A 1 111 ? 46.335  -17.055 6.494   1.00 29.70 ? 137  ARG A CB  1 
ATOM   908   C CG  . ARG A 1 111 ? 46.822  -18.264 7.272   1.00 33.72 ? 137  ARG A CG  1 
ATOM   909   C CD  . ARG A 1 111 ? 45.688  -18.907 8.063   1.00 34.97 ? 137  ARG A CD  1 
ATOM   910   N NE  . ARG A 1 111 ? 46.132  -19.400 9.364   1.00 37.17 ? 137  ARG A NE  1 
ATOM   911   C CZ  . ARG A 1 111 ? 45.393  -20.156 10.175  1.00 37.32 ? 137  ARG A CZ  1 
ATOM   912   N NH1 . ARG A 1 111 ? 44.169  -20.517 9.817   1.00 38.21 ? 137  ARG A NH1 1 
ATOM   913   N NH2 . ARG A 1 111 ? 45.871  -20.527 11.354  1.00 37.56 ? 137  ARG A NH2 1 
ATOM   914   N N   . PHE A 1 112 ? 47.442  -14.271 5.884   1.00 22.22 ? 138  PHE A N   1 
ATOM   915   C CA  . PHE A 1 112 ? 48.537  -13.391 5.510   1.00 22.45 ? 138  PHE A CA  1 
ATOM   916   C C   . PHE A 1 112 ? 48.561  -12.167 6.427   1.00 21.59 ? 138  PHE A C   1 
ATOM   917   O O   . PHE A 1 112 ? 49.620  -11.750 6.888   1.00 21.55 ? 138  PHE A O   1 
ATOM   918   C CB  . PHE A 1 112 ? 48.380  -12.939 4.064   1.00 22.02 ? 138  PHE A CB  1 
ATOM   919   C CG  . PHE A 1 112 ? 49.393  -11.924 3.643   1.00 22.02 ? 138  PHE A CG  1 
ATOM   920   C CD1 . PHE A 1 112 ? 50.728  -12.280 3.488   1.00 20.46 ? 138  PHE A CD1 1 
ATOM   921   C CD2 . PHE A 1 112 ? 49.016  -10.609 3.405   1.00 22.25 ? 138  PHE A CD2 1 
ATOM   922   C CE1 . PHE A 1 112 ? 51.673  -11.339 3.099   1.00 22.89 ? 138  PHE A CE1 1 
ATOM   923   C CE2 . PHE A 1 112 ? 49.953  -9.658  3.015   1.00 21.66 ? 138  PHE A CE2 1 
ATOM   924   C CZ  . PHE A 1 112 ? 51.283  -10.023 2.862   1.00 20.84 ? 138  PHE A CZ  1 
ATOM   925   N N   . ALA A 1 113 ? 47.392  -11.594 6.686   1.00 21.07 ? 139  ALA A N   1 
ATOM   926   C CA  . ALA A 1 113 ? 47.295  -10.430 7.558   1.00 21.90 ? 139  ALA A CA  1 
ATOM   927   C C   . ALA A 1 113 ? 47.931  -10.730 8.922   1.00 22.41 ? 139  ALA A C   1 
ATOM   928   O O   . ALA A 1 113 ? 48.678  -9.910  9.466   1.00 22.48 ? 139  ALA A O   1 
ATOM   929   C CB  . ALA A 1 113 ? 45.839  -10.030 7.725   1.00 21.63 ? 139  ALA A CB  1 
ATOM   930   N N   . ALA A 1 114 ? 47.635  -11.906 9.471   1.00 22.57 ? 140  ALA A N   1 
ATOM   931   C CA  . ALA A 1 114 ? 48.190  -12.311 10.760  1.00 22.26 ? 140  ALA A CA  1 
ATOM   932   C C   . ALA A 1 114 ? 49.710  -12.407 10.680  1.00 22.52 ? 140  ALA A C   1 
ATOM   933   O O   . ALA A 1 114 ? 50.416  -11.962 11.585  1.00 23.05 ? 140  ALA A O   1 
ATOM   934   C CB  . ALA A 1 114 ? 47.601  -13.653 11.182  1.00 21.92 ? 140  ALA A CB  1 
ATOM   935   N N   . LYS A 1 115 ? 50.201  -13.001 9.598   1.00 20.64 ? 141  LYS A N   1 
ATOM   936   C CA  . LYS A 1 115 ? 51.634  -13.156 9.378   1.00 22.79 ? 141  LYS A CA  1 
ATOM   937   C C   . LYS A 1 115 ? 52.283  -11.778 9.271   1.00 21.83 ? 141  LYS A C   1 
ATOM   938   O O   . LYS A 1 115 ? 53.361  -11.536 9.828   1.00 20.30 ? 141  LYS A O   1 
ATOM   939   C CB  . LYS A 1 115 ? 51.878  -13.937 8.082   1.00 26.27 ? 141  LYS A CB  1 
ATOM   940   C CG  . LYS A 1 115 ? 52.565  -15.280 8.240   1.00 31.33 ? 141  LYS A CG  1 
ATOM   941   C CD  . LYS A 1 115 ? 54.039  -15.118 8.560   1.00 35.26 ? 141  LYS A CD  1 
ATOM   942   C CE  . LYS A 1 115 ? 54.750  -16.455 8.536   1.00 37.05 ? 141  LYS A CE  1 
ATOM   943   N NZ  . LYS A 1 115 ? 54.613  -17.126 7.212   1.00 38.72 ? 141  LYS A NZ  1 
ATOM   944   N N   . LEU A 1 116 ? 51.622  -10.886 8.551   1.00 19.31 ? 142  LEU A N   1 
ATOM   945   C CA  . LEU A 1 116 ? 52.126  -9.531  8.359   1.00 20.11 ? 142  LEU A CA  1 
ATOM   946   C C   . LEU A 1 116 ? 52.230  -8.803  9.698   1.00 18.95 ? 142  LEU A C   1 
ATOM   947   O O   . LEU A 1 116 ? 53.238  -8.181  9.996   1.00 18.47 ? 142  LEU A O   1 
ATOM   948   C CB  . LEU A 1 116 ? 51.212  -8.767  7.392   1.00 18.33 ? 142  LEU A CB  1 
ATOM   949   C CG  . LEU A 1 116 ? 51.551  -7.310  7.060   1.00 21.39 ? 142  LEU A CG  1 
ATOM   950   C CD1 . LEU A 1 116 ? 50.954  -6.941  5.712   1.00 20.19 ? 142  LEU A CD1 1 
ATOM   951   C CD2 . LEU A 1 116 ? 51.032  -6.389  8.160   1.00 20.29 ? 142  LEU A CD2 1 
ATOM   952   N N   . ILE A 1 117 ? 51.179  -8.893  10.502  1.00 20.20 ? 143  ILE A N   1 
ATOM   953   C CA  . ILE A 1 117 ? 51.152  -8.259  11.812  1.00 20.76 ? 143  ILE A CA  1 
ATOM   954   C C   . ILE A 1 117 ? 52.307  -8.786  12.667  1.00 22.14 ? 143  ILE A C   1 
ATOM   955   O O   . ILE A 1 117 ? 53.022  -8.019  13.322  1.00 21.66 ? 143  ILE A O   1 
ATOM   956   C CB  . ILE A 1 117 ? 49.812  -8.544  12.524  1.00 20.86 ? 143  ILE A CB  1 
ATOM   957   C CG1 . ILE A 1 117 ? 48.675  -7.862  11.768  1.00 19.26 ? 143  ILE A CG1 1 
ATOM   958   C CG2 . ILE A 1 117 ? 49.869  -8.066  13.957  1.00 22.30 ? 143  ILE A CG2 1 
ATOM   959   C CD1 . ILE A 1 117 ? 47.285  -8.273  12.231  1.00 20.84 ? 143  ILE A CD1 1 
ATOM   960   N N   . GLU A 1 118 ? 52.488  -10.104 12.653  1.00 22.79 ? 144  GLU A N   1 
ATOM   961   C CA  . GLU A 1 118 ? 53.551  -10.718 13.430  1.00 24.10 ? 144  GLU A CA  1 
ATOM   962   C C   . GLU A 1 118 ? 54.903  -10.222 12.938  1.00 23.13 ? 144  GLU A C   1 
ATOM   963   O O   . GLU A 1 118 ? 55.807  -9.983  13.736  1.00 23.87 ? 144  GLU A O   1 
ATOM   964   C CB  . GLU A 1 118 ? 53.476  -12.244 13.334  1.00 26.64 ? 144  GLU A CB  1 
ATOM   965   C CG  . GLU A 1 118 ? 54.459  -12.948 14.257  1.00 33.51 ? 144  GLU A CG  1 
ATOM   966   C CD  . GLU A 1 118 ? 54.268  -14.450 14.290  1.00 38.80 ? 144  GLU A CD  1 
ATOM   967   O OE1 . GLU A 1 118 ? 54.383  -15.093 13.225  1.00 41.53 ? 144  GLU A OE1 1 
ATOM   968   O OE2 . GLU A 1 118 ? 54.004  -14.992 15.385  1.00 42.92 ? 144  GLU A OE2 1 
ATOM   969   N N   . GLY A 1 119 ? 55.035  -10.062 11.623  1.00 22.00 ? 145  GLY A N   1 
ATOM   970   C CA  . GLY A 1 119 ? 56.281  -9.574  11.059  1.00 19.63 ? 145  GLY A CA  1 
ATOM   971   C C   . GLY A 1 119 ? 56.560  -8.150  11.505  1.00 19.62 ? 145  GLY A C   1 
ATOM   972   O O   . GLY A 1 119 ? 57.708  -7.786  11.772  1.00 19.62 ? 145  GLY A O   1 
ATOM   973   N N   . VAL A 1 120 ? 55.516  -7.334  11.585  1.00 17.95 ? 146  VAL A N   1 
ATOM   974   C CA  . VAL A 1 120 ? 55.696  -5.956  12.019  1.00 19.76 ? 146  VAL A CA  1 
ATOM   975   C C   . VAL A 1 120 ? 56.108  -5.964  13.489  1.00 19.88 ? 146  VAL A C   1 
ATOM   976   O O   . VAL A 1 120 ? 57.035  -5.262  13.885  1.00 19.91 ? 146  VAL A O   1 
ATOM   977   C CB  . VAL A 1 120 ? 54.403  -5.128  11.851  1.00 18.96 ? 146  VAL A CB  1 
ATOM   978   C CG1 . VAL A 1 120 ? 54.645  -3.694  12.301  1.00 20.75 ? 146  VAL A CG1 1 
ATOM   979   C CG2 . VAL A 1 120 ? 53.948  -5.159  10.395  1.00 18.42 ? 146  VAL A CG2 1 
ATOM   980   N N   . LEU A 1 121 ? 55.430  -6.772  14.293  1.00 21.16 ? 147  LEU A N   1 
ATOM   981   C CA  . LEU A 1 121 ? 55.762  -6.850  15.709  1.00 22.67 ? 147  LEU A CA  1 
ATOM   982   C C   . LEU A 1 121 ? 57.198  -7.344  15.897  1.00 22.78 ? 147  LEU A C   1 
ATOM   983   O O   . LEU A 1 121 ? 57.873  -6.968  16.851  1.00 22.85 ? 147  LEU A O   1 
ATOM   984   C CB  . LEU A 1 121 ? 54.789  -7.783  16.434  1.00 22.63 ? 147  LEU A CB  1 
ATOM   985   C CG  . LEU A 1 121 ? 53.309  -7.406  16.367  1.00 24.36 ? 147  LEU A CG  1 
ATOM   986   C CD1 . LEU A 1 121 ? 52.501  -8.424  17.145  1.00 24.95 ? 147  LEU A CD1 1 
ATOM   987   C CD2 . LEU A 1 121 ? 53.094  -6.021  16.946  1.00 25.17 ? 147  LEU A CD2 1 
ATOM   988   N N   . ASP A 1 122 ? 57.662  -8.185  14.979  1.00 23.18 ? 148  ASP A N   1 
ATOM   989   C CA  . ASP A 1 122 ? 59.015  -8.712  15.051  1.00 23.40 ? 148  ASP A CA  1 
ATOM   990   C C   . ASP A 1 122 ? 60.016  -7.592  14.790  1.00 25.00 ? 148  ASP A C   1 
ATOM   991   O O   . ASP A 1 122 ? 61.067  -7.498  15.438  1.00 25.69 ? 148  ASP A O   1 
ATOM   992   C CB  . ASP A 1 122 ? 59.204  -9.807  14.006  1.00 23.56 ? 148  ASP A CB  1 
ATOM   993   C CG  . ASP A 1 122 ? 60.538  -10.500 14.134  1.00 24.69 ? 148  ASP A CG  1 
ATOM   994   O OD1 . ASP A 1 122 ? 60.772  -11.143 15.177  1.00 27.98 ? 148  ASP A OD1 1 
ATOM   995   O OD2 . ASP A 1 122 ? 61.351  -10.404 13.195  1.00 25.67 ? 148  ASP A OD2 1 
ATOM   996   N N   . PHE A 1 123 ? 59.687  -6.744  13.818  1.00 24.30 ? 149  PHE A N   1 
ATOM   997   C CA  . PHE A 1 123 ? 60.552  -5.629  13.470  1.00 21.40 ? 149  PHE A CA  1 
ATOM   998   C C   . PHE A 1 123 ? 60.534  -4.651  14.632  1.00 21.02 ? 149  PHE A C   1 
ATOM   999   O O   . PHE A 1 123 ? 61.557  -4.060  14.975  1.00 21.30 ? 149  PHE A O   1 
ATOM   1000  C CB  . PHE A 1 123 ? 60.043  -4.946  12.201  1.00 20.13 ? 149  PHE A CB  1 
ATOM   1001  C CG  . PHE A 1 123 ? 60.969  -3.897  11.662  1.00 18.98 ? 149  PHE A CG  1 
ATOM   1002  C CD1 . PHE A 1 123 ? 60.721  -2.549  11.890  1.00 19.74 ? 149  PHE A CD1 1 
ATOM   1003  C CD2 . PHE A 1 123 ? 62.096  -4.257  10.928  1.00 18.22 ? 149  PHE A CD2 1 
ATOM   1004  C CE1 . PHE A 1 123 ? 61.583  -1.569  11.394  1.00 19.20 ? 149  PHE A CE1 1 
ATOM   1005  C CE2 . PHE A 1 123 ? 62.966  -3.285  10.428  1.00 18.83 ? 149  PHE A CE2 1 
ATOM   1006  C CZ  . PHE A 1 123 ? 62.707  -1.940  10.663  1.00 19.43 ? 149  PHE A CZ  1 
ATOM   1007  N N   . LYS A 1 124 ? 59.364  -4.502  15.245  1.00 18.88 ? 150  LYS A N   1 
ATOM   1008  C CA  . LYS A 1 124 ? 59.200  -3.601  16.371  1.00 20.70 ? 150  LYS A CA  1 
ATOM   1009  C C   . LYS A 1 124 ? 60.085  -4.015  17.546  1.00 22.53 ? 150  LYS A C   1 
ATOM   1010  O O   . LYS A 1 124 ? 60.562  -3.160  18.299  1.00 22.96 ? 150  LYS A O   1 
ATOM   1011  C CB  . LYS A 1 124 ? 57.733  -3.582  16.801  1.00 18.74 ? 150  LYS A CB  1 
ATOM   1012  C CG  . LYS A 1 124 ? 57.435  -2.724  18.030  1.00 19.91 ? 150  LYS A CG  1 
ATOM   1013  C CD  . LYS A 1 124 ? 55.932  -2.600  18.273  1.00 18.99 ? 150  LYS A CD  1 
ATOM   1014  C CE  . LYS A 1 124 ? 55.627  -1.872  19.583  1.00 20.83 ? 150  LYS A CE  1 
ATOM   1015  N NZ  . LYS A 1 124 ? 56.052  -2.640  20.789  1.00 19.59 ? 150  LYS A NZ  1 
ATOM   1016  N N   . SER A 1 125 ? 60.315  -5.321  17.695  1.00 22.71 ? 151  SER A N   1 
ATOM   1017  C CA  . SER A 1 125 ? 61.138  -5.819  18.793  1.00 24.13 ? 151  SER A CA  1 
ATOM   1018  C C   . SER A 1 125 ? 62.521  -5.199  18.722  1.00 25.31 ? 151  SER A C   1 
ATOM   1019  O O   . SER A 1 125 ? 63.088  -4.828  19.745  1.00 23.76 ? 151  SER A O   1 
ATOM   1020  C CB  . SER A 1 125 ? 61.250  -7.349  18.746  1.00 23.17 ? 151  SER A CB  1 
ATOM   1021  O OG  . SER A 1 125 ? 62.151  -7.781  17.743  1.00 27.22 ? 151  SER A OG  1 
ATOM   1022  N N   . MET A 1 126 ? 63.062  -5.087  17.509  1.00 26.86 ? 152  MET A N   1 
ATOM   1023  C CA  . MET A 1 126 ? 64.377  -4.496  17.320  1.00 28.76 ? 152  MET A CA  1 
ATOM   1024  C C   . MET A 1 126 ? 64.365  -3.018  17.675  1.00 29.26 ? 152  MET A C   1 
ATOM   1025  O O   . MET A 1 126 ? 65.355  -2.489  18.181  1.00 30.29 ? 152  MET A O   1 
ATOM   1026  C CB  . MET A 1 126 ? 64.843  -4.667  15.875  1.00 30.13 ? 152  MET A CB  1 
ATOM   1027  C CG  . MET A 1 126 ? 65.154  -6.093  15.498  1.00 31.00 ? 152  MET A CG  1 
ATOM   1028  S SD  . MET A 1 126 ? 65.818  -6.182  13.838  1.00 35.65 ? 152  MET A SD  1 
ATOM   1029  C CE  . MET A 1 126 ? 64.282  -6.235  12.887  1.00 33.18 ? 152  MET A CE  1 
ATOM   1030  N N   . ILE A 1 127 ? 63.248  -2.348  17.404  1.00 28.99 ? 153  ILE A N   1 
ATOM   1031  C CA  . ILE A 1 127 ? 63.125  -0.929  17.716  1.00 28.98 ? 153  ILE A CA  1 
ATOM   1032  C C   . ILE A 1 127 ? 63.054  -0.701  19.225  1.00 27.90 ? 153  ILE A C   1 
ATOM   1033  O O   . ILE A 1 127 ? 63.770  0.137   19.764  1.00 27.03 ? 153  ILE A O   1 
ATOM   1034  C CB  . ILE A 1 127 ? 61.866  -0.326  17.050  1.00 29.59 ? 153  ILE A CB  1 
ATOM   1035  C CG1 . ILE A 1 127 ? 62.054  -0.296  15.527  1.00 30.49 ? 153  ILE A CG1 1 
ATOM   1036  C CG2 . ILE A 1 127 ? 61.592  1.070   17.601  1.00 28.41 ? 153  ILE A CG2 1 
ATOM   1037  C CD1 . ILE A 1 127 ? 60.857  0.233   14.763  1.00 28.82 ? 153  ILE A CD1 1 
ATOM   1038  N N   . ASP A 1 128 ? 62.197  -1.447  19.904  1.00 28.93 ? 154  ASP A N   1 
ATOM   1039  C CA  . ASP A 1 128 ? 62.070  -1.297  21.350  1.00 31.95 ? 154  ASP A CA  1 
ATOM   1040  C C   . ASP A 1 128 ? 63.373  -1.621  22.068  1.00 32.57 ? 154  ASP A C   1 
ATOM   1041  O O   . ASP A 1 128 ? 63.725  -0.972  23.050  1.00 32.73 ? 154  ASP A O   1 
ATOM   1042  C CB  . ASP A 1 128 ? 60.951  -2.189  21.903  1.00 32.38 ? 154  ASP A CB  1 
ATOM   1043  C CG  . ASP A 1 128 ? 59.573  -1.725  21.483  1.00 33.76 ? 154  ASP A CG  1 
ATOM   1044  O OD1 . ASP A 1 128 ? 59.357  -0.499  21.396  1.00 35.80 ? 154  ASP A OD1 1 
ATOM   1045  O OD2 . ASP A 1 128 ? 58.697  -2.584  21.257  1.00 35.05 ? 154  ASP A OD2 1 
ATOM   1046  N N   . ASN A 1 129 ? 64.090  -2.623  21.568  1.00 33.18 ? 155  ASN A N   1 
ATOM   1047  C CA  . ASN A 1 129 ? 65.350  -3.032  22.174  1.00 33.97 ? 155  ASN A CA  1 
ATOM   1048  C C   . ASN A 1 129 ? 66.539  -2.289  21.587  1.00 34.69 ? 155  ASN A C   1 
ATOM   1049  O O   . ASN A 1 129 ? 67.684  -2.535  21.969  1.00 34.37 ? 155  ASN A O   1 
ATOM   1050  C CB  . ASN A 1 129 ? 65.560  -4.540  22.001  1.00 33.81 ? 155  ASN A CB  1 
ATOM   1051  C CG  . ASN A 1 129 ? 64.419  -5.355  22.570  1.00 34.95 ? 155  ASN A CG  1 
ATOM   1052  O OD1 . ASN A 1 129 ? 64.001  -5.150  23.708  1.00 36.61 ? 155  ASN A OD1 1 
ATOM   1053  N ND2 . ASN A 1 129 ? 63.906  -6.290  21.778  1.00 35.17 ? 155  ASN A ND2 1 
ATOM   1054  N N   . GLU A 1 130 ? 66.269  -1.384  20.652  1.00 34.41 ? 156  GLU A N   1 
ATOM   1055  C CA  . GLU A 1 130 ? 67.331  -0.606  20.028  1.00 33.99 ? 156  GLU A CA  1 
ATOM   1056  C C   . GLU A 1 130 ? 68.415  -1.506  19.444  1.00 33.73 ? 156  GLU A C   1 
ATOM   1057  O O   . GLU A 1 130 ? 69.601  -1.190  19.520  1.00 34.77 ? 156  GLU A O   1 
ATOM   1058  C CB  . GLU A 1 130 ? 67.948  0.347   21.054  1.00 33.87 ? 156  GLU A CB  1 
ATOM   1059  C CG  . GLU A 1 130 ? 67.023  1.476   21.478  1.00 35.91 ? 156  GLU A CG  1 
ATOM   1060  C CD  . GLU A 1 130 ? 67.576  2.287   22.633  1.00 37.24 ? 156  GLU A CD  1 
ATOM   1061  O OE1 . GLU A 1 130 ? 68.794  2.566   22.640  1.00 36.02 ? 156  GLU A OE1 1 
ATOM   1062  O OE2 . GLU A 1 130 ? 66.787  2.659   23.526  1.00 38.97 ? 156  GLU A OE2 1 
ATOM   1063  N N   . THR A 1 131 ? 68.009  -2.625  18.861  1.00 33.13 ? 157  THR A N   1 
ATOM   1064  C CA  . THR A 1 131 ? 68.966  -3.558  18.280  1.00 32.92 ? 157  THR A CA  1 
ATOM   1065  C C   . THR A 1 131 ? 68.959  -3.496  16.758  1.00 32.98 ? 157  THR A C   1 
ATOM   1066  O O   . THR A 1 131 ? 69.668  -4.252  16.091  1.00 32.09 ? 157  THR A O   1 
ATOM   1067  C CB  . THR A 1 131 ? 68.655  -4.988  18.709  1.00 33.01 ? 157  THR A CB  1 
ATOM   1068  O OG1 . THR A 1 131 ? 67.340  -5.333  18.259  1.00 33.32 ? 157  THR A OG1 1 
ATOM   1069  C CG2 . THR A 1 131 ? 68.724  -5.110  20.228  1.00 32.45 ? 157  THR A CG2 1 
ATOM   1070  N N   . LEU A 1 132 ? 68.152  -2.592  16.213  1.00 32.87 ? 158  LEU A N   1 
ATOM   1071  C CA  . LEU A 1 132 ? 68.055  -2.425  14.772  1.00 33.46 ? 158  LEU A CA  1 
ATOM   1072  C C   . LEU A 1 132 ? 69.442  -2.149  14.183  1.00 33.25 ? 158  LEU A C   1 
ATOM   1073  O O   . LEU A 1 132 ? 70.137  -1.220  14.602  1.00 32.67 ? 158  LEU A O   1 
ATOM   1074  C CB  . LEU A 1 132 ? 67.098  -1.275  14.451  1.00 34.30 ? 158  LEU A CB  1 
ATOM   1075  C CG  . LEU A 1 132 ? 66.491  -1.272  13.050  1.00 35.10 ? 158  LEU A CG  1 
ATOM   1076  C CD1 . LEU A 1 132 ? 65.743  -2.574  12.796  1.00 35.23 ? 158  LEU A CD1 1 
ATOM   1077  C CD2 . LEU A 1 132 ? 65.551  -0.094  12.921  1.00 36.98 ? 158  LEU A CD2 1 
ATOM   1078  N N   . PRO A 1 133 ? 69.863  -2.966  13.209  1.00 33.32 ? 159  PRO A N   1 
ATOM   1079  C CA  . PRO A 1 133 ? 71.167  -2.827  12.553  1.00 33.88 ? 159  PRO A CA  1 
ATOM   1080  C C   . PRO A 1 133 ? 71.429  -1.430  12.007  1.00 34.66 ? 159  PRO A C   1 
ATOM   1081  O O   . PRO A 1 133 ? 70.520  -0.758  11.525  1.00 34.05 ? 159  PRO A O   1 
ATOM   1082  C CB  . PRO A 1 133 ? 71.107  -3.872  11.443  1.00 33.41 ? 159  PRO A CB  1 
ATOM   1083  C CG  . PRO A 1 133 ? 70.238  -4.928  12.038  1.00 33.86 ? 159  PRO A CG  1 
ATOM   1084  C CD  . PRO A 1 133 ? 69.134  -4.127  12.673  1.00 33.51 ? 159  PRO A CD  1 
ATOM   1085  N N   . VAL A 1 134 ? 72.684  -1.004  12.086  1.00 35.41 ? 160  VAL A N   1 
ATOM   1086  C CA  . VAL A 1 134 ? 73.079  0.306   11.594  1.00 36.41 ? 160  VAL A CA  1 
ATOM   1087  C C   . VAL A 1 134 ? 73.197  0.239   10.076  1.00 35.50 ? 160  VAL A C   1 
ATOM   1088  O O   . VAL A 1 134 ? 73.705  -0.738  9.525   1.00 36.06 ? 160  VAL A O   1 
ATOM   1089  C CB  . VAL A 1 134 ? 74.438  0.747   12.196  1.00 37.18 ? 160  VAL A CB  1 
ATOM   1090  C CG1 . VAL A 1 134 ? 74.861  2.092   11.612  1.00 38.56 ? 160  VAL A CG1 1 
ATOM   1091  C CG2 . VAL A 1 134 ? 74.327  0.835   13.713  1.00 37.28 ? 160  VAL A CG2 1 
ATOM   1092  N N   . GLU A 1 135 ? 72.721  1.276   9.403   1.00 34.29 ? 161  GLU A N   1 
ATOM   1093  C CA  . GLU A 1 135 ? 72.782  1.313   7.949   1.00 34.63 ? 161  GLU A CA  1 
ATOM   1094  C C   . GLU A 1 135 ? 73.818  2.318   7.460   1.00 33.87 ? 161  GLU A C   1 
ATOM   1095  O O   . GLU A 1 135 ? 74.234  3.208   8.206   1.00 32.17 ? 161  GLU A O   1 
ATOM   1096  C CB  . GLU A 1 135 ? 71.409  1.668   7.380   1.00 34.44 ? 161  GLU A CB  1 
ATOM   1097  C CG  . GLU A 1 135 ? 70.303  0.759   7.869   1.00 34.78 ? 161  GLU A CG  1 
ATOM   1098  C CD  . GLU A 1 135 ? 68.936  1.216   7.417   1.00 34.56 ? 161  GLU A CD  1 
ATOM   1099  O OE1 . GLU A 1 135 ? 68.610  1.049   6.224   1.00 36.59 ? 161  GLU A OE1 1 
ATOM   1100  O OE2 . GLU A 1 135 ? 68.192  1.753   8.259   1.00 33.33 ? 161  GLU A OE2 1 
ATOM   1101  N N   . PHE A 1 136 ? 74.230  2.162   6.206   1.00 34.93 ? 162  PHE A N   1 
ATOM   1102  C CA  . PHE A 1 136 ? 75.217  3.048   5.597   1.00 37.13 ? 162  PHE A CA  1 
ATOM   1103  C C   . PHE A 1 136 ? 74.787  3.561   4.224   1.00 37.87 ? 162  PHE A C   1 
ATOM   1104  O O   . PHE A 1 136 ? 74.007  2.924   3.518   1.00 37.80 ? 162  PHE A O   1 
ATOM   1105  C CB  . PHE A 1 136 ? 76.569  2.337   5.459   1.00 38.12 ? 162  PHE A CB  1 
ATOM   1106  C CG  . PHE A 1 136 ? 77.174  1.916   6.766   1.00 39.87 ? 162  PHE A CG  1 
ATOM   1107  C CD1 . PHE A 1 136 ? 76.772  0.737   7.385   1.00 40.38 ? 162  PHE A CD1 1 
ATOM   1108  C CD2 . PHE A 1 136 ? 78.140  2.704   7.387   1.00 40.38 ? 162  PHE A CD2 1 
ATOM   1109  C CE1 . PHE A 1 136 ? 77.320  0.348   8.604   1.00 40.75 ? 162  PHE A CE1 1 
ATOM   1110  C CE2 . PHE A 1 136 ? 78.695  2.323   8.608   1.00 40.55 ? 162  PHE A CE2 1 
ATOM   1111  C CZ  . PHE A 1 136 ? 78.283  1.142   9.216   1.00 41.50 ? 162  PHE A CZ  1 
ATOM   1112  N N   . LEU A 1 137 ? 75.305  4.728   3.858   1.00 38.79 ? 163  LEU A N   1 
ATOM   1113  C CA  . LEU A 1 137 ? 75.006  5.343   2.572   1.00 40.67 ? 163  LEU A CA  1 
ATOM   1114  C C   . LEU A 1 137 ? 76.234  6.166   2.217   1.00 41.34 ? 163  LEU A C   1 
ATOM   1115  O O   . LEU A 1 137 ? 76.553  7.146   2.893   1.00 40.91 ? 163  LEU A O   1 
ATOM   1116  C CB  . LEU A 1 137 ? 73.769  6.241   2.679   1.00 41.86 ? 163  LEU A CB  1 
ATOM   1117  C CG  . LEU A 1 137 ? 72.973  6.528   1.399   1.00 43.58 ? 163  LEU A CG  1 
ATOM   1118  C CD1 . LEU A 1 137 ? 71.777  7.408   1.733   1.00 43.40 ? 163  LEU A CD1 1 
ATOM   1119  C CD2 . LEU A 1 137 ? 73.855  7.207   0.369   1.00 43.75 ? 163  LEU A CD2 1 
ATOM   1120  N N   . GLY A 1 138 ? 76.929  5.759   1.162   1.00 41.61 ? 164  GLY A N   1 
ATOM   1121  C CA  . GLY A 1 138 ? 78.129  6.468   0.768   1.00 42.03 ? 164  GLY A CA  1 
ATOM   1122  C C   . GLY A 1 138 ? 79.260  6.117   1.717   1.00 41.25 ? 164  GLY A C   1 
ATOM   1123  O O   . GLY A 1 138 ? 80.269  6.819   1.783   1.00 41.45 ? 164  GLY A O   1 
ATOM   1124  N N   . GLY A 1 139 ? 79.079  5.025   2.456   1.00 40.38 ? 165  GLY A N   1 
ATOM   1125  C CA  . GLY A 1 139 ? 80.087  4.575   3.402   1.00 38.40 ? 165  GLY A CA  1 
ATOM   1126  C C   . GLY A 1 139 ? 80.021  5.292   4.740   1.00 37.16 ? 165  GLY A C   1 
ATOM   1127  O O   . GLY A 1 139 ? 80.956  5.208   5.540   1.00 37.36 ? 165  GLY A O   1 
ATOM   1128  N N   . GLN A 1 140 ? 78.914  5.989   4.990   1.00 34.69 ? 166  GLN A N   1 
ATOM   1129  C CA  . GLN A 1 140 ? 78.736  6.730   6.234   1.00 32.63 ? 166  GLN A CA  1 
ATOM   1130  C C   . GLN A 1 140 ? 77.563  6.206   7.065   1.00 29.99 ? 166  GLN A C   1 
ATOM   1131  O O   . GLN A 1 140 ? 76.531  5.816   6.521   1.00 29.37 ? 166  GLN A O   1 
ATOM   1132  C CB  . GLN A 1 140 ? 78.500  8.212   5.924   1.00 33.72 ? 166  GLN A CB  1 
ATOM   1133  C CG  . GLN A 1 140 ? 79.565  8.865   5.053   1.00 35.26 ? 166  GLN A CG  1 
ATOM   1134  C CD  . GLN A 1 140 ? 80.942  8.817   5.682   1.00 36.87 ? 166  GLN A CD  1 
ATOM   1135  O OE1 . GLN A 1 140 ? 81.112  9.145   6.858   1.00 36.62 ? 166  GLN A OE1 1 
ATOM   1136  N NE2 . GLN A 1 140 ? 81.939  8.421   4.900   1.00 39.22 ? 166  GLN A NE2 1 
ATOM   1137  N N   . PRO A 1 141 ? 77.715  6.183   8.401   1.00 28.54 ? 167  PRO A N   1 
ATOM   1138  C CA  . PRO A 1 141 ? 76.648  5.705   9.288   1.00 26.50 ? 167  PRO A CA  1 
ATOM   1139  C C   . PRO A 1 141 ? 75.412  6.569   9.071   1.00 22.54 ? 167  PRO A C   1 
ATOM   1140  O O   . PRO A 1 141 ? 75.531  7.758   8.782   1.00 21.12 ? 167  PRO A O   1 
ATOM   1141  C CB  . PRO A 1 141 ? 77.239  5.902   10.680  1.00 26.16 ? 167  PRO A CB  1 
ATOM   1142  C CG  . PRO A 1 141 ? 78.691  5.729   10.452  1.00 28.92 ? 167  PRO A CG  1 
ATOM   1143  C CD  . PRO A 1 141 ? 78.931  6.491   9.173   1.00 29.05 ? 167  PRO A CD  1 
ATOM   1144  N N   . LEU A 1 142 ? 74.236  5.974   9.226   1.00 19.18 ? 168  LEU A N   1 
ATOM   1145  C CA  . LEU A 1 142 ? 72.990  6.698   9.021   1.00 17.44 ? 168  LEU A CA  1 
ATOM   1146  C C   . LEU A 1 142 ? 72.147  6.887   10.273  1.00 16.89 ? 168  LEU A C   1 
ATOM   1147  O O   . LEU A 1 142 ? 72.179  6.071   11.190  1.00 17.01 ? 168  LEU A O   1 
ATOM   1148  C CB  . LEU A 1 142 ? 72.151  5.985   7.951   1.00 15.69 ? 168  LEU A CB  1 
ATOM   1149  C CG  . LEU A 1 142 ? 72.809  5.781   6.584   1.00 15.18 ? 168  LEU A CG  1 
ATOM   1150  C CD1 . LEU A 1 142 ? 71.838  5.038   5.663   1.00 15.62 ? 168  LEU A CD1 1 
ATOM   1151  C CD2 . LEU A 1 142 ? 73.201  7.136   5.991   1.00 15.20 ? 168  LEU A CD2 1 
ATOM   1152  N N   . CYS A 1 143 ? 71.382  7.974   10.282  1.00 16.41 ? 169  CYS A N   1 
ATOM   1153  C CA  . CYS A 1 143 ? 70.485  8.293   11.381  1.00 16.67 ? 169  CYS A CA  1 
ATOM   1154  C C   . CYS A 1 143 ? 69.377  7.253   11.420  1.00 17.87 ? 169  CYS A C   1 
ATOM   1155  O O   . CYS A 1 143 ? 68.846  6.870   10.377  1.00 16.55 ? 169  CYS A O   1 
ATOM   1156  C CB  . CYS A 1 143 ? 69.871  9.677   11.163  1.00 17.13 ? 169  CYS A CB  1 
ATOM   1157  S SG  . CYS A 1 143 ? 68.529  10.092  12.297  1.00 20.11 ? 169  CYS A SG  1 
ATOM   1158  N N   . MET A 1 144 ? 69.026  6.811   12.626  1.00 16.48 ? 170  MET A N   1 
ATOM   1159  C CA  . MET A 1 144 ? 67.974  5.816   12.802  1.00 16.44 ? 170  MET A CA  1 
ATOM   1160  C C   . MET A 1 144 ? 66.752  6.417   13.482  1.00 14.60 ? 170  MET A C   1 
ATOM   1161  O O   . MET A 1 144 ? 65.825  5.706   13.859  1.00 14.94 ? 170  MET A O   1 
ATOM   1162  C CB  . MET A 1 144 ? 68.508  4.653   13.634  1.00 15.90 ? 170  MET A CB  1 
ATOM   1163  C CG  . MET A 1 144 ? 69.743  4.001   13.040  1.00 16.61 ? 170  MET A CG  1 
ATOM   1164  S SD  . MET A 1 144 ? 69.428  3.197   11.442  1.00 20.07 ? 170  MET A SD  1 
ATOM   1165  C CE  . MET A 1 144 ? 68.631  1.658   11.982  1.00 19.44 ? 170  MET A CE  1 
ATOM   1166  N N   . ASN A 1 145 ? 66.754  7.734   13.635  1.00 16.06 ? 171  ASN A N   1 
ATOM   1167  C CA  . ASN A 1 145 ? 65.649  8.413   14.304  1.00 15.96 ? 171  ASN A CA  1 
ATOM   1168  C C   . ASN A 1 145 ? 64.272  8.128   13.713  1.00 16.88 ? 171  ASN A C   1 
ATOM   1169  O O   . ASN A 1 145 ? 63.296  7.944   14.450  1.00 15.66 ? 171  ASN A O   1 
ATOM   1170  C CB  . ASN A 1 145 ? 65.866  9.922   14.293  1.00 16.02 ? 171  ASN A CB  1 
ATOM   1171  C CG  . ASN A 1 145 ? 64.772  10.658  15.015  1.00 16.07 ? 171  ASN A CG  1 
ATOM   1172  O OD1 . ASN A 1 145 ? 64.608  10.509  16.225  1.00 18.22 ? 171  ASN A OD1 1 
ATOM   1173  N ND2 . ASN A 1 145 ? 64.002  11.448  14.281  1.00 18.45 ? 171  ASN A ND2 1 
ATOM   1174  N N   . GLN A 1 146 ? 64.194  8.100   12.386  1.00 18.44 ? 172  GLN A N   1 
ATOM   1175  C CA  . GLN A 1 146 ? 62.931  7.860   11.698  1.00 19.58 ? 172  GLN A CA  1 
ATOM   1176  C C   . GLN A 1 146 ? 62.224  6.579   12.137  1.00 19.33 ? 172  GLN A C   1 
ATOM   1177  O O   . GLN A 1 146 ? 60.998  6.546   12.206  1.00 19.97 ? 172  GLN A O   1 
ATOM   1178  C CB  . GLN A 1 146 ? 63.160  7.845   10.185  1.00 21.54 ? 172  GLN A CB  1 
ATOM   1179  C CG  . GLN A 1 146 ? 63.504  9.217   9.591   1.00 25.13 ? 172  GLN A CG  1 
ATOM   1180  C CD  . GLN A 1 146 ? 63.792  9.146   8.098   1.00 26.23 ? 172  GLN A CD  1 
ATOM   1181  O OE1 . GLN A 1 146 ? 63.024  8.560   7.332   1.00 26.79 ? 172  GLN A OE1 1 
ATOM   1182  N NE2 . GLN A 1 146 ? 64.894  9.758   7.679   1.00 23.82 ? 172  GLN A NE2 1 
ATOM   1183  N N   . TYR A 1 147 ? 62.987  5.531   12.441  1.00 19.47 ? 173  TYR A N   1 
ATOM   1184  C CA  . TYR A 1 147 ? 62.400  4.270   12.877  1.00 20.00 ? 173  TYR A CA  1 
ATOM   1185  C C   . TYR A 1 147 ? 61.625  4.387   14.183  1.00 21.71 ? 173  TYR A C   1 
ATOM   1186  O O   . TYR A 1 147 ? 60.781  3.547   14.487  1.00 22.95 ? 173  TYR A O   1 
ATOM   1187  C CB  . TYR A 1 147 ? 63.488  3.210   13.027  1.00 20.08 ? 173  TYR A CB  1 
ATOM   1188  C CG  . TYR A 1 147 ? 64.071  2.764   11.710  1.00 18.54 ? 173  TYR A CG  1 
ATOM   1189  C CD1 . TYR A 1 147 ? 63.384  1.873   10.894  1.00 18.41 ? 173  TYR A CD1 1 
ATOM   1190  C CD2 . TYR A 1 147 ? 65.300  3.249   11.275  1.00 18.14 ? 173  TYR A CD2 1 
ATOM   1191  C CE1 . TYR A 1 147 ? 63.915  1.463   9.670   1.00 16.41 ? 173  TYR A CE1 1 
ATOM   1192  C CE2 . TYR A 1 147 ? 65.836  2.861   10.059  1.00 18.27 ? 173  TYR A CE2 1 
ATOM   1193  C CZ  . TYR A 1 147 ? 65.141  1.962   9.263   1.00 16.49 ? 173  TYR A CZ  1 
ATOM   1194  O OH  . TYR A 1 147 ? 65.680  1.572   8.066   1.00 17.03 ? 173  TYR A OH  1 
ATOM   1195  N N   . TYR A 1 148 ? 61.903  5.430   14.957  1.00 22.73 ? 174  TYR A N   1 
ATOM   1196  C CA  . TYR A 1 148 ? 61.206  5.624   16.227  1.00 23.51 ? 174  TYR A CA  1 
ATOM   1197  C C   . TYR A 1 148 ? 60.113  6.671   16.071  1.00 23.81 ? 174  TYR A C   1 
ATOM   1198  O O   . TYR A 1 148 ? 59.732  7.335   17.040  1.00 24.34 ? 174  TYR A O   1 
ATOM   1199  C CB  . TYR A 1 148 ? 62.185  6.053   17.331  1.00 23.84 ? 174  TYR A CB  1 
ATOM   1200  C CG  . TYR A 1 148 ? 63.202  4.987   17.689  1.00 25.87 ? 174  TYR A CG  1 
ATOM   1201  C CD1 . TYR A 1 148 ? 64.265  4.691   16.835  1.00 26.27 ? 174  TYR A CD1 1 
ATOM   1202  C CD2 . TYR A 1 148 ? 63.066  4.231   18.854  1.00 25.80 ? 174  TYR A CD2 1 
ATOM   1203  C CE1 . TYR A 1 148 ? 65.162  3.661   17.129  1.00 27.18 ? 174  TYR A CE1 1 
ATOM   1204  C CE2 . TYR A 1 148 ? 63.958  3.201   19.155  1.00 26.49 ? 174  TYR A CE2 1 
ATOM   1205  C CZ  . TYR A 1 148 ? 64.999  2.919   18.290  1.00 26.75 ? 174  TYR A CZ  1 
ATOM   1206  O OH  . TYR A 1 148 ? 65.864  1.885   18.575  1.00 29.62 ? 174  TYR A OH  1 
ATOM   1207  N N   . GLN A 1 149 ? 59.614  6.815   14.850  1.00 21.79 ? 175  GLN A N   1 
ATOM   1208  C CA  . GLN A 1 149 ? 58.567  7.789   14.571  1.00 22.99 ? 175  GLN A CA  1 
ATOM   1209  C C   . GLN A 1 149 ? 57.410  7.152   13.813  1.00 21.46 ? 175  GLN A C   1 
ATOM   1210  O O   . GLN A 1 149 ? 56.316  7.699   13.778  1.00 23.47 ? 175  GLN A O   1 
ATOM   1211  C CB  . GLN A 1 149 ? 59.120  8.939   13.727  1.00 24.11 ? 175  GLN A CB  1 
ATOM   1212  C CG  . GLN A 1 149 ? 60.462  9.488   14.186  1.00 28.84 ? 175  GLN A CG  1 
ATOM   1213  C CD  . GLN A 1 149 ? 60.454  9.891   15.646  1.00 30.33 ? 175  GLN A CD  1 
ATOM   1214  O OE1 . GLN A 1 149 ? 59.487  10.473  16.130  1.00 30.81 ? 175  GLN A OE1 1 
ATOM   1215  N NE2 . GLN A 1 149 ? 61.541  9.592   16.351  1.00 32.21 ? 175  GLN A NE2 1 
ATOM   1216  N N   . ILE A 1 150 ? 57.654  5.988   13.219  1.00 21.48 ? 176  ILE A N   1 
ATOM   1217  C CA  . ILE A 1 150 ? 56.642  5.303   12.416  1.00 21.45 ? 176  ILE A CA  1 
ATOM   1218  C C   . ILE A 1 150 ? 55.590  4.486   13.163  1.00 19.73 ? 176  ILE A C   1 
ATOM   1219  O O   . ILE A 1 150 ? 54.431  4.453   12.748  1.00 18.50 ? 176  ILE A O   1 
ATOM   1220  C CB  . ILE A 1 150 ? 57.307  4.389   11.365  1.00 23.05 ? 176  ILE A CB  1 
ATOM   1221  C CG1 . ILE A 1 150 ? 58.246  3.405   12.057  1.00 24.95 ? 176  ILE A CG1 1 
ATOM   1222  C CG2 . ILE A 1 150 ? 58.084  5.230   10.367  1.00 23.04 ? 176  ILE A CG2 1 
ATOM   1223  C CD1 . ILE A 1 150 ? 58.972  2.491   11.101  1.00 26.98 ? 176  ILE A CD1 1 
ATOM   1224  N N   . LEU A 1 151 ? 55.984  3.826   14.249  1.00 17.56 ? 177  LEU A N   1 
ATOM   1225  C CA  . LEU A 1 151 ? 55.054  3.012   15.031  1.00 16.52 ? 177  LEU A CA  1 
ATOM   1226  C C   . LEU A 1 151 ? 54.412  3.755   16.196  1.00 15.59 ? 177  LEU A C   1 
ATOM   1227  O O   . LEU A 1 151 ? 55.003  4.663   16.772  1.00 16.11 ? 177  LEU A O   1 
ATOM   1228  C CB  . LEU A 1 151 ? 55.767  1.772   15.579  1.00 16.71 ? 177  LEU A CB  1 
ATOM   1229  C CG  . LEU A 1 151 ? 56.369  0.825   14.542  1.00 17.88 ? 177  LEU A CG  1 
ATOM   1230  C CD1 . LEU A 1 151 ? 57.179  -0.254  15.240  1.00 18.77 ? 177  LEU A CD1 1 
ATOM   1231  C CD2 . LEU A 1 151 ? 55.253  0.213   13.710  1.00 18.32 ? 177  LEU A CD2 1 
ATOM   1232  N N   . SER A 1 152 ? 53.204  3.337   16.548  1.00 15.68 ? 178  SER A N   1 
ATOM   1233  C CA  . SER A 1 152 ? 52.466  3.928   17.656  1.00 16.93 ? 178  SER A CA  1 
ATOM   1234  C C   . SER A 1 152 ? 52.396  5.452   17.552  1.00 17.08 ? 178  SER A C   1 
ATOM   1235  O O   . SER A 1 152 ? 52.480  6.159   18.553  1.00 16.26 ? 178  SER A O   1 
ATOM   1236  C CB  . SER A 1 152 ? 53.113  3.518   18.985  1.00 17.56 ? 178  SER A CB  1 
ATOM   1237  O OG  . SER A 1 152 ? 53.193  2.108   19.093  1.00 18.26 ? 178  SER A OG  1 
ATOM   1238  N N   . SER A 1 153 ? 52.244  5.955   16.335  1.00 15.45 ? 179  SER A N   1 
ATOM   1239  C CA  . SER A 1 153 ? 52.157  7.392   16.130  1.00 16.89 ? 179  SER A CA  1 
ATOM   1240  C C   . SER A 1 153 ? 50.961  7.736   15.263  1.00 16.16 ? 179  SER A C   1 
ATOM   1241  O O   . SER A 1 153 ? 50.338  6.861   14.652  1.00 14.12 ? 179  SER A O   1 
ATOM   1242  C CB  . SER A 1 153 ? 53.424  7.915   15.472  1.00 15.02 ? 179  SER A CB  1 
ATOM   1243  O OG  . SER A 1 153 ? 53.630  7.303   14.224  1.00 18.34 ? 179  SER A OG  1 
ATOM   1244  N N   . CYS A 1 154 ? 50.643  9.025   15.196  1.00 15.57 ? 180  CYS A N   1 
ATOM   1245  C CA  . CYS A 1 154 ? 49.506  9.457   14.402  1.00 15.83 ? 180  CYS A CA  1 
ATOM   1246  C C   . CYS A 1 154 ? 49.513  10.962  14.220  1.00 16.99 ? 180  CYS A C   1 
ATOM   1247  O O   . CYS A 1 154 ? 49.988  11.701  15.094  1.00 18.08 ? 180  CYS A O   1 
ATOM   1248  C CB  . CYS A 1 154 ? 48.201  9.040   15.087  1.00 13.60 ? 180  CYS A CB  1 
ATOM   1249  S SG  . CYS A 1 154 ? 46.671  9.348   14.150  1.00 15.25 ? 180  CYS A SG  1 
ATOM   1250  N N   . ARG A 1 155 ? 49.004  11.412  13.081  1.00 15.27 ? 181  ARG A N   1 
ATOM   1251  C CA  . ARG A 1 155 ? 48.918  12.839  12.811  1.00 16.28 ? 181  ARG A CA  1 
ATOM   1252  C C   . ARG A 1 155 ? 47.620  13.323  13.459  1.00 16.14 ? 181  ARG A C   1 
ATOM   1253  O O   . ARG A 1 155 ? 46.660  12.556  13.587  1.00 15.76 ? 181  ARG A O   1 
ATOM   1254  C CB  . ARG A 1 155 ? 48.896  13.095  11.305  1.00 15.23 ? 181  ARG A CB  1 
ATOM   1255  C CG  . ARG A 1 155 ? 48.759  14.564  10.914  1.00 15.15 ? 181  ARG A CG  1 
ATOM   1256  C CD  . ARG A 1 155 ? 49.316  14.796  9.522   1.00 14.19 ? 181  ARG A CD  1 
ATOM   1257  N NE  . ARG A 1 155 ? 49.132  16.165  9.046   1.00 11.63 ? 181  ARG A NE  1 
ATOM   1258  C CZ  . ARG A 1 155 ? 49.780  16.675  8.003   1.00 11.37 ? 181  ARG A CZ  1 
ATOM   1259  N NH1 . ARG A 1 155 ? 50.651  15.935  7.329   1.00 9.82  ? 181  ARG A NH1 1 
ATOM   1260  N NH2 . ARG A 1 155 ? 49.551  17.927  7.624   1.00 11.85 ? 181  ARG A NH2 1 
ATOM   1261  N N   . VAL A 1 156 ? 47.604  14.581  13.891  1.00 16.99 ? 182  VAL A N   1 
ATOM   1262  C CA  . VAL A 1 156 ? 46.425  15.155  14.539  1.00 16.31 ? 182  VAL A CA  1 
ATOM   1263  C C   . VAL A 1 156 ? 46.034  16.474  13.876  1.00 17.55 ? 182  VAL A C   1 
ATOM   1264  O O   . VAL A 1 156 ? 46.845  17.397  13.782  1.00 17.99 ? 182  VAL A O   1 
ATOM   1265  C CB  . VAL A 1 156 ? 46.682  15.437  16.036  1.00 16.69 ? 182  VAL A CB  1 
ATOM   1266  C CG1 . VAL A 1 156 ? 45.377  15.812  16.737  1.00 14.20 ? 182  VAL A CG1 1 
ATOM   1267  C CG2 . VAL A 1 156 ? 47.325  14.220  16.692  1.00 16.96 ? 182  VAL A CG2 1 
ATOM   1268  N N   . PRO A 1 157 ? 44.773  16.573  13.416  1.00 17.89 ? 183  PRO A N   1 
ATOM   1269  C CA  . PRO A 1 157 ? 44.196  17.748  12.752  1.00 17.92 ? 183  PRO A CA  1 
ATOM   1270  C C   . PRO A 1 157 ? 44.338  18.988  13.626  1.00 16.75 ? 183  PRO A C   1 
ATOM   1271  O O   . PRO A 1 157 ? 44.022  18.942  14.808  1.00 17.61 ? 183  PRO A O   1 
ATOM   1272  C CB  . PRO A 1 157 ? 42.721  17.372  12.598  1.00 19.18 ? 183  PRO A CB  1 
ATOM   1273  C CG  . PRO A 1 157 ? 42.731  15.907  12.569  1.00 18.52 ? 183  PRO A CG  1 
ATOM   1274  C CD  . PRO A 1 157 ? 43.740  15.547  13.619  1.00 17.14 ? 183  PRO A CD  1 
ATOM   1275  N N   . GLY A 1 158 ? 44.795  20.086  13.038  1.00 16.42 ? 184  GLY A N   1 
ATOM   1276  C CA  . GLY A 1 158 ? 44.939  21.333  13.767  1.00 16.65 ? 184  GLY A CA  1 
ATOM   1277  C C   . GLY A 1 158 ? 44.282  22.457  12.989  1.00 17.60 ? 184  GLY A C   1 
ATOM   1278  O O   . GLY A 1 158 ? 44.351  22.467  11.766  1.00 17.17 ? 184  GLY A O   1 
ATOM   1279  N N   . PRO A 1 159 ? 43.638  23.422  13.665  1.00 20.57 ? 185  PRO A N   1 
ATOM   1280  C CA  . PRO A 1 159 ? 42.976  24.542  12.983  1.00 20.37 ? 185  PRO A CA  1 
ATOM   1281  C C   . PRO A 1 159 ? 43.901  25.361  12.088  1.00 19.34 ? 185  PRO A C   1 
ATOM   1282  O O   . PRO A 1 159 ? 43.509  25.796  11.007  1.00 18.45 ? 185  PRO A O   1 
ATOM   1283  C CB  . PRO A 1 159 ? 42.398  25.360  14.140  1.00 21.13 ? 185  PRO A CB  1 
ATOM   1284  C CG  . PRO A 1 159 ? 43.340  25.065  15.264  1.00 22.81 ? 185  PRO A CG  1 
ATOM   1285  C CD  . PRO A 1 159 ? 43.579  23.589  15.126  1.00 21.04 ? 185  PRO A CD  1 
ATOM   1286  N N   . LYS A 1 160 ? 45.132  25.565  12.538  1.00 19.69 ? 186  LYS A N   1 
ATOM   1287  C CA  . LYS A 1 160 ? 46.089  26.333  11.757  1.00 20.54 ? 186  LYS A CA  1 
ATOM   1288  C C   . LYS A 1 160 ? 47.116  25.397  11.147  1.00 19.41 ? 186  LYS A C   1 
ATOM   1289  O O   . LYS A 1 160 ? 47.370  25.427  9.940   1.00 19.56 ? 186  LYS A O   1 
ATOM   1290  C CB  . LYS A 1 160 ? 46.789  27.369  12.641  1.00 24.37 ? 186  LYS A CB  1 
ATOM   1291  C CG  . LYS A 1 160 ? 47.793  28.246  11.896  1.00 30.37 ? 186  LYS A CG  1 
ATOM   1292  C CD  . LYS A 1 160 ? 48.558  29.174  12.845  1.00 35.68 ? 186  LYS A CD  1 
ATOM   1293  C CE  . LYS A 1 160 ? 49.487  30.113  12.075  1.00 37.24 ? 186  LYS A CE  1 
ATOM   1294  N NZ  . LYS A 1 160 ? 50.347  30.926  12.986  1.00 39.92 ? 186  LYS A NZ  1 
ATOM   1295  N N   . GLN A 1 161 ? 47.711  24.563  11.990  1.00 17.16 ? 187  GLN A N   1 
ATOM   1296  C CA  . GLN A 1 161 ? 48.698  23.614  11.516  1.00 18.24 ? 187  GLN A CA  1 
ATOM   1297  C C   . GLN A 1 161 ? 48.468  22.299  12.251  1.00 17.90 ? 187  GLN A C   1 
ATOM   1298  O O   . GLN A 1 161 ? 47.865  22.270  13.324  1.00 16.86 ? 187  GLN A O   1 
ATOM   1299  C CB  . GLN A 1 161 ? 50.118  24.140  11.767  1.00 19.41 ? 187  GLN A CB  1 
ATOM   1300  C CG  . GLN A 1 161 ? 50.627  23.914  13.174  1.00 23.29 ? 187  GLN A CG  1 
ATOM   1301  C CD  . GLN A 1 161 ? 52.108  24.218  13.334  1.00 26.12 ? 187  GLN A CD  1 
ATOM   1302  O OE1 . GLN A 1 161 ? 52.795  23.577  14.124  1.00 28.93 ? 187  GLN A OE1 1 
ATOM   1303  N NE2 . GLN A 1 161 ? 52.602  25.211  12.596  1.00 22.95 ? 187  GLN A NE2 1 
ATOM   1304  N N   . ASP A 1 162 ? 48.938  21.208  11.667  1.00 17.10 ? 188  ASP A N   1 
ATOM   1305  C CA  . ASP A 1 162 ? 48.757  19.903  12.278  1.00 19.02 ? 188  ASP A CA  1 
ATOM   1306  C C   . ASP A 1 162 ? 49.864  19.568  13.265  1.00 19.35 ? 188  ASP A C   1 
ATOM   1307  O O   . ASP A 1 162 ? 50.894  20.234  13.318  1.00 21.59 ? 188  ASP A O   1 
ATOM   1308  C CB  . ASP A 1 162 ? 48.691  18.819  11.190  1.00 19.66 ? 188  ASP A CB  1 
ATOM   1309  C CG  . ASP A 1 162 ? 47.338  18.767  10.491  1.00 19.39 ? 188  ASP A CG  1 
ATOM   1310  O OD1 . ASP A 1 162 ? 46.480  19.625  10.776  1.00 20.63 ? 188  ASP A OD1 1 
ATOM   1311  O OD2 . ASP A 1 162 ? 47.128  17.861  9.658   1.00 20.87 ? 188  ASP A OD2 1 
ATOM   1312  N N   . SER A 1 163 ? 49.641  18.536  14.064  1.00 20.05 ? 189  SER A N   1 
ATOM   1313  C CA  . SER A 1 163 ? 50.651  18.099  15.009  1.00 19.96 ? 189  SER A CA  1 
ATOM   1314  C C   . SER A 1 163 ? 50.773  16.594  14.871  1.00 20.45 ? 189  SER A C   1 
ATOM   1315  O O   . SER A 1 163 ? 49.976  15.953  14.177  1.00 17.77 ? 189  SER A O   1 
ATOM   1316  C CB  . SER A 1 163 ? 50.255  18.447  16.442  1.00 19.26 ? 189  SER A CB  1 
ATOM   1317  O OG  . SER A 1 163 ? 49.145  17.673  16.850  1.00 20.30 ? 189  SER A OG  1 
ATOM   1318  N N   . VAL A 1 164 ? 51.785  16.038  15.524  1.00 19.83 ? 190  VAL A N   1 
ATOM   1319  C CA  . VAL A 1 164 ? 52.010  14.604  15.502  1.00 21.15 ? 190  VAL A CA  1 
ATOM   1320  C C   . VAL A 1 164 ? 52.191  14.090  16.925  1.00 20.72 ? 190  VAL A C   1 
ATOM   1321  O O   . VAL A 1 164 ? 52.880  14.716  17.735  1.00 19.81 ? 190  VAL A O   1 
ATOM   1322  C CB  . VAL A 1 164 ? 53.263  14.247  14.689  1.00 22.02 ? 190  VAL A CB  1 
ATOM   1323  C CG1 . VAL A 1 164 ? 53.519  12.750  14.771  1.00 23.00 ? 190  VAL A CG1 1 
ATOM   1324  C CG2 . VAL A 1 164 ? 53.081  14.673  13.250  1.00 21.67 ? 190  VAL A CG2 1 
ATOM   1325  N N   . VAL A 1 165 ? 51.551  12.965  17.222  1.00 20.05 ? 191  VAL A N   1 
ATOM   1326  C CA  . VAL A 1 165 ? 51.643  12.337  18.531  1.00 19.17 ? 191  VAL A CA  1 
ATOM   1327  C C   . VAL A 1 165 ? 52.375  11.005  18.402  1.00 21.08 ? 191  VAL A C   1 
ATOM   1328  O O   . VAL A 1 165 ? 52.119  10.228  17.477  1.00 18.88 ? 191  VAL A O   1 
ATOM   1329  C CB  . VAL A 1 165 ? 50.251  12.074  19.148  1.00 18.86 ? 191  VAL A CB  1 
ATOM   1330  C CG1 . VAL A 1 165 ? 49.628  13.384  19.621  1.00 17.34 ? 191  VAL A CG1 1 
ATOM   1331  C CG2 . VAL A 1 165 ? 49.347  11.366  18.146  1.00 14.85 ? 191  VAL A CG2 1 
ATOM   1332  N N   . ASN A 1 166 ? 53.282  10.748  19.335  1.00 21.32 ? 192  ASN A N   1 
ATOM   1333  C CA  . ASN A 1 166 ? 54.062  9.518   19.330  1.00 23.17 ? 192  ASN A CA  1 
ATOM   1334  C C   . ASN A 1 166 ? 54.035  8.924   20.735  1.00 23.01 ? 192  ASN A C   1 
ATOM   1335  O O   . ASN A 1 166 ? 54.505  9.552   21.681  1.00 21.63 ? 192  ASN A O   1 
ATOM   1336  C CB  . ASN A 1 166 ? 55.491  9.848   18.912  1.00 24.49 ? 192  ASN A CB  1 
ATOM   1337  C CG  . ASN A 1 166 ? 56.343  8.616   18.705  1.00 27.48 ? 192  ASN A CG  1 
ATOM   1338  O OD1 . ASN A 1 166 ? 57.455  8.711   18.187  1.00 30.83 ? 192  ASN A OD1 1 
ATOM   1339  N ND2 . ASN A 1 166 ? 55.840  7.458   19.118  1.00 26.45 ? 192  ASN A ND2 1 
ATOM   1340  N N   . PHE A 1 167 ? 53.483  7.717   20.866  1.00 24.25 ? 193  PHE A N   1 
ATOM   1341  C CA  . PHE A 1 167 ? 53.375  7.047   22.165  1.00 24.60 ? 193  PHE A CA  1 
ATOM   1342  C C   . PHE A 1 167 ? 54.331  5.865   22.315  1.00 26.08 ? 193  PHE A C   1 
ATOM   1343  O O   . PHE A 1 167 ? 54.232  5.094   23.274  1.00 26.36 ? 193  PHE A O   1 
ATOM   1344  C CB  . PHE A 1 167 ? 51.944  6.547   22.385  1.00 23.06 ? 193  PHE A CB  1 
ATOM   1345  C CG  . PHE A 1 167 ? 50.889  7.572   22.089  1.00 24.30 ? 193  PHE A CG  1 
ATOM   1346  C CD1 . PHE A 1 167 ? 50.364  7.699   20.806  1.00 23.27 ? 193  PHE A CD1 1 
ATOM   1347  C CD2 . PHE A 1 167 ? 50.432  8.428   23.088  1.00 22.77 ? 193  PHE A CD2 1 
ATOM   1348  C CE1 . PHE A 1 167 ? 49.394  8.670   20.525  1.00 23.15 ? 193  PHE A CE1 1 
ATOM   1349  C CE2 . PHE A 1 167 ? 49.471  9.395   22.819  1.00 24.03 ? 193  PHE A CE2 1 
ATOM   1350  C CZ  . PHE A 1 167 ? 48.948  9.517   21.532  1.00 23.84 ? 193  PHE A CZ  1 
ATOM   1351  N N   . LEU A 1 168 ? 55.252  5.725   21.366  1.00 27.05 ? 194  LEU A N   1 
ATOM   1352  C CA  . LEU A 1 168 ? 56.216  4.634   21.390  1.00 28.33 ? 194  LEU A CA  1 
ATOM   1353  C C   . LEU A 1 168 ? 56.996  4.616   22.702  1.00 30.74 ? 194  LEU A C   1 
ATOM   1354  O O   . LEU A 1 168 ? 57.410  3.556   23.175  1.00 30.96 ? 194  LEU A O   1 
ATOM   1355  C CB  . LEU A 1 168 ? 57.187  4.773   20.216  1.00 27.39 ? 194  LEU A CB  1 
ATOM   1356  C CG  . LEU A 1 168 ? 58.232  3.664   20.067  1.00 27.81 ? 194  LEU A CG  1 
ATOM   1357  C CD1 . LEU A 1 168 ? 57.565  2.411   19.541  1.00 26.29 ? 194  LEU A CD1 1 
ATOM   1358  C CD2 . LEU A 1 168 ? 59.327  4.097   19.112  1.00 27.13 ? 194  LEU A CD2 1 
ATOM   1359  N N   . LYS A 1 169 ? 57.188  5.791   23.293  1.00 32.33 ? 195  LYS A N   1 
ATOM   1360  C CA  . LYS A 1 169 ? 57.930  5.893   24.541  1.00 33.60 ? 195  LYS A CA  1 
ATOM   1361  C C   . LYS A 1 169 ? 57.125  6.487   25.687  1.00 33.97 ? 195  LYS A C   1 
ATOM   1362  O O   . LYS A 1 169 ? 57.688  7.087   26.599  1.00 34.25 ? 195  LYS A O   1 
ATOM   1363  C CB  . LYS A 1 169 ? 59.192  6.727   24.322  1.00 34.94 ? 195  LYS A CB  1 
ATOM   1364  C CG  . LYS A 1 169 ? 60.206  6.079   23.392  1.00 37.95 ? 195  LYS A CG  1 
ATOM   1365  C CD  . LYS A 1 169 ? 61.414  6.981   23.195  1.00 40.72 ? 195  LYS A CD  1 
ATOM   1366  C CE  . LYS A 1 169 ? 62.461  6.345   22.287  1.00 42.09 ? 195  LYS A CE  1 
ATOM   1367  N NZ  . LYS A 1 169 ? 63.064  5.112   22.865  1.00 44.18 ? 195  LYS A NZ  1 
ATOM   1368  N N   . SER A 1 170 ? 55.806  6.319   25.643  1.00 34.42 ? 196  SER A N   1 
ATOM   1369  C CA  . SER A 1 170 ? 54.951  6.837   26.702  1.00 35.72 ? 196  SER A CA  1 
ATOM   1370  C C   . SER A 1 170 ? 55.059  5.927   27.928  1.00 37.07 ? 196  SER A C   1 
ATOM   1371  O O   . SER A 1 170 ? 55.532  4.796   27.819  1.00 36.16 ? 196  SER A O   1 
ATOM   1372  C CB  . SER A 1 170 ? 53.500  6.911   26.219  1.00 35.74 ? 196  SER A CB  1 
ATOM   1373  O OG  . SER A 1 170 ? 53.000  5.629   25.889  1.00 38.82 ? 196  SER A OG  1 
ATOM   1374  N N   . LYS A 1 171 ? 54.629  6.423   29.089  1.00 38.34 ? 197  LYS A N   1 
ATOM   1375  C CA  . LYS A 1 171 ? 54.685  5.647   30.331  1.00 39.78 ? 197  LYS A CA  1 
ATOM   1376  C C   . LYS A 1 171 ? 54.345  4.176   30.091  1.00 38.84 ? 197  LYS A C   1 
ATOM   1377  O O   . LYS A 1 171 ? 55.130  3.285   30.425  1.00 38.75 ? 197  LYS A O   1 
ATOM   1378  C CB  . LYS A 1 171 ? 53.723  6.237   31.371  1.00 42.12 ? 197  LYS A CB  1 
ATOM   1379  C CG  . LYS A 1 171 ? 54.166  7.580   31.942  1.00 45.17 ? 197  LYS A CG  1 
ATOM   1380  C CD  . LYS A 1 171 ? 55.495  7.448   32.674  1.00 47.59 ? 197  LYS A CD  1 
ATOM   1381  C CE  . LYS A 1 171 ? 56.021  8.799   33.123  1.00 49.42 ? 197  LYS A CE  1 
ATOM   1382  N NZ  . LYS A 1 171 ? 56.256  9.709   31.968  1.00 50.38 ? 197  LYS A NZ  1 
ATOM   1383  N N   . ARG A 1 172 ? 53.176  3.929   29.516  1.00 38.11 ? 198  ARG A N   1 
ATOM   1384  C CA  . ARG A 1 172 ? 52.746  2.573   29.205  1.00 36.79 ? 198  ARG A CA  1 
ATOM   1385  C C   . ARG A 1 172 ? 52.458  2.454   27.708  1.00 33.21 ? 198  ARG A C   1 
ATOM   1386  O O   . ARG A 1 172 ? 51.327  2.643   27.260  1.00 32.99 ? 198  ARG A O   1 
ATOM   1387  C CB  . ARG A 1 172 ? 51.515  2.194   30.039  1.00 40.16 ? 198  ARG A CB  1 
ATOM   1388  C CG  . ARG A 1 172 ? 50.569  3.343   30.388  1.00 45.80 ? 198  ARG A CG  1 
ATOM   1389  C CD  . ARG A 1 172 ? 49.445  3.513   29.373  1.00 51.00 ? 198  ARG A CD  1 
ATOM   1390  N NE  . ARG A 1 172 ? 48.289  4.206   29.946  1.00 55.24 ? 198  ARG A NE  1 
ATOM   1391  C CZ  . ARG A 1 172 ? 48.297  5.466   30.377  1.00 56.73 ? 198  ARG A CZ  1 
ATOM   1392  N NH1 . ARG A 1 172 ? 49.403  6.197   30.303  1.00 57.59 ? 198  ARG A NH1 1 
ATOM   1393  N NH2 . ARG A 1 172 ? 47.195  5.997   30.894  1.00 57.80 ? 198  ARG A NH2 1 
ATOM   1394  N N   . PRO A 1 173 ? 53.498  2.141   26.917  1.00 30.01 ? 199  PRO A N   1 
ATOM   1395  C CA  . PRO A 1 173 ? 53.425  1.991   25.462  1.00 29.07 ? 199  PRO A CA  1 
ATOM   1396  C C   . PRO A 1 173 ? 52.248  1.138   24.996  1.00 26.67 ? 199  PRO A C   1 
ATOM   1397  O O   . PRO A 1 173 ? 51.895  0.144   25.628  1.00 25.64 ? 199  PRO A O   1 
ATOM   1398  C CB  . PRO A 1 173 ? 54.772  1.355   25.117  1.00 29.59 ? 199  PRO A CB  1 
ATOM   1399  C CG  . PRO A 1 173 ? 55.682  1.969   26.138  1.00 30.62 ? 199  PRO A CG  1 
ATOM   1400  C CD  . PRO A 1 173 ? 54.859  1.841   27.397  1.00 31.14 ? 199  PRO A CD  1 
ATOM   1401  N N   . PRO A 1 174 ? 51.616  1.539   23.884  1.00 24.53 ? 200  PRO A N   1 
ATOM   1402  C CA  . PRO A 1 174 ? 50.471  0.809   23.330  1.00 24.53 ? 200  PRO A CA  1 
ATOM   1403  C C   . PRO A 1 174 ? 50.860  -0.620  22.967  1.00 22.57 ? 200  PRO A C   1 
ATOM   1404  O O   . PRO A 1 174 ? 51.946  -0.858  22.435  1.00 21.97 ? 200  PRO A O   1 
ATOM   1405  C CB  . PRO A 1 174 ? 50.102  1.632   22.099  1.00 24.78 ? 200  PRO A CB  1 
ATOM   1406  C CG  . PRO A 1 174 ? 50.503  3.022   22.497  1.00 24.86 ? 200  PRO A CG  1 
ATOM   1407  C CD  . PRO A 1 174 ? 51.848  2.781   23.133  1.00 24.97 ? 200  PRO A CD  1 
ATOM   1408  N N   . THR A 1 175 ? 49.978  -1.565  23.257  1.00 23.22 ? 201  THR A N   1 
ATOM   1409  C CA  . THR A 1 175 ? 50.240  -2.967  22.947  1.00 24.14 ? 201  THR A CA  1 
ATOM   1410  C C   . THR A 1 175 ? 49.137  -3.467  22.026  1.00 23.85 ? 201  THR A C   1 
ATOM   1411  O O   . THR A 1 175 ? 48.952  -4.671  21.854  1.00 24.17 ? 201  THR A O   1 
ATOM   1412  C CB  . THR A 1 175 ? 50.239  -3.834  24.219  1.00 25.79 ? 201  THR A CB  1 
ATOM   1413  O OG1 . THR A 1 175 ? 48.935  -3.799  24.812  1.00 25.76 ? 201  THR A OG1 1 
ATOM   1414  C CG2 . THR A 1 175 ? 51.261  -3.309  25.222  1.00 25.19 ? 201  THR A CG2 1 
ATOM   1415  N N   . HIS A 1 176 ? 48.405  -2.536  21.428  1.00 22.39 ? 202  HIS A N   1 
ATOM   1416  C CA  . HIS A 1 176 ? 47.315  -2.908  20.538  1.00 22.11 ? 202  HIS A CA  1 
ATOM   1417  C C   . HIS A 1 176 ? 47.432  -2.246  19.170  1.00 21.37 ? 202  HIS A C   1 
ATOM   1418  O O   . HIS A 1 176 ? 48.071  -1.206  19.013  1.00 19.77 ? 202  HIS A O   1 
ATOM   1419  C CB  . HIS A 1 176 ? 45.985  -2.493  21.156  1.00 21.96 ? 202  HIS A CB  1 
ATOM   1420  C CG  . HIS A 1 176 ? 45.768  -1.012  21.149  1.00 23.09 ? 202  HIS A CG  1 
ATOM   1421  N ND1 . HIS A 1 176 ? 45.099  -0.364  20.135  1.00 24.99 ? 202  HIS A ND1 1 
ATOM   1422  C CD2 . HIS A 1 176 ? 46.203  -0.045  21.992  1.00 22.15 ? 202  HIS A CD2 1 
ATOM   1423  C CE1 . HIS A 1 176 ? 45.129  0.939   20.350  1.00 23.29 ? 202  HIS A CE1 1 
ATOM   1424  N NE2 . HIS A 1 176 ? 45.794  1.161   21.472  1.00 22.66 ? 202  HIS A NE2 1 
ATOM   1425  N N   . ILE A 1 177 ? 46.824  -2.873  18.170  1.00 20.41 ? 203  ILE A N   1 
ATOM   1426  C CA  . ILE A 1 177 ? 46.807  -2.308  16.833  1.00 19.45 ? 203  ILE A CA  1 
ATOM   1427  C C   . ILE A 1 177 ? 45.336  -2.072  16.527  1.00 18.40 ? 203  ILE A C   1 
ATOM   1428  O O   . ILE A 1 177 ? 44.461  -2.464  17.308  1.00 17.49 ? 203  ILE A O   1 
ATOM   1429  C CB  . ILE A 1 177 ? 47.385  -3.278  15.752  1.00 20.09 ? 203  ILE A CB  1 
ATOM   1430  C CG1 . ILE A 1 177 ? 46.474  -4.495  15.605  1.00 21.01 ? 203  ILE A CG1 1 
ATOM   1431  C CG2 . ILE A 1 177 ? 48.803  -3.703  16.113  1.00 19.74 ? 203  ILE A CG2 1 
ATOM   1432  C CD1 . ILE A 1 177 ? 46.752  -5.346  14.372  1.00 19.25 ? 203  ILE A CD1 1 
ATOM   1433  N N   . THR A 1 178 ? 45.064  -1.424  15.403  1.00 18.95 ? 204  THR A N   1 
ATOM   1434  C CA  . THR A 1 178 ? 43.688  -1.202  14.993  1.00 18.65 ? 204  THR A CA  1 
ATOM   1435  C C   . THR A 1 178 ? 43.435  -1.929  13.675  1.00 19.97 ? 204  THR A C   1 
ATOM   1436  O O   . THR A 1 178 ? 44.282  -1.923  12.782  1.00 21.54 ? 204  THR A O   1 
ATOM   1437  C CB  . THR A 1 178 ? 43.367  0.297   14.832  1.00 17.65 ? 204  THR A CB  1 
ATOM   1438  O OG1 . THR A 1 178 ? 44.438  0.957   14.145  1.00 16.93 ? 204  THR A OG1 1 
ATOM   1439  C CG2 . THR A 1 178 ? 43.166  0.927   16.188  1.00 17.78 ? 204  THR A CG2 1 
ATOM   1440  N N   . VAL A 1 179 ? 42.281  -2.581  13.577  1.00 20.26 ? 205  VAL A N   1 
ATOM   1441  C CA  . VAL A 1 179 ? 41.912  -3.306  12.371  1.00 19.77 ? 205  VAL A CA  1 
ATOM   1442  C C   . VAL A 1 179 ? 40.632  -2.704  11.821  1.00 19.62 ? 205  VAL A C   1 
ATOM   1443  O O   . VAL A 1 179 ? 39.677  -2.485  12.556  1.00 19.93 ? 205  VAL A O   1 
ATOM   1444  C CB  . VAL A 1 179 ? 41.675  -4.799  12.657  1.00 19.85 ? 205  VAL A CB  1 
ATOM   1445  C CG1 . VAL A 1 179 ? 41.319  -5.531  11.367  1.00 19.87 ? 205  VAL A CG1 1 
ATOM   1446  C CG2 . VAL A 1 179 ? 42.910  -5.402  13.266  1.00 18.24 ? 205  VAL A CG2 1 
ATOM   1447  N N   . VAL A 1 180 ? 40.616  -2.437  10.521  1.00 21.27 ? 206  VAL A N   1 
ATOM   1448  C CA  . VAL A 1 180 ? 39.445  -1.846  9.892   1.00 21.75 ? 206  VAL A CA  1 
ATOM   1449  C C   . VAL A 1 180 ? 38.843  -2.790  8.860   1.00 21.45 ? 206  VAL A C   1 
ATOM   1450  O O   . VAL A 1 180 ? 39.535  -3.223  7.941   1.00 21.07 ? 206  VAL A O   1 
ATOM   1451  C CB  . VAL A 1 180 ? 39.785  -0.525  9.158   1.00 21.90 ? 206  VAL A CB  1 
ATOM   1452  C CG1 . VAL A 1 180 ? 38.550  0.360   9.105   1.00 20.18 ? 206  VAL A CG1 1 
ATOM   1453  C CG2 . VAL A 1 180 ? 40.946  0.175   9.831   1.00 25.01 ? 206  VAL A CG2 1 
ATOM   1454  N N   . HIS A 1 181 ? 37.561  -3.095  9.013   1.00 22.29 ? 207  HIS A N   1 
ATOM   1455  C CA  . HIS A 1 181 ? 36.853  -3.964  8.077   1.00 23.29 ? 207  HIS A CA  1 
ATOM   1456  C C   . HIS A 1 181 ? 35.464  -3.375  7.845   1.00 23.84 ? 207  HIS A C   1 
ATOM   1457  O O   . HIS A 1 181 ? 34.700  -3.156  8.787   1.00 24.03 ? 207  HIS A O   1 
ATOM   1458  C CB  . HIS A 1 181 ? 36.749  -5.389  8.632   1.00 23.36 ? 207  HIS A CB  1 
ATOM   1459  C CG  . HIS A 1 181 ? 35.965  -6.323  7.759   1.00 25.09 ? 207  HIS A CG  1 
ATOM   1460  N ND1 . HIS A 1 181 ? 36.177  -6.428  6.401   1.00 26.31 ? 207  HIS A ND1 1 
ATOM   1461  C CD2 . HIS A 1 181 ? 34.950  -7.174  8.046   1.00 25.82 ? 207  HIS A CD2 1 
ATOM   1462  C CE1 . HIS A 1 181 ? 35.322  -7.297  5.888   1.00 26.62 ? 207  HIS A CE1 1 
ATOM   1463  N NE2 . HIS A 1 181 ? 34.566  -7.764  6.866   1.00 27.62 ? 207  HIS A NE2 1 
ATOM   1464  N N   . ASN A 1 182 ? 35.144  -3.105  6.585   1.00 23.74 ? 208  ASN A N   1 
ATOM   1465  C CA  . ASN A 1 182 ? 33.862  -2.509  6.241   1.00 24.75 ? 208  ASN A CA  1 
ATOM   1466  C C   . ASN A 1 182 ? 33.630  -1.194  6.989   1.00 24.29 ? 208  ASN A C   1 
ATOM   1467  O O   . ASN A 1 182 ? 32.540  -0.941  7.505   1.00 23.11 ? 208  ASN A O   1 
ATOM   1468  C CB  . ASN A 1 182 ? 32.713  -3.485  6.524   1.00 25.30 ? 208  ASN A CB  1 
ATOM   1469  C CG  . ASN A 1 182 ? 32.674  -4.634  5.535   1.00 28.76 ? 208  ASN A CG  1 
ATOM   1470  O OD1 . ASN A 1 182 ? 32.891  -4.444  4.338   1.00 28.09 ? 208  ASN A OD1 1 
ATOM   1471  N ND2 . ASN A 1 182 ? 32.385  -5.834  6.028   1.00 27.80 ? 208  ASN A ND2 1 
ATOM   1472  N N   . TYR A 1 183 ? 34.672  -0.364  7.050   1.00 24.85 ? 209  TYR A N   1 
ATOM   1473  C CA  . TYR A 1 183 ? 34.597  0.948   7.694   1.00 24.18 ? 209  TYR A CA  1 
ATOM   1474  C C   . TYR A 1 183 ? 34.546  0.888   9.220   1.00 24.75 ? 209  TYR A C   1 
ATOM   1475  O O   . TYR A 1 183 ? 34.501  1.921   9.881   1.00 26.60 ? 209  TYR A O   1 
ATOM   1476  C CB  . TYR A 1 183 ? 33.369  1.717   7.176   1.00 23.70 ? 209  TYR A CB  1 
ATOM   1477  C CG  . TYR A 1 183 ? 33.215  1.740   5.664   1.00 24.41 ? 209  TYR A CG  1 
ATOM   1478  C CD1 . TYR A 1 183 ? 31.993  2.068   5.073   1.00 25.35 ? 209  TYR A CD1 1 
ATOM   1479  C CD2 . TYR A 1 183 ? 34.282  1.414   4.824   1.00 24.87 ? 209  TYR A CD2 1 
ATOM   1480  C CE1 . TYR A 1 183 ? 31.837  2.062   3.680   1.00 26.31 ? 209  TYR A CE1 1 
ATOM   1481  C CE2 . TYR A 1 183 ? 34.135  1.407   3.434   1.00 25.74 ? 209  TYR A CE2 1 
ATOM   1482  C CZ  . TYR A 1 183 ? 32.911  1.729   2.871   1.00 26.84 ? 209  TYR A CZ  1 
ATOM   1483  O OH  . TYR A 1 183 ? 32.756  1.711   1.503   1.00 27.26 ? 209  TYR A OH  1 
ATOM   1484  N N   . GLN A 1 184 ? 34.556  -0.314  9.780   1.00 24.40 ? 210  GLN A N   1 
ATOM   1485  C CA  . GLN A 1 184 ? 34.490  -0.466  11.230  1.00 25.59 ? 210  GLN A CA  1 
ATOM   1486  C C   . GLN A 1 184 ? 35.856  -0.716  11.850  1.00 24.52 ? 210  GLN A C   1 
ATOM   1487  O O   . GLN A 1 184 ? 36.597  -1.592  11.410  1.00 25.87 ? 210  GLN A O   1 
ATOM   1488  C CB  . GLN A 1 184 ? 33.531  -1.600  11.593  1.00 28.37 ? 210  GLN A CB  1 
ATOM   1489  C CG  . GLN A 1 184 ? 32.057  -1.216  11.483  1.00 30.77 ? 210  GLN A CG  1 
ATOM   1490  C CD  . GLN A 1 184 ? 31.121  -2.410  11.567  1.00 32.31 ? 210  GLN A CD  1 
ATOM   1491  O OE1 . GLN A 1 184 ? 30.883  -3.096  10.575  1.00 34.91 ? 210  GLN A OE1 1 
ATOM   1492  N NE2 . GLN A 1 184 ? 30.594  -2.664  12.758  1.00 30.21 ? 210  GLN A NE2 1 
ATOM   1493  N N   . PHE A 1 185 ? 36.186  0.062   12.876  1.00 22.91 ? 211  PHE A N   1 
ATOM   1494  C CA  . PHE A 1 185 ? 37.477  -0.071  13.547  1.00 20.60 ? 211  PHE A CA  1 
ATOM   1495  C C   . PHE A 1 185 ? 37.415  -0.926  14.803  1.00 20.72 ? 211  PHE A C   1 
ATOM   1496  O O   . PHE A 1 185 ? 36.458  -0.846  15.574  1.00 17.81 ? 211  PHE A O   1 
ATOM   1497  C CB  . PHE A 1 185 ? 38.033  1.305   13.925  1.00 20.19 ? 211  PHE A CB  1 
ATOM   1498  C CG  . PHE A 1 185 ? 38.312  2.194   12.753  1.00 19.26 ? 211  PHE A CG  1 
ATOM   1499  C CD1 . PHE A 1 185 ? 37.296  2.955   12.185  1.00 20.00 ? 211  PHE A CD1 1 
ATOM   1500  C CD2 . PHE A 1 185 ? 39.590  2.274   12.216  1.00 19.43 ? 211  PHE A CD2 1 
ATOM   1501  C CE1 . PHE A 1 185 ? 37.549  3.788   11.097  1.00 21.20 ? 211  PHE A CE1 1 
ATOM   1502  C CE2 . PHE A 1 185 ? 39.855  3.102   11.128  1.00 18.96 ? 211  PHE A CE2 1 
ATOM   1503  C CZ  . PHE A 1 185 ? 38.837  3.858   10.571  1.00 19.79 ? 211  PHE A CZ  1 
ATOM   1504  N N   . PHE A 1 186 ? 38.451  -1.732  15.010  1.00 21.00 ? 212  PHE A N   1 
ATOM   1505  C CA  . PHE A 1 186 ? 38.520  -2.587  16.184  1.00 23.12 ? 212  PHE A CA  1 
ATOM   1506  C C   . PHE A 1 186 ? 39.863  -2.432  16.881  1.00 23.76 ? 212  PHE A C   1 
ATOM   1507  O O   . PHE A 1 186 ? 40.891  -2.232  16.238  1.00 24.67 ? 212  PHE A O   1 
ATOM   1508  C CB  . PHE A 1 186 ? 38.322  -4.056  15.800  1.00 23.74 ? 212  PHE A CB  1 
ATOM   1509  C CG  . PHE A 1 186 ? 36.992  -4.348  15.186  1.00 25.22 ? 212  PHE A CG  1 
ATOM   1510  C CD1 . PHE A 1 186 ? 36.724  -4.004  13.862  1.00 26.08 ? 212  PHE A CD1 1 
ATOM   1511  C CD2 . PHE A 1 186 ? 36.004  -4.985  15.930  1.00 24.16 ? 212  PHE A CD2 1 
ATOM   1512  C CE1 . PHE A 1 186 ? 35.485  -4.297  13.290  1.00 26.02 ? 212  PHE A CE1 1 
ATOM   1513  C CE2 . PHE A 1 186 ? 34.768  -5.279  15.364  1.00 25.60 ? 212  PHE A CE2 1 
ATOM   1514  C CZ  . PHE A 1 186 ? 34.509  -4.935  14.040  1.00 24.96 ? 212  PHE A CZ  1 
ATOM   1515  N N   . GLU A 1 187 ? 39.841  -2.532  18.203  1.00 24.17 ? 213  GLU A N   1 
ATOM   1516  C CA  . GLU A 1 187 ? 41.046  -2.425  19.009  1.00 25.28 ? 213  GLU A CA  1 
ATOM   1517  C C   . GLU A 1 187 ? 41.524  -3.842  19.292  1.00 26.24 ? 213  GLU A C   1 
ATOM   1518  O O   . GLU A 1 187 ? 40.843  -4.595  19.988  1.00 27.19 ? 213  GLU A O   1 
ATOM   1519  C CB  . GLU A 1 187 ? 40.724  -1.698  20.315  1.00 25.09 ? 213  GLU A CB  1 
ATOM   1520  C CG  . GLU A 1 187 ? 41.888  -1.622  21.265  1.00 28.58 ? 213  GLU A CG  1 
ATOM   1521  C CD  . GLU A 1 187 ? 41.566  -0.835  22.514  1.00 29.18 ? 213  GLU A CD  1 
ATOM   1522  O OE1 . GLU A 1 187 ? 41.335  0.389   22.412  1.00 29.08 ? 213  GLU A OE1 1 
ATOM   1523  O OE2 . GLU A 1 187 ? 41.537  -1.448  23.600  1.00 31.29 ? 213  GLU A OE2 1 
ATOM   1524  N N   . LEU A 1 188 ? 42.688  -4.205  18.752  1.00 26.25 ? 214  LEU A N   1 
ATOM   1525  C CA  . LEU A 1 188 ? 43.226  -5.554  18.933  1.00 27.03 ? 214  LEU A CA  1 
ATOM   1526  C C   . LEU A 1 188 ? 44.574  -5.621  19.643  1.00 27.55 ? 214  LEU A C   1 
ATOM   1527  O O   . LEU A 1 188 ? 45.582  -5.143  19.120  1.00 25.89 ? 214  LEU A O   1 
ATOM   1528  C CB  . LEU A 1 188 ? 43.364  -6.246  17.570  1.00 26.21 ? 214  LEU A CB  1 
ATOM   1529  C CG  . LEU A 1 188 ? 44.072  -7.606  17.548  1.00 27.02 ? 214  LEU A CG  1 
ATOM   1530  C CD1 . LEU A 1 188 ? 43.217  -8.626  18.279  1.00 25.79 ? 214  LEU A CD1 1 
ATOM   1531  C CD2 . LEU A 1 188 ? 44.323  -8.053  16.108  1.00 26.26 ? 214  LEU A CD2 1 
ATOM   1532  N N   . ASP A 1 189 ? 44.594  -6.235  20.829  1.00 29.37 ? 215  ASP A N   1 
ATOM   1533  C CA  . ASP A 1 189 ? 45.829  -6.394  21.595  1.00 30.28 ? 215  ASP A CA  1 
ATOM   1534  C C   . ASP A 1 189 ? 46.675  -7.488  20.943  1.00 29.26 ? 215  ASP A C   1 
ATOM   1535  O O   . ASP A 1 189 ? 46.199  -8.599  20.708  1.00 30.71 ? 215  ASP A O   1 
ATOM   1536  C CB  . ASP A 1 189 ? 45.518  -6.768  23.050  1.00 33.46 ? 215  ASP A CB  1 
ATOM   1537  C CG  . ASP A 1 189 ? 45.162  -5.559  23.902  1.00 38.45 ? 215  ASP A CG  1 
ATOM   1538  O OD1 . ASP A 1 189 ? 46.016  -4.654  24.034  1.00 40.09 ? 215  ASP A OD1 1 
ATOM   1539  O OD2 . ASP A 1 189 ? 44.034  -5.510  24.441  1.00 39.07 ? 215  ASP A OD2 1 
ATOM   1540  N N   . VAL A 1 190 ? 47.925  -7.168  20.642  1.00 27.80 ? 216  VAL A N   1 
ATOM   1541  C CA  . VAL A 1 190 ? 48.811  -8.127  20.002  1.00 26.74 ? 216  VAL A CA  1 
ATOM   1542  C C   . VAL A 1 190 ? 49.891  -8.622  20.950  1.00 27.46 ? 216  VAL A C   1 
ATOM   1543  O O   . VAL A 1 190 ? 50.848  -9.275  20.528  1.00 26.65 ? 216  VAL A O   1 
ATOM   1544  C CB  . VAL A 1 190 ? 49.477  -7.511  18.767  1.00 26.21 ? 216  VAL A CB  1 
ATOM   1545  C CG1 . VAL A 1 190 ? 48.437  -7.283  17.685  1.00 25.84 ? 216  VAL A CG1 1 
ATOM   1546  C CG2 . VAL A 1 190 ? 50.147  -6.196  19.145  1.00 23.89 ? 216  VAL A CG2 1 
ATOM   1547  N N   . TYR A 1 191 ? 49.735  -8.303  22.233  1.00 28.68 ? 217  TYR A N   1 
ATOM   1548  C CA  . TYR A 1 191 ? 50.684  -8.723  23.257  1.00 28.74 ? 217  TYR A CA  1 
ATOM   1549  C C   . TYR A 1 191 ? 49.944  -9.386  24.414  1.00 30.45 ? 217  TYR A C   1 
ATOM   1550  O O   . TYR A 1 191 ? 48.813  -9.022  24.738  1.00 29.65 ? 217  TYR A O   1 
ATOM   1551  C CB  . TYR A 1 191 ? 51.475  -7.521  23.785  1.00 26.75 ? 217  TYR A CB  1 
ATOM   1552  C CG  . TYR A 1 191 ? 52.493  -6.966  22.807  1.00 25.86 ? 217  TYR A CG  1 
ATOM   1553  C CD1 . TYR A 1 191 ? 53.699  -7.626  22.579  1.00 24.08 ? 217  TYR A CD1 1 
ATOM   1554  C CD2 . TYR A 1 191 ? 52.246  -5.787  22.107  1.00 25.77 ? 217  TYR A CD2 1 
ATOM   1555  C CE1 . TYR A 1 191 ? 54.639  -7.124  21.680  1.00 25.77 ? 217  TYR A CE1 1 
ATOM   1556  C CE2 . TYR A 1 191 ? 53.177  -5.275  21.203  1.00 24.44 ? 217  TYR A CE2 1 
ATOM   1557  C CZ  . TYR A 1 191 ? 54.371  -5.947  20.997  1.00 24.90 ? 217  TYR A CZ  1 
ATOM   1558  O OH  . TYR A 1 191 ? 55.307  -5.445  20.124  1.00 25.35 ? 217  TYR A OH  1 
ATOM   1559  N N   . HIS A 1 192 ? 50.586  -10.371 25.026  1.00 33.26 ? 218  HIS A N   1 
ATOM   1560  C CA  . HIS A 1 192 ? 49.999  -11.082 26.153  1.00 36.13 ? 218  HIS A CA  1 
ATOM   1561  C C   . HIS A 1 192 ? 50.282  -10.305 27.429  1.00 38.31 ? 218  HIS A C   1 
ATOM   1562  O O   . HIS A 1 192 ? 50.949  -9.270  27.398  1.00 39.44 ? 218  HIS A O   1 
ATOM   1563  C CB  . HIS A 1 192 ? 50.602  -12.486 26.263  1.00 33.86 ? 218  HIS A CB  1 
ATOM   1564  C CG  . HIS A 1 192 ? 50.161  -13.419 25.178  1.00 31.66 ? 218  HIS A CG  1 
ATOM   1565  N ND1 . HIS A 1 192 ? 48.844  -13.791 25.010  1.00 31.21 ? 218  HIS A ND1 1 
ATOM   1566  C CD2 . HIS A 1 192 ? 50.857  -14.052 24.207  1.00 31.11 ? 218  HIS A CD2 1 
ATOM   1567  C CE1 . HIS A 1 192 ? 48.750  -14.616 23.983  1.00 30.41 ? 218  HIS A CE1 1 
ATOM   1568  N NE2 . HIS A 1 192 ? 49.957  -14.790 23.477  1.00 30.47 ? 218  HIS A NE2 1 
ATOM   1569  N N   . SER A 1 193 ? 49.775  -10.814 28.547  1.00 41.55 ? 219  SER A N   1 
ATOM   1570  C CA  . SER A 1 193 ? 49.981  -10.195 29.853  1.00 43.65 ? 219  SER A CA  1 
ATOM   1571  C C   . SER A 1 193 ? 51.466  -10.188 30.192  1.00 44.73 ? 219  SER A C   1 
ATOM   1572  O O   . SER A 1 193 ? 52.028  -9.153  30.551  1.00 45.99 ? 219  SER A O   1 
ATOM   1573  C CB  . SER A 1 193 ? 49.230  -10.980 30.927  1.00 44.67 ? 219  SER A CB  1 
ATOM   1574  O OG  . SER A 1 193 ? 47.891  -11.214 30.529  1.00 48.65 ? 219  SER A OG  1 
ATOM   1575  N N   . ASP A 1 194 ? 52.095  -11.353 30.079  1.00 45.78 ? 220  ASP A N   1 
ATOM   1576  C CA  . ASP A 1 194 ? 53.517  -11.495 30.377  1.00 46.65 ? 220  ASP A CA  1 
ATOM   1577  C C   . ASP A 1 194 ? 54.382  -10.539 29.565  1.00 45.82 ? 220  ASP A C   1 
ATOM   1578  O O   . ASP A 1 194 ? 55.515  -10.246 29.942  1.00 46.24 ? 220  ASP A O   1 
ATOM   1579  C CB  . ASP A 1 194 ? 53.972  -12.936 30.122  1.00 48.55 ? 220  ASP A CB  1 
ATOM   1580  C CG  . ASP A 1 194 ? 53.550  -13.450 28.758  1.00 50.27 ? 220  ASP A CG  1 
ATOM   1581  O OD1 . ASP A 1 194 ? 53.884  -12.806 27.743  1.00 50.78 ? 220  ASP A OD1 1 
ATOM   1582  O OD2 . ASP A 1 194 ? 52.886  -14.506 28.698  1.00 52.08 ? 220  ASP A OD2 1 
ATOM   1583  N N   . GLY A 1 195 ? 53.846  -10.059 28.445  1.00 45.46 ? 221  GLY A N   1 
ATOM   1584  C CA  . GLY A 1 195 ? 54.594  -9.144  27.606  1.00 43.36 ? 221  GLY A CA  1 
ATOM   1585  C C   . GLY A 1 195 ? 55.010  -9.727  26.268  1.00 42.09 ? 221  GLY A C   1 
ATOM   1586  O O   . GLY A 1 195 ? 55.499  -9.003  25.401  1.00 42.66 ? 221  GLY A O   1 
ATOM   1587  N N   . THR A 1 196 ? 54.824  -11.033 26.095  1.00 40.25 ? 222  THR A N   1 
ATOM   1588  C CA  . THR A 1 196 ? 55.194  -11.687 24.840  1.00 38.36 ? 222  THR A CA  1 
ATOM   1589  C C   . THR A 1 196 ? 54.130  -11.410 23.785  1.00 36.80 ? 222  THR A C   1 
ATOM   1590  O O   . THR A 1 196 ? 52.941  -11.319 24.094  1.00 35.99 ? 222  THR A O   1 
ATOM   1591  C CB  . THR A 1 196 ? 55.313  -13.217 24.993  1.00 37.95 ? 222  THR A CB  1 
ATOM   1592  O OG1 . THR A 1 196 ? 54.020  -13.767 25.275  1.00 38.44 ? 222  THR A OG1 1 
ATOM   1593  C CG2 . THR A 1 196 ? 56.273  -13.570 26.120  1.00 38.04 ? 222  THR A CG2 1 
ATOM   1594  N N   . PRO A 1 197 ? 54.548  -11.281 22.518  1.00 35.58 ? 223  PRO A N   1 
ATOM   1595  C CA  . PRO A 1 197 ? 53.623  -11.014 21.415  1.00 34.81 ? 223  PRO A CA  1 
ATOM   1596  C C   . PRO A 1 197 ? 52.803  -12.238 21.029  1.00 33.55 ? 223  PRO A C   1 
ATOM   1597  O O   . PRO A 1 197 ? 53.279  -13.365 21.131  1.00 32.76 ? 223  PRO A O   1 
ATOM   1598  C CB  . PRO A 1 197 ? 54.557  -10.588 20.292  1.00 35.56 ? 223  PRO A CB  1 
ATOM   1599  C CG  . PRO A 1 197 ? 55.747  -11.464 20.525  1.00 36.20 ? 223  PRO A CG  1 
ATOM   1600  C CD  . PRO A 1 197 ? 55.936  -11.366 22.029  1.00 35.30 ? 223  PRO A CD  1 
ATOM   1601  N N   . LEU A 1 198 ? 51.571  -12.011 20.589  1.00 32.93 ? 224  LEU A N   1 
ATOM   1602  C CA  . LEU A 1 198 ? 50.716  -13.108 20.159  1.00 33.40 ? 224  LEU A CA  1 
ATOM   1603  C C   . LEU A 1 198 ? 51.329  -13.759 18.928  1.00 33.68 ? 224  LEU A C   1 
ATOM   1604  O O   . LEU A 1 198 ? 52.123  -13.143 18.217  1.00 33.72 ? 224  LEU A O   1 
ATOM   1605  C CB  . LEU A 1 198 ? 49.308  -12.611 19.820  1.00 32.23 ? 224  LEU A CB  1 
ATOM   1606  C CG  . LEU A 1 198 ? 48.280  -12.615 20.953  1.00 33.57 ? 224  LEU A CG  1 
ATOM   1607  C CD1 . LEU A 1 198 ? 48.699  -11.641 22.039  1.00 34.01 ? 224  LEU A CD1 1 
ATOM   1608  C CD2 . LEU A 1 198 ? 46.915  -12.244 20.401  1.00 33.53 ? 224  LEU A CD2 1 
ATOM   1609  N N   . THR A 1 199 ? 50.956  -15.011 18.684  1.00 33.72 ? 225  THR A N   1 
ATOM   1610  C CA  . THR A 1 199 ? 51.463  -15.758 17.539  1.00 33.59 ? 225  THR A CA  1 
ATOM   1611  C C   . THR A 1 199 ? 50.600  -15.483 16.310  1.00 33.02 ? 225  THR A C   1 
ATOM   1612  O O   . THR A 1 199 ? 49.502  -14.931 16.420  1.00 31.81 ? 225  THR A O   1 
ATOM   1613  C CB  . THR A 1 199 ? 51.440  -17.273 17.820  1.00 34.25 ? 225  THR A CB  1 
ATOM   1614  O OG1 . THR A 1 199 ? 50.098  -17.676 18.121  1.00 32.61 ? 225  THR A OG1 1 
ATOM   1615  C CG2 . THR A 1 199 ? 52.345  -17.617 19.001  1.00 34.73 ? 225  THR A CG2 1 
ATOM   1616  N N   . SER A 1 200 ? 51.102  -15.869 15.143  1.00 32.14 ? 226  SER A N   1 
ATOM   1617  C CA  . SER A 1 200 ? 50.369  -15.672 13.904  1.00 32.90 ? 226  SER A CA  1 
ATOM   1618  C C   . SER A 1 200 ? 49.026  -16.400 13.981  1.00 33.27 ? 226  SER A C   1 
ATOM   1619  O O   . SER A 1 200 ? 48.003  -15.885 13.530  1.00 33.02 ? 226  SER A O   1 
ATOM   1620  C CB  . SER A 1 200 ? 51.192  -16.191 12.723  1.00 33.56 ? 226  SER A CB  1 
ATOM   1621  O OG  . SER A 1 200 ? 51.540  -17.555 12.892  1.00 34.54 ? 226  SER A OG  1 
ATOM   1622  N N   . ASP A 1 201 ? 49.028  -17.594 14.566  1.00 33.74 ? 227  ASP A N   1 
ATOM   1623  C CA  . ASP A 1 201 ? 47.803  -18.373 14.700  1.00 33.51 ? 227  ASP A CA  1 
ATOM   1624  C C   . ASP A 1 201 ? 46.843  -17.634 15.629  1.00 32.14 ? 227  ASP A C   1 
ATOM   1625  O O   . ASP A 1 201 ? 45.641  -17.554 15.372  1.00 30.77 ? 227  ASP A O   1 
ATOM   1626  C CB  . ASP A 1 201 ? 48.119  -19.752 15.278  1.00 36.22 ? 227  ASP A CB  1 
ATOM   1627  C CG  . ASP A 1 201 ? 46.918  -20.677 15.268  1.00 39.62 ? 227  ASP A CG  1 
ATOM   1628  O OD1 . ASP A 1 201 ? 46.821  -21.531 16.174  1.00 41.72 ? 227  ASP A OD1 1 
ATOM   1629  O OD2 . ASP A 1 201 ? 46.074  -20.563 14.350  1.00 40.31 ? 227  ASP A OD2 1 
ATOM   1630  N N   . GLN A 1 202 ? 47.388  -17.092 16.715  1.00 30.42 ? 228  GLN A N   1 
ATOM   1631  C CA  . GLN A 1 202 ? 46.595  -16.354 17.685  1.00 28.84 ? 228  GLN A CA  1 
ATOM   1632  C C   . GLN A 1 202 ? 46.010  -15.087 17.077  1.00 26.62 ? 228  GLN A C   1 
ATOM   1633  O O   . GLN A 1 202 ? 44.851  -14.755 17.319  1.00 25.44 ? 228  GLN A O   1 
ATOM   1634  C CB  . GLN A 1 202 ? 47.453  -16.017 18.904  1.00 31.39 ? 228  GLN A CB  1 
ATOM   1635  C CG  . GLN A 1 202 ? 47.589  -17.170 19.889  1.00 35.19 ? 228  GLN A CG  1 
ATOM   1636  C CD  . GLN A 1 202 ? 48.802  -17.030 20.778  1.00 38.14 ? 228  GLN A CD  1 
ATOM   1637  O OE1 . GLN A 1 202 ? 49.190  -15.922 21.142  1.00 39.87 ? 228  GLN A OE1 1 
ATOM   1638  N NE2 . GLN A 1 202 ? 49.404  -18.158 21.145  1.00 39.18 ? 228  GLN A NE2 1 
ATOM   1639  N N   . ILE A 1 203 ? 46.808  -14.381 16.284  1.00 25.01 ? 229  ILE A N   1 
ATOM   1640  C CA  . ILE A 1 203 ? 46.329  -13.162 15.644  1.00 24.27 ? 229  ILE A CA  1 
ATOM   1641  C C   . ILE A 1 203 ? 45.231  -13.512 14.652  1.00 23.91 ? 229  ILE A C   1 
ATOM   1642  O O   . ILE A 1 203 ? 44.232  -12.808 14.541  1.00 24.25 ? 229  ILE A O   1 
ATOM   1643  C CB  . ILE A 1 203 ? 47.471  -12.419 14.915  1.00 22.51 ? 229  ILE A CB  1 
ATOM   1644  C CG1 . ILE A 1 203 ? 48.510  -11.957 15.936  1.00 22.73 ? 229  ILE A CG1 1 
ATOM   1645  C CG2 . ILE A 1 203 ? 46.922  -11.209 14.164  1.00 20.93 ? 229  ILE A CG2 1 
ATOM   1646  C CD1 . ILE A 1 203 ? 49.655  -11.200 15.317  1.00 22.62 ? 229  ILE A CD1 1 
ATOM   1647  N N   . PHE A 1 204 ? 45.417  -14.613 13.935  1.00 25.63 ? 230  PHE A N   1 
ATOM   1648  C CA  . PHE A 1 204 ? 44.426  -15.059 12.963  1.00 26.19 ? 230  PHE A CA  1 
ATOM   1649  C C   . PHE A 1 204 ? 43.054  -15.238 13.617  1.00 26.06 ? 230  PHE A C   1 
ATOM   1650  O O   . PHE A 1 204 ? 42.042  -14.753 13.113  1.00 25.13 ? 230  PHE A O   1 
ATOM   1651  C CB  . PHE A 1 204 ? 44.865  -16.386 12.346  1.00 28.30 ? 230  PHE A CB  1 
ATOM   1652  C CG  . PHE A 1 204 ? 43.861  -16.974 11.409  1.00 29.90 ? 230  PHE A CG  1 
ATOM   1653  C CD1 . PHE A 1 204 ? 43.719  -16.472 10.120  1.00 30.28 ? 230  PHE A CD1 1 
ATOM   1654  C CD2 . PHE A 1 204 ? 43.034  -18.012 11.822  1.00 31.78 ? 230  PHE A CD2 1 
ATOM   1655  C CE1 . PHE A 1 204 ? 42.763  -16.996 9.253   1.00 32.75 ? 230  PHE A CE1 1 
ATOM   1656  C CE2 . PHE A 1 204 ? 42.074  -18.543 10.964  1.00 33.25 ? 230  PHE A CE2 1 
ATOM   1657  C CZ  . PHE A 1 204 ? 41.938  -18.032 9.676   1.00 32.58 ? 230  PHE A CZ  1 
ATOM   1658  N N   . VAL A 1 205 ? 43.040  -15.944 14.744  1.00 26.45 ? 231  VAL A N   1 
ATOM   1659  C CA  . VAL A 1 205 ? 41.813  -16.209 15.494  1.00 26.58 ? 231  VAL A CA  1 
ATOM   1660  C C   . VAL A 1 205 ? 41.099  -14.907 15.842  1.00 26.29 ? 231  VAL A C   1 
ATOM   1661  O O   . VAL A 1 205 ? 39.873  -14.810 15.766  1.00 27.37 ? 231  VAL A O   1 
ATOM   1662  C CB  . VAL A 1 205 ? 42.111  -16.977 16.811  1.00 28.19 ? 231  VAL A CB  1 
ATOM   1663  C CG1 . VAL A 1 205 ? 40.822  -17.219 17.566  1.00 28.87 ? 231  VAL A CG1 1 
ATOM   1664  C CG2 . VAL A 1 205 ? 42.809  -18.304 16.511  1.00 29.96 ? 231  VAL A CG2 1 
ATOM   1665  N N   . GLN A 1 206 ? 41.877  -13.901 16.224  1.00 25.49 ? 232  GLN A N   1 
ATOM   1666  C CA  . GLN A 1 206 ? 41.315  -12.605 16.579  1.00 24.27 ? 232  GLN A CA  1 
ATOM   1667  C C   . GLN A 1 206 ? 40.736  -11.896 15.355  1.00 22.94 ? 232  GLN A C   1 
ATOM   1668  O O   . GLN A 1 206 ? 39.659  -11.308 15.428  1.00 22.61 ? 232  GLN A O   1 
ATOM   1669  C CB  . GLN A 1 206 ? 42.384  -11.737 17.241  1.00 25.39 ? 232  GLN A CB  1 
ATOM   1670  C CG  . GLN A 1 206 ? 42.973  -12.338 18.512  1.00 25.82 ? 232  GLN A CG  1 
ATOM   1671  C CD  . GLN A 1 206 ? 41.931  -12.569 19.587  1.00 27.27 ? 232  GLN A CD  1 
ATOM   1672  O OE1 . GLN A 1 206 ? 41.048  -13.414 19.441  1.00 26.51 ? 232  GLN A OE1 1 
ATOM   1673  N NE2 . GLN A 1 206 ? 42.023  -11.807 20.673  1.00 27.41 ? 232  GLN A NE2 1 
ATOM   1674  N N   . LEU A 1 207 ? 41.444  -11.955 14.230  1.00 22.55 ? 233  LEU A N   1 
ATOM   1675  C CA  . LEU A 1 207 ? 40.965  -11.327 13.001  1.00 23.64 ? 233  LEU A CA  1 
ATOM   1676  C C   . LEU A 1 207 ? 39.618  -11.923 12.564  1.00 25.24 ? 233  LEU A C   1 
ATOM   1677  O O   . LEU A 1 207 ? 38.771  -11.221 12.006  1.00 24.92 ? 233  LEU A O   1 
ATOM   1678  C CB  . LEU A 1 207 ? 42.000  -11.493 11.881  1.00 22.06 ? 233  LEU A CB  1 
ATOM   1679  C CG  . LEU A 1 207 ? 43.366  -10.825 12.099  1.00 21.83 ? 233  LEU A CG  1 
ATOM   1680  C CD1 . LEU A 1 207 ? 44.271  -11.098 10.912  1.00 19.45 ? 233  LEU A CD1 1 
ATOM   1681  C CD2 . LEU A 1 207 ? 43.186  -9.326  12.277  1.00 20.35 ? 233  LEU A CD2 1 
ATOM   1682  N N   . GLU A 1 208 ? 39.413  -13.213 12.827  1.00 27.80 ? 234  GLU A N   1 
ATOM   1683  C CA  . GLU A 1 208 ? 38.154  -13.868 12.461  1.00 30.11 ? 234  GLU A CA  1 
ATOM   1684  C C   . GLU A 1 208 ? 37.007  -13.257 13.253  1.00 29.83 ? 234  GLU A C   1 
ATOM   1685  O O   . GLU A 1 208 ? 35.971  -12.908 12.689  1.00 30.17 ? 234  GLU A O   1 
ATOM   1686  C CB  . GLU A 1 208 ? 38.213  -15.376 12.732  1.00 30.87 ? 234  GLU A CB  1 
ATOM   1687  C CG  . GLU A 1 208 ? 39.193  -16.133 11.850  1.00 34.97 ? 234  GLU A CG  1 
ATOM   1688  C CD  . GLU A 1 208 ? 38.989  -17.637 11.917  1.00 36.56 ? 234  GLU A CD  1 
ATOM   1689  O OE1 . GLU A 1 208 ? 39.102  -18.205 13.023  1.00 37.57 ? 234  GLU A OE1 1 
ATOM   1690  O OE2 . GLU A 1 208 ? 38.713  -18.248 10.862  1.00 35.44 ? 234  GLU A OE2 1 
ATOM   1691  N N   . LYS A 1 209 ? 37.193  -13.135 14.565  1.00 30.20 ? 235  LYS A N   1 
ATOM   1692  C CA  . LYS A 1 209 ? 36.171  -12.545 15.418  1.00 31.03 ? 235  LYS A CA  1 
ATOM   1693  C C   . LYS A 1 209 ? 35.862  -11.149 14.891  1.00 30.26 ? 235  LYS A C   1 
ATOM   1694  O O   . LYS A 1 209 ? 34.700  -10.771 14.732  1.00 30.90 ? 235  LYS A O   1 
ATOM   1695  C CB  . LYS A 1 209 ? 36.671  -12.450 16.859  1.00 31.40 ? 235  LYS A CB  1 
ATOM   1696  C CG  . LYS A 1 209 ? 37.072  -13.783 17.471  1.00 32.15 ? 235  LYS A CG  1 
ATOM   1697  C CD  . LYS A 1 209 ? 37.598  -13.599 18.889  1.00 32.87 ? 235  LYS A CD  1 
ATOM   1698  C CE  . LYS A 1 209 ? 38.085  -14.918 19.474  1.00 32.73 ? 235  LYS A CE  1 
ATOM   1699  N NZ  . LYS A 1 209 ? 38.843  -14.730 20.743  1.00 32.94 ? 235  LYS A NZ  1 
ATOM   1700  N N   . ILE A 1 210 ? 36.919  -10.387 14.616  1.00 30.00 ? 236  ILE A N   1 
ATOM   1701  C CA  . ILE A 1 210 ? 36.785  -9.032  14.103  1.00 29.30 ? 236  ILE A CA  1 
ATOM   1702  C C   . ILE A 1 210 ? 35.993  -9.015  12.801  1.00 29.29 ? 236  ILE A C   1 
ATOM   1703  O O   . ILE A 1 210 ? 35.067  -8.222  12.635  1.00 28.43 ? 236  ILE A O   1 
ATOM   1704  C CB  . ILE A 1 210 ? 38.174  -8.403  13.854  1.00 29.19 ? 236  ILE A CB  1 
ATOM   1705  C CG1 . ILE A 1 210 ? 38.884  -8.183  15.190  1.00 28.24 ? 236  ILE A CG1 1 
ATOM   1706  C CG2 . ILE A 1 210 ? 38.033  -7.092  13.093  1.00 28.34 ? 236  ILE A CG2 1 
ATOM   1707  C CD1 . ILE A 1 210 ? 40.361  -7.917  15.065  1.00 26.50 ? 236  ILE A CD1 1 
ATOM   1708  N N   . TRP A 1 211 ? 36.357  -9.904  11.883  1.00 29.31 ? 237  TRP A N   1 
ATOM   1709  C CA  . TRP A 1 211 ? 35.686  -9.979  10.594  1.00 31.20 ? 237  TRP A CA  1 
ATOM   1710  C C   . TRP A 1 211 ? 34.198  -10.299 10.706  1.00 31.56 ? 237  TRP A C   1 
ATOM   1711  O O   . TRP A 1 211 ? 33.387  -9.752  9.955   1.00 32.68 ? 237  TRP A O   1 
ATOM   1712  C CB  . TRP A 1 211 ? 36.371  -11.024 9.711   1.00 31.12 ? 237  TRP A CB  1 
ATOM   1713  C CG  . TRP A 1 211 ? 35.778  -11.137 8.343   1.00 31.80 ? 237  TRP A CG  1 
ATOM   1714  C CD1 . TRP A 1 211 ? 34.602  -11.745 8.005   1.00 32.02 ? 237  TRP A CD1 1 
ATOM   1715  C CD2 . TRP A 1 211 ? 36.330  -10.623 7.125   1.00 32.26 ? 237  TRP A CD2 1 
ATOM   1716  N NE1 . TRP A 1 211 ? 34.389  -11.643 6.652   1.00 32.63 ? 237  TRP A NE1 1 
ATOM   1717  C CE2 . TRP A 1 211 ? 35.433  -10.959 6.086   1.00 32.67 ? 237  TRP A CE2 1 
ATOM   1718  C CE3 . TRP A 1 211 ? 37.496  -9.913  6.807   1.00 31.93 ? 237  TRP A CE3 1 
ATOM   1719  C CZ2 . TRP A 1 211 ? 35.665  -10.609 4.750   1.00 32.55 ? 237  TRP A CZ2 1 
ATOM   1720  C CZ3 . TRP A 1 211 ? 37.727  -9.565  5.480   1.00 31.84 ? 237  TRP A CZ3 1 
ATOM   1721  C CH2 . TRP A 1 211 ? 36.814  -9.915  4.469   1.00 32.52 ? 237  TRP A CH2 1 
ATOM   1722  N N   . ASN A 1 212 ? 33.837  -11.179 11.635  1.00 31.95 ? 238  ASN A N   1 
ATOM   1723  C CA  . ASN A 1 212 ? 32.438  -11.556 11.810  1.00 31.42 ? 238  ASN A CA  1 
ATOM   1724  C C   . ASN A 1 212 ? 31.633  -10.502 12.552  1.00 31.90 ? 238  ASN A C   1 
ATOM   1725  O O   . ASN A 1 212 ? 30.405  -10.482 12.477  1.00 31.51 ? 238  ASN A O   1 
ATOM   1726  C CB  . ASN A 1 212 ? 32.330  -12.894 12.541  1.00 30.52 ? 238  ASN A CB  1 
ATOM   1727  C CG  . ASN A 1 212 ? 32.953  -14.031 11.762  1.00 31.29 ? 238  ASN A CG  1 
ATOM   1728  O OD1 . ASN A 1 212 ? 32.891  -14.060 10.532  1.00 29.84 ? 238  ASN A OD1 1 
ATOM   1729  N ND2 . ASN A 1 212 ? 33.546  -14.983 12.470  1.00 29.52 ? 238  ASN A ND2 1 
ATOM   1730  N N   . SER A 1 213 ? 32.331  -9.619  13.267  1.00 33.11 ? 239  SER A N   1 
ATOM   1731  C CA  . SER A 1 213 ? 31.683  -8.552  14.019  1.00 33.43 ? 239  SER A CA  1 
ATOM   1732  C C   . SER A 1 213 ? 31.423  -7.346  13.123  1.00 33.51 ? 239  SER A C   1 
ATOM   1733  O O   . SER A 1 213 ? 30.883  -6.333  13.567  1.00 33.55 ? 239  SER A O   1 
ATOM   1734  C CB  . SER A 1 213 ? 32.559  -8.134  15.197  1.00 34.70 ? 239  SER A CB  1 
ATOM   1735  O OG  . SER A 1 213 ? 32.776  -9.226  16.067  1.00 35.06 ? 239  SER A OG  1 
ATOM   1736  N N   . SER A 1 214 ? 31.817  -7.461  11.861  1.00 33.82 ? 240  SER A N   1 
ATOM   1737  C CA  . SER A 1 214 ? 31.623  -6.388  10.896  1.00 35.11 ? 240  SER A CA  1 
ATOM   1738  C C   . SER A 1 214 ? 31.416  -6.965  9.504   1.00 36.33 ? 240  SER A C   1 
ATOM   1739  O O   . SER A 1 214 ? 32.097  -6.577  8.553   1.00 35.98 ? 240  SER A O   1 
ATOM   1740  C CB  . SER A 1 214 ? 32.832  -5.451  10.901  1.00 34.56 ? 240  SER A CB  1 
ATOM   1741  O OG  . SER A 1 214 ? 34.035  -6.174  10.717  1.00 33.84 ? 240  SER A OG  1 
ATOM   1742  N N   . LEU A 1 215 ? 30.462  -7.889  9.399   1.00 37.90 ? 241  LEU A N   1 
ATOM   1743  C CA  . LEU A 1 215 ? 30.141  -8.557  8.142   1.00 39.88 ? 241  LEU A CA  1 
ATOM   1744  C C   . LEU A 1 215 ? 29.441  -7.661  7.128   1.00 41.03 ? 241  LEU A C   1 
ATOM   1745  O O   . LEU A 1 215 ? 29.567  -7.866  5.922   1.00 40.97 ? 241  LEU A O   1 
ATOM   1746  C CB  . LEU A 1 215 ? 29.271  -9.784  8.415   1.00 39.83 ? 241  LEU A CB  1 
ATOM   1747  C CG  . LEU A 1 215 ? 29.935  -10.913 9.208   1.00 40.65 ? 241  LEU A CG  1 
ATOM   1748  C CD1 . LEU A 1 215 ? 28.883  -11.931 9.614   1.00 41.81 ? 241  LEU A CD1 1 
ATOM   1749  C CD2 . LEU A 1 215 ? 31.033  -11.563 8.371   1.00 40.61 ? 241  LEU A CD2 1 
ATOM   1750  N N   . GLN A 1 216 ? 28.700  -6.670  7.614   1.00 42.93 ? 242  GLN A N   1 
ATOM   1751  C CA  . GLN A 1 216 ? 27.989  -5.765  6.720   1.00 44.63 ? 242  GLN A CA  1 
ATOM   1752  C C   . GLN A 1 216 ? 28.621  -4.379  6.733   1.00 44.56 ? 242  GLN A C   1 
ATOM   1753  O O   . GLN A 1 216 ? 29.172  -3.940  7.744   1.00 42.39 ? 242  GLN A O   1 
ATOM   1754  C CB  . GLN A 1 216 ? 26.520  -5.656  7.132   1.00 47.75 ? 242  GLN A CB  1 
ATOM   1755  C CG  . GLN A 1 216 ? 25.605  -5.154  6.022   1.00 52.32 ? 242  GLN A CG  1 
ATOM   1756  C CD  . GLN A 1 216 ? 24.267  -4.653  6.536   1.00 54.93 ? 242  GLN A CD  1 
ATOM   1757  O OE1 . GLN A 1 216 ? 23.650  -5.263  7.411   1.00 56.13 ? 242  GLN A OE1 1 
ATOM   1758  N NE2 . GLN A 1 216 ? 23.805  -3.539  5.981   1.00 55.95 ? 242  GLN A NE2 1 
ATOM   1759  N N   . SER A 1 217 ? 28.534  -3.691  5.600   1.00 44.54 ? 243  SER A N   1 
ATOM   1760  C CA  . SER A 1 217 ? 29.095  -2.356  5.481   1.00 45.50 ? 243  SER A CA  1 
ATOM   1761  C C   . SER A 1 217 ? 27.964  -1.335  5.597   1.00 45.59 ? 243  SER A C   1 
ATOM   1762  O O   . SER A 1 217 ? 27.758  -0.509  4.707   1.00 46.13 ? 243  SER A O   1 
ATOM   1763  C CB  . SER A 1 217 ? 29.808  -2.218  4.135   1.00 46.33 ? 243  SER A CB  1 
ATOM   1764  O OG  . SER A 1 217 ? 30.578  -1.030  4.076   1.00 49.05 ? 243  SER A OG  1 
ATOM   1765  N N   . ASN A 1 218 ? 27.236  -1.400  6.707   1.00 45.18 ? 244  ASN A N   1 
ATOM   1766  C CA  . ASN A 1 218 ? 26.115  -0.500  6.958   1.00 45.02 ? 244  ASN A CA  1 
ATOM   1767  C C   . ASN A 1 218 ? 26.516  0.723   7.779   1.00 44.12 ? 244  ASN A C   1 
ATOM   1768  O O   . ASN A 1 218 ? 25.845  1.757   7.721   1.00 46.04 ? 244  ASN A O   1 
ATOM   1769  C CB  . ASN A 1 218 ? 24.994  -1.250  7.682   1.00 46.11 ? 244  ASN A CB  1 
ATOM   1770  C CG  . ASN A 1 218 ? 25.461  -1.888  8.979   1.00 47.62 ? 244  ASN A CG  1 
ATOM   1771  O OD1 . ASN A 1 218 ? 26.401  -2.683  8.990   1.00 49.45 ? 244  ASN A OD1 1 
ATOM   1772  N ND2 . ASN A 1 218 ? 24.800  -1.547  10.079  1.00 47.85 ? 244  ASN A ND2 1 
ATOM   1773  N N   . LYS A 1 219 ? 27.600  0.608   8.541   1.00 41.43 ? 245  LYS A N   1 
ATOM   1774  C CA  . LYS A 1 219 ? 28.068  1.718   9.366   1.00 39.10 ? 245  LYS A CA  1 
ATOM   1775  C C   . LYS A 1 219 ? 28.611  2.858   8.508   1.00 36.74 ? 245  LYS A C   1 
ATOM   1776  O O   . LYS A 1 219 ? 29.059  2.642   7.384   1.00 36.19 ? 245  LYS A O   1 
ATOM   1777  C CB  . LYS A 1 219 ? 29.166  1.243   10.322  1.00 39.45 ? 245  LYS A CB  1 
ATOM   1778  C CG  . LYS A 1 219 ? 28.750  0.138   11.284  1.00 41.04 ? 245  LYS A CG  1 
ATOM   1779  C CD  . LYS A 1 219 ? 27.698  0.620   12.272  1.00 42.66 ? 245  LYS A CD  1 
ATOM   1780  C CE  . LYS A 1 219 ? 27.350  -0.467  13.277  1.00 42.47 ? 245  LYS A CE  1 
ATOM   1781  N NZ  . LYS A 1 219 ? 26.334  -0.003  14.261  1.00 43.83 ? 245  LYS A NZ  1 
ATOM   1782  N N   . GLU A 1 220 ? 28.568  4.072   9.046   1.00 34.99 ? 246  GLU A N   1 
ATOM   1783  C CA  . GLU A 1 220 ? 29.070  5.242   8.332   1.00 32.23 ? 246  GLU A CA  1 
ATOM   1784  C C   . GLU A 1 220 ? 30.596  5.210   8.254   1.00 29.49 ? 246  GLU A C   1 
ATOM   1785  O O   . GLU A 1 220 ? 31.271  4.924   9.240   1.00 29.06 ? 246  GLU A O   1 
ATOM   1786  C CB  . GLU A 1 220 ? 28.629  6.528   9.038   1.00 33.87 ? 246  GLU A CB  1 
ATOM   1787  C CG  . GLU A 1 220 ? 27.155  6.875   8.893   1.00 34.35 ? 246  GLU A CG  1 
ATOM   1788  C CD  . GLU A 1 220 ? 26.753  7.145   7.456   1.00 36.21 ? 246  GLU A CD  1 
ATOM   1789  O OE1 . GLU A 1 220 ? 27.519  7.821   6.735   1.00 37.76 ? 246  GLU A OE1 1 
ATOM   1790  O OE2 . GLU A 1 220 ? 25.662  6.694   7.051   1.00 37.77 ? 246  GLU A OE2 1 
ATOM   1791  N N   . PRO A 1 221 ? 31.158  5.507   7.071   1.00 27.22 ? 247  PRO A N   1 
ATOM   1792  C CA  . PRO A 1 221 ? 32.614  5.500   6.897   1.00 25.54 ? 247  PRO A CA  1 
ATOM   1793  C C   . PRO A 1 221 ? 33.262  6.733   7.544   1.00 23.99 ? 247  PRO A C   1 
ATOM   1794  O O   . PRO A 1 221 ? 33.830  7.586   6.861   1.00 24.52 ? 247  PRO A O   1 
ATOM   1795  C CB  . PRO A 1 221 ? 32.770  5.469   5.378   1.00 25.93 ? 247  PRO A CB  1 
ATOM   1796  C CG  . PRO A 1 221 ? 31.609  6.307   4.917   1.00 25.31 ? 247  PRO A CG  1 
ATOM   1797  C CD  . PRO A 1 221 ? 30.473  5.825   5.804   1.00 25.70 ? 247  PRO A CD  1 
ATOM   1798  N N   . VAL A 1 222 ? 33.169  6.821   8.866   1.00 23.63 ? 248  VAL A N   1 
ATOM   1799  C CA  . VAL A 1 222 ? 33.737  7.950   9.604   1.00 22.07 ? 248  VAL A CA  1 
ATOM   1800  C C   . VAL A 1 222 ? 35.184  8.245   9.211   1.00 21.00 ? 248  VAL A C   1 
ATOM   1801  O O   . VAL A 1 222 ? 35.584  9.405   9.126   1.00 19.63 ? 248  VAL A O   1 
ATOM   1802  C CB  . VAL A 1 222 ? 33.676  7.706   11.126  1.00 23.23 ? 248  VAL A CB  1 
ATOM   1803  C CG1 . VAL A 1 222 ? 34.237  8.913   11.871  1.00 23.04 ? 248  VAL A CG1 1 
ATOM   1804  C CG2 . VAL A 1 222 ? 32.240  7.435   11.553  1.00 22.97 ? 248  VAL A CG2 1 
ATOM   1805  N N   . GLY A 1 223 ? 35.956  7.186   8.958   1.00 20.47 ? 249  GLY A N   1 
ATOM   1806  C CA  . GLY A 1 223 ? 37.349  7.328   8.572   1.00 19.19 ? 249  GLY A CA  1 
ATOM   1807  C C   . GLY A 1 223 ? 37.599  8.111   7.293   1.00 19.15 ? 249  GLY A C   1 
ATOM   1808  O O   . GLY A 1 223 ? 38.716  8.571   7.052   1.00 17.90 ? 249  GLY A O   1 
ATOM   1809  N N   . ILE A 1 224 ? 36.579  8.269   6.464   1.00 17.91 ? 250  ILE A N   1 
ATOM   1810  C CA  . ILE A 1 224 ? 36.773  9.003   5.223   1.00 19.05 ? 250  ILE A CA  1 
ATOM   1811  C C   . ILE A 1 224 ? 36.979  10.496  5.513   1.00 17.43 ? 250  ILE A C   1 
ATOM   1812  O O   . ILE A 1 224 ? 37.462  11.254  4.662   1.00 17.46 ? 250  ILE A O   1 
ATOM   1813  C CB  . ILE A 1 224 ? 35.582  8.776   4.267   1.00 19.06 ? 250  ILE A CB  1 
ATOM   1814  C CG1 . ILE A 1 224 ? 36.013  9.082   2.838   1.00 21.47 ? 250  ILE A CG1 1 
ATOM   1815  C CG2 . ILE A 1 224 ? 34.405  9.645   4.653   1.00 19.69 ? 250  ILE A CG2 1 
ATOM   1816  C CD1 . ILE A 1 224 ? 35.025  8.615   1.808   1.00 23.31 ? 250  ILE A CD1 1 
ATOM   1817  N N   . LEU A 1 225 ? 36.640  10.904  6.726   1.00 16.89 ? 251  LEU A N   1 
ATOM   1818  C CA  . LEU A 1 225 ? 36.792  12.295  7.148   1.00 16.42 ? 251  LEU A CA  1 
ATOM   1819  C C   . LEU A 1 225 ? 38.263  12.712  7.149   1.00 15.37 ? 251  LEU A C   1 
ATOM   1820  O O   . LEU A 1 225 ? 38.586  13.885  6.985   1.00 14.93 ? 251  LEU A O   1 
ATOM   1821  C CB  . LEU A 1 225 ? 36.218  12.476  8.551   1.00 15.84 ? 251  LEU A CB  1 
ATOM   1822  C CG  . LEU A 1 225 ? 34.703  12.316  8.688   1.00 16.00 ? 251  LEU A CG  1 
ATOM   1823  C CD1 . LEU A 1 225 ? 34.335  12.187  10.161  1.00 13.77 ? 251  LEU A CD1 1 
ATOM   1824  C CD2 . LEU A 1 225 ? 33.998  13.503  8.030   1.00 14.32 ? 251  LEU A CD2 1 
ATOM   1825  N N   . THR A 1 226 ? 39.146  11.737  7.323   1.00 14.26 ? 252  THR A N   1 
ATOM   1826  C CA  . THR A 1 226 ? 40.583  11.988  7.366   1.00 15.04 ? 252  THR A CA  1 
ATOM   1827  C C   . THR A 1 226 ? 41.200  12.267  6.006   1.00 15.11 ? 252  THR A C   1 
ATOM   1828  O O   . THR A 1 226 ? 42.397  12.511  5.905   1.00 15.60 ? 252  THR A O   1 
ATOM   1829  C CB  . THR A 1 226 ? 41.330  10.798  7.972   1.00 14.57 ? 252  THR A CB  1 
ATOM   1830  O OG1 . THR A 1 226 ? 41.151  9.649   7.137   1.00 12.61 ? 252  THR A OG1 1 
ATOM   1831  C CG2 . THR A 1 226 ? 40.808  10.501  9.372   1.00 13.13 ? 252  THR A CG2 1 
ATOM   1832  N N   . SER A 1 227 ? 40.385  12.233  4.955   1.00 16.18 ? 253  SER A N   1 
ATOM   1833  C CA  . SER A 1 227 ? 40.887  12.478  3.608   1.00 14.48 ? 253  SER A CA  1 
ATOM   1834  C C   . SER A 1 227 ? 40.543  13.865  3.093   1.00 14.12 ? 253  SER A C   1 
ATOM   1835  O O   . SER A 1 227 ? 40.945  14.242  1.996   1.00 14.00 ? 253  SER A O   1 
ATOM   1836  C CB  . SER A 1 227 ? 40.318  11.437  2.638   1.00 16.06 ? 253  SER A CB  1 
ATOM   1837  O OG  . SER A 1 227 ? 38.922  11.606  2.492   1.00 16.95 ? 253  SER A OG  1 
ATOM   1838  N N   . ASN A 1 228 ? 39.793  14.627  3.882   1.00 14.54 ? 254  ASN A N   1 
ATOM   1839  C CA  . ASN A 1 228 ? 39.394  15.962  3.453   1.00 15.49 ? 254  ASN A CA  1 
ATOM   1840  C C   . ASN A 1 228 ? 40.489  16.996  3.709   1.00 16.22 ? 254  ASN A C   1 
ATOM   1841  O O   . ASN A 1 228 ? 41.541  16.671  4.257   1.00 16.53 ? 254  ASN A O   1 
ATOM   1842  C CB  . ASN A 1 228 ? 38.110  16.362  4.186   1.00 16.23 ? 254  ASN A CB  1 
ATOM   1843  C CG  . ASN A 1 228 ? 37.260  17.330  3.390   1.00 14.64 ? 254  ASN A CG  1 
ATOM   1844  O OD1 . ASN A 1 228 ? 37.760  18.067  2.546   1.00 14.83 ? 254  ASN A OD1 1 
ATOM   1845  N ND2 . ASN A 1 228 ? 35.962  17.336  3.670   1.00 18.21 ? 254  ASN A ND2 1 
ATOM   1846  N N   . HIS A 1 229 ? 40.244  18.246  3.305   1.00 16.24 ? 255  HIS A N   1 
ATOM   1847  C CA  . HIS A 1 229 ? 41.211  19.320  3.515   1.00 16.99 ? 255  HIS A CA  1 
ATOM   1848  C C   . HIS A 1 229 ? 41.564  19.362  5.002   1.00 15.73 ? 255  HIS A C   1 
ATOM   1849  O O   . HIS A 1 229 ? 40.707  19.087  5.842   1.00 17.47 ? 255  HIS A O   1 
ATOM   1850  C CB  . HIS A 1 229 ? 40.607  20.656  3.097   1.00 15.54 ? 255  HIS A CB  1 
ATOM   1851  C CG  . HIS A 1 229 ? 41.590  21.783  3.074   1.00 16.75 ? 255  HIS A CG  1 
ATOM   1852  N ND1 . HIS A 1 229 ? 42.309  22.123  1.946   1.00 16.55 ? 255  HIS A ND1 1 
ATOM   1853  C CD2 . HIS A 1 229 ? 41.986  22.646  4.044   1.00 14.94 ? 255  HIS A CD2 1 
ATOM   1854  C CE1 . HIS A 1 229 ? 43.107  23.141  2.223   1.00 12.84 ? 255  HIS A CE1 1 
ATOM   1855  N NE2 . HIS A 1 229 ? 42.929  23.480  3.487   1.00 16.11 ? 255  HIS A NE2 1 
ATOM   1856  N N   . ARG A 1 230 ? 42.800  19.708  5.346   1.00 15.20 ? 256  ARG A N   1 
ATOM   1857  C CA  . ARG A 1 230 ? 43.175  19.714  6.764   1.00 14.67 ? 256  ARG A CA  1 
ATOM   1858  C C   . ARG A 1 230 ? 42.389  20.732  7.582   1.00 14.65 ? 256  ARG A C   1 
ATOM   1859  O O   . ARG A 1 230 ? 42.035  20.464  8.727   1.00 18.31 ? 256  ARG A O   1 
ATOM   1860  C CB  . ARG A 1 230 ? 44.675  19.960  6.927   1.00 9.73  ? 256  ARG A CB  1 
ATOM   1861  C CG  . ARG A 1 230 ? 45.540  18.986  6.118   1.00 11.52 ? 256  ARG A CG  1 
ATOM   1862  C CD  . ARG A 1 230 ? 45.180  17.511  6.370   1.00 11.06 ? 256  ARG A CD  1 
ATOM   1863  N NE  . ARG A 1 230 ? 45.465  17.085  7.740   1.00 12.06 ? 256  ARG A NE  1 
ATOM   1864  C CZ  . ARG A 1 230 ? 45.187  15.879  8.239   1.00 10.97 ? 256  ARG A CZ  1 
ATOM   1865  N NH1 . ARG A 1 230 ? 44.609  14.949  7.487   1.00 10.05 ? 256  ARG A NH1 1 
ATOM   1866  N NH2 . ARG A 1 230 ? 45.487  15.611  9.501   1.00 10.75 ? 256  ARG A NH2 1 
ATOM   1867  N N   . ASN A 1 231 ? 42.089  21.890  7.001   1.00 15.96 ? 257  ASN A N   1 
ATOM   1868  C CA  . ASN A 1 231 ? 41.316  22.881  7.734   1.00 18.06 ? 257  ASN A CA  1 
ATOM   1869  C C   . ASN A 1 231 ? 39.929  22.330  8.030   1.00 16.94 ? 257  ASN A C   1 
ATOM   1870  O O   . ASN A 1 231 ? 39.429  22.445  9.149   1.00 16.02 ? 257  ASN A O   1 
ATOM   1871  C CB  . ASN A 1 231 ? 41.196  24.179  6.942   1.00 23.64 ? 257  ASN A CB  1 
ATOM   1872  C CG  . ASN A 1 231 ? 42.490  24.959  6.904   1.00 30.14 ? 257  ASN A CG  1 
ATOM   1873  O OD1 . ASN A 1 231 ? 43.154  25.136  7.927   1.00 34.11 ? 257  ASN A OD1 1 
ATOM   1874  N ND2 . ASN A 1 231 ? 42.852  25.453  5.724   1.00 33.31 ? 257  ASN A ND2 1 
ATOM   1875  N N   . THR A 1 232 ? 39.314  21.721  7.023   1.00 15.16 ? 258  THR A N   1 
ATOM   1876  C CA  . THR A 1 232 ? 37.982  21.151  7.172   1.00 14.71 ? 258  THR A CA  1 
ATOM   1877  C C   . THR A 1 232 ? 37.991  19.968  8.126   1.00 14.63 ? 258  THR A C   1 
ATOM   1878  O O   . THR A 1 232 ? 37.115  19.832  8.979   1.00 14.71 ? 258  THR A O   1 
ATOM   1879  C CB  . THR A 1 232 ? 37.452  20.695  5.813   1.00 13.37 ? 258  THR A CB  1 
ATOM   1880  O OG1 . THR A 1 232 ? 37.611  21.770  4.878   1.00 15.05 ? 258  THR A OG1 1 
ATOM   1881  C CG2 . THR A 1 232 ? 35.988  20.308  5.911   1.00 13.63 ? 258  THR A CG2 1 
ATOM   1882  N N   . TRP A 1 233 ? 38.982  19.095  7.966   1.00 15.04 ? 259  TRP A N   1 
ATOM   1883  C CA  . TRP A 1 233 ? 39.104  17.923  8.822   1.00 15.04 ? 259  TRP A CA  1 
ATOM   1884  C C   . TRP A 1 233 ? 39.381  18.371  10.266  1.00 15.56 ? 259  TRP A C   1 
ATOM   1885  O O   . TRP A 1 233 ? 38.879  17.774  11.217  1.00 16.93 ? 259  TRP A O   1 
ATOM   1886  C CB  . TRP A 1 233 ? 40.238  17.029  8.306   1.00 16.07 ? 259  TRP A CB  1 
ATOM   1887  C CG  . TRP A 1 233 ? 40.595  15.860  9.187   1.00 13.77 ? 259  TRP A CG  1 
ATOM   1888  C CD1 . TRP A 1 233 ? 41.844  15.328  9.372   1.00 13.45 ? 259  TRP A CD1 1 
ATOM   1889  C CD2 . TRP A 1 233 ? 39.705  15.072  9.987   1.00 13.97 ? 259  TRP A CD2 1 
ATOM   1890  N NE1 . TRP A 1 233 ? 41.782  14.265  10.239  1.00 14.40 ? 259  TRP A NE1 1 
ATOM   1891  C CE2 . TRP A 1 233 ? 40.481  14.086  10.631  1.00 14.80 ? 259  TRP A CE2 1 
ATOM   1892  C CE3 . TRP A 1 233 ? 38.324  15.107  10.224  1.00 15.68 ? 259  TRP A CE3 1 
ATOM   1893  C CZ2 . TRP A 1 233 ? 39.922  13.138  11.502  1.00 16.84 ? 259  TRP A CZ2 1 
ATOM   1894  C CZ3 . TRP A 1 233 ? 37.769  14.173  11.085  1.00 15.26 ? 259  TRP A CZ3 1 
ATOM   1895  C CH2 . TRP A 1 233 ? 38.567  13.200  11.715  1.00 16.74 ? 259  TRP A CH2 1 
ATOM   1896  N N   . ALA A 1 234 ? 40.171  19.426  10.431  1.00 15.94 ? 260  ALA A N   1 
ATOM   1897  C CA  . ALA A 1 234 ? 40.484  19.916  11.773  1.00 17.01 ? 260  ALA A CA  1 
ATOM   1898  C C   . ALA A 1 234 ? 39.195  20.238  12.512  1.00 17.21 ? 260  ALA A C   1 
ATOM   1899  O O   . ALA A 1 234 ? 39.028  19.862  13.673  1.00 17.66 ? 260  ALA A O   1 
ATOM   1900  C CB  . ALA A 1 234 ? 41.371  21.160  11.703  1.00 15.51 ? 260  ALA A CB  1 
ATOM   1901  N N   . LYS A 1 235 ? 38.282  20.919  11.832  1.00 18.60 ? 261  LYS A N   1 
ATOM   1902  C CA  . LYS A 1 235 ? 37.003  21.297  12.431  1.00 21.81 ? 261  LYS A CA  1 
ATOM   1903  C C   . LYS A 1 235 ? 36.068  20.107  12.617  1.00 20.82 ? 261  LYS A C   1 
ATOM   1904  O O   . LYS A 1 235 ? 35.429  19.969  13.655  1.00 21.70 ? 261  LYS A O   1 
ATOM   1905  C CB  . LYS A 1 235 ? 36.306  22.370  11.585  1.00 23.32 ? 261  LYS A CB  1 
ATOM   1906  C CG  . LYS A 1 235 ? 34.998  22.863  12.192  1.00 30.82 ? 261  LYS A CG  1 
ATOM   1907  C CD  . LYS A 1 235 ? 34.385  23.998  11.376  1.00 33.82 ? 261  LYS A CD  1 
ATOM   1908  C CE  . LYS A 1 235 ? 33.145  24.573  12.053  1.00 35.26 ? 261  LYS A CE  1 
ATOM   1909  N NZ  . LYS A 1 235 ? 32.543  25.673  11.244  1.00 36.24 ? 261  LYS A NZ  1 
ATOM   1910  N N   . ALA A 1 236 ? 35.982  19.252  11.602  1.00 21.29 ? 262  ALA A N   1 
ATOM   1911  C CA  . ALA A 1 236 ? 35.122  18.075  11.673  1.00 20.25 ? 262  ALA A CA  1 
ATOM   1912  C C   . ALA A 1 236 ? 35.629  17.155  12.780  1.00 20.21 ? 262  ALA A C   1 
ATOM   1913  O O   . ALA A 1 236 ? 34.848  16.514  13.481  1.00 20.78 ? 262  ALA A O   1 
ATOM   1914  C CB  . ALA A 1 236 ? 35.123  17.338  10.339  1.00 18.24 ? 262  ALA A CB  1 
ATOM   1915  N N   . TYR A 1 237 ? 36.945  17.103  12.935  1.00 20.84 ? 263  TYR A N   1 
ATOM   1916  C CA  . TYR A 1 237 ? 37.571  16.271  13.956  1.00 20.61 ? 263  TYR A CA  1 
ATOM   1917  C C   . TYR A 1 237 ? 37.189  16.770  15.343  1.00 20.05 ? 263  TYR A C   1 
ATOM   1918  O O   . TYR A 1 237 ? 36.810  15.996  16.213  1.00 19.40 ? 263  TYR A O   1 
ATOM   1919  C CB  . TYR A 1 237 ? 39.096  16.312  13.795  1.00 19.98 ? 263  TYR A CB  1 
ATOM   1920  C CG  . TYR A 1 237 ? 39.867  15.648  14.918  1.00 22.52 ? 263  TYR A CG  1 
ATOM   1921  C CD1 . TYR A 1 237 ? 39.905  14.260  15.047  1.00 21.93 ? 263  TYR A CD1 1 
ATOM   1922  C CD2 . TYR A 1 237 ? 40.547  16.415  15.861  1.00 22.32 ? 263  TYR A CD2 1 
ATOM   1923  C CE1 . TYR A 1 237 ? 40.607  13.651  16.094  1.00 22.31 ? 263  TYR A CE1 1 
ATOM   1924  C CE2 . TYR A 1 237 ? 41.249  15.821  16.910  1.00 22.36 ? 263  TYR A CE2 1 
ATOM   1925  C CZ  . TYR A 1 237 ? 41.275  14.442  17.022  1.00 21.94 ? 263  TYR A CZ  1 
ATOM   1926  O OH  . TYR A 1 237 ? 41.978  13.870  18.057  1.00 21.84 ? 263  TYR A OH  1 
ATOM   1927  N N   . ASN A 1 238 ? 37.290  18.071  15.538  1.00 22.19 ? 264  ASN A N   1 
ATOM   1928  C CA  . ASN A 1 238 ? 36.967  18.666  16.822  1.00 24.70 ? 264  ASN A CA  1 
ATOM   1929  C C   . ASN A 1 238 ? 35.529  18.366  17.224  1.00 23.55 ? 264  ASN A C   1 
ATOM   1930  O O   . ASN A 1 238 ? 35.227  18.178  18.397  1.00 24.27 ? 264  ASN A O   1 
ATOM   1931  C CB  . ASN A 1 238 ? 37.202  20.176  16.769  1.00 27.86 ? 264  ASN A CB  1 
ATOM   1932  C CG  . ASN A 1 238 ? 37.109  20.827  18.135  1.00 32.42 ? 264  ASN A CG  1 
ATOM   1933  O OD1 . ASN A 1 238 ? 36.026  20.951  18.706  1.00 34.65 ? 264  ASN A OD1 1 
ATOM   1934  N ND2 . ASN A 1 238 ? 38.251  21.245  18.667  1.00 33.98 ? 264  ASN A ND2 1 
ATOM   1935  N N   . ASN A 1 239 ? 34.638  18.309  16.246  1.00 24.26 ? 265  ASN A N   1 
ATOM   1936  C CA  . ASN A 1 239 ? 33.241  18.028  16.537  1.00 24.05 ? 265  ASN A CA  1 
ATOM   1937  C C   . ASN A 1 239 ? 33.073  16.557  16.849  1.00 23.63 ? 265  ASN A C   1 
ATOM   1938  O O   . ASN A 1 239 ? 32.413  16.177  17.812  1.00 23.90 ? 265  ASN A O   1 
ATOM   1939  C CB  . ASN A 1 239 ? 32.370  18.395  15.339  1.00 24.99 ? 265  ASN A CB  1 
ATOM   1940  C CG  . ASN A 1 239 ? 30.912  18.081  15.570  1.00 25.94 ? 265  ASN A CG  1 
ATOM   1941  O OD1 . ASN A 1 239 ? 30.264  18.681  16.428  1.00 27.80 ? 265  ASN A OD1 1 
ATOM   1942  N ND2 . ASN A 1 239 ? 30.385  17.128  14.811  1.00 25.26 ? 265  ASN A ND2 1 
ATOM   1943  N N   . LEU A 1 240 ? 33.687  15.735  16.011  1.00 23.25 ? 266  LEU A N   1 
ATOM   1944  C CA  . LEU A 1 240 ? 33.616  14.292  16.151  1.00 23.30 ? 266  LEU A CA  1 
ATOM   1945  C C   . LEU A 1 240 ? 33.953  13.794  17.548  1.00 23.42 ? 266  LEU A C   1 
ATOM   1946  O O   . LEU A 1 240 ? 33.266  12.919  18.078  1.00 23.62 ? 266  LEU A O   1 
ATOM   1947  C CB  . LEU A 1 240 ? 34.561  13.622  15.152  1.00 21.90 ? 266  LEU A CB  1 
ATOM   1948  C CG  . LEU A 1 240 ? 34.736  12.106  15.266  1.00 21.43 ? 266  LEU A CG  1 
ATOM   1949  C CD1 . LEU A 1 240 ? 33.481  11.402  14.760  1.00 21.79 ? 266  LEU A CD1 1 
ATOM   1950  C CD2 . LEU A 1 240 ? 35.962  11.680  14.461  1.00 20.42 ? 266  LEU A CD2 1 
ATOM   1951  N N   . ILE A 1 241 ? 35.007  14.349  18.137  1.00 23.15 ? 267  ILE A N   1 
ATOM   1952  C CA  . ILE A 1 241 ? 35.454  13.921  19.461  1.00 23.97 ? 267  ILE A CA  1 
ATOM   1953  C C   . ILE A 1 241 ? 34.740  14.565  20.646  1.00 25.29 ? 267  ILE A C   1 
ATOM   1954  O O   . ILE A 1 241 ? 35.175  14.397  21.788  1.00 23.87 ? 267  ILE A O   1 
ATOM   1955  C CB  . ILE A 1 241 ? 36.975  14.135  19.643  1.00 24.21 ? 267  ILE A CB  1 
ATOM   1956  C CG1 . ILE A 1 241 ? 37.323  15.617  19.457  1.00 26.01 ? 267  ILE A CG1 1 
ATOM   1957  C CG2 . ILE A 1 241 ? 37.743  13.281  18.643  1.00 24.30 ? 267  ILE A CG2 1 
ATOM   1958  C CD1 . ILE A 1 241 ? 38.761  15.960  19.803  1.00 26.46 ? 267  ILE A CD1 1 
ATOM   1959  N N   . LYS A 1 242 ? 33.660  15.297  20.395  1.00 26.34 ? 268  LYS A N   1 
ATOM   1960  C CA  . LYS A 1 242 ? 32.912  15.906  21.491  1.00 28.56 ? 268  LYS A CA  1 
ATOM   1961  C C   . LYS A 1 242 ? 32.127  14.822  22.221  1.00 29.30 ? 268  LYS A C   1 
ATOM   1962  O O   . LYS A 1 242 ? 31.688  15.022  23.348  1.00 28.73 ? 268  LYS A O   1 
ATOM   1963  C CB  . LYS A 1 242 ? 31.945  16.967  20.976  1.00 31.04 ? 268  LYS A CB  1 
ATOM   1964  C CG  . LYS A 1 242 ? 32.610  18.292  20.669  1.00 34.66 ? 268  LYS A CG  1 
ATOM   1965  C CD  . LYS A 1 242 ? 31.655  19.258  19.991  1.00 38.53 ? 268  LYS A CD  1 
ATOM   1966  C CE  . LYS A 1 242 ? 32.345  20.582  19.688  1.00 41.54 ? 268  LYS A CE  1 
ATOM   1967  N NZ  . LYS A 1 242 ? 31.524  21.458  18.803  1.00 44.51 ? 268  LYS A NZ  1 
ATOM   1968  N N   . ASP A 1 243 ? 31.945  13.674  21.571  1.00 29.39 ? 269  ASP A N   1 
ATOM   1969  C CA  . ASP A 1 243 ? 31.226  12.559  22.175  1.00 29.66 ? 269  ASP A CA  1 
ATOM   1970  C C   . ASP A 1 243 ? 32.229  11.699  22.923  1.00 30.95 ? 269  ASP A C   1 
ATOM   1971  O O   . ASP A 1 243 ? 33.330  11.472  22.429  1.00 32.38 ? 269  ASP A O   1 
ATOM   1972  C CB  . ASP A 1 243 ? 30.538  11.718  21.097  1.00 31.76 ? 269  ASP A CB  1 
ATOM   1973  C CG  . ASP A 1 243 ? 29.949  10.433  21.651  1.00 33.59 ? 269  ASP A CG  1 
ATOM   1974  O OD1 . ASP A 1 243 ? 29.009  10.518  22.468  1.00 34.80 ? 269  ASP A OD1 1 
ATOM   1975  O OD2 . ASP A 1 243 ? 30.431  9.340   21.278  1.00 34.64 ? 269  ASP A OD2 1 
ATOM   1976  N N   . LYS A 1 244 ? 31.850  11.215  24.105  1.00 30.57 ? 270  LYS A N   1 
ATOM   1977  C CA  . LYS A 1 244 ? 32.748  10.389  24.909  1.00 31.33 ? 270  LYS A CA  1 
ATOM   1978  C C   . LYS A 1 244 ? 33.212  9.139   24.171  1.00 31.24 ? 270  LYS A C   1 
ATOM   1979  O O   . LYS A 1 244 ? 34.400  8.820   24.165  1.00 29.84 ? 270  LYS A O   1 
ATOM   1980  C CB  . LYS A 1 244 ? 32.069  9.961   26.212  1.00 33.05 ? 270  LYS A CB  1 
ATOM   1981  C CG  . LYS A 1 244 ? 32.956  9.104   27.115  1.00 34.70 ? 270  LYS A CG  1 
ATOM   1982  C CD  . LYS A 1 244 ? 32.198  8.626   28.345  1.00 37.98 ? 270  LYS A CD  1 
ATOM   1983  C CE  . LYS A 1 244 ? 33.058  7.741   29.233  1.00 39.94 ? 270  LYS A CE  1 
ATOM   1984  N NZ  . LYS A 1 244 ? 32.244  7.094   30.301  1.00 42.30 ? 270  LYS A NZ  1 
ATOM   1985  N N   . VAL A 1 245 ? 32.264  8.432   23.557  1.00 30.36 ? 271  VAL A N   1 
ATOM   1986  C CA  . VAL A 1 245 ? 32.562  7.204   22.833  1.00 30.45 ? 271  VAL A CA  1 
ATOM   1987  C C   . VAL A 1 245 ? 33.465  7.471   21.630  1.00 28.76 ? 271  VAL A C   1 
ATOM   1988  O O   . VAL A 1 245 ? 34.470  6.778   21.423  1.00 26.58 ? 271  VAL A O   1 
ATOM   1989  C CB  . VAL A 1 245 ? 31.263  6.532   22.337  1.00 31.03 ? 271  VAL A CB  1 
ATOM   1990  C CG1 . VAL A 1 245 ? 31.584  5.207   21.675  1.00 31.08 ? 271  VAL A CG1 1 
ATOM   1991  C CG2 . VAL A 1 245 ? 30.307  6.321   23.503  1.00 32.96 ? 271  VAL A CG2 1 
ATOM   1992  N N   . ASN A 1 246 ? 33.092  8.467   20.837  1.00 28.72 ? 272  ASN A N   1 
ATOM   1993  C CA  . ASN A 1 246 ? 33.858  8.829   19.656  1.00 27.60 ? 272  ASN A CA  1 
ATOM   1994  C C   . ASN A 1 246 ? 35.294  9.155   20.045  1.00 27.79 ? 272  ASN A C   1 
ATOM   1995  O O   . ASN A 1 246 ? 36.236  8.617   19.460  1.00 28.08 ? 272  ASN A O   1 
ATOM   1996  C CB  . ASN A 1 246 ? 33.220  10.033  18.964  1.00 27.69 ? 272  ASN A CB  1 
ATOM   1997  C CG  . ASN A 1 246 ? 31.897  9.700   18.296  1.00 28.10 ? 272  ASN A CG  1 
ATOM   1998  O OD1 . ASN A 1 246 ? 31.363  8.606   18.465  1.00 28.00 ? 272  ASN A OD1 1 
ATOM   1999  N ND2 . ASN A 1 246 ? 31.362  10.648  17.526  1.00 25.76 ? 272  ASN A ND2 1 
ATOM   2000  N N   . ARG A 1 247 ? 35.459  10.023  21.045  1.00 27.37 ? 273  ARG A N   1 
ATOM   2001  C CA  . ARG A 1 247 ? 36.790  10.420  21.489  1.00 26.35 ? 273  ARG A CA  1 
ATOM   2002  C C   . ARG A 1 247 ? 37.594  9.208   21.921  1.00 25.66 ? 273  ARG A C   1 
ATOM   2003  O O   . ARG A 1 247 ? 38.796  9.127   21.675  1.00 24.27 ? 273  ARG A O   1 
ATOM   2004  C CB  . ARG A 1 247 ? 36.699  11.418  22.650  1.00 27.33 ? 273  ARG A CB  1 
ATOM   2005  C CG  . ARG A 1 247 ? 38.058  11.891  23.167  1.00 30.10 ? 273  ARG A CG  1 
ATOM   2006  C CD  . ARG A 1 247 ? 37.932  13.082  24.116  1.00 33.10 ? 273  ARG A CD  1 
ATOM   2007  N NE  . ARG A 1 247 ? 37.115  12.782  25.289  1.00 38.10 ? 273  ARG A NE  1 
ATOM   2008  C CZ  . ARG A 1 247 ? 35.822  13.076  25.406  1.00 39.37 ? 273  ARG A CZ  1 
ATOM   2009  N NH1 . ARG A 1 247 ? 35.179  13.689  24.420  1.00 41.17 ? 273  ARG A NH1 1 
ATOM   2010  N NH2 . ARG A 1 247 ? 35.169  12.748  26.513  1.00 40.18 ? 273  ARG A NH2 1 
ATOM   2011  N N   . GLU A 1 248 ? 36.921  8.262   22.562  1.00 23.69 ? 274  GLU A N   1 
ATOM   2012  C CA  . GLU A 1 248 ? 37.584  7.060   23.030  1.00 26.06 ? 274  GLU A CA  1 
ATOM   2013  C C   . GLU A 1 248 ? 38.062  6.212   21.851  1.00 24.02 ? 274  GLU A C   1 
ATOM   2014  O O   . GLU A 1 248 ? 39.164  5.662   21.878  1.00 24.59 ? 274  GLU A O   1 
ATOM   2015  C CB  . GLU A 1 248 ? 36.627  6.260   23.920  1.00 30.90 ? 274  GLU A CB  1 
ATOM   2016  C CG  . GLU A 1 248 ? 37.232  5.012   24.559  1.00 36.44 ? 274  GLU A CG  1 
ATOM   2017  C CD  . GLU A 1 248 ? 36.233  4.254   25.430  1.00 41.37 ? 274  GLU A CD  1 
ATOM   2018  O OE1 . GLU A 1 248 ? 35.172  3.845   24.909  1.00 42.78 ? 274  GLU A OE1 1 
ATOM   2019  O OE2 . GLU A 1 248 ? 36.505  4.063   26.637  1.00 42.97 ? 274  GLU A OE2 1 
ATOM   2020  N N   . SER A 1 249 ? 37.237  6.110   20.821  1.00 22.98 ? 275  SER A N   1 
ATOM   2021  C CA  . SER A 1 249 ? 37.592  5.318   19.647  1.00 22.93 ? 275  SER A CA  1 
ATOM   2022  C C   . SER A 1 249 ? 38.768  5.937   18.900  1.00 21.37 ? 275  SER A C   1 
ATOM   2023  O O   . SER A 1 249 ? 39.699  5.243   18.499  1.00 20.92 ? 275  SER A O   1 
ATOM   2024  C CB  . SER A 1 249 ? 36.384  5.183   18.717  1.00 23.89 ? 275  SER A CB  1 
ATOM   2025  O OG  . SER A 1 249 ? 35.372  4.383   19.312  1.00 24.71 ? 275  SER A OG  1 
ATOM   2026  N N   . VAL A 1 250 ? 38.719  7.250   18.716  1.00 21.01 ? 276  VAL A N   1 
ATOM   2027  C CA  . VAL A 1 250 ? 39.786  7.966   18.033  1.00 19.81 ? 276  VAL A CA  1 
ATOM   2028  C C   . VAL A 1 250 ? 41.100  7.807   18.780  1.00 19.08 ? 276  VAL A C   1 
ATOM   2029  O O   . VAL A 1 250 ? 42.140  7.544   18.176  1.00 18.19 ? 276  VAL A O   1 
ATOM   2030  C CB  . VAL A 1 250 ? 39.462  9.463   17.921  1.00 19.40 ? 276  VAL A CB  1 
ATOM   2031  C CG1 . VAL A 1 250 ? 40.708  10.243  17.505  1.00 18.59 ? 276  VAL A CG1 1 
ATOM   2032  C CG2 . VAL A 1 250 ? 38.336  9.660   16.923  1.00 18.50 ? 276  VAL A CG2 1 
ATOM   2033  N N   . ASN A 1 251 ? 41.051  7.964   20.099  1.00 20.78 ? 277  ASN A N   1 
ATOM   2034  C CA  . ASN A 1 251 ? 42.249  7.829   20.922  1.00 21.33 ? 277  ASN A CA  1 
ATOM   2035  C C   . ASN A 1 251 ? 42.887  6.452   20.719  1.00 19.99 ? 277  ASN A C   1 
ATOM   2036  O O   . ASN A 1 251 ? 44.102  6.330   20.588  1.00 18.45 ? 277  ASN A O   1 
ATOM   2037  C CB  . ASN A 1 251 ? 41.898  8.058   22.395  1.00 24.81 ? 277  ASN A CB  1 
ATOM   2038  C CG  . ASN A 1 251 ? 43.104  7.955   23.303  1.00 27.98 ? 277  ASN A CG  1 
ATOM   2039  O OD1 . ASN A 1 251 ? 43.445  6.871   23.775  1.00 32.50 ? 277  ASN A OD1 1 
ATOM   2040  N ND2 . ASN A 1 251 ? 43.767  9.081   23.541  1.00 29.79 ? 277  ASN A ND2 1 
ATOM   2041  N N   . SER A 1 252 ? 42.059  5.418   20.673  1.00 19.08 ? 278  SER A N   1 
ATOM   2042  C CA  . SER A 1 252 ? 42.557  4.068   20.451  1.00 19.57 ? 278  SER A CA  1 
ATOM   2043  C C   . SER A 1 252 ? 43.283  3.973   19.108  1.00 18.01 ? 278  SER A C   1 
ATOM   2044  O O   . SER A 1 252 ? 44.358  3.382   19.003  1.00 17.02 ? 278  SER A O   1 
ATOM   2045  C CB  . SER A 1 252 ? 41.398  3.075   20.476  1.00 19.27 ? 278  SER A CB  1 
ATOM   2046  O OG  . SER A 1 252 ? 41.856  1.783   20.117  1.00 22.30 ? 278  SER A OG  1 
ATOM   2047  N N   . ILE A 1 253 ? 42.681  4.559   18.084  1.00 16.78 ? 279  ILE A N   1 
ATOM   2048  C CA  . ILE A 1 253 ? 43.262  4.551   16.749  1.00 16.09 ? 279  ILE A CA  1 
ATOM   2049  C C   . ILE A 1 253 ? 44.609  5.266   16.730  1.00 15.38 ? 279  ILE A C   1 
ATOM   2050  O O   . ILE A 1 253 ? 45.606  4.736   16.241  1.00 14.18 ? 279  ILE A O   1 
ATOM   2051  C CB  . ILE A 1 253 ? 42.298  5.218   15.723  1.00 16.38 ? 279  ILE A CB  1 
ATOM   2052  C CG1 . ILE A 1 253 ? 41.054  4.335   15.532  1.00 16.92 ? 279  ILE A CG1 1 
ATOM   2053  C CG2 . ILE A 1 253 ? 43.012  5.442   14.404  1.00 14.73 ? 279  ILE A CG2 1 
ATOM   2054  C CD1 . ILE A 1 253 ? 39.979  4.927   14.618  1.00 14.32 ? 279  ILE A CD1 1 
ATOM   2055  N N   . GLN A 1 254 ? 44.645  6.470   17.291  1.00 16.09 ? 280  GLN A N   1 
ATOM   2056  C CA  . GLN A 1 254 ? 45.872  7.253   17.301  1.00 16.21 ? 280  GLN A CA  1 
ATOM   2057  C C   . GLN A 1 254 ? 47.004  6.563   18.043  1.00 17.14 ? 280  GLN A C   1 
ATOM   2058  O O   . GLN A 1 254 ? 48.160  6.623   17.629  1.00 15.85 ? 280  GLN A O   1 
ATOM   2059  C CB  . GLN A 1 254 ? 45.609  8.628   17.916  1.00 18.60 ? 280  GLN A CB  1 
ATOM   2060  C CG  . GLN A 1 254 ? 44.445  9.369   17.255  1.00 20.78 ? 280  GLN A CG  1 
ATOM   2061  C CD  . GLN A 1 254 ? 44.267  10.785  17.771  1.00 21.60 ? 280  GLN A CD  1 
ATOM   2062  O OE1 . GLN A 1 254 ? 44.394  11.037  18.968  1.00 21.35 ? 280  GLN A OE1 1 
ATOM   2063  N NE2 . GLN A 1 254 ? 43.958  11.713  16.868  1.00 19.75 ? 280  GLN A NE2 1 
ATOM   2064  N N   . LYS A 1 255 ? 46.667  5.882   19.133  1.00 17.06 ? 281  LYS A N   1 
ATOM   2065  C CA  . LYS A 1 255 ? 47.677  5.196   19.926  1.00 19.84 ? 281  LYS A CA  1 
ATOM   2066  C C   . LYS A 1 255 ? 48.111  3.849   19.370  1.00 19.26 ? 281  LYS A C   1 
ATOM   2067  O O   . LYS A 1 255 ? 49.228  3.414   19.631  1.00 20.26 ? 281  LYS A O   1 
ATOM   2068  C CB  . LYS A 1 255 ? 47.182  5.008   21.359  1.00 22.17 ? 281  LYS A CB  1 
ATOM   2069  C CG  . LYS A 1 255 ? 47.108  6.295   22.156  1.00 26.41 ? 281  LYS A CG  1 
ATOM   2070  C CD  . LYS A 1 255 ? 46.547  6.037   23.539  1.00 28.83 ? 281  LYS A CD  1 
ATOM   2071  C CE  . LYS A 1 255 ? 46.353  7.333   24.303  1.00 28.89 ? 281  LYS A CE  1 
ATOM   2072  N NZ  . LYS A 1 255 ? 45.594  7.079   25.554  1.00 30.57 ? 281  LYS A NZ  1 
ATOM   2073  N N   . SER A 1 256 ? 47.233  3.194   18.611  1.00 17.93 ? 282  SER A N   1 
ATOM   2074  C CA  . SER A 1 256 ? 47.534  1.883   18.043  1.00 18.30 ? 282  SER A CA  1 
ATOM   2075  C C   . SER A 1 256 ? 48.911  1.839   17.383  1.00 17.82 ? 282  SER A C   1 
ATOM   2076  O O   . SER A 1 256 ? 49.341  2.812   16.760  1.00 16.65 ? 282  SER A O   1 
ATOM   2077  C CB  . SER A 1 256 ? 46.456  1.486   17.035  1.00 17.77 ? 282  SER A CB  1 
ATOM   2078  O OG  . SER A 1 256 ? 46.504  2.306   15.890  1.00 21.98 ? 282  SER A OG  1 
ATOM   2079  N N   . ILE A 1 257 ? 49.604  0.710   17.532  1.00 16.95 ? 283  ILE A N   1 
ATOM   2080  C CA  . ILE A 1 257 ? 50.940  0.538   16.964  1.00 17.44 ? 283  ILE A CA  1 
ATOM   2081  C C   . ILE A 1 257 ? 50.929  0.804   15.457  1.00 17.47 ? 283  ILE A C   1 
ATOM   2082  O O   . ILE A 1 257 ? 51.866  1.377   14.906  1.00 14.53 ? 283  ILE A O   1 
ATOM   2083  C CB  . ILE A 1 257 ? 51.465  -0.892  17.226  1.00 17.97 ? 283  ILE A CB  1 
ATOM   2084  C CG1 . ILE A 1 257 ? 51.407  -1.214  18.727  1.00 19.03 ? 283  ILE A CG1 1 
ATOM   2085  C CG2 . ILE A 1 257 ? 52.897  -1.017  16.741  1.00 18.34 ? 283  ILE A CG2 1 
ATOM   2086  C CD1 . ILE A 1 257 ? 51.769  -2.658  19.056  1.00 18.69 ? 283  ILE A CD1 1 
ATOM   2087  N N   . PHE A 1 258 ? 49.857  0.369   14.804  1.00 18.30 ? 284  PHE A N   1 
ATOM   2088  C CA  . PHE A 1 258 ? 49.668  0.554   13.370  1.00 19.91 ? 284  PHE A CA  1 
ATOM   2089  C C   . PHE A 1 258 ? 48.302  -0.006  13.001  1.00 19.00 ? 284  PHE A C   1 
ATOM   2090  O O   . PHE A 1 258 ? 47.707  -0.764  13.768  1.00 20.35 ? 284  PHE A O   1 
ATOM   2091  C CB  . PHE A 1 258 ? 50.781  -0.144  12.571  1.00 19.74 ? 284  PHE A CB  1 
ATOM   2092  C CG  . PHE A 1 258 ? 50.799  -1.642  12.709  1.00 22.89 ? 284  PHE A CG  1 
ATOM   2093  C CD1 . PHE A 1 258 ? 50.083  -2.442  11.828  1.00 24.60 ? 284  PHE A CD1 1 
ATOM   2094  C CD2 . PHE A 1 258 ? 51.548  -2.256  13.713  1.00 24.93 ? 284  PHE A CD2 1 
ATOM   2095  C CE1 . PHE A 1 258 ? 50.115  -3.836  11.943  1.00 23.86 ? 284  PHE A CE1 1 
ATOM   2096  C CE2 . PHE A 1 258 ? 51.586  -3.642  13.836  1.00 25.55 ? 284  PHE A CE2 1 
ATOM   2097  C CZ  . PHE A 1 258 ? 50.865  -4.432  12.943  1.00 24.80 ? 284  PHE A CZ  1 
ATOM   2098  N N   . THR A 1 259 ? 47.805  0.379   11.831  1.00 17.91 ? 285  THR A N   1 
ATOM   2099  C CA  . THR A 1 259 ? 46.499  -0.060  11.375  1.00 17.53 ? 285  THR A CA  1 
ATOM   2100  C C   . THR A 1 259 ? 46.557  -1.056  10.223  1.00 18.05 ? 285  THR A C   1 
ATOM   2101  O O   . THR A 1 259 ? 47.395  -0.940  9.321   1.00 17.31 ? 285  THR A O   1 
ATOM   2102  C CB  . THR A 1 259 ? 45.643  1.148   10.942  1.00 17.54 ? 285  THR A CB  1 
ATOM   2103  O OG1 . THR A 1 259 ? 45.520  2.067   12.036  1.00 17.93 ? 285  THR A OG1 1 
ATOM   2104  C CG2 . THR A 1 259 ? 44.262  0.695   10.521  1.00 14.18 ? 285  THR A CG2 1 
ATOM   2105  N N   . VAL A 1 260 ? 45.670  -2.042  10.270  1.00 17.70 ? 286  VAL A N   1 
ATOM   2106  C CA  . VAL A 1 260 ? 45.585  -3.053  9.215   1.00 16.93 ? 286  VAL A CA  1 
ATOM   2107  C C   . VAL A 1 260 ? 44.203  -2.913  8.598   1.00 16.98 ? 286  VAL A C   1 
ATOM   2108  O O   . VAL A 1 260 ? 43.197  -3.013  9.305   1.00 17.41 ? 286  VAL A O   1 
ATOM   2109  C CB  . VAL A 1 260 ? 45.721  -4.482  9.776   1.00 17.50 ? 286  VAL A CB  1 
ATOM   2110  C CG1 . VAL A 1 260 ? 45.450  -5.506  8.672   1.00 13.86 ? 286  VAL A CG1 1 
ATOM   2111  C CG2 . VAL A 1 260 ? 47.110  -4.683  10.369  1.00 16.26 ? 286  VAL A CG2 1 
ATOM   2112  N N   . CYS A 1 261 ? 44.163  -2.664  7.287   1.00 16.17 ? 287  CYS A N   1 
ATOM   2113  C CA  . CYS A 1 261 ? 42.912  -2.487  6.558   1.00 16.07 ? 287  CYS A CA  1 
ATOM   2114  C C   . CYS A 1 261 ? 42.531  -3.746  5.764   1.00 17.72 ? 287  CYS A C   1 
ATOM   2115  O O   . CYS A 1 261 ? 43.226  -4.139  4.825   1.00 16.20 ? 287  CYS A O   1 
ATOM   2116  C CB  . CYS A 1 261 ? 43.039  -1.306  5.594   1.00 15.50 ? 287  CYS A CB  1 
ATOM   2117  S SG  . CYS A 1 261 ? 43.823  0.163   6.321   1.00 16.10 ? 287  CYS A SG  1 
ATOM   2118  N N   . LEU A 1 262 ? 41.428  -4.377  6.151   1.00 20.22 ? 288  LEU A N   1 
ATOM   2119  C CA  . LEU A 1 262 ? 40.937  -5.575  5.466   1.00 22.30 ? 288  LEU A CA  1 
ATOM   2120  C C   . LEU A 1 262 ? 39.925  -5.099  4.433   1.00 23.35 ? 288  LEU A C   1 
ATOM   2121  O O   . LEU A 1 262 ? 38.728  -5.026  4.712   1.00 25.19 ? 288  LEU A O   1 
ATOM   2122  C CB  . LEU A 1 262 ? 40.271  -6.521  6.472   1.00 22.51 ? 288  LEU A CB  1 
ATOM   2123  C CG  . LEU A 1 262 ? 41.125  -6.944  7.673   1.00 22.61 ? 288  LEU A CG  1 
ATOM   2124  C CD1 . LEU A 1 262 ? 40.327  -7.852  8.581   1.00 23.55 ? 288  LEU A CD1 1 
ATOM   2125  C CD2 . LEU A 1 262 ? 42.357  -7.671  7.193   1.00 22.67 ? 288  LEU A CD2 1 
ATOM   2126  N N   . ASP A 1 263 ? 40.415  -4.761  3.243   1.00 24.03 ? 289  ASP A N   1 
ATOM   2127  C CA  . ASP A 1 263 ? 39.562  -4.256  2.174   1.00 26.21 ? 289  ASP A CA  1 
ATOM   2128  C C   . ASP A 1 263 ? 38.596  -5.300  1.624   1.00 30.00 ? 289  ASP A C   1 
ATOM   2129  O O   . ASP A 1 263 ? 38.900  -6.494  1.604   1.00 29.89 ? 289  ASP A O   1 
ATOM   2130  C CB  . ASP A 1 263 ? 40.427  -3.687  1.047   1.00 24.53 ? 289  ASP A CB  1 
ATOM   2131  C CG  . ASP A 1 263 ? 40.996  -2.315  1.382   1.00 23.00 ? 289  ASP A CG  1 
ATOM   2132  O OD1 . ASP A 1 263 ? 40.904  -1.896  2.558   1.00 23.03 ? 289  ASP A OD1 1 
ATOM   2133  O OD2 . ASP A 1 263 ? 41.541  -1.655  0.471   1.00 20.81 ? 289  ASP A OD2 1 
ATOM   2134  N N   . LYS A 1 264 ? 37.423  -4.837  1.197   1.00 32.71 ? 290  LYS A N   1 
ATOM   2135  C CA  . LYS A 1 264 ? 36.393  -5.713  0.648   1.00 36.27 ? 290  LYS A CA  1 
ATOM   2136  C C   . LYS A 1 264 ? 36.642  -5.921  -0.838  1.00 37.50 ? 290  LYS A C   1 
ATOM   2137  O O   . LYS A 1 264 ? 37.500  -5.264  -1.427  1.00 37.41 ? 290  LYS A O   1 
ATOM   2138  C CB  . LYS A 1 264 ? 35.005  -5.097  0.854   1.00 36.40 ? 290  LYS A CB  1 
ATOM   2139  C CG  . LYS A 1 264 ? 34.822  -3.750  0.167   1.00 37.92 ? 290  LYS A CG  1 
ATOM   2140  C CD  . LYS A 1 264 ? 33.367  -3.299  0.169   1.00 40.02 ? 290  LYS A CD  1 
ATOM   2141  C CE  . LYS A 1 264 ? 32.880  -2.898  1.556   1.00 41.40 ? 290  LYS A CE  1 
ATOM   2142  N NZ  . LYS A 1 264 ? 33.486  -1.629  2.049   1.00 40.56 ? 290  LYS A NZ  1 
ATOM   2143  N N   . GLN A 1 265 ? 35.887  -6.838  -1.440  1.00 39.64 ? 291  GLN A N   1 
ATOM   2144  C CA  . GLN A 1 265 ? 36.024  -7.133  -2.860  1.00 40.69 ? 291  GLN A CA  1 
ATOM   2145  C C   . GLN A 1 265 ? 35.602  -5.937  -3.693  1.00 40.96 ? 291  GLN A C   1 
ATOM   2146  O O   . GLN A 1 265 ? 34.627  -5.259  -3.368  1.00 39.43 ? 291  GLN A O   1 
ATOM   2147  C CB  . GLN A 1 265 ? 35.161  -8.335  -3.244  1.00 42.68 ? 291  GLN A CB  1 
ATOM   2148  C CG  . GLN A 1 265 ? 35.250  -8.713  -4.720  1.00 43.94 ? 291  GLN A CG  1 
ATOM   2149  C CD  . GLN A 1 265 ? 34.275  -9.813  -5.091  1.00 45.81 ? 291  GLN A CD  1 
ATOM   2150  O OE1 . GLN A 1 265 ? 33.068  -9.674  -4.902  1.00 46.14 ? 291  GLN A OE1 1 
ATOM   2151  N NE2 . GLN A 1 265 ? 34.796  -10.911 -5.626  1.00 46.28 ? 291  GLN A NE2 1 
ATOM   2152  N N   . VAL A 1 266 ? 36.340  -5.690  -4.772  1.00 41.57 ? 292  VAL A N   1 
ATOM   2153  C CA  . VAL A 1 266 ? 36.048  -4.582  -5.671  1.00 43.02 ? 292  VAL A CA  1 
ATOM   2154  C C   . VAL A 1 266 ? 35.692  -5.086  -7.071  1.00 44.52 ? 292  VAL A C   1 
ATOM   2155  O O   . VAL A 1 266 ? 36.133  -6.161  -7.484  1.00 43.57 ? 292  VAL A O   1 
ATOM   2156  C CB  . VAL A 1 266 ? 37.250  -3.612  -5.770  1.00 42.30 ? 292  VAL A CB  1 
ATOM   2157  C CG1 . VAL A 1 266 ? 37.358  -2.795  -4.496  1.00 43.02 ? 292  VAL A CG1 1 
ATOM   2158  C CG2 . VAL A 1 266 ? 38.537  -4.388  -5.998  1.00 40.98 ? 292  VAL A CG2 1 
ATOM   2159  N N   . PRO A 1 267 ? 34.881  -4.312  -7.814  1.00 45.80 ? 293  PRO A N   1 
ATOM   2160  C CA  . PRO A 1 267 ? 34.449  -4.659  -9.172  1.00 46.60 ? 293  PRO A CA  1 
ATOM   2161  C C   . PRO A 1 267 ? 35.616  -5.004  -10.090 1.00 47.37 ? 293  PRO A C   1 
ATOM   2162  O O   . PRO A 1 267 ? 36.519  -4.197  -10.299 1.00 47.18 ? 293  PRO A O   1 
ATOM   2163  C CB  . PRO A 1 267 ? 33.709  -3.403  -9.627  1.00 46.98 ? 293  PRO A CB  1 
ATOM   2164  C CG  . PRO A 1 267 ? 33.112  -2.901  -8.354  1.00 46.70 ? 293  PRO A CG  1 
ATOM   2165  C CD  . PRO A 1 267 ? 34.268  -3.042  -7.386  1.00 46.71 ? 293  PRO A CD  1 
ATOM   2166  N N   . ARG A 1 268 ? 35.587  -6.216  -10.631 1.00 47.89 ? 294  ARG A N   1 
ATOM   2167  C CA  . ARG A 1 268 ? 36.634  -6.674  -11.530 1.00 48.23 ? 294  ARG A CA  1 
ATOM   2168  C C   . ARG A 1 268 ? 36.789  -5.667  -12.660 1.00 47.20 ? 294  ARG A C   1 
ATOM   2169  O O   . ARG A 1 268 ? 35.799  -5.166  -13.191 1.00 47.92 ? 294  ARG A O   1 
ATOM   2170  C CB  . ARG A 1 268 ? 36.273  -8.056  -12.091 1.00 50.47 ? 294  ARG A CB  1 
ATOM   2171  C CG  . ARG A 1 268 ? 37.372  -8.705  -12.918 1.00 53.37 ? 294  ARG A CG  1 
ATOM   2172  C CD  . ARG A 1 268 ? 37.016  -10.144 -13.287 1.00 56.41 ? 294  ARG A CD  1 
ATOM   2173  N NE  . ARG A 1 268 ? 38.075  -10.803 -14.049 1.00 58.74 ? 294  ARG A NE  1 
ATOM   2174  C CZ  . ARG A 1 268 ? 39.296  -11.052 -13.580 1.00 60.19 ? 294  ARG A CZ  1 
ATOM   2175  N NH1 . ARG A 1 268 ? 39.623  -10.703 -12.342 1.00 60.48 ? 294  ARG A NH1 1 
ATOM   2176  N NH2 . ARG A 1 268 ? 40.195  -11.651 -14.351 1.00 60.63 ? 294  ARG A NH2 1 
ATOM   2177  N N   . VAL A 1 269 ? 38.032  -5.367  -13.021 1.00 45.57 ? 295  VAL A N   1 
ATOM   2178  C CA  . VAL A 1 269 ? 38.292  -4.412  -14.089 1.00 44.29 ? 295  VAL A CA  1 
ATOM   2179  C C   . VAL A 1 269 ? 39.188  -5.001  -15.171 1.00 44.21 ? 295  VAL A C   1 
ATOM   2180  O O   . VAL A 1 269 ? 39.708  -6.110  -15.031 1.00 43.45 ? 295  VAL A O   1 
ATOM   2181  C CB  . VAL A 1 269 ? 38.957  -3.122  -13.541 1.00 43.77 ? 295  VAL A CB  1 
ATOM   2182  C CG1 . VAL A 1 269 ? 38.037  -2.446  -12.538 1.00 42.22 ? 295  VAL A CG1 1 
ATOM   2183  C CG2 . VAL A 1 269 ? 40.289  -3.458  -12.890 1.00 43.24 ? 295  VAL A CG2 1 
ATOM   2184  N N   . SER A 1 270 ? 39.363  -4.249  -16.252 1.00 44.60 ? 296  SER A N   1 
ATOM   2185  C CA  . SER A 1 270 ? 40.203  -4.687  -17.357 1.00 45.85 ? 296  SER A CA  1 
ATOM   2186  C C   . SER A 1 270 ? 41.619  -4.985  -16.874 1.00 45.94 ? 296  SER A C   1 
ATOM   2187  O O   . SER A 1 270 ? 42.073  -4.423  -15.876 1.00 44.84 ? 296  SER A O   1 
ATOM   2188  C CB  . SER A 1 270 ? 40.251  -3.614  -18.438 1.00 45.84 ? 296  SER A CB  1 
ATOM   2189  O OG  . SER A 1 270 ? 41.030  -4.060  -19.529 1.00 49.36 ? 296  SER A OG  1 
ATOM   2190  N N   . ASP A 1 271 ? 42.319  -5.855  -17.592 1.00 46.43 ? 297  ASP A N   1 
ATOM   2191  C CA  . ASP A 1 271 ? 43.678  -6.230  -17.216 1.00 47.19 ? 297  ASP A CA  1 
ATOM   2192  C C   . ASP A 1 271 ? 44.722  -5.164  -17.537 1.00 45.74 ? 297  ASP A C   1 
ATOM   2193  O O   . ASP A 1 271 ? 45.825  -5.193  -16.991 1.00 46.49 ? 297  ASP A O   1 
ATOM   2194  C CB  . ASP A 1 271 ? 44.069  -7.545  -17.895 1.00 50.28 ? 297  ASP A CB  1 
ATOM   2195  C CG  . ASP A 1 271 ? 43.130  -8.681  -17.543 1.00 53.51 ? 297  ASP A CG  1 
ATOM   2196  O OD1 . ASP A 1 271 ? 41.921  -8.569  -17.843 1.00 54.98 ? 297  ASP A OD1 1 
ATOM   2197  O OD2 . ASP A 1 271 ? 43.597  -9.686  -16.965 1.00 54.92 ? 297  ASP A OD2 1 
ATOM   2198  N N   . ASP A 1 272 ? 44.379  -4.223  -18.411 1.00 43.79 ? 298  ASP A N   1 
ATOM   2199  C CA  . ASP A 1 272 ? 45.313  -3.163  -18.782 1.00 42.64 ? 298  ASP A CA  1 
ATOM   2200  C C   . ASP A 1 272 ? 45.229  -1.976  -17.819 1.00 40.15 ? 298  ASP A C   1 
ATOM   2201  O O   . ASP A 1 272 ? 46.023  -1.038  -17.904 1.00 40.14 ? 298  ASP A O   1 
ATOM   2202  C CB  . ASP A 1 272 ? 45.042  -2.682  -20.212 1.00 44.32 ? 298  ASP A CB  1 
ATOM   2203  C CG  . ASP A 1 272 ? 43.723  -1.945  -20.339 1.00 47.41 ? 298  ASP A CG  1 
ATOM   2204  O OD1 . ASP A 1 272 ? 43.540  -1.210  -21.334 1.00 48.91 ? 298  ASP A OD1 1 
ATOM   2205  O OD2 . ASP A 1 272 ? 42.861  -2.105  -19.449 1.00 49.38 ? 298  ASP A OD2 1 
ATOM   2206  N N   . VAL A 1 273 ? 44.268  -2.017  -16.908 1.00 36.80 ? 299  VAL A N   1 
ATOM   2207  C CA  . VAL A 1 273 ? 44.103  -0.942  -15.940 1.00 34.62 ? 299  VAL A CA  1 
ATOM   2208  C C   . VAL A 1 273 ? 44.077  -1.499  -14.528 1.00 31.48 ? 299  VAL A C   1 
ATOM   2209  O O   . VAL A 1 273 ? 43.935  -0.749  -13.562 1.00 31.12 ? 299  VAL A O   1 
ATOM   2210  C CB  . VAL A 1 273 ? 42.794  -0.175  -16.182 1.00 35.91 ? 299  VAL A CB  1 
ATOM   2211  C CG1 . VAL A 1 273 ? 42.823  0.482   -17.548 1.00 38.21 ? 299  VAL A CG1 1 
ATOM   2212  C CG2 . VAL A 1 273 ? 41.607  -1.119  -16.072 1.00 36.64 ? 299  VAL A CG2 1 
ATOM   2213  N N   . TYR A 1 274 ? 44.221  -2.815  -14.416 1.00 27.99 ? 300  TYR A N   1 
ATOM   2214  C CA  . TYR A 1 274 ? 44.189  -3.487  -13.121 1.00 25.94 ? 300  TYR A CA  1 
ATOM   2215  C C   . TYR A 1 274 ? 45.236  -2.959  -12.147 1.00 25.14 ? 300  TYR A C   1 
ATOM   2216  O O   . TYR A 1 274 ? 44.907  -2.571  -11.025 1.00 24.12 ? 300  TYR A O   1 
ATOM   2217  C CB  . TYR A 1 274 ? 44.389  -4.994  -13.291 1.00 23.43 ? 300  TYR A CB  1 
ATOM   2218  C CG  . TYR A 1 274 ? 44.486  -5.737  -11.979 1.00 23.87 ? 300  TYR A CG  1 
ATOM   2219  C CD1 . TYR A 1 274 ? 43.388  -5.832  -11.123 1.00 23.20 ? 300  TYR A CD1 1 
ATOM   2220  C CD2 . TYR A 1 274 ? 45.681  -6.338  -11.586 1.00 22.71 ? 300  TYR A CD2 1 
ATOM   2221  C CE1 . TYR A 1 274 ? 43.479  -6.511  -9.908  1.00 22.78 ? 300  TYR A CE1 1 
ATOM   2222  C CE2 . TYR A 1 274 ? 45.783  -7.012  -10.377 1.00 22.92 ? 300  TYR A CE2 1 
ATOM   2223  C CZ  . TYR A 1 274 ? 44.679  -7.098  -9.546  1.00 22.16 ? 300  TYR A CZ  1 
ATOM   2224  O OH  . TYR A 1 274 ? 44.773  -7.792  -8.365  1.00 24.02 ? 300  TYR A OH  1 
ATOM   2225  N N   . ARG A 1 275 ? 46.492  -2.942  -12.572 1.00 24.55 ? 301  ARG A N   1 
ATOM   2226  C CA  . ARG A 1 275 ? 47.552  -2.466  -11.703 1.00 25.24 ? 301  ARG A CA  1 
ATOM   2227  C C   . ARG A 1 275 ? 47.354  -1.001  -11.298 1.00 23.17 ? 301  ARG A C   1 
ATOM   2228  O O   . ARG A 1 275 ? 47.671  -0.628  -10.173 1.00 23.77 ? 301  ARG A O   1 
ATOM   2229  C CB  . ARG A 1 275 ? 48.913  -2.662  -12.375 1.00 27.51 ? 301  ARG A CB  1 
ATOM   2230  C CG  . ARG A 1 275 ? 50.080  -2.480  -11.413 1.00 32.13 ? 301  ARG A CG  1 
ATOM   2231  C CD  . ARG A 1 275 ? 51.403  -2.842  -12.071 1.00 34.13 ? 301  ARG A CD  1 
ATOM   2232  N NE  . ARG A 1 275 ? 52.545  -2.688  -11.169 1.00 34.90 ? 301  ARG A NE  1 
ATOM   2233  C CZ  . ARG A 1 275 ? 52.755  -3.424  -10.081 1.00 36.51 ? 301  ARG A CZ  1 
ATOM   2234  N NH1 . ARG A 1 275 ? 51.895  -4.377  -9.740  1.00 38.34 ? 301  ARG A NH1 1 
ATOM   2235  N NH2 . ARG A 1 275 ? 53.837  -3.220  -9.339  1.00 37.19 ? 301  ARG A NH2 1 
ATOM   2236  N N   . ASN A 1 276 ? 46.830  -0.181  -12.207 1.00 20.85 ? 302  ASN A N   1 
ATOM   2237  C CA  . ASN A 1 276 ? 46.584  1.226   -11.911 1.00 19.43 ? 302  ASN A CA  1 
ATOM   2238  C C   . ASN A 1 276 ? 45.485  1.359   -10.845 1.00 21.25 ? 302  ASN A C   1 
ATOM   2239  O O   . ASN A 1 276 ? 45.528  2.253   -9.988  1.00 19.69 ? 302  ASN A O   1 
ATOM   2240  C CB  . ASN A 1 276 ? 46.183  1.983   -13.186 1.00 17.23 ? 302  ASN A CB  1 
ATOM   2241  C CG  . ASN A 1 276 ? 47.276  1.963   -14.252 1.00 17.74 ? 302  ASN A CG  1 
ATOM   2242  O OD1 . ASN A 1 276 ? 48.460  1.871   -13.941 1.00 15.43 ? 302  ASN A OD1 1 
ATOM   2243  N ND2 . ASN A 1 276 ? 46.876  2.059   -15.518 1.00 17.91 ? 302  ASN A ND2 1 
ATOM   2244  N N   . HIS A 1 277 ? 44.507  0.459   -10.894 1.00 21.72 ? 303  HIS A N   1 
ATOM   2245  C CA  . HIS A 1 277 ? 43.422  0.467   -9.918  1.00 21.85 ? 303  HIS A CA  1 
ATOM   2246  C C   . HIS A 1 277 ? 43.893  -0.019  -8.557  1.00 21.71 ? 303  HIS A C   1 
ATOM   2247  O O   . HIS A 1 277 ? 43.392  0.429   -7.532  1.00 22.04 ? 303  HIS A O   1 
ATOM   2248  C CB  . HIS A 1 277 ? 42.254  -0.384  -10.410 1.00 24.91 ? 303  HIS A CB  1 
ATOM   2249  C CG  . HIS A 1 277 ? 41.327  0.347   -11.331 1.00 27.63 ? 303  HIS A CG  1 
ATOM   2250  N ND1 . HIS A 1 277 ? 41.733  0.844   -12.551 1.00 29.35 ? 303  HIS A ND1 1 
ATOM   2251  C CD2 . HIS A 1 277 ? 40.024  0.692   -11.199 1.00 29.71 ? 303  HIS A CD2 1 
ATOM   2252  C CE1 . HIS A 1 277 ? 40.720  1.467   -13.131 1.00 28.66 ? 303  HIS A CE1 1 
ATOM   2253  N NE2 . HIS A 1 277 ? 39.671  1.388   -12.331 1.00 30.33 ? 303  HIS A NE2 1 
ATOM   2254  N N   . VAL A 1 278 ? 44.859  -0.933  -8.540  1.00 20.27 ? 304  VAL A N   1 
ATOM   2255  C CA  . VAL A 1 278 ? 45.390  -1.425  -7.273  1.00 19.80 ? 304  VAL A CA  1 
ATOM   2256  C C   . VAL A 1 278 ? 46.255  -0.320  -6.641  1.00 18.66 ? 304  VAL A C   1 
ATOM   2257  O O   . VAL A 1 278 ? 46.299  -0.171  -5.423  1.00 18.38 ? 304  VAL A O   1 
ATOM   2258  C CB  . VAL A 1 278 ? 46.242  -2.694  -7.479  1.00 20.97 ? 304  VAL A CB  1 
ATOM   2259  C CG1 . VAL A 1 278 ? 46.814  -3.150  -6.150  1.00 21.20 ? 304  VAL A CG1 1 
ATOM   2260  C CG2 . VAL A 1 278 ? 45.393  -3.801  -8.100  1.00 21.57 ? 304  VAL A CG2 1 
ATOM   2261  N N   . ALA A 1 279 ? 46.930  0.455   -7.475  1.00 17.94 ? 305  ALA A N   1 
ATOM   2262  C CA  . ALA A 1 279 ? 47.755  1.560   -6.987  1.00 18.81 ? 305  ALA A CA  1 
ATOM   2263  C C   . ALA A 1 279 ? 46.852  2.615   -6.352  1.00 19.18 ? 305  ALA A C   1 
ATOM   2264  O O   . ALA A 1 279 ? 47.186  3.190   -5.312  1.00 18.88 ? 305  ALA A O   1 
ATOM   2265  C CB  . ALA A 1 279 ? 48.548  2.166   -8.130  1.00 18.20 ? 305  ALA A CB  1 
ATOM   2266  N N   . GLY A 1 280 ? 45.705  2.859   -6.987  1.00 18.46 ? 306  GLY A N   1 
ATOM   2267  C CA  . GLY A 1 280 ? 44.747  3.824   -6.472  1.00 17.04 ? 306  GLY A CA  1 
ATOM   2268  C C   . GLY A 1 280 ? 44.154  3.326   -5.166  1.00 17.68 ? 306  GLY A C   1 
ATOM   2269  O O   . GLY A 1 280 ? 43.932  4.101   -4.233  1.00 16.45 ? 306  GLY A O   1 
ATOM   2270  N N   . GLN A 1 281 ? 43.898  2.028   -5.087  1.00 16.61 ? 307  GLN A N   1 
ATOM   2271  C CA  . GLN A 1 281 ? 43.353  1.455   -3.869  1.00 17.70 ? 307  GLN A CA  1 
ATOM   2272  C C   . GLN A 1 281 ? 44.304  1.687   -2.692  1.00 17.20 ? 307  GLN A C   1 
ATOM   2273  O O   . GLN A 1 281 ? 43.867  1.953   -1.572  1.00 14.47 ? 307  GLN A O   1 
ATOM   2274  C CB  . GLN A 1 281 ? 43.139  -0.049  -4.049  1.00 19.67 ? 307  GLN A CB  1 
ATOM   2275  C CG  . GLN A 1 281 ? 42.635  -0.765  -2.806  1.00 22.58 ? 307  GLN A CG  1 
ATOM   2276  C CD  . GLN A 1 281 ? 42.304  -2.225  -3.070  1.00 26.44 ? 307  GLN A CD  1 
ATOM   2277  O OE1 . GLN A 1 281 ? 41.887  -2.950  -2.170  1.00 27.56 ? 307  GLN A OE1 1 
ATOM   2278  N NE2 . GLN A 1 281 ? 42.492  -2.660  -4.312  1.00 26.80 ? 307  GLN A NE2 1 
ATOM   2279  N N   . MET A 1 282 ? 45.605  1.581   -2.951  1.00 15.93 ? 308  MET A N   1 
ATOM   2280  C CA  . MET A 1 282 ? 46.601  1.755   -1.900  1.00 17.37 ? 308  MET A CA  1 
ATOM   2281  C C   . MET A 1 282 ? 46.868  3.216   -1.584  1.00 17.05 ? 308  MET A C   1 
ATOM   2282  O O   . MET A 1 282 ? 47.214  3.559   -0.452  1.00 18.42 ? 308  MET A O   1 
ATOM   2283  C CB  . MET A 1 282 ? 47.906  1.078   -2.301  1.00 17.70 ? 308  MET A CB  1 
ATOM   2284  C CG  . MET A 1 282 ? 47.738  -0.388  -2.630  1.00 16.44 ? 308  MET A CG  1 
ATOM   2285  S SD  . MET A 1 282 ? 46.981  -1.317  -1.290  1.00 19.38 ? 308  MET A SD  1 
ATOM   2286  C CE  . MET A 1 282 ? 46.583  -2.888  -2.155  1.00 16.69 ? 308  MET A CE  1 
ATOM   2287  N N   . LEU A 1 283 ? 46.692  4.073   -2.581  1.00 15.28 ? 309  LEU A N   1 
ATOM   2288  C CA  . LEU A 1 283 ? 46.922  5.501   -2.405  1.00 15.64 ? 309  LEU A CA  1 
ATOM   2289  C C   . LEU A 1 283 ? 45.745  6.245   -1.764  1.00 16.92 ? 309  LEU A C   1 
ATOM   2290  O O   . LEU A 1 283 ? 45.947  7.020   -0.823  1.00 15.90 ? 309  LEU A O   1 
ATOM   2291  C CB  . LEU A 1 283 ? 47.271  6.152   -3.752  1.00 13.68 ? 309  LEU A CB  1 
ATOM   2292  C CG  . LEU A 1 283 ? 47.725  7.619   -3.713  1.00 13.17 ? 309  LEU A CG  1 
ATOM   2293  C CD1 . LEU A 1 283 ? 48.963  7.739   -2.838  1.00 12.45 ? 309  LEU A CD1 1 
ATOM   2294  C CD2 . LEU A 1 283 ? 48.027  8.127   -5.119  1.00 11.79 ? 309  LEU A CD2 1 
ATOM   2295  N N   . HIS A 1 284 ? 44.523  6.008   -2.261  1.00 16.48 ? 310  HIS A N   1 
ATOM   2296  C CA  . HIS A 1 284 ? 43.330  6.689   -1.752  1.00 16.88 ? 310  HIS A CA  1 
ATOM   2297  C C   . HIS A 1 284 ? 42.154  5.794   -1.374  1.00 19.59 ? 310  HIS A C   1 
ATOM   2298  O O   . HIS A 1 284 ? 41.190  6.247   -0.748  1.00 18.48 ? 310  HIS A O   1 
ATOM   2299  C CB  . HIS A 1 284 ? 42.840  7.719   -2.774  1.00 19.10 ? 310  HIS A CB  1 
ATOM   2300  C CG  . HIS A 1 284 ? 42.681  7.167   -4.161  1.00 18.84 ? 310  HIS A CG  1 
ATOM   2301  N ND1 . HIS A 1 284 ? 43.514  7.523   -5.199  1.00 20.41 ? 310  HIS A ND1 1 
ATOM   2302  C CD2 . HIS A 1 284 ? 41.787  6.293   -4.678  1.00 17.87 ? 310  HIS A CD2 1 
ATOM   2303  C CE1 . HIS A 1 284 ? 43.139  6.896   -6.298  1.00 18.28 ? 310  HIS A CE1 1 
ATOM   2304  N NE2 . HIS A 1 284 ? 42.093  6.140   -6.010  1.00 19.51 ? 310  HIS A NE2 1 
ATOM   2305  N N   . GLY A 1 285 ? 42.206  4.523   -1.775  1.00 19.72 ? 311  GLY A N   1 
ATOM   2306  C CA  . GLY A 1 285 ? 41.129  3.625   -1.421  1.00 20.88 ? 311  GLY A CA  1 
ATOM   2307  C C   . GLY A 1 285 ? 40.122  3.332   -2.518  1.00 22.97 ? 311  GLY A C   1 
ATOM   2308  O O   . GLY A 1 285 ? 39.271  2.463   -2.350  1.00 21.89 ? 311  GLY A O   1 
ATOM   2309  N N   . GLY A 1 286 ? 40.208  4.050   -3.631  1.00 23.89 ? 312  GLY A N   1 
ATOM   2310  C CA  . GLY A 1 286 ? 39.284  3.807   -4.725  1.00 25.25 ? 312  GLY A CA  1 
ATOM   2311  C C   . GLY A 1 286 ? 38.051  4.689   -4.726  1.00 25.19 ? 312  GLY A C   1 
ATOM   2312  O O   . GLY A 1 286 ? 37.539  5.032   -5.784  1.00 27.57 ? 312  GLY A O   1 
ATOM   2313  N N   . GLY A 1 287 ? 37.561  5.052   -3.550  1.00 25.41 ? 313  GLY A N   1 
ATOM   2314  C CA  . GLY A 1 287 ? 36.377  5.892   -3.486  1.00 24.70 ? 313  GLY A CA  1 
ATOM   2315  C C   . GLY A 1 287 ? 35.533  5.570   -2.274  1.00 25.62 ? 313  GLY A C   1 
ATOM   2316  O O   . GLY A 1 287 ? 35.773  4.567   -1.609  1.00 24.83 ? 313  GLY A O   1 
ATOM   2317  N N   . SER A 1 288 ? 34.545  6.414   -1.983  1.00 26.99 ? 314  SER A N   1 
ATOM   2318  C CA  . SER A 1 288 ? 33.675  6.211   -0.826  1.00 29.44 ? 314  SER A CA  1 
ATOM   2319  C C   . SER A 1 288 ? 32.843  4.940   -0.942  1.00 30.74 ? 314  SER A C   1 
ATOM   2320  O O   . SER A 1 288 ? 32.392  4.381   0.057   1.00 31.37 ? 314  SER A O   1 
ATOM   2321  C CB  . SER A 1 288 ? 32.733  7.401   -0.659  1.00 30.59 ? 314  SER A CB  1 
ATOM   2322  O OG  . SER A 1 288 ? 31.756  7.417   -1.682  1.00 30.81 ? 314  SER A OG  1 
ATOM   2323  N N   . LYS A 1 289 ? 32.629  4.482   -2.170  1.00 31.56 ? 315  LYS A N   1 
ATOM   2324  C CA  . LYS A 1 289 ? 31.847  3.276   -2.377  1.00 33.22 ? 315  LYS A CA  1 
ATOM   2325  C C   . LYS A 1 289 ? 32.706  2.020   -2.353  1.00 33.06 ? 315  LYS A C   1 
ATOM   2326  O O   . LYS A 1 289 ? 32.185  0.906   -2.413  1.00 33.08 ? 315  LYS A O   1 
ATOM   2327  C CB  . LYS A 1 289 ? 31.086  3.363   -3.702  1.00 34.90 ? 315  LYS A CB  1 
ATOM   2328  C CG  . LYS A 1 289 ? 29.885  4.294   -3.663  1.00 37.74 ? 315  LYS A CG  1 
ATOM   2329  C CD  . LYS A 1 289 ? 29.109  4.208   -4.966  1.00 40.59 ? 315  LYS A CD  1 
ATOM   2330  C CE  . LYS A 1 289 ? 27.843  5.044   -4.927  1.00 42.69 ? 315  LYS A CE  1 
ATOM   2331  N NZ  . LYS A 1 289 ? 27.073  4.911   -6.196  1.00 45.55 ? 315  LYS A NZ  1 
ATOM   2332  N N   . PHE A 1 290 ? 34.021  2.197   -2.244  1.00 31.15 ? 316  PHE A N   1 
ATOM   2333  C CA  . PHE A 1 290 ? 34.925  1.060   -2.232  1.00 30.32 ? 316  PHE A CA  1 
ATOM   2334  C C   . PHE A 1 290 ? 35.644  0.839   -0.910  1.00 28.96 ? 316  PHE A C   1 
ATOM   2335  O O   . PHE A 1 290 ? 35.076  0.273   0.024   1.00 29.82 ? 316  PHE A O   1 
ATOM   2336  C CB  . PHE A 1 290 ? 35.937  1.204   -3.365  1.00 31.71 ? 316  PHE A CB  1 
ATOM   2337  C CG  . PHE A 1 290 ? 35.310  1.335   -4.722  1.00 33.91 ? 316  PHE A CG  1 
ATOM   2338  C CD1 . PHE A 1 290 ? 35.366  2.540   -5.418  1.00 34.96 ? 316  PHE A CD1 1 
ATOM   2339  C CD2 . PHE A 1 290 ? 34.658  0.252   -5.306  1.00 36.07 ? 316  PHE A CD2 1 
ATOM   2340  C CE1 . PHE A 1 290 ? 34.782  2.664   -6.680  1.00 34.94 ? 316  PHE A CE1 1 
ATOM   2341  C CE2 . PHE A 1 290 ? 34.070  0.366   -6.569  1.00 35.86 ? 316  PHE A CE2 1 
ATOM   2342  C CZ  . PHE A 1 290 ? 34.135  1.576   -7.255  1.00 35.44 ? 316  PHE A CZ  1 
ATOM   2343  N N   . ASN A 1 291 ? 36.895  1.284   -0.818  1.00 26.00 ? 317  ASN A N   1 
ATOM   2344  C CA  . ASN A 1 291 ? 37.645  1.087   0.410   1.00 23.47 ? 317  ASN A CA  1 
ATOM   2345  C C   . ASN A 1 291 ? 38.220  2.376   1.010   1.00 22.31 ? 317  ASN A C   1 
ATOM   2346  O O   . ASN A 1 291 ? 38.994  2.320   1.961   1.00 21.83 ? 317  ASN A O   1 
ATOM   2347  C CB  . ASN A 1 291 ? 38.767  0.064   0.167   1.00 22.58 ? 317  ASN A CB  1 
ATOM   2348  C CG  . ASN A 1 291 ? 38.236  -1.362  -0.036  1.00 23.88 ? 317  ASN A CG  1 
ATOM   2349  O OD1 . ASN A 1 291 ? 37.740  -1.993  0.898   1.00 24.87 ? 317  ASN A OD1 1 
ATOM   2350  N ND2 . ASN A 1 291 ? 38.340  -1.868  -1.262  1.00 19.43 ? 317  ASN A ND2 1 
ATOM   2351  N N   . SER A 1 292 ? 37.835  3.534   0.477   1.00 20.32 ? 318  SER A N   1 
ATOM   2352  C CA  . SER A 1 292 ? 38.342  4.801   1.005   1.00 19.09 ? 318  SER A CA  1 
ATOM   2353  C C   . SER A 1 292 ? 37.868  5.070   2.433   1.00 19.20 ? 318  SER A C   1 
ATOM   2354  O O   . SER A 1 292 ? 38.549  5.748   3.200   1.00 17.45 ? 318  SER A O   1 
ATOM   2355  C CB  . SER A 1 292 ? 37.932  5.964   0.100   1.00 18.47 ? 318  SER A CB  1 
ATOM   2356  O OG  . SER A 1 292 ? 38.669  5.947   -1.111  1.00 18.27 ? 318  SER A OG  1 
ATOM   2357  N N   . GLY A 1 293 ? 36.698  4.538   2.779   1.00 18.85 ? 319  GLY A N   1 
ATOM   2358  C CA  . GLY A 1 293 ? 36.160  4.722   4.114   1.00 18.58 ? 319  GLY A CA  1 
ATOM   2359  C C   . GLY A 1 293 ? 36.714  3.696   5.087   1.00 20.53 ? 319  GLY A C   1 
ATOM   2360  O O   . GLY A 1 293 ? 36.482  3.787   6.297   1.00 19.68 ? 319  GLY A O   1 
ATOM   2361  N N   . ASN A 1 294 ? 37.447  2.713   4.556   1.00 19.22 ? 320  ASN A N   1 
ATOM   2362  C CA  . ASN A 1 294 ? 38.038  1.653   5.373   1.00 18.18 ? 320  ASN A CA  1 
ATOM   2363  C C   . ASN A 1 294 ? 39.479  2.044   5.713   1.00 18.60 ? 320  ASN A C   1 
ATOM   2364  O O   . ASN A 1 294 ? 40.411  1.244   5.569   1.00 15.43 ? 320  ASN A O   1 
ATOM   2365  C CB  . ASN A 1 294 ? 38.027  0.326   4.591   1.00 18.55 ? 320  ASN A CB  1 
ATOM   2366  C CG  . ASN A 1 294 ? 38.127  -0.896  5.494   1.00 17.59 ? 320  ASN A CG  1 
ATOM   2367  O OD1 . ASN A 1 294 ? 37.352  -1.049  6.441   1.00 21.53 ? 320  ASN A OD1 1 
ATOM   2368  N ND2 . ASN A 1 294 ? 39.079  -1.781  5.200   1.00 17.94 ? 320  ASN A ND2 1 
ATOM   2369  N N   . ARG A 1 295 ? 39.660  3.280   6.179   1.00 17.68 ? 321  ARG A N   1 
ATOM   2370  C CA  . ARG A 1 295 ? 40.992  3.756   6.507   1.00 17.32 ? 321  ARG A CA  1 
ATOM   2371  C C   . ARG A 1 295 ? 40.969  4.921   7.501   1.00 17.15 ? 321  ARG A C   1 
ATOM   2372  O O   . ARG A 1 295 ? 39.912  5.420   7.891   1.00 17.58 ? 321  ARG A O   1 
ATOM   2373  C CB  . ARG A 1 295 ? 41.709  4.236   5.236   1.00 15.93 ? 321  ARG A CB  1 
ATOM   2374  C CG  . ARG A 1 295 ? 41.738  3.267   4.047   1.00 18.05 ? 321  ARG A CG  1 
ATOM   2375  C CD  . ARG A 1 295 ? 43.145  3.096   3.489   1.00 14.56 ? 321  ARG A CD  1 
ATOM   2376  N NE  . ARG A 1 295 ? 43.147  2.407   2.204   1.00 17.49 ? 321  ARG A NE  1 
ATOM   2377  C CZ  . ARG A 1 295 ? 42.603  1.206   1.988   1.00 14.61 ? 321  ARG A CZ  1 
ATOM   2378  N NH1 . ARG A 1 295 ? 42.011  0.550   2.974   1.00 9.98  ? 321  ARG A NH1 1 
ATOM   2379  N NH2 . ARG A 1 295 ? 42.655  0.677   0.779   1.00 13.41 ? 321  ARG A NH2 1 
ATOM   2380  N N   . TRP A 1 296 ? 42.156  5.336   7.914   1.00 14.59 ? 322  TRP A N   1 
ATOM   2381  C CA  . TRP A 1 296 ? 42.317  6.468   8.820   1.00 13.36 ? 322  TRP A CA  1 
ATOM   2382  C C   . TRP A 1 296 ? 43.653  7.052   8.391   1.00 11.79 ? 322  TRP A C   1 
ATOM   2383  O O   . TRP A 1 296 ? 44.709  6.650   8.876   1.00 10.56 ? 322  TRP A O   1 
ATOM   2384  C CB  . TRP A 1 296 ? 42.343  5.998   10.276  1.00 14.26 ? 322  TRP A CB  1 
ATOM   2385  C CG  . TRP A 1 296 ? 42.249  7.124   11.244  1.00 14.18 ? 322  TRP A CG  1 
ATOM   2386  C CD1 . TRP A 1 296 ? 43.278  7.864   11.749  1.00 13.89 ? 322  TRP A CD1 1 
ATOM   2387  C CD2 . TRP A 1 296 ? 41.049  7.693   11.779  1.00 14.97 ? 322  TRP A CD2 1 
ATOM   2388  N NE1 . TRP A 1 296 ? 42.796  8.862   12.565  1.00 15.62 ? 322  TRP A NE1 1 
ATOM   2389  C CE2 . TRP A 1 296 ? 41.428  8.778   12.598  1.00 15.80 ? 322  TRP A CE2 1 
ATOM   2390  C CE3 . TRP A 1 296 ? 39.689  7.387   11.640  1.00 14.09 ? 322  TRP A CE3 1 
ATOM   2391  C CZ2 . TRP A 1 296 ? 40.491  9.564   13.277  1.00 16.30 ? 322  TRP A CZ2 1 
ATOM   2392  C CZ3 . TRP A 1 296 ? 38.760  8.169   12.316  1.00 14.69 ? 322  TRP A CZ3 1 
ATOM   2393  C CH2 . TRP A 1 296 ? 39.164  9.244   13.122  1.00 14.37 ? 322  TRP A CH2 1 
ATOM   2394  N N   . PHE A 1 297 ? 43.594  7.989   7.447   1.00 11.52 ? 323  PHE A N   1 
ATOM   2395  C CA  . PHE A 1 297 ? 44.796  8.583   6.878   1.00 12.74 ? 323  PHE A CA  1 
ATOM   2396  C C   . PHE A 1 297 ? 45.711  9.414   7.770   1.00 13.85 ? 323  PHE A C   1 
ATOM   2397  O O   . PHE A 1 297 ? 46.785  9.827   7.325   1.00 12.68 ? 323  PHE A O   1 
ATOM   2398  C CB  . PHE A 1 297 ? 44.436  9.373   5.622   1.00 14.04 ? 323  PHE A CB  1 
ATOM   2399  C CG  . PHE A 1 297 ? 43.890  8.518   4.515   1.00 14.08 ? 323  PHE A CG  1 
ATOM   2400  C CD1 . PHE A 1 297 ? 42.517  8.422   4.305   1.00 16.20 ? 323  PHE A CD1 1 
ATOM   2401  C CD2 . PHE A 1 297 ? 44.747  7.786   3.695   1.00 16.07 ? 323  PHE A CD2 1 
ATOM   2402  C CE1 . PHE A 1 297 ? 42.001  7.606   3.290   1.00 15.56 ? 323  PHE A CE1 1 
ATOM   2403  C CE2 . PHE A 1 297 ? 44.239  6.967   2.678   1.00 16.11 ? 323  PHE A CE2 1 
ATOM   2404  C CZ  . PHE A 1 297 ? 42.865  6.881   2.480   1.00 14.90 ? 323  PHE A CZ  1 
ATOM   2405  N N   . ASP A 1 298 ? 45.300  9.663   9.010   1.00 12.47 ? 324  ASP A N   1 
ATOM   2406  C CA  . ASP A 1 298 ? 46.153  10.400  9.932   1.00 14.51 ? 324  ASP A CA  1 
ATOM   2407  C C   . ASP A 1 298 ? 47.150  9.409   10.531  1.00 14.29 ? 324  ASP A C   1 
ATOM   2408  O O   . ASP A 1 298 ? 48.226  9.798   10.987  1.00 13.82 ? 324  ASP A O   1 
ATOM   2409  C CB  . ASP A 1 298 ? 45.336  11.037  11.061  1.00 13.36 ? 324  ASP A CB  1 
ATOM   2410  C CG  . ASP A 1 298 ? 44.620  12.293  10.619  1.00 14.44 ? 324  ASP A CG  1 
ATOM   2411  O OD1 . ASP A 1 298 ? 45.074  12.918  9.638   1.00 15.21 ? 324  ASP A OD1 1 
ATOM   2412  O OD2 . ASP A 1 298 ? 43.615  12.663  11.265  1.00 18.31 ? 324  ASP A OD2 1 
ATOM   2413  N N   . LYS A 1 299 ? 46.785  8.125   10.517  1.00 13.77 ? 325  LYS A N   1 
ATOM   2414  C CA  . LYS A 1 299 ? 47.634  7.069   11.069  1.00 13.94 ? 325  LYS A CA  1 
ATOM   2415  C C   . LYS A 1 299 ? 48.931  6.950   10.284  1.00 14.65 ? 325  LYS A C   1 
ATOM   2416  O O   . LYS A 1 299 ? 48.930  6.821   9.065   1.00 16.45 ? 325  LYS A O   1 
ATOM   2417  C CB  . LYS A 1 299 ? 46.917  5.722   11.051  1.00 13.67 ? 325  LYS A CB  1 
ATOM   2418  C CG  . LYS A 1 299 ? 47.588  4.697   11.937  1.00 14.45 ? 325  LYS A CG  1 
ATOM   2419  C CD  . LYS A 1 299 ? 47.560  5.189   13.373  1.00 15.72 ? 325  LYS A CD  1 
ATOM   2420  C CE  . LYS A 1 299 ? 48.400  4.325   14.279  1.00 14.83 ? 325  LYS A CE  1 
ATOM   2421  N NZ  . LYS A 1 299 ? 48.327  4.843   15.670  1.00 14.81 ? 325  LYS A NZ  1 
ATOM   2422  N N   . THR A 1 300 ? 50.041  6.966   10.996  1.00 14.90 ? 326  THR A N   1 
ATOM   2423  C CA  . THR A 1 300 ? 51.343  6.894   10.364  1.00 15.22 ? 326  THR A CA  1 
ATOM   2424  C C   . THR A 1 300 ? 51.549  5.684   9.457   1.00 16.37 ? 326  THR A C   1 
ATOM   2425  O O   . THR A 1 300 ? 52.024  5.831   8.326   1.00 14.99 ? 326  THR A O   1 
ATOM   2426  C CB  . THR A 1 300 ? 52.442  6.939   11.426  1.00 15.21 ? 326  THR A CB  1 
ATOM   2427  O OG1 . THR A 1 300 ? 52.276  8.132   12.203  1.00 15.84 ? 326  THR A OG1 1 
ATOM   2428  C CG2 . THR A 1 300 ? 53.813  6.945   10.779  1.00 14.21 ? 326  THR A CG2 1 
ATOM   2429  N N   . LEU A 1 301 ? 51.193  4.506   9.947   1.00 15.60 ? 327  LEU A N   1 
ATOM   2430  C CA  . LEU A 1 301 ? 51.373  3.279   9.179   1.00 17.99 ? 327  LEU A CA  1 
ATOM   2431  C C   . LEU A 1 301 ? 50.082  2.513   8.935   1.00 16.97 ? 327  LEU A C   1 
ATOM   2432  O O   . LEU A 1 301 ? 49.436  2.053   9.878   1.00 16.91 ? 327  LEU A O   1 
ATOM   2433  C CB  . LEU A 1 301 ? 52.368  2.354   9.891   1.00 19.01 ? 327  LEU A CB  1 
ATOM   2434  C CG  . LEU A 1 301 ? 53.844  2.752   9.812   1.00 22.85 ? 327  LEU A CG  1 
ATOM   2435  C CD1 . LEU A 1 301 ? 54.681  1.837   10.693  1.00 25.69 ? 327  LEU A CD1 1 
ATOM   2436  C CD2 . LEU A 1 301 ? 54.318  2.676   8.365   1.00 22.75 ? 327  LEU A CD2 1 
ATOM   2437  N N   . GLN A 1 302 ? 49.709  2.378   7.672   1.00 15.77 ? 328  GLN A N   1 
ATOM   2438  C CA  . GLN A 1 302 ? 48.512  1.619   7.319   1.00 16.22 ? 328  GLN A CA  1 
ATOM   2439  C C   . GLN A 1 302 ? 48.865  0.505   6.340   1.00 17.43 ? 328  GLN A C   1 
ATOM   2440  O O   . GLN A 1 302 ? 49.295  0.774   5.218   1.00 17.72 ? 328  GLN A O   1 
ATOM   2441  C CB  . GLN A 1 302 ? 47.451  2.509   6.660   1.00 15.51 ? 328  GLN A CB  1 
ATOM   2442  C CG  . GLN A 1 302 ? 46.612  3.353   7.605   1.00 14.14 ? 328  GLN A CG  1 
ATOM   2443  C CD  . GLN A 1 302 ? 45.518  4.113   6.873   1.00 15.74 ? 328  GLN A CD  1 
ATOM   2444  O OE1 . GLN A 1 302 ? 45.784  5.102   6.187   1.00 17.69 ? 328  GLN A OE1 1 
ATOM   2445  N NE2 . GLN A 1 302 ? 44.280  3.642   6.997   1.00 13.60 ? 328  GLN A NE2 1 
ATOM   2446  N N   . PHE A 1 303 ? 48.696  -0.749  6.768   1.00 17.51 ? 329  PHE A N   1 
ATOM   2447  C CA  . PHE A 1 303 ? 48.957  -1.886  5.897   1.00 17.45 ? 329  PHE A CA  1 
ATOM   2448  C C   . PHE A 1 303 ? 47.606  -2.331  5.343   1.00 17.36 ? 329  PHE A C   1 
ATOM   2449  O O   . PHE A 1 303 ? 46.642  -2.475  6.089   1.00 17.99 ? 329  PHE A O   1 
ATOM   2450  C CB  . PHE A 1 303 ? 49.619  -3.032  6.669   1.00 18.16 ? 329  PHE A CB  1 
ATOM   2451  C CG  . PHE A 1 303 ? 51.034  -2.744  7.065   1.00 18.16 ? 329  PHE A CG  1 
ATOM   2452  C CD1 . PHE A 1 303 ? 51.318  -2.076  8.246   1.00 20.70 ? 329  PHE A CD1 1 
ATOM   2453  C CD2 . PHE A 1 303 ? 52.081  -3.090  6.221   1.00 18.96 ? 329  PHE A CD2 1 
ATOM   2454  C CE1 . PHE A 1 303 ? 52.627  -1.747  8.576   1.00 20.19 ? 329  PHE A CE1 1 
ATOM   2455  C CE2 . PHE A 1 303 ? 53.385  -2.768  6.538   1.00 19.18 ? 329  PHE A CE2 1 
ATOM   2456  C CZ  . PHE A 1 303 ? 53.660  -2.090  7.721   1.00 18.97 ? 329  PHE A CZ  1 
ATOM   2457  N N   . ILE A 1 304 ? 47.544  -2.534  4.031   1.00 16.13 ? 330  ILE A N   1 
ATOM   2458  C CA  . ILE A 1 304 ? 46.303  -2.919  3.365   1.00 16.65 ? 330  ILE A CA  1 
ATOM   2459  C C   . ILE A 1 304 ? 46.373  -4.336  2.799   1.00 17.19 ? 330  ILE A C   1 
ATOM   2460  O O   . ILE A 1 304 ? 47.350  -4.723  2.154   1.00 17.59 ? 330  ILE A O   1 
ATOM   2461  C CB  . ILE A 1 304 ? 45.972  -1.923  2.207   1.00 17.44 ? 330  ILE A CB  1 
ATOM   2462  C CG1 . ILE A 1 304 ? 45.921  -0.490  2.749   1.00 15.15 ? 330  ILE A CG1 1 
ATOM   2463  C CG2 . ILE A 1 304 ? 44.646  -2.290  1.545   1.00 16.87 ? 330  ILE A CG2 1 
ATOM   2464  C CD1 . ILE A 1 304 ? 46.222  0.579   1.700   1.00 14.44 ? 330  ILE A CD1 1 
ATOM   2465  N N   . VAL A 1 305 ? 45.334  -5.115  3.058   1.00 19.03 ? 331  VAL A N   1 
ATOM   2466  C CA  . VAL A 1 305 ? 45.276  -6.473  2.553   1.00 19.99 ? 331  VAL A CA  1 
ATOM   2467  C C   . VAL A 1 305 ? 43.983  -6.603  1.764   1.00 21.11 ? 331  VAL A C   1 
ATOM   2468  O O   . VAL A 1 305 ? 42.895  -6.615  2.340   1.00 21.10 ? 331  VAL A O   1 
ATOM   2469  C CB  . VAL A 1 305 ? 45.287  -7.494  3.701   1.00 21.85 ? 331  VAL A CB  1 
ATOM   2470  C CG1 . VAL A 1 305 ? 45.244  -8.914  3.146   1.00 19.66 ? 331  VAL A CG1 1 
ATOM   2471  C CG2 . VAL A 1 305 ? 46.535  -7.289  4.555   1.00 19.37 ? 331  VAL A CG2 1 
ATOM   2472  N N   . ALA A 1 306 ? 44.112  -6.669  0.443   1.00 21.95 ? 332  ALA A N   1 
ATOM   2473  C CA  . ALA A 1 306 ? 42.962  -6.792  -0.445  1.00 23.81 ? 332  ALA A CA  1 
ATOM   2474  C C   . ALA A 1 306 ? 42.375  -8.201  -0.421  1.00 24.67 ? 332  ALA A C   1 
ATOM   2475  O O   . ALA A 1 306 ? 43.031  -9.163  -0.015  1.00 24.76 ? 332  ALA A O   1 
ATOM   2476  C CB  . ALA A 1 306 ? 43.354  -6.420  -1.878  1.00 23.80 ? 332  ALA A CB  1 
ATOM   2477  N N   . GLU A 1 307 ? 41.136  -8.309  -0.875  1.00 27.88 ? 333  GLU A N   1 
ATOM   2478  C CA  . GLU A 1 307 ? 40.424  -9.582  -0.915  1.00 29.19 ? 333  GLU A CA  1 
ATOM   2479  C C   . GLU A 1 307 ? 40.877  -10.472 -2.071  1.00 28.25 ? 333  GLU A C   1 
ATOM   2480  O O   . GLU A 1 307 ? 40.844  -11.696 -1.973  1.00 28.78 ? 333  GLU A O   1 
ATOM   2481  C CB  . GLU A 1 307 ? 38.921  -9.304  -1.018  1.00 31.83 ? 333  GLU A CB  1 
ATOM   2482  C CG  . GLU A 1 307 ? 38.024  -10.522 -1.188  1.00 36.58 ? 333  GLU A CG  1 
ATOM   2483  C CD  . GLU A 1 307 ? 37.947  -10.999 -2.627  1.00 39.31 ? 333  GLU A CD  1 
ATOM   2484  O OE1 . GLU A 1 307 ? 37.934  -10.143 -3.537  1.00 39.89 ? 333  GLU A OE1 1 
ATOM   2485  O OE2 . GLU A 1 307 ? 37.879  -12.226 -2.846  1.00 40.50 ? 333  GLU A OE2 1 
ATOM   2486  N N   . ASP A 1 308 ? 41.320  -9.849  -3.156  1.00 27.13 ? 334  ASP A N   1 
ATOM   2487  C CA  . ASP A 1 308 ? 41.751  -10.585 -4.337  1.00 26.95 ? 334  ASP A CA  1 
ATOM   2488  C C   . ASP A 1 308 ? 43.229  -10.984 -4.299  1.00 26.34 ? 334  ASP A C   1 
ATOM   2489  O O   . ASP A 1 308 ? 43.776  -11.448 -5.299  1.00 26.82 ? 334  ASP A O   1 
ATOM   2490  C CB  . ASP A 1 308 ? 41.473  -9.748  -5.583  1.00 27.87 ? 334  ASP A CB  1 
ATOM   2491  C CG  . ASP A 1 308 ? 42.439  -8.602  -5.729  1.00 28.79 ? 334  ASP A CG  1 
ATOM   2492  O OD1 . ASP A 1 308 ? 42.830  -8.031  -4.690  1.00 32.10 ? 334  ASP A OD1 1 
ATOM   2493  O OD2 . ASP A 1 308 ? 42.805  -8.273  -6.876  1.00 30.16 ? 334  ASP A OD2 1 
ATOM   2494  N N   . GLY A 1 309 ? 43.872  -10.801 -3.148  1.00 25.78 ? 335  GLY A N   1 
ATOM   2495  C CA  . GLY A 1 309 ? 45.275  -11.165 -3.021  1.00 24.23 ? 335  GLY A CA  1 
ATOM   2496  C C   . GLY A 1 309 ? 46.236  -9.991  -3.027  1.00 23.74 ? 335  GLY A C   1 
ATOM   2497  O O   . GLY A 1 309 ? 47.385  -10.106 -2.599  1.00 23.42 ? 335  GLY A O   1 
ATOM   2498  N N   . SER A 1 310 ? 45.772  -8.853  -3.522  1.00 23.20 ? 336  SER A N   1 
ATOM   2499  C CA  . SER A 1 310 ? 46.612  -7.667  -3.579  1.00 23.24 ? 336  SER A CA  1 
ATOM   2500  C C   . SER A 1 310 ? 46.865  -7.120  -2.181  1.00 21.96 ? 336  SER A C   1 
ATOM   2501  O O   . SER A 1 310 ? 46.065  -7.319  -1.268  1.00 22.65 ? 336  SER A O   1 
ATOM   2502  C CB  . SER A 1 310 ? 45.949  -6.589  -4.433  1.00 24.23 ? 336  SER A CB  1 
ATOM   2503  O OG  . SER A 1 310 ? 45.876  -6.984  -5.786  1.00 27.80 ? 336  SER A OG  1 
ATOM   2504  N N   . CYS A 1 311 ? 47.986  -6.440  -2.011  1.00 20.08 ? 337  CYS A N   1 
ATOM   2505  C CA  . CYS A 1 311 ? 48.309  -5.846  -0.723  1.00 19.48 ? 337  CYS A CA  1 
ATOM   2506  C C   . CYS A 1 311 ? 49.286  -4.703  -0.914  1.00 18.28 ? 337  CYS A C   1 
ATOM   2507  O O   . CYS A 1 311 ? 49.944  -4.588  -1.948  1.00 16.06 ? 337  CYS A O   1 
ATOM   2508  C CB  . CYS A 1 311 ? 48.888  -6.892  0.236   1.00 19.94 ? 337  CYS A CB  1 
ATOM   2509  S SG  . CYS A 1 311 ? 50.528  -7.537  -0.172  1.00 28.55 ? 337  CYS A SG  1 
ATOM   2510  N N   . GLY A 1 312 ? 49.358  -3.834  0.091   1.00 17.85 ? 338  GLY A N   1 
ATOM   2511  C CA  . GLY A 1 312 ? 50.254  -2.703  0.019   1.00 15.46 ? 338  GLY A CA  1 
ATOM   2512  C C   . GLY A 1 312 ? 50.117  -1.865  1.270   1.00 15.70 ? 338  GLY A C   1 
ATOM   2513  O O   . GLY A 1 312 ? 49.737  -2.368  2.325   1.00 15.65 ? 338  GLY A O   1 
ATOM   2514  N N   . MET A 1 313 ? 50.418  -0.585  1.157   1.00 15.32 ? 339  MET A N   1 
ATOM   2515  C CA  . MET A 1 313 ? 50.310  0.290   2.307   1.00 17.54 ? 339  MET A CA  1 
ATOM   2516  C C   . MET A 1 313 ? 50.390  1.761   1.933   1.00 16.52 ? 339  MET A C   1 
ATOM   2517  O O   . MET A 1 313 ? 50.736  2.118   0.808   1.00 16.24 ? 339  MET A O   1 
ATOM   2518  C CB  . MET A 1 313 ? 51.406  -0.049  3.307   1.00 20.24 ? 339  MET A CB  1 
ATOM   2519  C CG  . MET A 1 313 ? 52.795  0.010   2.728   1.00 22.69 ? 339  MET A CG  1 
ATOM   2520  S SD  . MET A 1 313 ? 54.010  -0.057  4.029   1.00 32.44 ? 339  MET A SD  1 
ATOM   2521  C CE  . MET A 1 313 ? 53.992  1.695   4.540   1.00 28.72 ? 339  MET A CE  1 
ATOM   2522  N N   . VAL A 1 314 ? 50.042  2.611   2.894   1.00 15.36 ? 340  VAL A N   1 
ATOM   2523  C CA  . VAL A 1 314 ? 50.072  4.054   2.720   1.00 13.47 ? 340  VAL A CA  1 
ATOM   2524  C C   . VAL A 1 314 ? 50.505  4.607   4.083   1.00 13.77 ? 340  VAL A C   1 
ATOM   2525  O O   . VAL A 1 314 ? 50.007  4.170   5.120   1.00 14.36 ? 340  VAL A O   1 
ATOM   2526  C CB  . VAL A 1 314 ? 48.672  4.593   2.293   1.00 10.30 ? 340  VAL A CB  1 
ATOM   2527  C CG1 . VAL A 1 314 ? 47.615  4.159   3.275   1.00 12.92 ? 340  VAL A CG1 1 
ATOM   2528  C CG2 . VAL A 1 314 ? 48.695  6.108   2.181   1.00 15.17 ? 340  VAL A CG2 1 
ATOM   2529  N N   . TYR A 1 315 ? 51.445  5.540   4.081   1.00 13.64 ? 341  TYR A N   1 
ATOM   2530  C CA  . TYR A 1 315 ? 51.942  6.101   5.333   1.00 13.14 ? 341  TYR A CA  1 
ATOM   2531  C C   . TYR A 1 315 ? 51.912  7.613   5.332   1.00 12.43 ? 341  TYR A C   1 
ATOM   2532  O O   . TYR A 1 315 ? 52.065  8.241   4.287   1.00 13.57 ? 341  TYR A O   1 
ATOM   2533  C CB  . TYR A 1 315 ? 53.371  5.606   5.599   1.00 12.37 ? 341  TYR A CB  1 
ATOM   2534  C CG  . TYR A 1 315 ? 54.455  6.259   4.752   1.00 14.33 ? 341  TYR A CG  1 
ATOM   2535  C CD1 . TYR A 1 315 ? 55.102  7.419   5.180   1.00 15.10 ? 341  TYR A CD1 1 
ATOM   2536  C CD2 . TYR A 1 315 ? 54.852  5.698   3.537   1.00 14.42 ? 341  TYR A CD2 1 
ATOM   2537  C CE1 . TYR A 1 315 ? 56.127  8.002   4.419   1.00 16.80 ? 341  TYR A CE1 1 
ATOM   2538  C CE2 . TYR A 1 315 ? 55.864  6.267   2.776   1.00 14.76 ? 341  TYR A CE2 1 
ATOM   2539  C CZ  . TYR A 1 315 ? 56.501  7.417   3.221   1.00 16.83 ? 341  TYR A CZ  1 
ATOM   2540  O OH  . TYR A 1 315 ? 57.514  7.971   2.468   1.00 18.31 ? 341  TYR A OH  1 
ATOM   2541  N N   . GLU A 1 316 ? 51.723  8.189   6.513   1.00 13.46 ? 342  GLU A N   1 
ATOM   2542  C CA  . GLU A 1 316 ? 51.665  9.636   6.688   1.00 13.82 ? 342  GLU A CA  1 
ATOM   2543  C C   . GLU A 1 316 ? 53.103  10.182  6.684   1.00 14.23 ? 342  GLU A C   1 
ATOM   2544  O O   . GLU A 1 316 ? 53.926  9.831   7.535   1.00 14.00 ? 342  GLU A O   1 
ATOM   2545  C CB  . GLU A 1 316 ? 50.935  9.937   8.000   1.00 13.73 ? 342  GLU A CB  1 
ATOM   2546  C CG  . GLU A 1 316 ? 50.241  11.275  8.038   1.00 14.73 ? 342  GLU A CG  1 
ATOM   2547  C CD  . GLU A 1 316 ? 51.228  12.408  8.127   1.00 13.88 ? 342  GLU A CD  1 
ATOM   2548  O OE1 . GLU A 1 316 ? 52.022  12.409  9.089   1.00 14.54 ? 342  GLU A OE1 1 
ATOM   2549  O OE2 . GLU A 1 316 ? 51.216  13.289  7.242   1.00 14.46 ? 342  GLU A OE2 1 
ATOM   2550  N N   . HIS A 1 317 ? 53.394  11.029  5.702   1.00 14.06 ? 343  HIS A N   1 
ATOM   2551  C CA  . HIS A 1 317 ? 54.738  11.573  5.492   1.00 15.56 ? 343  HIS A CA  1 
ATOM   2552  C C   . HIS A 1 317 ? 55.391  12.380  6.603   1.00 16.93 ? 343  HIS A C   1 
ATOM   2553  O O   . HIS A 1 317 ? 56.616  12.414  6.698   1.00 19.30 ? 343  HIS A O   1 
ATOM   2554  C CB  . HIS A 1 317 ? 54.766  12.405  4.210   1.00 15.35 ? 343  HIS A CB  1 
ATOM   2555  C CG  . HIS A 1 317 ? 55.928  12.097  3.320   1.00 15.60 ? 343  HIS A CG  1 
ATOM   2556  N ND1 . HIS A 1 317 ? 57.198  11.868  3.803   1.00 14.95 ? 343  HIS A ND1 1 
ATOM   2557  C CD2 . HIS A 1 317 ? 56.013  11.996  1.972   1.00 15.84 ? 343  HIS A CD2 1 
ATOM   2558  C CE1 . HIS A 1 317 ? 58.016  11.639  2.792   1.00 14.46 ? 343  HIS A CE1 1 
ATOM   2559  N NE2 . HIS A 1 317 ? 57.322  11.708  1.669   1.00 16.48 ? 343  HIS A NE2 1 
ATOM   2560  N N   . ALA A 1 318 ? 54.605  13.039  7.428   1.00 18.75 ? 344  ALA A N   1 
ATOM   2561  C CA  . ALA A 1 318 ? 55.201  13.830  8.491   1.00 23.57 ? 344  ALA A CA  1 
ATOM   2562  C C   . ALA A 1 318 ? 56.129  12.979  9.367   1.00 25.75 ? 344  ALA A C   1 
ATOM   2563  O O   . ALA A 1 318 ? 57.089  13.489  9.941   1.00 26.42 ? 344  ALA A O   1 
ATOM   2564  C CB  . ALA A 1 318 ? 54.115  14.475  9.331   1.00 21.50 ? 344  ALA A CB  1 
ATOM   2565  N N   . ALA A 1 319 ? 55.864  11.676  9.434   1.00 28.92 ? 345  ALA A N   1 
ATOM   2566  C CA  . ALA A 1 319 ? 56.669  10.770  10.256  1.00 31.14 ? 345  ALA A CA  1 
ATOM   2567  C C   . ALA A 1 319 ? 58.065  10.470  9.714   1.00 32.62 ? 345  ALA A C   1 
ATOM   2568  O O   . ALA A 1 319 ? 59.060  10.977  10.237  1.00 33.83 ? 345  ALA A O   1 
ATOM   2569  C CB  . ALA A 1 319 ? 55.919  9.464   10.478  1.00 31.40 ? 345  ALA A CB  1 
ATOM   2570  N N   . ALA A 1 320 ? 58.149  9.644   8.675   1.00 32.11 ? 346  ALA A N   1 
ATOM   2571  C CA  . ALA A 1 320 ? 59.450  9.291   8.122   1.00 31.21 ? 346  ALA A CA  1 
ATOM   2572  C C   . ALA A 1 320 ? 59.511  9.392   6.612   1.00 30.94 ? 346  ALA A C   1 
ATOM   2573  O O   . ALA A 1 320 ? 58.595  9.897   5.965   1.00 30.52 ? 346  ALA A O   1 
ATOM   2574  C CB  . ALA A 1 320 ? 59.828  7.884   8.554   1.00 31.49 ? 346  ALA A CB  1 
ATOM   2575  N N   . GLU A 1 321 ? 60.615  8.895   6.057   1.00 30.84 ? 347  GLU A N   1 
ATOM   2576  C CA  . GLU A 1 321 ? 60.828  8.901   4.619   1.00 30.01 ? 347  GLU A CA  1 
ATOM   2577  C C   . GLU A 1 321 ? 60.612  7.514   4.021   1.00 29.50 ? 347  GLU A C   1 
ATOM   2578  O O   . GLU A 1 321 ? 60.077  6.615   4.673   1.00 28.07 ? 347  GLU A O   1 
ATOM   2579  C CB  . GLU A 1 321 ? 62.244  9.373   4.288   1.00 31.18 ? 347  GLU A CB  1 
ATOM   2580  C CG  . GLU A 1 321 ? 62.554  10.790  4.737   1.00 31.70 ? 347  GLU A CG  1 
ATOM   2581  C CD  . GLU A 1 321 ? 61.556  11.794  4.203   1.00 30.59 ? 347  GLU A CD  1 
ATOM   2582  O OE1 . GLU A 1 321 ? 61.167  11.681  3.023   1.00 31.37 ? 347  GLU A OE1 1 
ATOM   2583  O OE2 . GLU A 1 321 ? 61.171  12.703  4.963   1.00 32.87 ? 347  GLU A OE2 1 
ATOM   2584  N N   . GLY A 1 322 ? 61.045  7.353   2.775   1.00 28.33 ? 348  GLY A N   1 
ATOM   2585  C CA  . GLY A 1 322 ? 60.886  6.090   2.078   1.00 27.65 ? 348  GLY A CA  1 
ATOM   2586  C C   . GLY A 1 322 ? 61.758  4.955   2.582   1.00 27.20 ? 348  GLY A C   1 
ATOM   2587  O O   . GLY A 1 322 ? 61.230  3.923   2.997   1.00 28.06 ? 348  GLY A O   1 
ATOM   2588  N N   . PRO A 1 323 ? 63.092  5.107   2.552   1.00 26.26 ? 349  PRO A N   1 
ATOM   2589  C CA  . PRO A 1 323 ? 64.022  4.067   3.012   1.00 26.31 ? 349  PRO A CA  1 
ATOM   2590  C C   . PRO A 1 323 ? 63.609  3.357   4.307   1.00 24.80 ? 349  PRO A C   1 
ATOM   2591  O O   . PRO A 1 323 ? 63.544  2.129   4.347   1.00 26.52 ? 349  PRO A O   1 
ATOM   2592  C CB  . PRO A 1 323 ? 65.344  4.823   3.128   1.00 27.91 ? 349  PRO A CB  1 
ATOM   2593  C CG  . PRO A 1 323 ? 65.256  5.787   1.975   1.00 27.19 ? 349  PRO A CG  1 
ATOM   2594  C CD  . PRO A 1 323 ? 63.828  6.298   2.084   1.00 26.79 ? 349  PRO A CD  1 
ATOM   2595  N N   . PRO A 1 324 ? 63.326  4.111   5.381   1.00 22.15 ? 350  PRO A N   1 
ATOM   2596  C CA  . PRO A 1 324 ? 62.922  3.469   6.637   1.00 20.67 ? 350  PRO A CA  1 
ATOM   2597  C C   . PRO A 1 324 ? 61.681  2.591   6.440   1.00 20.88 ? 350  PRO A C   1 
ATOM   2598  O O   . PRO A 1 324 ? 61.618  1.454   6.912   1.00 19.80 ? 350  PRO A O   1 
ATOM   2599  C CB  . PRO A 1 324 ? 62.648  4.657   7.553   1.00 19.74 ? 350  PRO A CB  1 
ATOM   2600  C CG  . PRO A 1 324 ? 63.634  5.682   7.062   1.00 19.24 ? 350  PRO A CG  1 
ATOM   2601  C CD  . PRO A 1 324 ? 63.494  5.565   5.563   1.00 22.27 ? 350  PRO A CD  1 
ATOM   2602  N N   . ILE A 1 325 ? 60.697  3.134   5.731   1.00 19.87 ? 351  ILE A N   1 
ATOM   2603  C CA  . ILE A 1 325 ? 59.458  2.416   5.466   1.00 18.72 ? 351  ILE A CA  1 
ATOM   2604  C C   . ILE A 1 325 ? 59.718  1.112   4.703   1.00 18.23 ? 351  ILE A C   1 
ATOM   2605  O O   . ILE A 1 325 ? 59.219  0.049   5.086   1.00 17.26 ? 351  ILE A O   1 
ATOM   2606  C CB  . ILE A 1 325 ? 58.474  3.280   4.628   1.00 18.61 ? 351  ILE A CB  1 
ATOM   2607  C CG1 . ILE A 1 325 ? 58.032  4.520   5.416   1.00 17.44 ? 351  ILE A CG1 1 
ATOM   2608  C CG2 . ILE A 1 325 ? 57.272  2.443   4.219   1.00 17.71 ? 351  ILE A CG2 1 
ATOM   2609  C CD1 . ILE A 1 325 ? 57.191  4.238   6.646   1.00 16.56 ? 351  ILE A CD1 1 
ATOM   2610  N N   . VAL A 1 326 ? 60.494  1.197   3.624   1.00 18.15 ? 352  VAL A N   1 
ATOM   2611  C CA  . VAL A 1 326 ? 60.783  0.019   2.809   1.00 20.09 ? 352  VAL A CA  1 
ATOM   2612  C C   . VAL A 1 326 ? 61.630  -0.986  3.573   1.00 19.83 ? 352  VAL A C   1 
ATOM   2613  O O   . VAL A 1 326 ? 61.528  -2.191  3.349   1.00 20.05 ? 352  VAL A O   1 
ATOM   2614  C CB  . VAL A 1 326 ? 61.499  0.388   1.471   1.00 21.60 ? 352  VAL A CB  1 
ATOM   2615  C CG1 . VAL A 1 326 ? 60.636  1.335   0.654   1.00 22.69 ? 352  VAL A CG1 1 
ATOM   2616  C CG2 . VAL A 1 326 ? 62.829  1.020   1.748   1.00 23.10 ? 352  VAL A CG2 1 
ATOM   2617  N N   . ALA A 1 327 ? 62.476  -0.494  4.468   1.00 19.48 ? 353  ALA A N   1 
ATOM   2618  C CA  . ALA A 1 327 ? 63.312  -1.383  5.266   1.00 19.90 ? 353  ALA A CA  1 
ATOM   2619  C C   . ALA A 1 327 ? 62.363  -2.249  6.098   1.00 19.56 ? 353  ALA A C   1 
ATOM   2620  O O   . ALA A 1 327 ? 62.535  -3.460  6.209   1.00 19.14 ? 353  ALA A O   1 
ATOM   2621  C CB  . ALA A 1 327 ? 64.232  -0.570  6.169   1.00 20.46 ? 353  ALA A CB  1 
ATOM   2622  N N   . LEU A 1 328 ? 61.344  -1.620  6.670   1.00 19.24 ? 354  LEU A N   1 
ATOM   2623  C CA  . LEU A 1 328 ? 60.364  -2.346  7.463   1.00 20.17 ? 354  LEU A CA  1 
ATOM   2624  C C   . LEU A 1 328 ? 59.597  -3.319  6.558   1.00 20.24 ? 354  LEU A C   1 
ATOM   2625  O O   . LEU A 1 328 ? 59.290  -4.441  6.961   1.00 19.30 ? 354  LEU A O   1 
ATOM   2626  C CB  . LEU A 1 328 ? 59.405  -1.356  8.125   1.00 20.54 ? 354  LEU A CB  1 
ATOM   2627  C CG  . LEU A 1 328 ? 58.223  -1.892  8.928   1.00 22.24 ? 354  LEU A CG  1 
ATOM   2628  C CD1 . LEU A 1 328 ? 57.818  -0.869  9.969   1.00 24.33 ? 354  LEU A CD1 1 
ATOM   2629  C CD2 . LEU A 1 328 ? 57.065  -2.191  7.998   1.00 22.17 ? 354  LEU A CD2 1 
ATOM   2630  N N   . VAL A 1 329 ? 59.293  -2.890  5.335   1.00 19.08 ? 355  VAL A N   1 
ATOM   2631  C CA  . VAL A 1 329 ? 58.571  -3.742  4.395   1.00 20.39 ? 355  VAL A CA  1 
ATOM   2632  C C   . VAL A 1 329 ? 59.383  -4.982  4.039   1.00 21.06 ? 355  VAL A C   1 
ATOM   2633  O O   . VAL A 1 329 ? 58.888  -6.104  4.131   1.00 22.31 ? 355  VAL A O   1 
ATOM   2634  C CB  . VAL A 1 329 ? 58.214  -2.970  3.095   1.00 21.07 ? 355  VAL A CB  1 
ATOM   2635  C CG1 . VAL A 1 329 ? 57.849  -3.952  1.970   1.00 20.24 ? 355  VAL A CG1 1 
ATOM   2636  C CG2 . VAL A 1 329 ? 57.052  -2.025  3.370   1.00 20.46 ? 355  VAL A CG2 1 
ATOM   2637  N N   . ASP A 1 330 ? 60.628  -4.778  3.629   1.00 20.70 ? 356  ASP A N   1 
ATOM   2638  C CA  . ASP A 1 330 ? 61.481  -5.894  3.270   1.00 22.73 ? 356  ASP A CA  1 
ATOM   2639  C C   . ASP A 1 330 ? 61.542  -6.932  4.377   1.00 23.30 ? 356  ASP A C   1 
ATOM   2640  O O   . ASP A 1 330 ? 61.518  -8.133  4.117   1.00 25.26 ? 356  ASP A O   1 
ATOM   2641  C CB  . ASP A 1 330 ? 62.887  -5.399  2.941   1.00 22.07 ? 356  ASP A CB  1 
ATOM   2642  C CG  . ASP A 1 330 ? 62.942  -4.678  1.621   1.00 22.95 ? 356  ASP A CG  1 
ATOM   2643  O OD1 . ASP A 1 330 ? 61.950  -4.768  0.874   1.00 23.79 ? 356  ASP A OD1 1 
ATOM   2644  O OD2 . ASP A 1 330 ? 63.970  -4.037  1.324   1.00 23.76 ? 356  ASP A OD2 1 
ATOM   2645  N N   . HIS A 1 331 ? 61.606  -6.462  5.613   1.00 23.31 ? 357  HIS A N   1 
ATOM   2646  C CA  . HIS A 1 331 ? 61.671  -7.358  6.751   1.00 23.93 ? 357  HIS A CA  1 
ATOM   2647  C C   . HIS A 1 331 ? 60.348  -8.092  6.960   1.00 23.68 ? 357  HIS A C   1 
ATOM   2648  O O   . HIS A 1 331 ? 60.324  -9.306  7.142   1.00 23.61 ? 357  HIS A O   1 
ATOM   2649  C CB  . HIS A 1 331 ? 62.063  -6.566  8.002   1.00 22.78 ? 357  HIS A CB  1 
ATOM   2650  C CG  . HIS A 1 331 ? 62.130  -7.396  9.246   1.00 21.73 ? 357  HIS A CG  1 
ATOM   2651  N ND1 . HIS A 1 331 ? 61.010  -7.736  9.972   1.00 21.46 ? 357  HIS A ND1 1 
ATOM   2652  C CD2 . HIS A 1 331 ? 63.178  -7.977  9.877   1.00 20.70 ? 357  HIS A CD2 1 
ATOM   2653  C CE1 . HIS A 1 331 ? 61.365  -8.487  10.998  1.00 20.80 ? 357  HIS A CE1 1 
ATOM   2654  N NE2 . HIS A 1 331 ? 62.674  -8.649  10.962  1.00 20.55 ? 357  HIS A NE2 1 
ATOM   2655  N N   . VAL A 1 332 ? 59.248  -7.353  6.917   1.00 24.65 ? 358  VAL A N   1 
ATOM   2656  C CA  . VAL A 1 332 ? 57.931  -7.946  7.104   1.00 25.50 ? 358  VAL A CA  1 
ATOM   2657  C C   . VAL A 1 332 ? 57.630  -8.974  6.012   1.00 26.86 ? 358  VAL A C   1 
ATOM   2658  O O   . VAL A 1 332 ? 57.215  -10.099 6.301   1.00 26.64 ? 358  VAL A O   1 
ATOM   2659  C CB  . VAL A 1 332 ? 56.828  -6.859  7.093   1.00 26.09 ? 358  VAL A CB  1 
ATOM   2660  C CG1 . VAL A 1 332 ? 55.456  -7.506  7.113   1.00 25.17 ? 358  VAL A CG1 1 
ATOM   2661  C CG2 . VAL A 1 332 ? 56.994  -5.945  8.300   1.00 26.26 ? 358  VAL A CG2 1 
ATOM   2662  N N   . MET A 1 333 ? 57.844  -8.588  4.763   1.00 27.11 ? 359  MET A N   1 
ATOM   2663  C CA  . MET A 1 333 ? 57.578  -9.487  3.647   1.00 28.27 ? 359  MET A CA  1 
ATOM   2664  C C   . MET A 1 333 ? 58.410  -10.754 3.750   1.00 28.78 ? 359  MET A C   1 
ATOM   2665  O O   . MET A 1 333 ? 57.895  -11.857 3.563   1.00 29.17 ? 359  MET A O   1 
ATOM   2666  C CB  . MET A 1 333 ? 57.861  -8.783  2.323   1.00 26.83 ? 359  MET A CB  1 
ATOM   2667  C CG  . MET A 1 333 ? 56.903  -7.639  2.032   1.00 27.10 ? 359  MET A CG  1 
ATOM   2668  S SD  . MET A 1 333 ? 55.183  -8.182  1.908   1.00 28.53 ? 359  MET A SD  1 
ATOM   2669  C CE  . MET A 1 333 ? 54.618  -7.865  3.527   1.00 30.41 ? 359  MET A CE  1 
ATOM   2670  N N   . GLU A 1 334 ? 59.692  -10.596 4.053   1.00 30.47 ? 360  GLU A N   1 
ATOM   2671  C CA  . GLU A 1 334 ? 60.581  -11.739 4.181   1.00 33.30 ? 360  GLU A CA  1 
ATOM   2672  C C   . GLU A 1 334 ? 60.128  -12.613 5.344   1.00 33.98 ? 360  GLU A C   1 
ATOM   2673  O O   . GLU A 1 334 ? 60.396  -13.817 5.375   1.00 35.57 ? 360  GLU A O   1 
ATOM   2674  C CB  . GLU A 1 334 ? 62.015  -11.266 4.411   1.00 35.40 ? 360  GLU A CB  1 
ATOM   2675  C CG  . GLU A 1 334 ? 63.011  -12.399 4.610   1.00 40.82 ? 360  GLU A CG  1 
ATOM   2676  C CD  . GLU A 1 334 ? 63.059  -13.355 3.431   1.00 44.13 ? 360  GLU A CD  1 
ATOM   2677  O OE1 . GLU A 1 334 ? 63.413  -12.914 2.316   1.00 46.58 ? 360  GLU A OE1 1 
ATOM   2678  O OE2 . GLU A 1 334 ? 62.744  -14.550 3.617   1.00 46.62 ? 360  GLU A OE2 1 
ATOM   2679  N N   . TYR A 1 335 ? 59.433  -12.004 6.295   1.00 33.14 ? 361  TYR A N   1 
ATOM   2680  C CA  . TYR A 1 335 ? 58.946  -12.734 7.455   1.00 32.90 ? 361  TYR A CA  1 
ATOM   2681  C C   . TYR A 1 335 ? 57.732  -13.577 7.093   1.00 32.78 ? 361  TYR A C   1 
ATOM   2682  O O   . TYR A 1 335 ? 57.585  -14.701 7.572   1.00 32.77 ? 361  TYR A O   1 
ATOM   2683  C CB  . TYR A 1 335 ? 58.592  -11.757 8.574   1.00 32.69 ? 361  TYR A CB  1 
ATOM   2684  C CG  . TYR A 1 335 ? 58.217  -12.421 9.880   1.00 32.95 ? 361  TYR A CG  1 
ATOM   2685  C CD1 . TYR A 1 335 ? 56.918  -12.870 10.109  1.00 33.19 ? 361  TYR A CD1 1 
ATOM   2686  C CD2 . TYR A 1 335 ? 59.164  -12.602 10.887  1.00 33.53 ? 361  TYR A CD2 1 
ATOM   2687  C CE1 . TYR A 1 335 ? 56.569  -13.480 11.309  1.00 33.47 ? 361  TYR A CE1 1 
ATOM   2688  C CE2 . TYR A 1 335 ? 58.827  -13.214 12.091  1.00 34.28 ? 361  TYR A CE2 1 
ATOM   2689  C CZ  . TYR A 1 335 ? 57.527  -13.650 12.294  1.00 34.59 ? 361  TYR A CZ  1 
ATOM   2690  O OH  . TYR A 1 335 ? 57.188  -14.260 13.479  1.00 34.75 ? 361  TYR A OH  1 
ATOM   2691  N N   . THR A 1 336 ? 56.871  -13.033 6.241   1.00 32.61 ? 362  THR A N   1 
ATOM   2692  C CA  . THR A 1 336 ? 55.667  -13.741 5.815   1.00 33.59 ? 362  THR A CA  1 
ATOM   2693  C C   . THR A 1 336 ? 56.025  -14.941 4.948   1.00 34.92 ? 362  THR A C   1 
ATOM   2694  O O   . THR A 1 336 ? 55.173  -15.771 4.644   1.00 34.65 ? 362  THR A O   1 
ATOM   2695  C CB  . THR A 1 336 ? 54.725  -12.827 5.009   1.00 32.05 ? 362  THR A CB  1 
ATOM   2696  O OG1 . THR A 1 336 ? 55.349  -12.470 3.770   1.00 30.01 ? 362  THR A OG1 1 
ATOM   2697  C CG2 . THR A 1 336 ? 54.413  -11.563 5.791   1.00 32.08 ? 362  THR A CG2 1 
ATOM   2698  N N   . LYS A 1 337 ? 57.288  -15.025 4.544   1.00 37.14 ? 363  LYS A N   1 
ATOM   2699  C CA  . LYS A 1 337 ? 57.748  -16.137 3.722   1.00 40.42 ? 363  LYS A CA  1 
ATOM   2700  C C   . LYS A 1 337 ? 58.395  -17.208 4.586   1.00 42.88 ? 363  LYS A C   1 
ATOM   2701  O O   . LYS A 1 337 ? 58.701  -18.301 4.108   1.00 42.97 ? 363  LYS A O   1 
ATOM   2702  C CB  . LYS A 1 337 ? 58.756  -15.658 2.675   1.00 40.83 ? 363  LYS A CB  1 
ATOM   2703  C CG  . LYS A 1 337 ? 58.147  -14.867 1.539   1.00 41.91 ? 363  LYS A CG  1 
ATOM   2704  C CD  . LYS A 1 337 ? 59.224  -14.341 0.609   1.00 44.20 ? 363  LYS A CD  1 
ATOM   2705  C CE  . LYS A 1 337 ? 58.633  -13.373 -0.392  1.00 45.42 ? 363  LYS A CE  1 
ATOM   2706  N NZ  . LYS A 1 337 ? 57.884  -12.300 0.311   1.00 47.53 ? 363  LYS A NZ  1 
ATOM   2707  N N   . LYS A 1 338 ? 58.610  -16.892 5.861   1.00 45.54 ? 364  LYS A N   1 
ATOM   2708  C CA  . LYS A 1 338 ? 59.218  -17.851 6.773   1.00 48.67 ? 364  LYS A CA  1 
ATOM   2709  C C   . LYS A 1 338 ? 58.237  -18.941 7.178   1.00 50.62 ? 364  LYS A C   1 
ATOM   2710  O O   . LYS A 1 338 ? 57.066  -18.676 7.450   1.00 51.10 ? 364  LYS A O   1 
ATOM   2711  C CB  . LYS A 1 338 ? 59.753  -17.145 8.026   1.00 49.15 ? 364  LYS A CB  1 
ATOM   2712  C CG  . LYS A 1 338 ? 61.073  -16.418 7.803   1.00 50.44 ? 364  LYS A CG  1 
ATOM   2713  C CD  . LYS A 1 338 ? 61.620  -15.832 9.098   1.00 52.50 ? 364  LYS A CD  1 
ATOM   2714  C CE  . LYS A 1 338 ? 63.009  -15.240 8.897   1.00 53.32 ? 364  LYS A CE  1 
ATOM   2715  N NZ  . LYS A 1 338 ? 63.549  -14.662 10.160  1.00 54.21 ? 364  LYS A NZ  1 
ATOM   2716  N N   . PRO A 1 339 ? 58.708  -20.197 7.216   1.00 52.36 ? 365  PRO A N   1 
ATOM   2717  C CA  . PRO A 1 339 ? 57.893  -21.353 7.581   1.00 54.14 ? 365  PRO A CA  1 
ATOM   2718  C C   . PRO A 1 339 ? 57.305  -21.277 8.991   1.00 56.18 ? 365  PRO A C   1 
ATOM   2719  O O   . PRO A 1 339 ? 57.582  -20.341 9.743   1.00 55.94 ? 365  PRO A O   1 
ATOM   2720  C CB  . PRO A 1 339 ? 58.865  -22.520 7.419   1.00 53.56 ? 365  PRO A CB  1 
ATOM   2721  C CG  . PRO A 1 339 ? 60.193  -21.892 7.724   1.00 53.32 ? 365  PRO A CG  1 
ATOM   2722  C CD  . PRO A 1 339 ? 60.103  -20.597 6.965   1.00 51.97 ? 365  PRO A CD  1 
ATOM   2723  N N   . GLU A 1 340 ? 56.495  -22.272 9.334   1.00 59.35 ? 366  GLU A N   1 
ATOM   2724  C CA  . GLU A 1 340 ? 55.845  -22.346 10.641  1.00 62.30 ? 366  GLU A CA  1 
ATOM   2725  C C   . GLU A 1 340 ? 56.491  -23.424 11.514  1.00 63.73 ? 366  GLU A C   1 
ATOM   2726  O O   . GLU A 1 340 ? 57.007  -24.419 11.002  1.00 64.18 ? 366  GLU A O   1 
ATOM   2727  C CB  . GLU A 1 340 ? 54.360  -22.652 10.454  1.00 62.43 ? 366  GLU A CB  1 
ATOM   2728  C CG  . GLU A 1 340 ? 53.624  -21.595 9.647   1.00 63.50 ? 366  GLU A CG  1 
ATOM   2729  C CD  . GLU A 1 340 ? 52.265  -22.061 9.169   1.00 63.77 ? 366  GLU A CD  1 
ATOM   2730  O OE1 . GLU A 1 340 ? 52.212  -22.979 8.324   1.00 63.25 ? 366  GLU A OE1 1 
ATOM   2731  O OE2 . GLU A 1 340 ? 51.247  -21.511 9.640   1.00 64.26 ? 366  GLU A OE2 1 
ATOM   2732  N N   . LEU A 1 341 ? 56.457  -23.224 12.831  1.00 65.44 ? 367  LEU A N   1 
ATOM   2733  C CA  . LEU A 1 341 ? 57.049  -24.179 13.766  1.00 67.22 ? 367  LEU A CA  1 
ATOM   2734  C C   . LEU A 1 341 ? 56.046  -24.642 14.825  1.00 68.43 ? 367  LEU A C   1 
ATOM   2735  O O   . LEU A 1 341 ? 55.303  -25.606 14.612  1.00 68.38 ? 367  LEU A O   1 
ATOM   2736  C CB  . LEU A 1 341 ? 58.268  -23.550 14.450  1.00 67.09 ? 367  LEU A CB  1 
ATOM   2737  C CG  . LEU A 1 341 ? 59.398  -23.059 13.538  1.00 67.22 ? 367  LEU A CG  1 
ATOM   2738  C CD1 . LEU A 1 341 ? 60.484  -22.412 14.386  1.00 67.08 ? 367  LEU A CD1 1 
ATOM   2739  C CD2 . LEU A 1 341 ? 59.967  -24.220 12.731  1.00 66.67 ? 367  LEU A CD2 1 
ATOM   2740  N N   . VAL A 1 342 ? 56.034  -23.952 15.963  1.00 69.66 ? 368  VAL A N   1 
ATOM   2741  C CA  . VAL A 1 342 ? 55.130  -24.281 17.065  1.00 70.46 ? 368  VAL A CA  1 
ATOM   2742  C C   . VAL A 1 342 ? 53.659  -24.054 16.723  1.00 71.03 ? 368  VAL A C   1 
ATOM   2743  O O   . VAL A 1 342 ? 53.181  -22.917 16.691  1.00 71.70 ? 368  VAL A O   1 
ATOM   2744  C CB  . VAL A 1 342 ? 55.476  -23.467 18.345  1.00 70.41 ? 368  VAL A CB  1 
ATOM   2745  C CG1 . VAL A 1 342 ? 56.715  -24.049 19.013  1.00 69.84 ? 368  VAL A CG1 1 
ATOM   2746  C CG2 . VAL A 1 342 ? 55.701  -21.998 17.993  1.00 70.22 ? 368  VAL A CG2 1 
ATOM   2747  N N   . ARG A 1 343 ? 52.947  -25.150 16.473  1.00 71.18 ? 369  ARG A N   1 
ATOM   2748  C CA  . ARG A 1 343 ? 51.531  -25.085 16.143  1.00 71.05 ? 369  ARG A CA  1 
ATOM   2749  C C   . ARG A 1 343 ? 50.702  -25.621 17.310  1.00 70.83 ? 369  ARG A C   1 
ATOM   2750  O O   . ARG A 1 343 ? 49.579  -26.098 17.128  1.00 71.12 ? 369  ARG A O   1 
ATOM   2751  C CB  . ARG A 1 343 ? 51.248  -25.895 14.875  1.00 71.76 ? 369  ARG A CB  1 
ATOM   2752  C CG  . ARG A 1 343 ? 50.744  -25.055 13.708  1.00 72.91 ? 369  ARG A CG  1 
ATOM   2753  C CD  . ARG A 1 343 ? 49.393  -24.416 14.022  1.00 73.49 ? 369  ARG A CD  1 
ATOM   2754  N NE  . ARG A 1 343 ? 48.984  -23.446 13.006  1.00 74.21 ? 369  ARG A NE  1 
ATOM   2755  C CZ  . ARG A 1 343 ? 49.576  -22.271 12.806  1.00 74.44 ? 369  ARG A CZ  1 
ATOM   2756  N NH1 . ARG A 1 343 ? 50.611  -21.903 13.553  1.00 74.14 ? 369  ARG A NH1 1 
ATOM   2757  N NH2 . ARG A 1 343 ? 49.139  -21.462 11.851  1.00 74.05 ? 369  ARG A NH2 1 
ATOM   2758  N N   . SER A 1 344 ? 51.266  -25.536 18.510  1.00 70.16 ? 370  SER A N   1 
ATOM   2759  C CA  . SER A 1 344 ? 50.589  -26.002 19.715  1.00 69.53 ? 370  SER A CA  1 
ATOM   2760  C C   . SER A 1 344 ? 49.219  -25.337 19.856  1.00 68.91 ? 370  SER A C   1 
ATOM   2761  O O   . SER A 1 344 ? 49.015  -24.210 19.403  1.00 68.42 ? 370  SER A O   1 
ATOM   2762  C CB  . SER A 1 344 ? 51.449  -25.689 20.941  1.00 70.06 ? 370  SER A CB  1 
ATOM   2763  O OG  . SER A 1 344 ? 51.794  -24.312 20.977  1.00 70.42 ? 370  SER A OG  1 
ATOM   2764  N N   . PRO A 1 345 ? 48.259  -26.034 20.489  1.00 68.16 ? 371  PRO A N   1 
ATOM   2765  C CA  . PRO A 1 345 ? 46.911  -25.489 20.678  1.00 67.08 ? 371  PRO A CA  1 
ATOM   2766  C C   . PRO A 1 345 ? 46.907  -24.229 21.536  1.00 65.68 ? 371  PRO A C   1 
ATOM   2767  O O   . PRO A 1 345 ? 47.152  -24.281 22.740  1.00 65.62 ? 371  PRO A O   1 
ATOM   2768  C CB  . PRO A 1 345 ? 46.163  -26.647 21.333  1.00 67.42 ? 371  PRO A CB  1 
ATOM   2769  C CG  . PRO A 1 345 ? 47.241  -27.319 22.136  1.00 67.78 ? 371  PRO A CG  1 
ATOM   2770  C CD  . PRO A 1 345 ? 48.393  -27.341 21.156  1.00 68.23 ? 371  PRO A CD  1 
ATOM   2771  N N   . MET A 1 346 ? 46.630  -23.098 20.901  1.00 64.80 ? 372  MET A N   1 
ATOM   2772  C CA  . MET A 1 346 ? 46.588  -21.817 21.592  1.00 63.57 ? 372  MET A CA  1 
ATOM   2773  C C   . MET A 1 346 ? 45.401  -21.740 22.552  1.00 62.58 ? 372  MET A C   1 
ATOM   2774  O O   . MET A 1 346 ? 44.365  -22.366 22.326  1.00 62.31 ? 372  MET A O   1 
ATOM   2775  C CB  . MET A 1 346 ? 46.520  -20.685 20.562  1.00 62.78 ? 372  MET A CB  1 
ATOM   2776  C CG  . MET A 1 346 ? 45.537  -20.948 19.431  1.00 61.30 ? 372  MET A CG  1 
ATOM   2777  S SD  . MET A 1 346 ? 44.231  -19.714 19.325  1.00 58.43 ? 372  MET A SD  1 
ATOM   2778  C CE  . MET A 1 346 ? 43.056  -20.368 20.497  1.00 58.07 ? 372  MET A CE  1 
ATOM   2779  N N   . VAL A 1 347 ? 45.566  -20.974 23.627  1.00 61.40 ? 373  VAL A N   1 
ATOM   2780  C CA  . VAL A 1 347 ? 44.522  -20.810 24.632  1.00 59.85 ? 373  VAL A CA  1 
ATOM   2781  C C   . VAL A 1 347 ? 43.523  -19.721 24.245  1.00 58.69 ? 373  VAL A C   1 
ATOM   2782  O O   . VAL A 1 347 ? 43.820  -18.857 23.418  1.00 58.79 ? 373  VAL A O   1 
ATOM   2783  C CB  . VAL A 1 347 ? 45.127  -20.447 26.001  1.00 60.52 ? 373  VAL A CB  1 
ATOM   2784  C CG1 . VAL A 1 347 ? 45.884  -21.640 26.573  1.00 60.62 ? 373  VAL A CG1 1 
ATOM   2785  C CG2 . VAL A 1 347 ? 46.052  -19.248 25.850  1.00 60.52 ? 373  VAL A CG2 1 
ATOM   2786  N N   . PRO A 1 348 ? 42.322  -19.749 24.846  1.00 57.08 ? 374  PRO A N   1 
ATOM   2787  C CA  . PRO A 1 348 ? 41.277  -18.761 24.559  1.00 55.09 ? 374  PRO A CA  1 
ATOM   2788  C C   . PRO A 1 348 ? 41.786  -17.319 24.578  1.00 52.68 ? 374  PRO A C   1 
ATOM   2789  O O   . PRO A 1 348 ? 42.793  -17.003 25.220  1.00 51.73 ? 374  PRO A O   1 
ATOM   2790  C CB  . PRO A 1 348 ? 40.240  -19.037 25.643  1.00 56.03 ? 374  PRO A CB  1 
ATOM   2791  C CG  . PRO A 1 348 ? 40.348  -20.528 25.814  1.00 56.23 ? 374  PRO A CG  1 
ATOM   2792  C CD  . PRO A 1 348 ? 41.846  -20.740 25.830  1.00 57.17 ? 374  PRO A CD  1 
ATOM   2793  N N   . LEU A 1 349 ? 41.078  -16.451 23.864  1.00 49.43 ? 375  LEU A N   1 
ATOM   2794  C CA  . LEU A 1 349 ? 41.451  -15.047 23.769  1.00 45.93 ? 375  LEU A CA  1 
ATOM   2795  C C   . LEU A 1 349 ? 40.220  -14.157 23.879  1.00 43.55 ? 375  LEU A C   1 
ATOM   2796  O O   . LEU A 1 349 ? 39.114  -14.562 23.518  1.00 43.29 ? 375  LEU A O   1 
ATOM   2797  C CB  . LEU A 1 349 ? 42.152  -14.795 22.433  1.00 45.21 ? 375  LEU A CB  1 
ATOM   2798  C CG  . LEU A 1 349 ? 43.463  -15.557 22.219  1.00 44.04 ? 375  LEU A CG  1 
ATOM   2799  C CD1 . LEU A 1 349 ? 43.785  -15.609 20.733  1.00 44.34 ? 375  LEU A CD1 1 
ATOM   2800  C CD2 . LEU A 1 349 ? 44.582  -14.888 23.011  1.00 43.49 ? 375  LEU A CD2 1 
ATOM   2801  N N   . PRO A 1 350 ? 40.399  -12.928 24.380  1.00 41.57 ? 376  PRO A N   1 
ATOM   2802  C CA  . PRO A 1 350 ? 39.286  -11.987 24.530  1.00 39.55 ? 376  PRO A CA  1 
ATOM   2803  C C   . PRO A 1 350 ? 38.759  -11.464 23.196  1.00 37.87 ? 376  PRO A C   1 
ATOM   2804  O O   . PRO A 1 350 ? 39.455  -11.510 22.183  1.00 36.79 ? 376  PRO A O   1 
ATOM   2805  C CB  . PRO A 1 350 ? 39.890  -10.884 25.389  1.00 39.72 ? 376  PRO A CB  1 
ATOM   2806  C CG  . PRO A 1 350 ? 41.322  -10.866 24.940  1.00 39.98 ? 376  PRO A CG  1 
ATOM   2807  C CD  . PRO A 1 350 ? 41.661  -12.338 24.862  1.00 41.52 ? 376  PRO A CD  1 
ATOM   2808  N N   . MET A 1 351 ? 37.522  -10.972 23.208  1.00 37.14 ? 377  MET A N   1 
ATOM   2809  C CA  . MET A 1 351 ? 36.885  -10.428 22.011  1.00 37.27 ? 377  MET A CA  1 
ATOM   2810  C C   . MET A 1 351 ? 37.414  -9.016  21.736  1.00 36.81 ? 377  MET A C   1 
ATOM   2811  O O   . MET A 1 351 ? 37.283  -8.117  22.572  1.00 36.30 ? 377  MET A O   1 
ATOM   2812  C CB  . MET A 1 351 ? 35.361  -10.389 22.201  1.00 37.91 ? 377  MET A CB  1 
ATOM   2813  C CG  . MET A 1 351 ? 34.559  -9.744  21.064  1.00 39.04 ? 377  MET A CG  1 
ATOM   2814  S SD  . MET A 1 351 ? 34.622  -10.619 19.479  1.00 40.67 ? 377  MET A SD  1 
ATOM   2815  C CE  . MET A 1 351 ? 34.931  -9.275  18.353  1.00 39.80 ? 377  MET A CE  1 
ATOM   2816  N N   . PRO A 1 352 ? 38.038  -8.810  20.567  1.00 36.04 ? 378  PRO A N   1 
ATOM   2817  C CA  . PRO A 1 352 ? 38.574  -7.490  20.221  1.00 35.59 ? 378  PRO A CA  1 
ATOM   2818  C C   . PRO A 1 352 ? 37.518  -6.407  20.403  1.00 34.88 ? 378  PRO A C   1 
ATOM   2819  O O   . PRO A 1 352 ? 36.420  -6.503  19.858  1.00 36.04 ? 378  PRO A O   1 
ATOM   2820  C CB  . PRO A 1 352 ? 38.991  -7.667  18.766  1.00 34.56 ? 378  PRO A CB  1 
ATOM   2821  C CG  . PRO A 1 352 ? 39.448  -9.095  18.743  1.00 34.66 ? 378  PRO A CG  1 
ATOM   2822  C CD  . PRO A 1 352 ? 38.350  -9.792  19.515  1.00 35.36 ? 378  PRO A CD  1 
ATOM   2823  N N   . LYS A 1 353 ? 37.855  -5.381  21.177  1.00 34.66 ? 379  LYS A N   1 
ATOM   2824  C CA  . LYS A 1 353 ? 36.933  -4.288  21.442  1.00 33.73 ? 379  LYS A CA  1 
ATOM   2825  C C   . LYS A 1 353 ? 36.577  -3.547  20.161  1.00 33.31 ? 379  LYS A C   1 
ATOM   2826  O O   . LYS A 1 353 ? 37.447  -3.204  19.369  1.00 33.35 ? 379  LYS A O   1 
ATOM   2827  C CB  . LYS A 1 353 ? 37.550  -3.309  22.443  1.00 35.08 ? 379  LYS A CB  1 
ATOM   2828  C CG  . LYS A 1 353 ? 36.613  -2.189  22.856  1.00 37.19 ? 379  LYS A CG  1 
ATOM   2829  C CD  . LYS A 1 353 ? 37.274  -1.233  23.831  1.00 39.06 ? 379  LYS A CD  1 
ATOM   2830  C CE  . LYS A 1 353 ? 36.310  -0.135  24.251  1.00 40.07 ? 379  LYS A CE  1 
ATOM   2831  N NZ  . LYS A 1 353 ? 36.983  0.888   25.093  1.00 41.68 ? 379  LYS A NZ  1 
ATOM   2832  N N   . LYS A 1 354 ? 35.288  -3.298  19.964  1.00 32.52 ? 380  LYS A N   1 
ATOM   2833  C CA  . LYS A 1 354 ? 34.821  -2.588  18.782  1.00 31.96 ? 380  LYS A CA  1 
ATOM   2834  C C   . LYS A 1 354 ? 34.766  -1.087  19.068  1.00 30.80 ? 380  LYS A C   1 
ATOM   2835  O O   . LYS A 1 354 ? 34.030  -0.648  19.953  1.00 29.82 ? 380  LYS A O   1 
ATOM   2836  C CB  . LYS A 1 354 ? 33.442  -3.118  18.383  1.00 32.47 ? 380  LYS A CB  1 
ATOM   2837  C CG  . LYS A 1 354 ? 32.822  -2.431  17.196  1.00 34.17 ? 380  LYS A CG  1 
ATOM   2838  C CD  . LYS A 1 354 ? 31.556  -3.152  16.780  1.00 36.77 ? 380  LYS A CD  1 
ATOM   2839  C CE  . LYS A 1 354 ? 30.796  -2.358  15.744  1.00 39.32 ? 380  LYS A CE  1 
ATOM   2840  N NZ  . LYS A 1 354 ? 29.577  -3.072  15.281  1.00 42.13 ? 380  LYS A NZ  1 
ATOM   2841  N N   . LEU A 1 355 ? 35.556  -0.315  18.324  1.00 28.95 ? 381  LEU A N   1 
ATOM   2842  C CA  . LEU A 1 355 ? 35.617  1.138   18.486  1.00 29.04 ? 381  LEU A CA  1 
ATOM   2843  C C   . LEU A 1 355 ? 34.439  1.791   17.770  1.00 30.90 ? 381  LEU A C   1 
ATOM   2844  O O   . LEU A 1 355 ? 34.562  2.258   16.635  1.00 31.35 ? 381  LEU A O   1 
ATOM   2845  C CB  . LEU A 1 355 ? 36.931  1.670   17.913  1.00 27.14 ? 381  LEU A CB  1 
ATOM   2846  C CG  . LEU A 1 355 ? 38.202  0.964   18.399  1.00 25.91 ? 381  LEU A CG  1 
ATOM   2847  C CD1 . LEU A 1 355 ? 39.415  1.508   17.665  1.00 25.70 ? 381  LEU A CD1 1 
ATOM   2848  C CD2 . LEU A 1 355 ? 38.349  1.157   19.897  1.00 24.31 ? 381  LEU A CD2 1 
ATOM   2849  N N   . ARG A 1 356 ? 33.297  1.824   18.446  1.00 32.16 ? 382  ARG A N   1 
ATOM   2850  C CA  . ARG A 1 356 ? 32.081  2.391   17.875  1.00 32.80 ? 382  ARG A CA  1 
ATOM   2851  C C   . ARG A 1 356 ? 32.118  3.903   17.741  1.00 31.61 ? 382  ARG A C   1 
ATOM   2852  O O   . ARG A 1 356 ? 32.921  4.577   18.382  1.00 31.65 ? 382  ARG A O   1 
ATOM   2853  C CB  . ARG A 1 356 ? 30.872  1.978   18.718  1.00 36.55 ? 382  ARG A CB  1 
ATOM   2854  C CG  . ARG A 1 356 ? 30.578  0.484   18.672  1.00 41.22 ? 382  ARG A CG  1 
ATOM   2855  C CD  . ARG A 1 356 ? 29.372  0.120   19.530  1.00 44.76 ? 382  ARG A CD  1 
ATOM   2856  N NE  . ARG A 1 356 ? 28.899  -1.236  19.260  1.00 48.47 ? 382  ARG A NE  1 
ATOM   2857  C CZ  . ARG A 1 356 ? 27.849  -1.793  19.859  1.00 52.10 ? 382  ARG A CZ  1 
ATOM   2858  N NH1 . ARG A 1 356 ? 27.158  -1.114  20.773  1.00 53.49 ? 382  ARG A NH1 1 
ATOM   2859  N NH2 . ARG A 1 356 ? 27.471  -3.026  19.538  1.00 53.06 ? 382  ARG A NH2 1 
ATOM   2860  N N   . PHE A 1 357 ? 31.239  4.423   16.890  1.00 29.96 ? 383  PHE A N   1 
ATOM   2861  C CA  . PHE A 1 357 ? 31.129  5.855   16.649  1.00 29.62 ? 383  PHE A CA  1 
ATOM   2862  C C   . PHE A 1 357 ? 29.670  6.287   16.674  1.00 30.10 ? 383  PHE A C   1 
ATOM   2863  O O   . PHE A 1 357 ? 28.841  5.723   15.962  1.00 29.01 ? 383  PHE A O   1 
ATOM   2864  C CB  . PHE A 1 357 ? 31.725  6.222   15.284  1.00 29.67 ? 383  PHE A CB  1 
ATOM   2865  C CG  . PHE A 1 357 ? 33.216  6.404   15.294  1.00 29.86 ? 383  PHE A CG  1 
ATOM   2866  C CD1 . PHE A 1 357 ? 33.793  7.472   15.971  1.00 29.50 ? 383  PHE A CD1 1 
ATOM   2867  C CD2 . PHE A 1 357 ? 34.044  5.512   14.618  1.00 29.49 ? 383  PHE A CD2 1 
ATOM   2868  C CE1 . PHE A 1 357 ? 35.175  7.652   15.977  1.00 29.75 ? 383  PHE A CE1 1 
ATOM   2869  C CE2 . PHE A 1 357 ? 35.428  5.681   14.616  1.00 29.15 ? 383  PHE A CE2 1 
ATOM   2870  C CZ  . PHE A 1 357 ? 35.995  6.756   15.300  1.00 30.71 ? 383  PHE A CZ  1 
ATOM   2871  N N   . ASN A 1 358 ? 29.362  7.290   17.494  1.00 30.87 ? 384  ASN A N   1 
ATOM   2872  C CA  . ASN A 1 358 ? 28.004  7.818   17.590  1.00 31.04 ? 384  ASN A CA  1 
ATOM   2873  C C   . ASN A 1 358 ? 27.827  8.894   16.521  1.00 31.12 ? 384  ASN A C   1 
ATOM   2874  O O   . ASN A 1 358 ? 28.361  9.998   16.639  1.00 32.00 ? 384  ASN A O   1 
ATOM   2875  C CB  . ASN A 1 358 ? 27.751  8.416   18.976  1.00 33.30 ? 384  ASN A CB  1 
ATOM   2876  C CG  . ASN A 1 358 ? 27.663  7.358   20.060  1.00 34.55 ? 384  ASN A CG  1 
ATOM   2877  O OD1 . ASN A 1 358 ? 26.892  6.404   19.946  1.00 35.64 ? 384  ASN A OD1 1 
ATOM   2878  N ND2 . ASN A 1 358 ? 28.448  7.526   21.118  1.00 32.66 ? 384  ASN A ND2 1 
ATOM   2879  N N   . ILE A 1 359 ? 27.074  8.568   15.481  1.00 30.63 ? 385  ILE A N   1 
ATOM   2880  C CA  . ILE A 1 359 ? 26.844  9.496   14.382  1.00 29.24 ? 385  ILE A CA  1 
ATOM   2881  C C   . ILE A 1 359 ? 25.711  10.473  14.684  1.00 30.20 ? 385  ILE A C   1 
ATOM   2882  O O   . ILE A 1 359 ? 24.716  10.119  15.313  1.00 31.36 ? 385  ILE A O   1 
ATOM   2883  C CB  . ILE A 1 359 ? 26.518  8.727   13.086  1.00 27.89 ? 385  ILE A CB  1 
ATOM   2884  C CG1 . ILE A 1 359 ? 27.615  7.692   12.811  1.00 27.70 ? 385  ILE A CG1 1 
ATOM   2885  C CG2 . ILE A 1 359 ? 26.391  9.692   11.919  1.00 26.46 ? 385  ILE A CG2 1 
ATOM   2886  C CD1 . ILE A 1 359 ? 28.998  8.281   12.577  1.00 23.23 ? 385  ILE A CD1 1 
ATOM   2887  N N   . THR A 1 360 ? 25.881  11.713  14.245  1.00 29.00 ? 386  THR A N   1 
ATOM   2888  C CA  . THR A 1 360 ? 24.875  12.735  14.452  1.00 28.69 ? 386  THR A CA  1 
ATOM   2889  C C   . THR A 1 360 ? 24.641  13.390  13.104  1.00 29.58 ? 386  THR A C   1 
ATOM   2890  O O   . THR A 1 360 ? 25.395  13.172  12.159  1.00 30.88 ? 386  THR A O   1 
ATOM   2891  C CB  . THR A 1 360 ? 25.348  13.817  15.448  1.00 28.86 ? 386  THR A CB  1 
ATOM   2892  O OG1 . THR A 1 360 ? 26.417  14.576  14.863  1.00 27.34 ? 386  THR A OG1 1 
ATOM   2893  C CG2 . THR A 1 360 ? 25.826  13.176  16.749  1.00 26.87 ? 386  THR A CG2 1 
ATOM   2894  N N   . PRO A 1 361 ? 23.574  14.185  12.987  1.00 29.67 ? 387  PRO A N   1 
ATOM   2895  C CA  . PRO A 1 361 ? 23.289  14.855  11.718  1.00 29.78 ? 387  PRO A CA  1 
ATOM   2896  C C   . PRO A 1 361 ? 24.473  15.684  11.219  1.00 30.10 ? 387  PRO A C   1 
ATOM   2897  O O   . PRO A 1 361 ? 24.730  15.759  10.017  1.00 30.73 ? 387  PRO A O   1 
ATOM   2898  C CB  . PRO A 1 361 ? 22.077  15.714  12.057  1.00 30.29 ? 387  PRO A CB  1 
ATOM   2899  C CG  . PRO A 1 361 ? 21.355  14.862  13.061  1.00 28.66 ? 387  PRO A CG  1 
ATOM   2900  C CD  . PRO A 1 361 ? 22.477  14.390  13.948  1.00 29.31 ? 387  PRO A CD  1 
ATOM   2901  N N   . GLU A 1 362 ? 25.200  16.299  12.146  1.00 29.46 ? 388  GLU A N   1 
ATOM   2902  C CA  . GLU A 1 362 ? 26.341  17.132  11.780  1.00 29.15 ? 388  GLU A CA  1 
ATOM   2903  C C   . GLU A 1 362 ? 27.504  16.286  11.275  1.00 27.93 ? 388  GLU A C   1 
ATOM   2904  O O   . GLU A 1 362 ? 28.135  16.615  10.269  1.00 28.77 ? 388  GLU A O   1 
ATOM   2905  C CB  . GLU A 1 362 ? 26.793  17.976  12.976  1.00 30.03 ? 388  GLU A CB  1 
ATOM   2906  C CG  . GLU A 1 362 ? 27.678  19.154  12.583  1.00 34.68 ? 388  GLU A CG  1 
ATOM   2907  C CD  . GLU A 1 362 ? 28.105  20.000  13.772  1.00 36.63 ? 388  GLU A CD  1 
ATOM   2908  O OE1 . GLU A 1 362 ? 27.271  20.246  14.670  1.00 38.35 ? 388  GLU A OE1 1 
ATOM   2909  O OE2 . GLU A 1 362 ? 29.274  20.438  13.800  1.00 36.37 ? 388  GLU A OE2 1 
ATOM   2910  N N   . ILE A 1 363 ? 27.786  15.200  11.983  1.00 26.04 ? 389  ILE A N   1 
ATOM   2911  C CA  . ILE A 1 363 ? 28.857  14.290  11.600  1.00 24.82 ? 389  ILE A CA  1 
ATOM   2912  C C   . ILE A 1 363 ? 28.530  13.687  10.235  1.00 24.21 ? 389  ILE A C   1 
ATOM   2913  O O   . ILE A 1 363 ? 29.396  13.573  9.368   1.00 23.00 ? 389  ILE A O   1 
ATOM   2914  C CB  . ILE A 1 363 ? 28.999  13.155  12.633  1.00 24.84 ? 389  ILE A CB  1 
ATOM   2915  C CG1 . ILE A 1 363 ? 29.443  13.737  13.980  1.00 24.34 ? 389  ILE A CG1 1 
ATOM   2916  C CG2 . ILE A 1 363 ? 29.980  12.108  12.132  1.00 22.86 ? 389  ILE A CG2 1 
ATOM   2917  C CD1 . ILE A 1 363 ? 29.432  12.730  15.110  1.00 24.15 ? 389  ILE A CD1 1 
ATOM   2918  N N   . LYS A 1 364 ? 27.271  13.301  10.053  1.00 23.24 ? 390  LYS A N   1 
ATOM   2919  C CA  . LYS A 1 364 ? 26.828  12.716  8.792   1.00 23.65 ? 390  LYS A CA  1 
ATOM   2920  C C   . LYS A 1 364 ? 27.130  13.692  7.660   1.00 24.12 ? 390  LYS A C   1 
ATOM   2921  O O   . LYS A 1 364 ? 27.693  13.316  6.630   1.00 23.77 ? 390  LYS A O   1 
ATOM   2922  C CB  . LYS A 1 364 ? 25.325  12.418  8.849   1.00 24.52 ? 390  LYS A CB  1 
ATOM   2923  C CG  . LYS A 1 364 ? 24.714  11.950  7.542   1.00 27.45 ? 390  LYS A CG  1 
ATOM   2924  C CD  . LYS A 1 364 ? 25.340  10.652  7.057   1.00 28.77 ? 390  LYS A CD  1 
ATOM   2925  C CE  . LYS A 1 364 ? 24.682  10.181  5.773   1.00 28.74 ? 390  LYS A CE  1 
ATOM   2926  N NZ  . LYS A 1 364 ? 25.339  8.956   5.240   1.00 30.40 ? 390  LYS A NZ  1 
ATOM   2927  N N   . ASN A 1 365 ? 26.771  14.957  7.863   1.00 23.73 ? 391  ASN A N   1 
ATOM   2928  C CA  . ASN A 1 365 ? 27.013  15.978  6.854   1.00 25.18 ? 391  ASN A CA  1 
ATOM   2929  C C   . ASN A 1 365 ? 28.504  16.077  6.528   1.00 24.48 ? 391  ASN A C   1 
ATOM   2930  O O   . ASN A 1 365 ? 28.876  16.227  5.362   1.00 24.51 ? 391  ASN A O   1 
ATOM   2931  C CB  . ASN A 1 365 ? 26.489  17.332  7.336   1.00 26.02 ? 391  ASN A CB  1 
ATOM   2932  C CG  . ASN A 1 365 ? 26.768  18.444  6.353   1.00 28.85 ? 391  ASN A CG  1 
ATOM   2933  O OD1 . ASN A 1 365 ? 26.333  18.398  5.199   1.00 31.99 ? 391  ASN A OD1 1 
ATOM   2934  N ND2 . ASN A 1 365 ? 27.503  19.457  6.796   1.00 31.40 ? 391  ASN A ND2 1 
ATOM   2935  N N   . ASP A 1 366 ? 29.347  15.995  7.558   1.00 23.10 ? 392  ASP A N   1 
ATOM   2936  C CA  . ASP A 1 366 ? 30.794  16.065  7.373   1.00 21.72 ? 392  ASP A CA  1 
ATOM   2937  C C   . ASP A 1 366 ? 31.297  14.881  6.540   1.00 21.08 ? 392  ASP A C   1 
ATOM   2938  O O   . ASP A 1 366 ? 32.162  15.036  5.683   1.00 21.71 ? 392  ASP A O   1 
ATOM   2939  C CB  . ASP A 1 366 ? 31.519  16.077  8.726   1.00 19.14 ? 392  ASP A CB  1 
ATOM   2940  C CG  . ASP A 1 366 ? 31.322  17.379  9.498   1.00 20.30 ? 392  ASP A CG  1 
ATOM   2941  O OD1 . ASP A 1 366 ? 31.329  18.464  8.880   1.00 19.54 ? 392  ASP A OD1 1 
ATOM   2942  O OD2 . ASP A 1 366 ? 31.186  17.315  10.740  1.00 19.44 ? 392  ASP A OD2 1 
ATOM   2943  N N   . ILE A 1 367 ? 30.755  13.698  6.799   1.00 21.19 ? 393  ILE A N   1 
ATOM   2944  C CA  . ILE A 1 367 ? 31.151  12.501  6.062   1.00 21.90 ? 393  ILE A CA  1 
ATOM   2945  C C   . ILE A 1 367 ? 30.800  12.649  4.580   1.00 22.59 ? 393  ILE A C   1 
ATOM   2946  O O   . ILE A 1 367 ? 31.605  12.320  3.702   1.00 22.69 ? 393  ILE A O   1 
ATOM   2947  C CB  . ILE A 1 367 ? 30.450  11.249  6.640   1.00 21.62 ? 393  ILE A CB  1 
ATOM   2948  C CG1 . ILE A 1 367 ? 30.916  11.028  8.080   1.00 22.26 ? 393  ILE A CG1 1 
ATOM   2949  C CG2 . ILE A 1 367 ? 30.752  10.021  5.789   1.00 21.26 ? 393  ILE A CG2 1 
ATOM   2950  C CD1 . ILE A 1 367 ? 30.180  9.929   8.808   1.00 22.06 ? 393  ILE A CD1 1 
ATOM   2951  N N   . GLU A 1 368 ? 29.598  13.157  4.306   1.00 23.15 ? 394  GLU A N   1 
ATOM   2952  C CA  . GLU A 1 368 ? 29.148  13.347  2.934   1.00 24.14 ? 394  GLU A CA  1 
ATOM   2953  C C   . GLU A 1 368 ? 30.015  14.368  2.224   1.00 23.67 ? 394  GLU A C   1 
ATOM   2954  O O   . GLU A 1 368 ? 30.386  14.181  1.068   1.00 24.17 ? 394  GLU A O   1 
ATOM   2955  C CB  . GLU A 1 368 ? 27.677  13.777  2.920   1.00 26.56 ? 394  GLU A CB  1 
ATOM   2956  C CG  . GLU A 1 368 ? 26.741  12.688  3.437   1.00 28.83 ? 394  GLU A CG  1 
ATOM   2957  C CD  . GLU A 1 368 ? 26.758  11.450  2.555   1.00 30.35 ? 394  GLU A CD  1 
ATOM   2958  O OE1 . GLU A 1 368 ? 26.606  10.325  3.077   1.00 31.08 ? 394  GLU A OE1 1 
ATOM   2959  O OE2 . GLU A 1 368 ? 26.915  11.609  1.327   1.00 31.63 ? 394  GLU A OE2 1 
ATOM   2960  N N   . LYS A 1 369 ? 30.356  15.447  2.918   1.00 24.11 ? 395  LYS A N   1 
ATOM   2961  C CA  . LYS A 1 369 ? 31.203  16.467  2.319   1.00 25.14 ? 395  LYS A CA  1 
ATOM   2962  C C   . LYS A 1 369 ? 32.564  15.866  1.994   1.00 23.60 ? 395  LYS A C   1 
ATOM   2963  O O   . LYS A 1 369 ? 33.172  16.201  0.986   1.00 24.13 ? 395  LYS A O   1 
ATOM   2964  C CB  . LYS A 1 369 ? 31.375  17.654  3.272   1.00 27.03 ? 395  LYS A CB  1 
ATOM   2965  C CG  . LYS A 1 369 ? 30.080  18.364  3.611   1.00 30.13 ? 395  LYS A CG  1 
ATOM   2966  C CD  . LYS A 1 369 ? 29.497  19.106  2.412   1.00 33.66 ? 395  LYS A CD  1 
ATOM   2967  C CE  . LYS A 1 369 ? 30.334  20.319  2.028   1.00 36.06 ? 395  LYS A CE  1 
ATOM   2968  N NZ  . LYS A 1 369 ? 29.725  21.067  0.889   1.00 37.05 ? 395  LYS A NZ  1 
ATOM   2969  N N   . ALA A 1 370 ? 33.037  14.976  2.865   1.00 23.10 ? 396  ALA A N   1 
ATOM   2970  C CA  . ALA A 1 370 ? 34.318  14.317  2.661   1.00 21.20 ? 396  ALA A CA  1 
ATOM   2971  C C   . ALA A 1 370 ? 34.229  13.397  1.442   1.00 21.10 ? 396  ALA A C   1 
ATOM   2972  O O   . ALA A 1 370 ? 35.175  13.324  0.651   1.00 20.95 ? 396  ALA A O   1 
ATOM   2973  C CB  . ALA A 1 370 ? 34.703  13.513  3.895   1.00 18.69 ? 396  ALA A CB  1 
ATOM   2974  N N   . LYS A 1 371 ? 33.102  12.701  1.286   1.00 20.86 ? 397  LYS A N   1 
ATOM   2975  C CA  . LYS A 1 371 ? 32.916  11.802  0.142   1.00 20.81 ? 397  LYS A CA  1 
ATOM   2976  C C   . LYS A 1 371 ? 33.019  12.599  -1.144  1.00 21.12 ? 397  LYS A C   1 
ATOM   2977  O O   . LYS A 1 371 ? 33.698  12.199  -2.088  1.00 21.70 ? 397  LYS A O   1 
ATOM   2978  C CB  . LYS A 1 371 ? 31.539  11.138  0.174   1.00 21.20 ? 397  LYS A CB  1 
ATOM   2979  C CG  . LYS A 1 371 ? 31.340  10.104  1.265   1.00 21.57 ? 397  LYS A CG  1 
ATOM   2980  C CD  . LYS A 1 371 ? 29.900  9.615   1.270   1.00 23.62 ? 397  LYS A CD  1 
ATOM   2981  C CE  . LYS A 1 371 ? 29.701  8.464   2.238   1.00 22.87 ? 397  LYS A CE  1 
ATOM   2982  N NZ  . LYS A 1 371 ? 28.296  7.976   2.182   1.00 24.19 ? 397  LYS A NZ  1 
ATOM   2983  N N   . GLN A 1 372 ? 32.327  13.735  -1.164  1.00 20.74 ? 398  GLN A N   1 
ATOM   2984  C CA  . GLN A 1 372 ? 32.306  14.618  -2.319  1.00 22.03 ? 398  GLN A CA  1 
ATOM   2985  C C   . GLN A 1 372 ? 33.700  15.105  -2.647  1.00 20.88 ? 398  GLN A C   1 
ATOM   2986  O O   . GLN A 1 372 ? 34.120  15.103  -3.801  1.00 20.78 ? 398  GLN A O   1 
ATOM   2987  C CB  . GLN A 1 372 ? 31.389  15.809  -2.039  1.00 25.55 ? 398  GLN A CB  1 
ATOM   2988  C CG  . GLN A 1 372 ? 29.926  15.417  -1.885  1.00 32.54 ? 398  GLN A CG  1 
ATOM   2989  C CD  . GLN A 1 372 ? 29.098  16.469  -1.170  1.00 37.30 ? 398  GLN A CD  1 
ATOM   2990  O OE1 . GLN A 1 372 ? 29.182  17.662  -1.473  1.00 38.30 ? 398  GLN A OE1 1 
ATOM   2991  N NE2 . GLN A 1 372 ? 28.280  16.028  -0.219  1.00 36.83 ? 398  GLN A NE2 1 
ATOM   2992  N N   . ASN A 1 373 ? 34.424  15.538  -1.618  1.00 19.33 ? 399  ASN A N   1 
ATOM   2993  C CA  . ASN A 1 373 ? 35.775  16.029  -1.816  1.00 17.23 ? 399  ASN A CA  1 
ATOM   2994  C C   . ASN A 1 373 ? 36.669  14.936  -2.383  1.00 16.47 ? 399  ASN A C   1 
ATOM   2995  O O   . ASN A 1 373 ? 37.390  15.153  -3.357  1.00 16.98 ? 399  ASN A O   1 
ATOM   2996  C CB  . ASN A 1 373 ? 36.372  16.499  -0.492  1.00 18.15 ? 399  ASN A CB  1 
ATOM   2997  C CG  . ASN A 1 373 ? 37.825  16.912  -0.634  1.00 16.58 ? 399  ASN A CG  1 
ATOM   2998  O OD1 . ASN A 1 373 ? 38.129  17.942  -1.236  1.00 15.63 ? 399  ASN A OD1 1 
ATOM   2999  N ND2 . ASN A 1 373 ? 38.726  16.097  -0.100  1.00 14.72 ? 399  ASN A ND2 1 
ATOM   3000  N N   . LEU A 1 374 ? 36.629  13.764  -1.752  1.00 15.75 ? 400  LEU A N   1 
ATOM   3001  C CA  . LEU A 1 374 ? 37.462  12.643  -2.168  1.00 16.71 ? 400  LEU A CA  1 
ATOM   3002  C C   . LEU A 1 374 ? 37.132  12.191  -3.585  1.00 17.75 ? 400  LEU A C   1 
ATOM   3003  O O   . LEU A 1 374 ? 38.023  11.796  -4.341  1.00 19.56 ? 400  LEU A O   1 
ATOM   3004  C CB  . LEU A 1 374 ? 37.307  11.466  -1.204  1.00 15.77 ? 400  LEU A CB  1 
ATOM   3005  C CG  . LEU A 1 374 ? 38.211  10.258  -1.491  1.00 18.44 ? 400  LEU A CG  1 
ATOM   3006  C CD1 . LEU A 1 374 ? 39.675  10.690  -1.606  1.00 16.34 ? 400  LEU A CD1 1 
ATOM   3007  C CD2 . LEU A 1 374 ? 38.039  9.234   -0.384  1.00 18.51 ? 400  LEU A CD2 1 
ATOM   3008  N N   . SER A 1 375 ? 35.854  12.258  -3.943  1.00 17.88 ? 401  SER A N   1 
ATOM   3009  C CA  . SER A 1 375 ? 35.418  11.879  -5.279  1.00 19.09 ? 401  SER A CA  1 
ATOM   3010  C C   . SER A 1 375 ? 36.100  12.775  -6.308  1.00 17.73 ? 401  SER A C   1 
ATOM   3011  O O   . SER A 1 375 ? 36.594  12.298  -7.328  1.00 16.87 ? 401  SER A O   1 
ATOM   3012  C CB  . SER A 1 375 ? 33.905  12.016  -5.391  1.00 20.12 ? 401  SER A CB  1 
ATOM   3013  O OG  . SER A 1 375 ? 33.482  11.615  -6.676  1.00 25.88 ? 401  SER A OG  1 
ATOM   3014  N N   . ILE A 1 376 ? 36.117  14.084  -6.043  1.00 16.25 ? 402  ILE A N   1 
ATOM   3015  C CA  . ILE A 1 376 ? 36.762  15.031  -6.939  1.00 15.99 ? 402  ILE A CA  1 
ATOM   3016  C C   . ILE A 1 376 ? 38.255  14.712  -7.066  1.00 15.91 ? 402  ILE A C   1 
ATOM   3017  O O   . ILE A 1 376 ? 38.794  14.643  -8.169  1.00 13.12 ? 402  ILE A O   1 
ATOM   3018  C CB  . ILE A 1 376 ? 36.582  16.486  -6.429  1.00 18.67 ? 402  ILE A CB  1 
ATOM   3019  C CG1 . ILE A 1 376 ? 35.098  16.863  -6.477  1.00 20.02 ? 402  ILE A CG1 1 
ATOM   3020  C CG2 . ILE A 1 376 ? 37.415  17.459  -7.269  1.00 15.82 ? 402  ILE A CG2 1 
ATOM   3021  C CD1 . ILE A 1 376 ? 34.786  18.222  -5.910  1.00 21.05 ? 402  ILE A CD1 1 
ATOM   3022  N N   . MET A 1 377 ? 38.922  14.505  -5.929  1.00 15.24 ? 403  MET A N   1 
ATOM   3023  C CA  . MET A 1 377 ? 40.356  14.197  -5.923  1.00 14.95 ? 403  MET A CA  1 
ATOM   3024  C C   . MET A 1 377 ? 40.686  12.986  -6.797  1.00 14.34 ? 403  MET A C   1 
ATOM   3025  O O   . MET A 1 377 ? 41.571  13.042  -7.652  1.00 15.64 ? 403  MET A O   1 
ATOM   3026  C CB  . MET A 1 377 ? 40.831  13.910  -4.490  1.00 14.13 ? 403  MET A CB  1 
ATOM   3027  C CG  . MET A 1 377 ? 40.877  15.131  -3.571  1.00 17.23 ? 403  MET A CG  1 
ATOM   3028  S SD  . MET A 1 377 ? 40.931  14.674  -1.813  1.00 17.38 ? 403  MET A SD  1 
ATOM   3029  C CE  . MET A 1 377 ? 42.475  13.790  -1.747  1.00 12.84 ? 403  MET A CE  1 
ATOM   3030  N N   . ILE A 1 378 ? 39.982  11.890  -6.569  1.00 15.67 ? 404  ILE A N   1 
ATOM   3031  C CA  . ILE A 1 378 ? 40.220  10.663  -7.312  1.00 17.06 ? 404  ILE A CA  1 
ATOM   3032  C C   . ILE A 1 378 ? 39.964  10.852  -8.804  1.00 18.67 ? 404  ILE A C   1 
ATOM   3033  O O   . ILE A 1 378 ? 40.778  10.448  -9.634  1.00 19.83 ? 404  ILE A O   1 
ATOM   3034  C CB  . ILE A 1 378 ? 39.338  9.523   -6.765  1.00 17.24 ? 404  ILE A CB  1 
ATOM   3035  C CG1 . ILE A 1 378 ? 39.741  9.209   -5.316  1.00 16.92 ? 404  ILE A CG1 1 
ATOM   3036  C CG2 . ILE A 1 378 ? 39.460  8.296   -7.652  1.00 17.49 ? 404  ILE A CG2 1 
ATOM   3037  C CD1 . ILE A 1 378 ? 38.853  8.170   -4.631  1.00 16.04 ? 404  ILE A CD1 1 
ATOM   3038  N N   . GLN A 1 379 ? 38.847  11.478  -9.151  1.00 19.40 ? 405  GLN A N   1 
ATOM   3039  C CA  . GLN A 1 379 ? 38.526  11.684  -10.558 1.00 20.90 ? 405  GLN A CA  1 
ATOM   3040  C C   . GLN A 1 379 ? 39.611  12.461  -11.287 1.00 18.90 ? 405  GLN A C   1 
ATOM   3041  O O   . GLN A 1 379 ? 39.831  12.266  -12.478 1.00 17.11 ? 405  GLN A O   1 
ATOM   3042  C CB  . GLN A 1 379 ? 37.189  12.419  -10.704 1.00 24.04 ? 405  GLN A CB  1 
ATOM   3043  C CG  . GLN A 1 379 ? 35.967  11.616  -10.266 1.00 31.07 ? 405  GLN A CG  1 
ATOM   3044  C CD  . GLN A 1 379 ? 34.685  12.428  -10.371 1.00 36.30 ? 405  GLN A CD  1 
ATOM   3045  O OE1 . GLN A 1 379 ? 34.399  13.024  -11.411 1.00 39.53 ? 405  GLN A OE1 1 
ATOM   3046  N NE2 . GLN A 1 379 ? 33.903  12.450  -9.298  1.00 37.54 ? 405  GLN A NE2 1 
ATOM   3047  N N   . ASP A 1 380 ? 40.305  13.334  -10.568 1.00 16.88 ? 406  ASP A N   1 
ATOM   3048  C CA  . ASP A 1 380 ? 41.342  14.138  -11.185 1.00 15.69 ? 406  ASP A CA  1 
ATOM   3049  C C   . ASP A 1 380 ? 42.733  13.494  -11.225 1.00 15.77 ? 406  ASP A C   1 
ATOM   3050  O O   . ASP A 1 380 ? 43.636  14.003  -11.886 1.00 14.76 ? 406  ASP A O   1 
ATOM   3051  C CB  . ASP A 1 380 ? 41.411  15.488  -10.469 1.00 18.02 ? 406  ASP A CB  1 
ATOM   3052  C CG  . ASP A 1 380 ? 42.299  16.472  -11.172 1.00 18.15 ? 406  ASP A CG  1 
ATOM   3053  O OD1 . ASP A 1 380 ? 42.168  16.623  -12.405 1.00 21.78 ? 406  ASP A OD1 1 
ATOM   3054  O OD2 . ASP A 1 380 ? 43.123  17.103  -10.485 1.00 22.27 ? 406  ASP A OD2 1 
ATOM   3055  N N   . LEU A 1 381 ? 42.899  12.368  -10.528 1.00 15.65 ? 407  LEU A N   1 
ATOM   3056  C CA  . LEU A 1 381 ? 44.186  11.671  -10.473 1.00 14.99 ? 407  LEU A CA  1 
ATOM   3057  C C   . LEU A 1 381 ? 44.378  10.695  -11.632 1.00 14.11 ? 407  LEU A C   1 
ATOM   3058  O O   . LEU A 1 381 ? 43.557  9.803   -11.849 1.00 15.22 ? 407  LEU A O   1 
ATOM   3059  C CB  . LEU A 1 381 ? 44.335  10.914  -9.149  1.00 14.21 ? 407  LEU A CB  1 
ATOM   3060  C CG  . LEU A 1 381 ? 45.692  10.226  -8.955  1.00 12.43 ? 407  LEU A CG  1 
ATOM   3061  C CD1 . LEU A 1 381 ? 46.792  11.264  -9.049  1.00 10.88 ? 407  LEU A CD1 1 
ATOM   3062  C CD2 . LEU A 1 381 ? 45.755  9.518   -7.612  1.00 13.03 ? 407  LEU A CD2 1 
ATOM   3063  N N   . ASP A 1 382 ? 45.467  10.873  -12.366 1.00 14.37 ? 408  ASP A N   1 
ATOM   3064  C CA  . ASP A 1 382 ? 45.791  10.033  -13.522 1.00 15.73 ? 408  ASP A CA  1 
ATOM   3065  C C   . ASP A 1 382 ? 47.024  9.206   -13.186 1.00 15.97 ? 408  ASP A C   1 
ATOM   3066  O O   . ASP A 1 382 ? 48.117  9.745   -13.044 1.00 17.97 ? 408  ASP A O   1 
ATOM   3067  C CB  . ASP A 1 382 ? 46.041  10.928  -14.747 1.00 14.43 ? 408  ASP A CB  1 
ATOM   3068  C CG  . ASP A 1 382 ? 46.598  10.164  -15.952 1.00 14.44 ? 408  ASP A CG  1 
ATOM   3069  O OD1 . ASP A 1 382 ? 46.429  8.928   -16.036 1.00 15.54 ? 408  ASP A OD1 1 
ATOM   3070  O OD2 . ASP A 1 382 ? 47.203  10.814  -16.832 1.00 13.39 ? 408  ASP A OD2 1 
ATOM   3071  N N   . ILE A 1 383 ? 46.846  7.898   -13.055 1.00 16.68 ? 409  ILE A N   1 
ATOM   3072  C CA  . ILE A 1 383 ? 47.953  7.016   -12.716 1.00 18.29 ? 409  ILE A CA  1 
ATOM   3073  C C   . ILE A 1 383 ? 48.319  6.007   -13.797 1.00 17.73 ? 409  ILE A C   1 
ATOM   3074  O O   . ILE A 1 383 ? 47.453  5.468   -14.491 1.00 18.41 ? 409  ILE A O   1 
ATOM   3075  C CB  . ILE A 1 383 ? 47.667  6.221   -11.420 1.00 18.50 ? 409  ILE A CB  1 
ATOM   3076  C CG1 . ILE A 1 383 ? 47.511  7.189   -10.244 1.00 20.66 ? 409  ILE A CG1 1 
ATOM   3077  C CG2 . ILE A 1 383 ? 48.805  5.242   -11.150 1.00 19.59 ? 409  ILE A CG2 1 
ATOM   3078  C CD1 . ILE A 1 383 ? 47.055  6.520   -8.946  1.00 23.12 ? 409  ILE A CD1 1 
ATOM   3079  N N   . MET A 1 384 ? 49.606  5.750   -13.924 1.00 17.29 ? 410  MET A N   1 
ATOM   3080  C CA  . MET A 1 384 ? 50.079  4.769   -14.886 1.00 17.50 ? 410  MET A CA  1 
ATOM   3081  C C   . MET A 1 384 ? 51.223  3.978   -14.272 1.00 16.83 ? 410  MET A C   1 
ATOM   3082  O O   . MET A 1 384 ? 52.279  4.541   -13.968 1.00 14.80 ? 410  MET A O   1 
ATOM   3083  C CB  . MET A 1 384 ? 50.537  5.447   -16.178 1.00 19.08 ? 410  MET A CB  1 
ATOM   3084  C CG  . MET A 1 384 ? 51.146  4.485   -17.200 1.00 22.10 ? 410  MET A CG  1 
ATOM   3085  S SD  . MET A 1 384 ? 50.133  3.024   -17.551 1.00 26.84 ? 410  MET A SD  1 
ATOM   3086  C CE  . MET A 1 384 ? 49.016  3.665   -18.756 1.00 27.52 ? 410  MET A CE  1 
ATOM   3087  N N   . MET A 1 385 ? 51.001  2.682   -14.064 1.00 15.34 ? 411  MET A N   1 
ATOM   3088  C CA  . MET A 1 385 ? 52.022  1.803   -13.494 1.00 15.10 ? 411  MET A CA  1 
ATOM   3089  C C   . MET A 1 385 ? 52.802  1.120   -14.620 1.00 17.27 ? 411  MET A C   1 
ATOM   3090  O O   . MET A 1 385 ? 52.225  0.416   -15.450 1.00 17.74 ? 411  MET A O   1 
ATOM   3091  C CB  . MET A 1 385 ? 51.373  0.747   -12.602 1.00 15.59 ? 411  MET A CB  1 
ATOM   3092  C CG  . MET A 1 385 ? 50.518  1.327   -11.494 1.00 13.71 ? 411  MET A CG  1 
ATOM   3093  S SD  . MET A 1 385 ? 51.487  2.427   -10.442 1.00 17.31 ? 411  MET A SD  1 
ATOM   3094  C CE  . MET A 1 385 ? 52.225  1.261   -9.336  1.00 10.12 ? 411  MET A CE  1 
ATOM   3095  N N   . LEU A 1 386 ? 54.111  1.326   -14.645 1.00 15.94 ? 412  LEU A N   1 
ATOM   3096  C CA  . LEU A 1 386 ? 54.945  0.741   -15.688 1.00 15.87 ? 412  LEU A CA  1 
ATOM   3097  C C   . LEU A 1 386 ? 56.005  -0.209  -15.152 1.00 16.03 ? 412  LEU A C   1 
ATOM   3098  O O   . LEU A 1 386 ? 56.868  0.180   -14.362 1.00 13.83 ? 412  LEU A O   1 
ATOM   3099  C CB  . LEU A 1 386 ? 55.635  1.848   -16.492 1.00 16.81 ? 412  LEU A CB  1 
ATOM   3100  C CG  . LEU A 1 386 ? 56.834  1.465   -17.369 1.00 18.52 ? 412  LEU A CG  1 
ATOM   3101  C CD1 . LEU A 1 386 ? 56.348  0.736   -18.610 1.00 18.08 ? 412  LEU A CD1 1 
ATOM   3102  C CD2 . LEU A 1 386 ? 57.616  2.720   -17.750 1.00 18.38 ? 412  LEU A CD2 1 
ATOM   3103  N N   . THR A 1 387 ? 55.931  -1.461  -15.577 1.00 15.03 ? 413  THR A N   1 
ATOM   3104  C CA  . THR A 1 387 ? 56.921  -2.446  -15.180 1.00 15.21 ? 413  THR A CA  1 
ATOM   3105  C C   . THR A 1 387 ? 57.914  -2.538  -16.337 1.00 14.96 ? 413  THR A C   1 
ATOM   3106  O O   . THR A 1 387 ? 57.618  -3.157  -17.356 1.00 16.75 ? 413  THR A O   1 
ATOM   3107  C CB  . THR A 1 387 ? 56.287  -3.831  -14.958 1.00 15.94 ? 413  THR A CB  1 
ATOM   3108  O OG1 . THR A 1 387 ? 55.384  -3.778  -13.844 1.00 18.12 ? 413  THR A OG1 1 
ATOM   3109  C CG2 . THR A 1 387 ? 57.365  -4.863  -14.675 1.00 16.86 ? 413  THR A CG2 1 
ATOM   3110  N N   . PHE A 1 388 ? 59.068  -1.893  -16.188 1.00 15.21 ? 414  PHE A N   1 
ATOM   3111  C CA  . PHE A 1 388 ? 60.121  -1.902  -17.201 1.00 13.75 ? 414  PHE A CA  1 
ATOM   3112  C C   . PHE A 1 388 ? 60.839  -3.251  -17.075 1.00 15.80 ? 414  PHE A C   1 
ATOM   3113  O O   . PHE A 1 388 ? 61.714  -3.402  -16.214 1.00 14.29 ? 414  PHE A O   1 
ATOM   3114  C CB  . PHE A 1 388 ? 61.112  -0.765  -16.924 1.00 12.43 ? 414  PHE A CB  1 
ATOM   3115  C CG  . PHE A 1 388 ? 62.032  -0.462  -18.071 1.00 13.26 ? 414  PHE A CG  1 
ATOM   3116  C CD1 . PHE A 1 388 ? 61.582  0.292   -19.148 1.00 13.56 ? 414  PHE A CD1 1 
ATOM   3117  C CD2 . PHE A 1 388 ? 63.345  -0.920  -18.077 1.00 12.54 ? 414  PHE A CD2 1 
ATOM   3118  C CE1 . PHE A 1 388 ? 62.413  0.590   -20.209 1.00 10.45 ? 414  PHE A CE1 1 
ATOM   3119  C CE2 . PHE A 1 388 ? 64.193  -0.628  -19.141 1.00 11.24 ? 414  PHE A CE2 1 
ATOM   3120  C CZ  . PHE A 1 388 ? 63.729  0.130   -20.210 1.00 12.13 ? 414  PHE A CZ  1 
ATOM   3121  N N   . HIS A 1 389 ? 60.472  -4.226  -17.913 1.00 14.76 ? 415  HIS A N   1 
ATOM   3122  C CA  . HIS A 1 389 ? 61.074  -5.568  -17.838 1.00 16.12 ? 415  HIS A CA  1 
ATOM   3123  C C   . HIS A 1 389 ? 62.346  -5.692  -18.655 1.00 15.77 ? 415  HIS A C   1 
ATOM   3124  O O   . HIS A 1 389 ? 63.138  -6.609  -18.445 1.00 16.79 ? 415  HIS A O   1 
ATOM   3125  C CB  . HIS A 1 389 ? 60.091  -6.637  -18.337 1.00 17.59 ? 415  HIS A CB  1 
ATOM   3126  C CG  . HIS A 1 389 ? 59.828  -6.570  -19.810 1.00 20.10 ? 415  HIS A CG  1 
ATOM   3127  N ND1 . HIS A 1 389 ? 59.008  -5.616  -20.376 1.00 21.93 ? 415  HIS A ND1 1 
ATOM   3128  C CD2 . HIS A 1 389 ? 60.331  -7.290  -20.843 1.00 21.06 ? 415  HIS A CD2 1 
ATOM   3129  C CE1 . HIS A 1 389 ? 59.021  -5.749  -21.691 1.00 22.28 ? 415  HIS A CE1 1 
ATOM   3130  N NE2 . HIS A 1 389 ? 59.816  -6.756  -22.000 1.00 20.89 ? 415  HIS A NE2 1 
ATOM   3131  N N   . HIS A 1 390 ? 62.516  -4.776  -19.596 1.00 16.05 ? 416  HIS A N   1 
ATOM   3132  C CA  . HIS A 1 390 ? 63.672  -4.758  -20.482 1.00 18.04 ? 416  HIS A CA  1 
ATOM   3133  C C   . HIS A 1 390 ? 64.991  -4.949  -19.741 1.00 19.26 ? 416  HIS A C   1 
ATOM   3134  O O   . HIS A 1 390 ? 65.842  -5.729  -20.164 1.00 20.14 ? 416  HIS A O   1 
ATOM   3135  C CB  . HIS A 1 390 ? 63.683  -3.447  -21.261 1.00 19.12 ? 416  HIS A CB  1 
ATOM   3136  C CG  . HIS A 1 390 ? 62.424  -3.200  -22.028 1.00 21.37 ? 416  HIS A CG  1 
ATOM   3137  N ND1 . HIS A 1 390 ? 62.104  -3.897  -23.174 1.00 19.89 ? 416  HIS A ND1 1 
ATOM   3138  C CD2 . HIS A 1 390 ? 61.391  -2.358  -21.799 1.00 21.21 ? 416  HIS A CD2 1 
ATOM   3139  C CE1 . HIS A 1 390 ? 60.927  -3.492  -23.622 1.00 21.22 ? 416  HIS A CE1 1 
ATOM   3140  N NE2 . HIS A 1 390 ? 60.473  -2.557  -22.804 1.00 22.65 ? 416  HIS A NE2 1 
ATOM   3141  N N   . PHE A 1 391 ? 65.171  -4.216  -18.647 1.00 18.07 ? 417  PHE A N   1 
ATOM   3142  C CA  . PHE A 1 391 ? 66.388  -4.337  -17.857 1.00 16.71 ? 417  PHE A CA  1 
ATOM   3143  C C   . PHE A 1 391 ? 66.310  -3.513  -16.580 1.00 16.81 ? 417  PHE A C   1 
ATOM   3144  O O   . PHE A 1 391 ? 65.342  -2.790  -16.353 1.00 16.74 ? 417  PHE A O   1 
ATOM   3145  C CB  . PHE A 1 391 ? 67.617  -3.932  -18.688 1.00 13.84 ? 417  PHE A CB  1 
ATOM   3146  C CG  . PHE A 1 391 ? 67.676  -2.468  -19.046 1.00 16.41 ? 417  PHE A CG  1 
ATOM   3147  C CD1 . PHE A 1 391 ? 68.095  -1.523  -18.113 1.00 14.12 ? 417  PHE A CD1 1 
ATOM   3148  C CD2 . PHE A 1 391 ? 67.318  -2.037  -20.323 1.00 13.60 ? 417  PHE A CD2 1 
ATOM   3149  C CE1 . PHE A 1 391 ? 68.156  -0.168  -18.443 1.00 15.05 ? 417  PHE A CE1 1 
ATOM   3150  C CE2 . PHE A 1 391 ? 67.374  -0.687  -20.664 1.00 14.67 ? 417  PHE A CE2 1 
ATOM   3151  C CZ  . PHE A 1 391 ? 67.795  0.256   -19.720 1.00 14.04 ? 417  PHE A CZ  1 
ATOM   3152  N N   . GLY A 1 392 ? 67.334  -3.645  -15.741 1.00 15.59 ? 418  GLY A N   1 
ATOM   3153  C CA  . GLY A 1 392 ? 67.371  -2.912  -14.489 1.00 15.96 ? 418  GLY A CA  1 
ATOM   3154  C C   . GLY A 1 392 ? 68.736  -2.309  -14.248 1.00 15.87 ? 418  GLY A C   1 
ATOM   3155  O O   . GLY A 1 392 ? 69.363  -1.776  -15.162 1.00 14.98 ? 418  GLY A O   1 
ATOM   3156  N N   . LYS A 1 393 ? 69.206  -2.388  -13.008 1.00 16.29 ? 419  LYS A N   1 
ATOM   3157  C CA  . LYS A 1 393 ? 70.512  -1.852  -12.673 1.00 15.84 ? 419  LYS A CA  1 
ATOM   3158  C C   . LYS A 1 393 ? 71.609  -2.570  -13.452 1.00 16.09 ? 419  LYS A C   1 
ATOM   3159  O O   . LYS A 1 393 ? 72.678  -2.012  -13.691 1.00 14.59 ? 419  LYS A O   1 
ATOM   3160  C CB  . LYS A 1 393 ? 70.771  -2.007  -11.176 1.00 18.98 ? 419  LYS A CB  1 
ATOM   3161  C CG  . LYS A 1 393 ? 69.743  -1.316  -10.302 1.00 18.67 ? 419  LYS A CG  1 
ATOM   3162  C CD  . LYS A 1 393 ? 70.087  -1.479  -8.832  1.00 20.34 ? 419  LYS A CD  1 
ATOM   3163  C CE  . LYS A 1 393 ? 69.913  -2.919  -8.376  1.00 21.07 ? 419  LYS A CE  1 
ATOM   3164  N NZ  . LYS A 1 393 ? 70.291  -3.096  -6.946  1.00 22.19 ? 419  LYS A NZ  1 
ATOM   3165  N N   . ASP A 1 394 ? 71.337  -3.812  -13.857 1.00 16.74 ? 420  ASP A N   1 
ATOM   3166  C CA  . ASP A 1 394 ? 72.318  -4.607  -14.592 1.00 16.90 ? 420  ASP A CA  1 
ATOM   3167  C C   . ASP A 1 394 ? 72.986  -3.927  -15.781 1.00 17.30 ? 420  ASP A C   1 
ATOM   3168  O O   . ASP A 1 394 ? 74.215  -3.906  -15.885 1.00 19.82 ? 420  ASP A O   1 
ATOM   3169  C CB  . ASP A 1 394 ? 71.698  -5.943  -15.048 1.00 19.77 ? 420  ASP A CB  1 
ATOM   3170  C CG  . ASP A 1 394 ? 70.429  -5.770  -15.886 1.00 21.18 ? 420  ASP A CG  1 
ATOM   3171  O OD1 . ASP A 1 394 ? 70.054  -4.625  -16.219 1.00 20.03 ? 420  ASP A OD1 1 
ATOM   3172  O OD2 . ASP A 1 394 ? 69.804  -6.803  -16.203 1.00 22.61 ? 420  ASP A OD2 1 
ATOM   3173  N N   . PHE A 1 395 ? 72.192  -3.355  -16.685 1.00 16.15 ? 421  PHE A N   1 
ATOM   3174  C CA  . PHE A 1 395 ? 72.796  -2.720  -17.845 1.00 15.03 ? 421  PHE A CA  1 
ATOM   3175  C C   . PHE A 1 395 ? 73.640  -1.501  -17.500 1.00 13.28 ? 421  PHE A C   1 
ATOM   3176  O O   . PHE A 1 395 ? 74.806  -1.422  -17.873 1.00 13.54 ? 421  PHE A O   1 
ATOM   3177  C CB  . PHE A 1 395 ? 71.737  -2.346  -18.886 1.00 14.52 ? 421  PHE A CB  1 
ATOM   3178  C CG  . PHE A 1 395 ? 72.300  -1.601  -20.051 1.00 16.01 ? 421  PHE A CG  1 
ATOM   3179  C CD1 . PHE A 1 395 ? 73.168  -2.226  -20.940 1.00 14.16 ? 421  PHE A CD1 1 
ATOM   3180  C CD2 . PHE A 1 395 ? 72.039  -0.245  -20.208 1.00 15.18 ? 421  PHE A CD2 1 
ATOM   3181  C CE1 . PHE A 1 395 ? 73.779  -1.503  -21.968 1.00 16.06 ? 421  PHE A CE1 1 
ATOM   3182  C CE2 . PHE A 1 395 ? 72.643  0.484   -21.229 1.00 15.89 ? 421  PHE A CE2 1 
ATOM   3183  C CZ  . PHE A 1 395 ? 73.516  -0.145  -22.109 1.00 15.18 ? 421  PHE A CZ  1 
ATOM   3184  N N   . PRO A 1 396 ? 73.062  -0.523  -16.787 1.00 14.97 ? 422  PRO A N   1 
ATOM   3185  C CA  . PRO A 1 396 ? 73.823  0.671   -16.417 1.00 14.82 ? 422  PRO A CA  1 
ATOM   3186  C C   . PRO A 1 396 ? 75.157  0.295   -15.758 1.00 14.76 ? 422  PRO A C   1 
ATOM   3187  O O   . PRO A 1 396 ? 76.204  0.850   -16.098 1.00 15.62 ? 422  PRO A O   1 
ATOM   3188  C CB  . PRO A 1 396 ? 72.877  1.388   -15.456 1.00 14.84 ? 422  PRO A CB  1 
ATOM   3189  C CG  . PRO A 1 396 ? 71.546  1.050   -16.020 1.00 17.05 ? 422  PRO A CG  1 
ATOM   3190  C CD  . PRO A 1 396 ? 71.669  -0.419  -16.324 1.00 13.69 ? 422  PRO A CD  1 
ATOM   3191  N N   . LYS A 1 397 ? 75.119  -0.647  -14.822 1.00 16.85 ? 423  LYS A N   1 
ATOM   3192  C CA  . LYS A 1 397 ? 76.338  -1.080  -14.146 1.00 18.41 ? 423  LYS A CA  1 
ATOM   3193  C C   . LYS A 1 397 ? 77.358  -1.666  -15.117 1.00 19.10 ? 423  LYS A C   1 
ATOM   3194  O O   . LYS A 1 397 ? 78.549  -1.349  -15.041 1.00 19.55 ? 423  LYS A O   1 
ATOM   3195  C CB  . LYS A 1 397 ? 76.006  -2.085  -13.038 1.00 18.11 ? 423  LYS A CB  1 
ATOM   3196  C CG  . LYS A 1 397 ? 75.332  -1.417  -11.843 1.00 20.16 ? 423  LYS A CG  1 
ATOM   3197  C CD  . LYS A 1 397 ? 75.269  -2.299  -10.613 1.00 22.23 ? 423  LYS A CD  1 
ATOM   3198  C CE  . LYS A 1 397 ? 74.414  -3.525  -10.845 1.00 26.02 ? 423  LYS A CE  1 
ATOM   3199  N NZ  . LYS A 1 397 ? 74.287  -4.324  -9.599  1.00 27.77 ? 423  LYS A NZ  1 
ATOM   3200  N N   . SER A 1 398 ? 76.897  -2.502  -16.044 1.00 18.80 ? 424  SER A N   1 
ATOM   3201  C CA  . SER A 1 398 ? 77.796  -3.110  -17.022 1.00 18.21 ? 424  SER A CA  1 
ATOM   3202  C C   . SER A 1 398 ? 78.427  -2.023  -17.889 1.00 18.69 ? 424  SER A C   1 
ATOM   3203  O O   . SER A 1 398 ? 79.426  -2.253  -18.568 1.00 20.93 ? 424  SER A O   1 
ATOM   3204  C CB  . SER A 1 398 ? 77.027  -4.094  -17.906 1.00 16.92 ? 424  SER A CB  1 
ATOM   3205  O OG  . SER A 1 398 ? 76.177  -3.403  -18.813 1.00 17.43 ? 424  SER A OG  1 
ATOM   3206  N N   . GLU A 1 399 ? 77.836  -0.837  -17.858 1.00 18.72 ? 425  GLU A N   1 
ATOM   3207  C CA  . GLU A 1 399 ? 78.346  0.296   -18.615 1.00 20.29 ? 425  GLU A CA  1 
ATOM   3208  C C   . GLU A 1 399 ? 79.167  1.225   -17.727 1.00 19.88 ? 425  GLU A C   1 
ATOM   3209  O O   . GLU A 1 399 ? 79.655  2.255   -18.182 1.00 20.01 ? 425  GLU A O   1 
ATOM   3210  C CB  . GLU A 1 399 ? 77.187  1.079   -19.235 1.00 21.90 ? 425  GLU A CB  1 
ATOM   3211  C CG  . GLU A 1 399 ? 76.565  0.424   -20.447 1.00 22.33 ? 425  GLU A CG  1 
ATOM   3212  C CD  . GLU A 1 399 ? 77.547  0.301   -21.586 1.00 25.65 ? 425  GLU A CD  1 
ATOM   3213  O OE1 . GLU A 1 399 ? 78.269  1.287   -21.856 1.00 26.40 ? 425  GLU A OE1 1 
ATOM   3214  O OE2 . GLU A 1 399 ? 77.595  -0.773  -22.219 1.00 27.31 ? 425  GLU A OE2 1 
ATOM   3215  N N   . LYS A 1 400 ? 79.321  0.849   -16.463 1.00 20.29 ? 426  LYS A N   1 
ATOM   3216  C CA  . LYS A 1 400 ? 80.063  1.650   -15.493 1.00 21.11 ? 426  LYS A CA  1 
ATOM   3217  C C   . LYS A 1 400 ? 79.348  2.988   -15.287 1.00 19.10 ? 426  LYS A C   1 
ATOM   3218  O O   . LYS A 1 400 ? 79.983  4.036   -15.174 1.00 18.74 ? 426  LYS A O   1 
ATOM   3219  C CB  . LYS A 1 400 ? 81.502  1.887   -15.960 1.00 23.10 ? 426  LYS A CB  1 
ATOM   3220  C CG  . LYS A 1 400 ? 82.271  0.600   -16.281 1.00 26.64 ? 426  LYS A CG  1 
ATOM   3221  C CD  . LYS A 1 400 ? 82.248  -0.361  -15.096 1.00 30.72 ? 426  LYS A CD  1 
ATOM   3222  C CE  . LYS A 1 400 ? 82.647  -1.776  -15.500 1.00 33.37 ? 426  LYS A CE  1 
ATOM   3223  N NZ  . LYS A 1 400 ? 82.471  -2.719  -14.358 1.00 36.09 ? 426  LYS A NZ  1 
ATOM   3224  N N   . LEU A 1 401 ? 78.024  2.944   -15.243 1.00 17.84 ? 427  LEU A N   1 
ATOM   3225  C CA  . LEU A 1 401 ? 77.227  4.150   -15.041 1.00 17.99 ? 427  LEU A CA  1 
ATOM   3226  C C   . LEU A 1 401 ? 76.273  3.937   -13.880 1.00 16.31 ? 427  LEU A C   1 
ATOM   3227  O O   . LEU A 1 401 ? 75.788  2.830   -13.659 1.00 17.88 ? 427  LEU A O   1 
ATOM   3228  C CB  . LEU A 1 401 ? 76.419  4.484   -16.301 1.00 17.14 ? 427  LEU A CB  1 
ATOM   3229  C CG  . LEU A 1 401 ? 77.203  4.854   -17.564 1.00 18.31 ? 427  LEU A CG  1 
ATOM   3230  C CD1 . LEU A 1 401 ? 76.263  4.863   -18.761 1.00 18.45 ? 427  LEU A CD1 1 
ATOM   3231  C CD2 . LEU A 1 401 ? 77.869  6.213   -17.384 1.00 18.70 ? 427  LEU A CD2 1 
ATOM   3232  N N   . SER A 1 402 ? 76.006  5.004   -13.133 1.00 15.17 ? 428  SER A N   1 
ATOM   3233  C CA  . SER A 1 402 ? 75.089  4.918   -12.015 1.00 13.29 ? 428  SER A CA  1 
ATOM   3234  C C   . SER A 1 402 ? 73.670  4.657   -12.502 1.00 13.87 ? 428  SER A C   1 
ATOM   3235  O O   . SER A 1 402 ? 73.126  5.429   -13.286 1.00 14.62 ? 428  SER A O   1 
ATOM   3236  C CB  . SER A 1 402 ? 75.088  6.220   -11.218 1.00 12.84 ? 428  SER A CB  1 
ATOM   3237  O OG  . SER A 1 402 ? 73.946  6.260   -10.377 1.00 13.15 ? 428  SER A OG  1 
ATOM   3238  N N   . PRO A 1 403 ? 73.050  3.566   -12.038 1.00 13.38 ? 429  PRO A N   1 
ATOM   3239  C CA  . PRO A 1 403 ? 71.679  3.233   -12.450 1.00 12.98 ? 429  PRO A CA  1 
ATOM   3240  C C   . PRO A 1 403 ? 70.680  4.378   -12.221 1.00 14.48 ? 429  PRO A C   1 
ATOM   3241  O O   . PRO A 1 403 ? 69.927  4.762   -13.120 1.00 13.64 ? 429  PRO A O   1 
ATOM   3242  C CB  . PRO A 1 403 ? 71.357  2.009   -11.598 1.00 10.46 ? 429  PRO A CB  1 
ATOM   3243  C CG  . PRO A 1 403 ? 72.700  1.332   -11.474 1.00 11.25 ? 429  PRO A CG  1 
ATOM   3244  C CD  . PRO A 1 403 ? 73.644  2.485   -11.227 1.00 11.85 ? 429  PRO A CD  1 
ATOM   3245  N N   . ASP A 1 404 ? 70.676  4.920   -11.009 1.00 13.21 ? 430  ASP A N   1 
ATOM   3246  C CA  . ASP A 1 404 ? 69.759  6.002   -10.685 1.00 13.23 ? 430  ASP A CA  1 
ATOM   3247  C C   . ASP A 1 404 ? 69.991  7.198   -11.593 1.00 12.22 ? 430  ASP A C   1 
ATOM   3248  O O   . ASP A 1 404 ? 69.037  7.788   -12.097 1.00 13.94 ? 430  ASP A O   1 
ATOM   3249  C CB  . ASP A 1 404 ? 69.913  6.431   -9.224  1.00 14.63 ? 430  ASP A CB  1 
ATOM   3250  C CG  . ASP A 1 404 ? 68.827  7.397   -8.798  1.00 13.62 ? 430  ASP A CG  1 
ATOM   3251  O OD1 . ASP A 1 404 ? 67.666  6.962   -8.673  1.00 13.09 ? 430  ASP A OD1 1 
ATOM   3252  O OD2 . ASP A 1 404 ? 69.135  8.591   -8.611  1.00 17.23 ? 430  ASP A OD2 1 
ATOM   3253  N N   . ALA A 1 405 ? 71.250  7.549   -11.807 1.00 11.29 ? 431  ALA A N   1 
ATOM   3254  C CA  . ALA A 1 405 ? 71.584  8.677   -12.669 1.00 11.23 ? 431  ALA A CA  1 
ATOM   3255  C C   . ALA A 1 405 ? 71.140  8.352   -14.096 1.00 11.33 ? 431  ALA A C   1 
ATOM   3256  O O   . ALA A 1 405 ? 70.648  9.217   -14.825 1.00 10.26 ? 431  ALA A O   1 
ATOM   3257  C CB  . ALA A 1 405 ? 73.084  8.932   -12.640 1.00 11.05 ? 431  ALA A CB  1 
ATOM   3258  N N   . PHE A 1 406 ? 71.321  7.101   -14.482 1.00 10.29 ? 432  PHE A N   1 
ATOM   3259  C CA  . PHE A 1 406 ? 70.939  6.659   -15.812 1.00 11.40 ? 432  PHE A CA  1 
ATOM   3260  C C   . PHE A 1 406 ? 69.445  6.864   -15.976 1.00 9.16  ? 432  PHE A C   1 
ATOM   3261  O O   . PHE A 1 406 ? 68.994  7.426   -16.965 1.00 9.84  ? 432  PHE A O   1 
ATOM   3262  C CB  . PHE A 1 406 ? 71.314  5.188   -16.006 1.00 10.95 ? 432  PHE A CB  1 
ATOM   3263  C CG  . PHE A 1 406 ? 70.982  4.644   -17.375 1.00 13.81 ? 432  PHE A CG  1 
ATOM   3264  C CD1 . PHE A 1 406 ? 69.688  4.240   -17.691 1.00 11.39 ? 432  PHE A CD1 1 
ATOM   3265  C CD2 . PHE A 1 406 ? 71.982  4.483   -18.330 1.00 13.10 ? 432  PHE A CD2 1 
ATOM   3266  C CE1 . PHE A 1 406 ? 69.399  3.678   -18.934 1.00 13.11 ? 432  PHE A CE1 1 
ATOM   3267  C CE2 . PHE A 1 406 ? 71.703  3.922   -19.579 1.00 14.29 ? 432  PHE A CE2 1 
ATOM   3268  C CZ  . PHE A 1 406 ? 70.405  3.517   -19.881 1.00 11.45 ? 432  PHE A CZ  1 
ATOM   3269  N N   . ILE A 1 407 ? 68.677  6.421   -14.989 1.00 8.81  ? 433  ILE A N   1 
ATOM   3270  C CA  . ILE A 1 407 ? 67.235  6.568   -15.015 1.00 9.36  ? 433  ILE A CA  1 
ATOM   3271  C C   . ILE A 1 407 ? 66.812  8.038   -15.021 1.00 10.83 ? 433  ILE A C   1 
ATOM   3272  O O   . ILE A 1 407 ? 65.930  8.442   -15.779 1.00 9.55  ? 433  ILE A O   1 
ATOM   3273  C CB  . ILE A 1 407 ? 66.613  5.854   -13.799 1.00 10.32 ? 433  ILE A CB  1 
ATOM   3274  C CG1 . ILE A 1 407 ? 66.828  4.346   -13.933 1.00 9.04  ? 433  ILE A CG1 1 
ATOM   3275  C CG2 . ILE A 1 407 ? 65.146  6.216   -13.658 1.00 7.23  ? 433  ILE A CG2 1 
ATOM   3276  C CD1 . ILE A 1 407 ? 66.458  3.574   -12.673 1.00 6.28  ? 433  ILE A CD1 1 
ATOM   3277  N N   . GLN A 1 408 ? 67.444  8.851   -14.175 1.00 10.29 ? 434  GLN A N   1 
ATOM   3278  C CA  . GLN A 1 408 ? 67.093  10.265  -14.120 1.00 10.23 ? 434  GLN A CA  1 
ATOM   3279  C C   . GLN A 1 408 ? 67.365  10.932  -15.467 1.00 9.74  ? 434  GLN A C   1 
ATOM   3280  O O   . GLN A 1 408 ? 66.537  11.702  -15.961 1.00 12.32 ? 434  GLN A O   1 
ATOM   3281  C CB  . GLN A 1 408 ? 67.885  10.968  -13.009 1.00 9.77  ? 434  GLN A CB  1 
ATOM   3282  C CG  . GLN A 1 408 ? 67.369  10.677  -11.596 1.00 8.74  ? 434  GLN A CG  1 
ATOM   3283  C CD  . GLN A 1 408 ? 66.020  11.314  -11.328 1.00 8.69  ? 434  GLN A CD  1 
ATOM   3284  O OE1 . GLN A 1 408 ? 65.730  12.399  -11.832 1.00 10.41 ? 434  GLN A OE1 1 
ATOM   3285  N NE2 . GLN A 1 408 ? 65.185  10.657  -10.520 1.00 6.45  ? 434  GLN A NE2 1 
ATOM   3286  N N   . VAL A 1 409 ? 68.513  10.634  -16.061 1.00 10.98 ? 435  VAL A N   1 
ATOM   3287  C CA  . VAL A 1 409 ? 68.870  11.220  -17.348 1.00 10.87 ? 435  VAL A CA  1 
ATOM   3288  C C   . VAL A 1 409 ? 67.860  10.769  -18.409 1.00 12.39 ? 435  VAL A C   1 
ATOM   3289  O O   . VAL A 1 409 ? 67.501  11.547  -19.303 1.00 11.54 ? 435  VAL A O   1 
ATOM   3290  C CB  . VAL A 1 409 ? 70.301  10.825  -17.769 1.00 10.98 ? 435  VAL A CB  1 
ATOM   3291  C CG1 . VAL A 1 409 ? 70.543  11.227  -19.211 1.00 13.32 ? 435  VAL A CG1 1 
ATOM   3292  C CG2 . VAL A 1 409 ? 71.328  11.524  -16.868 1.00 13.08 ? 435  VAL A CG2 1 
ATOM   3293  N N   . ALA A 1 410 ? 67.389  9.525   -18.303 1.00 11.25 ? 436  ALA A N   1 
ATOM   3294  C CA  . ALA A 1 410 ? 66.405  9.009   -19.244 1.00 12.48 ? 436  ALA A CA  1 
ATOM   3295  C C   . ALA A 1 410 ? 65.103  9.799   -19.105 1.00 13.87 ? 436  ALA A C   1 
ATOM   3296  O O   . ALA A 1 410 ? 64.436  10.080  -20.101 1.00 13.02 ? 436  ALA A O   1 
ATOM   3297  C CB  . ALA A 1 410 ? 66.156  7.527   -18.984 1.00 11.81 ? 436  ALA A CB  1 
ATOM   3298  N N   . LEU A 1 411 ? 64.738  10.153  -17.865 1.00 12.94 ? 437  LEU A N   1 
ATOM   3299  C CA  . LEU A 1 411 ? 63.512  10.911  -17.617 1.00 12.44 ? 437  LEU A CA  1 
ATOM   3300  C C   . LEU A 1 411 ? 63.620  12.300  -18.246 1.00 13.10 ? 437  LEU A C   1 
ATOM   3301  O O   . LEU A 1 411 ? 62.649  12.802  -18.825 1.00 13.10 ? 437  LEU A O   1 
ATOM   3302  C CB  . LEU A 1 411 ? 63.252  11.038  -16.114 1.00 12.77 ? 437  LEU A CB  1 
ATOM   3303  C CG  . LEU A 1 411 ? 61.945  11.742  -15.748 1.00 13.40 ? 437  LEU A CG  1 
ATOM   3304  C CD1 . LEU A 1 411 ? 60.762  11.054  -16.417 1.00 14.62 ? 437  LEU A CD1 1 
ATOM   3305  C CD2 . LEU A 1 411 ? 61.778  11.735  -14.247 1.00 11.74 ? 437  LEU A CD2 1 
ATOM   3306  N N   . GLN A 1 412 ? 64.794  12.921  -18.133 1.00 12.07 ? 438  GLN A N   1 
ATOM   3307  C CA  . GLN A 1 412 ? 65.015  14.232  -18.726 1.00 10.88 ? 438  GLN A CA  1 
ATOM   3308  C C   . GLN A 1 412 ? 64.841  14.112  -20.253 1.00 12.25 ? 438  GLN A C   1 
ATOM   3309  O O   . GLN A 1 412 ? 64.173  14.948  -20.880 1.00 11.20 ? 438  GLN A O   1 
ATOM   3310  C CB  . GLN A 1 412 ? 66.430  14.721  -18.399 1.00 11.20 ? 438  GLN A CB  1 
ATOM   3311  C CG  . GLN A 1 412 ? 66.637  15.103  -16.923 1.00 9.59  ? 438  GLN A CG  1 
ATOM   3312  C CD  . GLN A 1 412 ? 65.683  16.193  -16.486 1.00 8.79  ? 438  GLN A CD  1 
ATOM   3313  O OE1 . GLN A 1 412 ? 65.709  17.302  -17.017 1.00 11.12 ? 438  GLN A OE1 1 
ATOM   3314  N NE2 . GLN A 1 412 ? 64.826  15.880  -15.524 1.00 8.97  ? 438  GLN A NE2 1 
ATOM   3315  N N   . LEU A 1 413 ? 65.421  13.063  -20.844 1.00 10.88 ? 439  LEU A N   1 
ATOM   3316  C CA  . LEU A 1 413 ? 65.317  12.852  -22.290 1.00 11.10 ? 439  LEU A CA  1 
ATOM   3317  C C   . LEU A 1 413 ? 63.855  12.713  -22.703 1.00 10.62 ? 439  LEU A C   1 
ATOM   3318  O O   . LEU A 1 413 ? 63.410  13.364  -23.638 1.00 13.26 ? 439  LEU A O   1 
ATOM   3319  C CB  . LEU A 1 413 ? 66.089  11.596  -22.707 1.00 9.70  ? 439  LEU A CB  1 
ATOM   3320  C CG  . LEU A 1 413 ? 65.942  11.165  -24.170 1.00 7.22  ? 439  LEU A CG  1 
ATOM   3321  C CD1 . LEU A 1 413 ? 66.378  12.291  -25.100 1.00 4.79  ? 439  LEU A CD1 1 
ATOM   3322  C CD2 . LEU A 1 413 ? 66.770  9.913   -24.422 1.00 5.07  ? 439  LEU A CD2 1 
ATOM   3323  N N   . ALA A 1 414 ? 63.116  11.879  -21.981 1.00 11.91 ? 440  ALA A N   1 
ATOM   3324  C CA  . ALA A 1 414 ? 61.698  11.646  -22.249 1.00 12.21 ? 440  ALA A CA  1 
ATOM   3325  C C   . ALA A 1 414 ? 60.865  12.930  -22.174 1.00 13.23 ? 440  ALA A C   1 
ATOM   3326  O O   . ALA A 1 414 ? 59.973  13.156  -23.008 1.00 13.24 ? 440  ALA A O   1 
ATOM   3327  C CB  . ALA A 1 414 ? 61.150  10.622  -21.263 1.00 10.41 ? 440  ALA A CB  1 
ATOM   3328  N N   . TYR A 1 415 ? 61.149  13.760  -21.174 1.00 11.51 ? 441  TYR A N   1 
ATOM   3329  C CA  . TYR A 1 415 ? 60.415  15.011  -20.982 1.00 10.51 ? 441  TYR A CA  1 
ATOM   3330  C C   . TYR A 1 415 ? 60.709  15.982  -22.119 1.00 9.62  ? 441  TYR A C   1 
ATOM   3331  O O   . TYR A 1 415 ? 59.804  16.601  -22.664 1.00 10.35 ? 441  TYR A O   1 
ATOM   3332  C CB  . TYR A 1 415 ? 60.780  15.658  -19.640 1.00 11.12 ? 441  TYR A CB  1 
ATOM   3333  C CG  . TYR A 1 415 ? 59.878  16.817  -19.283 1.00 13.53 ? 441  TYR A CG  1 
ATOM   3334  C CD1 . TYR A 1 415 ? 58.727  16.619  -18.521 1.00 13.46 ? 441  TYR A CD1 1 
ATOM   3335  C CD2 . TYR A 1 415 ? 60.155  18.105  -19.739 1.00 15.24 ? 441  TYR A CD2 1 
ATOM   3336  C CE1 . TYR A 1 415 ? 57.872  17.678  -18.222 1.00 15.27 ? 441  TYR A CE1 1 
ATOM   3337  C CE2 . TYR A 1 415 ? 59.309  19.170  -19.447 1.00 17.17 ? 441  TYR A CE2 1 
ATOM   3338  C CZ  . TYR A 1 415 ? 58.169  18.947  -18.687 1.00 16.53 ? 441  TYR A CZ  1 
ATOM   3339  O OH  . TYR A 1 415 ? 57.322  19.988  -18.394 1.00 22.29 ? 441  TYR A OH  1 
ATOM   3340  N N   . TYR A 1 416 ? 61.977  16.121  -22.468 1.00 9.94  ? 442  TYR A N   1 
ATOM   3341  C CA  . TYR A 1 416 ? 62.364  17.014  -23.550 1.00 13.00 ? 442  TYR A CA  1 
ATOM   3342  C C   . TYR A 1 416 ? 61.718  16.563  -24.868 1.00 13.42 ? 442  TYR A C   1 
ATOM   3343  O O   . TYR A 1 416 ? 61.283  17.390  -25.673 1.00 14.22 ? 442  TYR A O   1 
ATOM   3344  C CB  . TYR A 1 416 ? 63.881  17.004  -23.708 1.00 14.93 ? 442  TYR A CB  1 
ATOM   3345  C CG  . TYR A 1 416 ? 64.403  18.036  -24.673 1.00 17.92 ? 442  TYR A CG  1 
ATOM   3346  C CD1 . TYR A 1 416 ? 64.463  19.380  -24.316 1.00 18.99 ? 442  TYR A CD1 1 
ATOM   3347  C CD2 . TYR A 1 416 ? 64.820  17.672  -25.951 1.00 18.08 ? 442  TYR A CD2 1 
ATOM   3348  C CE1 . TYR A 1 416 ? 64.927  20.345  -25.216 1.00 21.70 ? 442  TYR A CE1 1 
ATOM   3349  C CE2 . TYR A 1 416 ? 65.281  18.620  -26.855 1.00 22.18 ? 442  TYR A CE2 1 
ATOM   3350  C CZ  . TYR A 1 416 ? 65.331  19.955  -26.486 1.00 22.27 ? 442  TYR A CZ  1 
ATOM   3351  O OH  . TYR A 1 416 ? 65.769  20.889  -27.396 1.00 23.75 ? 442  TYR A OH  1 
ATOM   3352  N N   . ARG A 1 417 ? 61.656  15.259  -25.086 1.00 14.71 ? 443  ARG A N   1 
ATOM   3353  C CA  . ARG A 1 417 ? 61.064  14.734  -26.315 1.00 16.75 ? 443  ARG A CA  1 
ATOM   3354  C C   . ARG A 1 417 ? 59.595  15.092  -26.404 1.00 16.87 ? 443  ARG A C   1 
ATOM   3355  O O   . ARG A 1 417 ? 59.062  15.305  -27.489 1.00 17.86 ? 443  ARG A O   1 
ATOM   3356  C CB  . ARG A 1 417 ? 61.232  13.213  -26.390 1.00 15.34 ? 443  ARG A CB  1 
ATOM   3357  C CG  . ARG A 1 417 ? 62.644  12.760  -26.761 1.00 13.16 ? 443  ARG A CG  1 
ATOM   3358  C CD  . ARG A 1 417 ? 62.757  11.226  -26.757 1.00 13.13 ? 443  ARG A CD  1 
ATOM   3359  N NE  . ARG A 1 417 ? 63.989  10.779  -27.405 1.00 12.25 ? 443  ARG A NE  1 
ATOM   3360  C CZ  . ARG A 1 417 ? 64.420  9.512   -27.426 1.00 15.05 ? 443  ARG A CZ  1 
ATOM   3361  N NH1 . ARG A 1 417 ? 63.730  8.536   -26.825 1.00 13.24 ? 443  ARG A NH1 1 
ATOM   3362  N NH2 . ARG A 1 417 ? 65.537  9.208   -28.078 1.00 12.99 ? 443  ARG A NH2 1 
ATOM   3363  N N   . ILE A 1 418 ? 58.932  15.162  -25.252 1.00 15.56 ? 444  ILE A N   1 
ATOM   3364  C CA  . ILE A 1 418 ? 57.526  15.489  -25.240 1.00 14.88 ? 444  ILE A CA  1 
ATOM   3365  C C   . ILE A 1 418 ? 57.252  16.989  -25.310 1.00 15.18 ? 444  ILE A C   1 
ATOM   3366  O O   . ILE A 1 418 ? 56.420  17.429  -26.104 1.00 14.31 ? 444  ILE A O   1 
ATOM   3367  C CB  . ILE A 1 418 ? 56.843  14.973  -23.974 1.00 15.48 ? 444  ILE A CB  1 
ATOM   3368  C CG1 . ILE A 1 418 ? 56.944  13.450  -23.906 1.00 16.11 ? 444  ILE A CG1 1 
ATOM   3369  C CG2 . ILE A 1 418 ? 55.397  15.436  -23.954 1.00 13.85 ? 444  ILE A CG2 1 
ATOM   3370  C CD1 . ILE A 1 418 ? 56.277  12.863  -22.672 1.00 12.10 ? 444  ILE A CD1 1 
ATOM   3371  N N   . TYR A 1 419 ? 57.944  17.772  -24.482 1.00 14.50 ? 445  TYR A N   1 
ATOM   3372  C CA  . TYR A 1 419 ? 57.704  19.215  -24.438 1.00 15.48 ? 445  TYR A CA  1 
ATOM   3373  C C   . TYR A 1 419 ? 58.687  20.127  -25.162 1.00 16.43 ? 445  TYR A C   1 
ATOM   3374  O O   . TYR A 1 419 ? 58.447  21.330  -25.273 1.00 17.63 ? 445  TYR A O   1 
ATOM   3375  C CB  . TYR A 1 419 ? 57.565  19.673  -22.982 1.00 15.00 ? 445  TYR A CB  1 
ATOM   3376  C CG  . TYR A 1 419 ? 56.480  18.930  -22.242 1.00 13.02 ? 445  TYR A CG  1 
ATOM   3377  C CD1 . TYR A 1 419 ? 56.778  17.789  -21.505 1.00 12.55 ? 445  TYR A CD1 1 
ATOM   3378  C CD2 . TYR A 1 419 ? 55.143  19.326  -22.331 1.00 14.03 ? 445  TYR A CD2 1 
ATOM   3379  C CE1 . TYR A 1 419 ? 55.781  17.052  -20.877 1.00 10.67 ? 445  TYR A CE1 1 
ATOM   3380  C CE2 . TYR A 1 419 ? 54.128  18.587  -21.710 1.00 13.03 ? 445  TYR A CE2 1 
ATOM   3381  C CZ  . TYR A 1 419 ? 54.461  17.451  -20.984 1.00 12.67 ? 445  TYR A CZ  1 
ATOM   3382  O OH  . TYR A 1 419 ? 53.488  16.715  -20.345 1.00 11.43 ? 445  TYR A OH  1 
ATOM   3383  N N   . GLY A 1 420 ? 59.787  19.569  -25.642 1.00 17.48 ? 446  GLY A N   1 
ATOM   3384  C CA  . GLY A 1 420 ? 60.753  20.371  -26.369 1.00 17.49 ? 446  GLY A CA  1 
ATOM   3385  C C   . GLY A 1 420 ? 61.574  21.319  -25.519 1.00 18.12 ? 446  GLY A C   1 
ATOM   3386  O O   . GLY A 1 420 ? 62.237  22.216  -26.048 1.00 16.08 ? 446  GLY A O   1 
ATOM   3387  N N   . GLN A 1 421 ? 61.539  21.128  -24.206 1.00 17.14 ? 447  GLN A N   1 
ATOM   3388  C CA  . GLN A 1 421 ? 62.309  21.976  -23.303 1.00 20.16 ? 447  GLN A CA  1 
ATOM   3389  C C   . GLN A 1 421 ? 62.473  21.262  -21.966 1.00 19.00 ? 447  GLN A C   1 
ATOM   3390  O O   . GLN A 1 421 ? 61.716  20.340  -21.658 1.00 18.78 ? 447  GLN A O   1 
ATOM   3391  C CB  . GLN A 1 421 ? 61.600  23.321  -23.094 1.00 20.64 ? 447  GLN A CB  1 
ATOM   3392  C CG  . GLN A 1 421 ? 60.320  23.220  -22.277 1.00 23.27 ? 447  GLN A CG  1 
ATOM   3393  C CD  . GLN A 1 421 ? 59.614  24.554  -22.130 1.00 25.52 ? 447  GLN A CD  1 
ATOM   3394  O OE1 . GLN A 1 421 ? 59.140  25.130  -23.111 1.00 27.22 ? 447  GLN A OE1 1 
ATOM   3395  N NE2 . GLN A 1 421 ? 59.544  25.057  -20.903 1.00 28.28 ? 447  GLN A NE2 1 
ATOM   3396  N N   . ALA A 1 422 ? 63.463  21.684  -21.185 1.00 17.66 ? 448  ALA A N   1 
ATOM   3397  C CA  . ALA A 1 422 ? 63.716  21.098  -19.866 1.00 16.31 ? 448  ALA A CA  1 
ATOM   3398  C C   . ALA A 1 422 ? 62.734  21.698  -18.860 1.00 17.85 ? 448  ALA A C   1 
ATOM   3399  O O   . ALA A 1 422 ? 61.998  22.628  -19.186 1.00 17.72 ? 448  ALA A O   1 
ATOM   3400  C CB  . ALA A 1 422 ? 65.146  21.386  -19.429 1.00 15.62 ? 448  ALA A CB  1 
ATOM   3401  N N   . CYS A 1 423 ? 62.721  21.166  -17.637 1.00 17.37 ? 449  CYS A N   1 
ATOM   3402  C CA  . CYS A 1 423 ? 61.835  21.672  -16.591 1.00 16.41 ? 449  CYS A CA  1 
ATOM   3403  C C   . CYS A 1 423 ? 62.417  21.389  -15.209 1.00 14.90 ? 449  CYS A C   1 
ATOM   3404  O O   . CYS A 1 423 ? 63.203  20.456  -15.036 1.00 14.86 ? 449  CYS A O   1 
ATOM   3405  C CB  . CYS A 1 423 ? 60.443  21.031  -16.689 1.00 14.53 ? 449  CYS A CB  1 
ATOM   3406  S SG  . CYS A 1 423 ? 60.354  19.262  -16.328 1.00 15.86 ? 449  CYS A SG  1 
ATOM   3407  N N   . ALA A 1 424 ? 62.040  22.208  -14.231 1.00 13.40 ? 450  ALA A N   1 
ATOM   3408  C CA  . ALA A 1 424 ? 62.505  22.028  -12.857 1.00 12.17 ? 450  ALA A CA  1 
ATOM   3409  C C   . ALA A 1 424 ? 62.184  20.602  -12.466 1.00 10.13 ? 450  ALA A C   1 
ATOM   3410  O O   . ALA A 1 424 ? 61.026  20.185  -12.500 1.00 10.00 ? 450  ALA A O   1 
ATOM   3411  C CB  . ALA A 1 424 ? 61.788  22.986  -11.918 1.00 11.93 ? 450  ALA A CB  1 
ATOM   3412  N N   . THR A 1 425 ? 63.211  19.854  -12.093 1.00 9.61  ? 451  THR A N   1 
ATOM   3413  C CA  . THR A 1 425 ? 63.033  18.463  -11.710 1.00 10.25 ? 451  THR A CA  1 
ATOM   3414  C C   . THR A 1 425 ? 63.544  18.255  -10.302 1.00 10.29 ? 451  THR A C   1 
ATOM   3415  O O   . THR A 1 425 ? 64.617  18.743  -9.933  1.00 11.31 ? 451  THR A O   1 
ATOM   3416  C CB  . THR A 1 425 ? 63.774  17.533  -12.678 1.00 10.72 ? 451  THR A CB  1 
ATOM   3417  O OG1 . THR A 1 425 ? 63.242  17.737  -13.992 1.00 11.92 ? 451  THR A OG1 1 
ATOM   3418  C CG2 . THR A 1 425 ? 63.618  16.066  -12.263 1.00 9.18  ? 451  THR A CG2 1 
ATOM   3419  N N   . TYR A 1 426 ? 62.769  17.511  -9.531  1.00 9.89  ? 452  TYR A N   1 
ATOM   3420  C CA  . TYR A 1 426 ? 63.100  17.236  -8.154  1.00 10.11 ? 452  TYR A CA  1 
ATOM   3421  C C   . TYR A 1 426 ? 63.307  15.745  -7.934  1.00 11.45 ? 452  TYR A C   1 
ATOM   3422  O O   . TYR A 1 426 ? 62.487  14.930  -8.356  1.00 11.54 ? 452  TYR A O   1 
ATOM   3423  C CB  . TYR A 1 426 ? 61.956  17.720  -7.269  1.00 10.26 ? 452  TYR A CB  1 
ATOM   3424  C CG  . TYR A 1 426 ? 62.118  17.452  -5.795  1.00 10.11 ? 452  TYR A CG  1 
ATOM   3425  C CD1 . TYR A 1 426 ? 62.357  18.498  -4.911  1.00 11.54 ? 452  TYR A CD1 1 
ATOM   3426  C CD2 . TYR A 1 426 ? 61.996  16.160  -5.270  1.00 11.91 ? 452  TYR A CD2 1 
ATOM   3427  C CE1 . TYR A 1 426 ? 62.462  18.280  -3.544  1.00 11.03 ? 452  TYR A CE1 1 
ATOM   3428  C CE2 . TYR A 1 426 ? 62.107  15.930  -3.892  1.00 9.07  ? 452  TYR A CE2 1 
ATOM   3429  C CZ  . TYR A 1 426 ? 62.340  17.004  -3.038  1.00 11.76 ? 452  TYR A CZ  1 
ATOM   3430  O OH  . TYR A 1 426 ? 62.453  16.828  -1.675  1.00 11.59 ? 452  TYR A OH  1 
ATOM   3431  N N   . GLU A 1 427 ? 64.404  15.392  -7.287  1.00 10.89 ? 453  GLU A N   1 
ATOM   3432  C CA  . GLU A 1 427 ? 64.663  14.001  -6.938  1.00 12.05 ? 453  GLU A CA  1 
ATOM   3433  C C   . GLU A 1 427 ? 65.075  13.987  -5.466  1.00 11.42 ? 453  GLU A C   1 
ATOM   3434  O O   . GLU A 1 427 ? 66.012  14.678  -5.082  1.00 11.36 ? 453  GLU A O   1 
ATOM   3435  C CB  . GLU A 1 427 ? 65.777  13.374  -7.790  1.00 12.75 ? 453  GLU A CB  1 
ATOM   3436  C CG  . GLU A 1 427 ? 66.374  12.150  -7.089  1.00 12.91 ? 453  GLU A CG  1 
ATOM   3437  C CD  . GLU A 1 427 ? 67.273  11.263  -7.948  1.00 12.76 ? 453  GLU A CD  1 
ATOM   3438  O OE1 . GLU A 1 427 ? 68.036  11.772  -8.795  1.00 14.44 ? 453  GLU A OE1 1 
ATOM   3439  O OE2 . GLU A 1 427 ? 67.229  10.034  -7.746  1.00 14.52 ? 453  GLU A OE2 1 
ATOM   3440  N N   . SER A 1 428 ? 64.363  13.207  -4.657  1.00 11.57 ? 454  SER A N   1 
ATOM   3441  C CA  . SER A 1 428 ? 64.643  13.080  -3.230  1.00 13.46 ? 454  SER A CA  1 
ATOM   3442  C C   . SER A 1 428 ? 66.056  12.570  -2.968  1.00 14.69 ? 454  SER A C   1 
ATOM   3443  O O   . SER A 1 428 ? 66.498  11.614  -3.601  1.00 13.85 ? 454  SER A O   1 
ATOM   3444  C CB  . SER A 1 428 ? 63.676  12.087  -2.577  1.00 11.89 ? 454  SER A CB  1 
ATOM   3445  O OG  . SER A 1 428 ? 62.332  12.420  -2.827  1.00 15.86 ? 454  SER A OG  1 
ATOM   3446  N N   . ALA A 1 429 ? 66.757  13.201  -2.022  1.00 14.37 ? 455  ALA A N   1 
ATOM   3447  C CA  . ALA A 1 429 ? 68.097  12.775  -1.634  1.00 13.72 ? 455  ALA A CA  1 
ATOM   3448  C C   . ALA A 1 429 ? 68.079  12.627  -0.118  1.00 14.64 ? 455  ALA A C   1 
ATOM   3449  O O   . ALA A 1 429 ? 67.616  13.518  0.582   1.00 13.48 ? 455  ALA A O   1 
ATOM   3450  C CB  . ALA A 1 429 ? 69.123  13.814  -2.037  1.00 14.20 ? 455  ALA A CB  1 
ATOM   3451  N N   . SER A 1 430 ? 68.579  11.505  0.384   1.00 13.41 ? 456  SER A N   1 
ATOM   3452  C CA  . SER A 1 430 ? 68.597  11.272  1.819   1.00 14.95 ? 456  SER A CA  1 
ATOM   3453  C C   . SER A 1 430 ? 69.746  11.981  2.518   1.00 14.37 ? 456  SER A C   1 
ATOM   3454  O O   . SER A 1 430 ? 70.886  11.914  2.070   1.00 15.39 ? 456  SER A O   1 
ATOM   3455  C CB  . SER A 1 430 ? 68.699  9.777   2.127   1.00 15.15 ? 456  SER A CB  1 
ATOM   3456  O OG  . SER A 1 430 ? 68.777  9.568   3.533   1.00 16.96 ? 456  SER A OG  1 
ATOM   3457  N N   . LEU A 1 431 ? 69.441  12.649  3.627   1.00 16.32 ? 457  LEU A N   1 
ATOM   3458  C CA  . LEU A 1 431 ? 70.451  13.345  4.423   1.00 15.66 ? 457  LEU A CA  1 
ATOM   3459  C C   . LEU A 1 431 ? 70.656  12.594  5.746   1.00 15.69 ? 457  LEU A C   1 
ATOM   3460  O O   . LEU A 1 431 ? 71.163  13.158  6.715   1.00 14.28 ? 457  LEU A O   1 
ATOM   3461  C CB  . LEU A 1 431 ? 70.004  14.792  4.695   1.00 15.53 ? 457  LEU A CB  1 
ATOM   3462  C CG  . LEU A 1 431 ? 70.255  15.828  3.590   1.00 15.79 ? 457  LEU A CG  1 
ATOM   3463  C CD1 . LEU A 1 431 ? 71.734  16.135  3.496   1.00 15.89 ? 457  LEU A CD1 1 
ATOM   3464  C CD2 . LEU A 1 431 ? 69.754  15.296  2.273   1.00 20.38 ? 457  LEU A CD2 1 
ATOM   3465  N N   . ARG A 1 432 ? 70.280  11.318  5.777   1.00 14.25 ? 458  ARG A N   1 
ATOM   3466  C CA  . ARG A 1 432 ? 70.407  10.521  7.001   1.00 14.81 ? 458  ARG A CA  1 
ATOM   3467  C C   . ARG A 1 432 ? 71.826  10.323  7.525   1.00 14.66 ? 458  ARG A C   1 
ATOM   3468  O O   . ARG A 1 432 ? 72.017  9.786   8.616   1.00 14.57 ? 458  ARG A O   1 
ATOM   3469  C CB  . ARG A 1 432 ? 69.729  9.160   6.834   1.00 13.76 ? 458  ARG A CB  1 
ATOM   3470  C CG  . ARG A 1 432 ? 68.205  9.217   6.844   1.00 13.68 ? 458  ARG A CG  1 
ATOM   3471  C CD  . ARG A 1 432 ? 67.632  7.833   6.577   1.00 16.18 ? 458  ARG A CD  1 
ATOM   3472  N NE  . ARG A 1 432 ? 68.133  6.857   7.540   1.00 15.29 ? 458  ARG A NE  1 
ATOM   3473  C CZ  . ARG A 1 432 ? 68.135  5.540   7.337   1.00 16.14 ? 458  ARG A CZ  1 
ATOM   3474  N NH1 . ARG A 1 432 ? 67.665  5.038   6.200   1.00 16.24 ? 458  ARG A NH1 1 
ATOM   3475  N NH2 . ARG A 1 432 ? 68.606  4.725   8.268   1.00 14.73 ? 458  ARG A NH2 1 
ATOM   3476  N N   . MET A 1 433 ? 72.834  10.747  6.779   1.00 14.86 ? 459  MET A N   1 
ATOM   3477  C CA  . MET A 1 433 ? 74.181  10.588  7.308   1.00 17.46 ? 459  MET A CA  1 
ATOM   3478  C C   . MET A 1 433 ? 74.391  11.651  8.387   1.00 15.34 ? 459  MET A C   1 
ATOM   3479  O O   . MET A 1 433 ? 75.412  11.650  9.071   1.00 15.16 ? 459  MET A O   1 
ATOM   3480  C CB  . MET A 1 433 ? 75.236  10.725  6.216   1.00 19.84 ? 459  MET A CB  1 
ATOM   3481  C CG  . MET A 1 433 ? 75.371  12.106  5.646   1.00 23.26 ? 459  MET A CG  1 
ATOM   3482  S SD  . MET A 1 433 ? 76.968  12.252  4.838   1.00 32.08 ? 459  MET A SD  1 
ATOM   3483  C CE  . MET A 1 433 ? 76.821  10.989  3.531   1.00 27.72 ? 459  MET A CE  1 
ATOM   3484  N N   . PHE A 1 434 ? 73.420  12.549  8.521   1.00 13.39 ? 460  PHE A N   1 
ATOM   3485  C CA  . PHE A 1 434 ? 73.463  13.603  9.532   1.00 12.31 ? 460  PHE A CA  1 
ATOM   3486  C C   . PHE A 1 434 ? 72.353  13.370  10.553  1.00 12.48 ? 460  PHE A C   1 
ATOM   3487  O O   . PHE A 1 434 ? 71.288  12.851  10.218  1.00 10.71 ? 460  PHE A O   1 
ATOM   3488  C CB  . PHE A 1 434 ? 73.310  14.988  8.889   1.00 12.88 ? 460  PHE A CB  1 
ATOM   3489  C CG  . PHE A 1 434 ? 74.364  15.299  7.861   1.00 12.19 ? 460  PHE A CG  1 
ATOM   3490  C CD1 . PHE A 1 434 ? 74.058  15.271  6.504   1.00 10.96 ? 460  PHE A CD1 1 
ATOM   3491  C CD2 . PHE A 1 434 ? 75.672  15.564  8.246   1.00 12.35 ? 460  PHE A CD2 1 
ATOM   3492  C CE1 . PHE A 1 434 ? 75.039  15.497  5.540   1.00 10.06 ? 460  PHE A CE1 1 
ATOM   3493  C CE2 . PHE A 1 434 ? 76.671  15.794  7.286   1.00 13.67 ? 460  PHE A CE2 1 
ATOM   3494  C CZ  . PHE A 1 434 ? 76.353  15.760  5.933   1.00 13.91 ? 460  PHE A CZ  1 
ATOM   3495  N N   . HIS A 1 435 ? 72.618  13.744  11.806  1.00 12.72 ? 461  HIS A N   1 
ATOM   3496  C CA  . HIS A 1 435 ? 71.654  13.575  12.888  1.00 13.74 ? 461  HIS A CA  1 
ATOM   3497  C C   . HIS A 1 435 ? 70.286  14.149  12.513  1.00 12.94 ? 461  HIS A C   1 
ATOM   3498  O O   . HIS A 1 435 ? 70.187  15.306  12.112  1.00 16.04 ? 461  HIS A O   1 
ATOM   3499  C CB  . HIS A 1 435 ? 72.168  14.260  14.161  1.00 14.02 ? 461  HIS A CB  1 
ATOM   3500  C CG  . HIS A 1 435 ? 71.293  14.043  15.361  1.00 13.80 ? 461  HIS A CG  1 
ATOM   3501  N ND1 . HIS A 1 435 ? 70.916  15.067  16.199  1.00 15.42 ? 461  HIS A ND1 1 
ATOM   3502  C CD2 . HIS A 1 435 ? 70.722  12.922  15.850  1.00 13.95 ? 461  HIS A CD2 1 
ATOM   3503  C CE1 . HIS A 1 435 ? 70.137  14.587  17.155  1.00 14.90 ? 461  HIS A CE1 1 
ATOM   3504  N NE2 . HIS A 1 435 ? 70.007  13.281  16.965  1.00 14.45 ? 461  HIS A NE2 1 
ATOM   3505  N N   . LEU A 1 436 ? 69.247  13.334  12.646  1.00 12.59 ? 462  LEU A N   1 
ATOM   3506  C CA  . LEU A 1 436 ? 67.866  13.727  12.338  1.00 12.01 ? 462  LEU A CA  1 
ATOM   3507  C C   . LEU A 1 436 ? 67.667  14.141  10.874  1.00 11.30 ? 462  LEU A C   1 
ATOM   3508  O O   . LEU A 1 436 ? 66.617  14.657  10.500  1.00 9.35  ? 462  LEU A O   1 
ATOM   3509  C CB  . LEU A 1 436 ? 67.415  14.866  13.277  1.00 13.29 ? 462  LEU A CB  1 
ATOM   3510  C CG  . LEU A 1 436 ? 67.514  14.595  14.789  1.00 15.68 ? 462  LEU A CG  1 
ATOM   3511  C CD1 . LEU A 1 436 ? 67.135  15.844  15.594  1.00 15.75 ? 462  LEU A CD1 1 
ATOM   3512  C CD2 . LEU A 1 436 ? 66.609  13.430  15.152  1.00 15.62 ? 462  LEU A CD2 1 
ATOM   3513  N N   . GLY A 1 437 ? 68.670  13.899  10.041  1.00 11.33 ? 463  GLY A N   1 
ATOM   3514  C CA  . GLY A 1 437 ? 68.562  14.273  8.642   1.00 12.70 ? 463  GLY A CA  1 
ATOM   3515  C C   . GLY A 1 437 ? 67.386  13.649  7.910   1.00 12.00 ? 463  GLY A C   1 
ATOM   3516  O O   . GLY A 1 437 ? 67.064  12.475  8.109   1.00 10.58 ? 463  GLY A O   1 
ATOM   3517  N N   . ARG A 1 438 ? 66.732  14.437  7.069   1.00 12.76 ? 464  ARG A N   1 
ATOM   3518  C CA  . ARG A 1 438 ? 65.605  13.933  6.290   1.00 12.68 ? 464  ARG A CA  1 
ATOM   3519  C C   . ARG A 1 438 ? 66.027  13.881  4.829   1.00 11.37 ? 464  ARG A C   1 
ATOM   3520  O O   . ARG A 1 438 ? 66.610  12.899  4.376   1.00 12.53 ? 464  ARG A O   1 
ATOM   3521  C CB  . ARG A 1 438 ? 64.380  14.838  6.457   1.00 13.92 ? 464  ARG A CB  1 
ATOM   3522  C CG  . ARG A 1 438 ? 63.816  14.863  7.871   1.00 19.59 ? 464  ARG A CG  1 
ATOM   3523  C CD  . ARG A 1 438 ? 62.971  13.636  8.184   1.00 21.45 ? 464  ARG A CD  1 
ATOM   3524  N NE  . ARG A 1 438 ? 61.795  13.541  7.316   1.00 23.29 ? 464  ARG A NE  1 
ATOM   3525  C CZ  . ARG A 1 438 ? 60.567  13.283  7.751   1.00 23.51 ? 464  ARG A CZ  1 
ATOM   3526  N NH1 . ARG A 1 438 ? 60.338  13.097  9.048   1.00 23.18 ? 464  ARG A NH1 1 
ATOM   3527  N NH2 . ARG A 1 438 ? 59.558  13.192  6.894   1.00 19.68 ? 464  ARG A NH2 1 
ATOM   3528  N N   . THR A 1 439 ? 65.772  14.959  4.088   1.00 9.67  ? 465  THR A N   1 
ATOM   3529  C CA  . THR A 1 439 ? 66.119  14.962  2.678   1.00 10.02 ? 465  THR A CA  1 
ATOM   3530  C C   . THR A 1 439 ? 66.558  16.318  2.139   1.00 12.34 ? 465  THR A C   1 
ATOM   3531  O O   . THR A 1 439 ? 66.391  17.356  2.779   1.00 11.10 ? 465  THR A O   1 
ATOM   3532  C CB  . THR A 1 439 ? 64.915  14.540  1.815   1.00 10.95 ? 465  THR A CB  1 
ATOM   3533  O OG1 . THR A 1 439 ? 63.943  15.589  1.852   1.00 12.13 ? 465  THR A OG1 1 
ATOM   3534  C CG2 . THR A 1 439 ? 64.271  13.227  2.318   1.00 9.38  ? 465  THR A CG2 1 
ATOM   3535  N N   . ASP A 1 440 ? 67.130  16.291  0.939   1.00 11.35 ? 466  ASP A N   1 
ATOM   3536  C CA  . ASP A 1 440 ? 67.530  17.506  0.257   1.00 12.66 ? 466  ASP A CA  1 
ATOM   3537  C C   . ASP A 1 440 ? 67.107  17.286  -1.192  1.00 12.40 ? 466  ASP A C   1 
ATOM   3538  O O   . ASP A 1 440 ? 66.538  16.242  -1.529  1.00 10.53 ? 466  ASP A O   1 
ATOM   3539  C CB  . ASP A 1 440 ? 69.032  17.758  0.332   1.00 12.63 ? 466  ASP A CB  1 
ATOM   3540  C CG  . ASP A 1 440 ? 69.373  19.251  0.300   1.00 15.76 ? 466  ASP A CG  1 
ATOM   3541  O OD1 . ASP A 1 440 ? 68.703  20.022  -0.430  1.00 12.44 ? 466  ASP A OD1 1 
ATOM   3542  O OD2 . ASP A 1 440 ? 70.323  19.652  1.001   1.00 17.72 ? 466  ASP A OD2 1 
ATOM   3543  N N   . THR A 1 441 ? 67.383  18.252  -2.044  1.00 12.68 ? 467  THR A N   1 
ATOM   3544  C CA  . THR A 1 441 ? 66.968  18.140  -3.428  1.00 12.12 ? 467  THR A CA  1 
ATOM   3545  C C   . THR A 1 441 ? 68.079  17.968  -4.437  1.00 12.08 ? 467  THR A C   1 
ATOM   3546  O O   . THR A 1 441 ? 69.038  18.740  -4.470  1.00 12.95 ? 467  THR A O   1 
ATOM   3547  C CB  . THR A 1 441 ? 66.136  19.380  -3.844  1.00 12.05 ? 467  THR A CB  1 
ATOM   3548  O OG1 . THR A 1 441 ? 65.014  19.506  -2.964  1.00 9.76  ? 467  THR A OG1 1 
ATOM   3549  C CG2 . THR A 1 441 ? 65.639  19.250  -5.295  1.00 12.37 ? 467  THR A CG2 1 
ATOM   3550  N N   . ILE A 1 442 ? 67.936  16.940  -5.266  1.00 9.54  ? 468  ILE A N   1 
ATOM   3551  C CA  . ILE A 1 442 ? 68.872  16.708  -6.346  1.00 10.63 ? 468  ILE A CA  1 
ATOM   3552  C C   . ILE A 1 442 ? 68.123  17.231  -7.576  1.00 9.44  ? 468  ILE A C   1 
ATOM   3553  O O   . ILE A 1 442 ? 67.011  16.787  -7.858  1.00 9.55  ? 468  ILE A O   1 
ATOM   3554  C CB  . ILE A 1 442 ? 69.164  15.205  -6.518  1.00 11.37 ? 468  ILE A CB  1 
ATOM   3555  C CG1 . ILE A 1 442 ? 69.979  14.709  -5.324  1.00 12.80 ? 468  ILE A CG1 1 
ATOM   3556  C CG2 . ILE A 1 442 ? 69.910  14.947  -7.833  1.00 12.59 ? 468  ILE A CG2 1 
ATOM   3557  C CD1 . ILE A 1 442 ? 70.145  13.224  -5.286  1.00 12.13 ? 468  ILE A CD1 1 
ATOM   3558  N N   . ARG A 1 443 ? 68.703  18.202  -8.276  1.00 9.21  ? 469  ARG A N   1 
ATOM   3559  C CA  . ARG A 1 443 ? 68.070  18.755  -9.473  1.00 10.37 ? 469  ARG A CA  1 
ATOM   3560  C C   . ARG A 1 443 ? 68.566  18.040  -10.726 1.00 11.56 ? 469  ARG A C   1 
ATOM   3561  O O   . ARG A 1 443 ? 69.698  18.243  -11.161 1.00 13.04 ? 469  ARG A O   1 
ATOM   3562  C CB  . ARG A 1 443 ? 68.322  20.261  -9.573  1.00 9.52  ? 469  ARG A CB  1 
ATOM   3563  C CG  . ARG A 1 443 ? 67.436  21.045  -8.628  1.00 10.53 ? 469  ARG A CG  1 
ATOM   3564  C CD  . ARG A 1 443 ? 67.825  22.505  -8.491  1.00 12.64 ? 469  ARG A CD  1 
ATOM   3565  N NE  . ARG A 1 443 ? 66.877  23.171  -7.599  1.00 10.09 ? 469  ARG A NE  1 
ATOM   3566  C CZ  . ARG A 1 443 ? 65.692  23.629  -7.976  1.00 10.91 ? 469  ARG A CZ  1 
ATOM   3567  N NH1 . ARG A 1 443 ? 65.304  23.515  -9.240  1.00 12.13 ? 469  ARG A NH1 1 
ATOM   3568  N NH2 . ARG A 1 443 ? 64.870  24.168  -7.084  1.00 7.90  ? 469  ARG A NH2 1 
ATOM   3569  N N   . SER A 1 444 ? 67.697  17.207  -11.295 1.00 13.66 ? 470  SER A N   1 
ATOM   3570  C CA  . SER A 1 444 ? 68.006  16.407  -12.480 1.00 13.11 ? 470  SER A CA  1 
ATOM   3571  C C   . SER A 1 444 ? 68.128  17.222  -13.763 1.00 12.36 ? 470  SER A C   1 
ATOM   3572  O O   . SER A 1 444 ? 68.718  16.761  -14.738 1.00 9.81  ? 470  SER A O   1 
ATOM   3573  C CB  . SER A 1 444 ? 66.953  15.319  -12.661 1.00 12.38 ? 470  SER A CB  1 
ATOM   3574  O OG  . SER A 1 444 ? 66.787  14.589  -11.465 1.00 16.38 ? 470  SER A OG  1 
ATOM   3575  N N   . ALA A 1 445 ? 67.557  18.421  -13.778 1.00 11.73 ? 471  ALA A N   1 
ATOM   3576  C CA  . ALA A 1 445 ? 67.688  19.271  -14.955 1.00 11.89 ? 471  ALA A CA  1 
ATOM   3577  C C   . ALA A 1 445 ? 68.946  20.104  -14.783 1.00 13.51 ? 471  ALA A C   1 
ATOM   3578  O O   . ALA A 1 445 ? 69.035  20.923  -13.868 1.00 17.59 ? 471  ALA A O   1 
ATOM   3579  C CB  . ALA A 1 445 ? 66.483  20.178  -15.101 1.00 13.21 ? 471  ALA A CB  1 
ATOM   3580  N N   . SER A 1 446 ? 69.924  19.888  -15.662 1.00 13.87 ? 472  SER A N   1 
ATOM   3581  C CA  . SER A 1 446 ? 71.174  20.628  -15.583 1.00 13.35 ? 472  SER A CA  1 
ATOM   3582  C C   . SER A 1 446 ? 71.735  21.008  -16.954 1.00 14.29 ? 472  SER A C   1 
ATOM   3583  O O   . SER A 1 446 ? 71.123  20.743  -17.988 1.00 14.26 ? 472  SER A O   1 
ATOM   3584  C CB  . SER A 1 446 ? 72.219  19.810  -14.835 1.00 12.44 ? 472  SER A CB  1 
ATOM   3585  O OG  . SER A 1 446 ? 72.544  18.642  -15.575 1.00 16.81 ? 472  SER A OG  1 
ATOM   3586  N N   . ILE A 1 447 ? 72.903  21.634  -16.951 1.00 13.91 ? 473  ILE A N   1 
ATOM   3587  C CA  . ILE A 1 447 ? 73.538  22.048  -18.189 1.00 15.97 ? 473  ILE A CA  1 
ATOM   3588  C C   . ILE A 1 447 ? 73.922  20.828  -19.006 1.00 16.77 ? 473  ILE A C   1 
ATOM   3589  O O   . ILE A 1 447 ? 73.755  20.816  -20.224 1.00 19.16 ? 473  ILE A O   1 
ATOM   3590  C CB  . ILE A 1 447 ? 74.791  22.887  -17.904 1.00 15.40 ? 473  ILE A CB  1 
ATOM   3591  C CG1 . ILE A 1 447 ? 74.373  24.169  -17.178 1.00 15.02 ? 473  ILE A CG1 1 
ATOM   3592  C CG2 . ILE A 1 447 ? 75.542  23.188  -19.208 1.00 15.73 ? 473  ILE A CG2 1 
ATOM   3593  C CD1 . ILE A 1 447 ? 75.517  24.911  -16.539 1.00 16.49 ? 473  ILE A CD1 1 
ATOM   3594  N N   . ASP A 1 448 ? 74.424  19.794  -18.332 1.00 15.99 ? 474  ASP A N   1 
ATOM   3595  C CA  . ASP A 1 448 ? 74.833  18.571  -19.010 1.00 15.52 ? 474  ASP A CA  1 
ATOM   3596  C C   . ASP A 1 448 ? 73.668  17.719  -19.503 1.00 14.74 ? 474  ASP A C   1 
ATOM   3597  O O   . ASP A 1 448 ? 73.735  17.159  -20.593 1.00 15.53 ? 474  ASP A O   1 
ATOM   3598  C CB  . ASP A 1 448 ? 75.758  17.750  -18.100 1.00 17.39 ? 474  ASP A CB  1 
ATOM   3599  C CG  . ASP A 1 448 ? 77.072  18.456  -17.831 1.00 18.22 ? 474  ASP A CG  1 
ATOM   3600  O OD1 . ASP A 1 448 ? 77.696  18.928  -18.804 1.00 19.04 ? 474  ASP A OD1 1 
ATOM   3601  O OD2 . ASP A 1 448 ? 77.486  18.533  -16.658 1.00 21.75 ? 474  ASP A OD2 1 
ATOM   3602  N N   . SER A 1 449 ? 72.597  17.615  -18.715 1.00 12.63 ? 475  SER A N   1 
ATOM   3603  C CA  . SER A 1 449 ? 71.454  16.829  -19.152 1.00 13.29 ? 475  SER A CA  1 
ATOM   3604  C C   . SER A 1 449 ? 70.810  17.502  -20.358 1.00 14.43 ? 475  SER A C   1 
ATOM   3605  O O   . SER A 1 449 ? 70.442  16.836  -21.324 1.00 13.91 ? 475  SER A O   1 
ATOM   3606  C CB  . SER A 1 449 ? 70.417  16.675  -18.034 1.00 11.61 ? 475  SER A CB  1 
ATOM   3607  O OG  . SER A 1 449 ? 69.781  17.900  -17.742 1.00 15.88 ? 475  SER A OG  1 
ATOM   3608  N N   . LEU A 1 450 ? 70.673  18.823  -20.321 1.00 13.55 ? 476  LEU A N   1 
ATOM   3609  C CA  . LEU A 1 450 ? 70.059  19.509  -21.446 1.00 15.11 ? 476  LEU A CA  1 
ATOM   3610  C C   . LEU A 1 450 ? 70.925  19.361  -22.700 1.00 15.24 ? 476  LEU A C   1 
ATOM   3611  O O   . LEU A 1 450 ? 70.404  19.199  -23.805 1.00 15.82 ? 476  LEU A O   1 
ATOM   3612  C CB  . LEU A 1 450 ? 69.854  20.993  -21.121 1.00 13.66 ? 476  LEU A CB  1 
ATOM   3613  C CG  . LEU A 1 450 ? 69.202  21.826  -22.227 1.00 13.93 ? 476  LEU A CG  1 
ATOM   3614  C CD1 . LEU A 1 450 ? 67.860  21.216  -22.601 1.00 12.39 ? 476  LEU A CD1 1 
ATOM   3615  C CD2 . LEU A 1 450 ? 69.028  23.261  -21.760 1.00 14.71 ? 476  LEU A CD2 1 
ATOM   3616  N N   . ALA A 1 451 ? 72.237  19.402  -22.528 1.00 15.45 ? 477  ALA A N   1 
ATOM   3617  C CA  . ALA A 1 451 ? 73.140  19.262  -23.665 1.00 16.85 ? 477  ALA A CA  1 
ATOM   3618  C C   . ALA A 1 451 ? 72.966  17.879  -24.279 1.00 17.28 ? 477  ALA A C   1 
ATOM   3619  O O   . ALA A 1 451 ? 73.119  17.703  -25.485 1.00 17.07 ? 477  ALA A O   1 
ATOM   3620  C CB  . ALA A 1 451 ? 74.576  19.459  -23.226 1.00 15.33 ? 477  ALA A CB  1 
ATOM   3621  N N   . PHE A 1 452 ? 72.642  16.898  -23.436 1.00 17.16 ? 478  PHE A N   1 
ATOM   3622  C CA  . PHE A 1 452 ? 72.448  15.533  -23.896 1.00 17.84 ? 478  PHE A CA  1 
ATOM   3623  C C   . PHE A 1 452 ? 71.132  15.338  -24.639 1.00 18.78 ? 478  PHE A C   1 
ATOM   3624  O O   . PHE A 1 452 ? 71.114  14.797  -25.741 1.00 19.03 ? 478  PHE A O   1 
ATOM   3625  C CB  . PHE A 1 452 ? 72.503  14.547  -22.725 1.00 17.94 ? 478  PHE A CB  1 
ATOM   3626  C CG  . PHE A 1 452 ? 71.966  13.177  -23.072 1.00 18.07 ? 478  PHE A CG  1 
ATOM   3627  C CD1 . PHE A 1 452 ? 72.568  12.401  -24.065 1.00 16.26 ? 478  PHE A CD1 1 
ATOM   3628  C CD2 . PHE A 1 452 ? 70.843  12.678  -22.429 1.00 16.14 ? 478  PHE A CD2 1 
ATOM   3629  C CE1 . PHE A 1 452 ? 72.055  11.151  -24.409 1.00 16.88 ? 478  PHE A CE1 1 
ATOM   3630  C CE2 . PHE A 1 452 ? 70.321  11.431  -22.764 1.00 17.62 ? 478  PHE A CE2 1 
ATOM   3631  C CZ  . PHE A 1 452 ? 70.924  10.665  -23.753 1.00 15.46 ? 478  PHE A CZ  1 
ATOM   3632  N N   . VAL A 1 453 ? 70.031  15.764  -24.024 1.00 17.52 ? 479  VAL A N   1 
ATOM   3633  C CA  . VAL A 1 453 ? 68.718  15.612  -24.635 1.00 18.18 ? 479  VAL A CA  1 
ATOM   3634  C C   . VAL A 1 453 ? 68.637  16.340  -25.973 1.00 19.16 ? 479  VAL A C   1 
ATOM   3635  O O   . VAL A 1 453 ? 67.941  15.899  -26.889 1.00 20.87 ? 479  VAL A O   1 
ATOM   3636  C CB  . VAL A 1 453 ? 67.612  16.116  -23.688 1.00 18.55 ? 479  VAL A CB  1 
ATOM   3637  C CG1 . VAL A 1 453 ? 67.681  15.347  -22.373 1.00 16.86 ? 479  VAL A CG1 1 
ATOM   3638  C CG2 . VAL A 1 453 ? 67.756  17.616  -23.443 1.00 17.26 ? 479  VAL A CG2 1 
ATOM   3639  N N   . LYS A 1 454 ? 69.362  17.443  -26.087 1.00 19.71 ? 480  LYS A N   1 
ATOM   3640  C CA  . LYS A 1 454 ? 69.385  18.209  -27.326 1.00 21.22 ? 480  LYS A CA  1 
ATOM   3641  C C   . LYS A 1 454 ? 70.172  17.456  -28.390 1.00 21.43 ? 480  LYS A C   1 
ATOM   3642  O O   . LYS A 1 454 ? 69.670  17.204  -29.486 1.00 20.38 ? 480  LYS A O   1 
ATOM   3643  C CB  . LYS A 1 454 ? 70.019  19.581  -27.098 1.00 21.75 ? 480  LYS A CB  1 
ATOM   3644  C CG  . LYS A 1 454 ? 69.106  20.558  -26.386 1.00 25.41 ? 480  LYS A CG  1 
ATOM   3645  C CD  . LYS A 1 454 ? 69.707  21.946  -26.369 1.00 27.46 ? 480  LYS A CD  1 
ATOM   3646  C CE  . LYS A 1 454 ? 68.700  22.974  -25.876 1.00 31.41 ? 480  LYS A CE  1 
ATOM   3647  N NZ  . LYS A 1 454 ? 67.529  23.105  -26.786 1.00 32.29 ? 480  LYS A NZ  1 
ATOM   3648  N N   . GLY A 1 455 ? 71.405  17.092  -28.056 1.00 20.86 ? 481  GLY A N   1 
ATOM   3649  C CA  . GLY A 1 455 ? 72.241  16.374  -28.999 1.00 22.84 ? 481  GLY A CA  1 
ATOM   3650  C C   . GLY A 1 455 ? 71.688  15.005  -29.346 1.00 24.01 ? 481  GLY A C   1 
ATOM   3651  O O   . GLY A 1 455 ? 71.926  14.486  -30.438 1.00 24.24 ? 481  GLY A O   1 
ATOM   3652  N N   . MET A 1 456 ? 70.950  14.418  -28.416 1.00 24.06 ? 482  MET A N   1 
ATOM   3653  C CA  . MET A 1 456 ? 70.366  13.105  -28.629 1.00 25.89 ? 482  MET A CA  1 
ATOM   3654  C C   . MET A 1 456 ? 69.332  13.142  -29.753 1.00 28.93 ? 482  MET A C   1 
ATOM   3655  O O   . MET A 1 456 ? 69.303  12.254  -30.604 1.00 30.06 ? 482  MET A O   1 
ATOM   3656  C CB  . MET A 1 456 ? 69.716  12.610  -27.338 1.00 23.69 ? 482  MET A CB  1 
ATOM   3657  C CG  . MET A 1 456 ? 69.112  11.233  -27.450 1.00 22.27 ? 482  MET A CG  1 
ATOM   3658  S SD  . MET A 1 456 ? 70.381  9.996   -27.732 1.00 20.57 ? 482  MET A SD  1 
ATOM   3659  C CE  . MET A 1 456 ? 69.466  8.522   -27.440 1.00 19.29 ? 482  MET A CE  1 
ATOM   3660  N N   . GLY A 1 457 ? 68.483  14.167  -29.754 1.00 31.23 ? 483  GLY A N   1 
ATOM   3661  C CA  . GLY A 1 457 ? 67.465  14.278  -30.785 1.00 32.87 ? 483  GLY A CA  1 
ATOM   3662  C C   . GLY A 1 457 ? 67.934  15.092  -31.979 1.00 34.16 ? 483  GLY A C   1 
ATOM   3663  O O   . GLY A 1 457 ? 67.132  15.521  -32.811 1.00 35.24 ? 483  GLY A O   1 
ATOM   3664  N N   . ASP A 1 458 ? 69.238  15.310  -32.070 1.00 34.25 ? 484  ASP A N   1 
ATOM   3665  C CA  . ASP A 1 458 ? 69.784  16.080  -33.174 1.00 34.41 ? 484  ASP A CA  1 
ATOM   3666  C C   . ASP A 1 458 ? 70.258  15.122  -34.256 1.00 35.32 ? 484  ASP A C   1 
ATOM   3667  O O   . ASP A 1 458 ? 71.251  14.415  -34.074 1.00 35.10 ? 484  ASP A O   1 
ATOM   3668  C CB  . ASP A 1 458 ? 70.948  16.936  -32.694 1.00 34.04 ? 484  ASP A CB  1 
ATOM   3669  C CG  . ASP A 1 458 ? 71.362  17.973  -33.713 1.00 35.97 ? 484  ASP A CG  1 
ATOM   3670  O OD1 . ASP A 1 458 ? 71.421  17.638  -34.916 1.00 37.21 ? 484  ASP A OD1 1 
ATOM   3671  O OD2 . ASP A 1 458 ? 71.637  19.124  -33.312 1.00 35.34 ? 484  ASP A OD2 1 
ATOM   3672  N N   . SER A 1 459 ? 69.547  15.102  -35.382 1.00 35.52 ? 485  SER A N   1 
ATOM   3673  C CA  . SER A 1 459 ? 69.890  14.220  -36.494 1.00 36.09 ? 485  SER A CA  1 
ATOM   3674  C C   . SER A 1 459 ? 71.154  14.658  -37.228 1.00 35.79 ? 485  SER A C   1 
ATOM   3675  O O   . SER A 1 459 ? 71.478  14.128  -38.289 1.00 34.95 ? 485  SER A O   1 
ATOM   3676  C CB  . SER A 1 459 ? 68.720  14.141  -37.486 1.00 36.71 ? 485  SER A CB  1 
ATOM   3677  O OG  . SER A 1 459 ? 68.426  15.409  -38.061 1.00 38.62 ? 485  SER A OG  1 
ATOM   3678  N N   . THR A 1 460 ? 71.870  15.620  -36.660 1.00 36.30 ? 486  THR A N   1 
ATOM   3679  C CA  . THR A 1 460 ? 73.093  16.103  -37.281 1.00 37.24 ? 486  THR A CA  1 
ATOM   3680  C C   . THR A 1 460 ? 74.286  15.852  -36.375 1.00 37.55 ? 486  THR A C   1 
ATOM   3681  O O   . THR A 1 460 ? 75.399  16.278  -36.673 1.00 39.09 ? 486  THR A O   1 
ATOM   3682  C CB  . THR A 1 460 ? 73.026  17.609  -37.570 1.00 37.40 ? 486  THR A CB  1 
ATOM   3683  O OG1 . THR A 1 460 ? 73.347  18.336  -36.379 1.00 37.68 ? 486  THR A OG1 1 
ATOM   3684  C CG2 . THR A 1 460 ? 71.630  18.004  -38.042 1.00 37.18 ? 486  THR A CG2 1 
ATOM   3685  N N   . VAL A 1 461 ? 74.048  15.168  -35.260 1.00 38.00 ? 487  VAL A N   1 
ATOM   3686  C CA  . VAL A 1 461 ? 75.113  14.864  -34.303 1.00 37.83 ? 487  VAL A CA  1 
ATOM   3687  C C   . VAL A 1 461 ? 75.509  13.390  -34.371 1.00 38.17 ? 487  VAL A C   1 
ATOM   3688  O O   . VAL A 1 461 ? 74.659  12.507  -34.265 1.00 37.06 ? 487  VAL A O   1 
ATOM   3689  C CB  . VAL A 1 461 ? 74.677  15.181  -32.855 1.00 37.19 ? 487  VAL A CB  1 
ATOM   3690  C CG1 . VAL A 1 461 ? 75.762  14.761  -31.879 1.00 35.79 ? 487  VAL A CG1 1 
ATOM   3691  C CG2 . VAL A 1 461 ? 74.394  16.663  -32.714 1.00 36.82 ? 487  VAL A CG2 1 
ATOM   3692  N N   . PRO A 1 462 ? 76.814  13.109  -34.542 1.00 39.21 ? 488  PRO A N   1 
ATOM   3693  C CA  . PRO A 1 462 ? 77.321  11.735  -34.622 1.00 40.11 ? 488  PRO A CA  1 
ATOM   3694  C C   . PRO A 1 462 ? 76.828  10.898  -33.450 1.00 40.29 ? 488  PRO A C   1 
ATOM   3695  O O   . PRO A 1 462 ? 76.904  11.325  -32.299 1.00 39.69 ? 488  PRO A O   1 
ATOM   3696  C CB  . PRO A 1 462 ? 78.831  11.930  -34.598 1.00 40.32 ? 488  PRO A CB  1 
ATOM   3697  C CG  . PRO A 1 462 ? 78.999  13.221  -35.324 1.00 40.24 ? 488  PRO A CG  1 
ATOM   3698  C CD  . PRO A 1 462 ? 77.916  14.073  -34.693 1.00 39.46 ? 488  PRO A CD  1 
ATOM   3699  N N   . GLU A 1 463 ? 76.327  9.708   -33.751 1.00 40.67 ? 489  GLU A N   1 
ATOM   3700  C CA  . GLU A 1 463 ? 75.813  8.816   -32.722 1.00 41.28 ? 489  GLU A CA  1 
ATOM   3701  C C   . GLU A 1 463 ? 76.835  8.624   -31.599 1.00 41.84 ? 489  GLU A C   1 
ATOM   3702  O O   . GLU A 1 463 ? 76.473  8.614   -30.421 1.00 41.90 ? 489  GLU A O   1 
ATOM   3703  C CB  . GLU A 1 463 ? 75.436  7.465   -33.337 1.00 40.25 ? 489  GLU A CB  1 
ATOM   3704  C CG  . GLU A 1 463 ? 74.253  6.801   -32.651 1.00 40.53 ? 489  GLU A CG  1 
ATOM   3705  C CD  . GLU A 1 463 ? 73.903  5.449   -33.240 1.00 39.08 ? 489  GLU A CD  1 
ATOM   3706  O OE1 . GLU A 1 463 ? 74.770  4.553   -33.227 1.00 38.18 ? 489  GLU A OE1 1 
ATOM   3707  O OE2 . GLU A 1 463 ? 72.756  5.283   -33.706 1.00 38.55 ? 489  GLU A OE2 1 
ATOM   3708  N N   . GLN A 1 464 ? 78.106  8.492   -31.964 1.00 42.73 ? 490  GLN A N   1 
ATOM   3709  C CA  . GLN A 1 464 ? 79.175  8.304   -30.983 1.00 43.58 ? 490  GLN A CA  1 
ATOM   3710  C C   . GLN A 1 464 ? 79.364  9.570   -30.144 1.00 42.27 ? 490  GLN A C   1 
ATOM   3711  O O   . GLN A 1 464 ? 79.804  9.519   -28.996 1.00 43.07 ? 490  GLN A O   1 
ATOM   3712  C CB  . GLN A 1 464 ? 80.474  7.935   -31.707 1.00 46.59 ? 490  GLN A CB  1 
ATOM   3713  C CG  . GLN A 1 464 ? 81.622  7.505   -30.800 1.00 49.85 ? 490  GLN A CG  1 
ATOM   3714  C CD  . GLN A 1 464 ? 82.450  8.675   -30.310 1.00 51.54 ? 490  GLN A CD  1 
ATOM   3715  O OE1 . GLN A 1 464 ? 83.021  9.423   -31.105 1.00 51.92 ? 490  GLN A OE1 1 
ATOM   3716  N NE2 . GLN A 1 464 ? 82.526  8.836   -28.993 1.00 53.18 ? 490  GLN A NE2 1 
ATOM   3717  N N   . GLN A 1 465 ? 79.014  10.707  -30.726 1.00 40.26 ? 491  GLN A N   1 
ATOM   3718  C CA  . GLN A 1 465 ? 79.131  11.975  -30.029 1.00 37.39 ? 491  GLN A CA  1 
ATOM   3719  C C   . GLN A 1 465 ? 78.051  12.074  -28.957 1.00 34.30 ? 491  GLN A C   1 
ATOM   3720  O O   . GLN A 1 465 ? 78.258  12.685  -27.907 1.00 34.04 ? 491  GLN A O   1 
ATOM   3721  C CB  . GLN A 1 465 ? 78.996  13.124  -31.023 1.00 40.28 ? 491  GLN A CB  1 
ATOM   3722  C CG  . GLN A 1 465 ? 79.031  14.488  -30.378 1.00 43.84 ? 491  GLN A CG  1 
ATOM   3723  C CD  . GLN A 1 465 ? 80.148  14.613  -29.371 1.00 46.21 ? 491  GLN A CD  1 
ATOM   3724  O OE1 . GLN A 1 465 ? 81.300  14.283  -29.659 1.00 47.82 ? 491  GLN A OE1 1 
ATOM   3725  N NE2 . GLN A 1 465 ? 79.818  15.097  -28.179 1.00 48.10 ? 491  GLN A NE2 1 
ATOM   3726  N N   . LYS A 1 466 ? 76.896  11.473  -29.226 1.00 29.90 ? 492  LYS A N   1 
ATOM   3727  C CA  . LYS A 1 466 ? 75.801  11.498  -28.268 1.00 26.65 ? 492  LYS A CA  1 
ATOM   3728  C C   . LYS A 1 466 ? 76.177  10.661  -27.048 1.00 24.73 ? 492  LYS A C   1 
ATOM   3729  O O   . LYS A 1 466 ? 75.692  10.908  -25.945 1.00 22.90 ? 492  LYS A O   1 
ATOM   3730  C CB  . LYS A 1 466 ? 74.523  10.935  -28.890 1.00 25.81 ? 492  LYS A CB  1 
ATOM   3731  C CG  . LYS A 1 466 ? 74.135  11.542  -30.228 1.00 27.12 ? 492  LYS A CG  1 
ATOM   3732  C CD  . LYS A 1 466 ? 72.756  11.044  -30.651 1.00 27.05 ? 492  LYS A CD  1 
ATOM   3733  C CE  . LYS A 1 466 ? 72.492  11.276  -32.131 1.00 27.07 ? 492  LYS A CE  1 
ATOM   3734  N NZ  . LYS A 1 466 ? 72.741  12.681  -32.550 1.00 27.89 ? 492  LYS A NZ  1 
ATOM   3735  N N   . VAL A 1 467 ? 77.030  9.666   -27.260 1.00 22.89 ? 493  VAL A N   1 
ATOM   3736  C CA  . VAL A 1 467 ? 77.478  8.790   -26.182 1.00 24.29 ? 493  VAL A CA  1 
ATOM   3737  C C   . VAL A 1 467 ? 78.225  9.588   -25.120 1.00 23.77 ? 493  VAL A C   1 
ATOM   3738  O O   . VAL A 1 467 ? 77.972  9.439   -23.928 1.00 25.47 ? 493  VAL A O   1 
ATOM   3739  C CB  . VAL A 1 467 ? 78.410  7.673   -26.709 1.00 24.17 ? 493  VAL A CB  1 
ATOM   3740  C CG1 . VAL A 1 467 ? 79.019  6.909   -25.541 1.00 23.70 ? 493  VAL A CG1 1 
ATOM   3741  C CG2 . VAL A 1 467 ? 77.626  6.730   -27.604 1.00 23.96 ? 493  VAL A CG2 1 
ATOM   3742  N N   . GLU A 1 468 ? 79.147  10.437  -25.561 1.00 23.90 ? 494  GLU A N   1 
ATOM   3743  C CA  . GLU A 1 468 ? 79.933  11.267  -24.649 1.00 24.65 ? 494  GLU A CA  1 
ATOM   3744  C C   . GLU A 1 468 ? 78.992  12.160  -23.831 1.00 24.02 ? 494  GLU A C   1 
ATOM   3745  O O   . GLU A 1 468 ? 79.112  12.260  -22.605 1.00 23.12 ? 494  GLU A O   1 
ATOM   3746  C CB  . GLU A 1 468 ? 80.917  12.140  -25.440 1.00 26.67 ? 494  GLU A CB  1 
ATOM   3747  C CG  . GLU A 1 468 ? 81.867  11.352  -26.350 1.00 33.08 ? 494  GLU A CG  1 
ATOM   3748  C CD  . GLU A 1 468 ? 82.718  12.242  -27.255 1.00 36.79 ? 494  GLU A CD  1 
ATOM   3749  O OE1 . GLU A 1 468 ? 83.494  11.695  -28.068 1.00 40.84 ? 494  GLU A OE1 1 
ATOM   3750  O OE2 . GLU A 1 468 ? 82.615  13.485  -27.160 1.00 40.49 ? 494  GLU A OE2 1 
ATOM   3751  N N   . LEU A 1 469 ? 78.059  12.805  -24.517 1.00 21.66 ? 495  LEU A N   1 
ATOM   3752  C CA  . LEU A 1 469 ? 77.095  13.680  -23.858 1.00 22.33 ? 495  LEU A CA  1 
ATOM   3753  C C   . LEU A 1 469 ? 76.274  12.912  -22.837 1.00 21.43 ? 495  LEU A C   1 
ATOM   3754  O O   . LEU A 1 469 ? 75.941  13.434  -21.780 1.00 21.79 ? 495  LEU A O   1 
ATOM   3755  C CB  . LEU A 1 469 ? 76.168  14.323  -24.895 1.00 20.46 ? 495  LEU A CB  1 
ATOM   3756  C CG  . LEU A 1 469 ? 76.810  15.337  -25.846 1.00 19.82 ? 495  LEU A CG  1 
ATOM   3757  C CD1 . LEU A 1 469 ? 75.808  15.764  -26.901 1.00 20.58 ? 495  LEU A CD1 1 
ATOM   3758  C CD2 . LEU A 1 469 ? 77.284  16.538  -25.057 1.00 19.87 ? 495  LEU A CD2 1 
ATOM   3759  N N   . LEU A 1 470 ? 75.942  11.666  -23.162 1.00 21.54 ? 496  LEU A N   1 
ATOM   3760  C CA  . LEU A 1 470 ? 75.147  10.834  -22.266 1.00 21.22 ? 496  LEU A CA  1 
ATOM   3761  C C   . LEU A 1 470 ? 75.930  10.528  -20.991 1.00 20.75 ? 496  LEU A C   1 
ATOM   3762  O O   . LEU A 1 470 ? 75.434  10.738  -19.883 1.00 20.64 ? 496  LEU A O   1 
ATOM   3763  C CB  . LEU A 1 470 ? 74.751  9.530   -22.969 1.00 18.95 ? 496  LEU A CB  1 
ATOM   3764  C CG  . LEU A 1 470 ? 73.764  8.589   -22.272 1.00 18.86 ? 496  LEU A CG  1 
ATOM   3765  C CD1 . LEU A 1 470 ? 73.126  7.692   -23.327 1.00 20.59 ? 496  LEU A CD1 1 
ATOM   3766  C CD2 . LEU A 1 470 ? 74.463  7.769   -21.183 1.00 16.49 ? 496  LEU A CD2 1 
ATOM   3767  N N   . ARG A 1 471 ? 77.152  10.041  -21.141 1.00 20.43 ? 497  ARG A N   1 
ATOM   3768  C CA  . ARG A 1 471 ? 77.973  9.731   -19.978 1.00 22.21 ? 497  ARG A CA  1 
ATOM   3769  C C   . ARG A 1 471 ? 78.231  10.979  -19.135 1.00 21.61 ? 497  ARG A C   1 
ATOM   3770  O O   . ARG A 1 471 ? 78.240  10.911  -17.906 1.00 20.49 ? 497  ARG A O   1 
ATOM   3771  C CB  . ARG A 1 471 ? 79.303  9.128   -20.420 1.00 22.60 ? 497  ARG A CB  1 
ATOM   3772  C CG  . ARG A 1 471 ? 79.166  7.755   -21.047 1.00 25.45 ? 497  ARG A CG  1 
ATOM   3773  C CD  . ARG A 1 471 ? 80.483  7.298   -21.654 1.00 28.70 ? 497  ARG A CD  1 
ATOM   3774  N NE  . ARG A 1 471 ? 80.343  6.004   -22.310 1.00 31.31 ? 497  ARG A NE  1 
ATOM   3775  C CZ  . ARG A 1 471 ? 81.108  5.586   -23.317 1.00 32.93 ? 497  ARG A CZ  1 
ATOM   3776  N NH1 . ARG A 1 471 ? 82.076  6.361   -23.794 1.00 33.02 ? 497  ARG A NH1 1 
ATOM   3777  N NH2 . ARG A 1 471 ? 80.894  4.395   -23.856 1.00 34.00 ? 497  ARG A NH2 1 
ATOM   3778  N N   . LYS A 1 472 ? 78.436  12.114  -19.790 1.00 21.12 ? 498  LYS A N   1 
ATOM   3779  C CA  . LYS A 1 472 ? 78.699  13.358  -19.078 1.00 21.56 ? 498  LYS A CA  1 
ATOM   3780  C C   . LYS A 1 472 ? 77.492  13.780  -18.235 1.00 21.08 ? 498  LYS A C   1 
ATOM   3781  O O   . LYS A 1 472 ? 77.642  14.252  -17.109 1.00 19.80 ? 498  LYS A O   1 
ATOM   3782  C CB  . LYS A 1 472 ? 79.066  14.452  -20.080 1.00 23.71 ? 498  LYS A CB  1 
ATOM   3783  C CG  . LYS A 1 472 ? 79.584  15.731  -19.448 1.00 29.68 ? 498  LYS A CG  1 
ATOM   3784  C CD  . LYS A 1 472 ? 80.469  16.484  -20.427 1.00 34.04 ? 498  LYS A CD  1 
ATOM   3785  C CE  . LYS A 1 472 ? 81.059  17.730  -19.784 1.00 36.85 ? 498  LYS A CE  1 
ATOM   3786  N NZ  . LYS A 1 472 ? 82.104  18.355  -20.640 1.00 38.13 ? 498  LYS A NZ  1 
ATOM   3787  N N   . ALA A 1 473 ? 76.290  13.598  -18.779 1.00 19.24 ? 499  ALA A N   1 
ATOM   3788  C CA  . ALA A 1 473 ? 75.077  13.956  -18.053 1.00 19.24 ? 499  ALA A CA  1 
ATOM   3789  C C   . ALA A 1 473 ? 74.932  13.057  -16.829 1.00 18.41 ? 499  ALA A C   1 
ATOM   3790  O O   . ALA A 1 473 ? 74.641  13.535  -15.731 1.00 19.25 ? 499  ALA A O   1 
ATOM   3791  C CB  . ALA A 1 473 ? 73.865  13.807  -18.954 1.00 16.70 ? 499  ALA A CB  1 
ATOM   3792  N N   . VAL A 1 474 ? 75.134  11.762  -17.034 1.00 17.27 ? 500  VAL A N   1 
ATOM   3793  C CA  . VAL A 1 474 ? 75.048  10.766  -15.967 1.00 18.51 ? 500  VAL A CA  1 
ATOM   3794  C C   . VAL A 1 474 ? 76.068  11.085  -14.874 1.00 18.72 ? 500  VAL A C   1 
ATOM   3795  O O   . VAL A 1 474 ? 75.734  11.100  -13.688 1.00 19.23 ? 500  VAL A O   1 
ATOM   3796  C CB  . VAL A 1 474 ? 75.316  9.341   -16.519 1.00 18.18 ? 500  VAL A CB  1 
ATOM   3797  C CG1 . VAL A 1 474 ? 75.286  8.322   -15.391 1.00 17.80 ? 500  VAL A CG1 1 
ATOM   3798  C CG2 . VAL A 1 474 ? 74.276  8.988   -17.568 1.00 16.44 ? 500  VAL A CG2 1 
ATOM   3799  N N   . GLN A 1 475 ? 77.310  11.337  -15.270 1.00 18.87 ? 501  GLN A N   1 
ATOM   3800  C CA  . GLN A 1 475 ? 78.348  11.670  -14.303 1.00 20.44 ? 501  GLN A CA  1 
ATOM   3801  C C   . GLN A 1 475 ? 77.997  12.955  -13.558 1.00 17.75 ? 501  GLN A C   1 
ATOM   3802  O O   . GLN A 1 475 ? 78.205  13.056  -12.350 1.00 14.52 ? 501  GLN A O   1 
ATOM   3803  C CB  . GLN A 1 475 ? 79.705  11.827  -14.995 1.00 24.16 ? 501  GLN A CB  1 
ATOM   3804  C CG  . GLN A 1 475 ? 80.328  10.510  -15.437 1.00 33.00 ? 501  GLN A CG  1 
ATOM   3805  C CD  . GLN A 1 475 ? 80.357  9.485   -14.322 1.00 37.46 ? 501  GLN A CD  1 
ATOM   3806  O OE1 . GLN A 1 475 ? 80.802  9.775   -13.209 1.00 42.21 ? 501  GLN A OE1 1 
ATOM   3807  N NE2 . GLN A 1 475 ? 79.888  8.275   -14.610 1.00 39.04 ? 501  GLN A NE2 1 
ATOM   3808  N N   . ALA A 1 476 ? 77.466  13.944  -14.280 1.00 16.19 ? 502  ALA A N   1 
ATOM   3809  C CA  . ALA A 1 476 ? 77.095  15.208  -13.656 1.00 16.52 ? 502  ALA A CA  1 
ATOM   3810  C C   . ALA A 1 476 ? 76.030  14.957  -12.594 1.00 16.42 ? 502  ALA A C   1 
ATOM   3811  O O   . ALA A 1 476 ? 76.102  15.499  -11.494 1.00 17.08 ? 502  ALA A O   1 
ATOM   3812  C CB  . ALA A 1 476 ? 76.572  16.178  -14.704 1.00 17.61 ? 502  ALA A CB  1 
ATOM   3813  N N   . HIS A 1 477 ? 75.049  14.124  -12.928 1.00 15.60 ? 503  HIS A N   1 
ATOM   3814  C CA  . HIS A 1 477 ? 73.968  13.793  -12.010 1.00 15.62 ? 503  HIS A CA  1 
ATOM   3815  C C   . HIS A 1 477 ? 74.490  13.010  -10.794 1.00 17.58 ? 503  HIS A C   1 
ATOM   3816  O O   . HIS A 1 477 ? 74.014  13.198  -9.668  1.00 18.75 ? 503  HIS A O   1 
ATOM   3817  C CB  . HIS A 1 477 ? 72.889  12.991  -12.751 1.00 12.78 ? 503  HIS A CB  1 
ATOM   3818  C CG  . HIS A 1 477 ? 71.668  12.743  -11.932 1.00 9.74  ? 503  HIS A CG  1 
ATOM   3819  N ND1 . HIS A 1 477 ? 71.609  11.755  -10.972 1.00 9.47  ? 503  HIS A ND1 1 
ATOM   3820  C CD2 . HIS A 1 477 ? 70.486  13.404  -11.866 1.00 6.87  ? 503  HIS A CD2 1 
ATOM   3821  C CE1 . HIS A 1 477 ? 70.443  11.823  -10.351 1.00 6.87  ? 503  HIS A CE1 1 
ATOM   3822  N NE2 . HIS A 1 477 ? 69.745  12.814  -10.874 1.00 10.56 ? 503  HIS A NE2 1 
ATOM   3823  N N   . ARG A 1 478 ? 75.471  12.142  -11.024 1.00 17.41 ? 504  ARG A N   1 
ATOM   3824  C CA  . ARG A 1 478 ? 76.071  11.355  -9.948  1.00 17.58 ? 504  ARG A CA  1 
ATOM   3825  C C   . ARG A 1 478 ? 76.830  12.297  -8.998  1.00 18.98 ? 504  ARG A C   1 
ATOM   3826  O O   . ARG A 1 478 ? 76.838  12.095  -7.783  1.00 15.48 ? 504  ARG A O   1 
ATOM   3827  C CB  . ARG A 1 478 ? 77.032  10.330  -10.534 1.00 19.54 ? 504  ARG A CB  1 
ATOM   3828  C CG  . ARG A 1 478 ? 77.804  9.515   -9.503  1.00 22.95 ? 504  ARG A CG  1 
ATOM   3829  C CD  . ARG A 1 478 ? 76.885  8.606   -8.691  1.00 26.56 ? 504  ARG A CD  1 
ATOM   3830  N NE  . ARG A 1 478 ? 76.722  9.064   -7.312  1.00 29.88 ? 504  ARG A NE  1 
ATOM   3831  C CZ  . ARG A 1 478 ? 75.919  8.490   -6.418  1.00 31.04 ? 504  ARG A CZ  1 
ATOM   3832  N NH1 . ARG A 1 478 ? 75.192  7.427   -6.750  1.00 30.71 ? 504  ARG A NH1 1 
ATOM   3833  N NH2 . ARG A 1 478 ? 75.845  8.974   -5.183  1.00 30.87 ? 504  ARG A NH2 1 
ATOM   3834  N N   . ALA A 1 479 ? 77.464  13.325  -9.561  1.00 18.00 ? 505  ALA A N   1 
ATOM   3835  C CA  . ALA A 1 479 ? 78.211  14.291  -8.759  1.00 19.33 ? 505  ALA A CA  1 
ATOM   3836  C C   . ALA A 1 479 ? 77.245  15.094  -7.883  1.00 19.18 ? 505  ALA A C   1 
ATOM   3837  O O   . ALA A 1 479 ? 77.523  15.341  -6.705  1.00 19.21 ? 505  ALA A O   1 
ATOM   3838  C CB  . ALA A 1 479 ? 79.004  15.230  -9.673  1.00 18.31 ? 505  ALA A CB  1 
ATOM   3839  N N   . TYR A 1 480 ? 76.120  15.496  -8.462  1.00 17.22 ? 506  TYR A N   1 
ATOM   3840  C CA  . TYR A 1 480 ? 75.114  16.270  -7.744  1.00 15.38 ? 506  TYR A CA  1 
ATOM   3841  C C   . TYR A 1 480 ? 74.564  15.391  -6.623  1.00 14.39 ? 506  TYR A C   1 
ATOM   3842  O O   . TYR A 1 480 ? 74.399  15.837  -5.487  1.00 14.03 ? 506  TYR A O   1 
ATOM   3843  C CB  . TYR A 1 480 ? 73.997  16.683  -8.713  1.00 13.77 ? 506  TYR A CB  1 
ATOM   3844  C CG  . TYR A 1 480 ? 73.140  17.854  -8.257  1.00 13.52 ? 506  TYR A CG  1 
ATOM   3845  C CD1 . TYR A 1 480 ? 72.810  18.874  -9.145  1.00 13.09 ? 506  TYR A CD1 1 
ATOM   3846  C CD2 . TYR A 1 480 ? 72.657  17.939  -6.953  1.00 13.85 ? 506  TYR A CD2 1 
ATOM   3847  C CE1 . TYR A 1 480 ? 72.024  19.946  -8.756  1.00 13.64 ? 506  TYR A CE1 1 
ATOM   3848  C CE2 . TYR A 1 480 ? 71.869  19.016  -6.544  1.00 13.08 ? 506  TYR A CE2 1 
ATOM   3849  C CZ  . TYR A 1 480 ? 71.557  20.016  -7.459  1.00 13.19 ? 506  TYR A CZ  1 
ATOM   3850  O OH  . TYR A 1 480 ? 70.794  21.099  -7.093  1.00 9.50  ? 506  TYR A OH  1 
ATOM   3851  N N   . THR A 1 481 ? 74.304  14.127  -6.942  1.00 13.54 ? 507  THR A N   1 
ATOM   3852  C CA  . THR A 1 481 ? 73.790  13.193  -5.953  1.00 13.87 ? 507  THR A CA  1 
ATOM   3853  C C   . THR A 1 481 ? 74.751  13.032  -4.765  1.00 15.64 ? 507  THR A C   1 
ATOM   3854  O O   . THR A 1 481 ? 74.316  13.013  -3.611  1.00 16.03 ? 507  THR A O   1 
ATOM   3855  C CB  . THR A 1 481 ? 73.551  11.817  -6.572  1.00 12.74 ? 507  THR A CB  1 
ATOM   3856  O OG1 . THR A 1 481 ? 72.667  11.942  -7.694  1.00 12.23 ? 507  THR A OG1 1 
ATOM   3857  C CG2 . THR A 1 481 ? 72.928  10.886  -5.543  1.00 12.64 ? 507  THR A CG2 1 
ATOM   3858  N N   . ASP A 1 482 ? 76.044  12.906  -5.049  1.00 16.44 ? 508  ASP A N   1 
ATOM   3859  C CA  . ASP A 1 482 ? 77.043  12.757  -3.995  1.00 18.16 ? 508  ASP A CA  1 
ATOM   3860  C C   . ASP A 1 482 ? 77.096  14.004  -3.114  1.00 18.00 ? 508  ASP A C   1 
ATOM   3861  O O   . ASP A 1 482 ? 77.219  13.901  -1.895  1.00 18.24 ? 508  ASP A O   1 
ATOM   3862  C CB  . ASP A 1 482 ? 78.421  12.467  -4.602  1.00 20.19 ? 508  ASP A CB  1 
ATOM   3863  C CG  . ASP A 1 482 ? 78.538  11.047  -5.132  1.00 22.08 ? 508  ASP A CG  1 
ATOM   3864  O OD1 . ASP A 1 482 ? 78.116  10.117  -4.417  1.00 26.18 ? 508  ASP A OD1 1 
ATOM   3865  O OD2 . ASP A 1 482 ? 79.063  10.858  -6.251  1.00 24.96 ? 508  ASP A OD2 1 
ATOM   3866  N N   . ARG A 1 483 ? 76.988  15.178  -3.729  1.00 15.94 ? 509  ARG A N   1 
ATOM   3867  C CA  . ARG A 1 483 ? 77.004  16.426  -2.971  1.00 15.72 ? 509  ARG A CA  1 
ATOM   3868  C C   . ARG A 1 483 ? 75.739  16.553  -2.117  1.00 16.20 ? 509  ARG A C   1 
ATOM   3869  O O   . ARG A 1 483 ? 75.789  17.006  -0.974  1.00 16.66 ? 509  ARG A O   1 
ATOM   3870  C CB  . ARG A 1 483 ? 77.095  17.629  -3.918  1.00 15.18 ? 509  ARG A CB  1 
ATOM   3871  C CG  . ARG A 1 483 ? 78.436  17.818  -4.610  1.00 15.68 ? 509  ARG A CG  1 
ATOM   3872  C CD  . ARG A 1 483 ? 78.528  19.224  -5.194  1.00 16.50 ? 509  ARG A CD  1 
ATOM   3873  N NE  . ARG A 1 483 ? 77.555  19.476  -6.254  1.00 19.24 ? 509  ARG A NE  1 
ATOM   3874  C CZ  . ARG A 1 483 ? 77.713  19.089  -7.520  1.00 19.25 ? 509  ARG A CZ  1 
ATOM   3875  N NH1 . ARG A 1 483 ? 78.809  18.432  -7.879  1.00 19.09 ? 509  ARG A NH1 1 
ATOM   3876  N NH2 . ARG A 1 483 ? 76.786  19.373  -8.424  1.00 17.81 ? 509  ARG A NH2 1 
ATOM   3877  N N   . ALA A 1 484 ? 74.607  16.145  -2.673  1.00 14.90 ? 510  ALA A N   1 
ATOM   3878  C CA  . ALA A 1 484 ? 73.345  16.240  -1.957  1.00 14.75 ? 510  ALA A CA  1 
ATOM   3879  C C   . ALA A 1 484 ? 73.326  15.429  -0.668  1.00 15.34 ? 510  ALA A C   1 
ATOM   3880  O O   . ALA A 1 484 ? 72.925  15.936  0.378   1.00 14.72 ? 510  ALA A O   1 
ATOM   3881  C CB  . ALA A 1 484 ? 72.207  15.807  -2.855  1.00 14.92 ? 510  ALA A CB  1 
ATOM   3882  N N   . ILE A 1 485 ? 73.758  14.177  -0.741  1.00 14.12 ? 511  ILE A N   1 
ATOM   3883  C CA  . ILE A 1 485 ? 73.762  13.318  0.436   1.00 17.03 ? 511  ILE A CA  1 
ATOM   3884  C C   . ILE A 1 485 ? 74.800  13.734  1.470   1.00 17.69 ? 511  ILE A C   1 
ATOM   3885  O O   . ILE A 1 485 ? 74.755  13.282  2.616   1.00 19.44 ? 511  ILE A O   1 
ATOM   3886  C CB  . ILE A 1 485 ? 74.001  11.850  0.060   1.00 16.61 ? 511  ILE A CB  1 
ATOM   3887  C CG1 . ILE A 1 485 ? 75.305  11.717  -0.718  1.00 19.58 ? 511  ILE A CG1 1 
ATOM   3888  C CG2 . ILE A 1 485 ? 72.828  11.332  -0.756  1.00 19.72 ? 511  ILE A CG2 1 
ATOM   3889  C CD1 . ILE A 1 485 ? 75.631  10.290  -1.099  1.00 23.95 ? 511  ILE A CD1 1 
ATOM   3890  N N   . ARG A 1 486 ? 75.735  14.584  1.063   1.00 17.66 ? 512  ARG A N   1 
ATOM   3891  C CA  . ARG A 1 486 ? 76.773  15.082  1.965   1.00 18.65 ? 512  ARG A CA  1 
ATOM   3892  C C   . ARG A 1 486 ? 76.435  16.491  2.469   1.00 18.11 ? 512  ARG A C   1 
ATOM   3893  O O   . ARG A 1 486 ? 77.289  17.173  3.024   1.00 18.67 ? 512  ARG A O   1 
ATOM   3894  C CB  . ARG A 1 486 ? 78.132  15.096  1.258   1.00 20.03 ? 512  ARG A CB  1 
ATOM   3895  C CG  . ARG A 1 486 ? 78.705  13.714  1.009   1.00 25.10 ? 512  ARG A CG  1 
ATOM   3896  C CD  . ARG A 1 486 ? 79.973  13.762  0.167   1.00 28.85 ? 512  ARG A CD  1 
ATOM   3897  N NE  . ARG A 1 486 ? 80.544  12.429  -0.005  1.00 33.70 ? 512  ARG A NE  1 
ATOM   3898  C CZ  . ARG A 1 486 ? 79.898  11.395  -0.543  1.00 34.35 ? 512  ARG A CZ  1 
ATOM   3899  N NH1 . ARG A 1 486 ? 78.652  11.534  -0.972  1.00 32.56 ? 512  ARG A NH1 1 
ATOM   3900  N NH2 . ARG A 1 486 ? 80.499  10.216  -0.638  1.00 36.02 ? 512  ARG A NH2 1 
ATOM   3901  N N   . GLY A 1 487 ? 75.191  16.925  2.270   1.00 17.21 ? 513  GLY A N   1 
ATOM   3902  C CA  . GLY A 1 487 ? 74.779  18.246  2.725   1.00 15.96 ? 513  GLY A CA  1 
ATOM   3903  C C   . GLY A 1 487 ? 75.377  19.393  1.924   1.00 17.01 ? 513  GLY A C   1 
ATOM   3904  O O   . GLY A 1 487 ? 75.518  20.512  2.433   1.00 17.44 ? 513  GLY A O   1 
ATOM   3905  N N   . GLU A 1 488 ? 75.723  19.124  0.669   1.00 16.35 ? 514  GLU A N   1 
ATOM   3906  C CA  . GLU A 1 488 ? 76.310  20.139  -0.199  1.00 16.97 ? 514  GLU A CA  1 
ATOM   3907  C C   . GLU A 1 488 ? 75.324  20.648  -1.257  1.00 16.28 ? 514  GLU A C   1 
ATOM   3908  O O   . GLU A 1 488 ? 75.694  21.434  -2.128  1.00 14.97 ? 514  GLU A O   1 
ATOM   3909  C CB  . GLU A 1 488 ? 77.576  19.595  -0.868  1.00 18.72 ? 514  GLU A CB  1 
ATOM   3910  C CG  . GLU A 1 488 ? 78.825  19.640  0.016   1.00 24.05 ? 514  GLU A CG  1 
ATOM   3911  C CD  . GLU A 1 488 ? 80.039  18.988  -0.631  1.00 26.20 ? 514  GLU A CD  1 
ATOM   3912  O OE1 . GLU A 1 488 ? 80.264  19.194  -1.842  1.00 28.88 ? 514  GLU A OE1 1 
ATOM   3913  O OE2 . GLU A 1 488 ? 80.779  18.281  0.082   1.00 27.25 ? 514  GLU A OE2 1 
ATOM   3914  N N   . ALA A 1 489 ? 74.078  20.199  -1.183  1.00 15.90 ? 515  ALA A N   1 
ATOM   3915  C CA  . ALA A 1 489 ? 73.055  20.665  -2.117  1.00 16.90 ? 515  ALA A CA  1 
ATOM   3916  C C   . ALA A 1 489 ? 72.733  22.090  -1.693  1.00 15.77 ? 515  ALA A C   1 
ATOM   3917  O O   . ALA A 1 489 ? 73.296  22.588  -0.721  1.00 16.59 ? 515  ALA A O   1 
ATOM   3918  C CB  . ALA A 1 489 ? 71.809  19.789  -2.025  1.00 17.52 ? 515  ALA A CB  1 
ATOM   3919  N N   . PHE A 1 490 ? 71.827  22.754  -2.405  1.00 16.51 ? 516  PHE A N   1 
ATOM   3920  C CA  . PHE A 1 490 ? 71.498  24.125  -2.044  1.00 14.89 ? 516  PHE A CA  1 
ATOM   3921  C C   . PHE A 1 490 ? 70.017  24.387  -1.785  1.00 14.95 ? 516  PHE A C   1 
ATOM   3922  O O   . PHE A 1 490 ? 69.677  25.398  -1.169  1.00 15.38 ? 516  PHE A O   1 
ATOM   3923  C CB  . PHE A 1 490 ? 71.993  25.085  -3.131  1.00 15.68 ? 516  PHE A CB  1 
ATOM   3924  C CG  . PHE A 1 490 ? 71.218  24.999  -4.421  1.00 15.76 ? 516  PHE A CG  1 
ATOM   3925  C CD1 . PHE A 1 490 ? 69.967  25.600  -4.547  1.00 13.96 ? 516  PHE A CD1 1 
ATOM   3926  C CD2 . PHE A 1 490 ? 71.750  24.329  -5.520  1.00 15.52 ? 516  PHE A CD2 1 
ATOM   3927  C CE1 . PHE A 1 490 ? 69.262  25.538  -5.749  1.00 14.32 ? 516  PHE A CE1 1 
ATOM   3928  C CE2 . PHE A 1 490 ? 71.055  24.261  -6.725  1.00 13.49 ? 516  PHE A CE2 1 
ATOM   3929  C CZ  . PHE A 1 490 ? 69.807  24.870  -6.841  1.00 14.07 ? 516  PHE A CZ  1 
ATOM   3930  N N   . ASP A 1 491 ? 69.131  23.500  -2.231  1.00 12.89 ? 517  ASP A N   1 
ATOM   3931  C CA  . ASP A 1 491 ? 67.706  23.752  -2.036  1.00 12.85 ? 517  ASP A CA  1 
ATOM   3932  C C   . ASP A 1 491 ? 67.244  23.990  -0.604  1.00 12.51 ? 517  ASP A C   1 
ATOM   3933  O O   . ASP A 1 491 ? 66.569  24.982  -0.327  1.00 12.27 ? 517  ASP A O   1 
ATOM   3934  C CB  . ASP A 1 491 ? 66.871  22.643  -2.665  1.00 11.45 ? 517  ASP A CB  1 
ATOM   3935  C CG  . ASP A 1 491 ? 66.575  22.909  -4.125  1.00 14.84 ? 517  ASP A CG  1 
ATOM   3936  O OD1 . ASP A 1 491 ? 67.463  22.669  -4.970  1.00 13.28 ? 517  ASP A OD1 1 
ATOM   3937  O OD2 . ASP A 1 491 ? 65.459  23.386  -4.426  1.00 13.25 ? 517  ASP A OD2 1 
ATOM   3938  N N   . ARG A 1 492 ? 67.585  23.077  0.303   1.00 11.29 ? 518  ARG A N   1 
ATOM   3939  C CA  . ARG A 1 492 ? 67.199  23.230  1.699   1.00 11.64 ? 518  ARG A CA  1 
ATOM   3940  C C   . ARG A 1 492 ? 67.908  24.461  2.272   1.00 12.54 ? 518  ARG A C   1 
ATOM   3941  O O   . ARG A 1 492 ? 67.342  25.189  3.082   1.00 13.18 ? 518  ARG A O   1 
ATOM   3942  C CB  . ARG A 1 492 ? 67.582  21.977  2.496   1.00 12.56 ? 518  ARG A CB  1 
ATOM   3943  C CG  . ARG A 1 492 ? 66.847  20.726  2.072   1.00 12.57 ? 518  ARG A CG  1 
ATOM   3944  C CD  . ARG A 1 492 ? 65.370  20.824  2.395   1.00 13.32 ? 518  ARG A CD  1 
ATOM   3945  N NE  . ARG A 1 492 ? 64.715  19.612  1.945   1.00 14.57 ? 518  ARG A NE  1 
ATOM   3946  C CZ  . ARG A 1 492 ? 64.405  19.363  0.675   1.00 14.52 ? 518  ARG A CZ  1 
ATOM   3947  N NH1 . ARG A 1 492 ? 64.668  20.262  -0.271  1.00 9.07  ? 518  ARG A NH1 1 
ATOM   3948  N NH2 . ARG A 1 492 ? 63.900  18.186  0.347   1.00 12.77 ? 518  ARG A NH2 1 
ATOM   3949  N N   . HIS A 1 493 ? 69.144  24.698  1.843   1.00 12.99 ? 519  HIS A N   1 
ATOM   3950  C CA  . HIS A 1 493 ? 69.904  25.854  2.313   1.00 12.96 ? 519  HIS A CA  1 
ATOM   3951  C C   . HIS A 1 493 ? 69.148  27.141  1.970   1.00 14.90 ? 519  HIS A C   1 
ATOM   3952  O O   . HIS A 1 493 ? 68.840  27.949  2.852   1.00 14.88 ? 519  HIS A O   1 
ATOM   3953  C CB  . HIS A 1 493 ? 71.292  25.860  1.657   1.00 13.69 ? 519  HIS A CB  1 
ATOM   3954  C CG  . HIS A 1 493 ? 72.189  26.969  2.121   1.00 13.52 ? 519  HIS A CG  1 
ATOM   3955  N ND1 . HIS A 1 493 ? 73.369  27.284  1.480   1.00 13.36 ? 519  HIS A ND1 1 
ATOM   3956  C CD2 . HIS A 1 493 ? 72.079  27.841  3.152   1.00 14.47 ? 519  HIS A CD2 1 
ATOM   3957  C CE1 . HIS A 1 493 ? 73.945  28.305  2.093   1.00 14.06 ? 519  HIS A CE1 1 
ATOM   3958  N NE2 . HIS A 1 493 ? 73.183  28.663  3.112   1.00 13.92 ? 519  HIS A NE2 1 
ATOM   3959  N N   . LEU A 1 494 ? 68.831  27.322  0.684   1.00 13.93 ? 520  LEU A N   1 
ATOM   3960  C CA  . LEU A 1 494 ? 68.121  28.517  0.244   1.00 14.31 ? 520  LEU A CA  1 
ATOM   3961  C C   . LEU A 1 494 ? 66.813  28.683  0.979   1.00 13.77 ? 520  LEU A C   1 
ATOM   3962  O O   . LEU A 1 494 ? 66.411  29.800  1.294   1.00 13.44 ? 520  LEU A O   1 
ATOM   3963  C CB  . LEU A 1 494 ? 67.847  28.481  -1.261  1.00 14.43 ? 520  LEU A CB  1 
ATOM   3964  C CG  . LEU A 1 494 ? 69.069  28.369  -2.173  1.00 18.09 ? 520  LEU A CG  1 
ATOM   3965  C CD1 . LEU A 1 494 ? 68.636  28.646  -3.601  1.00 19.54 ? 520  LEU A CD1 1 
ATOM   3966  C CD2 . LEU A 1 494 ? 70.145  29.354  -1.746  1.00 15.37 ? 520  LEU A CD2 1 
ATOM   3967  N N   . LEU A 1 495 ? 66.134  27.564  1.235   1.00 14.32 ? 521  LEU A N   1 
ATOM   3968  C CA  . LEU A 1 495 ? 64.874  27.597  1.966   1.00 13.79 ? 521  LEU A CA  1 
ATOM   3969  C C   . LEU A 1 495 ? 65.157  28.142  3.365   1.00 13.49 ? 521  LEU A C   1 
ATOM   3970  O O   . LEU A 1 495 ? 64.392  28.945  3.892   1.00 14.01 ? 521  LEU A O   1 
ATOM   3971  C CB  . LEU A 1 495 ? 64.275  26.188  2.085   1.00 12.91 ? 521  LEU A CB  1 
ATOM   3972  C CG  . LEU A 1 495 ? 63.135  26.013  3.100   1.00 12.76 ? 521  LEU A CG  1 
ATOM   3973  C CD1 . LEU A 1 495 ? 61.966  26.927  2.726   1.00 12.37 ? 521  LEU A CD1 1 
ATOM   3974  C CD2 . LEU A 1 495 ? 62.701  24.540  3.162   1.00 10.95 ? 521  LEU A CD2 1 
ATOM   3975  N N   . GLY A 1 496 ? 66.260  27.692  3.951   1.00 14.74 ? 522  GLY A N   1 
ATOM   3976  C CA  . GLY A 1 496 ? 66.648  28.138  5.278   1.00 15.82 ? 522  GLY A CA  1 
ATOM   3977  C C   . GLY A 1 496 ? 66.899  29.635  5.309   1.00 16.24 ? 522  GLY A C   1 
ATOM   3978  O O   . GLY A 1 496 ? 66.487  30.315  6.253   1.00 16.61 ? 522  GLY A O   1 
ATOM   3979  N N   . LEU A 1 497 ? 67.577  30.150  4.283   1.00 14.71 ? 523  LEU A N   1 
ATOM   3980  C CA  . LEU A 1 497 ? 67.867  31.581  4.194   1.00 13.93 ? 523  LEU A CA  1 
ATOM   3981  C C   . LEU A 1 497 ? 66.560  32.390  4.127   1.00 14.11 ? 523  LEU A C   1 
ATOM   3982  O O   . LEU A 1 497 ? 66.455  33.474  4.702   1.00 13.90 ? 523  LEU A O   1 
ATOM   3983  C CB  . LEU A 1 497 ? 68.750  31.861  2.967   1.00 10.41 ? 523  LEU A CB  1 
ATOM   3984  C CG  . LEU A 1 497 ? 70.198  31.336  2.973   1.00 11.18 ? 523  LEU A CG  1 
ATOM   3985  C CD1 . LEU A 1 497 ? 70.790  31.562  1.601   1.00 12.25 ? 523  LEU A CD1 1 
ATOM   3986  C CD2 . LEU A 1 497 ? 71.061  32.034  4.031   1.00 12.15 ? 523  LEU A CD2 1 
ATOM   3987  N N   . LYS A 1 498 ? 65.555  31.860  3.442   1.00 14.14 ? 524  LYS A N   1 
ATOM   3988  C CA  . LYS A 1 498 ? 64.280  32.553  3.344   1.00 15.33 ? 524  LYS A CA  1 
ATOM   3989  C C   . LYS A 1 498 ? 63.544  32.527  4.689   1.00 14.84 ? 524  LYS A C   1 
ATOM   3990  O O   . LYS A 1 498 ? 63.027  33.559  5.133   1.00 13.80 ? 524  LYS A O   1 
ATOM   3991  C CB  . LYS A 1 498 ? 63.417  31.910  2.256   1.00 17.06 ? 524  LYS A CB  1 
ATOM   3992  C CG  . LYS A 1 498 ? 62.092  32.611  2.014   1.00 19.77 ? 524  LYS A CG  1 
ATOM   3993  C CD  . LYS A 1 498 ? 61.393  32.055  0.772   1.00 22.63 ? 524  LYS A CD  1 
ATOM   3994  C CE  . LYS A 1 498 ? 60.848  30.641  0.971   1.00 26.21 ? 524  LYS A CE  1 
ATOM   3995  N NZ  . LYS A 1 498 ? 59.618  30.593  1.815   1.00 28.43 ? 524  LYS A NZ  1 
ATOM   3996  N N   . LEU A 1 499 ? 63.489  31.369  5.340   1.00 13.83 ? 525  LEU A N   1 
ATOM   3997  C CA  . LEU A 1 499 ? 62.804  31.284  6.626   1.00 13.91 ? 525  LEU A CA  1 
ATOM   3998  C C   . LEU A 1 499 ? 63.555  32.131  7.649   1.00 14.41 ? 525  LEU A C   1 
ATOM   3999  O O   . LEU A 1 499 ? 62.942  32.731  8.535   1.00 14.44 ? 525  LEU A O   1 
ATOM   4000  C CB  . LEU A 1 499 ? 62.714  29.827  7.098   1.00 11.77 ? 525  LEU A CB  1 
ATOM   4001  C CG  . LEU A 1 499 ? 61.896  28.886  6.200   1.00 11.75 ? 525  LEU A CG  1 
ATOM   4002  C CD1 . LEU A 1 499 ? 61.991  27.468  6.731   1.00 10.18 ? 525  LEU A CD1 1 
ATOM   4003  C CD2 . LEU A 1 499 ? 60.441  29.339  6.139   1.00 9.74  ? 525  LEU A CD2 1 
ATOM   4004  N N   . GLN A 1 500 ? 64.875  32.194  7.512   1.00 14.20 ? 526  GLN A N   1 
ATOM   4005  C CA  . GLN A 1 500 ? 65.692  32.981  8.427   1.00 15.11 ? 526  GLN A CA  1 
ATOM   4006  C C   . GLN A 1 500 ? 65.332  34.457  8.269   1.00 16.20 ? 526  GLN A C   1 
ATOM   4007  O O   . GLN A 1 500 ? 65.195  35.180  9.264   1.00 16.74 ? 526  GLN A O   1 
ATOM   4008  C CB  . GLN A 1 500 ? 67.178  32.768  8.134   1.00 13.61 ? 526  GLN A CB  1 
ATOM   4009  C CG  . GLN A 1 500 ? 68.119  33.452  9.122   1.00 15.45 ? 526  GLN A CG  1 
ATOM   4010  C CD  . GLN A 1 500 ? 67.982  32.928  10.543  1.00 16.50 ? 526  GLN A CD  1 
ATOM   4011  O OE1 . GLN A 1 500 ? 68.023  31.719  10.783  1.00 15.92 ? 526  GLN A OE1 1 
ATOM   4012  N NE2 . GLN A 1 500 ? 67.829  33.838  11.500  1.00 17.55 ? 526  GLN A NE2 1 
ATOM   4013  N N   . ALA A 1 501 ? 65.170  34.894  7.020   1.00 14.71 ? 527  ALA A N   1 
ATOM   4014  C CA  . ALA A 1 501 ? 64.807  36.276  6.727   1.00 14.66 ? 527  ALA A CA  1 
ATOM   4015  C C   . ALA A 1 501 ? 63.483  36.582  7.410   1.00 14.77 ? 527  ALA A C   1 
ATOM   4016  O O   . ALA A 1 501 ? 63.326  37.631  8.032   1.00 15.09 ? 527  ALA A O   1 
ATOM   4017  C CB  . ALA A 1 501 ? 64.675  36.478  5.219   1.00 13.53 ? 527  ALA A CB  1 
ATOM   4018  N N   . ILE A 1 502 ? 62.521  35.667  7.289   1.00 13.25 ? 528  ILE A N   1 
ATOM   4019  C CA  . ILE A 1 502 ? 61.216  35.863  7.908   1.00 12.60 ? 528  ILE A CA  1 
ATOM   4020  C C   . ILE A 1 502 ? 61.375  35.978  9.427   1.00 14.53 ? 528  ILE A C   1 
ATOM   4021  O O   . ILE A 1 502 ? 60.793  36.855  10.069  1.00 14.27 ? 528  ILE A O   1 
ATOM   4022  C CB  . ILE A 1 502 ? 60.278  34.673  7.584   1.00 12.70 ? 528  ILE A CB  1 
ATOM   4023  C CG1 . ILE A 1 502 ? 59.904  34.692  6.098   1.00 11.83 ? 528  ILE A CG1 1 
ATOM   4024  C CG2 . ILE A 1 502 ? 59.025  34.728  8.447   1.00 8.32  ? 528  ILE A CG2 1 
ATOM   4025  C CD1 . ILE A 1 502 ? 59.159  33.444  5.651   1.00 12.45 ? 528  ILE A CD1 1 
ATOM   4026  N N   . GLU A 1 503 ? 62.172  35.086  9.998   1.00 15.35 ? 529  GLU A N   1 
ATOM   4027  C CA  . GLU A 1 503 ? 62.391  35.078  11.433  1.00 16.21 ? 529  GLU A CA  1 
ATOM   4028  C C   . GLU A 1 503 ? 63.127  36.334  11.897  1.00 17.19 ? 529  GLU A C   1 
ATOM   4029  O O   . GLU A 1 503 ? 62.841  36.865  12.965  1.00 16.39 ? 529  GLU A O   1 
ATOM   4030  C CB  . GLU A 1 503 ? 63.159  33.820  11.815  1.00 17.88 ? 529  GLU A CB  1 
ATOM   4031  C CG  . GLU A 1 503 ? 63.438  33.697  13.286  1.00 20.21 ? 529  GLU A CG  1 
ATOM   4032  C CD  . GLU A 1 503 ? 64.112  32.388  13.613  1.00 22.89 ? 529  GLU A CD  1 
ATOM   4033  O OE1 . GLU A 1 503 ? 63.466  31.330  13.431  1.00 22.37 ? 529  GLU A OE1 1 
ATOM   4034  O OE2 . GLU A 1 503 ? 65.284  32.413  14.042  1.00 16.88 ? 529  GLU A OE2 1 
ATOM   4035  N N   . ASP A 1 504 ? 64.068  36.811  11.089  1.00 17.67 ? 530  ASP A N   1 
ATOM   4036  C CA  . ASP A 1 504 ? 64.818  38.014  11.428  1.00 18.39 ? 530  ASP A CA  1 
ATOM   4037  C C   . ASP A 1 504 ? 63.954  39.261  11.286  1.00 19.37 ? 530  ASP A C   1 
ATOM   4038  O O   . ASP A 1 504 ? 64.404  40.371  11.550  1.00 20.77 ? 530  ASP A O   1 
ATOM   4039  C CB  . ASP A 1 504 ? 66.060  38.142  10.536  1.00 17.54 ? 530  ASP A CB  1 
ATOM   4040  C CG  . ASP A 1 504 ? 67.119  37.118  10.871  1.00 18.87 ? 530  ASP A CG  1 
ATOM   4041  O OD1 . ASP A 1 504 ? 66.948  36.414  11.885  1.00 16.12 ? 530  ASP A OD1 1 
ATOM   4042  O OD2 . ASP A 1 504 ? 68.123  37.019  10.132  1.00 21.99 ? 530  ASP A OD2 1 
ATOM   4043  N N   . LEU A 1 505 ? 62.709  39.064  10.872  1.00 19.36 ? 531  LEU A N   1 
ATOM   4044  C CA  . LEU A 1 505 ? 61.769  40.160  10.700  1.00 21.04 ? 531  LEU A CA  1 
ATOM   4045  C C   . LEU A 1 505 ? 62.254  41.190  9.669   1.00 22.99 ? 531  LEU A C   1 
ATOM   4046  O O   . LEU A 1 505 ? 61.999  42.389  9.802   1.00 23.77 ? 531  LEU A O   1 
ATOM   4047  C CB  . LEU A 1 505 ? 61.500  40.843  12.048  1.00 20.27 ? 531  LEU A CB  1 
ATOM   4048  C CG  . LEU A 1 505 ? 60.923  39.940  13.144  1.00 21.50 ? 531  LEU A CG  1 
ATOM   4049  C CD1 . LEU A 1 505 ? 60.692  40.743  14.425  1.00 21.43 ? 531  LEU A CD1 1 
ATOM   4050  C CD2 . LEU A 1 505 ? 59.621  39.310  12.655  1.00 20.60 ? 531  LEU A CD2 1 
ATOM   4051  N N   . VAL A 1 506 ? 62.954  40.723  8.641   1.00 23.50 ? 532  VAL A N   1 
ATOM   4052  C CA  . VAL A 1 506 ? 63.432  41.618  7.597   1.00 23.66 ? 532  VAL A CA  1 
ATOM   4053  C C   . VAL A 1 506 ? 62.604  41.398  6.335   1.00 24.27 ? 532  VAL A C   1 
ATOM   4054  O O   . VAL A 1 506 ? 62.012  40.333  6.146   1.00 25.07 ? 532  VAL A O   1 
ATOM   4055  C CB  . VAL A 1 506 ? 64.914  41.370  7.279   1.00 23.12 ? 532  VAL A CB  1 
ATOM   4056  C CG1 . VAL A 1 506 ? 65.757  41.615  8.524   1.00 24.56 ? 532  VAL A CG1 1 
ATOM   4057  C CG2 . VAL A 1 506 ? 65.110  39.963  6.775   1.00 25.30 ? 532  VAL A CG2 1 
ATOM   4058  N N   . SER A 1 507 ? 62.554  42.406  5.473   1.00 24.38 ? 533  SER A N   1 
ATOM   4059  C CA  . SER A 1 507 ? 61.787  42.306  4.239   1.00 25.14 ? 533  SER A CA  1 
ATOM   4060  C C   . SER A 1 507 ? 62.260  41.110  3.421   1.00 22.88 ? 533  SER A C   1 
ATOM   4061  O O   . SER A 1 507 ? 63.447  40.786  3.406   1.00 22.72 ? 533  SER A O   1 
ATOM   4062  C CB  . SER A 1 507 ? 61.941  43.585  3.418   1.00 27.06 ? 533  SER A CB  1 
ATOM   4063  O OG  . SER A 1 507 ? 63.306  43.816  3.108   1.00 32.24 ? 533  SER A OG  1 
ATOM   4064  N N   . MET A 1 508 ? 61.325  40.454  2.756   1.00 20.87 ? 534  MET A N   1 
ATOM   4065  C CA  . MET A 1 508 ? 61.646  39.296  1.937   1.00 21.36 ? 534  MET A CA  1 
ATOM   4066  C C   . MET A 1 508 ? 62.672  39.651  0.859   1.00 20.71 ? 534  MET A C   1 
ATOM   4067  O O   . MET A 1 508 ? 62.438  40.531  0.031   1.00 20.17 ? 534  MET A O   1 
ATOM   4068  C CB  . MET A 1 508 ? 60.372  38.766  1.278   1.00 22.23 ? 534  MET A CB  1 
ATOM   4069  C CG  . MET A 1 508 ? 60.583  37.570  0.373   1.00 23.17 ? 534  MET A CG  1 
ATOM   4070  S SD  . MET A 1 508 ? 61.302  36.184  1.269   1.00 27.00 ? 534  MET A SD  1 
ATOM   4071  C CE  . MET A 1 508 ? 59.843  35.533  2.155   1.00 24.26 ? 534  MET A CE  1 
ATOM   4072  N N   . PRO A 1 509 ? 63.835  38.979  0.868   1.00 21.24 ? 535  PRO A N   1 
ATOM   4073  C CA  . PRO A 1 509 ? 64.899  39.218  -0.113  1.00 21.17 ? 535  PRO A CA  1 
ATOM   4074  C C   . PRO A 1 509 ? 64.376  39.026  -1.536  1.00 21.34 ? 535  PRO A C   1 
ATOM   4075  O O   . PRO A 1 509 ? 63.672  38.050  -1.815  1.00 19.88 ? 535  PRO A O   1 
ATOM   4076  C CB  . PRO A 1 509 ? 65.945  38.171  0.258   1.00 21.30 ? 535  PRO A CB  1 
ATOM   4077  C CG  . PRO A 1 509 ? 65.784  38.068  1.740   1.00 21.01 ? 535  PRO A CG  1 
ATOM   4078  C CD  . PRO A 1 509 ? 64.284  38.030  1.900   1.00 20.70 ? 535  PRO A CD  1 
ATOM   4079  N N   . ASP A 1 510 ? 64.721  39.954  -2.425  1.00 21.65 ? 536  ASP A N   1 
ATOM   4080  C CA  . ASP A 1 510 ? 64.287  39.898  -3.820  1.00 22.44 ? 536  ASP A CA  1 
ATOM   4081  C C   . ASP A 1 510 ? 64.593  38.552  -4.458  1.00 19.31 ? 536  ASP A C   1 
ATOM   4082  O O   . ASP A 1 510 ? 63.786  38.016  -5.210  1.00 18.11 ? 536  ASP A O   1 
ATOM   4083  C CB  . ASP A 1 510 ? 64.975  40.993  -4.642  1.00 25.28 ? 536  ASP A CB  1 
ATOM   4084  C CG  . ASP A 1 510 ? 64.660  42.380  -4.137  1.00 29.27 ? 536  ASP A CG  1 
ATOM   4085  O OD1 . ASP A 1 510 ? 63.466  42.679  -3.927  1.00 29.61 ? 536  ASP A OD1 1 
ATOM   4086  O OD2 . ASP A 1 510 ? 65.609  43.173  -3.960  1.00 32.60 ? 536  ASP A OD2 1 
ATOM   4087  N N   . ILE A 1 511 ? 65.763  38.012  -4.161  1.00 17.76 ? 537  ILE A N   1 
ATOM   4088  C CA  . ILE A 1 511 ? 66.165  36.734  -4.732  1.00 19.75 ? 537  ILE A CA  1 
ATOM   4089  C C   . ILE A 1 511 ? 65.105  35.649  -4.562  1.00 19.58 ? 537  ILE A C   1 
ATOM   4090  O O   . ILE A 1 511 ? 64.999  34.741  -5.384  1.00 20.56 ? 537  ILE A O   1 
ATOM   4091  C CB  . ILE A 1 511 ? 67.482  36.247  -4.109  1.00 21.16 ? 537  ILE A CB  1 
ATOM   4092  C CG1 . ILE A 1 511 ? 68.093  35.150  -4.982  1.00 23.20 ? 537  ILE A CG1 1 
ATOM   4093  C CG2 . ILE A 1 511 ? 67.235  35.737  -2.695  1.00 21.66 ? 537  ILE A CG2 1 
ATOM   4094  C CD1 . ILE A 1 511 ? 69.460  34.720  -4.518  1.00 24.46 ? 537  ILE A CD1 1 
ATOM   4095  N N   . PHE A 1 512 ? 64.315  35.753  -3.497  1.00 19.92 ? 538  PHE A N   1 
ATOM   4096  C CA  . PHE A 1 512 ? 63.266  34.775  -3.216  1.00 20.53 ? 538  PHE A CA  1 
ATOM   4097  C C   . PHE A 1 512 ? 61.942  35.143  -3.876  1.00 20.17 ? 538  PHE A C   1 
ATOM   4098  O O   . PHE A 1 512 ? 61.037  34.313  -3.964  1.00 22.38 ? 538  PHE A O   1 
ATOM   4099  C CB  . PHE A 1 512 ? 63.080  34.618  -1.698  1.00 17.76 ? 538  PHE A CB  1 
ATOM   4100  C CG  . PHE A 1 512 ? 64.281  34.024  -1.000  1.00 19.01 ? 538  PHE A CG  1 
ATOM   4101  C CD1 . PHE A 1 512 ? 64.800  34.612  0.145   1.00 16.25 ? 538  PHE A CD1 1 
ATOM   4102  C CD2 . PHE A 1 512 ? 64.904  32.883  -1.507  1.00 17.75 ? 538  PHE A CD2 1 
ATOM   4103  C CE1 . PHE A 1 512 ? 65.926  34.072  0.774   1.00 15.50 ? 538  PHE A CE1 1 
ATOM   4104  C CE2 . PHE A 1 512 ? 66.021  32.341  -0.889  1.00 16.59 ? 538  PHE A CE2 1 
ATOM   4105  C CZ  . PHE A 1 512 ? 66.535  32.945  0.263   1.00 15.59 ? 538  PHE A CZ  1 
ATOM   4106  N N   . MET A 1 513 ? 61.827  36.385  -4.331  1.00 20.76 ? 539  MET A N   1 
ATOM   4107  C CA  . MET A 1 513 ? 60.609  36.831  -5.004  1.00 22.11 ? 539  MET A CA  1 
ATOM   4108  C C   . MET A 1 513 ? 60.875  36.872  -6.501  1.00 21.11 ? 539  MET A C   1 
ATOM   4109  O O   . MET A 1 513 ? 60.008  37.229  -7.295  1.00 20.84 ? 539  MET A O   1 
ATOM   4110  C CB  . MET A 1 513 ? 60.183  38.213  -4.509  1.00 24.55 ? 539  MET A CB  1 
ATOM   4111  C CG  . MET A 1 513 ? 59.749  38.222  -3.051  1.00 27.45 ? 539  MET A CG  1 
ATOM   4112  S SD  . MET A 1 513 ? 59.075  39.812  -2.530  1.00 32.78 ? 539  MET A SD  1 
ATOM   4113  C CE  . MET A 1 513 ? 60.589  40.799  -2.386  1.00 28.85 ? 539  MET A CE  1 
ATOM   4114  N N   . ASP A 1 514 ? 62.081  36.483  -6.872  1.00 20.64 ? 540  ASP A N   1 
ATOM   4115  C CA  . ASP A 1 514 ? 62.500  36.459  -8.264  1.00 20.04 ? 540  ASP A CA  1 
ATOM   4116  C C   . ASP A 1 514 ? 61.745  35.373  -9.042  1.00 20.52 ? 540  ASP A C   1 
ATOM   4117  O O   . ASP A 1 514 ? 61.470  34.290  -8.518  1.00 19.49 ? 540  ASP A O   1 
ATOM   4118  C CB  . ASP A 1 514 ? 64.002  36.188  -8.325  1.00 20.01 ? 540  ASP A CB  1 
ATOM   4119  C CG  . ASP A 1 514 ? 64.541  36.202  -9.730  1.00 20.68 ? 540  ASP A CG  1 
ATOM   4120  O OD1 . ASP A 1 514 ? 65.723  35.842  -9.902  1.00 22.10 ? 540  ASP A OD1 1 
ATOM   4121  O OD2 . ASP A 1 514 ? 63.794  36.576  -10.658 1.00 22.72 ? 540  ASP A OD2 1 
ATOM   4122  N N   . THR A 1 515 ? 61.403  35.669  -10.290 1.00 20.28 ? 541  THR A N   1 
ATOM   4123  C CA  . THR A 1 515 ? 60.703  34.708  -11.135 1.00 20.83 ? 541  THR A CA  1 
ATOM   4124  C C   . THR A 1 515 ? 61.484  33.398  -11.242 1.00 18.81 ? 541  THR A C   1 
ATOM   4125  O O   . THR A 1 515 ? 60.907  32.321  -11.173 1.00 18.54 ? 541  THR A O   1 
ATOM   4126  C CB  . THR A 1 515 ? 60.504  35.272  -12.551 1.00 22.05 ? 541  THR A CB  1 
ATOM   4127  O OG1 . THR A 1 515 ? 59.622  36.401  -12.495 1.00 26.32 ? 541  THR A OG1 1 
ATOM   4128  C CG2 . THR A 1 515 ? 59.925  34.203  -13.476 1.00 23.32 ? 541  THR A CG2 1 
ATOM   4129  N N   . SER A 1 516 ? 62.795  33.501  -11.410 1.00 18.89 ? 542  SER A N   1 
ATOM   4130  C CA  . SER A 1 516 ? 63.653  32.323  -11.536 1.00 19.55 ? 542  SER A CA  1 
ATOM   4131  C C   . SER A 1 516 ? 63.479  31.346  -10.391 1.00 19.36 ? 542  SER A C   1 
ATOM   4132  O O   . SER A 1 516 ? 63.473  30.134  -10.591 1.00 18.69 ? 542  SER A O   1 
ATOM   4133  C CB  . SER A 1 516 ? 65.122  32.731  -11.609 1.00 19.88 ? 542  SER A CB  1 
ATOM   4134  O OG  . SER A 1 516 ? 65.355  33.551  -12.735 1.00 23.60 ? 542  SER A OG  1 
ATOM   4135  N N   . TYR A 1 517 ? 63.354  31.879  -9.179  1.00 19.70 ? 543  TYR A N   1 
ATOM   4136  C CA  . TYR A 1 517 ? 63.185  31.026  -8.019  1.00 18.03 ? 543  TYR A CA  1 
ATOM   4137  C C   . TYR A 1 517 ? 61.826  30.348  -8.078  1.00 17.36 ? 543  TYR A C   1 
ATOM   4138  O O   . TYR A 1 517 ? 61.701  29.167  -7.767  1.00 17.05 ? 543  TYR A O   1 
ATOM   4139  C CB  . TYR A 1 517 ? 63.310  31.837  -6.730  1.00 18.35 ? 543  TYR A CB  1 
ATOM   4140  C CG  . TYR A 1 517 ? 63.391  30.972  -5.494  1.00 16.96 ? 543  TYR A CG  1 
ATOM   4141  C CD1 . TYR A 1 517 ? 62.368  30.969  -4.548  1.00 15.76 ? 543  TYR A CD1 1 
ATOM   4142  C CD2 . TYR A 1 517 ? 64.495  30.152  -5.272  1.00 18.24 ? 543  TYR A CD2 1 
ATOM   4143  C CE1 . TYR A 1 517 ? 62.443  30.170  -3.405  1.00 16.44 ? 543  TYR A CE1 1 
ATOM   4144  C CE2 . TYR A 1 517 ? 64.577  29.339  -4.135  1.00 16.95 ? 543  TYR A CE2 1 
ATOM   4145  C CZ  . TYR A 1 517 ? 63.549  29.355  -3.207  1.00 15.99 ? 543  TYR A CZ  1 
ATOM   4146  O OH  . TYR A 1 517 ? 63.628  28.557  -2.086  1.00 18.26 ? 543  TYR A OH  1 
ATOM   4147  N N   . ALA A 1 518 ? 60.805  31.089  -8.486  1.00 15.95 ? 544  ALA A N   1 
ATOM   4148  C CA  . ALA A 1 518 ? 59.471  30.511  -8.570  1.00 16.33 ? 544  ALA A CA  1 
ATOM   4149  C C   . ALA A 1 518 ? 59.494  29.323  -9.536  1.00 16.52 ? 544  ALA A C   1 
ATOM   4150  O O   . ALA A 1 518 ? 58.945  28.256  -9.246  1.00 16.90 ? 544  ALA A O   1 
ATOM   4151  C CB  . ALA A 1 518 ? 58.477  31.556  -9.043  1.00 15.91 ? 544  ALA A CB  1 
ATOM   4152  N N   . ILE A 1 519 ? 60.141  29.519  -10.681 1.00 16.06 ? 545  ILE A N   1 
ATOM   4153  C CA  . ILE A 1 519 ? 60.252  28.482  -11.699 1.00 16.06 ? 545  ILE A CA  1 
ATOM   4154  C C   . ILE A 1 519 ? 61.022  27.298  -11.133 1.00 14.74 ? 545  ILE A C   1 
ATOM   4155  O O   . ILE A 1 519 ? 60.562  26.160  -11.198 1.00 15.97 ? 545  ILE A O   1 
ATOM   4156  C CB  . ILE A 1 519 ? 60.980  29.027  -12.954 1.00 16.98 ? 545  ILE A CB  1 
ATOM   4157  C CG1 . ILE A 1 519 ? 60.123  30.111  -13.613 1.00 17.28 ? 545  ILE A CG1 1 
ATOM   4158  C CG2 . ILE A 1 519 ? 61.238  27.907  -13.960 1.00 16.87 ? 545  ILE A CG2 1 
ATOM   4159  C CD1 . ILE A 1 519 ? 60.775  30.782  -14.810 1.00 16.92 ? 545  ILE A CD1 1 
ATOM   4160  N N   . ALA A 1 520 ? 62.190  27.587  -10.560 1.00 12.19 ? 546  ALA A N   1 
ATOM   4161  C CA  . ALA A 1 520 ? 63.057  26.567  -9.983  1.00 12.19 ? 546  ALA A CA  1 
ATOM   4162  C C   . ALA A 1 520 ? 62.359  25.716  -8.922  1.00 12.28 ? 546  ALA A C   1 
ATOM   4163  O O   . ALA A 1 520 ? 62.653  24.527  -8.782  1.00 14.76 ? 546  ALA A O   1 
ATOM   4164  C CB  . ALA A 1 520 ? 64.316  27.222  -9.395  1.00 13.26 ? 546  ALA A CB  1 
ATOM   4165  N N   . MET A 1 521 ? 61.433  26.320  -8.183  1.00 12.63 ? 547  MET A N   1 
ATOM   4166  C CA  . MET A 1 521 ? 60.713  25.606  -7.132  1.00 13.15 ? 547  MET A CA  1 
ATOM   4167  C C   . MET A 1 521 ? 59.388  24.991  -7.578  1.00 15.42 ? 547  MET A C   1 
ATOM   4168  O O   . MET A 1 521 ? 58.709  24.323  -6.797  1.00 15.61 ? 547  MET A O   1 
ATOM   4169  C CB  . MET A 1 521 ? 60.496  26.533  -5.934  1.00 14.21 ? 547  MET A CB  1 
ATOM   4170  C CG  . MET A 1 521 ? 61.791  27.047  -5.312  1.00 15.31 ? 547  MET A CG  1 
ATOM   4171  S SD  . MET A 1 521 ? 62.938  25.749  -4.786  1.00 16.57 ? 547  MET A SD  1 
ATOM   4172  C CE  . MET A 1 521 ? 62.078  25.117  -3.328  1.00 14.08 ? 547  MET A CE  1 
ATOM   4173  N N   . HIS A 1 522 ? 59.021  25.224  -8.836  1.00 15.75 ? 548  HIS A N   1 
ATOM   4174  C CA  . HIS A 1 522 ? 57.793  24.672  -9.394  1.00 16.93 ? 548  HIS A CA  1 
ATOM   4175  C C   . HIS A 1 522 ? 58.206  23.403  -10.142 1.00 16.79 ? 548  HIS A C   1 
ATOM   4176  O O   . HIS A 1 522 ? 58.520  23.447  -11.329 1.00 18.94 ? 548  HIS A O   1 
ATOM   4177  C CB  . HIS A 1 522 ? 57.170  25.694  -10.347 1.00 18.15 ? 548  HIS A CB  1 
ATOM   4178  C CG  . HIS A 1 522 ? 55.802  25.325  -10.812 1.00 17.73 ? 548  HIS A CG  1 
ATOM   4179  N ND1 . HIS A 1 522 ? 55.574  24.545  -11.926 1.00 19.60 ? 548  HIS A ND1 1 
ATOM   4180  C CD2 . HIS A 1 522 ? 54.584  25.584  -10.277 1.00 17.64 ? 548  HIS A CD2 1 
ATOM   4181  C CE1 . HIS A 1 522 ? 54.276  24.338  -12.056 1.00 16.98 ? 548  HIS A CE1 1 
ATOM   4182  N NE2 . HIS A 1 522 ? 53.653  24.956  -11.070 1.00 19.35 ? 548  HIS A NE2 1 
ATOM   4183  N N   . PHE A 1 523 ? 58.208  22.270  -9.436  1.00 15.72 ? 549  PHE A N   1 
ATOM   4184  C CA  . PHE A 1 523 ? 58.652  21.001  -10.000 1.00 13.78 ? 549  PHE A CA  1 
ATOM   4185  C C   . PHE A 1 523 ? 57.664  20.235  -10.889 1.00 12.44 ? 549  PHE A C   1 
ATOM   4186  O O   . PHE A 1 523 ? 56.868  19.433  -10.412 1.00 11.26 ? 549  PHE A O   1 
ATOM   4187  C CB  . PHE A 1 523 ? 59.134  20.095  -8.859  1.00 11.89 ? 549  PHE A CB  1 
ATOM   4188  C CG  . PHE A 1 523 ? 60.270  20.682  -8.050  1.00 13.17 ? 549  PHE A CG  1 
ATOM   4189  C CD1 . PHE A 1 523 ? 61.533  20.848  -8.607  1.00 12.54 ? 549  PHE A CD1 1 
ATOM   4190  C CD2 . PHE A 1 523 ? 60.067  21.079  -6.727  1.00 12.84 ? 549  PHE A CD2 1 
ATOM   4191  C CE1 . PHE A 1 523 ? 62.580  21.404  -7.858  1.00 13.55 ? 549  PHE A CE1 1 
ATOM   4192  C CE2 . PHE A 1 523 ? 61.100  21.633  -5.977  1.00 12.11 ? 549  PHE A CE2 1 
ATOM   4193  C CZ  . PHE A 1 523 ? 62.362  21.796  -6.548  1.00 13.17 ? 549  PHE A CZ  1 
ATOM   4194  N N   . ASN A 1 524 ? 57.730  20.483  -12.190 1.00 12.35 ? 550  ASN A N   1 
ATOM   4195  C CA  . ASN A 1 524 ? 56.860  19.794  -13.136 1.00 12.26 ? 550  ASN A CA  1 
ATOM   4196  C C   . ASN A 1 524 ? 57.152  18.299  -13.048 1.00 12.12 ? 550  ASN A C   1 
ATOM   4197  O O   . ASN A 1 524 ? 56.304  17.465  -13.381 1.00 14.76 ? 550  ASN A O   1 
ATOM   4198  C CB  . ASN A 1 524 ? 57.103  20.342  -14.534 1.00 13.15 ? 550  ASN A CB  1 
ATOM   4199  C CG  . ASN A 1 524 ? 56.687  21.796  -14.642 1.00 14.05 ? 550  ASN A CG  1 
ATOM   4200  O OD1 . ASN A 1 524 ? 55.546  22.098  -14.981 1.00 18.01 ? 550  ASN A OD1 1 
ATOM   4201  N ND2 . ASN A 1 524 ? 57.600  22.691  -14.301 1.00 13.79 ? 550  ASN A ND2 1 
ATOM   4202  N N   . LEU A 1 525 ? 58.353  17.974  -12.581 1.00 10.44 ? 551  LEU A N   1 
ATOM   4203  C CA  . LEU A 1 525 ? 58.743  16.587  -12.362 1.00 11.09 ? 551  LEU A CA  1 
ATOM   4204  C C   . LEU A 1 525 ? 59.187  16.421  -10.909 1.00 11.79 ? 551  LEU A C   1 
ATOM   4205  O O   . LEU A 1 525 ? 60.189  17.004  -10.486 1.00 12.14 ? 551  LEU A O   1 
ATOM   4206  C CB  . LEU A 1 525 ? 59.878  16.162  -13.299 1.00 9.56  ? 551  LEU A CB  1 
ATOM   4207  C CG  . LEU A 1 525 ? 59.497  15.893  -14.757 1.00 10.34 ? 551  LEU A CG  1 
ATOM   4208  C CD1 . LEU A 1 525 ? 60.762  15.581  -15.536 1.00 8.27  ? 551  LEU A CD1 1 
ATOM   4209  C CD2 . LEU A 1 525 ? 58.484  14.747  -14.857 1.00 4.82  ? 551  LEU A CD2 1 
ATOM   4210  N N   . SER A 1 526 ? 58.418  15.661  -10.141 1.00 10.67 ? 552  SER A N   1 
ATOM   4211  C CA  . SER A 1 526 ? 58.764  15.386  -8.747  1.00 12.50 ? 552  SER A CA  1 
ATOM   4212  C C   . SER A 1 526 ? 58.984  13.885  -8.703  1.00 12.17 ? 552  SER A C   1 
ATOM   4213  O O   . SER A 1 526 ? 58.056  13.109  -8.923  1.00 11.03 ? 552  SER A O   1 
ATOM   4214  C CB  . SER A 1 526 ? 57.637  15.774  -7.800  1.00 11.96 ? 552  SER A CB  1 
ATOM   4215  O OG  . SER A 1 526 ? 57.971  15.369  -6.479  1.00 11.57 ? 552  SER A OG  1 
ATOM   4216  N N   . THR A 1 527 ? 60.211  13.487  -8.385  1.00 12.05 ? 553  THR A N   1 
ATOM   4217  C CA  . THR A 1 527 ? 60.591  12.084  -8.394  1.00 12.12 ? 553  THR A CA  1 
ATOM   4218  C C   . THR A 1 527 ? 61.336  11.608  -7.152  1.00 14.58 ? 553  THR A C   1 
ATOM   4219  O O   . THR A 1 527 ? 61.765  12.399  -6.311  1.00 14.85 ? 553  THR A O   1 
ATOM   4220  C CB  . THR A 1 527 ? 61.528  11.827  -9.560  1.00 9.27  ? 553  THR A CB  1 
ATOM   4221  O OG1 . THR A 1 527 ? 62.780  12.455  -9.276  1.00 10.35 ? 553  THR A OG1 1 
ATOM   4222  C CG2 . THR A 1 527 ? 60.990  12.446  -10.850 1.00 10.27 ? 553  THR A CG2 1 
ATOM   4223  N N   . ALA A 1 528 ? 61.537  10.300  -7.082  1.00 14.57 ? 554  ALA A N   1 
ATOM   4224  C CA  . ALA A 1 528 ? 62.254  9.702   -5.972  1.00 16.26 ? 554  ALA A CA  1 
ATOM   4225  C C   . ALA A 1 528 ? 62.465  8.225   -6.247  1.00 17.42 ? 554  ALA A C   1 
ATOM   4226  O O   . ALA A 1 528 ? 61.629  7.568   -6.874  1.00 16.33 ? 554  ALA A O   1 
ATOM   4227  C CB  . ALA A 1 528 ? 61.481  9.891   -4.672  1.00 14.60 ? 554  ALA A CB  1 
ATOM   4228  N N   . GLN A 1 529 ? 63.595  7.709   -5.793  1.00 18.36 ? 555  GLN A N   1 
ATOM   4229  C CA  . GLN A 1 529 ? 63.887  6.302   -5.967  1.00 21.17 ? 555  GLN A CA  1 
ATOM   4230  C C   . GLN A 1 529 ? 63.616  5.614   -4.635  1.00 23.06 ? 555  GLN A C   1 
ATOM   4231  O O   . GLN A 1 529 ? 64.016  6.109   -3.586  1.00 24.38 ? 555  GLN A O   1 
ATOM   4232  C CB  . GLN A 1 529 ? 65.345  6.108   -6.370  1.00 20.66 ? 555  GLN A CB  1 
ATOM   4233  C CG  . GLN A 1 529 ? 65.697  4.672   -6.679  1.00 25.29 ? 555  GLN A CG  1 
ATOM   4234  C CD  . GLN A 1 529 ? 67.190  4.446   -6.716  1.00 25.13 ? 555  GLN A CD  1 
ATOM   4235  O OE1 . GLN A 1 529 ? 67.853  4.469   -5.683  1.00 31.36 ? 555  GLN A OE1 1 
ATOM   4236  N NE2 . GLN A 1 529 ? 67.732  4.245   -7.910  1.00 25.20 ? 555  GLN A NE2 1 
ATOM   4237  N N   . VAL A 1 530 ? 62.925  4.483   -4.685  1.00 24.20 ? 556  VAL A N   1 
ATOM   4238  C CA  . VAL A 1 530 ? 62.610  3.712   -3.491  1.00 27.13 ? 556  VAL A CA  1 
ATOM   4239  C C   . VAL A 1 530 ? 63.260  2.333   -3.556  1.00 26.46 ? 556  VAL A C   1 
ATOM   4240  O O   . VAL A 1 530 ? 62.594  1.342   -3.844  1.00 27.32 ? 556  VAL A O   1 
ATOM   4241  C CB  . VAL A 1 530 ? 61.078  3.530   -3.312  1.00 30.00 ? 556  VAL A CB  1 
ATOM   4242  C CG1 . VAL A 1 530 ? 60.449  4.849   -2.927  1.00 30.16 ? 556  VAL A CG1 1 
ATOM   4243  C CG2 . VAL A 1 530 ? 60.443  2.991   -4.604  1.00 30.42 ? 556  VAL A CG2 1 
ATOM   4244  N N   . PRO A 1 531 ? 64.576  2.259   -3.309  1.00 27.42 ? 557  PRO A N   1 
ATOM   4245  C CA  . PRO A 1 531 ? 65.305  0.984   -3.344  1.00 27.91 ? 557  PRO A CA  1 
ATOM   4246  C C   . PRO A 1 531 ? 64.715  -0.006  -2.345  1.00 27.42 ? 557  PRO A C   1 
ATOM   4247  O O   . PRO A 1 531 ? 64.467  0.350   -1.199  1.00 27.42 ? 557  PRO A O   1 
ATOM   4248  C CB  . PRO A 1 531 ? 66.729  1.387   -2.957  1.00 28.20 ? 557  PRO A CB  1 
ATOM   4249  C CG  . PRO A 1 531 ? 66.829  2.791   -3.447  1.00 29.15 ? 557  PRO A CG  1 
ATOM   4250  C CD  . PRO A 1 531 ? 65.497  3.382   -3.060  1.00 27.98 ? 557  PRO A CD  1 
ATOM   4251  N N   . ALA A 1 532 ? 64.482  -1.241  -2.772  1.00 25.89 ? 558  ALA A N   1 
ATOM   4252  C CA  . ALA A 1 532 ? 63.944  -2.246  -1.867  1.00 25.42 ? 558  ALA A CA  1 
ATOM   4253  C C   . ALA A 1 532 ? 64.216  -3.634  -2.406  1.00 24.93 ? 558  ALA A C   1 
ATOM   4254  O O   . ALA A 1 532 ? 64.285  -3.829  -3.618  1.00 25.40 ? 558  ALA A O   1 
ATOM   4255  C CB  . ALA A 1 532 ? 62.445  -2.044  -1.684  1.00 24.82 ? 558  ALA A CB  1 
ATOM   4256  N N   . LYS A 1 533 ? 64.385  -4.591  -1.498  1.00 24.99 ? 559  LYS A N   1 
ATOM   4257  C CA  . LYS A 1 533 ? 64.622  -5.976  -1.879  1.00 24.79 ? 559  LYS A CA  1 
ATOM   4258  C C   . LYS A 1 533 ? 63.296  -6.554  -2.359  1.00 23.75 ? 559  LYS A C   1 
ATOM   4259  O O   . LYS A 1 533 ? 63.246  -7.353  -3.292  1.00 23.56 ? 559  LYS A O   1 
ATOM   4260  C CB  . LYS A 1 533 ? 65.150  -6.783  -0.685  1.00 26.40 ? 559  LYS A CB  1 
ATOM   4261  C CG  . LYS A 1 533 ? 66.500  -6.304  -0.162  1.00 31.08 ? 559  LYS A CG  1 
ATOM   4262  C CD  . LYS A 1 533 ? 67.032  -7.192  0.968   1.00 32.74 ? 559  LYS A CD  1 
ATOM   4263  C CE  . LYS A 1 533 ? 66.123  -7.142  2.186   1.00 36.12 ? 559  LYS A CE  1 
ATOM   4264  N NZ  . LYS A 1 533 ? 66.495  -8.139  3.231   1.00 38.21 ? 559  LYS A NZ  1 
ATOM   4265  N N   . THR A 1 534 ? 62.215  -6.135  -1.708  1.00 22.28 ? 560  THR A N   1 
ATOM   4266  C CA  . THR A 1 534 ? 60.877  -6.586  -2.069  1.00 22.03 ? 560  THR A CA  1 
ATOM   4267  C C   . THR A 1 534 ? 60.518  -5.986  -3.427  1.00 21.95 ? 560  THR A C   1 
ATOM   4268  O O   . THR A 1 534 ? 60.780  -4.810  -3.671  1.00 21.94 ? 560  THR A O   1 
ATOM   4269  C CB  . THR A 1 534 ? 59.848  -6.113  -1.038  1.00 22.12 ? 560  THR A CB  1 
ATOM   4270  O OG1 . THR A 1 534 ? 60.211  -6.602  0.257   1.00 23.88 ? 560  THR A OG1 1 
ATOM   4271  C CG2 . THR A 1 534 ? 58.464  -6.614  -1.396  1.00 22.13 ? 560  THR A CG2 1 
ATOM   4272  N N   . ASP A 1 535 ? 59.922  -6.786  -4.305  1.00 20.35 ? 561  ASP A N   1 
ATOM   4273  C CA  . ASP A 1 535 ? 59.548  -6.306  -5.632  1.00 20.37 ? 561  ASP A CA  1 
ATOM   4274  C C   . ASP A 1 535 ? 58.293  -5.437  -5.523  1.00 20.30 ? 561  ASP A C   1 
ATOM   4275  O O   . ASP A 1 535 ? 57.205  -5.808  -5.947  1.00 19.85 ? 561  ASP A O   1 
ATOM   4276  C CB  . ASP A 1 535 ? 59.308  -7.507  -6.556  1.00 21.09 ? 561  ASP A CB  1 
ATOM   4277  C CG  . ASP A 1 535 ? 59.097  -7.104  -8.001  1.00 22.66 ? 561  ASP A CG  1 
ATOM   4278  O OD1 . ASP A 1 535 ? 59.696  -6.098  -8.436  1.00 22.03 ? 561  ASP A OD1 1 
ATOM   4279  O OD2 . ASP A 1 535 ? 58.352  -7.811  -8.712  1.00 24.52 ? 561  ASP A OD2 1 
ATOM   4280  N N   . CYS A 1 536 ? 58.459  -4.255  -4.946  1.00 19.36 ? 562  CYS A N   1 
ATOM   4281  C CA  . CYS A 1 536 ? 57.344  -3.355  -4.751  1.00 16.81 ? 562  CYS A CA  1 
ATOM   4282  C C   . CYS A 1 536 ? 57.680  -2.043  -5.413  1.00 16.76 ? 562  CYS A C   1 
ATOM   4283  O O   . CYS A 1 536 ? 58.763  -1.875  -5.956  1.00 15.27 ? 562  CYS A O   1 
ATOM   4284  C CB  . CYS A 1 536 ? 57.159  -3.121  -3.265  1.00 18.49 ? 562  CYS A CB  1 
ATOM   4285  S SG  . CYS A 1 536 ? 58.666  -2.442  -2.505  1.00 18.67 ? 562  CYS A SG  1 
ATOM   4286  N N   . VAL A 1 537 ? 56.758  -1.095  -5.333  1.00 16.92 ? 563  VAL A N   1 
ATOM   4287  C CA  . VAL A 1 537 ? 56.973  0.214   -5.919  1.00 17.47 ? 563  VAL A CA  1 
ATOM   4288  C C   . VAL A 1 537 ? 56.092  1.215   -5.187  1.00 16.43 ? 563  VAL A C   1 
ATOM   4289  O O   . VAL A 1 537 ? 54.977  0.884   -4.782  1.00 17.83 ? 563  VAL A O   1 
ATOM   4290  C CB  . VAL A 1 537 ? 56.613  0.213   -7.424  1.00 17.85 ? 563  VAL A CB  1 
ATOM   4291  C CG1 . VAL A 1 537 ? 55.129  -0.069  -7.601  1.00 18.73 ? 563  VAL A CG1 1 
ATOM   4292  C CG2 . VAL A 1 537 ? 56.985  1.539   -8.063  1.00 18.34 ? 563  VAL A CG2 1 
ATOM   4293  N N   . GLY A 1 538 ? 56.600  2.425   -4.998  1.00 16.52 ? 564  GLY A N   1 
ATOM   4294  C CA  . GLY A 1 538 ? 55.813  3.445   -4.326  1.00 15.89 ? 564  GLY A CA  1 
ATOM   4295  C C   . GLY A 1 538 ? 55.212  4.411   -5.340  1.00 14.28 ? 564  GLY A C   1 
ATOM   4296  O O   . GLY A 1 538 ? 55.541  4.359   -6.518  1.00 14.68 ? 564  GLY A O   1 
ATOM   4297  N N   . PHE A 1 539 ? 54.313  5.281   -4.890  1.00 12.86 ? 565  PHE A N   1 
ATOM   4298  C CA  . PHE A 1 539 ? 53.705  6.278   -5.755  1.00 14.04 ? 565  PHE A CA  1 
ATOM   4299  C C   . PHE A 1 539 ? 53.107  7.432   -4.965  1.00 14.43 ? 565  PHE A C   1 
ATOM   4300  O O   . PHE A 1 539 ? 52.768  7.287   -3.789  1.00 15.05 ? 565  PHE A O   1 
ATOM   4301  C CB  . PHE A 1 539 ? 52.659  5.643   -6.680  1.00 15.63 ? 565  PHE A CB  1 
ATOM   4302  C CG  . PHE A 1 539 ? 51.878  4.543   -6.050  1.00 17.79 ? 565  PHE A CG  1 
ATOM   4303  C CD1 . PHE A 1 539 ? 50.837  4.827   -5.172  1.00 17.60 ? 565  PHE A CD1 1 
ATOM   4304  C CD2 . PHE A 1 539 ? 52.212  3.212   -6.292  1.00 19.75 ? 565  PHE A CD2 1 
ATOM   4305  C CE1 . PHE A 1 539 ? 50.142  3.799   -4.533  1.00 19.29 ? 565  PHE A CE1 1 
ATOM   4306  C CE2 . PHE A 1 539 ? 51.520  2.175   -5.655  1.00 19.46 ? 565  PHE A CE2 1 
ATOM   4307  C CZ  . PHE A 1 539 ? 50.488  2.473   -4.774  1.00 18.94 ? 565  PHE A CZ  1 
ATOM   4308  N N   . PHE A 1 540 ? 52.988  8.583   -5.616  1.00 13.54 ? 566  PHE A N   1 
ATOM   4309  C CA  . PHE A 1 540 ? 52.435  9.772   -4.976  1.00 13.82 ? 566  PHE A CA  1 
ATOM   4310  C C   . PHE A 1 540 ? 51.950  10.702  -6.072  1.00 13.64 ? 566  PHE A C   1 
ATOM   4311  O O   . PHE A 1 540 ? 52.394  10.607  -7.210  1.00 12.87 ? 566  PHE A O   1 
ATOM   4312  C CB  . PHE A 1 540 ? 53.514  10.467  -4.137  1.00 11.97 ? 566  PHE A CB  1 
ATOM   4313  C CG  . PHE A 1 540 ? 54.844  10.593  -4.843  1.00 10.39 ? 566  PHE A CG  1 
ATOM   4314  C CD1 . PHE A 1 540 ? 55.065  11.602  -5.772  1.00 9.76  ? 566  PHE A CD1 1 
ATOM   4315  C CD2 . PHE A 1 540 ? 55.853  9.661   -4.622  1.00 9.39  ? 566  PHE A CD2 1 
ATOM   4316  C CE1 . PHE A 1 540 ? 56.270  11.684  -6.477  1.00 9.92  ? 566  PHE A CE1 1 
ATOM   4317  C CE2 . PHE A 1 540 ? 57.062  9.726   -5.316  1.00 10.40 ? 566  PHE A CE2 1 
ATOM   4318  C CZ  . PHE A 1 540 ? 57.272  10.745  -6.251  1.00 11.99 ? 566  PHE A CZ  1 
ATOM   4319  N N   . GLY A 1 541 ? 51.036  11.603  -5.739  1.00 14.34 ? 567  GLY A N   1 
ATOM   4320  C CA  . GLY A 1 541 ? 50.555  12.520  -6.750  1.00 13.20 ? 567  GLY A CA  1 
ATOM   4321  C C   . GLY A 1 541 ? 51.575  13.598  -7.057  1.00 13.18 ? 567  GLY A C   1 
ATOM   4322  O O   . GLY A 1 541 ? 52.524  13.784  -6.298  1.00 12.56 ? 567  GLY A O   1 
ATOM   4323  N N   . PRO A 1 542 ? 51.421  14.324  -8.179  1.00 12.47 ? 568  PRO A N   1 
ATOM   4324  C CA  . PRO A 1 542 ? 52.362  15.390  -8.537  1.00 12.00 ? 568  PRO A CA  1 
ATOM   4325  C C   . PRO A 1 542 ? 52.354  16.483  -7.459  1.00 11.72 ? 568  PRO A C   1 
ATOM   4326  O O   . PRO A 1 542 ? 51.427  16.553  -6.658  1.00 14.35 ? 568  PRO A O   1 
ATOM   4327  C CB  . PRO A 1 542 ? 51.815  15.902  -9.863  1.00 12.15 ? 568  PRO A CB  1 
ATOM   4328  C CG  . PRO A 1 542 ? 51.141  14.678  -10.454 1.00 14.08 ? 568  PRO A CG  1 
ATOM   4329  C CD  . PRO A 1 542 ? 50.441  14.092  -9.256  1.00 13.03 ? 568  PRO A CD  1 
ATOM   4330  N N   . VAL A 1 543 ? 53.375  17.330  -7.434  1.00 12.75 ? 569  VAL A N   1 
ATOM   4331  C CA  . VAL A 1 543 ? 53.443  18.407  -6.444  1.00 14.04 ? 569  VAL A CA  1 
ATOM   4332  C C   . VAL A 1 543 ? 52.861  19.702  -7.002  1.00 15.02 ? 569  VAL A C   1 
ATOM   4333  O O   . VAL A 1 543 ? 52.626  20.661  -6.262  1.00 14.15 ? 569  VAL A O   1 
ATOM   4334  C CB  . VAL A 1 543 ? 54.884  18.642  -5.960  1.00 12.26 ? 569  VAL A CB  1 
ATOM   4335  C CG1 . VAL A 1 543 ? 55.376  17.390  -5.247  1.00 11.83 ? 569  VAL A CG1 1 
ATOM   4336  C CG2 . VAL A 1 543 ? 55.798  18.996  -7.131  1.00 11.23 ? 569  VAL A CG2 1 
ATOM   4337  N N   . VAL A 1 544 ? 52.624  19.723  -8.309  1.00 13.65 ? 570  VAL A N   1 
ATOM   4338  C CA  . VAL A 1 544 ? 52.018  20.880  -8.955  1.00 13.45 ? 570  VAL A CA  1 
ATOM   4339  C C   . VAL A 1 544 ? 50.933  20.403  -9.925  1.00 15.73 ? 570  VAL A C   1 
ATOM   4340  O O   . VAL A 1 544 ? 50.987  19.280  -10.429 1.00 16.15 ? 570  VAL A O   1 
ATOM   4341  C CB  . VAL A 1 544 ? 53.059  21.737  -9.723  1.00 12.87 ? 570  VAL A CB  1 
ATOM   4342  C CG1 . VAL A 1 544 ? 53.967  22.478  -8.729  1.00 9.83  ? 570  VAL A CG1 1 
ATOM   4343  C CG2 . VAL A 1 544 ? 53.868  20.863  -10.675 1.00 11.71 ? 570  VAL A CG2 1 
ATOM   4344  N N   . PRO A 1 545 ? 49.919  21.247  -10.178 1.00 17.52 ? 571  PRO A N   1 
ATOM   4345  C CA  . PRO A 1 545 ? 48.805  20.930  -11.082 1.00 17.25 ? 571  PRO A CA  1 
ATOM   4346  C C   . PRO A 1 545 ? 49.238  20.431  -12.465 1.00 15.20 ? 571  PRO A C   1 
ATOM   4347  O O   . PRO A 1 545 ? 48.608  19.536  -13.028 1.00 14.48 ? 571  PRO A O   1 
ATOM   4348  C CB  . PRO A 1 545 ? 48.045  22.251  -11.169 1.00 17.68 ? 571  PRO A CB  1 
ATOM   4349  C CG  . PRO A 1 545 ? 48.254  22.838  -9.808  1.00 19.76 ? 571  PRO A CG  1 
ATOM   4350  C CD  . PRO A 1 545 ? 49.716  22.563  -9.542  1.00 18.82 ? 571  PRO A CD  1 
ATOM   4351  N N   . ASP A 1 546 ? 50.302  21.017  -13.002 1.00 15.54 ? 572  ASP A N   1 
ATOM   4352  C CA  . ASP A 1 546 ? 50.812  20.647  -14.324 1.00 15.49 ? 572  ASP A CA  1 
ATOM   4353  C C   . ASP A 1 546 ? 52.109  19.834  -14.259 1.00 13.94 ? 572  ASP A C   1 
ATOM   4354  O O   . ASP A 1 546 ? 52.986  19.978  -15.118 1.00 14.95 ? 572  ASP A O   1 
ATOM   4355  C CB  . ASP A 1 546 ? 51.037  21.907  -15.167 1.00 14.87 ? 572  ASP A CB  1 
ATOM   4356  C CG  . ASP A 1 546 ? 52.083  22.825  -14.572 1.00 19.94 ? 572  ASP A CG  1 
ATOM   4357  O OD1 . ASP A 1 546 ? 52.252  22.809  -13.333 1.00 20.01 ? 572  ASP A OD1 1 
ATOM   4358  O OD2 . ASP A 1 546 ? 52.730  23.578  -15.332 1.00 19.75 ? 572  ASP A OD2 1 
ATOM   4359  N N   . GLY A 1 547 ? 52.227  18.976  -13.255 1.00 12.53 ? 573  GLY A N   1 
ATOM   4360  C CA  . GLY A 1 547 ? 53.432  18.173  -13.131 1.00 13.41 ? 573  GLY A CA  1 
ATOM   4361  C C   . GLY A 1 547 ? 53.162  16.686  -13.040 1.00 13.78 ? 573  GLY A C   1 
ATOM   4362  O O   . GLY A 1 547 ? 52.018  16.245  -13.119 1.00 13.90 ? 573  GLY A O   1 
ATOM   4363  N N   . TYR A 1 548 ? 54.225  15.910  -12.869 1.00 13.43 ? 574  TYR A N   1 
ATOM   4364  C CA  . TYR A 1 548 ? 54.106  14.465  -12.749 1.00 12.88 ? 574  TYR A CA  1 
ATOM   4365  C C   . TYR A 1 548 ? 54.729  14.000  -11.445 1.00 12.88 ? 574  TYR A C   1 
ATOM   4366  O O   . TYR A 1 548 ? 55.645  14.637  -10.925 1.00 11.10 ? 574  TYR A O   1 
ATOM   4367  C CB  . TYR A 1 548 ? 54.842  13.747  -13.881 1.00 13.72 ? 574  TYR A CB  1 
ATOM   4368  C CG  . TYR A 1 548 ? 54.304  13.964  -15.265 1.00 13.22 ? 574  TYR A CG  1 
ATOM   4369  C CD1 . TYR A 1 548 ? 54.763  15.012  -16.055 1.00 12.04 ? 574  TYR A CD1 1 
ATOM   4370  C CD2 . TYR A 1 548 ? 53.359  13.095  -15.797 1.00 14.03 ? 574  TYR A CD2 1 
ATOM   4371  C CE1 . TYR A 1 548 ? 54.299  15.184  -17.358 1.00 13.09 ? 574  TYR A CE1 1 
ATOM   4372  C CE2 . TYR A 1 548 ? 52.878  13.260  -17.087 1.00 13.87 ? 574  TYR A CE2 1 
ATOM   4373  C CZ  . TYR A 1 548 ? 53.355  14.304  -17.863 1.00 11.29 ? 574  TYR A CZ  1 
ATOM   4374  O OH  . TYR A 1 548 ? 52.891  14.460  -19.143 1.00 15.31 ? 574  TYR A OH  1 
ATOM   4375  N N   . GLY A 1 549 ? 54.230  12.872  -10.944 1.00 12.40 ? 575  GLY A N   1 
ATOM   4376  C CA  . GLY A 1 549 ? 54.757  12.265  -9.733  1.00 13.57 ? 575  GLY A CA  1 
ATOM   4377  C C   . GLY A 1 549 ? 55.363  10.926  -10.135 1.00 13.74 ? 575  GLY A C   1 
ATOM   4378  O O   . GLY A 1 549 ? 54.643  9.958   -10.379 1.00 15.08 ? 575  GLY A O   1 
ATOM   4379  N N   . ILE A 1 550 ? 56.682  10.851  -10.217 1.00 12.02 ? 576  ILE A N   1 
ATOM   4380  C CA  . ILE A 1 550 ? 57.301  9.600   -10.636 1.00 12.70 ? 576  ILE A CA  1 
ATOM   4381  C C   . ILE A 1 550 ? 58.119  8.934   -9.540  1.00 12.98 ? 576  ILE A C   1 
ATOM   4382  O O   . ILE A 1 550 ? 59.017  9.548   -8.961  1.00 13.37 ? 576  ILE A O   1 
ATOM   4383  C CB  . ILE A 1 550 ? 58.178  9.830   -11.885 1.00 12.50 ? 576  ILE A CB  1 
ATOM   4384  C CG1 . ILE A 1 550 ? 57.322  10.456  -12.995 1.00 11.47 ? 576  ILE A CG1 1 
ATOM   4385  C CG2 . ILE A 1 550 ? 58.771  8.512   -12.373 1.00 13.26 ? 576  ILE A CG2 1 
ATOM   4386  C CD1 . ILE A 1 550 ? 58.121  10.933  -14.177 1.00 12.67 ? 576  ILE A CD1 1 
ATOM   4387  N N   . CYS A 1 551 ? 57.798  7.677   -9.258  1.00 12.60 ? 577  CYS A N   1 
ATOM   4388  C CA  . CYS A 1 551 ? 58.510  6.911   -8.234  1.00 12.86 ? 577  CYS A CA  1 
ATOM   4389  C C   . CYS A 1 551 ? 58.955  5.583   -8.853  1.00 13.77 ? 577  CYS A C   1 
ATOM   4390  O O   . CYS A 1 551 ? 58.247  5.002   -9.683  1.00 11.76 ? 577  CYS A O   1 
ATOM   4391  C CB  . CYS A 1 551 ? 57.599  6.656   -7.028  1.00 12.47 ? 577  CYS A CB  1 
ATOM   4392  S SG  . CYS A 1 551 ? 58.446  6.013   -5.563  1.00 19.83 ? 577  CYS A SG  1 
ATOM   4393  N N   . TYR A 1 552 ? 60.140  5.114   -8.482  1.00 12.77 ? 578  TYR A N   1 
ATOM   4394  C CA  . TYR A 1 552 ? 60.622  3.862   -9.038  1.00 14.27 ? 578  TYR A CA  1 
ATOM   4395  C C   . TYR A 1 552 ? 61.486  3.057   -8.091  1.00 15.68 ? 578  TYR A C   1 
ATOM   4396  O O   . TYR A 1 552 ? 62.078  3.588   -7.141  1.00 15.68 ? 578  TYR A O   1 
ATOM   4397  C CB  . TYR A 1 552 ? 61.404  4.109   -10.332 1.00 11.70 ? 578  TYR A CB  1 
ATOM   4398  C CG  . TYR A 1 552 ? 62.500  5.137   -10.205 1.00 12.28 ? 578  TYR A CG  1 
ATOM   4399  C CD1 . TYR A 1 552 ? 62.208  6.502   -10.254 1.00 12.11 ? 578  TYR A CD1 1 
ATOM   4400  C CD2 . TYR A 1 552 ? 63.829  4.754   -10.014 1.00 10.78 ? 578  TYR A CD2 1 
ATOM   4401  C CE1 . TYR A 1 552 ? 63.209  7.457   -10.110 1.00 12.23 ? 578  TYR A CE1 1 
ATOM   4402  C CE2 . TYR A 1 552 ? 64.839  5.707   -9.874  1.00 12.78 ? 578  TYR A CE2 1 
ATOM   4403  C CZ  . TYR A 1 552 ? 64.522  7.055   -9.920  1.00 12.97 ? 578  TYR A CZ  1 
ATOM   4404  O OH  . TYR A 1 552 ? 65.509  8.006   -9.766  1.00 12.80 ? 578  TYR A OH  1 
ATOM   4405  N N   . ASN A 1 553 ? 61.530  1.759   -8.357  1.00 14.97 ? 579  ASN A N   1 
ATOM   4406  C CA  . ASN A 1 553 ? 62.329  0.837   -7.571  1.00 15.18 ? 579  ASN A CA  1 
ATOM   4407  C C   . ASN A 1 553 ? 63.184  0.065   -8.562  1.00 15.68 ? 579  ASN A C   1 
ATOM   4408  O O   . ASN A 1 553 ? 62.694  -0.837  -9.238  1.00 14.47 ? 579  ASN A O   1 
ATOM   4409  C CB  . ASN A 1 553 ? 61.441  -0.128  -6.787  1.00 15.13 ? 579  ASN A CB  1 
ATOM   4410  C CG  . ASN A 1 553 ? 62.254  -1.164  -6.027  1.00 15.94 ? 579  ASN A CG  1 
ATOM   4411  O OD1 . ASN A 1 553 ? 63.482  -1.157  -6.089  1.00 17.35 ? 579  ASN A OD1 1 
ATOM   4412  N ND2 . ASN A 1 553 ? 61.578  -2.058  -5.317  1.00 14.12 ? 579  ASN A ND2 1 
ATOM   4413  N N   . PRO A 1 554 ? 64.467  0.437   -8.685  1.00 17.50 ? 580  PRO A N   1 
ATOM   4414  C CA  . PRO A 1 554 ? 65.395  -0.229  -9.607  1.00 17.01 ? 580  PRO A CA  1 
ATOM   4415  C C   . PRO A 1 554 ? 65.802  -1.600  -9.095  1.00 17.20 ? 580  PRO A C   1 
ATOM   4416  O O   . PRO A 1 554 ? 66.470  -1.711  -8.066  1.00 18.16 ? 580  PRO A O   1 
ATOM   4417  C CB  . PRO A 1 554 ? 66.596  0.716   -9.648  1.00 17.67 ? 580  PRO A CB  1 
ATOM   4418  C CG  . PRO A 1 554 ? 66.018  2.046   -9.272  1.00 18.61 ? 580  PRO A CG  1 
ATOM   4419  C CD  . PRO A 1 554 ? 65.057  1.687   -8.176  1.00 16.18 ? 580  PRO A CD  1 
ATOM   4420  N N   . MET A 1 555 ? 65.391  -2.643  -9.804  1.00 16.59 ? 581  MET A N   1 
ATOM   4421  C CA  . MET A 1 555 ? 65.757  -3.994  -9.416  1.00 16.82 ? 581  MET A CA  1 
ATOM   4422  C C   . MET A 1 555 ? 66.929  -4.374  -10.313 1.00 16.45 ? 581  MET A C   1 
ATOM   4423  O O   . MET A 1 555 ? 67.369  -3.583  -11.151 1.00 15.40 ? 581  MET A O   1 
ATOM   4424  C CB  . MET A 1 555 ? 64.594  -4.968  -9.618  1.00 20.12 ? 581  MET A CB  1 
ATOM   4425  C CG  . MET A 1 555 ? 63.311  -4.611  -8.862  1.00 21.01 ? 581  MET A CG  1 
ATOM   4426  S SD  . MET A 1 555 ? 63.452  -4.687  -7.065  1.00 26.53 ? 581  MET A SD  1 
ATOM   4427  C CE  . MET A 1 555 ? 63.298  -6.465  -6.789  1.00 21.68 ? 581  MET A CE  1 
ATOM   4428  N N   . GLU A 1 556 ? 67.435  -5.591  -10.151 1.00 15.11 ? 582  GLU A N   1 
ATOM   4429  C CA  . GLU A 1 556 ? 68.575  -6.028  -10.936 1.00 15.35 ? 582  GLU A CA  1 
ATOM   4430  C C   . GLU A 1 556 ? 68.281  -6.187  -12.426 1.00 15.10 ? 582  GLU A C   1 
ATOM   4431  O O   . GLU A 1 556 ? 69.012  -5.655  -13.256 1.00 14.87 ? 582  GLU A O   1 
ATOM   4432  C CB  . GLU A 1 556 ? 69.125  -7.341  -10.351 1.00 15.79 ? 582  GLU A CB  1 
ATOM   4433  C CG  . GLU A 1 556 ? 70.395  -7.893  -11.022 1.00 15.35 ? 582  GLU A CG  1 
ATOM   4434  C CD  . GLU A 1 556 ? 71.558  -6.916  -11.032 1.00 18.90 ? 582  GLU A CD  1 
ATOM   4435  O OE1 . GLU A 1 556 ? 71.658  -6.070  -10.117 1.00 20.11 ? 582  GLU A OE1 1 
ATOM   4436  O OE2 . GLU A 1 556 ? 72.403  -7.014  -11.951 1.00 19.76 ? 582  GLU A OE2 1 
ATOM   4437  N N   . ALA A 1 557 ? 67.203  -6.892  -12.754 1.00 16.24 ? 583  ALA A N   1 
ATOM   4438  C CA  . ALA A 1 557 ? 66.832  -7.151  -14.147 1.00 18.08 ? 583  ALA A CA  1 
ATOM   4439  C C   . ALA A 1 557 ? 65.626  -6.367  -14.657 1.00 17.24 ? 583  ALA A C   1 
ATOM   4440  O O   . ALA A 1 557 ? 65.275  -6.470  -15.829 1.00 16.15 ? 583  ALA A O   1 
ATOM   4441  C CB  . ALA A 1 557 ? 66.593  -8.648  -14.342 1.00 17.70 ? 583  ALA A CB  1 
ATOM   4442  N N   . HIS A 1 558 ? 64.987  -5.602  -13.781 1.00 16.22 ? 584  HIS A N   1 
ATOM   4443  C CA  . HIS A 1 558 ? 63.840  -4.794  -14.177 1.00 15.23 ? 584  HIS A CA  1 
ATOM   4444  C C   . HIS A 1 558 ? 63.687  -3.581  -13.265 1.00 15.31 ? 584  HIS A C   1 
ATOM   4445  O O   . HIS A 1 558 ? 64.380  -3.459  -12.257 1.00 16.61 ? 584  HIS A O   1 
ATOM   4446  C CB  . HIS A 1 558 ? 62.550  -5.622  -14.154 1.00 15.20 ? 584  HIS A CB  1 
ATOM   4447  C CG  . HIS A 1 558 ? 62.117  -6.041  -12.785 1.00 16.69 ? 584  HIS A CG  1 
ATOM   4448  N ND1 . HIS A 1 558 ? 62.693  -7.093  -12.109 1.00 17.65 ? 584  HIS A ND1 1 
ATOM   4449  C CD2 . HIS A 1 558 ? 61.174  -5.531  -11.954 1.00 15.92 ? 584  HIS A CD2 1 
ATOM   4450  C CE1 . HIS A 1 558 ? 62.131  -7.214  -10.921 1.00 17.53 ? 584  HIS A CE1 1 
ATOM   4451  N NE2 . HIS A 1 558 ? 61.203  -6.279  -10.800 1.00 16.04 ? 584  HIS A NE2 1 
ATOM   4452  N N   . ILE A 1 559 ? 62.785  -2.679  -13.636 1.00 15.08 ? 585  ILE A N   1 
ATOM   4453  C CA  . ILE A 1 559 ? 62.538  -1.475  -12.852 1.00 13.75 ? 585  ILE A CA  1 
ATOM   4454  C C   . ILE A 1 559 ? 61.044  -1.205  -12.712 1.00 14.24 ? 585  ILE A C   1 
ATOM   4455  O O   . ILE A 1 559 ? 60.328  -1.105  -13.716 1.00 16.18 ? 585  ILE A O   1 
ATOM   4456  C CB  . ILE A 1 559 ? 63.190  -0.227  -13.497 1.00 14.93 ? 585  ILE A CB  1 
ATOM   4457  C CG1 . ILE A 1 559 ? 64.689  -0.462  -13.700 1.00 16.59 ? 585  ILE A CG1 1 
ATOM   4458  C CG2 . ILE A 1 559 ? 62.964  0.995   -12.611 1.00 13.90 ? 585  ILE A CG2 1 
ATOM   4459  C CD1 . ILE A 1 559 ? 65.370  0.627   -14.504 1.00 15.22 ? 585  ILE A CD1 1 
ATOM   4460  N N   . ASN A 1 560 ? 60.580  -1.097  -11.472 1.00 11.99 ? 586  ASN A N   1 
ATOM   4461  C CA  . ASN A 1 560 ? 59.176  -0.813  -11.210 1.00 12.66 ? 586  ASN A CA  1 
ATOM   4462  C C   . ASN A 1 560 ? 58.974  0.698   -11.230 1.00 13.76 ? 586  ASN A C   1 
ATOM   4463  O O   . ASN A 1 560 ? 59.624  1.427   -10.482 1.00 14.05 ? 586  ASN A O   1 
ATOM   4464  C CB  . ASN A 1 560 ? 58.766  -1.340  -9.845  1.00 11.93 ? 586  ASN A CB  1 
ATOM   4465  C CG  . ASN A 1 560 ? 58.845  -2.847  -9.751  1.00 14.00 ? 586  ASN A CG  1 
ATOM   4466  O OD1 . ASN A 1 560 ? 59.097  -3.393  -8.678  1.00 14.43 ? 586  ASN A OD1 1 
ATOM   4467  N ND2 . ASN A 1 560 ? 58.616  -3.524  -10.867 1.00 9.17  ? 586  ASN A ND2 1 
ATOM   4468  N N   . PHE A 1 561 ? 58.068  1.159   -12.079 1.00 13.75 ? 587  PHE A N   1 
ATOM   4469  C CA  . PHE A 1 561 ? 57.790  2.584   -12.207 1.00 13.35 ? 587  PHE A CA  1 
ATOM   4470  C C   . PHE A 1 561 ? 56.350  2.944   -11.884 1.00 13.97 ? 587  PHE A C   1 
ATOM   4471  O O   . PHE A 1 561 ? 55.437  2.146   -12.087 1.00 13.26 ? 587  PHE A O   1 
ATOM   4472  C CB  . PHE A 1 561 ? 58.061  3.048   -13.640 1.00 13.66 ? 587  PHE A CB  1 
ATOM   4473  C CG  . PHE A 1 561 ? 59.505  3.270   -13.957 1.00 11.67 ? 587  PHE A CG  1 
ATOM   4474  C CD1 . PHE A 1 561 ? 60.172  4.377   -13.445 1.00 10.30 ? 587  PHE A CD1 1 
ATOM   4475  C CD2 . PHE A 1 561 ? 60.189  2.407   -14.808 1.00 9.30  ? 587  PHE A CD2 1 
ATOM   4476  C CE1 . PHE A 1 561 ? 61.491  4.630   -13.773 1.00 8.89  ? 587  PHE A CE1 1 
ATOM   4477  C CE2 . PHE A 1 561 ? 61.517  2.650   -15.145 1.00 10.20 ? 587  PHE A CE2 1 
ATOM   4478  C CZ  . PHE A 1 561 ? 62.173  3.763   -14.631 1.00 9.38  ? 587  PHE A CZ  1 
ATOM   4479  N N   . SER A 1 562 ? 56.147  4.154   -11.372 1.00 13.30 ? 588  SER A N   1 
ATOM   4480  C CA  . SER A 1 562 ? 54.797  4.641   -11.115 1.00 14.30 ? 588  SER A CA  1 
ATOM   4481  C C   . SER A 1 562 ? 54.796  6.084   -11.594 1.00 15.58 ? 588  SER A C   1 
ATOM   4482  O O   . SER A 1 562 ? 55.681  6.860   -11.224 1.00 16.66 ? 588  SER A O   1 
ATOM   4483  C CB  . SER A 1 562 ? 54.427  4.579   -9.626  1.00 15.57 ? 588  SER A CB  1 
ATOM   4484  O OG  . SER A 1 562 ? 55.055  5.604   -8.879  1.00 16.22 ? 588  SER A OG  1 
ATOM   4485  N N   . VAL A 1 563 ? 53.823  6.433   -12.438 1.00 14.82 ? 589  VAL A N   1 
ATOM   4486  C CA  . VAL A 1 563 ? 53.705  7.796   -12.966 1.00 13.26 ? 589  VAL A CA  1 
ATOM   4487  C C   . VAL A 1 563 ? 52.314  8.382   -12.700 1.00 13.84 ? 589  VAL A C   1 
ATOM   4488  O O   . VAL A 1 563 ? 51.293  7.791   -13.081 1.00 14.64 ? 589  VAL A O   1 
ATOM   4489  C CB  . VAL A 1 563 ? 53.974  7.835   -14.486 1.00 13.21 ? 589  VAL A CB  1 
ATOM   4490  C CG1 . VAL A 1 563 ? 53.918  9.274   -15.009 1.00 13.03 ? 589  VAL A CG1 1 
ATOM   4491  C CG2 . VAL A 1 563 ? 55.327  7.222   -14.773 1.00 15.01 ? 589  VAL A CG2 1 
ATOM   4492  N N   . SER A 1 564 ? 52.277  9.538   -12.049 1.00 10.39 ? 590  SER A N   1 
ATOM   4493  C CA  . SER A 1 564 ? 51.010  10.181  -11.734 1.00 10.58 ? 590  SER A CA  1 
ATOM   4494  C C   . SER A 1 564 ? 50.908  11.536  -12.404 1.00 9.48  ? 590  SER A C   1 
ATOM   4495  O O   . SER A 1 564 ? 51.920  12.153  -12.742 1.00 9.49  ? 590  SER A O   1 
ATOM   4496  C CB  . SER A 1 564 ? 50.875  10.392  -10.224 1.00 10.48 ? 590  SER A CB  1 
ATOM   4497  O OG  . SER A 1 564 ? 51.883  11.289  -9.742  1.00 12.01 ? 590  SER A OG  1 
ATOM   4498  N N   . ALA A 1 565 ? 49.680  11.986  -12.603 1.00 10.49 ? 591  ALA A N   1 
ATOM   4499  C CA  . ALA A 1 565 ? 49.430  13.285  -13.209 1.00 9.91  ? 591  ALA A CA  1 
ATOM   4500  C C   . ALA A 1 565 ? 47.999  13.679  -12.882 1.00 11.50 ? 591  ALA A C   1 
ATOM   4501  O O   . ALA A 1 565 ? 47.233  12.885  -12.333 1.00 12.62 ? 591  ALA A O   1 
ATOM   4502  C CB  . ALA A 1 565 ? 49.634  13.215  -14.717 1.00 11.11 ? 591  ALA A CB  1 
ATOM   4503  N N   . TYR A 1 566 ? 47.649  14.925  -13.194 1.00 14.71 ? 592  TYR A N   1 
ATOM   4504  C CA  . TYR A 1 566 ? 46.306  15.419  -12.936 1.00 15.85 ? 592  TYR A CA  1 
ATOM   4505  C C   . TYR A 1 566 ? 45.555  15.653  -14.240 1.00 16.33 ? 592  TYR A C   1 
ATOM   4506  O O   . TYR A 1 566 ? 46.086  16.245  -15.178 1.00 14.58 ? 592  TYR A O   1 
ATOM   4507  C CB  . TYR A 1 566 ? 46.349  16.724  -12.134 1.00 16.32 ? 592  TYR A CB  1 
ATOM   4508  C CG  . TYR A 1 566 ? 46.915  16.565  -10.745 1.00 15.80 ? 592  TYR A CG  1 
ATOM   4509  C CD1 . TYR A 1 566 ? 46.283  15.753  -9.806  1.00 15.84 ? 592  TYR A CD1 1 
ATOM   4510  C CD2 . TYR A 1 566 ? 48.103  17.196  -10.381 1.00 15.14 ? 592  TYR A CD2 1 
ATOM   4511  C CE1 . TYR A 1 566 ? 46.821  15.567  -8.540  1.00 14.30 ? 592  TYR A CE1 1 
ATOM   4512  C CE2 . TYR A 1 566 ? 48.653  17.014  -9.117  1.00 15.30 ? 592  TYR A CE2 1 
ATOM   4513  C CZ  . TYR A 1 566 ? 48.008  16.197  -8.205  1.00 15.50 ? 592  TYR A CZ  1 
ATOM   4514  O OH  . TYR A 1 566 ? 48.560  15.985  -6.964  1.00 16.51 ? 592  TYR A OH  1 
ATOM   4515  N N   . ASN A 1 567 ? 44.315  15.189  -14.291 1.00 17.70 ? 593  ASN A N   1 
ATOM   4516  C CA  . ASN A 1 567 ? 43.494  15.361  -15.479 1.00 20.11 ? 593  ASN A CA  1 
ATOM   4517  C C   . ASN A 1 567 ? 43.071  16.813  -15.680 1.00 21.38 ? 593  ASN A C   1 
ATOM   4518  O O   . ASN A 1 567 ? 42.580  17.180  -16.742 1.00 23.49 ? 593  ASN A O   1 
ATOM   4519  C CB  . ASN A 1 567 ? 42.266  14.462  -15.390 1.00 17.89 ? 593  ASN A CB  1 
ATOM   4520  C CG  . ASN A 1 567 ? 42.633  13.002  -15.377 1.00 18.36 ? 593  ASN A CG  1 
ATOM   4521  O OD1 . ASN A 1 567 ? 43.446  12.557  -16.187 1.00 19.25 ? 593  ASN A OD1 1 
ATOM   4522  N ND2 . ASN A 1 567 ? 42.039  12.241  -14.464 1.00 16.81 ? 593  ASN A ND2 1 
ATOM   4523  N N   . SER A 1 568 ? 43.263  17.636  -14.651 1.00 21.06 ? 594  SER A N   1 
ATOM   4524  C CA  . SER A 1 568 ? 42.907  19.045  -14.740 1.00 21.44 ? 594  SER A CA  1 
ATOM   4525  C C   . SER A 1 568 ? 43.858  19.759  -15.700 1.00 21.02 ? 594  SER A C   1 
ATOM   4526  O O   . SER A 1 568 ? 43.530  20.825  -16.226 1.00 21.67 ? 594  SER A O   1 
ATOM   4527  C CB  . SER A 1 568 ? 42.939  19.713  -13.350 1.00 21.09 ? 594  SER A CB  1 
ATOM   4528  O OG  . SER A 1 568 ? 44.254  19.757  -12.818 1.00 22.85 ? 594  SER A OG  1 
ATOM   4529  N N   . CYS A 1 569 ? 45.029  19.164  -15.936 1.00 21.07 ? 595  CYS A N   1 
ATOM   4530  C CA  . CYS A 1 569 ? 46.019  19.742  -16.849 1.00 21.50 ? 595  CYS A CA  1 
ATOM   4531  C C   . CYS A 1 569 ? 46.100  18.932  -18.140 1.00 22.53 ? 595  CYS A C   1 
ATOM   4532  O O   . CYS A 1 569 ? 46.738  17.881  -18.183 1.00 24.04 ? 595  CYS A O   1 
ATOM   4533  C CB  . CYS A 1 569 ? 47.405  19.775  -16.196 1.00 18.90 ? 595  CYS A CB  1 
ATOM   4534  S SG  . CYS A 1 569 ? 48.725  20.420  -17.264 1.00 21.32 ? 595  CYS A SG  1 
ATOM   4535  N N   . ALA A 1 570 ? 45.463  19.429  -19.194 1.00 23.35 ? 596  ALA A N   1 
ATOM   4536  C CA  . ALA A 1 570 ? 45.444  18.732  -20.481 1.00 23.82 ? 596  ALA A CA  1 
ATOM   4537  C C   . ALA A 1 570 ? 46.842  18.504  -21.060 1.00 23.94 ? 596  ALA A C   1 
ATOM   4538  O O   . ALA A 1 570 ? 47.033  17.634  -21.911 1.00 25.03 ? 596  ALA A O   1 
ATOM   4539  C CB  . ALA A 1 570 ? 44.576  19.503  -21.479 1.00 23.83 ? 596  ALA A CB  1 
ATOM   4540  N N   . GLU A 1 571 ? 47.820  19.271  -20.590 1.00 23.59 ? 597  GLU A N   1 
ATOM   4541  C CA  . GLU A 1 571 ? 49.186  19.142  -21.079 1.00 24.18 ? 597  GLU A CA  1 
ATOM   4542  C C   . GLU A 1 571 ? 49.928  17.924  -20.517 1.00 22.73 ? 597  GLU A C   1 
ATOM   4543  O O   . GLU A 1 571 ? 51.033  17.614  -20.958 1.00 22.57 ? 597  GLU A O   1 
ATOM   4544  C CB  . GLU A 1 571 ? 49.987  20.404  -20.750 1.00 27.68 ? 597  GLU A CB  1 
ATOM   4545  C CG  . GLU A 1 571 ? 49.607  21.661  -21.539 1.00 33.93 ? 597  GLU A CG  1 
ATOM   4546  C CD  . GLU A 1 571 ? 48.151  22.066  -21.384 1.00 37.02 ? 597  GLU A CD  1 
ATOM   4547  O OE1 . GLU A 1 571 ? 47.643  22.109  -20.241 1.00 38.40 ? 597  GLU A OE1 1 
ATOM   4548  O OE2 . GLU A 1 571 ? 47.517  22.363  -22.418 1.00 40.44 ? 597  GLU A OE2 1 
ATOM   4549  N N   . THR A 1 572 ? 49.333  17.232  -19.547 1.00 20.60 ? 598  THR A N   1 
ATOM   4550  C CA  . THR A 1 572 ? 49.987  16.066  -18.964 1.00 18.37 ? 598  THR A CA  1 
ATOM   4551  C C   . THR A 1 572 ? 49.176  14.787  -19.130 1.00 16.57 ? 598  THR A C   1 
ATOM   4552  O O   . THR A 1 572 ? 47.944  14.812  -19.129 1.00 15.69 ? 598  THR A O   1 
ATOM   4553  C CB  . THR A 1 572 ? 50.263  16.261  -17.456 1.00 18.17 ? 598  THR A CB  1 
ATOM   4554  O OG1 . THR A 1 572 ? 49.021  16.410  -16.757 1.00 17.35 ? 598  THR A OG1 1 
ATOM   4555  C CG2 . THR A 1 572 ? 51.128  17.493  -17.222 1.00 17.20 ? 598  THR A CG2 1 
ATOM   4556  N N   . ASN A 1 573 ? 49.879  13.676  -19.283 1.00 14.13 ? 599  ASN A N   1 
ATOM   4557  C CA  . ASN A 1 573 ? 49.245  12.371  -19.440 1.00 14.43 ? 599  ASN A CA  1 
ATOM   4558  C C   . ASN A 1 573 ? 50.175  11.295  -18.910 1.00 13.18 ? 599  ASN A C   1 
ATOM   4559  O O   . ASN A 1 573 ? 51.226  11.043  -19.486 1.00 12.77 ? 599  ASN A O   1 
ATOM   4560  C CB  . ASN A 1 573 ? 48.937  12.090  -20.913 1.00 15.44 ? 599  ASN A CB  1 
ATOM   4561  C CG  . ASN A 1 573 ? 48.297  10.728  -21.121 1.00 14.64 ? 599  ASN A CG  1 
ATOM   4562  O OD1 . ASN A 1 573 ? 48.978  9.703   -21.168 1.00 16.04 ? 599  ASN A OD1 1 
ATOM   4563  N ND2 . ASN A 1 573 ? 46.975  10.711  -21.220 1.00 18.58 ? 599  ASN A ND2 1 
ATOM   4564  N N   . ALA A 1 574 ? 49.776  10.658  -17.816 1.00 13.99 ? 600  ALA A N   1 
ATOM   4565  C CA  . ALA A 1 574 ? 50.585  9.616   -17.193 1.00 13.97 ? 600  ALA A CA  1 
ATOM   4566  C C   . ALA A 1 574 ? 51.043  8.515   -18.167 1.00 14.77 ? 600  ALA A C   1 
ATOM   4567  O O   . ALA A 1 574 ? 52.232  8.190   -18.230 1.00 14.66 ? 600  ALA A O   1 
ATOM   4568  C CB  . ALA A 1 574 ? 49.815  8.996   -16.028 1.00 12.52 ? 600  ALA A CB  1 
ATOM   4569  N N   . ALA A 1 575 ? 50.114  7.940   -18.922 1.00 14.14 ? 601  ALA A N   1 
ATOM   4570  C CA  . ALA A 1 575 ? 50.473  6.878   -19.858 1.00 14.74 ? 601  ALA A CA  1 
ATOM   4571  C C   . ALA A 1 575 ? 51.524  7.336   -20.867 1.00 15.03 ? 601  ALA A C   1 
ATOM   4572  O O   . ALA A 1 575 ? 52.509  6.639   -21.107 1.00 15.35 ? 601  ALA A O   1 
ATOM   4573  C CB  . ALA A 1 575 ? 49.229  6.376   -20.586 1.00 15.83 ? 601  ALA A CB  1 
ATOM   4574  N N   . ARG A 1 576 ? 51.310  8.508   -21.456 1.00 15.75 ? 602  ARG A N   1 
ATOM   4575  C CA  . ARG A 1 576 ? 52.235  9.038   -22.444 1.00 17.10 ? 602  ARG A CA  1 
ATOM   4576  C C   . ARG A 1 576 ? 53.631  9.236   -21.880 1.00 16.37 ? 602  ARG A C   1 
ATOM   4577  O O   . ARG A 1 576 ? 54.622  8.858   -22.502 1.00 16.97 ? 602  ARG A O   1 
ATOM   4578  C CB  . ARG A 1 576 ? 51.717  10.360  -23.008 1.00 19.09 ? 602  ARG A CB  1 
ATOM   4579  C CG  . ARG A 1 576 ? 52.527  10.870  -24.192 1.00 26.73 ? 602  ARG A CG  1 
ATOM   4580  C CD  . ARG A 1 576 ? 51.949  12.161  -24.764 1.00 31.60 ? 602  ARG A CD  1 
ATOM   4581  N NE  . ARG A 1 576 ? 52.669  12.578  -25.961 1.00 38.64 ? 602  ARG A NE  1 
ATOM   4582  C CZ  . ARG A 1 576 ? 52.543  13.777  -26.530 1.00 42.53 ? 602  ARG A CZ  1 
ATOM   4583  N NH1 . ARG A 1 576 ? 51.723  14.686  -26.008 1.00 44.20 ? 602  ARG A NH1 1 
ATOM   4584  N NH2 . ARG A 1 576 ? 53.235  14.074  -27.625 1.00 43.52 ? 602  ARG A NH2 1 
ATOM   4585  N N   . MET A 1 577 ? 53.709  9.844   -20.701 1.00 14.95 ? 603  MET A N   1 
ATOM   4586  C CA  . MET A 1 577 ? 54.999  10.085  -20.061 1.00 13.84 ? 603  MET A CA  1 
ATOM   4587  C C   . MET A 1 577 ? 55.697  8.749   -19.798 1.00 12.86 ? 603  MET A C   1 
ATOM   4588  O O   . MET A 1 577 ? 56.890  8.608   -20.032 1.00 12.94 ? 603  MET A O   1 
ATOM   4589  C CB  . MET A 1 577 ? 54.798  10.843  -18.742 1.00 15.91 ? 603  MET A CB  1 
ATOM   4590  C CG  . MET A 1 577 ? 56.087  11.204  -18.009 1.00 14.14 ? 603  MET A CG  1 
ATOM   4591  S SD  . MET A 1 577 ? 56.972  12.593  -18.782 1.00 18.98 ? 603  MET A SD  1 
ATOM   4592  C CE  . MET A 1 577 ? 58.348  11.773  -19.394 1.00 12.02 ? 603  MET A CE  1 
ATOM   4593  N N   . ALA A 1 578 ? 54.946  7.765   -19.327 1.00 12.37 ? 604  ALA A N   1 
ATOM   4594  C CA  . ALA A 1 578 ? 55.512  6.449   -19.044 1.00 13.81 ? 604  ALA A CA  1 
ATOM   4595  C C   . ALA A 1 578 ? 56.085  5.805   -20.307 1.00 14.43 ? 604  ALA A C   1 
ATOM   4596  O O   . ALA A 1 578 ? 57.154  5.190   -20.278 1.00 15.02 ? 604  ALA A O   1 
ATOM   4597  C CB  . ALA A 1 578 ? 54.459  5.549   -18.431 1.00 14.84 ? 604  ALA A CB  1 
ATOM   4598  N N   . HIS A 1 579 ? 55.367  5.947   -21.421 1.00 14.98 ? 605  HIS A N   1 
ATOM   4599  C CA  . HIS A 1 579 ? 55.810  5.392   -22.692 1.00 14.38 ? 605  HIS A CA  1 
ATOM   4600  C C   . HIS A 1 579 ? 57.089  6.057   -23.172 1.00 12.14 ? 605  HIS A C   1 
ATOM   4601  O O   . HIS A 1 579 ? 58.020  5.384   -23.601 1.00 11.39 ? 605  HIS A O   1 
ATOM   4602  C CB  . HIS A 1 579 ? 54.710  5.557   -23.739 1.00 18.53 ? 605  HIS A CB  1 
ATOM   4603  C CG  . HIS A 1 579 ? 53.481  4.751   -23.443 1.00 19.71 ? 605  HIS A CG  1 
ATOM   4604  N ND1 . HIS A 1 579 ? 52.233  5.106   -23.907 1.00 22.59 ? 605  HIS A ND1 1 
ATOM   4605  C CD2 . HIS A 1 579 ? 53.314  3.596   -22.758 1.00 20.21 ? 605  HIS A CD2 1 
ATOM   4606  C CE1 . HIS A 1 579 ? 51.345  4.201   -23.518 1.00 22.05 ? 605  HIS A CE1 1 
ATOM   4607  N NE2 . HIS A 1 579 ? 51.981  3.273   -22.818 1.00 20.96 ? 605  HIS A NE2 1 
ATOM   4608  N N   . TYR A 1 580 ? 57.158  7.379   -23.095 1.00 12.21 ? 606  TYR A N   1 
ATOM   4609  C CA  . TYR A 1 580 ? 58.379  8.050   -23.526 1.00 13.05 ? 606  TYR A CA  1 
ATOM   4610  C C   . TYR A 1 580 ? 59.555  7.705   -22.611 1.00 12.84 ? 606  TYR A C   1 
ATOM   4611  O O   . TYR A 1 580 ? 60.706  7.657   -23.060 1.00 12.20 ? 606  TYR A O   1 
ATOM   4612  C CB  . TYR A 1 580 ? 58.188  9.561   -23.563 1.00 13.99 ? 606  TYR A CB  1 
ATOM   4613  C CG  . TYR A 1 580 ? 57.495  10.058  -24.812 1.00 17.13 ? 606  TYR A CG  1 
ATOM   4614  C CD1 . TYR A 1 580 ? 56.138  9.826   -25.026 1.00 18.52 ? 606  TYR A CD1 1 
ATOM   4615  C CD2 . TYR A 1 580 ? 58.197  10.787  -25.770 1.00 17.93 ? 606  TYR A CD2 1 
ATOM   4616  C CE1 . TYR A 1 580 ? 55.494  10.316  -26.164 1.00 19.66 ? 606  TYR A CE1 1 
ATOM   4617  C CE2 . TYR A 1 580 ? 57.569  11.279  -26.908 1.00 19.65 ? 606  TYR A CE2 1 
ATOM   4618  C CZ  . TYR A 1 580 ? 56.215  11.042  -27.098 1.00 21.29 ? 606  TYR A CZ  1 
ATOM   4619  O OH  . TYR A 1 580 ? 55.581  11.532  -28.217 1.00 23.80 ? 606  TYR A OH  1 
ATOM   4620  N N   . LEU A 1 581 ? 59.272  7.480   -21.334 1.00 13.08 ? 607  LEU A N   1 
ATOM   4621  C CA  . LEU A 1 581 ? 60.319  7.121   -20.377 1.00 13.71 ? 607  LEU A CA  1 
ATOM   4622  C C   . LEU A 1 581 ? 60.854  5.739   -20.763 1.00 12.48 ? 607  LEU A C   1 
ATOM   4623  O O   . LEU A 1 581 ? 62.055  5.531   -20.855 1.00 14.39 ? 607  LEU A O   1 
ATOM   4624  C CB  . LEU A 1 581 ? 59.743  7.105   -18.956 1.00 10.33 ? 607  LEU A CB  1 
ATOM   4625  C CG  . LEU A 1 581 ? 60.659  6.607   -17.837 1.00 11.11 ? 607  LEU A CG  1 
ATOM   4626  C CD1 . LEU A 1 581 ? 61.974  7.380   -17.885 1.00 9.53  ? 607  LEU A CD1 1 
ATOM   4627  C CD2 . LEU A 1 581 ? 59.967  6.751   -16.475 1.00 10.07 ? 607  LEU A CD2 1 
ATOM   4628  N N   . GLU A 1 582 ? 59.958  4.803   -21.001 1.00 14.57 ? 608  GLU A N   1 
ATOM   4629  C CA  . GLU A 1 582 ? 60.372  3.461   -21.397 1.00 15.28 ? 608  GLU A CA  1 
ATOM   4630  C C   . GLU A 1 582 ? 61.235  3.521   -22.662 1.00 14.52 ? 608  GLU A C   1 
ATOM   4631  O O   . GLU A 1 582 ? 62.297  2.906   -22.733 1.00 15.34 ? 608  GLU A O   1 
ATOM   4632  C CB  . GLU A 1 582 ? 59.142  2.572   -21.635 1.00 13.95 ? 608  GLU A CB  1 
ATOM   4633  C CG  . GLU A 1 582 ? 59.458  1.223   -22.273 1.00 15.91 ? 608  GLU A CG  1 
ATOM   4634  C CD  . GLU A 1 582 ? 58.209  0.404   -22.575 1.00 17.59 ? 608  GLU A CD  1 
ATOM   4635  O OE1 . GLU A 1 582 ? 57.199  0.977   -23.044 1.00 19.14 ? 608  GLU A OE1 1 
ATOM   4636  O OE2 . GLU A 1 582 ? 58.245  -0.825  -22.358 1.00 20.61 ? 608  GLU A OE2 1 
ATOM   4637  N N   . LYS A 1 583 ? 60.779  4.281   -23.658 1.00 15.18 ? 609  LYS A N   1 
ATOM   4638  C CA  . LYS A 1 583 ? 61.511  4.406   -24.909 1.00 13.83 ? 609  LYS A CA  1 
ATOM   4639  C C   . LYS A 1 583 ? 62.828  5.127   -24.713 1.00 13.39 ? 609  LYS A C   1 
ATOM   4640  O O   . LYS A 1 583 ? 63.823  4.794   -25.351 1.00 14.92 ? 609  LYS A O   1 
ATOM   4641  C CB  . LYS A 1 583 ? 60.650  5.120   -25.965 1.00 16.62 ? 609  LYS A CB  1 
ATOM   4642  C CG  . LYS A 1 583 ? 61.229  5.108   -27.391 1.00 16.75 ? 609  LYS A CG  1 
ATOM   4643  C CD  . LYS A 1 583 ? 61.496  3.682   -27.872 1.00 18.02 ? 609  LYS A CD  1 
ATOM   4644  C CE  . LYS A 1 583 ? 61.692  3.590   -29.390 1.00 17.53 ? 609  LYS A CE  1 
ATOM   4645  N NZ  . LYS A 1 583 ? 62.819  4.414   -29.898 1.00 16.98 ? 609  LYS A NZ  1 
ATOM   4646  N N   . ALA A 1 584 ? 62.836  6.115   -23.820 1.00 11.64 ? 610  ALA A N   1 
ATOM   4647  C CA  . ALA A 1 584 ? 64.051  6.873   -23.526 1.00 10.11 ? 610  ALA A CA  1 
ATOM   4648  C C   . ALA A 1 584 ? 65.130  5.947   -22.962 1.00 8.85  ? 610  ALA A C   1 
ATOM   4649  O O   . ALA A 1 584 ? 66.268  5.967   -23.409 1.00 10.00 ? 610  ALA A O   1 
ATOM   4650  C CB  . ALA A 1 584 ? 63.740  7.992   -22.529 1.00 8.75  ? 610  ALA A CB  1 
ATOM   4651  N N   . LEU A 1 585 ? 64.759  5.129   -21.988 1.00 8.90  ? 611  LEU A N   1 
ATOM   4652  C CA  . LEU A 1 585 ? 65.687  4.175   -21.378 1.00 10.92 ? 611  LEU A CA  1 
ATOM   4653  C C   . LEU A 1 585 ? 66.264  3.220   -22.439 1.00 13.40 ? 611  LEU A C   1 
ATOM   4654  O O   . LEU A 1 585 ? 67.476  2.990   -22.505 1.00 12.29 ? 611  LEU A O   1 
ATOM   4655  C CB  . LEU A 1 585 ? 64.954  3.360   -20.308 1.00 10.90 ? 611  LEU A CB  1 
ATOM   4656  C CG  . LEU A 1 585 ? 64.590  4.066   -19.001 1.00 11.83 ? 611  LEU A CG  1 
ATOM   4657  C CD1 . LEU A 1 585 ? 63.506  3.296   -18.267 1.00 10.10 ? 611  LEU A CD1 1 
ATOM   4658  C CD2 . LEU A 1 585 ? 65.834  4.169   -18.144 1.00 12.18 ? 611  LEU A CD2 1 
ATOM   4659  N N   . LEU A 1 586 ? 65.381  2.676   -23.273 1.00 12.73 ? 612  LEU A N   1 
ATOM   4660  C CA  . LEU A 1 586 ? 65.791  1.750   -24.320 1.00 13.73 ? 612  LEU A CA  1 
ATOM   4661  C C   . LEU A 1 586 ? 66.734  2.390   -25.328 1.00 14.63 ? 612  LEU A C   1 
ATOM   4662  O O   . LEU A 1 586 ? 67.768  1.811   -25.669 1.00 16.00 ? 612  LEU A O   1 
ATOM   4663  C CB  . LEU A 1 586 ? 64.561  1.200   -25.034 1.00 13.27 ? 612  LEU A CB  1 
ATOM   4664  C CG  . LEU A 1 586 ? 63.674  0.291   -24.181 1.00 14.74 ? 612  LEU A CG  1 
ATOM   4665  C CD1 . LEU A 1 586 ? 62.362  0.044   -24.898 1.00 17.00 ? 612  LEU A CD1 1 
ATOM   4666  C CD2 . LEU A 1 586 ? 64.394  -1.022  -23.890 1.00 15.32 ? 612  LEU A CD2 1 
ATOM   4667  N N   . ASP A 1 587 ? 66.381  3.584   -25.809 1.00 14.04 ? 613  ASP A N   1 
ATOM   4668  C CA  . ASP A 1 587 ? 67.216  4.278   -26.778 1.00 15.01 ? 613  ASP A CA  1 
ATOM   4669  C C   . ASP A 1 587 ? 68.602  4.553   -26.223 1.00 14.48 ? 613  ASP A C   1 
ATOM   4670  O O   . ASP A 1 587 ? 69.593  4.493   -26.954 1.00 14.63 ? 613  ASP A O   1 
ATOM   4671  C CB  . ASP A 1 587 ? 66.570  5.598   -27.224 1.00 17.23 ? 613  ASP A CB  1 
ATOM   4672  C CG  . ASP A 1 587 ? 65.372  5.384   -28.138 1.00 19.78 ? 613  ASP A CG  1 
ATOM   4673  O OD1 . ASP A 1 587 ? 65.319  4.342   -28.825 1.00 21.16 ? 613  ASP A OD1 1 
ATOM   4674  O OD2 . ASP A 1 587 ? 64.495  6.271   -28.181 1.00 21.56 ? 613  ASP A OD2 1 
ATOM   4675  N N   . MET A 1 588 ? 68.681  4.877   -24.934 1.00 13.93 ? 614  MET A N   1 
ATOM   4676  C CA  . MET A 1 588 ? 69.974  5.151   -24.310 1.00 13.74 ? 614  MET A CA  1 
ATOM   4677  C C   . MET A 1 588 ? 70.801  3.857   -24.296 1.00 11.60 ? 614  MET A C   1 
ATOM   4678  O O   . MET A 1 588 ? 72.003  3.879   -24.557 1.00 10.80 ? 614  MET A O   1 
ATOM   4679  C CB  . MET A 1 588 ? 69.768  5.699   -22.891 1.00 12.01 ? 614  MET A CB  1 
ATOM   4680  C CG  . MET A 1 588 ? 69.487  7.207   -22.865 1.00 14.75 ? 614  MET A CG  1 
ATOM   4681  S SD  . MET A 1 588 ? 68.905  7.828   -21.267 1.00 15.38 ? 614  MET A SD  1 
ATOM   4682  C CE  . MET A 1 588 ? 70.428  7.779   -20.258 1.00 12.91 ? 614  MET A CE  1 
ATOM   4683  N N   . ARG A 1 589 ? 70.154  2.731   -24.009 1.00 12.33 ? 615  ARG A N   1 
ATOM   4684  C CA  . ARG A 1 589 ? 70.852  1.453   -24.018 1.00 14.24 ? 615  ARG A CA  1 
ATOM   4685  C C   . ARG A 1 589 ? 71.352  1.180   -25.438 1.00 15.06 ? 615  ARG A C   1 
ATOM   4686  O O   . ARG A 1 589 ? 72.503  0.792   -25.645 1.00 15.20 ? 615  ARG A O   1 
ATOM   4687  C CB  . ARG A 1 589 ? 69.924  0.311   -23.585 1.00 12.75 ? 615  ARG A CB  1 
ATOM   4688  C CG  . ARG A 1 589 ? 70.595  -1.055  -23.742 1.00 17.48 ? 615  ARG A CG  1 
ATOM   4689  C CD  . ARG A 1 589 ? 69.821  -2.228  -23.131 1.00 16.01 ? 615  ARG A CD  1 
ATOM   4690  N NE  . ARG A 1 589 ? 68.557  -2.519  -23.806 1.00 16.75 ? 615  ARG A NE  1 
ATOM   4691  C CZ  . ARG A 1 589 ? 67.842  -3.617  -23.576 1.00 18.03 ? 615  ARG A CZ  1 
ATOM   4692  N NH1 . ARG A 1 589 ? 68.269  -4.527  -22.696 1.00 15.74 ? 615  ARG A NH1 1 
ATOM   4693  N NH2 . ARG A 1 589 ? 66.695  -3.821  -24.215 1.00 18.82 ? 615  ARG A NH2 1 
ATOM   4694  N N   . THR A 1 590 ? 70.486  1.396   -26.418 1.00 15.71 ? 616  THR A N   1 
ATOM   4695  C CA  . THR A 1 590 ? 70.858  1.154   -27.805 1.00 17.09 ? 616  THR A CA  1 
ATOM   4696  C C   . THR A 1 590 ? 72.073  1.980   -28.178 1.00 17.45 ? 616  THR A C   1 
ATOM   4697  O O   . THR A 1 590 ? 73.035  1.466   -28.755 1.00 17.41 ? 616  THR A O   1 
ATOM   4698  C CB  . THR A 1 590 ? 69.700  1.495   -28.744 1.00 18.30 ? 616  THR A CB  1 
ATOM   4699  O OG1 . THR A 1 590 ? 68.580  0.667   -28.415 1.00 17.56 ? 616  THR A OG1 1 
ATOM   4700  C CG2 . THR A 1 590 ? 70.092  1.260   -30.197 1.00 17.52 ? 616  THR A CG2 1 
ATOM   4701  N N   . LEU A 1 591 ? 72.036  3.263   -27.830 1.00 17.03 ? 617  LEU A N   1 
ATOM   4702  C CA  . LEU A 1 591 ? 73.142  4.146   -28.140 1.00 16.88 ? 617  LEU A CA  1 
ATOM   4703  C C   . LEU A 1 591 ? 74.452  3.615   -27.568 1.00 17.68 ? 617  LEU A C   1 
ATOM   4704  O O   . LEU A 1 591 ? 75.443  3.503   -28.286 1.00 17.15 ? 617  LEU A O   1 
ATOM   4705  C CB  . LEU A 1 591 ? 72.862  5.543   -27.585 1.00 17.62 ? 617  LEU A CB  1 
ATOM   4706  C CG  . LEU A 1 591 ? 73.963  6.597   -27.721 1.00 18.04 ? 617  LEU A CG  1 
ATOM   4707  C CD1 . LEU A 1 591 ? 74.210  6.905   -29.184 1.00 19.85 ? 617  LEU A CD1 1 
ATOM   4708  C CD2 . LEU A 1 591 ? 73.554  7.862   -26.998 1.00 18.08 ? 617  LEU A CD2 1 
ATOM   4709  N N   . LEU A 1 592 ? 74.448  3.287   -26.277 1.00 17.22 ? 618  LEU A N   1 
ATOM   4710  C CA  . LEU A 1 592 ? 75.643  2.783   -25.606 1.00 18.43 ? 618  LEU A CA  1 
ATOM   4711  C C   . LEU A 1 592 ? 76.113  1.440   -26.164 1.00 19.32 ? 618  LEU A C   1 
ATOM   4712  O O   . LEU A 1 592 ? 77.316  1.206   -26.288 1.00 19.95 ? 618  LEU A O   1 
ATOM   4713  C CB  . LEU A 1 592 ? 75.387  2.667   -24.101 1.00 17.55 ? 618  LEU A CB  1 
ATOM   4714  C CG  . LEU A 1 592 ? 75.146  3.986   -23.356 1.00 17.28 ? 618  LEU A CG  1 
ATOM   4715  C CD1 . LEU A 1 592 ? 74.699  3.704   -21.930 1.00 16.18 ? 618  LEU A CD1 1 
ATOM   4716  C CD2 . LEU A 1 592 ? 76.414  4.824   -23.367 1.00 15.09 ? 618  LEU A CD2 1 
ATOM   4717  N N   . GLN A 1 593 ? 75.175  0.565   -26.506 1.00 21.19 ? 619  GLN A N   1 
ATOM   4718  C CA  . GLN A 1 593 ? 75.532  -0.738  -27.057 1.00 22.33 ? 619  GLN A CA  1 
ATOM   4719  C C   . GLN A 1 593 ? 76.115  -0.619  -28.461 1.00 23.94 ? 619  GLN A C   1 
ATOM   4720  O O   . GLN A 1 593 ? 76.995  -1.389  -28.844 1.00 24.32 ? 619  GLN A O   1 
ATOM   4721  C CB  . GLN A 1 593 ? 74.311  -1.644  -27.090 1.00 21.99 ? 619  GLN A CB  1 
ATOM   4722  C CG  . GLN A 1 593 ? 73.966  -2.226  -25.745 1.00 22.85 ? 619  GLN A CG  1 
ATOM   4723  C CD  . GLN A 1 593 ? 72.704  -3.045  -25.780 1.00 25.17 ? 619  GLN A CD  1 
ATOM   4724  O OE1 . GLN A 1 593 ? 72.426  -3.816  -24.862 1.00 28.73 ? 619  GLN A OE1 1 
ATOM   4725  N NE2 . GLN A 1 593 ? 71.919  -2.874  -26.837 1.00 26.10 ? 619  GLN A NE2 1 
ATOM   4726  N N   . ASN A 1 594 ? 75.629  0.348   -29.230 1.00 23.39 ? 620  ASN A N   1 
ATOM   4727  C CA  . ASN A 1 594 ? 76.117  0.533   -30.587 1.00 25.32 ? 620  ASN A CA  1 
ATOM   4728  C C   . ASN A 1 594 ? 77.559  1.014   -30.611 1.00 26.99 ? 620  ASN A C   1 
ATOM   4729  O O   . ASN A 1 594 ? 78.231  0.944   -31.641 1.00 26.53 ? 620  ASN A O   1 
ATOM   4730  C CB  . ASN A 1 594 ? 75.239  1.541   -31.329 1.00 22.21 ? 620  ASN A CB  1 
ATOM   4731  C CG  . ASN A 1 594 ? 73.884  0.974   -31.714 1.00 19.63 ? 620  ASN A CG  1 
ATOM   4732  O OD1 . ASN A 1 594 ? 73.076  1.669   -32.325 1.00 22.37 ? 620  ASN A OD1 1 
ATOM   4733  N ND2 . ASN A 1 594 ? 73.627  -0.281  -31.363 1.00 14.38 ? 620  ASN A ND2 1 
ATOM   4734  N N   . HIS A 1 595 ? 78.037  1.500   -29.473 1.00 30.16 ? 621  HIS A N   1 
ATOM   4735  C CA  . HIS A 1 595 ? 79.397  2.009   -29.401 1.00 34.52 ? 621  HIS A CA  1 
ATOM   4736  C C   . HIS A 1 595 ? 80.138  1.578   -28.144 1.00 38.31 ? 621  HIS A C   1 
ATOM   4737  O O   . HIS A 1 595 ? 80.336  2.384   -27.236 1.00 39.78 ? 621  HIS A O   1 
ATOM   4738  C CB  . HIS A 1 595 ? 79.361  3.533   -29.479 1.00 33.36 ? 621  HIS A CB  1 
ATOM   4739  C CG  . HIS A 1 595 ? 78.682  4.053   -30.704 1.00 33.78 ? 621  HIS A CG  1 
ATOM   4740  N ND1 . HIS A 1 595 ? 79.292  4.081   -31.939 1.00 33.17 ? 621  HIS A ND1 1 
ATOM   4741  C CD2 . HIS A 1 595 ? 77.427  4.530   -30.894 1.00 34.24 ? 621  HIS A CD2 1 
ATOM   4742  C CE1 . HIS A 1 595 ? 78.445  4.552   -32.839 1.00 32.88 ? 621  HIS A CE1 1 
ATOM   4743  N NE2 . HIS A 1 595 ? 77.305  4.832   -32.230 1.00 33.26 ? 621  HIS A NE2 1 
ATOM   4744  N N   . PRO A 1 596 ? 80.550  0.301   -28.071 1.00 42.56 ? 622  PRO A N   1 
ATOM   4745  C CA  . PRO A 1 596 ? 81.277  -0.222  -26.907 1.00 45.94 ? 622  PRO A CA  1 
ATOM   4746  C C   . PRO A 1 596 ? 82.632  0.462   -26.729 1.00 49.60 ? 622  PRO A C   1 
ATOM   4747  O O   . PRO A 1 596 ? 83.243  0.908   -27.703 1.00 49.54 ? 622  PRO A O   1 
ATOM   4748  C CB  . PRO A 1 596 ? 81.433  -1.706  -27.233 1.00 45.52 ? 622  PRO A CB  1 
ATOM   4749  C CG  . PRO A 1 596 ? 80.234  -1.996  -28.080 1.00 45.30 ? 622  PRO A CG  1 
ATOM   4750  C CD  . PRO A 1 596 ? 80.198  -0.793  -28.993 1.00 42.87 ? 622  PRO A CD  1 
ATOM   4751  N N   . ARG A 1 597 ? 83.104  0.539   -25.489 1.00 53.66 ? 623  ARG A N   1 
ATOM   4752  C CA  . ARG A 1 597 ? 84.391  1.169   -25.211 1.00 57.88 ? 623  ARG A CA  1 
ATOM   4753  C C   . ARG A 1 597 ? 85.537  0.174   -25.340 1.00 60.10 ? 623  ARG A C   1 
ATOM   4754  O O   . ARG A 1 597 ? 86.543  0.462   -25.988 1.00 60.62 ? 623  ARG A O   1 
ATOM   4755  C CB  . ARG A 1 597 ? 84.408  1.763   -23.805 1.00 58.44 ? 623  ARG A CB  1 
ATOM   4756  C CG  . ARG A 1 597 ? 83.491  2.955   -23.610 1.00 59.66 ? 623  ARG A CG  1 
ATOM   4757  C CD  . ARG A 1 597 ? 83.530  3.405   -22.164 1.00 60.45 ? 623  ARG A CD  1 
ATOM   4758  N NE  . ARG A 1 597 ? 83.230  2.288   -21.275 1.00 60.75 ? 623  ARG A NE  1 
ATOM   4759  C CZ  . ARG A 1 597 ? 83.331  2.331   -19.952 1.00 60.52 ? 623  ARG A CZ  1 
ATOM   4760  N NH1 . ARG A 1 597 ? 83.728  3.443   -19.347 1.00 61.02 ? 623  ARG A NH1 1 
ATOM   4761  N NH2 . ARG A 1 597 ? 83.045  1.255   -19.234 1.00 61.18 ? 623  ARG A NH2 1 
ATOM   4762  N N   . ALA A 1 598 ? 85.383  -0.993  -24.715 1.00 62.25 ? 624  ALA A N   1 
ATOM   4763  C CA  . ALA A 1 598 ? 86.412  -2.028  -24.756 1.00 64.71 ? 624  ALA A CA  1 
ATOM   4764  C C   . ALA A 1 598 ? 86.783  -2.366  -26.198 1.00 66.38 ? 624  ALA A C   1 
ATOM   4765  O O   . ALA A 1 598 ? 86.079  -3.124  -26.867 1.00 67.47 ? 624  ALA A O   1 
ATOM   4766  C CB  . ALA A 1 598 ? 85.920  -3.282  -24.028 1.00 64.14 ? 624  ALA A CB  1 
ATOM   4767  N N   . LYS A 1 599 ? 87.892  -1.797  -26.671 1.00 67.60 ? 625  LYS A N   1 
ATOM   4768  C CA  . LYS A 1 599 ? 88.360  -2.027  -28.038 1.00 68.63 ? 625  LYS A CA  1 
ATOM   4769  C C   . LYS A 1 599 ? 87.325  -1.602  -29.081 1.00 69.50 ? 625  LYS A C   1 
ATOM   4770  O O   . LYS A 1 599 ? 86.352  -0.915  -28.702 1.00 69.89 ? 625  LYS A O   1 
ATOM   4771  C CB  . LYS A 1 599 ? 88.728  -3.505  -28.242 1.00 68.49 ? 625  LYS A CB  1 
ATOM   4772  C CG  . LYS A 1 599 ? 90.071  -3.914  -27.634 1.00 68.67 ? 625  LYS A CG  1 
ATOM   4773  C CD  . LYS A 1 599 ? 90.048  -3.939  -26.109 1.00 68.76 ? 625  LYS A CD  1 
ATOM   4774  C CE  . LYS A 1 599 ? 89.397  -5.206  -25.560 1.00 68.96 ? 625  LYS A CE  1 
ATOM   4775  N NZ  . LYS A 1 599 ? 87.954  -5.333  -25.903 1.00 69.20 ? 625  LYS A NZ  1 
ATOM   4776  O OXT . LYS A 1 599 ? 87.507  -1.940  -30.271 1.00 69.87 ? 625  LYS A OXT 1 
ATOM   4777  N N   . SER B 1 1   ? -27.129 22.315  51.083  1.00 39.79 ? 27   SER B N   1 
ATOM   4778  C CA  . SER B 1 1   ? -25.676 22.002  51.228  1.00 38.62 ? 27   SER B CA  1 
ATOM   4779  C C   . SER B 1 1   ? -25.445 20.498  51.221  1.00 37.81 ? 27   SER B C   1 
ATOM   4780  O O   . SER B 1 1   ? -26.384 19.712  51.089  1.00 38.15 ? 27   SER B O   1 
ATOM   4781  C CB  . SER B 1 1   ? -25.141 22.574  52.538  1.00 38.68 ? 27   SER B CB  1 
ATOM   4782  O OG  . SER B 1 1   ? -25.724 21.915  53.654  1.00 39.37 ? 27   SER B OG  1 
ATOM   4783  N N   . HIS B 1 2   ? -24.189 20.103  51.370  1.00 36.76 ? 28   HIS B N   1 
ATOM   4784  C CA  . HIS B 1 2   ? -23.832 18.695  51.386  1.00 36.66 ? 28   HIS B CA  1 
ATOM   4785  C C   . HIS B 1 2   ? -24.361 17.987  52.637  1.00 36.72 ? 28   HIS B C   1 
ATOM   4786  O O   . HIS B 1 2   ? -25.100 17.005  52.540  1.00 34.79 ? 28   HIS B O   1 
ATOM   4787  C CB  . HIS B 1 2   ? -22.314 18.547  51.317  1.00 36.54 ? 28   HIS B CB  1 
ATOM   4788  C CG  . HIS B 1 2   ? -21.840 17.132  51.389  1.00 36.01 ? 28   HIS B CG  1 
ATOM   4789  N ND1 . HIS B 1 2   ? -22.212 16.175  50.468  1.00 34.09 ? 28   HIS B ND1 1 
ATOM   4790  C CD2 . HIS B 1 2   ? -21.012 16.512  52.262  1.00 35.72 ? 28   HIS B CD2 1 
ATOM   4791  C CE1 . HIS B 1 2   ? -21.631 15.026  50.772  1.00 35.21 ? 28   HIS B CE1 1 
ATOM   4792  N NE2 . HIS B 1 2   ? -20.897 15.205  51.854  1.00 36.21 ? 28   HIS B NE2 1 
ATOM   4793  N N   . MET B 1 3   ? -23.976 18.489  53.812  1.00 37.78 ? 29   MET B N   1 
ATOM   4794  C CA  . MET B 1 3   ? -24.398 17.899  55.080  1.00 38.67 ? 29   MET B CA  1 
ATOM   4795  C C   . MET B 1 3   ? -25.919 17.745  55.134  1.00 37.70 ? 29   MET B C   1 
ATOM   4796  O O   . MET B 1 3   ? -26.431 16.751  55.655  1.00 36.64 ? 29   MET B O   1 
ATOM   4797  C CB  . MET B 1 3   ? -23.923 18.769  56.250  1.00 41.13 ? 29   MET B CB  1 
ATOM   4798  C CG  . MET B 1 3   ? -24.105 18.116  57.617  1.00 46.48 ? 29   MET B CG  1 
ATOM   4799  S SD  . MET B 1 3   ? -23.705 19.180  59.020  1.00 52.57 ? 29   MET B SD  1 
ATOM   4800  C CE  . MET B 1 3   ? -25.363 19.831  59.436  1.00 50.25 ? 29   MET B CE  1 
ATOM   4801  N N   . ALA B 1 4   ? -26.631 18.730  54.586  1.00 36.29 ? 30   ALA B N   1 
ATOM   4802  C CA  . ALA B 1 4   ? -28.090 18.715  54.551  1.00 34.84 ? 30   ALA B CA  1 
ATOM   4803  C C   . ALA B 1 4   ? -28.585 17.533  53.722  1.00 33.61 ? 30   ALA B C   1 
ATOM   4804  O O   . ALA B 1 4   ? -29.509 16.827  54.123  1.00 31.55 ? 30   ALA B O   1 
ATOM   4805  C CB  . ALA B 1 4   ? -28.609 20.025  53.962  1.00 36.05 ? 30   ALA B CB  1 
ATOM   4806  N N   . HIS B 1 5   ? -27.969 17.333  52.558  1.00 32.73 ? 31   HIS B N   1 
ATOM   4807  C CA  . HIS B 1 5   ? -28.330 16.232  51.670  1.00 32.10 ? 31   HIS B CA  1 
ATOM   4808  C C   . HIS B 1 5   ? -28.129 14.884  52.371  1.00 30.40 ? 31   HIS B C   1 
ATOM   4809  O O   . HIS B 1 5   ? -29.010 14.021  52.339  1.00 30.25 ? 31   HIS B O   1 
ATOM   4810  C CB  . HIS B 1 5   ? -27.474 16.285  50.398  1.00 32.44 ? 31   HIS B CB  1 
ATOM   4811  C CG  . HIS B 1 5   ? -27.576 15.056  49.544  1.00 34.74 ? 31   HIS B CG  1 
ATOM   4812  N ND1 . HIS B 1 5   ? -28.771 14.605  49.027  1.00 35.15 ? 31   HIS B ND1 1 
ATOM   4813  C CD2 . HIS B 1 5   ? -26.633 14.179  49.130  1.00 34.42 ? 31   HIS B CD2 1 
ATOM   4814  C CE1 . HIS B 1 5   ? -28.562 13.501  48.332  1.00 36.14 ? 31   HIS B CE1 1 
ATOM   4815  N NE2 . HIS B 1 5   ? -27.270 13.221  48.380  1.00 34.28 ? 31   HIS B NE2 1 
ATOM   4816  N N   . GLN B 1 6   ? -26.975 14.712  53.007  1.00 29.67 ? 32   GLN B N   1 
ATOM   4817  C CA  . GLN B 1 6   ? -26.660 13.466  53.703  1.00 28.87 ? 32   GLN B CA  1 
ATOM   4818  C C   . GLN B 1 6   ? -27.641 13.149  54.828  1.00 29.65 ? 32   GLN B C   1 
ATOM   4819  O O   . GLN B 1 6   ? -28.071 12.006  54.981  1.00 28.85 ? 32   GLN B O   1 
ATOM   4820  C CB  . GLN B 1 6   ? -25.236 13.517  54.261  1.00 25.87 ? 32   GLN B CB  1 
ATOM   4821  C CG  . GLN B 1 6   ? -24.145 13.732  53.201  1.00 23.18 ? 32   GLN B CG  1 
ATOM   4822  C CD  . GLN B 1 6   ? -24.089 12.631  52.142  1.00 22.93 ? 32   GLN B CD  1 
ATOM   4823  O OE1 . GLN B 1 6   ? -24.034 11.440  52.463  1.00 20.64 ? 32   GLN B OE1 1 
ATOM   4824  N NE2 . GLN B 1 6   ? -24.083 13.031  50.875  1.00 15.08 ? 32   GLN B NE2 1 
ATOM   4825  N N   . ASP B 1 7   ? -28.010 14.161  55.611  1.00 29.90 ? 33   ASP B N   1 
ATOM   4826  C CA  . ASP B 1 7   ? -28.942 13.951  56.711  1.00 31.44 ? 33   ASP B CA  1 
ATOM   4827  C C   . ASP B 1 7   ? -30.293 13.396  56.255  1.00 30.14 ? 33   ASP B C   1 
ATOM   4828  O O   . ASP B 1 7   ? -30.959 12.681  57.006  1.00 30.22 ? 33   ASP B O   1 
ATOM   4829  C CB  . ASP B 1 7   ? -29.162 15.257  57.476  1.00 34.71 ? 33   ASP B CB  1 
ATOM   4830  C CG  . ASP B 1 7   ? -27.888 15.783  58.103  1.00 38.67 ? 33   ASP B CG  1 
ATOM   4831  O OD1 . ASP B 1 7   ? -27.139 14.983  58.707  1.00 38.96 ? 33   ASP B OD1 1 
ATOM   4832  O OD2 . ASP B 1 7   ? -27.640 17.003  58.003  1.00 41.30 ? 33   ASP B OD2 1 
ATOM   4833  N N   . ALA B 1 8   ? -30.698 13.720  55.032  1.00 27.82 ? 34   ALA B N   1 
ATOM   4834  C CA  . ALA B 1 8   ? -31.972 13.236  54.512  1.00 27.12 ? 34   ALA B CA  1 
ATOM   4835  C C   . ALA B 1 8   ? -31.877 11.800  53.992  1.00 24.69 ? 34   ALA B C   1 
ATOM   4836  O O   . ALA B 1 8   ? -32.891 11.166  53.719  1.00 26.39 ? 34   ALA B O   1 
ATOM   4837  C CB  . ALA B 1 8   ? -32.467 14.162  53.405  1.00 27.39 ? 34   ALA B CB  1 
ATOM   4838  N N   . LEU B 1 9   ? -30.661 11.285  53.866  1.00 21.88 ? 35   LEU B N   1 
ATOM   4839  C CA  . LEU B 1 9   ? -30.473 9.928   53.365  1.00 19.48 ? 35   LEU B CA  1 
ATOM   4840  C C   . LEU B 1 9   ? -30.722 8.862   54.433  1.00 18.17 ? 35   LEU B C   1 
ATOM   4841  O O   . LEU B 1 9   ? -30.451 9.061   55.617  1.00 18.66 ? 35   LEU B O   1 
ATOM   4842  C CB  . LEU B 1 9   ? -29.058 9.766   52.798  1.00 19.65 ? 35   LEU B CB  1 
ATOM   4843  C CG  . LEU B 1 9   ? -28.684 10.593  51.563  1.00 18.94 ? 35   LEU B CG  1 
ATOM   4844  C CD1 . LEU B 1 9   ? -27.179 10.500  51.335  1.00 20.31 ? 35   LEU B CD1 1 
ATOM   4845  C CD2 . LEU B 1 9   ? -29.450 10.096  50.339  1.00 18.99 ? 35   LEU B CD2 1 
ATOM   4846  N N   . PRO B 1 10  ? -31.267 7.708   54.031  1.00 17.12 ? 36   PRO B N   1 
ATOM   4847  C CA  . PRO B 1 10  ? -31.533 6.638   54.991  1.00 16.66 ? 36   PRO B CA  1 
ATOM   4848  C C   . PRO B 1 10  ? -30.231 6.000   55.455  1.00 15.55 ? 36   PRO B C   1 
ATOM   4849  O O   . PRO B 1 10  ? -29.237 6.018   54.736  1.00 14.30 ? 36   PRO B O   1 
ATOM   4850  C CB  . PRO B 1 10  ? -32.396 5.668   54.192  1.00 16.08 ? 36   PRO B CB  1 
ATOM   4851  C CG  . PRO B 1 10  ? -31.819 5.814   52.807  1.00 16.90 ? 36   PRO B CG  1 
ATOM   4852  C CD  . PRO B 1 10  ? -31.669 7.306   52.670  1.00 15.90 ? 36   PRO B CD  1 
ATOM   4853  N N   . ARG B 1 11  ? -30.244 5.441   56.662  1.00 15.77 ? 37   ARG B N   1 
ATOM   4854  C CA  . ARG B 1 11  ? -29.069 4.788   57.221  1.00 16.54 ? 37   ARG B CA  1 
ATOM   4855  C C   . ARG B 1 11  ? -29.002 3.339   56.750  1.00 14.53 ? 37   ARG B C   1 
ATOM   4856  O O   . ARG B 1 11  ? -30.031 2.713   56.517  1.00 13.91 ? 37   ARG B O   1 
ATOM   4857  C CB  . ARG B 1 11  ? -29.131 4.844   58.754  1.00 18.58 ? 37   ARG B CB  1 
ATOM   4858  C CG  . ARG B 1 11  ? -28.439 6.054   59.377  1.00 24.19 ? 37   ARG B CG  1 
ATOM   4859  C CD  . ARG B 1 11  ? -28.790 7.357   58.669  1.00 24.94 ? 37   ARG B CD  1 
ATOM   4860  N NE  . ARG B 1 11  ? -28.031 8.481   59.211  1.00 28.37 ? 37   ARG B NE  1 
ATOM   4861  C CZ  . ARG B 1 11  ? -27.879 9.653   58.597  1.00 30.09 ? 37   ARG B CZ  1 
ATOM   4862  N NH1 . ARG B 1 11  ? -28.428 9.868   57.405  1.00 29.75 ? 37   ARG B NH1 1 
ATOM   4863  N NH2 . ARG B 1 11  ? -27.182 10.619  59.183  1.00 31.51 ? 37   ARG B NH2 1 
ATOM   4864  N N   . LEU B 1 12  ? -27.789 2.816   56.605  1.00 16.03 ? 38   LEU B N   1 
ATOM   4865  C CA  . LEU B 1 12  ? -27.596 1.437   56.171  1.00 13.71 ? 38   LEU B CA  1 
ATOM   4866  C C   . LEU B 1 12  ? -28.334 0.504   57.116  1.00 14.97 ? 38   LEU B C   1 
ATOM   4867  O O   . LEU B 1 12  ? -28.110 0.517   58.325  1.00 15.10 ? 38   LEU B O   1 
ATOM   4868  C CB  . LEU B 1 12  ? -26.109 1.083   56.143  1.00 14.47 ? 38   LEU B CB  1 
ATOM   4869  C CG  . LEU B 1 12  ? -25.731 -0.220  55.424  1.00 14.58 ? 38   LEU B CG  1 
ATOM   4870  C CD1 . LEU B 1 12  ? -25.932 -0.030  53.930  1.00 13.78 ? 38   LEU B CD1 1 
ATOM   4871  C CD2 . LEU B 1 12  ? -24.285 -0.589  55.708  1.00 12.54 ? 38   LEU B CD2 1 
ATOM   4872  N N   . PRO B 1 13  ? -29.238 -0.325  56.580  1.00 14.66 ? 39   PRO B N   1 
ATOM   4873  C CA  . PRO B 1 13  ? -29.990 -1.251  57.422  1.00 13.91 ? 39   PRO B CA  1 
ATOM   4874  C C   . PRO B 1 13  ? -29.252 -2.550  57.699  1.00 13.06 ? 39   PRO B C   1 
ATOM   4875  O O   . PRO B 1 13  ? -28.217 -2.839  57.095  1.00 13.87 ? 39   PRO B O   1 
ATOM   4876  C CB  . PRO B 1 13  ? -31.252 -1.495  56.604  1.00 13.77 ? 39   PRO B CB  1 
ATOM   4877  C CG  . PRO B 1 13  ? -30.691 -1.520  55.204  1.00 14.96 ? 39   PRO B CG  1 
ATOM   4878  C CD  . PRO B 1 13  ? -29.753 -0.334  55.197  1.00 14.07 ? 39   PRO B CD  1 
ATOM   4879  N N   . VAL B 1 14  ? -29.803 -3.319  58.628  1.00 12.65 ? 40   VAL B N   1 
ATOM   4880  C CA  . VAL B 1 14  ? -29.272 -4.622  58.984  1.00 12.69 ? 40   VAL B CA  1 
ATOM   4881  C C   . VAL B 1 14  ? -30.410 -5.576  58.646  1.00 12.58 ? 40   VAL B C   1 
ATOM   4882  O O   . VAL B 1 14  ? -31.439 -5.584  59.321  1.00 13.23 ? 40   VAL B O   1 
ATOM   4883  C CB  . VAL B 1 14  ? -28.965 -4.730  60.486  1.00 13.44 ? 40   VAL B CB  1 
ATOM   4884  C CG1 . VAL B 1 14  ? -28.472 -6.137  60.813  1.00 12.07 ? 40   VAL B CG1 1 
ATOM   4885  C CG2 . VAL B 1 14  ? -27.942 -3.671  60.895  1.00 13.72 ? 40   VAL B CG2 1 
ATOM   4886  N N   . PRO B 1 15  ? -30.254 -6.364  57.569  1.00 12.84 ? 41   PRO B N   1 
ATOM   4887  C CA  . PRO B 1 15  ? -31.279 -7.321  57.135  1.00 12.76 ? 41   PRO B CA  1 
ATOM   4888  C C   . PRO B 1 15  ? -31.639 -8.294  58.255  1.00 14.41 ? 41   PRO B C   1 
ATOM   4889  O O   . PRO B 1 15  ? -30.846 -8.515  59.168  1.00 13.86 ? 41   PRO B O   1 
ATOM   4890  C CB  . PRO B 1 15  ? -30.605 -8.045  55.964  1.00 11.42 ? 41   PRO B CB  1 
ATOM   4891  C CG  . PRO B 1 15  ? -29.665 -7.014  55.409  1.00 12.86 ? 41   PRO B CG  1 
ATOM   4892  C CD  . PRO B 1 15  ? -29.099 -6.370  56.655  1.00 13.38 ? 41   PRO B CD  1 
ATOM   4893  N N   . PRO B 1 16  ? -32.855 -8.864  58.215  1.00 14.50 ? 42   PRO B N   1 
ATOM   4894  C CA  . PRO B 1 16  ? -33.263 -9.821  59.246  1.00 14.92 ? 42   PRO B CA  1 
ATOM   4895  C C   . PRO B 1 16  ? -32.303 -10.998 59.113  1.00 16.62 ? 42   PRO B C   1 
ATOM   4896  O O   . PRO B 1 16  ? -31.855 -11.306 58.004  1.00 17.15 ? 42   PRO B O   1 
ATOM   4897  C CB  . PRO B 1 16  ? -34.681 -10.199 58.826  1.00 15.55 ? 42   PRO B CB  1 
ATOM   4898  C CG  . PRO B 1 16  ? -35.184 -8.943  58.164  1.00 15.63 ? 42   PRO B CG  1 
ATOM   4899  C CD  . PRO B 1 16  ? -33.991 -8.499  57.348  1.00 14.62 ? 42   PRO B CD  1 
ATOM   4900  N N   . LEU B 1 17  ? -31.973 -11.632 60.232  1.00 15.19 ? 43   LEU B N   1 
ATOM   4901  C CA  . LEU B 1 17  ? -31.065 -12.767 60.227  1.00 15.33 ? 43   LEU B CA  1 
ATOM   4902  C C   . LEU B 1 17  ? -31.569 -13.878 59.306  1.00 14.77 ? 43   LEU B C   1 
ATOM   4903  O O   . LEU B 1 17  ? -30.840 -14.343 58.437  1.00 13.84 ? 43   LEU B O   1 
ATOM   4904  C CB  . LEU B 1 17  ? -30.908 -13.310 61.650  1.00 16.09 ? 43   LEU B CB  1 
ATOM   4905  C CG  . LEU B 1 17  ? -29.923 -14.458 61.876  1.00 16.48 ? 43   LEU B CG  1 
ATOM   4906  C CD1 . LEU B 1 17  ? -28.526 -14.006 61.503  1.00 16.81 ? 43   LEU B CD1 1 
ATOM   4907  C CD2 . LEU B 1 17  ? -29.960 -14.893 63.331  1.00 18.65 ? 43   LEU B CD2 1 
ATOM   4908  N N   . GLN B 1 18  ? -32.814 -14.295 59.485  1.00 15.60 ? 44   GLN B N   1 
ATOM   4909  C CA  . GLN B 1 18  ? -33.359 -15.381 58.672  1.00 16.95 ? 44   GLN B CA  1 
ATOM   4910  C C   . GLN B 1 18  ? -33.389 -15.085 57.181  1.00 16.22 ? 44   GLN B C   1 
ATOM   4911  O O   . GLN B 1 18  ? -33.150 -15.967 56.352  1.00 14.96 ? 44   GLN B O   1 
ATOM   4912  C CB  . GLN B 1 18  ? -34.766 -15.743 59.134  1.00 21.02 ? 44   GLN B CB  1 
ATOM   4913  C CG  . GLN B 1 18  ? -35.369 -16.925 58.384  1.00 27.95 ? 44   GLN B CG  1 
ATOM   4914  C CD  . GLN B 1 18  ? -36.658 -17.402 59.012  1.00 32.91 ? 44   GLN B CD  1 
ATOM   4915  O OE1 . GLN B 1 18  ? -37.639 -16.659 59.083  1.00 35.60 ? 44   GLN B OE1 1 
ATOM   4916  N NE2 . GLN B 1 18  ? -36.664 -18.644 59.483  1.00 35.07 ? 44   GLN B NE2 1 
ATOM   4917  N N   . GLN B 1 19  ? -33.698 -13.840 56.852  1.00 15.43 ? 45   GLN B N   1 
ATOM   4918  C CA  . GLN B 1 19  ? -33.763 -13.411 55.468  1.00 14.89 ? 45   GLN B CA  1 
ATOM   4919  C C   . GLN B 1 19  ? -32.420 -13.620 54.778  1.00 14.55 ? 45   GLN B C   1 
ATOM   4920  O O   . GLN B 1 19  ? -32.359 -14.260 53.730  1.00 15.83 ? 45   GLN B O   1 
ATOM   4921  C CB  . GLN B 1 19  ? -34.164 -11.933 55.403  1.00 15.32 ? 45   GLN B CB  1 
ATOM   4922  C CG  . GLN B 1 19  ? -34.141 -11.336 54.010  1.00 16.39 ? 45   GLN B CG  1 
ATOM   4923  C CD  . GLN B 1 19  ? -34.391 -9.841  54.016  1.00 17.46 ? 45   GLN B CD  1 
ATOM   4924  O OE1 . GLN B 1 19  ? -35.461 -9.385  54.419  1.00 18.31 ? 45   GLN B OE1 1 
ATOM   4925  N NE2 . GLN B 1 19  ? -33.401 -9.072  53.577  1.00 14.56 ? 45   GLN B NE2 1 
ATOM   4926  N N   . SER B 1 20  ? -31.348 -13.093 55.366  1.00 11.40 ? 46   SER B N   1 
ATOM   4927  C CA  . SER B 1 20  ? -30.019 -13.228 54.775  1.00 11.64 ? 46   SER B CA  1 
ATOM   4928  C C   . SER B 1 20  ? -29.526 -14.662 54.743  1.00 11.91 ? 46   SER B C   1 
ATOM   4929  O O   . SER B 1 20  ? -28.856 -15.061 53.790  1.00 11.58 ? 46   SER B O   1 
ATOM   4930  C CB  . SER B 1 20  ? -29.006 -12.354 55.513  1.00 10.44 ? 46   SER B CB  1 
ATOM   4931  O OG  . SER B 1 20  ? -29.307 -10.983 55.310  1.00 12.58 ? 46   SER B OG  1 
ATOM   4932  N N   . LEU B 1 21  ? -29.839 -15.430 55.781  1.00 10.65 ? 47   LEU B N   1 
ATOM   4933  C CA  . LEU B 1 21  ? -29.419 -16.824 55.829  1.00 12.10 ? 47   LEU B CA  1 
ATOM   4934  C C   . LEU B 1 21  ? -30.150 -17.603 54.724  1.00 14.33 ? 47   LEU B C   1 
ATOM   4935  O O   . LEU B 1 21  ? -29.564 -18.483 54.089  1.00 15.26 ? 47   LEU B O   1 
ATOM   4936  C CB  . LEU B 1 21  ? -29.715 -17.418 57.209  1.00 10.11 ? 47   LEU B CB  1 
ATOM   4937  C CG  . LEU B 1 21  ? -28.841 -16.849 58.333  1.00 11.36 ? 47   LEU B CG  1 
ATOM   4938  C CD1 . LEU B 1 21  ? -29.211 -17.472 59.671  1.00 8.22  ? 47   LEU B CD1 1 
ATOM   4939  C CD2 . LEU B 1 21  ? -27.380 -17.118 58.012  1.00 9.19  ? 47   LEU B CD2 1 
ATOM   4940  N N   . ASP B 1 22  ? -31.414 -17.268 54.482  1.00 15.71 ? 48   ASP B N   1 
ATOM   4941  C CA  . ASP B 1 22  ? -32.191 -17.926 53.434  1.00 17.37 ? 48   ASP B CA  1 
ATOM   4942  C C   . ASP B 1 22  ? -31.553 -17.661 52.056  1.00 17.43 ? 48   ASP B C   1 
ATOM   4943  O O   . ASP B 1 22  ? -31.377 -18.587 51.263  1.00 17.66 ? 48   ASP B O   1 
ATOM   4944  C CB  . ASP B 1 22  ? -33.629 -17.410 53.445  1.00 22.47 ? 48   ASP B CB  1 
ATOM   4945  C CG  . ASP B 1 22  ? -34.486 -18.056 52.374  1.00 29.31 ? 48   ASP B CG  1 
ATOM   4946  O OD1 . ASP B 1 22  ? -34.735 -19.280 52.473  1.00 33.75 ? 48   ASP B OD1 1 
ATOM   4947  O OD2 . ASP B 1 22  ? -34.907 -17.351 51.429  1.00 33.49 ? 48   ASP B OD2 1 
ATOM   4948  N N   . TYR B 1 23  ? -31.201 -16.403 51.770  1.00 15.06 ? 49   TYR B N   1 
ATOM   4949  C CA  . TYR B 1 23  ? -30.588 -16.076 50.484  1.00 14.80 ? 49   TYR B CA  1 
ATOM   4950  C C   . TYR B 1 23  ? -29.246 -16.757 50.348  1.00 14.17 ? 49   TYR B C   1 
ATOM   4951  O O   . TYR B 1 23  ? -28.866 -17.200 49.260  1.00 14.77 ? 49   TYR B O   1 
ATOM   4952  C CB  . TYR B 1 23  ? -30.413 -14.566 50.323  1.00 14.65 ? 49   TYR B CB  1 
ATOM   4953  C CG  . TYR B 1 23  ? -31.706 -13.827 50.092  1.00 19.11 ? 49   TYR B CG  1 
ATOM   4954  C CD1 . TYR B 1 23  ? -32.615 -14.256 49.124  1.00 17.46 ? 49   TYR B CD1 1 
ATOM   4955  C CD2 . TYR B 1 23  ? -32.012 -12.681 50.821  1.00 17.60 ? 49   TYR B CD2 1 
ATOM   4956  C CE1 . TYR B 1 23  ? -33.797 -13.559 48.887  1.00 19.17 ? 49   TYR B CE1 1 
ATOM   4957  C CE2 . TYR B 1 23  ? -33.193 -11.978 50.593  1.00 19.65 ? 49   TYR B CE2 1 
ATOM   4958  C CZ  . TYR B 1 23  ? -34.079 -12.421 49.622  1.00 20.15 ? 49   TYR B CZ  1 
ATOM   4959  O OH  . TYR B 1 23  ? -35.223 -11.702 49.353  1.00 20.73 ? 49   TYR B OH  1 
ATOM   4960  N N   . TYR B 1 24  ? -28.527 -16.837 51.466  1.00 11.21 ? 50   TYR B N   1 
ATOM   4961  C CA  . TYR B 1 24  ? -27.229 -17.481 51.490  1.00 11.23 ? 50   TYR B CA  1 
ATOM   4962  C C   . TYR B 1 24  ? -27.347 -18.923 51.000  1.00 11.60 ? 50   TYR B C   1 
ATOM   4963  O O   . TYR B 1 24  ? -26.636 -19.320 50.082  1.00 13.41 ? 50   TYR B O   1 
ATOM   4964  C CB  . TYR B 1 24  ? -26.667 -17.443 52.910  1.00 10.01 ? 50   TYR B CB  1 
ATOM   4965  C CG  . TYR B 1 24  ? -25.363 -18.180 53.096  1.00 9.59  ? 50   TYR B CG  1 
ATOM   4966  C CD1 . TYR B 1 24  ? -24.276 -17.945 52.256  1.00 9.10  ? 50   TYR B CD1 1 
ATOM   4967  C CD2 . TYR B 1 24  ? -25.205 -19.088 54.139  1.00 8.87  ? 50   TYR B CD2 1 
ATOM   4968  C CE1 . TYR B 1 24  ? -23.064 -18.604 52.450  1.00 10.49 ? 50   TYR B CE1 1 
ATOM   4969  C CE2 . TYR B 1 24  ? -24.003 -19.748 54.343  1.00 9.88  ? 50   TYR B CE2 1 
ATOM   4970  C CZ  . TYR B 1 24  ? -22.939 -19.508 53.495  1.00 11.61 ? 50   TYR B CZ  1 
ATOM   4971  O OH  . TYR B 1 24  ? -21.769 -20.212 53.666  1.00 13.53 ? 50   TYR B OH  1 
ATOM   4972  N N   . LEU B 1 25  ? -28.244 -19.700 51.602  1.00 12.31 ? 51   LEU B N   1 
ATOM   4973  C CA  . LEU B 1 25  ? -28.440 -21.098 51.204  1.00 12.97 ? 51   LEU B CA  1 
ATOM   4974  C C   . LEU B 1 25  ? -28.800 -21.252 49.726  1.00 13.33 ? 51   LEU B C   1 
ATOM   4975  O O   . LEU B 1 25  ? -28.341 -22.179 49.063  1.00 14.83 ? 51   LEU B O   1 
ATOM   4976  C CB  . LEU B 1 25  ? -29.520 -21.759 52.076  1.00 12.50 ? 51   LEU B CB  1 
ATOM   4977  C CG  . LEU B 1 25  ? -29.129 -21.965 53.547  1.00 13.24 ? 51   LEU B CG  1 
ATOM   4978  C CD1 . LEU B 1 25  ? -30.342 -22.345 54.383  1.00 13.25 ? 51   LEU B CD1 1 
ATOM   4979  C CD2 . LEU B 1 25  ? -28.062 -23.042 53.634  1.00 12.92 ? 51   LEU B CD2 1 
ATOM   4980  N N   . LYS B 1 26  ? -29.613 -20.338 49.203  1.00 13.60 ? 52   LYS B N   1 
ATOM   4981  C CA  . LYS B 1 26  ? -29.991 -20.409 47.798  1.00 13.60 ? 52   LYS B CA  1 
ATOM   4982  C C   . LYS B 1 26  ? -28.805 -20.123 46.889  1.00 12.51 ? 52   LYS B C   1 
ATOM   4983  O O   . LYS B 1 26  ? -28.646 -20.762 45.852  1.00 11.81 ? 52   LYS B O   1 
ATOM   4984  C CB  . LYS B 1 26  ? -31.121 -19.430 47.495  1.00 14.37 ? 52   LYS B CB  1 
ATOM   4985  C CG  . LYS B 1 26  ? -32.457 -19.862 48.066  1.00 21.05 ? 52   LYS B CG  1 
ATOM   4986  C CD  . LYS B 1 26  ? -33.547 -18.871 47.705  1.00 28.12 ? 52   LYS B CD  1 
ATOM   4987  C CE  . LYS B 1 26  ? -34.896 -19.326 48.230  1.00 31.09 ? 52   LYS B CE  1 
ATOM   4988  N NZ  . LYS B 1 26  ? -34.894 -19.446 49.711  1.00 35.07 ? 52   LYS B NZ  1 
ATOM   4989  N N   . ALA B 1 27  ? -27.970 -19.162 47.289  1.00 11.48 ? 53   ALA B N   1 
ATOM   4990  C CA  . ALA B 1 27  ? -26.794 -18.780 46.511  1.00 11.33 ? 53   ALA B CA  1 
ATOM   4991  C C   . ALA B 1 27  ? -25.704 -19.846 46.550  1.00 12.27 ? 53   ALA B C   1 
ATOM   4992  O O   . ALA B 1 27  ? -24.846 -19.904 45.667  1.00 11.94 ? 53   ALA B O   1 
ATOM   4993  C CB  . ALA B 1 27  ? -26.240 -17.433 47.014  1.00 11.21 ? 53   ALA B CB  1 
ATOM   4994  N N   . LEU B 1 28  ? -25.736 -20.702 47.573  1.00 12.47 ? 54   LEU B N   1 
ATOM   4995  C CA  . LEU B 1 28  ? -24.740 -21.765 47.694  1.00 12.40 ? 54   LEU B CA  1 
ATOM   4996  C C   . LEU B 1 28  ? -25.046 -22.978 46.822  1.00 11.98 ? 54   LEU B C   1 
ATOM   4997  O O   . LEU B 1 28  ? -24.140 -23.663 46.359  1.00 13.77 ? 54   LEU B O   1 
ATOM   4998  C CB  . LEU B 1 28  ? -24.649 -22.255 49.144  1.00 9.80  ? 54   LEU B CB  1 
ATOM   4999  C CG  . LEU B 1 28  ? -23.996 -21.362 50.195  1.00 11.73 ? 54   LEU B CG  1 
ATOM   5000  C CD1 . LEU B 1 28  ? -24.152 -21.993 51.573  1.00 12.95 ? 54   LEU B CD1 1 
ATOM   5001  C CD2 . LEU B 1 28  ? -22.537 -21.180 49.850  1.00 12.02 ? 54   LEU B CD2 1 
ATOM   5002  N N   . GLN B 1 29  ? -26.324 -23.250 46.616  1.00 13.45 ? 55   GLN B N   1 
ATOM   5003  C CA  . GLN B 1 29  ? -26.739 -24.420 45.851  1.00 14.92 ? 55   GLN B CA  1 
ATOM   5004  C C   . GLN B 1 29  ? -25.956 -24.725 44.584  1.00 14.10 ? 55   GLN B C   1 
ATOM   5005  O O   . GLN B 1 29  ? -25.532 -25.862 44.375  1.00 14.31 ? 55   GLN B O   1 
ATOM   5006  C CB  . GLN B 1 29  ? -28.230 -24.339 45.526  1.00 18.67 ? 55   GLN B CB  1 
ATOM   5007  C CG  . GLN B 1 29  ? -29.111 -24.584 46.728  1.00 24.36 ? 55   GLN B CG  1 
ATOM   5008  C CD  . GLN B 1 29  ? -30.551 -24.806 46.337  1.00 28.30 ? 55   GLN B CD  1 
ATOM   5009  O OE1 . GLN B 1 29  ? -30.838 -25.572 45.418  1.00 28.95 ? 55   GLN B OE1 1 
ATOM   5010  N NE2 . GLN B 1 29  ? -31.465 -24.148 47.039  1.00 29.84 ? 55   GLN B NE2 1 
ATOM   5011  N N   . PRO B 1 30  ? -25.759 -23.724 43.714  1.00 12.77 ? 56   PRO B N   1 
ATOM   5012  C CA  . PRO B 1 30  ? -25.013 -23.968 42.476  1.00 12.48 ? 56   PRO B CA  1 
ATOM   5013  C C   . PRO B 1 30  ? -23.506 -24.080 42.594  1.00 12.44 ? 56   PRO B C   1 
ATOM   5014  O O   . PRO B 1 30  ? -22.842 -24.468 41.640  1.00 11.74 ? 56   PRO B O   1 
ATOM   5015  C CB  . PRO B 1 30  ? -25.423 -22.791 41.595  1.00 12.95 ? 56   PRO B CB  1 
ATOM   5016  C CG  . PRO B 1 30  ? -25.635 -21.692 42.588  1.00 12.97 ? 56   PRO B CG  1 
ATOM   5017  C CD  . PRO B 1 30  ? -26.398 -22.394 43.688  1.00 12.56 ? 56   PRO B CD  1 
ATOM   5018  N N   . ILE B 1 31  ? -22.946 -23.748 43.757  1.00 11.16 ? 57   ILE B N   1 
ATOM   5019  C CA  . ILE B 1 31  ? -21.497 -23.804 43.882  1.00 11.50 ? 57   ILE B CA  1 
ATOM   5020  C C   . ILE B 1 31  ? -20.930 -24.744 44.930  1.00 11.26 ? 57   ILE B C   1 
ATOM   5021  O O   . ILE B 1 31  ? -19.721 -24.755 45.153  1.00 11.09 ? 57   ILE B O   1 
ATOM   5022  C CB  . ILE B 1 31  ? -20.897 -22.406 44.138  1.00 11.52 ? 57   ILE B CB  1 
ATOM   5023  C CG1 . ILE B 1 31  ? -21.501 -21.804 45.407  1.00 9.84  ? 57   ILE B CG1 1 
ATOM   5024  C CG2 . ILE B 1 31  ? -21.121 -21.516 42.920  1.00 9.86  ? 57   ILE B CG2 1 
ATOM   5025  C CD1 . ILE B 1 31  ? -20.932 -20.454 45.750  1.00 9.90  ? 57   ILE B CD1 1 
ATOM   5026  N N   . VAL B 1 32  ? -21.781 -25.523 45.579  1.00 12.98 ? 58   VAL B N   1 
ATOM   5027  C CA  . VAL B 1 32  ? -21.290 -26.470 46.575  1.00 14.57 ? 58   VAL B CA  1 
ATOM   5028  C C   . VAL B 1 32  ? -21.944 -27.823 46.331  1.00 15.35 ? 58   VAL B C   1 
ATOM   5029  O O   . VAL B 1 32  ? -23.027 -27.896 45.746  1.00 15.11 ? 58   VAL B O   1 
ATOM   5030  C CB  . VAL B 1 32  ? -21.609 -26.009 48.019  1.00 15.38 ? 58   VAL B CB  1 
ATOM   5031  C CG1 . VAL B 1 32  ? -20.964 -24.656 48.285  1.00 13.73 ? 58   VAL B CG1 1 
ATOM   5032  C CG2 . VAL B 1 32  ? -23.106 -25.952 48.229  1.00 16.00 ? 58   VAL B CG2 1 
ATOM   5033  N N   . SER B 1 33  ? -21.283 -28.891 46.775  1.00 16.79 ? 59   SER B N   1 
ATOM   5034  C CA  . SER B 1 33  ? -21.811 -30.244 46.605  1.00 19.60 ? 59   SER B CA  1 
ATOM   5035  C C   . SER B 1 33  ? -23.073 -30.400 47.429  1.00 21.13 ? 59   SER B C   1 
ATOM   5036  O O   . SER B 1 33  ? -23.348 -29.592 48.315  1.00 20.67 ? 59   SER B O   1 
ATOM   5037  C CB  . SER B 1 33  ? -20.790 -31.292 47.064  1.00 19.79 ? 59   SER B CB  1 
ATOM   5038  O OG  . SER B 1 33  ? -20.619 -31.261 48.475  1.00 19.34 ? 59   SER B OG  1 
ATOM   5039  N N   . GLU B 1 34  ? -23.842 -31.444 47.134  1.00 23.10 ? 60   GLU B N   1 
ATOM   5040  C CA  . GLU B 1 34  ? -25.079 -31.700 47.857  1.00 26.91 ? 60   GLU B CA  1 
ATOM   5041  C C   . GLU B 1 34  ? -24.796 -31.976 49.330  1.00 25.43 ? 60   GLU B C   1 
ATOM   5042  O O   . GLU B 1 34  ? -25.571 -31.584 50.199  1.00 25.37 ? 60   GLU B O   1 
ATOM   5043  C CB  . GLU B 1 34  ? -25.821 -32.894 47.244  1.00 30.64 ? 60   GLU B CB  1 
ATOM   5044  C CG  . GLU B 1 34  ? -26.275 -32.673 45.812  1.00 36.75 ? 60   GLU B CG  1 
ATOM   5045  C CD  . GLU B 1 34  ? -26.991 -33.879 45.230  1.00 40.97 ? 60   GLU B CD  1 
ATOM   5046  O OE1 . GLU B 1 34  ? -28.047 -34.273 45.773  1.00 42.72 ? 60   GLU B OE1 1 
ATOM   5047  O OE2 . GLU B 1 34  ? -26.496 -34.437 44.227  1.00 43.76 ? 60   GLU B OE2 1 
ATOM   5048  N N   . GLU B 1 35  ? -23.691 -32.655 49.602  1.00 24.94 ? 61   GLU B N   1 
ATOM   5049  C CA  . GLU B 1 35  ? -23.313 -32.982 50.973  1.00 25.38 ? 61   GLU B CA  1 
ATOM   5050  C C   . GLU B 1 35  ? -22.931 -31.720 51.734  1.00 23.45 ? 61   GLU B C   1 
ATOM   5051  O O   . GLU B 1 35  ? -23.323 -31.535 52.883  1.00 21.69 ? 61   GLU B O   1 
ATOM   5052  C CB  . GLU B 1 35  ? -22.130 -33.949 50.992  1.00 27.97 ? 61   GLU B CB  1 
ATOM   5053  C CG  . GLU B 1 35  ? -22.379 -35.292 50.313  1.00 35.30 ? 61   GLU B CG  1 
ATOM   5054  C CD  . GLU B 1 35  ? -22.724 -35.176 48.832  1.00 39.13 ? 61   GLU B CD  1 
ATOM   5055  O OE1 . GLU B 1 35  ? -21.969 -34.528 48.072  1.00 37.97 ? 61   GLU B OE1 1 
ATOM   5056  O OE2 . GLU B 1 35  ? -23.754 -35.751 48.421  1.00 42.14 ? 61   GLU B OE2 1 
ATOM   5057  N N   . GLU B 1 36  ? -22.158 -30.847 51.090  1.00 22.14 ? 62   GLU B N   1 
ATOM   5058  C CA  . GLU B 1 36  ? -21.732 -29.616 51.734  1.00 20.94 ? 62   GLU B CA  1 
ATOM   5059  C C   . GLU B 1 36  ? -22.911 -28.687 51.999  1.00 20.85 ? 62   GLU B C   1 
ATOM   5060  O O   . GLU B 1 36  ? -22.931 -27.989 53.014  1.00 20.89 ? 62   GLU B O   1 
ATOM   5061  C CB  . GLU B 1 36  ? -20.679 -28.900 50.878  1.00 21.67 ? 62   GLU B CB  1 
ATOM   5062  C CG  . GLU B 1 36  ? -19.438 -29.743 50.626  1.00 23.07 ? 62   GLU B CG  1 
ATOM   5063  C CD  . GLU B 1 36  ? -18.520 -29.155 49.572  1.00 24.27 ? 62   GLU B CD  1 
ATOM   5064  O OE1 . GLU B 1 36  ? -19.012 -28.468 48.651  1.00 24.23 ? 62   GLU B OE1 1 
ATOM   5065  O OE2 . GLU B 1 36  ? -17.298 -29.408 49.648  1.00 22.21 ? 62   GLU B OE2 1 
ATOM   5066  N N   . TRP B 1 37  ? -23.890 -28.682 51.096  1.00 19.16 ? 63   TRP B N   1 
ATOM   5067  C CA  . TRP B 1 37  ? -25.072 -27.836 51.256  1.00 20.16 ? 63   TRP B CA  1 
ATOM   5068  C C   . TRP B 1 37  ? -25.931 -28.340 52.413  1.00 21.22 ? 63   TRP B C   1 
ATOM   5069  O O   . TRP B 1 37  ? -26.354 -27.564 53.269  1.00 21.22 ? 63   TRP B O   1 
ATOM   5070  C CB  . TRP B 1 37  ? -25.916 -27.822 49.979  1.00 18.71 ? 63   TRP B CB  1 
ATOM   5071  C CG  . TRP B 1 37  ? -27.015 -26.801 50.017  1.00 17.02 ? 63   TRP B CG  1 
ATOM   5072  C CD1 . TRP B 1 37  ? -26.951 -25.512 49.574  1.00 17.29 ? 63   TRP B CD1 1 
ATOM   5073  C CD2 . TRP B 1 37  ? -28.336 -26.973 50.555  1.00 18.14 ? 63   TRP B CD2 1 
ATOM   5074  N NE1 . TRP B 1 37  ? -28.148 -24.866 49.801  1.00 16.74 ? 63   TRP B NE1 1 
ATOM   5075  C CE2 . TRP B 1 37  ? -29.016 -25.742 50.401  1.00 15.92 ? 63   TRP B CE2 1 
ATOM   5076  C CE3 . TRP B 1 37  ? -29.009 -28.048 51.153  1.00 17.23 ? 63   TRP B CE3 1 
ATOM   5077  C CZ2 . TRP B 1 37  ? -30.335 -25.557 50.822  1.00 17.22 ? 63   TRP B CZ2 1 
ATOM   5078  C CZ3 . TRP B 1 37  ? -30.328 -27.862 51.574  1.00 16.25 ? 63   TRP B CZ3 1 
ATOM   5079  C CH2 . TRP B 1 37  ? -30.973 -26.625 51.403  1.00 16.55 ? 63   TRP B CH2 1 
ATOM   5080  N N   . ALA B 1 38  ? -26.197 -29.646 52.425  1.00 20.31 ? 64   ALA B N   1 
ATOM   5081  C CA  . ALA B 1 38  ? -26.995 -30.260 53.483  1.00 19.83 ? 64   ALA B CA  1 
ATOM   5082  C C   . ALA B 1 38  ? -26.383 -29.925 54.850  1.00 18.31 ? 64   ALA B C   1 
ATOM   5083  O O   . ALA B 1 38  ? -27.094 -29.535 55.782  1.00 17.56 ? 64   ALA B O   1 
ATOM   5084  C CB  . ALA B 1 38  ? -27.049 -31.772 53.283  1.00 19.66 ? 64   ALA B CB  1 
ATOM   5085  N N   . HIS B 1 39  ? -25.068 -30.082 54.962  1.00 17.17 ? 65   HIS B N   1 
ATOM   5086  C CA  . HIS B 1 39  ? -24.377 -29.773 56.206  1.00 17.00 ? 65   HIS B CA  1 
ATOM   5087  C C   . HIS B 1 39  ? -24.556 -28.295 56.538  1.00 16.30 ? 65   HIS B C   1 
ATOM   5088  O O   . HIS B 1 39  ? -24.977 -27.950 57.641  1.00 16.68 ? 65   HIS B O   1 
ATOM   5089  C CB  . HIS B 1 39  ? -22.892 -30.096 56.095  1.00 18.62 ? 65   HIS B CB  1 
ATOM   5090  C CG  . HIS B 1 39  ? -22.119 -29.790 57.341  1.00 20.95 ? 65   HIS B CG  1 
ATOM   5091  N ND1 . HIS B 1 39  ? -21.112 -28.847 57.381  1.00 21.06 ? 65   HIS B ND1 1 
ATOM   5092  C CD2 . HIS B 1 39  ? -22.212 -30.293 58.593  1.00 20.58 ? 65   HIS B CD2 1 
ATOM   5093  C CE1 . HIS B 1 39  ? -20.619 -28.788 58.605  1.00 19.73 ? 65   HIS B CE1 1 
ATOM   5094  N NE2 . HIS B 1 39  ? -21.270 -29.653 59.359  1.00 22.69 ? 65   HIS B NE2 1 
ATOM   5095  N N   . THR B 1 40  ? -24.238 -27.420 55.586  1.00 15.61 ? 66   THR B N   1 
ATOM   5096  C CA  . THR B 1 40  ? -24.385 -25.978 55.787  1.00 14.09 ? 66   THR B CA  1 
ATOM   5097  C C   . THR B 1 40  ? -25.814 -25.632 56.210  1.00 14.22 ? 66   THR B C   1 
ATOM   5098  O O   . THR B 1 40  ? -26.029 -24.727 57.008  1.00 13.71 ? 66   THR B O   1 
ATOM   5099  C CB  . THR B 1 40  ? -24.051 -25.217 54.503  1.00 13.31 ? 66   THR B CB  1 
ATOM   5100  O OG1 . THR B 1 40  ? -22.680 -25.447 54.169  1.00 10.98 ? 66   THR B OG1 1 
ATOM   5101  C CG2 . THR B 1 40  ? -24.314 -23.717 54.675  1.00 14.31 ? 66   THR B CG2 1 
ATOM   5102  N N   . LYS B 1 41  ? -26.792 -26.347 55.664  1.00 15.68 ? 67   LYS B N   1 
ATOM   5103  C CA  . LYS B 1 41  ? -28.185 -26.123 56.019  1.00 17.73 ? 67   LYS B CA  1 
ATOM   5104  C C   . LYS B 1 41  ? -28.372 -26.400 57.512  1.00 18.03 ? 67   LYS B C   1 
ATOM   5105  O O   . LYS B 1 41  ? -29.099 -25.684 58.205  1.00 17.18 ? 67   LYS B O   1 
ATOM   5106  C CB  . LYS B 1 41  ? -29.083 -27.055 55.197  1.00 21.60 ? 67   LYS B CB  1 
ATOM   5107  C CG  . LYS B 1 41  ? -30.551 -27.057 55.617  1.00 24.83 ? 67   LYS B CG  1 
ATOM   5108  C CD  . LYS B 1 41  ? -31.166 -25.689 55.371  1.00 29.68 ? 67   LYS B CD  1 
ATOM   5109  C CE  . LYS B 1 41  ? -32.617 -25.612 55.831  1.00 33.26 ? 67   LYS B CE  1 
ATOM   5110  N NZ  . LYS B 1 41  ? -33.214 -24.263 55.571  1.00 32.65 ? 67   LYS B NZ  1 
ATOM   5111  N N   . GLN B 1 42  ? -27.716 -27.436 58.003  1.00 17.72 ? 68   GLN B N   1 
ATOM   5112  C CA  . GLN B 1 42  ? -27.825 -27.784 59.414  1.00 19.71 ? 68   GLN B CA  1 
ATOM   5113  C C   . GLN B 1 42  ? -27.159 -26.699 60.269  1.00 17.14 ? 68   GLN B C   1 
ATOM   5114  O O   . GLN B 1 42  ? -27.695 -26.302 61.304  1.00 15.48 ? 68   GLN B O   1 
ATOM   5115  C CB  . GLN B 1 42  ? -27.179 -29.140 59.679  1.00 23.12 ? 68   GLN B CB  1 
ATOM   5116  C CG  . GLN B 1 42  ? -27.962 -29.993 60.662  1.00 32.38 ? 68   GLN B CG  1 
ATOM   5117  C CD  . GLN B 1 42  ? -27.161 -31.172 61.170  1.00 36.78 ? 68   GLN B CD  1 
ATOM   5118  O OE1 . GLN B 1 42  ? -26.416 -31.805 60.419  1.00 39.63 ? 68   GLN B OE1 1 
ATOM   5119  N NE2 . GLN B 1 42  ? -27.324 -31.487 62.450  1.00 38.76 ? 68   GLN B NE2 1 
ATOM   5120  N N   . LEU B 1 43  ? -25.998 -26.222 59.835  1.00 14.92 ? 69   LEU B N   1 
ATOM   5121  C CA  . LEU B 1 43  ? -25.299 -25.172 60.566  1.00 15.28 ? 69   LEU B CA  1 
ATOM   5122  C C   . LEU B 1 43  ? -26.136 -23.898 60.598  1.00 15.81 ? 69   LEU B C   1 
ATOM   5123  O O   . LEU B 1 43  ? -26.107 -23.159 61.582  1.00 16.34 ? 69   LEU B O   1 
ATOM   5124  C CB  . LEU B 1 43  ? -23.942 -24.872 59.929  1.00 13.25 ? 69   LEU B CB  1 
ATOM   5125  C CG  . LEU B 1 43  ? -22.893 -25.983 59.994  1.00 13.82 ? 69   LEU B CG  1 
ATOM   5126  C CD1 . LEU B 1 43  ? -21.606 -25.481 59.350  1.00 13.33 ? 69   LEU B CD1 1 
ATOM   5127  C CD2 . LEU B 1 43  ? -22.665 -26.426 61.451  1.00 13.07 ? 69   LEU B CD2 1 
ATOM   5128  N N   . VAL B 1 44  ? -26.882 -23.642 59.527  1.00 15.42 ? 70   VAL B N   1 
ATOM   5129  C CA  . VAL B 1 44  ? -27.718 -22.447 59.461  1.00 15.35 ? 70   VAL B CA  1 
ATOM   5130  C C   . VAL B 1 44  ? -28.859 -22.529 60.467  1.00 15.01 ? 70   VAL B C   1 
ATOM   5131  O O   . VAL B 1 44  ? -29.120 -21.571 61.198  1.00 15.25 ? 70   VAL B O   1 
ATOM   5132  C CB  . VAL B 1 44  ? -28.272 -22.235 58.026  1.00 15.57 ? 70   VAL B CB  1 
ATOM   5133  C CG1 . VAL B 1 44  ? -29.353 -21.166 58.015  1.00 15.98 ? 70   VAL B CG1 1 
ATOM   5134  C CG2 . VAL B 1 44  ? -27.138 -21.809 57.107  1.00 14.55 ? 70   VAL B CG2 1 
ATOM   5135  N N   . ASP B 1 45  ? -29.525 -23.678 60.520  1.00 16.14 ? 71   ASP B N   1 
ATOM   5136  C CA  . ASP B 1 45  ? -30.626 -23.867 61.459  1.00 16.80 ? 71   ASP B CA  1 
ATOM   5137  C C   . ASP B 1 45  ? -30.113 -23.715 62.892  1.00 17.37 ? 71   ASP B C   1 
ATOM   5138  O O   . ASP B 1 45  ? -30.787 -23.134 63.749  1.00 15.21 ? 71   ASP B O   1 
ATOM   5139  C CB  . ASP B 1 45  ? -31.257 -25.257 61.288  1.00 18.16 ? 71   ASP B CB  1 
ATOM   5140  C CG  . ASP B 1 45  ? -32.093 -25.378 60.010  1.00 18.16 ? 71   ASP B CG  1 
ATOM   5141  O OD1 . ASP B 1 45  ? -32.567 -24.344 59.496  1.00 20.13 ? 71   ASP B OD1 1 
ATOM   5142  O OD2 . ASP B 1 45  ? -32.290 -26.517 59.536  1.00 20.80 ? 71   ASP B OD2 1 
ATOM   5143  N N   . GLU B 1 46  ? -28.920 -24.233 63.149  1.00 17.65 ? 72   GLU B N   1 
ATOM   5144  C CA  . GLU B 1 46  ? -28.346 -24.149 64.487  1.00 19.88 ? 72   GLU B CA  1 
ATOM   5145  C C   . GLU B 1 46  ? -27.896 -22.730 64.812  1.00 18.12 ? 72   GLU B C   1 
ATOM   5146  O O   . GLU B 1 46  ? -28.005 -22.278 65.944  1.00 17.46 ? 72   GLU B O   1 
ATOM   5147  C CB  . GLU B 1 46  ? -27.156 -25.102 64.617  1.00 23.24 ? 72   GLU B CB  1 
ATOM   5148  C CG  . GLU B 1 46  ? -26.455 -25.026 65.972  1.00 33.96 ? 72   GLU B CG  1 
ATOM   5149  C CD  . GLU B 1 46  ? -27.238 -25.672 67.115  1.00 39.10 ? 72   GLU B CD  1 
ATOM   5150  O OE1 . GLU B 1 46  ? -28.381 -25.249 67.397  1.00 42.25 ? 72   GLU B OE1 1 
ATOM   5151  O OE2 . GLU B 1 46  ? -26.701 -26.611 67.742  1.00 41.67 ? 72   GLU B OE2 1 
ATOM   5152  N N   . PHE B 1 47  ? -27.401 -22.024 63.799  1.00 16.44 ? 73   PHE B N   1 
ATOM   5153  C CA  . PHE B 1 47  ? -26.915 -20.662 63.959  1.00 14.93 ? 73   PHE B CA  1 
ATOM   5154  C C   . PHE B 1 47  ? -27.998 -19.688 64.418  1.00 14.48 ? 73   PHE B C   1 
ATOM   5155  O O   . PHE B 1 47  ? -27.738 -18.781 65.218  1.00 13.15 ? 73   PHE B O   1 
ATOM   5156  C CB  . PHE B 1 47  ? -26.324 -20.180 62.632  1.00 15.47 ? 73   PHE B CB  1 
ATOM   5157  C CG  . PHE B 1 47  ? -25.622 -18.857 62.721  1.00 13.83 ? 73   PHE B CG  1 
ATOM   5158  C CD1 . PHE B 1 47  ? -24.529 -18.689 63.566  1.00 13.48 ? 73   PHE B CD1 1 
ATOM   5159  C CD2 . PHE B 1 47  ? -26.035 -17.783 61.936  1.00 14.63 ? 73   PHE B CD2 1 
ATOM   5160  C CE1 . PHE B 1 47  ? -23.855 -17.471 63.625  1.00 13.76 ? 73   PHE B CE1 1 
ATOM   5161  C CE2 . PHE B 1 47  ? -25.365 -16.557 61.988  1.00 15.79 ? 73   PHE B CE2 1 
ATOM   5162  C CZ  . PHE B 1 47  ? -24.270 -16.405 62.838  1.00 14.71 ? 73   PHE B CZ  1 
ATOM   5163  N N   . GLN B 1 48  ? -29.215 -19.864 63.907  1.00 13.86 ? 74   GLN B N   1 
ATOM   5164  C CA  . GLN B 1 48  ? -30.295 -18.961 64.268  1.00 15.21 ? 74   GLN B CA  1 
ATOM   5165  C C   . GLN B 1 48  ? -31.330 -19.536 65.229  1.00 15.14 ? 74   GLN B C   1 
ATOM   5166  O O   . GLN B 1 48  ? -32.387 -18.947 65.426  1.00 17.21 ? 74   GLN B O   1 
ATOM   5167  C CB  . GLN B 1 48  ? -30.981 -18.445 62.996  1.00 17.74 ? 74   GLN B CB  1 
ATOM   5168  C CG  . GLN B 1 48  ? -31.412 -19.534 62.030  1.00 20.24 ? 74   GLN B CG  1 
ATOM   5169  C CD  . GLN B 1 48  ? -32.099 -18.997 60.781  1.00 23.50 ? 74   GLN B CD  1 
ATOM   5170  O OE1 . GLN B 1 48  ? -32.166 -19.682 59.763  1.00 24.82 ? 74   GLN B OE1 1 
ATOM   5171  N NE2 . GLN B 1 48  ? -32.632 -17.781 60.863  1.00 22.59 ? 74   GLN B NE2 1 
ATOM   5172  N N   . THR B 1 49  ? -31.031 -20.674 65.843  1.00 16.77 ? 75   THR B N   1 
ATOM   5173  C CA  . THR B 1 49  ? -31.981 -21.268 66.781  1.00 19.52 ? 75   THR B CA  1 
ATOM   5174  C C   . THR B 1 49  ? -32.098 -20.394 68.036  1.00 20.24 ? 75   THR B C   1 
ATOM   5175  O O   . THR B 1 49  ? -31.205 -19.591 68.327  1.00 20.43 ? 75   THR B O   1 
ATOM   5176  C CB  . THR B 1 49  ? -31.559 -22.695 67.196  1.00 19.34 ? 75   THR B CB  1 
ATOM   5177  O OG1 . THR B 1 49  ? -32.643 -23.322 67.889  1.00 20.67 ? 75   THR B OG1 1 
ATOM   5178  C CG2 . THR B 1 49  ? -30.343 -22.660 68.104  1.00 21.18 ? 75   THR B CG2 1 
ATOM   5179  N N   . SER B 1 50  ? -33.202 -20.536 68.762  1.00 21.20 ? 76   SER B N   1 
ATOM   5180  C CA  . SER B 1 50  ? -33.423 -19.757 69.977  1.00 21.65 ? 76   SER B CA  1 
ATOM   5181  C C   . SER B 1 50  ? -32.290 -19.929 70.971  1.00 23.00 ? 76   SER B C   1 
ATOM   5182  O O   . SER B 1 50  ? -31.924 -21.056 71.312  1.00 24.09 ? 76   SER B O   1 
ATOM   5183  C CB  . SER B 1 50  ? -34.729 -20.169 70.648  1.00 21.94 ? 76   SER B CB  1 
ATOM   5184  O OG  . SER B 1 50  ? -35.842 -19.801 69.854  1.00 23.49 ? 76   SER B OG  1 
ATOM   5185  N N   . GLY B 1 51  ? -31.746 -18.810 71.438  1.00 23.70 ? 77   GLY B N   1 
ATOM   5186  C CA  . GLY B 1 51  ? -30.656 -18.862 72.396  1.00 23.14 ? 77   GLY B CA  1 
ATOM   5187  C C   . GLY B 1 51  ? -29.333 -19.204 71.746  1.00 23.47 ? 77   GLY B C   1 
ATOM   5188  O O   . GLY B 1 51  ? -28.373 -19.552 72.432  1.00 25.02 ? 77   GLY B O   1 
ATOM   5189  N N   . GLY B 1 52  ? -29.276 -19.099 70.423  1.00 20.57 ? 78   GLY B N   1 
ATOM   5190  C CA  . GLY B 1 52  ? -28.058 -19.440 69.713  1.00 18.60 ? 78   GLY B CA  1 
ATOM   5191  C C   . GLY B 1 52  ? -27.078 -18.298 69.543  1.00 17.79 ? 78   GLY B C   1 
ATOM   5192  O O   . GLY B 1 52  ? -27.261 -17.206 70.091  1.00 17.40 ? 78   GLY B O   1 
ATOM   5193  N N   . VAL B 1 53  ? -26.032 -18.557 68.767  1.00 15.50 ? 79   VAL B N   1 
ATOM   5194  C CA  . VAL B 1 53  ? -25.000 -17.572 68.503  1.00 14.66 ? 79   VAL B CA  1 
ATOM   5195  C C   . VAL B 1 53  ? -25.459 -16.458 67.556  1.00 14.11 ? 79   VAL B C   1 
ATOM   5196  O O   . VAL B 1 53  ? -25.276 -15.279 67.845  1.00 14.62 ? 79   VAL B O   1 
ATOM   5197  C CB  . VAL B 1 53  ? -23.753 -18.251 67.899  1.00 14.85 ? 79   VAL B CB  1 
ATOM   5198  C CG1 . VAL B 1 53  ? -22.703 -17.206 67.575  1.00 14.92 ? 79   VAL B CG1 1 
ATOM   5199  C CG2 . VAL B 1 53  ? -23.209 -19.310 68.861  1.00 16.46 ? 79   VAL B CG2 1 
ATOM   5200  N N   . GLY B 1 54  ? -26.047 -16.835 66.424  1.00 13.72 ? 80   GLY B N   1 
ATOM   5201  C CA  . GLY B 1 54  ? -26.487 -15.842 65.455  1.00 13.55 ? 80   GLY B CA  1 
ATOM   5202  C C   . GLY B 1 54  ? -27.415 -14.794 66.028  1.00 14.95 ? 80   GLY B C   1 
ATOM   5203  O O   . GLY B 1 54  ? -27.301 -13.599 65.742  1.00 15.07 ? 80   GLY B O   1 
ATOM   5204  N N   . GLU B 1 55  ? -28.354 -15.251 66.845  1.00 15.95 ? 81   GLU B N   1 
ATOM   5205  C CA  . GLU B 1 55  ? -29.321 -14.373 67.470  1.00 17.85 ? 81   GLU B CA  1 
ATOM   5206  C C   . GLU B 1 55  ? -28.615 -13.263 68.264  1.00 17.75 ? 81   GLU B C   1 
ATOM   5207  O O   . GLU B 1 55  ? -29.002 -12.090 68.186  1.00 15.69 ? 81   GLU B O   1 
ATOM   5208  C CB  . GLU B 1 55  ? -30.208 -15.216 68.380  1.00 22.84 ? 81   GLU B CB  1 
ATOM   5209  C CG  . GLU B 1 55  ? -31.410 -14.515 68.951  1.00 29.38 ? 81   GLU B CG  1 
ATOM   5210  C CD  . GLU B 1 55  ? -32.343 -15.481 69.660  1.00 32.28 ? 81   GLU B CD  1 
ATOM   5211  O OE1 . GLU B 1 55  ? -31.892 -16.162 70.605  1.00 33.49 ? 81   GLU B OE1 1 
ATOM   5212  O OE2 . GLU B 1 55  ? -33.524 -15.556 69.267  1.00 35.33 ? 81   GLU B OE2 1 
ATOM   5213  N N   . ARG B 1 56  ? -27.577 -13.624 69.015  1.00 16.14 ? 82   ARG B N   1 
ATOM   5214  C CA  . ARG B 1 56  ? -26.850 -12.626 69.792  1.00 17.00 ? 82   ARG B CA  1 
ATOM   5215  C C   . ARG B 1 56  ? -26.038 -11.727 68.876  1.00 15.78 ? 82   ARG B C   1 
ATOM   5216  O O   . ARG B 1 56  ? -25.992 -10.518 69.077  1.00 15.94 ? 82   ARG B O   1 
ATOM   5217  C CB  . ARG B 1 56  ? -25.921 -13.284 70.814  1.00 18.45 ? 82   ARG B CB  1 
ATOM   5218  C CG  . ARG B 1 56  ? -26.644 -13.877 72.017  1.00 24.05 ? 82   ARG B CG  1 
ATOM   5219  C CD  . ARG B 1 56  ? -25.661 -14.319 73.096  1.00 27.77 ? 82   ARG B CD  1 
ATOM   5220  N NE  . ARG B 1 56  ? -24.802 -15.404 72.636  1.00 29.48 ? 82   ARG B NE  1 
ATOM   5221  C CZ  . ARG B 1 56  ? -25.207 -16.663 72.491  1.00 32.16 ? 82   ARG B CZ  1 
ATOM   5222  N NH1 . ARG B 1 56  ? -26.460 -17.002 72.781  1.00 31.67 ? 82   ARG B NH1 1 
ATOM   5223  N NH2 . ARG B 1 56  ? -24.366 -17.584 72.040  1.00 32.44 ? 82   ARG B NH2 1 
ATOM   5224  N N   . LEU B 1 57  ? -25.395 -12.305 67.867  1.00 15.09 ? 83   LEU B N   1 
ATOM   5225  C CA  . LEU B 1 57  ? -24.597 -11.500 66.951  1.00 14.42 ? 83   LEU B CA  1 
ATOM   5226  C C   . LEU B 1 57  ? -25.461 -10.476 66.212  1.00 14.62 ? 83   LEU B C   1 
ATOM   5227  O O   . LEU B 1 57  ? -25.045 -9.334  66.024  1.00 15.77 ? 83   LEU B O   1 
ATOM   5228  C CB  . LEU B 1 57  ? -23.875 -12.397 65.937  1.00 12.97 ? 83   LEU B CB  1 
ATOM   5229  C CG  . LEU B 1 57  ? -22.893 -13.390 66.566  1.00 13.20 ? 83   LEU B CG  1 
ATOM   5230  C CD1 . LEU B 1 57  ? -22.301 -14.309 65.504  1.00 10.84 ? 83   LEU B CD1 1 
ATOM   5231  C CD2 . LEU B 1 57  ? -21.804 -12.614 67.292  1.00 11.34 ? 83   LEU B CD2 1 
ATOM   5232  N N   . GLN B 1 58  ? -26.660 -10.887 65.809  1.00 13.00 ? 84   GLN B N   1 
ATOM   5233  C CA  . GLN B 1 58  ? -27.584 -10.009 65.095  1.00 13.20 ? 84   GLN B CA  1 
ATOM   5234  C C   . GLN B 1 58  ? -27.938 -8.819  65.991  1.00 14.51 ? 84   GLN B C   1 
ATOM   5235  O O   . GLN B 1 58  ? -27.975 -7.665  65.547  1.00 12.45 ? 84   GLN B O   1 
ATOM   5236  C CB  . GLN B 1 58  ? -28.843 -10.796 64.729  1.00 11.22 ? 84   GLN B CB  1 
ATOM   5237  C CG  . GLN B 1 58  ? -29.946 -9.999  64.045  1.00 13.21 ? 84   GLN B CG  1 
ATOM   5238  C CD  . GLN B 1 58  ? -29.659 -9.628  62.589  1.00 12.79 ? 84   GLN B CD  1 
ATOM   5239  O OE1 . GLN B 1 58  ? -30.429 -8.892  61.975  1.00 14.17 ? 84   GLN B OE1 1 
ATOM   5240  N NE2 . GLN B 1 58  ? -28.560 -10.137 62.035  1.00 8.30  ? 84   GLN B NE2 1 
ATOM   5241  N N   . LYS B 1 59  ? -28.194 -9.116  67.256  1.00 14.52 ? 85   LYS B N   1 
ATOM   5242  C CA  . LYS B 1 59  ? -28.533 -8.086  68.223  1.00 15.90 ? 85   LYS B CA  1 
ATOM   5243  C C   . LYS B 1 59  ? -27.407 -7.074  68.285  1.00 14.09 ? 85   LYS B C   1 
ATOM   5244  O O   . LYS B 1 59  ? -27.647 -5.876  68.338  1.00 15.10 ? 85   LYS B O   1 
ATOM   5245  C CB  . LYS B 1 59  ? -28.739 -8.707  69.605  1.00 18.84 ? 85   LYS B CB  1 
ATOM   5246  C CG  . LYS B 1 59  ? -30.058 -9.436  69.784  1.00 25.83 ? 85   LYS B CG  1 
ATOM   5247  C CD  . LYS B 1 59  ? -31.213 -8.440  69.838  1.00 30.41 ? 85   LYS B CD  1 
ATOM   5248  C CE  . LYS B 1 59  ? -32.548 -9.099  70.167  1.00 32.59 ? 85   LYS B CE  1 
ATOM   5249  N NZ  . LYS B 1 59  ? -33.646 -8.087  70.271  1.00 33.61 ? 85   LYS B NZ  1 
ATOM   5250  N N   . GLY B 1 60  ? -26.174 -7.571  68.281  1.00 14.43 ? 86   GLY B N   1 
ATOM   5251  C CA  . GLY B 1 60  ? -25.022 -6.697  68.354  1.00 13.71 ? 86   GLY B CA  1 
ATOM   5252  C C   . GLY B 1 60  ? -24.917 -5.767  67.166  1.00 13.85 ? 86   GLY B C   1 
ATOM   5253  O O   . GLY B 1 60  ? -24.503 -4.612  67.301  1.00 13.68 ? 86   GLY B O   1 
ATOM   5254  N N   . LEU B 1 61  ? -25.278 -6.271  65.992  1.00 12.94 ? 87   LEU B N   1 
ATOM   5255  C CA  . LEU B 1 61  ? -25.217 -5.452  64.787  1.00 13.08 ? 87   LEU B CA  1 
ATOM   5256  C C   . LEU B 1 61  ? -26.286 -4.378  64.830  1.00 12.45 ? 87   LEU B C   1 
ATOM   5257  O O   . LEU B 1 61  ? -26.041 -3.251  64.435  1.00 13.74 ? 87   LEU B O   1 
ATOM   5258  C CB  . LEU B 1 61  ? -25.407 -6.302  63.525  1.00 13.78 ? 87   LEU B CB  1 
ATOM   5259  C CG  . LEU B 1 61  ? -24.220 -7.121  63.009  1.00 13.96 ? 87   LEU B CG  1 
ATOM   5260  C CD1 . LEU B 1 61  ? -24.598 -7.891  61.737  1.00 13.55 ? 87   LEU B CD1 1 
ATOM   5261  C CD2 . LEU B 1 61  ? -23.070 -6.178  62.734  1.00 13.17 ? 87   LEU B CD2 1 
ATOM   5262  N N   . GLU B 1 62  ? -27.480 -4.734  65.298  1.00 14.20 ? 88   GLU B N   1 
ATOM   5263  C CA  . GLU B 1 62  ? -28.574 -3.768  65.360  1.00 16.61 ? 88   GLU B CA  1 
ATOM   5264  C C   . GLU B 1 62  ? -28.217 -2.664  66.340  1.00 16.39 ? 88   GLU B C   1 
ATOM   5265  O O   . GLU B 1 62  ? -28.595 -1.507  66.148  1.00 16.04 ? 88   GLU B O   1 
ATOM   5266  C CB  . GLU B 1 62  ? -29.892 -4.453  65.755  1.00 17.02 ? 88   GLU B CB  1 
ATOM   5267  C CG  . GLU B 1 62  ? -30.364 -5.454  64.698  1.00 18.56 ? 88   GLU B CG  1 
ATOM   5268  C CD  . GLU B 1 62  ? -31.550 -6.295  65.141  1.00 21.98 ? 88   GLU B CD  1 
ATOM   5269  O OE1 . GLU B 1 62  ? -31.712 -6.501  66.365  1.00 22.00 ? 88   GLU B OE1 1 
ATOM   5270  O OE2 . GLU B 1 62  ? -32.305 -6.780  64.269  1.00 24.07 ? 88   GLU B OE2 1 
ATOM   5271  N N   . ARG B 1 63  ? -27.483 -3.021  67.387  1.00 14.21 ? 89   ARG B N   1 
ATOM   5272  C CA  . ARG B 1 63  ? -27.058 -2.029  68.360  1.00 15.29 ? 89   ARG B CA  1 
ATOM   5273  C C   . ARG B 1 63  ? -25.990 -1.163  67.712  1.00 14.16 ? 89   ARG B C   1 
ATOM   5274  O O   . ARG B 1 63  ? -25.934 0.043   67.928  1.00 15.51 ? 89   ARG B O   1 
ATOM   5275  C CB  . ARG B 1 63  ? -26.476 -2.691  69.613  1.00 17.22 ? 89   ARG B CB  1 
ATOM   5276  C CG  . ARG B 1 63  ? -27.492 -3.283  70.579  1.00 20.27 ? 89   ARG B CG  1 
ATOM   5277  C CD  . ARG B 1 63  ? -26.899 -3.368  71.983  1.00 25.11 ? 89   ARG B CD  1 
ATOM   5278  N NE  . ARG B 1 63  ? -25.618 -4.068  71.985  1.00 27.50 ? 89   ARG B NE  1 
ATOM   5279  C CZ  . ARG B 1 63  ? -25.493 -5.391  71.923  1.00 30.74 ? 89   ARG B CZ  1 
ATOM   5280  N NH1 . ARG B 1 63  ? -26.573 -6.174  71.869  1.00 30.66 ? 89   ARG B NH1 1 
ATOM   5281  N NH2 . ARG B 1 63  ? -24.286 -5.940  71.880  1.00 29.55 ? 89   ARG B NH2 1 
ATOM   5282  N N   . ARG B 1 64  ? -25.135 -1.787  66.907  1.00 12.75 ? 90   ARG B N   1 
ATOM   5283  C CA  . ARG B 1 64  ? -24.071 -1.058  66.242  1.00 11.60 ? 90   ARG B CA  1 
ATOM   5284  C C   . ARG B 1 64  ? -24.643 0.002   65.292  1.00 12.68 ? 90   ARG B C   1 
ATOM   5285  O O   . ARG B 1 64  ? -24.097 1.105   65.171  1.00 13.52 ? 90   ARG B O   1 
ATOM   5286  C CB  . ARG B 1 64  ? -23.171 -2.041  65.483  1.00 11.05 ? 90   ARG B CB  1 
ATOM   5287  C CG  . ARG B 1 64  ? -21.929 -1.415  64.889  1.00 10.81 ? 90   ARG B CG  1 
ATOM   5288  C CD  . ARG B 1 64  ? -21.154 -2.422  64.056  1.00 11.53 ? 90   ARG B CD  1 
ATOM   5289  N NE  . ARG B 1 64  ? -19.932 -1.848  63.502  1.00 10.73 ? 90   ARG B NE  1 
ATOM   5290  C CZ  . ARG B 1 64  ? -18.783 -1.739  64.168  1.00 13.82 ? 90   ARG B CZ  1 
ATOM   5291  N NH1 . ARG B 1 64  ? -18.684 -2.171  65.423  1.00 11.42 ? 90   ARG B NH1 1 
ATOM   5292  N NH2 . ARG B 1 64  ? -17.727 -1.199  63.576  1.00 12.76 ? 90   ARG B NH2 1 
ATOM   5293  N N   . ALA B 1 65  ? -25.743 -0.326  64.638  1.00 11.90 ? 91   ALA B N   1 
ATOM   5294  C CA  . ALA B 1 65  ? -26.375 0.611   63.713  1.00 16.24 ? 91   ALA B CA  1 
ATOM   5295  C C   . ALA B 1 65  ? -27.025 1.764   64.473  1.00 17.72 ? 91   ALA B C   1 
ATOM   5296  O O   . ALA B 1 65  ? -27.277 2.820   63.895  1.00 18.69 ? 91   ALA B O   1 
ATOM   5297  C CB  . ALA B 1 65  ? -27.414 -0.102  62.857  1.00 13.87 ? 91   ALA B CB  1 
ATOM   5298  N N   . LYS B 1 66  ? -27.290 1.570   65.763  1.00 19.64 ? 92   LYS B N   1 
ATOM   5299  C CA  . LYS B 1 66  ? -27.902 2.622   66.577  1.00 21.94 ? 92   LYS B CA  1 
ATOM   5300  C C   . LYS B 1 66  ? -26.857 3.582   67.133  1.00 21.09 ? 92   LYS B C   1 
ATOM   5301  O O   . LYS B 1 66  ? -27.188 4.665   67.605  1.00 23.21 ? 92   LYS B O   1 
ATOM   5302  C CB  . LYS B 1 66  ? -28.685 2.011   67.736  1.00 24.84 ? 92   LYS B CB  1 
ATOM   5303  C CG  . LYS B 1 66  ? -29.924 1.263   67.301  1.00 30.58 ? 92   LYS B CG  1 
ATOM   5304  C CD  . LYS B 1 66  ? -31.174 2.095   67.526  1.00 35.04 ? 92   LYS B CD  1 
ATOM   5305  C CE  . LYS B 1 66  ? -31.480 2.246   69.018  1.00 38.21 ? 92   LYS B CE  1 
ATOM   5306  N NZ  . LYS B 1 66  ? -32.715 3.043   69.284  1.00 38.90 ? 92   LYS B NZ  1 
ATOM   5307  N N   . LYS B 1 67  ? -25.590 3.197   67.081  1.00 20.93 ? 93   LYS B N   1 
ATOM   5308  C CA  . LYS B 1 67  ? -24.560 4.075   67.605  1.00 21.73 ? 93   LYS B CA  1 
ATOM   5309  C C   . LYS B 1 67  ? -23.534 4.549   66.590  1.00 22.42 ? 93   LYS B C   1 
ATOM   5310  O O   . LYS B 1 67  ? -22.512 5.124   66.959  1.00 24.69 ? 93   LYS B O   1 
ATOM   5311  C CB  . LYS B 1 67  ? -23.868 3.411   68.798  1.00 21.83 ? 93   LYS B CB  1 
ATOM   5312  C CG  . LYS B 1 67  ? -23.281 2.050   68.522  1.00 20.05 ? 93   LYS B CG  1 
ATOM   5313  C CD  . LYS B 1 67  ? -22.863 1.388   69.828  1.00 20.88 ? 93   LYS B CD  1 
ATOM   5314  C CE  . LYS B 1 67  ? -22.085 0.109   69.578  1.00 21.64 ? 93   LYS B CE  1 
ATOM   5315  N NZ  . LYS B 1 67  ? -21.633 -0.576  70.829  1.00 20.94 ? 93   LYS B NZ  1 
ATOM   5316  N N   . MET B 1 68  ? -23.820 4.315   65.314  1.00 21.77 ? 94   MET B N   1 
ATOM   5317  C CA  . MET B 1 68  ? -22.936 4.728   64.229  1.00 20.14 ? 94   MET B CA  1 
ATOM   5318  C C   . MET B 1 68  ? -23.784 5.237   63.072  1.00 18.45 ? 94   MET B C   1 
ATOM   5319  O O   . MET B 1 68  ? -24.933 4.824   62.913  1.00 17.82 ? 94   MET B O   1 
ATOM   5320  C CB  . MET B 1 68  ? -22.101 3.548   63.738  1.00 22.63 ? 94   MET B CB  1 
ATOM   5321  C CG  . MET B 1 68  ? -21.206 2.921   64.778  1.00 24.89 ? 94   MET B CG  1 
ATOM   5322  S SD  . MET B 1 68  ? -20.196 1.666   63.990  1.00 24.20 ? 94   MET B SD  1 
ATOM   5323  C CE  . MET B 1 68  ? -18.684 2.579   63.684  1.00 29.60 ? 94   MET B CE  1 
ATOM   5324  N N   . GLU B 1 69  ? -23.224 6.130   62.262  1.00 16.51 ? 95   GLU B N   1 
ATOM   5325  C CA  . GLU B 1 69  ? -23.963 6.647   61.120  1.00 17.59 ? 95   GLU B CA  1 
ATOM   5326  C C   . GLU B 1 69  ? -24.161 5.528   60.102  1.00 15.15 ? 95   GLU B C   1 
ATOM   5327  O O   . GLU B 1 69  ? -25.195 5.453   59.453  1.00 17.65 ? 95   GLU B O   1 
ATOM   5328  C CB  . GLU B 1 69  ? -23.214 7.797   60.449  1.00 19.89 ? 95   GLU B CB  1 
ATOM   5329  C CG  . GLU B 1 69  ? -22.879 8.945   61.363  1.00 26.40 ? 95   GLU B CG  1 
ATOM   5330  C CD  . GLU B 1 69  ? -22.610 10.215  60.595  1.00 31.12 ? 95   GLU B CD  1 
ATOM   5331  O OE1 . GLU B 1 69  ? -23.565 10.993  60.383  1.00 35.07 ? 95   GLU B OE1 1 
ATOM   5332  O OE2 . GLU B 1 69  ? -21.450 10.431  60.189  1.00 31.78 ? 95   GLU B OE2 1 
ATOM   5333  N N   . ASN B 1 70  ? -23.155 4.671   59.970  1.00 13.45 ? 96   ASN B N   1 
ATOM   5334  C CA  . ASN B 1 70  ? -23.182 3.532   59.043  1.00 12.70 ? 96   ASN B CA  1 
ATOM   5335  C C   . ASN B 1 70  ? -22.483 2.383   59.759  1.00 10.98 ? 96   ASN B C   1 
ATOM   5336  O O   . ASN B 1 70  ? -21.277 2.428   59.963  1.00 9.58  ? 96   ASN B O   1 
ATOM   5337  C CB  . ASN B 1 70  ? -22.420 3.877   57.762  1.00 12.60 ? 96   ASN B CB  1 
ATOM   5338  C CG  . ASN B 1 70  ? -22.480 2.763   56.726  1.00 14.84 ? 96   ASN B CG  1 
ATOM   5339  O OD1 . ASN B 1 70  ? -22.155 1.614   57.015  1.00 15.88 ? 96   ASN B OD1 1 
ATOM   5340  N ND2 . ASN B 1 70  ? -22.890 3.108   55.508  1.00 12.47 ? 96   ASN B ND2 1 
ATOM   5341  N N   . TRP B 1 71  ? -23.229 1.352   60.142  1.00 10.99 ? 97   TRP B N   1 
ATOM   5342  C CA  . TRP B 1 71  ? -22.632 0.241   60.884  1.00 11.95 ? 97   TRP B CA  1 
ATOM   5343  C C   . TRP B 1 71  ? -21.529 -0.525  60.162  1.00 11.23 ? 97   TRP B C   1 
ATOM   5344  O O   . TRP B 1 71  ? -20.717 -1.196  60.806  1.00 11.06 ? 97   TRP B O   1 
ATOM   5345  C CB  . TRP B 1 71  ? -23.702 -0.768  61.334  1.00 10.53 ? 97   TRP B CB  1 
ATOM   5346  C CG  . TRP B 1 71  ? -24.294 -1.559  60.224  1.00 12.18 ? 97   TRP B CG  1 
ATOM   5347  C CD1 . TRP B 1 71  ? -25.448 -1.285  59.553  1.00 12.34 ? 97   TRP B CD1 1 
ATOM   5348  C CD2 . TRP B 1 71  ? -23.756 -2.753  59.630  1.00 13.45 ? 97   TRP B CD2 1 
ATOM   5349  N NE1 . TRP B 1 71  ? -25.666 -2.226  58.583  1.00 14.40 ? 97   TRP B NE1 1 
ATOM   5350  C CE2 . TRP B 1 71  ? -24.645 -3.140  58.604  1.00 13.89 ? 97   TRP B CE2 1 
ATOM   5351  C CE3 . TRP B 1 71  ? -22.613 -3.532  59.863  1.00 11.89 ? 97   TRP B CE3 1 
ATOM   5352  C CZ2 . TRP B 1 71  ? -24.429 -4.271  57.809  1.00 12.95 ? 97   TRP B CZ2 1 
ATOM   5353  C CZ3 . TRP B 1 71  ? -22.397 -4.658  59.072  1.00 13.53 ? 97   TRP B CZ3 1 
ATOM   5354  C CH2 . TRP B 1 71  ? -23.304 -5.017  58.056  1.00 12.93 ? 97   TRP B CH2 1 
ATOM   5355  N N   . LEU B 1 72  ? -21.488 -0.418  58.839  1.00 10.78 ? 98   LEU B N   1 
ATOM   5356  C CA  . LEU B 1 72  ? -20.500 -1.140  58.041  1.00 11.57 ? 98   LEU B CA  1 
ATOM   5357  C C   . LEU B 1 72  ? -19.270 -0.349  57.579  1.00 12.41 ? 98   LEU B C   1 
ATOM   5358  O O   . LEU B 1 72  ? -18.212 -0.930  57.349  1.00 10.83 ? 98   LEU B O   1 
ATOM   5359  C CB  . LEU B 1 72  ? -21.193 -1.723  56.802  1.00 11.77 ? 98   LEU B CB  1 
ATOM   5360  C CG  . LEU B 1 72  ? -20.350 -2.431  55.738  1.00 11.56 ? 98   LEU B CG  1 
ATOM   5361  C CD1 . LEU B 1 72  ? -19.775 -3.726  56.314  1.00 8.71  ? 98   LEU B CD1 1 
ATOM   5362  C CD2 . LEU B 1 72  ? -21.221 -2.714  54.510  1.00 12.00 ? 98   LEU B CD2 1 
ATOM   5363  N N   . SER B 1 73  ? -19.424 0.965   57.431  1.00 13.68 ? 99   SER B N   1 
ATOM   5364  C CA  . SER B 1 73  ? -18.355 1.837   56.942  1.00 14.81 ? 99   SER B CA  1 
ATOM   5365  C C   . SER B 1 73  ? -16.933 1.538   57.399  1.00 14.14 ? 99   SER B C   1 
ATOM   5366  O O   . SER B 1 73  ? -16.068 1.184   56.595  1.00 13.49 ? 99   SER B O   1 
ATOM   5367  C CB  . SER B 1 73  ? -18.664 3.300   57.280  1.00 16.77 ? 99   SER B CB  1 
ATOM   5368  O OG  . SER B 1 73  ? -19.644 3.837   56.412  1.00 25.17 ? 99   SER B OG  1 
ATOM   5369  N N   . GLU B 1 74  ? -16.681 1.702   58.685  1.00 11.89 ? 100  GLU B N   1 
ATOM   5370  C CA  . GLU B 1 74  ? -15.343 1.483   59.200  1.00 11.98 ? 100  GLU B CA  1 
ATOM   5371  C C   . GLU B 1 74  ? -14.886 0.030   59.006  1.00 9.66  ? 100  GLU B C   1 
ATOM   5372  O O   . GLU B 1 74  ? -13.754 -0.211  58.577  1.00 8.12  ? 100  GLU B O   1 
ATOM   5373  C CB  . GLU B 1 74  ? -15.292 1.920   60.666  1.00 12.44 ? 100  GLU B CB  1 
ATOM   5374  C CG  . GLU B 1 74  ? -13.916 1.835   61.293  1.00 18.98 ? 100  GLU B CG  1 
ATOM   5375  C CD  . GLU B 1 74  ? -13.854 2.417   62.705  1.00 21.62 ? 100  GLU B CD  1 
ATOM   5376  O OE1 . GLU B 1 74  ? -12.806 2.254   63.360  1.00 28.01 ? 100  GLU B OE1 1 
ATOM   5377  O OE2 . GLU B 1 74  ? -14.841 3.037   63.160  1.00 23.90 ? 100  GLU B OE2 1 
ATOM   5378  N N   . TRP B 1 75  ? -15.746 -0.934  59.311  1.00 10.66 ? 101  TRP B N   1 
ATOM   5379  C CA  . TRP B 1 75  ? -15.392 -2.341  59.128  1.00 10.73 ? 101  TRP B CA  1 
ATOM   5380  C C   . TRP B 1 75  ? -14.969 -2.657  57.687  1.00 9.91  ? 101  TRP B C   1 
ATOM   5381  O O   . TRP B 1 75  ? -13.964 -3.325  57.460  1.00 9.82  ? 101  TRP B O   1 
ATOM   5382  C CB  . TRP B 1 75  ? -16.567 -3.244  59.495  1.00 10.08 ? 101  TRP B CB  1 
ATOM   5383  C CG  . TRP B 1 75  ? -16.650 -3.583  60.937  1.00 10.38 ? 101  TRP B CG  1 
ATOM   5384  C CD1 . TRP B 1 75  ? -15.651 -3.485  61.864  1.00 11.21 ? 101  TRP B CD1 1 
ATOM   5385  C CD2 . TRP B 1 75  ? -17.768 -4.178  61.612  1.00 11.20 ? 101  TRP B CD2 1 
ATOM   5386  N NE1 . TRP B 1 75  ? -16.078 -3.984  63.071  1.00 11.85 ? 101  TRP B NE1 1 
ATOM   5387  C CE2 . TRP B 1 75  ? -17.370 -4.421  62.945  1.00 11.94 ? 101  TRP B CE2 1 
ATOM   5388  C CE3 . TRP B 1 75  ? -19.066 -4.534  61.217  1.00 7.08  ? 101  TRP B CE3 1 
ATOM   5389  C CZ2 . TRP B 1 75  ? -18.223 -5.006  63.887  1.00 11.03 ? 101  TRP B CZ2 1 
ATOM   5390  C CZ3 . TRP B 1 75  ? -19.909 -5.116  62.150  1.00 7.86  ? 101  TRP B CZ3 1 
ATOM   5391  C CH2 . TRP B 1 75  ? -19.483 -5.348  63.474  1.00 10.39 ? 101  TRP B CH2 1 
ATOM   5392  N N   . TRP B 1 76  ? -15.740 -2.189  56.707  1.00 9.37  ? 102  TRP B N   1 
ATOM   5393  C CA  . TRP B 1 76  ? -15.412 -2.464  55.311  1.00 10.19 ? 102  TRP B CA  1 
ATOM   5394  C C   . TRP B 1 76  ? -14.081 -1.859  54.877  1.00 10.37 ? 102  TRP B C   1 
ATOM   5395  O O   . TRP B 1 76  ? -13.241 -2.541  54.280  1.00 9.87  ? 102  TRP B O   1 
ATOM   5396  C CB  . TRP B 1 76  ? -16.522 -1.949  54.388  1.00 10.61 ? 102  TRP B CB  1 
ATOM   5397  C CG  . TRP B 1 76  ? -16.271 -2.279  52.944  1.00 9.38  ? 102  TRP B CG  1 
ATOM   5398  C CD1 . TRP B 1 76  ? -16.067 -1.400  51.927  1.00 9.11  ? 102  TRP B CD1 1 
ATOM   5399  C CD2 . TRP B 1 76  ? -16.209 -3.591  52.366  1.00 7.54  ? 102  TRP B CD2 1 
ATOM   5400  N NE1 . TRP B 1 76  ? -15.884 -2.080  50.739  1.00 10.09 ? 102  TRP B NE1 1 
ATOM   5401  C CE2 . TRP B 1 76  ? -15.968 -3.427  50.982  1.00 9.05  ? 102  TRP B CE2 1 
ATOM   5402  C CE3 . TRP B 1 76  ? -16.335 -4.889  52.880  1.00 9.94  ? 102  TRP B CE3 1 
ATOM   5403  C CZ2 . TRP B 1 76  ? -15.852 -4.512  50.106  1.00 8.61  ? 102  TRP B CZ2 1 
ATOM   5404  C CZ3 . TRP B 1 76  ? -16.218 -5.975  52.009  1.00 9.85  ? 102  TRP B CZ3 1 
ATOM   5405  C CH2 . TRP B 1 76  ? -15.980 -5.774  50.637  1.00 12.95 ? 102  TRP B CH2 1 
ATOM   5406  N N   . LEU B 1 77  ? -13.900 -0.571  55.159  1.00 10.74 ? 103  LEU B N   1 
ATOM   5407  C CA  . LEU B 1 77  ? -12.680 0.143   54.800  1.00 11.70 ? 103  LEU B CA  1 
ATOM   5408  C C   . LEU B 1 77  ? -11.453 -0.568  55.378  1.00 12.70 ? 103  LEU B C   1 
ATOM   5409  O O   . LEU B 1 77  ? -10.426 -0.721  54.710  1.00 12.46 ? 103  LEU B O   1 
ATOM   5410  C CB  . LEU B 1 77  ? -12.738 1.574   55.342  1.00 11.11 ? 103  LEU B CB  1 
ATOM   5411  C CG  . LEU B 1 77  ? -11.425 2.353   55.219  1.00 16.29 ? 103  LEU B CG  1 
ATOM   5412  C CD1 . LEU B 1 77  ? -11.132 2.643   53.746  1.00 16.96 ? 103  LEU B CD1 1 
ATOM   5413  C CD2 . LEU B 1 77  ? -11.503 3.643   56.030  1.00 19.03 ? 103  LEU B CD2 1 
ATOM   5414  N N   . LYS B 1 78  ? -11.571 -1.002  56.621  1.00 12.73 ? 104  LYS B N   1 
ATOM   5415  C CA  . LYS B 1 78  ? -10.479 -1.684  57.291  1.00 15.30 ? 104  LYS B CA  1 
ATOM   5416  C C   . LYS B 1 78  ? -10.186 -3.076  56.723  1.00 14.94 ? 104  LYS B C   1 
ATOM   5417  O O   . LYS B 1 78  ? -9.048  -3.390  56.379  1.00 15.10 ? 104  LYS B O   1 
ATOM   5418  C CB  . LYS B 1 78  ? -10.786 -1.803  58.791  1.00 16.98 ? 104  LYS B CB  1 
ATOM   5419  C CG  . LYS B 1 78  ? -9.594  -2.266  59.628  1.00 24.43 ? 104  LYS B CG  1 
ATOM   5420  C CD  . LYS B 1 78  ? -9.941  -2.499  61.116  1.00 24.27 ? 104  LYS B CD  1 
ATOM   5421  C CE  . LYS B 1 78  ? -10.830 -3.731  61.327  1.00 26.17 ? 104  LYS B CE  1 
ATOM   5422  N NZ  . LYS B 1 78  ? -11.017 -4.096  62.769  1.00 23.59 ? 104  LYS B NZ  1 
ATOM   5423  N N   . THR B 1 79  ? -11.226 -3.908  56.623  1.00 14.89 ? 105  THR B N   1 
ATOM   5424  C CA  . THR B 1 79  ? -11.073 -5.282  56.155  1.00 16.30 ? 105  THR B CA  1 
ATOM   5425  C C   . THR B 1 79  ? -10.746 -5.412  54.675  1.00 14.76 ? 105  THR B C   1 
ATOM   5426  O O   . THR B 1 79  ? -9.886  -6.202  54.293  1.00 15.94 ? 105  THR B O   1 
ATOM   5427  C CB  . THR B 1 79  ? -12.338 -6.106  56.474  1.00 18.20 ? 105  THR B CB  1 
ATOM   5428  O OG1 . THR B 1 79  ? -12.649 -5.975  57.865  1.00 21.73 ? 105  THR B OG1 1 
ATOM   5429  C CG2 . THR B 1 79  ? -12.106 -7.578  56.189  1.00 21.97 ? 105  THR B CG2 1 
ATOM   5430  N N   . ALA B 1 80  ? -11.419 -4.620  53.842  1.00 12.91 ? 106  ALA B N   1 
ATOM   5431  C CA  . ALA B 1 80  ? -11.198 -4.678  52.406  1.00 12.45 ? 106  ALA B CA  1 
ATOM   5432  C C   . ALA B 1 80  ? -9.938  -3.972  51.910  1.00 11.94 ? 106  ALA B C   1 
ATOM   5433  O O   . ALA B 1 80  ? -9.369  -4.368  50.891  1.00 11.45 ? 106  ALA B O   1 
ATOM   5434  C CB  . ALA B 1 80  ? -12.418 -4.117  51.681  1.00 10.94 ? 106  ALA B CB  1 
ATOM   5435  N N   . TYR B 1 81  ? -9.486  -2.939  52.621  1.00 11.19 ? 107  TYR B N   1 
ATOM   5436  C CA  . TYR B 1 81  ? -8.323  -2.196  52.148  1.00 10.42 ? 107  TYR B CA  1 
ATOM   5437  C C   . TYR B 1 81  ? -7.219  -1.905  53.157  1.00 10.36 ? 107  TYR B C   1 
ATOM   5438  O O   . TYR B 1 81  ? -6.074  -2.322  52.970  1.00 10.16 ? 107  TYR B O   1 
ATOM   5439  C CB  . TYR B 1 81  ? -8.788  -0.868  51.515  1.00 10.36 ? 107  TYR B CB  1 
ATOM   5440  C CG  . TYR B 1 81  ? -9.870  -1.021  50.459  1.00 12.91 ? 107  TYR B CG  1 
ATOM   5441  C CD1 . TYR B 1 81  ? -11.183 -0.589  50.697  1.00 12.01 ? 107  TYR B CD1 1 
ATOM   5442  C CD2 . TYR B 1 81  ? -9.601  -1.661  49.251  1.00 13.29 ? 107  TYR B CD2 1 
ATOM   5443  C CE1 . TYR B 1 81  ? -12.196 -0.803  49.760  1.00 12.66 ? 107  TYR B CE1 1 
ATOM   5444  C CE2 . TYR B 1 81  ? -10.609 -1.877  48.307  1.00 13.94 ? 107  TYR B CE2 1 
ATOM   5445  C CZ  . TYR B 1 81  ? -11.896 -1.454  48.566  1.00 14.19 ? 107  TYR B CZ  1 
ATOM   5446  O OH  . TYR B 1 81  ? -12.887 -1.732  47.652  1.00 15.01 ? 107  TYR B OH  1 
ATOM   5447  N N   . LEU B 1 82  ? -7.552  -1.181  54.224  1.00 10.93 ? 108  LEU B N   1 
ATOM   5448  C CA  . LEU B 1 82  ? -6.536  -0.797  55.196  1.00 12.32 ? 108  LEU B CA  1 
ATOM   5449  C C   . LEU B 1 82  ? -5.735  -1.972  55.742  1.00 11.89 ? 108  LEU B C   1 
ATOM   5450  O O   . LEU B 1 82  ? -4.519  -1.881  55.886  1.00 9.29  ? 108  LEU B O   1 
ATOM   5451  C CB  . LEU B 1 82  ? -7.158  0.024   56.339  1.00 13.07 ? 108  LEU B CB  1 
ATOM   5452  C CG  . LEU B 1 82  ? -7.814  1.360   55.944  1.00 15.86 ? 108  LEU B CG  1 
ATOM   5453  C CD1 . LEU B 1 82  ? -8.088  2.176   57.191  1.00 16.49 ? 108  LEU B CD1 1 
ATOM   5454  C CD2 . LEU B 1 82  ? -6.913  2.155   55.017  1.00 17.63 ? 108  LEU B CD2 1 
ATOM   5455  N N   . GLN B 1 83  ? -6.409  -3.079  56.012  1.00 12.48 ? 109  GLN B N   1 
ATOM   5456  C CA  . GLN B 1 83  ? -5.744  -4.273  56.521  1.00 13.47 ? 109  GLN B CA  1 
ATOM   5457  C C   . GLN B 1 83  ? -5.243  -5.207  55.420  1.00 12.72 ? 109  GLN B C   1 
ATOM   5458  O O   . GLN B 1 83  ? -4.617  -6.224  55.699  1.00 13.02 ? 109  GLN B O   1 
ATOM   5459  C CB  . GLN B 1 83  ? -6.687  -5.034  57.449  1.00 14.85 ? 109  GLN B CB  1 
ATOM   5460  C CG  . GLN B 1 83  ? -7.006  -4.260  58.707  1.00 17.74 ? 109  GLN B CG  1 
ATOM   5461  C CD  . GLN B 1 83  ? -7.893  -5.035  59.651  1.00 22.95 ? 109  GLN B CD  1 
ATOM   5462  O OE1 . GLN B 1 83  ? -8.109  -4.621  60.782  1.00 26.64 ? 109  GLN B OE1 1 
ATOM   5463  N NE2 . GLN B 1 83  ? -8.414  -6.167  59.188  1.00 24.41 ? 109  GLN B NE2 1 
ATOM   5464  N N   . PHE B 1 84  ? -5.531  -4.868  54.164  1.00 13.52 ? 110  PHE B N   1 
ATOM   5465  C CA  . PHE B 1 84  ? -5.084  -5.681  53.035  1.00 11.42 ? 110  PHE B CA  1 
ATOM   5466  C C   . PHE B 1 84  ? -3.613  -5.328  52.829  1.00 11.41 ? 110  PHE B C   1 
ATOM   5467  O O   . PHE B 1 84  ? -3.284  -4.225  52.408  1.00 9.93  ? 110  PHE B O   1 
ATOM   5468  C CB  . PHE B 1 84  ? -5.925  -5.331  51.796  1.00 12.17 ? 110  PHE B CB  1 
ATOM   5469  C CG  . PHE B 1 84  ? -5.733  -6.277  50.641  1.00 13.19 ? 110  PHE B CG  1 
ATOM   5470  C CD1 . PHE B 1 84  ? -5.578  -7.644  50.865  1.00 13.84 ? 110  PHE B CD1 1 
ATOM   5471  C CD2 . PHE B 1 84  ? -5.735  -5.809  49.331  1.00 12.95 ? 110  PHE B CD2 1 
ATOM   5472  C CE1 . PHE B 1 84  ? -5.428  -8.531  49.805  1.00 15.61 ? 110  PHE B CE1 1 
ATOM   5473  C CE2 . PHE B 1 84  ? -5.585  -6.689  48.257  1.00 15.00 ? 110  PHE B CE2 1 
ATOM   5474  C CZ  . PHE B 1 84  ? -5.430  -8.049  48.490  1.00 14.28 ? 110  PHE B CZ  1 
ATOM   5475  N N   . ARG B 1 85  ? -2.727  -6.279  53.126  1.00 10.80 ? 111  ARG B N   1 
ATOM   5476  C CA  . ARG B 1 85  ? -1.293  -6.044  53.040  1.00 9.37  ? 111  ARG B CA  1 
ATOM   5477  C C   . ARG B 1 85  ? -0.628  -6.290  51.694  1.00 10.18 ? 111  ARG B C   1 
ATOM   5478  O O   . ARG B 1 85  ? 0.554   -5.994  51.511  1.00 9.81  ? 111  ARG B O   1 
ATOM   5479  C CB  . ARG B 1 85  ? -0.613  -6.858  54.146  1.00 9.92  ? 111  ARG B CB  1 
ATOM   5480  C CG  . ARG B 1 85  ? -1.254  -6.618  55.506  1.00 7.42  ? 111  ARG B CG  1 
ATOM   5481  C CD  . ARG B 1 85  ? -1.234  -5.128  55.878  1.00 7.45  ? 111  ARG B CD  1 
ATOM   5482  N NE  . ARG B 1 85  ? 0.110   -4.664  56.234  1.00 9.91  ? 111  ARG B NE  1 
ATOM   5483  C CZ  . ARG B 1 85  ? 0.456   -3.390  56.419  1.00 10.32 ? 111  ARG B CZ  1 
ATOM   5484  N NH1 . ARG B 1 85  ? -0.435  -2.421  56.269  1.00 9.75  ? 111  ARG B NH1 1 
ATOM   5485  N NH2 . ARG B 1 85  ? 1.693   -3.093  56.795  1.00 11.02 ? 111  ARG B NH2 1 
ATOM   5486  N N   . GLN B 1 86  ? -1.378  -6.851  50.755  1.00 10.96 ? 112  GLN B N   1 
ATOM   5487  C CA  . GLN B 1 86  ? -0.825  -7.087  49.437  1.00 12.28 ? 112  GLN B CA  1 
ATOM   5488  C C   . GLN B 1 86  ? -0.579  -5.719  48.803  1.00 11.44 ? 112  GLN B C   1 
ATOM   5489  O O   . GLN B 1 86  ? -1.169  -4.714  49.219  1.00 9.62  ? 112  GLN B O   1 
ATOM   5490  C CB  . GLN B 1 86  ? -1.817  -7.868  48.571  1.00 14.58 ? 112  GLN B CB  1 
ATOM   5491  C CG  . GLN B 1 86  ? -1.810  -9.374  48.767  1.00 18.71 ? 112  GLN B CG  1 
ATOM   5492  C CD  . GLN B 1 86  ? -0.542  -10.009 48.248  1.00 22.06 ? 112  GLN B CD  1 
ATOM   5493  O OE1 . GLN B 1 86  ? 0.432   -10.165 48.984  1.00 26.40 ? 112  GLN B OE1 1 
ATOM   5494  N NE2 . GLN B 1 86  ? -0.535  -10.363 46.968  1.00 25.04 ? 112  GLN B NE2 1 
ATOM   5495  N N   . PRO B 1 87  ? 0.310   -5.657  47.801  1.00 8.71  ? 113  PRO B N   1 
ATOM   5496  C CA  . PRO B 1 87  ? 0.613   -4.398  47.112  1.00 10.04 ? 113  PRO B CA  1 
ATOM   5497  C C   . PRO B 1 87  ? -0.690  -3.823  46.579  1.00 10.64 ? 113  PRO B C   1 
ATOM   5498  O O   . PRO B 1 87  ? -1.561  -4.574  46.147  1.00 12.48 ? 113  PRO B O   1 
ATOM   5499  C CB  . PRO B 1 87  ? 1.533   -4.839  45.978  1.00 7.52  ? 113  PRO B CB  1 
ATOM   5500  C CG  . PRO B 1 87  ? 2.271   -5.995  46.578  1.00 9.14  ? 113  PRO B CG  1 
ATOM   5501  C CD  . PRO B 1 87  ? 1.183   -6.743  47.322  1.00 7.87  ? 113  PRO B CD  1 
ATOM   5502  N N   . VAL B 1 88  ? -0.839  -2.504  46.619  1.00 9.99  ? 114  VAL B N   1 
ATOM   5503  C CA  . VAL B 1 88  ? -2.062  -1.900  46.113  1.00 8.42  ? 114  VAL B CA  1 
ATOM   5504  C C   . VAL B 1 88  ? -2.077  -2.001  44.602  1.00 7.64  ? 114  VAL B C   1 
ATOM   5505  O O   . VAL B 1 88  ? -3.138  -2.068  43.992  1.00 10.28 ? 114  VAL B O   1 
ATOM   5506  C CB  . VAL B 1 88  ? -2.209  -0.408  46.532  1.00 5.98  ? 114  VAL B CB  1 
ATOM   5507  C CG1 . VAL B 1 88  ? -2.258  -0.302  48.036  1.00 6.54  ? 114  VAL B CG1 1 
ATOM   5508  C CG2 . VAL B 1 88  ? -1.065  0.424   45.958  1.00 6.37  ? 114  VAL B CG2 1 
ATOM   5509  N N   . VAL B 1 89  ? -0.898  -2.035  44.003  1.00 6.66  ? 115  VAL B N   1 
ATOM   5510  C CA  . VAL B 1 89  ? -0.804  -2.141  42.557  1.00 8.73  ? 115  VAL B CA  1 
ATOM   5511  C C   . VAL B 1 89  ? -1.347  -3.486  42.065  1.00 8.06  ? 115  VAL B C   1 
ATOM   5512  O O   . VAL B 1 89  ? -0.979  -4.534  42.604  1.00 7.85  ? 115  VAL B O   1 
ATOM   5513  C CB  . VAL B 1 89  ? 0.652   -1.970  42.131  1.00 9.17  ? 115  VAL B CB  1 
ATOM   5514  C CG1 . VAL B 1 89  ? 0.787   -2.039  40.623  1.00 9.57  ? 115  VAL B CG1 1 
ATOM   5515  C CG2 . VAL B 1 89  ? 1.161   -0.644  42.651  1.00 8.85  ? 115  VAL B CG2 1 
ATOM   5516  N N   . ILE B 1 90  ? -2.234  -3.437  41.069  1.00 8.28  ? 116  ILE B N   1 
ATOM   5517  C CA  . ILE B 1 90  ? -2.859  -4.629  40.475  1.00 6.84  ? 116  ILE B CA  1 
ATOM   5518  C C   . ILE B 1 90  ? -3.897  -5.294  41.378  1.00 8.30  ? 116  ILE B C   1 
ATOM   5519  O O   . ILE B 1 90  ? -5.031  -5.558  40.958  1.00 8.04  ? 116  ILE B O   1 
ATOM   5520  C CB  . ILE B 1 90  ? -1.809  -5.710  40.112  1.00 7.39  ? 116  ILE B CB  1 
ATOM   5521  C CG1 . ILE B 1 90  ? -0.870  -5.183  39.039  1.00 6.84  ? 116  ILE B CG1 1 
ATOM   5522  C CG2 . ILE B 1 90  ? -2.502  -7.004  39.654  1.00 9.10  ? 116  ILE B CG2 1 
ATOM   5523  C CD1 . ILE B 1 90  ? 0.278   -6.115  38.763  1.00 6.09  ? 116  ILE B CD1 1 
ATOM   5524  N N   . TYR B 1 91  ? -3.502  -5.550  42.623  1.00 6.66  ? 117  TYR B N   1 
ATOM   5525  C CA  . TYR B 1 91  ? -4.359  -6.217  43.589  1.00 8.23  ? 117  TYR B CA  1 
ATOM   5526  C C   . TYR B 1 91  ? -5.443  -5.353  44.211  1.00 9.39  ? 117  TYR B C   1 
ATOM   5527  O O   . TYR B 1 91  ? -6.435  -5.874  44.725  1.00 12.26 ? 117  TYR B O   1 
ATOM   5528  C CB  . TYR B 1 91  ? -3.497  -6.826  44.701  1.00 8.81  ? 117  TYR B CB  1 
ATOM   5529  C CG  . TYR B 1 91  ? -2.326  -7.624  44.161  1.00 10.65 ? 117  TYR B CG  1 
ATOM   5530  C CD1 . TYR B 1 91  ? -1.021  -7.348  44.565  1.00 10.18 ? 117  TYR B CD1 1 
ATOM   5531  C CD2 . TYR B 1 91  ? -2.515  -8.595  43.179  1.00 10.49 ? 117  TYR B CD2 1 
ATOM   5532  C CE1 . TYR B 1 91  ? 0.074   -8.011  43.991  1.00 10.51 ? 117  TYR B CE1 1 
ATOM   5533  C CE2 . TYR B 1 91  ? -1.443  -9.257  42.604  1.00 10.21 ? 117  TYR B CE2 1 
ATOM   5534  C CZ  . TYR B 1 91  ? -0.152  -8.964  43.001  1.00 13.29 ? 117  TYR B CZ  1 
ATOM   5535  O OH  . TYR B 1 91  ? 0.908   -9.581  42.370  1.00 15.13 ? 117  TYR B OH  1 
ATOM   5536  N N   . SER B 1 92  ? -5.279  -4.032  44.163  1.00 9.60  ? 118  SER B N   1 
ATOM   5537  C CA  . SER B 1 92  ? -6.255  -3.151  44.791  1.00 10.25 ? 118  SER B CA  1 
ATOM   5538  C C   . SER B 1 92  ? -6.684  -1.937  43.961  1.00 9.75  ? 118  SER B C   1 
ATOM   5539  O O   . SER B 1 92  ? -7.876  -1.728  43.729  1.00 9.68  ? 118  SER B O   1 
ATOM   5540  C CB  . SER B 1 92  ? -5.686  -2.673  46.133  1.00 9.13  ? 118  SER B CB  1 
ATOM   5541  O OG  . SER B 1 92  ? -6.627  -1.921  46.864  1.00 8.99  ? 118  SER B OG  1 
ATOM   5542  N N   . SER B 1 93  ? -5.705  -1.134  43.547  1.00 8.59  ? 119  SER B N   1 
ATOM   5543  C CA  . SER B 1 93  ? -5.953  0.081   42.787  1.00 8.89  ? 119  SER B CA  1 
ATOM   5544  C C   . SER B 1 93  ? -6.471  -0.202  41.375  1.00 7.31  ? 119  SER B C   1 
ATOM   5545  O O   . SER B 1 93  ? -5.747  -0.721  40.527  1.00 9.41  ? 119  SER B O   1 
ATOM   5546  C CB  . SER B 1 93  ? -4.668  0.907   42.743  1.00 9.84  ? 119  SER B CB  1 
ATOM   5547  O OG  . SER B 1 93  ? -4.200  1.168   44.064  1.00 9.14  ? 119  SER B OG  1 
ATOM   5548  N N   . PRO B 1 94  ? -7.738  0.140   41.107  1.00 7.93  ? 120  PRO B N   1 
ATOM   5549  C CA  . PRO B 1 94  ? -8.283  -0.117  39.764  1.00 10.46 ? 120  PRO B CA  1 
ATOM   5550  C C   . PRO B 1 94  ? -7.688  0.830   38.727  1.00 12.69 ? 120  PRO B C   1 
ATOM   5551  O O   . PRO B 1 94  ? -7.412  1.998   39.014  1.00 12.68 ? 120  PRO B O   1 
ATOM   5552  C CB  . PRO B 1 94  ? -9.786  0.097   39.945  1.00 8.30  ? 120  PRO B CB  1 
ATOM   5553  C CG  . PRO B 1 94  ? -10.001 -0.091  41.437  1.00 11.31 ? 120  PRO B CG  1 
ATOM   5554  C CD  . PRO B 1 94  ? -8.803  0.594   42.013  1.00 8.26  ? 120  PRO B CD  1 
ATOM   5555  N N   . GLY B 1 95  ? -7.470  0.311   37.528  1.00 12.24 ? 121  GLY B N   1 
ATOM   5556  C CA  . GLY B 1 95  ? -6.919  1.130   36.471  1.00 12.94 ? 121  GLY B CA  1 
ATOM   5557  C C   . GLY B 1 95  ? -8.028  1.543   35.525  1.00 14.81 ? 121  GLY B C   1 
ATOM   5558  O O   . GLY B 1 95  ? -9.090  0.919   35.477  1.00 14.20 ? 121  GLY B O   1 
ATOM   5559  N N   . VAL B 1 96  ? -7.793  2.612   34.773  1.00 14.61 ? 122  VAL B N   1 
ATOM   5560  C CA  . VAL B 1 96  ? -8.783  3.083   33.821  1.00 16.54 ? 122  VAL B CA  1 
ATOM   5561  C C   . VAL B 1 96  ? -8.095  3.492   32.523  1.00 17.90 ? 122  VAL B C   1 
ATOM   5562  O O   . VAL B 1 96  ? -7.119  4.247   32.532  1.00 17.65 ? 122  VAL B O   1 
ATOM   5563  C CB  . VAL B 1 96  ? -9.578  4.289   34.382  1.00 17.56 ? 122  VAL B CB  1 
ATOM   5564  C CG1 . VAL B 1 96  ? -10.575 4.766   33.346  1.00 19.21 ? 122  VAL B CG1 1 
ATOM   5565  C CG2 . VAL B 1 96  ? -10.308 3.896   35.668  1.00 18.33 ? 122  VAL B CG2 1 
ATOM   5566  N N   . ILE B 1 97  ? -8.588  2.968   31.405  1.00 17.46 ? 123  ILE B N   1 
ATOM   5567  C CA  . ILE B 1 97  ? -8.022  3.311   30.109  1.00 16.74 ? 123  ILE B CA  1 
ATOM   5568  C C   . ILE B 1 97  ? -9.033  4.262   29.455  1.00 14.51 ? 123  ILE B C   1 
ATOM   5569  O O   . ILE B 1 97  ? -10.223 3.947   29.335  1.00 13.89 ? 123  ILE B O   1 
ATOM   5570  C CB  . ILE B 1 97  ? -7.780  2.028   29.248  1.00 18.06 ? 123  ILE B CB  1 
ATOM   5571  C CG1 . ILE B 1 97  ? -6.748  2.295   28.156  1.00 20.05 ? 123  ILE B CG1 1 
ATOM   5572  C CG2 . ILE B 1 97  ? -9.067  1.561   28.614  1.00 21.22 ? 123  ILE B CG2 1 
ATOM   5573  C CD1 . ILE B 1 97  ? -7.195  3.280   27.124  1.00 21.62 ? 123  ILE B CD1 1 
ATOM   5574  N N   . LEU B 1 98  ? -8.569  5.448   29.080  1.00 13.69 ? 124  LEU B N   1 
ATOM   5575  C CA  . LEU B 1 98  ? -9.440  6.442   28.461  1.00 14.10 ? 124  LEU B CA  1 
ATOM   5576  C C   . LEU B 1 98  ? -9.221  6.445   26.951  1.00 16.25 ? 124  LEU B C   1 
ATOM   5577  O O   . LEU B 1 98  ? -8.302  5.794   26.458  1.00 14.48 ? 124  LEU B O   1 
ATOM   5578  C CB  . LEU B 1 98  ? -9.119  7.822   29.020  1.00 13.13 ? 124  LEU B CB  1 
ATOM   5579  C CG  . LEU B 1 98  ? -9.180  7.949   30.539  1.00 13.35 ? 124  LEU B CG  1 
ATOM   5580  C CD1 . LEU B 1 98  ? -8.495  9.238   30.973  1.00 10.37 ? 124  LEU B CD1 1 
ATOM   5581  C CD2 . LEU B 1 98  ? -10.634 7.894   30.993  1.00 11.88 ? 124  LEU B CD2 1 
ATOM   5582  N N   . PRO B 1 99  ? -10.077 7.162   26.195  1.00 16.26 ? 125  PRO B N   1 
ATOM   5583  C CA  . PRO B 1 99  ? -9.953  7.241   24.735  1.00 16.24 ? 125  PRO B CA  1 
ATOM   5584  C C   . PRO B 1 99  ? -8.604  7.850   24.374  1.00 17.00 ? 125  PRO B C   1 
ATOM   5585  O O   . PRO B 1 99  ? -8.191  8.839   24.979  1.00 16.67 ? 125  PRO B O   1 
ATOM   5586  C CB  . PRO B 1 99  ? -11.112 8.159   24.346  1.00 16.90 ? 125  PRO B CB  1 
ATOM   5587  C CG  . PRO B 1 99  ? -12.151 7.817   25.364  1.00 15.94 ? 125  PRO B CG  1 
ATOM   5588  C CD  . PRO B 1 99  ? -11.328 7.799   26.640  1.00 16.57 ? 125  PRO B CD  1 
ATOM   5589  N N   . LYS B 1 100 ? -7.924  7.270   23.390  1.00 15.63 ? 126  LYS B N   1 
ATOM   5590  C CA  . LYS B 1 100 ? -6.626  7.769   22.952  1.00 17.05 ? 126  LYS B CA  1 
ATOM   5591  C C   . LYS B 1 100 ? -6.759  9.158   22.322  1.00 17.55 ? 126  LYS B C   1 
ATOM   5592  O O   . LYS B 1 100 ? -7.656  9.392   21.522  1.00 18.72 ? 126  LYS B O   1 
ATOM   5593  C CB  . LYS B 1 100 ? -6.014  6.795   21.944  1.00 15.33 ? 126  LYS B CB  1 
ATOM   5594  C CG  . LYS B 1 100 ? -4.637  7.199   21.465  1.00 14.75 ? 126  LYS B CG  1 
ATOM   5595  C CD  . LYS B 1 100 ? -4.044  6.129   20.571  1.00 17.75 ? 126  LYS B CD  1 
ATOM   5596  C CE  . LYS B 1 100 ? -2.585  6.416   20.269  1.00 19.75 ? 126  LYS B CE  1 
ATOM   5597  N NZ  . LYS B 1 100 ? -1.945  5.272   19.567  1.00 22.65 ? 126  LYS B NZ  1 
ATOM   5598  N N   . GLN B 1 101 ? -5.867  10.070  22.686  1.00 18.53 ? 127  GLN B N   1 
ATOM   5599  C CA  . GLN B 1 101 ? -5.901  11.431  22.151  1.00 19.94 ? 127  GLN B CA  1 
ATOM   5600  C C   . GLN B 1 101 ? -5.182  11.488  20.829  1.00 21.36 ? 127  GLN B C   1 
ATOM   5601  O O   . GLN B 1 101 ? -4.512  10.531  20.448  1.00 22.73 ? 127  GLN B O   1 
ATOM   5602  C CB  . GLN B 1 101 ? -5.253  12.407  23.126  1.00 20.67 ? 127  GLN B CB  1 
ATOM   5603  C CG  . GLN B 1 101 ? -5.935  12.417  24.462  1.00 20.56 ? 127  GLN B CG  1 
ATOM   5604  C CD  . GLN B 1 101 ? -7.425  12.565  24.313  1.00 21.54 ? 127  GLN B CD  1 
ATOM   5605  O OE1 . GLN B 1 101 ? -7.909  13.590  23.835  1.00 22.90 ? 127  GLN B OE1 1 
ATOM   5606  N NE2 . GLN B 1 101 ? -8.168  11.540  24.708  1.00 20.52 ? 127  GLN B NE2 1 
ATOM   5607  N N   . ASP B 1 102 ? -5.288  12.626  20.145  1.00 22.71 ? 128  ASP B N   1 
ATOM   5608  C CA  . ASP B 1 102 ? -4.665  12.784  18.837  1.00 23.99 ? 128  ASP B CA  1 
ATOM   5609  C C   . ASP B 1 102 ? -3.303  13.467  18.780  1.00 24.64 ? 128  ASP B C   1 
ATOM   5610  O O   . ASP B 1 102 ? -2.711  13.554  17.706  1.00 25.88 ? 128  ASP B O   1 
ATOM   5611  C CB  . ASP B 1 102 ? -5.612  13.535  17.898  1.00 25.68 ? 128  ASP B CB  1 
ATOM   5612  C CG  . ASP B 1 102 ? -5.937  14.934  18.392  1.00 28.07 ? 128  ASP B CG  1 
ATOM   5613  O OD1 . ASP B 1 102 ? -5.107  15.518  19.124  1.00 27.94 ? 128  ASP B OD1 1 
ATOM   5614  O OD2 . ASP B 1 102 ? -7.010  15.464  18.034  1.00 28.31 ? 128  ASP B OD2 1 
ATOM   5615  N N   . PHE B 1 103 ? -2.794  13.956  19.905  1.00 22.47 ? 129  PHE B N   1 
ATOM   5616  C CA  . PHE B 1 103 ? -1.503  14.636  19.861  1.00 22.12 ? 129  PHE B CA  1 
ATOM   5617  C C   . PHE B 1 103 ? -0.404  13.688  19.409  1.00 23.62 ? 129  PHE B C   1 
ATOM   5618  O O   . PHE B 1 103 ? -0.419  12.504  19.740  1.00 25.26 ? 129  PHE B O   1 
ATOM   5619  C CB  . PHE B 1 103 ? -1.175  15.273  21.221  1.00 19.62 ? 129  PHE B CB  1 
ATOM   5620  C CG  . PHE B 1 103 ? -1.017  14.287  22.351  1.00 15.23 ? 129  PHE B CG  1 
ATOM   5621  C CD1 . PHE B 1 103 ? 0.147   13.540  22.483  1.00 15.15 ? 129  PHE B CD1 1 
ATOM   5622  C CD2 . PHE B 1 103 ? -2.012  14.148  23.311  1.00 13.48 ? 129  PHE B CD2 1 
ATOM   5623  C CE1 . PHE B 1 103 ? 0.326   12.666  23.560  1.00 15.19 ? 129  PHE B CE1 1 
ATOM   5624  C CE2 . PHE B 1 103 ? -1.849  13.281  24.392  1.00 14.26 ? 129  PHE B CE2 1 
ATOM   5625  C CZ  . PHE B 1 103 ? -0.676  12.538  24.517  1.00 13.71 ? 129  PHE B CZ  1 
ATOM   5626  N N   . VAL B 1 104 ? 0.542   14.210  18.634  1.00 24.16 ? 130  VAL B N   1 
ATOM   5627  C CA  . VAL B 1 104 ? 1.630   13.388  18.124  1.00 25.21 ? 130  VAL B CA  1 
ATOM   5628  C C   . VAL B 1 104 ? 3.006   13.929  18.458  1.00 26.74 ? 130  VAL B C   1 
ATOM   5629  O O   . VAL B 1 104 ? 4.013   13.373  18.015  1.00 26.68 ? 130  VAL B O   1 
ATOM   5630  C CB  . VAL B 1 104 ? 1.546   13.226  16.582  1.00 26.88 ? 130  VAL B CB  1 
ATOM   5631  C CG1 . VAL B 1 104 ? 0.265   12.515  16.206  1.00 26.13 ? 130  VAL B CG1 1 
ATOM   5632  C CG2 . VAL B 1 104 ? 1.622   14.589  15.907  1.00 26.27 ? 130  VAL B CG2 1 
ATOM   5633  N N   . ASP B 1 105 ? 3.045   15.020  19.223  1.00 26.61 ? 131  ASP B N   1 
ATOM   5634  C CA  . ASP B 1 105 ? 4.302   15.642  19.622  1.00 27.06 ? 131  ASP B CA  1 
ATOM   5635  C C   . ASP B 1 105 ? 4.238   16.098  21.077  1.00 25.24 ? 131  ASP B C   1 
ATOM   5636  O O   . ASP B 1 105 ? 3.165   16.119  21.682  1.00 23.99 ? 131  ASP B O   1 
ATOM   5637  C CB  . ASP B 1 105 ? 4.630   16.838  18.717  1.00 27.75 ? 131  ASP B CB  1 
ATOM   5638  C CG  . ASP B 1 105 ? 3.478   17.820  18.596  1.00 30.70 ? 131  ASP B CG  1 
ATOM   5639  O OD1 . ASP B 1 105 ? 2.897   18.209  19.633  1.00 30.19 ? 131  ASP B OD1 1 
ATOM   5640  O OD2 . ASP B 1 105 ? 3.160   18.216  17.453  1.00 35.84 ? 131  ASP B OD2 1 
ATOM   5641  N N   . LEU B 1 106 ? 5.389   16.468  21.622  1.00 25.96 ? 132  LEU B N   1 
ATOM   5642  C CA  . LEU B 1 106 ? 5.492   16.908  23.009  1.00 25.30 ? 132  LEU B CA  1 
ATOM   5643  C C   . LEU B 1 106 ? 4.546   18.061  23.324  1.00 25.55 ? 132  LEU B C   1 
ATOM   5644  O O   . LEU B 1 106 ? 3.895   18.066  24.371  1.00 25.57 ? 132  LEU B O   1 
ATOM   5645  C CB  . LEU B 1 106 ? 6.941   17.299  23.332  1.00 27.00 ? 132  LEU B CB  1 
ATOM   5646  C CG  . LEU B 1 106 ? 7.284   17.664  24.783  1.00 27.86 ? 132  LEU B CG  1 
ATOM   5647  C CD1 . LEU B 1 106 ? 7.033   19.143  25.021  1.00 29.23 ? 132  LEU B CD1 1 
ATOM   5648  C CD2 . LEU B 1 106 ? 6.465   16.800  25.736  1.00 25.75 ? 132  LEU B CD2 1 
ATOM   5649  N N   . GLN B 1 107 ? 4.457   19.035  22.416  1.00 24.49 ? 133  GLN B N   1 
ATOM   5650  C CA  . GLN B 1 107 ? 3.571   20.171  22.628  1.00 24.19 ? 133  GLN B CA  1 
ATOM   5651  C C   . GLN B 1 107 ? 2.133   19.712  22.787  1.00 22.92 ? 133  GLN B C   1 
ATOM   5652  O O   . GLN B 1 107 ? 1.385   20.247  23.602  1.00 23.15 ? 133  GLN B O   1 
ATOM   5653  C CB  . GLN B 1 107 ? 3.665   21.165  21.463  1.00 27.16 ? 133  GLN B CB  1 
ATOM   5654  C CG  . GLN B 1 107 ? 2.591   22.254  21.502  1.00 32.02 ? 133  GLN B CG  1 
ATOM   5655  C CD  . GLN B 1 107 ? 2.814   23.341  20.471  1.00 35.99 ? 133  GLN B CD  1 
ATOM   5656  O OE1 . GLN B 1 107 ? 3.035   23.060  19.294  1.00 38.70 ? 133  GLN B OE1 1 
ATOM   5657  N NE2 . GLN B 1 107 ? 2.749   24.594  20.908  1.00 36.14 ? 133  GLN B NE2 1 
ATOM   5658  N N   . GLY B 1 108 ? 1.741   18.712  21.993  1.00 20.87 ? 134  GLY B N   1 
ATOM   5659  C CA  . GLY B 1 108 ? 0.390   18.208  22.076  1.00 17.14 ? 134  GLY B CA  1 
ATOM   5660  C C   . GLY B 1 108 ? 0.153   17.418  23.351  1.00 15.32 ? 134  GLY B C   1 
ATOM   5661  O O   . GLY B 1 108 ? -0.923  17.493  23.943  1.00 15.27 ? 134  GLY B O   1 
ATOM   5662  N N   . GLN B 1 109 ? 1.151   16.652  23.774  1.00 14.25 ? 135  GLN B N   1 
ATOM   5663  C CA  . GLN B 1 109 ? 1.013   15.865  24.994  1.00 14.81 ? 135  GLN B CA  1 
ATOM   5664  C C   . GLN B 1 109 ? 0.802   16.807  26.176  1.00 15.04 ? 135  GLN B C   1 
ATOM   5665  O O   . GLN B 1 109 ? -0.074  16.577  27.012  1.00 17.75 ? 135  GLN B O   1 
ATOM   5666  C CB  . GLN B 1 109 ? 2.264   15.009  25.233  1.00 16.35 ? 135  GLN B CB  1 
ATOM   5667  C CG  . GLN B 1 109 ? 2.200   14.129  26.484  1.00 17.74 ? 135  GLN B CG  1 
ATOM   5668  C CD  . GLN B 1 109 ? 3.463   13.313  26.726  1.00 20.51 ? 135  GLN B CD  1 
ATOM   5669  O OE1 . GLN B 1 109 ? 3.523   12.496  27.651  1.00 22.82 ? 135  GLN B OE1 1 
ATOM   5670  N NE2 . GLN B 1 109 ? 4.478   13.527  25.895  1.00 20.30 ? 135  GLN B NE2 1 
ATOM   5671  N N   . LEU B 1 110 ? 1.594   17.875  26.237  1.00 15.72 ? 136  LEU B N   1 
ATOM   5672  C CA  . LEU B 1 110 ? 1.483   18.828  27.335  1.00 15.90 ? 136  LEU B CA  1 
ATOM   5673  C C   . LEU B 1 110 ? 0.191   19.620  27.255  1.00 15.93 ? 136  LEU B C   1 
ATOM   5674  O O   . LEU B 1 110 ? -0.442  19.908  28.268  1.00 17.00 ? 136  LEU B O   1 
ATOM   5675  C CB  . LEU B 1 110 ? 2.695   19.771  27.355  1.00 14.95 ? 136  LEU B CB  1 
ATOM   5676  C CG  . LEU B 1 110 ? 4.060   19.119  27.625  1.00 16.25 ? 136  LEU B CG  1 
ATOM   5677  C CD1 . LEU B 1 110 ? 5.096   20.210  27.835  1.00 17.32 ? 136  LEU B CD1 1 
ATOM   5678  C CD2 . LEU B 1 110 ? 3.999   18.216  28.856  1.00 17.69 ? 136  LEU B CD2 1 
ATOM   5679  N N   . ARG B 1 111 ? -0.206  19.961  26.041  1.00 14.02 ? 137  ARG B N   1 
ATOM   5680  C CA  . ARG B 1 111 ? -1.438  20.698  25.847  1.00 15.36 ? 137  ARG B CA  1 
ATOM   5681  C C   . ARG B 1 111 ? -2.623  19.927  26.431  1.00 13.22 ? 137  ARG B C   1 
ATOM   5682  O O   . ARG B 1 111 ? -3.430  20.478  27.172  1.00 14.62 ? 137  ARG B O   1 
ATOM   5683  C CB  . ARG B 1 111 ? -1.662  20.940  24.358  1.00 19.02 ? 137  ARG B CB  1 
ATOM   5684  C CG  . ARG B 1 111 ? -2.027  22.352  24.033  1.00 25.20 ? 137  ARG B CG  1 
ATOM   5685  C CD  . ARG B 1 111 ? -0.808  23.250  24.012  1.00 28.03 ? 137  ARG B CD  1 
ATOM   5686  N NE  . ARG B 1 111 ? -1.130  24.561  24.561  1.00 32.89 ? 137  ARG B NE  1 
ATOM   5687  C CZ  . ARG B 1 111 ? -0.396  25.657  24.384  1.00 32.26 ? 137  ARG B CZ  1 
ATOM   5688  N NH1 . ARG B 1 111 ? 0.714   25.612  23.660  1.00 33.98 ? 137  ARG B NH1 1 
ATOM   5689  N NH2 . ARG B 1 111 ? -0.767  26.791  24.956  1.00 31.02 ? 137  ARG B NH2 1 
ATOM   5690  N N   . PHE B 1 112 ? -2.738  18.651  26.084  1.00 11.15 ? 138  PHE B N   1 
ATOM   5691  C CA  . PHE B 1 112 ? -3.837  17.828  26.593  1.00 11.35 ? 138  PHE B CA  1 
ATOM   5692  C C   . PHE B 1 112 ? -3.744  17.690  28.115  1.00 12.16 ? 138  PHE B C   1 
ATOM   5693  O O   . PHE B 1 112 ? -4.754  17.771  28.820  1.00 13.70 ? 138  PHE B O   1 
ATOM   5694  C CB  . PHE B 1 112 ? -3.797  16.438  25.957  1.00 9.74  ? 138  PHE B CB  1 
ATOM   5695  C CG  . PHE B 1 112 ? -4.750  15.463  26.584  1.00 11.17 ? 138  PHE B CG  1 
ATOM   5696  C CD1 . PHE B 1 112 ? -6.126  15.598  26.402  1.00 10.49 ? 138  PHE B CD1 1 
ATOM   5697  C CD2 . PHE B 1 112 ? -4.278  14.421  27.370  1.00 10.54 ? 138  PHE B CD2 1 
ATOM   5698  C CE1 . PHE B 1 112 ? -7.018  14.711  26.994  1.00 12.60 ? 138  PHE B CE1 1 
ATOM   5699  C CE2 . PHE B 1 112 ? -5.165  13.523  27.971  1.00 13.49 ? 138  PHE B CE2 1 
ATOM   5700  C CZ  . PHE B 1 112 ? -6.534  13.665  27.786  1.00 12.49 ? 138  PHE B CZ  1 
ATOM   5701  N N   . ALA B 1 113 ? -2.532  17.476  28.612  1.00 12.02 ? 139  ALA B N   1 
ATOM   5702  C CA  . ALA B 1 113 ? -2.320  17.335  30.046  1.00 12.53 ? 139  ALA B CA  1 
ATOM   5703  C C   . ALA B 1 113 ? -2.788  18.613  30.751  1.00 12.93 ? 139  ALA B C   1 
ATOM   5704  O O   . ALA B 1 113 ? -3.405  18.549  31.817  1.00 13.22 ? 139  ALA B O   1 
ATOM   5705  C CB  . ALA B 1 113 ? -0.839  17.062  30.329  1.00 12.29 ? 139  ALA B CB  1 
ATOM   5706  N N   . ALA B 1 114 ? -2.512  19.764  30.146  1.00 12.53 ? 140  ALA B N   1 
ATOM   5707  C CA  . ALA B 1 114 ? -2.920  21.038  30.727  1.00 12.26 ? 140  ALA B CA  1 
ATOM   5708  C C   . ALA B 1 114 ? -4.445  21.161  30.762  1.00 13.53 ? 140  ALA B C   1 
ATOM   5709  O O   . ALA B 1 114 ? -5.012  21.621  31.746  1.00 11.26 ? 140  ALA B O   1 
ATOM   5710  C CB  . ALA B 1 114 ? -2.295  22.205  29.948  1.00 9.73  ? 140  ALA B CB  1 
ATOM   5711  N N   . LYS B 1 115 ? -5.116  20.746  29.683  1.00 14.17 ? 141  LYS B N   1 
ATOM   5712  C CA  . LYS B 1 115 ? -6.576  20.817  29.642  1.00 14.10 ? 141  LYS B CA  1 
ATOM   5713  C C   . LYS B 1 115 ? -7.208  19.843  30.614  1.00 11.58 ? 141  LYS B C   1 
ATOM   5714  O O   . LYS B 1 115 ? -8.236  20.132  31.214  1.00 10.53 ? 141  LYS B O   1 
ATOM   5715  C CB  . LYS B 1 115 ? -7.102  20.529  28.238  1.00 17.76 ? 141  LYS B CB  1 
ATOM   5716  C CG  . LYS B 1 115 ? -6.986  21.698  27.308  1.00 25.36 ? 141  LYS B CG  1 
ATOM   5717  C CD  . LYS B 1 115 ? -8.353  22.273  26.977  1.00 30.91 ? 141  LYS B CD  1 
ATOM   5718  C CE  . LYS B 1 115 ? -9.115  21.385  26.001  1.00 31.77 ? 141  LYS B CE  1 
ATOM   5719  N NZ  . LYS B 1 115 ? -10.311 22.090  25.452  1.00 34.98 ? 141  LYS B NZ  1 
ATOM   5720  N N   . LEU B 1 116 ? -6.592  18.676  30.751  1.00 11.96 ? 142  LEU B N   1 
ATOM   5721  C CA  . LEU B 1 116 ? -7.088  17.654  31.665  1.00 10.21 ? 142  LEU B CA  1 
ATOM   5722  C C   . LEU B 1 116 ? -7.031  18.212  33.085  1.00 7.69  ? 142  LEU B C   1 
ATOM   5723  O O   . LEU B 1 116 ? -7.991  18.101  33.847  1.00 10.18 ? 142  LEU B O   1 
ATOM   5724  C CB  . LEU B 1 116 ? -6.224  16.391  31.541  1.00 10.57 ? 142  LEU B CB  1 
ATOM   5725  C CG  . LEU B 1 116 ? -6.603  15.127  32.319  1.00 13.13 ? 142  LEU B CG  1 
ATOM   5726  C CD1 . LEU B 1 116 ? -6.035  13.905  31.621  1.00 11.91 ? 142  LEU B CD1 1 
ATOM   5727  C CD2 . LEU B 1 116 ? -6.076  15.205  33.735  1.00 12.13 ? 142  LEU B CD2 1 
ATOM   5728  N N   . ILE B 1 117 ? -5.910  18.819  33.433  1.00 9.56  ? 143  ILE B N   1 
ATOM   5729  C CA  . ILE B 1 117 ? -5.751  19.405  34.760  1.00 8.29  ? 143  ILE B CA  1 
ATOM   5730  C C   . ILE B 1 117 ? -6.855  20.435  34.970  1.00 10.86 ? 143  ILE B C   1 
ATOM   5731  O O   . ILE B 1 117 ? -7.526  20.457  36.002  1.00 10.24 ? 143  ILE B O   1 
ATOM   5732  C CB  . ILE B 1 117 ? -4.371  20.083  34.906  1.00 8.48  ? 143  ILE B CB  1 
ATOM   5733  C CG1 . ILE B 1 117 ? -3.275  19.010  34.986  1.00 7.83  ? 143  ILE B CG1 1 
ATOM   5734  C CG2 . ILE B 1 117 ? -4.325  20.957  36.151  1.00 9.85  ? 143  ILE B CG2 1 
ATOM   5735  C CD1 . ILE B 1 117 ? -1.875  19.539  34.738  1.00 4.80  ? 143  ILE B CD1 1 
ATOM   5736  N N   . GLU B 1 118 ? -7.065  21.288  33.955  1.00 11.33 ? 144  GLU B N   1 
ATOM   5737  C CA  . GLU B 1 118 ? -8.082  22.314  34.048  1.00 12.66 ? 144  GLU B CA  1 
ATOM   5738  C C   . GLU B 1 118 ? -9.459  21.703  34.264  1.00 10.14 ? 144  GLU B C   1 
ATOM   5739  O O   . GLU B 1 118 ? -10.260 22.218  35.028  1.00 9.46  ? 144  GLU B O   1 
ATOM   5740  C CB  . GLU B 1 118 ? -8.050  23.186  32.779  1.00 15.12 ? 144  GLU B CB  1 
ATOM   5741  C CG  . GLU B 1 118 ? -9.012  24.377  32.779  1.00 22.74 ? 144  GLU B CG  1 
ATOM   5742  C CD  . GLU B 1 118 ? -8.853  25.249  31.533  1.00 28.83 ? 144  GLU B CD  1 
ATOM   5743  O OE1 . GLU B 1 118 ? -8.705  24.685  30.427  1.00 33.44 ? 144  GLU B OE1 1 
ATOM   5744  O OE2 . GLU B 1 118 ? -8.883  26.494  31.649  1.00 32.29 ? 144  GLU B OE2 1 
ATOM   5745  N N   . GLY B 1 119 ? -9.733  20.591  33.598  1.00 11.20 ? 145  GLY B N   1 
ATOM   5746  C CA  . GLY B 1 119 ? -11.023 19.951  33.750  1.00 9.87  ? 145  GLY B CA  1 
ATOM   5747  C C   . GLY B 1 119 ? -11.222 19.413  35.158  1.00 9.61  ? 145  GLY B C   1 
ATOM   5748  O O   . GLY B 1 119 ? -12.334 19.450  35.690  1.00 7.07  ? 145  GLY B O   1 
ATOM   5749  N N   . VAL B 1 120 ? -10.161 18.904  35.775  1.00 11.10 ? 146  VAL B N   1 
ATOM   5750  C CA  . VAL B 1 120 ? -10.307 18.388  37.127  1.00 11.06 ? 146  VAL B CA  1 
ATOM   5751  C C   . VAL B 1 120 ? -10.634 19.548  38.069  1.00 12.35 ? 146  VAL B C   1 
ATOM   5752  O O   . VAL B 1 120 ? -11.461 19.413  38.970  1.00 12.15 ? 146  VAL B O   1 
ATOM   5753  C CB  . VAL B 1 120 ? -9.023  17.672  37.611  1.00 12.37 ? 146  VAL B CB  1 
ATOM   5754  C CG1 . VAL B 1 120 ? -9.238  17.149  39.030  1.00 12.82 ? 146  VAL B CG1 1 
ATOM   5755  C CG2 . VAL B 1 120 ? -8.665  16.514  36.666  1.00 11.13 ? 146  VAL B CG2 1 
ATOM   5756  N N   . LEU B 1 121 ? -9.994  20.700  37.854  1.00 13.87 ? 147  LEU B N   1 
ATOM   5757  C CA  . LEU B 1 121 ? -10.241 21.858  38.709  1.00 14.12 ? 147  LEU B CA  1 
ATOM   5758  C C   . LEU B 1 121 ? -11.690 22.308  38.589  1.00 15.36 ? 147  LEU B C   1 
ATOM   5759  O O   . LEU B 1 121 ? -12.336 22.635  39.583  1.00 14.28 ? 147  LEU B O   1 
ATOM   5760  C CB  . LEU B 1 121 ? -9.308  23.015  38.339  1.00 12.95 ? 147  LEU B CB  1 
ATOM   5761  C CG  . LEU B 1 121 ? -7.808  22.732  38.461  1.00 14.38 ? 147  LEU B CG  1 
ATOM   5762  C CD1 . LEU B 1 121 ? -7.017  23.976  38.089  1.00 15.49 ? 147  LEU B CD1 1 
ATOM   5763  C CD2 . LEU B 1 121 ? -7.476  22.290  39.879  1.00 13.94 ? 147  LEU B CD2 1 
ATOM   5764  N N   . ASP B 1 122 ? -12.208 22.310  37.359  1.00 15.46 ? 148  ASP B N   1 
ATOM   5765  C CA  . ASP B 1 122 ? -13.591 22.709  37.121  1.00 15.78 ? 148  ASP B CA  1 
ATOM   5766  C C   . ASP B 1 122 ? -14.532 21.810  37.920  1.00 15.72 ? 148  ASP B C   1 
ATOM   5767  O O   . ASP B 1 122 ? -15.478 22.281  38.550  1.00 16.21 ? 148  ASP B O   1 
ATOM   5768  C CB  . ASP B 1 122 ? -13.912 22.611  35.630  1.00 16.97 ? 148  ASP B CB  1 
ATOM   5769  C CG  . ASP B 1 122 ? -15.229 23.266  35.279  1.00 17.52 ? 148  ASP B CG  1 
ATOM   5770  O OD1 . ASP B 1 122 ? -15.299 24.512  35.317  1.00 18.92 ? 148  ASP B OD1 1 
ATOM   5771  O OD2 . ASP B 1 122 ? -16.193 22.537  34.977  1.00 17.61 ? 148  ASP B OD2 1 
ATOM   5772  N N   . PHE B 1 123 ? -14.271 20.506  37.896  1.00 15.65 ? 149  PHE B N   1 
ATOM   5773  C CA  . PHE B 1 123 ? -15.097 19.566  38.640  1.00 14.79 ? 149  PHE B CA  1 
ATOM   5774  C C   . PHE B 1 123 ? -14.909 19.805  40.142  1.00 14.08 ? 149  PHE B C   1 
ATOM   5775  O O   . PHE B 1 123 ? -15.853 19.698  40.921  1.00 13.33 ? 149  PHE B O   1 
ATOM   5776  C CB  . PHE B 1 123 ? -14.708 18.127  38.275  1.00 15.30 ? 149  PHE B CB  1 
ATOM   5777  C CG  . PHE B 1 123 ? -15.552 17.073  38.948  1.00 16.87 ? 149  PHE B CG  1 
ATOM   5778  C CD1 . PHE B 1 123 ? -15.205 16.582  40.200  1.00 16.70 ? 149  PHE B CD1 1 
ATOM   5779  C CD2 . PHE B 1 123 ? -16.694 16.573  38.329  1.00 16.03 ? 149  PHE B CD2 1 
ATOM   5780  C CE1 . PHE B 1 123 ? -15.980 15.609  40.824  1.00 18.37 ? 149  PHE B CE1 1 
ATOM   5781  C CE2 . PHE B 1 123 ? -17.474 15.603  38.940  1.00 16.27 ? 149  PHE B CE2 1 
ATOM   5782  C CZ  . PHE B 1 123 ? -17.120 15.116  40.191  1.00 17.77 ? 149  PHE B CZ  1 
ATOM   5783  N N   . LYS B 1 124 ? -13.695 20.151  40.542  1.00 14.04 ? 150  LYS B N   1 
ATOM   5784  C CA  . LYS B 1 124 ? -13.409 20.393  41.949  1.00 15.84 ? 150  LYS B CA  1 
ATOM   5785  C C   . LYS B 1 124 ? -14.164 21.601  42.497  1.00 18.32 ? 150  LYS B C   1 
ATOM   5786  O O   . LYS B 1 124 ? -14.599 21.597  43.651  1.00 18.65 ? 150  LYS B O   1 
ATOM   5787  C CB  . LYS B 1 124 ? -11.901 20.567  42.150  1.00 15.43 ? 150  LYS B CB  1 
ATOM   5788  C CG  . LYS B 1 124 ? -11.478 20.945  43.567  1.00 14.98 ? 150  LYS B CG  1 
ATOM   5789  C CD  . LYS B 1 124 ? -9.973  20.813  43.731  1.00 14.79 ? 150  LYS B CD  1 
ATOM   5790  C CE  . LYS B 1 124 ? -9.534  21.296  45.099  1.00 16.03 ? 150  LYS B CE  1 
ATOM   5791  N NZ  . LYS B 1 124 ? -9.773  22.754  45.206  1.00 18.08 ? 150  LYS B NZ  1 
ATOM   5792  N N   . SER B 1 125 ? -14.345 22.629  41.666  1.00 18.07 ? 151  SER B N   1 
ATOM   5793  C CA  . SER B 1 125 ? -15.052 23.816  42.119  1.00 17.48 ? 151  SER B CA  1 
ATOM   5794  C C   . SER B 1 125 ? -16.433 23.446  42.639  1.00 17.46 ? 151  SER B C   1 
ATOM   5795  O O   . SER B 1 125 ? -16.931 24.074  43.570  1.00 17.46 ? 151  SER B O   1 
ATOM   5796  C CB  . SER B 1 125 ? -15.181 24.837  40.985  1.00 16.58 ? 151  SER B CB  1 
ATOM   5797  O OG  . SER B 1 125 ? -16.096 24.392  40.007  1.00 19.85 ? 151  SER B OG  1 
ATOM   5798  N N   . MET B 1 126 ? -17.049 22.428  42.042  1.00 16.81 ? 152  MET B N   1 
ATOM   5799  C CA  . MET B 1 126 ? -18.377 21.990  42.467  1.00 18.58 ? 152  MET B CA  1 
ATOM   5800  C C   . MET B 1 126 ? -18.285 21.260  43.799  1.00 18.81 ? 152  MET B C   1 
ATOM   5801  O O   . MET B 1 126 ? -19.196 21.337  44.629  1.00 19.66 ? 152  MET B O   1 
ATOM   5802  C CB  . MET B 1 126 ? -19.021 21.078  41.417  1.00 20.39 ? 152  MET B CB  1 
ATOM   5803  C CG  . MET B 1 126 ? -19.357 21.783  40.107  1.00 21.77 ? 152  MET B CG  1 
ATOM   5804  S SD  . MET B 1 126 ? -20.370 20.760  39.011  1.00 25.05 ? 152  MET B SD  1 
ATOM   5805  C CE  . MET B 1 126 ? -19.117 19.696  38.311  1.00 22.73 ? 152  MET B CE  1 
ATOM   5806  N N   . ILE B 1 127 ? -17.183 20.545  44.001  1.00 18.70 ? 153  ILE B N   1 
ATOM   5807  C CA  . ILE B 1 127 ? -16.976 19.837  45.255  1.00 19.41 ? 153  ILE B CA  1 
ATOM   5808  C C   . ILE B 1 127 ? -16.744 20.862  46.369  1.00 20.22 ? 153  ILE B C   1 
ATOM   5809  O O   . ILE B 1 127 ? -17.338 20.759  47.444  1.00 19.92 ? 153  ILE B O   1 
ATOM   5810  C CB  . ILE B 1 127 ? -15.758 18.893  45.163  1.00 19.81 ? 153  ILE B CB  1 
ATOM   5811  C CG1 . ILE B 1 127 ? -16.078 17.739  44.202  1.00 20.23 ? 153  ILE B CG1 1 
ATOM   5812  C CG2 . ILE B 1 127 ? -15.375 18.378  46.549  1.00 17.54 ? 153  ILE B CG2 1 
ATOM   5813  C CD1 . ILE B 1 127 ? -14.956 16.755  44.022  1.00 19.44 ? 153  ILE B CD1 1 
ATOM   5814  N N   . ASP B 1 128 ? -15.902 21.857  46.108  1.00 20.11 ? 154  ASP B N   1 
ATOM   5815  C CA  . ASP B 1 128 ? -15.618 22.873  47.120  1.00 23.45 ? 154  ASP B CA  1 
ATOM   5816  C C   . ASP B 1 128 ? -16.826 23.742  47.419  1.00 25.06 ? 154  ASP B C   1 
ATOM   5817  O O   . ASP B 1 128 ? -17.005 24.182  48.552  1.00 27.12 ? 154  ASP B O   1 
ATOM   5818  C CB  . ASP B 1 128 ? -14.453 23.765  46.696  1.00 22.46 ? 154  ASP B CB  1 
ATOM   5819  C CG  . ASP B 1 128 ? -13.148 23.013  46.614  1.00 23.35 ? 154  ASP B CG  1 
ATOM   5820  O OD1 . ASP B 1 128 ? -12.893 22.148  47.482  1.00 27.33 ? 154  ASP B OD1 1 
ATOM   5821  O OD2 . ASP B 1 128 ? -12.365 23.303  45.689  1.00 25.40 ? 154  ASP B OD2 1 
ATOM   5822  N N   . ASN B 1 129 ? -17.651 23.993  46.407  1.00 25.72 ? 155  ASN B N   1 
ATOM   5823  C CA  . ASN B 1 129 ? -18.836 24.821  46.595  1.00 27.20 ? 155  ASN B CA  1 
ATOM   5824  C C   . ASN B 1 129 ? -20.053 23.990  46.972  1.00 27.98 ? 155  ASN B C   1 
ATOM   5825  O O   . ASN B 1 129 ? -21.144 24.525  47.166  1.00 27.98 ? 155  ASN B O   1 
ATOM   5826  C CB  . ASN B 1 129 ? -19.138 25.622  45.324  1.00 27.60 ? 155  ASN B CB  1 
ATOM   5827  C CG  . ASN B 1 129 ? -18.012 26.569  44.951  1.00 28.06 ? 155  ASN B CG  1 
ATOM   5828  O OD1 . ASN B 1 129 ? -17.355 27.137  45.821  1.00 27.55 ? 155  ASN B OD1 1 
ATOM   5829  N ND2 . ASN B 1 129 ? -17.796 26.753  43.651  1.00 27.75 ? 155  ASN B ND2 1 
ATOM   5830  N N   . GLU B 1 130 ? -19.862 22.679  47.081  1.00 27.42 ? 156  GLU B N   1 
ATOM   5831  C CA  . GLU B 1 130 ? -20.955 21.782  47.427  1.00 27.91 ? 156  GLU B CA  1 
ATOM   5832  C C   . GLU B 1 130 ? -22.159 21.999  46.512  1.00 27.38 ? 156  GLU B C   1 
ATOM   5833  O O   . GLU B 1 130 ? -23.299 22.025  46.967  1.00 26.98 ? 156  GLU B O   1 
ATOM   5834  C CB  . GLU B 1 130 ? -21.362 21.984  48.891  1.00 28.24 ? 156  GLU B CB  1 
ATOM   5835  C CG  . GLU B 1 130 ? -20.363 21.420  49.889  1.00 31.22 ? 156  GLU B CG  1 
ATOM   5836  C CD  . GLU B 1 130 ? -20.729 21.731  51.329  1.00 32.40 ? 156  GLU B CD  1 
ATOM   5837  O OE1 . GLU B 1 130 ? -21.924 21.640  51.675  1.00 34.25 ? 156  GLU B OE1 1 
ATOM   5838  O OE2 . GLU B 1 130 ? -19.817 22.054  52.121  1.00 34.43 ? 156  GLU B OE2 1 
ATOM   5839  N N   . THR B 1 131 ? -21.896 22.156  45.219  1.00 27.35 ? 157  THR B N   1 
ATOM   5840  C CA  . THR B 1 131 ? -22.956 22.362  44.240  1.00 26.98 ? 157  THR B CA  1 
ATOM   5841  C C   . THR B 1 131 ? -23.044 21.183  43.281  1.00 27.52 ? 157  THR B C   1 
ATOM   5842  O O   . THR B 1 131 ? -23.762 21.219  42.282  1.00 26.43 ? 157  THR B O   1 
ATOM   5843  C CB  . THR B 1 131 ? -22.714 23.644  43.438  1.00 27.90 ? 157  THR B CB  1 
ATOM   5844  O OG1 . THR B 1 131 ? -21.348 23.689  43.004  1.00 28.26 ? 157  THR B OG1 1 
ATOM   5845  C CG2 . THR B 1 131 ? -23.024 24.869  44.295  1.00 25.71 ? 157  THR B CG2 1 
ATOM   5846  N N   . LEU B 1 132 ? -22.311 20.125  43.600  1.00 28.01 ? 158  LEU B N   1 
ATOM   5847  C CA  . LEU B 1 132 ? -22.317 18.935  42.772  1.00 28.63 ? 158  LEU B CA  1 
ATOM   5848  C C   . LEU B 1 132 ? -23.747 18.390  42.683  1.00 28.96 ? 158  LEU B C   1 
ATOM   5849  O O   . LEU B 1 132 ? -24.382 18.100  43.697  1.00 29.41 ? 158  LEU B O   1 
ATOM   5850  C CB  . LEU B 1 132 ? -21.366 17.899  43.375  1.00 29.35 ? 158  LEU B CB  1 
ATOM   5851  C CG  . LEU B 1 132 ? -20.741 16.880  42.427  1.00 29.14 ? 158  LEU B CG  1 
ATOM   5852  C CD1 . LEU B 1 132 ? -20.055 17.582  41.268  1.00 30.67 ? 158  LEU B CD1 1 
ATOM   5853  C CD2 . LEU B 1 132 ? -19.736 16.056  43.198  1.00 30.88 ? 158  LEU B CD2 1 
ATOM   5854  N N   . PRO B 1 133 ? -24.276 18.264  41.457  1.00 28.16 ? 159  PRO B N   1 
ATOM   5855  C CA  . PRO B 1 133 ? -25.628 17.763  41.205  1.00 28.47 ? 159  PRO B CA  1 
ATOM   5856  C C   . PRO B 1 133 ? -25.948 16.466  41.939  1.00 28.74 ? 159  PRO B C   1 
ATOM   5857  O O   . PRO B 1 133 ? -25.105 15.583  42.055  1.00 27.59 ? 159  PRO B O   1 
ATOM   5858  C CB  . PRO B 1 133 ? -25.645 17.574  39.691  1.00 29.33 ? 159  PRO B CB  1 
ATOM   5859  C CG  . PRO B 1 133 ? -24.736 18.658  39.219  1.00 28.73 ? 159  PRO B CG  1 
ATOM   5860  C CD  . PRO B 1 133 ? -23.590 18.574  40.189  1.00 28.53 ? 159  PRO B CD  1 
ATOM   5861  N N   . VAL B 1 134 ? -27.182 16.358  42.414  1.00 29.80 ? 160  VAL B N   1 
ATOM   5862  C CA  . VAL B 1 134 ? -27.642 15.174  43.126  1.00 31.68 ? 160  VAL B CA  1 
ATOM   5863  C C   . VAL B 1 134 ? -27.811 13.993  42.172  1.00 31.90 ? 160  VAL B C   1 
ATOM   5864  O O   . VAL B 1 134 ? -28.422 14.121  41.110  1.00 33.28 ? 160  VAL B O   1 
ATOM   5865  C CB  . VAL B 1 134 ? -28.990 15.438  43.816  1.00 32.91 ? 160  VAL B CB  1 
ATOM   5866  C CG1 . VAL B 1 134 ? -29.490 14.165  44.472  1.00 34.21 ? 160  VAL B CG1 1 
ATOM   5867  C CG2 . VAL B 1 134 ? -28.840 16.562  44.834  1.00 34.65 ? 160  VAL B CG2 1 
ATOM   5868  N N   . GLU B 1 135 ? -27.272 12.842  42.554  1.00 31.14 ? 161  GLU B N   1 
ATOM   5869  C CA  . GLU B 1 135 ? -27.367 11.646  41.724  1.00 31.01 ? 161  GLU B CA  1 
ATOM   5870  C C   . GLU B 1 135 ? -28.406 10.666  42.257  1.00 31.00 ? 161  GLU B C   1 
ATOM   5871  O O   . GLU B 1 135 ? -28.686 10.635  43.456  1.00 28.54 ? 161  GLU B O   1 
ATOM   5872  C CB  . GLU B 1 135 ? -25.999 10.960  41.643  1.00 31.28 ? 161  GLU B CB  1 
ATOM   5873  C CG  . GLU B 1 135 ? -25.030 11.611  40.660  1.00 34.05 ? 161  GLU B CG  1 
ATOM   5874  C CD  . GLU B 1 135 ? -23.615 11.068  40.775  1.00 35.60 ? 161  GLU B CD  1 
ATOM   5875  O OE1 . GLU B 1 135 ? -22.848 11.178  39.796  1.00 37.68 ? 161  GLU B OE1 1 
ATOM   5876  O OE2 . GLU B 1 135 ? -23.259 10.544  41.852  1.00 35.54 ? 161  GLU B OE2 1 
ATOM   5877  N N   . PHE B 1 136 ? -28.981 9.873   41.358  1.00 31.68 ? 162  PHE B N   1 
ATOM   5878  C CA  . PHE B 1 136 ? -29.974 8.875   41.745  1.00 34.85 ? 162  PHE B CA  1 
ATOM   5879  C C   . PHE B 1 136 ? -29.609 7.523   41.139  1.00 36.39 ? 162  PHE B C   1 
ATOM   5880  O O   . PHE B 1 136 ? -28.931 7.458   40.113  1.00 36.73 ? 162  PHE B O   1 
ATOM   5881  C CB  . PHE B 1 136 ? -31.374 9.278   41.270  1.00 34.58 ? 162  PHE B CB  1 
ATOM   5882  C CG  . PHE B 1 136 ? -31.816 10.628  41.755  1.00 35.98 ? 162  PHE B CG  1 
ATOM   5883  C CD1 . PHE B 1 136 ? -31.391 11.785  41.109  1.00 37.75 ? 162  PHE B CD1 1 
ATOM   5884  C CD2 . PHE B 1 136 ? -32.638 10.748  42.872  1.00 35.84 ? 162  PHE B CD2 1 
ATOM   5885  C CE1 . PHE B 1 136 ? -31.778 13.044  41.568  1.00 38.39 ? 162  PHE B CE1 1 
ATOM   5886  C CE2 . PHE B 1 136 ? -33.029 12.001  43.338  1.00 36.95 ? 162  PHE B CE2 1 
ATOM   5887  C CZ  . PHE B 1 136 ? -32.600 13.150  42.688  1.00 37.62 ? 162  PHE B CZ  1 
ATOM   5888  N N   . LEU B 1 137 ? -30.050 6.445   41.775  1.00 38.19 ? 163  LEU B N   1 
ATOM   5889  C CA  . LEU B 1 137 ? -29.755 5.112   41.269  1.00 40.90 ? 163  LEU B CA  1 
ATOM   5890  C C   . LEU B 1 137 ? -31.051 4.454   40.810  1.00 41.95 ? 163  LEU B C   1 
ATOM   5891  O O   . LEU B 1 137 ? -31.137 3.941   39.690  1.00 44.81 ? 163  LEU B O   1 
ATOM   5892  C CB  . LEU B 1 137 ? -29.096 4.262   42.357  1.00 40.98 ? 163  LEU B CB  1 
ATOM   5893  C CG  . LEU B 1 137 ? -28.027 3.266   41.897  1.00 42.01 ? 163  LEU B CG  1 
ATOM   5894  C CD1 . LEU B 1 137 ? -28.614 2.284   40.902  1.00 41.54 ? 163  LEU B CD1 1 
ATOM   5895  C CD2 . LEU B 1 137 ? -26.869 4.024   41.268  1.00 43.51 ? 163  LEU B CD2 1 
ATOM   5896  N N   . GLY B 1 138 ? -32.055 4.472   41.675  1.00 41.25 ? 164  GLY B N   1 
ATOM   5897  C CA  . GLY B 1 138 ? -33.333 3.882   41.321  1.00 40.68 ? 164  GLY B CA  1 
ATOM   5898  C C   . GLY B 1 138 ? -34.451 4.803   41.755  1.00 39.58 ? 164  GLY B C   1 
ATOM   5899  O O   . GLY B 1 138 ? -35.392 4.377   42.422  1.00 41.03 ? 164  GLY B O   1 
ATOM   5900  N N   . GLY B 1 139 ? -34.352 6.071   41.373  1.00 37.79 ? 165  GLY B N   1 
ATOM   5901  C CA  . GLY B 1 139 ? -35.361 7.037   41.761  1.00 36.40 ? 165  GLY B CA  1 
ATOM   5902  C C   . GLY B 1 139 ? -35.061 7.547   43.162  1.00 34.68 ? 165  GLY B C   1 
ATOM   5903  O O   . GLY B 1 139 ? -35.785 8.389   43.698  1.00 35.40 ? 165  GLY B O   1 
ATOM   5904  N N   . GLN B 1 140 ? -33.987 7.036   43.755  1.00 31.60 ? 166  GLN B N   1 
ATOM   5905  C CA  . GLN B 1 140 ? -33.589 7.438   45.101  1.00 29.78 ? 166  GLN B CA  1 
ATOM   5906  C C   . GLN B 1 140 ? -32.291 8.255   45.089  1.00 26.36 ? 166  GLN B C   1 
ATOM   5907  O O   . GLN B 1 140 ? -31.369 7.959   44.325  1.00 24.35 ? 166  GLN B O   1 
ATOM   5908  C CB  . GLN B 1 140 ? -33.406 6.194   45.980  1.00 30.98 ? 166  GLN B CB  1 
ATOM   5909  C CG  . GLN B 1 140 ? -34.643 5.309   46.103  1.00 32.72 ? 166  GLN B CG  1 
ATOM   5910  C CD  . GLN B 1 140 ? -35.815 6.033   46.731  1.00 34.06 ? 166  GLN B CD  1 
ATOM   5911  O OE1 . GLN B 1 140 ? -35.667 6.705   47.753  1.00 36.08 ? 166  GLN B OE1 1 
ATOM   5912  N NE2 . GLN B 1 140 ? -36.992 5.897   46.130  1.00 37.45 ? 166  GLN B NE2 1 
ATOM   5913  N N   . PRO B 1 141 ? -32.209 9.300   45.931  1.00 23.51 ? 167  PRO B N   1 
ATOM   5914  C CA  . PRO B 1 141 ? -31.007 10.139  45.999  1.00 22.45 ? 167  PRO B CA  1 
ATOM   5915  C C   . PRO B 1 141 ? -29.840 9.311   46.515  1.00 20.20 ? 167  PRO B C   1 
ATOM   5916  O O   . PRO B 1 141 ? -30.044 8.370   47.293  1.00 19.98 ? 167  PRO B O   1 
ATOM   5917  C CB  . PRO B 1 141 ? -31.414 11.246  46.966  1.00 22.38 ? 167  PRO B CB  1 
ATOM   5918  C CG  . PRO B 1 141 ? -32.362 10.551  47.883  1.00 24.10 ? 167  PRO B CG  1 
ATOM   5919  C CD  . PRO B 1 141 ? -33.202 9.727   46.931  1.00 23.39 ? 167  PRO B CD  1 
ATOM   5920  N N   . LEU B 1 142 ? -28.629 9.658   46.080  1.00 17.85 ? 168  LEU B N   1 
ATOM   5921  C CA  . LEU B 1 142 ? -27.428 8.930   46.475  1.00 17.52 ? 168  LEU B CA  1 
ATOM   5922  C C   . LEU B 1 142 ? -26.434 9.745   47.299  1.00 18.53 ? 168  LEU B C   1 
ATOM   5923  O O   . LEU B 1 142 ? -26.308 10.962  47.148  1.00 16.91 ? 168  LEU B O   1 
ATOM   5924  C CB  . LEU B 1 142 ? -26.708 8.402   45.232  1.00 15.47 ? 168  LEU B CB  1 
ATOM   5925  C CG  . LEU B 1 142 ? -27.543 7.584   44.241  1.00 16.21 ? 168  LEU B CG  1 
ATOM   5926  C CD1 . LEU B 1 142 ? -26.642 7.166   43.084  1.00 15.18 ? 168  LEU B CD1 1 
ATOM   5927  C CD2 . LEU B 1 142 ? -28.165 6.366   44.928  1.00 15.57 ? 168  LEU B CD2 1 
ATOM   5928  N N   . CYS B 1 143 ? -25.731 9.028   48.170  1.00 15.85 ? 169  CYS B N   1 
ATOM   5929  C CA  . CYS B 1 143 ? -24.709 9.584   49.035  1.00 16.54 ? 169  CYS B CA  1 
ATOM   5930  C C   . CYS B 1 143 ? -23.622 10.206  48.165  1.00 16.94 ? 169  CYS B C   1 
ATOM   5931  O O   . CYS B 1 143 ? -23.224 9.620   47.159  1.00 16.59 ? 169  CYS B O   1 
ATOM   5932  C CB  . CYS B 1 143 ? -24.136 8.457   49.900  1.00 14.26 ? 169  CYS B CB  1 
ATOM   5933  S SG  . CYS B 1 143 ? -22.827 8.979   51.010  1.00 16.98 ? 169  CYS B SG  1 
ATOM   5934  N N   . MET B 1 144 ? -23.134 11.384  48.558  1.00 14.95 ? 170  MET B N   1 
ATOM   5935  C CA  . MET B 1 144 ? -22.099 12.066  47.793  1.00 15.97 ? 170  MET B CA  1 
ATOM   5936  C C   . MET B 1 144 ? -20.784 12.140  48.554  1.00 16.10 ? 170  MET B C   1 
ATOM   5937  O O   . MET B 1 144 ? -19.843 12.795  48.131  1.00 16.98 ? 170  MET B O   1 
ATOM   5938  C CB  . MET B 1 144 ? -22.563 13.485  47.443  1.00 16.27 ? 170  MET B CB  1 
ATOM   5939  C CG  . MET B 1 144 ? -23.880 13.559  46.680  1.00 17.93 ? 170  MET B CG  1 
ATOM   5940  S SD  . MET B 1 144 ? -23.809 12.754  45.064  1.00 19.08 ? 170  MET B SD  1 
ATOM   5941  C CE  . MET B 1 144 ? -23.067 14.055  44.064  1.00 17.86 ? 170  MET B CE  1 
ATOM   5942  N N   . ASN B 1 145 ? -20.720 11.457  49.692  1.00 17.36 ? 171  ASN B N   1 
ATOM   5943  C CA  . ASN B 1 145 ? -19.518 11.482  50.509  1.00 16.13 ? 171  ASN B CA  1 
ATOM   5944  C C   . ASN B 1 145 ? -18.223 11.144  49.773  1.00 17.78 ? 171  ASN B C   1 
ATOM   5945  O O   . ASN B 1 145 ? -17.180 11.765  50.004  1.00 17.60 ? 171  ASN B O   1 
ATOM   5946  C CB  . ASN B 1 145 ? -19.679 10.526  51.683  1.00 17.07 ? 171  ASN B CB  1 
ATOM   5947  C CG  . ASN B 1 145 ? -18.496 10.556  52.600  1.00 15.75 ? 171  ASN B CG  1 
ATOM   5948  O OD1 . ASN B 1 145 ? -18.216 11.575  53.231  1.00 18.19 ? 171  ASN B OD1 1 
ATOM   5949  N ND2 . ASN B 1 145 ? -17.781 9.444   52.678  1.00 18.36 ? 171  ASN B ND2 1 
ATOM   5950  N N   . GLN B 1 146 ? -18.286 10.150  48.892  1.00 18.15 ? 172  GLN B N   1 
ATOM   5951  C CA  . GLN B 1 146 ? -17.106 9.727   48.152  1.00 18.73 ? 172  GLN B CA  1 
ATOM   5952  C C   . GLN B 1 146 ? -16.431 10.858  47.377  1.00 17.33 ? 172  GLN B C   1 
ATOM   5953  O O   . GLN B 1 146 ? -15.211 10.855  47.218  1.00 16.80 ? 172  GLN B O   1 
ATOM   5954  C CB  . GLN B 1 146 ? -17.469 8.569   47.213  1.00 20.59 ? 172  GLN B CB  1 
ATOM   5955  C CG  . GLN B 1 146 ? -17.831 7.270   47.948  1.00 24.46 ? 172  GLN B CG  1 
ATOM   5956  C CD  . GLN B 1 146 ? -18.262 6.154   47.006  1.00 26.84 ? 172  GLN B CD  1 
ATOM   5957  O OE1 . GLN B 1 146 ? -17.548 5.811   46.061  1.00 28.70 ? 172  GLN B OE1 1 
ATOM   5958  N NE2 . GLN B 1 146 ? -19.430 5.577   47.267  1.00 26.42 ? 172  GLN B NE2 1 
ATOM   5959  N N   . TYR B 1 147 ? -17.210 11.824  46.906  1.00 18.91 ? 173  TYR B N   1 
ATOM   5960  C CA  . TYR B 1 147 ? -16.642 12.943  46.153  1.00 18.51 ? 173  TYR B CA  1 
ATOM   5961  C C   . TYR B 1 147 ? -15.701 13.786  47.018  1.00 19.56 ? 173  TYR B C   1 
ATOM   5962  O O   . TYR B 1 147 ? -14.811 14.468  46.505  1.00 19.19 ? 173  TYR B O   1 
ATOM   5963  C CB  . TYR B 1 147 ? -17.763 13.813  45.569  1.00 18.02 ? 173  TYR B CB  1 
ATOM   5964  C CG  . TYR B 1 147 ? -18.515 13.126  44.444  1.00 17.46 ? 173  TYR B CG  1 
ATOM   5965  C CD1 . TYR B 1 147 ? -17.915 12.928  43.200  1.00 17.49 ? 173  TYR B CD1 1 
ATOM   5966  C CD2 . TYR B 1 147 ? -19.806 12.629  44.638  1.00 15.77 ? 173  TYR B CD2 1 
ATOM   5967  C CE1 . TYR B 1 147 ? -18.580 12.247  42.179  1.00 18.48 ? 173  TYR B CE1 1 
ATOM   5968  C CE2 . TYR B 1 147 ? -20.472 11.947  43.631  1.00 17.26 ? 173  TYR B CE2 1 
ATOM   5969  C CZ  . TYR B 1 147 ? -19.854 11.758  42.403  1.00 16.84 ? 173  TYR B CZ  1 
ATOM   5970  O OH  . TYR B 1 147 ? -20.508 11.072  41.406  1.00 20.43 ? 173  TYR B OH  1 
ATOM   5971  N N   . TYR B 1 148 ? -15.885 13.718  48.337  1.00 20.10 ? 174  TYR B N   1 
ATOM   5972  C CA  . TYR B 1 148 ? -15.046 14.475  49.258  1.00 21.12 ? 174  TYR B CA  1 
ATOM   5973  C C   . TYR B 1 148 ? -13.925 13.628  49.858  1.00 21.49 ? 174  TYR B C   1 
ATOM   5974  O O   . TYR B 1 148 ? -13.482 13.862  50.986  1.00 22.27 ? 174  TYR B O   1 
ATOM   5975  C CB  . TYR B 1 148 ? -15.901 15.087  50.368  1.00 22.65 ? 174  TYR B CB  1 
ATOM   5976  C CG  . TYR B 1 148 ? -16.924 16.071  49.839  1.00 26.16 ? 174  TYR B CG  1 
ATOM   5977  C CD1 . TYR B 1 148 ? -18.100 15.629  49.227  1.00 25.78 ? 174  TYR B CD1 1 
ATOM   5978  C CD2 . TYR B 1 148 ? -16.693 17.447  49.900  1.00 26.57 ? 174  TYR B CD2 1 
ATOM   5979  C CE1 . TYR B 1 148 ? -19.016 16.537  48.687  1.00 28.23 ? 174  TYR B CE1 1 
ATOM   5980  C CE2 . TYR B 1 148 ? -17.596 18.354  49.362  1.00 27.74 ? 174  TYR B CE2 1 
ATOM   5981  C CZ  . TYR B 1 148 ? -18.754 17.899  48.757  1.00 28.67 ? 174  TYR B CZ  1 
ATOM   5982  O OH  . TYR B 1 148 ? -19.637 18.813  48.223  1.00 30.49 ? 174  TYR B OH  1 
ATOM   5983  N N   . GLN B 1 149 ? -13.459 12.644  49.096  1.00 20.08 ? 175  GLN B N   1 
ATOM   5984  C CA  . GLN B 1 149 ? -12.388 11.781  49.573  1.00 18.95 ? 175  GLN B CA  1 
ATOM   5985  C C   . GLN B 1 149 ? -11.344 11.557  48.484  1.00 16.78 ? 175  GLN B C   1 
ATOM   5986  O O   . GLN B 1 149 ? -10.214 11.180  48.776  1.00 17.12 ? 175  GLN B O   1 
ATOM   5987  C CB  . GLN B 1 149 ? -12.954 10.416  49.997  1.00 18.45 ? 175  GLN B CB  1 
ATOM   5988  C CG  . GLN B 1 149 ? -14.159 10.452  50.935  1.00 21.10 ? 175  GLN B CG  1 
ATOM   5989  C CD  . GLN B 1 149 ? -13.870 11.175  52.231  1.00 23.31 ? 175  GLN B CD  1 
ATOM   5990  O OE1 . GLN B 1 149 ? -12.811 10.998  52.827  1.00 25.76 ? 175  GLN B OE1 1 
ATOM   5991  N NE2 . GLN B 1 149 ? -14.820 11.986  52.688  1.00 27.51 ? 175  GLN B NE2 1 
ATOM   5992  N N   . ILE B 1 150 ? -11.717 11.805  47.232  1.00 14.89 ? 176  ILE B N   1 
ATOM   5993  C CA  . ILE B 1 150 ? -10.810 11.550  46.117  1.00 16.25 ? 176  ILE B CA  1 
ATOM   5994  C C   . ILE B 1 150 ? -9.714  12.572  45.868  1.00 15.26 ? 176  ILE B C   1 
ATOM   5995  O O   . ILE B 1 150 ? -8.608  12.209  45.469  1.00 14.34 ? 176  ILE B O   1 
ATOM   5996  C CB  . ILE B 1 150 ? -11.584 11.354  44.798  1.00 16.65 ? 176  ILE B CB  1 
ATOM   5997  C CG1 . ILE B 1 150 ? -12.423 12.595  44.499  1.00 19.87 ? 176  ILE B CG1 1 
ATOM   5998  C CG2 . ILE B 1 150 ? -12.486 10.129  44.898  1.00 17.83 ? 176  ILE B CG2 1 
ATOM   5999  C CD1 . ILE B 1 150 ? -13.144 12.522  43.185  1.00 21.57 ? 176  ILE B CD1 1 
ATOM   6000  N N   . LEU B 1 151 ? -10.018 13.846  46.086  1.00 14.22 ? 177  LEU B N   1 
ATOM   6001  C CA  . LEU B 1 151 ? -9.040  14.899  45.865  1.00 13.36 ? 177  LEU B CA  1 
ATOM   6002  C C   . LEU B 1 151 ? -8.286  15.244  47.135  1.00 14.50 ? 177  LEU B C   1 
ATOM   6003  O O   . LEU B 1 151 ? -8.792  15.068  48.243  1.00 14.04 ? 177  LEU B O   1 
ATOM   6004  C CB  . LEU B 1 151 ? -9.741  16.153  45.338  1.00 13.64 ? 177  LEU B CB  1 
ATOM   6005  C CG  . LEU B 1 151 ? -10.502 16.033  44.012  1.00 14.54 ? 177  LEU B CG  1 
ATOM   6006  C CD1 . LEU B 1 151 ? -11.310 17.305  43.775  1.00 14.53 ? 177  LEU B CD1 1 
ATOM   6007  C CD2 . LEU B 1 151 ? -9.517  15.778  42.870  1.00 13.02 ? 177  LEU B CD2 1 
ATOM   6008  N N   . SER B 1 152 ? -7.062  15.735  46.955  1.00 14.73 ? 178  SER B N   1 
ATOM   6009  C CA  . SER B 1 152 ? -6.219  16.152  48.061  1.00 15.30 ? 178  SER B CA  1 
ATOM   6010  C C   . SER B 1 152 ? -6.188  15.116  49.174  1.00 14.89 ? 178  SER B C   1 
ATOM   6011  O O   . SER B 1 152 ? -6.277  15.451  50.355  1.00 12.95 ? 178  SER B O   1 
ATOM   6012  C CB  . SER B 1 152 ? -6.729  17.489  48.603  1.00 14.53 ? 178  SER B CB  1 
ATOM   6013  O OG  . SER B 1 152 ? -6.936  18.395  47.534  1.00 19.36 ? 178  SER B OG  1 
ATOM   6014  N N   . SER B 1 153 ? -6.064  13.848  48.800  1.00 14.26 ? 179  SER B N   1 
ATOM   6015  C CA  . SER B 1 153 ? -6.020  12.795  49.797  1.00 12.88 ? 179  SER B CA  1 
ATOM   6016  C C   . SER B 1 153 ? -4.907  11.833  49.446  1.00 13.90 ? 179  SER B C   1 
ATOM   6017  O O   . SER B 1 153 ? -4.358  11.896  48.352  1.00 12.75 ? 179  SER B O   1 
ATOM   6018  C CB  . SER B 1 153 ? -7.357  12.057  49.842  1.00 12.73 ? 179  SER B CB  1 
ATOM   6019  O OG  . SER B 1 153 ? -7.668  11.489  48.587  1.00 16.50 ? 179  SER B OG  1 
ATOM   6020  N N   . CYS B 1 154 ? -4.560  10.956  50.385  1.00 13.71 ? 180  CYS B N   1 
ATOM   6021  C CA  . CYS B 1 154 ? -3.500  9.989   50.138  1.00 13.57 ? 180  CYS B CA  1 
ATOM   6022  C C   . CYS B 1 154 ? -3.494  8.869   51.168  1.00 14.94 ? 180  CYS B C   1 
ATOM   6023  O O   . CYS B 1 154 ? -3.875  9.062   52.322  1.00 14.95 ? 180  CYS B O   1 
ATOM   6024  C CB  . CYS B 1 154 ? -2.121  10.676  50.147  1.00 11.18 ? 180  CYS B CB  1 
ATOM   6025  S SG  . CYS B 1 154 ? -0.829  9.849   49.175  1.00 16.16 ? 180  CYS B SG  1 
ATOM   6026  N N   . ARG B 1 155 ? -3.072  7.689   50.737  1.00 13.90 ? 181  ARG B N   1 
ATOM   6027  C CA  . ARG B 1 155 ? -2.986  6.554   51.636  1.00 12.88 ? 181  ARG B CA  1 
ATOM   6028  C C   . ARG B 1 155 ? -1.611  6.634   52.297  1.00 11.24 ? 181  ARG B C   1 
ATOM   6029  O O   . ARG B 1 155 ? -0.649  7.065   51.671  1.00 9.92  ? 181  ARG B O   1 
ATOM   6030  C CB  . ARG B 1 155 ? -3.120  5.256   50.854  1.00 13.43 ? 181  ARG B CB  1 
ATOM   6031  C CG  . ARG B 1 155 ? -3.037  3.994   51.705  1.00 12.68 ? 181  ARG B CG  1 
ATOM   6032  C CD  . ARG B 1 155 ? -3.518  2.789   50.901  1.00 11.81 ? 181  ARG B CD  1 
ATOM   6033  N NE  . ARG B 1 155 ? -3.345  1.539   51.629  1.00 12.01 ? 181  ARG B NE  1 
ATOM   6034  C CZ  . ARG B 1 155 ? -4.108  0.461   51.439  1.00 12.47 ? 181  ARG B CZ  1 
ATOM   6035  N NH1 . ARG B 1 155 ? -5.100  0.482   50.544  1.00 10.95 ? 181  ARG B NH1 1 
ATOM   6036  N NH2 . ARG B 1 155 ? -3.891  -0.642  52.145  1.00 10.39 ? 181  ARG B NH2 1 
ATOM   6037  N N   . VAL B 1 156 ? -1.533  6.232   53.562  1.00 11.35 ? 182  VAL B N   1 
ATOM   6038  C CA  . VAL B 1 156 ? -0.278  6.259   54.317  1.00 13.64 ? 182  VAL B CA  1 
ATOM   6039  C C   . VAL B 1 156 ? 0.051   4.858   54.819  1.00 12.47 ? 182  VAL B C   1 
ATOM   6040  O O   . VAL B 1 156 ? -0.758  4.216   55.481  1.00 12.91 ? 182  VAL B O   1 
ATOM   6041  C CB  . VAL B 1 156 ? -0.361  7.209   55.548  1.00 15.40 ? 182  VAL B CB  1 
ATOM   6042  C CG1 . VAL B 1 156 ? 0.995   7.284   56.270  1.00 16.56 ? 182  VAL B CG1 1 
ATOM   6043  C CG2 . VAL B 1 156 ? -0.810  8.588   55.102  1.00 15.51 ? 182  VAL B CG2 1 
ATOM   6044  N N   . PRO B 1 157 ? 1.253   4.366   54.495  1.00 13.27 ? 183  PRO B N   1 
ATOM   6045  C CA  . PRO B 1 157 ? 1.708   3.035   54.903  1.00 13.80 ? 183  PRO B CA  1 
ATOM   6046  C C   . PRO B 1 157 ? 1.848   2.951   56.420  1.00 13.64 ? 183  PRO B C   1 
ATOM   6047  O O   . PRO B 1 157 ? 2.473   3.817   57.029  1.00 14.90 ? 183  PRO B O   1 
ATOM   6048  C CB  . PRO B 1 157 ? 3.063   2.900   54.223  1.00 13.49 ? 183  PRO B CB  1 
ATOM   6049  C CG  . PRO B 1 157 ? 2.996   3.863   53.090  1.00 15.97 ? 183  PRO B CG  1 
ATOM   6050  C CD  . PRO B 1 157 ? 2.260   5.025   53.657  1.00 15.03 ? 183  PRO B CD  1 
ATOM   6051  N N   . GLY B 1 158 ? 1.268   1.918   57.012  1.00 12.68 ? 184  GLY B N   1 
ATOM   6052  C CA  . GLY B 1 158 ? 1.364   1.719   58.451  1.00 11.50 ? 184  GLY B CA  1 
ATOM   6053  C C   . GLY B 1 158 ? 1.934   0.332   58.724  1.00 12.77 ? 184  GLY B C   1 
ATOM   6054  O O   . GLY B 1 158 ? 1.661   -0.596  57.955  1.00 12.09 ? 184  GLY B O   1 
ATOM   6055  N N   . PRO B 1 159 ? 2.714   0.144   59.804  1.00 10.89 ? 185  PRO B N   1 
ATOM   6056  C CA  . PRO B 1 159 ? 3.294   -1.172  60.118  1.00 11.41 ? 185  PRO B CA  1 
ATOM   6057  C C   . PRO B 1 159 ? 2.269   -2.277  60.370  1.00 11.14 ? 185  PRO B C   1 
ATOM   6058  O O   . PRO B 1 159 ? 2.546   -3.446  60.125  1.00 11.30 ? 185  PRO B O   1 
ATOM   6059  C CB  . PRO B 1 159 ? 4.167   -0.887  61.345  1.00 11.08 ? 185  PRO B CB  1 
ATOM   6060  C CG  . PRO B 1 159 ? 3.464   0.267   62.008  1.00 11.04 ? 185  PRO B CG  1 
ATOM   6061  C CD  . PRO B 1 159 ? 3.070   1.136   60.833  1.00 9.44  ? 185  PRO B CD  1 
ATOM   6062  N N   . LYS B 1 160 ? 1.089   -1.907  60.859  1.00 11.38 ? 186  LYS B N   1 
ATOM   6063  C CA  . LYS B 1 160 ? 0.043   -2.885  61.140  1.00 13.02 ? 186  LYS B CA  1 
ATOM   6064  C C   . LYS B 1 160 ? -1.062  -2.782  60.104  1.00 13.99 ? 186  LYS B C   1 
ATOM   6065  O O   . LYS B 1 160 ? -1.484  -3.786  59.521  1.00 14.97 ? 186  LYS B O   1 
ATOM   6066  C CB  . LYS B 1 160 ? -0.541  -2.661  62.539  1.00 14.11 ? 186  LYS B CB  1 
ATOM   6067  C CG  . LYS B 1 160 ? -1.666  -3.631  62.913  1.00 19.61 ? 186  LYS B CG  1 
ATOM   6068  C CD  . LYS B 1 160 ? -1.972  -3.552  64.415  1.00 24.32 ? 186  LYS B CD  1 
ATOM   6069  C CE  . LYS B 1 160 ? -2.974  -4.610  64.878  1.00 25.75 ? 186  LYS B CE  1 
ATOM   6070  N NZ  . LYS B 1 160 ? -4.364  -4.287  64.456  1.00 29.57 ? 186  LYS B NZ  1 
ATOM   6071  N N   . GLN B 1 161 ? -1.538  -1.557  59.899  1.00 13.42 ? 187  GLN B N   1 
ATOM   6072  C CA  . GLN B 1 161 ? -2.576  -1.281  58.917  1.00 13.88 ? 187  GLN B CA  1 
ATOM   6073  C C   . GLN B 1 161 ? -2.372  0.137   58.390  1.00 13.74 ? 187  GLN B C   1 
ATOM   6074  O O   . GLN B 1 161 ? -1.777  0.993   59.052  1.00 12.22 ? 187  GLN B O   1 
ATOM   6075  C CB  . GLN B 1 161 ? -3.970  -1.431  59.525  1.00 15.30 ? 187  GLN B CB  1 
ATOM   6076  C CG  . GLN B 1 161 ? -4.250  -0.551  60.720  1.00 20.14 ? 187  GLN B CG  1 
ATOM   6077  C CD  . GLN B 1 161 ? -5.662  -0.723  61.231  1.00 24.22 ? 187  GLN B CD  1 
ATOM   6078  O OE1 . GLN B 1 161 ? -6.606  -0.147  60.692  1.00 28.86 ? 187  GLN B OE1 1 
ATOM   6079  N NE2 . GLN B 1 161 ? -5.822  -1.530  62.270  1.00 25.16 ? 187  GLN B NE2 1 
ATOM   6080  N N   . ASP B 1 162 ? -2.845  0.387   57.177  1.00 13.11 ? 188  ASP B N   1 
ATOM   6081  C CA  . ASP B 1 162 ? -2.664  1.698   56.578  1.00 12.51 ? 188  ASP B CA  1 
ATOM   6082  C C   . ASP B 1 162 ? -3.685  2.705   57.056  1.00 11.83 ? 188  ASP B C   1 
ATOM   6083  O O   . ASP B 1 162 ? -4.613  2.370   57.785  1.00 10.40 ? 188  ASP B O   1 
ATOM   6084  C CB  . ASP B 1 162 ? -2.707  1.569   55.060  1.00 11.33 ? 188  ASP B CB  1 
ATOM   6085  C CG  . ASP B 1 162 ? -1.476  0.888   54.511  1.00 13.71 ? 188  ASP B CG  1 
ATOM   6086  O OD1 . ASP B 1 162 ? -0.593  0.511   55.316  1.00 12.35 ? 188  ASP B OD1 1 
ATOM   6087  O OD2 . ASP B 1 162 ? -1.386  0.732   53.277  1.00 14.97 ? 188  ASP B OD2 1 
ATOM   6088  N N   . SER B 1 163 ? -3.488  3.958   56.661  1.00 10.79 ? 189  SER B N   1 
ATOM   6089  C CA  . SER B 1 163 ? -4.403  5.015   57.030  1.00 11.35 ? 189  SER B CA  1 
ATOM   6090  C C   . SER B 1 163 ? -4.507  5.927   55.826  1.00 11.98 ? 189  SER B C   1 
ATOM   6091  O O   . SER B 1 163 ? -3.768  5.751   54.854  1.00 10.79 ? 189  SER B O   1 
ATOM   6092  C CB  . SER B 1 163 ? -3.884  5.794   58.245  1.00 9.94  ? 189  SER B CB  1 
ATOM   6093  O OG  . SER B 1 163 ? -2.601  6.341   57.995  1.00 11.14 ? 189  SER B OG  1 
ATOM   6094  N N   . VAL B 1 164 ? -5.420  6.882   55.887  1.00 14.89 ? 190  VAL B N   1 
ATOM   6095  C CA  . VAL B 1 164 ? -5.616  7.831   54.792  1.00 16.56 ? 190  VAL B CA  1 
ATOM   6096  C C   . VAL B 1 164 ? -5.650  9.272   55.313  1.00 16.83 ? 190  VAL B C   1 
ATOM   6097  O O   . VAL B 1 164 ? -6.223  9.544   56.369  1.00 17.28 ? 190  VAL B O   1 
ATOM   6098  C CB  . VAL B 1 164 ? -6.936  7.553   54.044  1.00 18.42 ? 190  VAL B CB  1 
ATOM   6099  C CG1 . VAL B 1 164 ? -7.144  8.582   52.942  1.00 20.91 ? 190  VAL B CG1 1 
ATOM   6100  C CG2 . VAL B 1 164 ? -6.913  6.159   53.446  1.00 18.08 ? 190  VAL B CG2 1 
ATOM   6101  N N   . VAL B 1 165 ? -5.010  10.179  54.588  1.00 16.64 ? 191  VAL B N   1 
ATOM   6102  C CA  . VAL B 1 165 ? -4.998  11.589  54.954  1.00 16.58 ? 191  VAL B CA  1 
ATOM   6103  C C   . VAL B 1 165 ? -5.835  12.347  53.927  1.00 17.77 ? 191  VAL B C   1 
ATOM   6104  O O   . VAL B 1 165 ? -5.747  12.071  52.729  1.00 17.01 ? 191  VAL B O   1 
ATOM   6105  C CB  . VAL B 1 165 ? -3.570  12.167  54.963  1.00 15.61 ? 191  VAL B CB  1 
ATOM   6106  C CG1 . VAL B 1 165 ? -2.841  11.732  56.221  1.00 16.91 ? 191  VAL B CG1 1 
ATOM   6107  C CG2 . VAL B 1 165 ? -2.814  11.704  53.739  1.00 15.17 ? 191  VAL B CG2 1 
ATOM   6108  N N   . ASN B 1 166 ? -6.646  13.288  54.399  1.00 15.51 ? 192  ASN B N   1 
ATOM   6109  C CA  . ASN B 1 166 ? -7.508  14.075  53.523  1.00 16.76 ? 192  ASN B CA  1 
ATOM   6110  C C   . ASN B 1 166 ? -7.368  15.541  53.905  1.00 16.62 ? 192  ASN B C   1 
ATOM   6111  O O   . ASN B 1 166 ? -7.779  15.934  54.998  1.00 14.34 ? 192  ASN B O   1 
ATOM   6112  C CB  . ASN B 1 166 ? -8.955  13.617  53.703  1.00 17.01 ? 192  ASN B CB  1 
ATOM   6113  C CG  . ASN B 1 166 ? -9.882  14.165  52.641  1.00 21.14 ? 192  ASN B CG  1 
ATOM   6114  O OD1 . ASN B 1 166 ? -10.927 13.575  52.367  1.00 25.63 ? 192  ASN B OD1 1 
ATOM   6115  N ND2 . ASN B 1 166 ? -9.526  15.304  52.052  1.00 17.35 ? 192  ASN B ND2 1 
ATOM   6116  N N   . PHE B 1 167 ? -6.793  16.338  53.002  1.00 16.54 ? 193  PHE B N   1 
ATOM   6117  C CA  . PHE B 1 167 ? -6.575  17.762  53.247  1.00 19.57 ? 193  PHE B CA  1 
ATOM   6118  C C   . PHE B 1 167 ? -7.572  18.676  52.537  1.00 20.62 ? 193  PHE B C   1 
ATOM   6119  O O   . PHE B 1 167 ? -7.406  19.899  52.541  1.00 21.00 ? 193  PHE B O   1 
ATOM   6120  C CB  . PHE B 1 167 ? -5.164  18.161  52.808  1.00 20.42 ? 193  PHE B CB  1 
ATOM   6121  C CG  . PHE B 1 167 ? -4.091  17.260  53.325  1.00 23.51 ? 193  PHE B CG  1 
ATOM   6122  C CD1 . PHE B 1 167 ? -3.771  16.087  52.650  1.00 23.24 ? 193  PHE B CD1 1 
ATOM   6123  C CD2 . PHE B 1 167 ? -3.409  17.568  54.497  1.00 24.32 ? 193  PHE B CD2 1 
ATOM   6124  C CE1 . PHE B 1 167 ? -2.791  15.232  53.133  1.00 24.66 ? 193  PHE B CE1 1 
ATOM   6125  C CE2 . PHE B 1 167 ? -2.425  16.719  54.991  1.00 24.44 ? 193  PHE B CE2 1 
ATOM   6126  C CZ  . PHE B 1 167 ? -2.116  15.549  54.308  1.00 25.67 ? 193  PHE B CZ  1 
ATOM   6127  N N   . LEU B 1 168 ? -8.597  18.092  51.927  1.00 21.98 ? 194  LEU B N   1 
ATOM   6128  C CA  . LEU B 1 168 ? -9.592  18.870  51.197  1.00 24.33 ? 194  LEU B CA  1 
ATOM   6129  C C   . LEU B 1 168 ? -10.147 20.019  52.035  1.00 27.62 ? 194  LEU B C   1 
ATOM   6130  O O   . LEU B 1 168 ? -10.199 21.165  51.576  1.00 27.30 ? 194  LEU B O   1 
ATOM   6131  C CB  . LEU B 1 168 ? -10.744 17.975  50.747  1.00 23.53 ? 194  LEU B CB  1 
ATOM   6132  C CG  . LEU B 1 168 ? -11.706 18.602  49.735  1.00 23.72 ? 194  LEU B CG  1 
ATOM   6133  C CD1 . LEU B 1 168 ? -10.992 18.898  48.415  1.00 20.94 ? 194  LEU B CD1 1 
ATOM   6134  C CD2 . LEU B 1 168 ? -12.856 17.646  49.511  1.00 24.45 ? 194  LEU B CD2 1 
ATOM   6135  N N   . LYS B 1 169 ? -10.557 19.703  53.262  1.00 28.81 ? 195  LYS B N   1 
ATOM   6136  C CA  . LYS B 1 169 ? -11.120 20.696  54.166  1.00 32.13 ? 195  LYS B CA  1 
ATOM   6137  C C   . LYS B 1 169 ? -10.156 21.131  55.271  1.00 32.59 ? 195  LYS B C   1 
ATOM   6138  O O   . LYS B 1 169 ? -10.583 21.447  56.380  1.00 33.55 ? 195  LYS B O   1 
ATOM   6139  C CB  . LYS B 1 169 ? -12.410 20.153  54.791  1.00 33.65 ? 195  LYS B CB  1 
ATOM   6140  C CG  . LYS B 1 169 ? -13.557 19.957  53.804  1.00 36.58 ? 195  LYS B CG  1 
ATOM   6141  C CD  . LYS B 1 169 ? -14.799 19.412  54.505  1.00 40.15 ? 195  LYS B CD  1 
ATOM   6142  C CE  . LYS B 1 169 ? -15.985 19.300  53.551  1.00 42.43 ? 195  LYS B CE  1 
ATOM   6143  N NZ  . LYS B 1 169 ? -17.206 18.737  54.204  1.00 43.09 ? 195  LYS B NZ  1 
ATOM   6144  N N   . SER B 1 170 ? -8.861  21.150  54.982  1.00 31.85 ? 196  SER B N   1 
ATOM   6145  C CA  . SER B 1 170 ? -7.893  21.564  55.990  1.00 33.35 ? 196  SER B CA  1 
ATOM   6146  C C   . SER B 1 170 ? -7.950  23.083  56.162  1.00 33.70 ? 196  SER B C   1 
ATOM   6147  O O   . SER B 1 170 ? -8.618  23.775  55.395  1.00 34.33 ? 196  SER B O   1 
ATOM   6148  C CB  . SER B 1 170 ? -6.487  21.158  55.568  1.00 32.64 ? 196  SER B CB  1 
ATOM   6149  O OG  . SER B 1 170 ? -6.101  21.864  54.406  1.00 36.49 ? 196  SER B OG  1 
ATOM   6150  N N   . LYS B 1 171 ? -7.250  23.595  57.168  1.00 34.51 ? 197  LYS B N   1 
ATOM   6151  C CA  . LYS B 1 171 ? -7.216  25.034  57.431  1.00 34.56 ? 197  LYS B CA  1 
ATOM   6152  C C   . LYS B 1 171 ? -6.745  25.764  56.178  1.00 33.65 ? 197  LYS B C   1 
ATOM   6153  O O   . LYS B 1 171 ? -7.378  26.721  55.728  1.00 32.98 ? 197  LYS B O   1 
ATOM   6154  C CB  . LYS B 1 171 ? -6.275  25.346  58.602  1.00 37.13 ? 197  LYS B CB  1 
ATOM   6155  C CG  . LYS B 1 171 ? -6.704  24.715  59.922  1.00 42.03 ? 197  LYS B CG  1 
ATOM   6156  C CD  . LYS B 1 171 ? -5.819  25.155  61.085  1.00 44.23 ? 197  LYS B CD  1 
ATOM   6157  C CE  . LYS B 1 171 ? -6.274  24.521  62.396  1.00 45.55 ? 197  LYS B CE  1 
ATOM   6158  N NZ  . LYS B 1 171 ? -5.410  24.918  63.544  1.00 46.95 ? 197  LYS B NZ  1 
ATOM   6159  N N   . ARG B 1 172 ? -5.625  25.313  55.621  1.00 30.95 ? 198  ARG B N   1 
ATOM   6160  C CA  . ARG B 1 172 ? -5.085  25.904  54.405  1.00 30.26 ? 198  ARG B CA  1 
ATOM   6161  C C   . ARG B 1 172 ? -5.069  24.829  53.318  1.00 26.96 ? 198  ARG B C   1 
ATOM   6162  O O   . ARG B 1 172 ? -4.039  24.204  53.063  1.00 26.08 ? 198  ARG B O   1 
ATOM   6163  C CB  . ARG B 1 172 ? -3.670  26.445  54.646  1.00 33.21 ? 198  ARG B CB  1 
ATOM   6164  C CG  . ARG B 1 172 ? -2.700  25.435  55.253  1.00 39.91 ? 198  ARG B CG  1 
ATOM   6165  C CD  . ARG B 1 172 ? -1.290  26.009  55.359  1.00 44.48 ? 198  ARG B CD  1 
ATOM   6166  N NE  . ARG B 1 172 ? -0.329  25.054  55.915  1.00 49.52 ? 198  ARG B NE  1 
ATOM   6167  C CZ  . ARG B 1 172 ? -0.001  23.889  55.358  1.00 50.36 ? 198  ARG B CZ  1 
ATOM   6168  N NH1 . ARG B 1 172 ? -0.552  23.507  54.211  1.00 51.69 ? 198  ARG B NH1 1 
ATOM   6169  N NH2 . ARG B 1 172 ? 0.886   23.102  55.952  1.00 50.24 ? 198  ARG B NH2 1 
ATOM   6170  N N   . PRO B 1 173 ? -6.219  24.599  52.674  1.00 24.53 ? 199  PRO B N   1 
ATOM   6171  C CA  . PRO B 1 173 ? -6.377  23.599  51.612  1.00 22.53 ? 199  PRO B CA  1 
ATOM   6172  C C   . PRO B 1 173 ? -5.286  23.641  50.547  1.00 19.67 ? 199  PRO B C   1 
ATOM   6173  O O   . PRO B 1 173 ? -4.874  24.711  50.096  1.00 17.70 ? 199  PRO B O   1 
ATOM   6174  C CB  . PRO B 1 173 ? -7.751  23.925  51.037  1.00 24.45 ? 199  PRO B CB  1 
ATOM   6175  C CG  . PRO B 1 173 ? -8.497  24.412  52.249  1.00 25.69 ? 199  PRO B CG  1 
ATOM   6176  C CD  . PRO B 1 173 ? -7.486  25.316  52.905  1.00 24.92 ? 199  PRO B CD  1 
ATOM   6177  N N   . PRO B 1 174 ? -4.796  22.463  50.139  1.00 17.72 ? 200  PRO B N   1 
ATOM   6178  C CA  . PRO B 1 174 ? -3.748  22.418  49.120  1.00 16.40 ? 200  PRO B CA  1 
ATOM   6179  C C   . PRO B 1 174 ? -4.195  23.107  47.827  1.00 14.94 ? 200  PRO B C   1 
ATOM   6180  O O   . PRO B 1 174 ? -5.349  22.993  47.412  1.00 13.85 ? 200  PRO B O   1 
ATOM   6181  C CB  . PRO B 1 174 ? -3.516  20.920  48.927  1.00 17.55 ? 200  PRO B CB  1 
ATOM   6182  C CG  . PRO B 1 174 ? -3.882  20.343  50.279  1.00 18.27 ? 200  PRO B CG  1 
ATOM   6183  C CD  . PRO B 1 174 ? -5.123  21.112  50.629  1.00 17.65 ? 200  PRO B CD  1 
ATOM   6184  N N   . THR B 1 175 ? -3.279  23.827  47.202  1.00 13.09 ? 201  THR B N   1 
ATOM   6185  C CA  . THR B 1 175 ? -3.576  24.521  45.962  1.00 14.22 ? 201  THR B CA  1 
ATOM   6186  C C   . THR B 1 175 ? -2.647  23.996  44.876  1.00 13.23 ? 201  THR B C   1 
ATOM   6187  O O   . THR B 1 175 ? -2.582  24.558  43.786  1.00 12.69 ? 201  THR B O   1 
ATOM   6188  C CB  . THR B 1 175 ? -3.323  26.016  46.111  1.00 14.58 ? 201  THR B CB  1 
ATOM   6189  O OG1 . THR B 1 175 ? -1.963  26.203  46.516  1.00 16.75 ? 201  THR B OG1 1 
ATOM   6190  C CG2 . THR B 1 175 ? -4.252  26.621  47.154  1.00 13.92 ? 201  THR B CG2 1 
ATOM   6191  N N   . HIS B 1 176 ? -1.918  22.920  45.173  1.00 9.40  ? 202  HIS B N   1 
ATOM   6192  C CA  . HIS B 1 176 ? -0.996  22.361  44.198  1.00 10.37 ? 202  HIS B CA  1 
ATOM   6193  C C   . HIS B 1 176 ? -1.311  20.904  43.850  1.00 10.89 ? 202  HIS B C   1 
ATOM   6194  O O   . HIS B 1 176 ? -2.054  20.221  44.557  1.00 11.38 ? 202  HIS B O   1 
ATOM   6195  C CB  . HIS B 1 176 ? 0.429   22.416  44.739  1.00 9.84  ? 202  HIS B CB  1 
ATOM   6196  C CG  . HIS B 1 176 ? 0.666   21.463  45.875  1.00 11.90 ? 202  HIS B CG  1 
ATOM   6197  N ND1 . HIS B 1 176 ? 1.434   20.323  45.743  1.00 12.44 ? 202  HIS B ND1 1 
ATOM   6198  C CD2 . HIS B 1 176 ? 0.176   21.441  47.134  1.00 11.56 ? 202  HIS B CD2 1 
ATOM   6199  C CE1 . HIS B 1 176 ? 1.400   19.642  46.878  1.00 9.93  ? 202  HIS B CE1 1 
ATOM   6200  N NE2 . HIS B 1 176 ? 0.640   20.301  47.734  1.00 14.09 ? 202  HIS B NE2 1 
ATOM   6201  N N   . ILE B 1 177 ? -0.768  20.447  42.730  1.00 11.13 ? 203  ILE B N   1 
ATOM   6202  C CA  . ILE B 1 177 ? -0.925  19.049  42.312  1.00 10.90 ? 203  ILE B CA  1 
ATOM   6203  C C   . ILE B 1 177 ? 0.521   18.604  42.182  1.00 10.26 ? 203  ILE B C   1 
ATOM   6204  O O   . ILE B 1 177 ? 1.439   19.421  42.322  1.00 10.38 ? 203  ILE B O   1 
ATOM   6205  C CB  . ILE B 1 177 ? -1.595  18.878  40.897  1.00 9.63  ? 203  ILE B CB  1 
ATOM   6206  C CG1 . ILE B 1 177 ? -0.770  19.620  39.851  1.00 10.68 ? 203  ILE B CG1 1 
ATOM   6207  C CG2 . ILE B 1 177 ? -3.022  19.384  40.907  1.00 11.02 ? 203  ILE B CG2 1 
ATOM   6208  C CD1 . ILE B 1 177 ? -1.101  19.265  38.394  1.00 11.86 ? 203  ILE B CD1 1 
ATOM   6209  N N   . THR B 1 178 ? 0.725   17.319  41.919  1.00 9.83  ? 204  THR B N   1 
ATOM   6210  C CA  . THR B 1 178 ? 2.064   16.810  41.702  1.00 9.96  ? 204  THR B CA  1 
ATOM   6211  C C   . THR B 1 178 ? 2.137   16.364  40.246  1.00 10.85 ? 204  THR B C   1 
ATOM   6212  O O   . THR B 1 178 ? 1.151   15.888  39.678  1.00 10.49 ? 204  THR B O   1 
ATOM   6213  C CB  . THR B 1 178 ? 2.414   15.626  42.644  1.00 10.02 ? 204  THR B CB  1 
ATOM   6214  O OG1 . THR B 1 178 ? 1.242   14.855  42.928  1.00 12.68 ? 204  THR B OG1 1 
ATOM   6215  C CG2 . THR B 1 178 ? 2.985   16.140  43.933  1.00 12.07 ? 204  THR B CG2 1 
ATOM   6216  N N   . VAL B 1 179 ? 3.301   16.562  39.638  1.00 9.63  ? 205  VAL B N   1 
ATOM   6217  C CA  . VAL B 1 179 ? 3.528   16.182  38.253  1.00 10.74 ? 205  VAL B CA  1 
ATOM   6218  C C   . VAL B 1 179 ? 4.776   15.314  38.255  1.00 11.32 ? 205  VAL B C   1 
ATOM   6219  O O   . VAL B 1 179 ? 5.796   15.697  38.831  1.00 13.41 ? 205  VAL B O   1 
ATOM   6220  C CB  . VAL B 1 179 ? 3.771   17.413  37.337  1.00 8.81  ? 205  VAL B CB  1 
ATOM   6221  C CG1 . VAL B 1 179 ? 3.958   16.965  35.896  1.00 9.51  ? 205  VAL B CG1 1 
ATOM   6222  C CG2 . VAL B 1 179 ? 2.600   18.361  37.425  1.00 7.12  ? 205  VAL B CG2 1 
ATOM   6223  N N   . VAL B 1 180 ? 4.697   14.161  37.618  1.00 11.28 ? 206  VAL B N   1 
ATOM   6224  C CA  . VAL B 1 180 ? 5.830   13.240  37.572  1.00 14.54 ? 206  VAL B CA  1 
ATOM   6225  C C   . VAL B 1 180 ? 6.330   13.055  36.147  1.00 13.72 ? 206  VAL B C   1 
ATOM   6226  O O   . VAL B 1 180 ? 5.563   12.681  35.267  1.00 15.75 ? 206  VAL B O   1 
ATOM   6227  C CB  . VAL B 1 180 ? 5.450   11.845  38.110  1.00 16.19 ? 206  VAL B CB  1 
ATOM   6228  C CG1 . VAL B 1 180 ? 6.682   11.147  38.626  1.00 16.93 ? 206  VAL B CG1 1 
ATOM   6229  C CG2 . VAL B 1 180 ? 4.401   11.964  39.190  1.00 18.77 ? 206  VAL B CG2 1 
ATOM   6230  N N   . HIS B 1 181 ? 7.613   13.301  35.922  1.00 14.49 ? 207  HIS B N   1 
ATOM   6231  C CA  . HIS B 1 181 ? 8.201   13.133  34.594  1.00 14.29 ? 207  HIS B CA  1 
ATOM   6232  C C   . HIS B 1 181 ? 9.581   12.526  34.787  1.00 14.01 ? 207  HIS B C   1 
ATOM   6233  O O   . HIS B 1 181 ? 10.402  13.063  35.531  1.00 13.37 ? 207  HIS B O   1 
ATOM   6234  C CB  . HIS B 1 181 ? 8.285   14.485  33.866  1.00 13.18 ? 207  HIS B CB  1 
ATOM   6235  C CG  . HIS B 1 181 ? 8.995   14.419  32.549  1.00 11.68 ? 207  HIS B CG  1 
ATOM   6236  N ND1 . HIS B 1 181 ? 8.643   13.533  31.555  1.00 14.85 ? 207  HIS B ND1 1 
ATOM   6237  C CD2 . HIS B 1 181 ? 10.062  15.107  32.080  1.00 13.80 ? 207  HIS B CD2 1 
ATOM   6238  C CE1 . HIS B 1 181 ? 9.468   13.675  30.534  1.00 11.63 ? 207  HIS B CE1 1 
ATOM   6239  N NE2 . HIS B 1 181 ? 10.339  14.622  30.827  1.00 15.73 ? 207  HIS B NE2 1 
ATOM   6240  N N   . ASN B 1 182 ? 9.840   11.407  34.114  1.00 14.05 ? 208  ASN B N   1 
ATOM   6241  C CA  . ASN B 1 182 ? 11.119  10.713  34.256  1.00 14.74 ? 208  ASN B CA  1 
ATOM   6242  C C   . ASN B 1 182 ? 11.431  10.401  35.732  1.00 13.59 ? 208  ASN B C   1 
ATOM   6243  O O   . ASN B 1 182 ? 12.561  10.574  36.181  1.00 14.74 ? 208  ASN B O   1 
ATOM   6244  C CB  . ASN B 1 182 ? 12.268  11.523  33.629  1.00 14.54 ? 208  ASN B CB  1 
ATOM   6245  C CG  . ASN B 1 182 ? 12.370  11.325  32.118  1.00 16.33 ? 208  ASN B CG  1 
ATOM   6246  O OD1 . ASN B 1 182 ? 12.242  10.207  31.621  1.00 16.91 ? 208  ASN B OD1 1 
ATOM   6247  N ND2 . ASN B 1 182 ? 12.626  12.406  31.387  1.00 15.38 ? 208  ASN B ND2 1 
ATOM   6248  N N   . TYR B 1 183 ? 10.419  9.952   36.470  1.00 12.59 ? 209  TYR B N   1 
ATOM   6249  C CA  . TYR B 1 183 ? 10.553  9.573   37.885  1.00 13.29 ? 209  TYR B CA  1 
ATOM   6250  C C   . TYR B 1 183 ? 10.711  10.760  38.851  1.00 14.12 ? 209  TYR B C   1 
ATOM   6251  O O   . TYR B 1 183 ? 10.684  10.579  40.073  1.00 13.77 ? 209  TYR B O   1 
ATOM   6252  C CB  . TYR B 1 183 ? 11.747  8.626   38.055  1.00 9.84  ? 209  TYR B CB  1 
ATOM   6253  C CG  . TYR B 1 183 ? 11.772  7.463   37.082  1.00 12.49 ? 209  TYR B CG  1 
ATOM   6254  C CD1 . TYR B 1 183 ? 12.945  6.740   36.865  1.00 13.49 ? 209  TYR B CD1 1 
ATOM   6255  C CD2 . TYR B 1 183 ? 10.619  7.068   36.390  1.00 11.46 ? 209  TYR B CD2 1 
ATOM   6256  C CE1 . TYR B 1 183 ? 12.971  5.654   35.992  1.00 14.59 ? 209  TYR B CE1 1 
ATOM   6257  C CE2 . TYR B 1 183 ? 10.639  5.991   35.515  1.00 11.40 ? 209  TYR B CE2 1 
ATOM   6258  C CZ  . TYR B 1 183 ? 11.818  5.286   35.325  1.00 12.70 ? 209  TYR B CZ  1 
ATOM   6259  O OH  . TYR B 1 183 ? 11.852  4.192   34.490  1.00 15.51 ? 209  TYR B OH  1 
ATOM   6260  N N   . GLN B 1 184 ? 10.860  11.959  38.307  1.00 14.31 ? 210  GLN B N   1 
ATOM   6261  C CA  . GLN B 1 184 ? 11.041  13.175  39.115  1.00 14.18 ? 210  GLN B CA  1 
ATOM   6262  C C   . GLN B 1 184 ? 9.735   13.897  39.444  1.00 11.08 ? 210  GLN B C   1 
ATOM   6263  O O   . GLN B 1 184 ? 8.947   14.209  38.556  1.00 10.63 ? 210  GLN B O   1 
ATOM   6264  C CB  . GLN B 1 184 ? 12.006  14.113  38.385  1.00 14.77 ? 210  GLN B CB  1 
ATOM   6265  C CG  . GLN B 1 184 ? 13.446  13.602  38.408  1.00 18.32 ? 210  GLN B CG  1 
ATOM   6266  C CD  . GLN B 1 184 ? 14.280  14.053  37.221  1.00 20.72 ? 210  GLN B CD  1 
ATOM   6267  O OE1 . GLN B 1 184 ? 14.166  13.510  36.123  1.00 22.65 ? 210  GLN B OE1 1 
ATOM   6268  N NE2 . GLN B 1 184 ? 15.129  15.051  37.440  1.00 21.06 ? 210  GLN B NE2 1 
ATOM   6269  N N   . PHE B 1 185 ? 9.515   14.162  40.730  1.00 9.14  ? 211  PHE B N   1 
ATOM   6270  C CA  . PHE B 1 185 ? 8.300   14.828  41.173  1.00 8.82  ? 211  PHE B CA  1 
ATOM   6271  C C   . PHE B 1 185 ? 8.416   16.328  41.315  1.00 11.09 ? 211  PHE B C   1 
ATOM   6272  O O   . PHE B 1 185 ? 9.431   16.849  41.782  1.00 10.88 ? 211  PHE B O   1 
ATOM   6273  C CB  . PHE B 1 185 ? 7.824   14.270  42.508  1.00 9.99  ? 211  PHE B CB  1 
ATOM   6274  C CG  . PHE B 1 185 ? 7.400   12.841  42.447  1.00 12.49 ? 211  PHE B CG  1 
ATOM   6275  C CD1 . PHE B 1 185 ? 8.338   11.823  42.565  1.00 11.35 ? 211  PHE B CD1 1 
ATOM   6276  C CD2 . PHE B 1 185 ? 6.063   12.508  42.272  1.00 10.84 ? 211  PHE B CD2 1 
ATOM   6277  C CE1 . PHE B 1 185 ? 7.949   10.490  42.511  1.00 13.05 ? 211  PHE B CE1 1 
ATOM   6278  C CE2 . PHE B 1 185 ? 5.664   11.181  42.216  1.00 12.12 ? 211  PHE B CE2 1 
ATOM   6279  C CZ  . PHE B 1 185 ? 6.605   10.169  42.336  1.00 11.97 ? 211  PHE B CZ  1 
ATOM   6280  N N   . PHE B 1 186 ? 7.345   17.009  40.930  1.00 12.07 ? 212  PHE B N   1 
ATOM   6281  C CA  . PHE B 1 186 ? 7.285   18.461  40.994  1.00 11.76 ? 212  PHE B CA  1 
ATOM   6282  C C   . PHE B 1 186 ? 5.989   18.910  41.654  1.00 12.63 ? 212  PHE B C   1 
ATOM   6283  O O   . PHE B 1 186 ? 4.926   18.314  41.454  1.00 10.97 ? 212  PHE B O   1 
ATOM   6284  C CB  . PHE B 1 186 ? 7.345   19.072  39.584  1.00 9.95  ? 212  PHE B CB  1 
ATOM   6285  C CG  . PHE B 1 186 ? 8.668   18.903  38.889  1.00 12.34 ? 212  PHE B CG  1 
ATOM   6286  C CD1 . PHE B 1 186 ? 9.039   17.677  38.337  1.00 11.52 ? 212  PHE B CD1 1 
ATOM   6287  C CD2 . PHE B 1 186 ? 9.541   19.983  38.768  1.00 12.54 ? 212  PHE B CD2 1 
ATOM   6288  C CE1 . PHE B 1 186 ? 10.261  17.536  37.674  1.00 13.22 ? 212  PHE B CE1 1 
ATOM   6289  C CE2 . PHE B 1 186 ? 10.768  19.844  38.104  1.00 15.10 ? 212  PHE B CE2 1 
ATOM   6290  C CZ  . PHE B 1 186 ? 11.124  18.618  37.557  1.00 14.55 ? 212  PHE B CZ  1 
ATOM   6291  N N   . GLU B 1 187 ? 6.101   19.982  42.431  1.00 11.75 ? 213  GLU B N   1 
ATOM   6292  C CA  . GLU B 1 187 ? 4.974   20.592  43.113  1.00 13.54 ? 213  GLU B CA  1 
ATOM   6293  C C   . GLU B 1 187 ? 4.523   21.735  42.194  1.00 13.50 ? 213  GLU B C   1 
ATOM   6294  O O   . GLU B 1 187 ? 5.282   22.668  41.940  1.00 14.24 ? 213  GLU B O   1 
ATOM   6295  C CB  . GLU B 1 187 ? 5.423   21.157  44.463  1.00 14.82 ? 213  GLU B CB  1 
ATOM   6296  C CG  . GLU B 1 187 ? 4.342   21.884  45.239  1.00 19.76 ? 213  GLU B CG  1 
ATOM   6297  C CD  . GLU B 1 187 ? 4.848   22.384  46.580  1.00 24.51 ? 213  GLU B CD  1 
ATOM   6298  O OE1 . GLU B 1 187 ? 5.159   21.548  47.455  1.00 25.47 ? 213  GLU B OE1 1 
ATOM   6299  O OE2 . GLU B 1 187 ? 4.947   23.615  46.756  1.00 28.58 ? 213  GLU B OE2 1 
ATOM   6300  N N   . LEU B 1 188 ? 3.301   21.653  41.690  1.00 13.70 ? 214  LEU B N   1 
ATOM   6301  C CA  . LEU B 1 188 ? 2.775   22.690  40.806  1.00 14.33 ? 214  LEU B CA  1 
ATOM   6302  C C   . LEU B 1 188 ? 1.509   23.346  41.338  1.00 14.12 ? 214  LEU B C   1 
ATOM   6303  O O   . LEU B 1 188 ? 0.488   22.684  41.504  1.00 14.71 ? 214  LEU B O   1 
ATOM   6304  C CB  . LEU B 1 188 ? 2.493   22.108  39.411  1.00 14.00 ? 214  LEU B CB  1 
ATOM   6305  C CG  . LEU B 1 188 ? 1.764   23.005  38.400  1.00 13.70 ? 214  LEU B CG  1 
ATOM   6306  C CD1 . LEU B 1 188 ? 2.600   24.235  38.063  1.00 13.21 ? 214  LEU B CD1 1 
ATOM   6307  C CD2 . LEU B 1 188 ? 1.475   22.201  37.143  1.00 12.79 ? 214  LEU B CD2 1 
ATOM   6308  N N   . ASP B 1 189 ? 1.568   24.652  41.616  1.00 13.43 ? 215  ASP B N   1 
ATOM   6309  C CA  . ASP B 1 189 ? 0.373   25.346  42.087  1.00 13.38 ? 215  ASP B CA  1 
ATOM   6310  C C   . ASP B 1 189 ? -0.535  25.546  40.879  1.00 10.84 ? 215  ASP B C   1 
ATOM   6311  O O   . ASP B 1 189 ? -0.075  25.974  39.817  1.00 12.83 ? 215  ASP B O   1 
ATOM   6312  C CB  . ASP B 1 189 ? 0.711   26.709  42.693  1.00 15.63 ? 215  ASP B CB  1 
ATOM   6313  C CG  . ASP B 1 189 ? 1.225   26.607  44.115  1.00 20.76 ? 215  ASP B CG  1 
ATOM   6314  O OD1 . ASP B 1 189 ? 0.525   26.019  44.970  1.00 21.16 ? 215  ASP B OD1 1 
ATOM   6315  O OD2 . ASP B 1 189 ? 2.328   27.129  44.376  1.00 21.92 ? 215  ASP B OD2 1 
ATOM   6316  N N   . VAL B 1 190 ? -1.809  25.224  41.040  1.00 10.34 ? 216  VAL B N   1 
ATOM   6317  C CA  . VAL B 1 190 ? -2.775  25.364  39.956  1.00 13.33 ? 216  VAL B CA  1 
ATOM   6318  C C   . VAL B 1 190 ? -3.836  26.410  40.269  1.00 14.16 ? 216  VAL B C   1 
ATOM   6319  O O   . VAL B 1 190 ? -4.878  26.480  39.611  1.00 14.62 ? 216  VAL B O   1 
ATOM   6320  C CB  . VAL B 1 190 ? -3.453  24.017  39.630  1.00 10.49 ? 216  VAL B CB  1 
ATOM   6321  C CG1 . VAL B 1 190 ? -2.448  23.114  38.955  1.00 13.95 ? 216  VAL B CG1 1 
ATOM   6322  C CG2 . VAL B 1 190 ? -3.972  23.343  40.890  1.00 10.39 ? 216  VAL B CG2 1 
ATOM   6323  N N   . TYR B 1 191 ? -3.553  27.218  41.283  1.00 14.22 ? 217  TYR B N   1 
ATOM   6324  C CA  . TYR B 1 191 ? -4.434  28.300  41.706  1.00 15.06 ? 217  TYR B CA  1 
ATOM   6325  C C   . TYR B 1 191 ? -3.585  29.548  41.925  1.00 15.60 ? 217  TYR B C   1 
ATOM   6326  O O   . TYR B 1 191 ? -2.475  29.473  42.455  1.00 15.31 ? 217  TYR B O   1 
ATOM   6327  C CB  . TYR B 1 191 ? -5.140  27.950  43.018  1.00 14.47 ? 217  TYR B CB  1 
ATOM   6328  C CG  . TYR B 1 191 ? -6.208  26.890  42.895  1.00 16.25 ? 217  TYR B CG  1 
ATOM   6329  C CD1 . TYR B 1 191 ? -7.458  27.196  42.354  1.00 15.48 ? 217  TYR B CD1 1 
ATOM   6330  C CD2 . TYR B 1 191 ? -5.972  25.577  43.314  1.00 14.99 ? 217  TYR B CD2 1 
ATOM   6331  C CE1 . TYR B 1 191 ? -8.445  26.224  42.239  1.00 16.47 ? 217  TYR B CE1 1 
ATOM   6332  C CE2 . TYR B 1 191 ? -6.953  24.608  43.202  1.00 14.90 ? 217  TYR B CE2 1 
ATOM   6333  C CZ  . TYR B 1 191 ? -8.183  24.935  42.670  1.00 13.95 ? 217  TYR B CZ  1 
ATOM   6334  O OH  . TYR B 1 191 ? -9.163  23.976  42.592  1.00 18.95 ? 217  TYR B OH  1 
ATOM   6335  N N   . HIS B 1 192 ? -4.087  30.694  41.487  1.00 14.88 ? 218  HIS B N   1 
ATOM   6336  C CA  . HIS B 1 192 ? -3.361  31.939  41.684  1.00 13.61 ? 218  HIS B CA  1 
ATOM   6337  C C   . HIS B 1 192 ? -3.546  32.334  43.140  1.00 13.22 ? 218  HIS B C   1 
ATOM   6338  O O   . HIS B 1 192 ? -4.388  31.782  43.843  1.00 10.73 ? 218  HIS B O   1 
ATOM   6339  C CB  . HIS B 1 192 ? -3.923  33.033  40.774  1.00 12.15 ? 218  HIS B CB  1 
ATOM   6340  C CG  . HIS B 1 192 ? -3.620  32.814  39.330  1.00 13.32 ? 218  HIS B CG  1 
ATOM   6341  N ND1 . HIS B 1 192 ? -2.349  32.932  38.813  1.00 13.88 ? 218  HIS B ND1 1 
ATOM   6342  C CD2 . HIS B 1 192 ? -4.411  32.428  38.301  1.00 13.24 ? 218  HIS B CD2 1 
ATOM   6343  C CE1 . HIS B 1 192 ? -2.367  32.630  37.529  1.00 13.45 ? 218  HIS B CE1 1 
ATOM   6344  N NE2 . HIS B 1 192 ? -3.606  32.323  37.192  1.00 11.88 ? 218  HIS B NE2 1 
ATOM   6345  N N   . SER B 1 193 ? -2.750  33.298  43.588  1.00 14.30 ? 219  SER B N   1 
ATOM   6346  C CA  . SER B 1 193 ? -2.833  33.785  44.955  1.00 17.07 ? 219  SER B CA  1 
ATOM   6347  C C   . SER B 1 193 ? -4.240  34.281  45.285  1.00 16.93 ? 219  SER B C   1 
ATOM   6348  O O   . SER B 1 193 ? -4.690  34.175  46.426  1.00 15.81 ? 219  SER B O   1 
ATOM   6349  C CB  . SER B 1 193 ? -1.824  34.915  45.162  1.00 18.50 ? 219  SER B CB  1 
ATOM   6350  O OG  . SER B 1 193 ? -1.867  35.373  46.498  1.00 21.58 ? 219  SER B OG  1 
ATOM   6351  N N   . ASP B 1 194 ? -4.927  34.839  44.287  1.00 17.91 ? 220  ASP B N   1 
ATOM   6352  C CA  . ASP B 1 194 ? -6.281  35.353  44.488  1.00 19.33 ? 220  ASP B CA  1 
ATOM   6353  C C   . ASP B 1 194 ? -7.328  34.246  44.578  1.00 19.16 ? 220  ASP B C   1 
ATOM   6354  O O   . ASP B 1 194 ? -8.518  34.519  44.732  1.00 18.43 ? 220  ASP B O   1 
ATOM   6355  C CB  . ASP B 1 194 ? -6.677  36.316  43.363  1.00 21.78 ? 220  ASP B CB  1 
ATOM   6356  C CG  . ASP B 1 194 ? -6.632  35.669  41.990  1.00 24.78 ? 220  ASP B CG  1 
ATOM   6357  O OD1 . ASP B 1 194 ? -6.612  34.423  41.902  1.00 24.61 ? 220  ASP B OD1 1 
ATOM   6358  O OD2 . ASP B 1 194 ? -6.624  36.420  40.991  1.00 28.02 ? 220  ASP B OD2 1 
ATOM   6359  N N   . GLY B 1 195 ? -6.886  32.999  44.472  1.00 19.45 ? 221  GLY B N   1 
ATOM   6360  C CA  . GLY B 1 195 ? -7.812  31.887  44.555  1.00 19.80 ? 221  GLY B CA  1 
ATOM   6361  C C   . GLY B 1 195 ? -8.323  31.392  43.212  1.00 20.62 ? 221  GLY B C   1 
ATOM   6362  O O   . GLY B 1 195 ? -8.826  30.273  43.114  1.00 20.68 ? 221  GLY B O   1 
ATOM   6363  N N   . THR B 1 196 ? -8.206  32.212  42.173  1.00 19.34 ? 222  THR B N   1 
ATOM   6364  C CA  . THR B 1 196 ? -8.679  31.806  40.857  1.00 18.95 ? 222  THR B CA  1 
ATOM   6365  C C   . THR B 1 196 ? -7.768  30.723  40.281  1.00 19.29 ? 222  THR B C   1 
ATOM   6366  O O   . THR B 1 196 ? -6.542  30.791  40.409  1.00 18.75 ? 222  THR B O   1 
ATOM   6367  C CB  . THR B 1 196 ? -8.710  32.990  39.873  1.00 19.69 ? 222  THR B CB  1 
ATOM   6368  O OG1 . THR B 1 196 ? -7.373  33.418  39.586  1.00 21.03 ? 222  THR B OG1 1 
ATOM   6369  C CG2 . THR B 1 196 ? -9.486  34.150  40.467  1.00 20.64 ? 222  THR B CG2 1 
ATOM   6370  N N   . PRO B 1 197 ? -8.357  29.708  39.635  1.00 18.76 ? 223  PRO B N   1 
ATOM   6371  C CA  . PRO B 1 197 ? -7.565  28.623  39.049  1.00 17.35 ? 223  PRO B CA  1 
ATOM   6372  C C   . PRO B 1 197 ? -6.744  29.086  37.856  1.00 16.93 ? 223  PRO B C   1 
ATOM   6373  O O   . PRO B 1 197 ? -7.156  29.989  37.128  1.00 17.71 ? 223  PRO B O   1 
ATOM   6374  C CB  . PRO B 1 197 ? -8.624  27.609  38.640  1.00 17.42 ? 223  PRO B CB  1 
ATOM   6375  C CG  . PRO B 1 197 ? -9.774  28.479  38.252  1.00 19.57 ? 223  PRO B CG  1 
ATOM   6376  C CD  . PRO B 1 197 ? -9.794  29.510  39.369  1.00 17.96 ? 223  PRO B CD  1 
ATOM   6377  N N   . LEU B 1 198 ? -5.579  28.472  37.666  1.00 15.70 ? 224  LEU B N   1 
ATOM   6378  C CA  . LEU B 1 198 ? -4.731  28.791  36.523  1.00 15.92 ? 224  LEU B CA  1 
ATOM   6379  C C   . LEU B 1 198 ? -5.489  28.350  35.270  1.00 15.21 ? 224  LEU B C   1 
ATOM   6380  O O   . LEU B 1 198 ? -6.347  27.469  35.353  1.00 14.74 ? 224  LEU B O   1 
ATOM   6381  C CB  . LEU B 1 198 ? -3.418  28.019  36.604  1.00 14.94 ? 224  LEU B CB  1 
ATOM   6382  C CG  . LEU B 1 198 ? -2.205  28.784  37.131  1.00 16.31 ? 224  LEU B CG  1 
ATOM   6383  C CD1 . LEU B 1 198 ? -2.386  29.143  38.592  1.00 13.55 ? 224  LEU B CD1 1 
ATOM   6384  C CD2 . LEU B 1 198 ? -0.980  27.924  36.957  1.00 14.38 ? 224  LEU B CD2 1 
ATOM   6385  N N   . THR B 1 199 ? -5.181  28.958  34.130  1.00 14.12 ? 225  THR B N   1 
ATOM   6386  C CA  . THR B 1 199 ? -5.823  28.604  32.867  1.00 14.28 ? 225  THR B CA  1 
ATOM   6387  C C   . THR B 1 199 ? -5.022  27.480  32.225  1.00 14.36 ? 225  THR B C   1 
ATOM   6388  O O   . THR B 1 199 ? -3.861  27.269  32.571  1.00 14.73 ? 225  THR B O   1 
ATOM   6389  C CB  . THR B 1 199 ? -5.839  29.786  31.884  1.00 13.56 ? 225  THR B CB  1 
ATOM   6390  O OG1 . THR B 1 199 ? -4.499  30.107  31.501  1.00 14.76 ? 225  THR B OG1 1 
ATOM   6391  C CG2 . THR B 1 199 ? -6.481  31.002  32.513  1.00 16.42 ? 225  THR B CG2 1 
ATOM   6392  N N   . SER B 1 200 ? -5.637  26.765  31.288  1.00 14.16 ? 226  SER B N   1 
ATOM   6393  C CA  . SER B 1 200 ? -4.946  25.675  30.612  1.00 16.49 ? 226  SER B CA  1 
ATOM   6394  C C   . SER B 1 200 ? -3.636  26.192  30.035  1.00 16.11 ? 226  SER B C   1 
ATOM   6395  O O   . SER B 1 200 ? -2.596  25.537  30.141  1.00 16.12 ? 226  SER B O   1 
ATOM   6396  C CB  . SER B 1 200 ? -5.830  25.090  29.506  1.00 17.81 ? 226  SER B CB  1 
ATOM   6397  O OG  . SER B 1 200 ? -6.141  26.069  28.531  1.00 21.35 ? 226  SER B OG  1 
ATOM   6398  N N   . ASP B 1 201 ? -3.694  27.377  29.425  1.00 16.33 ? 227  ASP B N   1 
ATOM   6399  C CA  . ASP B 1 201 ? -2.517  28.004  28.828  1.00 16.15 ? 227  ASP B CA  1 
ATOM   6400  C C   . ASP B 1 201 ? -1.430  28.218  29.880  1.00 13.37 ? 227  ASP B C   1 
ATOM   6401  O O   . ASP B 1 201 ? -0.256  27.963  29.627  1.00 12.20 ? 227  ASP B O   1 
ATOM   6402  C CB  . ASP B 1 201 ? -2.885  29.360  28.209  1.00 21.17 ? 227  ASP B CB  1 
ATOM   6403  C CG  . ASP B 1 201 ? -3.738  29.216  26.960  1.00 27.89 ? 227  ASP B CG  1 
ATOM   6404  O OD1 . ASP B 1 201 ? -4.361  30.217  26.545  1.00 31.06 ? 227  ASP B OD1 1 
ATOM   6405  O OD2 . ASP B 1 201 ? -3.783  28.102  26.390  1.00 30.18 ? 227  ASP B OD2 1 
ATOM   6406  N N   . GLN B 1 202 ? -1.816  28.697  31.050  1.00 12.33 ? 228  GLN B N   1 
ATOM   6407  C CA  . GLN B 1 202 ? -0.846  28.934  32.115  1.00 12.49 ? 228  GLN B CA  1 
ATOM   6408  C C   . GLN B 1 202 ? -0.299  27.600  32.635  1.00 11.81 ? 228  GLN B C   1 
ATOM   6409  O O   . GLN B 1 202 ? 0.892   27.480  32.927  1.00 11.57 ? 228  GLN B O   1 
ATOM   6410  C CB  . GLN B 1 202 ? -1.497  29.739  33.240  1.00 11.54 ? 228  GLN B CB  1 
ATOM   6411  C CG  . GLN B 1 202 ? -1.780  31.194  32.846  1.00 12.59 ? 228  GLN B CG  1 
ATOM   6412  C CD  . GLN B 1 202 ? -2.795  31.867  33.752  1.00 13.19 ? 228  GLN B CD  1 
ATOM   6413  O OE1 . GLN B 1 202 ? -3.097  33.050  33.598  1.00 16.46 ? 228  GLN B OE1 1 
ATOM   6414  N NE2 . GLN B 1 202 ? -3.336  31.110  34.703  1.00 10.79 ? 228  GLN B NE2 1 
ATOM   6415  N N   . ILE B 1 203 ? -1.167  26.593  32.732  1.00 11.94 ? 229  ILE B N   1 
ATOM   6416  C CA  . ILE B 1 203 ? -0.741  25.271  33.187  1.00 11.35 ? 229  ILE B CA  1 
ATOM   6417  C C   . ILE B 1 203 ? 0.248   24.715  32.173  1.00 12.51 ? 229  ILE B C   1 
ATOM   6418  O O   . ILE B 1 203 ? 1.251   24.115  32.539  1.00 14.99 ? 229  ILE B O   1 
ATOM   6419  C CB  . ILE B 1 203 ? -1.950  24.317  33.328  1.00 10.67 ? 229  ILE B CB  1 
ATOM   6420  C CG1 . ILE B 1 203 ? -2.849  24.808  34.468  1.00 10.04 ? 229  ILE B CG1 1 
ATOM   6421  C CG2 . ILE B 1 203 ? -1.477  22.879  33.570  1.00 8.80  ? 229  ILE B CG2 1 
ATOM   6422  C CD1 . ILE B 1 203 ? -4.207  24.156  34.502  1.00 12.31 ? 229  ILE B CD1 1 
ATOM   6423  N N   . PHE B 1 204 ? -0.031  24.933  30.888  1.00 12.90 ? 230  PHE B N   1 
ATOM   6424  C CA  . PHE B 1 204 ? 0.850   24.457  29.827  1.00 14.33 ? 230  PHE B CA  1 
ATOM   6425  C C   . PHE B 1 204 ? 2.258   25.033  29.998  1.00 13.91 ? 230  PHE B C   1 
ATOM   6426  O O   . PHE B 1 204 ? 3.254   24.315  29.935  1.00 14.47 ? 230  PHE B O   1 
ATOM   6427  C CB  . PHE B 1 204 ? 0.299   24.860  28.462  1.00 15.14 ? 230  PHE B CB  1 
ATOM   6428  C CG  . PHE B 1 204 ? 1.239   24.578  27.330  1.00 15.12 ? 230  PHE B CG  1 
ATOM   6429  C CD1 . PHE B 1 204 ? 1.404   23.283  26.853  1.00 15.95 ? 230  PHE B CD1 1 
ATOM   6430  C CD2 . PHE B 1 204 ? 1.982   25.602  26.758  1.00 16.20 ? 230  PHE B CD2 1 
ATOM   6431  C CE1 . PHE B 1 204 ? 2.292   23.011  25.828  1.00 16.58 ? 230  PHE B CE1 1 
ATOM   6432  C CE2 . PHE B 1 204 ? 2.879   25.343  25.728  1.00 17.57 ? 230  PHE B CE2 1 
ATOM   6433  C CZ  . PHE B 1 204 ? 3.034   24.043  25.260  1.00 18.15 ? 230  PHE B CZ  1 
ATOM   6434  N N   . VAL B 1 205 ? 2.328   26.338  30.209  1.00 13.54 ? 231  VAL B N   1 
ATOM   6435  C CA  . VAL B 1 205 ? 3.601   27.018  30.405  1.00 11.99 ? 231  VAL B CA  1 
ATOM   6436  C C   . VAL B 1 205 ? 4.377   26.362  31.551  1.00 10.94 ? 231  VAL B C   1 
ATOM   6437  O O   . VAL B 1 205 ? 5.585   26.139  31.451  1.00 11.22 ? 231  VAL B O   1 
ATOM   6438  C CB  . VAL B 1 205 ? 3.383   28.505  30.742  1.00 11.78 ? 231  VAL B CB  1 
ATOM   6439  C CG1 . VAL B 1 205 ? 4.701   29.134  31.137  1.00 10.14 ? 231  VAL B CG1 1 
ATOM   6440  C CG2 . VAL B 1 205 ? 2.748   29.224  29.541  1.00 12.19 ? 231  VAL B CG2 1 
ATOM   6441  N N   . GLN B 1 206 ? 3.677   26.061  32.641  1.00 9.45  ? 232  GLN B N   1 
ATOM   6442  C CA  . GLN B 1 206 ? 4.294   25.424  33.803  1.00 11.77 ? 232  GLN B CA  1 
ATOM   6443  C C   . GLN B 1 206 ? 4.768   24.008  33.481  1.00 12.16 ? 232  GLN B C   1 
ATOM   6444  O O   . GLN B 1 206 ? 5.844   23.594  33.906  1.00 13.40 ? 232  GLN B O   1 
ATOM   6445  C CB  . GLN B 1 206 ? 3.309   25.397  34.974  1.00 12.20 ? 232  GLN B CB  1 
ATOM   6446  C CG  . GLN B 1 206 ? 2.912   26.771  35.494  1.00 12.54 ? 232  GLN B CG  1 
ATOM   6447  C CD  . GLN B 1 206 ? 4.091   27.540  36.053  1.00 12.63 ? 232  GLN B CD  1 
ATOM   6448  O OE1 . GLN B 1 206 ? 5.023   27.890  35.325  1.00 13.17 ? 232  GLN B OE1 1 
ATOM   6449  N NE2 . GLN B 1 206 ? 4.060   27.803  37.355  1.00 12.88 ? 232  GLN B NE2 1 
ATOM   6450  N N   . LEU B 1 207 ? 3.956   23.255  32.731  1.00 13.59 ? 233  LEU B N   1 
ATOM   6451  C CA  . LEU B 1 207 ? 4.330   21.894  32.355  1.00 13.06 ? 233  LEU B CA  1 
ATOM   6452  C C   . LEU B 1 207 ? 5.598   21.908  31.517  1.00 13.68 ? 233  LEU B C   1 
ATOM   6453  O O   . LEU B 1 207 ? 6.448   21.033  31.647  1.00 15.16 ? 233  LEU B O   1 
ATOM   6454  C CB  . LEU B 1 207 ? 3.199   21.208  31.575  1.00 13.87 ? 233  LEU B CB  1 
ATOM   6455  C CG  . LEU B 1 207 ? 1.911   20.939  32.359  1.00 15.08 ? 233  LEU B CG  1 
ATOM   6456  C CD1 . LEU B 1 207 ? 0.928   20.180  31.475  1.00 15.73 ? 233  LEU B CD1 1 
ATOM   6457  C CD2 . LEU B 1 207 ? 2.229   20.144  33.622  1.00 13.78 ? 233  LEU B CD2 1 
ATOM   6458  N N   . GLU B 1 208 ? 5.739   22.904  30.645  1.00 14.59 ? 234  GLU B N   1 
ATOM   6459  C CA  . GLU B 1 208 ? 6.947   22.982  29.836  1.00 15.09 ? 234  GLU B CA  1 
ATOM   6460  C C   . GLU B 1 208 ? 8.170   23.134  30.722  1.00 13.56 ? 234  GLU B C   1 
ATOM   6461  O O   . GLU B 1 208 ? 9.198   22.516  30.470  1.00 12.99 ? 234  GLU B O   1 
ATOM   6462  C CB  . GLU B 1 208 ? 6.903   24.163  28.869  1.00 17.82 ? 234  GLU B CB  1 
ATOM   6463  C CG  . GLU B 1 208 ? 5.969   23.994  27.712  1.00 23.17 ? 234  GLU B CG  1 
ATOM   6464  C CD  . GLU B 1 208 ? 6.149   25.096  26.694  1.00 25.48 ? 234  GLU B CD  1 
ATOM   6465  O OE1 . GLU B 1 208 ? 5.920   26.271  27.047  1.00 26.94 ? 234  GLU B OE1 1 
ATOM   6466  O OE2 . GLU B 1 208 ? 6.533   24.789  25.548  1.00 25.86 ? 234  GLU B OE2 1 
ATOM   6467  N N   . LYS B 1 209 ? 8.068   23.981  31.745  1.00 13.00 ? 235  LYS B N   1 
ATOM   6468  C CA  . LYS B 1 209 ? 9.187   24.203  32.654  1.00 13.31 ? 235  LYS B CA  1 
ATOM   6469  C C   . LYS B 1 209 ? 9.550   22.891  33.351  1.00 11.92 ? 235  LYS B C   1 
ATOM   6470  O O   . LYS B 1 209 ? 10.717  22.498  33.394  1.00 10.77 ? 235  LYS B O   1 
ATOM   6471  C CB  . LYS B 1 209 ? 8.831   25.260  33.710  1.00 12.57 ? 235  LYS B CB  1 
ATOM   6472  C CG  . LYS B 1 209 ? 8.610   26.671  33.156  1.00 14.91 ? 235  LYS B CG  1 
ATOM   6473  C CD  . LYS B 1 209 ? 8.117   27.604  34.260  1.00 14.48 ? 235  LYS B CD  1 
ATOM   6474  C CE  . LYS B 1 209 ? 7.755   28.982  33.721  1.00 13.82 ? 235  LYS B CE  1 
ATOM   6475  N NZ  . LYS B 1 209 ? 7.052   29.772  34.775  1.00 10.63 ? 235  LYS B NZ  1 
ATOM   6476  N N   . ILE B 1 210 ? 8.543   22.221  33.894  1.00 11.18 ? 236  ILE B N   1 
ATOM   6477  C CA  . ILE B 1 210 ? 8.747   20.954  34.589  1.00 12.36 ? 236  ILE B CA  1 
ATOM   6478  C C   . ILE B 1 210 ? 9.434   19.954  33.673  1.00 12.71 ? 236  ILE B C   1 
ATOM   6479  O O   . ILE B 1 210 ? 10.461  19.372  34.020  1.00 12.33 ? 236  ILE B O   1 
ATOM   6480  C CB  . ILE B 1 210 ? 7.395   20.400  35.089  1.00 10.91 ? 236  ILE B CB  1 
ATOM   6481  C CG1 . ILE B 1 210 ? 6.905   21.280  36.244  1.00 9.59  ? 236  ILE B CG1 1 
ATOM   6482  C CG2 . ILE B 1 210 ? 7.536   18.958  35.545  1.00 11.22 ? 236  ILE B CG2 1 
ATOM   6483  C CD1 . ILE B 1 210 ? 5.496   21.010  36.690  1.00 6.46  ? 236  ILE B CD1 1 
ATOM   6484  N N   . TRP B 1 211 ? 8.872   19.781  32.488  1.00 13.60 ? 237  TRP B N   1 
ATOM   6485  C CA  . TRP B 1 211 ? 9.437   18.868  31.514  1.00 15.43 ? 237  TRP B CA  1 
ATOM   6486  C C   . TRP B 1 211 ? 10.914  19.158  31.240  1.00 15.89 ? 237  TRP B C   1 
ATOM   6487  O O   . TRP B 1 211 ? 11.751  18.252  31.297  1.00 16.82 ? 237  TRP B O   1 
ATOM   6488  C CB  . TRP B 1 211 ? 8.638   18.941  30.207  1.00 16.09 ? 237  TRP B CB  1 
ATOM   6489  C CG  . TRP B 1 211 ? 9.102   17.964  29.166  1.00 17.66 ? 237  TRP B CG  1 
ATOM   6490  C CD1 . TRP B 1 211 ? 10.235  18.050  28.407  1.00 15.79 ? 237  TRP B CD1 1 
ATOM   6491  C CD2 . TRP B 1 211 ? 8.479   16.719  28.816  1.00 17.32 ? 237  TRP B CD2 1 
ATOM   6492  N NE1 . TRP B 1 211 ? 10.362  16.939  27.615  1.00 17.71 ? 237  TRP B NE1 1 
ATOM   6493  C CE2 . TRP B 1 211 ? 9.298   16.104  27.843  1.00 17.89 ? 237  TRP B CE2 1 
ATOM   6494  C CE3 . TRP B 1 211 ? 7.312   16.062  29.231  1.00 18.32 ? 237  TRP B CE3 1 
ATOM   6495  C CZ2 . TRP B 1 211 ? 8.989   14.859  27.277  1.00 15.24 ? 237  TRP B CZ2 1 
ATOM   6496  C CZ3 . TRP B 1 211 ? 7.003   14.821  28.666  1.00 17.62 ? 237  TRP B CZ3 1 
ATOM   6497  C CH2 . TRP B 1 211 ? 7.843   14.236  27.699  1.00 16.93 ? 237  TRP B CH2 1 
ATOM   6498  N N   . ASN B 1 212 ? 11.233  20.414  30.946  1.00 15.83 ? 238  ASN B N   1 
ATOM   6499  C CA  . ASN B 1 212 ? 12.609  20.785  30.642  1.00 17.81 ? 238  ASN B CA  1 
ATOM   6500  C C   . ASN B 1 212 ? 13.514  20.695  31.859  1.00 17.53 ? 238  ASN B C   1 
ATOM   6501  O O   . ASN B 1 212 ? 14.736  20.693  31.729  1.00 17.46 ? 238  ASN B O   1 
ATOM   6502  C CB  . ASN B 1 212 ? 12.675  22.193  30.040  1.00 19.46 ? 238  ASN B CB  1 
ATOM   6503  C CG  . ASN B 1 212 ? 12.026  22.268  28.667  1.00 23.92 ? 238  ASN B CG  1 
ATOM   6504  O OD1 . ASN B 1 212 ? 12.162  21.352  27.855  1.00 26.79 ? 238  ASN B OD1 1 
ATOM   6505  N ND2 . ASN B 1 212 ? 11.325  23.363  28.398  1.00 23.25 ? 238  ASN B ND2 1 
ATOM   6506  N N   . SER B 1 213 ? 12.914  20.604  33.039  1.00 17.40 ? 239  SER B N   1 
ATOM   6507  C CA  . SER B 1 213 ? 13.696  20.496  34.263  1.00 19.59 ? 239  SER B CA  1 
ATOM   6508  C C   . SER B 1 213 ? 13.859  19.042  34.689  1.00 18.81 ? 239  SER B C   1 
ATOM   6509  O O   . SER B 1 213 ? 14.319  18.761  35.795  1.00 18.96 ? 239  SER B O   1 
ATOM   6510  C CB  . SER B 1 213 ? 13.041  21.305  35.381  1.00 20.71 ? 239  SER B CB  1 
ATOM   6511  O OG  . SER B 1 213 ? 12.981  22.676  35.021  1.00 23.60 ? 239  SER B OG  1 
ATOM   6512  N N   . SER B 1 214 ? 13.477  18.120  33.814  1.00 17.78 ? 240  SER B N   1 
ATOM   6513  C CA  . SER B 1 214 ? 13.609  16.696  34.110  1.00 18.30 ? 240  SER B CA  1 
ATOM   6514  C C   . SER B 1 214 ? 13.781  15.896  32.829  1.00 19.49 ? 240  SER B C   1 
ATOM   6515  O O   . SER B 1 214 ? 13.187  14.834  32.667  1.00 19.42 ? 240  SER B O   1 
ATOM   6516  C CB  . SER B 1 214 ? 12.385  16.182  34.884  1.00 17.11 ? 240  SER B CB  1 
ATOM   6517  O OG  . SER B 1 214 ? 11.172  16.439  34.196  1.00 17.72 ? 240  SER B OG  1 
ATOM   6518  N N   . LEU B 1 215 ? 14.612  16.413  31.931  1.00 21.34 ? 241  LEU B N   1 
ATOM   6519  C CA  . LEU B 1 215 ? 14.872  15.784  30.642  1.00 24.27 ? 241  LEU B CA  1 
ATOM   6520  C C   . LEU B 1 215 ? 15.622  14.458  30.734  1.00 27.19 ? 241  LEU B C   1 
ATOM   6521  O O   . LEU B 1 215 ? 15.460  13.587  29.874  1.00 27.31 ? 241  LEU B O   1 
ATOM   6522  C CB  . LEU B 1 215 ? 15.659  16.746  29.754  1.00 23.72 ? 241  LEU B CB  1 
ATOM   6523  C CG  . LEU B 1 215 ? 14.921  18.016  29.343  1.00 23.65 ? 241  LEU B CG  1 
ATOM   6524  C CD1 . LEU B 1 215 ? 15.906  18.977  28.688  1.00 24.08 ? 241  LEU B CD1 1 
ATOM   6525  C CD2 . LEU B 1 215 ? 13.769  17.668  28.399  1.00 25.50 ? 241  LEU B CD2 1 
ATOM   6526  N N   . GLN B 1 216 ? 16.445  14.304  31.763  1.00 29.65 ? 242  GLN B N   1 
ATOM   6527  C CA  . GLN B 1 216 ? 17.206  13.076  31.917  1.00 34.49 ? 242  GLN B CA  1 
ATOM   6528  C C   . GLN B 1 216 ? 16.641  12.143  32.975  1.00 35.44 ? 242  GLN B C   1 
ATOM   6529  O O   . GLN B 1 216 ? 15.960  12.572  33.905  1.00 36.02 ? 242  GLN B O   1 
ATOM   6530  C CB  . GLN B 1 216 ? 18.661  13.398  32.252  1.00 36.97 ? 242  GLN B CB  1 
ATOM   6531  C CG  . GLN B 1 216 ? 19.460  13.901  31.064  1.00 41.81 ? 242  GLN B CG  1 
ATOM   6532  C CD  . GLN B 1 216 ? 20.928  14.052  31.381  1.00 44.72 ? 242  GLN B CD  1 
ATOM   6533  O OE1 . GLN B 1 216 ? 21.318  14.898  32.186  1.00 46.90 ? 242  GLN B OE1 1 
ATOM   6534  N NE2 . GLN B 1 216 ? 21.758  13.224  30.754  1.00 46.39 ? 242  GLN B NE2 1 
ATOM   6535  N N   . SER B 1 217 ? 16.926  10.855  32.821  1.00 36.81 ? 243  SER B N   1 
ATOM   6536  C CA  . SER B 1 217 ? 16.466  9.854   33.776  1.00 38.93 ? 243  SER B CA  1 
ATOM   6537  C C   . SER B 1 217 ? 17.629  9.397   34.646  1.00 39.13 ? 243  SER B C   1 
ATOM   6538  O O   . SER B 1 217 ? 17.907  8.207   34.756  1.00 39.18 ? 243  SER B O   1 
ATOM   6539  C CB  . SER B 1 217 ? 15.868  8.656   33.040  1.00 39.33 ? 243  SER B CB  1 
ATOM   6540  O OG  . SER B 1 217 ? 14.814  9.068   32.183  1.00 42.57 ? 243  SER B OG  1 
ATOM   6541  N N   . ASN B 1 218 ? 18.309  10.358  35.261  1.00 40.73 ? 244  ASN B N   1 
ATOM   6542  C CA  . ASN B 1 218 ? 19.448  10.058  36.117  1.00 41.55 ? 244  ASN B CA  1 
ATOM   6543  C C   . ASN B 1 218 ? 19.032  10.114  37.587  1.00 40.39 ? 244  ASN B C   1 
ATOM   6544  O O   . ASN B 1 218 ? 19.834  10.451  38.463  1.00 40.96 ? 244  ASN B O   1 
ATOM   6545  C CB  . ASN B 1 218 ? 20.581  11.057  35.850  1.00 43.26 ? 244  ASN B CB  1 
ATOM   6546  C CG  . ASN B 1 218 ? 20.218  12.476  36.250  1.00 46.14 ? 244  ASN B CG  1 
ATOM   6547  O OD1 . ASN B 1 218 ? 19.212  13.029  35.798  1.00 47.45 ? 244  ASN B OD1 1 
ATOM   6548  N ND2 . ASN B 1 218 ? 21.040  13.074  37.104  1.00 48.01 ? 244  ASN B ND2 1 
ATOM   6549  N N   . LYS B 1 219 ? 17.772  9.778   37.854  1.00 37.16 ? 245  LYS B N   1 
ATOM   6550  C CA  . LYS B 1 219 ? 17.262  9.791   39.217  1.00 33.43 ? 245  LYS B CA  1 
ATOM   6551  C C   . LYS B 1 219 ? 16.608  8.456   39.565  1.00 29.85 ? 245  LYS B C   1 
ATOM   6552  O O   . LYS B 1 219 ? 15.978  7.814   38.724  1.00 28.29 ? 245  LYS B O   1 
ATOM   6553  C CB  . LYS B 1 219 ? 16.255  10.932  39.393  1.00 35.77 ? 245  LYS B CB  1 
ATOM   6554  C CG  . LYS B 1 219 ? 16.835  12.325  39.141  1.00 37.09 ? 245  LYS B CG  1 
ATOM   6555  C CD  . LYS B 1 219 ? 17.919  12.673  40.153  1.00 36.84 ? 245  LYS B CD  1 
ATOM   6556  C CE  . LYS B 1 219 ? 18.443  14.086  39.946  1.00 37.96 ? 245  LYS B CE  1 
ATOM   6557  N NZ  . LYS B 1 219 ? 19.520  14.428  40.918  1.00 38.33 ? 245  LYS B NZ  1 
ATOM   6558  N N   . GLU B 1 220 ? 16.781  8.033   40.810  1.00 26.13 ? 246  GLU B N   1 
ATOM   6559  C CA  . GLU B 1 220 ? 16.206  6.782   41.278  1.00 21.01 ? 246  GLU B CA  1 
ATOM   6560  C C   . GLU B 1 220 ? 14.685  6.888   41.304  1.00 19.36 ? 246  GLU B C   1 
ATOM   6561  O O   . GLU B 1 220 ? 14.132  7.914   41.705  1.00 18.98 ? 246  GLU B O   1 
ATOM   6562  C CB  . GLU B 1 220 ? 16.722  6.467   42.682  1.00 21.65 ? 246  GLU B CB  1 
ATOM   6563  C CG  . GLU B 1 220 ? 18.196  6.098   42.749  1.00 22.16 ? 246  GLU B CG  1 
ATOM   6564  C CD  . GLU B 1 220 ? 18.483  4.797   42.031  1.00 21.38 ? 246  GLU B CD  1 
ATOM   6565  O OE1 . GLU B 1 220 ? 17.598  3.920   42.049  1.00 23.30 ? 246  GLU B OE1 1 
ATOM   6566  O OE2 . GLU B 1 220 ? 19.583  4.642   41.460  1.00 23.44 ? 246  GLU B OE2 1 
ATOM   6567  N N   . PRO B 1 221 ? 13.983  5.829   40.865  1.00 16.58 ? 247  PRO B N   1 
ATOM   6568  C CA  . PRO B 1 221 ? 12.519  5.825   40.853  1.00 16.73 ? 247  PRO B CA  1 
ATOM   6569  C C   . PRO B 1 221 ? 11.947  5.578   42.250  1.00 16.44 ? 247  PRO B C   1 
ATOM   6570  O O   . PRO B 1 221 ? 11.391  4.514   42.526  1.00 17.78 ? 247  PRO B O   1 
ATOM   6571  C CB  . PRO B 1 221 ? 12.188  4.699   39.877  1.00 16.28 ? 247  PRO B CB  1 
ATOM   6572  C CG  . PRO B 1 221 ? 13.310  3.730   40.107  1.00 15.68 ? 247  PRO B CG  1 
ATOM   6573  C CD  . PRO B 1 221 ? 14.520  4.638   40.183  1.00 15.42 ? 247  PRO B CD  1 
ATOM   6574  N N   . VAL B 1 222 ? 12.096  6.566   43.124  1.00 13.47 ? 248  VAL B N   1 
ATOM   6575  C CA  . VAL B 1 222 ? 11.599  6.470   44.492  1.00 13.44 ? 248  VAL B CA  1 
ATOM   6576  C C   . VAL B 1 222 ? 10.122  6.088   44.547  1.00 12.84 ? 248  VAL B C   1 
ATOM   6577  O O   . VAL B 1 222 ? 9.697   5.348   45.429  1.00 12.35 ? 248  VAL B O   1 
ATOM   6578  C CB  . VAL B 1 222 ? 11.760  7.804   45.233  1.00 15.10 ? 248  VAL B CB  1 
ATOM   6579  C CG1 . VAL B 1 222 ? 11.203  7.695   46.641  1.00 15.11 ? 248  VAL B CG1 1 
ATOM   6580  C CG2 . VAL B 1 222 ? 13.222  8.196   45.267  1.00 17.38 ? 248  VAL B CG2 1 
ATOM   6581  N N   . GLY B 1 223 ? 9.340   6.605   43.600  1.00 12.28 ? 249  GLY B N   1 
ATOM   6582  C CA  . GLY B 1 223 ? 7.920   6.314   43.584  1.00 11.34 ? 249  GLY B CA  1 
ATOM   6583  C C   . GLY B 1 223 ? 7.584   4.837   43.479  1.00 9.75  ? 249  GLY B C   1 
ATOM   6584  O O   . GLY B 1 223 ? 6.522   4.403   43.918  1.00 9.45  ? 249  GLY B O   1 
ATOM   6585  N N   . ILE B 1 224 ? 8.500   4.061   42.904  1.00 9.39  ? 250  ILE B N   1 
ATOM   6586  C CA  . ILE B 1 224 ? 8.292   2.631   42.718  1.00 10.54 ? 250  ILE B CA  1 
ATOM   6587  C C   . ILE B 1 224 ? 8.201   1.895   44.052  1.00 9.79  ? 250  ILE B C   1 
ATOM   6588  O O   . ILE B 1 224 ? 7.749   0.752   44.115  1.00 10.31 ? 250  ILE B O   1 
ATOM   6589  C CB  . ILE B 1 224 ? 9.412   2.018   41.825  1.00 10.84 ? 250  ILE B CB  1 
ATOM   6590  C CG1 . ILE B 1 224 ? 8.836   0.882   40.987  1.00 11.42 ? 250  ILE B CG1 1 
ATOM   6591  C CG2 . ILE B 1 224 ? 10.551  1.476   42.674  1.00 11.78 ? 250  ILE B CG2 1 
ATOM   6592  C CD1 . ILE B 1 224 ? 9.753   0.427   39.867  1.00 16.11 ? 250  ILE B CD1 1 
ATOM   6593  N N   . LEU B 1 225 ? 8.624   2.560   45.119  1.00 9.74  ? 251  LEU B N   1 
ATOM   6594  C CA  . LEU B 1 225 ? 8.560   1.964   46.443  1.00 8.59  ? 251  LEU B CA  1 
ATOM   6595  C C   . LEU B 1 225 ? 7.098   1.757   46.837  1.00 9.22  ? 251  LEU B C   1 
ATOM   6596  O O   . LEU B 1 225 ? 6.771   0.838   47.576  1.00 9.86  ? 251  LEU B O   1 
ATOM   6597  C CB  . LEU B 1 225 ? 9.272   2.867   47.467  1.00 7.99  ? 251  LEU B CB  1 
ATOM   6598  C CG  . LEU B 1 225 ? 10.802  2.979   47.349  1.00 11.24 ? 251  LEU B CG  1 
ATOM   6599  C CD1 . LEU B 1 225 ? 11.293  4.135   48.204  1.00 11.79 ? 251  LEU B CD1 1 
ATOM   6600  C CD2 . LEU B 1 225 ? 11.468  1.676   47.785  1.00 10.09 ? 251  LEU B CD2 1 
ATOM   6601  N N   . THR B 1 226 ? 6.212   2.606   46.312  1.00 8.39  ? 252  THR B N   1 
ATOM   6602  C CA  . THR B 1 226 ? 4.781   2.522   46.624  1.00 7.71  ? 252  THR B CA  1 
ATOM   6603  C C   . THR B 1 226 ? 4.048   1.325   46.008  1.00 6.91  ? 252  THR B C   1 
ATOM   6604  O O   . THR B 1 226 ? 2.866   1.110   46.281  1.00 8.49  ? 252  THR B O   1 
ATOM   6605  C CB  . THR B 1 226 ? 4.039   3.792   46.167  1.00 7.40  ? 252  THR B CB  1 
ATOM   6606  O OG1 . THR B 1 226 ? 4.172   3.921   44.747  1.00 6.30  ? 252  THR B OG1 1 
ATOM   6607  C CG2 . THR B 1 226 ? 4.618   5.033   46.851  1.00 6.60  ? 252  THR B CG2 1 
ATOM   6608  N N   . SER B 1 227 ? 4.741   0.548   45.180  1.00 7.50  ? 253  SER B N   1 
ATOM   6609  C CA  . SER B 1 227 ? 4.131   -0.617  44.544  1.00 7.90  ? 253  SER B CA  1 
ATOM   6610  C C   . SER B 1 227 ? 4.464   -1.915  45.272  1.00 9.41  ? 253  SER B C   1 
ATOM   6611  O O   . SER B 1 227 ? 4.026   -2.984  44.848  1.00 9.97  ? 253  SER B O   1 
ATOM   6612  C CB  . SER B 1 227 ? 4.631   -0.755  43.109  1.00 7.03  ? 253  SER B CB  1 
ATOM   6613  O OG  . SER B 1 227 ? 6.041   -0.948  43.103  1.00 8.49  ? 253  SER B OG  1 
ATOM   6614  N N   . ASN B 1 228 ? 5.230   -1.831  46.361  1.00 9.26  ? 254  ASN B N   1 
ATOM   6615  C CA  . ASN B 1 228 ? 5.631   -3.043  47.090  1.00 8.95  ? 254  ASN B CA  1 
ATOM   6616  C C   . ASN B 1 228 ? 4.603   -3.522  48.118  1.00 9.05  ? 254  ASN B C   1 
ATOM   6617  O O   . ASN B 1 228 ? 3.577   -2.884  48.349  1.00 8.93  ? 254  ASN B O   1 
ATOM   6618  C CB  . ASN B 1 228 ? 6.998   -2.821  47.771  1.00 9.39  ? 254  ASN B CB  1 
ATOM   6619  C CG  . ASN B 1 228 ? 7.862   -4.090  47.785  1.00 11.51 ? 254  ASN B CG  1 
ATOM   6620  O OD1 . ASN B 1 228 ? 7.339   -5.202  47.754  1.00 9.35  ? 254  ASN B OD1 1 
ATOM   6621  N ND2 . ASN B 1 228 ? 9.181   -3.921  47.844  1.00 8.94  ? 254  ASN B ND2 1 
ATOM   6622  N N   . HIS B 1 229 ? 4.881   -4.684  48.721  1.00 7.13  ? 255  HIS B N   1 
ATOM   6623  C CA  . HIS B 1 229 ? 4.013   -5.252  49.742  1.00 8.69  ? 255  HIS B CA  1 
ATOM   6624  C C   . HIS B 1 229 ? 3.881   -4.185  50.832  1.00 8.27  ? 255  HIS B C   1 
ATOM   6625  O O   . HIS B 1 229 ? 4.870   -3.540  51.176  1.00 9.41  ? 255  HIS B O   1 
ATOM   6626  C CB  . HIS B 1 229 ? 4.650   -6.510  50.313  1.00 9.00  ? 255  HIS B CB  1 
ATOM   6627  C CG  . HIS B 1 229 ? 3.747   -7.277  51.216  1.00 10.95 ? 255  HIS B CG  1 
ATOM   6628  N ND1 . HIS B 1 229 ? 3.004   -8.355  50.789  1.00 15.78 ? 255  HIS B ND1 1 
ATOM   6629  C CD2 . HIS B 1 229 ? 3.443   -7.106  52.529  1.00 10.50 ? 255  HIS B CD2 1 
ATOM   6630  C CE1 . HIS B 1 229 ? 2.280   -8.815  51.792  1.00 14.30 ? 255  HIS B CE1 1 
ATOM   6631  N NE2 . HIS B 1 229 ? 2.528   -8.079  52.861  1.00 14.83 ? 255  HIS B NE2 1 
ATOM   6632  N N   . ARG B 1 230 ? 2.687   -4.016  51.390  1.00 8.65  ? 256  ARG B N   1 
ATOM   6633  C CA  . ARG B 1 230 ? 2.471   -2.980  52.400  1.00 9.29  ? 256  ARG B CA  1 
ATOM   6634  C C   . ARG B 1 230 ? 3.355   -3.127  53.632  1.00 11.75 ? 256  ARG B C   1 
ATOM   6635  O O   . ARG B 1 230 ? 3.828   -2.130  54.186  1.00 12.99 ? 256  ARG B O   1 
ATOM   6636  C CB  . ARG B 1 230 ? 0.988   -2.917  52.779  1.00 7.28  ? 256  ARG B CB  1 
ATOM   6637  C CG  . ARG B 1 230 ? 0.051   -2.819  51.563  1.00 6.04  ? 256  ARG B CG  1 
ATOM   6638  C CD  . ARG B 1 230 ? 0.398   -1.666  50.628  1.00 6.30  ? 256  ARG B CD  1 
ATOM   6639  N NE  . ARG B 1 230 ? 0.235   -0.362  51.260  1.00 5.79  ? 256  ARG B NE  1 
ATOM   6640  C CZ  . ARG B 1 230 ? 0.465   0.794   50.648  1.00 8.41  ? 256  ARG B CZ  1 
ATOM   6641  N NH1 . ARG B 1 230 ? 0.870   0.809   49.382  1.00 7.80  ? 256  ARG B NH1 1 
ATOM   6642  N NH2 . ARG B 1 230 ? 0.303   1.943   51.298  1.00 6.57  ? 256  ARG B NH2 1 
ATOM   6643  N N   . ASN B 1 231 ? 3.603   -4.365  54.062  1.00 11.64 ? 257  ASN B N   1 
ATOM   6644  C CA  . ASN B 1 231 ? 4.482   -4.567  55.202  1.00 11.49 ? 257  ASN B CA  1 
ATOM   6645  C C   . ASN B 1 231 ? 5.855   -4.019  54.820  1.00 11.10 ? 257  ASN B C   1 
ATOM   6646  O O   . ASN B 1 231 ? 6.464   -3.285  55.585  1.00 11.73 ? 257  ASN B O   1 
ATOM   6647  C CB  . ASN B 1 231 ? 4.605   -6.055  55.540  1.00 11.51 ? 257  ASN B CB  1 
ATOM   6648  C CG  . ASN B 1 231 ? 3.463   -6.570  56.389  1.00 13.39 ? 257  ASN B CG  1 
ATOM   6649  O OD1 . ASN B 1 231 ? 2.457   -5.889  56.611  1.00 12.91 ? 257  ASN B OD1 1 
ATOM   6650  N ND2 . ASN B 1 231 ? 3.612   -7.800  56.872  1.00 15.43 ? 257  ASN B ND2 1 
ATOM   6651  N N   . THR B 1 232 ? 6.337   -4.381  53.628  1.00 10.38 ? 258  THR B N   1 
ATOM   6652  C CA  . THR B 1 232 ? 7.637   -3.930  53.151  1.00 10.21 ? 258  THR B CA  1 
ATOM   6653  C C   . THR B 1 232 ? 7.656   -2.414  52.937  1.00 11.73 ? 258  THR B C   1 
ATOM   6654  O O   . THR B 1 232 ? 8.590   -1.720  53.368  1.00 10.99 ? 258  THR B O   1 
ATOM   6655  C CB  . THR B 1 232 ? 7.965   -4.608  51.833  1.00 11.53 ? 258  THR B CB  1 
ATOM   6656  O OG1 . THR B 1 232 ? 7.827   -6.019  52.003  1.00 13.06 ? 258  THR B OG1 1 
ATOM   6657  C CG2 . THR B 1 232 ? 9.378   -4.281  51.385  1.00 8.98  ? 258  THR B CG2 1 
ATOM   6658  N N   . TRP B 1 233 ? 6.635   -1.906  52.265  1.00 10.53 ? 259  TRP B N   1 
ATOM   6659  C CA  . TRP B 1 233 ? 6.555   -0.477  52.001  1.00 11.84 ? 259  TRP B CA  1 
ATOM   6660  C C   . TRP B 1 233 ? 6.471   0.299   53.325  1.00 13.16 ? 259  TRP B C   1 
ATOM   6661  O O   . TRP B 1 233 ? 7.055   1.367   53.463  1.00 13.54 ? 259  TRP B O   1 
ATOM   6662  C CB  . TRP B 1 233 ? 5.329   -0.205  51.127  1.00 12.04 ? 259  TRP B CB  1 
ATOM   6663  C CG  . TRP B 1 233 ? 5.021   1.245   50.833  1.00 11.16 ? 259  TRP B CG  1 
ATOM   6664  C CD1 . TRP B 1 233 ? 3.782   1.786   50.621  1.00 11.74 ? 259  TRP B CD1 1 
ATOM   6665  C CD2 . TRP B 1 233 ? 5.956   2.321   50.679  1.00 9.20  ? 259  TRP B CD2 1 
ATOM   6666  N NE1 . TRP B 1 233 ? 3.888   3.123   50.346  1.00 11.88 ? 259  TRP B NE1 1 
ATOM   6667  C CE2 . TRP B 1 233 ? 5.210   3.480   50.376  1.00 11.94 ? 259  TRP B CE2 1 
ATOM   6668  C CE3 . TRP B 1 233 ? 7.350   2.419   50.766  1.00 9.41  ? 259  TRP B CE3 1 
ATOM   6669  C CZ2 . TRP B 1 233 ? 5.811   4.727   50.160  1.00 10.28 ? 259  TRP B CZ2 1 
ATOM   6670  C CZ3 . TRP B 1 233 ? 7.947   3.654   50.552  1.00 11.10 ? 259  TRP B CZ3 1 
ATOM   6671  C CH2 . TRP B 1 233 ? 7.178   4.793   50.253  1.00 10.58 ? 259  TRP B CH2 1 
ATOM   6672  N N   . ALA B 1 234 ? 5.768   -0.250  54.313  1.00 14.11 ? 260  ALA B N   1 
ATOM   6673  C CA  . ALA B 1 234 ? 5.626   0.440   55.593  1.00 15.21 ? 260  ALA B CA  1 
ATOM   6674  C C   . ALA B 1 234 ? 6.994   0.728   56.215  1.00 15.36 ? 260  ALA B C   1 
ATOM   6675  O O   . ALA B 1 234 ? 7.240   1.824   56.718  1.00 14.33 ? 260  ALA B O   1 
ATOM   6676  C CB  . ALA B 1 234 ? 4.778   -0.393  56.542  1.00 15.69 ? 260  ALA B CB  1 
ATOM   6677  N N   . LYS B 1 235 ? 7.876   -0.260  56.171  1.00 14.92 ? 261  LYS B N   1 
ATOM   6678  C CA  . LYS B 1 235 ? 9.208   -0.116  56.730  1.00 15.83 ? 261  LYS B CA  1 
ATOM   6679  C C   . LYS B 1 235 ? 10.084  0.762   55.850  1.00 14.04 ? 261  LYS B C   1 
ATOM   6680  O O   . LYS B 1 235 ? 10.853  1.576   56.355  1.00 12.75 ? 261  LYS B O   1 
ATOM   6681  C CB  . LYS B 1 235 ? 9.855   -1.489  56.902  1.00 17.48 ? 261  LYS B CB  1 
ATOM   6682  C CG  . LYS B 1 235 ? 11.235  -1.436  57.531  1.00 21.38 ? 261  LYS B CG  1 
ATOM   6683  C CD  . LYS B 1 235 ? 11.811  -2.838  57.674  1.00 25.67 ? 261  LYS B CD  1 
ATOM   6684  C CE  . LYS B 1 235 ? 13.236  -2.806  58.210  1.00 28.23 ? 261  LYS B CE  1 
ATOM   6685  N NZ  . LYS B 1 235 ? 13.820  -4.176  58.337  1.00 31.84 ? 261  LYS B NZ  1 
ATOM   6686  N N   . ALA B 1 236 ? 9.983   0.596   54.540  1.00 13.55 ? 262  ALA B N   1 
ATOM   6687  C CA  . ALA B 1 236 ? 10.803  1.391   53.631  1.00 12.66 ? 262  ALA B CA  1 
ATOM   6688  C C   . ALA B 1 236 ? 10.360  2.856   53.671  1.00 12.52 ? 262  ALA B C   1 
ATOM   6689  O O   . ALA B 1 236 ? 11.184  3.763   53.524  1.00 12.90 ? 262  ALA B O   1 
ATOM   6690  C CB  . ALA B 1 236 ? 10.695  0.854   52.216  1.00 12.51 ? 262  ALA B CB  1 
ATOM   6691  N N   . TYR B 1 237 ? 9.076   3.072   53.868  1.00 11.67 ? 263  TYR B N   1 
ATOM   6692  C CA  . TYR B 1 237 ? 8.512   4.417   53.946  1.00 13.84 ? 263  TYR B CA  1 
ATOM   6693  C C   . TYR B 1 237 ? 9.063   5.101   55.192  1.00 15.97 ? 263  TYR B C   1 
ATOM   6694  O O   . TYR B 1 237 ? 9.575   6.220   55.135  1.00 15.24 ? 263  TYR B O   1 
ATOM   6695  C CB  . TYR B 1 237 ? 6.993   4.329   54.044  1.00 14.59 ? 263  TYR B CB  1 
ATOM   6696  C CG  . TYR B 1 237 ? 6.294   5.639   54.317  1.00 16.16 ? 263  TYR B CG  1 
ATOM   6697  C CD1 . TYR B 1 237 ? 6.134   6.588   53.313  1.00 18.09 ? 263  TYR B CD1 1 
ATOM   6698  C CD2 . TYR B 1 237 ? 5.790   5.929   55.585  1.00 19.12 ? 263  TYR B CD2 1 
ATOM   6699  C CE1 . TYR B 1 237 ? 5.491   7.794   53.560  1.00 18.70 ? 263  TYR B CE1 1 
ATOM   6700  C CE2 . TYR B 1 237 ? 5.142   7.134   55.846  1.00 19.17 ? 263  TYR B CE2 1 
ATOM   6701  C CZ  . TYR B 1 237 ? 4.999   8.060   54.825  1.00 19.45 ? 263  TYR B CZ  1 
ATOM   6702  O OH  . TYR B 1 237 ? 4.373   9.255   55.079  1.00 20.53 ? 263  TYR B OH  1 
ATOM   6703  N N   . ASN B 1 238 ? 8.953   4.407   56.322  1.00 17.41 ? 264  ASN B N   1 
ATOM   6704  C CA  . ASN B 1 238 ? 9.424   4.937   57.592  1.00 18.67 ? 264  ASN B CA  1 
ATOM   6705  C C   . ASN B 1 238 ? 10.872  5.385   57.488  1.00 18.96 ? 264  ASN B C   1 
ATOM   6706  O O   . ASN B 1 238 ? 11.230  6.459   57.962  1.00 19.07 ? 264  ASN B O   1 
ATOM   6707  C CB  . ASN B 1 238 ? 9.263   3.881   58.693  1.00 20.63 ? 264  ASN B CB  1 
ATOM   6708  C CG  . ASN B 1 238 ? 9.705   4.387   60.051  1.00 23.06 ? 264  ASN B CG  1 
ATOM   6709  O OD1 . ASN B 1 238 ? 10.848  4.191   60.458  1.00 25.60 ? 264  ASN B OD1 1 
ATOM   6710  N ND2 . ASN B 1 238 ? 8.799   5.060   60.755  1.00 22.57 ? 264  ASN B ND2 1 
ATOM   6711  N N   . ASN B 1 239 ? 11.707  4.572   56.853  1.00 18.68 ? 265  ASN B N   1 
ATOM   6712  C CA  . ASN B 1 239 ? 13.108  4.927   56.701  1.00 20.22 ? 265  ASN B CA  1 
ATOM   6713  C C   . ASN B 1 239 ? 13.278  6.101   55.744  1.00 20.17 ? 265  ASN B C   1 
ATOM   6714  O O   . ASN B 1 239 ? 14.104  6.993   55.968  1.00 20.72 ? 265  ASN B O   1 
ATOM   6715  C CB  . ASN B 1 239 ? 13.902  3.738   56.170  1.00 21.80 ? 265  ASN B CB  1 
ATOM   6716  C CG  . ASN B 1 239 ? 15.363  4.063   55.977  1.00 26.20 ? 265  ASN B CG  1 
ATOM   6717  O OD1 . ASN B 1 239 ? 16.086  4.324   56.942  1.00 28.89 ? 265  ASN B OD1 1 
ATOM   6718  N ND2 . ASN B 1 239 ? 15.812  4.061   54.727  1.00 24.70 ? 265  ASN B ND2 1 
ATOM   6719  N N   . LEU B 1 240 ? 12.493  6.091   54.675  1.00 19.18 ? 266  LEU B N   1 
ATOM   6720  C CA  . LEU B 1 240 ? 12.552  7.139   53.665  1.00 18.65 ? 266  LEU B CA  1 
ATOM   6721  C C   . LEU B 1 240 ? 12.325  8.521   54.265  1.00 17.65 ? 266  LEU B C   1 
ATOM   6722  O O   . LEU B 1 240 ? 13.081  9.448   53.993  1.00 17.80 ? 266  LEU B O   1 
ATOM   6723  C CB  . LEU B 1 240 ? 11.501  6.878   52.585  1.00 19.38 ? 266  LEU B CB  1 
ATOM   6724  C CG  . LEU B 1 240 ? 11.437  7.869   51.424  1.00 19.05 ? 266  LEU B CG  1 
ATOM   6725  C CD1 . LEU B 1 240 ? 12.695  7.752   50.575  1.00 16.97 ? 266  LEU B CD1 1 
ATOM   6726  C CD2 . LEU B 1 240 ? 10.199  7.589   50.586  1.00 18.24 ? 266  LEU B CD2 1 
ATOM   6727  N N   . ILE B 1 241 ? 11.295  8.652   55.093  1.00 16.99 ? 267  ILE B N   1 
ATOM   6728  C CA  . ILE B 1 241 ? 10.980  9.942   55.688  1.00 19.62 ? 267  ILE B CA  1 
ATOM   6729  C C   . ILE B 1 241 ? 11.805  10.332  56.914  1.00 21.49 ? 267  ILE B C   1 
ATOM   6730  O O   . ILE B 1 241 ? 11.435  11.257  57.639  1.00 22.46 ? 267  ILE B O   1 
ATOM   6731  C CB  . ILE B 1 241 ? 9.494   10.040  56.051  1.00 18.08 ? 267  ILE B CB  1 
ATOM   6732  C CG1 . ILE B 1 241 ? 9.129   8.964   57.070  1.00 18.05 ? 267  ILE B CG1 1 
ATOM   6733  C CG2 . ILE B 1 241 ? 8.646   9.907   54.790  1.00 19.19 ? 267  ILE B CG2 1 
ATOM   6734  C CD1 . ILE B 1 241 ? 7.740   9.116   57.595  1.00 16.83 ? 267  ILE B CD1 1 
ATOM   6735  N N   . LYS B 1 242 ? 12.917  9.643   57.148  1.00 21.43 ? 268  LYS B N   1 
ATOM   6736  C CA  . LYS B 1 242 ? 13.781  9.997   58.269  1.00 23.17 ? 268  LYS B CA  1 
ATOM   6737  C C   . LYS B 1 242 ? 14.534  11.269  57.906  1.00 23.47 ? 268  LYS B C   1 
ATOM   6738  O O   . LYS B 1 242 ? 14.811  12.102  58.767  1.00 23.82 ? 268  LYS B O   1 
ATOM   6739  C CB  . LYS B 1 242 ? 14.777  8.879   58.572  1.00 24.17 ? 268  LYS B CB  1 
ATOM   6740  C CG  . LYS B 1 242 ? 14.176  7.751   59.398  1.00 28.14 ? 268  LYS B CG  1 
ATOM   6741  C CD  . LYS B 1 242 ? 15.126  6.570   59.515  1.00 31.05 ? 268  LYS B CD  1 
ATOM   6742  C CE  . LYS B 1 242 ? 14.445  5.363   60.162  1.00 34.99 ? 268  LYS B CE  1 
ATOM   6743  N NZ  . LYS B 1 242 ? 15.213  4.102   59.933  1.00 34.33 ? 268  LYS B NZ  1 
ATOM   6744  N N   . ASP B 1 243 ? 14.864  11.414  56.625  1.00 22.71 ? 269  ASP B N   1 
ATOM   6745  C CA  . ASP B 1 243 ? 15.576  12.587  56.142  1.00 22.65 ? 269  ASP B CA  1 
ATOM   6746  C C   . ASP B 1 243 ? 14.604  13.755  56.037  1.00 23.29 ? 269  ASP B C   1 
ATOM   6747  O O   . ASP B 1 243 ? 13.459  13.572  55.626  1.00 23.29 ? 269  ASP B O   1 
ATOM   6748  C CB  . ASP B 1 243 ? 16.173  12.296  54.774  1.00 24.63 ? 269  ASP B CB  1 
ATOM   6749  C CG  . ASP B 1 243 ? 16.826  13.508  54.159  1.00 27.92 ? 269  ASP B CG  1 
ATOM   6750  O OD1 . ASP B 1 243 ? 17.937  13.878  54.605  1.00 28.68 ? 269  ASP B OD1 1 
ATOM   6751  O OD2 . ASP B 1 243 ? 16.225  14.094  53.233  1.00 30.70 ? 269  ASP B OD2 1 
ATOM   6752  N N   . LYS B 1 244 ? 15.063  14.951  56.405  1.00 22.41 ? 270  LYS B N   1 
ATOM   6753  C CA  . LYS B 1 244 ? 14.237  16.158  56.356  1.00 21.58 ? 270  LYS B CA  1 
ATOM   6754  C C   . LYS B 1 244 ? 13.663  16.443  54.960  1.00 18.59 ? 270  LYS B C   1 
ATOM   6755  O O   . LYS B 1 244 ? 12.468  16.657  54.808  1.00 16.68 ? 270  LYS B O   1 
ATOM   6756  C CB  . LYS B 1 244 ? 15.057  17.371  56.827  1.00 23.49 ? 270  LYS B CB  1 
ATOM   6757  C CG  . LYS B 1 244 ? 14.377  18.711  56.554  1.00 27.71 ? 270  LYS B CG  1 
ATOM   6758  C CD  . LYS B 1 244 ? 15.274  19.913  56.894  1.00 31.19 ? 270  LYS B CD  1 
ATOM   6759  C CE  . LYS B 1 244 ? 14.623  21.234  56.457  1.00 35.24 ? 270  LYS B CE  1 
ATOM   6760  N NZ  . LYS B 1 244 ? 15.238  22.468  57.051  1.00 36.45 ? 270  LYS B NZ  1 
ATOM   6761  N N   . VAL B 1 245 ? 14.520  16.467  53.949  1.00 18.94 ? 271  VAL B N   1 
ATOM   6762  C CA  . VAL B 1 245 ? 14.088  16.742  52.583  1.00 19.66 ? 271  VAL B CA  1 
ATOM   6763  C C   . VAL B 1 245 ? 13.073  15.698  52.090  1.00 19.18 ? 271  VAL B C   1 
ATOM   6764  O O   . VAL B 1 245 ? 12.008  16.048  51.556  1.00 20.58 ? 271  VAL B O   1 
ATOM   6765  C CB  . VAL B 1 245 ? 15.301  16.760  51.634  1.00 20.84 ? 271  VAL B CB  1 
ATOM   6766  C CG1 . VAL B 1 245 ? 14.843  17.021  50.202  1.00 21.12 ? 271  VAL B CG1 1 
ATOM   6767  C CG2 . VAL B 1 245 ? 16.301  17.822  52.102  1.00 20.79 ? 271  VAL B CG2 1 
ATOM   6768  N N   . ASN B 1 246 ? 13.397  14.430  52.264  1.00 16.85 ? 272  ASN B N   1 
ATOM   6769  C CA  . ASN B 1 246 ? 12.498  13.368  51.828  1.00 15.75 ? 272  ASN B CA  1 
ATOM   6770  C C   . ASN B 1 246 ? 11.131  13.546  52.441  1.00 14.80 ? 272  ASN B C   1 
ATOM   6771  O O   . ASN B 1 246 ? 10.119  13.387  51.771  1.00 14.55 ? 272  ASN B O   1 
ATOM   6772  C CB  . ASN B 1 246 ? 13.045  12.002  52.224  1.00 13.68 ? 272  ASN B CB  1 
ATOM   6773  C CG  . ASN B 1 246 ? 14.306  11.651  51.496  1.00 13.95 ? 272  ASN B CG  1 
ATOM   6774  O OD1 . ASN B 1 246 ? 14.721  12.354  50.576  1.00 14.48 ? 272  ASN B OD1 1 
ATOM   6775  N ND2 . ASN B 1 246 ? 14.934  10.553  51.896  1.00 17.09 ? 272  ASN B ND2 1 
ATOM   6776  N N   . ARG B 1 247 ? 11.100  13.888  53.725  1.00 16.77 ? 273  ARG B N   1 
ATOM   6777  C CA  . ARG B 1 247 ? 9.839   14.059  54.420  1.00 17.19 ? 273  ARG B CA  1 
ATOM   6778  C C   . ARG B 1 247 ? 8.990   15.186  53.818  1.00 17.66 ? 273  ARG B C   1 
ATOM   6779  O O   . ARG B 1 247 ? 7.765   15.070  53.742  1.00 15.30 ? 273  ARG B O   1 
ATOM   6780  C CB  . ARG B 1 247 ? 10.105  14.321  55.906  1.00 18.14 ? 273  ARG B CB  1 
ATOM   6781  C CG  . ARG B 1 247 ? 8.886   14.312  56.792  1.00 20.09 ? 273  ARG B CG  1 
ATOM   6782  C CD  . ARG B 1 247 ? 9.289   14.126  58.263  1.00 23.21 ? 273  ARG B CD  1 
ATOM   6783  N NE  . ARG B 1 247 ? 10.279  15.101  58.728  1.00 24.20 ? 273  ARG B NE  1 
ATOM   6784  C CZ  . ARG B 1 247 ? 11.566  14.831  58.945  1.00 24.40 ? 273  ARG B CZ  1 
ATOM   6785  N NH1 . ARG B 1 247 ? 12.046  13.609  58.743  1.00 24.72 ? 273  ARG B NH1 1 
ATOM   6786  N NH2 . ARG B 1 247 ? 12.382  15.785  59.379  1.00 25.20 ? 273  ARG B NH2 1 
ATOM   6787  N N   . GLU B 1 248 ? 9.642   16.263  53.379  1.00 17.94 ? 274  GLU B N   1 
ATOM   6788  C CA  . GLU B 1 248 ? 8.937   17.395  52.778  1.00 18.27 ? 274  GLU B CA  1 
ATOM   6789  C C   . GLU B 1 248 ? 8.438   17.009  51.390  1.00 15.72 ? 274  GLU B C   1 
ATOM   6790  O O   . GLU B 1 248 ? 7.308   17.317  51.025  1.00 14.47 ? 274  GLU B O   1 
ATOM   6791  C CB  . GLU B 1 248 ? 9.865   18.611  52.684  1.00 23.46 ? 274  GLU B CB  1 
ATOM   6792  C CG  . GLU B 1 248 ? 9.172   19.871  52.168  1.00 31.13 ? 274  GLU B CG  1 
ATOM   6793  C CD  . GLU B 1 248 ? 10.078  21.092  52.168  1.00 35.61 ? 274  GLU B CD  1 
ATOM   6794  O OE1 . GLU B 1 248 ? 11.045  21.128  51.375  1.00 37.50 ? 274  GLU B OE1 1 
ATOM   6795  O OE2 . GLU B 1 248 ? 9.823   22.016  52.970  1.00 36.76 ? 274  GLU B OE2 1 
ATOM   6796  N N   . SER B 1 249 ? 9.283   16.340  50.614  1.00 15.47 ? 275  SER B N   1 
ATOM   6797  C CA  . SER B 1 249 ? 8.874   15.915  49.285  1.00 15.95 ? 275  SER B CA  1 
ATOM   6798  C C   . SER B 1 249 ? 7.663   14.993  49.391  1.00 15.79 ? 275  SER B C   1 
ATOM   6799  O O   . SER B 1 249 ? 6.675   15.181  48.686  1.00 16.68 ? 275  SER B O   1 
ATOM   6800  C CB  . SER B 1 249 ? 10.014  15.200  48.567  1.00 15.56 ? 275  SER B CB  1 
ATOM   6801  O OG  . SER B 1 249 ? 11.056  16.100  48.253  1.00 14.79 ? 275  SER B OG  1 
ATOM   6802  N N   . VAL B 1 250 ? 7.735   13.995  50.275  1.00 14.96 ? 276  VAL B N   1 
ATOM   6803  C CA  . VAL B 1 250 ? 6.618   13.073  50.474  1.00 13.39 ? 276  VAL B CA  1 
ATOM   6804  C C   . VAL B 1 250 ? 5.368   13.853  50.915  1.00 14.46 ? 276  VAL B C   1 
ATOM   6805  O O   . VAL B 1 250 ? 4.262   13.608  50.429  1.00 13.93 ? 276  VAL B O   1 
ATOM   6806  C CB  . VAL B 1 250 ? 6.964   12.007  51.561  1.00 13.21 ? 276  VAL B CB  1 
ATOM   6807  C CG1 . VAL B 1 250 ? 5.701   11.335  52.065  1.00 10.26 ? 276  VAL B CG1 1 
ATOM   6808  C CG2 . VAL B 1 250 ? 7.923   10.963  50.993  1.00 13.08 ? 276  VAL B CG2 1 
ATOM   6809  N N   . ASN B 1 251 ? 5.551   14.799  51.835  1.00 14.51 ? 277  ASN B N   1 
ATOM   6810  C CA  . ASN B 1 251 ? 4.436   15.602  52.332  1.00 15.98 ? 277  ASN B CA  1 
ATOM   6811  C C   . ASN B 1 251 ? 3.731   16.356  51.190  1.00 15.22 ? 277  ASN B C   1 
ATOM   6812  O O   . ASN B 1 251 ? 2.503   16.397  51.129  1.00 16.60 ? 277  ASN B O   1 
ATOM   6813  C CB  . ASN B 1 251 ? 4.937   16.593  53.394  1.00 17.88 ? 277  ASN B CB  1 
ATOM   6814  C CG  . ASN B 1 251 ? 3.802   17.324  54.087  1.00 22.62 ? 277  ASN B CG  1 
ATOM   6815  O OD1 . ASN B 1 251 ? 3.738   18.554  54.068  1.00 26.51 ? 277  ASN B OD1 1 
ATOM   6816  N ND2 . ASN B 1 251 ? 2.898   16.570  54.700  1.00 23.95 ? 277  ASN B ND2 1 
ATOM   6817  N N   . SER B 1 252 ? 4.503   16.945  50.289  1.00 14.10 ? 278  SER B N   1 
ATOM   6818  C CA  . SER B 1 252 ? 3.922   17.669  49.164  1.00 14.85 ? 278  SER B CA  1 
ATOM   6819  C C   . SER B 1 252 ? 3.080   16.726  48.296  1.00 14.20 ? 278  SER B C   1 
ATOM   6820  O O   . SER B 1 252 ? 1.963   17.057  47.884  1.00 12.42 ? 278  SER B O   1 
ATOM   6821  C CB  . SER B 1 252 ? 5.028   18.282  48.328  1.00 14.93 ? 278  SER B CB  1 
ATOM   6822  O OG  . SER B 1 252 ? 4.483   18.912  47.184  1.00 17.37 ? 278  SER B OG  1 
ATOM   6823  N N   . ILE B 1 253 ? 3.628   15.550  48.009  1.00 14.03 ? 279  ILE B N   1 
ATOM   6824  C CA  . ILE B 1 253 ? 2.911   14.569  47.215  1.00 11.06 ? 279  ILE B CA  1 
ATOM   6825  C C   . ILE B 1 253 ? 1.589   14.197  47.891  1.00 11.06 ? 279  ILE B C   1 
ATOM   6826  O O   . ILE B 1 253 ? 0.532   14.254  47.275  1.00 11.39 ? 279  ILE B O   1 
ATOM   6827  C CB  . ILE B 1 253 ? 3.776   13.303  47.023  1.00 10.93 ? 279  ILE B CB  1 
ATOM   6828  C CG1 . ILE B 1 253 ? 5.038   13.664  46.232  1.00 10.80 ? 279  ILE B CG1 1 
ATOM   6829  C CG2 . ILE B 1 253 ? 2.990   12.223  46.294  1.00 11.24 ? 279  ILE B CG2 1 
ATOM   6830  C CD1 . ILE B 1 253 ? 6.021   12.530  46.108  1.00 12.93 ? 279  ILE B CD1 1 
ATOM   6831  N N   . GLN B 1 254 ? 1.649   13.837  49.173  1.00 12.37 ? 280  GLN B N   1 
ATOM   6832  C CA  . GLN B 1 254 ? 0.448   13.432  49.910  1.00 12.27 ? 280  GLN B CA  1 
ATOM   6833  C C   . GLN B 1 254 ? -0.650  14.485  49.936  1.00 11.38 ? 280  GLN B C   1 
ATOM   6834  O O   . GLN B 1 254 ? -1.839  14.158  49.902  1.00 9.17  ? 280  GLN B O   1 
ATOM   6835  C CB  . GLN B 1 254 ? 0.814   13.015  51.346  1.00 13.12 ? 280  GLN B CB  1 
ATOM   6836  C CG  . GLN B 1 254 ? 1.843   11.885  51.395  1.00 16.75 ? 280  GLN B CG  1 
ATOM   6837  C CD  . GLN B 1 254 ? 2.011   11.265  52.777  1.00 21.23 ? 280  GLN B CD  1 
ATOM   6838  O OE1 . GLN B 1 254 ? 2.024   11.970  53.793  1.00 19.43 ? 280  GLN B OE1 1 
ATOM   6839  N NE2 . GLN B 1 254 ? 2.156   9.942   52.820  1.00 18.17 ? 280  GLN B NE2 1 
ATOM   6840  N N   . LYS B 1 255 ? -0.255  15.752  50.000  1.00 10.59 ? 281  LYS B N   1 
ATOM   6841  C CA  . LYS B 1 255 ? -1.233  16.823  50.029  1.00 14.36 ? 281  LYS B CA  1 
ATOM   6842  C C   . LYS B 1 255 ? -1.751  17.248  48.662  1.00 12.43 ? 281  LYS B C   1 
ATOM   6843  O O   . LYS B 1 255 ? -2.855  17.773  48.580  1.00 13.21 ? 281  LYS B O   1 
ATOM   6844  C CB  . LYS B 1 255 ? -0.674  18.046  50.761  1.00 15.29 ? 281  LYS B CB  1 
ATOM   6845  C CG  . LYS B 1 255 ? -0.404  17.754  52.213  1.00 21.51 ? 281  LYS B CG  1 
ATOM   6846  C CD  . LYS B 1 255 ? -0.111  19.006  53.027  1.00 26.40 ? 281  LYS B CD  1 
ATOM   6847  C CE  . LYS B 1 255 ? 1.214   19.639  52.656  1.00 29.48 ? 281  LYS B CE  1 
ATOM   6848  N NZ  . LYS B 1 255 ? 1.644   20.620  53.696  1.00 33.45 ? 281  LYS B NZ  1 
ATOM   6849  N N   . SER B 1 256 ? -0.989  17.018  47.597  1.00 12.62 ? 282  SER B N   1 
ATOM   6850  C CA  . SER B 1 256 ? -1.428  17.448  46.259  1.00 12.01 ? 282  SER B CA  1 
ATOM   6851  C C   . SER B 1 256 ? -2.879  17.055  45.934  1.00 12.25 ? 282  SER B C   1 
ATOM   6852  O O   . SER B 1 256 ? -3.366  16.004  46.358  1.00 11.09 ? 282  SER B O   1 
ATOM   6853  C CB  . SER B 1 256 ? -0.477  16.900  45.188  1.00 13.31 ? 282  SER B CB  1 
ATOM   6854  O OG  . SER B 1 256 ? -0.527  15.488  45.081  1.00 16.16 ? 282  SER B OG  1 
ATOM   6855  N N   . ILE B 1 257 ? -3.593  17.920  45.204  1.00 10.92 ? 283  ILE B N   1 
ATOM   6856  C CA  . ILE B 1 257 ? -4.980  17.643  44.849  1.00 10.71 ? 283  ILE B CA  1 
ATOM   6857  C C   . ILE B 1 257 ? -5.057  16.305  44.106  1.00 9.28  ? 283  ILE B C   1 
ATOM   6858  O O   . ILE B 1 257 ? -5.977  15.515  44.316  1.00 9.51  ? 283  ILE B O   1 
ATOM   6859  C CB  . ILE B 1 257 ? -5.561  18.773  43.969  1.00 11.94 ? 283  ILE B CB  1 
ATOM   6860  C CG1 . ILE B 1 257 ? -5.464  20.109  44.710  1.00 12.11 ? 283  ILE B CG1 1 
ATOM   6861  C CG2 . ILE B 1 257 ? -7.010  18.474  43.638  1.00 8.56  ? 283  ILE B CG2 1 
ATOM   6862  C CD1 . ILE B 1 257 ? -5.935  21.316  43.899  1.00 14.54 ? 283  ILE B CD1 1 
ATOM   6863  N N   . PHE B 1 258 ? -4.082  16.063  43.248  1.00 8.61  ? 284  PHE B N   1 
ATOM   6864  C CA  . PHE B 1 258 ? -3.997  14.817  42.492  1.00 10.43 ? 284  PHE B CA  1 
ATOM   6865  C C   . PHE B 1 258 ? -2.663  14.811  41.769  1.00 10.39 ? 284  PHE B C   1 
ATOM   6866  O O   . PHE B 1 258 ? -1.956  15.817  41.743  1.00 11.63 ? 284  PHE B O   1 
ATOM   6867  C CB  . PHE B 1 258 ? -5.173  14.690  41.515  1.00 11.34 ? 284  PHE B CB  1 
ATOM   6868  C CG  . PHE B 1 258 ? -5.219  15.755  40.462  1.00 13.98 ? 284  PHE B CG  1 
ATOM   6869  C CD1 . PHE B 1 258 ? -4.523  15.602  39.273  1.00 14.65 ? 284  PHE B CD1 1 
ATOM   6870  C CD2 . PHE B 1 258 ? -5.974  16.913  40.656  1.00 15.53 ? 284  PHE B CD2 1 
ATOM   6871  C CE1 . PHE B 1 258 ? -4.581  16.585  38.287  1.00 16.51 ? 284  PHE B CE1 1 
ATOM   6872  C CE2 . PHE B 1 258 ? -6.035  17.896  39.681  1.00 14.90 ? 284  PHE B CE2 1 
ATOM   6873  C CZ  . PHE B 1 258 ? -5.333  17.725  38.489  1.00 10.88 ? 284  PHE B CZ  1 
ATOM   6874  N N   . THR B 1 259 ? -2.303  13.670  41.190  1.00 8.90  ? 285  THR B N   1 
ATOM   6875  C CA  . THR B 1 259 ? -1.034  13.570  40.508  1.00 7.71  ? 285  THR B CA  1 
ATOM   6876  C C   . THR B 1 259 ? -1.193  13.376  39.011  1.00 9.19  ? 285  THR B C   1 
ATOM   6877  O O   . THR B 1 259 ? -2.110  12.683  38.561  1.00 10.50 ? 285  THR B O   1 
ATOM   6878  C CB  . THR B 1 259 ? -0.204  12.404  41.079  1.00 9.09  ? 285  THR B CB  1 
ATOM   6879  O OG1 . THR B 1 259 ? 0.044   12.636  42.470  1.00 10.99 ? 285  THR B OG1 1 
ATOM   6880  C CG2 . THR B 1 259 ? 1.115   12.273  40.356  1.00 5.88  ? 285  THR B CG2 1 
ATOM   6881  N N   . VAL B 1 260 ? -0.311  14.004  38.248  1.00 8.77  ? 286  VAL B N   1 
ATOM   6882  C CA  . VAL B 1 260 ? -0.326  13.873  36.795  1.00 10.85 ? 286  VAL B CA  1 
ATOM   6883  C C   . VAL B 1 260 ? 0.994   13.235  36.391  1.00 11.25 ? 286  VAL B C   1 
ATOM   6884  O O   . VAL B 1 260 ? 2.070   13.742  36.727  1.00 12.03 ? 286  VAL B O   1 
ATOM   6885  C CB  . VAL B 1 260 ? -0.469  15.239  36.082  1.00 11.09 ? 286  VAL B CB  1 
ATOM   6886  C CG1 . VAL B 1 260 ? -0.239  15.076  34.583  1.00 11.48 ? 286  VAL B CG1 1 
ATOM   6887  C CG2 . VAL B 1 260 ? -1.856  15.806  36.323  1.00 10.31 ? 286  VAL B CG2 1 
ATOM   6888  N N   . CYS B 1 261 ? 0.905   12.112  35.686  1.00 10.34 ? 287  CYS B N   1 
ATOM   6889  C CA  . CYS B 1 261 ? 2.092   11.392  35.254  1.00 9.61  ? 287  CYS B CA  1 
ATOM   6890  C C   . CYS B 1 261 ? 2.349   11.596  33.757  1.00 12.03 ? 287  CYS B C   1 
ATOM   6891  O O   . CYS B 1 261 ? 1.522   11.220  32.920  1.00 9.61  ? 287  CYS B O   1 
ATOM   6892  C CB  . CYS B 1 261 ? 1.930   9.900   35.548  1.00 11.26 ? 287  CYS B CB  1 
ATOM   6893  S SG  . CYS B 1 261 ? 1.306   9.537   37.203  1.00 12.86 ? 287  CYS B SG  1 
ATOM   6894  N N   . LEU B 1 262 ? 3.482   12.203  33.421  1.00 11.85 ? 288  LEU B N   1 
ATOM   6895  C CA  . LEU B 1 262 ? 3.835   12.428  32.021  1.00 12.95 ? 288  LEU B CA  1 
ATOM   6896  C C   . LEU B 1 262 ? 4.776   11.289  31.630  1.00 13.04 ? 288  LEU B C   1 
ATOM   6897  O O   . LEU B 1 262 ? 5.985   11.391  31.813  1.00 12.90 ? 288  LEU B O   1 
ATOM   6898  C CB  . LEU B 1 262 ? 4.528   13.786  31.867  1.00 10.43 ? 288  LEU B CB  1 
ATOM   6899  C CG  . LEU B 1 262 ? 3.749   15.010  32.375  1.00 12.71 ? 288  LEU B CG  1 
ATOM   6900  C CD1 . LEU B 1 262 ? 4.565   16.266  32.132  1.00 9.54  ? 288  LEU B CD1 1 
ATOM   6901  C CD2 . LEU B 1 262 ? 2.398   15.119  31.675  1.00 10.39 ? 288  LEU B CD2 1 
ATOM   6902  N N   . ASP B 1 263 ? 4.208   10.203  31.103  1.00 13.89 ? 289  ASP B N   1 
ATOM   6903  C CA  . ASP B 1 263 ? 4.988   9.018   30.729  1.00 15.88 ? 289  ASP B CA  1 
ATOM   6904  C C   . ASP B 1 263 ? 5.919   9.173   29.531  1.00 18.47 ? 289  ASP B C   1 
ATOM   6905  O O   . ASP B 1 263 ? 5.706   10.016  28.655  1.00 20.49 ? 289  ASP B O   1 
ATOM   6906  C CB  . ASP B 1 263 ? 4.054   7.809   30.538  1.00 14.58 ? 289  ASP B CB  1 
ATOM   6907  C CG  . ASP B 1 263 ? 3.546   7.264   31.863  1.00 15.68 ? 289  ASP B CG  1 
ATOM   6908  O OD1 . ASP B 1 263 ? 3.855   7.898   32.898  1.00 13.15 ? 289  ASP B OD1 1 
ATOM   6909  O OD2 . ASP B 1 263 ? 2.843   6.228   31.888  1.00 10.65 ? 289  ASP B OD2 1 
ATOM   6910  N N   . LYS B 1 264 ? 6.968   8.358   29.521  1.00 21.32 ? 290  LYS B N   1 
ATOM   6911  C CA  . LYS B 1 264 ? 7.972   8.380   28.466  1.00 23.14 ? 290  LYS B CA  1 
ATOM   6912  C C   . LYS B 1 264 ? 7.615   7.402   27.356  1.00 24.55 ? 290  LYS B C   1 
ATOM   6913  O O   . LYS B 1 264 ? 6.795   6.503   27.540  1.00 23.26 ? 290  LYS B O   1 
ATOM   6914  C CB  . LYS B 1 264 ? 9.342   8.019   29.042  1.00 24.53 ? 290  LYS B CB  1 
ATOM   6915  C CG  . LYS B 1 264 ? 9.396   6.633   29.666  1.00 26.05 ? 290  LYS B CG  1 
ATOM   6916  C CD  . LYS B 1 264 ? 10.826  6.161   29.877  1.00 29.94 ? 290  LYS B CD  1 
ATOM   6917  C CE  . LYS B 1 264 ? 11.509  6.875   31.033  1.00 30.86 ? 290  LYS B CE  1 
ATOM   6918  N NZ  . LYS B 1 264 ? 10.983  6.435   32.353  1.00 30.87 ? 290  LYS B NZ  1 
ATOM   6919  N N   . GLN B 1 265 ? 8.239   7.586   26.196  1.00 26.68 ? 291  GLN B N   1 
ATOM   6920  C CA  . GLN B 1 265 ? 7.992   6.715   25.057  1.00 29.40 ? 291  GLN B CA  1 
ATOM   6921  C C   . GLN B 1 265 ? 8.363   5.282   25.418  1.00 29.26 ? 291  GLN B C   1 
ATOM   6922  O O   . GLN B 1 265 ? 9.390   5.047   26.049  1.00 29.45 ? 291  GLN B O   1 
ATOM   6923  C CB  . GLN B 1 265 ? 8.827   7.161   23.860  1.00 30.70 ? 291  GLN B CB  1 
ATOM   6924  C CG  . GLN B 1 265 ? 8.714   6.230   22.669  1.00 34.27 ? 291  GLN B CG  1 
ATOM   6925  C CD  . GLN B 1 265 ? 9.727   6.536   21.593  1.00 35.94 ? 291  GLN B CD  1 
ATOM   6926  O OE1 . GLN B 1 265 ? 10.932  6.537   21.842  1.00 36.53 ? 291  GLN B OE1 1 
ATOM   6927  N NE2 . GLN B 1 265 ? 9.245   6.792   20.384  1.00 38.05 ? 291  GLN B NE2 1 
ATOM   6928  N N   . VAL B 1 266 ? 7.523   4.331   25.027  1.00 30.33 ? 292  VAL B N   1 
ATOM   6929  C CA  . VAL B 1 266 ? 7.784   2.919   25.297  1.00 31.10 ? 292  VAL B CA  1 
ATOM   6930  C C   . VAL B 1 266 ? 7.968   2.186   23.968  1.00 32.82 ? 292  VAL B C   1 
ATOM   6931  O O   . VAL B 1 266 ? 7.551   2.681   22.920  1.00 31.45 ? 292  VAL B O   1 
ATOM   6932  C CB  . VAL B 1 266 ? 6.620   2.263   26.063  1.00 29.86 ? 292  VAL B CB  1 
ATOM   6933  C CG1 . VAL B 1 266 ? 6.454   2.927   27.417  1.00 31.92 ? 292  VAL B CG1 1 
ATOM   6934  C CG2 . VAL B 1 266 ? 5.339   2.375   25.258  1.00 29.43 ? 292  VAL B CG2 1 
ATOM   6935  N N   . PRO B 1 267 ? 8.606   1.002   23.993  1.00 34.45 ? 293  PRO B N   1 
ATOM   6936  C CA  . PRO B 1 267 ? 8.825   0.228   22.766  1.00 35.54 ? 293  PRO B CA  1 
ATOM   6937  C C   . PRO B 1 267 ? 7.525   -0.067  22.020  1.00 35.82 ? 293  PRO B C   1 
ATOM   6938  O O   . PRO B 1 267 ? 6.467   -0.234  22.628  1.00 34.35 ? 293  PRO B O   1 
ATOM   6939  C CB  . PRO B 1 267 ? 9.502   -1.043  23.278  1.00 35.10 ? 293  PRO B CB  1 
ATOM   6940  C CG  . PRO B 1 267 ? 10.287  -0.545  24.444  1.00 35.74 ? 293  PRO B CG  1 
ATOM   6941  C CD  . PRO B 1 267 ? 9.295   0.372   25.133  1.00 35.70 ? 293  PRO B CD  1 
ATOM   6942  N N   . ARG B 1 268 ? 7.620   -0.119  20.696  1.00 37.66 ? 294  ARG B N   1 
ATOM   6943  C CA  . ARG B 1 268 ? 6.473   -0.400  19.841  1.00 38.40 ? 294  ARG B CA  1 
ATOM   6944  C C   . ARG B 1 268 ? 6.137   -1.880  19.980  1.00 36.89 ? 294  ARG B C   1 
ATOM   6945  O O   . ARG B 1 268 ? 7.031   -2.707  20.147  1.00 36.08 ? 294  ARG B O   1 
ATOM   6946  C CB  . ARG B 1 268 ? 6.827   -0.086  18.382  1.00 42.04 ? 294  ARG B CB  1 
ATOM   6947  C CG  . ARG B 1 268 ? 5.641   -0.010  17.429  1.00 47.66 ? 294  ARG B CG  1 
ATOM   6948  C CD  . ARG B 1 268 ? 4.805   1.240   17.683  1.00 52.34 ? 294  ARG B CD  1 
ATOM   6949  N NE  . ARG B 1 268 ? 3.842   1.498   16.611  1.00 57.38 ? 294  ARG B NE  1 
ATOM   6950  C CZ  . ARG B 1 268 ? 2.836   0.687   16.289  1.00 59.27 ? 294  ARG B CZ  1 
ATOM   6951  N NH1 . ARG B 1 268 ? 2.649   -0.447  16.954  1.00 61.08 ? 294  ARG B NH1 1 
ATOM   6952  N NH2 . ARG B 1 268 ? 2.013   1.011   15.300  1.00 60.40 ? 294  ARG B NH2 1 
ATOM   6953  N N   . VAL B 1 269 ? 4.853   -2.209  19.921  1.00 35.35 ? 295  VAL B N   1 
ATOM   6954  C CA  . VAL B 1 269 ? 4.421   -3.595  20.035  1.00 35.74 ? 295  VAL B CA  1 
ATOM   6955  C C   . VAL B 1 269 ? 3.374   -3.904  18.976  1.00 35.79 ? 295  VAL B C   1 
ATOM   6956  O O   . VAL B 1 269 ? 2.774   -2.992  18.405  1.00 35.30 ? 295  VAL B O   1 
ATOM   6957  C CB  . VAL B 1 269 ? 3.814   -3.888  21.431  1.00 35.84 ? 295  VAL B CB  1 
ATOM   6958  C CG1 . VAL B 1 269 ? 4.856   -3.687  22.514  1.00 36.18 ? 295  VAL B CG1 1 
ATOM   6959  C CG2 . VAL B 1 269 ? 2.625   -2.982  21.679  1.00 35.77 ? 295  VAL B CG2 1 
ATOM   6960  N N   . SER B 1 270 ? 3.158   -5.191  18.719  1.00 35.86 ? 296  SER B N   1 
ATOM   6961  C CA  . SER B 1 270 ? 2.173   -5.614  17.732  1.00 36.66 ? 296  SER B CA  1 
ATOM   6962  C C   . SER B 1 270 ? 0.804   -5.024  18.051  1.00 36.02 ? 296  SER B C   1 
ATOM   6963  O O   . SER B 1 270 ? 0.392   -4.963  19.210  1.00 35.46 ? 296  SER B O   1 
ATOM   6964  C CB  . SER B 1 270 ? 2.096   -7.146  17.671  1.00 36.32 ? 296  SER B CB  1 
ATOM   6965  O OG  . SER B 1 270 ? 1.899   -7.709  18.955  1.00 41.82 ? 296  SER B OG  1 
ATOM   6966  N N   . ASP B 1 271 ? 0.107   -4.591  17.011  1.00 35.90 ? 297  ASP B N   1 
ATOM   6967  C CA  . ASP B 1 271 ? -1.206  -3.983  17.167  1.00 37.99 ? 297  ASP B CA  1 
ATOM   6968  C C   . ASP B 1 271 ? -2.211  -4.830  17.952  1.00 37.55 ? 297  ASP B C   1 
ATOM   6969  O O   . ASP B 1 271 ? -3.031  -4.294  18.696  1.00 37.90 ? 297  ASP B O   1 
ATOM   6970  C CB  . ASP B 1 271 ? -1.788  -3.656  15.796  1.00 39.05 ? 297  ASP B CB  1 
ATOM   6971  C CG  . ASP B 1 271 ? -0.863  -2.798  14.964  1.00 42.09 ? 297  ASP B CG  1 
ATOM   6972  O OD1 . ASP B 1 271 ? -0.539  -1.668  15.395  1.00 42.79 ? 297  ASP B OD1 1 
ATOM   6973  O OD2 . ASP B 1 271 ? -0.454  -3.255  13.875  1.00 43.24 ? 297  ASP B OD2 1 
ATOM   6974  N N   . ASP B 1 272 ? -2.149  -6.145  17.786  1.00 36.34 ? 298  ASP B N   1 
ATOM   6975  C CA  . ASP B 1 272 ? -3.076  -7.042  18.469  1.00 35.76 ? 298  ASP B CA  1 
ATOM   6976  C C   . ASP B 1 272 ? -2.896  -7.051  19.992  1.00 33.07 ? 298  ASP B C   1 
ATOM   6977  O O   . ASP B 1 272 ? -3.812  -7.429  20.726  1.00 33.36 ? 298  ASP B O   1 
ATOM   6978  C CB  . ASP B 1 272 ? -2.924  -8.461  17.918  1.00 38.81 ? 298  ASP B CB  1 
ATOM   6979  C CG  . ASP B 1 272 ? -1.644  -9.121  18.372  1.00 42.06 ? 298  ASP B CG  1 
ATOM   6980  O OD1 . ASP B 1 272 ? -0.582  -8.469  18.296  1.00 43.32 ? 298  ASP B OD1 1 
ATOM   6981  O OD2 . ASP B 1 272 ? -1.697  -10.290 18.806  1.00 44.04 ? 298  ASP B OD2 1 
ATOM   6982  N N   . VAL B 1 273 ? -1.723  -6.640  20.467  1.00 30.05 ? 299  VAL B N   1 
ATOM   6983  C CA  . VAL B 1 273 ? -1.471  -6.607  21.905  1.00 27.86 ? 299  VAL B CA  1 
ATOM   6984  C C   . VAL B 1 273 ? -1.295  -5.185  22.429  1.00 26.98 ? 299  VAL B C   1 
ATOM   6985  O O   . VAL B 1 273 ? -1.042  -4.978  23.615  1.00 26.76 ? 299  VAL B O   1 
ATOM   6986  C CB  . VAL B 1 273 ? -0.216  -7.409  22.286  1.00 28.01 ? 299  VAL B CB  1 
ATOM   6987  C CG1 . VAL B 1 273 ? -0.357  -8.861  21.823  1.00 28.47 ? 299  VAL B CG1 1 
ATOM   6988  C CG2 . VAL B 1 273 ? 1.021   -6.747  21.700  1.00 29.43 ? 299  VAL B CG2 1 
ATOM   6989  N N   . TYR B 1 274 ? -1.429  -4.208  21.538  1.00 26.04 ? 300  TYR B N   1 
ATOM   6990  C CA  . TYR B 1 274 ? -1.286  -2.803  21.905  1.00 24.30 ? 300  TYR B CA  1 
ATOM   6991  C C   . TYR B 1 274 ? -2.185  -2.415  23.078  1.00 23.01 ? 300  TYR B C   1 
ATOM   6992  O O   . TYR B 1 274 ? -1.691  -1.951  24.104  1.00 22.92 ? 300  TYR B O   1 
ATOM   6993  C CB  . TYR B 1 274 ? -1.601  -1.905  20.708  1.00 23.97 ? 300  TYR B CB  1 
ATOM   6994  C CG  . TYR B 1 274 ? -1.467  -0.434  21.017  1.00 24.27 ? 300  TYR B CG  1 
ATOM   6995  C CD1 . TYR B 1 274 ? -0.234  0.119   21.374  1.00 22.63 ? 300  TYR B CD1 1 
ATOM   6996  C CD2 . TYR B 1 274 ? -2.576  0.407   20.965  1.00 25.51 ? 300  TYR B CD2 1 
ATOM   6997  C CE1 . TYR B 1 274 ? -0.114  1.472   21.667  1.00 22.51 ? 300  TYR B CE1 1 
ATOM   6998  C CE2 . TYR B 1 274 ? -2.466  1.761   21.261  1.00 24.73 ? 300  TYR B CE2 1 
ATOM   6999  C CZ  . TYR B 1 274 ? -1.237  2.286   21.608  1.00 23.86 ? 300  TYR B CZ  1 
ATOM   7000  O OH  . TYR B 1 274 ? -1.149  3.628   21.895  1.00 26.16 ? 300  TYR B OH  1 
ATOM   7001  N N   . ARG B 1 275 ? -3.493  -2.597  22.933  1.00 21.81 ? 301  ARG B N   1 
ATOM   7002  C CA  . ARG B 1 275 ? -4.414  -2.249  24.013  1.00 21.63 ? 301  ARG B CA  1 
ATOM   7003  C C   . ARG B 1 275 ? -4.081  -2.964  25.320  1.00 19.61 ? 301  ARG B C   1 
ATOM   7004  O O   . ARG B 1 275 ? -4.231  -2.389  26.398  1.00 18.75 ? 301  ARG B O   1 
ATOM   7005  C CB  . ARG B 1 275 ? -5.868  -2.549  23.625  1.00 24.24 ? 301  ARG B CB  1 
ATOM   7006  C CG  . ARG B 1 275 ? -6.584  -1.395  22.924  1.00 29.95 ? 301  ARG B CG  1 
ATOM   7007  C CD  . ARG B 1 275 ? -8.066  -1.698  22.718  1.00 32.77 ? 301  ARG B CD  1 
ATOM   7008  N NE  . ARG B 1 275 ? -8.845  -1.677  23.959  1.00 33.83 ? 301  ARG B NE  1 
ATOM   7009  C CZ  . ARG B 1 275 ? -9.163  -0.570  24.625  1.00 34.71 ? 301  ARG B CZ  1 
ATOM   7010  N NH1 . ARG B 1 275 ? -8.767  0.616   24.174  1.00 35.20 ? 301  ARG B NH1 1 
ATOM   7011  N NH2 . ARG B 1 275 ? -9.894  -0.640  25.730  1.00 35.64 ? 301  ARG B NH2 1 
ATOM   7012  N N   . ASN B 1 276 ? -3.624  -4.208  25.242  1.00 16.68 ? 302  ASN B N   1 
ATOM   7013  C CA  . ASN B 1 276 ? -3.294  -4.919  26.472  1.00 16.29 ? 302  ASN B CA  1 
ATOM   7014  C C   . ASN B 1 276 ? -2.120  -4.235  27.172  1.00 13.87 ? 302  ASN B C   1 
ATOM   7015  O O   . ASN B 1 276 ? -2.102  -4.137  28.400  1.00 11.88 ? 302  ASN B O   1 
ATOM   7016  C CB  . ASN B 1 276 ? -2.958  -6.388  26.197  1.00 14.96 ? 302  ASN B CB  1 
ATOM   7017  C CG  . ASN B 1 276 ? -4.136  -7.162  25.627  1.00 16.77 ? 302  ASN B CG  1 
ATOM   7018  O OD1 . ASN B 1 276 ? -5.299  -6.772  25.781  1.00 17.41 ? 302  ASN B OD1 1 
ATOM   7019  N ND2 . ASN B 1 276 ? -3.840  -8.279  24.976  1.00 15.44 ? 302  ASN B ND2 1 
ATOM   7020  N N   . HIS B 1 277 ? -1.154  -3.764  26.402  1.00 14.16 ? 303  HIS B N   1 
ATOM   7021  C CA  . HIS B 1 277 ? -0.002  -3.080  26.980  1.00 15.41 ? 303  HIS B CA  1 
ATOM   7022  C C   . HIS B 1 277 ? -0.402  -1.745  27.574  1.00 14.90 ? 303  HIS B C   1 
ATOM   7023  O O   . HIS B 1 277 ? 0.079   -1.374  28.643  1.00 14.97 ? 303  HIS B O   1 
ATOM   7024  C CB  . HIS B 1 277 ? 1.098   -2.875  25.942  1.00 18.48 ? 303  HIS B CB  1 
ATOM   7025  C CG  . HIS B 1 277 ? 1.950   -4.085  25.728  1.00 22.92 ? 303  HIS B CG  1 
ATOM   7026  N ND1 . HIS B 1 277 ? 1.488   -5.222  25.102  1.00 25.47 ? 303  HIS B ND1 1 
ATOM   7027  C CD2 . HIS B 1 277 ? 3.239   -4.339  26.065  1.00 24.88 ? 303  HIS B CD2 1 
ATOM   7028  C CE1 . HIS B 1 277 ? 2.452   -6.123  25.060  1.00 25.09 ? 303  HIS B CE1 1 
ATOM   7029  N NE2 . HIS B 1 277 ? 3.525   -5.613  25.636  1.00 25.25 ? 303  HIS B NE2 1 
ATOM   7030  N N   . VAL B 1 278 ? -1.276  -1.016  26.888  1.00 13.14 ? 304  VAL B N   1 
ATOM   7031  C CA  . VAL B 1 278 ? -1.721  0.272   27.407  1.00 13.90 ? 304  VAL B CA  1 
ATOM   7032  C C   . VAL B 1 278 ? -2.432  0.067   28.756  1.00 12.86 ? 304  VAL B C   1 
ATOM   7033  O O   . VAL B 1 278 ? -2.171  0.790   29.715  1.00 12.42 ? 304  VAL B O   1 
ATOM   7034  C CB  . VAL B 1 278 ? -2.670  0.984   26.410  1.00 15.29 ? 304  VAL B CB  1 
ATOM   7035  C CG1 . VAL B 1 278 ? -3.149  2.299   26.993  1.00 14.91 ? 304  VAL B CG1 1 
ATOM   7036  C CG2 . VAL B 1 278 ? -1.940  1.234   25.083  1.00 14.76 ? 304  VAL B CG2 1 
ATOM   7037  N N   . ALA B 1 279 ? -3.316  -0.925  28.839  1.00 11.32 ? 305  ALA B N   1 
ATOM   7038  C CA  . ALA B 1 279 ? -4.011  -1.187  30.095  1.00 10.84 ? 305  ALA B CA  1 
ATOM   7039  C C   . ALA B 1 279 ? -2.974  -1.510  31.176  1.00 11.34 ? 305  ALA B C   1 
ATOM   7040  O O   . ALA B 1 279 ? -3.148  -1.164  32.348  1.00 13.05 ? 305  ALA B O   1 
ATOM   7041  C CB  . ALA B 1 279 ? -4.993  -2.342  29.922  1.00 11.27 ? 305  ALA B CB  1 
ATOM   7042  N N   . GLY B 1 280 ? -1.882  -2.154  30.775  1.00 10.56 ? 306  GLY B N   1 
ATOM   7043  C CA  . GLY B 1 280 ? -0.835  -2.491  31.724  1.00 9.49  ? 306  GLY B CA  1 
ATOM   7044  C C   . GLY B 1 280 ? -0.138  -1.224  32.201  1.00 11.71 ? 306  GLY B C   1 
ATOM   7045  O O   . GLY B 1 280 ? 0.218   -1.101  33.379  1.00 9.16  ? 306  GLY B O   1 
ATOM   7046  N N   . GLN B 1 281 ? 0.055   -0.274  31.292  1.00 11.57 ? 307  GLN B N   1 
ATOM   7047  C CA  . GLN B 1 281 ? 0.716   0.969   31.656  1.00 12.90 ? 307  GLN B CA  1 
ATOM   7048  C C   . GLN B 1 281 ? -0.130  1.757   32.648  1.00 13.18 ? 307  GLN B C   1 
ATOM   7049  O O   . GLN B 1 281 ? 0.403   2.405   33.546  1.00 16.11 ? 307  GLN B O   1 
ATOM   7050  C CB  . GLN B 1 281 ? 0.970   1.819   30.407  1.00 14.58 ? 307  GLN B CB  1 
ATOM   7051  C CG  . GLN B 1 281 ? 1.627   3.181   30.693  1.00 17.76 ? 307  GLN B CG  1 
ATOM   7052  C CD  . GLN B 1 281 ? 1.897   3.980   29.425  1.00 20.76 ? 307  GLN B CD  1 
ATOM   7053  O OE1 . GLN B 1 281 ? 2.505   5.048   29.465  1.00 20.73 ? 307  GLN B OE1 1 
ATOM   7054  N NE2 . GLN B 1 281 ? 1.428   3.467   28.291  1.00 18.97 ? 307  GLN B NE2 1 
ATOM   7055  N N   . MET B 1 282 ? -1.443  1.695   32.480  1.00 13.08 ? 308  MET B N   1 
ATOM   7056  C CA  . MET B 1 282 ? -2.371  2.415   33.347  1.00 14.43 ? 308  MET B CA  1 
ATOM   7057  C C   . MET B 1 282 ? -2.544  1.716   34.692  1.00 13.64 ? 308  MET B C   1 
ATOM   7058  O O   . MET B 1 282 ? -2.777  2.367   35.716  1.00 14.29 ? 308  MET B O   1 
ATOM   7059  C CB  . MET B 1 282 ? -3.734  2.554   32.653  1.00 13.89 ? 308  MET B CB  1 
ATOM   7060  C CG  . MET B 1 282 ? -4.045  3.966   32.153  1.00 19.08 ? 308  MET B CG  1 
ATOM   7061  S SD  . MET B 1 282 ? -2.637  4.799   31.431  1.00 14.60 ? 308  MET B SD  1 
ATOM   7062  C CE  . MET B 1 282 ? -3.055  4.704   29.698  1.00 22.46 ? 308  MET B CE  1 
ATOM   7063  N N   . LEU B 1 283 ? -2.415  0.401   34.694  1.00 11.79 ? 309  LEU B N   1 
ATOM   7064  C CA  . LEU B 1 283 ? -2.587  -0.360  35.929  1.00 10.93 ? 309  LEU B CA  1 
ATOM   7065  C C   . LEU B 1 283 ? -1.338  -0.402  36.792  1.00 10.54 ? 309  LEU B C   1 
ATOM   7066  O O   . LEU B 1 283 ? -1.405  -0.131  37.988  1.00 12.06 ? 309  LEU B O   1 
ATOM   7067  C CB  . LEU B 1 283 ? -3.029  -1.797  35.623  1.00 10.01 ? 309  LEU B CB  1 
ATOM   7068  C CG  . LEU B 1 283 ? -3.411  -2.704  36.804  1.00 9.28  ? 309  LEU B CG  1 
ATOM   7069  C CD1 . LEU B 1 283 ? -4.680  -2.202  37.491  1.00 8.63  ? 309  LEU B CD1 1 
ATOM   7070  C CD2 . LEU B 1 283 ? -3.624  -4.122  36.297  1.00 7.05  ? 309  LEU B CD2 1 
ATOM   7071  N N   . HIS B 1 284 ? -0.199  -0.728  36.186  1.00 10.33 ? 310  HIS B N   1 
ATOM   7072  C CA  . HIS B 1 284 ? 1.039   -0.853  36.934  1.00 9.21  ? 310  HIS B CA  1 
ATOM   7073  C C   . HIS B 1 284 ? 2.244   -0.102  36.392  1.00 10.53 ? 310  HIS B C   1 
ATOM   7074  O O   . HIS B 1 284 ? 3.295   -0.077  37.025  1.00 10.40 ? 310  HIS B O   1 
ATOM   7075  C CB  . HIS B 1 284 ? 1.392   -2.328  37.066  1.00 8.96  ? 310  HIS B CB  1 
ATOM   7076  C CG  . HIS B 1 284 ? 1.524   -3.027  35.750  1.00 9.12  ? 310  HIS B CG  1 
ATOM   7077  N ND1 . HIS B 1 284 ? 0.680   -4.043  35.366  1.00 10.40 ? 310  HIS B ND1 1 
ATOM   7078  C CD2 . HIS B 1 284 ? 2.404   -2.860  34.738  1.00 8.32  ? 310  HIS B CD2 1 
ATOM   7079  C CE1 . HIS B 1 284 ? 1.036   -4.478  34.170  1.00 7.56  ? 310  HIS B CE1 1 
ATOM   7080  N NE2 . HIS B 1 284 ? 2.081   -3.773  33.767  1.00 11.18 ? 310  HIS B NE2 1 
ATOM   7081  N N   . GLY B 1 285 ? 2.122   0.472   35.200  1.00 11.39 ? 311  GLY B N   1 
ATOM   7082  C CA  . GLY B 1 285 ? 3.238   1.234   34.669  1.00 9.89  ? 311  GLY B CA  1 
ATOM   7083  C C   . GLY B 1 285 ? 4.130   0.546   33.664  1.00 12.12 ? 311  GLY B C   1 
ATOM   7084  O O   . GLY B 1 285 ? 4.917   1.194   32.973  1.00 10.96 ? 311  GLY B O   1 
ATOM   7085  N N   . GLY B 1 286 ? 4.021   -0.772  33.590  1.00 14.51 ? 312  GLY B N   1 
ATOM   7086  C CA  . GLY B 1 286 ? 4.822   -1.504  32.637  1.00 16.16 ? 312  GLY B CA  1 
ATOM   7087  C C   . GLY B 1 286 ? 6.105   -2.078  33.190  1.00 17.81 ? 312  GLY B C   1 
ATOM   7088  O O   . GLY B 1 286 ? 6.609   -3.054  32.648  1.00 21.49 ? 312  GLY B O   1 
ATOM   7089  N N   . GLY B 1 287 ? 6.638   -1.494  34.265  1.00 17.76 ? 313  GLY B N   1 
ATOM   7090  C CA  . GLY B 1 287 ? 7.874   -1.998  34.836  1.00 16.46 ? 313  GLY B CA  1 
ATOM   7091  C C   . GLY B 1 287 ? 8.874   -0.899  35.167  1.00 18.31 ? 313  GLY B C   1 
ATOM   7092  O O   . GLY B 1 287 ? 8.724   0.239   34.717  1.00 15.81 ? 313  GLY B O   1 
ATOM   7093  N N   . SER B 1 288 ? 9.903   -1.240  35.936  1.00 18.65 ? 314  SER B N   1 
ATOM   7094  C CA  . SER B 1 288 ? 10.915  -0.270  36.354  1.00 22.53 ? 314  SER B CA  1 
ATOM   7095  C C   . SER B 1 288 ? 11.704  0.303   35.194  1.00 24.69 ? 314  SER B C   1 
ATOM   7096  O O   . SER B 1 288 ? 12.436  1.283   35.345  1.00 25.14 ? 314  SER B O   1 
ATOM   7097  C CB  . SER B 1 288 ? 11.893  -0.918  37.318  1.00 21.96 ? 314  SER B CB  1 
ATOM   7098  O OG  . SER B 1 288 ? 12.686  -1.866  36.633  1.00 24.23 ? 314  SER B OG  1 
ATOM   7099  N N   . LYS B 1 289 ? 11.564  -0.316  34.032  1.00 25.46 ? 315  LYS B N   1 
ATOM   7100  C CA  . LYS B 1 289 ? 12.269  0.150   32.852  1.00 27.88 ? 315  LYS B CA  1 
ATOM   7101  C C   . LYS B 1 289 ? 11.383  1.021   31.977  1.00 26.00 ? 315  LYS B C   1 
ATOM   7102  O O   . LYS B 1 289 ? 11.848  1.578   30.990  1.00 26.68 ? 315  LYS B O   1 
ATOM   7103  C CB  . LYS B 1 289 ? 12.788  -1.051  32.054  1.00 30.98 ? 315  LYS B CB  1 
ATOM   7104  C CG  . LYS B 1 289 ? 11.771  -2.181  31.930  1.00 37.18 ? 315  LYS B CG  1 
ATOM   7105  C CD  . LYS B 1 289 ? 12.343  -3.359  31.147  1.00 41.07 ? 315  LYS B CD  1 
ATOM   7106  C CE  . LYS B 1 289 ? 11.321  -4.482  31.010  1.00 42.29 ? 315  LYS B CE  1 
ATOM   7107  N NZ  . LYS B 1 289 ? 11.807  -5.559  30.098  1.00 44.69 ? 315  LYS B NZ  1 
ATOM   7108  N N   . PHE B 1 290 ? 10.112  1.143   32.343  1.00 24.57 ? 316  PHE B N   1 
ATOM   7109  C CA  . PHE B 1 290 ? 9.174   1.940   31.558  1.00 22.23 ? 316  PHE B CA  1 
ATOM   7110  C C   . PHE B 1 290 ? 8.603   3.140   32.296  1.00 19.62 ? 316  PHE B C   1 
ATOM   7111  O O   . PHE B 1 290 ? 9.203   4.216   32.293  1.00 20.42 ? 316  PHE B O   1 
ATOM   7112  C CB  . PHE B 1 290 ? 8.037   1.049   31.053  1.00 23.82 ? 316  PHE B CB  1 
ATOM   7113  C CG  . PHE B 1 290 ? 8.503   -0.091  30.197  1.00 26.73 ? 316  PHE B CG  1 
ATOM   7114  C CD1 . PHE B 1 290 ? 8.152   -1.399  30.508  1.00 30.05 ? 316  PHE B CD1 1 
ATOM   7115  C CD2 . PHE B 1 290 ? 9.302   0.141   29.083  1.00 29.32 ? 316  PHE B CD2 1 
ATOM   7116  C CE1 . PHE B 1 290 ? 8.589   -2.464  29.724  1.00 31.58 ? 316  PHE B CE1 1 
ATOM   7117  C CE2 . PHE B 1 290 ? 9.746   -0.917  28.290  1.00 31.34 ? 316  PHE B CE2 1 
ATOM   7118  C CZ  . PHE B 1 290 ? 9.387   -2.222  28.614  1.00 30.49 ? 316  PHE B CZ  1 
ATOM   7119  N N   . ASN B 1 291 ? 7.445   2.963   32.926  1.00 17.72 ? 317  ASN B N   1 
ATOM   7120  C CA  . ASN B 1 291 ? 6.819   4.064   33.644  1.00 15.82 ? 317  ASN B CA  1 
ATOM   7121  C C   . ASN B 1 291 ? 6.328   3.744   35.055  1.00 14.15 ? 317  ASN B C   1 
ATOM   7122  O O   . ASN B 1 291 ? 5.647   4.563   35.674  1.00 14.58 ? 317  ASN B O   1 
ATOM   7123  C CB  . ASN B 1 291 ? 5.673   4.633   32.807  1.00 13.76 ? 317  ASN B CB  1 
ATOM   7124  C CG  . ASN B 1 291 ? 6.165   5.278   31.525  1.00 16.16 ? 317  ASN B CG  1 
ATOM   7125  O OD1 . ASN B 1 291 ? 6.848   6.304   31.556  1.00 14.42 ? 317  ASN B OD1 1 
ATOM   7126  N ND2 . ASN B 1 291 ? 5.840   4.670   30.391  1.00 14.82 ? 317  ASN B ND2 1 
ATOM   7127  N N   . SER B 1 292 ? 6.676   2.574   35.579  1.00 12.65 ? 318  SER B N   1 
ATOM   7128  C CA  . SER B 1 292 ? 6.256   2.224   36.930  1.00 12.04 ? 318  SER B CA  1 
ATOM   7129  C C   . SER B 1 292 ? 6.884   3.145   37.976  1.00 10.35 ? 318  SER B C   1 
ATOM   7130  O O   . SER B 1 292 ? 6.310   3.364   39.039  1.00 10.20 ? 318  SER B O   1 
ATOM   7131  C CB  . SER B 1 292 ? 6.615   0.774   37.235  1.00 12.37 ? 318  SER B CB  1 
ATOM   7132  O OG  . SER B 1 292 ? 5.800   -0.097  36.471  1.00 12.07 ? 318  SER B OG  1 
ATOM   7133  N N   . GLY B 1 293 ? 8.056   3.679   37.680  1.00 8.97  ? 319  GLY B N   1 
ATOM   7134  C CA  . GLY B 1 293 ? 8.696   4.570   38.630  1.00 11.17 ? 319  GLY B CA  1 
ATOM   7135  C C   . GLY B 1 293 ? 8.146   5.976   38.514  1.00 12.04 ? 319  GLY B C   1 
ATOM   7136  O O   . GLY B 1 293 ? 8.389   6.821   39.371  1.00 13.00 ? 319  GLY B O   1 
ATOM   7137  N N   . ASN B 1 294 ? 7.405   6.230   37.440  1.00 10.08 ? 320  ASN B N   1 
ATOM   7138  C CA  . ASN B 1 294 ? 6.819   7.546   37.199  1.00 10.30 ? 320  ASN B CA  1 
ATOM   7139  C C   . ASN B 1 294 ? 5.445   7.568   37.849  1.00 10.05 ? 320  ASN B C   1 
ATOM   7140  O O   . ASN B 1 294 ? 4.462   8.026   37.271  1.00 10.38 ? 320  ASN B O   1 
ATOM   7141  C CB  . ASN B 1 294 ? 6.706   7.783   35.689  1.00 10.55 ? 320  ASN B CB  1 
ATOM   7142  C CG  . ASN B 1 294 ? 6.785   9.245   35.316  1.00 13.49 ? 320  ASN B CG  1 
ATOM   7143  O OD1 . ASN B 1 294 ? 7.683   9.964   35.757  1.00 13.53 ? 320  ASN B OD1 1 
ATOM   7144  N ND2 . ASN B 1 294 ? 5.852   9.698   34.484  1.00 10.96 ? 320  ASN B ND2 1 
ATOM   7145  N N   . ARG B 1 295 ? 5.389   7.070   39.082  1.00 11.46 ? 321  ARG B N   1 
ATOM   7146  C CA  . ARG B 1 295 ? 4.124   6.984   39.806  1.00 10.54 ? 321  ARG B CA  1 
ATOM   7147  C C   . ARG B 1 295 ? 4.279   7.073   41.328  1.00 11.49 ? 321  ARG B C   1 
ATOM   7148  O O   . ARG B 1 295 ? 5.388   7.028   41.871  1.00 11.24 ? 321  ARG B O   1 
ATOM   7149  C CB  . ARG B 1 295 ? 3.447   5.638   39.500  1.00 10.80 ? 321  ARG B CB  1 
ATOM   7150  C CG  . ARG B 1 295 ? 3.273   5.269   38.015  1.00 12.76 ? 321  ARG B CG  1 
ATOM   7151  C CD  . ARG B 1 295 ? 1.840   5.461   37.523  1.00 10.71 ? 321  ARG B CD  1 
ATOM   7152  N NE  . ARG B 1 295 ? 1.687   4.929   36.172  1.00 12.47 ? 321  ARG B NE  1 
ATOM   7153  C CZ  . ARG B 1 295 ? 2.218   5.476   35.082  1.00 10.66 ? 321  ARG B CZ  1 
ATOM   7154  N NH1 . ARG B 1 295 ? 2.935   6.591   35.168  1.00 8.96  ? 321  ARG B NH1 1 
ATOM   7155  N NH2 . ARG B 1 295 ? 2.053   4.895   33.905  1.00 11.23 ? 321  ARG B NH2 1 
ATOM   7156  N N   . TRP B 1 296 ? 3.147   7.218   42.011  1.00 10.07 ? 322  TRP B N   1 
ATOM   7157  C CA  . TRP B 1 296 ? 3.129   7.222   43.467  1.00 9.47  ? 322  TRP B CA  1 
ATOM   7158  C C   . TRP B 1 296 ? 1.779   6.574   43.793  1.00 8.66  ? 322  TRP B C   1 
ATOM   7159  O O   . TRP B 1 296 ? 0.765   7.249   43.959  1.00 7.25  ? 322  TRP B O   1 
ATOM   7160  C CB  . TRP B 1 296 ? 3.230   8.641   44.036  1.00 7.67  ? 322  TRP B CB  1 
ATOM   7161  C CG  . TRP B 1 296 ? 3.441   8.628   45.516  1.00 8.32  ? 322  TRP B CG  1 
ATOM   7162  C CD1 . TRP B 1 296 ? 2.478   8.581   46.474  1.00 5.84  ? 322  TRP B CD1 1 
ATOM   7163  C CD2 . TRP B 1 296 ? 4.702   8.602   46.204  1.00 7.50  ? 322  TRP B CD2 1 
ATOM   7164  N NE1 . TRP B 1 296 ? 3.055   8.527   47.726  1.00 7.88  ? 322  TRP B NE1 1 
ATOM   7165  C CE2 . TRP B 1 296 ? 4.418   8.541   47.590  1.00 8.49  ? 322  TRP B CE2 1 
ATOM   7166  C CE3 . TRP B 1 296 ? 6.040   8.625   45.794  1.00 9.61  ? 322  TRP B CE3 1 
ATOM   7167  C CZ2 . TRP B 1 296 ? 5.422   8.506   48.562  1.00 9.85  ? 322  TRP B CZ2 1 
ATOM   7168  C CZ3 . TRP B 1 296 ? 7.037   8.591   46.759  1.00 11.89 ? 322  TRP B CZ3 1 
ATOM   7169  C CH2 . TRP B 1 296 ? 6.720   8.533   48.128  1.00 10.34 ? 322  TRP B CH2 1 
ATOM   7170  N N   . PHE B 1 297 ? 1.788   5.238   43.879  1.00 6.77  ? 323  PHE B N   1 
ATOM   7171  C CA  . PHE B 1 297 ? 0.561   4.476   44.088  1.00 8.48  ? 323  PHE B CA  1 
ATOM   7172  C C   . PHE B 1 297 ? -0.249  4.669   45.358  1.00 9.62  ? 323  PHE B C   1 
ATOM   7173  O O   . PHE B 1 297 ? -1.366  4.164   45.470  1.00 10.27 ? 323  PHE B O   1 
ATOM   7174  C CB  . PHE B 1 297 ? 0.824   2.989   43.818  1.00 7.12  ? 323  PHE B CB  1 
ATOM   7175  C CG  . PHE B 1 297 ? 1.232   2.708   42.390  1.00 7.08  ? 323  PHE B CG  1 
ATOM   7176  C CD1 . PHE B 1 297 ? 2.577   2.613   42.049  1.00 9.90  ? 323  PHE B CD1 1 
ATOM   7177  C CD2 . PHE B 1 297 ? 0.278   2.552   41.388  1.00 11.20 ? 323  PHE B CD2 1 
ATOM   7178  C CE1 . PHE B 1 297 ? 2.967   2.370   40.727  1.00 9.52  ? 323  PHE B CE1 1 
ATOM   7179  C CE2 . PHE B 1 297 ? 0.656   2.309   40.065  1.00 8.41  ? 323  PHE B CE2 1 
ATOM   7180  C CZ  . PHE B 1 297 ? 2.004   2.221   39.737  1.00 9.99  ? 323  PHE B CZ  1 
ATOM   7181  N N   . ASP B 1 298 ? 0.299   5.408   46.318  1.00 10.81 ? 324  ASP B N   1 
ATOM   7182  C CA  . ASP B 1 298 ? -0.464  5.687   47.520  1.00 10.60 ? 324  ASP B CA  1 
ATOM   7183  C C   . ASP B 1 298 ? -1.425  6.840   47.204  1.00 11.12 ? 324  ASP B C   1 
ATOM   7184  O O   . ASP B 1 298 ? -2.422  7.035   47.901  1.00 11.84 ? 324  ASP B O   1 
ATOM   7185  C CB  . ASP B 1 298 ? 0.445   6.097   48.681  1.00 12.00 ? 324  ASP B CB  1 
ATOM   7186  C CG  . ASP B 1 298 ? 1.167   4.917   49.303  1.00 13.47 ? 324  ASP B CG  1 
ATOM   7187  O OD1 . ASP B 1 298 ? 0.605   3.803   49.288  1.00 11.53 ? 324  ASP B OD1 1 
ATOM   7188  O OD2 . ASP B 1 298 ? 2.285   5.116   49.818  1.00 13.05 ? 324  ASP B OD2 1 
ATOM   7189  N N   . LYS B 1 299 ? -1.114  7.601   46.157  1.00 10.82 ? 325  LYS B N   1 
ATOM   7190  C CA  . LYS B 1 299 ? -1.945  8.744   45.752  1.00 11.67 ? 325  LYS B CA  1 
ATOM   7191  C C   . LYS B 1 299 ? -3.324  8.301   45.280  1.00 11.21 ? 325  LYS B C   1 
ATOM   7192  O O   . LYS B 1 299 ? -3.432  7.436   44.419  1.00 10.52 ? 325  LYS B O   1 
ATOM   7193  C CB  . LYS B 1 299 ? -1.269  9.535   44.632  1.00 12.87 ? 325  LYS B CB  1 
ATOM   7194  C CG  . LYS B 1 299 ? -1.864  10.915  44.442  1.00 15.15 ? 325  LYS B CG  1 
ATOM   7195  C CD  . LYS B 1 299 ? -1.654  11.722  45.712  1.00 15.53 ? 325  LYS B CD  1 
ATOM   7196  C CE  . LYS B 1 299 ? -2.501  12.972  45.736  1.00 15.56 ? 325  LYS B CE  1 
ATOM   7197  N NZ  . LYS B 1 299 ? -2.387  13.679  47.051  1.00 18.72 ? 325  LYS B NZ  1 
ATOM   7198  N N   . THR B 1 300 ? -4.387  8.908   45.824  1.00 9.89  ? 326  THR B N   1 
ATOM   7199  C CA  . THR B 1 300 ? -5.746  8.540   45.449  1.00 11.98 ? 326  THR B CA  1 
ATOM   7200  C C   . THR B 1 300 ? -6.055  8.704   43.963  1.00 11.92 ? 326  THR B C   1 
ATOM   7201  O O   . THR B 1 300 ? -6.591  7.797   43.330  1.00 12.11 ? 326  THR B O   1 
ATOM   7202  C CB  . THR B 1 300 ? -6.783  9.360   46.257  1.00 13.23 ? 326  THR B CB  1 
ATOM   7203  O OG1 . THR B 1 300 ? -6.586  9.117   47.653  1.00 13.26 ? 326  THR B OG1 1 
ATOM   7204  C CG2 . THR B 1 300 ? -8.207  8.953   45.882  1.00 13.57 ? 326  THR B CG2 1 
ATOM   7205  N N   . LEU B 1 301 ? -5.719  9.854   43.403  1.00 12.78 ? 327  LEU B N   1 
ATOM   7206  C CA  . LEU B 1 301 ? -5.983  10.100  41.990  1.00 13.07 ? 327  LEU B CA  1 
ATOM   7207  C C   . LEU B 1 301 ? -4.721  10.335  41.178  1.00 11.79 ? 327  LEU B C   1 
ATOM   7208  O O   . LEU B 1 301 ? -3.994  11.296  41.409  1.00 8.47  ? 327  LEU B O   1 
ATOM   7209  C CB  . LEU B 1 301 ? -6.912  11.308  41.816  1.00 15.61 ? 327  LEU B CB  1 
ATOM   7210  C CG  . LEU B 1 301 ? -8.363  11.164  42.268  1.00 20.93 ? 327  LEU B CG  1 
ATOM   7211  C CD1 . LEU B 1 301 ? -9.125  12.461  41.982  1.00 22.67 ? 327  LEU B CD1 1 
ATOM   7212  C CD2 . LEU B 1 301 ? -9.009  9.983   41.547  1.00 22.51 ? 327  LEU B CD2 1 
ATOM   7213  N N   . GLN B 1 302 ? -4.461  9.452   40.223  1.00 8.43  ? 328  GLN B N   1 
ATOM   7214  C CA  . GLN B 1 302 ? -3.303  9.605   39.353  1.00 10.97 ? 328  GLN B CA  1 
ATOM   7215  C C   . GLN B 1 302 ? -3.746  9.565   37.908  1.00 11.91 ? 328  GLN B C   1 
ATOM   7216  O O   . GLN B 1 302 ? -4.276  8.553   37.455  1.00 13.26 ? 328  GLN B O   1 
ATOM   7217  C CB  . GLN B 1 302 ? -2.293  8.475   39.555  1.00 9.73  ? 328  GLN B CB  1 
ATOM   7218  C CG  . GLN B 1 302 ? -1.363  8.613   40.734  1.00 9.31  ? 328  GLN B CG  1 
ATOM   7219  C CD  . GLN B 1 302 ? -0.311  7.524   40.703  1.00 9.97  ? 328  GLN B CD  1 
ATOM   7220  O OE1 . GLN B 1 302 ? -0.572  6.374   41.074  1.00 11.16 ? 328  GLN B OE1 1 
ATOM   7221  N NE2 . GLN B 1 302 ? 0.889   7.873   40.241  1.00 4.55  ? 328  GLN B NE2 1 
ATOM   7222  N N   . PHE B 1 303 ? -3.528  10.663  37.180  1.00 10.52 ? 329  PHE B N   1 
ATOM   7223  C CA  . PHE B 1 303 ? -3.876  10.703  35.770  1.00 10.67 ? 329  PHE B CA  1 
ATOM   7224  C C   . PHE B 1 303 ? -2.597  10.473  34.989  1.00 11.15 ? 329  PHE B C   1 
ATOM   7225  O O   . PHE B 1 303 ? -1.538  11.000  35.324  1.00 12.42 ? 329  PHE B O   1 
ATOM   7226  C CB  . PHE B 1 303 ? -4.507  12.041  35.387  1.00 11.60 ? 329  PHE B CB  1 
ATOM   7227  C CG  . PHE B 1 303 ? -5.886  12.228  35.942  1.00 11.75 ? 329  PHE B CG  1 
ATOM   7228  C CD1 . PHE B 1 303 ? -6.078  12.784  37.203  1.00 13.22 ? 329  PHE B CD1 1 
ATOM   7229  C CD2 . PHE B 1 303 ? -6.998  11.823  35.210  1.00 15.59 ? 329  PHE B CD2 1 
ATOM   7230  C CE1 . PHE B 1 303 ? -7.363  12.931  37.726  1.00 14.75 ? 329  PHE B CE1 1 
ATOM   7231  C CE2 . PHE B 1 303 ? -8.285  11.964  35.724  1.00 15.72 ? 329  PHE B CE2 1 
ATOM   7232  C CZ  . PHE B 1 303 ? -8.463  12.521  36.989  1.00 16.11 ? 329  PHE B CZ  1 
ATOM   7233  N N   . ILE B 1 304 ? -2.698  9.670   33.941  1.00 10.22 ? 330  ILE B N   1 
ATOM   7234  C CA  . ILE B 1 304 ? -1.532  9.323   33.147  1.00 10.29 ? 330  ILE B CA  1 
ATOM   7235  C C   . ILE B 1 304 ? -1.677  9.804   31.710  1.00 10.28 ? 330  ILE B C   1 
ATOM   7236  O O   . ILE B 1 304 ? -2.712  9.599   31.080  1.00 10.55 ? 330  ILE B O   1 
ATOM   7237  C CB  . ILE B 1 304 ? -1.336  7.789   33.192  1.00 10.39 ? 330  ILE B CB  1 
ATOM   7238  C CG1 . ILE B 1 304 ? -1.279  7.329   34.660  1.00 9.30  ? 330  ILE B CG1 1 
ATOM   7239  C CG2 . ILE B 1 304 ? -0.070  7.379   32.457  1.00 8.99  ? 330  ILE B CG2 1 
ATOM   7240  C CD1 . ILE B 1 304 ? -1.593  5.870   34.852  1.00 8.96  ? 330  ILE B CD1 1 
ATOM   7241  N N   . VAL B 1 305 ? -0.644  10.456  31.200  1.00 11.03 ? 331  VAL B N   1 
ATOM   7242  C CA  . VAL B 1 305 ? -0.668  10.935  29.825  1.00 13.65 ? 331  VAL B CA  1 
ATOM   7243  C C   . VAL B 1 305 ? 0.546   10.359  29.116  1.00 14.31 ? 331  VAL B C   1 
ATOM   7244  O O   . VAL B 1 305 ? 1.668   10.803  29.330  1.00 14.81 ? 331  VAL B O   1 
ATOM   7245  C CB  . VAL B 1 305 ? -0.623  12.478  29.760  1.00 14.89 ? 331  VAL B CB  1 
ATOM   7246  C CG1 . VAL B 1 305 ? -0.616  12.937  28.306  1.00 15.53 ? 331  VAL B CG1 1 
ATOM   7247  C CG2 . VAL B 1 305 ? -1.823  13.059  30.497  1.00 14.05 ? 331  VAL B CG2 1 
ATOM   7248  N N   . ALA B 1 306 ? 0.306   9.355   28.275  1.00 15.28 ? 332  ALA B N   1 
ATOM   7249  C CA  . ALA B 1 306 ? 1.367   8.685   27.534  1.00 15.86 ? 332  ALA B CA  1 
ATOM   7250  C C   . ALA B 1 306 ? 1.948   9.520   26.410  1.00 17.25 ? 332  ALA B C   1 
ATOM   7251  O O   . ALA B 1 306 ? 1.346   10.480  25.936  1.00 15.82 ? 332  ALA B O   1 
ATOM   7252  C CB  . ALA B 1 306 ? 0.857   7.355   26.970  1.00 18.21 ? 332  ALA B CB  1 
ATOM   7253  N N   . GLU B 1 307 ? 3.138   9.135   25.980  1.00 19.33 ? 333  GLU B N   1 
ATOM   7254  C CA  . GLU B 1 307 ? 3.823   9.827   24.906  1.00 20.74 ? 333  GLU B CA  1 
ATOM   7255  C C   . GLU B 1 307 ? 3.140   9.602   23.545  1.00 20.33 ? 333  GLU B C   1 
ATOM   7256  O O   . GLU B 1 307 ? 3.066   10.519  22.734  1.00 20.38 ? 333  GLU B O   1 
ATOM   7257  C CB  . GLU B 1 307 ? 5.280   9.345   24.881  1.00 21.69 ? 333  GLU B CB  1 
ATOM   7258  C CG  . GLU B 1 307 ? 6.185   9.924   23.812  1.00 25.84 ? 333  GLU B CG  1 
ATOM   7259  C CD  . GLU B 1 307 ? 6.115   9.184   22.488  1.00 29.01 ? 333  GLU B CD  1 
ATOM   7260  O OE1 . GLU B 1 307 ? 5.762   7.980   22.465  1.00 30.19 ? 333  GLU B OE1 1 
ATOM   7261  O OE2 . GLU B 1 307 ? 6.446   9.812   21.462  1.00 31.39 ? 333  GLU B OE2 1 
ATOM   7262  N N   . ASP B 1 308 ? 2.618   8.400   23.313  1.00 19.55 ? 334  ASP B N   1 
ATOM   7263  C CA  . ASP B 1 308 ? 1.983   8.078   22.029  1.00 19.87 ? 334  ASP B CA  1 
ATOM   7264  C C   . ASP B 1 308 ? 0.537   8.532   21.888  1.00 18.70 ? 334  ASP B C   1 
ATOM   7265  O O   . ASP B 1 308 ? -0.132  8.217   20.904  1.00 18.77 ? 334  ASP B O   1 
ATOM   7266  C CB  . ASP B 1 308 ? 2.077   6.570   21.742  1.00 20.73 ? 334  ASP B CB  1 
ATOM   7267  C CG  . ASP B 1 308 ? 1.203   5.737   22.661  1.00 22.68 ? 334  ASP B CG  1 
ATOM   7268  O OD1 . ASP B 1 308 ? 0.442   6.322   23.463  1.00 25.26 ? 334  ASP B OD1 1 
ATOM   7269  O OD2 . ASP B 1 308 ? 1.274   4.491   22.583  1.00 23.23 ? 334  ASP B OD2 1 
ATOM   7270  N N   . GLY B 1 309 ? 0.054   9.278   22.873  1.00 16.90 ? 335  GLY B N   1 
ATOM   7271  C CA  . GLY B 1 309 ? -1.307  9.765   22.804  1.00 14.72 ? 335  GLY B CA  1 
ATOM   7272  C C   . GLY B 1 309 ? -2.255  9.042   23.740  1.00 14.77 ? 335  GLY B C   1 
ATOM   7273  O O   . GLY B 1 309 ? -3.362  9.528   23.995  1.00 12.40 ? 335  GLY B O   1 
ATOM   7274  N N   . SER B 1 310 ? -1.835  7.885   24.248  1.00 13.80 ? 336  SER B N   1 
ATOM   7275  C CA  . SER B 1 310 ? -2.671  7.116   25.164  1.00 15.81 ? 336  SER B CA  1 
ATOM   7276  C C   . SER B 1 310 ? -2.783  7.846   26.495  1.00 15.22 ? 336  SER B C   1 
ATOM   7277  O O   . SER B 1 310 ? -1.912  8.636   26.864  1.00 16.23 ? 336  SER B O   1 
ATOM   7278  C CB  . SER B 1 310 ? -2.076  5.723   25.390  1.00 18.09 ? 336  SER B CB  1 
ATOM   7279  O OG  . SER B 1 310 ? -2.159  4.918   24.222  1.00 20.52 ? 336  SER B OG  1 
ATOM   7280  N N   . CYS B 1 311 ? -3.859  7.581   27.212  1.00 13.65 ? 337  CYS B N   1 
ATOM   7281  C CA  . CYS B 1 311 ? -4.058  8.214   28.494  1.00 16.21 ? 337  CYS B CA  1 
ATOM   7282  C C   . CYS B 1 311 ? -5.041  7.417   29.322  1.00 17.19 ? 337  CYS B C   1 
ATOM   7283  O O   . CYS B 1 311 ? -5.839  6.634   28.791  1.00 17.75 ? 337  CYS B O   1 
ATOM   7284  C CB  . CYS B 1 311 ? -4.580  9.638   28.318  1.00 14.72 ? 337  CYS B CB  1 
ATOM   7285  S SG  . CYS B 1 311 ? -6.258  9.730   27.657  1.00 18.44 ? 337  CYS B SG  1 
ATOM   7286  N N   . GLY B 1 312 ? -4.972  7.617   30.631  1.00 15.99 ? 338  GLY B N   1 
ATOM   7287  C CA  . GLY B 1 312 ? -5.865  6.913   31.527  1.00 14.51 ? 338  GLY B CA  1 
ATOM   7288  C C   . GLY B 1 312 ? -5.601  7.336   32.956  1.00 15.08 ? 338  GLY B C   1 
ATOM   7289  O O   . GLY B 1 312 ? -5.114  8.441   33.205  1.00 13.23 ? 338  GLY B O   1 
ATOM   7290  N N   . MET B 1 313 ? -5.917  6.458   33.904  1.00 14.85 ? 339  MET B N   1 
ATOM   7291  C CA  . MET B 1 313 ? -5.698  6.768   35.307  1.00 14.78 ? 339  MET B CA  1 
ATOM   7292  C C   . MET B 1 313 ? -5.699  5.523   36.189  1.00 13.92 ? 339  MET B C   1 
ATOM   7293  O O   . MET B 1 313 ? -6.062  4.432   35.751  1.00 12.10 ? 339  MET B O   1 
ATOM   7294  C CB  . MET B 1 313 ? -6.775  7.736   35.807  1.00 15.50 ? 339  MET B CB  1 
ATOM   7295  C CG  . MET B 1 313 ? -8.185  7.176   35.759  1.00 22.75 ? 339  MET B CG  1 
ATOM   7296  S SD  . MET B 1 313 ? -9.375  8.322   36.464  1.00 32.93 ? 339  MET B SD  1 
ATOM   7297  C CE  . MET B 1 313 ? -8.986  8.140   38.224  1.00 28.21 ? 339  MET B CE  1 
ATOM   7298  N N   . VAL B 1 314 ? -5.275  5.698   37.432  1.00 11.17 ? 340  VAL B N   1 
ATOM   7299  C CA  . VAL B 1 314 ? -5.255  4.618   38.412  1.00 10.48 ? 340  VAL B CA  1 
ATOM   7300  C C   . VAL B 1 314 ? -5.576  5.301   39.740  1.00 11.68 ? 340  VAL B C   1 
ATOM   7301  O O   . VAL B 1 314 ? -5.041  6.374   40.030  1.00 10.38 ? 340  VAL B O   1 
ATOM   7302  C CB  . VAL B 1 314 ? -3.863  3.922   38.445  1.00 10.95 ? 340  VAL B CB  1 
ATOM   7303  C CG1 . VAL B 1 314 ? -2.769  4.947   38.636  1.00 14.18 ? 340  VAL B CG1 1 
ATOM   7304  C CG2 . VAL B 1 314 ? -3.821  2.857   39.545  1.00 12.92 ? 340  VAL B CG2 1 
ATOM   7305  N N   . TYR B 1 315 ? -6.478  4.714   40.526  1.00 10.25 ? 341  TYR B N   1 
ATOM   7306  C CA  . TYR B 1 315 ? -6.846  5.321   41.794  1.00 9.82  ? 341  TYR B CA  1 
ATOM   7307  C C   . TYR B 1 315 ? -6.766  4.353   42.968  1.00 11.84 ? 341  TYR B C   1 
ATOM   7308  O O   . TYR B 1 315 ? -7.012  3.154   42.825  1.00 12.66 ? 341  TYR B O   1 
ATOM   7309  C CB  . TYR B 1 315 ? -8.250  5.926   41.707  1.00 9.00  ? 341  TYR B CB  1 
ATOM   7310  C CG  . TYR B 1 315 ? -9.396  4.939   41.716  1.00 12.07 ? 341  TYR B CG  1 
ATOM   7311  C CD1 . TYR B 1 315 ? -10.019 4.569   42.910  1.00 12.99 ? 341  TYR B CD1 1 
ATOM   7312  C CD2 . TYR B 1 315 ? -9.877  4.392   40.526  1.00 13.54 ? 341  TYR B CD2 1 
ATOM   7313  C CE1 . TYR B 1 315 ? -11.100 3.685   42.912  1.00 15.53 ? 341  TYR B CE1 1 
ATOM   7314  C CE2 . TYR B 1 315 ? -10.941 3.505   40.521  1.00 15.06 ? 341  TYR B CE2 1 
ATOM   7315  C CZ  . TYR B 1 315 ? -11.552 3.157   41.716  1.00 17.52 ? 341  TYR B CZ  1 
ATOM   7316  O OH  . TYR B 1 315 ? -12.614 2.282   41.706  1.00 20.86 ? 341  TYR B OH  1 
ATOM   7317  N N   . GLU B 1 316 ? -6.414  4.892   44.129  1.00 12.07 ? 342  GLU B N   1 
ATOM   7318  C CA  . GLU B 1 316 ? -6.286  4.112   45.358  1.00 12.30 ? 342  GLU B CA  1 
ATOM   7319  C C   . GLU B 1 316 ? -7.706  3.854   45.861  1.00 12.23 ? 342  GLU B C   1 
ATOM   7320  O O   . GLU B 1 316 ? -8.448  4.780   46.174  1.00 13.53 ? 342  GLU B O   1 
ATOM   7321  C CB  . GLU B 1 316 ? -5.451  4.906   46.366  1.00 13.51 ? 342  GLU B CB  1 
ATOM   7322  C CG  . GLU B 1 316 ? -4.674  4.053   47.341  1.00 12.60 ? 342  GLU B CG  1 
ATOM   7323  C CD  . GLU B 1 316 ? -5.585  3.287   48.260  1.00 14.29 ? 342  GLU B CD  1 
ATOM   7324  O OE1 . GLU B 1 316 ? -6.449  3.932   48.886  1.00 15.45 ? 342  GLU B OE1 1 
ATOM   7325  O OE2 . GLU B 1 316 ? -5.447  2.048   48.353  1.00 17.63 ? 342  GLU B OE2 1 
ATOM   7326  N N   . HIS B 1 317 ? -8.075  2.576   45.925  1.00 14.30 ? 343  HIS B N   1 
ATOM   7327  C CA  . HIS B 1 317 ? -9.428  2.157   46.291  1.00 13.96 ? 343  HIS B CA  1 
ATOM   7328  C C   . HIS B 1 317 ? -9.979  2.525   47.657  1.00 15.58 ? 343  HIS B C   1 
ATOM   7329  O O   . HIS B 1 317 ? -11.196 2.619   47.829  1.00 15.17 ? 343  HIS B O   1 
ATOM   7330  C CB  . HIS B 1 317 ? -9.578  0.646   46.112  1.00 13.49 ? 343  HIS B CB  1 
ATOM   7331  C CG  . HIS B 1 317 ? -10.855 0.248   45.453  1.00 12.10 ? 343  HIS B CG  1 
ATOM   7332  N ND1 . HIS B 1 317 ? -12.054 0.874   45.718  1.00 12.57 ? 343  HIS B ND1 1 
ATOM   7333  C CD2 . HIS B 1 317 ? -11.128 -0.729  44.557  1.00 15.53 ? 343  HIS B CD2 1 
ATOM   7334  C CE1 . HIS B 1 317 ? -13.015 0.298   45.008  1.00 15.16 ? 343  HIS B CE1 1 
ATOM   7335  N NE2 . HIS B 1 317 ? -12.479 -0.680  44.296  1.00 15.21 ? 343  HIS B NE2 1 
ATOM   7336  N N   . ALA B 1 318 ? -9.108  2.733   48.628  1.00 18.15 ? 344  ALA B N   1 
ATOM   7337  C CA  . ALA B 1 318 ? -9.578  3.074   49.962  1.00 20.57 ? 344  ALA B CA  1 
ATOM   7338  C C   . ALA B 1 318 ? -10.494 4.292   49.931  1.00 23.13 ? 344  ALA B C   1 
ATOM   7339  O O   . ALA B 1 318 ? -11.437 4.379   50.709  1.00 23.06 ? 344  ALA B O   1 
ATOM   7340  C CB  . ALA B 1 318 ? -8.400  3.327   50.875  1.00 20.12 ? 344  ALA B CB  1 
ATOM   7341  N N   . ALA B 1 319 ? -10.220 5.220   49.009  1.00 25.85 ? 345  ALA B N   1 
ATOM   7342  C CA  . ALA B 1 319 ? -10.999 6.445   48.880  1.00 27.04 ? 345  ALA B CA  1 
ATOM   7343  C C   . ALA B 1 319 ? -12.445 6.251   48.444  1.00 28.86 ? 345  ALA B C   1 
ATOM   7344  O O   . ALA B 1 319 ? -13.363 6.430   49.247  1.00 31.40 ? 345  ALA B O   1 
ATOM   7345  C CB  . ALA B 1 319 ? -10.309 7.399   47.930  1.00 27.87 ? 345  ALA B CB  1 
ATOM   7346  N N   . ALA B 1 320 ? -12.661 5.907   47.178  1.00 28.05 ? 346  ALA B N   1 
ATOM   7347  C CA  . ALA B 1 320 ? -14.030 5.731   46.695  1.00 27.21 ? 346  ALA B CA  1 
ATOM   7348  C C   . ALA B 1 320 ? -14.192 4.571   45.726  1.00 27.55 ? 346  ALA B C   1 
ATOM   7349  O O   . ALA B 1 320 ? -13.279 3.765   45.523  1.00 26.09 ? 346  ALA B O   1 
ATOM   7350  C CB  . ALA B 1 320 ? -14.526 7.019   46.041  1.00 27.75 ? 346  ALA B CB  1 
ATOM   7351  N N   . GLU B 1 321 ? -15.381 4.499   45.131  1.00 26.60 ? 347  GLU B N   1 
ATOM   7352  C CA  . GLU B 1 321 ? -15.710 3.454   44.180  1.00 25.99 ? 347  GLU B CA  1 
ATOM   7353  C C   . GLU B 1 321 ? -15.574 3.963   42.752  1.00 25.04 ? 347  GLU B C   1 
ATOM   7354  O O   . GLU B 1 321 ? -15.120 5.087   42.513  1.00 23.08 ? 347  GLU B O   1 
ATOM   7355  C CB  . GLU B 1 321 ? -17.142 2.962   44.404  1.00 26.98 ? 347  GLU B CB  1 
ATOM   7356  C CG  . GLU B 1 321 ? -17.453 2.515   45.829  1.00 29.83 ? 347  GLU B CG  1 
ATOM   7357  C CD  . GLU B 1 321 ? -16.497 1.452   46.320  1.00 28.10 ? 347  GLU B CD  1 
ATOM   7358  O OE1 . GLU B 1 321 ? -16.113 0.588   45.508  1.00 29.95 ? 347  GLU B OE1 1 
ATOM   7359  O OE2 . GLU B 1 321 ? -16.142 1.477   47.516  1.00 28.55 ? 347  GLU B OE2 1 
ATOM   7360  N N   . GLY B 1 322 ? -15.987 3.121   41.814  1.00 23.29 ? 348  GLY B N   1 
ATOM   7361  C CA  . GLY B 1 322 ? -15.910 3.457   40.409  1.00 22.15 ? 348  GLY B CA  1 
ATOM   7362  C C   . GLY B 1 322 ? -16.817 4.590   39.962  1.00 22.51 ? 348  GLY B C   1 
ATOM   7363  O O   . GLY B 1 322 ? -16.322 5.581   39.427  1.00 23.03 ? 348  GLY B O   1 
ATOM   7364  N N   . PRO B 1 323 ? -18.140 4.479   40.165  1.00 21.67 ? 349  PRO B N   1 
ATOM   7365  C CA  . PRO B 1 323 ? -19.064 5.537   39.746  1.00 23.18 ? 349  PRO B CA  1 
ATOM   7366  C C   . PRO B 1 323 ? -18.579 6.957   40.054  1.00 21.49 ? 349  PRO B C   1 
ATOM   7367  O O   . PRO B 1 323 ? -18.504 7.795   39.155  1.00 21.70 ? 349  PRO B O   1 
ATOM   7368  C CB  . PRO B 1 323 ? -20.360 5.158   40.461  1.00 24.06 ? 349  PRO B CB  1 
ATOM   7369  C CG  . PRO B 1 323 ? -20.297 3.645   40.444  1.00 24.30 ? 349  PRO B CG  1 
ATOM   7370  C CD  . PRO B 1 323 ? -18.863 3.407   40.874  1.00 24.31 ? 349  PRO B CD  1 
ATOM   7371  N N   . PRO B 1 324 ? -18.228 7.245   41.316  1.00 20.04 ? 350  PRO B N   1 
ATOM   7372  C CA  . PRO B 1 324 ? -17.756 8.600   41.626  1.00 18.77 ? 350  PRO B CA  1 
ATOM   7373  C C   . PRO B 1 324 ? -16.576 9.014   40.740  1.00 18.72 ? 350  PRO B C   1 
ATOM   7374  O O   . PRO B 1 324 ? -16.514 10.137  40.246  1.00 16.48 ? 350  PRO B O   1 
ATOM   7375  C CB  . PRO B 1 324 ? -17.376 8.499   43.098  1.00 20.31 ? 350  PRO B CB  1 
ATOM   7376  C CG  . PRO B 1 324 ? -18.375 7.486   43.618  1.00 21.31 ? 350  PRO B CG  1 
ATOM   7377  C CD  . PRO B 1 324 ? -18.338 6.432   42.540  1.00 20.46 ? 350  PRO B CD  1 
ATOM   7378  N N   . ILE B 1 325 ? -15.642 8.084   40.544  1.00 18.17 ? 351  ILE B N   1 
ATOM   7379  C CA  . ILE B 1 325 ? -14.473 8.325   39.720  1.00 17.47 ? 351  ILE B CA  1 
ATOM   7380  C C   . ILE B 1 325 ? -14.865 8.567   38.262  1.00 18.41 ? 351  ILE B C   1 
ATOM   7381  O O   . ILE B 1 325 ? -14.333 9.479   37.622  1.00 17.71 ? 351  ILE B O   1 
ATOM   7382  C CB  . ILE B 1 325 ? -13.497 7.130   39.760  1.00 17.73 ? 351  ILE B CB  1 
ATOM   7383  C CG1 . ILE B 1 325 ? -12.964 6.928   41.178  1.00 19.62 ? 351  ILE B CG1 1 
ATOM   7384  C CG2 . ILE B 1 325 ? -12.354 7.363   38.783  1.00 17.93 ? 351  ILE B CG2 1 
ATOM   7385  C CD1 . ILE B 1 325 ? -12.154 8.085   41.713  1.00 18.00 ? 351  ILE B CD1 1 
ATOM   7386  N N   . VAL B 1 326 ? -15.782 7.749   37.737  1.00 17.89 ? 352  VAL B N   1 
ATOM   7387  C CA  . VAL B 1 326 ? -16.221 7.889   36.347  1.00 20.27 ? 352  VAL B CA  1 
ATOM   7388  C C   . VAL B 1 326 ? -16.943 9.212   36.127  1.00 18.60 ? 352  VAL B C   1 
ATOM   7389  O O   . VAL B 1 326 ? -16.871 9.790   35.048  1.00 21.90 ? 352  VAL B O   1 
ATOM   7390  C CB  . VAL B 1 326 ? -17.169 6.735   35.908  1.00 20.85 ? 352  VAL B CB  1 
ATOM   7391  C CG1 . VAL B 1 326 ? -16.690 5.426   36.480  1.00 24.84 ? 352  VAL B CG1 1 
ATOM   7392  C CG2 . VAL B 1 326 ? -18.599 7.025   36.326  1.00 25.58 ? 352  VAL B CG2 1 
ATOM   7393  N N   . ALA B 1 327 ? -17.649 9.687   37.139  1.00 18.98 ? 353  ALA B N   1 
ATOM   7394  C CA  . ALA B 1 327 ? -18.353 10.955  37.005  1.00 20.26 ? 353  ALA B CA  1 
ATOM   7395  C C   . ALA B 1 327 ? -17.325 12.055  36.741  1.00 20.02 ? 353  ALA B C   1 
ATOM   7396  O O   . ALA B 1 327 ? -17.528 12.924  35.897  1.00 19.77 ? 353  ALA B O   1 
ATOM   7397  C CB  . ALA B 1 327 ? -19.133 11.264  38.266  1.00 19.85 ? 353  ALA B CB  1 
ATOM   7398  N N   . LEU B 1 328 ? -16.214 12.005  37.470  1.00 19.59 ? 354  LEU B N   1 
ATOM   7399  C CA  . LEU B 1 328 ? -15.162 12.996  37.319  1.00 18.58 ? 354  LEU B CA  1 
ATOM   7400  C C   . LEU B 1 328 ? -14.506 12.833  35.957  1.00 19.19 ? 354  LEU B C   1 
ATOM   7401  O O   . LEU B 1 328 ? -14.230 13.816  35.260  1.00 18.34 ? 354  LEU B O   1 
ATOM   7402  C CB  . LEU B 1 328 ? -14.136 12.841  38.449  1.00 18.67 ? 354  LEU B CB  1 
ATOM   7403  C CG  . LEU B 1 328 ? -12.942 13.800  38.501  1.00 19.86 ? 354  LEU B CG  1 
ATOM   7404  C CD1 . LEU B 1 328 ? -12.485 13.977  39.940  1.00 19.90 ? 354  LEU B CD1 1 
ATOM   7405  C CD2 . LEU B 1 328 ? -11.817 13.259  37.640  1.00 20.86 ? 354  LEU B CD2 1 
ATOM   7406  N N   . VAL B 1 329 ? -14.267 11.582  35.570  1.00 18.80 ? 355  VAL B N   1 
ATOM   7407  C CA  . VAL B 1 329 ? -13.654 11.299  34.283  1.00 17.95 ? 355  VAL B CA  1 
ATOM   7408  C C   . VAL B 1 329 ? -14.518 11.834  33.146  1.00 17.18 ? 355  VAL B C   1 
ATOM   7409  O O   . VAL B 1 329 ? -14.020 12.516  32.249  1.00 16.90 ? 355  VAL B O   1 
ATOM   7410  C CB  . VAL B 1 329 ? -13.444 9.782   34.092  1.00 18.60 ? 355  VAL B CB  1 
ATOM   7411  C CG1 . VAL B 1 329 ? -13.058 9.477   32.647  1.00 19.95 ? 355  VAL B CG1 1 
ATOM   7412  C CG2 . VAL B 1 329 ? -12.357 9.293   35.044  1.00 19.71 ? 355  VAL B CG2 1 
ATOM   7413  N N   . ASP B 1 330 ? -15.815 11.535  33.183  1.00 16.59 ? 356  ASP B N   1 
ATOM   7414  C CA  . ASP B 1 330 ? -16.714 12.000  32.132  1.00 17.08 ? 356  ASP B CA  1 
ATOM   7415  C C   . ASP B 1 330 ? -16.691 13.520  32.046  1.00 17.38 ? 356  ASP B C   1 
ATOM   7416  O O   . ASP B 1 330 ? -16.733 14.092  30.949  1.00 17.95 ? 356  ASP B O   1 
ATOM   7417  C CB  . ASP B 1 330 ? -18.147 11.511  32.383  1.00 16.89 ? 356  ASP B CB  1 
ATOM   7418  C CG  . ASP B 1 330 ? -18.335 10.043  32.019  1.00 17.31 ? 356  ASP B CG  1 
ATOM   7419  O OD1 . ASP B 1 330 ? -17.504 9.514   31.250  1.00 19.18 ? 356  ASP B OD1 1 
ATOM   7420  O OD2 . ASP B 1 330 ? -19.306 9.416   32.494  1.00 15.73 ? 356  ASP B OD2 1 
ATOM   7421  N N   . HIS B 1 331 ? -16.607 14.174  33.206  1.00 17.00 ? 357  HIS B N   1 
ATOM   7422  C CA  . HIS B 1 331 ? -16.574 15.629  33.260  1.00 16.56 ? 357  HIS B CA  1 
ATOM   7423  C C   . HIS B 1 331 ? -15.282 16.157  32.665  1.00 17.02 ? 357  HIS B C   1 
ATOM   7424  O O   . HIS B 1 331 ? -15.302 17.027  31.794  1.00 17.06 ? 357  HIS B O   1 
ATOM   7425  C CB  . HIS B 1 331 ? -16.707 16.104  34.710  1.00 15.84 ? 357  HIS B CB  1 
ATOM   7426  C CG  . HIS B 1 331 ? -16.914 17.578  34.844  1.00 16.11 ? 357  HIS B CG  1 
ATOM   7427  N ND1 . HIS B 1 331 ? -15.900 18.490  34.651  1.00 19.44 ? 357  HIS B ND1 1 
ATOM   7428  C CD2 . HIS B 1 331 ? -18.026 18.299  35.114  1.00 16.41 ? 357  HIS B CD2 1 
ATOM   7429  C CE1 . HIS B 1 331 ? -16.379 19.714  34.794  1.00 17.82 ? 357  HIS B CE1 1 
ATOM   7430  N NE2 . HIS B 1 331 ? -17.669 19.626  35.077  1.00 20.04 ? 357  HIS B NE2 1 
ATOM   7431  N N   . VAL B 1 332 ? -14.160 15.625  33.131  1.00 16.43 ? 358  VAL B N   1 
ATOM   7432  C CA  . VAL B 1 332 ? -12.859 16.045  32.625  1.00 17.28 ? 358  VAL B CA  1 
ATOM   7433  C C   . VAL B 1 332 ? -12.727 15.816  31.113  1.00 18.21 ? 358  VAL B C   1 
ATOM   7434  O O   . VAL B 1 332 ? -12.321 16.714  30.372  1.00 18.35 ? 358  VAL B O   1 
ATOM   7435  C CB  . VAL B 1 332 ? -11.726 15.293  33.353  1.00 15.83 ? 358  VAL B CB  1 
ATOM   7436  C CG1 . VAL B 1 332 ? -10.398 15.601  32.713  1.00 17.08 ? 358  VAL B CG1 1 
ATOM   7437  C CG2 . VAL B 1 332 ? -11.702 15.694  34.821  1.00 17.34 ? 358  VAL B CG2 1 
ATOM   7438  N N   . MET B 1 333 ? -13.068 14.619  30.655  1.00 18.25 ? 359  MET B N   1 
ATOM   7439  C CA  . MET B 1 333 ? -12.957 14.323  29.233  1.00 19.62 ? 359  MET B CA  1 
ATOM   7440  C C   . MET B 1 333 ? -13.815 15.255  28.391  1.00 19.62 ? 359  MET B C   1 
ATOM   7441  O O   . MET B 1 333 ? -13.379 15.723  27.342  1.00 19.57 ? 359  MET B O   1 
ATOM   7442  C CB  . MET B 1 333 ? -13.331 12.866  28.959  1.00 18.45 ? 359  MET B CB  1 
ATOM   7443  C CG  . MET B 1 333 ? -12.314 11.866  29.480  1.00 20.90 ? 359  MET B CG  1 
ATOM   7444  S SD  . MET B 1 333 ? -10.613 12.252  29.000  1.00 23.23 ? 359  MET B SD  1 
ATOM   7445  C CE  . MET B 1 333 ? -9.951  12.662  30.553  1.00 25.01 ? 359  MET B CE  1 
ATOM   7446  N N   . GLU B 1 334 ? -15.030 15.527  28.848  1.00 21.71 ? 360  GLU B N   1 
ATOM   7447  C CA  . GLU B 1 334 ? -15.918 16.413  28.106  1.00 23.73 ? 360  GLU B CA  1 
ATOM   7448  C C   . GLU B 1 334 ? -15.331 17.821  28.074  1.00 24.26 ? 360  GLU B C   1 
ATOM   7449  O O   . GLU B 1 334 ? -15.477 18.544  27.084  1.00 23.54 ? 360  GLU B O   1 
ATOM   7450  C CB  . GLU B 1 334 ? -17.302 16.452  28.754  1.00 27.30 ? 360  GLU B CB  1 
ATOM   7451  C CG  . GLU B 1 334 ? -18.254 17.422  28.075  1.00 32.72 ? 360  GLU B CG  1 
ATOM   7452  C CD  . GLU B 1 334 ? -19.650 17.379  28.657  1.00 36.92 ? 360  GLU B CD  1 
ATOM   7453  O OE1 . GLU B 1 334 ? -19.804 17.647  29.868  1.00 38.37 ? 360  GLU B OE1 1 
ATOM   7454  O OE2 . GLU B 1 334 ? -20.599 17.081  27.899  1.00 38.67 ? 360  GLU B OE2 1 
ATOM   7455  N N   . TYR B 1 335 ? -14.656 18.197  29.161  1.00 22.62 ? 361  TYR B N   1 
ATOM   7456  C CA  . TYR B 1 335 ? -14.040 19.515  29.276  1.00 21.85 ? 361  TYR B CA  1 
ATOM   7457  C C   . TYR B 1 335 ? -12.895 19.671  28.280  1.00 22.40 ? 361  TYR B C   1 
ATOM   7458  O O   . TYR B 1 335 ? -12.731 20.733  27.682  1.00 22.03 ? 361  TYR B O   1 
ATOM   7459  C CB  . TYR B 1 335 ? -13.528 19.741  30.706  1.00 20.05 ? 361  TYR B CB  1 
ATOM   7460  C CG  . TYR B 1 335 ? -13.057 21.153  30.970  1.00 19.99 ? 361  TYR B CG  1 
ATOM   7461  C CD1 . TYR B 1 335 ? -11.789 21.572  30.570  1.00 19.79 ? 361  TYR B CD1 1 
ATOM   7462  C CD2 . TYR B 1 335 ? -13.898 22.085  31.577  1.00 20.09 ? 361  TYR B CD2 1 
ATOM   7463  C CE1 . TYR B 1 335 ? -11.371 22.889  30.764  1.00 22.22 ? 361  TYR B CE1 1 
ATOM   7464  C CE2 . TYR B 1 335 ? -13.491 23.400  31.775  1.00 21.23 ? 361  TYR B CE2 1 
ATOM   7465  C CZ  . TYR B 1 335 ? -12.230 23.794  31.365  1.00 23.62 ? 361  TYR B CZ  1 
ATOM   7466  O OH  . TYR B 1 335 ? -11.835 25.094  31.557  1.00 29.35 ? 361  TYR B OH  1 
ATOM   7467  N N   . THR B 1 336 ? -12.109 18.610  28.100  1.00 22.51 ? 362  THR B N   1 
ATOM   7468  C CA  . THR B 1 336 ? -10.989 18.649  27.165  1.00 24.12 ? 362  THR B CA  1 
ATOM   7469  C C   . THR B 1 336 ? -11.521 18.787  25.742  1.00 27.21 ? 362  THR B C   1 
ATOM   7470  O O   . THR B 1 336 ? -10.778 19.102  24.814  1.00 26.39 ? 362  THR B O   1 
ATOM   7471  C CB  . THR B 1 336 ? -10.120 17.371  27.246  1.00 22.28 ? 362  THR B CB  1 
ATOM   7472  O OG1 . THR B 1 336 ? -10.871 16.237  26.795  1.00 18.98 ? 362  THR B OG1 1 
ATOM   7473  C CG2 . THR B 1 336 ? -9.658  17.132  28.676  1.00 23.06 ? 362  THR B CG2 1 
ATOM   7474  N N   . LYS B 1 337 ? -12.817 18.549  25.583  1.00 31.51 ? 363  LYS B N   1 
ATOM   7475  C CA  . LYS B 1 337 ? -13.473 18.657  24.283  1.00 36.88 ? 363  LYS B CA  1 
ATOM   7476  C C   . LYS B 1 337 ? -14.123 20.021  24.092  1.00 40.07 ? 363  LYS B C   1 
ATOM   7477  O O   . LYS B 1 337 ? -14.338 20.451  22.963  1.00 40.84 ? 363  LYS B O   1 
ATOM   7478  C CB  . LYS B 1 337 ? -14.530 17.559  24.124  1.00 37.30 ? 363  LYS B CB  1 
ATOM   7479  C CG  . LYS B 1 337 ? -13.958 16.168  23.974  1.00 37.91 ? 363  LYS B CG  1 
ATOM   7480  C CD  . LYS B 1 337 ? -15.051 15.114  23.973  1.00 42.03 ? 363  LYS B CD  1 
ATOM   7481  C CE  . LYS B 1 337 ? -14.478 13.756  23.624  1.00 43.53 ? 363  LYS B CE  1 
ATOM   7482  N NZ  . LYS B 1 337 ? -13.266 13.470  24.437  1.00 47.75 ? 363  LYS B NZ  1 
ATOM   7483  N N   . LYS B 1 338 ? -14.446 20.694  25.195  1.00 44.81 ? 364  LYS B N   1 
ATOM   7484  C CA  . LYS B 1 338 ? -15.067 22.013  25.127  1.00 48.70 ? 364  LYS B CA  1 
ATOM   7485  C C   . LYS B 1 338 ? -14.151 22.990  24.402  1.00 51.51 ? 364  LYS B C   1 
ATOM   7486  O O   . LYS B 1 338 ? -12.936 22.963  24.581  1.00 50.96 ? 364  LYS B O   1 
ATOM   7487  C CB  . LYS B 1 338 ? -15.376 22.549  26.531  1.00 50.50 ? 364  LYS B CB  1 
ATOM   7488  C CG  . LYS B 1 338 ? -16.511 21.817  27.242  1.00 53.37 ? 364  LYS B CG  1 
ATOM   7489  C CD  . LYS B 1 338 ? -16.757 22.380  28.644  1.00 55.23 ? 364  LYS B CD  1 
ATOM   7490  C CE  . LYS B 1 338 ? -17.846 21.596  29.381  1.00 56.53 ? 364  LYS B CE  1 
ATOM   7491  N NZ  . LYS B 1 338 ? -18.031 22.037  30.798  1.00 56.21 ? 364  LYS B NZ  1 
ATOM   7492  N N   . PRO B 1 339 ? -14.730 23.868  23.568  1.00 54.43 ? 365  PRO B N   1 
ATOM   7493  C CA  . PRO B 1 339 ? -13.987 24.869  22.796  1.00 56.69 ? 365  PRO B CA  1 
ATOM   7494  C C   . PRO B 1 339 ? -13.020 25.711  23.616  1.00 59.10 ? 365  PRO B C   1 
ATOM   7495  O O   . PRO B 1 339 ? -13.343 26.162  24.719  1.00 58.59 ? 365  PRO B O   1 
ATOM   7496  C CB  . PRO B 1 339 ? -15.096 25.710  22.175  1.00 56.59 ? 365  PRO B CB  1 
ATOM   7497  C CG  . PRO B 1 339 ? -16.167 24.695  21.935  1.00 56.29 ? 365  PRO B CG  1 
ATOM   7498  C CD  . PRO B 1 339 ? -16.165 23.919  23.234  1.00 55.02 ? 365  PRO B CD  1 
ATOM   7499  N N   . GLU B 1 340 ? -11.830 25.913  23.061  1.00 61.68 ? 366  GLU B N   1 
ATOM   7500  C CA  . GLU B 1 340 ? -10.801 26.707  23.711  1.00 64.62 ? 366  GLU B CA  1 
ATOM   7501  C C   . GLU B 1 340 ? -10.924 28.144  23.231  1.00 66.36 ? 366  GLU B C   1 
ATOM   7502  O O   . GLU B 1 340 ? -10.004 28.691  22.619  1.00 66.75 ? 366  GLU B O   1 
ATOM   7503  C CB  . GLU B 1 340 ? -9.416  26.157  23.370  1.00 65.47 ? 366  GLU B CB  1 
ATOM   7504  C CG  . GLU B 1 340 ? -9.212  24.717  23.804  1.00 66.97 ? 366  GLU B CG  1 
ATOM   7505  C CD  . GLU B 1 340 ? -7.779  24.252  23.648  1.00 68.17 ? 366  GLU B CD  1 
ATOM   7506  O OE1 . GLU B 1 340 ? -7.288  24.176  22.500  1.00 68.62 ? 366  GLU B OE1 1 
ATOM   7507  O OE2 . GLU B 1 340 ? -7.140  23.964  24.680  1.00 69.71 ? 366  GLU B OE2 1 
ATOM   7508  N N   . LEU B 1 341 ? -12.078 28.744  23.505  1.00 68.06 ? 367  LEU B N   1 
ATOM   7509  C CA  . LEU B 1 341 ? -12.352 30.119  23.109  1.00 69.13 ? 367  LEU B CA  1 
ATOM   7510  C C   . LEU B 1 341 ? -12.135 31.026  24.319  1.00 69.74 ? 367  LEU B C   1 
ATOM   7511  O O   . LEU B 1 341 ? -11.677 32.163  24.182  1.00 70.28 ? 367  LEU B O   1 
ATOM   7512  C CB  . LEU B 1 341 ? -13.796 30.234  22.599  1.00 69.57 ? 367  LEU B CB  1 
ATOM   7513  C CG  . LEU B 1 341 ? -14.157 31.385  21.649  1.00 70.36 ? 367  LEU B CG  1 
ATOM   7514  C CD1 . LEU B 1 341 ? -15.550 31.147  21.075  1.00 70.28 ? 367  LEU B CD1 1 
ATOM   7515  C CD2 . LEU B 1 341 ? -14.092 32.721  22.377  1.00 70.23 ? 367  LEU B CD2 1 
ATOM   7516  N N   . VAL B 1 342 ? -12.460 30.511  25.504  1.00 69.88 ? 368  VAL B N   1 
ATOM   7517  C CA  . VAL B 1 342 ? -12.288 31.261  26.745  1.00 69.44 ? 368  VAL B CA  1 
ATOM   7518  C C   . VAL B 1 342 ? -10.810 31.331  27.126  1.00 69.45 ? 368  VAL B C   1 
ATOM   7519  O O   . VAL B 1 342 ? -10.379 30.743  28.120  1.00 69.50 ? 368  VAL B O   1 
ATOM   7520  C CB  . VAL B 1 342 ? -13.089 30.622  27.912  1.00 69.01 ? 368  VAL B CB  1 
ATOM   7521  C CG1 . VAL B 1 342 ? -14.563 30.980  27.793  1.00 68.56 ? 368  VAL B CG1 1 
ATOM   7522  C CG2 . VAL B 1 342 ? -12.917 29.111  27.893  1.00 68.80 ? 368  VAL B CG2 1 
ATOM   7523  N N   . ARG B 1 343 ? -10.042 32.054  26.316  1.00 69.39 ? 369  ARG B N   1 
ATOM   7524  C CA  . ARG B 1 343 ? -8.612  32.228  26.542  1.00 69.13 ? 369  ARG B CA  1 
ATOM   7525  C C   . ARG B 1 343 ? -8.391  33.463  27.418  1.00 68.33 ? 369  ARG B C   1 
ATOM   7526  O O   . ARG B 1 343 ? -8.935  34.535  27.137  1.00 68.41 ? 369  ARG B O   1 
ATOM   7527  C CB  . ARG B 1 343 ? -7.886  32.417  25.205  1.00 70.03 ? 369  ARG B CB  1 
ATOM   7528  C CG  . ARG B 1 343 ? -8.159  31.344  24.150  1.00 71.04 ? 369  ARG B CG  1 
ATOM   7529  C CD  . ARG B 1 343 ? -7.508  30.002  24.481  1.00 72.09 ? 369  ARG B CD  1 
ATOM   7530  N NE  . ARG B 1 343 ? -8.200  29.272  25.541  1.00 73.10 ? 369  ARG B NE  1 
ATOM   7531  C CZ  . ARG B 1 343 ? -7.825  28.075  25.987  1.00 73.35 ? 369  ARG B CZ  1 
ATOM   7532  N NH1 . ARG B 1 343 ? -6.763  27.470  25.470  1.00 72.77 ? 369  ARG B NH1 1 
ATOM   7533  N NH2 . ARG B 1 343 ? -8.516  27.476  26.948  1.00 73.07 ? 369  ARG B NH2 1 
ATOM   7534  N N   . SER B 1 344 ? -7.599  33.315  28.478  1.00 66.90 ? 370  SER B N   1 
ATOM   7535  C CA  . SER B 1 344 ? -7.317  34.436  29.372  1.00 64.95 ? 370  SER B CA  1 
ATOM   7536  C C   . SER B 1 344 ? -5.875  34.913  29.191  1.00 62.70 ? 370  SER B C   1 
ATOM   7537  O O   . SER B 1 344 ? -5.024  34.174  28.689  1.00 63.80 ? 370  SER B O   1 
ATOM   7538  C CB  . SER B 1 344 ? -7.538  34.030  30.830  1.00 65.67 ? 370  SER B CB  1 
ATOM   7539  O OG  . SER B 1 344 ? -6.306  33.726  31.463  1.00 66.15 ? 370  SER B OG  1 
ATOM   7540  N N   . PRO B 1 345 ? -5.582  36.162  29.595  1.00 59.51 ? 371  PRO B N   1 
ATOM   7541  C CA  . PRO B 1 345 ? -4.231  36.712  29.466  1.00 55.79 ? 371  PRO B CA  1 
ATOM   7542  C C   . PRO B 1 345 ? -3.250  36.101  30.461  1.00 52.07 ? 371  PRO B C   1 
ATOM   7543  O O   . PRO B 1 345 ? -3.523  36.024  31.656  1.00 52.01 ? 371  PRO B O   1 
ATOM   7544  C CB  . PRO B 1 345 ? -4.448  38.203  29.698  1.00 56.60 ? 371  PRO B CB  1 
ATOM   7545  C CG  . PRO B 1 345 ? -5.559  38.215  30.700  1.00 57.26 ? 371  PRO B CG  1 
ATOM   7546  C CD  . PRO B 1 345 ? -6.509  37.173  30.138  1.00 59.28 ? 371  PRO B CD  1 
ATOM   7547  N N   . MET B 1 346 ? -2.107  35.666  29.946  1.00 47.76 ? 372  MET B N   1 
ATOM   7548  C CA  . MET B 1 346 ? -1.053  35.059  30.751  1.00 42.90 ? 372  MET B CA  1 
ATOM   7549  C C   . MET B 1 346 ? -0.490  36.061  31.763  1.00 38.71 ? 372  MET B C   1 
ATOM   7550  O O   . MET B 1 346 ? -0.569  37.271  31.567  1.00 37.86 ? 372  MET B O   1 
ATOM   7551  C CB  . MET B 1 346 ? 0.063   34.584  29.827  1.00 44.35 ? 372  MET B CB  1 
ATOM   7552  C CG  . MET B 1 346 ? 1.308   34.140  30.533  1.00 46.29 ? 372  MET B CG  1 
ATOM   7553  S SD  . MET B 1 346 ? 1.278   32.423  30.992  1.00 45.95 ? 372  MET B SD  1 
ATOM   7554  C CE  . MET B 1 346 ? 3.083   32.167  31.251  1.00 50.09 ? 372  MET B CE  1 
ATOM   7555  N N   . VAL B 1 347 ? 0.071   35.552  32.851  1.00 33.08 ? 373  VAL B N   1 
ATOM   7556  C CA  . VAL B 1 347 ? 0.648   36.405  33.876  1.00 27.22 ? 373  VAL B CA  1 
ATOM   7557  C C   . VAL B 1 347 ? 1.956   35.769  34.325  1.00 23.16 ? 373  VAL B C   1 
ATOM   7558  O O   . VAL B 1 347 ? 2.229   34.612  34.015  1.00 22.47 ? 373  VAL B O   1 
ATOM   7559  C CB  . VAL B 1 347 ? -0.302  36.538  35.092  1.00 28.16 ? 373  VAL B CB  1 
ATOM   7560  C CG1 . VAL B 1 347 ? -1.639  37.128  34.655  1.00 27.59 ? 373  VAL B CG1 1 
ATOM   7561  C CG2 . VAL B 1 347 ? -0.519  35.182  35.734  1.00 28.54 ? 373  VAL B CG2 1 
ATOM   7562  N N   . PRO B 1 348 ? 2.800   36.527  35.038  1.00 19.73 ? 374  PRO B N   1 
ATOM   7563  C CA  . PRO B 1 348 ? 4.069   35.972  35.506  1.00 17.29 ? 374  PRO B CA  1 
ATOM   7564  C C   . PRO B 1 348 ? 3.819   34.714  36.343  1.00 15.06 ? 374  PRO B C   1 
ATOM   7565  O O   . PRO B 1 348 ? 2.920   34.693  37.178  1.00 14.37 ? 374  PRO B O   1 
ATOM   7566  C CB  . PRO B 1 348 ? 4.657   37.114  36.332  1.00 17.53 ? 374  PRO B CB  1 
ATOM   7567  C CG  . PRO B 1 348 ? 4.162   38.333  35.585  1.00 19.26 ? 374  PRO B CG  1 
ATOM   7568  C CD  . PRO B 1 348 ? 2.718   37.972  35.323  1.00 18.83 ? 374  PRO B CD  1 
ATOM   7569  N N   . LEU B 1 349 ? 4.605   33.670  36.107  1.00 13.91 ? 375  LEU B N   1 
ATOM   7570  C CA  . LEU B 1 349 ? 4.455   32.425  36.851  1.00 15.50 ? 375  LEU B CA  1 
ATOM   7571  C C   . LEU B 1 349 ? 5.774   31.973  37.455  1.00 12.57 ? 375  LEU B C   1 
ATOM   7572  O O   . LEU B 1 349 ? 6.838   32.132  36.860  1.00 12.45 ? 375  LEU B O   1 
ATOM   7573  C CB  . LEU B 1 349 ? 3.899   31.310  35.951  1.00 13.32 ? 375  LEU B CB  1 
ATOM   7574  C CG  . LEU B 1 349 ? 2.509   31.540  35.351  1.00 15.73 ? 375  LEU B CG  1 
ATOM   7575  C CD1 . LEU B 1 349 ? 2.235   30.518  34.252  1.00 12.73 ? 375  LEU B CD1 1 
ATOM   7576  C CD2 . LEU B 1 349 ? 1.457   31.445  36.445  1.00 14.15 ? 375  LEU B CD2 1 
ATOM   7577  N N   . PRO B 1 350 ? 5.713   31.393  38.653  1.00 13.25 ? 376  PRO B N   1 
ATOM   7578  C CA  . PRO B 1 350 ? 6.928   30.924  39.322  1.00 14.09 ? 376  PRO B CA  1 
ATOM   7579  C C   . PRO B 1 350 ? 7.419   29.591  38.754  1.00 13.82 ? 376  PRO B C   1 
ATOM   7580  O O   . PRO B 1 350 ? 6.739   28.955  37.949  1.00 12.21 ? 376  PRO B O   1 
ATOM   7581  C CB  . PRO B 1 350 ? 6.482   30.804  40.771  1.00 14.73 ? 376  PRO B CB  1 
ATOM   7582  C CG  . PRO B 1 350 ? 5.050   30.339  40.618  1.00 16.87 ? 376  PRO B CG  1 
ATOM   7583  C CD  . PRO B 1 350 ? 4.525   31.214  39.510  1.00 13.11 ? 376  PRO B CD  1 
ATOM   7584  N N   . MET B 1 351 ? 8.603   29.185  39.180  1.00 14.15 ? 377  MET B N   1 
ATOM   7585  C CA  . MET B 1 351 ? 9.175   27.928  38.745  1.00 15.80 ? 377  MET B CA  1 
ATOM   7586  C C   . MET B 1 351 ? 8.670   26.796  39.631  1.00 16.60 ? 377  MET B C   1 
ATOM   7587  O O   . MET B 1 351 ? 8.934   26.775  40.830  1.00 19.96 ? 377  MET B O   1 
ATOM   7588  C CB  . MET B 1 351 ? 10.698  27.997  38.811  1.00 16.98 ? 377  MET B CB  1 
ATOM   7589  C CG  . MET B 1 351 ? 11.394  26.672  38.537  1.00 19.42 ? 377  MET B CG  1 
ATOM   7590  S SD  . MET B 1 351 ? 11.000  25.968  36.913  1.00 18.12 ? 377  MET B SD  1 
ATOM   7591  C CE  . MET B 1 351 ? 12.226  26.758  35.863  1.00 22.43 ? 377  MET B CE  1 
ATOM   7592  N N   . PRO B 1 352 ? 7.918   25.845  39.051  1.00 15.61 ? 378  PRO B N   1 
ATOM   7593  C CA  . PRO B 1 352 ? 7.412   24.723  39.848  1.00 15.30 ? 378  PRO B CA  1 
ATOM   7594  C C   . PRO B 1 352 ? 8.559   24.126  40.655  1.00 13.98 ? 378  PRO B C   1 
ATOM   7595  O O   . PRO B 1 352 ? 9.657   23.961  40.136  1.00 13.94 ? 378  PRO B O   1 
ATOM   7596  C CB  . PRO B 1 352 ? 6.886   23.759  38.785  1.00 14.07 ? 378  PRO B CB  1 
ATOM   7597  C CG  . PRO B 1 352 ? 6.395   24.706  37.710  1.00 15.09 ? 378  PRO B CG  1 
ATOM   7598  C CD  . PRO B 1 352 ? 7.516   25.715  37.640  1.00 15.04 ? 378  PRO B CD  1 
ATOM   7599  N N   . LYS B 1 353 ? 8.305   23.808  41.918  1.00 16.06 ? 379  LYS B N   1 
ATOM   7600  C CA  . LYS B 1 353 ? 9.331   23.250  42.797  1.00 18.30 ? 379  LYS B CA  1 
ATOM   7601  C C   . LYS B 1 353 ? 9.575   21.765  42.580  1.00 17.70 ? 379  LYS B C   1 
ATOM   7602  O O   . LYS B 1 353 ? 8.641   20.969  42.650  1.00 17.07 ? 379  LYS B O   1 
ATOM   7603  C CB  . LYS B 1 353 ? 8.942   23.461  44.264  1.00 20.99 ? 379  LYS B CB  1 
ATOM   7604  C CG  . LYS B 1 353 ? 8.825   24.925  44.662  1.00 28.89 ? 379  LYS B CG  1 
ATOM   7605  C CD  . LYS B 1 353 ? 8.362   25.075  46.109  1.00 31.82 ? 379  LYS B CD  1 
ATOM   7606  C CE  . LYS B 1 353 ? 8.284   26.541  46.530  1.00 34.09 ? 379  LYS B CE  1 
ATOM   7607  N NZ  . LYS B 1 353 ? 7.809   26.649  47.940  1.00 38.31 ? 379  LYS B NZ  1 
ATOM   7608  N N   . LYS B 1 354 ? 10.826  21.393  42.312  1.00 17.16 ? 380  LYS B N   1 
ATOM   7609  C CA  . LYS B 1 354 ? 11.169  19.985  42.140  1.00 19.99 ? 380  LYS B CA  1 
ATOM   7610  C C   . LYS B 1 354 ? 11.315  19.393  43.541  1.00 20.28 ? 380  LYS B C   1 
ATOM   7611  O O   . LYS B 1 354 ? 11.976  19.979  44.397  1.00 21.91 ? 380  LYS B O   1 
ATOM   7612  C CB  . LYS B 1 354 ? 12.485  19.817  41.373  1.00 21.03 ? 380  LYS B CB  1 
ATOM   7613  C CG  . LYS B 1 354 ? 12.915  18.348  41.269  1.00 22.75 ? 380  LYS B CG  1 
ATOM   7614  C CD  . LYS B 1 354 ? 14.241  18.137  40.544  1.00 23.20 ? 380  LYS B CD  1 
ATOM   7615  C CE  . LYS B 1 354 ? 14.117  18.351  39.045  1.00 24.94 ? 380  LYS B CE  1 
ATOM   7616  N NZ  . LYS B 1 354 ? 15.361  17.953  38.325  1.00 25.00 ? 380  LYS B NZ  1 
ATOM   7617  N N   . LEU B 1 355 ? 10.685  18.246  43.772  1.00 19.02 ? 381  LEU B N   1 
ATOM   7618  C CA  . LEU B 1 355 ? 10.737  17.575  45.069  1.00 18.71 ? 381  LEU B CA  1 
ATOM   7619  C C   . LEU B 1 355 ? 11.878  16.550  45.067  1.00 19.08 ? 381  LEU B C   1 
ATOM   7620  O O   . LEU B 1 355 ? 11.699  15.423  44.606  1.00 21.13 ? 381  LEU B O   1 
ATOM   7621  C CB  . LEU B 1 355 ? 9.393   16.887  45.343  1.00 16.58 ? 381  LEU B CB  1 
ATOM   7622  C CG  . LEU B 1 355 ? 8.166   17.775  45.095  1.00 18.43 ? 381  LEU B CG  1 
ATOM   7623  C CD1 . LEU B 1 355 ? 6.881   16.985  45.320  1.00 16.75 ? 381  LEU B CD1 1 
ATOM   7624  C CD2 . LEU B 1 355 ? 8.225   19.000  46.008  1.00 17.12 ? 381  LEU B CD2 1 
ATOM   7625  N N   . ARG B 1 356 ? 13.043  16.950  45.574  1.00 19.24 ? 382  ARG B N   1 
ATOM   7626  C CA  . ARG B 1 356 ? 14.227  16.085  45.620  1.00 20.12 ? 382  ARG B CA  1 
ATOM   7627  C C   . ARG B 1 356 ? 14.118  14.981  46.658  1.00 19.78 ? 382  ARG B C   1 
ATOM   7628  O O   . ARG B 1 356 ? 13.263  15.012  47.539  1.00 19.69 ? 382  ARG B O   1 
ATOM   7629  C CB  . ARG B 1 356 ? 15.496  16.896  45.927  1.00 21.76 ? 382  ARG B CB  1 
ATOM   7630  C CG  . ARG B 1 356 ? 15.847  17.956  44.903  1.00 29.12 ? 382  ARG B CG  1 
ATOM   7631  C CD  . ARG B 1 356 ? 17.185  18.644  45.205  1.00 30.61 ? 382  ARG B CD  1 
ATOM   7632  N NE  . ARG B 1 356 ? 17.266  19.150  46.571  1.00 33.30 ? 382  ARG B NE  1 
ATOM   7633  C CZ  . ARG B 1 356 ? 17.847  18.498  47.573  1.00 35.44 ? 382  ARG B CZ  1 
ATOM   7634  N NH1 . ARG B 1 356 ? 18.404  17.311  47.360  1.00 36.45 ? 382  ARG B NH1 1 
ATOM   7635  N NH2 . ARG B 1 356 ? 17.868  19.026  48.790  1.00 35.16 ? 382  ARG B NH2 1 
ATOM   7636  N N   . PHE B 1 357 ? 15.026  14.018  46.552  1.00 19.77 ? 383  PHE B N   1 
ATOM   7637  C CA  . PHE B 1 357 ? 15.088  12.892  47.469  1.00 20.20 ? 383  PHE B CA  1 
ATOM   7638  C C   . PHE B 1 357 ? 16.547  12.568  47.767  1.00 19.54 ? 383  PHE B C   1 
ATOM   7639  O O   . PHE B 1 357 ? 17.359  12.462  46.855  1.00 19.72 ? 383  PHE B O   1 
ATOM   7640  C CB  . PHE B 1 357 ? 14.402  11.660  46.848  1.00 18.77 ? 383  PHE B CB  1 
ATOM   7641  C CG  . PHE B 1 357 ? 12.913  11.622  47.052  1.00 17.54 ? 383  PHE B CG  1 
ATOM   7642  C CD1 . PHE B 1 357 ? 12.384  11.427  48.323  1.00 16.99 ? 383  PHE B CD1 1 
ATOM   7643  C CD2 . PHE B 1 357 ? 12.038  11.791  45.981  1.00 18.39 ? 383  PHE B CD2 1 
ATOM   7644  C CE1 . PHE B 1 357 ? 11.004  11.400  48.529  1.00 18.23 ? 383  PHE B CE1 1 
ATOM   7645  C CE2 . PHE B 1 357 ? 10.650  11.766  46.178  1.00 15.51 ? 383  PHE B CE2 1 
ATOM   7646  C CZ  . PHE B 1 357 ? 10.137  11.571  47.454  1.00 16.51 ? 383  PHE B CZ  1 
ATOM   7647  N N   . ASN B 1 358 ? 16.885  12.426  49.049  1.00 21.13 ? 384  ASN B N   1 
ATOM   7648  C CA  . ASN B 1 358 ? 18.246  12.069  49.428  1.00 19.12 ? 384  ASN B CA  1 
ATOM   7649  C C   . ASN B 1 358 ? 18.294  10.540  49.462  1.00 19.87 ? 384  ASN B C   1 
ATOM   7650  O O   . ASN B 1 358 ? 17.744  9.909   50.363  1.00 19.91 ? 384  ASN B O   1 
ATOM   7651  C CB  . ASN B 1 358 ? 18.601  12.653  50.801  1.00 19.74 ? 384  ASN B CB  1 
ATOM   7652  C CG  . ASN B 1 358 ? 18.756  14.169  50.768  1.00 19.80 ? 384  ASN B CG  1 
ATOM   7653  O OD1 . ASN B 1 358 ? 19.575  14.701  50.023  1.00 21.18 ? 384  ASN B OD1 1 
ATOM   7654  N ND2 . ASN B 1 358 ? 17.965  14.865  51.573  1.00 19.19 ? 384  ASN B ND2 1 
ATOM   7655  N N   . ILE B 1 359 ? 18.935  9.947   48.465  1.00 20.35 ? 385  ILE B N   1 
ATOM   7656  C CA  . ILE B 1 359 ? 19.024  8.494   48.377  1.00 21.63 ? 385  ILE B CA  1 
ATOM   7657  C C   . ILE B 1 359 ? 20.248  7.921   49.078  1.00 22.14 ? 385  ILE B C   1 
ATOM   7658  O O   . ILE B 1 359 ? 21.380  8.179   48.675  1.00 24.92 ? 385  ILE B O   1 
ATOM   7659  C CB  . ILE B 1 359 ? 19.053  8.028   46.907  1.00 21.99 ? 385  ILE B CB  1 
ATOM   7660  C CG1 . ILE B 1 359 ? 17.842  8.593   46.153  1.00 23.20 ? 385  ILE B CG1 1 
ATOM   7661  C CG2 . ILE B 1 359 ? 19.067  6.510   46.845  1.00 23.32 ? 385  ILE B CG2 1 
ATOM   7662  C CD1 . ILE B 1 359 ? 16.495  8.222   46.749  1.00 20.08 ? 385  ILE B CD1 1 
ATOM   7663  N N   . THR B 1 360 ? 20.015  7.147   50.127  1.00 20.19 ? 386  THR B N   1 
ATOM   7664  C CA  . THR B 1 360 ? 21.093  6.513   50.872  1.00 20.11 ? 386  THR B CA  1 
ATOM   7665  C C   . THR B 1 360 ? 21.254  5.083   50.336  1.00 20.99 ? 386  THR B C   1 
ATOM   7666  O O   . THR B 1 360 ? 20.421  4.600   49.562  1.00 19.55 ? 386  THR B O   1 
ATOM   7667  C CB  . THR B 1 360 ? 20.755  6.443   52.379  1.00 19.95 ? 386  THR B CB  1 
ATOM   7668  O OG1 . THR B 1 360 ? 19.519  5.740   52.544  1.00 20.50 ? 386  THR B OG1 1 
ATOM   7669  C CG2 . THR B 1 360 ? 20.614  7.847   52.987  1.00 18.71 ? 386  THR B CG2 1 
ATOM   7670  N N   . PRO B 1 361 ? 22.341  4.394   50.718  1.00 20.86 ? 387  PRO B N   1 
ATOM   7671  C CA  . PRO B 1 361 ? 22.512  3.024   50.229  1.00 20.48 ? 387  PRO B CA  1 
ATOM   7672  C C   . PRO B 1 361 ? 21.303  2.175   50.656  1.00 20.47 ? 387  PRO B C   1 
ATOM   7673  O O   . PRO B 1 361 ? 20.870  1.282   49.928  1.00 20.43 ? 387  PRO B O   1 
ATOM   7674  C CB  . PRO B 1 361 ? 23.817  2.586   50.895  1.00 21.53 ? 387  PRO B CB  1 
ATOM   7675  C CG  . PRO B 1 361 ? 24.594  3.882   50.971  1.00 21.89 ? 387  PRO B CG  1 
ATOM   7676  C CD  . PRO B 1 361 ? 23.533  4.840   51.462  1.00 21.71 ? 387  PRO B CD  1 
ATOM   7677  N N   . GLU B 1 362 ? 20.748  2.479   51.822  1.00 19.64 ? 388  GLU B N   1 
ATOM   7678  C CA  . GLU B 1 362 ? 19.594  1.745   52.335  1.00 22.27 ? 388  GLU B CA  1 
ATOM   7679  C C   . GLU B 1 362 ? 18.355  2.008   51.475  1.00 21.07 ? 388  GLU B C   1 
ATOM   7680  O O   . GLU B 1 362 ? 17.610  1.089   51.134  1.00 20.18 ? 388  GLU B O   1 
ATOM   7681  C CB  . GLU B 1 362 ? 19.330  2.143   53.794  1.00 25.13 ? 388  GLU B CB  1 
ATOM   7682  C CG  . GLU B 1 362 ? 18.126  1.474   54.456  1.00 32.02 ? 388  GLU B CG  1 
ATOM   7683  C CD  . GLU B 1 362 ? 18.045  1.769   55.953  1.00 35.70 ? 388  GLU B CD  1 
ATOM   7684  O OE1 . GLU B 1 362 ? 18.217  2.943   56.348  1.00 38.27 ? 388  GLU B OE1 1 
ATOM   7685  O OE2 . GLU B 1 362 ? 17.789  0.830   56.734  1.00 36.22 ? 388  GLU B OE2 1 
ATOM   7686  N N   . ILE B 1 363 ? 18.140  3.267   51.108  1.00 19.68 ? 389  ILE B N   1 
ATOM   7687  C CA  . ILE B 1 363 ? 16.991  3.604   50.282  1.00 17.30 ? 389  ILE B CA  1 
ATOM   7688  C C   . ILE B 1 363 ? 17.157  3.001   48.893  1.00 16.80 ? 389  ILE B C   1 
ATOM   7689  O O   . ILE B 1 363 ? 16.204  2.497   48.307  1.00 17.46 ? 389  ILE B O   1 
ATOM   7690  C CB  . ILE B 1 363 ? 16.827  5.125   50.165  1.00 16.69 ? 389  ILE B CB  1 
ATOM   7691  C CG1 . ILE B 1 363 ? 16.465  5.709   51.538  1.00 17.06 ? 389  ILE B CG1 1 
ATOM   7692  C CG2 . ILE B 1 363 ? 15.761  5.445   49.132  1.00 14.38 ? 389  ILE B CG2 1 
ATOM   7693  C CD1 . ILE B 1 363 ? 16.523  7.230   51.616  1.00 15.30 ? 389  ILE B CD1 1 
ATOM   7694  N N   . LYS B 1 364 ? 18.378  3.056   48.380  1.00 16.40 ? 390  LYS B N   1 
ATOM   7695  C CA  . LYS B 1 364 ? 18.690  2.507   47.068  1.00 15.89 ? 390  LYS B CA  1 
ATOM   7696  C C   . LYS B 1 364 ? 18.361  1.016   47.039  1.00 16.99 ? 390  LYS B C   1 
ATOM   7697  O O   . LYS B 1 364 ? 17.798  0.508   46.067  1.00 16.22 ? 390  LYS B O   1 
ATOM   7698  C CB  . LYS B 1 364 ? 20.170  2.722   46.762  1.00 17.93 ? 390  LYS B CB  1 
ATOM   7699  C CG  . LYS B 1 364 ? 20.675  2.016   45.515  1.00 19.86 ? 390  LYS B CG  1 
ATOM   7700  C CD  . LYS B 1 364 ? 19.880  2.400   44.275  1.00 23.02 ? 390  LYS B CD  1 
ATOM   7701  C CE  . LYS B 1 364 ? 20.440  1.700   43.042  1.00 24.40 ? 390  LYS B CE  1 
ATOM   7702  N NZ  . LYS B 1 364 ? 19.546  1.817   41.854  1.00 24.38 ? 390  LYS B NZ  1 
ATOM   7703  N N   . ASN B 1 365 ? 18.717  0.316   48.111  1.00 15.93 ? 391  ASN B N   1 
ATOM   7704  C CA  . ASN B 1 365 ? 18.442  -1.113  48.198  1.00 16.17 ? 391  ASN B CA  1 
ATOM   7705  C C   . ASN B 1 365 ? 16.944  -1.375  48.181  1.00 15.83 ? 391  ASN B C   1 
ATOM   7706  O O   . ASN B 1 365 ? 16.492  -2.320  47.539  1.00 14.44 ? 391  ASN B O   1 
ATOM   7707  C CB  . ASN B 1 365 ? 19.038  -1.708  49.477  1.00 17.77 ? 391  ASN B CB  1 
ATOM   7708  C CG  . ASN B 1 365 ? 18.707  -3.186  49.637  1.00 20.42 ? 391  ASN B CG  1 
ATOM   7709  O OD1 . ASN B 1 365 ? 19.121  -4.018  48.829  1.00 22.57 ? 391  ASN B OD1 1 
ATOM   7710  N ND2 . ASN B 1 365 ? 17.944  -3.515  50.674  1.00 21.44 ? 391  ASN B ND2 1 
ATOM   7711  N N   . ASP B 1 366 ? 16.179  -0.546  48.893  1.00 14.78 ? 392  ASP B N   1 
ATOM   7712  C CA  . ASP B 1 366 ? 14.729  -0.711  48.953  1.00 15.31 ? 392  ASP B CA  1 
ATOM   7713  C C   . ASP B 1 366 ? 14.117  -0.509  47.578  1.00 15.22 ? 392  ASP B C   1 
ATOM   7714  O O   . ASP B 1 366 ? 13.175  -1.207  47.193  1.00 14.88 ? 392  ASP B O   1 
ATOM   7715  C CB  . ASP B 1 366 ? 14.094  0.282   49.938  1.00 15.61 ? 392  ASP B CB  1 
ATOM   7716  C CG  . ASP B 1 366 ? 14.387  -0.056  51.392  1.00 17.46 ? 392  ASP B CG  1 
ATOM   7717  O OD1 . ASP B 1 366 ? 14.532  -1.253  51.713  1.00 17.92 ? 392  ASP B OD1 1 
ATOM   7718  O OD2 . ASP B 1 366 ? 14.448  0.879   52.221  1.00 16.05 ? 392  ASP B OD2 1 
ATOM   7719  N N   . ILE B 1 367 ? 14.657  0.456   46.839  1.00 14.50 ? 393  ILE B N   1 
ATOM   7720  C CA  . ILE B 1 367 ? 14.180  0.740   45.497  1.00 14.99 ? 393  ILE B CA  1 
ATOM   7721  C C   . ILE B 1 367 ? 14.426  -0.473  44.607  1.00 15.59 ? 393  ILE B C   1 
ATOM   7722  O O   . ILE B 1 367 ? 13.556  -0.857  43.825  1.00 16.53 ? 393  ILE B O   1 
ATOM   7723  C CB  . ILE B 1 367 ? 14.897  1.976   44.904  1.00 13.38 ? 393  ILE B CB  1 
ATOM   7724  C CG1 . ILE B 1 367 ? 14.432  3.238   45.641  1.00 11.91 ? 393  ILE B CG1 1 
ATOM   7725  C CG2 . ILE B 1 367 ? 14.613  2.096   43.413  1.00 12.19 ? 393  ILE B CG2 1 
ATOM   7726  C CD1 . ILE B 1 367 ? 15.074  4.508   45.117  1.00 12.37 ? 393  ILE B CD1 1 
ATOM   7727  N N   . GLU B 1 368 ? 15.601  -1.081  44.724  1.00 15.54 ? 394  GLU B N   1 
ATOM   7728  C CA  . GLU B 1 368 ? 15.911  -2.255  43.904  1.00 17.53 ? 394  GLU B CA  1 
ATOM   7729  C C   . GLU B 1 368 ? 15.020  -3.433  44.271  1.00 16.54 ? 394  GLU B C   1 
ATOM   7730  O O   . GLU B 1 368 ? 14.614  -4.209  43.410  1.00 15.91 ? 394  GLU B O   1 
ATOM   7731  C CB  . GLU B 1 368 ? 17.380  -2.650  44.056  1.00 19.49 ? 394  GLU B CB  1 
ATOM   7732  C CG  . GLU B 1 368 ? 18.332  -1.662  43.411  1.00 23.34 ? 394  GLU B CG  1 
ATOM   7733  C CD  . GLU B 1 368 ? 18.018  -1.448  41.946  1.00 24.36 ? 394  GLU B CD  1 
ATOM   7734  O OE1 . GLU B 1 368 ? 17.944  -0.279  41.517  1.00 23.28 ? 394  GLU B OE1 1 
ATOM   7735  O OE2 . GLU B 1 368 ? 17.844  -2.453  41.224  1.00 25.08 ? 394  GLU B OE2 1 
ATOM   7736  N N   . LYS B 1 369 ? 14.712  -3.567  45.557  1.00 16.63 ? 395  LYS B N   1 
ATOM   7737  C CA  . LYS B 1 369 ? 13.850  -4.650  46.002  1.00 17.30 ? 395  LYS B CA  1 
ATOM   7738  C C   . LYS B 1 369 ? 12.452  -4.408  45.465  1.00 15.73 ? 395  LYS B C   1 
ATOM   7739  O O   . LYS B 1 369 ? 11.758  -5.339  45.072  1.00 13.88 ? 395  LYS B O   1 
ATOM   7740  C CB  . LYS B 1 369 ? 13.822  -4.719  47.531  1.00 19.97 ? 395  LYS B CB  1 
ATOM   7741  C CG  . LYS B 1 369 ? 15.169  -5.036  48.155  1.00 24.42 ? 395  LYS B CG  1 
ATOM   7742  C CD  . LYS B 1 369 ? 15.698  -6.398  47.708  1.00 28.17 ? 395  LYS B CD  1 
ATOM   7743  C CE  . LYS B 1 369 ? 14.784  -7.542  48.154  1.00 30.68 ? 395  LYS B CE  1 
ATOM   7744  N NZ  . LYS B 1 369 ? 15.209  -8.865  47.605  1.00 32.07 ? 395  LYS B NZ  1 
ATOM   7745  N N   . ALA B 1 370 ? 12.042  -3.139  45.438  1.00 14.63 ? 396  ALA B N   1 
ATOM   7746  C CA  . ALA B 1 370 ? 10.721  -2.798  44.933  1.00 13.06 ? 396  ALA B CA  1 
ATOM   7747  C C   . ALA B 1 370 ? 10.648  -3.139  43.453  1.00 13.00 ? 396  ALA B C   1 
ATOM   7748  O O   . ALA B 1 370 ? 9.622   -3.628  42.977  1.00 13.34 ? 396  ALA B O   1 
ATOM   7749  C CB  . ALA B 1 370 ? 10.429  -1.319  45.153  1.00 13.02 ? 396  ALA B CB  1 
ATOM   7750  N N   . LYS B 1 371 ? 11.741  -2.888  42.730  1.00 12.13 ? 397  LYS B N   1 
ATOM   7751  C CA  . LYS B 1 371 ? 11.809  -3.193  41.303  1.00 13.65 ? 397  LYS B CA  1 
ATOM   7752  C C   . LYS B 1 371 ? 11.619  -4.689  41.086  1.00 14.16 ? 397  LYS B C   1 
ATOM   7753  O O   . LYS B 1 371 ? 10.830  -5.109  40.240  1.00 12.97 ? 397  LYS B O   1 
ATOM   7754  C CB  . LYS B 1 371 ? 13.165  -2.802  40.722  1.00 15.02 ? 397  LYS B CB  1 
ATOM   7755  C CG  . LYS B 1 371 ? 13.408  -1.314  40.590  1.00 16.83 ? 397  LYS B CG  1 
ATOM   7756  C CD  . LYS B 1 371 ? 14.805  -1.074  40.038  1.00 17.55 ? 397  LYS B CD  1 
ATOM   7757  C CE  . LYS B 1 371 ? 15.090  0.404   39.853  1.00 21.22 ? 397  LYS B CE  1 
ATOM   7758  N NZ  . LYS B 1 371 ? 16.493  0.623   39.396  1.00 20.63 ? 397  LYS B NZ  1 
ATOM   7759  N N   . GLN B 1 372 ? 12.371  -5.488  41.846  1.00 15.32 ? 398  GLN B N   1 
ATOM   7760  C CA  . GLN B 1 372 ? 12.305  -6.942  41.753  1.00 17.35 ? 398  GLN B CA  1 
ATOM   7761  C C   . GLN B 1 372 ? 10.905  -7.453  42.045  1.00 16.68 ? 398  GLN B C   1 
ATOM   7762  O O   . GLN B 1 372 ? 10.375  -8.304  41.332  1.00 16.27 ? 398  GLN B O   1 
ATOM   7763  C CB  . GLN B 1 372 ? 13.289  -7.568  42.745  1.00 19.33 ? 398  GLN B CB  1 
ATOM   7764  C CG  . GLN B 1 372 ? 14.750  -7.343  42.381  1.00 23.79 ? 398  GLN B CG  1 
ATOM   7765  C CD  . GLN B 1 372 ? 15.705  -7.711  43.501  1.00 28.67 ? 398  GLN B CD  1 
ATOM   7766  O OE1 . GLN B 1 372 ? 15.491  -8.688  44.222  1.00 31.36 ? 398  GLN B OE1 1 
ATOM   7767  N NE2 . GLN B 1 372 ? 16.777  -6.941  43.640  1.00 29.16 ? 398  GLN B NE2 1 
ATOM   7768  N N   . ASN B 1 373 ? 10.297  -6.935  43.103  1.00 14.69 ? 399  ASN B N   1 
ATOM   7769  C CA  . ASN B 1 373 ? 8.967   -7.371  43.466  1.00 14.84 ? 399  ASN B CA  1 
ATOM   7770  C C   . ASN B 1 373 ? 7.941   -7.066  42.381  1.00 15.15 ? 399  ASN B C   1 
ATOM   7771  O O   . ASN B 1 373 ? 7.081   -7.893  42.056  1.00 14.10 ? 399  ASN B O   1 
ATOM   7772  C CB  . ASN B 1 373 ? 8.536   -6.696  44.757  1.00 14.23 ? 399  ASN B CB  1 
ATOM   7773  C CG  . ASN B 1 373 ? 7.137   -7.068  45.152  1.00 14.12 ? 399  ASN B CG  1 
ATOM   7774  O OD1 . ASN B 1 373 ? 6.880   -8.187  45.594  1.00 15.33 ? 399  ASN B OD1 1 
ATOM   7775  N ND2 . ASN B 1 373 ? 6.208   -6.139  44.979  1.00 17.22 ? 399  ASN B ND2 1 
ATOM   7776  N N   . LEU B 1 374 ? 8.039   -5.868  41.816  1.00 13.25 ? 400  LEU B N   1 
ATOM   7777  C CA  . LEU B 1 374 ? 7.104   -5.444  40.792  1.00 13.15 ? 400  LEU B CA  1 
ATOM   7778  C C   . LEU B 1 374 ? 7.226   -6.241  39.497  1.00 13.45 ? 400  LEU B C   1 
ATOM   7779  O O   . LEU B 1 374 ? 6.215   -6.632  38.930  1.00 14.40 ? 400  LEU B O   1 
ATOM   7780  C CB  . LEU B 1 374 ? 7.280   -3.943  40.530  1.00 11.46 ? 400  LEU B CB  1 
ATOM   7781  C CG  . LEU B 1 374 ? 6.316   -3.272  39.557  1.00 13.15 ? 400  LEU B CG  1 
ATOM   7782  C CD1 . LEU B 1 374 ? 4.876   -3.533  39.969  1.00 14.00 ? 400  LEU B CD1 1 
ATOM   7783  C CD2 . LEU B 1 374 ? 6.605   -1.782  39.528  1.00 15.76 ? 400  LEU B CD2 1 
ATOM   7784  N N   . SER B 1 375 ? 8.443   -6.486  39.032  1.00 13.42 ? 401  SER B N   1 
ATOM   7785  C CA  . SER B 1 375 ? 8.623   -7.254  37.800  1.00 15.84 ? 401  SER B CA  1 
ATOM   7786  C C   . SER B 1 375 ? 7.956   -8.619  37.956  1.00 14.80 ? 401  SER B C   1 
ATOM   7787  O O   . SER B 1 375 ? 7.398   -9.152  37.000  1.00 15.26 ? 401  SER B O   1 
ATOM   7788  C CB  . SER B 1 375 ? 10.105  -7.441  37.481  1.00 15.30 ? 401  SER B CB  1 
ATOM   7789  O OG  . SER B 1 375 ? 10.711  -8.242  38.476  1.00 26.02 ? 401  SER B OG  1 
ATOM   7790  N N   . ILE B 1 376 ? 8.023   -9.188  39.153  1.00 14.20 ? 402  ILE B N   1 
ATOM   7791  C CA  . ILE B 1 376 ? 7.397   -10.481 39.421  1.00 15.59 ? 402  ILE B CA  1 
ATOM   7792  C C   . ILE B 1 376 ? 5.879   -10.340 39.284  1.00 16.39 ? 402  ILE B C   1 
ATOM   7793  O O   . ILE B 1 376 ? 5.219   -11.177 38.664  1.00 16.38 ? 402  ILE B O   1 
ATOM   7794  C CB  . ILE B 1 376 ? 7.743   -10.978 40.850  1.00 17.28 ? 402  ILE B CB  1 
ATOM   7795  C CG1 . ILE B 1 376 ? 9.228   -11.344 40.920  1.00 17.90 ? 402  ILE B CG1 1 
ATOM   7796  C CG2 . ILE B 1 376 ? 6.876   -12.177 41.231  1.00 15.81 ? 402  ILE B CG2 1 
ATOM   7797  C CD1 . ILE B 1 376 ? 9.693   -11.754 42.302  1.00 19.40 ? 402  ILE B CD1 1 
ATOM   7798  N N   . MET B 1 377 ? 5.329   -9.273  39.861  1.00 14.15 ? 403  MET B N   1 
ATOM   7799  C CA  . MET B 1 377 ? 3.897   -9.032  39.796  1.00 13.31 ? 403  MET B CA  1 
ATOM   7800  C C   . MET B 1 377 ? 3.431   -8.858  38.356  1.00 12.62 ? 403  MET B C   1 
ATOM   7801  O O   . MET B 1 377 ? 2.443   -9.454  37.933  1.00 14.44 ? 403  MET B O   1 
ATOM   7802  C CB  . MET B 1 377 ? 3.543   -7.766  40.570  1.00 12.08 ? 403  MET B CB  1 
ATOM   7803  C CG  . MET B 1 377 ? 3.746   -7.862  42.072  1.00 13.34 ? 403  MET B CG  1 
ATOM   7804  S SD  . MET B 1 377 ? 3.735   -6.219  42.830  1.00 12.77 ? 403  MET B SD  1 
ATOM   7805  C CE  . MET B 1 377 ? 2.109   -5.657  42.285  1.00 13.76 ? 403  MET B CE  1 
ATOM   7806  N N   . ILE B 1 378 ? 4.143   -8.025  37.614  1.00 12.70 ? 404  ILE B N   1 
ATOM   7807  C CA  . ILE B 1 378 ? 3.797   -7.746  36.228  1.00 13.02 ? 404  ILE B CA  1 
ATOM   7808  C C   . ILE B 1 378 ? 3.931   -8.993  35.356  1.00 14.43 ? 404  ILE B C   1 
ATOM   7809  O O   . ILE B 1 378 ? 3.081   -9.254  34.504  1.00 13.44 ? 404  ILE B O   1 
ATOM   7810  C CB  . ILE B 1 378 ? 4.685   -6.605  35.663  1.00 12.88 ? 404  ILE B CB  1 
ATOM   7811  C CG1 . ILE B 1 378 ? 4.346   -5.288  36.379  1.00 11.90 ? 404  ILE B CG1 1 
ATOM   7812  C CG2 . ILE B 1 378 ? 4.504   -6.495  34.144  1.00 10.56 ? 404  ILE B CG2 1 
ATOM   7813  C CD1 . ILE B 1 378 ? 5.312   -4.147  36.076  1.00 10.08 ? 404  ILE B CD1 1 
ATOM   7814  N N   . GLN B 1 379 ? 4.991   -9.765  35.567  1.00 15.82 ? 405  GLN B N   1 
ATOM   7815  C CA  . GLN B 1 379 ? 5.198   -10.968 34.771  1.00 17.84 ? 405  GLN B CA  1 
ATOM   7816  C C   . GLN B 1 379 ? 4.102   -11.991 35.014  1.00 16.14 ? 405  GLN B C   1 
ATOM   7817  O O   . GLN B 1 379 ? 3.819   -12.812 34.149  1.00 17.41 ? 405  GLN B O   1 
ATOM   7818  C CB  . GLN B 1 379 ? 6.562   -11.588 35.079  1.00 18.13 ? 405  GLN B CB  1 
ATOM   7819  C CG  . GLN B 1 379 ? 7.725   -10.821 34.490  1.00 26.24 ? 405  GLN B CG  1 
ATOM   7820  C CD  . GLN B 1 379 ? 9.053   -11.459 34.819  1.00 28.92 ? 405  GLN B CD  1 
ATOM   7821  O OE1 . GLN B 1 379 ? 9.256   -12.651 34.588  1.00 33.84 ? 405  GLN B OE1 1 
ATOM   7822  N NE2 . GLN B 1 379 ? 9.973   -10.667 35.353  1.00 31.99 ? 405  GLN B NE2 1 
ATOM   7823  N N   . ASP B 1 380 ? 3.478   -11.931 36.181  1.00 15.58 ? 406  ASP B N   1 
ATOM   7824  C CA  . ASP B 1 380 ? 2.412   -12.869 36.514  1.00 15.29 ? 406  ASP B CA  1 
ATOM   7825  C C   . ASP B 1 380 ? 1.020   -12.396 36.100  1.00 14.99 ? 406  ASP B C   1 
ATOM   7826  O O   . ASP B 1 380 ? 0.063   -13.166 36.130  1.00 13.43 ? 406  ASP B O   1 
ATOM   7827  C CB  . ASP B 1 380 ? 2.430   -13.158 38.022  1.00 18.08 ? 406  ASP B CB  1 
ATOM   7828  C CG  . ASP B 1 380 ? 1.669   -14.420 38.387  1.00 19.60 ? 406  ASP B CG  1 
ATOM   7829  O OD1 . ASP B 1 380 ? 1.906   -15.466 37.747  1.00 23.57 ? 406  ASP B OD1 1 
ATOM   7830  O OD2 . ASP B 1 380 ? 0.843   -14.370 39.319  1.00 20.43 ? 406  ASP B OD2 1 
ATOM   7831  N N   . LEU B 1 381 ? 0.900   -11.136 35.706  1.00 13.35 ? 407  LEU B N   1 
ATOM   7832  C CA  . LEU B 1 381 ? -0.403  -10.606 35.318  1.00 15.20 ? 407  LEU B CA  1 
ATOM   7833  C C   . LEU B 1 381 ? -0.700  -10.851 33.841  1.00 14.74 ? 407  LEU B C   1 
ATOM   7834  O O   . LEU B 1 381 ? 0.107   -10.517 32.973  1.00 14.96 ? 407  LEU B O   1 
ATOM   7835  C CB  . LEU B 1 381 ? -0.484  -9.113  35.617  1.00 14.57 ? 407  LEU B CB  1 
ATOM   7836  C CG  . LEU B 1 381 ? -1.847  -8.475  35.335  1.00 15.38 ? 407  LEU B CG  1 
ATOM   7837  C CD1 . LEU B 1 381 ? -2.886  -9.137  36.223  1.00 12.29 ? 407  LEU B CD1 1 
ATOM   7838  C CD2 . LEU B 1 381 ? -1.793  -6.973  35.590  1.00 13.01 ? 407  LEU B CD2 1 
ATOM   7839  N N   . ASP B 1 382 ? -1.865  -11.421 33.579  1.00 13.67 ? 408  ASP B N   1 
ATOM   7840  C CA  . ASP B 1 382 ? -2.312  -11.762 32.229  1.00 15.27 ? 408  ASP B CA  1 
ATOM   7841  C C   . ASP B 1 382 ? -3.526  -10.897 31.925  1.00 15.48 ? 408  ASP B C   1 
ATOM   7842  O O   . ASP B 1 382 ? -4.593  -11.075 32.511  1.00 16.69 ? 408  ASP B O   1 
ATOM   7843  C CB  . ASP B 1 382 ? -2.669  -13.250 32.205  1.00 15.40 ? 408  ASP B CB  1 
ATOM   7844  C CG  . ASP B 1 382 ? -3.254  -13.700 30.883  1.00 17.29 ? 408  ASP B CG  1 
ATOM   7845  O OD1 . ASP B 1 382 ? -3.095  -12.979 29.879  1.00 17.40 ? 408  ASP B OD1 1 
ATOM   7846  O OD2 . ASP B 1 382 ? -3.867  -14.793 30.849  1.00 14.65 ? 408  ASP B OD2 1 
ATOM   7847  N N   . ILE B 1 383 ? -3.358  -9.950  31.012  1.00 15.82 ? 409  ILE B N   1 
ATOM   7848  C CA  . ILE B 1 383 ? -4.435  -9.039  30.657  1.00 17.03 ? 409  ILE B CA  1 
ATOM   7849  C C   . ILE B 1 383 ? -4.933  -9.206  29.232  1.00 17.13 ? 409  ILE B C   1 
ATOM   7850  O O   . ILE B 1 383 ? -4.157  -9.391  28.294  1.00 16.24 ? 409  ILE B O   1 
ATOM   7851  C CB  . ILE B 1 383 ? -3.995  -7.563  30.827  1.00 19.77 ? 409  ILE B CB  1 
ATOM   7852  C CG1 . ILE B 1 383 ? -3.610  -7.285  32.280  1.00 23.38 ? 409  ILE B CG1 1 
ATOM   7853  C CG2 . ILE B 1 383 ? -5.127  -6.635  30.419  1.00 20.63 ? 409  ILE B CG2 1 
ATOM   7854  C CD1 . ILE B 1 383 ? -3.060  -5.881  32.489  1.00 25.07 ? 409  ILE B CD1 1 
ATOM   7855  N N   . MET B 1 384 ? -6.244  -9.140  29.077  1.00 16.83 ? 410  MET B N   1 
ATOM   7856  C CA  . MET B 1 384 ? -6.837  -9.232  27.756  1.00 17.05 ? 410  MET B CA  1 
ATOM   7857  C C   . MET B 1 384 ? -7.942  -8.204  27.644  1.00 15.45 ? 410  MET B C   1 
ATOM   7858  O O   . MET B 1 384 ? -8.914  -8.245  28.395  1.00 11.80 ? 410  MET B O   1 
ATOM   7859  C CB  . MET B 1 384 ? -7.405  -10.628 27.497  1.00 18.37 ? 410  MET B CB  1 
ATOM   7860  C CG  . MET B 1 384 ? -8.157  -10.750 26.170  1.00 20.34 ? 410  MET B CG  1 
ATOM   7861  S SD  . MET B 1 384 ? -7.251  -10.227 24.679  1.00 25.59 ? 410  MET B SD  1 
ATOM   7862  C CE  . MET B 1 384 ? -6.108  -11.560 24.426  1.00 27.31 ? 410  MET B CE  1 
ATOM   7863  N N   . MET B 1 385 ? -7.777  -7.266  26.714  1.00 14.91 ? 411  MET B N   1 
ATOM   7864  C CA  . MET B 1 385 ? -8.774  -6.229  26.494  1.00 14.80 ? 411  MET B CA  1 
ATOM   7865  C C   . MET B 1 385 ? -9.678  -6.682  25.348  1.00 15.72 ? 411  MET B C   1 
ATOM   7866  O O   . MET B 1 385 ? -9.200  -7.146  24.318  1.00 16.56 ? 411  MET B O   1 
ATOM   7867  C CB  . MET B 1 385 ? -8.085  -4.900  26.164  1.00 13.55 ? 411  MET B CB  1 
ATOM   7868  C CG  . MET B 1 385 ? -7.166  -4.406  27.277  1.00 13.33 ? 411  MET B CG  1 
ATOM   7869  S SD  . MET B 1 385 ? -8.023  -4.191  28.835  1.00 13.49 ? 411  MET B SD  1 
ATOM   7870  C CE  . MET B 1 385 ? -8.877  -2.664  28.514  1.00 7.91  ? 411  MET B CE  1 
ATOM   7871  N N   . LEU B 1 386 ? -10.983 -6.568  25.548  1.00 16.65 ? 412  LEU B N   1 
ATOM   7872  C CA  . LEU B 1 386 ? -11.958 -6.985  24.547  1.00 17.66 ? 412  LEU B CA  1 
ATOM   7873  C C   . LEU B 1 386 ? -12.953 -5.879  24.236  1.00 17.62 ? 412  LEU B C   1 
ATOM   7874  O O   . LEU B 1 386 ? -13.664 -5.409  25.118  1.00 18.46 ? 412  LEU B O   1 
ATOM   7875  C CB  . LEU B 1 386 ? -12.728 -8.220  25.034  1.00 17.31 ? 412  LEU B CB  1 
ATOM   7876  C CG  . LEU B 1 386 ? -14.024 -8.562  24.282  1.00 20.66 ? 412  LEU B CG  1 
ATOM   7877  C CD1 . LEU B 1 386 ? -13.681 -8.911  22.841  1.00 18.58 ? 412  LEU B CD1 1 
ATOM   7878  C CD2 . LEU B 1 386 ? -14.755 -9.721  24.968  1.00 20.43 ? 412  LEU B CD2 1 
ATOM   7879  N N   . THR B 1 387 ? -12.996 -5.476  22.974  1.00 17.19 ? 413  THR B N   1 
ATOM   7880  C CA  . THR B 1 387 ? -13.925 -4.455  22.514  1.00 15.63 ? 413  THR B CA  1 
ATOM   7881  C C   . THR B 1 387 ? -15.028 -5.224  21.823  1.00 14.47 ? 413  THR B C   1 
ATOM   7882  O O   . THR B 1 387 ? -14.853 -5.663  20.689  1.00 13.18 ? 413  THR B O   1 
ATOM   7883  C CB  . THR B 1 387 ? -13.266 -3.514  21.488  1.00 15.99 ? 413  THR B CB  1 
ATOM   7884  O OG1 . THR B 1 387 ? -12.223 -2.773  22.131  1.00 17.53 ? 413  THR B OG1 1 
ATOM   7885  C CG2 . THR B 1 387 ? -14.287 -2.551  20.898  1.00 15.31 ? 413  THR B CG2 1 
ATOM   7886  N N   . PHE B 1 388 ? -16.145 -5.415  22.522  1.00 13.33 ? 414  PHE B N   1 
ATOM   7887  C CA  . PHE B 1 388 ? -17.288 -6.135  21.977  1.00 13.49 ? 414  PHE B CA  1 
ATOM   7888  C C   . PHE B 1 388 ? -18.092 -5.179  21.090  1.00 12.95 ? 414  PHE B C   1 
ATOM   7889  O O   . PHE B 1 388 ? -18.994 -4.506  21.583  1.00 10.97 ? 414  PHE B O   1 
ATOM   7890  C CB  . PHE B 1 388 ? -18.177 -6.626  23.121  1.00 12.75 ? 414  PHE B CB  1 
ATOM   7891  C CG  . PHE B 1 388 ? -19.192 -7.655  22.706  1.00 12.72 ? 414  PHE B CG  1 
ATOM   7892  C CD1 . PHE B 1 388 ? -18.823 -8.985  22.586  1.00 10.99 ? 414  PHE B CD1 1 
ATOM   7893  C CD2 . PHE B 1 388 ? -20.513 -7.298  22.434  1.00 12.28 ? 414  PHE B CD2 1 
ATOM   7894  C CE1 . PHE B 1 388 ? -19.739 -9.952  22.207  1.00 12.01 ? 414  PHE B CE1 1 
ATOM   7895  C CE2 . PHE B 1 388 ? -21.443 -8.258  22.052  1.00 13.83 ? 414  PHE B CE2 1 
ATOM   7896  C CZ  . PHE B 1 388 ? -21.053 -9.597  21.939  1.00 13.10 ? 414  PHE B CZ  1 
ATOM   7897  N N   . HIS B 1 389 ? -17.769 -5.121  19.799  1.00 14.04 ? 415  HIS B N   1 
ATOM   7898  C CA  . HIS B 1 389 ? -18.455 -4.224  18.863  1.00 13.76 ? 415  HIS B CA  1 
ATOM   7899  C C   . HIS B 1 389 ? -19.802 -4.748  18.374  1.00 14.37 ? 415  HIS B C   1 
ATOM   7900  O O   . HIS B 1 389 ? -20.628 -3.996  17.849  1.00 14.16 ? 415  HIS B O   1 
ATOM   7901  C CB  . HIS B 1 389 ? -17.582 -3.984  17.630  1.00 15.13 ? 415  HIS B CB  1 
ATOM   7902  C CG  . HIS B 1 389 ? -17.391 -5.207  16.785  1.00 18.58 ? 415  HIS B CG  1 
ATOM   7903  N ND1 . HIS B 1 389 ? -16.474 -6.188  17.088  1.00 20.99 ? 415  HIS B ND1 1 
ATOM   7904  C CD2 . HIS B 1 389 ? -18.030 -5.624  15.664  1.00 19.57 ? 415  HIS B CD2 1 
ATOM   7905  C CE1 . HIS B 1 389 ? -16.552 -7.158  16.195  1.00 20.23 ? 415  HIS B CE1 1 
ATOM   7906  N NE2 . HIS B 1 389 ? -17.490 -6.842  15.318  1.00 19.98 ? 415  HIS B NE2 1 
ATOM   7907  N N   . HIS B 1 390 ? -20.012 -6.054  18.529  1.00 13.16 ? 416  HIS B N   1 
ATOM   7908  C CA  . HIS B 1 390 ? -21.238 -6.687  18.064  1.00 13.57 ? 416  HIS B CA  1 
ATOM   7909  C C   . HIS B 1 390 ? -22.495 -5.933  18.472  1.00 15.28 ? 416  HIS B C   1 
ATOM   7910  O O   . HIS B 1 390 ? -23.393 -5.724  17.652  1.00 15.65 ? 416  HIS B O   1 
ATOM   7911  C CB  . HIS B 1 390 ? -21.272 -8.130  18.554  1.00 14.23 ? 416  HIS B CB  1 
ATOM   7912  C CG  . HIS B 1 390 ? -20.053 -8.913  18.163  1.00 12.03 ? 416  HIS B CG  1 
ATOM   7913  N ND1 . HIS B 1 390 ? -19.760 -9.230  16.854  1.00 13.61 ? 416  HIS B ND1 1 
ATOM   7914  C CD2 . HIS B 1 390 ? -19.032 -9.398  18.907  1.00 11.65 ? 416  HIS B CD2 1 
ATOM   7915  C CE1 . HIS B 1 390 ? -18.611 -9.879  16.810  1.00 10.80 ? 416  HIS B CE1 1 
ATOM   7916  N NE2 . HIS B 1 390 ? -18.147 -9.995  18.042  1.00 10.60 ? 416  HIS B NE2 1 
ATOM   7917  N N   . PHE B 1 391 ? -22.558 -5.529  19.740  1.00 15.06 ? 417  PHE B N   1 
ATOM   7918  C CA  . PHE B 1 391 ? -23.701 -4.781  20.246  1.00 14.24 ? 417  PHE B CA  1 
ATOM   7919  C C   . PHE B 1 391 ? -23.483 -4.335  21.686  1.00 12.88 ? 417  PHE B C   1 
ATOM   7920  O O   . PHE B 1 391 ? -22.501 -4.711  22.320  1.00 13.73 ? 417  PHE B O   1 
ATOM   7921  C CB  . PHE B 1 391 ? -24.980 -5.623  20.148  1.00 15.18 ? 417  PHE B CB  1 
ATOM   7922  C CG  . PHE B 1 391 ? -24.971 -6.865  21.009  1.00 17.07 ? 417  PHE B CG  1 
ATOM   7923  C CD1 . PHE B 1 391 ? -25.288 -6.796  22.360  1.00 15.00 ? 417  PHE B CD1 1 
ATOM   7924  C CD2 . PHE B 1 391 ? -24.675 -8.105  20.456  1.00 15.86 ? 417  PHE B CD2 1 
ATOM   7925  C CE1 . PHE B 1 391 ? -25.317 -7.945  23.150  1.00 17.07 ? 417  PHE B CE1 1 
ATOM   7926  C CE2 . PHE B 1 391 ? -24.699 -9.264  21.232  1.00 16.81 ? 417  PHE B CE2 1 
ATOM   7927  C CZ  . PHE B 1 391 ? -25.022 -9.186  22.583  1.00 17.03 ? 417  PHE B CZ  1 
ATOM   7928  N N   . GLY B 1 392 ? -24.395 -3.516  22.185  1.00 13.50 ? 418  GLY B N   1 
ATOM   7929  C CA  . GLY B 1 392 ? -24.290 -3.039  23.550  1.00 12.79 ? 418  GLY B CA  1 
ATOM   7930  C C   . GLY B 1 392 ? -25.607 -3.199  24.276  1.00 14.05 ? 418  GLY B C   1 
ATOM   7931  O O   . GLY B 1 392 ? -26.235 -4.262  24.219  1.00 12.83 ? 418  GLY B O   1 
ATOM   7932  N N   . LYS B 1 393 ? -26.029 -2.134  24.957  1.00 12.92 ? 419  LYS B N   1 
ATOM   7933  C CA  . LYS B 1 393 ? -27.279 -2.135  25.697  1.00 14.47 ? 419  LYS B CA  1 
ATOM   7934  C C   . LYS B 1 393 ? -28.477 -2.201  24.755  1.00 14.83 ? 419  LYS B C   1 
ATOM   7935  O O   . LYS B 1 393 ? -29.574 -2.572  25.157  1.00 15.53 ? 419  LYS B O   1 
ATOM   7936  C CB  . LYS B 1 393 ? -27.372 -0.871  26.564  1.00 14.08 ? 419  LYS B CB  1 
ATOM   7937  C CG  . LYS B 1 393 ? -26.259 -0.753  27.597  1.00 15.55 ? 419  LYS B CG  1 
ATOM   7938  C CD  . LYS B 1 393 ? -26.446 0.455   28.508  1.00 18.00 ? 419  LYS B CD  1 
ATOM   7939  C CE  . LYS B 1 393 ? -26.393 1.763   27.731  1.00 18.75 ? 419  LYS B CE  1 
ATOM   7940  N NZ  . LYS B 1 393 ? -26.503 2.941   28.637  1.00 20.92 ? 419  LYS B NZ  1 
ATOM   7941  N N   . ASP B 1 394 ? -28.267 -1.845  23.491  1.00 15.13 ? 420  ASP B N   1 
ATOM   7942  C CA  . ASP B 1 394 ? -29.364 -1.861  22.540  1.00 15.79 ? 420  ASP B CA  1 
ATOM   7943  C C   . ASP B 1 394 ? -30.103 -3.197  22.430  1.00 15.31 ? 420  ASP B C   1 
ATOM   7944  O O   . ASP B 1 394 ? -31.333 -3.237  22.566  1.00 15.77 ? 420  ASP B O   1 
ATOM   7945  C CB  . ASP B 1 394 ? -28.883 -1.416  21.149  1.00 16.63 ? 420  ASP B CB  1 
ATOM   7946  C CG  . ASP B 1 394 ? -27.608 -2.113  20.709  1.00 17.53 ? 420  ASP B CG  1 
ATOM   7947  O OD1 . ASP B 1 394 ? -27.246 -3.161  21.285  1.00 17.58 ? 420  ASP B OD1 1 
ATOM   7948  O OD2 . ASP B 1 394 ? -26.968 -1.598  19.769  1.00 16.99 ? 420  ASP B OD2 1 
ATOM   7949  N N   . PHE B 1 395 ? -29.376 -4.289  22.200  1.00 14.16 ? 421  PHE B N   1 
ATOM   7950  C CA  . PHE B 1 395 ? -30.031 -5.581  22.045  1.00 13.40 ? 421  PHE B CA  1 
ATOM   7951  C C   . PHE B 1 395 ? -30.771 -6.056  23.291  1.00 13.32 ? 421  PHE B C   1 
ATOM   7952  O O   . PHE B 1 395 ? -31.951 -6.388  23.237  1.00 13.61 ? 421  PHE B O   1 
ATOM   7953  C CB  . PHE B 1 395 ? -29.039 -6.659  21.606  1.00 13.19 ? 421  PHE B CB  1 
ATOM   7954  C CG  . PHE B 1 395 ? -29.661 -8.011  21.471  1.00 12.86 ? 421  PHE B CG  1 
ATOM   7955  C CD1 . PHE B 1 395 ? -30.562 -8.281  20.439  1.00 12.46 ? 421  PHE B CD1 1 
ATOM   7956  C CD2 . PHE B 1 395 ? -29.449 -8.977  22.445  1.00 12.44 ? 421  PHE B CD2 1 
ATOM   7957  C CE1 . PHE B 1 395 ? -31.248 -9.492  20.388  1.00 14.19 ? 421  PHE B CE1 1 
ATOM   7958  C CE2 . PHE B 1 395 ? -30.134 -10.194 22.403  1.00 14.08 ? 421  PHE B CE2 1 
ATOM   7959  C CZ  . PHE B 1 395 ? -31.031 -10.451 21.378  1.00 12.78 ? 421  PHE B CZ  1 
ATOM   7960  N N   . PRO B 1 396 ? -30.078 -6.120  24.435  1.00 12.69 ? 422  PRO B N   1 
ATOM   7961  C CA  . PRO B 1 396 ? -30.745 -6.561  25.656  1.00 11.17 ? 422  PRO B CA  1 
ATOM   7962  C C   . PRO B 1 396 ? -32.007 -5.733  25.898  1.00 11.49 ? 422  PRO B C   1 
ATOM   7963  O O   . PRO B 1 396 ? -33.062 -6.271  26.240  1.00 11.15 ? 422  PRO B O   1 
ATOM   7964  C CB  . PRO B 1 396 ? -29.684 -6.334  26.729  1.00 12.73 ? 422  PRO B CB  1 
ATOM   7965  C CG  . PRO B 1 396 ? -28.400 -6.542  25.977  1.00 13.56 ? 422  PRO B CG  1 
ATOM   7966  C CD  . PRO B 1 396 ? -28.643 -5.868  24.661  1.00 12.97 ? 422  PRO B CD  1 
ATOM   7967  N N   . LYS B 1 397 ? -31.908 -4.418  25.721  1.00 12.46 ? 423  LYS B N   1 
ATOM   7968  C CA  . LYS B 1 397 ? -33.071 -3.568  25.938  1.00 14.28 ? 423  LYS B CA  1 
ATOM   7969  C C   . LYS B 1 397 ? -34.201 -3.874  24.958  1.00 14.20 ? 423  LYS B C   1 
ATOM   7970  O O   . LYS B 1 397 ? -35.371 -3.903  25.337  1.00 14.03 ? 423  LYS B O   1 
ATOM   7971  C CB  . LYS B 1 397 ? -32.683 -2.088  25.845  1.00 14.10 ? 423  LYS B CB  1 
ATOM   7972  C CG  . LYS B 1 397 ? -31.922 -1.609  27.075  1.00 16.92 ? 423  LYS B CG  1 
ATOM   7973  C CD  . LYS B 1 397 ? -31.778 -0.097  27.112  1.00 18.94 ? 423  LYS B CD  1 
ATOM   7974  C CE  . LYS B 1 397 ? -30.829 0.398   26.045  1.00 19.29 ? 423  LYS B CE  1 
ATOM   7975  N NZ  . LYS B 1 397 ? -30.618 1.860   26.185  1.00 23.04 ? 423  LYS B NZ  1 
ATOM   7976  N N   . SER B 1 398 ? -33.850 -4.124  23.703  1.00 14.07 ? 424  SER B N   1 
ATOM   7977  C CA  . SER B 1 398 ? -34.863 -4.421  22.701  1.00 15.70 ? 424  SER B CA  1 
ATOM   7978  C C   . SER B 1 398 ? -35.604 -5.695  23.082  1.00 17.62 ? 424  SER B C   1 
ATOM   7979  O O   . SER B 1 398 ? -36.765 -5.882  22.720  1.00 19.94 ? 424  SER B O   1 
ATOM   7980  C CB  . SER B 1 398 ? -34.229 -4.559  21.309  1.00 15.35 ? 424  SER B CB  1 
ATOM   7981  O OG  . SER B 1 398 ? -33.483 -5.756  21.171  1.00 15.51 ? 424  SER B OG  1 
ATOM   7982  N N   . GLU B 1 399 ? -34.931 -6.560  23.834  1.00 17.60 ? 425  GLU B N   1 
ATOM   7983  C CA  . GLU B 1 399 ? -35.525 -7.808  24.285  1.00 18.42 ? 425  GLU B CA  1 
ATOM   7984  C C   . GLU B 1 399 ? -36.205 -7.605  25.638  1.00 19.01 ? 425  GLU B C   1 
ATOM   7985  O O   . GLU B 1 399 ? -36.672 -8.564  26.255  1.00 17.08 ? 425  GLU B O   1 
ATOM   7986  C CB  . GLU B 1 399 ? -34.446 -8.888  24.410  1.00 20.06 ? 425  GLU B CB  1 
ATOM   7987  C CG  . GLU B 1 399 ? -33.916 -9.442  23.096  1.00 22.04 ? 425  GLU B CG  1 
ATOM   7988  C CD  . GLU B 1 399 ? -34.978 -10.185 22.304  1.00 24.02 ? 425  GLU B CD  1 
ATOM   7989  O OE1 . GLU B 1 399 ? -35.786 -10.910 22.924  1.00 24.79 ? 425  GLU B OE1 1 
ATOM   7990  O OE2 . GLU B 1 399 ? -34.995 -10.056 21.063  1.00 23.47 ? 425  GLU B OE2 1 
ATOM   7991  N N   . LYS B 1 400 ? -36.260 -6.356  26.093  1.00 19.22 ? 426  LYS B N   1 
ATOM   7992  C CA  . LYS B 1 400 ? -36.867 -6.041  27.385  1.00 20.86 ? 426  LYS B CA  1 
ATOM   7993  C C   . LYS B 1 400 ? -36.078 -6.746  28.483  1.00 18.53 ? 426  LYS B C   1 
ATOM   7994  O O   . LYS B 1 400 ? -36.642 -7.211  29.477  1.00 18.44 ? 426  LYS B O   1 
ATOM   7995  C CB  . LYS B 1 400 ? -38.332 -6.496  27.430  1.00 23.60 ? 426  LYS B CB  1 
ATOM   7996  C CG  . LYS B 1 400 ? -39.241 -5.806  26.420  1.00 28.10 ? 426  LYS B CG  1 
ATOM   7997  C CD  . LYS B 1 400 ? -39.317 -4.308  26.671  1.00 32.06 ? 426  LYS B CD  1 
ATOM   7998  C CE  . LYS B 1 400 ? -40.156 -3.614  25.610  1.00 36.28 ? 426  LYS B CE  1 
ATOM   7999  N NZ  . LYS B 1 400 ? -40.197 -2.140  25.816  1.00 38.54 ? 426  LYS B NZ  1 
ATOM   8000  N N   . LEU B 1 401 ? -34.771 -6.827  28.288  1.00 16.25 ? 427  LEU B N   1 
ATOM   8001  C CA  . LEU B 1 401 ? -33.903 -7.479  29.255  1.00 15.63 ? 427  LEU B CA  1 
ATOM   8002  C C   . LEU B 1 401 ? -32.842 -6.512  29.768  1.00 15.21 ? 427  LEU B C   1 
ATOM   8003  O O   . LEU B 1 401 ? -32.359 -5.652  29.029  1.00 14.18 ? 427  LEU B O   1 
ATOM   8004  C CB  . LEU B 1 401 ? -33.218 -8.690  28.619  1.00 14.45 ? 427  LEU B CB  1 
ATOM   8005  C CG  . LEU B 1 401 ? -34.085 -9.893  28.245  1.00 15.09 ? 427  LEU B CG  1 
ATOM   8006  C CD1 . LEU B 1 401 ? -33.217 -10.904 27.513  1.00 14.29 ? 427  LEU B CD1 1 
ATOM   8007  C CD2 . LEU B 1 401 ? -34.714 -10.514 29.497  1.00 13.55 ? 427  LEU B CD2 1 
ATOM   8008  N N   . SER B 1 402 ? -32.494 -6.651  31.044  1.00 14.84 ? 428  SER B N   1 
ATOM   8009  C CA  . SER B 1 402 ? -31.464 -5.816  31.654  1.00 13.29 ? 428  SER B CA  1 
ATOM   8010  C C   . SER B 1 402 ? -30.104 -6.117  31.032  1.00 13.12 ? 428  SER B C   1 
ATOM   8011  O O   . SER B 1 402 ? -29.634 -7.256  31.072  1.00 13.83 ? 428  SER B O   1 
ATOM   8012  C CB  . SER B 1 402 ? -31.369 -6.080  33.157  1.00 13.92 ? 428  SER B CB  1 
ATOM   8013  O OG  . SER B 1 402 ? -30.179 -5.513  33.671  1.00 12.92 ? 428  SER B OG  1 
ATOM   8014  N N   . PRO B 1 403 ? -29.450 -5.097  30.457  1.00 11.23 ? 429  PRO B N   1 
ATOM   8015  C CA  . PRO B 1 403 ? -28.139 -5.254  29.831  1.00 11.03 ? 429  PRO B CA  1 
ATOM   8016  C C   . PRO B 1 403 ? -27.101 -5.825  30.804  1.00 13.04 ? 429  PRO B C   1 
ATOM   8017  O O   . PRO B 1 403 ? -26.331 -6.724  30.447  1.00 12.04 ? 429  PRO B O   1 
ATOM   8018  C CB  . PRO B 1 403 ? -27.796 -3.835  29.397  1.00 10.23 ? 429  PRO B CB  1 
ATOM   8019  C CG  . PRO B 1 403 ? -29.136 -3.246  29.092  1.00 8.64  ? 429  PRO B CG  1 
ATOM   8020  C CD  . PRO B 1 403 ? -29.966 -3.730  30.257  1.00 12.24 ? 429  PRO B CD  1 
ATOM   8021  N N   . ASP B 1 404 ? -27.070 -5.309  32.028  1.00 10.61 ? 430  ASP B N   1 
ATOM   8022  C CA  . ASP B 1 404 ? -26.090 -5.805  32.989  1.00 11.31 ? 430  ASP B CA  1 
ATOM   8023  C C   . ASP B 1 404 ? -26.343 -7.268  33.346  1.00 10.47 ? 430  ASP B C   1 
ATOM   8024  O O   . ASP B 1 404 ? -25.416 -8.076  33.370  1.00 11.99 ? 430  ASP B O   1 
ATOM   8025  C CB  . ASP B 1 404 ? -26.092 -4.945  34.261  1.00 11.69 ? 430  ASP B CB  1 
ATOM   8026  C CG  . ASP B 1 404 ? -24.997 -5.345  35.229  1.00 14.70 ? 430  ASP B CG  1 
ATOM   8027  O OD1 . ASP B 1 404 ? -23.809 -5.212  34.876  1.00 13.14 ? 430  ASP B OD1 1 
ATOM   8028  O OD2 . ASP B 1 404 ? -25.327 -5.808  36.342  1.00 14.75 ? 430  ASP B OD2 1 
ATOM   8029  N N   . ALA B 1 405 ? -27.595 -7.604  33.605  1.00 10.98 ? 431  ALA B N   1 
ATOM   8030  C CA  . ALA B 1 405 ? -27.966 -8.973  33.934  1.00 10.86 ? 431  ALA B CA  1 
ATOM   8031  C C   . ALA B 1 405 ? -27.666 -9.868  32.729  1.00 10.12 ? 431  ALA B C   1 
ATOM   8032  O O   . ALA B 1 405 ? -27.191 -10.992 32.874  1.00 10.83 ? 431  ALA B O   1 
ATOM   8033  C CB  . ALA B 1 405 ? -29.446 -9.041  34.302  1.00 7.37  ? 431  ALA B CB  1 
ATOM   8034  N N   . PHE B 1 406 ? -27.923 -9.349  31.536  1.00 12.26 ? 432  PHE B N   1 
ATOM   8035  C CA  . PHE B 1 406 ? -27.664 -10.096 30.303  1.00 11.07 ? 432  PHE B CA  1 
ATOM   8036  C C   . PHE B 1 406 ? -26.180 -10.427 30.186  1.00 11.97 ? 432  PHE B C   1 
ATOM   8037  O O   . PHE B 1 406 ? -25.802 -11.554 29.837  1.00 13.60 ? 432  PHE B O   1 
ATOM   8038  C CB  . PHE B 1 406 ? -28.117 -9.269  29.088  1.00 12.12 ? 432  PHE B CB  1 
ATOM   8039  C CG  . PHE B 1 406 ? -28.002 -9.990  27.775  1.00 11.16 ? 432  PHE B CG  1 
ATOM   8040  C CD1 . PHE B 1 406 ? -26.784 -10.065 27.104  1.00 12.69 ? 432  PHE B CD1 1 
ATOM   8041  C CD2 . PHE B 1 406 ? -29.121 -10.581 27.201  1.00 13.51 ? 432  PHE B CD2 1 
ATOM   8042  C CE1 . PHE B 1 406 ? -26.682 -10.726 25.866  1.00 13.20 ? 432  PHE B CE1 1 
ATOM   8043  C CE2 . PHE B 1 406 ? -29.030 -11.244 25.966  1.00 12.37 ? 432  PHE B CE2 1 
ATOM   8044  C CZ  . PHE B 1 406 ? -27.811 -11.313 25.305  1.00 11.83 ? 432  PHE B CZ  1 
ATOM   8045  N N   . ILE B 1 407 ? -25.340 -9.434  30.478  1.00 10.62 ? 433  ILE B N   1 
ATOM   8046  C CA  . ILE B 1 407 ? -23.894 -9.601  30.427  1.00 10.10 ? 433  ILE B CA  1 
ATOM   8047  C C   . ILE B 1 407 ? -23.432 -10.564 31.528  1.00 10.64 ? 433  ILE B C   1 
ATOM   8048  O O   . ILE B 1 407 ? -22.576 -11.415 31.288  1.00 11.67 ? 433  ILE B O   1 
ATOM   8049  C CB  . ILE B 1 407 ? -23.202 -8.236  30.592  1.00 10.52 ? 433  ILE B CB  1 
ATOM   8050  C CG1 . ILE B 1 407 ? -23.481 -7.360  29.365  1.00 12.16 ? 433  ILE B CG1 1 
ATOM   8051  C CG2 . ILE B 1 407 ? -21.709 -8.409  30.776  1.00 7.98  ? 433  ILE B CG2 1 
ATOM   8052  C CD1 . ILE B 1 407 ? -23.102 -5.917  29.574  1.00 11.62 ? 433  ILE B CD1 1 
ATOM   8053  N N   . GLN B 1 408 ? -23.994 -10.431 32.723  1.00 8.37  ? 434  GLN B N   1 
ATOM   8054  C CA  . GLN B 1 408 ? -23.632 -11.319 33.830  1.00 10.25 ? 434  GLN B CA  1 
ATOM   8055  C C   . GLN B 1 408 ? -24.039 -12.767 33.537  1.00 10.40 ? 434  GLN B C   1 
ATOM   8056  O O   . GLN B 1 408 ? -23.294 -13.694 33.836  1.00 11.24 ? 434  GLN B O   1 
ATOM   8057  C CB  . GLN B 1 408 ? -24.286 -10.851 35.130  1.00 9.82  ? 434  GLN B CB  1 
ATOM   8058  C CG  . GLN B 1 408 ? -23.632 -9.625  35.765  1.00 7.48  ? 434  GLN B CG  1 
ATOM   8059  C CD  . GLN B 1 408 ? -22.257 -9.920  36.324  1.00 10.95 ? 434  GLN B CD  1 
ATOM   8060  O OE1 . GLN B 1 408 ? -21.997 -11.013 36.840  1.00 11.18 ? 434  GLN B OE1 1 
ATOM   8061  N NE2 . GLN B 1 408 ? -21.369 -8.938  36.255  1.00 7.94  ? 434  GLN B NE2 1 
ATOM   8062  N N   . VAL B 1 409 ? -25.216 -12.970 32.954  1.00 11.36 ? 435  VAL B N   1 
ATOM   8063  C CA  . VAL B 1 409 ? -25.648 -14.329 32.625  1.00 10.92 ? 435  VAL B CA  1 
ATOM   8064  C C   . VAL B 1 409 ? -24.733 -14.886 31.530  1.00 10.06 ? 435  VAL B C   1 
ATOM   8065  O O   . VAL B 1 409 ? -24.328 -16.039 31.580  1.00 9.95  ? 435  VAL B O   1 
ATOM   8066  C CB  . VAL B 1 409 ? -27.132 -14.347 32.178  1.00 9.87  ? 435  VAL B CB  1 
ATOM   8067  C CG1 . VAL B 1 409 ? -27.500 -15.700 31.583  1.00 10.23 ? 435  VAL B CG1 1 
ATOM   8068  C CG2 . VAL B 1 409 ? -28.012 -14.075 33.379  1.00 9.83  ? 435  VAL B CG2 1 
ATOM   8069  N N   . ALA B 1 410 ? -24.379 -14.053 30.561  1.00 9.63  ? 436  ALA B N   1 
ATOM   8070  C CA  . ALA B 1 410 ? -23.486 -14.484 29.492  1.00 9.08  ? 436  ALA B CA  1 
ATOM   8071  C C   . ALA B 1 410 ? -22.141 -14.919 30.068  1.00 10.00 ? 436  ALA B C   1 
ATOM   8072  O O   . ALA B 1 410 ? -21.542 -15.894 29.609  1.00 10.25 ? 436  ALA B O   1 
ATOM   8073  C CB  . ALA B 1 410 ? -23.286 -13.367 28.491  1.00 9.16  ? 436  ALA B CB  1 
ATOM   8074  N N   . LEU B 1 411 ? -21.657 -14.192 31.078  1.00 8.98  ? 437  LEU B N   1 
ATOM   8075  C CA  . LEU B 1 411 ? -20.383 -14.541 31.697  1.00 9.31  ? 437  LEU B CA  1 
ATOM   8076  C C   . LEU B 1 411 ? -20.508 -15.894 32.392  1.00 8.12  ? 437  LEU B C   1 
ATOM   8077  O O   . LEU B 1 411 ? -19.599 -16.716 32.318  1.00 10.31 ? 437  LEU B O   1 
ATOM   8078  C CB  . LEU B 1 411 ? -19.921 -13.441 32.683  1.00 9.81  ? 437  LEU B CB  1 
ATOM   8079  C CG  . LEU B 1 411 ? -18.697 -13.813 33.544  1.00 9.82  ? 437  LEU B CG  1 
ATOM   8080  C CD1 . LEU B 1 411 ? -17.551 -14.227 32.633  1.00 11.20 ? 437  LEU B CD1 1 
ATOM   8081  C CD2 . LEU B 1 411 ? -18.274 -12.648 34.447  1.00 10.48 ? 437  LEU B CD2 1 
ATOM   8082  N N   . GLN B 1 412 ? -21.623 -16.137 33.054  1.00 7.69  ? 438  GLN B N   1 
ATOM   8083  C CA  . GLN B 1 412 ? -21.815 -17.429 33.712  1.00 8.70  ? 438  GLN B CA  1 
ATOM   8084  C C   . GLN B 1 412 ? -21.798 -18.554 32.661  1.00 9.27  ? 438  GLN B C   1 
ATOM   8085  O O   . GLN B 1 412 ? -21.246 -19.631 32.893  1.00 8.97  ? 438  GLN B O   1 
ATOM   8086  C CB  . GLN B 1 412 ? -23.147 -17.460 34.464  1.00 7.76  ? 438  GLN B CB  1 
ATOM   8087  C CG  . GLN B 1 412 ? -23.200 -16.519 35.653  1.00 11.18 ? 438  GLN B CG  1 
ATOM   8088  C CD  . GLN B 1 412 ? -22.196 -16.896 36.717  1.00 12.16 ? 438  GLN B CD  1 
ATOM   8089  O OE1 . GLN B 1 412 ? -22.280 -17.974 37.310  1.00 12.86 ? 438  GLN B OE1 1 
ATOM   8090  N NE2 . GLN B 1 412 ? -21.234 -16.016 36.959  1.00 13.30 ? 438  GLN B NE2 1 
ATOM   8091  N N   . LEU B 1 413 ? -22.391 -18.290 31.500  1.00 9.62  ? 439  LEU B N   1 
ATOM   8092  C CA  . LEU B 1 413 ? -22.438 -19.265 30.412  1.00 10.07 ? 439  LEU B CA  1 
ATOM   8093  C C   . LEU B 1 413 ? -21.030 -19.539 29.898  1.00 10.15 ? 439  LEU B C   1 
ATOM   8094  O O   . LEU B 1 413 ? -20.651 -20.691 29.664  1.00 9.70  ? 439  LEU B O   1 
ATOM   8095  C CB  . LEU B 1 413 ? -23.313 -18.739 29.267  1.00 10.36 ? 439  LEU B CB  1 
ATOM   8096  C CG  . LEU B 1 413 ? -23.369 -19.621 28.017  1.00 10.59 ? 439  LEU B CG  1 
ATOM   8097  C CD1 . LEU B 1 413 ? -23.966 -20.974 28.382  1.00 10.45 ? 439  LEU B CD1 1 
ATOM   8098  C CD2 . LEU B 1 413 ? -24.183 -18.926 26.930  1.00 12.75 ? 439  LEU B CD2 1 
ATOM   8099  N N   . ALA B 1 414 ? -20.252 -18.471 29.727  1.00 10.60 ? 440  ALA B N   1 
ATOM   8100  C CA  . ALA B 1 414 ? -18.888 -18.603 29.246  1.00 10.64 ? 440  ALA B CA  1 
ATOM   8101  C C   . ALA B 1 414 ? -18.058 -19.423 30.227  1.00 10.99 ? 440  ALA B C   1 
ATOM   8102  O O   . ALA B 1 414 ? -17.307 -20.309 29.823  1.00 10.63 ? 440  ALA B O   1 
ATOM   8103  C CB  . ALA B 1 414 ? -18.262 -17.227 29.060  1.00 10.32 ? 440  ALA B CB  1 
ATOM   8104  N N   . TYR B 1 415 ? -18.191 -19.132 31.514  1.00 9.47  ? 441  TYR B N   1 
ATOM   8105  C CA  . TYR B 1 415 ? -17.420 -19.860 32.518  1.00 12.05 ? 441  TYR B CA  1 
ATOM   8106  C C   . TYR B 1 415 ? -17.770 -21.347 32.521  1.00 10.64 ? 441  TYR B C   1 
ATOM   8107  O O   . TYR B 1 415 ? -16.888 -22.199 32.550  1.00 11.07 ? 441  TYR B O   1 
ATOM   8108  C CB  . TYR B 1 415 ? -17.655 -19.265 33.918  1.00 11.78 ? 441  TYR B CB  1 
ATOM   8109  C CG  . TYR B 1 415 ? -16.734 -19.831 34.982  1.00 14.07 ? 441  TYR B CG  1 
ATOM   8110  C CD1 . TYR B 1 415 ? -15.495 -19.248 35.255  1.00 14.27 ? 441  TYR B CD1 1 
ATOM   8111  C CD2 . TYR B 1 415 ? -17.094 -20.975 35.692  1.00 14.99 ? 441  TYR B CD2 1 
ATOM   8112  C CE1 . TYR B 1 415 ? -14.634 -19.799 36.219  1.00 15.68 ? 441  TYR B CE1 1 
ATOM   8113  C CE2 . TYR B 1 415 ? -16.243 -21.534 36.649  1.00 18.45 ? 441  TYR B CE2 1 
ATOM   8114  C CZ  . TYR B 1 415 ? -15.018 -20.945 36.907  1.00 15.94 ? 441  TYR B CZ  1 
ATOM   8115  O OH  . TYR B 1 415 ? -14.190 -21.528 37.837  1.00 17.45 ? 441  TYR B OH  1 
ATOM   8116  N N   . TYR B 1 416 ? -19.057 -21.657 32.492  1.00 12.38 ? 442  TYR B N   1 
ATOM   8117  C CA  . TYR B 1 416 ? -19.506 -23.043 32.510  1.00 13.72 ? 442  TYR B CA  1 
ATOM   8118  C C   . TYR B 1 416 ? -18.998 -23.814 31.287  1.00 12.89 ? 442  TYR B C   1 
ATOM   8119  O O   . TYR B 1 416 ? -18.566 -24.965 31.406  1.00 14.29 ? 442  TYR B O   1 
ATOM   8120  C CB  . TYR B 1 416 ? -21.032 -23.088 32.547  1.00 12.57 ? 442  TYR B CB  1 
ATOM   8121  C CG  . TYR B 1 416 ? -21.590 -24.473 32.751  1.00 15.83 ? 442  TYR B CG  1 
ATOM   8122  C CD1 . TYR B 1 416 ? -21.672 -25.038 34.026  1.00 17.01 ? 442  TYR B CD1 1 
ATOM   8123  C CD2 . TYR B 1 416 ? -21.998 -25.237 31.664  1.00 16.92 ? 442  TYR B CD2 1 
ATOM   8124  C CE1 . TYR B 1 416 ? -22.147 -26.341 34.207  1.00 18.54 ? 442  TYR B CE1 1 
ATOM   8125  C CE2 . TYR B 1 416 ? -22.465 -26.532 31.830  1.00 17.46 ? 442  TYR B CE2 1 
ATOM   8126  C CZ  . TYR B 1 416 ? -22.537 -27.082 33.093  1.00 18.79 ? 442  TYR B CZ  1 
ATOM   8127  O OH  . TYR B 1 416 ? -22.978 -28.379 33.217  1.00 19.32 ? 442  TYR B OH  1 
ATOM   8128  N N   . ARG B 1 417 ? -19.042 -23.183 30.129  1.00 12.96 ? 443  ARG B N   1 
ATOM   8129  C CA  . ARG B 1 417 ? -18.580 -23.831 28.907  1.00 12.77 ? 443  ARG B CA  1 
ATOM   8130  C C   . ARG B 1 417 ? -17.117 -24.190 28.999  1.00 13.45 ? 443  ARG B C   1 
ATOM   8131  O O   . ARG B 1 417 ? -16.668 -25.158 28.395  1.00 12.21 ? 443  ARG B O   1 
ATOM   8132  C CB  . ARG B 1 417 ? -18.827 -22.933 27.702  1.00 9.58  ? 443  ARG B CB  1 
ATOM   8133  C CG  . ARG B 1 417 ? -20.277 -22.877 27.299  1.00 9.56  ? 443  ARG B CG  1 
ATOM   8134  C CD  . ARG B 1 417 ? -20.481 -21.887 26.182  1.00 9.42  ? 443  ARG B CD  1 
ATOM   8135  N NE  . ARG B 1 417 ? -21.820 -21.979 25.614  1.00 10.86 ? 443  ARG B NE  1 
ATOM   8136  C CZ  . ARG B 1 417 ? -22.253 -21.218 24.614  1.00 11.51 ? 443  ARG B CZ  1 
ATOM   8137  N NH1 . ARG B 1 417 ? -21.449 -20.307 24.079  1.00 12.06 ? 443  ARG B NH1 1 
ATOM   8138  N NH2 . ARG B 1 417 ? -23.479 -21.380 24.135  1.00 9.91  ? 443  ARG B NH2 1 
ATOM   8139  N N   . ILE B 1 418 ? -16.366 -23.414 29.777  1.00 14.46 ? 444  ILE B N   1 
ATOM   8140  C CA  . ILE B 1 418 ? -14.948 -23.676 29.937  1.00 14.24 ? 444  ILE B CA  1 
ATOM   8141  C C   . ILE B 1 418 ? -14.618 -24.667 31.058  1.00 14.24 ? 444  ILE B C   1 
ATOM   8142  O O   . ILE B 1 418 ? -13.802 -25.573 30.876  1.00 13.18 ? 444  ILE B O   1 
ATOM   8143  C CB  . ILE B 1 418 ? -14.186 -22.372 30.225  1.00 16.83 ? 444  ILE B CB  1 
ATOM   8144  C CG1 . ILE B 1 418 ? -14.375 -21.398 29.059  1.00 18.31 ? 444  ILE B CG1 1 
ATOM   8145  C CG2 . ILE B 1 418 ? -12.721 -22.671 30.457  1.00 15.66 ? 444  ILE B CG2 1 
ATOM   8146  C CD1 . ILE B 1 418 ? -13.644 -20.087 29.234  1.00 17.63 ? 444  ILE B CD1 1 
ATOM   8147  N N   . TYR B 1 419 ? -15.252 -24.499 32.213  1.00 12.54 ? 445  TYR B N   1 
ATOM   8148  C CA  . TYR B 1 419 ? -14.954 -25.365 33.350  1.00 13.35 ? 445  TYR B CA  1 
ATOM   8149  C C   . TYR B 1 419 ? -15.942 -26.468 33.674  1.00 12.29 ? 445  TYR B C   1 
ATOM   8150  O O   . TYR B 1 419 ? -15.669 -27.299 34.532  1.00 14.51 ? 445  TYR B O   1 
ATOM   8151  C CB  . TYR B 1 419 ? -14.708 -24.523 34.597  1.00 12.62 ? 445  TYR B CB  1 
ATOM   8152  C CG  . TYR B 1 419 ? -13.588 -23.530 34.405  1.00 13.11 ? 445  TYR B CG  1 
ATOM   8153  C CD1 . TYR B 1 419 ? -13.852 -22.243 33.949  1.00 11.83 ? 445  TYR B CD1 1 
ATOM   8154  C CD2 . TYR B 1 419 ? -12.260 -23.898 34.616  1.00 12.43 ? 445  TYR B CD2 1 
ATOM   8155  C CE1 . TYR B 1 419 ? -12.821 -21.344 33.700  1.00 13.47 ? 445  TYR B CE1 1 
ATOM   8156  C CE2 . TYR B 1 419 ? -11.223 -23.010 34.372  1.00 15.18 ? 445  TYR B CE2 1 
ATOM   8157  C CZ  . TYR B 1 419 ? -11.510 -21.735 33.908  1.00 13.42 ? 445  TYR B CZ  1 
ATOM   8158  O OH  . TYR B 1 419 ? -10.480 -20.875 33.605  1.00 13.06 ? 445  TYR B OH  1 
ATOM   8159  N N   . GLY B 1 420 ? -17.073 -26.482 32.997  1.00 12.48 ? 446  GLY B N   1 
ATOM   8160  C CA  . GLY B 1 420 ? -18.048 -27.536 33.232  1.00 13.75 ? 446  GLY B CA  1 
ATOM   8161  C C   . GLY B 1 420 ? -18.784 -27.436 34.551  1.00 14.62 ? 446  GLY B C   1 
ATOM   8162  O O   . GLY B 1 420 ? -19.458 -28.376 34.966  1.00 12.74 ? 446  GLY B O   1 
ATOM   8163  N N   . GLN B 1 421 ? -18.673 -26.289 35.218  1.00 14.46 ? 447  GLN B N   1 
ATOM   8164  C CA  . GLN B 1 421 ? -19.362 -26.087 36.484  1.00 15.22 ? 447  GLN B CA  1 
ATOM   8165  C C   . GLN B 1 421 ? -19.385 -24.607 36.823  1.00 13.53 ? 447  GLN B C   1 
ATOM   8166  O O   . GLN B 1 421 ? -18.605 -23.841 36.278  1.00 13.94 ? 447  GLN B O   1 
ATOM   8167  C CB  . GLN B 1 421 ? -18.672 -26.887 37.597  1.00 17.34 ? 447  GLN B CB  1 
ATOM   8168  C CG  . GLN B 1 421 ? -17.271 -26.407 37.963  1.00 18.32 ? 447  GLN B CG  1 
ATOM   8169  C CD  . GLN B 1 421 ? -16.600 -27.317 38.982  1.00 22.14 ? 447  GLN B CD  1 
ATOM   8170  O OE1 . GLN B 1 421 ? -16.165 -28.425 38.656  1.00 24.68 ? 447  GLN B OE1 1 
ATOM   8171  N NE2 . GLN B 1 421 ? -16.534 -26.865 40.229  1.00 19.33 ? 447  GLN B NE2 1 
ATOM   8172  N N   . ALA B 1 422 ? -20.273 -24.210 37.723  1.00 12.30 ? 448  ALA B N   1 
ATOM   8173  C CA  . ALA B 1 422 ? -20.370 -22.804 38.122  1.00 12.78 ? 448  ALA B CA  1 
ATOM   8174  C C   . ALA B 1 422 ? -19.345 -22.473 39.195  1.00 13.48 ? 448  ALA B C   1 
ATOM   8175  O O   . ALA B 1 422 ? -18.743 -23.371 39.778  1.00 16.48 ? 448  ALA B O   1 
ATOM   8176  C CB  . ALA B 1 422 ? -21.761 -22.495 38.645  1.00 9.98  ? 448  ALA B CB  1 
ATOM   8177  N N   . CYS B 1 423 ? -19.150 -21.185 39.465  1.00 13.69 ? 449  CYS B N   1 
ATOM   8178  C CA  . CYS B 1 423 ? -18.193 -20.768 40.485  1.00 13.65 ? 449  CYS B CA  1 
ATOM   8179  C C   . CYS B 1 423 ? -18.704 -19.541 41.226  1.00 11.80 ? 449  CYS B C   1 
ATOM   8180  O O   . CYS B 1 423 ? -19.514 -18.786 40.692  1.00 12.62 ? 449  CYS B O   1 
ATOM   8181  C CB  . CYS B 1 423 ? -16.845 -20.442 39.837  1.00 12.52 ? 449  CYS B CB  1 
ATOM   8182  S SG  . CYS B 1 423 ? -16.845 -19.019 38.719  1.00 14.22 ? 449  CYS B SG  1 
ATOM   8183  N N   . ALA B 1 424 ? -18.253 -19.361 42.466  1.00 10.90 ? 450  ALA B N   1 
ATOM   8184  C CA  . ALA B 1 424 ? -18.631 -18.191 43.262  1.00 9.99  ? 450  ALA B CA  1 
ATOM   8185  C C   . ALA B 1 424 ? -18.288 -16.993 42.383  1.00 9.24  ? 450  ALA B C   1 
ATOM   8186  O O   . ALA B 1 424 ? -17.151 -16.855 41.934  1.00 8.84  ? 450  ALA B O   1 
ATOM   8187  C CB  . ALA B 1 424 ? -17.811 -18.145 44.554  1.00 8.68  ? 450  ALA B CB  1 
ATOM   8188  N N   . THR B 1 425 ? -19.284 -16.156 42.107  1.00 9.06  ? 451  THR B N   1 
ATOM   8189  C CA  . THR B 1 425 ? -19.108 -14.978 41.268  1.00 9.82  ? 451  THR B CA  1 
ATOM   8190  C C   . THR B 1 425 ? -19.540 -13.749 42.047  1.00 9.87  ? 451  THR B C   1 
ATOM   8191  O O   . THR B 1 425 ? -20.600 -13.735 42.677  1.00 9.02  ? 451  THR B O   1 
ATOM   8192  C CB  . THR B 1 425 ? -19.964 -15.069 39.992  1.00 8.34  ? 451  THR B CB  1 
ATOM   8193  O OG1 . THR B 1 425 ? -19.520 -16.183 39.206  1.00 11.92 ? 451  THR B OG1 1 
ATOM   8194  C CG2 . THR B 1 425 ? -19.858 -13.780 39.173  1.00 7.57  ? 451  THR B CG2 1 
ATOM   8195  N N   . TYR B 1 426 ? -18.711 -12.720 41.961  1.00 9.72  ? 452  TYR B N   1 
ATOM   8196  C CA  . TYR B 1 426 ? -18.919 -11.451 42.650  1.00 9.15  ? 452  TYR B CA  1 
ATOM   8197  C C   . TYR B 1 426 ? -19.173 -10.333 41.655  1.00 8.84  ? 452  TYR B C   1 
ATOM   8198  O O   . TYR B 1 426 ? -18.469 -10.220 40.656  1.00 9.60  ? 452  TYR B O   1 
ATOM   8199  C CB  . TYR B 1 426 ? -17.653 -11.110 43.452  1.00 10.61 ? 452  TYR B CB  1 
ATOM   8200  C CG  . TYR B 1 426 ? -17.693 -9.796  44.225  1.00 11.28 ? 452  TYR B CG  1 
ATOM   8201  C CD1 . TYR B 1 426 ? -17.830 -9.786  45.614  1.00 12.48 ? 452  TYR B CD1 1 
ATOM   8202  C CD2 . TYR B 1 426 ? -17.587 -8.568  43.572  1.00 9.86  ? 452  TYR B CD2 1 
ATOM   8203  C CE1 . TYR B 1 426 ? -17.857 -8.589  46.335  1.00 13.21 ? 452  TYR B CE1 1 
ATOM   8204  C CE2 . TYR B 1 426 ? -17.618 -7.353  44.291  1.00 12.37 ? 452  TYR B CE2 1 
ATOM   8205  C CZ  . TYR B 1 426 ? -17.753 -7.375  45.671  1.00 13.64 ? 452  TYR B CZ  1 
ATOM   8206  O OH  . TYR B 1 426 ? -17.760 -6.197  46.388  1.00 12.83 ? 452  TYR B OH  1 
ATOM   8207  N N   . GLU B 1 427 ? -20.188 -9.513  41.931  1.00 8.13  ? 453  GLU B N   1 
ATOM   8208  C CA  . GLU B 1 427 ? -20.486 -8.348  41.105  1.00 9.43  ? 453  GLU B CA  1 
ATOM   8209  C C   . GLU B 1 427 ? -20.749 -7.170  42.056  1.00 9.29  ? 453  GLU B C   1 
ATOM   8210  O O   . GLU B 1 427 ? -21.614 -7.260  42.926  1.00 8.70  ? 453  GLU B O   1 
ATOM   8211  C CB  . GLU B 1 427 ? -21.710 -8.551  40.203  1.00 7.33  ? 453  GLU B CB  1 
ATOM   8212  C CG  . GLU B 1 427 ? -22.203 -7.210  39.655  1.00 7.91  ? 453  GLU B CG  1 
ATOM   8213  C CD  . GLU B 1 427 ? -23.273 -7.290  38.573  1.00 11.38 ? 453  GLU B CD  1 
ATOM   8214  O OE1 . GLU B 1 427 ? -24.178 -8.146  38.646  1.00 12.14 ? 453  GLU B OE1 1 
ATOM   8215  O OE2 . GLU B 1 427 ? -23.214 -6.449  37.657  1.00 14.83 ? 453  GLU B OE2 1 
ATOM   8216  N N   . SER B 1 428 ? -20.020 -6.080  41.886  1.00 11.01 ? 454  SER B N   1 
ATOM   8217  C CA  . SER B 1 428 ? -20.191 -4.905  42.741  1.00 12.51 ? 454  SER B CA  1 
ATOM   8218  C C   . SER B 1 428 ? -21.575 -4.291  42.610  1.00 12.75 ? 454  SER B C   1 
ATOM   8219  O O   . SER B 1 428 ? -22.081 -4.105  41.506  1.00 14.25 ? 454  SER B O   1 
ATOM   8220  C CB  . SER B 1 428 ? -19.156 -3.839  42.394  1.00 10.78 ? 454  SER B CB  1 
ATOM   8221  O OG  . SER B 1 428 ? -17.862 -4.396  42.413  1.00 13.56 ? 454  SER B OG  1 
ATOM   8222  N N   . ALA B 1 429 ? -22.172 -3.985  43.752  1.00 12.90 ? 455  ALA B N   1 
ATOM   8223  C CA  . ALA B 1 429 ? -23.483 -3.358  43.821  1.00 10.74 ? 455  ALA B CA  1 
ATOM   8224  C C   . ALA B 1 429 ? -23.304 -2.133  44.700  1.00 13.04 ? 455  ALA B C   1 
ATOM   8225  O O   . ALA B 1 429 ? -22.757 -2.228  45.798  1.00 11.48 ? 455  ALA B O   1 
ATOM   8226  C CB  . ALA B 1 429 ? -24.493 -4.301  44.440  1.00 11.87 ? 455  ALA B CB  1 
ATOM   8227  N N   . SER B 1 430 ? -23.752 -0.985  44.213  1.00 14.18 ? 456  SER B N   1 
ATOM   8228  C CA  . SER B 1 430 ? -23.624 0.255   44.969  1.00 15.08 ? 456  SER B CA  1 
ATOM   8229  C C   . SER B 1 430 ? -24.678 0.389   46.067  1.00 14.25 ? 456  SER B C   1 
ATOM   8230  O O   . SER B 1 430 ? -25.863 0.130   45.839  1.00 13.47 ? 456  SER B O   1 
ATOM   8231  C CB  . SER B 1 430 ? -23.746 1.459   44.039  1.00 15.45 ? 456  SER B CB  1 
ATOM   8232  O OG  . SER B 1 430 ? -23.708 2.664   44.785  1.00 16.72 ? 456  SER B OG  1 
ATOM   8233  N N   . LEU B 1 431 ? -24.245 0.789   47.258  1.00 13.70 ? 457  LEU B N   1 
ATOM   8234  C CA  . LEU B 1 431 ? -25.163 0.991   48.372  1.00 12.85 ? 457  LEU B CA  1 
ATOM   8235  C C   . LEU B 1 431 ? -25.260 2.498   48.630  1.00 14.03 ? 457  LEU B C   1 
ATOM   8236  O O   . LEU B 1 431 ? -25.607 2.930   49.731  1.00 14.31 ? 457  LEU B O   1 
ATOM   8237  C CB  . LEU B 1 431 ? -24.652 0.268   49.628  1.00 12.52 ? 457  LEU B CB  1 
ATOM   8238  C CG  . LEU B 1 431 ? -24.944 -1.230  49.764  1.00 12.91 ? 457  LEU B CG  1 
ATOM   8239  C CD1 . LEU B 1 431 ? -26.396 -1.426  50.174  1.00 10.61 ? 457  LEU B CD1 1 
ATOM   8240  C CD2 . LEU B 1 431 ? -24.638 -1.945  48.452  1.00 16.90 ? 457  LEU B CD2 1 
ATOM   8241  N N   . ARG B 1 432 ? -24.961 3.297   47.606  1.00 13.39 ? 458  ARG B N   1 
ATOM   8242  C CA  . ARG B 1 432 ? -24.999 4.749   47.750  1.00 14.32 ? 458  ARG B CA  1 
ATOM   8243  C C   . ARG B 1 432 ? -26.351 5.352   48.076  1.00 14.24 ? 458  ARG B C   1 
ATOM   8244  O O   . ARG B 1 432 ? -26.447 6.551   48.303  1.00 16.06 ? 458  ARG B O   1 
ATOM   8245  C CB  . ARG B 1 432 ? -24.429 5.442   46.510  1.00 12.25 ? 458  ARG B CB  1 
ATOM   8246  C CG  . ARG B 1 432 ? -22.919 5.400   46.415  1.00 11.94 ? 458  ARG B CG  1 
ATOM   8247  C CD  . ARG B 1 432 ? -22.473 6.100   45.162  1.00 16.05 ? 458  ARG B CD  1 
ATOM   8248  N NE  . ARG B 1 432 ? -22.829 7.512   45.186  1.00 15.49 ? 458  ARG B NE  1 
ATOM   8249  C CZ  . ARG B 1 432 ? -22.752 8.301   44.122  1.00 17.37 ? 458  ARG B CZ  1 
ATOM   8250  N NH1 . ARG B 1 432 ? -22.335 7.801   42.959  1.00 17.22 ? 458  ARG B NH1 1 
ATOM   8251  N NH2 . ARG B 1 432 ? -23.072 9.588   44.212  1.00 11.82 ? 458  ARG B NH2 1 
ATOM   8252  N N   . MET B 1 433 ? -27.414 4.558   48.094  1.00 14.76 ? 459  MET B N   1 
ATOM   8253  C CA  . MET B 1 433 ? -28.685 5.164   48.447  1.00 15.86 ? 459  MET B CA  1 
ATOM   8254  C C   . MET B 1 433 ? -28.753 5.316   49.966  1.00 14.58 ? 459  MET B C   1 
ATOM   8255  O O   . MET B 1 433 ? -29.669 5.936   50.501  1.00 13.34 ? 459  MET B O   1 
ATOM   8256  C CB  . MET B 1 433 ? -29.867 4.343   47.930  1.00 18.25 ? 459  MET B CB  1 
ATOM   8257  C CG  . MET B 1 433 ? -30.060 3.010   48.587  1.00 24.38 ? 459  MET B CG  1 
ATOM   8258  S SD  . MET B 1 433 ? -31.690 2.404   48.134  1.00 36.06 ? 459  MET B SD  1 
ATOM   8259  C CE  . MET B 1 433 ? -31.621 2.551   46.332  1.00 25.57 ? 459  MET B CE  1 
ATOM   8260  N N   . PHE B 1 434 ? -27.764 4.749   50.660  1.00 11.82 ? 460  PHE B N   1 
ATOM   8261  C CA  . PHE B 1 434 ? -27.703 4.862   52.109  1.00 12.96 ? 460  PHE B CA  1 
ATOM   8262  C C   . PHE B 1 434 ? -26.531 5.772   52.502  1.00 10.83 ? 460  PHE B C   1 
ATOM   8263  O O   . PHE B 1 434 ? -25.508 5.819   51.814  1.00 10.12 ? 460  PHE B O   1 
ATOM   8264  C CB  . PHE B 1 434 ? -27.563 3.476   52.750  1.00 12.95 ? 460  PHE B CB  1 
ATOM   8265  C CG  . PHE B 1 434 ? -28.700 2.547   52.425  1.00 13.52 ? 460  PHE B CG  1 
ATOM   8266  C CD1 . PHE B 1 434 ? -28.548 1.547   51.468  1.00 15.05 ? 460  PHE B CD1 1 
ATOM   8267  C CD2 . PHE B 1 434 ? -29.932 2.686   53.054  1.00 15.06 ? 460  PHE B CD2 1 
ATOM   8268  C CE1 . PHE B 1 434 ? -29.600 0.702   51.145  1.00 14.75 ? 460  PHE B CE1 1 
ATOM   8269  C CE2 . PHE B 1 434 ? -30.998 1.841   52.734  1.00 15.65 ? 460  PHE B CE2 1 
ATOM   8270  C CZ  . PHE B 1 434 ? -30.832 0.851   51.782  1.00 16.47 ? 460  PHE B CZ  1 
ATOM   8271  N N   . HIS B 1 435 ? -26.690 6.512   53.593  1.00 11.07 ? 461  HIS B N   1 
ATOM   8272  C CA  . HIS B 1 435 ? -25.635 7.417   54.049  1.00 10.45 ? 461  HIS B CA  1 
ATOM   8273  C C   . HIS B 1 435 ? -24.303 6.675   54.167  1.00 11.48 ? 461  HIS B C   1 
ATOM   8274  O O   . HIS B 1 435 ? -24.215 5.663   54.869  1.00 11.21 ? 461  HIS B O   1 
ATOM   8275  C CB  . HIS B 1 435 ? -26.004 8.022   55.409  1.00 13.19 ? 461  HIS B CB  1 
ATOM   8276  C CG  . HIS B 1 435 ? -24.971 8.961   55.952  1.00 16.15 ? 461  HIS B CG  1 
ATOM   8277  N ND1 . HIS B 1 435 ? -24.572 8.950   57.271  1.00 17.11 ? 461  HIS B ND1 1 
ATOM   8278  C CD2 . HIS B 1 435 ? -24.248 9.931   55.345  1.00 17.04 ? 461  HIS B CD2 1 
ATOM   8279  C CE1 . HIS B 1 435 ? -23.645 9.870   57.452  1.00 15.67 ? 461  HIS B CE1 1 
ATOM   8280  N NE2 . HIS B 1 435 ? -23.425 10.478  56.302  1.00 17.32 ? 461  HIS B NE2 1 
ATOM   8281  N N   . LEU B 1 436 ? -23.285 7.179   53.469  1.00 11.28 ? 462  LEU B N   1 
ATOM   8282  C CA  . LEU B 1 436 ? -21.933 6.607   53.470  1.00 13.39 ? 462  LEU B CA  1 
ATOM   8283  C C   . LEU B 1 436 ? -21.880 5.203   52.855  1.00 13.79 ? 462  LEU B C   1 
ATOM   8284  O O   . LEU B 1 436 ? -20.873 4.506   52.936  1.00 13.92 ? 462  LEU B O   1 
ATOM   8285  C CB  . LEU B 1 436 ? -21.347 6.601   54.907  1.00 12.98 ? 462  LEU B CB  1 
ATOM   8286  C CG  . LEU B 1 436 ? -21.280 7.955   55.652  1.00 13.34 ? 462  LEU B CG  1 
ATOM   8287  C CD1 . LEU B 1 436 ? -20.792 7.753   57.080  1.00 14.57 ? 462  LEU B CD1 1 
ATOM   8288  C CD2 . LEU B 1 436 ? -20.349 8.923   54.938  1.00 14.51 ? 462  LEU B CD2 1 
ATOM   8289  N N   . GLY B 1 437 ? -22.968 4.802   52.211  1.00 14.24 ? 463  GLY B N   1 
ATOM   8290  C CA  . GLY B 1 437 ? -22.993 3.490   51.600  1.00 12.37 ? 463  GLY B CA  1 
ATOM   8291  C C   . GLY B 1 437 ? -21.910 3.306   50.554  1.00 12.53 ? 463  GLY B C   1 
ATOM   8292  O O   . GLY B 1 437 ? -21.648 4.208   49.756  1.00 11.64 ? 463  GLY B O   1 
ATOM   8293  N N   . ARG B 1 438 ? -21.265 2.139   50.556  1.00 12.43 ? 464  ARG B N   1 
ATOM   8294  C CA  . ARG B 1 438 ? -20.233 1.842   49.567  1.00 13.66 ? 464  ARG B CA  1 
ATOM   8295  C C   . ARG B 1 438 ? -20.754 0.757   48.625  1.00 11.58 ? 464  ARG B C   1 
ATOM   8296  O O   . ARG B 1 438 ? -21.432 1.055   47.653  1.00 12.18 ? 464  ARG B O   1 
ATOM   8297  C CB  . ARG B 1 438 ? -18.942 1.369   50.247  1.00 16.77 ? 464  ARG B CB  1 
ATOM   8298  C CG  . ARG B 1 438 ? -18.311 2.400   51.157  1.00 23.60 ? 464  ARG B CG  1 
ATOM   8299  C CD  . ARG B 1 438 ? -17.740 3.548   50.356  1.00 27.78 ? 464  ARG B CD  1 
ATOM   8300  N NE  . ARG B 1 438 ? -16.472 3.189   49.731  1.00 32.60 ? 464  ARG B NE  1 
ATOM   8301  C CZ  . ARG B 1 438 ? -15.343 2.991   50.406  1.00 34.95 ? 464  ARG B CZ  1 
ATOM   8302  N NH1 . ARG B 1 438 ? -15.326 3.116   51.729  1.00 39.13 ? 464  ARG B NH1 1 
ATOM   8303  N NH2 . ARG B 1 438 ? -14.228 2.681   49.763  1.00 32.60 ? 464  ARG B NH2 1 
ATOM   8304  N N   . THR B 1 439 ? -20.459 -0.500  48.928  1.00 11.56 ? 465  THR B N   1 
ATOM   8305  C CA  . THR B 1 439 ? -20.902 -1.604  48.079  1.00 10.42 ? 465  THR B CA  1 
ATOM   8306  C C   . THR B 1 439 ? -21.360 -2.857  48.831  1.00 11.17 ? 465  THR B C   1 
ATOM   8307  O O   . THR B 1 439 ? -21.097 -3.015  50.026  1.00 10.69 ? 465  THR B O   1 
ATOM   8308  C CB  . THR B 1 439 ? -19.773 -2.058  47.130  1.00 8.70  ? 465  THR B CB  1 
ATOM   8309  O OG1 . THR B 1 439 ? -18.751 -2.717  47.895  1.00 11.35 ? 465  THR B OG1 1 
ATOM   8310  C CG2 . THR B 1 439 ? -19.150 -0.864  46.380  1.00 8.70  ? 465  THR B CG2 1 
ATOM   8311  N N   . ASP B 1 440 ? -22.075 -3.734  48.122  1.00 9.55  ? 466  ASP B N   1 
ATOM   8312  C CA  . ASP B 1 440 ? -22.500 -5.011  48.678  1.00 10.45 ? 466  ASP B CA  1 
ATOM   8313  C C   . ASP B 1 440 ? -22.299 -5.981  47.509  1.00 12.65 ? 466  ASP B C   1 
ATOM   8314  O O   . ASP B 1 440 ? -21.941 -5.566  46.392  1.00 10.42 ? 466  ASP B O   1 
ATOM   8315  C CB  . ASP B 1 440 ? -23.958 -5.030  49.157  1.00 11.67 ? 466  ASP B CB  1 
ATOM   8316  C CG  . ASP B 1 440 ? -24.219 -6.142  50.193  1.00 12.99 ? 466  ASP B CG  1 
ATOM   8317  O OD1 . ASP B 1 440 ? -23.474 -7.149  50.199  1.00 13.21 ? 466  ASP B OD1 1 
ATOM   8318  O OD2 . ASP B 1 440 ? -25.180 -6.021  50.987  1.00 14.78 ? 466  ASP B OD2 1 
ATOM   8319  N N   . THR B 1 441 ? -22.520 -7.257  47.755  1.00 11.80 ? 467  THR B N   1 
ATOM   8320  C CA  . THR B 1 441 ? -22.281 -8.250  46.730  1.00 10.86 ? 467  THR B CA  1 
ATOM   8321  C C   . THR B 1 441 ? -23.503 -8.810  46.051  1.00 11.50 ? 467  THR B C   1 
ATOM   8322  O O   . THR B 1 441 ? -24.475 -9.201  46.696  1.00 11.49 ? 467  THR B O   1 
ATOM   8323  C CB  . THR B 1 441 ? -21.478 -9.433  47.309  1.00 12.88 ? 467  THR B CB  1 
ATOM   8324  O OG1 . THR B 1 441 ? -20.292 -8.933  47.934  1.00 11.03 ? 467  THR B OG1 1 
ATOM   8325  C CG2 . THR B 1 441 ? -21.094 -10.425 46.210  1.00 12.30 ? 467  THR B CG2 1 
ATOM   8326  N N   . ILE B 1 442 ? -23.439 -8.834  44.728  1.00 12.73 ? 468  ILE B N   1 
ATOM   8327  C CA  . ILE B 1 442 ? -24.484 -9.426  43.925  1.00 11.86 ? 468  ILE B CA  1 
ATOM   8328  C C   . ILE B 1 442 ? -23.812 -10.714 43.449  1.00 11.37 ? 468  ILE B C   1 
ATOM   8329  O O   . ILE B 1 442 ? -22.753 -10.668 42.822  1.00 11.58 ? 468  ILE B O   1 
ATOM   8330  C CB  . ILE B 1 442 ? -24.845 -8.557  42.698  1.00 10.94 ? 468  ILE B CB  1 
ATOM   8331  C CG1 . ILE B 1 442 ? -25.755 -7.405  43.121  1.00 11.23 ? 468  ILE B CG1 1 
ATOM   8332  C CG2 . ILE B 1 442 ? -25.563 -9.402  41.642  1.00 10.44 ? 468  ILE B CG2 1 
ATOM   8333  C CD1 . ILE B 1 442 ? -25.978 -6.388  42.027  1.00 7.53  ? 468  ILE B CD1 1 
ATOM   8334  N N   . ARG B 1 443 ? -24.393 -11.853 43.795  1.00 10.56 ? 469  ARG B N   1 
ATOM   8335  C CA  . ARG B 1 443 ? -23.846 -13.145 43.388  1.00 12.37 ? 469  ARG B CA  1 
ATOM   8336  C C   . ARG B 1 443 ? -24.540 -13.624 42.119  1.00 11.94 ? 469  ARG B C   1 
ATOM   8337  O O   . ARG B 1 443 ? -25.701 -14.018 42.162  1.00 10.99 ? 469  ARG B O   1 
ATOM   8338  C CB  . ARG B 1 443 ? -24.020 -14.179 44.499  1.00 10.02 ? 469  ARG B CB  1 
ATOM   8339  C CG  . ARG B 1 443 ? -23.052 -14.009 45.636  1.00 10.97 ? 469  ARG B CG  1 
ATOM   8340  C CD  . ARG B 1 443 ? -23.396 -14.891 46.811  1.00 11.78 ? 469  ARG B CD  1 
ATOM   8341  N NE  . ARG B 1 443 ? -22.454 -14.656 47.897  1.00 9.55  ? 469  ARG B NE  1 
ATOM   8342  C CZ  . ARG B 1 443 ? -21.235 -15.179 47.943  1.00 10.98 ? 469  ARG B CZ  1 
ATOM   8343  N NH1 . ARG B 1 443 ? -20.811 -15.983 46.965  1.00 8.46  ? 469  ARG B NH1 1 
ATOM   8344  N NH2 . ARG B 1 443 ? -20.425 -14.888 48.954  1.00 5.74  ? 469  ARG B NH2 1 
ATOM   8345  N N   . SER B 1 444 ? -23.809 -13.601 41.005  1.00 12.72 ? 470  SER B N   1 
ATOM   8346  C CA  . SER B 1 444 ? -24.330 -13.986 39.687  1.00 14.58 ? 470  SER B CA  1 
ATOM   8347  C C   . SER B 1 444 ? -24.588 -15.479 39.506  1.00 14.78 ? 470  SER B C   1 
ATOM   8348  O O   . SER B 1 444 ? -25.423 -15.869 38.679  1.00 14.58 ? 470  SER B O   1 
ATOM   8349  C CB  . SER B 1 444 ? -23.360 -13.539 38.601  1.00 13.24 ? 470  SER B CB  1 
ATOM   8350  O OG  . SER B 1 444 ? -22.907 -12.236 38.858  1.00 15.63 ? 470  SER B OG  1 
ATOM   8351  N N   . ALA B 1 445 ? -23.848 -16.309 40.231  1.00 13.46 ? 471  ALA B N   1 
ATOM   8352  C CA  . ALA B 1 445 ? -24.041 -17.745 40.137  1.00 13.98 ? 471  ALA B CA  1 
ATOM   8353  C C   . ALA B 1 445 ? -25.219 -18.080 41.032  1.00 14.32 ? 471  ALA B C   1 
ATOM   8354  O O   . ALA B 1 445 ? -25.145 -17.951 42.259  1.00 16.36 ? 471  ALA B O   1 
ATOM   8355  C CB  . ALA B 1 445 ? -22.790 -18.486 40.583  1.00 11.39 ? 471  ALA B CB  1 
ATOM   8356  N N   . SER B 1 446 ? -26.309 -18.514 40.407  1.00 13.86 ? 472  SER B N   1 
ATOM   8357  C CA  . SER B 1 446 ? -27.527 -18.845 41.130  1.00 13.17 ? 472  SER B CA  1 
ATOM   8358  C C   . SER B 1 446 ? -28.183 -20.115 40.589  1.00 13.36 ? 472  SER B C   1 
ATOM   8359  O O   . SER B 1 446 ? -27.678 -20.737 39.655  1.00 13.16 ? 472  SER B O   1 
ATOM   8360  C CB  . SER B 1 446 ? -28.511 -17.695 40.987  1.00 12.02 ? 472  SER B CB  1 
ATOM   8361  O OG  . SER B 1 446 ? -28.906 -17.580 39.619  1.00 14.72 ? 472  SER B OG  1 
ATOM   8362  N N   . ILE B 1 447 ? -29.308 -20.490 41.184  1.00 12.85 ? 473  ILE B N   1 
ATOM   8363  C CA  . ILE B 1 447 ? -30.045 -21.676 40.754  1.00 14.77 ? 473  ILE B CA  1 
ATOM   8364  C C   . ILE B 1 447 ? -30.549 -21.493 39.326  1.00 15.05 ? 473  ILE B C   1 
ATOM   8365  O O   . ILE B 1 447 ? -30.479 -22.410 38.516  1.00 15.93 ? 473  ILE B O   1 
ATOM   8366  C CB  . ILE B 1 447 ? -31.240 -21.950 41.696  1.00 15.28 ? 473  ILE B CB  1 
ATOM   8367  C CG1 . ILE B 1 447 ? -30.722 -22.229 43.111  1.00 13.12 ? 473  ILE B CG1 1 
ATOM   8368  C CG2 . ILE B 1 447 ? -32.067 -23.126 41.173  1.00 15.09 ? 473  ILE B CG2 1 
ATOM   8369  C CD1 . ILE B 1 447 ? -31.811 -22.286 44.158  1.00 14.33 ? 473  ILE B CD1 1 
ATOM   8370  N N   . ASP B 1 448 ? -31.046 -20.304 39.017  1.00 13.74 ? 474  ASP B N   1 
ATOM   8371  C CA  . ASP B 1 448 ? -31.547 -20.028 37.677  1.00 14.05 ? 474  ASP B CA  1 
ATOM   8372  C C   . ASP B 1 448 ? -30.436 -19.899 36.635  1.00 13.37 ? 474  ASP B C   1 
ATOM   8373  O O   . ASP B 1 448 ? -30.598 -20.365 35.508  1.00 15.61 ? 474  ASP B O   1 
ATOM   8374  C CB  . ASP B 1 448 ? -32.417 -18.775 37.691  1.00 13.74 ? 474  ASP B CB  1 
ATOM   8375  C CG  . ASP B 1 448 ? -33.631 -18.935 38.574  1.00 15.98 ? 474  ASP B CG  1 
ATOM   8376  O OD1 . ASP B 1 448 ? -34.353 -19.937 38.383  1.00 18.16 ? 474  ASP B OD1 1 
ATOM   8377  O OD2 . ASP B 1 448 ? -33.862 -18.082 39.456  1.00 16.31 ? 474  ASP B OD2 1 
ATOM   8378  N N   . SER B 1 449 ? -29.303 -19.296 37.001  1.00 12.31 ? 475  SER B N   1 
ATOM   8379  C CA  . SER B 1 449 ? -28.205 -19.159 36.041  1.00 11.56 ? 475  SER B CA  1 
ATOM   8380  C C   . SER B 1 449 ? -27.633 -20.529 35.711  1.00 12.88 ? 475  SER B C   1 
ATOM   8381  O O   . SER B 1 449 ? -27.330 -20.818 34.553  1.00 11.70 ? 475  SER B O   1 
ATOM   8382  C CB  . SER B 1 449 ? -27.098 -18.210 36.563  1.00 10.29 ? 475  SER B CB  1 
ATOM   8383  O OG  . SER B 1 449 ? -26.247 -18.803 37.523  1.00 10.54 ? 475  SER B OG  1 
ATOM   8384  N N   . LEU B 1 450 ? -27.495 -21.374 36.735  1.00 11.25 ? 476  LEU B N   1 
ATOM   8385  C CA  . LEU B 1 450 ? -26.966 -22.714 36.548  1.00 11.81 ? 476  LEU B CA  1 
ATOM   8386  C C   . LEU B 1 450 ? -27.920 -23.536 35.677  1.00 11.51 ? 476  LEU B C   1 
ATOM   8387  O O   . LEU B 1 450 ? -27.490 -24.241 34.773  1.00 10.92 ? 476  LEU B O   1 
ATOM   8388  C CB  . LEU B 1 450 ? -26.766 -23.394 37.904  1.00 12.85 ? 476  LEU B CB  1 
ATOM   8389  C CG  . LEU B 1 450 ? -26.271 -24.841 37.843  1.00 13.31 ? 476  LEU B CG  1 
ATOM   8390  C CD1 . LEU B 1 450 ? -24.920 -24.880 37.147  1.00 12.07 ? 476  LEU B CD1 1 
ATOM   8391  C CD2 . LEU B 1 450 ? -26.182 -25.422 39.251  1.00 14.06 ? 476  LEU B CD2 1 
ATOM   8392  N N   . ALA B 1 451 ? -29.216 -23.436 35.937  1.00 10.79 ? 477  ALA B N   1 
ATOM   8393  C CA  . ALA B 1 451 ? -30.189 -24.179 35.140  1.00 12.46 ? 477  ALA B CA  1 
ATOM   8394  C C   . ALA B 1 451 ? -30.089 -23.725 33.670  1.00 13.05 ? 477  ALA B C   1 
ATOM   8395  O O   . ALA B 1 451 ? -30.236 -24.532 32.747  1.00 13.55 ? 477  ALA B O   1 
ATOM   8396  C CB  . ALA B 1 451 ? -31.599 -23.952 35.681  1.00 10.12 ? 477  ALA B CB  1 
ATOM   8397  N N   . PHE B 1 452 ? -29.813 -22.445 33.455  1.00 13.52 ? 478  PHE B N   1 
ATOM   8398  C CA  . PHE B 1 452 ? -29.691 -21.927 32.094  1.00 14.63 ? 478  PHE B CA  1 
ATOM   8399  C C   . PHE B 1 452 ? -28.429 -22.401 31.386  1.00 13.73 ? 478  PHE B C   1 
ATOM   8400  O O   . PHE B 1 452 ? -28.491 -22.845 30.240  1.00 13.72 ? 478  PHE B O   1 
ATOM   8401  C CB  . PHE B 1 452 ? -29.710 -20.395 32.076  1.00 13.70 ? 478  PHE B CB  1 
ATOM   8402  C CG  . PHE B 1 452 ? -29.242 -19.801 30.770  1.00 12.69 ? 478  PHE B CG  1 
ATOM   8403  C CD1 . PHE B 1 452 ? -29.908 -20.082 29.575  1.00 11.75 ? 478  PHE B CD1 1 
ATOM   8404  C CD2 . PHE B 1 452 ? -28.116 -18.987 30.731  1.00 12.86 ? 478  PHE B CD2 1 
ATOM   8405  C CE1 . PHE B 1 452 ? -29.450 -19.558 28.354  1.00 10.63 ? 478  PHE B CE1 1 
ATOM   8406  C CE2 . PHE B 1 452 ? -27.651 -18.458 29.520  1.00 14.39 ? 478  PHE B CE2 1 
ATOM   8407  C CZ  . PHE B 1 452 ? -28.321 -18.746 28.330  1.00 14.06 ? 478  PHE B CZ  1 
ATOM   8408  N N   . VAL B 1 453 ? -27.286 -22.296 32.056  1.00 12.17 ? 479  VAL B N   1 
ATOM   8409  C CA  . VAL B 1 453 ? -26.033 -22.698 31.433  1.00 12.78 ? 479  VAL B CA  1 
ATOM   8410  C C   . VAL B 1 453 ? -26.022 -24.182 31.084  1.00 14.01 ? 479  VAL B C   1 
ATOM   8411  O O   . VAL B 1 453 ? -25.415 -24.596 30.090  1.00 14.56 ? 479  VAL B O   1 
ATOM   8412  C CB  . VAL B 1 453 ? -24.816 -22.326 32.321  1.00 12.92 ? 479  VAL B CB  1 
ATOM   8413  C CG1 . VAL B 1 453 ? -24.810 -20.811 32.539  1.00 10.84 ? 479  VAL B CG1 1 
ATOM   8414  C CG2 . VAL B 1 453 ? -24.861 -23.073 33.658  1.00 12.50 ? 479  VAL B CG2 1 
ATOM   8415  N N   . LYS B 1 454 ? -26.713 -24.978 31.884  1.00 13.35 ? 480  LYS B N   1 
ATOM   8416  C CA  . LYS B 1 454 ? -26.790 -26.406 31.619  1.00 16.57 ? 480  LYS B CA  1 
ATOM   8417  C C   . LYS B 1 454 ? -27.765 -26.658 30.471  1.00 16.13 ? 480  LYS B C   1 
ATOM   8418  O O   . LYS B 1 454 ? -27.462 -27.400 29.543  1.00 17.43 ? 480  LYS B O   1 
ATOM   8419  C CB  . LYS B 1 454 ? -27.253 -27.156 32.866  1.00 17.83 ? 480  LYS B CB  1 
ATOM   8420  C CG  . LYS B 1 454 ? -26.140 -27.418 33.871  1.00 20.21 ? 480  LYS B CG  1 
ATOM   8421  C CD  . LYS B 1 454 ? -26.672 -28.171 35.084  1.00 22.68 ? 480  LYS B CD  1 
ATOM   8422  C CE  . LYS B 1 454 ? -25.548 -28.542 36.043  1.00 24.37 ? 480  LYS B CE  1 
ATOM   8423  N NZ  . LYS B 1 454 ? -26.064 -29.271 37.234  1.00 26.56 ? 480  LYS B NZ  1 
ATOM   8424  N N   . GLY B 1 455 ? -28.930 -26.023 30.539  1.00 16.19 ? 481  GLY B N   1 
ATOM   8425  C CA  . GLY B 1 455 ? -29.941 -26.195 29.509  1.00 17.96 ? 481  GLY B CA  1 
ATOM   8426  C C   . GLY B 1 455 ? -29.471 -25.706 28.155  1.00 19.56 ? 481  GLY B C   1 
ATOM   8427  O O   . GLY B 1 455 ? -29.811 -26.284 27.116  1.00 17.54 ? 481  GLY B O   1 
ATOM   8428  N N   . MET B 1 456 ? -28.684 -24.636 28.167  1.00 18.67 ? 482  MET B N   1 
ATOM   8429  C CA  . MET B 1 456 ? -28.177 -24.052 26.942  1.00 20.70 ? 482  MET B CA  1 
ATOM   8430  C C   . MET B 1 456 ? -27.473 -25.088 26.064  1.00 23.28 ? 482  MET B C   1 
ATOM   8431  O O   . MET B 1 456 ? -27.636 -25.076 24.845  1.00 24.88 ? 482  MET B O   1 
ATOM   8432  C CB  . MET B 1 456 ? -27.232 -22.899 27.262  1.00 18.81 ? 482  MET B CB  1 
ATOM   8433  C CG  . MET B 1 456 ? -26.842 -22.113 26.031  1.00 20.32 ? 482  MET B CG  1 
ATOM   8434  S SD  . MET B 1 456 ? -28.211 -21.479 25.069  1.00 19.88 ? 482  MET B SD  1 
ATOM   8435  C CE  . MET B 1 456 ? -27.333 -20.213 24.116  1.00 16.52 ? 482  MET B CE  1 
ATOM   8436  N N   . GLY B 1 457 ? -26.708 -25.990 26.672  1.00 24.07 ? 483  GLY B N   1 
ATOM   8437  C CA  . GLY B 1 457 ? -26.020 -27.002 25.881  1.00 25.18 ? 483  GLY B CA  1 
ATOM   8438  C C   . GLY B 1 457 ? -26.642 -28.384 25.993  1.00 26.37 ? 483  GLY B C   1 
ATOM   8439  O O   . GLY B 1 457 ? -25.979 -29.389 25.731  1.00 27.26 ? 483  GLY B O   1 
ATOM   8440  N N   . ASP B 1 458 ? -27.915 -28.443 26.376  1.00 26.60 ? 484  ASP B N   1 
ATOM   8441  C CA  . ASP B 1 458 ? -28.606 -29.719 26.539  1.00 26.89 ? 484  ASP B CA  1 
ATOM   8442  C C   . ASP B 1 458 ? -29.583 -29.976 25.389  1.00 27.35 ? 484  ASP B C   1 
ATOM   8443  O O   . ASP B 1 458 ? -30.573 -29.257 25.230  1.00 26.43 ? 484  ASP B O   1 
ATOM   8444  C CB  . ASP B 1 458 ? -29.370 -29.719 27.862  1.00 27.14 ? 484  ASP B CB  1 
ATOM   8445  C CG  . ASP B 1 458 ? -29.885 -31.093 28.243  1.00 28.08 ? 484  ASP B CG  1 
ATOM   8446  O OD1 . ASP B 1 458 ? -30.057 -31.950 27.346  1.00 27.14 ? 484  ASP B OD1 1 
ATOM   8447  O OD2 . ASP B 1 458 ? -30.128 -31.309 29.447  1.00 27.37 ? 484  ASP B OD2 1 
ATOM   8448  N N   . SER B 1 459 ? -29.319 -31.009 24.597  1.00 26.95 ? 485  SER B N   1 
ATOM   8449  C CA  . SER B 1 459 ? -30.190 -31.328 23.475  1.00 26.26 ? 485  SER B CA  1 
ATOM   8450  C C   . SER B 1 459 ? -31.620 -31.661 23.876  1.00 25.79 ? 485  SER B C   1 
ATOM   8451  O O   . SER B 1 459 ? -32.553 -31.433 23.104  1.00 27.28 ? 485  SER B O   1 
ATOM   8452  C CB  . SER B 1 459 ? -29.598 -32.476 22.664  1.00 25.52 ? 485  SER B CB  1 
ATOM   8453  O OG  . SER B 1 459 ? -28.630 -31.980 21.765  1.00 26.86 ? 485  SER B OG  1 
ATOM   8454  N N   . THR B 1 460 ? -31.799 -32.185 25.077  1.00 25.00 ? 486  THR B N   1 
ATOM   8455  C CA  . THR B 1 460 ? -33.133 -32.535 25.543  1.00 24.88 ? 486  THR B CA  1 
ATOM   8456  C C   . THR B 1 460 ? -33.941 -31.290 25.895  1.00 25.17 ? 486  THR B C   1 
ATOM   8457  O O   . THR B 1 460 ? -35.128 -31.377 26.219  1.00 25.68 ? 486  THR B O   1 
ATOM   8458  C CB  . THR B 1 460 ? -33.068 -33.447 26.776  1.00 25.50 ? 486  THR B CB  1 
ATOM   8459  O OG1 . THR B 1 460 ? -32.538 -32.711 27.887  1.00 26.50 ? 486  THR B OG1 1 
ATOM   8460  C CG2 . THR B 1 460 ? -32.172 -34.654 26.497  1.00 24.27 ? 486  THR B CG2 1 
ATOM   8461  N N   . VAL B 1 461 ? -33.300 -30.126 25.825  1.00 24.15 ? 487  VAL B N   1 
ATOM   8462  C CA  . VAL B 1 461 ? -33.985 -28.878 26.136  1.00 22.84 ? 487  VAL B CA  1 
ATOM   8463  C C   . VAL B 1 461 ? -34.280 -28.086 24.863  1.00 22.91 ? 487  VAL B C   1 
ATOM   8464  O O   . VAL B 1 461 ? -33.367 -27.552 24.225  1.00 24.19 ? 487  VAL B O   1 
ATOM   8465  C CB  . VAL B 1 461 ? -33.144 -27.998 27.085  1.00 21.89 ? 487  VAL B CB  1 
ATOM   8466  C CG1 . VAL B 1 461 ? -33.832 -26.661 27.301  1.00 19.05 ? 487  VAL B CG1 1 
ATOM   8467  C CG2 . VAL B 1 461 ? -32.950 -28.723 28.419  1.00 21.51 ? 487  VAL B CG2 1 
ATOM   8468  N N   . PRO B 1 462 ? -35.559 -28.012 24.472  1.00 22.74 ? 488  PRO B N   1 
ATOM   8469  C CA  . PRO B 1 462 ? -35.935 -27.274 23.261  1.00 21.64 ? 488  PRO B CA  1 
ATOM   8470  C C   . PRO B 1 462 ? -35.458 -25.826 23.368  1.00 21.35 ? 488  PRO B C   1 
ATOM   8471  O O   . PRO B 1 462 ? -35.414 -25.264 24.463  1.00 19.44 ? 488  PRO B O   1 
ATOM   8472  C CB  . PRO B 1 462 ? -37.458 -27.376 23.255  1.00 20.89 ? 488  PRO B CB  1 
ATOM   8473  C CG  . PRO B 1 462 ? -37.710 -28.697 23.931  1.00 22.96 ? 488  PRO B CG  1 
ATOM   8474  C CD  . PRO B 1 462 ? -36.739 -28.650 25.085  1.00 23.15 ? 488  PRO B CD  1 
ATOM   8475  N N   . GLU B 1 463 ? -35.108 -25.226 22.231  1.00 21.64 ? 489  GLU B N   1 
ATOM   8476  C CA  . GLU B 1 463 ? -34.640 -23.844 22.220  1.00 22.45 ? 489  GLU B CA  1 
ATOM   8477  C C   . GLU B 1 463 ? -35.632 -22.895 22.880  1.00 22.39 ? 489  GLU B C   1 
ATOM   8478  O O   . GLU B 1 463 ? -35.232 -21.956 23.556  1.00 22.60 ? 489  GLU B O   1 
ATOM   8479  C CB  . GLU B 1 463 ? -34.346 -23.369 20.789  1.00 24.36 ? 489  GLU B CB  1 
ATOM   8480  C CG  . GLU B 1 463 ? -33.198 -24.096 20.102  1.00 28.76 ? 489  GLU B CG  1 
ATOM   8481  C CD  . GLU B 1 463 ? -32.531 -23.247 19.033  1.00 33.87 ? 489  GLU B CD  1 
ATOM   8482  O OE1 . GLU B 1 463 ? -33.252 -22.649 18.207  1.00 35.83 ? 489  GLU B OE1 1 
ATOM   8483  O OE2 . GLU B 1 463 ? -31.282 -23.182 19.014  1.00 36.80 ? 489  GLU B OE2 1 
ATOM   8484  N N   . GLN B 1 464 ? -36.928 -23.124 22.688  1.00 22.13 ? 490  GLN B N   1 
ATOM   8485  C CA  . GLN B 1 464 ? -37.916 -22.249 23.311  1.00 23.57 ? 490  GLN B CA  1 
ATOM   8486  C C   . GLN B 1 464 ? -37.756 -22.283 24.828  1.00 23.23 ? 490  GLN B C   1 
ATOM   8487  O O   . GLN B 1 464 ? -37.952 -21.273 25.510  1.00 23.25 ? 490  GLN B O   1 
ATOM   8488  C CB  . GLN B 1 464 ? -39.346 -22.666 22.938  1.00 26.13 ? 490  GLN B CB  1 
ATOM   8489  C CG  . GLN B 1 464 ? -39.820 -22.146 21.585  1.00 30.70 ? 490  GLN B CG  1 
ATOM   8490  C CD  . GLN B 1 464 ? -41.224 -22.616 21.223  1.00 34.16 ? 490  GLN B CD  1 
ATOM   8491  O OE1 . GLN B 1 464 ? -42.179 -22.410 21.976  1.00 35.84 ? 490  GLN B OE1 1 
ATOM   8492  N NE2 . GLN B 1 464 ? -41.354 -23.250 20.064  1.00 34.62 ? 490  GLN B NE2 1 
ATOM   8493  N N   . GLN B 1 465 ? -37.404 -23.451 25.360  1.00 21.28 ? 491  GLN B N   1 
ATOM   8494  C CA  . GLN B 1 465 ? -37.218 -23.585 26.798  1.00 20.48 ? 491  GLN B CA  1 
ATOM   8495  C C   . GLN B 1 465 ? -35.886 -22.984 27.218  1.00 17.82 ? 491  GLN B C   1 
ATOM   8496  O O   . GLN B 1 465 ? -35.751 -22.494 28.337  1.00 17.42 ? 491  GLN B O   1 
ATOM   8497  C CB  . GLN B 1 465 ? -37.317 -25.055 27.222  1.00 22.73 ? 491  GLN B CB  1 
ATOM   8498  C CG  . GLN B 1 465 ? -38.751 -25.501 27.514  1.00 25.71 ? 491  GLN B CG  1 
ATOM   8499  C CD  . GLN B 1 465 ? -39.659 -25.453 26.293  1.00 28.87 ? 491  GLN B CD  1 
ATOM   8500  O OE1 . GLN B 1 465 ? -39.626 -26.345 25.446  1.00 29.08 ? 491  GLN B OE1 1 
ATOM   8501  N NE2 . GLN B 1 465 ? -40.471 -24.403 26.197  1.00 27.16 ? 491  GLN B NE2 1 
ATOM   8502  N N   . LYS B 1 466 ? -34.908 -23.015 26.318  1.00 16.13 ? 492  LYS B N   1 
ATOM   8503  C CA  . LYS B 1 466 ? -33.608 -22.431 26.613  1.00 15.21 ? 492  LYS B CA  1 
ATOM   8504  C C   . LYS B 1 466 ? -33.829 -20.942 26.795  1.00 15.40 ? 492  LYS B C   1 
ATOM   8505  O O   . LYS B 1 466 ? -33.199 -20.309 27.642  1.00 16.69 ? 492  LYS B O   1 
ATOM   8506  C CB  . LYS B 1 466 ? -32.616 -22.643 25.466  1.00 13.61 ? 492  LYS B CB  1 
ATOM   8507  C CG  . LYS B 1 466 ? -32.259 -24.082 25.174  1.00 15.60 ? 492  LYS B CG  1 
ATOM   8508  C CD  . LYS B 1 466 ? -31.066 -24.133 24.228  1.00 19.23 ? 492  LYS B CD  1 
ATOM   8509  C CE  . LYS B 1 466 ? -30.938 -25.481 23.546  1.00 20.00 ? 492  LYS B CE  1 
ATOM   8510  N NZ  . LYS B 1 466 ? -30.858 -26.578 24.535  1.00 19.11 ? 492  LYS B NZ  1 
ATOM   8511  N N   . VAL B 1 467 ? -34.721 -20.391 25.981  1.00 12.67 ? 493  VAL B N   1 
ATOM   8512  C CA  . VAL B 1 467 ? -35.059 -18.972 26.041  1.00 14.61 ? 493  VAL B CA  1 
ATOM   8513  C C   . VAL B 1 467 ? -35.732 -18.660 27.372  1.00 14.50 ? 493  VAL B C   1 
ATOM   8514  O O   . VAL B 1 467 ? -35.408 -17.671 28.023  1.00 16.45 ? 493  VAL B O   1 
ATOM   8515  C CB  . VAL B 1 467 ? -36.024 -18.568 24.898  1.00 13.04 ? 493  VAL B CB  1 
ATOM   8516  C CG1 . VAL B 1 467 ? -36.556 -17.163 25.126  1.00 11.63 ? 493  VAL B CG1 1 
ATOM   8517  C CG2 . VAL B 1 467 ? -35.298 -18.648 23.565  1.00 13.73 ? 493  VAL B CG2 1 
ATOM   8518  N N   . GLU B 1 468 ? -36.672 -19.503 27.778  1.00 13.91 ? 494  GLU B N   1 
ATOM   8519  C CA  . GLU B 1 468 ? -37.363 -19.277 29.040  1.00 16.28 ? 494  GLU B CA  1 
ATOM   8520  C C   . GLU B 1 468 ? -36.360 -19.297 30.196  1.00 15.17 ? 494  GLU B C   1 
ATOM   8521  O O   . GLU B 1 468 ? -36.472 -18.492 31.128  1.00 15.03 ? 494  GLU B O   1 
ATOM   8522  C CB  . GLU B 1 468 ? -38.440 -20.345 29.261  1.00 16.43 ? 494  GLU B CB  1 
ATOM   8523  C CG  . GLU B 1 468 ? -39.524 -20.319 28.199  1.00 19.28 ? 494  GLU B CG  1 
ATOM   8524  C CD  . GLU B 1 468 ? -40.450 -21.517 28.277  1.00 20.39 ? 494  GLU B CD  1 
ATOM   8525  O OE1 . GLU B 1 468 ? -41.327 -21.631 27.400  1.00 21.95 ? 494  GLU B OE1 1 
ATOM   8526  O OE2 . GLU B 1 468 ? -40.310 -22.344 29.208  1.00 21.27 ? 494  GLU B OE2 1 
ATOM   8527  N N   . LEU B 1 469 ? -35.391 -20.212 30.127  1.00 14.90 ? 495  LEU B N   1 
ATOM   8528  C CA  . LEU B 1 469 ? -34.347 -20.356 31.149  1.00 14.98 ? 495  LEU B CA  1 
ATOM   8529  C C   . LEU B 1 469 ? -33.430 -19.131 31.159  1.00 15.41 ? 495  LEU B C   1 
ATOM   8530  O O   . LEU B 1 469 ? -32.960 -18.694 32.212  1.00 13.78 ? 495  LEU B O   1 
ATOM   8531  C CB  . LEU B 1 469 ? -33.517 -21.620 30.882  1.00 13.20 ? 495  LEU B CB  1 
ATOM   8532  C CG  . LEU B 1 469 ? -34.178 -22.970 31.197  1.00 14.60 ? 495  LEU B CG  1 
ATOM   8533  C CD1 . LEU B 1 469 ? -33.249 -24.109 30.788  1.00 13.23 ? 495  LEU B CD1 1 
ATOM   8534  C CD2 . LEU B 1 469 ? -34.517 -23.058 32.690  1.00 13.74 ? 495  LEU B CD2 1 
ATOM   8535  N N   . LEU B 1 470 ? -33.175 -18.584 29.970  1.00 13.58 ? 496  LEU B N   1 
ATOM   8536  C CA  . LEU B 1 470 ? -32.330 -17.414 29.842  1.00 12.76 ? 496  LEU B CA  1 
ATOM   8537  C C   . LEU B 1 470 ? -33.047 -16.240 30.512  1.00 14.22 ? 496  LEU B C   1 
ATOM   8538  O O   . LEU B 1 470 ? -32.478 -15.581 31.390  1.00 13.73 ? 496  LEU B O   1 
ATOM   8539  C CB  . LEU B 1 470 ? -32.065 -17.135 28.356  1.00 11.64 ? 496  LEU B CB  1 
ATOM   8540  C CG  . LEU B 1 470 ? -31.109 -16.013 27.939  1.00 9.67  ? 496  LEU B CG  1 
ATOM   8541  C CD1 . LEU B 1 470 ? -30.768 -16.159 26.455  1.00 9.71  ? 496  LEU B CD1 1 
ATOM   8542  C CD2 . LEU B 1 470 ? -31.744 -14.648 28.227  1.00 7.42  ? 496  LEU B CD2 1 
ATOM   8543  N N   . ARG B 1 471 ? -34.292 -15.985 30.129  1.00 13.22 ? 497  ARG B N   1 
ATOM   8544  C CA  . ARG B 1 471 ? -35.028 -14.877 30.727  1.00 16.11 ? 497  ARG B CA  1 
ATOM   8545  C C   . ARG B 1 471 ? -35.174 -15.008 32.245  1.00 15.41 ? 497  ARG B C   1 
ATOM   8546  O O   . ARG B 1 471 ? -35.110 -14.015 32.970  1.00 12.95 ? 497  ARG B O   1 
ATOM   8547  C CB  . ARG B 1 471 ? -36.404 -14.767 30.082  1.00 17.78 ? 497  ARG B CB  1 
ATOM   8548  C CG  . ARG B 1 471 ? -36.347 -14.371 28.613  1.00 23.47 ? 497  ARG B CG  1 
ATOM   8549  C CD  . ARG B 1 471 ? -37.726 -14.423 27.969  1.00 26.73 ? 497  ARG B CD  1 
ATOM   8550  N NE  . ARG B 1 471 ? -37.680 -14.059 26.556  1.00 32.22 ? 497  ARG B NE  1 
ATOM   8551  C CZ  . ARG B 1 471 ? -38.629 -14.361 25.670  1.00 33.87 ? 497  ARG B CZ  1 
ATOM   8552  N NH1 . ARG B 1 471 ? -39.709 -15.043 26.042  1.00 34.93 ? 497  ARG B NH1 1 
ATOM   8553  N NH2 . ARG B 1 471 ? -38.505 -13.971 24.409  1.00 33.19 ? 497  ARG B NH2 1 
ATOM   8554  N N   . LYS B 1 472 ? -35.363 -16.231 32.724  1.00 15.30 ? 498  LYS B N   1 
ATOM   8555  C CA  . LYS B 1 472 ? -35.536 -16.460 34.150  1.00 17.05 ? 498  LYS B CA  1 
ATOM   8556  C C   . LYS B 1 472 ? -34.248 -16.150 34.898  1.00 16.87 ? 498  LYS B C   1 
ATOM   8557  O O   . LYS B 1 472 ? -34.282 -15.650 36.028  1.00 14.94 ? 498  LYS B O   1 
ATOM   8558  C CB  . LYS B 1 472 ? -35.960 -17.906 34.403  1.00 19.77 ? 498  LYS B CB  1 
ATOM   8559  C CG  . LYS B 1 472 ? -36.470 -18.148 35.810  1.00 22.46 ? 498  LYS B CG  1 
ATOM   8560  C CD  . LYS B 1 472 ? -37.144 -19.513 35.908  1.00 27.18 ? 498  LYS B CD  1 
ATOM   8561  C CE  . LYS B 1 472 ? -37.833 -19.698 37.257  1.00 30.14 ? 498  LYS B CE  1 
ATOM   8562  N NZ  . LYS B 1 472 ? -38.529 -21.014 37.369  1.00 30.80 ? 498  LYS B NZ  1 
ATOM   8563  N N   . ALA B 1 473 ? -33.119 -16.454 34.261  1.00 15.22 ? 499  ALA B N   1 
ATOM   8564  C CA  . ALA B 1 473 ? -31.812 -16.196 34.842  1.00 14.05 ? 499  ALA B CA  1 
ATOM   8565  C C   . ALA B 1 473 ? -31.592 -14.690 34.883  1.00 14.59 ? 499  ALA B C   1 
ATOM   8566  O O   . ALA B 1 473 ? -31.092 -14.149 35.872  1.00 13.25 ? 499  ALA B O   1 
ATOM   8567  C CB  . ALA B 1 473 ? -30.725 -16.853 34.005  1.00 14.07 ? 499  ALA B CB  1 
ATOM   8568  N N   . VAL B 1 474 ? -31.957 -14.014 33.800  1.00 13.50 ? 500  VAL B N   1 
ATOM   8569  C CA  . VAL B 1 474 ? -31.789 -12.569 33.730  1.00 14.24 ? 500  VAL B CA  1 
ATOM   8570  C C   . VAL B 1 474 ? -32.648 -11.901 34.796  1.00 14.37 ? 500  VAL B C   1 
ATOM   8571  O O   . VAL B 1 474 ? -32.169 -11.036 35.532  1.00 14.53 ? 500  VAL B O   1 
ATOM   8572  C CB  . VAL B 1 474 ? -32.155 -12.043 32.326  1.00 13.05 ? 500  VAL B CB  1 
ATOM   8573  C CG1 . VAL B 1 474 ? -32.227 -10.518 32.324  1.00 12.15 ? 500  VAL B CG1 1 
ATOM   8574  C CG2 . VAL B 1 474 ? -31.112 -12.530 31.322  1.00 12.51 ? 500  VAL B CG2 1 
ATOM   8575  N N   . GLN B 1 475 ? -33.909 -12.316 34.896  1.00 14.41 ? 501  GLN B N   1 
ATOM   8576  C CA  . GLN B 1 475 ? -34.805 -11.749 35.896  1.00 16.52 ? 501  GLN B CA  1 
ATOM   8577  C C   . GLN B 1 475 ? -34.345 -12.033 37.321  1.00 14.90 ? 501  GLN B C   1 
ATOM   8578  O O   . GLN B 1 475 ? -34.438 -11.163 38.184  1.00 14.48 ? 501  GLN B O   1 
ATOM   8579  C CB  . GLN B 1 475 ? -36.228 -12.266 35.701  1.00 21.16 ? 501  GLN B CB  1 
ATOM   8580  C CG  . GLN B 1 475 ? -36.978 -11.548 34.587  1.00 29.23 ? 501  GLN B CG  1 
ATOM   8581  C CD  . GLN B 1 475 ? -36.968 -10.040 34.761  1.00 32.38 ? 501  GLN B CD  1 
ATOM   8582  O OE1 . GLN B 1 475 ? -37.550 -9.511  35.711  1.00 32.87 ? 501  GLN B OE1 1 
ATOM   8583  N NE2 . GLN B 1 475 ? -36.297 -9.345  33.850  1.00 31.71 ? 501  GLN B NE2 1 
ATOM   8584  N N   . ALA B 1 476 ? -33.851 -13.236 37.576  1.00 13.20 ? 502  ALA B N   1 
ATOM   8585  C CA  . ALA B 1 476 ? -33.386 -13.563 38.920  1.00 13.92 ? 502  ALA B CA  1 
ATOM   8586  C C   . ALA B 1 476 ? -32.227 -12.636 39.282  1.00 13.72 ? 502  ALA B C   1 
ATOM   8587  O O   . ALA B 1 476 ? -32.135 -12.144 40.405  1.00 14.94 ? 502  ALA B O   1 
ATOM   8588  C CB  . ALA B 1 476 ? -32.935 -15.007 38.982  1.00 10.62 ? 502  ALA B CB  1 
ATOM   8589  N N   . HIS B 1 477 ? -31.347 -12.393 38.319  1.00 12.93 ? 503  HIS B N   1 
ATOM   8590  C CA  . HIS B 1 477 ? -30.204 -11.536 38.550  1.00 12.78 ? 503  HIS B CA  1 
ATOM   8591  C C   . HIS B 1 477 ? -30.624 -10.082 38.734  1.00 12.85 ? 503  HIS B C   1 
ATOM   8592  O O   . HIS B 1 477 ? -29.992 -9.334  39.489  1.00 11.77 ? 503  HIS B O   1 
ATOM   8593  C CB  . HIS B 1 477 ? -29.216 -11.664 37.395  1.00 12.00 ? 503  HIS B CB  1 
ATOM   8594  C CG  . HIS B 1 477 ? -27.948 -10.900 37.605  1.00 12.39 ? 503  HIS B CG  1 
ATOM   8595  N ND1 . HIS B 1 477 ? -27.851 -9.543  37.385  1.00 12.73 ? 503  HIS B ND1 1 
ATOM   8596  C CD2 . HIS B 1 477 ? -26.727 -11.298 38.038  1.00 11.30 ? 503  HIS B CD2 1 
ATOM   8597  C CE1 . HIS B 1 477 ? -26.625 -9.136  37.669  1.00 11.92 ? 503  HIS B CE1 1 
ATOM   8598  N NE2 . HIS B 1 477 ? -25.922 -10.182 38.067  1.00 13.48 ? 503  HIS B NE2 1 
ATOM   8599  N N   . ARG B 1 478 ? -31.687 -9.684  38.043  1.00 13.78 ? 504  ARG B N   1 
ATOM   8600  C CA  . ARG B 1 478 ? -32.198 -8.323  38.152  1.00 14.72 ? 504  ARG B CA  1 
ATOM   8601  C C   . ARG B 1 478 ? -32.793 -8.149  39.549  1.00 13.58 ? 504  ARG B C   1 
ATOM   8602  O O   . ARG B 1 478 ? -32.573 -7.128  40.199  1.00 14.09 ? 504  ARG B O   1 
ATOM   8603  C CB  . ARG B 1 478 ? -33.282 -8.068  37.096  1.00 16.95 ? 504  ARG B CB  1 
ATOM   8604  C CG  . ARG B 1 478 ? -33.919 -6.681  37.162  1.00 20.03 ? 504  ARG B CG  1 
ATOM   8605  C CD  . ARG B 1 478 ? -32.906 -5.590  36.816  1.00 24.22 ? 504  ARG B CD  1 
ATOM   8606  N NE  . ARG B 1 478 ? -32.720 -4.640  37.908  1.00 26.28 ? 504  ARG B NE  1 
ATOM   8607  C CZ  . ARG B 1 478 ? -31.765 -3.714  37.956  1.00 26.91 ? 504  ARG B CZ  1 
ATOM   8608  N NH1 . ARG B 1 478 ? -30.885 -3.596  36.972  1.00 26.68 ? 504  ARG B NH1 1 
ATOM   8609  N NH2 . ARG B 1 478 ? -31.694 -2.901  39.000  1.00 28.01 ? 504  ARG B NH2 1 
ATOM   8610  N N   . ALA B 1 479 ? -33.533 -9.151  40.010  1.00 12.38 ? 505  ALA B N   1 
ATOM   8611  C CA  . ALA B 1 479 ? -34.160 -9.099  41.332  1.00 14.10 ? 505  ALA B CA  1 
ATOM   8612  C C   . ALA B 1 479 ? -33.089 -9.049  42.432  1.00 14.27 ? 505  ALA B C   1 
ATOM   8613  O O   . ALA B 1 479 ? -33.233 -8.316  43.415  1.00 16.10 ? 505  ALA B O   1 
ATOM   8614  C CB  . ALA B 1 479 ? -35.078 -10.316 41.531  1.00 10.89 ? 505  ALA B CB  1 
ATOM   8615  N N   . TYR B 1 480 ? -32.018 -9.817  42.253  1.00 12.43 ? 506  TYR B N   1 
ATOM   8616  C CA  . TYR B 1 480 ? -30.921 -9.859  43.213  1.00 11.84 ? 506  TYR B CA  1 
ATOM   8617  C C   . TYR B 1 480 ? -30.240 -8.486  43.213  1.00 12.92 ? 506  TYR B C   1 
ATOM   8618  O O   . TYR B 1 480 ? -29.835 -7.980  44.260  1.00 11.70 ? 506  TYR B O   1 
ATOM   8619  C CB  . TYR B 1 480 ? -29.928 -10.956 42.812  1.00 11.43 ? 506  TYR B CB  1 
ATOM   8620  C CG  . TYR B 1 480 ? -28.967 -11.386 43.908  1.00 12.52 ? 506  TYR B CG  1 
ATOM   8621  C CD1 . TYR B 1 480 ? -28.604 -12.727 44.053  1.00 10.87 ? 506  TYR B CD1 1 
ATOM   8622  C CD2 . TYR B 1 480 ? -28.415 -10.459 44.798  1.00 10.98 ? 506  TYR B CD2 1 
ATOM   8623  C CE1 . TYR B 1 480 ? -27.720 -13.133 45.051  1.00 11.93 ? 506  TYR B CE1 1 
ATOM   8624  C CE2 . TYR B 1 480 ? -27.532 -10.862 45.806  1.00 11.33 ? 506  TYR B CE2 1 
ATOM   8625  C CZ  . TYR B 1 480 ? -27.189 -12.202 45.927  1.00 11.60 ? 506  TYR B CZ  1 
ATOM   8626  O OH  . TYR B 1 480 ? -26.324 -12.625 46.916  1.00 10.68 ? 506  TYR B OH  1 
ATOM   8627  N N   . THR B 1 481 ? -30.129 -7.879  42.040  1.00 11.75 ? 507  THR B N   1 
ATOM   8628  C CA  . THR B 1 481 ? -29.519 -6.566  41.931  1.00 12.29 ? 507  THR B CA  1 
ATOM   8629  C C   . THR B 1 481 ? -30.356 -5.524  42.669  1.00 14.14 ? 507  THR B C   1 
ATOM   8630  O O   . THR B 1 481 ? -29.804 -4.743  43.455  1.00 14.16 ? 507  THR B O   1 
ATOM   8631  C CB  . THR B 1 481 ? -29.366 -6.175  40.457  1.00 12.20 ? 507  THR B CB  1 
ATOM   8632  O OG1 . THR B 1 481 ? -28.374 -7.013  39.855  1.00 10.54 ? 507  THR B OG1 1 
ATOM   8633  C CG2 . THR B 1 481 ? -28.948 -4.714  40.319  1.00 10.47 ? 507  THR B CG2 1 
ATOM   8634  N N   . ASP B 1 482 ? -31.668 -5.512  42.431  1.00 13.63 ? 508  ASP B N   1 
ATOM   8635  C CA  . ASP B 1 482 ? -32.544 -4.551  43.097  1.00 16.14 ? 508  ASP B CA  1 
ATOM   8636  C C   . ASP B 1 482 ? -32.509 -4.724  44.614  1.00 18.26 ? 508  ASP B C   1 
ATOM   8637  O O   . ASP B 1 482 ? -32.674 -3.753  45.352  1.00 17.92 ? 508  ASP B O   1 
ATOM   8638  C CB  . ASP B 1 482 ? -33.993 -4.689  42.619  1.00 17.84 ? 508  ASP B CB  1 
ATOM   8639  C CG  . ASP B 1 482 ? -34.175 -4.313  41.154  1.00 20.18 ? 508  ASP B CG  1 
ATOM   8640  O OD1 . ASP B 1 482 ? -33.637 -3.272  40.728  1.00 24.53 ? 508  ASP B OD1 1 
ATOM   8641  O OD2 . ASP B 1 482 ? -34.876 -5.056  40.436  1.00 23.53 ? 508  ASP B OD2 1 
ATOM   8642  N N   . ARG B 1 483 ? -32.316 -5.950  45.084  1.00 17.75 ? 509  ARG B N   1 
ATOM   8643  C CA  . ARG B 1 483 ? -32.264 -6.161  46.526  1.00 17.04 ? 509  ARG B CA  1 
ATOM   8644  C C   . ARG B 1 483 ? -30.950 -5.630  47.093  1.00 16.31 ? 509  ARG B C   1 
ATOM   8645  O O   . ARG B 1 483 ? -30.949 -4.950  48.117  1.00 17.62 ? 509  ARG B O   1 
ATOM   8646  C CB  . ARG B 1 483 ? -32.393 -7.649  46.879  1.00 16.93 ? 509  ARG B CB  1 
ATOM   8647  C CG  . ARG B 1 483 ? -33.795 -8.217  46.697  1.00 17.79 ? 509  ARG B CG  1 
ATOM   8648  C CD  . ARG B 1 483 ? -33.936 -9.554  47.399  1.00 15.79 ? 509  ARG B CD  1 
ATOM   8649  N NE  . ARG B 1 483 ? -33.086 -10.591 46.826  1.00 15.51 ? 509  ARG B NE  1 
ATOM   8650  C CZ  . ARG B 1 483 ? -33.417 -11.330 45.761  1.00 16.26 ? 509  ARG B CZ  1 
ATOM   8651  N NH1 . ARG B 1 483 ? -34.579 -11.142 45.143  1.00 16.15 ? 509  ARG B NH1 1 
ATOM   8652  N NH2 . ARG B 1 483 ? -32.587 -12.266 45.333  1.00 13.76 ? 509  ARG B NH2 1 
ATOM   8653  N N   . ALA B 1 484 ? -29.842 -5.938  46.427  1.00 13.26 ? 510  ALA B N   1 
ATOM   8654  C CA  . ALA B 1 484 ? -28.524 -5.505  46.890  1.00 14.47 ? 510  ALA B CA  1 
ATOM   8655  C C   . ALA B 1 484 ? -28.458 -3.990  47.007  1.00 15.41 ? 510  ALA B C   1 
ATOM   8656  O O   . ALA B 1 484 ? -27.998 -3.445  48.011  1.00 15.44 ? 510  ALA B O   1 
ATOM   8657  C CB  . ALA B 1 484 ? -27.445 -6.000  45.940  1.00 11.82 ? 510  ALA B CB  1 
ATOM   8658  N N   . ILE B 1 485 ? -28.915 -3.323  45.953  1.00 14.03 ? 511  ILE B N   1 
ATOM   8659  C CA  . ILE B 1 485 ? -28.943 -1.877  45.886  1.00 15.41 ? 511  ILE B CA  1 
ATOM   8660  C C   . ILE B 1 485 ? -29.766 -1.302  47.036  1.00 14.04 ? 511  ILE B C   1 
ATOM   8661  O O   . ILE B 1 485 ? -29.529 -0.176  47.477  1.00 15.65 ? 511  ILE B O   1 
ATOM   8662  C CB  . ILE B 1 485 ? -29.528 -1.432  44.519  1.00 16.46 ? 511  ILE B CB  1 
ATOM   8663  C CG1 . ILE B 1 485 ? -28.385 -1.053  43.581  1.00 19.32 ? 511  ILE B CG1 1 
ATOM   8664  C CG2 . ILE B 1 485 ? -30.502 -0.295  44.692  1.00 18.28 ? 511  ILE B CG2 1 
ATOM   8665  C CD1 . ILE B 1 485 ? -27.503 -2.209  43.232  1.00 19.62 ? 511  ILE B CD1 1 
ATOM   8666  N N   . ARG B 1 486 ? -30.733 -2.071  47.518  1.00 13.60 ? 512  ARG B N   1 
ATOM   8667  C CA  . ARG B 1 486 ? -31.585 -1.604  48.610  1.00 16.22 ? 512  ARG B CA  1 
ATOM   8668  C C   . ARG B 1 486 ? -31.200 -2.168  49.977  1.00 14.09 ? 512  ARG B C   1 
ATOM   8669  O O   . ARG B 1 486 ? -31.995 -2.152  50.914  1.00 13.58 ? 512  ARG B O   1 
ATOM   8670  C CB  . ARG B 1 486 ? -33.046 -1.923  48.294  1.00 18.22 ? 512  ARG B CB  1 
ATOM   8671  C CG  . ARG B 1 486 ? -33.574 -1.154  47.095  1.00 21.81 ? 512  ARG B CG  1 
ATOM   8672  C CD  . ARG B 1 486 ? -35.005 -1.542  46.770  1.00 24.75 ? 512  ARG B CD  1 
ATOM   8673  N NE  . ARG B 1 486 ? -35.530 -0.765  45.654  1.00 27.82 ? 512  ARG B NE  1 
ATOM   8674  C CZ  . ARG B 1 486 ? -35.020 -0.783  44.425  1.00 28.95 ? 512  ARG B CZ  1 
ATOM   8675  N NH1 . ARG B 1 486 ? -33.966 -1.542  44.153  1.00 27.74 ? 512  ARG B NH1 1 
ATOM   8676  N NH2 . ARG B 1 486 ? -35.564 -0.041  43.468  1.00 27.49 ? 512  ARG B NH2 1 
ATOM   8677  N N   . GLY B 1 487 ? -29.973 -2.655  50.083  1.00 14.11 ? 513  GLY B N   1 
ATOM   8678  C CA  . GLY B 1 487 ? -29.492 -3.202  51.340  1.00 13.28 ? 513  GLY B CA  1 
ATOM   8679  C C   . GLY B 1 487 ? -30.132 -4.517  51.748  1.00 14.63 ? 513  GLY B C   1 
ATOM   8680  O O   . GLY B 1 487 ? -30.208 -4.819  52.938  1.00 11.94 ? 513  GLY B O   1 
ATOM   8681  N N   . GLU B 1 488 ? -30.595 -5.304  50.776  1.00 14.29 ? 514  GLU B N   1 
ATOM   8682  C CA  . GLU B 1 488 ? -31.215 -6.592  51.082  1.00 14.74 ? 514  GLU B CA  1 
ATOM   8683  C C   . GLU B 1 488 ? -30.361 -7.798  50.681  1.00 13.84 ? 514  GLU B C   1 
ATOM   8684  O O   . GLU B 1 488 ? -30.819 -8.937  50.767  1.00 14.73 ? 514  GLU B O   1 
ATOM   8685  C CB  . GLU B 1 488 ? -32.598 -6.704  50.437  1.00 19.26 ? 514  GLU B CB  1 
ATOM   8686  C CG  . GLU B 1 488 ? -33.711 -5.976  51.186  1.00 22.96 ? 514  GLU B CG  1 
ATOM   8687  C CD  . GLU B 1 488 ? -35.017 -5.944  50.408  1.00 28.29 ? 514  GLU B CD  1 
ATOM   8688  O OE1 . GLU B 1 488 ? -35.465 -7.008  49.923  1.00 28.43 ? 514  GLU B OE1 1 
ATOM   8689  O OE2 . GLU B 1 488 ? -35.599 -4.847  50.289  1.00 28.92 ? 514  GLU B OE2 1 
ATOM   8690  N N   . ALA B 1 489 ? -29.135 -7.556  50.241  1.00 13.24 ? 515  ALA B N   1 
ATOM   8691  C CA  . ALA B 1 489 ? -28.235 -8.654  49.893  1.00 12.88 ? 515  ALA B CA  1 
ATOM   8692  C C   . ALA B 1 489 ? -27.786 -9.223  51.237  1.00 12.68 ? 515  ALA B C   1 
ATOM   8693  O O   . ALA B 1 489 ? -28.308 -8.819  52.277  1.00 13.41 ? 515  ALA B O   1 
ATOM   8694  C CB  . ALA B 1 489 ? -27.042 -8.146  49.103  1.00 13.01 ? 515  ALA B CB  1 
ATOM   8695  N N   . PHE B 1 490 ? -26.821 -10.135 51.245  1.00 13.17 ? 516  PHE B N   1 
ATOM   8696  C CA  . PHE B 1 490 ? -26.416 -10.722 52.518  1.00 11.77 ? 516  PHE B CA  1 
ATOM   8697  C C   . PHE B 1 490 ? -24.931 -10.790 52.816  1.00 12.78 ? 516  PHE B C   1 
ATOM   8698  O O   . PHE B 1 490 ? -24.542 -11.021 53.964  1.00 14.21 ? 516  PHE B O   1 
ATOM   8699  C CB  . PHE B 1 490 ? -26.998 -12.139 52.634  1.00 11.83 ? 516  PHE B CB  1 
ATOM   8700  C CG  . PHE B 1 490 ? -26.379 -13.136 51.679  1.00 12.25 ? 516  PHE B CG  1 
ATOM   8701  C CD1 . PHE B 1 490 ? -25.147 -13.724 51.957  1.00 10.46 ? 516  PHE B CD1 1 
ATOM   8702  C CD2 . PHE B 1 490 ? -27.026 -13.474 50.496  1.00 11.08 ? 516  PHE B CD2 1 
ATOM   8703  C CE1 . PHE B 1 490 ? -24.571 -14.636 51.067  1.00 10.97 ? 516  PHE B CE1 1 
ATOM   8704  C CE2 . PHE B 1 490 ? -26.460 -14.385 49.595  1.00 12.14 ? 516  PHE B CE2 1 
ATOM   8705  C CZ  . PHE B 1 490 ? -25.229 -14.966 49.883  1.00 11.77 ? 516  PHE B CZ  1 
ATOM   8706  N N   . ASP B 1 491 ? -24.095 -10.598 51.795  1.00 10.98 ? 517  ASP B N   1 
ATOM   8707  C CA  . ASP B 1 491 ? -22.660 -10.699 51.992  1.00 10.79 ? 517  ASP B CA  1 
ATOM   8708  C C   . ASP B 1 491 ? -22.061 -9.769  53.042  1.00 10.43 ? 517  ASP B C   1 
ATOM   8709  O O   . ASP B 1 491 ? -21.302 -10.227 53.892  1.00 9.57  ? 517  ASP B O   1 
ATOM   8710  C CB  . ASP B 1 491 ? -21.919 -10.525 50.667  1.00 9.31  ? 517  ASP B CB  1 
ATOM   8711  C CG  . ASP B 1 491 ? -21.817 -11.828 49.899  1.00 13.79 ? 517  ASP B CG  1 
ATOM   8712  O OD1 . ASP B 1 491 ? -22.744 -12.140 49.127  1.00 12.52 ? 517  ASP B OD1 1 
ATOM   8713  O OD2 . ASP B 1 491 ? -20.815 -12.554 50.089  1.00 11.31 ? 517  ASP B OD2 1 
ATOM   8714  N N   . ARG B 1 492 ? -22.385 -8.484  52.991  1.00 8.60  ? 518  ARG B N   1 
ATOM   8715  C CA  . ARG B 1 492 ? -21.850 -7.550  53.973  1.00 10.20 ? 518  ARG B CA  1 
ATOM   8716  C C   . ARG B 1 492 ? -22.455 -7.874  55.332  1.00 9.84  ? 518  ARG B C   1 
ATOM   8717  O O   . ARG B 1 492 ? -21.803 -7.692  56.367  1.00 12.88 ? 518  ARG B O   1 
ATOM   8718  C CB  . ARG B 1 492 ? -22.176 -6.102  53.587  1.00 9.91  ? 518  ARG B CB  1 
ATOM   8719  C CG  . ARG B 1 492 ? -21.530 -5.647  52.291  1.00 7.40  ? 518  ARG B CG  1 
ATOM   8720  C CD  . ARG B 1 492 ? -20.009 -5.684  52.384  1.00 8.35  ? 518  ARG B CD  1 
ATOM   8721  N NE  . ARG B 1 492 ? -19.410 -5.282  51.116  1.00 9.09  ? 518  ARG B NE  1 
ATOM   8722  C CZ  . ARG B 1 492 ? -19.271 -6.079  50.058  1.00 9.81  ? 518  ARG B CZ  1 
ATOM   8723  N NH1 . ARG B 1 492 ? -19.665 -7.352  50.101  1.00 6.98  ? 518  ARG B NH1 1 
ATOM   8724  N NH2 . ARG B 1 492 ? -18.794 -5.576  48.927  1.00 12.14 ? 518  ARG B NH2 1 
ATOM   8725  N N   . HIS B 1 493 ? -23.687 -8.359  55.326  1.00 10.62 ? 519  HIS B N   1 
ATOM   8726  C CA  . HIS B 1 493 ? -24.377 -8.722  56.560  1.00 11.43 ? 519  HIS B CA  1 
ATOM   8727  C C   . HIS B 1 493 ? -23.662 -9.900  57.236  1.00 11.78 ? 519  HIS B C   1 
ATOM   8728  O O   . HIS B 1 493 ? -23.380 -9.846  58.434  1.00 11.22 ? 519  HIS B O   1 
ATOM   8729  C CB  . HIS B 1 493 ? -25.837 -9.085  56.262  1.00 10.89 ? 519  HIS B CB  1 
ATOM   8730  C CG  . HIS B 1 493 ? -26.645 -9.416  57.481  1.00 11.58 ? 519  HIS B CG  1 
ATOM   8731  N ND1 . HIS B 1 493 ? -27.885 -10.013 57.408  1.00 12.22 ? 519  HIS B ND1 1 
ATOM   8732  C CD2 . HIS B 1 493 ? -26.394 -9.228  58.796  1.00 11.23 ? 519  HIS B CD2 1 
ATOM   8733  C CE1 . HIS B 1 493 ? -28.363 -10.181 58.631  1.00 11.86 ? 519  HIS B CE1 1 
ATOM   8734  N NE2 . HIS B 1 493 ? -27.475 -9.710  59.491  1.00 12.06 ? 519  HIS B NE2 1 
ATOM   8735  N N   . LEU B 1 494 ? -23.365 -10.960 56.480  1.00 12.34 ? 520  LEU B N   1 
ATOM   8736  C CA  . LEU B 1 494 ? -22.681 -12.116 57.055  1.00 12.56 ? 520  LEU B CA  1 
ATOM   8737  C C   . LEU B 1 494 ? -21.293 -11.692 57.517  1.00 13.10 ? 520  LEU B C   1 
ATOM   8738  O O   . LEU B 1 494 ? -20.793 -12.185 58.533  1.00 14.01 ? 520  LEU B O   1 
ATOM   8739  C CB  . LEU B 1 494 ? -22.560 -13.253 56.032  1.00 12.27 ? 520  LEU B CB  1 
ATOM   8740  C CG  . LEU B 1 494 ? -23.862 -13.952 55.635  1.00 16.04 ? 520  LEU B CG  1 
ATOM   8741  C CD1 . LEU B 1 494 ? -23.569 -15.178 54.772  1.00 13.40 ? 520  LEU B CD1 1 
ATOM   8742  C CD2 . LEU B 1 494 ? -24.611 -14.366 56.886  1.00 14.64 ? 520  LEU B CD2 1 
ATOM   8743  N N   . LEU B 1 495 ? -20.662 -10.788 56.766  1.00 10.46 ? 521  LEU B N   1 
ATOM   8744  C CA  . LEU B 1 495 ? -19.351 -10.301 57.150  1.00 10.46 ? 521  LEU B CA  1 
ATOM   8745  C C   . LEU B 1 495 ? -19.484 -9.585  58.499  1.00 10.10 ? 521  LEU B C   1 
ATOM   8746  O O   . LEU B 1 495 ? -18.652 -9.775  59.390  1.00 10.61 ? 521  LEU B O   1 
ATOM   8747  C CB  . LEU B 1 495 ? -18.806 -9.328  56.096  1.00 11.10 ? 521  LEU B CB  1 
ATOM   8748  C CG  . LEU B 1 495 ? -17.576 -8.502  56.508  1.00 12.53 ? 521  LEU B CG  1 
ATOM   8749  C CD1 . LEU B 1 495 ? -16.378 -9.419  56.727  1.00 13.10 ? 521  LEU B CD1 1 
ATOM   8750  C CD2 . LEU B 1 495 ? -17.267 -7.456  55.444  1.00 10.65 ? 521  LEU B CD2 1 
ATOM   8751  N N   . GLY B 1 496 ? -20.527 -8.780  58.635  1.00 9.53  ? 522  GLY B N   1 
ATOM   8752  C CA  . GLY B 1 496 ? -20.757 -8.047  59.873  1.00 10.29 ? 522  GLY B CA  1 
ATOM   8753  C C   . GLY B 1 496 ? -20.946 -8.970  61.058  1.00 11.01 ? 522  GLY B C   1 
ATOM   8754  O O   . GLY B 1 496 ? -20.432 -8.711  62.144  1.00 12.01 ? 522  GLY B O   1 
ATOM   8755  N N   . LEU B 1 497 ? -21.682 -10.056 60.854  1.00 12.38 ? 523  LEU B N   1 
ATOM   8756  C CA  . LEU B 1 497 ? -21.917 -11.010 61.926  1.00 11.23 ? 523  LEU B CA  1 
ATOM   8757  C C   . LEU B 1 497 ? -20.569 -11.606 62.350  1.00 12.22 ? 523  LEU B C   1 
ATOM   8758  O O   . LEU B 1 497 ? -20.283 -11.743 63.542  1.00 11.86 ? 523  LEU B O   1 
ATOM   8759  C CB  . LEU B 1 497 ? -22.888 -12.107 61.457  1.00 11.50 ? 523  LEU B CB  1 
ATOM   8760  C CG  . LEU B 1 497 ? -24.333 -11.672 61.168  1.00 13.67 ? 523  LEU B CG  1 
ATOM   8761  C CD1 . LEU B 1 497 ? -25.090 -12.738 60.359  1.00 10.61 ? 523  LEU B CD1 1 
ATOM   8762  C CD2 . LEU B 1 497 ? -25.036 -11.396 62.488  1.00 13.27 ? 523  LEU B CD2 1 
ATOM   8763  N N   . LYS B 1 498 ? -19.729 -11.934 61.374  1.00 11.76 ? 524  LYS B N   1 
ATOM   8764  C CA  . LYS B 1 498 ? -18.422 -12.488 61.676  1.00 12.96 ? 524  LYS B CA  1 
ATOM   8765  C C   . LYS B 1 498 ? -17.591 -11.487 62.481  1.00 13.32 ? 524  LYS B C   1 
ATOM   8766  O O   . LYS B 1 498 ? -17.000 -11.839 63.502  1.00 12.64 ? 524  LYS B O   1 
ATOM   8767  C CB  . LYS B 1 498 ? -17.688 -12.844 60.378  1.00 13.33 ? 524  LYS B CB  1 
ATOM   8768  C CG  . LYS B 1 498 ? -16.490 -13.753 60.589  1.00 15.64 ? 524  LYS B CG  1 
ATOM   8769  C CD  . LYS B 1 498 ? -15.708 -13.986 59.291  1.00 19.13 ? 524  LYS B CD  1 
ATOM   8770  C CE  . LYS B 1 498 ? -14.996 -12.718 58.832  1.00 21.92 ? 524  LYS B CE  1 
ATOM   8771  N NZ  . LYS B 1 498 ? -14.227 -12.893 57.559  1.00 23.58 ? 524  LYS B NZ  1 
ATOM   8772  N N   . LEU B 1 499 ? -17.548 -10.248 62.018  1.00 11.37 ? 525  LEU B N   1 
ATOM   8773  C CA  . LEU B 1 499 ? -16.775 -9.207  62.704  1.00 11.48 ? 525  LEU B CA  1 
ATOM   8774  C C   . LEU B 1 499 ? -17.344 -8.937  64.092  1.00 9.82  ? 525  LEU B C   1 
ATOM   8775  O O   . LEU B 1 499 ? -16.594 -8.693  65.030  1.00 12.22 ? 525  LEU B O   1 
ATOM   8776  C CB  . LEU B 1 499 ? -16.746 -7.921  61.870  1.00 7.96  ? 525  LEU B CB  1 
ATOM   8777  C CG  . LEU B 1 499 ? -16.066 -8.096  60.509  1.00 8.49  ? 525  LEU B CG  1 
ATOM   8778  C CD1 . LEU B 1 499 ? -16.143 -6.801  59.691  1.00 5.95  ? 525  LEU B CD1 1 
ATOM   8779  C CD2 . LEU B 1 499 ? -14.622 -8.525  60.735  1.00 7.47  ? 525  LEU B CD2 1 
ATOM   8780  N N   . GLN B 1 500 ? -18.664 -8.989  64.216  1.00 10.10 ? 526  GLN B N   1 
ATOM   8781  C CA  . GLN B 1 500 ? -19.326 -8.778  65.494  1.00 10.72 ? 526  GLN B CA  1 
ATOM   8782  C C   . GLN B 1 500 ? -18.930 -9.890  66.476  1.00 13.35 ? 526  GLN B C   1 
ATOM   8783  O O   . GLN B 1 500 ? -18.811 -9.652  67.683  1.00 12.62 ? 526  GLN B O   1 
ATOM   8784  C CB  . GLN B 1 500 ? -20.842 -8.772  65.302  1.00 12.37 ? 526  GLN B CB  1 
ATOM   8785  C CG  . GLN B 1 500 ? -21.639 -8.471  66.567  1.00 9.96  ? 526  GLN B CG  1 
ATOM   8786  C CD  . GLN B 1 500 ? -21.431 -7.058  67.062  1.00 11.86 ? 526  GLN B CD  1 
ATOM   8787  O OE1 . GLN B 1 500 ? -21.538 -6.091  66.298  1.00 8.79  ? 526  GLN B OE1 1 
ATOM   8788  N NE2 . GLN B 1 500 ? -21.147 -6.918  68.354  1.00 11.44 ? 526  GLN B NE2 1 
ATOM   8789  N N   . ALA B 1 501 ? -18.733 -11.103 65.963  1.00 13.46 ? 527  ALA B N   1 
ATOM   8790  C CA  . ALA B 1 501 ? -18.336 -12.225 66.816  1.00 13.61 ? 527  ALA B CA  1 
ATOM   8791  C C   . ALA B 1 501 ? -16.934 -11.961 67.371  1.00 13.96 ? 527  ALA B C   1 
ATOM   8792  O O   . ALA B 1 501 ? -16.679 -12.154 68.563  1.00 15.46 ? 527  ALA B O   1 
ATOM   8793  C CB  . ALA B 1 501 ? -18.341 -13.518 66.012  1.00 13.31 ? 527  ALA B CB  1 
ATOM   8794  N N   . ILE B 1 502 ? -16.033 -11.531 66.502  1.00 12.19 ? 528  ILE B N   1 
ATOM   8795  C CA  . ILE B 1 502 ? -14.668 -11.238 66.912  1.00 14.35 ? 528  ILE B CA  1 
ATOM   8796  C C   . ILE B 1 502 ? -14.667 -10.155 67.978  1.00 15.49 ? 528  ILE B C   1 
ATOM   8797  O O   . ILE B 1 502 ? -13.963 -10.254 68.971  1.00 15.64 ? 528  ILE B O   1 
ATOM   8798  C CB  . ILE B 1 502 ? -13.816 -10.769 65.721  1.00 14.94 ? 528  ILE B CB  1 
ATOM   8799  C CG1 . ILE B 1 502 ? -13.642 -11.921 64.728  1.00 13.41 ? 528  ILE B CG1 1 
ATOM   8800  C CG2 . ILE B 1 502 ? -12.459 -10.264 66.210  1.00 13.62 ? 528  ILE B CG2 1 
ATOM   8801  C CD1 . ILE B 1 502 ? -12.947 -11.510 63.467  1.00 13.38 ? 528  ILE B CD1 1 
ATOM   8802  N N   . GLU B 1 503 ? -15.474 -9.124  67.763  1.00 16.06 ? 529  GLU B N   1 
ATOM   8803  C CA  . GLU B 1 503 ? -15.576 -8.006  68.698  1.00 19.07 ? 529  GLU B CA  1 
ATOM   8804  C C   . GLU B 1 503 ? -16.234 -8.410  70.030  1.00 19.26 ? 529  GLU B C   1 
ATOM   8805  O O   . GLU B 1 503 ? -15.890 -7.867  71.087  1.00 18.77 ? 529  GLU B O   1 
ATOM   8806  C CB  . GLU B 1 503 ? -16.365 -6.866  68.050  1.00 19.31 ? 529  GLU B CB  1 
ATOM   8807  C CG  . GLU B 1 503 ? -16.544 -5.653  68.928  1.00 21.29 ? 529  GLU B CG  1 
ATOM   8808  C CD  . GLU B 1 503 ? -17.371 -4.583  68.250  1.00 22.61 ? 529  GLU B CD  1 
ATOM   8809  O OE1 . GLU B 1 503 ? -16.978 -4.132  67.149  1.00 18.35 ? 529  GLU B OE1 1 
ATOM   8810  O OE2 . GLU B 1 503 ? -18.412 -4.196  68.819  1.00 16.19 ? 529  GLU B OE2 1 
ATOM   8811  N N   . ASP B 1 504 ? -17.172 -9.352  69.984  1.00 19.05 ? 530  ASP B N   1 
ATOM   8812  C CA  . ASP B 1 504 ? -17.845 -9.808  71.203  1.00 19.01 ? 530  ASP B CA  1 
ATOM   8813  C C   . ASP B 1 504 ? -16.948 -10.755 71.989  1.00 19.33 ? 530  ASP B C   1 
ATOM   8814  O O   . ASP B 1 504 ? -17.323 -11.224 73.064  1.00 19.63 ? 530  ASP B O   1 
ATOM   8815  C CB  . ASP B 1 504 ? -19.151 -10.537 70.887  1.00 17.76 ? 530  ASP B CB  1 
ATOM   8816  C CG  . ASP B 1 504 ? -20.238 -9.616  70.376  1.00 19.56 ? 530  ASP B CG  1 
ATOM   8817  O OD1 . ASP B 1 504 ? -20.195 -8.396  70.656  1.00 17.16 ? 530  ASP B OD1 1 
ATOM   8818  O OD2 . ASP B 1 504 ? -21.161 -10.128 69.706  1.00 20.69 ? 530  ASP B OD2 1 
ATOM   8819  N N   . LEU B 1 505 ? -15.776 -11.052 71.440  1.00 19.88 ? 531  LEU B N   1 
ATOM   8820  C CA  . LEU B 1 505 ? -14.816 -11.932 72.101  1.00 21.24 ? 531  LEU B CA  1 
ATOM   8821  C C   . LEU B 1 505 ? -15.335 -13.357 72.240  1.00 23.04 ? 531  LEU B C   1 
ATOM   8822  O O   . LEU B 1 505 ? -15.027 -14.053 73.209  1.00 23.69 ? 531  LEU B O   1 
ATOM   8823  C CB  . LEU B 1 505 ? -14.460 -11.374 73.484  1.00 20.27 ? 531  LEU B CB  1 
ATOM   8824  C CG  . LEU B 1 505 ? -13.964 -9.924  73.507  1.00 19.24 ? 531  LEU B CG  1 
ATOM   8825  C CD1 . LEU B 1 505 ? -13.562 -9.519  74.932  1.00 21.18 ? 531  LEU B CD1 1 
ATOM   8826  C CD2 . LEU B 1 505 ? -12.794 -9.786  72.530  1.00 18.55 ? 531  LEU B CD2 1 
ATOM   8827  N N   . VAL B 1 506 ? -16.128 -13.790 71.270  1.00 22.88 ? 532  VAL B N   1 
ATOM   8828  C CA  . VAL B 1 506 ? -16.670 -15.139 71.299  1.00 23.16 ? 532  VAL B CA  1 
ATOM   8829  C C   . VAL B 1 506 ? -15.975 -15.970 70.235  1.00 23.79 ? 532  VAL B C   1 
ATOM   8830  O O   . VAL B 1 506 ? -15.386 -15.424 69.302  1.00 26.10 ? 532  VAL B O   1 
ATOM   8831  C CB  . VAL B 1 506 ? -18.183 -15.148 71.026  1.00 22.74 ? 532  VAL B CB  1 
ATOM   8832  C CG1 . VAL B 1 506 ? -18.901 -14.361 72.110  1.00 23.72 ? 532  VAL B CG1 1 
ATOM   8833  C CG2 . VAL B 1 506 ? -18.470 -14.571 69.647  1.00 21.96 ? 532  VAL B CG2 1 
ATOM   8834  N N   . SER B 1 507 ? -16.040 -17.289 70.377  1.00 22.78 ? 533  SER B N   1 
ATOM   8835  C CA  . SER B 1 507 ? -15.411 -18.185 69.417  1.00 24.35 ? 533  SER B CA  1 
ATOM   8836  C C   . SER B 1 507 ? -15.996 -17.988 68.018  1.00 19.64 ? 533  SER B C   1 
ATOM   8837  O O   . SER B 1 507 ? -17.178 -17.693 67.878  1.00 19.25 ? 533  SER B O   1 
ATOM   8838  C CB  . SER B 1 507 ? -15.600 -19.643 69.864  1.00 26.04 ? 533  SER B CB  1 
ATOM   8839  O OG  . SER B 1 507 ? -15.109 -20.539 68.883  1.00 34.29 ? 533  SER B OG  1 
ATOM   8840  N N   . MET B 1 508 ? -15.166 -18.151 66.997  1.00 18.42 ? 534  MET B N   1 
ATOM   8841  C CA  . MET B 1 508 ? -15.609 -18.012 65.613  1.00 19.14 ? 534  MET B CA  1 
ATOM   8842  C C   . MET B 1 508 ? -16.730 -19.007 65.329  1.00 17.27 ? 534  MET B C   1 
ATOM   8843  O O   . MET B 1 508 ? -16.513 -20.211 65.387  1.00 18.89 ? 534  MET B O   1 
ATOM   8844  C CB  . MET B 1 508 ? -14.439 -18.274 64.653  1.00 20.14 ? 534  MET B CB  1 
ATOM   8845  C CG  . MET B 1 508 ? -14.781 -18.169 63.172  1.00 21.58 ? 534  MET B CG  1 
ATOM   8846  S SD  . MET B 1 508 ? -15.436 -16.547 62.704  1.00 25.14 ? 534  MET B SD  1 
ATOM   8847  C CE  . MET B 1 508 ? -13.965 -15.451 62.957  1.00 20.35 ? 534  MET B CE  1 
ATOM   8848  N N   . PRO B 1 509 ? -17.944 -18.512 65.019  1.00 16.02 ? 535  PRO B N   1 
ATOM   8849  C CA  . PRO B 1 509 ? -19.098 -19.373 64.724  1.00 14.02 ? 535  PRO B CA  1 
ATOM   8850  C C   . PRO B 1 509 ? -18.789 -20.413 63.643  1.00 15.10 ? 535  PRO B C   1 
ATOM   8851  O O   . PRO B 1 509 ? -18.079 -20.121 62.676  1.00 11.07 ? 535  PRO B O   1 
ATOM   8852  C CB  . PRO B 1 509 ? -20.164 -18.377 64.272  1.00 14.67 ? 535  PRO B CB  1 
ATOM   8853  C CG  . PRO B 1 509 ? -19.828 -17.147 65.076  1.00 13.18 ? 535  PRO B CG  1 
ATOM   8854  C CD  . PRO B 1 509 ? -18.321 -17.088 64.981  1.00 13.32 ? 535  PRO B CD  1 
ATOM   8855  N N   . ASP B 1 510 ? -19.328 -21.621 63.806  1.00 14.62 ? 536  ASP B N   1 
ATOM   8856  C CA  . ASP B 1 510 ? -19.096 -22.697 62.844  1.00 14.82 ? 536  ASP B CA  1 
ATOM   8857  C C   . ASP B 1 510 ? -19.510 -22.316 61.424  1.00 14.37 ? 536  ASP B C   1 
ATOM   8858  O O   . ASP B 1 510 ? -18.874 -22.731 60.458  1.00 15.44 ? 536  ASP B O   1 
ATOM   8859  C CB  . ASP B 1 510 ? -19.859 -23.960 63.253  1.00 15.61 ? 536  ASP B CB  1 
ATOM   8860  C CG  . ASP B 1 510 ? -19.395 -24.523 64.586  1.00 17.43 ? 536  ASP B CG  1 
ATOM   8861  O OD1 . ASP B 1 510 ? -18.184 -24.448 64.886  1.00 20.37 ? 536  ASP B OD1 1 
ATOM   8862  O OD2 . ASP B 1 510 ? -20.244 -25.057 65.326  1.00 18.90 ? 536  ASP B OD2 1 
ATOM   8863  N N   . ILE B 1 511 ? -20.574 -21.538 61.298  1.00 14.61 ? 537  ILE B N   1 
ATOM   8864  C CA  . ILE B 1 511 ? -21.055 -21.135 59.979  1.00 17.29 ? 537  ILE B CA  1 
ATOM   8865  C C   . ILE B 1 511 ? -19.978 -20.407 59.172  1.00 17.26 ? 537  ILE B C   1 
ATOM   8866  O O   . ILE B 1 511 ? -19.984 -20.443 57.942  1.00 19.06 ? 537  ILE B O   1 
ATOM   8867  C CB  . ILE B 1 511 ? -22.306 -20.238 60.101  1.00 18.22 ? 537  ILE B CB  1 
ATOM   8868  C CG1 . ILE B 1 511 ? -22.958 -20.062 58.734  1.00 22.05 ? 537  ILE B CG1 1 
ATOM   8869  C CG2 . ILE B 1 511 ? -21.924 -18.884 60.675  1.00 19.91 ? 537  ILE B CG2 1 
ATOM   8870  C CD1 . ILE B 1 511 ? -24.294 -19.342 58.783  1.00 23.94 ? 537  ILE B CD1 1 
ATOM   8871  N N   . PHE B 1 512 ? -19.045 -19.750 59.862  1.00 16.40 ? 538  PHE B N   1 
ATOM   8872  C CA  . PHE B 1 512 ? -17.979 -19.034 59.173  1.00 16.20 ? 538  PHE B CA  1 
ATOM   8873  C C   . PHE B 1 512 ? -16.746 -19.903 58.984  1.00 16.56 ? 538  PHE B C   1 
ATOM   8874  O O   . PHE B 1 512 ? -15.852 -19.567 58.208  1.00 16.36 ? 538  PHE B O   1 
ATOM   8875  C CB  . PHE B 1 512 ? -17.617 -17.756 59.935  1.00 14.80 ? 538  PHE B CB  1 
ATOM   8876  C CG  . PHE B 1 512 ? -18.750 -16.785 60.039  1.00 15.34 ? 538  PHE B CG  1 
ATOM   8877  C CD1 . PHE B 1 512 ? -19.223 -16.375 61.283  1.00 14.25 ? 538  PHE B CD1 1 
ATOM   8878  C CD2 . PHE B 1 512 ? -19.374 -16.305 58.894  1.00 14.36 ? 538  PHE B CD2 1 
ATOM   8879  C CE1 . PHE B 1 512 ? -20.305 -15.504 61.383  1.00 14.45 ? 538  PHE B CE1 1 
ATOM   8880  C CE2 . PHE B 1 512 ? -20.461 -15.432 58.985  1.00 16.21 ? 538  PHE B CE2 1 
ATOM   8881  C CZ  . PHE B 1 512 ? -20.924 -15.034 60.231  1.00 15.20 ? 538  PHE B CZ  1 
ATOM   8882  N N   . MET B 1 513 ? -16.696 -21.020 59.703  1.00 16.60 ? 539  MET B N   1 
ATOM   8883  C CA  . MET B 1 513 ? -15.579 -21.944 59.586  1.00 18.10 ? 539  MET B CA  1 
ATOM   8884  C C   . MET B 1 513 ? -15.965 -23.009 58.562  1.00 18.51 ? 539  MET B C   1 
ATOM   8885  O O   . MET B 1 513 ? -15.126 -23.787 58.101  1.00 17.76 ? 539  MET B O   1 
ATOM   8886  C CB  . MET B 1 513 ? -15.290 -22.613 60.934  1.00 21.43 ? 539  MET B CB  1 
ATOM   8887  C CG  . MET B 1 513 ? -14.828 -21.666 62.030  1.00 26.24 ? 539  MET B CG  1 
ATOM   8888  S SD  . MET B 1 513 ? -13.261 -20.876 61.636  1.00 33.37 ? 539  MET B SD  1 
ATOM   8889  C CE  . MET B 1 513 ? -12.128 -22.269 61.794  1.00 30.99 ? 539  MET B CE  1 
ATOM   8890  N N   . ASP B 1 514 ? -17.247 -23.028 58.216  1.00 17.73 ? 540  ASP B N   1 
ATOM   8891  C CA  . ASP B 1 514 ? -17.807 -23.984 57.261  1.00 17.52 ? 540  ASP B CA  1 
ATOM   8892  C C   . ASP B 1 514 ? -17.113 -23.958 55.897  1.00 17.23 ? 540  ASP B C   1 
ATOM   8893  O O   . ASP B 1 514 ? -16.708 -22.903 55.417  1.00 14.11 ? 540  ASP B O   1 
ATOM   8894  C CB  . ASP B 1 514 ? -19.294 -23.675 57.078  1.00 18.17 ? 540  ASP B CB  1 
ATOM   8895  C CG  . ASP B 1 514 ? -19.976 -24.636 56.141  1.00 18.63 ? 540  ASP B CG  1 
ATOM   8896  O OD1 . ASP B 1 514 ? -21.113 -24.343 55.721  1.00 18.04 ? 540  ASP B OD1 1 
ATOM   8897  O OD2 . ASP B 1 514 ? -19.383 -25.686 55.833  1.00 22.65 ? 540  ASP B OD2 1 
ATOM   8898  N N   . THR B 1 515 ? -16.987 -25.123 55.263  1.00 17.04 ? 541  THR B N   1 
ATOM   8899  C CA  . THR B 1 515 ? -16.359 -25.206 53.950  1.00 17.87 ? 541  THR B CA  1 
ATOM   8900  C C   . THR B 1 515 ? -17.152 -24.415 52.893  1.00 16.77 ? 541  THR B C   1 
ATOM   8901  O O   . THR B 1 515 ? -16.573 -23.816 51.982  1.00 16.96 ? 541  THR B O   1 
ATOM   8902  C CB  . THR B 1 515 ? -16.246 -26.672 53.493  1.00 19.73 ? 541  THR B CB  1 
ATOM   8903  O OG1 . THR B 1 515 ? -15.448 -27.408 54.429  1.00 21.63 ? 541  THR B OG1 1 
ATOM   8904  C CG2 . THR B 1 515 ? -15.603 -26.745 52.131  1.00 22.07 ? 541  THR B CG2 1 
ATOM   8905  N N   . SER B 1 516 ? -18.469 -24.408 53.020  1.00 15.58 ? 542  SER B N   1 
ATOM   8906  C CA  . SER B 1 516 ? -19.321 -23.682 52.078  1.00 14.06 ? 542  SER B CA  1 
ATOM   8907  C C   . SER B 1 516 ? -19.055 -22.177 52.107  1.00 14.13 ? 542  SER B C   1 
ATOM   8908  O O   . SER B 1 516 ? -19.161 -21.498 51.086  1.00 12.92 ? 542  SER B O   1 
ATOM   8909  C CB  . SER B 1 516 ? -20.795 -23.938 52.401  1.00 11.98 ? 542  SER B CB  1 
ATOM   8910  O OG  . SER B 1 516 ? -21.145 -25.296 52.187  1.00 15.74 ? 542  SER B OG  1 
ATOM   8911  N N   . TYR B 1 517 ? -18.715 -21.646 53.286  1.00 12.61 ? 543  TYR B N   1 
ATOM   8912  C CA  . TYR B 1 517 ? -18.454 -20.221 53.386  1.00 12.17 ? 543  TYR B CA  1 
ATOM   8913  C C   . TYR B 1 517 ? -17.142 -19.886 52.694  1.00 12.45 ? 543  TYR B C   1 
ATOM   8914  O O   . TYR B 1 517 ? -17.051 -18.887 51.981  1.00 13.12 ? 543  TYR B O   1 
ATOM   8915  C CB  . TYR B 1 517 ? -18.428 -19.755 54.854  1.00 11.91 ? 543  TYR B CB  1 
ATOM   8916  C CG  . TYR B 1 517 ? -18.459 -18.244 54.996  1.00 12.20 ? 543  TYR B CG  1 
ATOM   8917  C CD1 . TYR B 1 517 ? -17.359 -17.544 55.488  1.00 12.23 ? 543  TYR B CD1 1 
ATOM   8918  C CD2 . TYR B 1 517 ? -19.568 -17.511 54.575  1.00 13.91 ? 543  TYR B CD2 1 
ATOM   8919  C CE1 . TYR B 1 517 ? -17.358 -16.143 55.549  1.00 13.15 ? 543  TYR B CE1 1 
ATOM   8920  C CE2 . TYR B 1 517 ? -19.586 -16.115 54.638  1.00 14.81 ? 543  TYR B CE2 1 
ATOM   8921  C CZ  . TYR B 1 517 ? -18.480 -15.438 55.120  1.00 14.75 ? 543  TYR B CZ  1 
ATOM   8922  O OH  . TYR B 1 517 ? -18.505 -14.064 55.149  1.00 17.87 ? 543  TYR B OH  1 
ATOM   8923  N N   . ALA B 1 518 ? -16.131 -20.731 52.893  1.00 11.44 ? 544  ALA B N   1 
ATOM   8924  C CA  . ALA B 1 518 ? -14.828 -20.525 52.266  1.00 12.44 ? 544  ALA B CA  1 
ATOM   8925  C C   . ALA B 1 518 ? -15.001 -20.520 50.747  1.00 12.20 ? 544  ALA B C   1 
ATOM   8926  O O   . ALA B 1 518 ? -14.412 -19.695 50.043  1.00 11.78 ? 544  ALA B O   1 
ATOM   8927  C CB  . ALA B 1 518 ? -13.861 -21.646 52.677  1.00 12.39 ? 544  ALA B CB  1 
ATOM   8928  N N   . ILE B 1 519 ? -15.812 -21.444 50.254  1.00 11.94 ? 545  ILE B N   1 
ATOM   8929  C CA  . ILE B 1 519 ? -16.059 -21.556 48.822  1.00 12.06 ? 545  ILE B CA  1 
ATOM   8930  C C   . ILE B 1 519 ? -16.809 -20.328 48.325  1.00 10.49 ? 545  ILE B C   1 
ATOM   8931  O O   . ILE B 1 519 ? -16.423 -19.715 47.332  1.00 13.57 ? 545  ILE B O   1 
ATOM   8932  C CB  . ILE B 1 519 ? -16.876 -22.824 48.506  1.00 11.43 ? 545  ILE B CB  1 
ATOM   8933  C CG1 . ILE B 1 519 ? -16.063 -24.065 48.885  1.00 17.03 ? 545  ILE B CG1 1 
ATOM   8934  C CG2 . ILE B 1 519 ? -17.227 -22.869 47.025  1.00 12.82 ? 545  ILE B CG2 1 
ATOM   8935  C CD1 . ILE B 1 519 ? -16.747 -25.385 48.580  1.00 13.67 ? 545  ILE B CD1 1 
ATOM   8936  N N   . ALA B 1 520 ? -17.869 -19.976 49.025  1.00 9.96  ? 546  ALA B N   1 
ATOM   8937  C CA  . ALA B 1 520 ? -18.677 -18.825 48.667  1.00 12.00 ? 546  ALA B CA  1 
ATOM   8938  C C   . ALA B 1 520 ? -17.893 -17.510 48.642  1.00 13.05 ? 546  ALA B C   1 
ATOM   8939  O O   . ALA B 1 520 ? -18.208 -16.617 47.844  1.00 13.20 ? 546  ALA B O   1 
ATOM   8940  C CB  . ALA B 1 520 ? -19.841 -18.710 49.630  1.00 12.56 ? 546  ALA B CB  1 
ATOM   8941  N N   . MET B 1 521 ? -16.880 -17.389 49.499  1.00 11.42 ? 547  MET B N   1 
ATOM   8942  C CA  . MET B 1 521 ? -16.089 -16.157 49.590  1.00 11.56 ? 547  MET B CA  1 
ATOM   8943  C C   . MET B 1 521 ? -14.827 -16.126 48.728  1.00 10.39 ? 547  MET B C   1 
ATOM   8944  O O   . MET B 1 521 ? -14.092 -15.136 48.714  1.00 9.01  ? 547  MET B O   1 
ATOM   8945  C CB  . MET B 1 521 ? -15.725 -15.892 51.053  1.00 9.89  ? 547  MET B CB  1 
ATOM   8946  C CG  . MET B 1 521 ? -16.925 -15.677 51.959  1.00 11.49 ? 547  MET B CG  1 
ATOM   8947  S SD  . MET B 1 521 ? -18.064 -14.434 51.342  1.00 14.35 ? 547  MET B SD  1 
ATOM   8948  C CE  . MET B 1 521 ? -17.022 -12.941 51.496  1.00 11.06 ? 547  MET B CE  1 
ATOM   8949  N N   . HIS B 1 522 ? -14.587 -17.219 48.019  1.00 9.32  ? 548  HIS B N   1 
ATOM   8950  C CA  . HIS B 1 522 ? -13.435 -17.351 47.144  1.00 9.91  ? 548  HIS B CA  1 
ATOM   8951  C C   . HIS B 1 522 ? -13.962 -17.068 45.736  1.00 11.21 ? 548  HIS B C   1 
ATOM   8952  O O   . HIS B 1 522 ? -14.418 -17.967 45.032  1.00 11.94 ? 548  HIS B O   1 
ATOM   8953  C CB  . HIS B 1 522 ? -12.878 -18.770 47.276  1.00 10.63 ? 548  HIS B CB  1 
ATOM   8954  C CG  . HIS B 1 522 ? -11.634 -19.005 46.481  1.00 11.60 ? 548  HIS B CG  1 
ATOM   8955  N ND1 . HIS B 1 522 ? -11.654 -19.338 45.145  1.00 15.09 ? 548  HIS B ND1 1 
ATOM   8956  C CD2 . HIS B 1 522 ? -10.328 -18.928 46.832  1.00 9.73  ? 548  HIS B CD2 1 
ATOM   8957  C CE1 . HIS B 1 522 ? -10.416 -19.458 44.705  1.00 9.80  ? 548  HIS B CE1 1 
ATOM   8958  N NE2 . HIS B 1 522 ? -9.589  -19.214 45.708  1.00 12.93 ? 548  HIS B NE2 1 
ATOM   8959  N N   . PHE B 1 523 ? -13.886 -15.807 45.312  1.00 8.69  ? 549  PHE B N   1 
ATOM   8960  C CA  . PHE B 1 523 ? -14.433 -15.455 44.010  1.00 10.85 ? 549  PHE B CA  1 
ATOM   8961  C C   . PHE B 1 523 ? -13.582 -15.679 42.764  1.00 9.94  ? 549  PHE B C   1 
ATOM   8962  O O   . PHE B 1 523 ? -12.809 -14.808 42.366  1.00 9.92  ? 549  PHE B O   1 
ATOM   8963  C CB  . PHE B 1 523 ? -14.910 -14.004 44.047  1.00 9.87  ? 549  PHE B CB  1 
ATOM   8964  C CG  . PHE B 1 523 ? -15.998 -13.749 45.058  1.00 11.00 ? 549  PHE B CG  1 
ATOM   8965  C CD1 . PHE B 1 523 ? -17.296 -14.221 44.849  1.00 10.10 ? 549  PHE B CD1 1 
ATOM   8966  C CD2 . PHE B 1 523 ? -15.726 -13.037 46.220  1.00 9.08  ? 549  PHE B CD2 1 
ATOM   8967  C CE1 . PHE B 1 523 ? -18.300 -13.981 45.785  1.00 11.82 ? 549  PHE B CE1 1 
ATOM   8968  C CE2 . PHE B 1 523 ? -16.719 -12.794 47.157  1.00 9.28  ? 549  PHE B CE2 1 
ATOM   8969  C CZ  . PHE B 1 523 ? -18.006 -13.262 46.944  1.00 11.73 ? 549  PHE B CZ  1 
ATOM   8970  N N   . ASN B 1 524 ? -13.745 -16.838 42.130  1.00 10.07 ? 550  ASN B N   1 
ATOM   8971  C CA  . ASN B 1 524 ? -13.005 -17.149 40.905  1.00 10.15 ? 550  ASN B CA  1 
ATOM   8972  C C   . ASN B 1 524 ? -13.349 -16.091 39.854  1.00 9.70  ? 550  ASN B C   1 
ATOM   8973  O O   . ASN B 1 524 ? -12.545 -15.783 38.971  1.00 10.33 ? 550  ASN B O   1 
ATOM   8974  C CB  . ASN B 1 524 ? -13.380 -18.545 40.421  1.00 10.52 ? 550  ASN B CB  1 
ATOM   8975  C CG  . ASN B 1 524 ? -13.026 -19.620 41.448  1.00 10.50 ? 550  ASN B CG  1 
ATOM   8976  O OD1 . ASN B 1 524 ? -11.950 -20.206 41.398  1.00 13.84 ? 550  ASN B OD1 1 
ATOM   8977  N ND2 . ASN B 1 524 ? -13.927 -19.841 42.391  1.00 12.27 ? 550  ASN B ND2 1 
ATOM   8978  N N   . LEU B 1 525 ? -14.545 -15.535 39.959  1.00 10.22 ? 551  LEU B N   1 
ATOM   8979  C CA  . LEU B 1 525 ? -14.972 -14.473 39.055  1.00 10.36 ? 551  LEU B CA  1 
ATOM   8980  C C   . LEU B 1 525 ? -15.272 -13.236 39.906  1.00 9.46  ? 551  LEU B C   1 
ATOM   8981  O O   . LEU B 1 525 ? -16.175 -13.252 40.735  1.00 9.89  ? 551  LEU B O   1 
ATOM   8982  C CB  . LEU B 1 525 ? -16.225 -14.881 38.275  1.00 9.06  ? 551  LEU B CB  1 
ATOM   8983  C CG  . LEU B 1 525 ? -16.015 -15.800 37.070  1.00 12.79 ? 551  LEU B CG  1 
ATOM   8984  C CD1 . LEU B 1 525 ? -17.365 -16.160 36.458  1.00 9.35  ? 551  LEU B CD1 1 
ATOM   8985  C CD2 . LEU B 1 525 ? -15.115 -15.105 36.056  1.00 8.85  ? 551  LEU B CD2 1 
ATOM   8986  N N   . SER B 1 526 ? -14.496 -12.188 39.713  1.00 8.42  ? 552  SER B N   1 
ATOM   8987  C CA  . SER B 1 526 ? -14.678 -10.937 40.441  1.00 8.26  ? 552  SER B CA  1 
ATOM   8988  C C   . SER B 1 526 ? -14.978 -9.905  39.364  1.00 7.76  ? 552  SER B C   1 
ATOM   8989  O O   . SER B 1 526 ? -14.115 -9.600  38.536  1.00 7.59  ? 552  SER B O   1 
ATOM   8990  C CB  . SER B 1 526 ? -13.406 -10.582 41.205  1.00 7.58  ? 552  SER B CB  1 
ATOM   8991  O OG  . SER B 1 526 ? -13.588 -9.383  41.922  1.00 10.28 ? 552  SER B OG  1 
ATOM   8992  N N   . THR B 1 527 ? -16.190 -9.361  39.388  1.00 6.79  ? 553  THR B N   1 
ATOM   8993  C CA  . THR B 1 527 ? -16.624 -8.419  38.353  1.00 10.09 ? 553  THR B CA  1 
ATOM   8994  C C   . THR B 1 527 ? -17.255 -7.121  38.844  1.00 10.50 ? 553  THR B C   1 
ATOM   8995  O O   . THR B 1 527 ? -17.611 -6.969  40.014  1.00 10.22 ? 553  THR B O   1 
ATOM   8996  C CB  . THR B 1 527 ? -17.687 -9.068  37.456  1.00 7.72  ? 553  THR B CB  1 
ATOM   8997  O OG1 . THR B 1 527 ? -18.907 -9.167  38.203  1.00 9.75  ? 553  THR B OG1 1 
ATOM   8998  C CG2 . THR B 1 527 ? -17.265 -10.482 37.039  1.00 9.14  ? 553  THR B CG2 1 
ATOM   8999  N N   . ALA B 1 528 ? -17.437 -6.196  37.910  1.00 10.22 ? 554  ALA B N   1 
ATOM   9000  C CA  . ALA B 1 528 ? -18.051 -4.920  38.228  1.00 11.71 ? 554  ALA B CA  1 
ATOM   9001  C C   . ALA B 1 528 ? -18.364 -4.187  36.940  1.00 11.56 ? 554  ALA B C   1 
ATOM   9002  O O   . ALA B 1 528 ? -17.615 -4.269  35.976  1.00 10.32 ? 554  ALA B O   1 
ATOM   9003  C CB  . ALA B 1 528 ? -17.112 -4.081  39.074  1.00 9.69  ? 554  ALA B CB  1 
ATOM   9004  N N   . GLN B 1 529 ? -19.482 -3.481  36.919  1.00 15.64 ? 555  GLN B N   1 
ATOM   9005  C CA  . GLN B 1 529 ? -19.854 -2.709  35.748  1.00 18.62 ? 555  GLN B CA  1 
ATOM   9006  C C   . GLN B 1 529 ? -19.494 -1.257  36.035  1.00 20.23 ? 555  GLN B C   1 
ATOM   9007  O O   . GLN B 1 529 ? -19.920 -0.714  37.044  1.00 21.97 ? 555  GLN B O   1 
ATOM   9008  C CB  . GLN B 1 529 ? -21.357 -2.796  35.493  1.00 17.42 ? 555  GLN B CB  1 
ATOM   9009  C CG  . GLN B 1 529 ? -21.761 -2.177  34.180  1.00 23.64 ? 555  GLN B CG  1 
ATOM   9010  C CD  . GLN B 1 529 ? -23.171 -1.641  34.202  1.00 23.53 ? 555  GLN B CD  1 
ATOM   9011  O OE1 . GLN B 1 529 ? -23.397 -0.474  34.514  1.00 28.70 ? 555  GLN B OE1 1 
ATOM   9012  N NE2 . GLN B 1 529 ? -24.134 -2.497  33.892  1.00 25.19 ? 555  GLN B NE2 1 
ATOM   9013  N N   . VAL B 1 530 ? -18.710 -0.635  35.167  1.00 19.80 ? 556  VAL B N   1 
ATOM   9014  C CA  . VAL B 1 530 ? -18.335 0.765   35.348  1.00 23.04 ? 556  VAL B CA  1 
ATOM   9015  C C   . VAL B 1 530 ? -18.925 1.563   34.188  1.00 21.52 ? 556  VAL B C   1 
ATOM   9016  O O   . VAL B 1 530 ? -18.232 1.866   33.219  1.00 20.12 ? 556  VAL B O   1 
ATOM   9017  C CB  . VAL B 1 530 ? -16.798 0.936   35.360  1.00 26.14 ? 556  VAL B CB  1 
ATOM   9018  C CG1 . VAL B 1 530 ? -16.426 2.407   35.460  1.00 27.90 ? 556  VAL B CG1 1 
ATOM   9019  C CG2 . VAL B 1 530 ? -16.205 0.156   36.516  1.00 27.50 ? 556  VAL B CG2 1 
ATOM   9020  N N   . PRO B 1 531 ? -20.225 1.886   34.266  1.00 21.99 ? 557  PRO B N   1 
ATOM   9021  C CA  . PRO B 1 531 ? -20.910 2.644   33.215  1.00 22.97 ? 557  PRO B CA  1 
ATOM   9022  C C   . PRO B 1 531 ? -20.438 4.091   33.148  1.00 22.36 ? 557  PRO B C   1 
ATOM   9023  O O   . PRO B 1 531 ? -20.502 4.818   34.135  1.00 23.88 ? 557  PRO B O   1 
ATOM   9024  C CB  . PRO B 1 531 ? -22.378 2.529   33.612  1.00 22.47 ? 557  PRO B CB  1 
ATOM   9025  C CG  . PRO B 1 531 ? -22.302 2.504   35.106  1.00 21.85 ? 557  PRO B CG  1 
ATOM   9026  C CD  . PRO B 1 531 ? -21.158 1.547   35.353  1.00 22.57 ? 557  PRO B CD  1 
ATOM   9027  N N   . ALA B 1 532 ? -19.961 4.497   31.980  1.00 21.69 ? 558  ALA B N   1 
ATOM   9028  C CA  . ALA B 1 532 ? -19.494 5.860   31.789  1.00 20.32 ? 558  ALA B CA  1 
ATOM   9029  C C   . ALA B 1 532 ? -19.894 6.382   30.417  1.00 19.97 ? 558  ALA B C   1 
ATOM   9030  O O   . ALA B 1 532 ? -20.075 5.606   29.478  1.00 20.22 ? 558  ALA B O   1 
ATOM   9031  C CB  . ALA B 1 532 ? -17.988 5.918   31.944  1.00 19.71 ? 558  ALA B CB  1 
ATOM   9032  N N   . LYS B 1 533 ? -20.051 7.695   30.308  1.00 18.11 ? 559  LYS B N   1 
ATOM   9033  C CA  . LYS B 1 533 ? -20.406 8.294   29.031  1.00 18.80 ? 559  LYS B CA  1 
ATOM   9034  C C   . LYS B 1 533 ? -19.163 8.241   28.151  1.00 17.27 ? 559  LYS B C   1 
ATOM   9035  O O   . LYS B 1 533 ? -19.256 8.012   26.950  1.00 16.64 ? 559  LYS B O   1 
ATOM   9036  C CB  . LYS B 1 533 ? -20.879 9.740   29.222  1.00 18.82 ? 559  LYS B CB  1 
ATOM   9037  C CG  . LYS B 1 533 ? -22.163 9.848   30.027  1.00 23.76 ? 559  LYS B CG  1 
ATOM   9038  C CD  . LYS B 1 533 ? -22.526 11.299  30.318  1.00 28.80 ? 559  LYS B CD  1 
ATOM   9039  C CE  . LYS B 1 533 ? -21.524 11.944  31.268  1.00 31.45 ? 559  LYS B CE  1 
ATOM   9040  N NZ  . LYS B 1 533 ? -21.758 13.407  31.442  1.00 33.49 ? 559  LYS B NZ  1 
ATOM   9041  N N   . THR B 1 534 ? -18.000 8.434   28.766  1.00 14.63 ? 560  THR B N   1 
ATOM   9042  C CA  . THR B 1 534 ? -16.726 8.388   28.052  1.00 14.81 ? 560  THR B CA  1 
ATOM   9043  C C   . THR B 1 534 ? -16.493 6.945   27.595  1.00 14.21 ? 560  THR B C   1 
ATOM   9044  O O   . THR B 1 534 ? -16.704 6.005   28.364  1.00 14.76 ? 560  THR B O   1 
ATOM   9045  C CB  . THR B 1 534 ? -15.551 8.817   28.964  1.00 14.53 ? 560  THR B CB  1 
ATOM   9046  O OG1 . THR B 1 534 ? -15.819 10.105  29.526  1.00 18.47 ? 560  THR B OG1 1 
ATOM   9047  C CG2 . THR B 1 534 ? -14.260 8.889   28.175  1.00 14.77 ? 560  THR B CG2 1 
ATOM   9048  N N   . ASP B 1 535 ? -16.059 6.766   26.355  1.00 13.87 ? 561  ASP B N   1 
ATOM   9049  C CA  . ASP B 1 535 ? -15.814 5.427   25.833  1.00 14.28 ? 561  ASP B CA  1 
ATOM   9050  C C   . ASP B 1 535 ? -14.550 4.856   26.471  1.00 13.98 ? 561  ASP B C   1 
ATOM   9051  O O   . ASP B 1 535 ? -13.513 4.708   25.828  1.00 14.68 ? 561  ASP B O   1 
ATOM   9052  C CB  . ASP B 1 535 ? -15.679 5.490   24.312  1.00 15.30 ? 561  ASP B CB  1 
ATOM   9053  C CG  . ASP B 1 535 ? -15.573 4.119   23.676  1.00 16.88 ? 561  ASP B CG  1 
ATOM   9054  O OD1 . ASP B 1 535 ? -16.073 3.142   24.272  1.00 16.97 ? 561  ASP B OD1 1 
ATOM   9055  O OD2 . ASP B 1 535 ? -15.000 4.025   22.574  1.00 18.05 ? 561  ASP B OD2 1 
ATOM   9056  N N   . CYS B 1 536 ? -14.652 4.535   27.752  1.00 13.18 ? 562  CYS B N   1 
ATOM   9057  C CA  . CYS B 1 536 ? -13.518 4.018   28.505  1.00 12.67 ? 562  CYS B CA  1 
ATOM   9058  C C   . CYS B 1 536 ? -13.875 2.704   29.161  1.00 12.27 ? 562  CYS B C   1 
ATOM   9059  O O   . CYS B 1 536 ? -15.024 2.250   29.094  1.00 14.66 ? 562  CYS B O   1 
ATOM   9060  C CB  . CYS B 1 536 ? -13.165 5.004   29.607  1.00 10.94 ? 562  CYS B CB  1 
ATOM   9061  S SG  . CYS B 1 536 ? -14.553 5.345   30.720  1.00 18.43 ? 562  CYS B SG  1 
ATOM   9062  N N   . VAL B 1 537 ? -12.894 2.115   29.832  1.00 11.95 ? 563  VAL B N   1 
ATOM   9063  C CA  . VAL B 1 537 ? -13.128 0.879   30.542  1.00 13.56 ? 563  VAL B CA  1 
ATOM   9064  C C   . VAL B 1 537 ? -12.140 0.733   31.701  1.00 14.10 ? 563  VAL B C   1 
ATOM   9065  O O   . VAL B 1 537 ? -10.983 1.148   31.609  1.00 13.66 ? 563  VAL B O   1 
ATOM   9066  C CB  . VAL B 1 537 ? -13.017 -0.340  29.591  1.00 14.68 ? 563  VAL B CB  1 
ATOM   9067  C CG1 . VAL B 1 537 ? -11.597 -0.522  29.120  1.00 13.45 ? 563  VAL B CG1 1 
ATOM   9068  C CG2 . VAL B 1 537 ? -13.512 -1.595  30.292  1.00 18.36 ? 563  VAL B CG2 1 
ATOM   9069  N N   . GLY B 1 538 ? -12.606 0.157   32.803  1.00 15.77 ? 564  GLY B N   1 
ATOM   9070  C CA  . GLY B 1 538 ? -11.728 -0.052  33.938  1.00 15.90 ? 564  GLY B CA  1 
ATOM   9071  C C   . GLY B 1 538 ? -11.169 -1.465  33.935  1.00 16.78 ? 564  GLY B C   1 
ATOM   9072  O O   . GLY B 1 538 ? -11.551 -2.290  33.101  1.00 17.50 ? 564  GLY B O   1 
ATOM   9073  N N   . PHE B 1 539 ? -10.248 -1.747  34.854  1.00 16.00 ? 565  PHE B N   1 
ATOM   9074  C CA  . PHE B 1 539 ? -9.663  -3.075  34.977  1.00 15.58 ? 565  PHE B CA  1 
ATOM   9075  C C   . PHE B 1 539 ? -8.947  -3.244  36.309  1.00 15.67 ? 565  PHE B C   1 
ATOM   9076  O O   . PHE B 1 539 ? -8.434  -2.278  36.880  1.00 15.89 ? 565  PHE B O   1 
ATOM   9077  C CB  . PHE B 1 539 ? -8.708  -3.379  33.808  1.00 18.36 ? 565  PHE B CB  1 
ATOM   9078  C CG  . PHE B 1 539 ? -7.904  -2.200  33.353  1.00 19.29 ? 565  PHE B CG  1 
ATOM   9079  C CD1 . PHE B 1 539 ? -6.727  -1.846  34.006  1.00 20.87 ? 565  PHE B CD1 1 
ATOM   9080  C CD2 . PHE B 1 539 ? -8.334  -1.421  32.274  1.00 21.29 ? 565  PHE B CD2 1 
ATOM   9081  C CE1 . PHE B 1 539 ? -5.989  -0.728  33.593  1.00 19.67 ? 565  PHE B CE1 1 
ATOM   9082  C CE2 . PHE B 1 539 ? -7.600  -0.301  31.856  1.00 19.08 ? 565  PHE B CE2 1 
ATOM   9083  C CZ  . PHE B 1 539 ? -6.430  0.040   32.520  1.00 19.92 ? 565  PHE B CZ  1 
ATOM   9084  N N   . PHE B 1 540 ? -8.930  -4.476  36.808  1.00 14.07 ? 566  PHE B N   1 
ATOM   9085  C CA  . PHE B 1 540 ? -8.287  -4.793  38.081  1.00 13.50 ? 566  PHE B CA  1 
ATOM   9086  C C   . PHE B 1 540 ? -7.848  -6.247  38.065  1.00 13.17 ? 566  PHE B C   1 
ATOM   9087  O O   . PHE B 1 540 ? -8.358  -7.041  37.272  1.00 13.99 ? 566  PHE B O   1 
ATOM   9088  C CB  . PHE B 1 540 ? -9.264  -4.549  39.234  1.00 10.67 ? 566  PHE B CB  1 
ATOM   9089  C CG  . PHE B 1 540 ? -10.633 -5.124  39.000  1.00 13.62 ? 566  PHE B CG  1 
ATOM   9090  C CD1 . PHE B 1 540 ? -10.885 -6.475  39.214  1.00 14.21 ? 566  PHE B CD1 1 
ATOM   9091  C CD2 . PHE B 1 540 ? -11.670 -4.313  38.550  1.00 13.56 ? 566  PHE B CD2 1 
ATOM   9092  C CE1 . PHE B 1 540 ? -12.152 -7.009  38.984  1.00 13.27 ? 566  PHE B CE1 1 
ATOM   9093  C CE2 . PHE B 1 540 ? -12.936 -4.834  38.318  1.00 14.93 ? 566  PHE B CE2 1 
ATOM   9094  C CZ  . PHE B 1 540 ? -13.179 -6.192  38.537  1.00 14.24 ? 566  PHE B CZ  1 
ATOM   9095  N N   . GLY B 1 541 ? -6.904  -6.595  38.925  1.00 11.02 ? 567  GLY B N   1 
ATOM   9096  C CA  . GLY B 1 541 ? -6.441  -7.971  38.963  1.00 10.87 ? 567  GLY B CA  1 
ATOM   9097  C C   . GLY B 1 541 ? -7.429  -8.890  39.653  1.00 9.86  ? 567  GLY B C   1 
ATOM   9098  O O   . GLY B 1 541 ? -8.312  -8.417  40.366  1.00 9.97  ? 567  GLY B O   1 
ATOM   9099  N N   . PRO B 1 542 ? -7.331  -10.215 39.437  1.00 10.39 ? 568  PRO B N   1 
ATOM   9100  C CA  . PRO B 1 542 ? -8.246  -11.165 40.082  1.00 10.64 ? 568  PRO B CA  1 
ATOM   9101  C C   . PRO B 1 542 ? -8.099  -11.045 41.598  1.00 10.41 ? 568  PRO B C   1 
ATOM   9102  O O   . PRO B 1 542 ? -7.081  -10.548 42.070  1.00 11.47 ? 568  PRO B O   1 
ATOM   9103  C CB  . PRO B 1 542 ? -7.750  -12.517 39.586  1.00 11.51 ? 568  PRO B CB  1 
ATOM   9104  C CG  . PRO B 1 542 ? -7.180  -12.201 38.241  1.00 10.94 ? 568  PRO B CG  1 
ATOM   9105  C CD  . PRO B 1 542 ? -6.443  -10.905 38.481  1.00 10.42 ? 568  PRO B CD  1 
ATOM   9106  N N   . VAL B 1 543 ? -9.097  -11.505 42.360  1.00 10.95 ? 569  VAL B N   1 
ATOM   9107  C CA  . VAL B 1 543 ? -9.035  -11.444 43.823  1.00 11.27 ? 569  VAL B CA  1 
ATOM   9108  C C   . VAL B 1 543 ? -8.513  -12.744 44.429  1.00 13.01 ? 569  VAL B C   1 
ATOM   9109  O O   . VAL B 1 543 ? -8.289  -12.834 45.639  1.00 12.38 ? 569  VAL B O   1 
ATOM   9110  C CB  . VAL B 1 543 ? -10.413 -11.120 44.456  1.00 12.39 ? 569  VAL B CB  1 
ATOM   9111  C CG1 . VAL B 1 543 ? -10.859 -9.736  44.006  1.00 11.27 ? 569  VAL B CG1 1 
ATOM   9112  C CG2 . VAL B 1 543 ? -11.447 -12.195 44.099  1.00 11.05 ? 569  VAL B CG2 1 
ATOM   9113  N N   . VAL B 1 544 ? -8.333  -13.749 43.570  1.00 12.29 ? 570  VAL B N   1 
ATOM   9114  C CA  . VAL B 1 544 ? -7.808  -15.046 43.964  1.00 13.26 ? 570  VAL B CA  1 
ATOM   9115  C C   . VAL B 1 544 ? -6.801  -15.515 42.911  1.00 13.32 ? 570  VAL B C   1 
ATOM   9116  O O   . VAL B 1 544 ? -6.896  -15.150 41.740  1.00 16.34 ? 570  VAL B O   1 
ATOM   9117  C CB  . VAL B 1 544 ? -8.935  -16.115 44.116  1.00 14.08 ? 570  VAL B CB  1 
ATOM   9118  C CG1 . VAL B 1 544 ? -9.848  -15.731 45.269  1.00 14.82 ? 570  VAL B CG1 1 
ATOM   9119  C CG2 . VAL B 1 544 ? -9.726  -16.264 42.824  1.00 13.02 ? 570  VAL B CG2 1 
ATOM   9120  N N   . PRO B 1 545 ? -5.816  -16.320 43.322  1.00 12.78 ? 571  PRO B N   1 
ATOM   9121  C CA  . PRO B 1 545 ? -4.779  -16.835 42.417  1.00 14.10 ? 571  PRO B CA  1 
ATOM   9122  C C   . PRO B 1 545 ? -5.333  -17.546 41.184  1.00 13.98 ? 571  PRO B C   1 
ATOM   9123  O O   . PRO B 1 545 ? -4.765  -17.458 40.091  1.00 15.36 ? 571  PRO B O   1 
ATOM   9124  C CB  . PRO B 1 545 ? -3.977  -17.783 43.312  1.00 14.30 ? 571  PRO B CB  1 
ATOM   9125  C CG  . PRO B 1 545 ? -4.116  -17.143 44.676  1.00 13.56 ? 571  PRO B CG  1 
ATOM   9126  C CD  . PRO B 1 545 ? -5.574  -16.776 44.706  1.00 14.38 ? 571  PRO B CD  1 
ATOM   9127  N N   . ASP B 1 546 ? -6.443  -18.251 41.368  1.00 13.08 ? 572  ASP B N   1 
ATOM   9128  C CA  . ASP B 1 546 ? -7.046  -18.990 40.273  1.00 14.56 ? 572  ASP B CA  1 
ATOM   9129  C C   . ASP B 1 546 ? -8.330  -18.346 39.790  1.00 13.51 ? 572  ASP B C   1 
ATOM   9130  O O   . ASP B 1 546 ? -9.276  -19.031 39.406  1.00 13.57 ? 572  ASP B O   1 
ATOM   9131  C CB  . ASP B 1 546 ? -7.313  -20.439 40.722  1.00 14.99 ? 572  ASP B CB  1 
ATOM   9132  C CG  . ASP B 1 546 ? -8.269  -20.520 41.907  1.00 19.31 ? 572  ASP B CG  1 
ATOM   9133  O OD1 . ASP B 1 546 ? -8.312  -19.564 42.717  1.00 19.35 ? 572  ASP B OD1 1 
ATOM   9134  O OD2 . ASP B 1 546 ? -8.971  -21.546 42.046  1.00 18.14 ? 572  ASP B OD2 1 
ATOM   9135  N N   . GLY B 1 547 ? -8.366  -17.009 39.797  1.00 11.22 ? 573  GLY B N   1 
ATOM   9136  C CA  . GLY B 1 547 ? -9.561  -16.325 39.358  1.00 9.61  ? 573  GLY B CA  1 
ATOM   9137  C C   . GLY B 1 547 ? -9.338  -15.327 38.244  1.00 10.40 ? 573  GLY B C   1 
ATOM   9138  O O   . GLY B 1 547 ? -8.227  -15.185 37.719  1.00 8.65  ? 573  GLY B O   1 
ATOM   9139  N N   . TYR B 1 548 ? -10.415 -14.637 37.876  1.00 9.90  ? 574  TYR B N   1 
ATOM   9140  C CA  . TYR B 1 548 ? -10.367 -13.624 36.838  1.00 8.69  ? 574  TYR B CA  1 
ATOM   9141  C C   . TYR B 1 548 ? -10.920 -12.308 37.368  1.00 10.08 ? 574  TYR B C   1 
ATOM   9142  O O   . TYR B 1 548 ? -11.827 -12.291 38.198  1.00 10.28 ? 574  TYR B O   1 
ATOM   9143  C CB  . TYR B 1 548 ? -11.230 -14.013 35.632  1.00 10.47 ? 574  TYR B CB  1 
ATOM   9144  C CG  . TYR B 1 548 ? -10.786 -15.217 34.846  1.00 9.19  ? 574  TYR B CG  1 
ATOM   9145  C CD1 . TYR B 1 548 ? -11.289 -16.477 35.135  1.00 12.23 ? 574  TYR B CD1 1 
ATOM   9146  C CD2 . TYR B 1 548 ? -9.905  -15.081 33.778  1.00 10.47 ? 574  TYR B CD2 1 
ATOM   9147  C CE1 . TYR B 1 548 ? -10.927 -17.592 34.375  1.00 12.78 ? 574  TYR B CE1 1 
ATOM   9148  C CE2 . TYR B 1 548 ? -9.531  -16.181 33.008  1.00 12.25 ? 574  TYR B CE2 1 
ATOM   9149  C CZ  . TYR B 1 548 ? -10.049 -17.437 33.317  1.00 12.20 ? 574  TYR B CZ  1 
ATOM   9150  O OH  . TYR B 1 548 ? -9.706  -18.541 32.573  1.00 16.22 ? 574  TYR B OH  1 
ATOM   9151  N N   . GLY B 1 549 ? -10.371 -11.213 36.864  1.00 9.98  ? 575  GLY B N   1 
ATOM   9152  C CA  . GLY B 1 549 ? -10.857 -9.890  37.220  1.00 9.88  ? 575  GLY B CA  1 
ATOM   9153  C C   . GLY B 1 549 ? -11.552 -9.357  35.975  1.00 9.59  ? 575  GLY B C   1 
ATOM   9154  O O   . GLY B 1 549 ? -10.898 -9.115  34.967  1.00 9.00  ? 575  GLY B O   1 
ATOM   9155  N N   . ILE B 1 550 ? -12.864 -9.183  36.018  1.00 9.73  ? 576  ILE B N   1 
ATOM   9156  C CA  . ILE B 1 550 ? -13.562 -8.694  34.832  1.00 10.81 ? 576  ILE B CA  1 
ATOM   9157  C C   . ILE B 1 550 ? -14.320 -7.404  35.039  1.00 10.28 ? 576  ILE B C   1 
ATOM   9158  O O   . ILE B 1 550 ? -15.178 -7.298  35.910  1.00 10.99 ? 576  ILE B O   1 
ATOM   9159  C CB  . ILE B 1 550 ? -14.538 -9.755  34.282  1.00 9.94  ? 576  ILE B CB  1 
ATOM   9160  C CG1 . ILE B 1 550 ? -13.750 -11.000 33.864  1.00 10.94 ? 576  ILE B CG1 1 
ATOM   9161  C CG2 . ILE B 1 550 ? -15.283 -9.204  33.072  1.00 10.91 ? 576  ILE B CG2 1 
ATOM   9162  C CD1 . ILE B 1 550 ? -14.605 -12.223 33.617  1.00 11.70 ? 576  ILE B CD1 1 
ATOM   9163  N N   . CYS B 1 551 ? -14.000 -6.411  34.212  1.00 9.45  ? 577  CYS B N   1 
ATOM   9164  C CA  . CYS B 1 551 ? -14.647 -5.112  34.317  1.00 10.96 ? 577  CYS B CA  1 
ATOM   9165  C C   . CYS B 1 551 ? -15.207 -4.707  32.958  1.00 10.75 ? 577  CYS B C   1 
ATOM   9166  O O   . CYS B 1 551 ? -14.601 -4.984  31.926  1.00 12.01 ? 577  CYS B O   1 
ATOM   9167  C CB  . CYS B 1 551 ? -13.634 -4.072  34.804  1.00 10.44 ? 577  CYS B CB  1 
ATOM   9168  S SG  . CYS B 1 551 ? -14.348 -2.452  35.159  1.00 17.30 ? 577  CYS B SG  1 
ATOM   9169  N N   . TYR B 1 552 ? -16.355 -4.048  32.943  1.00 11.74 ? 578  TYR B N   1 
ATOM   9170  C CA  . TYR B 1 552 ? -16.924 -3.658  31.664  1.00 12.60 ? 578  TYR B CA  1 
ATOM   9171  C C   . TYR B 1 552 ? -17.739 -2.384  31.706  1.00 14.75 ? 578  TYR B C   1 
ATOM   9172  O O   . TYR B 1 552 ? -18.295 -2.009  32.745  1.00 15.75 ? 578  TYR B O   1 
ATOM   9173  C CB  . TYR B 1 552 ? -17.786 -4.785  31.102  1.00 12.32 ? 578  TYR B CB  1 
ATOM   9174  C CG  . TYR B 1 552 ? -18.818 -5.287  32.076  1.00 10.03 ? 578  TYR B CG  1 
ATOM   9175  C CD1 . TYR B 1 552 ? -18.469 -6.170  33.094  1.00 9.96  ? 578  TYR B CD1 1 
ATOM   9176  C CD2 . TYR B 1 552 ? -20.142 -4.856  32.000  1.00 10.43 ? 578  TYR B CD2 1 
ATOM   9177  C CE1 . TYR B 1 552 ? -19.414 -6.616  34.016  1.00 9.14  ? 578  TYR B CE1 1 
ATOM   9178  C CE2 . TYR B 1 552 ? -21.096 -5.292  32.922  1.00 10.05 ? 578  TYR B CE2 1 
ATOM   9179  C CZ  . TYR B 1 552 ? -20.723 -6.174  33.924  1.00 9.12  ? 578  TYR B CZ  1 
ATOM   9180  O OH  . TYR B 1 552 ? -21.665 -6.625  34.814  1.00 10.43 ? 578  TYR B OH  1 
ATOM   9181  N N   . ASN B 1 553 ? -17.794 -1.720  30.554  1.00 13.63 ? 579  ASN B N   1 
ATOM   9182  C CA  . ASN B 1 553 ? -18.545 -0.488  30.402  1.00 13.19 ? 579  ASN B CA  1 
ATOM   9183  C C   . ASN B 1 553 ? -19.490 -0.694  29.237  1.00 13.43 ? 579  ASN B C   1 
ATOM   9184  O O   . ASN B 1 553 ? -19.113 -0.544  28.076  1.00 13.01 ? 579  ASN B O   1 
ATOM   9185  C CB  . ASN B 1 553 ? -17.608 0.685   30.112  1.00 11.68 ? 579  ASN B CB  1 
ATOM   9186  C CG  . ASN B 1 553 ? -18.359 1.946   29.706  1.00 13.58 ? 579  ASN B CG  1 
ATOM   9187  O OD1 . ASN B 1 553 ? -19.580 2.025   29.831  1.00 11.61 ? 579  ASN B OD1 1 
ATOM   9188  N ND2 . ASN B 1 553 ? -17.623 2.944   29.222  1.00 14.28 ? 579  ASN B ND2 1 
ATOM   9189  N N   . PRO B 1 554 ? -20.740 -1.046  29.535  1.00 13.78 ? 580  PRO B N   1 
ATOM   9190  C CA  . PRO B 1 554 ? -21.731 -1.272  28.485  1.00 13.84 ? 580  PRO B CA  1 
ATOM   9191  C C   . PRO B 1 554 ? -22.198 0.025   27.835  1.00 15.04 ? 580  PRO B C   1 
ATOM   9192  O O   . PRO B 1 554 ? -22.912 0.812   28.453  1.00 15.93 ? 580  PRO B O   1 
ATOM   9193  C CB  . PRO B 1 554 ? -22.853 -1.991  29.228  1.00 13.61 ? 580  PRO B CB  1 
ATOM   9194  C CG  . PRO B 1 554 ? -22.798 -1.367  30.582  1.00 13.93 ? 580  PRO B CG  1 
ATOM   9195  C CD  . PRO B 1 554 ? -21.319 -1.247  30.875  1.00 12.16 ? 580  PRO B CD  1 
ATOM   9196  N N   . MET B 1 555 ? -21.780 0.252   26.589  1.00 14.61 ? 581  MET B N   1 
ATOM   9197  C CA  . MET B 1 555 ? -22.195 1.443   25.861  1.00 15.80 ? 581  MET B CA  1 
ATOM   9198  C C   . MET B 1 555 ? -23.473 1.071   25.105  1.00 15.77 ? 581  MET B C   1 
ATOM   9199  O O   . MET B 1 555 ? -23.995 -0.033  25.267  1.00 15.74 ? 581  MET B O   1 
ATOM   9200  C CB  . MET B 1 555 ? -21.117 1.885   24.871  1.00 17.42 ? 581  MET B CB  1 
ATOM   9201  C CG  . MET B 1 555 ? -19.739 2.113   25.486  1.00 20.64 ? 581  MET B CG  1 
ATOM   9202  S SD  . MET B 1 555 ? -19.640 3.516   26.601  1.00 24.55 ? 581  MET B SD  1 
ATOM   9203  C CE  . MET B 1 555 ? -19.374 4.798   25.449  1.00 20.21 ? 581  MET B CE  1 
ATOM   9204  N N   . GLU B 1 556 ? -23.969 1.975   24.276  1.00 15.12 ? 582  GLU B N   1 
ATOM   9205  C CA  . GLU B 1 556 ? -25.202 1.722   23.538  1.00 16.86 ? 582  GLU B CA  1 
ATOM   9206  C C   . GLU B 1 556 ? -25.085 0.638   22.462  1.00 16.30 ? 582  GLU B C   1 
ATOM   9207  O O   . GLU B 1 556 ? -25.879 -0.307  22.441  1.00 14.84 ? 582  GLU B O   1 
ATOM   9208  C CB  . GLU B 1 556 ? -25.698 3.023   22.899  1.00 19.31 ? 582  GLU B CB  1 
ATOM   9209  C CG  . GLU B 1 556 ? -27.060 2.932   22.212  1.00 21.58 ? 582  GLU B CG  1 
ATOM   9210  C CD  . GLU B 1 556 ? -28.144 2.334   23.096  1.00 25.11 ? 582  GLU B CD  1 
ATOM   9211  O OE1 . GLU B 1 556 ? -28.106 2.540   24.328  1.00 25.91 ? 582  GLU B OE1 1 
ATOM   9212  O OE2 . GLU B 1 556 ? -29.050 1.665   22.555  1.00 27.41 ? 582  GLU B OE2 1 
ATOM   9213  N N   . ALA B 1 557 ? -24.094 0.773   21.587  1.00 16.31 ? 583  ALA B N   1 
ATOM   9214  C CA  . ALA B 1 557 ? -23.901 -0.162  20.482  1.00 16.07 ? 583  ALA B CA  1 
ATOM   9215  C C   . ALA B 1 557 ? -22.714 -1.105  20.645  1.00 15.01 ? 583  ALA B C   1 
ATOM   9216  O O   . ALA B 1 557 ? -22.465 -1.941  19.767  1.00 14.68 ? 583  ALA B O   1 
ATOM   9217  C CB  . ALA B 1 557 ? -23.780 0.612   19.168  1.00 15.61 ? 583  ALA B CB  1 
ATOM   9218  N N   . HIS B 1 558 ? -21.974 -0.959  21.747  1.00 12.68 ? 584  HIS B N   1 
ATOM   9219  C CA  . HIS B 1 558 ? -20.839 -1.837  22.029  1.00 12.74 ? 584  HIS B CA  1 
ATOM   9220  C C   . HIS B 1 558 ? -20.554 -1.926  23.529  1.00 13.53 ? 584  HIS B C   1 
ATOM   9221  O O   . HIS B 1 558 ? -21.148 -1.211  24.338  1.00 12.11 ? 584  HIS B O   1 
ATOM   9222  C CB  . HIS B 1 558 ? -19.565 -1.389  21.293  1.00 12.58 ? 584  HIS B CB  1 
ATOM   9223  C CG  . HIS B 1 558 ? -19.000 -0.087  21.774  1.00 14.97 ? 584  HIS B CG  1 
ATOM   9224  N ND1 . HIS B 1 558 ? -19.588 1.129   21.499  1.00 15.97 ? 584  HIS B ND1 1 
ATOM   9225  C CD2 . HIS B 1 558 ? -17.896 0.188   22.510  1.00 16.27 ? 584  HIS B CD2 1 
ATOM   9226  C CE1 . HIS B 1 558 ? -18.871 2.097   22.042  1.00 15.53 ? 584  HIS B CE1 1 
ATOM   9227  N NE2 . HIS B 1 558 ? -17.839 1.554   22.662  1.00 17.04 ? 584  HIS B NE2 1 
ATOM   9228  N N   . ILE B 1 559 ? -19.657 -2.823  23.892  1.00 12.45 ? 585  ILE B N   1 
ATOM   9229  C CA  . ILE B 1 559 ? -19.307 -3.006  25.292  1.00 13.14 ? 585  ILE B CA  1 
ATOM   9230  C C   . ILE B 1 559 ? -17.803 -3.127  25.444  1.00 13.84 ? 585  ILE B C   1 
ATOM   9231  O O   . ILE B 1 559 ? -17.172 -3.935  24.761  1.00 13.05 ? 585  ILE B O   1 
ATOM   9232  C CB  . ILE B 1 559 ? -19.933 -4.294  25.876  1.00 12.08 ? 585  ILE B CB  1 
ATOM   9233  C CG1 . ILE B 1 559 ? -21.446 -4.315  25.640  1.00 13.79 ? 585  ILE B CG1 1 
ATOM   9234  C CG2 . ILE B 1 559 ? -19.615 -4.376  27.360  1.00 10.83 ? 585  ILE B CG2 1 
ATOM   9235  C CD1 . ILE B 1 559 ? -22.103 -5.646  26.007  1.00 12.87 ? 585  ILE B CD1 1 
ATOM   9236  N N   . ASN B 1 560 ? -17.232 -2.324  26.344  1.00 12.22 ? 586  ASN B N   1 
ATOM   9237  C CA  . ASN B 1 560 ? -15.802 -2.375  26.607  1.00 12.38 ? 586  ASN B CA  1 
ATOM   9238  C C   . ASN B 1 560 ? -15.566 -3.407  27.712  1.00 12.46 ? 586  ASN B C   1 
ATOM   9239  O O   . ASN B 1 560 ? -16.209 -3.360  28.756  1.00 13.75 ? 586  ASN B O   1 
ATOM   9240  C CB  . ASN B 1 560 ? -15.307 -1.000  27.059  1.00 12.70 ? 586  ASN B CB  1 
ATOM   9241  C CG  . ASN B 1 560 ? -15.416 0.046   25.962  1.00 14.96 ? 586  ASN B CG  1 
ATOM   9242  O OD1 . ASN B 1 560 ? -15.576 1.236   26.240  1.00 17.87 ? 586  ASN B OD1 1 
ATOM   9243  N ND2 . ASN B 1 560 ? -15.316 -0.391  24.715  1.00 9.47  ? 586  ASN B ND2 1 
ATOM   9244  N N   . PHE B 1 561 ? -14.647 -4.345  27.473  1.00 11.18 ? 587  PHE B N   1 
ATOM   9245  C CA  . PHE B 1 561 ? -14.355 -5.394  28.445  1.00 11.31 ? 587  PHE B CA  1 
ATOM   9246  C C   . PHE B 1 561 ? -12.877 -5.435  28.814  1.00 11.13 ? 587  PHE B C   1 
ATOM   9247  O O   . PHE B 1 561 ? -12.016 -5.110  28.005  1.00 11.05 ? 587  PHE B O   1 
ATOM   9248  C CB  . PHE B 1 561 ? -14.725 -6.780  27.869  1.00 10.87 ? 587  PHE B CB  1 
ATOM   9249  C CG  . PHE B 1 561 ? -16.192 -7.121  27.948  1.00 10.03 ? 587  PHE B CG  1 
ATOM   9250  C CD1 . PHE B 1 561 ? -16.777 -7.432  29.171  1.00 10.41 ? 587  PHE B CD1 1 
ATOM   9251  C CD2 . PHE B 1 561 ? -16.986 -7.156  26.798  1.00 10.17 ? 587  PHE B CD2 1 
ATOM   9252  C CE1 . PHE B 1 561 ? -18.132 -7.773  29.256  1.00 8.80  ? 587  PHE B CE1 1 
ATOM   9253  C CE2 . PHE B 1 561 ? -18.349 -7.498  26.877  1.00 7.69  ? 587  PHE B CE2 1 
ATOM   9254  C CZ  . PHE B 1 561 ? -18.920 -7.804  28.105  1.00 7.89  ? 587  PHE B CZ  1 
ATOM   9255  N N   . SER B 1 562 ? -12.585 -5.851  30.044  1.00 10.69 ? 588  SER B N   1 
ATOM   9256  C CA  . SER B 1 562 ? -11.202 -6.028  30.470  1.00 11.59 ? 588  SER B CA  1 
ATOM   9257  C C   . SER B 1 562 ? -11.199 -7.343  31.249  1.00 11.57 ? 588  SER B C   1 
ATOM   9258  O O   . SER B 1 562 ? -12.037 -7.550  32.123  1.00 15.14 ? 588  SER B O   1 
ATOM   9259  C CB  . SER B 1 562 ? -10.711 -4.874  31.357  1.00 12.23 ? 588  SER B CB  1 
ATOM   9260  O OG  . SER B 1 562 ? -11.155 -4.997  32.701  1.00 13.36 ? 588  SER B OG  1 
ATOM   9261  N N   . VAL B 1 563 ? -10.287 -8.247  30.907  1.00 9.97  ? 589  VAL B N   1 
ATOM   9262  C CA  . VAL B 1 563 ? -10.213 -9.524  31.608  1.00 10.52 ? 589  VAL B CA  1 
ATOM   9263  C C   . VAL B 1 563 ? -8.796  -9.773  32.094  1.00 10.84 ? 589  VAL B C   1 
ATOM   9264  O O   . VAL B 1 563 ? -7.853  -9.752  31.293  1.00 11.48 ? 589  VAL B O   1 
ATOM   9265  C CB  . VAL B 1 563 ? -10.624 -10.722 30.707  1.00 10.66 ? 589  VAL B CB  1 
ATOM   9266  C CG1 . VAL B 1 563 ? -10.543 -12.019 31.501  1.00 9.04  ? 589  VAL B CG1 1 
ATOM   9267  C CG2 . VAL B 1 563 ? -12.026 -10.517 30.177  1.00 9.45  ? 589  VAL B CG2 1 
ATOM   9268  N N   . SER B 1 564 ? -8.636  -10.015 33.395  1.00 9.15  ? 590  SER B N   1 
ATOM   9269  C CA  . SER B 1 564 ? -7.308  -10.276 33.940  1.00 9.32  ? 590  SER B CA  1 
ATOM   9270  C C   . SER B 1 564 ? -7.221  -11.651 34.576  1.00 9.93  ? 590  SER B C   1 
ATOM   9271  O O   . SER B 1 564 ? -8.224  -12.221 34.988  1.00 10.82 ? 590  SER B O   1 
ATOM   9272  C CB  . SER B 1 564 ? -6.944  -9.241  35.002  1.00 7.84  ? 590  SER B CB  1 
ATOM   9273  O OG  . SER B 1 564 ? -7.832  -9.336  36.110  1.00 11.23 ? 590  SER B OG  1 
ATOM   9274  N N   . ALA B 1 565 ? -6.004  -12.167 34.663  1.00 10.97 ? 591  ALA B N   1 
ATOM   9275  C CA  . ALA B 1 565 ? -5.777  -13.469 35.258  1.00 11.34 ? 591  ALA B CA  1 
ATOM   9276  C C   . ALA B 1 565 ? -4.317  -13.570 35.645  1.00 11.66 ? 591  ALA B C   1 
ATOM   9277  O O   . ALA B 1 565 ? -3.510  -12.741 35.231  1.00 12.95 ? 591  ALA B O   1 
ATOM   9278  C CB  . ALA B 1 565 ? -6.129  -14.562 34.255  1.00 10.86 ? 591  ALA B CB  1 
ATOM   9279  N N   . TYR B 1 566 ? -3.975  -14.578 36.440  1.00 12.38 ? 592  TYR B N   1 
ATOM   9280  C CA  . TYR B 1 566 ? -2.587  -14.771 36.837  1.00 13.31 ? 592  TYR B CA  1 
ATOM   9281  C C   . TYR B 1 566 ? -1.966  -15.946 36.084  1.00 13.57 ? 592  TYR B C   1 
ATOM   9282  O O   . TYR B 1 566 ? -2.561  -17.021 36.006  1.00 14.90 ? 592  TYR B O   1 
ATOM   9283  C CB  . TYR B 1 566 ? -2.480  -15.004 38.347  1.00 11.15 ? 592  TYR B CB  1 
ATOM   9284  C CG  . TYR B 1 566 ? -2.931  -13.819 39.162  1.00 12.44 ? 592  TYR B CG  1 
ATOM   9285  C CD1 . TYR B 1 566 ? -2.326  -12.574 39.010  1.00 11.17 ? 592  TYR B CD1 1 
ATOM   9286  C CD2 . TYR B 1 566 ? -3.981  -13.938 40.065  1.00 13.20 ? 592  TYR B CD2 1 
ATOM   9287  C CE1 . TYR B 1 566 ? -2.762  -11.470 39.735  1.00 11.53 ? 592  TYR B CE1 1 
ATOM   9288  C CE2 . TYR B 1 566 ? -4.426  -12.847 40.801  1.00 12.84 ? 592  TYR B CE2 1 
ATOM   9289  C CZ  . TYR B 1 566 ? -3.815  -11.615 40.630  1.00 12.96 ? 592  TYR B CZ  1 
ATOM   9290  O OH  . TYR B 1 566 ? -4.293  -10.532 41.333  1.00 14.42 ? 592  TYR B OH  1 
ATOM   9291  N N   . ASN B 1 567 ? -0.768  -15.745 35.543  1.00 14.18 ? 593  ASN B N   1 
ATOM   9292  C CA  . ASN B 1 567 ? -0.087  -16.808 34.809  1.00 16.57 ? 593  ASN B CA  1 
ATOM   9293  C C   . ASN B 1 567 ? 0.387   -17.939 35.721  1.00 17.03 ? 593  ASN B C   1 
ATOM   9294  O O   . ASN B 1 567 ? 0.618   -19.048 35.262  1.00 18.77 ? 593  ASN B O   1 
ATOM   9295  C CB  . ASN B 1 567 ? 1.101   -16.246 34.023  1.00 15.62 ? 593  ASN B CB  1 
ATOM   9296  C CG  . ASN B 1 567 ? 0.683   -15.255 32.965  1.00 15.68 ? 593  ASN B CG  1 
ATOM   9297  O OD1 . ASN B 1 567 ? -0.274  -15.485 32.226  1.00 16.95 ? 593  ASN B OD1 1 
ATOM   9298  N ND2 . ASN B 1 567 ? 1.406   -14.145 32.871  1.00 14.60 ? 593  ASN B ND2 1 
ATOM   9299  N N   . SER B 1 568 ? 0.527   -17.650 37.004  1.00 17.59 ? 594  SER B N   1 
ATOM   9300  C CA  . SER B 1 568 ? 0.964   -18.650 37.977  1.00 19.44 ? 594  SER B CA  1 
ATOM   9301  C C   . SER B 1 568 ? -0.090  -19.750 38.114  1.00 20.40 ? 594  SER B C   1 
ATOM   9302  O O   . SER B 1 568 ? 0.144   -20.785 38.739  1.00 22.24 ? 594  SER B O   1 
ATOM   9303  C CB  . SER B 1 568 ? 1.191   -18.001 39.337  1.00 19.05 ? 594  SER B CB  1 
ATOM   9304  O OG  . SER B 1 568 ? -0.037  -17.536 39.849  1.00 22.82 ? 594  SER B OG  1 
ATOM   9305  N N   . CYS B 1 569 ? -1.263  -19.509 37.546  1.00 18.78 ? 595  CYS B N   1 
ATOM   9306  C CA  . CYS B 1 569 ? -2.334  -20.487 37.594  1.00 19.04 ? 595  CYS B CA  1 
ATOM   9307  C C   . CYS B 1 569 ? -2.622  -20.979 36.187  1.00 18.49 ? 595  CYS B C   1 
ATOM   9308  O O   . CYS B 1 569 ? -3.236  -20.269 35.389  1.00 17.67 ? 595  CYS B O   1 
ATOM   9309  C CB  . CYS B 1 569 ? -3.602  -19.880 38.190  1.00 18.62 ? 595  CYS B CB  1 
ATOM   9310  S SG  . CYS B 1 569 ? -5.006  -21.003 38.133  1.00 19.60 ? 595  CYS B SG  1 
ATOM   9311  N N   . ALA B 1 570 ? -2.183  -22.196 35.889  1.00 18.57 ? 596  ALA B N   1 
ATOM   9312  C CA  . ALA B 1 570 ? -2.390  -22.783 34.573  1.00 19.03 ? 596  ALA B CA  1 
ATOM   9313  C C   . ALA B 1 570 ? -3.868  -22.972 34.256  1.00 18.79 ? 596  ALA B C   1 
ATOM   9314  O O   . ALA B 1 570 ? -4.244  -23.191 33.114  1.00 19.39 ? 596  ALA B O   1 
ATOM   9315  C CB  . ALA B 1 570 ? -1.658  -24.126 34.486  1.00 19.70 ? 596  ALA B CB  1 
ATOM   9316  N N   . GLU B 1 571 ? -4.709  -22.873 35.273  1.00 19.99 ? 597  GLU B N   1 
ATOM   9317  C CA  . GLU B 1 571 ? -6.137  -23.069 35.086  1.00 22.06 ? 597  GLU B CA  1 
ATOM   9318  C C   . GLU B 1 571 ? -6.893  -21.865 34.537  1.00 21.21 ? 597  GLU B C   1 
ATOM   9319  O O   . GLU B 1 571 ? -8.082  -21.964 34.229  1.00 22.66 ? 597  GLU B O   1 
ATOM   9320  C CB  . GLU B 1 571 ? -6.773  -23.504 36.409  1.00 24.53 ? 597  GLU B CB  1 
ATOM   9321  C CG  . GLU B 1 571 ? -7.336  -24.901 36.380  1.00 31.47 ? 597  GLU B CG  1 
ATOM   9322  C CD  . GLU B 1 571 ? -6.343  -25.912 35.870  1.00 32.39 ? 597  GLU B CD  1 
ATOM   9323  O OE1 . GLU B 1 571 ? -5.349  -26.193 36.574  1.00 34.11 ? 597  GLU B OE1 1 
ATOM   9324  O OE2 . GLU B 1 571 ? -6.559  -26.420 34.753  1.00 38.67 ? 597  GLU B OE2 1 
ATOM   9325  N N   . THR B 1 572 ? -6.213  -20.726 34.408  1.00 18.52 ? 598  THR B N   1 
ATOM   9326  C CA  . THR B 1 572 ? -6.867  -19.525 33.900  1.00 14.93 ? 598  THR B CA  1 
ATOM   9327  C C   . THR B 1 572 ? -6.131  -18.939 32.707  1.00 14.72 ? 598  THR B C   1 
ATOM   9328  O O   . THR B 1 572 ? -4.924  -19.082 32.565  1.00 13.44 ? 598  THR B O   1 
ATOM   9329  C CB  . THR B 1 572 ? -6.959  -18.411 34.983  1.00 13.86 ? 598  THR B CB  1 
ATOM   9330  O OG1 . THR B 1 572 ? -5.637  -18.013 35.367  1.00 12.42 ? 598  THR B OG1 1 
ATOM   9331  C CG2 . THR B 1 572 ? -7.725  -18.897 36.210  1.00 12.37 ? 598  THR B CG2 1 
ATOM   9332  N N   . ASN B 1 573 ? -6.877  -18.265 31.845  1.00 14.23 ? 599  ASN B N   1 
ATOM   9333  C CA  . ASN B 1 573 ? -6.292  -17.631 30.680  1.00 14.55 ? 599  ASN B CA  1 
ATOM   9334  C C   . ASN B 1 573 ? -7.217  -16.517 30.246  1.00 13.79 ? 599  ASN B C   1 
ATOM   9335  O O   . ASN B 1 573 ? -8.334  -16.768 29.802  1.00 12.86 ? 599  ASN B O   1 
ATOM   9336  C CB  . ASN B 1 573 ? -6.109  -18.648 29.553  1.00 17.01 ? 599  ASN B CB  1 
ATOM   9337  C CG  . ASN B 1 573 ? -5.424  -18.050 28.349  1.00 16.94 ? 599  ASN B CG  1 
ATOM   9338  O OD1 . ASN B 1 573 ? -6.053  -17.382 27.533  1.00 18.38 ? 599  ASN B OD1 1 
ATOM   9339  N ND2 . ASN B 1 573 ? -4.117  -18.256 28.250  1.00 21.92 ? 599  ASN B ND2 1 
ATOM   9340  N N   . ALA B 1 574 ? -6.746  -15.280 30.394  1.00 14.49 ? 600  ALA B N   1 
ATOM   9341  C CA  . ALA B 1 574 ? -7.528  -14.107 30.043  1.00 14.13 ? 600  ALA B CA  1 
ATOM   9342  C C   . ALA B 1 574 ? -8.086  -14.133 28.619  1.00 13.80 ? 600  ALA B C   1 
ATOM   9343  O O   . ALA B 1 574 ? -9.272  -13.878 28.406  1.00 14.28 ? 600  ALA B O   1 
ATOM   9344  C CB  . ALA B 1 574 ? -6.687  -12.838 30.263  1.00 14.39 ? 600  ALA B CB  1 
ATOM   9345  N N   . ALA B 1 575 ? -7.239  -14.448 27.645  1.00 15.25 ? 601  ALA B N   1 
ATOM   9346  C CA  . ALA B 1 575 ? -7.669  -14.493 26.243  1.00 15.79 ? 601  ALA B CA  1 
ATOM   9347  C C   . ALA B 1 575 ? -8.800  -15.503 26.030  1.00 15.58 ? 601  ALA B C   1 
ATOM   9348  O O   . ALA B 1 575 ? -9.797  -15.202 25.379  1.00 17.86 ? 601  ALA B O   1 
ATOM   9349  C CB  . ALA B 1 575 ? -6.472  -14.834 25.328  1.00 13.97 ? 601  ALA B CB  1 
ATOM   9350  N N   . ARG B 1 576 ? -8.654  -16.693 26.593  1.00 16.67 ? 602  ARG B N   1 
ATOM   9351  C CA  . ARG B 1 576 ? -9.671  -17.722 26.444  1.00 16.30 ? 602  ARG B CA  1 
ATOM   9352  C C   . ARG B 1 576 ? -10.975 -17.284 27.104  1.00 13.74 ? 602  ARG B C   1 
ATOM   9353  O O   . ARG B 1 576 ? -12.047 -17.378 26.509  1.00 14.06 ? 602  ARG B O   1 
ATOM   9354  C CB  . ARG B 1 576 ? -9.161  -19.028 27.058  1.00 17.27 ? 602  ARG B CB  1 
ATOM   9355  C CG  . ARG B 1 576 ? -10.038 -20.240 26.806  1.00 21.00 ? 602  ARG B CG  1 
ATOM   9356  C CD  . ARG B 1 576 ? -9.171  -21.475 26.564  1.00 25.22 ? 602  ARG B CD  1 
ATOM   9357  N NE  . ARG B 1 576 ? -9.966  -22.648 26.211  1.00 31.25 ? 602  ARG B NE  1 
ATOM   9358  C CZ  . ARG B 1 576 ? -10.562 -23.444 27.095  1.00 32.66 ? 602  ARG B CZ  1 
ATOM   9359  N NH1 . ARG B 1 576 ? -10.447 -23.197 28.393  1.00 36.37 ? 602  ARG B NH1 1 
ATOM   9360  N NH2 . ARG B 1 576 ? -11.281 -24.479 26.682  1.00 34.03 ? 602  ARG B NH2 1 
ATOM   9361  N N   . MET B 1 577 ? -10.887 -16.792 28.325  1.00 13.47 ? 603  MET B N   1 
ATOM   9362  C CA  . MET B 1 577 ? -12.084 -16.349 29.025  1.00 13.56 ? 603  MET B CA  1 
ATOM   9363  C C   . MET B 1 577 ? -12.797 -15.260 28.219  1.00 12.38 ? 603  MET B C   1 
ATOM   9364  O O   . MET B 1 577 ? -14.017 -15.279 28.082  1.00 13.29 ? 603  MET B O   1 
ATOM   9365  C CB  . MET B 1 577 ? -11.708 -15.832 30.420  1.00 13.66 ? 603  MET B CB  1 
ATOM   9366  C CG  . MET B 1 577 ? -12.874 -15.363 31.287  1.00 15.51 ? 603  MET B CG  1 
ATOM   9367  S SD  . MET B 1 577 ? -14.223 -16.535 31.440  1.00 20.26 ? 603  MET B SD  1 
ATOM   9368  C CE  . MET B 1 577 ? -13.692 -17.463 32.677  1.00 12.39 ? 603  MET B CE  1 
ATOM   9369  N N   . ALA B 1 578 ? -12.028 -14.328 27.668  1.00 13.18 ? 604  ALA B N   1 
ATOM   9370  C CA  . ALA B 1 578 ? -12.603 -13.232 26.897  1.00 12.88 ? 604  ALA B CA  1 
ATOM   9371  C C   . ALA B 1 578 ? -13.296 -13.757 25.649  1.00 13.12 ? 604  ALA B C   1 
ATOM   9372  O O   . ALA B 1 578 ? -14.381 -13.294 25.295  1.00 13.53 ? 604  ALA B O   1 
ATOM   9373  C CB  . ALA B 1 578 ? -11.521 -12.223 26.516  1.00 12.76 ? 604  ALA B CB  1 
ATOM   9374  N N   . HIS B 1 579 ? -12.676 -14.737 25.003  1.00 12.77 ? 605  HIS B N   1 
ATOM   9375  C CA  . HIS B 1 579 ? -13.230 -15.337 23.792  1.00 14.59 ? 605  HIS B CA  1 
ATOM   9376  C C   . HIS B 1 579 ? -14.552 -16.044 24.071  1.00 13.05 ? 605  HIS B C   1 
ATOM   9377  O O   . HIS B 1 579 ? -15.510 -15.893 23.319  1.00 13.23 ? 605  HIS B O   1 
ATOM   9378  C CB  . HIS B 1 579 ? -12.231 -16.338 23.202  1.00 15.51 ? 605  HIS B CB  1 
ATOM   9379  C CG  . HIS B 1 579 ? -10.985 -15.703 22.663  1.00 17.57 ? 605  HIS B CG  1 
ATOM   9380  N ND1 . HIS B 1 579 ? -9.817  -16.408 22.465  1.00 21.07 ? 605  HIS B ND1 1 
ATOM   9381  C CD2 . HIS B 1 579 ? -10.740 -14.441 22.240  1.00 20.24 ? 605  HIS B CD2 1 
ATOM   9382  C CE1 . HIS B 1 579 ? -8.905  -15.605 21.941  1.00 22.54 ? 605  HIS B CE1 1 
ATOM   9383  N NE2 . HIS B 1 579 ? -9.441  -14.405 21.793  1.00 21.49 ? 605  HIS B NE2 1 
ATOM   9384  N N   . TYR B 1 580 ? -14.606 -16.818 25.147  1.00 12.71 ? 606  TYR B N   1 
ATOM   9385  C CA  . TYR B 1 580 ? -15.833 -17.532 25.466  1.00 11.03 ? 606  TYR B CA  1 
ATOM   9386  C C   . TYR B 1 580 ? -16.921 -16.559 25.870  1.00 11.69 ? 606  TYR B C   1 
ATOM   9387  O O   . TYR B 1 580 ? -18.110 -16.809 25.670  1.00 11.88 ? 606  TYR B O   1 
ATOM   9388  C CB  . TYR B 1 580 ? -15.608 -18.547 26.589  1.00 8.77  ? 606  TYR B CB  1 
ATOM   9389  C CG  . TYR B 1 580 ? -15.105 -19.893 26.103  1.00 9.46  ? 606  TYR B CG  1 
ATOM   9390  C CD1 . TYR B 1 580 ? -13.805 -20.046 25.623  1.00 8.79  ? 606  TYR B CD1 1 
ATOM   9391  C CD2 . TYR B 1 580 ? -15.930 -21.022 26.136  1.00 7.11  ? 606  TYR B CD2 1 
ATOM   9392  C CE1 . TYR B 1 580 ? -13.333 -21.291 25.195  1.00 9.17  ? 606  TYR B CE1 1 
ATOM   9393  C CE2 . TYR B 1 580 ? -15.465 -22.278 25.701  1.00 10.40 ? 606  TYR B CE2 1 
ATOM   9394  C CZ  . TYR B 1 580 ? -14.162 -22.404 25.239  1.00 10.22 ? 606  TYR B CZ  1 
ATOM   9395  O OH  . TYR B 1 580 ? -13.657 -23.633 24.864  1.00 9.82  ? 606  TYR B OH  1 
ATOM   9396  N N   . LEU B 1 581 ? -16.513 -15.435 26.451  1.00 12.06 ? 607  LEU B N   1 
ATOM   9397  C CA  . LEU B 1 581 ? -17.488 -14.447 26.878  1.00 11.32 ? 607  LEU B CA  1 
ATOM   9398  C C   . LEU B 1 581 ? -18.140 -13.830 25.645  1.00 10.74 ? 607  LEU B C   1 
ATOM   9399  O O   . LEU B 1 581 ? -19.362 -13.735 25.577  1.00 10.51 ? 607  LEU B O   1 
ATOM   9400  C CB  . LEU B 1 581 ? -16.810 -13.374 27.739  1.00 12.02 ? 607  LEU B CB  1 
ATOM   9401  C CG  . LEU B 1 581 ? -17.629 -12.117 28.059  1.00 11.10 ? 607  LEU B CG  1 
ATOM   9402  C CD1 . LEU B 1 581 ? -18.915 -12.501 28.791  1.00 8.74  ? 607  LEU B CD1 1 
ATOM   9403  C CD2 . LEU B 1 581 ? -16.770 -11.138 28.882  1.00 12.36 ? 607  LEU B CD2 1 
ATOM   9404  N N   . GLU B 1 582 ? -17.323 -13.420 24.676  1.00 10.41 ? 608  GLU B N   1 
ATOM   9405  C CA  . GLU B 1 582 ? -17.821 -12.832 23.434  1.00 11.56 ? 608  GLU B CA  1 
ATOM   9406  C C   . GLU B 1 582 ? -18.775 -13.805 22.729  1.00 11.42 ? 608  GLU B C   1 
ATOM   9407  O O   . GLU B 1 582 ? -19.861 -13.417 22.291  1.00 11.32 ? 608  GLU B O   1 
ATOM   9408  C CB  . GLU B 1 582 ? -16.646 -12.492 22.502  1.00 10.30 ? 608  GLU B CB  1 
ATOM   9409  C CG  . GLU B 1 582 ? -17.039 -12.133 21.057  1.00 12.27 ? 608  GLU B CG  1 
ATOM   9410  C CD  . GLU B 1 582 ? -15.844 -11.807 20.157  1.00 14.12 ? 608  GLU B CD  1 
ATOM   9411  O OE1 . GLU B 1 582 ? -14.789 -12.472 20.273  1.00 16.50 ? 608  GLU B OE1 1 
ATOM   9412  O OE2 . GLU B 1 582 ? -15.969 -10.895 19.310  1.00 16.16 ? 608  GLU B OE2 1 
ATOM   9413  N N   . LYS B 1 583 ? -18.370 -15.059 22.627  1.00 13.52 ? 609  LYS B N   1 
ATOM   9414  C CA  . LYS B 1 583 ? -19.186 -16.075 21.967  1.00 14.87 ? 609  LYS B CA  1 
ATOM   9415  C C   . LYS B 1 583 ? -20.464 -16.334 22.762  1.00 14.29 ? 609  LYS B C   1 
ATOM   9416  O O   . LYS B 1 583 ? -21.526 -16.562 22.187  1.00 14.17 ? 609  LYS B O   1 
ATOM   9417  C CB  . LYS B 1 583 ? -18.378 -17.367 21.816  1.00 16.13 ? 609  LYS B CB  1 
ATOM   9418  C CG  . LYS B 1 583 ? -19.047 -18.466 20.991  1.00 16.32 ? 609  LYS B CG  1 
ATOM   9419  C CD  . LYS B 1 583 ? -19.356 -17.999 19.577  1.00 15.70 ? 609  LYS B CD  1 
ATOM   9420  C CE  . LYS B 1 583 ? -19.557 -19.185 18.632  1.00 18.14 ? 609  LYS B CE  1 
ATOM   9421  N NZ  . LYS B 1 583 ? -20.630 -20.109 19.074  1.00 15.24 ? 609  LYS B NZ  1 
ATOM   9422  N N   . ALA B 1 584 ? -20.368 -16.287 24.088  1.00 14.53 ? 610  ALA B N   1 
ATOM   9423  C CA  . ALA B 1 584 ? -21.543 -16.520 24.922  1.00 14.44 ? 610  ALA B CA  1 
ATOM   9424  C C   . ALA B 1 584 ? -22.567 -15.416 24.671  1.00 13.90 ? 610  ALA B C   1 
ATOM   9425  O O   . ALA B 1 584 ? -23.759 -15.680 24.511  1.00 13.50 ? 610  ALA B O   1 
ATOM   9426  C CB  . ALA B 1 584 ? -21.147 -16.566 26.401  1.00 13.35 ? 610  ALA B CB  1 
ATOM   9427  N N   . LEU B 1 585 ? -22.092 -14.175 24.619  1.00 13.65 ? 611  LEU B N   1 
ATOM   9428  C CA  . LEU B 1 585 ? -22.962 -13.026 24.379  1.00 12.34 ? 611  LEU B CA  1 
ATOM   9429  C C   . LEU B 1 585 ? -23.650 -13.146 23.025  1.00 13.33 ? 611  LEU B C   1 
ATOM   9430  O O   . LEU B 1 585 ? -24.842 -12.865 22.888  1.00 11.95 ? 611  LEU B O   1 
ATOM   9431  C CB  . LEU B 1 585 ? -22.138 -11.736 24.423  1.00 10.39 ? 611  LEU B CB  1 
ATOM   9432  C CG  . LEU B 1 585 ? -21.696 -11.230 25.799  1.00 8.82  ? 611  LEU B CG  1 
ATOM   9433  C CD1 . LEU B 1 585 ? -20.576 -10.198 25.645  1.00 6.75  ? 611  LEU B CD1 1 
ATOM   9434  C CD2 . LEU B 1 585 ? -22.911 -10.644 26.518  1.00 6.84  ? 611  LEU B CD2 1 
ATOM   9435  N N   . LEU B 1 586 ? -22.891 -13.567 22.024  1.00 13.03 ? 612  LEU B N   1 
ATOM   9436  C CA  . LEU B 1 586 ? -23.437 -13.720 20.686  1.00 13.89 ? 612  LEU B CA  1 
ATOM   9437  C C   . LEU B 1 586 ? -24.439 -14.884 20.614  1.00 14.27 ? 612  LEU B C   1 
ATOM   9438  O O   . LEU B 1 586 ? -25.472 -14.761 19.953  1.00 13.93 ? 612  LEU B O   1 
ATOM   9439  C CB  . LEU B 1 586 ? -22.300 -13.919 19.684  1.00 11.75 ? 612  LEU B CB  1 
ATOM   9440  C CG  . LEU B 1 586 ? -21.365 -12.719 19.497  1.00 11.74 ? 612  LEU B CG  1 
ATOM   9441  C CD1 . LEU B 1 586 ? -20.196 -13.115 18.609  1.00 12.24 ? 612  LEU B CD1 1 
ATOM   9442  C CD2 . LEU B 1 586 ? -22.129 -11.555 18.882  1.00 10.41 ? 612  LEU B CD2 1 
ATOM   9443  N N   . ASP B 1 587 ? -24.155 -15.995 21.302  1.00 13.20 ? 613  ASP B N   1 
ATOM   9444  C CA  . ASP B 1 587 ? -25.067 -17.138 21.294  1.00 13.88 ? 613  ASP B CA  1 
ATOM   9445  C C   . ASP B 1 587 ? -26.387 -16.785 21.963  1.00 14.26 ? 613  ASP B C   1 
ATOM   9446  O O   . ASP B 1 587 ? -27.450 -17.238 21.529  1.00 13.57 ? 613  ASP B O   1 
ATOM   9447  C CB  . ASP B 1 587 ? -24.450 -18.357 22.001  1.00 12.89 ? 613  ASP B CB  1 
ATOM   9448  C CG  . ASP B 1 587 ? -23.342 -18.996 21.191  1.00 14.85 ? 613  ASP B CG  1 
ATOM   9449  O OD1 . ASP B 1 587 ? -23.220 -18.634 20.004  1.00 15.23 ? 613  ASP B OD1 1 
ATOM   9450  O OD2 . ASP B 1 587 ? -22.592 -19.845 21.726  1.00 15.09 ? 613  ASP B OD2 1 
ATOM   9451  N N   . MET B 1 588 ? -26.332 -15.973 23.016  1.00 13.52 ? 614  MET B N   1 
ATOM   9452  C CA  . MET B 1 588 ? -27.554 -15.582 23.701  1.00 12.77 ? 614  MET B CA  1 
ATOM   9453  C C   . MET B 1 588 ? -28.393 -14.700 22.779  1.00 12.42 ? 614  MET B C   1 
ATOM   9454  O O   . MET B 1 588 ? -29.623 -14.799 22.781  1.00 13.39 ? 614  MET B O   1 
ATOM   9455  C CB  . MET B 1 588 ? -27.225 -14.855 25.009  1.00 11.99 ? 614  MET B CB  1 
ATOM   9456  C CG  . MET B 1 588 ? -26.847 -15.815 26.136  1.00 12.69 ? 614  MET B CG  1 
ATOM   9457  S SD  . MET B 1 588 ? -26.249 -15.012 27.640  1.00 13.16 ? 614  MET B SD  1 
ATOM   9458  C CE  . MET B 1 588 ? -27.703 -14.229 28.204  1.00 9.54  ? 614  MET B CE  1 
ATOM   9459  N N   . ARG B 1 589 ? -27.740 -13.858 21.988  1.00 11.25 ? 615  ARG B N   1 
ATOM   9460  C CA  . ARG B 1 589 ? -28.462 -12.996 21.053  1.00 12.31 ? 615  ARG B CA  1 
ATOM   9461  C C   . ARG B 1 589 ? -29.095 -13.860 19.960  1.00 12.76 ? 615  ARG B C   1 
ATOM   9462  O O   . ARG B 1 589 ? -30.277 -13.718 19.650  1.00 13.14 ? 615  ARG B O   1 
ATOM   9463  C CB  . ARG B 1 589 ? -27.526 -11.973 20.398  1.00 10.69 ? 615  ARG B CB  1 
ATOM   9464  C CG  . ARG B 1 589 ? -28.260 -11.113 19.348  1.00 13.64 ? 615  ARG B CG  1 
ATOM   9465  C CD  . ARG B 1 589 ? -27.438 -9.965  18.753  1.00 12.30 ? 615  ARG B CD  1 
ATOM   9466  N NE  . ARG B 1 589 ? -26.314 -10.392 17.916  1.00 13.55 ? 615  ARG B NE  1 
ATOM   9467  C CZ  . ARG B 1 589 ? -25.591 -9.561  17.168  1.00 13.86 ? 615  ARG B CZ  1 
ATOM   9468  N NH1 . ARG B 1 589 ? -25.877 -8.264  17.151  1.00 14.49 ? 615  ARG B NH1 1 
ATOM   9469  N NH2 . ARG B 1 589 ? -24.584 -10.018 16.435  1.00 14.17 ? 615  ARG B NH2 1 
ATOM   9470  N N   . THR B 1 590 ? -28.303 -14.758 19.383  1.00 13.77 ? 616  THR B N   1 
ATOM   9471  C CA  . THR B 1 590 ? -28.793 -15.632 18.324  1.00 15.48 ? 616  THR B CA  1 
ATOM   9472  C C   . THR B 1 590 ? -29.999 -16.409 18.815  1.00 15.14 ? 616  THR B C   1 
ATOM   9473  O O   . THR B 1 590 ? -31.017 -16.478 18.130  1.00 16.09 ? 616  THR B O   1 
ATOM   9474  C CB  . THR B 1 590 ? -27.714 -16.622 17.880  1.00 16.08 ? 616  THR B CB  1 
ATOM   9475  O OG1 . THR B 1 590 ? -26.569 -15.893 17.424  1.00 18.35 ? 616  THR B OG1 1 
ATOM   9476  C CG2 . THR B 1 590 ? -28.231 -17.511 16.741  1.00 19.36 ? 616  THR B CG2 1 
ATOM   9477  N N   . LEU B 1 591 ? -29.885 -16.991 20.008  1.00 14.31 ? 617  LEU B N   1 
ATOM   9478  C CA  . LEU B 1 591 ? -30.977 -17.755 20.573  1.00 13.46 ? 617  LEU B CA  1 
ATOM   9479  C C   . LEU B 1 591 ? -32.236 -16.905 20.677  1.00 13.99 ? 617  LEU B C   1 
ATOM   9480  O O   . LEU B 1 591 ? -33.307 -17.317 20.228  1.00 14.65 ? 617  LEU B O   1 
ATOM   9481  C CB  . LEU B 1 591 ? -30.608 -18.276 21.963  1.00 14.26 ? 617  LEU B CB  1 
ATOM   9482  C CG  . LEU B 1 591 ? -31.744 -19.010 22.680  1.00 14.09 ? 617  LEU B CG  1 
ATOM   9483  C CD1 . LEU B 1 591 ? -32.045 -20.305 21.949  1.00 13.82 ? 617  LEU B CD1 1 
ATOM   9484  C CD2 . LEU B 1 591 ? -31.361 -19.286 24.124  1.00 15.55 ? 617  LEU B CD2 1 
ATOM   9485  N N   . LEU B 1 592 ? -32.112 -15.722 21.260  1.00 12.19 ? 618  LEU B N   1 
ATOM   9486  C CA  . LEU B 1 592 ? -33.267 -14.841 21.424  1.00 12.71 ? 618  LEU B CA  1 
ATOM   9487  C C   . LEU B 1 592 ? -33.843 -14.379 20.080  1.00 12.54 ? 618  LEU B C   1 
ATOM   9488  O O   . LEU B 1 592 ? -35.064 -14.304 19.915  1.00 10.51 ? 618  LEU B O   1 
ATOM   9489  C CB  . LEU B 1 592 ? -32.879 -13.626 22.282  1.00 11.83 ? 618  LEU B CB  1 
ATOM   9490  C CG  . LEU B 1 592 ? -32.505 -13.887 23.752  1.00 13.64 ? 618  LEU B CG  1 
ATOM   9491  C CD1 . LEU B 1 592 ? -31.911 -12.624 24.378  1.00 10.84 ? 618  LEU B CD1 1 
ATOM   9492  C CD2 . LEU B 1 592 ? -33.740 -14.327 24.513  1.00 10.67 ? 618  LEU B CD2 1 
ATOM   9493  N N   . GLN B 1 593 ? -32.974 -14.066 19.125  1.00 13.22 ? 619  GLN B N   1 
ATOM   9494  C CA  . GLN B 1 593 ? -33.446 -13.614 17.823  1.00 17.16 ? 619  GLN B CA  1 
ATOM   9495  C C   . GLN B 1 593 ? -34.104 -14.742 17.032  1.00 19.15 ? 619  GLN B C   1 
ATOM   9496  O O   . GLN B 1 593 ? -34.937 -14.484 16.171  1.00 18.91 ? 619  GLN B O   1 
ATOM   9497  C CB  . GLN B 1 593 ? -32.289 -13.028 17.021  1.00 18.36 ? 619  GLN B CB  1 
ATOM   9498  C CG  . GLN B 1 593 ? -31.921 -11.618 17.440  1.00 18.32 ? 619  GLN B CG  1 
ATOM   9499  C CD  . GLN B 1 593 ? -30.746 -11.068 16.667  1.00 19.10 ? 619  GLN B CD  1 
ATOM   9500  O OE1 . GLN B 1 593 ? -30.537 -9.859  16.616  1.00 24.42 ? 619  GLN B OE1 1 
ATOM   9501  N NE2 . GLN B 1 593 ? -29.964 -11.957 16.067  1.00 17.84 ? 619  GLN B NE2 1 
ATOM   9502  N N   . ASN B 1 594 ? -33.743 -15.988 17.333  1.00 20.28 ? 620  ASN B N   1 
ATOM   9503  C CA  . ASN B 1 594 ? -34.307 -17.136 16.626  1.00 23.43 ? 620  ASN B CA  1 
ATOM   9504  C C   . ASN B 1 594 ? -35.641 -17.549 17.241  1.00 25.82 ? 620  ASN B C   1 
ATOM   9505  O O   . ASN B 1 594 ? -36.286 -18.500 16.798  1.00 23.33 ? 620  ASN B O   1 
ATOM   9506  C CB  . ASN B 1 594 ? -33.336 -18.325 16.672  1.00 23.69 ? 620  ASN B CB  1 
ATOM   9507  C CG  . ASN B 1 594 ? -32.068 -18.102 15.838  1.00 26.34 ? 620  ASN B CG  1 
ATOM   9508  O OD1 . ASN B 1 594 ? -31.152 -18.928 15.860  1.00 26.33 ? 620  ASN B OD1 1 
ATOM   9509  N ND2 . ASN B 1 594 ? -32.016 -16.997 15.101  1.00 26.71 ? 620  ASN B ND2 1 
ATOM   9510  N N   . HIS B 1 595 ? -36.069 -16.824 18.268  1.00 29.39 ? 621  HIS B N   1 
ATOM   9511  C CA  . HIS B 1 595 ? -37.325 -17.162 18.912  1.00 36.17 ? 621  HIS B CA  1 
ATOM   9512  C C   . HIS B 1 595 ? -38.092 -15.947 19.382  1.00 41.18 ? 621  HIS B C   1 
ATOM   9513  O O   . HIS B 1 595 ? -38.329 -15.793 20.579  1.00 41.54 ? 621  HIS B O   1 
ATOM   9514  C CB  . HIS B 1 595 ? -37.057 -18.090 20.093  1.00 35.62 ? 621  HIS B CB  1 
ATOM   9515  C CG  . HIS B 1 595 ? -36.462 -19.405 19.696  1.00 38.09 ? 621  HIS B CG  1 
ATOM   9516  N ND1 . HIS B 1 595 ? -37.202 -20.404 19.099  1.00 37.45 ? 621  HIS B ND1 1 
ATOM   9517  C CD2 . HIS B 1 595 ? -35.191 -19.863 19.757  1.00 36.83 ? 621  HIS B CD2 1 
ATOM   9518  C CE1 . HIS B 1 595 ? -36.410 -21.422 18.807  1.00 37.98 ? 621  HIS B CE1 1 
ATOM   9519  N NE2 . HIS B 1 595 ? -35.184 -21.117 19.196  1.00 38.89 ? 621  HIS B NE2 1 
ATOM   9520  N N   . PRO B 1 596 ? -38.486 -15.065 18.448  1.00 45.82 ? 622  PRO B N   1 
ATOM   9521  C CA  . PRO B 1 596 ? -39.236 -13.857 18.808  1.00 49.75 ? 622  PRO B CA  1 
ATOM   9522  C C   . PRO B 1 596 ? -40.532 -14.211 19.538  1.00 53.50 ? 622  PRO B C   1 
ATOM   9523  O O   . PRO B 1 596 ? -40.931 -15.379 19.581  1.00 53.71 ? 622  PRO B O   1 
ATOM   9524  C CB  . PRO B 1 596 ? -39.504 -13.206 17.455  1.00 49.45 ? 622  PRO B CB  1 
ATOM   9525  C CG  . PRO B 1 596 ? -38.307 -13.598 16.655  1.00 49.35 ? 622  PRO B CG  1 
ATOM   9526  C CD  . PRO B 1 596 ? -38.161 -15.064 17.010  1.00 47.05 ? 622  PRO B CD  1 
ATOM   9527  N N   . ARG B 1 597 ? -41.186 -13.200 20.104  1.00 57.17 ? 623  ARG B N   1 
ATOM   9528  C CA  . ARG B 1 597 ? -42.436 -13.407 20.833  1.00 60.37 ? 623  ARG B CA  1 
ATOM   9529  C C   . ARG B 1 597 ? -43.652 -13.457 19.902  1.00 61.90 ? 623  ARG B C   1 
ATOM   9530  O O   . ARG B 1 597 ? -43.538 -13.824 18.729  1.00 62.11 ? 623  ARG B O   1 
ATOM   9531  C CB  . ARG B 1 597 ? -42.614 -12.301 21.879  1.00 61.73 ? 623  ARG B CB  1 
ATOM   9532  C CG  . ARG B 1 597 ? -42.615 -12.809 23.320  1.00 63.31 ? 623  ARG B CG  1 
ATOM   9533  C CD  . ARG B 1 597 ? -42.124 -11.744 24.284  1.00 64.47 ? 623  ARG B CD  1 
ATOM   9534  N NE  . ARG B 1 597 ? -40.754 -11.348 23.971  1.00 65.50 ? 623  ARG B NE  1 
ATOM   9535  C CZ  . ARG B 1 597 ? -40.043 -10.481 24.685  1.00 66.31 ? 623  ARG B CZ  1 
ATOM   9536  N NH1 . ARG B 1 597 ? -40.571 -9.912  25.761  1.00 66.41 ? 623  ARG B NH1 1 
ATOM   9537  N NH2 . ARG B 1 597 ? -38.803 -10.180 24.320  1.00 66.06 ? 623  ARG B NH2 1 
ATOM   9538  N N   . ALA B 1 598 ? -44.814 -13.096 20.436  1.00 63.47 ? 624  ALA B N   1 
ATOM   9539  C CA  . ALA B 1 598 ? -46.053 -13.104 19.668  1.00 64.66 ? 624  ALA B CA  1 
ATOM   9540  C C   . ALA B 1 598 ? -45.915 -12.407 18.317  1.00 65.52 ? 624  ALA B C   1 
ATOM   9541  O O   . ALA B 1 598 ? -44.967 -11.653 18.086  1.00 65.61 ? 624  ALA B O   1 
ATOM   9542  C CB  . ALA B 1 598 ? -47.166 -12.449 20.479  1.00 65.22 ? 624  ALA B CB  1 
ATOM   9543  N N   . LYS B 1 599 ? -46.873 -12.668 17.433  1.00 66.06 ? 625  LYS B N   1 
ATOM   9544  C CA  . LYS B 1 599 ? -46.891 -12.079 16.098  1.00 67.04 ? 625  LYS B CA  1 
ATOM   9545  C C   . LYS B 1 599 ? -45.663 -12.503 15.296  1.00 67.44 ? 625  LYS B C   1 
ATOM   9546  O O   . LYS B 1 599 ? -44.864 -13.308 15.821  1.00 67.94 ? 625  LYS B O   1 
ATOM   9547  C CB  . LYS B 1 599 ? -46.947 -10.549 16.191  1.00 67.06 ? 625  LYS B CB  1 
ATOM   9548  C CG  . LYS B 1 599 ? -47.457 -9.866  14.927  1.00 66.81 ? 625  LYS B CG  1 
ATOM   9549  C CD  . LYS B 1 599 ? -48.925 -10.201 14.680  1.00 66.56 ? 625  LYS B CD  1 
ATOM   9550  C CE  . LYS B 1 599 ? -49.402 -9.703  13.322  1.00 66.69 ? 625  LYS B CE  1 
ATOM   9551  N NZ  . LYS B 1 599 ? -49.217 -8.236  13.149  1.00 66.68 ? 625  LYS B NZ  1 
ATOM   9552  O OXT . LYS B 1 599 ? -45.517 -12.033 14.148  1.00 67.78 ? 625  LYS B OXT 1 
HETATM 9553  N N1A . COA C 2 .   ? 79.534  1.441   -12.097 1.00 34.31 ? 1601 COA A N1A 1 
HETATM 9554  C C2A . COA C 2 .   ? 79.067  0.264   -11.651 1.00 35.09 ? 1601 COA A C2A 1 
HETATM 9555  N N3A . COA C 2 .   ? 78.114  0.225   -10.713 1.00 35.10 ? 1601 COA A N3A 1 
HETATM 9556  C C4A . COA C 2 .   ? 77.598  1.362   -10.195 1.00 35.48 ? 1601 COA A C4A 1 
HETATM 9557  C C5A . COA C 2 .   ? 78.067  2.591   -10.625 1.00 35.07 ? 1601 COA A C5A 1 
HETATM 9558  C C6A . COA C 2 .   ? 79.065  2.610   -11.599 1.00 33.80 ? 1601 COA A C6A 1 
HETATM 9559  N N6A . COA C 2 .   ? 79.519  3.767   -12.069 1.00 31.45 ? 1601 COA A N6A 1 
HETATM 9560  N N7A . COA C 2 .   ? 77.422  3.533   -9.954  1.00 35.93 ? 1601 COA A N7A 1 
HETATM 9561  C C8A . COA C 2 .   ? 76.549  2.932   -9.136  1.00 34.64 ? 1601 COA A C8A 1 
HETATM 9562  N N9A . COA C 2 .   ? 76.671  1.596   -9.272  1.00 35.87 ? 1601 COA A N9A 1 
HETATM 9563  C C1B . COA C 2 .   ? 75.865  0.555   -8.573  1.00 36.23 ? 1601 COA A C1B 1 
HETATM 9564  C C2B . COA C 2 .   ? 75.929  0.719   -7.052  1.00 38.80 ? 1601 COA A C2B 1 
HETATM 9565  O O2B . COA C 2 .   ? 77.107  0.084   -6.556  1.00 40.74 ? 1601 COA A O2B 1 
HETATM 9566  C C3B . COA C 2 .   ? 74.715  -0.056  -6.614  1.00 39.44 ? 1601 COA A C3B 1 
HETATM 9567  O O3B . COA C 2 .   ? 75.011  -1.450  -6.613  1.00 42.55 ? 1601 COA A O3B 1 
HETATM 9568  P P3B . COA C 2 .   ? 74.026  -2.509  -5.882  1.00 45.78 ? 1601 COA A P3B 1 
HETATM 9569  O O7A . COA C 2 .   ? 74.978  -3.789  -5.707  1.00 45.83 ? 1601 COA A O7A 1 
HETATM 9570  O O8A . COA C 2 .   ? 73.658  -1.973  -4.554  1.00 44.43 ? 1601 COA A O8A 1 
HETATM 9571  O O9A . COA C 2 .   ? 72.952  -2.869  -6.837  1.00 44.15 ? 1601 COA A O9A 1 
HETATM 9572  C C4B . COA C 2 .   ? 73.666  0.253   -7.685  1.00 37.65 ? 1601 COA A C4B 1 
HETATM 9573  O O4B . COA C 2 .   ? 74.448  0.610   -8.894  1.00 36.94 ? 1601 COA A O4B 1 
HETATM 9574  C C5B . COA C 2 .   ? 72.813  1.483   -7.294  1.00 35.93 ? 1601 COA A C5B 1 
HETATM 9575  O O5B . COA C 2 .   ? 73.603  2.680   -7.243  1.00 35.93 ? 1601 COA A O5B 1 
HETATM 9576  P P1A . COA C 2 .   ? 73.002  4.067   -7.822  1.00 35.80 ? 1601 COA A P1A 1 
HETATM 9577  O O1A . COA C 2 .   ? 72.151  3.773   -9.003  1.00 35.88 ? 1601 COA A O1A 1 
HETATM 9578  O O2A . COA C 2 .   ? 74.096  5.048   -7.975  1.00 34.60 ? 1601 COA A O2A 1 
HETATM 9579  O O3A . COA C 2 .   ? 72.003  4.567   -6.649  1.00 36.41 ? 1601 COA A O3A 1 
HETATM 9580  P P2A . COA C 2 .   ? 72.529  4.832   -5.140  1.00 35.83 ? 1601 COA A P2A 1 
HETATM 9581  O O4A . COA C 2 .   ? 73.800  5.601   -5.169  1.00 34.24 ? 1601 COA A O4A 1 
HETATM 9582  O O5A . COA C 2 .   ? 72.494  3.559   -4.389  1.00 36.31 ? 1601 COA A O5A 1 
HETATM 9583  O O6A . COA C 2 .   ? 71.384  5.794   -4.535  1.00 36.19 ? 1601 COA A O6A 1 
HETATM 9584  C CBP . COA C 2 .   ? 70.144  7.866   -4.181  1.00 34.34 ? 1601 COA A CBP 1 
HETATM 9585  C CCP . COA C 2 .   ? 71.230  7.144   -4.994  1.00 34.13 ? 1601 COA A CCP 1 
HETATM 9586  C CDP . COA C 2 .   ? 68.792  7.177   -4.433  1.00 33.98 ? 1601 COA A CDP 1 
HETATM 9587  C CEP . COA C 2 .   ? 70.059  9.328   -4.645  1.00 32.82 ? 1601 COA A CEP 1 
HETATM 9588  C CAP . COA C 2 .   ? 70.516  7.791   -2.671  1.00 33.16 ? 1601 COA A CAP 1 
HETATM 9589  O OAP . COA C 2 .   ? 71.795  8.403   -2.458  1.00 34.19 ? 1601 COA A OAP 1 
HETATM 9590  C C9P . COA C 2 .   ? 69.462  8.470   -1.775  1.00 33.48 ? 1601 COA A C9P 1 
HETATM 9591  O O9P . COA C 2 .   ? 69.607  9.626   -1.388  1.00 28.89 ? 1601 COA A O9P 1 
HETATM 9592  N N8P . COA C 2 .   ? 68.415  7.704   -1.478  1.00 33.40 ? 1601 COA A N8P 1 
HETATM 9593  C C7P . COA C 2 .   ? 67.302  8.156   -0.632  1.00 35.46 ? 1601 COA A C7P 1 
HETATM 9594  C C6P . COA C 2 .   ? 66.100  8.547   -1.499  1.00 37.03 ? 1601 COA A C6P 1 
HETATM 9595  C C5P . COA C 2 .   ? 64.868  8.757   -0.618  1.00 40.68 ? 1601 COA A C5P 1 
HETATM 9596  O O5P . COA C 2 .   ? 64.946  9.397   0.438   1.00 41.19 ? 1601 COA A O5P 1 
HETATM 9597  N N4P . COA C 2 .   ? 63.741  8.205   -1.085  1.00 41.43 ? 1601 COA A N4P 1 
HETATM 9598  C C3P . COA C 2 .   ? 62.465  8.285   -0.353  1.00 44.28 ? 1601 COA A C3P 1 
HETATM 9599  C C2P . COA C 2 .   ? 61.907  9.709   -0.334  1.00 44.89 ? 1601 COA A C2P 1 
HETATM 9600  S S1P . COA C 2 .   ? 60.427  9.854   0.731   1.00 49.04 ? 1601 COA A S1P 1 
HETATM 9601  C CAC . HC5 D 3 .   ? 57.098  5.082   -0.513  1.00 29.59 ? 1602 HC5 A CAC 1 
HETATM 9602  C CAD . HC5 D 3 .   ? 57.741  6.471   -0.482  1.00 31.09 ? 1602 HC5 A CAD 1 
HETATM 9603  C CAE . HC5 D 3 .   ? 58.213  6.879   -1.878  1.00 31.97 ? 1602 HC5 A CAE 1 
HETATM 9604  C CAF . HC5 D 3 .   ? 58.952  8.220   -1.867  1.00 32.86 ? 1602 HC5 A CAF 1 
HETATM 9605  C CAG . HC5 D 3 .   ? 58.036  9.392   -1.511  1.00 34.25 ? 1602 HC5 A CAG 1 
HETATM 9606  C CAH . HC5 D 3 .   ? 58.800  10.716  -1.605  1.00 33.58 ? 1602 HC5 A CAH 1 
HETATM 9607  O OAI . HC5 D 3 .   ? 59.727  10.837  -2.404  1.00 37.20 ? 1602 HC5 A OAI 1 
HETATM 9608  O OAK . HC5 D 3 .   ? 58.430  11.764  -0.821  1.00 28.98 ? 1602 HC5 A OAK 1 
HETATM 9609  C CAP . HC5 D 3 .   ? 59.286  12.902  -1.022  1.00 23.73 ? 1602 HC5 A CAP 1 
HETATM 9610  C CAQ . HC5 D 3 .   ? 60.010  13.207  0.294   1.00 20.58 ? 1602 HC5 A CAQ 1 
HETATM 9611  C CAR . HC5 D 3 .   ? 61.065  14.306  0.141   1.00 19.03 ? 1602 HC5 A CAR 1 
HETATM 9612  O OAL . HC5 D 3 .   ? 61.223  15.145  1.011   1.00 18.28 ? 1602 HC5 A OAL 1 
HETATM 9613  O OAS . HC5 D 3 .   ? 61.784  14.338  -0.870  1.00 16.91 ? 1602 HC5 A OAS 1 
HETATM 9614  C CAO . HC5 D 3 .   ? 58.462  14.117  -1.476  1.00 22.37 ? 1602 HC5 A CAO 1 
HETATM 9615  N NAN . HC5 D 3 .   ? 57.919  13.993  -2.839  1.00 22.62 ? 1602 HC5 A NAN 1 
HETATM 9616  C CAT . HC5 D 3 .   ? 57.243  15.256  -3.173  1.00 21.28 ? 1602 HC5 A CAT 1 
HETATM 9617  C CAJ . HC5 D 3 .   ? 56.926  12.907  -2.930  1.00 21.39 ? 1602 HC5 A CAJ 1 
HETATM 9618  C CAM . HC5 D 3 .   ? 58.988  13.773  -3.825  1.00 21.14 ? 1602 HC5 A CAM 1 
HETATM 9619  N N1A . COA E 2 .   ? -35.981 -3.615  29.318  1.00 32.81 ? 1701 COA B N1A 1 
HETATM 9620  C C2A . COA E 2 .   ? -35.487 -2.546  28.671  1.00 34.42 ? 1701 COA B C2A 1 
HETATM 9621  N N3A . COA E 2 .   ? -34.474 -1.842  29.195  1.00 35.70 ? 1701 COA B N3A 1 
HETATM 9622  C C4A . COA E 2 .   ? -33.935 -2.178  30.386  1.00 35.23 ? 1701 COA B C4A 1 
HETATM 9623  C C5A . COA E 2 .   ? -34.441 -3.261  31.092  1.00 34.58 ? 1701 COA B C5A 1 
HETATM 9624  C C6A . COA E 2 .   ? -35.495 -3.978  30.528  1.00 32.47 ? 1701 COA B C6A 1 
HETATM 9625  N N6A . COA E 2 .   ? -36.011 -5.020  31.168  1.00 30.21 ? 1701 COA B N6A 1 
HETATM 9626  N N7A . COA E 2 .   ? -33.751 -3.373  32.219  1.00 34.79 ? 1701 COA B N7A 1 
HETATM 9627  C C8A . COA E 2 .   ? -32.833 -2.397  32.238  1.00 34.70 ? 1701 COA B C8A 1 
HETATM 9628  N N9A . COA E 2 .   ? -32.959 -1.653  31.121  1.00 34.08 ? 1701 COA B N9A 1 
HETATM 9629  C C1B . COA E 2 .   ? -32.116 -0.485  30.730  1.00 35.02 ? 1701 COA B C1B 1 
HETATM 9630  C C2B . COA E 2 .   ? -32.039 0.560   31.847  1.00 35.88 ? 1701 COA B C2B 1 
HETATM 9631  O O2B . COA E 2 .   ? -33.178 1.408   31.777  1.00 35.31 ? 1701 COA B O2B 1 
HETATM 9632  C C3B . COA E 2 .   ? -30.805 1.331   31.459  1.00 36.79 ? 1701 COA B C3B 1 
HETATM 9633  O O3B . COA E 2 .   ? -31.124 2.268   30.430  1.00 40.95 ? 1701 COA B O3B 1 
HETATM 9634  P P3B . COA E 2 .   ? -30.099 3.471   30.060  1.00 43.96 ? 1701 COA B P3B 1 
HETATM 9635  O O7A . COA E 2 .   ? -31.058 4.538   29.340  1.00 44.18 ? 1701 COA B O7A 1 
HETATM 9636  O O8A . COA E 2 .   ? -29.572 4.044   31.320  1.00 43.18 ? 1701 COA B O8A 1 
HETATM 9637  O O9A . COA E 2 .   ? -29.146 2.964   29.047  1.00 42.30 ? 1701 COA B O9A 1 
HETATM 9638  C C4B . COA E 2 .   ? -29.848 0.261   30.910  1.00 35.89 ? 1701 COA B C4B 1 
HETATM 9639  O O4B . COA E 2 .   ? -30.732 -0.833  30.436  1.00 36.15 ? 1701 COA B O4B 1 
HETATM 9640  C C5B . COA E 2 .   ? -28.950 -0.320  32.030  1.00 34.90 ? 1701 COA B C5B 1 
HETATM 9641  O O5B . COA E 2 .   ? -29.715 -1.059  32.999  1.00 34.08 ? 1701 COA B O5B 1 
HETATM 9642  P P1A . COA E 2 .   ? -29.078 -2.377  33.695  1.00 31.68 ? 1701 COA B P1A 1 
HETATM 9643  O O1A . COA E 2 .   ? -28.282 -3.120  32.691  1.00 30.84 ? 1701 COA B O1A 1 
HETATM 9644  O O2A . COA E 2 .   ? -30.135 -3.104  34.429  1.00 30.57 ? 1701 COA B O2A 1 
HETATM 9645  O O3A . COA E 2 .   ? -28.025 -1.773  34.753  1.00 32.10 ? 1701 COA B O3A 1 
HETATM 9646  P P2A . COA E 2 .   ? -28.491 -0.756  35.915  1.00 33.59 ? 1701 COA B P2A 1 
HETATM 9647  O O4A . COA E 2 .   ? -29.761 -1.226  36.525  1.00 34.13 ? 1701 COA B O4A 1 
HETATM 9648  O O5A . COA E 2 .   ? -28.436 0.625   35.385  1.00 34.51 ? 1701 COA B O5A 1 
HETATM 9649  O O6A . COA E 2 .   ? -27.317 -0.922  37.014  1.00 33.33 ? 1701 COA B O6A 1 
HETATM 9650  C CBP . COA E 2 .   ? -25.930 -2.040  38.699  1.00 32.12 ? 1701 COA B CBP 1 
HETATM 9651  C CCP . COA E 2 .   ? -27.152 -2.144  37.767  1.00 31.26 ? 1701 COA B CCP 1 
HETATM 9652  C CDP . COA E 2 .   ? -24.670 -1.841  37.842  1.00 31.30 ? 1701 COA B CDP 1 
HETATM 9653  C CEP . COA E 2 .   ? -25.794 -3.335  39.511  1.00 29.39 ? 1701 COA B CEP 1 
HETATM 9654  C CAP . COA E 2 .   ? -26.130 -0.827  39.648  1.00 32.16 ? 1701 COA B CAP 1 
HETATM 9655  O OAP . COA E 2 .   ? -27.322 -1.011  40.417  1.00 32.91 ? 1701 COA B OAP 1 
HETATM 9656  C C9P . COA E 2 .   ? -24.926 -0.615  40.596  1.00 34.47 ? 1701 COA B C9P 1 
HETATM 9657  O O9P . COA E 2 .   ? -24.902 -1.113  41.720  1.00 31.19 ? 1701 COA B O9P 1 
HETATM 9658  N N8P . COA E 2 .   ? -23.942 0.127   40.084  1.00 36.62 ? 1701 COA B N8P 1 
HETATM 9659  C C7P . COA E 2 .   ? -22.712 0.459   40.823  1.00 39.63 ? 1701 COA B C7P 1 
HETATM 9660  C C6P . COA E 2 .   ? -21.624 -0.583  40.549  1.00 41.93 ? 1701 COA B C6P 1 
HETATM 9661  C C5P . COA E 2 .   ? -20.291 -0.112  41.134  1.00 45.23 ? 1701 COA B C5P 1 
HETATM 9662  O O5P . COA E 2 .   ? -20.223 0.322   42.290  1.00 45.26 ? 1701 COA B O5P 1 
HETATM 9663  N N4P . COA E 2 .   ? -19.243 -0.218  40.303  1.00 46.47 ? 1701 COA B N4P 1 
HETATM 9664  C C3P . COA E 2 .   ? -17.886 0.205   40.695  1.00 49.54 ? 1701 COA B C3P 1 
HETATM 9665  C C2P . COA E 2 .   ? -17.352 -0.633  41.862  1.00 51.30 ? 1701 COA B C2P 1 
HETATM 9666  S S1P . COA E 2 .   ? -15.772 0.011   42.520  1.00 55.92 ? 1701 COA B S1P 1 
HETATM 9667  C CAC . HC5 F 3 .   ? -12.598 1.786   37.493  1.00 28.49 ? 1702 HC5 B CAC 1 
HETATM 9668  C CAD . HC5 F 3 .   ? -13.344 0.996   38.572  1.00 28.53 ? 1702 HC5 B CAD 1 
HETATM 9669  C CAE . HC5 F 3 .   ? -13.420 -0.487  38.201  1.00 30.52 ? 1702 HC5 B CAE 1 
HETATM 9670  C CAF . HC5 F 3 .   ? -14.186 -1.307  39.242  1.00 30.03 ? 1702 HC5 B CAF 1 
HETATM 9671  C CAG . HC5 F 3 .   ? -13.459 -1.393  40.587  1.00 29.36 ? 1702 HC5 B CAG 1 
HETATM 9672  C CAH . HC5 F 3 .   ? -14.230 -2.284  41.561  1.00 28.54 ? 1702 HC5 B CAH 1 
HETATM 9673  O OAI . HC5 F 3 .   ? -15.310 -2.783  41.222  1.00 31.46 ? 1702 HC5 B OAI 1 
HETATM 9674  O OAK . HC5 F 3 .   ? -13.722 -2.543  42.796  1.00 22.61 ? 1702 HC5 B OAK 1 
HETATM 9675  C CAP . HC5 F 3 .   ? -14.590 -3.384  43.580  1.00 19.97 ? 1702 HC5 B CAP 1 
HETATM 9676  C CAQ . HC5 F 3 .   ? -15.146 -2.562  44.753  1.00 17.26 ? 1702 HC5 B CAQ 1 
HETATM 9677  C CAR . HC5 F 3 .   ? -16.208 -3.311  45.570  1.00 15.89 ? 1702 HC5 B CAR 1 
HETATM 9678  O OAL . HC5 F 3 .   ? -16.246 -3.207  46.782  1.00 16.28 ? 1702 HC5 B OAL 1 
HETATM 9679  O OAS . HC5 F 3 .   ? -17.052 -4.021  45.003  1.00 14.51 ? 1702 HC5 B OAS 1 
HETATM 9680  C CAO . HC5 F 3 .   ? -13.811 -4.600  44.100  1.00 19.44 ? 1702 HC5 B CAO 1 
HETATM 9681  N NAN . HC5 F 3 .   ? -13.461 -5.576  43.036  1.00 20.76 ? 1702 HC5 B NAN 1 
HETATM 9682  C CAT . HC5 F 3 .   ? -12.792 -6.721  43.668  1.00 19.39 ? 1702 HC5 B CAT 1 
HETATM 9683  C CAJ . HC5 F 3 .   ? -12.544 -4.991  42.054  1.00 18.49 ? 1702 HC5 B CAJ 1 
HETATM 9684  C CAM . HC5 F 3 .   ? -14.672 -6.072  42.365  1.00 19.02 ? 1702 HC5 B CAM 1 
HETATM 9685  O O   . HOH G 4 .   ? 60.518  14.866  3.624   1.00 9.99  ? 1603 HOH A O   1 
HETATM 9686  O O   . HOH G 4 .   ? 72.579  18.628  0.623   1.00 8.64  ? 1604 HOH A O   1 
HETATM 9687  O O   . HOH G 4 .   ? 46.151  15.674  -17.635 1.00 29.02 ? 1605 HOH A O   1 
HETATM 9688  O O   . HOH G 4 .   ? 51.126  16.837  4.624   1.00 11.27 ? 1606 HOH A O   1 
HETATM 9689  O O   . HOH G 4 .   ? 48.722  17.478  4.340   1.00 10.81 ? 1607 HOH A O   1 
HETATM 9690  O O   . HOH G 4 .   ? 43.668  14.668  4.850   1.00 10.44 ? 1608 HOH A O   1 
HETATM 9691  O O   . HOH G 4 .   ? 49.502  17.256  -14.049 1.00 11.84 ? 1609 HOH A O   1 
HETATM 9692  O O   . HOH G 4 .   ? 72.139  17.594  12.733  1.00 9.25  ? 1610 HOH A O   1 
HETATM 9693  O O   . HOH G 4 .   ? 54.115  8.230   -8.355  1.00 10.02 ? 1611 HOH A O   1 
HETATM 9694  O O   . HOH G 4 .   ? 35.442  4.128   8.579   1.00 11.95 ? 1612 HOH A O   1 
HETATM 9695  O O   . HOH G 4 .   ? 37.611  14.194  1.418   1.00 7.95  ? 1613 HOH A O   1 
HETATM 9696  O O   . HOH G 4 .   ? 47.689  8.965   -0.229  1.00 14.68 ? 1614 HOH A O   1 
HETATM 9697  O O   . HOH G 4 .   ? 58.901  38.337  9.131   1.00 19.73 ? 1615 HOH A O   1 
HETATM 9698  O O   . HOH G 4 .   ? 55.053  -0.651  -11.480 1.00 11.62 ? 1616 HOH A O   1 
HETATM 9699  O O   . HOH G 4 .   ? 76.903  0.570   -33.775 1.00 9.77  ? 1617 HOH A O   1 
HETATM 9700  O O   . HOH G 4 .   ? 67.180  30.974  13.173  1.00 11.11 ? 1618 HOH A O   1 
HETATM 9701  O O   . HOH G 4 .   ? 36.984  16.031  7.447   1.00 13.53 ? 1619 HOH A O   1 
HETATM 9702  O O   . HOH G 4 .   ? 72.718  15.559  -15.340 1.00 14.70 ? 1620 HOH A O   1 
HETATM 9703  O O   . HOH G 4 .   ? 34.321  16.628  6.076   1.00 14.46 ? 1621 HOH A O   1 
HETATM 9704  O O   . HOH G 4 .   ? 65.822  10.488  4.729   1.00 16.52 ? 1622 HOH A O   1 
HETATM 9705  O O   . HOH G 4 .   ? 78.015  7.356   -12.959 1.00 15.42 ? 1623 HOH A O   1 
HETATM 9706  O O   . HOH G 4 .   ? 44.476  3.951   0.701   1.00 14.75 ? 1624 HOH A O   1 
HETATM 9707  O O   . HOH G 4 .   ? 70.820  22.689  0.876   1.00 15.84 ? 1625 HOH A O   1 
HETATM 9708  O O   . HOH G 4 .   ? 56.866  22.403  -6.591  1.00 17.08 ? 1626 HOH A O   1 
HETATM 9709  O O   . HOH G 4 .   ? 66.644  10.916  10.295  1.00 12.23 ? 1627 HOH A O   1 
HETATM 9710  O O   . HOH G 4 .   ? 64.303  24.148  11.789  1.00 12.02 ? 1628 HOH A O   1 
HETATM 9711  O O   . HOH G 4 .   ? 51.223  12.641  4.604   1.00 11.32 ? 1629 HOH A O   1 
HETATM 9712  O O   . HOH G 4 .   ? 65.332  26.007  -2.250  1.00 18.81 ? 1630 HOH A O   1 
HETATM 9713  O O   . HOH G 4 .   ? 69.716  21.343  -4.487  1.00 15.39 ? 1631 HOH A O   1 
HETATM 9714  O O   . HOH G 4 .   ? 55.183  17.381  -9.979  1.00 14.44 ? 1632 HOH A O   1 
HETATM 9715  O O   . HOH G 4 .   ? 63.556  21.722  -3.518  1.00 12.99 ? 1633 HOH A O   1 
HETATM 9716  O O   . HOH G 4 .   ? 70.970  20.456  -11.726 1.00 12.23 ? 1634 HOH A O   1 
HETATM 9717  O O   . HOH G 4 .   ? 60.904  36.289  14.543  1.00 18.96 ? 1635 HOH A O   1 
HETATM 9718  O O   . HOH G 4 .   ? 58.930  25.162  -13.231 1.00 13.37 ? 1636 HOH A O   1 
HETATM 9719  O O   . HOH G 4 .   ? 48.167  8.723   5.278   1.00 9.50  ? 1637 HOH A O   1 
HETATM 9720  O O   . HOH G 4 .   ? 67.102  20.875  18.959  1.00 20.70 ? 1638 HOH A O   1 
HETATM 9721  O O   . HOH G 4 .   ? 72.092  25.058  -20.395 1.00 20.34 ? 1639 HOH A O   1 
HETATM 9722  O O   . HOH G 4 .   ? 74.239  23.211  -9.689  1.00 9.28  ? 1640 HOH A O   1 
HETATM 9723  O O   . HOH G 4 .   ? 65.676  9.423   -4.937  1.00 12.73 ? 1641 HOH A O   1 
HETATM 9724  O O   . HOH G 4 .   ? 46.045  13.391  -16.859 1.00 17.56 ? 1642 HOH A O   1 
HETATM 9725  O O   . HOH G 4 .   ? 75.534  39.466  1.785   1.00 13.20 ? 1643 HOH A O   1 
HETATM 9726  O O   . HOH G 4 .   ? 65.167  22.126  13.958  1.00 11.13 ? 1644 HOH A O   1 
HETATM 9727  O O   . HOH G 4 .   ? 72.420  21.331  12.179  1.00 10.15 ? 1645 HOH A O   1 
HETATM 9728  O O   . HOH G 4 .   ? 34.692  19.445  2.375   1.00 21.33 ? 1646 HOH A O   1 
HETATM 9729  O O   . HOH G 4 .   ? 65.634  12.253  -28.996 1.00 20.67 ? 1647 HOH A O   1 
HETATM 9730  O O   . HOH G 4 .   ? 71.473  9.618   -8.470  1.00 17.80 ? 1648 HOH A O   1 
HETATM 9731  O O   . HOH G 4 .   ? 73.398  22.788  -14.298 1.00 15.49 ? 1649 HOH A O   1 
HETATM 9732  O O   . HOH G 4 .   ? 36.387  -3.945  4.046   1.00 25.69 ? 1650 HOH A O   1 
HETATM 9733  O O   . HOH G 4 .   ? 66.392  8.152   10.390  1.00 15.81 ? 1651 HOH A O   1 
HETATM 9734  O O   . HOH G 4 .   ? 53.761  -2.652  -17.083 1.00 21.03 ? 1652 HOH A O   1 
HETATM 9735  O O   . HOH G 4 .   ? 47.267  8.069   -18.343 1.00 19.50 ? 1653 HOH A O   1 
HETATM 9736  O O   . HOH G 4 .   ? 52.980  14.077  -3.349  1.00 22.35 ? 1654 HOH A O   1 
HETATM 9737  O O   . HOH G 4 .   ? 65.609  -8.069  -17.821 1.00 19.09 ? 1655 HOH A O   1 
HETATM 9738  O O   . HOH G 4 .   ? 61.260  8.776   -25.421 1.00 18.00 ? 1656 HOH A O   1 
HETATM 9739  O O   . HOH G 4 .   ? 73.365  22.968  -21.536 1.00 22.53 ? 1657 HOH A O   1 
HETATM 9740  O O   . HOH G 4 .   ? 67.381  18.181  -18.859 1.00 13.08 ? 1658 HOH A O   1 
HETATM 9741  O O   . HOH G 4 .   ? 60.340  24.375  -15.364 1.00 17.30 ? 1659 HOH A O   1 
HETATM 9742  O O   . HOH G 4 .   ? 48.156  20.703  7.758   1.00 16.25 ? 1660 HOH A O   1 
HETATM 9743  O O   . HOH G 4 .   ? 57.325  -6.609  19.442  1.00 24.32 ? 1661 HOH A O   1 
HETATM 9744  O O   . HOH G 4 .   ? 65.057  13.305  -14.328 1.00 16.22 ? 1662 HOH A O   1 
HETATM 9745  O O   . HOH G 4 .   ? 54.225  12.923  -1.347  1.00 20.86 ? 1663 HOH A O   1 
HETATM 9746  O O   . HOH G 4 .   ? 66.323  31.684  16.678  1.00 22.41 ? 1664 HOH A O   1 
HETATM 9747  O O   . HOH G 4 .   ? 43.861  11.616  13.944  1.00 15.70 ? 1665 HOH A O   1 
HETATM 9748  O O   . HOH G 4 .   ? 73.355  21.166  14.699  1.00 14.42 ? 1666 HOH A O   1 
HETATM 9749  O O   . HOH G 4 .   ? 51.471  5.689   28.601  1.00 34.69 ? 1667 HOH A O   1 
HETATM 9750  O O   . HOH G 4 .   ? 59.668  33.656  -6.539  1.00 22.19 ? 1668 HOH A O   1 
HETATM 9751  O O   . HOH G 4 .   ? 73.648  39.823  -15.105 1.00 24.30 ? 1669 HOH A O   1 
HETATM 9752  O O   . HOH G 4 .   ? 54.556  19.710  -17.938 1.00 39.24 ? 1670 HOH A O   1 
HETATM 9753  O O   . HOH G 4 .   ? 62.248  -8.597  -16.705 1.00 29.14 ? 1671 HOH A O   1 
HETATM 9754  O O   . HOH G 4 .   ? 76.014  24.009  -1.578  1.00 20.96 ? 1672 HOH A O   1 
HETATM 9755  O O   . HOH G 4 .   ? 75.494  19.945  -15.416 1.00 12.76 ? 1673 HOH A O   1 
HETATM 9756  O O   . HOH G 4 .   ? 64.924  24.223  -21.357 1.00 15.86 ? 1674 HOH A O   1 
HETATM 9757  O O   . HOH G 4 .   ? 57.677  16.595  0.826   1.00 20.38 ? 1675 HOH A O   1 
HETATM 9758  O O   . HOH G 4 .   ? 65.960  35.171  14.059  1.00 16.20 ? 1676 HOH A O   1 
HETATM 9759  O O   . HOH G 4 .   ? 64.225  23.204  0.045   1.00 14.74 ? 1677 HOH A O   1 
HETATM 9760  O O   . HOH G 4 .   ? 66.586  2.608   5.186   1.00 33.57 ? 1678 HOH A O   1 
HETATM 9761  O O   . HOH G 4 .   ? 48.745  6.256   6.431   1.00 15.38 ? 1679 HOH A O   1 
HETATM 9762  O O   . HOH G 4 .   ? 33.982  1.789   13.741  1.00 23.35 ? 1680 HOH A O   1 
HETATM 9763  O O   . HOH G 4 .   ? 75.942  3.183   -35.063 1.00 14.46 ? 1681 HOH A O   1 
HETATM 9764  O O   . HOH G 4 .   ? 49.442  -6.392  -4.341  1.00 22.24 ? 1682 HOH A O   1 
HETATM 9765  O O   . HOH G 4 .   ? 65.154  -4.454  6.608   1.00 25.31 ? 1683 HOH A O   1 
HETATM 9766  O O   . HOH G 4 .   ? 77.751  18.101  -21.687 1.00 19.26 ? 1684 HOH A O   1 
HETATM 9767  O O   . HOH G 4 .   ? 64.848  17.809  -20.254 1.00 14.75 ? 1685 HOH A O   1 
HETATM 9768  O O   . HOH G 4 .   ? 63.189  18.283  -17.814 1.00 18.44 ? 1686 HOH A O   1 
HETATM 9769  O O   . HOH G 4 .   ? 78.561  -0.986  -24.739 1.00 22.18 ? 1687 HOH A O   1 
HETATM 9770  O O   . HOH G 4 .   ? 43.922  -10.065 21.792  1.00 24.16 ? 1688 HOH A O   1 
HETATM 9771  O O   . HOH G 4 .   ? 49.664  26.859  6.016   1.00 20.33 ? 1689 HOH A O   1 
HETATM 9772  O O   . HOH G 4 .   ? 74.439  7.559   -3.130  1.00 16.97 ? 1690 HOH A O   1 
HETATM 9773  O O   . HOH G 4 .   ? 45.467  13.354  -19.859 1.00 33.19 ? 1691 HOH A O   1 
HETATM 9774  O O   . HOH G 4 .   ? 68.081  39.082  -2.587  1.00 17.80 ? 1692 HOH A O   1 
HETATM 9775  O O   . HOH G 4 .   ? 58.869  17.723  -5.292  1.00 19.05 ? 1693 HOH A O   1 
HETATM 9776  O O   . HOH G 4 .   ? 42.289  9.112   -14.654 1.00 15.31 ? 1694 HOH A O   1 
HETATM 9777  O O   . HOH G 4 .   ? 67.792  0.577   17.004  1.00 27.31 ? 1695 HOH A O   1 
HETATM 9778  O O   . HOH G 4 .   ? 67.517  22.724  -12.206 1.00 23.10 ? 1696 HOH A O   1 
HETATM 9779  O O   . HOH G 4 .   ? 66.475  32.717  -23.629 1.00 31.96 ? 1697 HOH A O   1 
HETATM 9780  O O   . HOH G 4 .   ? 82.130  3.904   -32.280 1.00 26.09 ? 1698 HOH A O   1 
HETATM 9781  O O   . HOH G 4 .   ? 67.526  -1.073  -25.902 1.00 18.25 ? 1699 HOH A O   1 
HETATM 9782  O O   . HOH G 4 .   ? 68.960  39.200  8.986   1.00 24.76 ? 1700 HOH A O   1 
HETATM 9783  O O   . HOH G 4 .   ? 58.252  -10.266 -1.190  1.00 21.94 ? 1701 HOH A O   1 
HETATM 9784  O O   . HOH G 4 .   ? 73.486  17.189  -13.008 1.00 20.38 ? 1702 HOH A O   1 
HETATM 9785  O O   . HOH G 4 .   ? 33.103  19.180  6.924   1.00 16.60 ? 1703 HOH A O   1 
HETATM 9786  O O   . HOH G 4 .   ? 29.989  2.276   15.240  1.00 31.06 ? 1704 HOH A O   1 
HETATM 9787  O O   . HOH G 4 .   ? 57.181  3.039   -24.730 1.00 19.37 ? 1705 HOH A O   1 
HETATM 9788  O O   . HOH G 4 .   ? 57.599  -6.071  -11.008 1.00 23.86 ? 1706 HOH A O   1 
HETATM 9789  O O   . HOH G 4 .   ? 65.312  -8.031  -11.353 1.00 27.66 ? 1707 HOH A O   1 
HETATM 9790  O O   . HOH G 4 .   ? 61.247  26.216  -17.060 1.00 19.27 ? 1708 HOH A O   1 
HETATM 9791  O O   . HOH G 4 .   ? 48.863  24.725  2.494   1.00 22.73 ? 1709 HOH A O   1 
HETATM 9792  O O   . HOH G 4 .   ? 35.162  -9.019  0.163   1.00 31.65 ? 1710 HOH A O   1 
HETATM 9793  O O   . HOH G 4 .   ? 71.033  7.314   -34.390 1.00 24.23 ? 1711 HOH A O   1 
HETATM 9794  O O   . HOH G 4 .   ? 58.398  3.702   15.629  1.00 23.16 ? 1712 HOH A O   1 
HETATM 9795  O O   . HOH G 4 .   ? 70.478  14.798  -14.559 1.00 15.56 ? 1713 HOH A O   1 
HETATM 9796  O O   . HOH G 4 .   ? 53.155  10.817  11.180  1.00 48.71 ? 1714 HOH A O   1 
HETATM 9797  O O   . HOH G 4 .   ? 69.267  30.385  -19.097 1.00 19.57 ? 1715 HOH A O   1 
HETATM 9798  O O   . HOH G 4 .   ? 55.074  -4.585  -7.499  1.00 40.17 ? 1716 HOH A O   1 
HETATM 9799  O O   . HOH G 4 .   ? 69.524  40.629  -4.024  1.00 24.20 ? 1717 HOH A O   1 
HETATM 9800  O O   . HOH G 4 .   ? 68.446  -1.758  9.910   1.00 24.51 ? 1718 HOH A O   1 
HETATM 9801  O O   . HOH G 4 .   ? 77.150  -3.233  -21.430 1.00 23.74 ? 1719 HOH A O   1 
HETATM 9802  O O   . HOH G 4 .   ? 83.712  31.587  -1.315  1.00 18.13 ? 1720 HOH A O   1 
HETATM 9803  O O   . HOH G 4 .   ? 77.355  16.997  -34.898 1.00 32.52 ? 1721 HOH A O   1 
HETATM 9804  O O   . HOH G 4 .   ? 27.324  6.482   4.012   1.00 26.49 ? 1722 HOH A O   1 
HETATM 9805  O O   . HOH G 4 .   ? 41.579  -9.039  -15.106 1.00 49.51 ? 1723 HOH A O   1 
HETATM 9806  O O   . HOH G 4 .   ? 70.818  -9.409  -15.007 1.00 21.09 ? 1724 HOH A O   1 
HETATM 9807  O O   . HOH G 4 .   ? 30.466  4.956   1.666   1.00 28.55 ? 1725 HOH A O   1 
HETATM 9808  O O   . HOH G 4 .   ? 75.325  20.668  -4.969  1.00 20.82 ? 1726 HOH A O   1 
HETATM 9809  O O   . HOH G 4 .   ? 71.221  -6.028  -7.535  1.00 36.40 ? 1727 HOH A O   1 
HETATM 9810  O O   . HOH G 4 .   ? 29.077  3.992   13.702  1.00 33.09 ? 1728 HOH A O   1 
HETATM 9811  O O   . HOH G 4 .   ? 43.580  -22.038 13.830  1.00 42.68 ? 1729 HOH A O   1 
HETATM 9812  O O   . HOH G 4 .   ? 69.445  31.815  14.664  1.00 21.40 ? 1730 HOH A O   1 
HETATM 9813  O O   . HOH G 4 .   ? 67.437  17.134  7.656   1.00 22.79 ? 1731 HOH A O   1 
HETATM 9814  O O   . HOH G 4 .   ? 47.630  -1.058  -15.113 1.00 23.82 ? 1732 HOH A O   1 
HETATM 9815  O O   . HOH G 4 .   ? 49.224  17.191  19.697  1.00 29.80 ? 1733 HOH A O   1 
HETATM 9816  O O   . HOH G 4 .   ? 34.997  3.358   1.078   1.00 21.52 ? 1734 HOH A O   1 
HETATM 9817  O O   . HOH G 4 .   ? 73.822  8.581   -9.029  1.00 20.91 ? 1735 HOH A O   1 
HETATM 9818  O O   . HOH G 4 .   ? 54.614  -13.593 1.394   1.00 33.74 ? 1736 HOH A O   1 
HETATM 9819  O O   . HOH G 4 .   ? 47.698  -0.413  24.392  1.00 19.82 ? 1737 HOH A O   1 
HETATM 9820  O O   . HOH G 4 .   ? 39.977  21.322  16.493  1.00 52.99 ? 1738 HOH A O   1 
HETATM 9821  O O   . HOH G 4 .   ? 71.674  16.132  -11.169 1.00 17.02 ? 1739 HOH A O   1 
HETATM 9822  O O   . HOH G 4 .   ? 77.977  21.701  3.355   1.00 30.38 ? 1740 HOH A O   1 
HETATM 9823  O O   . HOH G 4 .   ? 72.467  42.336  0.057   1.00 19.76 ? 1741 HOH A O   1 
HETATM 9824  O O   . HOH G 4 .   ? 39.403  -0.345  -3.213  1.00 25.09 ? 1742 HOH A O   1 
HETATM 9825  O O   . HOH G 4 .   ? 62.170  36.096  -20.615 1.00 26.88 ? 1743 HOH A O   1 
HETATM 9826  O O   . HOH G 4 .   ? 68.498  -7.777  -18.457 1.00 33.08 ? 1744 HOH A O   1 
HETATM 9827  O O   . HOH G 4 .   ? 59.762  17.364  -0.757  1.00 18.23 ? 1745 HOH A O   1 
HETATM 9828  O O   . HOH G 4 .   ? 40.479  4.614   23.983  1.00 26.16 ? 1746 HOH A O   1 
HETATM 9829  O O   . HOH G 4 .   ? 59.060  -5.461  21.413  1.00 33.62 ? 1747 HOH A O   1 
HETATM 9830  O O   . HOH G 4 .   ? 48.356  -6.532  -7.138  1.00 28.10 ? 1748 HOH A O   1 
HETATM 9831  O O   . HOH G 4 .   ? 80.345  30.784  6.094   1.00 31.37 ? 1749 HOH A O   1 
HETATM 9832  O O   . HOH G 4 .   ? 79.886  37.570  1.825   1.00 25.64 ? 1750 HOH A O   1 
HETATM 9833  O O   . HOH G 4 .   ? 64.812  17.851  4.783   1.00 15.97 ? 1751 HOH A O   1 
HETATM 9834  O O   . HOH G 4 .   ? 72.636  12.535  19.359  1.00 38.61 ? 1752 HOH A O   1 
HETATM 9835  O O   . HOH G 4 .   ? 66.251  33.924  -7.501  1.00 17.90 ? 1753 HOH A O   1 
HETATM 9836  O O   . HOH G 4 .   ? 53.866  -23.378 13.474  1.00 52.10 ? 1754 HOH A O   1 
HETATM 9837  O O   . HOH G 4 .   ? 64.310  42.742  -8.772  1.00 37.53 ? 1755 HOH A O   1 
HETATM 9838  O O   . HOH G 4 .   ? 55.687  -11.785 -1.569  1.00 29.91 ? 1756 HOH A O   1 
HETATM 9839  O O   . HOH G 4 .   ? 36.371  -16.928 1.056   1.00 35.82 ? 1757 HOH A O   1 
HETATM 9840  O O   . HOH G 4 .   ? 66.075  -2.753  -5.366  1.00 31.73 ? 1758 HOH A O   1 
HETATM 9841  O O   . HOH G 4 .   ? 33.575  1.480   21.496  1.00 27.83 ? 1759 HOH A O   1 
HETATM 9842  O O   . HOH G 4 .   ? 36.627  -1.962  -9.050  1.00 42.16 ? 1760 HOH A O   1 
HETATM 9843  O O   . HOH G 4 .   ? 65.755  -6.639  -22.737 1.00 24.46 ? 1761 HOH A O   1 
HETATM 9844  O O   . HOH G 4 .   ? 58.914  23.401  -4.226  1.00 18.72 ? 1762 HOH A O   1 
HETATM 9845  O O   . HOH G 4 .   ? 76.236  22.460  11.800  1.00 31.92 ? 1763 HOH A O   1 
HETATM 9846  O O   . HOH G 4 .   ? 72.921  11.411  3.682   1.00 18.52 ? 1764 HOH A O   1 
HETATM 9847  O O   . HOH G 4 .   ? 57.454  27.949  -7.196  1.00 16.83 ? 1765 HOH A O   1 
HETATM 9848  O O   . HOH G 4 .   ? 30.023  1.880   0.875   1.00 26.47 ? 1766 HOH A O   1 
HETATM 9849  O O   . HOH G 4 .   ? 61.373  28.302  -0.766  1.00 21.96 ? 1767 HOH A O   1 
HETATM 9850  O O   . HOH G 4 .   ? 74.765  21.263  -7.684  1.00 29.11 ? 1768 HOH A O   1 
HETATM 9851  O O   . HOH G 4 .   ? 69.715  2.541   -8.446  1.00 29.63 ? 1769 HOH A O   1 
HETATM 9852  O O   . HOH G 4 .   ? 68.306  6.765   3.410   1.00 19.98 ? 1770 HOH A O   1 
HETATM 9853  O O   . HOH G 4 .   ? 64.229  24.391  -25.610 1.00 32.82 ? 1771 HOH A O   1 
HETATM 9854  O O   . HOH G 4 .   ? 40.710  -0.043  -20.358 1.00 43.31 ? 1772 HOH A O   1 
HETATM 9855  O O   . HOH G 4 .   ? 43.592  14.936  -7.157  1.00 15.65 ? 1773 HOH A O   1 
HETATM 9856  O O   . HOH G 4 .   ? 66.881  25.588  20.083  1.00 26.75 ? 1774 HOH A O   1 
HETATM 9857  O O   . HOH G 4 .   ? 45.292  -2.085  25.348  1.00 29.73 ? 1775 HOH A O   1 
HETATM 9858  O O   . HOH G 4 .   ? 43.090  15.682  20.130  1.00 26.06 ? 1776 HOH A O   1 
HETATM 9859  O O   . HOH G 4 .   ? 68.411  4.961   -1.624  1.00 30.28 ? 1777 HOH A O   1 
HETATM 9860  O O   . HOH G 4 .   ? 64.867  36.485  -13.137 1.00 20.92 ? 1778 HOH A O   1 
HETATM 9861  O O   . HOH G 4 .   ? 76.781  17.984  -11.090 1.00 19.21 ? 1779 HOH A O   1 
HETATM 9862  O O   . HOH G 4 .   ? 32.131  16.132  12.853  1.00 22.47 ? 1780 HOH A O   1 
HETATM 9863  O O   . HOH G 4 .   ? 75.837  16.150  -21.695 1.00 16.49 ? 1781 HOH A O   1 
HETATM 9864  O O   . HOH G 4 .   ? 59.503  27.121  13.223  1.00 30.41 ? 1782 HOH A O   1 
HETATM 9865  O O   . HOH G 4 .   ? 65.680  1.315   -28.283 1.00 41.89 ? 1783 HOH A O   1 
HETATM 9866  O O   . HOH G 4 .   ? 84.675  35.025  -2.058  1.00 35.57 ? 1784 HOH A O   1 
HETATM 9867  O O   . HOH G 4 .   ? 48.012  -18.006 11.436  1.00 37.07 ? 1785 HOH A O   1 
HETATM 9868  O O   . HOH G 4 .   ? 78.077  24.016  8.909   1.00 22.95 ? 1786 HOH A O   1 
HETATM 9869  O O   . HOH G 4 .   ? 61.957  -4.063  25.495  1.00 41.16 ? 1787 HOH A O   1 
HETATM 9870  O O   . HOH G 4 .   ? 34.421  20.550  8.751   1.00 24.69 ? 1788 HOH A O   1 
HETATM 9871  O O   . HOH G 4 .   ? 65.994  8.522   3.138   1.00 38.54 ? 1789 HOH A O   1 
HETATM 9872  O O   . HOH G 4 .   ? 56.313  -2.566  -21.537 1.00 35.71 ? 1790 HOH A O   1 
HETATM 9873  O O   . HOH G 4 .   ? 77.713  29.795  -11.874 1.00 39.61 ? 1791 HOH A O   1 
HETATM 9874  O O   . HOH G 4 .   ? 57.270  5.827   16.638  1.00 29.21 ? 1792 HOH A O   1 
HETATM 9875  O O   . HOH G 4 .   ? 70.639  -5.159  -21.161 1.00 29.86 ? 1793 HOH A O   1 
HETATM 9876  O O   . HOH G 4 .   ? 78.822  27.290  7.499   1.00 19.32 ? 1794 HOH A O   1 
HETATM 9877  O O   . HOH G 4 .   ? 58.154  -10.945 17.409  1.00 39.87 ? 1795 HOH A O   1 
HETATM 9878  O O   . HOH G 4 .   ? 73.230  -8.844  -13.743 1.00 35.08 ? 1796 HOH A O   1 
HETATM 9879  O O   . HOH G 4 .   ? 51.623  3.452   12.731  1.00 23.57 ? 1797 HOH A O   1 
HETATM 9880  O O   . HOH G 4 .   ? 43.951  7.680   -16.093 1.00 25.36 ? 1798 HOH A O   1 
HETATM 9881  O O   . HOH G 4 .   ? 40.558  -5.474  -1.532  1.00 27.15 ? 1799 HOH A O   1 
HETATM 9882  O O   . HOH G 4 .   ? 46.773  19.101  16.292  1.00 37.80 ? 1800 HOH A O   1 
HETATM 9883  O O   . HOH G 4 .   ? 42.128  -13.893 -3.181  1.00 32.63 ? 1801 HOH A O   1 
HETATM 9884  O O   . HOH G 4 .   ? 27.460  -4.776  3.054   1.00 30.39 ? 1802 HOH A O   1 
HETATM 9885  O O   . HOH G 4 .   ? 30.952  4.462   12.008  1.00 26.19 ? 1803 HOH A O   1 
HETATM 9886  O O   . HOH G 4 .   ? 79.240  15.245  15.765  1.00 47.33 ? 1804 HOH A O   1 
HETATM 9887  O O   . HOH G 4 .   ? 67.195  -7.214  -7.839  1.00 28.73 ? 1805 HOH A O   1 
HETATM 9888  O O   . HOH G 4 .   ? 43.759  4.491   -10.120 1.00 40.39 ? 1806 HOH A O   1 
HETATM 9889  O O   . HOH G 4 .   ? 47.822  -16.773 3.383   1.00 30.47 ? 1807 HOH A O   1 
HETATM 9890  O O   . HOH G 4 .   ? 77.302  9.770   9.223   1.00 21.85 ? 1808 HOH A O   1 
HETATM 9891  O O   . HOH G 4 .   ? 43.398  10.733  -18.231 1.00 39.19 ? 1809 HOH A O   1 
HETATM 9892  O O   . HOH G 4 .   ? 41.382  -2.517  -6.984  1.00 42.61 ? 1810 HOH A O   1 
HETATM 9893  O O   . HOH G 4 .   ? 76.226  4.031   -5.766  1.00 29.34 ? 1811 HOH A O   1 
HETATM 9894  O O   . HOH G 4 .   ? 81.127  5.191   -18.521 1.00 29.33 ? 1812 HOH A O   1 
HETATM 9895  O O   . HOH G 4 .   ? 27.783  3.920   20.669  1.00 28.52 ? 1813 HOH A O   1 
HETATM 9896  O O   . HOH G 4 .   ? 81.841  5.165   -27.272 1.00 38.31 ? 1814 HOH A O   1 
HETATM 9897  O O   . HOH G 4 .   ? 38.531  -20.847 13.405  1.00 46.44 ? 1815 HOH A O   1 
HETATM 9898  O O   . HOH G 4 .   ? 79.142  1.958   -6.913  1.00 46.43 ? 1816 HOH A O   1 
HETATM 9899  O O   . HOH G 4 .   ? 56.152  -21.055 14.598  1.00 66.93 ? 1817 HOH A O   1 
HETATM 9900  O O   . HOH G 4 .   ? 64.422  11.845  11.580  1.00 25.36 ? 1818 HOH A O   1 
HETATM 9901  O O   . HOH G 4 .   ? 59.214  23.230  2.145   1.00 29.35 ? 1819 HOH A O   1 
HETATM 9902  O O   . HOH G 4 .   ? 42.412  11.416  21.155  1.00 28.26 ? 1820 HOH A O   1 
HETATM 9903  O O   . HOH G 4 .   ? 78.432  32.728  -5.638  1.00 27.90 ? 1821 HOH A O   1 
HETATM 9904  O O   . HOH G 4 .   ? 56.446  -5.514  -18.492 1.00 34.03 ? 1822 HOH A O   1 
HETATM 9905  O O   . HOH G 4 .   ? 33.285  5.509   -4.942  1.00 25.92 ? 1823 HOH A O   1 
HETATM 9906  O O   . HOH G 4 .   ? 51.395  -14.887 1.537   1.00 29.41 ? 1824 HOH A O   1 
HETATM 9907  O O   . HOH G 4 .   ? 63.214  -9.450  -13.844 1.00 41.40 ? 1825 HOH A O   1 
HETATM 9908  O O   . HOH G 4 .   ? 76.500  35.308  14.564  1.00 57.20 ? 1826 HOH A O   1 
HETATM 9909  O O   . HOH G 4 .   ? 59.335  -9.429  -3.513  1.00 24.80 ? 1827 HOH A O   1 
HETATM 9910  O O   . HOH G 4 .   ? 61.891  38.640  -11.258 1.00 23.91 ? 1828 HOH A O   1 
HETATM 9911  O O   . HOH G 4 .   ? 79.362  33.302  7.887   1.00 42.69 ? 1829 HOH A O   1 
HETATM 9912  O O   . HOH G 4 .   ? 43.994  17.610  -8.288  1.00 40.81 ? 1830 HOH A O   1 
HETATM 9913  O O   . HOH G 4 .   ? 75.878  -5.570  -14.493 1.00 23.31 ? 1831 HOH A O   1 
HETATM 9914  O O   . HOH G 4 .   ? 53.736  9.742   -29.357 1.00 47.49 ? 1832 HOH A O   1 
HETATM 9915  O O   . HOH G 4 .   ? 79.590  3.730   -21.279 1.00 33.83 ? 1833 HOH A O   1 
HETATM 9916  O O   . HOH G 4 .   ? 47.292  -3.663  -15.234 1.00 29.52 ? 1834 HOH A O   1 
HETATM 9917  O O   . HOH G 4 .   ? 57.386  12.062  15.764  1.00 42.26 ? 1835 HOH A O   1 
HETATM 9918  O O   . HOH G 4 .   ? 39.821  -7.224  -11.450 1.00 30.18 ? 1836 HOH A O   1 
HETATM 9919  O O   . HOH G 4 .   ? 82.641  39.501  3.536   1.00 33.73 ? 1837 HOH A O   1 
HETATM 9920  O O   . HOH G 4 .   ? 78.684  39.270  -4.800  1.00 28.95 ? 1838 HOH A O   1 
HETATM 9921  O O   . HOH G 4 .   ? 45.416  8.014   -20.466 1.00 20.29 ? 1839 HOH A O   1 
HETATM 9922  O O   . HOH G 4 .   ? 57.956  3.929   27.980  1.00 38.02 ? 1840 HOH A O   1 
HETATM 9923  O O   . HOH G 4 .   ? 79.375  31.413  3.689   1.00 23.34 ? 1841 HOH A O   1 
HETATM 9924  O O   . HOH G 4 .   ? 72.069  -1.786  -29.762 1.00 27.93 ? 1842 HOH A O   1 
HETATM 9925  O O   . HOH G 4 .   ? 58.971  32.827  -17.290 1.00 34.71 ? 1843 HOH A O   1 
HETATM 9926  O O   . HOH G 4 .   ? 38.327  -7.693  -5.464  1.00 31.03 ? 1844 HOH A O   1 
HETATM 9927  O O   . HOH G 4 .   ? 63.629  7.059   -30.585 1.00 37.57 ? 1845 HOH A O   1 
HETATM 9928  O O   . HOH G 4 .   ? 23.931  17.349  14.629  1.00 31.61 ? 1846 HOH A O   1 
HETATM 9929  O O   . HOH G 4 .   ? 65.549  2.071   0.423   1.00 25.49 ? 1847 HOH A O   1 
HETATM 9930  O O   . HOH G 4 .   ? 39.066  12.734  28.045  1.00 50.07 ? 1848 HOH A O   1 
HETATM 9931  O O   . HOH G 4 .   ? 37.047  20.799  2.311   1.00 41.47 ? 1849 HOH A O   1 
HETATM 9932  O O   . HOH G 4 .   ? 28.781  12.015  18.579  1.00 39.32 ? 1850 HOH A O   1 
HETATM 9933  O O   . HOH G 4 .   ? 52.459  19.896  -3.538  1.00 22.33 ? 1851 HOH A O   1 
HETATM 9934  O O   . HOH G 4 .   ? 51.370  21.741  15.603  1.00 43.39 ? 1852 HOH A O   1 
HETATM 9935  O O   . HOH G 4 .   ? 49.122  -22.770 16.639  1.00 69.09 ? 1853 HOH A O   1 
HETATM 9936  O O   . HOH G 4 .   ? 46.343  -12.963 25.974  1.00 45.57 ? 1854 HOH A O   1 
HETATM 9937  O O   . HOH G 4 .   ? 39.011  -17.544 21.287  1.00 37.33 ? 1855 HOH A O   1 
HETATM 9938  O O   . HOH G 4 .   ? 35.608  21.377  21.253  1.00 47.76 ? 1856 HOH A O   1 
HETATM 9939  O O   . HOH G 4 .   ? 72.031  19.447  -30.501 1.00 38.43 ? 1857 HOH A O   1 
HETATM 9940  O O   . HOH G 4 .   ? 75.990  43.152  8.312   1.00 29.87 ? 1858 HOH A O   1 
HETATM 9941  O O   . HOH G 4 .   ? 77.481  2.638   2.083   1.00 38.47 ? 1859 HOH A O   1 
HETATM 9942  O O   . HOH G 4 .   ? 48.692  19.047  2.976   1.00 62.83 ? 1860 HOH A O   1 
HETATM 9943  O O   . HOH G 4 .   ? 77.312  -4.006  -27.782 1.00 32.81 ? 1861 HOH A O   1 
HETATM 9944  O O   . HOH G 4 .   ? 44.265  -18.942 0.340   1.00 34.66 ? 1862 HOH A O   1 
HETATM 9945  O O   . HOH G 4 .   ? 73.255  21.459  -11.854 1.00 11.09 ? 1863 HOH A O   1 
HETATM 9946  O O   . HOH G 4 .   ? 75.010  19.391  -12.623 1.00 20.80 ? 1864 HOH A O   1 
HETATM 9947  O O   . HOH G 4 .   ? 58.018  -10.924 -5.482  1.00 17.16 ? 1865 HOH A O   1 
HETATM 9948  O O   . HOH G 4 .   ? 47.171  5.562   -17.131 1.00 23.86 ? 1866 HOH A O   1 
HETATM 9949  O O   . HOH G 4 .   ? 41.801  13.632  22.192  1.00 29.84 ? 1867 HOH A O   1 
HETATM 9950  O O   . HOH G 4 .   ? 61.312  30.426  12.384  1.00 21.78 ? 1868 HOH A O   1 
HETATM 9951  O O   . HOH G 4 .   ? 71.790  22.511  3.459   1.00 19.78 ? 1869 HOH A O   1 
HETATM 9952  O O   . HOH G 4 .   ? 69.252  2.682   16.770  1.00 29.85 ? 1870 HOH A O   1 
HETATM 9953  O O   . HOH G 4 .   ? 61.126  21.940  -2.199  1.00 20.86 ? 1871 HOH A O   1 
HETATM 9954  O O   . HOH G 4 .   ? 64.875  29.549  17.192  1.00 31.42 ? 1872 HOH A O   1 
HETATM 9955  O O   . HOH G 4 .   ? 65.562  -10.793 -17.608 1.00 30.62 ? 1873 HOH A O   1 
HETATM 9956  O O   . HOH G 4 .   ? 60.898  -10.516 -17.943 1.00 29.67 ? 1874 HOH A O   1 
HETATM 9957  O O   . HOH G 4 .   ? 63.930  14.745  11.731  1.00 19.68 ? 1875 HOH A O   1 
HETATM 9958  O O   . HOH G 4 .   ? 66.304  24.523  -23.992 1.00 30.97 ? 1876 HOH A O   1 
HETATM 9959  O O   . HOH G 4 .   ? 80.650  14.889  -5.999  1.00 33.29 ? 1877 HOH A O   1 
HETATM 9960  O O   . HOH G 4 .   ? 72.213  22.880  -24.227 1.00 21.59 ? 1878 HOH A O   1 
HETATM 9961  O O   . HOH G 4 .   ? 66.545  19.830  16.077  1.00 19.32 ? 1879 HOH A O   1 
HETATM 9962  O O   . HOH G 4 .   ? 72.895  4.619   24.003  1.00 48.42 ? 1880 HOH A O   1 
HETATM 9963  O O   . HOH G 4 .   ? 79.827  10.396  9.445   1.00 28.54 ? 1881 HOH A O   1 
HETATM 9964  O O   . HOH G 4 .   ? 59.850  -7.785  -15.363 1.00 27.84 ? 1882 HOH A O   1 
HETATM 9965  O O   . HOH G 4 .   ? 49.832  -0.455  -16.274 1.00 30.23 ? 1883 HOH A O   1 
HETATM 9966  O O   . HOH G 4 .   ? 35.738  6.546   26.964  1.00 34.01 ? 1884 HOH A O   1 
HETATM 9967  O O   . HOH G 4 .   ? 33.172  18.658  0.089   1.00 32.85 ? 1885 HOH A O   1 
HETATM 9968  O O   . HOH G 4 .   ? 60.018  25.844  -0.621  1.00 23.58 ? 1886 HOH A O   1 
HETATM 9969  O O   . HOH G 4 .   ? 57.516  19.305  -3.604  1.00 33.13 ? 1887 HOH A O   1 
HETATM 9970  O O   . HOH G 4 .   ? 55.299  15.292  0.045   1.00 28.13 ? 1888 HOH A O   1 
HETATM 9971  O O   . HOH G 4 .   ? 33.403  3.403   11.884  1.00 28.37 ? 1889 HOH A O   1 
HETATM 9972  O O   . HOH G 4 .   ? 59.260  20.086  -1.691  1.00 20.27 ? 1890 HOH A O   1 
HETATM 9973  O O   . HOH G 4 .   ? 54.500  -12.937 17.404  1.00 60.07 ? 1891 HOH A O   1 
HETATM 9974  O O   . HOH G 4 .   ? 85.492  33.896  -4.270  1.00 27.27 ? 1892 HOH A O   1 
HETATM 9975  O O   . HOH G 4 .   ? 45.235  19.846  -8.139  1.00 45.46 ? 1893 HOH A O   1 
HETATM 9976  O O   . HOH G 4 .   ? 61.067  7.231   -30.202 1.00 30.15 ? 1894 HOH A O   1 
HETATM 9977  O O   . HOH G 4 .   ? 53.997  0.737   21.402  1.00 27.33 ? 1895 HOH A O   1 
HETATM 9978  O O   . HOH G 4 .   ? 39.750  -0.268  -5.912  1.00 37.98 ? 1896 HOH A O   1 
HETATM 9979  O O   . HOH G 4 .   ? 45.592  14.931  20.445  1.00 27.83 ? 1897 HOH A O   1 
HETATM 9980  O O   . HOH G 4 .   ? 49.304  15.718  21.853  1.00 29.90 ? 1898 HOH A O   1 
HETATM 9981  O O   . HOH G 4 .   ? 64.758  17.953  7.804   1.00 38.23 ? 1899 HOH A O   1 
HETATM 9982  O O   . HOH G 4 .   ? 58.629  30.469  9.623   1.00 37.08 ? 1900 HOH A O   1 
HETATM 9983  O O   . HOH G 4 .   ? 74.113  19.288  -27.343 1.00 29.72 ? 1901 HOH A O   1 
HETATM 9984  O O   . HOH G 4 .   ? 61.238  23.558  -0.091  1.00 23.05 ? 1902 HOH A O   1 
HETATM 9985  O O   . HOH G 4 .   ? 57.009  27.073  -13.976 1.00 27.71 ? 1903 HOH A O   1 
HETATM 9986  O O   . HOH G 4 .   ? 57.947  21.187  0.212   1.00 32.31 ? 1904 HOH A O   1 
HETATM 9987  O O   . HOH G 4 .   ? 69.127  4.711   2.151   1.00 40.96 ? 1905 HOH A O   1 
HETATM 9988  O O   . HOH G 4 .   ? 27.869  -5.309  9.871   1.00 35.60 ? 1906 HOH A O   1 
HETATM 9989  O O   . HOH G 4 .   ? 45.318  -10.952 24.490  1.00 35.15 ? 1907 HOH A O   1 
HETATM 9990  O O   . HOH G 4 .   ? 51.584  15.468  -23.434 1.00 38.44 ? 1908 HOH A O   1 
HETATM 9991  O O   . HOH G 4 .   ? 60.060  36.693  -17.000 1.00 32.91 ? 1909 HOH A O   1 
HETATM 9992  O O   . HOH G 4 .   ? 66.527  25.033  22.651  1.00 39.37 ? 1910 HOH A O   1 
HETATM 9993  O O   . HOH G 4 .   ? 41.542  -17.968 21.534  1.00 62.12 ? 1911 HOH A O   1 
HETATM 9994  O O   . HOH G 4 .   ? 51.356  17.467  -3.612  1.00 24.78 ? 1912 HOH A O   1 
HETATM 9995  O O   . HOH G 4 .   ? 58.950  -13.209 16.068  1.00 44.70 ? 1913 HOH A O   1 
HETATM 9996  O O   . HOH G 4 .   ? 65.664  14.737  -27.961 1.00 27.45 ? 1914 HOH A O   1 
HETATM 9997  O O   . HOH G 4 .   ? 53.847  18.186  16.295  1.00 33.90 ? 1915 HOH A O   1 
HETATM 9998  O O   . HOH G 4 .   ? 81.359  17.679  -6.293  1.00 34.23 ? 1916 HOH A O   1 
HETATM 9999  O O   . HOH G 4 .   ? 42.268  19.436  16.813  1.00 31.47 ? 1917 HOH A O   1 
HETATM 10000 O O   . HOH G 4 .   ? 68.501  34.487  15.110  1.00 30.10 ? 1918 HOH A O   1 
HETATM 10001 O O   . HOH G 4 .   ? 58.097  2.567   -27.162 1.00 30.10 ? 1919 HOH A O   1 
HETATM 10002 O O   . HOH G 4 .   ? 71.610  3.139   -35.010 1.00 29.92 ? 1920 HOH A O   1 
HETATM 10003 O O   . HOH G 4 .   ? 35.994  -21.979 14.404  1.00 31.32 ? 1921 HOH A O   1 
HETATM 10004 O O   . HOH G 4 .   ? 30.157  12.397  25.925  1.00 32.42 ? 1922 HOH A O   1 
HETATM 10005 O O   . HOH G 4 .   ? 55.533  -12.608 -4.057  1.00 38.01 ? 1923 HOH A O   1 
HETATM 10006 O O   . HOH G 4 .   ? 65.126  23.287  19.121  1.00 31.03 ? 1924 HOH A O   1 
HETATM 10007 O O   . HOH G 4 .   ? 78.534  -2.296  -9.585  1.00 33.43 ? 1925 HOH A O   1 
HETATM 10008 O O   . HOH G 4 .   ? 28.164  16.109  16.777  1.00 32.02 ? 1926 HOH A O   1 
HETATM 10009 O O   . HOH G 4 .   ? 71.225  26.850  -22.176 1.00 37.15 ? 1927 HOH A O   1 
HETATM 10010 O O   . HOH G 4 .   ? 43.916  7.132   -9.198  1.00 36.15 ? 1928 HOH A O   1 
HETATM 10011 O O   . HOH G 4 .   ? 51.314  10.762  -1.973  1.00 29.21 ? 1929 HOH A O   1 
HETATM 10012 O O   . HOH G 4 .   ? 54.883  27.062  -7.679  1.00 41.36 ? 1930 HOH A O   1 
HETATM 10013 O O   . HOH G 4 .   ? 75.661  -4.677  -23.109 1.00 34.60 ? 1931 HOH A O   1 
HETATM 10014 O O   . HOH G 4 .   ? 65.873  20.548  -11.548 1.00 41.53 ? 1932 HOH A O   1 
HETATM 10015 O O   . HOH G 4 .   ? 53.896  25.097  3.781   1.00 26.59 ? 1933 HOH A O   1 
HETATM 10016 O O   . HOH G 4 .   ? 65.883  -7.780  -4.501  1.00 37.69 ? 1934 HOH A O   1 
HETATM 10017 O O   . HOH G 4 .   ? 67.322  18.030  -30.717 1.00 34.99 ? 1935 HOH A O   1 
HETATM 10018 O O   . HOH G 4 .   ? 72.959  18.112  18.886  1.00 37.31 ? 1936 HOH A O   1 
HETATM 10019 O O   . HOH G 4 .   ? 68.410  43.232  -4.732  1.00 39.03 ? 1937 HOH A O   1 
HETATM 10020 O O   . HOH G 4 .   ? 41.983  8.075   -10.423 1.00 32.44 ? 1938 HOH A O   1 
HETATM 10021 O O   . HOH G 4 .   ? 51.816  28.254  5.542   1.00 36.58 ? 1939 HOH A O   1 
HETATM 10022 O O   . HOH G 4 .   ? 36.979  19.017  21.057  1.00 42.10 ? 1940 HOH A O   1 
HETATM 10023 O O   . HOH G 4 .   ? 34.579  9.027   -2.912  1.00 40.63 ? 1941 HOH A O   1 
HETATM 10024 O O   . HOH G 4 .   ? 41.311  2.053   -7.055  1.00 28.96 ? 1942 HOH A O   1 
HETATM 10025 O O   . HOH G 4 .   ? 67.385  16.913  -35.581 1.00 37.23 ? 1943 HOH A O   1 
HETATM 10026 O O   . HOH G 4 .   ? 80.249  -4.025  -21.639 1.00 35.53 ? 1944 HOH A O   1 
HETATM 10027 O O   . HOH G 4 .   ? 69.477  -2.003  -28.464 1.00 60.28 ? 1945 HOH A O   1 
HETATM 10028 O O   . HOH G 4 .   ? 76.747  32.604  17.840  1.00 47.05 ? 1946 HOH A O   1 
HETATM 10029 O O   . HOH G 4 .   ? 58.695  23.993  -17.976 1.00 40.76 ? 1947 HOH A O   1 
HETATM 10030 O O   . HOH G 4 .   ? 32.708  20.723  10.741  1.00 46.31 ? 1948 HOH A O   1 
HETATM 10031 O O   . HOH G 4 .   ? 23.005  15.239  8.062   1.00 35.99 ? 1949 HOH A O   1 
HETATM 10032 O O   . HOH G 4 .   ? 55.087  25.029  -15.446 1.00 34.82 ? 1950 HOH A O   1 
HETATM 10033 O O   . HOH G 4 .   ? 78.795  6.118   -10.405 1.00 49.51 ? 1951 HOH A O   1 
HETATM 10034 O O   . HOH G 4 .   ? 40.283  -7.150  -3.791  1.00 50.39 ? 1952 HOH A O   1 
HETATM 10035 O O   . HOH G 4 .   ? 79.487  7.864   -5.507  1.00 44.78 ? 1953 HOH A O   1 
HETATM 10036 O O   . HOH G 4 .   ? 66.915  28.116  -21.468 1.00 41.75 ? 1954 HOH A O   1 
HETATM 10037 O O   . HOH G 4 .   ? 48.225  24.350  -0.148  1.00 39.72 ? 1955 HOH A O   1 
HETATM 10038 O O   . HOH G 4 .   ? 51.649  -2.451  -15.532 1.00 33.55 ? 1956 HOH A O   1 
HETATM 10039 O O   . HOH G 4 .   ? 76.996  33.033  13.027  1.00 31.90 ? 1957 HOH A O   1 
HETATM 10040 O O   . HOH G 4 .   ? 52.459  -15.470 3.951   1.00 43.73 ? 1958 HOH A O   1 
HETATM 10041 O O   . HOH G 4 .   ? 66.478  -2.798  8.457   1.00 39.15 ? 1959 HOH A O   1 
HETATM 10042 O O   . HOH G 4 .   ? 57.169  -7.621  -16.945 1.00 41.83 ? 1960 HOH A O   1 
HETATM 10043 O O   . HOH G 4 .   ? 40.355  -5.710  23.016  1.00 48.84 ? 1961 HOH A O   1 
HETATM 10044 O O   . HOH G 4 .   ? 77.237  26.516  13.164  1.00 37.39 ? 1962 HOH A O   1 
HETATM 10045 O O   . HOH G 4 .   ? 51.814  16.561  20.193  1.00 49.31 ? 1963 HOH A O   1 
HETATM 10046 O O   . HOH G 4 .   ? 49.066  -15.793 0.813   1.00 29.52 ? 1964 HOH A O   1 
HETATM 10047 O O   . HOH G 4 .   ? 73.736  30.380  18.609  1.00 36.14 ? 1965 HOH A O   1 
HETATM 10048 O O   . HOH G 4 .   ? 63.649  27.196  -20.951 1.00 39.77 ? 1966 HOH A O   1 
HETATM 10049 O O   . HOH G 4 .   ? 33.821  22.907  7.464   1.00 35.65 ? 1967 HOH A O   1 
HETATM 10050 O O   . HOH G 4 .   ? 61.033  30.987  -18.606 1.00 30.83 ? 1968 HOH A O   1 
HETATM 10051 O O   . HOH G 4 .   ? 45.466  24.875  0.893   1.00 35.21 ? 1969 HOH A O   1 
HETATM 10052 O O   . HOH G 4 .   ? 81.994  28.847  -10.700 1.00 40.54 ? 1970 HOH A O   1 
HETATM 10053 O O   . HOH G 4 .   ? 75.234  -3.365  9.240   1.00 47.44 ? 1971 HOH A O   1 
HETATM 10054 O O   . HOH G 4 .   ? 53.603  -1.719  -13.864 1.00 65.72 ? 1972 HOH A O   1 
HETATM 10055 O O   . HOH G 4 .   ? 58.414  25.414  -2.784  1.00 39.91 ? 1973 HOH A O   1 
HETATM 10056 O O   . HOH G 4 .   ? 62.671  22.701  -29.098 1.00 36.52 ? 1974 HOH A O   1 
HETATM 10057 O O   . HOH G 4 .   ? 26.695  4.286   11.552  1.00 31.82 ? 1975 HOH A O   1 
HETATM 10058 O O   . HOH G 4 .   ? 79.154  17.601  13.597  1.00 32.16 ? 1976 HOH A O   1 
HETATM 10059 O O   . HOH G 4 .   ? 47.443  2.279   24.781  1.00 27.77 ? 1977 HOH A O   1 
HETATM 10060 O O   . HOH G 4 .   ? 76.147  41.274  6.507   1.00 38.99 ? 1978 HOH A O   1 
HETATM 10061 O O   . HOH G 4 .   ? 61.592  13.976  11.431  1.00 37.05 ? 1979 HOH A O   1 
HETATM 10062 O O   . HOH G 4 .   ? 71.906  35.334  -19.416 1.00 37.21 ? 1980 HOH A O   1 
HETATM 10063 O O   . HOH G 4 .   ? 75.324  -6.507  -11.821 1.00 49.63 ? 1981 HOH A O   1 
HETATM 10064 O O   . HOH G 4 .   ? 38.372  10.587  -14.102 1.00 40.54 ? 1982 HOH A O   1 
HETATM 10065 O O   . HOH G 4 .   ? 35.369  3.466   22.012  1.00 37.61 ? 1983 HOH A O   1 
HETATM 10066 O O   . HOH G 4 .   ? 57.379  34.977  -16.440 1.00 40.50 ? 1984 HOH A O   1 
HETATM 10067 O O   . HOH G 4 .   ? 57.980  25.599  1.412   1.00 30.51 ? 1985 HOH A O   1 
HETATM 10068 O O   . HOH G 4 .   ? 62.262  17.449  9.342   1.00 29.53 ? 1986 HOH A O   1 
HETATM 10069 O O   . HOH G 4 .   ? 31.292  1.408   23.584  1.00 49.13 ? 1987 HOH A O   1 
HETATM 10070 O O   . HOH G 4 .   ? 67.178  -5.101  -5.772  1.00 35.63 ? 1988 HOH A O   1 
HETATM 10071 O O   . HOH G 4 .   ? 64.962  -7.236  5.258   1.00 54.36 ? 1989 HOH A O   1 
HETATM 10072 O O   . HOH G 4 .   ? 64.777  44.432  5.868   1.00 35.56 ? 1990 HOH A O   1 
HETATM 10073 O O   . HOH G 4 .   ? 78.209  -3.731  -25.286 1.00 44.11 ? 1991 HOH A O   1 
HETATM 10074 O O   . HOH G 4 .   ? 80.611  21.533  -2.916  1.00 41.07 ? 1992 HOH A O   1 
HETATM 10075 O O   . HOH G 4 .   ? 44.928  22.182  -19.244 1.00 50.62 ? 1993 HOH A O   1 
HETATM 10076 O O   . HOH G 4 .   ? 41.926  -7.994  21.636  1.00 27.82 ? 1994 HOH A O   1 
HETATM 10077 O O   . HOH G 4 .   ? 36.002  -1.502  3.089   1.00 30.57 ? 1995 HOH A O   1 
HETATM 10078 O O   . HOH G 4 .   ? 21.347  -2.227  5.860   1.00 43.81 ? 1996 HOH A O   1 
HETATM 10079 O O   . HOH G 4 .   ? 76.160  9.619   24.350  1.00 34.11 ? 1997 HOH A O   1 
HETATM 10080 O O   . HOH G 4 .   ? 66.870  13.847  19.146  1.00 38.00 ? 1998 HOH A O   1 
HETATM 10081 O O   . HOH G 4 .   ? 54.687  16.364  -28.139 1.00 37.99 ? 1999 HOH A O   1 
HETATM 10082 O O   . HOH G 4 .   ? 36.805  20.121  -2.173  1.00 40.57 ? 2000 HOH A O   1 
HETATM 10083 O O   . HOH G 4 .   ? 69.457  19.555  -36.345 1.00 38.83 ? 2001 HOH A O   1 
HETATM 10084 O O   . HOH G 4 .   ? 59.932  28.728  -17.584 1.00 48.21 ? 2002 HOH A O   1 
HETATM 10085 O O   . HOH G 4 .   ? 41.575  -5.137  -5.050  1.00 65.34 ? 2003 HOH A O   1 
HETATM 10086 O O   . HOH G 4 .   ? 36.151  -13.425 22.813  1.00 39.99 ? 2004 HOH A O   1 
HETATM 10087 O O   . HOH G 4 .   ? 56.502  0.331   22.265  1.00 36.66 ? 2005 HOH A O   1 
HETATM 10088 O O   . HOH G 4 .   ? 54.850  27.132  5.164   1.00 35.17 ? 2006 HOH A O   1 
HETATM 10089 O O   . HOH G 4 .   ? 56.012  -18.228 11.105  1.00 49.77 ? 2007 HOH A O   1 
HETATM 10090 O O   . HOH G 4 .   ? 52.962  -1.439  27.715  1.00 33.72 ? 2008 HOH A O   1 
HETATM 10091 O O   . HOH G 4 .   ? 82.281  21.649  -6.674  1.00 38.43 ? 2009 HOH A O   1 
HETATM 10092 O O   . HOH G 4 .   ? 81.215  1.160   -8.749  1.00 45.32 ? 2010 HOH A O   1 
HETATM 10093 O O   . HOH G 4 .   ? 39.393  1.860   24.134  1.00 37.45 ? 2011 HOH A O   1 
HETATM 10094 O O   . HOH G 4 .   ? 63.068  2.206   23.218  1.00 45.56 ? 2012 HOH A O   1 
HETATM 10095 O O   . HOH G 4 .   ? 60.526  1.837   22.272  1.00 38.20 ? 2013 HOH A O   1 
HETATM 10096 O O   . HOH G 4 .   ? 27.290  5.622   23.056  1.00 46.67 ? 2014 HOH A O   1 
HETATM 10097 O O   . HOH G 4 .   ? 50.574  -25.778 8.430   1.00 46.52 ? 2015 HOH A O   1 
HETATM 10098 O O   . HOH G 4 .   ? 70.678  -2.942  23.099  1.00 45.68 ? 2016 HOH A O   1 
HETATM 10099 O O   . HOH G 4 .   ? 38.033  15.873  -10.534 1.00 34.19 ? 2017 HOH A O   1 
HETATM 10100 O O   . HOH G 4 .   ? 81.720  12.171  2.592   1.00 41.80 ? 2018 HOH A O   1 
HETATM 10101 O O   . HOH G 4 .   ? 63.995  11.361  -31.145 1.00 50.55 ? 2019 HOH A O   1 
HETATM 10102 O O   . HOH G 4 .   ? 72.952  45.864  4.271   1.00 37.45 ? 2020 HOH A O   1 
HETATM 10103 O O   . HOH G 4 .   ? 74.917  -8.037  -15.950 1.00 42.47 ? 2021 HOH A O   1 
HETATM 10104 O O   . HOH G 4 .   ? 56.154  22.596  -24.209 1.00 39.77 ? 2022 HOH A O   1 
HETATM 10105 O O   . HOH G 4 .   ? 59.817  34.960  -20.256 1.00 54.53 ? 2023 HOH A O   1 
HETATM 10106 O O   . HOH G 4 .   ? 48.729  -1.889  27.471  1.00 39.30 ? 2024 HOH A O   1 
HETATM 10107 O O   . HOH G 4 .   ? 80.124  25.993  -6.527  1.00 41.24 ? 2025 HOH A O   1 
HETATM 10108 O O   . HOH G 4 .   ? 42.113  -20.969 8.085   1.00 65.88 ? 2026 HOH A O   1 
HETATM 10109 O O   . HOH G 4 .   ? 58.790  -8.173  -12.845 1.00 24.18 ? 2027 HOH A O   1 
HETATM 10110 O O   . HOH G 4 .   ? 68.198  40.857  -17.591 1.00 40.95 ? 2028 HOH A O   1 
HETATM 10111 O O   . HOH G 4 .   ? 60.140  7.719   19.909  1.00 31.10 ? 2029 HOH A O   1 
HETATM 10112 O O   . HOH G 4 .   ? 68.679  -1.728  5.425   1.00 44.74 ? 2030 HOH A O   1 
HETATM 10113 O O   . HOH G 4 .   ? 42.981  -12.188 -7.775  1.00 49.43 ? 2031 HOH A O   1 
HETATM 10114 O O   . HOH G 4 .   ? 34.880  22.296  15.216  1.00 41.89 ? 2032 HOH A O   1 
HETATM 10115 O O   . HOH G 4 .   ? 51.846  -23.653 11.447  1.00 65.00 ? 2033 HOH A O   1 
HETATM 10116 O O   . HOH G 4 .   ? 48.953  15.689  -22.912 1.00 48.78 ? 2034 HOH A O   1 
HETATM 10117 O O   . HOH G 4 .   ? 43.347  4.742   -12.925 1.00 47.18 ? 2035 HOH A O   1 
HETATM 10118 O O   . HOH G 4 .   ? 81.473  -4.149  -17.625 1.00 73.40 ? 2036 HOH A O   1 
HETATM 10119 O O   . HOH G 4 .   ? 57.953  22.360  -19.765 1.00 29.03 ? 2037 HOH A O   1 
HETATM 10120 O O   . HOH G 4 .   ? 81.545  28.862  4.987   1.00 38.47 ? 2038 HOH A O   1 
HETATM 10121 O O   . HOH G 4 .   ? 43.462  7.835   -18.695 1.00 84.70 ? 2039 HOH A O   1 
HETATM 10122 O O   . HOH G 4 .   ? 29.910  14.616  18.330  1.00 40.41 ? 2040 HOH A O   1 
HETATM 10123 O O   . HOH G 4 .   ? 40.977  7.348   25.559  1.00 49.32 ? 2041 HOH A O   1 
HETATM 10124 O O   . HOH G 4 .   ? 35.902  -11.731 0.808   1.00 47.41 ? 2042 HOH A O   1 
HETATM 10125 O O   . HOH G 4 .   ? 38.785  -14.557 -1.390  1.00 41.15 ? 2043 HOH A O   1 
HETATM 10126 O O   . HOH G 4 .   ? 39.063  -8.825  -16.371 1.00 48.81 ? 2044 HOH A O   1 
HETATM 10127 O O   . HOH G 4 .   ? 55.904  -3.343  -11.340 1.00 39.00 ? 2045 HOH A O   1 
HETATM 10128 O O   . HOH G 4 .   ? 75.874  47.359  5.514   1.00 45.99 ? 2046 HOH A O   1 
HETATM 10129 O O   . HOH G 4 .   ? 46.963  27.483  8.227   1.00 37.31 ? 2047 HOH A O   1 
HETATM 10130 O O   . HOH G 4 .   ? 69.884  1.794   -5.955  1.00 51.39 ? 2048 HOH A O   1 
HETATM 10131 O O   . HOH G 4 .   ? 38.072  -9.350  1.857   1.00 53.93 ? 2049 HOH A O   1 
HETATM 10132 O O   . HOH G 4 .   ? 67.934  41.095  -0.455  1.00 36.82 ? 2050 HOH A O   1 
HETATM 10133 O O   . HOH G 4 .   ? 54.799  22.375  -4.965  1.00 45.18 ? 2051 HOH A O   1 
HETATM 10134 O O   . HOH G 4 .   ? 70.795  11.364  -35.474 1.00 52.18 ? 2052 HOH A O   1 
HETATM 10135 O O   . HOH G 4 .   ? 29.779  -1.224  8.532   1.00 38.38 ? 2053 HOH A O   1 
HETATM 10136 O O   . HOH G 4 .   ? 51.960  29.909  14.904  1.00 67.10 ? 2054 HOH A O   1 
HETATM 10137 O O   . HOH G 4 .   ? 65.988  27.743  18.787  1.00 46.07 ? 2055 HOH A O   1 
HETATM 10138 O O   . HOH G 4 .   ? 26.602  18.321  16.822  1.00 50.95 ? 2056 HOH A O   1 
HETATM 10139 O O   . HOH G 4 .   ? 41.430  18.351  -19.247 1.00 37.63 ? 2057 HOH A O   1 
HETATM 10140 O O   . HOH G 4 .   ? 58.783  33.121  -2.226  1.00 44.19 ? 2058 HOH A O   1 
HETATM 10141 O O   . HOH G 4 .   ? 52.651  -6.014  -7.024  1.00 40.88 ? 2059 HOH A O   1 
HETATM 10142 O O   . HOH G 4 .   ? 37.998  -17.318 23.730  1.00 63.41 ? 2060 HOH A O   1 
HETATM 10143 O O   . HOH G 4 .   ? 75.783  19.165  -35.719 1.00 52.52 ? 2061 HOH A O   1 
HETATM 10144 O O   . HOH G 4 .   ? 65.675  1.098   2.922   1.00 36.29 ? 2062 HOH A O   1 
HETATM 10145 O O   . HOH G 4 .   ? 65.788  42.356  -1.366  1.00 42.06 ? 2063 HOH A O   1 
HETATM 10146 O O   . HOH G 4 .   ? 73.193  33.731  -25.898 1.00 47.15 ? 2064 HOH A O   1 
HETATM 10147 O O   . HOH G 4 .   ? 43.978  3.166   -15.683 1.00 40.62 ? 2065 HOH A O   1 
HETATM 10148 O O   . HOH G 4 .   ? 36.908  -17.829 -2.832  1.00 40.59 ? 2066 HOH A O   1 
HETATM 10149 O O   . HOH G 4 .   ? 69.508  5.061   23.487  1.00 49.09 ? 2067 HOH A O   1 
HETATM 10150 O O   . HOH G 4 .   ? 62.659  11.044  18.332  1.00 51.00 ? 2068 HOH A O   1 
HETATM 10151 O O   . HOH G 4 .   ? 48.737  33.078  13.474  1.00 46.61 ? 2069 HOH A O   1 
HETATM 10152 O O   . HOH G 4 .   ? 78.727  8.679   -2.195  1.00 50.46 ? 2070 HOH A O   1 
HETATM 10153 O O   . HOH G 4 .   ? 67.856  26.423  -24.492 1.00 33.44 ? 2071 HOH A O   1 
HETATM 10154 O O   . HOH G 4 .   ? 46.217  12.759  22.156  1.00 33.27 ? 2072 HOH A O   1 
HETATM 10155 O O   . HOH G 4 .   ? 51.899  -13.132 15.669  1.00 69.31 ? 2073 HOH A O   1 
HETATM 10156 O O   . HOH G 4 .   ? 69.754  44.524  -7.313  1.00 40.68 ? 2074 HOH A O   1 
HETATM 10157 O O   . HOH G 4 .   ? 66.090  42.670  1.212   1.00 41.49 ? 2075 HOH A O   1 
HETATM 10158 O O   . HOH G 4 .   ? 72.299  3.489   10.791  1.00 65.67 ? 2076 HOH A O   1 
HETATM 10159 O O   . HOH G 4 .   ? 57.078  34.888  -1.301  1.00 36.08 ? 2077 HOH A O   1 
HETATM 10160 O O   . HOH G 4 .   ? 28.677  6.717   -0.699  1.00 38.76 ? 2078 HOH A O   1 
HETATM 10161 O O   . HOH G 4 .   ? 39.434  -14.572 -3.914  1.00 50.80 ? 2079 HOH A O   1 
HETATM 10162 O O   . HOH G 4 .   ? 38.416  15.314  -13.250 1.00 31.50 ? 2080 HOH A O   1 
HETATM 10163 O O   . HOH G 4 .   ? 70.936  2.687   2.526   1.00 40.09 ? 2081 HOH A O   1 
HETATM 10164 O O   . HOH G 4 .   ? 66.564  10.010  17.918  1.00 41.74 ? 2082 HOH A O   1 
HETATM 10165 O O   . HOH G 4 .   ? 44.906  5.880   -14.527 1.00 63.52 ? 2083 HOH A O   1 
HETATM 10166 O O   . HOH G 4 .   ? 52.847  -8.505  -7.969  1.00 42.30 ? 2084 HOH A O   1 
HETATM 10167 O O   . HOH G 4 .   ? 35.708  7.047   -7.347  1.00 45.69 ? 2085 HOH A O   1 
HETATM 10168 O O   . HOH G 4 .   ? 63.438  15.584  14.215  1.00 34.08 ? 2086 HOH A O   1 
HETATM 10169 O O   . HOH G 4 .   ? 78.746  -4.060  -11.700 1.00 45.32 ? 2087 HOH A O   1 
HETATM 10170 O O   . HOH G 4 .   ? 62.724  43.355  -0.772  1.00 41.77 ? 2088 HOH A O   1 
HETATM 10171 O O   . HOH G 4 .   ? 73.534  22.150  -26.451 1.00 25.72 ? 2089 HOH A O   1 
HETATM 10172 O O   . HOH G 4 .   ? 40.069  8.764   -13.164 1.00 49.91 ? 2090 HOH A O   1 
HETATM 10173 O O   . HOH G 4 .   ? 21.416  13.159  8.931   1.00 34.66 ? 2091 HOH A O   1 
HETATM 10174 O O   . HOH G 4 .   ? 24.711  -1.441  19.563  1.00 38.92 ? 2092 HOH A O   1 
HETATM 10175 O O   . HOH G 4 .   ? 84.205  18.129  -7.181  1.00 31.35 ? 2093 HOH A O   1 
HETATM 10176 O O   . HOH G 4 .   ? 55.237  -1.544  26.435  1.00 44.67 ? 2094 HOH A O   1 
HETATM 10177 O O   . HOH G 4 .   ? 52.389  -15.397 -1.863  1.00 46.11 ? 2095 HOH A O   1 
HETATM 10178 O O   . HOH G 4 .   ? 71.491  31.518  -19.869 1.00 49.56 ? 2096 HOH A O   1 
HETATM 10179 O O   . HOH G 4 .   ? 51.754  25.374  2.299   1.00 34.99 ? 2097 HOH A O   1 
HETATM 10180 O O   . HOH G 4 .   ? 65.258  5.544   21.307  1.00 64.08 ? 2098 HOH A O   1 
HETATM 10181 O O   . HOH G 4 .   ? 70.864  -0.336  22.832  1.00 65.87 ? 2099 HOH A O   1 
HETATM 10182 O O   . HOH G 4 .   ? 68.790  26.388  -21.271 1.00 49.03 ? 2100 HOH A O   1 
HETATM 10183 O O   . HOH G 4 .   ? 23.424  14.784  5.506   1.00 36.05 ? 2101 HOH A O   1 
HETATM 10184 O O   . HOH G 4 .   ? 64.350  16.286  -29.633 1.00 38.11 ? 2102 HOH A O   1 
HETATM 10185 O O   . HOH G 4 .   ? 38.673  2.503   26.616  1.00 45.01 ? 2103 HOH A O   1 
HETATM 10186 O O   . HOH G 4 .   ? 40.369  4.307   -8.275  1.00 42.17 ? 2104 HOH A O   1 
HETATM 10187 O O   . HOH G 4 .   ? 37.388  2.118   22.648  1.00 72.35 ? 2105 HOH A O   1 
HETATM 10188 O O   . HOH G 4 .   ? 45.755  -14.953 -4.756  1.00 36.15 ? 2106 HOH A O   1 
HETATM 10189 O O   . HOH G 4 .   ? 37.946  -18.352 7.004   1.00 45.83 ? 2107 HOH A O   1 
HETATM 10190 O O   . HOH G 4 .   ? 77.745  39.987  8.483   1.00 44.81 ? 2108 HOH A O   1 
HETATM 10191 O O   . HOH G 4 .   ? 49.166  19.358  -4.537  1.00 39.32 ? 2109 HOH A O   1 
HETATM 10192 O O   . HOH G 4 .   ? 58.569  1.309   24.167  1.00 60.54 ? 2110 HOH A O   1 
HETATM 10193 O O   . HOH G 4 .   ? 34.679  27.313  11.174  1.00 40.46 ? 2111 HOH A O   1 
HETATM 10194 O O   . HOH G 4 .   ? 54.237  -11.615 -6.566  1.00 38.01 ? 2112 HOH A O   1 
HETATM 10195 O O   . HOH G 4 .   ? 49.269  -3.112  -16.655 1.00 69.21 ? 2113 HOH A O   1 
HETATM 10196 O O   . HOH G 4 .   ? 61.554  12.887  14.868  1.00 47.57 ? 2114 HOH A O   1 
HETATM 10197 O O   . HOH G 4 .   ? 36.652  -0.568  27.375  1.00 50.46 ? 2115 HOH A O   1 
HETATM 10198 O O   . HOH G 4 .   ? 29.258  9.098   24.882  1.00 42.43 ? 2116 HOH A O   1 
HETATM 10199 O O   . HOH G 4 .   ? 71.041  0.559   18.087  1.00 68.71 ? 2117 HOH A O   1 
HETATM 10200 O O   . HOH G 4 .   ? 77.034  22.335  -14.172 1.00 35.44 ? 2118 HOH A O   1 
HETATM 10201 O O   . HOH G 4 .   ? 60.036  -10.158 -11.616 1.00 41.18 ? 2119 HOH A O   1 
HETATM 10202 O O   . HOH G 4 .   ? 33.904  -20.456 14.914  1.00 44.76 ? 2120 HOH A O   1 
HETATM 10203 O O   . HOH G 4 .   ? 53.845  -17.000 11.586  1.00 51.20 ? 2121 HOH A O   1 
HETATM 10204 O O   . HOH G 4 .   ? 40.334  19.395  -0.675  1.00 32.46 ? 2122 HOH A O   1 
HETATM 10205 O O   . HOH G 4 .   ? 60.746  37.726  -14.604 1.00 41.66 ? 2123 HOH A O   1 
HETATM 10206 O O   . HOH G 4 .   ? 66.572  19.882  21.341  1.00 36.52 ? 2124 HOH A O   1 
HETATM 10207 O O   . HOH G 4 .   ? 72.628  9.539   -35.993 1.00 51.87 ? 2125 HOH A O   1 
HETATM 10208 O O   . HOH G 4 .   ? 50.063  -16.343 4.702   1.00 39.00 ? 2126 HOH A O   1 
HETATM 10209 O O   . HOH G 4 .   ? 58.336  28.094  3.176   1.00 33.36 ? 2127 HOH A O   1 
HETATM 10210 O O   . HOH G 4 .   ? 67.979  3.210   0.277   1.00 43.38 ? 2128 HOH A O   1 
HETATM 10211 O O   . HOH G 4 .   ? 32.611  20.600  4.514   1.00 44.43 ? 2129 HOH A O   1 
HETATM 10212 O O   . HOH G 4 .   ? 28.879  11.305  27.953  1.00 36.96 ? 2130 HOH A O   1 
HETATM 10213 O O   . HOH G 4 .   ? 68.833  -4.391  24.174  1.00 48.21 ? 2131 HOH A O   1 
HETATM 10214 O O   . HOH G 4 .   ? 56.762  -10.166 -7.817  1.00 37.68 ? 2132 HOH A O   1 
HETATM 10215 O O   . HOH G 4 .   ? 73.469  -2.859  7.237   1.00 40.09 ? 2133 HOH A O   1 
HETATM 10216 O O   . HOH G 4 .   ? 69.584  42.078  -15.680 1.00 49.73 ? 2134 HOH A O   1 
HETATM 10217 O O   . HOH G 4 .   ? 55.954  22.915  -21.503 1.00 36.46 ? 2135 HOH A O   1 
HETATM 10218 O O   . HOH G 4 .   ? 44.307  20.528  -4.959  1.00 44.18 ? 2136 HOH A O   1 
HETATM 10219 O O   . HOH G 4 .   ? 83.337  22.451  -1.562  1.00 46.96 ? 2137 HOH A O   1 
HETATM 10220 O O   . HOH G 4 .   ? 61.771  -9.107  0.756   1.00 51.22 ? 2138 HOH A O   1 
HETATM 10221 O O   . HOH G 4 .   ? 50.605  -13.658 29.837  1.00 45.23 ? 2139 HOH A O   1 
HETATM 10222 O O   . HOH G 4 .   ? 69.415  -10.542 -13.018 1.00 48.78 ? 2140 HOH A O   1 
HETATM 10223 O O   . HOH G 4 .   ? 66.618  -11.830 -15.313 1.00 43.99 ? 2141 HOH A O   1 
HETATM 10224 O O   . HOH G 4 .   ? 36.537  21.242  -4.884  1.00 43.18 ? 2142 HOH A O   1 
HETATM 10225 O O   . HOH G 4 .   ? 81.865  12.700  -32.026 1.00 46.67 ? 2143 HOH A O   1 
HETATM 10226 O O   . HOH G 4 .   ? 49.872  6.074   26.026  1.00 43.07 ? 2144 HOH A O   1 
HETATM 10227 O O   . HOH G 4 .   ? 66.940  18.587  -37.567 1.00 46.66 ? 2145 HOH A O   1 
HETATM 10228 O O   . HOH G 4 .   ? 66.954  -5.535  9.545   1.00 42.01 ? 2146 HOH A O   1 
HETATM 10229 O O   . HOH G 4 .   ? 58.519  9.159   21.558  1.00 46.86 ? 2147 HOH A O   1 
HETATM 10230 O O   . HOH G 4 .   ? 56.859  25.034  14.487  1.00 49.14 ? 2148 HOH A O   1 
HETATM 10231 O O   . HOH G 4 .   ? 62.043  25.397  -19.622 1.00 49.00 ? 2149 HOH A O   1 
HETATM 10232 O O   . HOH G 4 .   ? 49.344  -6.452  26.765  1.00 51.42 ? 2150 HOH A O   1 
HETATM 10233 O O   . HOH G 4 .   ? 40.600  -21.697 11.028  1.00 45.78 ? 2151 HOH A O   1 
HETATM 10234 O O   . HOH G 4 .   ? 82.661  9.196   -23.466 1.00 43.02 ? 2152 HOH A O   1 
HETATM 10235 O O   . HOH G 4 .   ? 44.766  4.906   26.966  1.00 49.85 ? 2153 HOH A O   1 
HETATM 10236 O O   . HOH G 4 .   ? 65.761  5.112   -31.996 1.00 47.27 ? 2154 HOH A O   1 
HETATM 10237 O O   . HOH G 4 .   ? 80.690  38.416  -9.637  1.00 43.79 ? 2155 HOH A O   1 
HETATM 10238 O O   . HOH G 4 .   ? 75.392  39.293  -16.982 1.00 52.95 ? 2156 HOH A O   1 
HETATM 10239 O O   . HOH G 4 .   ? 25.506  7.483   22.477  1.00 48.37 ? 2157 HOH A O   1 
HETATM 10240 O O   . HOH G 4 .   ? 59.820  32.140  -20.880 1.00 58.07 ? 2158 HOH A O   1 
HETATM 10241 O O   . HOH G 4 .   ? 40.383  -0.641  26.123  1.00 48.52 ? 2159 HOH A O   1 
HETATM 10242 O O   . HOH G 4 .   ? 31.009  19.418  12.144  1.00 52.35 ? 2160 HOH A O   1 
HETATM 10243 O O   . HOH G 4 .   ? 65.891  14.443  -38.657 1.00 56.61 ? 2161 HOH A O   1 
HETATM 10244 O O   . HOH G 4 .   ? 45.409  -20.650 5.167   1.00 44.64 ? 2162 HOH A O   1 
HETATM 10245 O O   . HOH G 4 .   ? 82.840  31.213  6.153   1.00 63.40 ? 2163 HOH A O   1 
HETATM 10246 O O   . HOH G 4 .   ? 70.986  25.043  -25.160 1.00 52.00 ? 2164 HOH A O   1 
HETATM 10247 O O   . HOH G 4 .   ? 77.117  -4.115  -7.044  1.00 52.29 ? 2165 HOH A O   1 
HETATM 10248 O O   . HOH G 4 .   ? 76.128  22.232  14.604  1.00 50.90 ? 2166 HOH A O   1 
HETATM 10249 O O   . HOH G 4 .   ? 70.556  33.507  16.679  1.00 71.32 ? 2167 HOH A O   1 
HETATM 10250 O O   . HOH G 4 .   ? 32.550  -8.587  4.436   1.00 46.56 ? 2168 HOH A O   1 
HETATM 10251 O O   . HOH G 4 .   ? 38.364  -1.605  -17.192 1.00 44.94 ? 2169 HOH A O   1 
HETATM 10252 O O   . HOH G 4 .   ? 58.272  -2.371  24.304  1.00 47.39 ? 2170 HOH A O   1 
HETATM 10253 O O   . HOH G 4 .   ? 44.878  8.925   27.445  1.00 36.92 ? 2171 HOH A O   1 
HETATM 10254 O O   . HOH G 4 .   ? 82.290  18.688  -3.660  1.00 43.43 ? 2172 HOH A O   1 
HETATM 10255 O O   . HOH G 4 .   ? 77.956  24.608  14.638  1.00 60.44 ? 2173 HOH A O   1 
HETATM 10256 O O   . HOH G 4 .   ? 44.788  19.823  17.830  1.00 57.03 ? 2174 HOH A O   1 
HETATM 10257 O O   . HOH G 4 .   ? 22.916  -0.129  11.814  1.00 46.54 ? 2175 HOH A O   1 
HETATM 10258 O O   . HOH G 4 .   ? 50.214  15.514  -28.184 1.00 46.51 ? 2176 HOH A O   1 
HETATM 10259 O O   . HOH G 4 .   ? 56.954  28.872  -15.991 1.00 48.36 ? 2177 HOH A O   1 
HETATM 10260 O O   . HOH G 4 .   ? 63.195  38.655  -14.394 1.00 41.02 ? 2178 HOH A O   1 
HETATM 10261 O O   . HOH G 4 .   ? 65.025  46.198  -3.012  1.00 49.36 ? 2179 HOH A O   1 
HETATM 10262 O O   . HOH G 4 .   ? 53.996  -2.428  23.285  1.00 55.30 ? 2180 HOH A O   1 
HETATM 10263 O O   . HOH G 4 .   ? 76.396  6.389   -1.780  1.00 42.29 ? 2181 HOH A O   1 
HETATM 10264 O O   . HOH G 4 .   ? 62.756  40.115  -7.020  1.00 40.47 ? 2182 HOH A O   1 
HETATM 10265 O O   . HOH G 4 .   ? 44.485  -8.366  26.139  1.00 49.16 ? 2183 HOH A O   1 
HETATM 10266 O O   . HOH G 4 .   ? 42.517  -23.037 23.962  1.00 52.52 ? 2184 HOH A O   1 
HETATM 10267 O O   . HOH G 4 .   ? 78.830  23.723  -15.160 1.00 29.77 ? 2185 HOH A O   1 
HETATM 10268 O O   . HOH G 4 .   ? 49.071  20.443  -6.966  1.00 36.45 ? 2186 HOH A O   1 
HETATM 10269 O O   . HOH G 4 .   ? 77.013  22.025  -11.087 1.00 36.41 ? 2187 HOH A O   1 
HETATM 10270 O O   . HOH G 4 .   ? 36.890  25.644  10.820  1.00 42.99 ? 2188 HOH A O   1 
HETATM 10271 O O   . HOH G 4 .   ? 81.358  15.492  -2.808  1.00 39.37 ? 2189 HOH A O   1 
HETATM 10272 O O   . HOH G 4 .   ? 56.713  34.562  -6.870  1.00 33.89 ? 2190 HOH A O   1 
HETATM 10273 O O   . HOH G 4 .   ? 64.172  -9.420  1.647   1.00 56.80 ? 2191 HOH A O   1 
HETATM 10274 O O   . HOH G 4 .   ? 56.111  24.274  -18.269 1.00 55.48 ? 2192 HOH A O   1 
HETATM 10275 O O   . HOH G 4 .   ? 85.119  18.748  -9.897  1.00 43.11 ? 2193 HOH A O   1 
HETATM 10276 O O   . HOH G 4 .   ? 53.243  22.198  -22.049 1.00 46.89 ? 2194 HOH A O   1 
HETATM 10277 O O   . HOH G 4 .   ? 60.761  -10.435 -8.745  1.00 47.58 ? 2195 HOH A O   1 
HETATM 10278 O O   . HOH G 4 .   ? 73.185  37.611  11.711  1.00 35.56 ? 2196 HOH A O   1 
HETATM 10279 O O   . HOH G 4 .   ? 69.501  0.163   24.930  1.00 45.47 ? 2197 HOH A O   1 
HETATM 10280 O O   . HOH G 4 .   ? 54.959  27.299  13.874  1.00 48.87 ? 2198 HOH A O   1 
HETATM 10281 O O   . HOH G 4 .   ? 57.300  30.468  4.311   1.00 46.19 ? 2199 HOH A O   1 
HETATM 10282 O O   . HOH G 4 .   ? 55.822  22.791  0.724   1.00 47.90 ? 2200 HOH A O   1 
HETATM 10283 O O   . HOH G 4 .   ? 56.512  8.305   22.911  1.00 45.40 ? 2201 HOH A O   1 
HETATM 10284 O O   . HOH G 4 .   ? 61.838  -9.674  -4.501  1.00 45.67 ? 2202 HOH A O   1 
HETATM 10285 O O   . HOH G 4 .   ? 43.519  22.892  -4.493  1.00 48.39 ? 2203 HOH A O   1 
HETATM 10286 O O   . HOH G 4 .   ? 83.557  7.869   8.387   1.00 42.95 ? 2204 HOH A O   1 
HETATM 10287 O O   . HOH G 4 .   ? 42.772  5.710   -17.369 1.00 57.56 ? 2205 HOH A O   1 
HETATM 10288 O O   . HOH G 4 .   ? 68.338  11.492  19.258  1.00 47.18 ? 2206 HOH A O   1 
HETATM 10289 O O   . HOH G 4 .   ? 70.520  0.392   3.674   1.00 46.52 ? 2207 HOH A O   1 
HETATM 10290 O O   . HOH G 4 .   ? 55.725  9.826   15.214  1.00 51.12 ? 2208 HOH A O   1 
HETATM 10291 O O   . HOH G 4 .   ? 54.567  25.142  -5.889  1.00 42.32 ? 2209 HOH A O   1 
HETATM 10292 O O   . HOH G 4 .   ? 28.439  -4.942  17.519  1.00 50.62 ? 2210 HOH A O   1 
HETATM 10293 O O   . HOH G 4 .   ? 29.170  2.515   22.363  1.00 52.81 ? 2211 HOH A O   1 
HETATM 10294 O O   . HOH G 4 .   ? 39.363  -13.254 -6.402  1.00 41.41 ? 2212 HOH A O   1 
HETATM 10295 O O   . HOH G 4 .   ? 78.036  35.196  6.688   1.00 73.24 ? 2213 HOH A O   1 
HETATM 10296 O O   . HOH G 4 .   ? 41.955  20.393  -2.375  1.00 61.22 ? 2214 HOH A O   1 
HETATM 10297 O O   . HOH G 4 .   ? 25.355  6.476   15.563  1.00 41.93 ? 2215 HOH A O   1 
HETATM 10298 O O   . HOH G 4 .   ? 47.314  13.379  -23.964 1.00 40.30 ? 2216 HOH A O   1 
HETATM 10299 O O   . HOH G 4 .   ? 31.395  -6.736  2.531   1.00 42.44 ? 2217 HOH A O   1 
HETATM 10300 O O   . HOH G 4 .   ? 42.050  18.964  -4.598  1.00 45.30 ? 2218 HOH A O   1 
HETATM 10301 O O   . HOH G 4 .   ? 27.868  13.163  -0.729  1.00 44.73 ? 2219 HOH A O   1 
HETATM 10302 O O   . HOH G 4 .   ? 58.443  40.844  3.357   1.00 43.29 ? 2220 HOH A O   1 
HETATM 10303 O O   . HOH G 4 .   ? 23.095  -5.548  10.484  1.00 58.40 ? 2221 HOH A O   1 
HETATM 10304 O O   . HOH G 4 .   ? 36.876  23.925  6.313   1.00 45.81 ? 2222 HOH A O   1 
HETATM 10305 O O   . HOH G 4 .   ? 49.373  0.695   26.813  1.00 48.89 ? 2223 HOH A O   1 
HETATM 10306 O O   . HOH G 4 .   ? 47.463  -27.270 15.788  1.00 55.02 ? 2224 HOH A O   1 
HETATM 10307 O O   . HOH G 4 .   ? 37.016  23.800  15.570  1.00 58.58 ? 2225 HOH A O   1 
HETATM 10308 O O   . HOH G 4 .   ? 80.122  18.710  -10.336 1.00 47.81 ? 2226 HOH A O   1 
HETATM 10309 O O   . HOH G 4 .   ? 81.225  12.866  14.624  1.00 48.37 ? 2227 HOH A O   1 
HETATM 10310 O O   . HOH G 4 .   ? 77.163  46.074  1.694   1.00 50.66 ? 2228 HOH A O   1 
HETATM 10311 O O   . HOH G 4 .   ? 81.740  -1.191  -19.842 1.00 57.55 ? 2229 HOH A O   1 
HETATM 10312 O O   . HOH G 4 .   ? 33.361  -13.746 -4.611  1.00 42.20 ? 2230 HOH A O   1 
HETATM 10313 O O   . HOH G 4 .   ? 60.064  21.215  -30.331 1.00 41.54 ? 2231 HOH A O   1 
HETATM 10314 O O   . HOH G 4 .   ? 61.753  17.892  -28.610 1.00 40.38 ? 2232 HOH A O   1 
HETATM 10315 O O   . HOH G 4 .   ? 44.511  27.256  7.018   1.00 53.78 ? 2233 HOH A O   1 
HETATM 10316 O O   . HOH G 4 .   ? 58.838  23.075  18.102  1.00 48.40 ? 2234 HOH A O   1 
HETATM 10317 O O   . HOH G 4 .   ? 49.518  -3.650  -19.352 1.00 48.00 ? 2235 HOH A O   1 
HETATM 10318 O O   . HOH G 4 .   ? 79.260  32.178  11.996  1.00 56.27 ? 2236 HOH A O   1 
HETATM 10319 O O   . HOH G 4 .   ? 63.959  -9.872  14.928  1.00 50.10 ? 2237 HOH A O   1 
HETATM 10320 O O   . HOH G 4 .   ? 49.752  35.332  12.798  1.00 60.35 ? 2238 HOH A O   1 
HETATM 10321 O O   . HOH G 4 .   ? 32.235  22.644  0.944   1.00 47.78 ? 2239 HOH A O   1 
HETATM 10322 O O   . HOH G 4 .   ? 72.825  44.993  0.240   1.00 46.60 ? 2240 HOH A O   1 
HETATM 10323 O O   . HOH G 4 .   ? 54.742  20.534  0.609   1.00 32.52 ? 2241 HOH A O   1 
HETATM 10324 O O   . HOH G 4 .   ? 74.603  46.462  1.755   1.00 36.20 ? 2242 HOH A O   1 
HETATM 10325 O O   . HOH G 4 .   ? 43.740  28.959  8.985   1.00 43.64 ? 2243 HOH A O   1 
HETATM 10326 O O   . HOH G 4 .   ? 56.486  36.567  -4.865  1.00 40.98 ? 2244 HOH A O   1 
HETATM 10327 O O   . HOH G 4 .   ? 83.829  20.695  -11.295 1.00 44.45 ? 2245 HOH A O   1 
HETATM 10328 O O   . HOH G 4 .   ? 79.523  22.798  -10.530 1.00 42.80 ? 2246 HOH A O   1 
HETATM 10329 O O   . HOH G 4 .   ? 60.970  11.470  11.981  1.00 44.00 ? 2247 HOH A O   1 
HETATM 10330 O O   . HOH G 4 .   ? 75.496  36.824  -17.487 1.00 51.94 ? 2248 HOH A O   1 
HETATM 10331 O O   . HOH G 4 .   ? 55.684  29.267  12.110  1.00 58.71 ? 2249 HOH A O   1 
HETATM 10332 O O   . HOH G 4 .   ? 49.518  -22.816 21.561  1.00 71.09 ? 2250 HOH A O   1 
HETATM 10333 O O   . HOH G 4 .   ? 57.934  19.995  -28.987 1.00 53.29 ? 2251 HOH A O   1 
HETATM 10334 O O   . HOH G 4 .   ? 36.595  7.873   -10.239 1.00 43.06 ? 2252 HOH A O   1 
HETATM 10335 O O   . HOH G 4 .   ? 40.877  -3.773  -22.217 1.00 55.09 ? 2253 HOH A O   1 
HETATM 10336 O O   . HOH G 4 .   ? 39.903  -11.627 -8.462  1.00 49.90 ? 2254 HOH A O   1 
HETATM 10337 O O   . HOH G 4 .   ? 35.851  26.033  14.825  1.00 47.45 ? 2255 HOH A O   1 
HETATM 10338 O O   . HOH G 4 .   ? 61.328  -16.721 4.770   1.00 62.67 ? 2256 HOH A O   1 
HETATM 10339 O O   . HOH G 4 .   ? 65.032  16.569  10.070  1.00 53.80 ? 2257 HOH A O   1 
HETATM 10340 O O   . HOH G 4 .   ? 81.974  11.630  -21.720 1.00 41.43 ? 2258 HOH A O   1 
HETATM 10341 O O   . HOH G 4 .   ? 55.718  -10.675 16.595  1.00 66.25 ? 2259 HOH A O   1 
HETATM 10342 O O   . HOH G 4 .   ? 80.951  38.596  -12.383 1.00 49.42 ? 2260 HOH A O   1 
HETATM 10343 O O   . HOH G 4 .   ? 63.282  5.388   25.647  1.00 71.08 ? 2261 HOH A O   1 
HETATM 10344 O O   . HOH G 4 .   ? 65.346  24.381  -27.943 1.00 70.84 ? 2262 HOH A O   1 
HETATM 10345 O O   . HOH G 4 .   ? 39.917  17.331  -13.581 1.00 66.15 ? 2263 HOH A O   1 
HETATM 10346 O O   . HOH G 4 .   ? 55.356  25.399  1.453   1.00 40.69 ? 2264 HOH A O   1 
HETATM 10347 O O   . HOH G 4 .   ? 23.158  7.951   14.563  1.00 52.21 ? 2265 HOH A O   1 
HETATM 10348 O O   . HOH G 4 .   ? 70.355  -3.118  26.404  1.00 55.25 ? 2266 HOH A O   1 
HETATM 10349 O O   . HOH G 4 .   ? 64.951  -8.544  -8.748  1.00 55.35 ? 2267 HOH A O   1 
HETATM 10350 O O   . HOH G 4 .   ? 24.587  16.697  4.108   1.00 52.32 ? 2268 HOH A O   1 
HETATM 10351 O O   . HOH G 4 .   ? 77.824  48.546  3.473   1.00 52.37 ? 2269 HOH A O   1 
HETATM 10352 O O   . HOH G 4 .   ? 44.165  25.460  -3.857  1.00 49.03 ? 2270 HOH A O   1 
HETATM 10353 O O   . HOH G 4 .   ? 29.839  -3.775  20.792  1.00 47.42 ? 2271 HOH A O   1 
HETATM 10354 O O   . HOH G 4 .   ? 39.251  23.559  14.294  1.00 43.89 ? 2272 HOH A O   1 
HETATM 10355 O O   . HOH G 4 .   ? 81.305  -2.480  -9.860  1.00 46.99 ? 2273 HOH A O   1 
HETATM 10356 O O   . HOH G 4 .   ? 81.822  12.403  9.070   1.00 41.35 ? 2274 HOH A O   1 
HETATM 10357 O O   . HOH G 4 .   ? 79.332  21.165  -18.810 1.00 47.28 ? 2275 HOH A O   1 
HETATM 10358 O O   . HOH H 4 .   ? -27.423 -5.035  50.084  1.00 9.12  ? 1703 HOH B O   1 
HETATM 10359 O O   . HOH H 4 .   ? -20.594 -3.864  67.124  1.00 11.83 ? 1704 HOH B O   1 
HETATM 10360 O O   . HOH H 4 .   ? -14.938 -4.377  65.819  1.00 11.24 ? 1705 HOH B O   1 
HETATM 10361 O O   . HOH H 4 .   ? 7.199   -3.445  44.268  1.00 10.04 ? 1706 HOH B O   1 
HETATM 10362 O O   . HOH H 4 .   ? -21.486 -21.664 55.999  1.00 9.71  ? 1707 HOH B O   1 
HETATM 10363 O O   . HOH H 4 .   ? 1.808   -1.015  47.432  1.00 7.91  ? 1708 HOH B O   1 
HETATM 10364 O O   . HOH H 4 .   ? -10.995 -13.223 40.969  1.00 8.15  ? 1709 HOH B O   1 
HETATM 10365 O O   . HOH H 4 .   ? -3.471  -9.107  53.714  1.00 15.53 ? 1710 HOH B O   1 
HETATM 10366 O O   . HOH H 4 .   ? -3.376  -18.255 34.202  1.00 8.21  ? 1711 HOH B O   1 
HETATM 10367 O O   . HOH H 4 .   ? -15.417 -0.925  48.094  1.00 9.07  ? 1712 HOH B O   1 
HETATM 10368 O O   . HOH H 4 .   ? -5.812  -16.524 37.620  1.00 10.60 ? 1713 HOH B O   1 
HETATM 10369 O O   . HOH H 4 .   ? 2.359   27.596  39.343  1.00 16.03 ? 1714 HOH B O   1 
HETATM 10370 O O   . HOH H 4 .   ? -23.186 4.393   42.519  1.00 18.71 ? 1715 HOH B O   1 
HETATM 10371 O O   . HOH H 4 .   ? -3.381  -3.186  49.859  1.00 5.55  ? 1716 HOH B O   1 
HETATM 10372 O O   . HOH H 4 .   ? -5.904  0.516   46.207  1.00 12.36 ? 1717 HOH B O   1 
HETATM 10373 O O   . HOH H 4 .   ? 11.434  -2.629  53.668  1.00 12.04 ? 1718 HOH B O   1 
HETATM 10374 O O   . HOH H 4 .   ? -3.918  -7.466  58.036  1.00 12.73 ? 1719 HOH B O   1 
HETATM 10375 O O   . HOH H 4 .   ? 8.314   -7.121  49.481  1.00 11.83 ? 1720 HOH B O   1 
HETATM 10376 O O   . HOH H 4 .   ? -14.977 -20.615 45.067  1.00 8.51  ? 1721 HOH B O   1 
HETATM 10377 O O   . HOH H 4 .   ? -4.474  -5.761  23.058  1.00 20.24 ? 1722 HOH B O   1 
HETATM 10378 O O   . HOH H 4 .   ? -0.812  23.851  48.491  1.00 10.43 ? 1723 HOH B O   1 
HETATM 10379 O O   . HOH H 4 .   ? -27.864 1.616   46.827  1.00 15.47 ? 1724 HOH B O   1 
HETATM 10380 O O   . HOH H 4 .   ? -27.512 -6.135  37.472  1.00 15.90 ? 1725 HOH B O   1 
HETATM 10381 O O   . HOH H 4 .   ? 8.586   -0.523  49.466  1.00 12.26 ? 1726 HOH B O   1 
HETATM 10382 O O   . HOH H 4 .   ? -22.378 -20.818 63.536  1.00 17.15 ? 1727 HOH B O   1 
HETATM 10383 O O   . HOH H 4 .   ? -26.968 3.835   61.420  1.00 10.16 ? 1728 HOH B O   1 
HETATM 10384 O O   . HOH H 4 .   ? -25.997 4.687   57.030  1.00 12.70 ? 1729 HOH B O   1 
HETATM 10385 O O   . HOH H 4 .   ? -35.317 -19.505 14.688  1.00 18.61 ? 1730 HOH B O   1 
HETATM 10386 O O   . HOH H 4 .   ? -13.833 -6.297  71.590  1.00 18.01 ? 1731 HOH B O   1 
HETATM 10387 O O   . HOH H 4 .   ? 8.367   10.068  32.160  1.00 11.40 ? 1732 HOH B O   1 
HETATM 10388 O O   . HOH H 4 .   ? -25.022 -10.926 48.626  1.00 9.55  ? 1733 HOH B O   1 
HETATM 10389 O O   . HOH H 4 .   ? -25.596 -7.666  53.244  1.00 11.14 ? 1734 HOH B O   1 
HETATM 10390 O O   . HOH H 4 .   ? -2.985  -0.933  40.104  1.00 8.18  ? 1735 HOH B O   1 
HETATM 10391 O O   . HOH H 4 .   ? -27.713 -12.593 40.663  1.00 9.80  ? 1736 HOH B O   1 
HETATM 10392 O O   . HOH H 4 .   ? -31.646 7.275   48.945  1.00 17.57 ? 1737 HOH B O   1 
HETATM 10393 O O   . HOH H 4 .   ? -17.701 -24.198 43.599  1.00 9.34  ? 1738 HOH B O   1 
HETATM 10394 O O   . HOH H 4 .   ? -29.307 -15.512 37.637  1.00 14.77 ? 1739 HOH B O   1 
HETATM 10395 O O   . HOH H 4 .   ? -14.675 -6.307  47.067  1.00 18.43 ? 1740 HOH B O   1 
HETATM 10396 O O   . HOH H 4 .   ? 11.063  -1.892  48.762  1.00 12.12 ? 1741 HOH B O   1 
HETATM 10397 O O   . HOH H 4 .   ? -18.886 -10.884 49.102  1.00 9.22  ? 1742 HOH B O   1 
HETATM 10398 O O   . HOH H 4 .   ? -12.786 -4.419  47.225  1.00 14.04 ? 1743 HOH B O   1 
HETATM 10399 O O   . HOH H 4 .   ? -31.864 -18.113 41.288  1.00 12.06 ? 1744 HOH B O   1 
HETATM 10400 O O   . HOH H 4 .   ? 7.200   34.259  34.752  1.00 19.40 ? 1745 HOH B O   1 
HETATM 10401 O O   . HOH H 4 .   ? 12.352  -2.848  51.070  1.00 17.47 ? 1746 HOH B O   1 
HETATM 10402 O O   . HOH H 4 .   ? -29.415 -17.864 67.215  1.00 20.43 ? 1747 HOH B O   1 
HETATM 10403 O O   . HOH H 4 .   ? 10.014  8.061   41.123  1.00 11.48 ? 1748 HOH B O   1 
HETATM 10404 O O   . HOH H 4 .   ? -11.707 -3.022  26.185  1.00 10.51 ? 1749 HOH B O   1 
HETATM 10405 O O   . HOH H 4 .   ? -23.912 -20.110 36.790  1.00 15.58 ? 1750 HOH B O   1 
HETATM 10406 O O   . HOH H 4 .   ? -2.975  3.384   43.293  1.00 7.81  ? 1751 HOH B O   1 
HETATM 10407 O O   . HOH H 4 .   ? -31.004 -10.280 53.246  1.00 18.33 ? 1752 HOH B O   1 
HETATM 10408 O O   . HOH H 4 .   ? -19.243 -1.656  51.340  1.00 14.85 ? 1753 HOH B O   1 
HETATM 10409 O O   . HOH H 4 .   ? -20.268 -12.871 53.456  1.00 12.48 ? 1754 HOH B O   1 
HETATM 10410 O O   . HOH H 4 .   ? -20.390 2.830   46.068  1.00 17.44 ? 1755 HOH B O   1 
HETATM 10411 O O   . HOH H 4 .   ? -2.497  -2.211  54.295  1.00 8.39  ? 1756 HOH B O   1 
HETATM 10412 O O   . HOH H 4 .   ? 5.931   -13.974 38.336  1.00 16.00 ? 1757 HOH B O   1 
HETATM 10413 O O   . HOH H 4 .   ? 16.258  21.749  46.574  1.00 30.84 ? 1758 HOH B O   1 
HETATM 10414 O O   . HOH H 4 .   ? 15.029  9.508   36.362  1.00 46.59 ? 1759 HOH B O   1 
HETATM 10415 O O   . HOH H 4 .   ? -24.024 -23.142 63.313  1.00 18.58 ? 1760 HOH B O   1 
HETATM 10416 O O   . HOH H 4 .   ? 6.525   32.008  33.323  1.00 17.62 ? 1761 HOH B O   1 
HETATM 10417 O O   . HOH H 4 .   ? -3.475  5.972   42.308  1.00 11.44 ? 1762 HOH B O   1 
HETATM 10418 O O   . HOH H 4 .   ? -15.658 8.839   24.622  1.00 17.56 ? 1763 HOH B O   1 
HETATM 10419 O O   . HOH H 4 .   ? -32.940 -20.341 34.407  1.00 7.72  ? 1764 HOH B O   1 
HETATM 10420 O O   . HOH H 4 .   ? -29.541 -19.082 43.790  1.00 14.45 ? 1765 HOH B O   1 
HETATM 10421 O O   . HOH H 4 .   ? -19.949 -19.537 37.267  1.00 12.18 ? 1766 HOH B O   1 
HETATM 10422 O O   . HOH H 4 .   ? -12.431 -13.924 47.119  1.00 15.50 ? 1767 HOH B O   1 
HETATM 10423 O O   . HOH H 4 .   ? -19.968 13.855  35.528  1.00 19.38 ? 1768 HOH B O   1 
HETATM 10424 O O   . HOH H 4 .   ? -4.226  -14.098 27.719  1.00 15.81 ? 1769 HOH B O   1 
HETATM 10425 O O   . HOH H 4 .   ? -18.115 -0.500  60.596  1.00 12.85 ? 1770 HOH B O   1 
HETATM 10426 O O   . HOH H 4 .   ? -7.451  21.011  48.140  1.00 13.93 ? 1771 HOH B O   1 
HETATM 10427 O O   . HOH H 4 .   ? -2.687  -16.492 32.639  1.00 14.04 ? 1772 HOH B O   1 
HETATM 10428 O O   . HOH H 4 .   ? -26.937 -14.186 37.209  1.00 12.81 ? 1773 HOH B O   1 
HETATM 10429 O O   . HOH H 4 .   ? -23.335 15.246  40.139  1.00 19.53 ? 1774 HOH B O   1 
HETATM 10430 O O   . HOH H 4 .   ? -10.312 14.965  24.374  1.00 18.68 ? 1775 HOH B O   1 
HETATM 10431 O O   . HOH H 4 .   ? -5.800  -2.243  49.463  1.00 8.40  ? 1776 HOH B O   1 
HETATM 10432 O O   . HOH H 4 .   ? -4.886  3.759   23.961  1.00 17.23 ? 1777 HOH B O   1 
HETATM 10433 O O   . HOH H 4 .   ? -22.594 -3.316  68.815  1.00 15.45 ? 1778 HOH B O   1 
HETATM 10434 O O   . HOH H 4 .   ? -9.492  -4.034  42.973  1.00 13.94 ? 1779 HOH B O   1 
HETATM 10435 O O   . HOH H 4 .   ? -33.363 -11.323 62.765  1.00 13.14 ? 1780 HOH B O   1 
HETATM 10436 O O   . HOH H 4 .   ? -21.312 -13.362 35.768  1.00 12.74 ? 1781 HOH B O   1 
HETATM 10437 O O   . HOH H 4 .   ? 10.672  -6.396  48.581  1.00 17.63 ? 1782 HOH B O   1 
HETATM 10438 O O   . HOH H 4 .   ? -30.272 -12.976 47.065  1.00 19.99 ? 1783 HOH B O   1 
HETATM 10439 O O   . HOH H 4 .   ? -21.373 -3.840  38.887  1.00 12.91 ? 1784 HOH B O   1 
HETATM 10440 O O   . HOH H 4 .   ? -14.506 -9.740  44.509  1.00 13.20 ? 1785 HOH B O   1 
HETATM 10441 O O   . HOH H 4 .   ? -23.333 -17.910 44.432  1.00 11.91 ? 1786 HOH B O   1 
HETATM 10442 O O   . HOH H 4 .   ? -22.145 2.873   21.447  1.00 19.54 ? 1787 HOH B O   1 
HETATM 10443 O O   . HOH H 4 .   ? -20.463 -27.501 54.306  1.00 16.81 ? 1788 HOH B O   1 
HETATM 10444 O O   . HOH H 4 .   ? -30.168 -24.817 39.278  1.00 19.78 ? 1789 HOH B O   1 
HETATM 10445 O O   . HOH H 4 .   ? -1.303  -19.251 32.945  1.00 17.08 ? 1790 HOH B O   1 
HETATM 10446 O O   . HOH H 4 .   ? -22.950 -2.573  17.208  1.00 15.58 ? 1791 HOH B O   1 
HETATM 10447 O O   . HOH H 4 .   ? -26.051 -27.787 64.488  1.00 34.71 ? 1792 HOH B O   1 
HETATM 10448 O O   . HOH H 4 .   ? 1.067   -12.333 30.689  1.00 15.43 ? 1793 HOH B O   1 
HETATM 10449 O O   . HOH H 4 .   ? -13.184 -27.215 36.070  1.00 22.54 ? 1794 HOH B O   1 
HETATM 10450 O O   . HOH H 4 .   ? 0.270   2.752   36.554  1.00 11.22 ? 1795 HOH B O   1 
HETATM 10451 O O   . HOH H 4 .   ? -9.983  -6.455  34.877  1.00 12.71 ? 1796 HOH B O   1 
HETATM 10452 O O   . HOH H 4 .   ? -29.918 -15.914 47.142  1.00 13.01 ? 1797 HOH B O   1 
HETATM 10453 O O   . HOH H 4 .   ? -35.018 -7.495  32.155  1.00 63.92 ? 1798 HOH B O   1 
HETATM 10454 O O   . HOH H 4 .   ? 17.671  16.573  54.825  1.00 15.81 ? 1799 HOH B O   1 
HETATM 10455 O O   . HOH H 4 .   ? -17.413 -28.012 46.367  1.00 23.21 ? 1800 HOH B O   1 
HETATM 10456 O O   . HOH H 4 .   ? -18.639 -25.509 41.395  1.00 15.54 ? 1801 HOH B O   1 
HETATM 10457 O O   . HOH H 4 .   ? -22.253 -12.545 70.917  1.00 18.85 ? 1802 HOH B O   1 
HETATM 10458 O O   . HOH H 4 .   ? 11.720  13.838  42.515  1.00 16.01 ? 1803 HOH B O   1 
HETATM 10459 O O   . HOH H 4 .   ? -7.082  15.942  23.105  1.00 22.82 ? 1804 HOH B O   1 
HETATM 10460 O O   . HOH H 4 .   ? -26.043 1.812   59.579  1.00 18.51 ? 1805 HOH B O   1 
HETATM 10461 O O   . HOH H 4 .   ? -16.688 -21.750 43.285  1.00 15.17 ? 1806 HOH B O   1 
HETATM 10462 O O   . HOH H 4 .   ? -0.431  34.170  42.078  1.00 24.63 ? 1807 HOH B O   1 
HETATM 10463 O O   . HOH H 4 .   ? 1.900   11.292  20.278  1.00 17.84 ? 1808 HOH B O   1 
HETATM 10464 O O   . HOH H 4 .   ? -26.054 -21.287 67.491  1.00 20.61 ? 1809 HOH B O   1 
HETATM 10465 O O   . HOH H 4 .   ? -11.302 24.365  41.405  1.00 15.13 ? 1810 HOH B O   1 
HETATM 10466 O O   . HOH H 4 .   ? -34.414 -21.540 35.994  1.00 12.80 ? 1811 HOH B O   1 
HETATM 10467 O O   . HOH H 4 .   ? -3.157  -5.843  60.109  1.00 20.65 ? 1812 HOH B O   1 
HETATM 10468 O O   . HOH H 4 .   ? -39.659 -16.980 22.645  1.00 30.21 ? 1813 HOH B O   1 
HETATM 10469 O O   . HOH H 4 .   ? 5.254   5.148   23.248  1.00 21.09 ? 1814 HOH B O   1 
HETATM 10470 O O   . HOH H 4 .   ? 1.726   25.263  47.611  1.00 24.89 ? 1815 HOH B O   1 
HETATM 10471 O O   . HOH H 4 .   ? -41.839 -25.752 18.800  1.00 30.34 ? 1816 HOH B O   1 
HETATM 10472 O O   . HOH H 4 .   ? -18.843 -6.006  70.741  1.00 17.22 ? 1817 HOH B O   1 
HETATM 10473 O O   . HOH H 4 .   ? 20.652  13.898  54.190  1.00 26.97 ? 1818 HOH B O   1 
HETATM 10474 O O   . HOH H 4 .   ? -27.404 4.318   26.011  1.00 24.20 ? 1819 HOH B O   1 
HETATM 10475 O O   . HOH H 4 .   ? -5.854  12.642  44.907  1.00 22.32 ? 1820 HOH B O   1 
HETATM 10476 O O   . HOH H 4 .   ? -21.302 4.967   36.787  1.00 26.22 ? 1821 HOH B O   1 
HETATM 10477 O O   . HOH H 4 .   ? 0.447   -10.228 39.796  1.00 15.83 ? 1822 HOH B O   1 
HETATM 10478 O O   . HOH H 4 .   ? 2.485   7.978   50.777  1.00 18.65 ? 1823 HOH B O   1 
HETATM 10479 O O   . HOH H 4 .   ? 10.002  30.926  40.874  1.00 29.52 ? 1824 HOH B O   1 
HETATM 10480 O O   . HOH H 4 .   ? -14.859 -23.845 39.206  1.00 16.54 ? 1825 HOH B O   1 
HETATM 10481 O O   . HOH H 4 .   ? -0.594  4.805   58.682  1.00 19.03 ? 1826 HOH B O   1 
HETATM 10482 O O   . HOH H 4 .   ? -30.118 0.854   60.300  1.00 24.42 ? 1827 HOH B O   1 
HETATM 10483 O O   . HOH H 4 .   ? -26.017 -3.865  53.301  1.00 36.28 ? 1828 HOH B O   1 
HETATM 10484 O O   . HOH H 4 .   ? -19.372 -27.340 29.912  1.00 19.47 ? 1829 HOH B O   1 
HETATM 10485 O O   . HOH H 4 .   ? -16.934 -27.847 56.686  1.00 24.86 ? 1830 HOH B O   1 
HETATM 10486 O O   . HOH H 4 .   ? -32.945 -1.201  21.947  1.00 21.30 ? 1831 HOH B O   1 
HETATM 10487 O O   . HOH H 4 .   ? -20.521 8.740   47.671  1.00 20.54 ? 1832 HOH B O   1 
HETATM 10488 O O   . HOH H 4 .   ? -25.499 -12.978 17.589  1.00 19.64 ? 1833 HOH B O   1 
HETATM 10489 O O   . HOH H 4 .   ? -5.810  5.815   25.722  1.00 21.10 ? 1834 HOH B O   1 
HETATM 10490 O O   . HOH H 4 .   ? -32.660 5.512   58.194  1.00 18.24 ? 1835 HOH B O   1 
HETATM 10491 O O   . HOH H 4 .   ? -19.678 5.011   67.172  1.00 12.95 ? 1836 HOH B O   1 
HETATM 10492 O O   . HOH H 4 .   ? -32.725 -13.642 42.602  1.00 13.27 ? 1837 HOH B O   1 
HETATM 10493 O O   . HOH H 4 .   ? -1.718  35.423  39.385  1.00 25.24 ? 1838 HOH B O   1 
HETATM 10494 O O   . HOH H 4 .   ? 7.192   34.621  38.893  1.00 25.57 ? 1839 HOH B O   1 
HETATM 10495 O O   . HOH H 4 .   ? -7.524  -10.627 46.917  1.00 31.72 ? 1840 HOH B O   1 
HETATM 10496 O O   . HOH H 4 .   ? -26.828 -16.121 43.566  1.00 11.13 ? 1841 HOH B O   1 
HETATM 10497 O O   . HOH H 4 .   ? -32.507 -6.091  61.838  1.00 26.52 ? 1842 HOH B O   1 
HETATM 10498 O O   . HOH H 4 .   ? 12.103  -7.931  46.350  1.00 18.11 ? 1843 HOH B O   1 
HETATM 10499 O O   . HOH H 4 .   ? -23.609 -9.135  70.101  1.00 21.82 ? 1844 HOH B O   1 
HETATM 10500 O O   . HOH H 4 .   ? -18.346 6.935   51.598  1.00 20.05 ? 1845 HOH B O   1 
HETATM 10501 O O   . HOH H 4 .   ? -20.806 6.791   50.001  1.00 17.02 ? 1846 HOH B O   1 
HETATM 10502 O O   . HOH H 4 .   ? 8.708   7.619   32.962  1.00 14.62 ? 1847 HOH B O   1 
HETATM 10503 O O   . HOH H 4 .   ? -18.697 -1.557  69.844  1.00 23.56 ? 1848 HOH B O   1 
HETATM 10504 O O   . HOH H 4 .   ? 3.357   5.788   24.929  1.00 18.59 ? 1849 HOH B O   1 
HETATM 10505 O O   . HOH H 4 .   ? 6.810   -1.401  24.920  1.00 44.08 ? 1850 HOH B O   1 
HETATM 10506 O O   . HOH H 4 .   ? -12.380 -12.374 69.329  1.00 22.31 ? 1851 HOH B O   1 
HETATM 10507 O O   . HOH H 4 .   ? -23.697 -24.236 25.799  1.00 13.72 ? 1852 HOH B O   1 
HETATM 10508 O O   . HOH H 4 .   ? -18.801 -9.079  52.492  1.00 14.94 ? 1853 HOH B O   1 
HETATM 10509 O O   . HOH H 4 .   ? -12.983 25.574  43.925  1.00 33.38 ? 1854 HOH B O   1 
HETATM 10510 O O   . HOH H 4 .   ? -32.321 -5.008  54.585  1.00 19.76 ? 1855 HOH B O   1 
HETATM 10511 O O   . HOH H 4 .   ? -12.523 15.335  47.411  1.00 21.66 ? 1856 HOH B O   1 
HETATM 10512 O O   . HOH H 4 .   ? -16.579 1.731   53.966  1.00 23.78 ? 1857 HOH B O   1 
HETATM 10513 O O   . HOH H 4 .   ? 19.181  12.717  56.863  1.00 30.03 ? 1858 HOH B O   1 
HETATM 10514 O O   . HOH H 4 .   ? -3.919  34.562  48.951  1.00 20.54 ? 1859 HOH B O   1 
HETATM 10515 O O   . HOH H 4 .   ? 3.361   9.720   57.542  1.00 19.68 ? 1860 HOH B O   1 
HETATM 10516 O O   . HOH H 4 .   ? -19.783 -1.314  17.462  1.00 22.20 ? 1861 HOH B O   1 
HETATM 10517 O O   . HOH H 4 .   ? -29.994 -6.111  36.281  1.00 19.95 ? 1862 HOH B O   1 
HETATM 10518 O O   . HOH H 4 .   ? 14.525  1.027   55.198  1.00 22.97 ? 1863 HOH B O   1 
HETATM 10519 O O   . HOH H 4 .   ? -9.968  22.173  48.634  1.00 22.07 ? 1864 HOH B O   1 
HETATM 10520 O O   . HOH H 4 .   ? -34.199 -8.795  63.916  1.00 29.95 ? 1865 HOH B O   1 
HETATM 10521 O O   . HOH H 4 .   ? -7.190  -8.386  44.863  1.00 28.70 ? 1866 HOH B O   1 
HETATM 10522 O O   . HOH H 4 .   ? -10.260 25.488  28.709  1.00 34.63 ? 1867 HOH B O   1 
HETATM 10523 O O   . HOH H 4 .   ? -12.276 -6.744  63.287  1.00 43.24 ? 1868 HOH B O   1 
HETATM 10524 O O   . HOH H 4 .   ? -16.020 -13.079 55.544  1.00 17.29 ? 1869 HOH B O   1 
HETATM 10525 O O   . HOH H 4 .   ? -9.511  10.300  51.201  1.00 31.37 ? 1870 HOH B O   1 
HETATM 10526 O O   . HOH H 4 .   ? 7.322   21.426  49.075  1.00 31.93 ? 1871 HOH B O   1 
HETATM 10527 O O   . HOH H 4 .   ? -10.984 -6.349  21.171  1.00 24.29 ? 1872 HOH B O   1 
HETATM 10528 O O   . HOH H 4 .   ? -22.068 3.714   29.466  1.00 16.60 ? 1873 HOH B O   1 
HETATM 10529 O O   . HOH H 4 .   ? 17.093  14.914  58.340  1.00 25.16 ? 1874 HOH B O   1 
HETATM 10530 O O   . HOH H 4 .   ? -38.336 -24.696 20.640  1.00 28.56 ? 1875 HOH B O   1 
HETATM 10531 O O   . HOH H 4 .   ? -40.262 -17.454 18.049  1.00 38.05 ? 1876 HOH B O   1 
HETATM 10532 O O   . HOH H 4 .   ? 3.943   26.035  40.798  1.00 17.98 ? 1877 HOH B O   1 
HETATM 10533 O O   . HOH H 4 .   ? -30.437 -29.030 31.212  1.00 25.63 ? 1878 HOH B O   1 
HETATM 10534 O O   . HOH H 4 .   ? -24.403 -32.423 58.616  1.00 38.58 ? 1879 HOH B O   1 
HETATM 10535 O O   . HOH H 4 .   ? -21.401 -21.012 35.254  1.00 12.27 ? 1880 HOH B O   1 
HETATM 10536 O O   . HOH H 4 .   ? -30.836 16.421  48.463  1.00 33.42 ? 1881 HOH B O   1 
HETATM 10537 O O   . HOH H 4 .   ? 9.542   2.965   35.518  1.00 16.14 ? 1882 HOH B O   1 
HETATM 10538 O O   . HOH H 4 .   ? -17.247 -18.631 72.411  1.00 26.03 ? 1883 HOH B O   1 
HETATM 10539 O O   . HOH H 4 .   ? -3.323  18.179  22.573  1.00 16.06 ? 1884 HOH B O   1 
HETATM 10540 O O   . HOH H 4 .   ? -7.627  24.234  46.873  1.00 20.03 ? 1885 HOH B O   1 
HETATM 10541 O O   . HOH H 4 .   ? 10.205  -3.492  37.527  1.00 30.36 ? 1886 HOH B O   1 
HETATM 10542 O O   . HOH H 4 .   ? -12.563 -27.274 53.897  1.00 33.87 ? 1887 HOH B O   1 
HETATM 10543 O O   . HOH H 4 .   ? -11.528 -22.453 43.054  1.00 19.60 ? 1888 HOH B O   1 
HETATM 10544 O O   . HOH H 4 .   ? -0.167  37.112  28.830  1.00 71.82 ? 1889 HOH B O   1 
HETATM 10545 O O   . HOH H 4 .   ? -4.864  -4.068  20.672  1.00 23.00 ? 1890 HOH B O   1 
HETATM 10546 O O   . HOH H 4 .   ? -25.647 -27.984 46.223  1.00 21.48 ? 1891 HOH B O   1 
HETATM 10547 O O   . HOH H 4 .   ? -14.216 -12.714 49.730  1.00 35.09 ? 1892 HOH B O   1 
HETATM 10548 O O   . HOH H 4 .   ? 4.570   2.256   30.445  1.00 21.63 ? 1893 HOH B O   1 
HETATM 10549 O O   . HOH H 4 .   ? -31.758 -11.223 67.343  1.00 25.73 ? 1894 HOH B O   1 
HETATM 10550 O O   . HOH H 4 .   ? 15.120  14.736  60.457  1.00 32.28 ? 1895 HOH B O   1 
HETATM 10551 O O   . HOH H 4 .   ? -23.575 -17.311 17.754  1.00 30.51 ? 1896 HOH B O   1 
HETATM 10552 O O   . HOH H 4 .   ? -35.814 -6.710  54.795  1.00 40.71 ? 1897 HOH B O   1 
HETATM 10553 O O   . HOH H 4 .   ? 21.902  3.663   53.926  1.00 28.45 ? 1898 HOH B O   1 
HETATM 10554 O O   . HOH H 4 .   ? -21.545 -16.193 43.584  1.00 41.81 ? 1899 HOH B O   1 
HETATM 10555 O O   . HOH H 4 .   ? -18.969 -19.349 25.224  1.00 15.95 ? 1900 HOH B O   1 
HETATM 10556 O O   . HOH H 4 .   ? -34.451 -23.749 65.673  1.00 27.92 ? 1901 HOH B O   1 
HETATM 10557 O O   . HOH H 4 .   ? -24.103 1.441   37.687  1.00 28.48 ? 1902 HOH B O   1 
HETATM 10558 O O   . HOH H 4 .   ? -36.822 -11.761 25.722  1.00 28.49 ? 1903 HOH B O   1 
HETATM 10559 O O   . HOH H 4 .   ? -7.397  6.431   58.104  1.00 29.08 ? 1904 HOH B O   1 
HETATM 10560 O O   . HOH H 4 .   ? -32.957 -21.423 51.401  1.00 39.21 ? 1905 HOH B O   1 
HETATM 10561 O O   . HOH H 4 .   ? -16.923 4.581   61.954  1.00 71.30 ? 1906 HOH B O   1 
HETATM 10562 O O   . HOH H 4 .   ? -29.146 -16.237 72.169  1.00 40.05 ? 1907 HOH B O   1 
HETATM 10563 O O   . HOH H 4 .   ? -25.385 -28.990 29.189  1.00 29.52 ? 1908 HOH B O   1 
HETATM 10564 O O   . HOH H 4 .   ? 12.832  19.452  47.169  1.00 25.86 ? 1909 HOH B O   1 
HETATM 10565 O O   . HOH H 4 .   ? -10.427 -5.814  48.725  1.00 43.00 ? 1910 HOH B O   1 
HETATM 10566 O O   . HOH H 4 .   ? -10.980 14.568  49.445  1.00 29.45 ? 1911 HOH B O   1 
HETATM 10567 O O   . HOH H 4 .   ? 16.673  18.796  32.577  1.00 20.19 ? 1912 HOH B O   1 
HETATM 10568 O O   . HOH H 4 .   ? -32.635 2.090   56.944  1.00 29.48 ? 1913 HOH B O   1 
HETATM 10569 O O   . HOH H 4 .   ? -30.816 -10.716 48.405  1.00 16.74 ? 1914 HOH B O   1 
HETATM 10570 O O   . HOH H 4 .   ? -33.860 -4.385  58.150  1.00 33.76 ? 1915 HOH B O   1 
HETATM 10571 O O   . HOH H 4 .   ? 4.683   34.740  39.877  1.00 28.56 ? 1916 HOH B O   1 
HETATM 10572 O O   . HOH H 4 .   ? -2.569  21.651  54.941  1.00 33.57 ? 1917 HOH B O   1 
HETATM 10573 O O   . HOH H 4 .   ? -23.600 -7.419  15.400  1.00 25.86 ? 1918 HOH B O   1 
HETATM 10574 O O   . HOH H 4 .   ? -6.632  -7.090  22.938  1.00 18.03 ? 1919 HOH B O   1 
HETATM 10575 O O   . HOH H 4 .   ? -39.571 -22.745 18.133  1.00 30.78 ? 1920 HOH B O   1 
HETATM 10576 O O   . HOH H 4 .   ? 16.632  8.047   55.158  1.00 34.15 ? 1921 HOH B O   1 
HETATM 10577 O O   . HOH H 4 .   ? -36.700 -9.529  44.898  1.00 30.61 ? 1922 HOH B O   1 
HETATM 10578 O O   . HOH H 4 .   ? -12.699 -10.622 57.740  1.00 30.36 ? 1923 HOH B O   1 
HETATM 10579 O O   . HOH H 4 .   ? -26.876 6.554   38.961  1.00 37.37 ? 1924 HOH B O   1 
HETATM 10580 O O   . HOH H 4 .   ? -37.331 -12.344 47.728  1.00 27.09 ? 1925 HOH B O   1 
HETATM 10581 O O   . HOH H 4 .   ? -5.437  -18.087 24.721  1.00 27.97 ? 1926 HOH B O   1 
HETATM 10582 O O   . HOH H 4 .   ? -19.479 -18.226 68.684  1.00 30.85 ? 1927 HOH B O   1 
HETATM 10583 O O   . HOH H 4 .   ? -1.422  27.032  49.374  1.00 39.37 ? 1928 HOH B O   1 
HETATM 10584 O O   . HOH H 4 .   ? 0.974   -13.022 46.726  1.00 48.85 ? 1929 HOH B O   1 
HETATM 10585 O O   . HOH H 4 .   ? -24.003 -29.441 43.339  1.00 43.09 ? 1930 HOH B O   1 
HETATM 10586 O O   . HOH H 4 .   ? 17.288  -6.663  50.970  1.00 28.97 ? 1931 HOH B O   1 
HETATM 10587 O O   . HOH H 4 .   ? 2.464   -11.976 48.970  1.00 41.26 ? 1932 HOH B O   1 
HETATM 10588 O O   . HOH H 4 .   ? 14.283  3.525   33.749  1.00 29.41 ? 1933 HOH B O   1 
HETATM 10589 O O   . HOH H 4 .   ? -23.171 -25.069 64.910  1.00 29.13 ? 1934 HOH B O   1 
HETATM 10590 O O   . HOH H 4 .   ? -27.950 -28.811 39.065  1.00 33.98 ? 1935 HOH B O   1 
HETATM 10591 O O   . HOH H 4 .   ? -13.679 -9.619  18.179  1.00 39.00 ? 1936 HOH B O   1 
HETATM 10592 O O   . HOH H 4 .   ? -10.382 -19.699 22.799  1.00 23.26 ? 1937 HOH B O   1 
HETATM 10593 O O   . HOH H 4 .   ? -14.879 -15.326 20.690  1.00 34.26 ? 1938 HOH B O   1 
HETATM 10594 O O   . HOH H 4 .   ? -29.615 1.778   19.916  1.00 29.24 ? 1939 HOH B O   1 
HETATM 10595 O O   . HOH H 4 .   ? 13.857  3.512   52.215  1.00 26.73 ? 1940 HOH B O   1 
HETATM 10596 O O   . HOH H 4 .   ? -32.922 6.773   39.088  1.00 32.44 ? 1941 HOH B O   1 
HETATM 10597 O O   . HOH H 4 .   ? -26.011 -1.814  32.038  1.00 29.05 ? 1942 HOH B O   1 
HETATM 10598 O O   . HOH H 4 .   ? -44.324 -20.937 21.107  1.00 42.40 ? 1943 HOH B O   1 
HETATM 10599 O O   . HOH H 4 .   ? -41.182 -26.261 23.160  1.00 31.55 ? 1944 HOH B O   1 
HETATM 10600 O O   . HOH H 4 .   ? -3.254  10.245  47.422  1.00 85.53 ? 1945 HOH B O   1 
HETATM 10601 O O   . HOH H 4 .   ? -20.325 25.708  41.488  1.00 41.98 ? 1946 HOH B O   1 
HETATM 10602 O O   . HOH H 4 .   ? -8.541  3.987   24.412  1.00 39.96 ? 1947 HOH B O   1 
HETATM 10603 O O   . HOH H 4 .   ? -8.098  13.731  20.553  1.00 29.95 ? 1948 HOH B O   1 
HETATM 10604 O O   . HOH H 4 .   ? -17.866 -25.220 60.470  1.00 21.47 ? 1949 HOH B O   1 
HETATM 10605 O O   . HOH H 4 .   ? -1.026  -12.272 28.244  1.00 39.64 ? 1950 HOH B O   1 
HETATM 10606 O O   . HOH H 4 .   ? 3.936   0.733   22.437  1.00 23.46 ? 1951 HOH B O   1 
HETATM 10607 O O   . HOH H 4 .   ? -31.441 -26.901 32.869  1.00 17.18 ? 1952 HOH B O   1 
HETATM 10608 O O   . HOH H 4 .   ? 5.745   24.957  48.903  1.00 37.18 ? 1953 HOH B O   1 
HETATM 10609 O O   . HOH H 4 .   ? -18.730 -33.146 48.944  1.00 24.04 ? 1954 HOH B O   1 
HETATM 10610 O O   . HOH H 4 .   ? -29.551 -30.764 56.148  1.00 18.39 ? 1955 HOH B O   1 
HETATM 10611 O O   . HOH H 4 .   ? 6.881   5.845   59.179  1.00 69.34 ? 1956 HOH B O   1 
HETATM 10612 O O   . HOH H 4 .   ? -6.626  2.092   22.374  1.00 64.18 ? 1957 HOH B O   1 
HETATM 10613 O O   . HOH H 4 .   ? 20.616  18.366  50.503  1.00 35.87 ? 1958 HOH B O   1 
HETATM 10614 O O   . HOH H 4 .   ? -35.774 -13.246 43.837  1.00 31.87 ? 1959 HOH B O   1 
HETATM 10615 O O   . HOH H 4 .   ? -9.045  4.710   21.962  1.00 27.08 ? 1960 HOH B O   1 
HETATM 10616 O O   . HOH H 4 .   ? -1.209  -24.078 37.976  1.00 35.07 ? 1961 HOH B O   1 
HETATM 10617 O O   . HOH H 4 .   ? -13.719 11.141  25.627  1.00 29.42 ? 1962 HOH B O   1 
HETATM 10618 O O   . HOH H 4 .   ? 2.936   -0.059  19.696  1.00 33.69 ? 1963 HOH B O   1 
HETATM 10619 O O   . HOH H 4 .   ? -21.543 -29.376 36.527  1.00 33.24 ? 1964 HOH B O   1 
HETATM 10620 O O   . HOH H 4 .   ? 9.560   32.933  37.469  1.00 29.61 ? 1965 HOH B O   1 
HETATM 10621 O O   . HOH H 4 .   ? 18.494  9.789   42.531  1.00 32.96 ? 1966 HOH B O   1 
HETATM 10622 O O   . HOH H 4 .   ? -13.768 2.149   47.370  1.00 64.34 ? 1967 HOH B O   1 
HETATM 10623 O O   . HOH H 4 .   ? 4.267   -15.732 36.658  1.00 35.52 ? 1968 HOH B O   1 
HETATM 10624 O O   . HOH H 4 .   ? -1.907  10.499  18.846  1.00 26.87 ? 1969 HOH B O   1 
HETATM 10625 O O   . HOH H 4 .   ? -13.038 -1.694  24.308  1.00 31.61 ? 1970 HOH B O   1 
HETATM 10626 O O   . HOH H 4 .   ? -33.069 -19.021 56.920  1.00 58.17 ? 1971 HOH B O   1 
HETATM 10627 O O   . HOH H 4 .   ? 6.723   -3.206  58.486  1.00 24.91 ? 1972 HOH B O   1 
HETATM 10628 O O   . HOH H 4 .   ? -28.619 -19.487 75.371  1.00 47.32 ? 1973 HOH B O   1 
HETATM 10629 O O   . HOH H 4 .   ? 3.878   6.611   27.467  1.00 34.75 ? 1974 HOH B O   1 
HETATM 10630 O O   . HOH H 4 .   ? -5.774  22.073  23.734  1.00 30.58 ? 1975 HOH B O   1 
HETATM 10631 O O   . HOH H 4 .   ? 1.345   -21.813 35.487  1.00 38.34 ? 1976 HOH B O   1 
HETATM 10632 O O   . HOH H 4 .   ? 3.658   3.382   21.661  1.00 29.64 ? 1977 HOH B O   1 
HETATM 10633 O O   . HOH H 4 .   ? -35.988 -21.156 40.186  1.00 33.65 ? 1978 HOH B O   1 
HETATM 10634 O O   . HOH H 4 .   ? 1.249   -10.324 18.478  1.00 41.10 ? 1979 HOH B O   1 
HETATM 10635 O O   . HOH H 4 .   ? -38.863 -23.171 31.264  1.00 24.99 ? 1980 HOH B O   1 
HETATM 10636 O O   . HOH H 4 .   ? 22.464  -0.019  48.085  1.00 27.98 ? 1981 HOH B O   1 
HETATM 10637 O O   . HOH H 4 .   ? -35.765 -11.741 15.578  1.00 49.06 ? 1982 HOH B O   1 
HETATM 10638 O O   . HOH H 4 .   ? -18.721 23.413  36.102  1.00 39.60 ? 1983 HOH B O   1 
HETATM 10639 O O   . HOH H 4 .   ? -36.574 -15.699 37.530  1.00 45.78 ? 1984 HOH B O   1 
HETATM 10640 O O   . HOH H 4 .   ? -33.954 -16.235 62.575  1.00 31.13 ? 1985 HOH B O   1 
HETATM 10641 O O   . HOH H 4 .   ? 14.360  2.167   37.085  1.00 27.23 ? 1986 HOH B O   1 
HETATM 10642 O O   . HOH H 4 .   ? -8.501  -6.367  42.465  1.00 17.01 ? 1987 HOH B O   1 
HETATM 10643 O O   . HOH H 4 .   ? 13.631  -1.330  54.619  1.00 31.75 ? 1988 HOH B O   1 
HETATM 10644 O O   . HOH H 4 .   ? 4.560   -7.092  20.176  1.00 34.56 ? 1989 HOH B O   1 
HETATM 10645 O O   . HOH H 4 .   ? -36.142 -26.288 19.684  1.00 33.75 ? 1990 HOH B O   1 
HETATM 10646 O O   . HOH H 4 .   ? -20.472 1.012   18.844  1.00 32.23 ? 1991 HOH B O   1 
HETATM 10647 O O   . HOH H 4 .   ? -20.724 -8.185  73.804  1.00 47.07 ? 1992 HOH B O   1 
HETATM 10648 O O   . HOH H 4 .   ? 8.018   -8.031  53.554  1.00 27.69 ? 1993 HOH B O   1 
HETATM 10649 O O   . HOH H 4 .   ? 18.053  10.263  53.473  1.00 23.47 ? 1994 HOH B O   1 
HETATM 10650 O O   . HOH H 4 .   ? -19.955 13.559  53.848  1.00 35.06 ? 1995 HOH B O   1 
HETATM 10651 O O   . HOH H 4 .   ? -29.435 -25.649 19.269  1.00 34.52 ? 1996 HOH B O   1 
HETATM 10652 O O   . HOH H 4 .   ? 11.266  3.021   27.214  1.00 40.67 ? 1997 HOH B O   1 
HETATM 10653 O O   . HOH H 4 .   ? -35.768 -9.478  50.912  1.00 26.67 ? 1998 HOH B O   1 
HETATM 10654 O O   . HOH H 4 .   ? -33.796 -8.196  34.004  1.00 67.30 ? 1999 HOH B O   1 
HETATM 10655 O O   . HOH H 4 .   ? 12.364  16.875  25.301  1.00 32.40 ? 2000 HOH B O   1 
HETATM 10656 O O   . HOH H 4 .   ? -12.442 -17.974 50.972  1.00 21.81 ? 2001 HOH B O   1 
HETATM 10657 O O   . HOH H 4 .   ? -1.122  -9.003  25.044  1.00 32.49 ? 2002 HOH B O   1 
HETATM 10658 O O   . HOH H 4 .   ? 18.250  18.199  38.683  1.00 37.32 ? 2003 HOH B O   1 
HETATM 10659 O O   . HOH H 4 .   ? -9.950  17.588  54.852  1.00 25.49 ? 2004 HOH B O   1 
HETATM 10660 O O   . HOH H 4 .   ? 12.011  10.814  42.392  1.00 29.78 ? 2005 HOH B O   1 
HETATM 10661 O O   . HOH H 4 .   ? -11.061 24.455  54.586  1.00 38.13 ? 2006 HOH B O   1 
HETATM 10662 O O   . HOH H 4 .   ? -23.872 -33.376 54.645  1.00 26.93 ? 2007 HOH B O   1 
HETATM 10663 O O   . HOH H 4 .   ? -25.081 -27.543 41.810  1.00 36.89 ? 2008 HOH B O   1 
HETATM 10664 O O   . HOH H 4 .   ? -34.547 -2.419  51.851  1.00 71.14 ? 2009 HOH B O   1 
HETATM 10665 O O   . HOH H 4 .   ? -37.038 -7.338  40.391  1.00 37.87 ? 2010 HOH B O   1 
HETATM 10666 O O   . HOH H 4 .   ? -7.976  -2.016  63.910  1.00 30.05 ? 2011 HOH B O   1 
HETATM 10667 O O   . HOH H 4 .   ? -34.634 -5.439  34.132  1.00 33.44 ? 2012 HOH B O   1 
HETATM 10668 O O   . HOH H 4 .   ? 1.981   -8.443  32.283  1.00 37.27 ? 2013 HOH B O   1 
HETATM 10669 O O   . HOH H 4 .   ? -42.250 -12.885 16.092  1.00 45.84 ? 2014 HOH B O   1 
HETATM 10670 O O   . HOH H 4 .   ? -18.705 2.358   60.668  1.00 11.86 ? 2015 HOH B O   1 
HETATM 10671 O O   . HOH H 4 .   ? -29.365 -16.494 44.431  1.00 11.08 ? 2016 HOH B O   1 
HETATM 10672 O O   . HOH H 4 .   ? -30.993 -15.631 42.452  1.00 12.32 ? 2017 HOH B O   1 
HETATM 10673 O O   . HOH H 4 .   ? 9.829   30.130  36.085  1.00 15.00 ? 2018 HOH B O   1 
HETATM 10674 O O   . HOH H 4 .   ? -32.390 -12.516 65.051  1.00 23.02 ? 2019 HOH B O   1 
HETATM 10675 O O   . HOH H 4 .   ? -29.616 -14.386 40.450  1.00 18.86 ? 2020 HOH B O   1 
HETATM 10676 O O   . HOH H 4 .   ? 4.275   33.702  42.345  1.00 14.62 ? 2021 HOH B O   1 
HETATM 10677 O O   . HOH H 4 .   ? -28.629 -25.312 41.687  1.00 16.25 ? 2022 HOH B O   1 
HETATM 10678 O O   . HOH H 4 .   ? 4.037   -0.120  28.721  1.00 19.95 ? 2023 HOH B O   1 
HETATM 10679 O O   . HOH H 4 .   ? -16.136 -10.274 49.831  1.00 22.83 ? 2024 HOH B O   1 
HETATM 10680 O O   . HOH H 4 .   ? -2.562  -7.519  62.259  1.00 22.60 ? 2025 HOH B O   1 
HETATM 10681 O O   . HOH H 4 .   ? -16.093 -31.058 51.740  1.00 24.05 ? 2026 HOH B O   1 
HETATM 10682 O O   . HOH H 4 .   ? 12.518  -5.465  50.292  1.00 19.23 ? 2027 HOH B O   1 
HETATM 10683 O O   . HOH H 4 .   ? -6.265  -9.235  54.209  1.00 27.32 ? 2028 HOH B O   1 
HETATM 10684 O O   . HOH H 4 .   ? -16.212 -9.653  52.541  1.00 19.02 ? 2029 HOH B O   1 
HETATM 10685 O O   . HOH H 4 .   ? -29.086 -26.750 37.391  1.00 16.55 ? 2030 HOH B O   1 
HETATM 10686 O O   . HOH H 4 .   ? -36.708 -13.893 39.482  1.00 26.83 ? 2031 HOH B O   1 
HETATM 10687 O O   . HOH H 4 .   ? -13.667 -6.386  66.760  1.00 83.46 ? 2032 HOH B O   1 
HETATM 10688 O O   . HOH H 4 .   ? -13.189 -22.736 45.076  1.00 22.77 ? 2033 HOH B O   1 
HETATM 10689 O O   . HOH H 4 .   ? -4.102  36.335  38.530  1.00 35.10 ? 2034 HOH B O   1 
HETATM 10690 O O   . HOH H 4 .   ? 0.296   32.418  40.126  1.00 24.75 ? 2035 HOH B O   1 
HETATM 10691 O O   . HOH H 4 .   ? -12.140 16.413  55.102  1.00 26.50 ? 2036 HOH B O   1 
HETATM 10692 O O   . HOH H 4 .   ? -34.583 -13.359 61.654  1.00 24.73 ? 2037 HOH B O   1 
HETATM 10693 O O   . HOH H 4 .   ? -36.722 -5.020  36.205  1.00 26.86 ? 2038 HOH B O   1 
HETATM 10694 O O   . HOH H 4 .   ? 0.108   -6.370  32.257  1.00 23.74 ? 2039 HOH B O   1 
HETATM 10695 O O   . HOH H 4 .   ? -21.753 -25.902 39.577  1.00 15.49 ? 2040 HOH B O   1 
HETATM 10696 O O   . HOH H 4 .   ? -14.315 -8.499  48.522  1.00 17.50 ? 2041 HOH B O   1 
HETATM 10697 O O   . HOH H 4 .   ? -18.286 -29.706 54.525  1.00 30.30 ? 2042 HOH B O   1 
HETATM 10698 O O   . HOH H 4 .   ? -18.440 5.452   64.912  1.00 22.03 ? 2043 HOH B O   1 
HETATM 10699 O O   . HOH H 4 .   ? -17.785 5.308   53.565  1.00 32.14 ? 2044 HOH B O   1 
HETATM 10700 O O   . HOH H 4 .   ? -12.776 -9.473  46.693  1.00 37.32 ? 2045 HOH B O   1 
HETATM 10701 O O   . HOH H 4 .   ? 2.117   22.565  51.393  1.00 32.52 ? 2046 HOH B O   1 
HETATM 10702 O O   . HOH H 4 .   ? -20.333 5.367   60.898  1.00 24.82 ? 2047 HOH B O   1 
HETATM 10703 O O   . HOH H 4 .   ? -28.120 -6.609  17.863  1.00 23.97 ? 2048 HOH B O   1 
HETATM 10704 O O   . HOH H 4 .   ? -6.115  34.518  50.292  1.00 25.50 ? 2049 HOH B O   1 
HETATM 10705 O O   . HOH H 4 .   ? -10.149 -7.257  46.397  1.00 33.54 ? 2050 HOH B O   1 
HETATM 10706 O O   . HOH H 4 .   ? 4.780   -4.617  59.364  1.00 32.13 ? 2051 HOH B O   1 
HETATM 10707 O O   . HOH H 4 .   ? -14.193 8.290   22.330  1.00 24.81 ? 2052 HOH B O   1 
HETATM 10708 O O   . HOH H 4 .   ? 16.020  12.975  43.734  1.00 26.14 ? 2053 HOH B O   1 
HETATM 10709 O O   . HOH H 4 .   ? -22.217 20.794  54.267  1.00 26.41 ? 2054 HOH B O   1 
HETATM 10710 O O   . HOH H 4 .   ? -40.200 -26.613 20.816  1.00 24.68 ? 2055 HOH B O   1 
HETATM 10711 O O   . HOH H 4 .   ? -4.794  15.847  21.752  1.00 26.25 ? 2056 HOH B O   1 
HETATM 10712 O O   . HOH H 4 .   ? 12.867  7.971   33.486  1.00 31.39 ? 2057 HOH B O   1 
HETATM 10713 O O   . HOH H 4 .   ? -2.250  -10.732 51.912  1.00 33.56 ? 2058 HOH B O   1 
HETATM 10714 O O   . HOH H 4 .   ? -26.361 -5.582  55.134  1.00 22.80 ? 2059 HOH B O   1 
HETATM 10715 O O   . HOH H 4 .   ? -7.144  6.907   49.328  1.00 32.55 ? 2060 HOH B O   1 
HETATM 10716 O O   . HOH H 4 .   ? -11.456 11.635  24.024  1.00 32.09 ? 2061 HOH B O   1 
HETATM 10717 O O   . HOH H 4 .   ? 17.079  18.703  35.046  1.00 38.25 ? 2062 HOH B O   1 
HETATM 10718 O O   . HOH H 4 .   ? -27.665 0.880   18.557  1.00 31.41 ? 2063 HOH B O   1 
HETATM 10719 O O   . HOH H 4 .   ? -3.936  -11.639 26.618  1.00 38.55 ? 2064 HOH B O   1 
HETATM 10720 O O   . HOH H 4 .   ? 7.238   27.518  29.655  1.00 28.05 ? 2065 HOH B O   1 
HETATM 10721 O O   . HOH H 4 .   ? -8.610  -5.046  21.961  1.00 35.47 ? 2066 HOH B O   1 
HETATM 10722 O O   . HOH H 4 .   ? -2.679  -18.650 30.551  1.00 31.50 ? 2067 HOH B O   1 
HETATM 10723 O O   . HOH H 4 .   ? -5.689  21.731  58.993  1.00 41.98 ? 2068 HOH B O   1 
HETATM 10724 O O   . HOH H 4 .   ? -25.992 -32.928 56.548  1.00 37.85 ? 2069 HOH B O   1 
HETATM 10725 O O   . HOH H 4 .   ? 8.239   21.555  55.311  1.00 57.36 ? 2070 HOH B O   1 
HETATM 10726 O O   . HOH H 4 .   ? -21.463 -4.428  71.246  1.00 23.20 ? 2071 HOH B O   1 
HETATM 10727 O O   . HOH H 4 .   ? 14.166  13.388  41.752  1.00 57.71 ? 2072 HOH B O   1 
HETATM 10728 O O   . HOH H 4 .   ? 2.681   -2.008  29.912  1.00 23.23 ? 2073 HOH B O   1 
HETATM 10729 O O   . HOH H 4 .   ? -21.252 -21.715 66.116  1.00 22.68 ? 2074 HOH B O   1 
HETATM 10730 O O   . HOH H 4 .   ? 17.600  3.039   39.332  1.00 31.83 ? 2075 HOH B O   1 
HETATM 10731 O O   . HOH H 4 .   ? 12.939  4.226   31.357  1.00 55.69 ? 2076 HOH B O   1 
HETATM 10732 O O   . HOH H 4 .   ? 5.799   27.227  42.266  1.00 28.28 ? 2077 HOH B O   1 
HETATM 10733 O O   . HOH H 4 .   ? 19.439  17.253  52.931  1.00 30.34 ? 2078 HOH B O   1 
HETATM 10734 O O   . HOH H 4 .   ? -14.654 -11.511 53.746  1.00 22.47 ? 2079 HOH B O   1 
HETATM 10735 O O   . HOH H 4 .   ? -3.596  25.230  26.648  1.00 38.91 ? 2080 HOH B O   1 
HETATM 10736 O O   . HOH H 4 .   ? -32.825 -8.785  66.934  1.00 36.92 ? 2081 HOH B O   1 
HETATM 10737 O O   . HOH H 4 .   ? -23.189 3.730   38.119  1.00 52.61 ? 2082 HOH B O   1 
HETATM 10738 O O   . HOH H 4 .   ? -10.330 -4.584  45.700  1.00 36.32 ? 2083 HOH B O   1 
HETATM 10739 O O   . HOH H 4 .   ? -22.511 -32.842 44.695  1.00 34.89 ? 2084 HOH B O   1 
HETATM 10740 O O   . HOH H 4 .   ? -20.995 12.728  56.346  1.00 36.15 ? 2085 HOH B O   1 
HETATM 10741 O O   . HOH H 4 .   ? -20.450 -18.385 71.534  1.00 32.18 ? 2086 HOH B O   1 
HETATM 10742 O O   . HOH H 4 .   ? 1.409   20.295  18.513  1.00 36.78 ? 2087 HOH B O   1 
HETATM 10743 O O   . HOH H 4 .   ? -33.112 -21.561 56.931  1.00 47.63 ? 2088 HOH B O   1 
HETATM 10744 O O   . HOH H 4 .   ? -24.475 2.668   30.541  1.00 34.36 ? 2089 HOH B O   1 
HETATM 10745 O O   . HOH H 4 .   ? -18.992 7.660   68.080  1.00 36.86 ? 2090 HOH B O   1 
HETATM 10746 O O   . HOH H 4 .   ? -24.366 -29.911 31.488  1.00 38.17 ? 2091 HOH B O   1 
HETATM 10747 O O   . HOH H 4 .   ? -21.585 0.879   52.982  1.00 30.01 ? 2092 HOH B O   1 
HETATM 10748 O O   . HOH H 4 .   ? 10.229  0.658   19.429  1.00 21.52 ? 2093 HOH B O   1 
HETATM 10749 O O   . HOH H 4 .   ? -21.958 -1.558  37.985  1.00 67.86 ? 2094 HOH B O   1 
HETATM 10750 O O   . HOH H 4 .   ? -37.988 -10.754 27.835  1.00 29.86 ? 2095 HOH B O   1 
HETATM 10751 O O   . HOH H 4 .   ? 12.374  1.710   58.897  1.00 30.46 ? 2096 HOH B O   1 
HETATM 10752 O O   . HOH H 4 .   ? -21.504 13.575  39.846  1.00 43.02 ? 2097 HOH B O   1 
HETATM 10753 O O   . HOH H 4 .   ? -23.832 4.928   27.164  1.00 37.78 ? 2098 HOH B O   1 
HETATM 10754 O O   . HOH H 4 .   ? -18.622 -1.192  14.974  1.00 27.39 ? 2099 HOH B O   1 
HETATM 10755 O O   . HOH H 4 .   ? 18.170  5.667   54.784  1.00 28.59 ? 2100 HOH B O   1 
HETATM 10756 O O   . HOH H 4 .   ? 12.619  23.774  41.521  1.00 33.48 ? 2101 HOH B O   1 
HETATM 10757 O O   . HOH H 4 .   ? 15.677  17.227  61.188  1.00 28.89 ? 2102 HOH B O   1 
HETATM 10758 O O   . HOH H 4 .   ? -21.582 18.784  46.280  1.00 33.94 ? 2103 HOH B O   1 
HETATM 10759 O O   . HOH H 4 .   ? -33.627 -17.053 67.070  1.00 38.12 ? 2104 HOH B O   1 
HETATM 10760 O O   . HOH H 4 .   ? 18.797  18.535  30.624  1.00 32.63 ? 2105 HOH B O   1 
HETATM 10761 O O   . HOH H 4 .   ? -10.907 9.299   53.186  1.00 52.83 ? 2106 HOH B O   1 
HETATM 10762 O O   . HOH H 4 .   ? 4.283   13.636  55.456  1.00 36.10 ? 2107 HOH B O   1 
HETATM 10763 O O   . HOH H 4 .   ? -15.387 -0.282  32.975  1.00 32.62 ? 2108 HOH B O   1 
HETATM 10764 O O   . HOH H 4 .   ? -13.036 -12.864 51.923  1.00 34.61 ? 2109 HOH B O   1 
HETATM 10765 O O   . HOH H 4 .   ? -23.485 -1.384  72.650  1.00 39.31 ? 2110 HOH B O   1 
HETATM 10766 O O   . HOH H 4 .   ? 18.343  -2.569  38.434  1.00 39.85 ? 2111 HOH B O   1 
HETATM 10767 O O   . HOH H 4 .   ? 6.218   19.703  20.097  1.00 36.31 ? 2112 HOH B O   1 
HETATM 10768 O O   . HOH H 4 .   ? 10.710  -5.179  54.805  1.00 23.03 ? 2113 HOH B O   1 
HETATM 10769 O O   . HOH H 4 .   ? -30.967 -30.534 53.968  1.00 30.88 ? 2114 HOH B O   1 
HETATM 10770 O O   . HOH H 4 .   ? -27.420 -19.653 20.200  1.00 20.78 ? 2115 HOH B O   1 
HETATM 10771 O O   . HOH H 4 .   ? -13.560 -23.773 41.592  1.00 37.97 ? 2116 HOH B O   1 
HETATM 10772 O O   . HOH H 4 .   ? 16.539  9.313   30.260  1.00 41.16 ? 2117 HOH B O   1 
HETATM 10773 O O   . HOH H 4 .   ? -28.288 -31.009 49.838  1.00 33.94 ? 2118 HOH B O   1 
HETATM 10774 O O   . HOH H 4 .   ? -30.832 -27.579 35.583  1.00 26.36 ? 2119 HOH B O   1 
HETATM 10775 O O   . HOH H 4 .   ? 24.566  1.574   47.250  1.00 28.98 ? 2120 HOH B O   1 
HETATM 10776 O O   . HOH H 4 .   ? -5.379  19.423  23.909  1.00 29.10 ? 2121 HOH B O   1 
HETATM 10777 O O   . HOH H 4 .   ? -17.580 -21.174 23.227  1.00 30.28 ? 2122 HOH B O   1 
HETATM 10778 O O   . HOH H 4 .   ? 2.414   0.759   24.609  1.00 37.92 ? 2123 HOH B O   1 
HETATM 10779 O O   . HOH H 4 .   ? -22.829 -0.417  15.607  1.00 35.39 ? 2124 HOH B O   1 
HETATM 10780 O O   . HOH H 4 .   ? -37.791 -25.472 31.978  1.00 40.50 ? 2125 HOH B O   1 
HETATM 10781 O O   . HOH H 4 .   ? -34.826 -14.612 52.217  1.00 25.81 ? 2126 HOH B O   1 
HETATM 10782 O O   . HOH H 4 .   ? 0.509   -12.614 41.146  1.00 36.14 ? 2127 HOH B O   1 
HETATM 10783 O O   . HOH H 4 .   ? -37.007 -13.242 21.897  1.00 27.66 ? 2128 HOH B O   1 
HETATM 10784 O O   . HOH H 4 .   ? -8.228  -22.591 29.870  1.00 39.31 ? 2129 HOH B O   1 
HETATM 10785 O O   . HOH H 4 .   ? 6.508   26.471  23.494  1.00 45.23 ? 2130 HOH B O   1 
HETATM 10786 O O   . HOH H 4 .   ? -22.916 17.275  47.715  1.00 36.34 ? 2131 HOH B O   1 
HETATM 10787 O O   . HOH H 4 .   ? -7.587  4.455   19.691  1.00 36.06 ? 2132 HOH B O   1 
HETATM 10788 O O   . HOH H 4 .   ? -10.047 -22.221 23.369  1.00 42.40 ? 2133 HOH B O   1 
HETATM 10789 O O   . HOH H 4 .   ? -43.009 -23.710 24.108  1.00 29.12 ? 2134 HOH B O   1 
HETATM 10790 O O   . HOH H 4 .   ? -36.256 -12.059 31.711  1.00 63.84 ? 2135 HOH B O   1 
HETATM 10791 O O   . HOH H 4 .   ? -19.915 -30.585 33.365  1.00 28.89 ? 2136 HOH B O   1 
HETATM 10792 O O   . HOH H 4 .   ? -11.899 -24.410 53.253  1.00 33.13 ? 2137 HOH B O   1 
HETATM 10793 O O   . HOH H 4 .   ? 14.657  10.449  43.281  1.00 38.23 ? 2138 HOH B O   1 
HETATM 10794 O O   . HOH H 4 .   ? 15.678  -0.764  36.283  1.00 35.53 ? 2139 HOH B O   1 
HETATM 10795 O O   . HOH H 4 .   ? -19.741 -20.880 68.179  1.00 25.55 ? 2140 HOH B O   1 
HETATM 10796 O O   . HOH H 4 .   ? 0.576   16.953  18.747  1.00 41.46 ? 2141 HOH B O   1 
HETATM 10797 O O   . HOH H 4 .   ? -14.170 -4.931  18.061  1.00 30.13 ? 2142 HOH B O   1 
HETATM 10798 O O   . HOH H 4 .   ? -30.810 -0.780  64.772  1.00 35.11 ? 2143 HOH B O   1 
HETATM 10799 O O   . HOH H 4 .   ? -8.392  -8.175  55.228  1.00 29.16 ? 2144 HOH B O   1 
HETATM 10800 O O   . HOH H 4 .   ? -30.355 18.590  57.658  1.00 47.36 ? 2145 HOH B O   1 
HETATM 10801 O O   . HOH H 4 .   ? -33.972 -12.743 68.607  1.00 38.00 ? 2146 HOH B O   1 
HETATM 10802 O O   . HOH H 4 .   ? -18.739 19.423  52.047  1.00 48.86 ? 2147 HOH B O   1 
HETATM 10803 O O   . HOH H 4 .   ? 1.315   29.904  40.669  1.00 30.42 ? 2148 HOH B O   1 
HETATM 10804 O O   . HOH H 4 .   ? 4.647   -15.027 40.632  1.00 35.47 ? 2149 HOH B O   1 
HETATM 10805 O O   . HOH H 4 .   ? -11.308 26.801  26.753  1.00 76.84 ? 2150 HOH B O   1 
HETATM 10806 O O   . HOH H 4 .   ? -41.843 -11.001 18.877  1.00 62.84 ? 2151 HOH B O   1 
HETATM 10807 O O   . HOH H 4 .   ? -15.959 -33.126 49.072  1.00 41.62 ? 2152 HOH B O   1 
HETATM 10808 O O   . HOH H 4 .   ? -2.763  -11.345 23.970  1.00 39.08 ? 2153 HOH B O   1 
HETATM 10809 O O   . HOH H 4 .   ? -21.253 7.802   37.621  1.00 40.42 ? 2154 HOH B O   1 
HETATM 10810 O O   . HOH H 4 .   ? -36.026 -11.557 19.022  1.00 40.33 ? 2155 HOH B O   1 
HETATM 10811 O O   . HOH H 4 .   ? -29.622 -0.903  39.155  1.00 52.76 ? 2156 HOH B O   1 
HETATM 10812 O O   . HOH H 4 .   ? -7.107  -23.406 25.346  1.00 35.00 ? 2157 HOH B O   1 
HETATM 10813 O O   . HOH H 4 .   ? -8.045  -8.414  57.878  1.00 34.66 ? 2158 HOH B O   1 
HETATM 10814 O O   . HOH H 4 .   ? -23.046 -28.269 38.271  1.00 34.47 ? 2159 HOH B O   1 
HETATM 10815 O O   . HOH H 4 .   ? -2.245  -16.650 26.842  1.00 54.36 ? 2160 HOH B O   1 
HETATM 10816 O O   . HOH H 4 .   ? 16.093  5.307   33.218  1.00 44.41 ? 2161 HOH B O   1 
HETATM 10817 O O   . HOH H 4 .   ? -21.549 -26.868 28.419  1.00 38.79 ? 2162 HOH B O   1 
HETATM 10818 O O   . HOH H 4 .   ? -32.215 -18.788 44.038  1.00 35.98 ? 2163 HOH B O   1 
HETATM 10819 O O   . HOH H 4 .   ? -22.327 -7.715  71.905  1.00 46.97 ? 2164 HOH B O   1 
HETATM 10820 O O   . HOH H 4 .   ? -19.541 13.507  29.220  1.00 36.43 ? 2165 HOH B O   1 
HETATM 10821 O O   . HOH H 4 .   ? -33.875 -27.532 32.570  1.00 24.60 ? 2166 HOH B O   1 
HETATM 10822 O O   . HOH H 4 .   ? 9.520   -4.924  35.428  1.00 33.33 ? 2167 HOH B O   1 
HETATM 10823 O O   . HOH H 4 .   ? -35.276 -16.664 70.957  1.00 48.47 ? 2168 HOH B O   1 
HETATM 10824 O O   . HOH H 4 .   ? -32.754 -25.633 38.878  1.00 36.23 ? 2169 HOH B O   1 
HETATM 10825 O O   . HOH H 4 .   ? -25.539 -35.277 53.268  1.00 35.05 ? 2170 HOH B O   1 
HETATM 10826 O O   . HOH H 4 .   ? -13.805 16.005  52.875  1.00 28.58 ? 2171 HOH B O   1 
HETATM 10827 O O   . HOH H 4 .   ? -0.003  7.198   18.221  1.00 37.01 ? 2172 HOH B O   1 
HETATM 10828 O O   . HOH H 4 .   ? 20.487  -3.908  46.583  1.00 36.20 ? 2173 HOH B O   1 
HETATM 10829 O O   . HOH H 4 .   ? -12.276 -18.815 67.368  1.00 45.55 ? 2174 HOH B O   1 
HETATM 10830 O O   . HOH H 4 .   ? -23.765 -22.834 66.750  1.00 36.30 ? 2175 HOH B O   1 
HETATM 10831 O O   . HOH H 4 .   ? -26.004 -37.021 48.605  1.00 47.43 ? 2176 HOH B O   1 
HETATM 10832 O O   . HOH H 4 .   ? 6.389   13.809  24.073  1.00 36.59 ? 2177 HOH B O   1 
HETATM 10833 O O   . HOH H 4 .   ? 1.765   3.723   25.546  1.00 29.36 ? 2178 HOH B O   1 
HETATM 10834 O O   . HOH H 4 .   ? 0.429   4.315   18.635  1.00 37.85 ? 2179 HOH B O   1 
HETATM 10835 O O   . HOH H 4 .   ? -22.874 -15.180 70.023  1.00 43.80 ? 2180 HOH B O   1 
HETATM 10836 O O   . HOH H 4 .   ? -9.346  28.618  45.824  1.00 31.13 ? 2181 HOH B O   1 
HETATM 10837 O O   . HOH H 4 .   ? -33.353 -22.572 63.618  1.00 36.20 ? 2182 HOH B O   1 
HETATM 10838 O O   . HOH H 4 .   ? -25.687 -2.711  17.701  1.00 42.29 ? 2183 HOH B O   1 
HETATM 10839 O O   . HOH H 4 .   ? -0.386  22.742  50.963  1.00 39.73 ? 2184 HOH B O   1 
HETATM 10840 O O   . HOH H 4 .   ? -13.699 -26.248 38.602  1.00 45.26 ? 2185 HOH B O   1 
HETATM 10841 O O   . HOH H 4 .   ? 12.931  22.327  45.131  1.00 55.20 ? 2186 HOH B O   1 
HETATM 10842 O O   . HOH H 4 .   ? -26.225 21.815  41.186  1.00 45.17 ? 2187 HOH B O   1 
HETATM 10843 O O   . HOH H 4 .   ? 0.538   -1.132  18.473  1.00 52.60 ? 2188 HOH B O   1 
HETATM 10844 O O   . HOH H 4 .   ? -0.669  30.552  44.396  1.00 30.90 ? 2189 HOH B O   1 
HETATM 10845 O O   . HOH H 4 .   ? -25.705 -31.809 35.487  1.00 46.75 ? 2190 HOH B O   1 
HETATM 10846 O O   . HOH H 4 .   ? -11.512 23.282  22.156  1.00 73.28 ? 2191 HOH B O   1 
HETATM 10847 O O   . HOH H 4 .   ? -33.680 -28.074 57.725  1.00 52.70 ? 2192 HOH B O   1 
HETATM 10848 O O   . HOH H 4 .   ? -16.164 -29.907 35.897  1.00 34.80 ? 2193 HOH B O   1 
HETATM 10849 O O   . HOH H 4 .   ? -23.322 -24.929 28.360  1.00 30.76 ? 2194 HOH B O   1 
HETATM 10850 O O   . HOH H 4 .   ? 3.504   21.206  49.714  1.00 47.31 ? 2195 HOH B O   1 
HETATM 10851 O O   . HOH H 4 .   ? -39.683 -28.988 27.218  1.00 34.73 ? 2196 HOH B O   1 
HETATM 10852 O O   . HOH H 4 .   ? -14.875 -14.972 66.597  1.00 25.09 ? 2197 HOH B O   1 
HETATM 10853 O O   . HOH H 4 .   ? -28.916 -28.049 22.518  1.00 39.14 ? 2198 HOH B O   1 
HETATM 10854 O O   . HOH H 4 .   ? -11.769 -19.203 53.352  1.00 34.72 ? 2199 HOH B O   1 
HETATM 10855 O O   . HOH H 4 .   ? -3.201  9.346   16.629  1.00 35.61 ? 2200 HOH B O   1 
HETATM 10856 O O   . HOH H 4 .   ? -35.741 -7.359  43.774  1.00 38.18 ? 2201 HOH B O   1 
HETATM 10857 O O   . HOH H 4 .   ? -35.529 -18.613 62.622  1.00 52.83 ? 2202 HOH B O   1 
HETATM 10858 O O   . HOH H 4 .   ? 19.133  15.261  45.768  1.00 38.82 ? 2203 HOH B O   1 
HETATM 10859 O O   . HOH H 4 .   ? 1.988   0.793   27.126  1.00 36.48 ? 2204 HOH B O   1 
HETATM 10860 O O   . HOH H 4 .   ? -4.909  36.223  33.862  1.00 44.91 ? 2205 HOH B O   1 
HETATM 10861 O O   . HOH H 4 .   ? 7.969   22.434  24.777  1.00 39.79 ? 2206 HOH B O   1 
HETATM 10862 O O   . HOH H 4 .   ? -29.800 -30.718 38.772  1.00 50.90 ? 2207 HOH B O   1 
HETATM 10863 O O   . HOH H 4 .   ? -0.874  -9.551  28.555  1.00 50.91 ? 2208 HOH B O   1 
HETATM 10864 O O   . HOH H 4 .   ? -9.880  -13.019 47.879  1.00 36.73 ? 2209 HOH B O   1 
HETATM 10865 O O   . HOH H 4 .   ? 12.678  -9.764  39.777  1.00 36.49 ? 2210 HOH B O   1 
HETATM 10866 O O   . HOH H 4 .   ? -6.854  -13.210 20.827  1.00 40.76 ? 2211 HOH B O   1 
HETATM 10867 O O   . HOH H 4 .   ? -23.608 -13.081 15.660  1.00 38.80 ? 2212 HOH B O   1 
HETATM 10868 O O   . HOH H 4 .   ? -14.639 -20.871 56.141  1.00 29.87 ? 2213 HOH B O   1 
HETATM 10869 O O   . HOH H 4 .   ? -11.858 -15.075 70.958  1.00 50.72 ? 2214 HOH B O   1 
HETATM 10870 O O   . HOH H 4 .   ? -38.019 -4.356  20.970  1.00 45.22 ? 2215 HOH B O   1 
HETATM 10871 O O   . HOH H 4 .   ? -36.360 -30.942 28.531  1.00 41.76 ? 2216 HOH B O   1 
HETATM 10872 O O   . HOH H 4 .   ? -20.638 -27.522 41.638  1.00 34.90 ? 2217 HOH B O   1 
HETATM 10873 O O   . HOH H 4 .   ? 17.107  -1.537  52.498  1.00 34.55 ? 2218 HOH B O   1 
HETATM 10874 O O   . HOH H 4 .   ? 5.493   28.802  26.172  1.00 40.23 ? 2219 HOH B O   1 
HETATM 10875 O O   . HOH H 4 .   ? -34.939 0.732   28.001  1.00 42.41 ? 2220 HOH B O   1 
HETATM 10876 O O   . HOH H 4 .   ? -34.459 -7.944  19.610  1.00 32.31 ? 2221 HOH B O   1 
HETATM 10877 O O   . HOH H 4 .   ? -4.111  23.315  56.949  1.00 49.87 ? 2222 HOH B O   1 
HETATM 10878 O O   . HOH H 4 .   ? -31.185 13.415  50.071  1.00 48.04 ? 2223 HOH B O   1 
HETATM 10879 O O   . HOH H 4 .   ? -33.997 -22.143 60.873  1.00 45.02 ? 2224 HOH B O   1 
HETATM 10880 O O   . HOH H 4 .   ? 15.453  15.255  40.299  1.00 85.81 ? 2225 HOH B O   1 
HETATM 10881 O O   . HOH H 4 .   ? -10.166 25.193  48.604  1.00 42.91 ? 2226 HOH B O   1 
HETATM 10882 O O   . HOH H 4 .   ? 11.010  25.638  29.970  1.00 34.16 ? 2227 HOH B O   1 
HETATM 10883 O O   . HOH H 4 .   ? -13.184 -22.752 21.667  1.00 42.60 ? 2228 HOH B O   1 
HETATM 10884 O O   . HOH H 4 .   ? -20.403 2.726   43.490  1.00 55.33 ? 2229 HOH B O   1 
HETATM 10885 O O   . HOH H 4 .   ? 7.724   31.861  30.968  1.00 33.20 ? 2230 HOH B O   1 
HETATM 10886 O O   . HOH H 4 .   ? -0.360  -5.770  29.765  1.00 36.25 ? 2231 HOH B O   1 
HETATM 10887 O O   . HOH H 4 .   ? -5.210  -9.354  22.093  1.00 55.89 ? 2232 HOH B O   1 
HETATM 10888 O O   . HOH H 4 .   ? -32.413 -1.981  59.684  1.00 39.08 ? 2233 HOH B O   1 
HETATM 10889 O O   . HOH H 4 .   ? -7.935  18.291  24.286  1.00 31.19 ? 2234 HOH B O   1 
HETATM 10890 O O   . HOH H 4 .   ? 8.841   11.070  22.261  1.00 44.94 ? 2235 HOH B O   1 
HETATM 10891 O O   . HOH H 4 .   ? -31.513 16.672  55.894  1.00 44.07 ? 2236 HOH B O   1 
HETATM 10892 O O   . HOH H 4 .   ? -24.222 5.348   40.170  1.00 48.83 ? 2237 HOH B O   1 
HETATM 10893 O O   . HOH H 4 .   ? -41.593 -28.927 23.668  1.00 42.06 ? 2238 HOH B O   1 
HETATM 10894 O O   . HOH H 4 .   ? 0.740   29.117  25.380  1.00 42.67 ? 2239 HOH B O   1 
HETATM 10895 O O   . HOH H 4 .   ? 5.763   19.955  51.586  1.00 34.90 ? 2240 HOH B O   1 
HETATM 10896 O O   . HOH H 4 .   ? -25.715 -32.125 22.697  1.00 41.87 ? 2241 HOH B O   1 
HETATM 10897 O O   . HOH H 4 .   ? -6.811  9.687   18.843  1.00 45.92 ? 2242 HOH B O   1 
HETATM 10898 O O   . HOH H 4 .   ? -6.065  -11.980 48.809  1.00 39.63 ? 2243 HOH B O   1 
HETATM 10899 O O   . HOH H 4 .   ? -7.258  35.985  33.030  1.00 78.27 ? 2244 HOH B O   1 
HETATM 10900 O O   . HOH H 4 .   ? -32.600 0.734   59.235  1.00 42.90 ? 2245 HOH B O   1 
HETATM 10901 O O   . HOH H 4 .   ? -21.421 8.568   25.463  1.00 47.13 ? 2246 HOH B O   1 
HETATM 10902 O O   . HOH H 4 .   ? -13.147 5.855   21.492  1.00 38.90 ? 2247 HOH B O   1 
HETATM 10903 O O   . HOH H 4 .   ? -23.675 11.719  37.244  1.00 38.47 ? 2248 HOH B O   1 
HETATM 10904 O O   . HOH H 4 .   ? -17.479 19.268  31.538  1.00 35.53 ? 2249 HOH B O   1 
HETATM 10905 O O   . HOH H 4 .   ? -17.196 -13.562 74.920  1.00 62.64 ? 2250 HOH B O   1 
HETATM 10906 O O   . HOH H 4 .   ? 12.934  13.642  28.092  1.00 43.20 ? 2251 HOH B O   1 
HETATM 10907 O O   . HOH H 4 .   ? 7.872   3.805   20.329  1.00 39.35 ? 2252 HOH B O   1 
HETATM 10908 O O   . HOH H 4 .   ? -35.365 -1.214  23.051  1.00 60.06 ? 2253 HOH B O   1 
HETATM 10909 O O   . HOH H 4 .   ? -33.836 -24.082 51.578  1.00 49.54 ? 2254 HOH B O   1 
HETATM 10910 O O   . HOH H 4 .   ? -12.907 -1.795  63.543  1.00 44.02 ? 2255 HOH B O   1 
HETATM 10911 O O   . HOH H 4 .   ? 1.763   25.060  53.255  1.00 59.72 ? 2256 HOH B O   1 
HETATM 10912 O O   . HOH H 4 .   ? -6.601  28.715  28.559  1.00 43.69 ? 2257 HOH B O   1 
HETATM 10913 O O   . HOH H 4 .   ? 21.409  -1.503  46.135  1.00 44.03 ? 2258 HOH B O   1 
HETATM 10914 O O   . HOH H 4 .   ? -26.808 12.860  45.290  1.00 54.00 ? 2259 HOH B O   1 
HETATM 10915 O O   . HOH H 4 .   ? -13.717 21.981  50.232  1.00 41.81 ? 2260 HOH B O   1 
HETATM 10916 O O   . HOH H 4 .   ? -27.752 -23.799 22.076  1.00 49.82 ? 2261 HOH B O   1 
HETATM 10917 O O   . HOH H 4 .   ? 23.084  1.336   54.620  1.00 45.69 ? 2262 HOH B O   1 
HETATM 10918 O O   . HOH H 4 .   ? -17.588 -26.590 67.249  1.00 40.88 ? 2263 HOH B O   1 
HETATM 10919 O O   . HOH H 4 .   ? 11.795  14.328  25.158  1.00 53.43 ? 2264 HOH B O   1 
HETATM 10920 O O   . HOH H 4 .   ? -18.356 15.316  25.977  1.00 47.28 ? 2265 HOH B O   1 
HETATM 10921 O O   . HOH H 4 .   ? 20.620  11.148  53.965  1.00 39.19 ? 2266 HOH B O   1 
HETATM 10922 O O   . HOH H 4 .   ? 15.629  0.984   34.260  1.00 39.78 ? 2267 HOH B O   1 
HETATM 10923 O O   . HOH H 4 .   ? -15.578 -26.681 60.762  1.00 36.11 ? 2268 HOH B O   1 
HETATM 10924 O O   . HOH H 4 .   ? 8.376   -6.950  34.207  1.00 37.12 ? 2269 HOH B O   1 
HETATM 10925 O O   . HOH H 4 .   ? 11.116  26.001  47.730  1.00 38.55 ? 2270 HOH B O   1 
HETATM 10926 O O   . HOH H 4 .   ? -27.620 -27.772 41.576  1.00 34.77 ? 2271 HOH B O   1 
HETATM 10927 O O   . HOH H 4 .   ? -15.834 5.708   51.978  1.00 49.36 ? 2272 HOH B O   1 
HETATM 10928 O O   . HOH H 4 .   ? -9.153  7.625   50.892  1.00 64.14 ? 2273 HOH B O   1 
HETATM 10929 O O   . HOH H 4 .   ? -1.301  -13.878 42.646  1.00 41.77 ? 2274 HOH B O   1 
HETATM 10930 O O   . HOH H 4 .   ? -20.297 7.159   63.318  1.00 22.35 ? 2275 HOH B O   1 
HETATM 10931 O O   . HOH H 4 .   ? -33.145 -8.242  17.426  1.00 27.14 ? 2276 HOH B O   1 
HETATM 10932 O O   . HOH H 4 .   ? -18.433 -23.868 24.071  1.00 27.30 ? 2277 HOH B O   1 
HETATM 10933 O O   . HOH H 4 .   ? -12.875 -7.872  50.661  1.00 34.62 ? 2278 HOH B O   1 
HETATM 10934 O O   . HOH H 4 .   ? 4.931   12.541  57.655  1.00 36.76 ? 2279 HOH B O   1 
HETATM 10935 O O   . HOH H 4 .   ? -8.393  -5.579  47.184  1.00 46.60 ? 2280 HOH B O   1 
HETATM 10936 O O   . HOH H 4 .   ? -16.691 8.589   67.462  1.00 30.06 ? 2281 HOH B O   1 
HETATM 10937 O O   . HOH H 4 .   ? -13.964 -2.538  17.362  1.00 40.09 ? 2282 HOH B O   1 
HETATM 10938 O O   . HOH H 4 .   ? -20.540 -31.258 43.487  1.00 40.18 ? 2283 HOH B O   1 
HETATM 10939 O O   . HOH H 4 .   ? -7.009  -9.879  19.544  1.00 40.54 ? 2284 HOH B O   1 
HETATM 10940 O O   . HOH H 4 .   ? -3.751  11.575  15.484  1.00 39.15 ? 2285 HOH B O   1 
HETATM 10941 O O   . HOH H 4 .   ? -38.134 -7.576  42.713  1.00 68.52 ? 2286 HOH B O   1 
HETATM 10942 O O   . HOH H 4 .   ? -0.722  21.099  19.866  1.00 43.26 ? 2287 HOH B O   1 
HETATM 10943 O O   . HOH H 4 .   ? -33.144 -27.230 36.821  1.00 35.70 ? 2288 HOH B O   1 
HETATM 10944 O O   . HOH H 4 .   ? 5.538   25.325  43.917  1.00 36.73 ? 2289 HOH B O   1 
HETATM 10945 O O   . HOH H 4 .   ? 15.246  20.990  44.282  1.00 53.66 ? 2290 HOH B O   1 
HETATM 10946 O O   . HOH H 4 .   ? -22.019 -16.225 72.188  1.00 64.05 ? 2291 HOH B O   1 
HETATM 10947 O O   . HOH H 4 .   ? 9.749   27.833  29.720  1.00 50.40 ? 2292 HOH B O   1 
HETATM 10948 O O   . HOH H 4 .   ? -25.301 0.709   32.321  1.00 44.33 ? 2293 HOH B O   1 
HETATM 10949 O O   . HOH H 4 .   ? -12.298 10.134  21.573  1.00 33.87 ? 2294 HOH B O   1 
HETATM 10950 O O   . HOH H 4 .   ? -23.678 -32.829 20.988  1.00 36.50 ? 2295 HOH B O   1 
HETATM 10951 O O   . HOH H 4 .   ? -37.228 -12.526 60.221  1.00 39.10 ? 2296 HOH B O   1 
HETATM 10952 O O   . HOH H 4 .   ? 14.379  -8.326  38.495  1.00 46.05 ? 2297 HOH B O   1 
HETATM 10953 O O   . HOH H 4 .   ? -12.158 -15.470 66.575  1.00 38.73 ? 2298 HOH B O   1 
HETATM 10954 O O   . HOH H 4 .   ? -25.477 2.825   17.504  1.00 35.04 ? 2299 HOH B O   1 
HETATM 10955 O O   . HOH H 4 .   ? -22.598 -10.960 13.973  1.00 35.79 ? 2300 HOH B O   1 
HETATM 10956 O O   . HOH H 4 .   ? 16.705  15.994  34.471  1.00 30.62 ? 2301 HOH B O   1 
HETATM 10957 O O   . HOH H 4 .   ? 3.183   -12.947 41.772  1.00 32.41 ? 2302 HOH B O   1 
HETATM 10958 O O   . HOH H 4 .   ? -21.848 9.856   36.082  1.00 48.22 ? 2303 HOH B O   1 
HETATM 10959 O O   . HOH H 4 .   ? -34.899 -26.531 34.855  1.00 34.87 ? 2304 HOH B O   1 
HETATM 10960 O O   . HOH H 4 .   ? 5.636   29.469  44.334  1.00 34.21 ? 2305 HOH B O   1 
HETATM 10961 O O   . HOH H 4 .   ? 22.017  12.357  39.804  1.00 51.02 ? 2306 HOH B O   1 
HETATM 10962 O O   . HOH H 4 .   ? -15.283 -1.413  65.034  1.00 31.77 ? 2307 HOH B O   1 
HETATM 10963 O O   . HOH H 4 .   ? 0.161   -7.153  63.493  1.00 51.03 ? 2308 HOH B O   1 
HETATM 10964 O O   . HOH H 4 .   ? -38.952 -17.498 31.769  1.00 32.94 ? 2309 HOH B O   1 
HETATM 10965 O O   . HOH H 4 .   ? -24.829 -29.372 39.792  1.00 48.95 ? 2310 HOH B O   1 
HETATM 10966 O O   . HOH H 4 .   ? -36.779 -16.421 66.422  1.00 41.63 ? 2311 HOH B O   1 
HETATM 10967 O O   . HOH H 4 .   ? 9.001   -5.479  56.802  1.00 43.21 ? 2312 HOH B O   1 
HETATM 10968 O O   . HOH H 4 .   ? -21.988 8.152   40.178  1.00 52.17 ? 2313 HOH B O   1 
HETATM 10969 O O   . HOH H 4 .   ? -1.015  -19.192 26.354  1.00 41.86 ? 2314 HOH B O   1 
HETATM 10970 O O   . HOH H 4 .   ? -10.408 10.565  55.937  1.00 42.68 ? 2315 HOH B O   1 
HETATM 10971 O O   . HOH H 4 .   ? -0.580  -22.853 40.441  1.00 40.64 ? 2316 HOH B O   1 
HETATM 10972 O O   . HOH H 4 .   ? 7.035   11.511  26.219  1.00 47.71 ? 2317 HOH B O   1 
HETATM 10973 O O   . HOH H 4 .   ? 13.165  24.947  45.332  1.00 39.32 ? 2318 HOH B O   1 
HETATM 10974 O O   . HOH H 4 .   ? -38.805 -11.139 43.325  1.00 37.51 ? 2319 HOH B O   1 
HETATM 10975 O O   . HOH H 4 .   ? -5.794  33.837  35.500  1.00 44.03 ? 2320 HOH B O   1 
HETATM 10976 O O   . HOH H 4 .   ? -19.246 -28.178 43.919  1.00 36.88 ? 2321 HOH B O   1 
HETATM 10977 O O   . HOH H 4 .   ? -30.691 -1.587  61.989  1.00 44.17 ? 2322 HOH B O   1 
HETATM 10978 O O   . HOH H 4 .   ? -19.150 0.329   53.584  1.00 41.59 ? 2323 HOH B O   1 
HETATM 10979 O O   . HOH H 4 .   ? 1.603   29.701  43.270  1.00 43.64 ? 2324 HOH B O   1 
HETATM 10980 O O   . HOH H 4 .   ? -37.324 -1.921  25.231  1.00 41.74 ? 2325 HOH B O   1 
HETATM 10981 O O   . HOH H 4 .   ? 17.699  15.301  43.524  1.00 51.34 ? 2326 HOH B O   1 
HETATM 10982 O O   . HOH H 4 .   ? -28.228 -34.742 54.464  1.00 43.43 ? 2327 HOH B O   1 
HETATM 10983 O O   . HOH H 4 .   ? -18.305 -32.732 52.195  1.00 39.93 ? 2328 HOH B O   1 
HETATM 10984 O O   . HOH H 4 .   ? -39.497 -7.520  22.609  1.00 45.20 ? 2329 HOH B O   1 
HETATM 10985 O O   . HOH H 4 .   ? -2.784  -26.508 39.118  1.00 40.53 ? 2330 HOH B O   1 
HETATM 10986 O O   . HOH H 4 .   ? -33.052 -15.386 65.094  1.00 44.87 ? 2331 HOH B O   1 
HETATM 10987 O O   . HOH H 4 .   ? 11.521  30.065  33.906  1.00 39.93 ? 2332 HOH B O   1 
HETATM 10988 O O   . HOH H 4 .   ? -26.190 -32.549 25.153  1.00 41.35 ? 2333 HOH B O   1 
HETATM 10989 O O   . HOH H 4 .   ? -27.294 -13.489 15.588  1.00 47.87 ? 2334 HOH B O   1 
HETATM 10990 O O   . HOH H 4 .   ? -6.747  -3.402  40.667  1.00 31.03 ? 2335 HOH B O   1 
HETATM 10991 O O   . HOH H 4 .   ? 23.143  13.206  34.084  1.00 40.62 ? 2336 HOH B O   1 
HETATM 10992 O O   . HOH H 4 .   ? 16.589  6.481   36.483  1.00 32.39 ? 2337 HOH B O   1 
HETATM 10993 O O   . HOH H 4 .   ? -28.472 -30.972 33.130  1.00 50.37 ? 2338 HOH B O   1 
HETATM 10994 O O   . HOH H 4 .   ? -38.349 -11.244 30.366  1.00 44.60 ? 2339 HOH B O   1 
HETATM 10995 O O   . HOH H 4 .   ? -26.152 -34.860 50.675  1.00 44.73 ? 2340 HOH B O   1 
HETATM 10996 O O   . HOH H 4 .   ? -36.873 -6.064  19.172  1.00 39.43 ? 2341 HOH B O   1 
HETATM 10997 O O   . HOH H 4 .   ? -35.688 0.329   25.307  1.00 40.35 ? 2342 HOH B O   1 
HETATM 10998 O O   . HOH H 4 .   ? -17.425 -21.811 67.483  1.00 47.68 ? 2343 HOH B O   1 
HETATM 10999 O O   . HOH H 4 .   ? 11.296  26.437  42.294  1.00 41.75 ? 2344 HOH B O   1 
HETATM 11000 O O   . HOH H 4 .   ? -23.402 -15.545 15.211  1.00 47.51 ? 2345 HOH B O   1 
HETATM 11001 O O   . HOH H 4 .   ? 6.182   -15.750 42.741  1.00 42.25 ? 2346 HOH B O   1 
HETATM 11002 O O   . HOH H 4 .   ? -11.038 0.116   63.223  1.00 41.50 ? 2347 HOH B O   1 
HETATM 11003 O O   . HOH H 4 .   ? -10.455 -21.591 53.792  1.00 42.13 ? 2348 HOH B O   1 
HETATM 11004 O O   . HOH H 4 .   ? 10.086  -2.293  18.741  1.00 43.48 ? 2349 HOH B O   1 
HETATM 11005 O O   . HOH H 4 .   ? 12.701  -6.769  58.889  1.00 53.73 ? 2350 HOH B O   1 
HETATM 11006 O O   . HOH H 4 .   ? -19.797 -29.900 40.038  1.00 44.56 ? 2351 HOH B O   1 
HETATM 11007 O O   . HOH H 4 .   ? -4.116  29.750  23.636  1.00 71.60 ? 2352 HOH B O   1 
HETATM 11008 O O   . HOH H 4 .   ? -7.372  -10.701 52.040  1.00 32.43 ? 2353 HOH B O   1 
HETATM 11009 O O   . HOH H 4 .   ? -11.968 26.910  40.909  1.00 34.93 ? 2354 HOH B O   1 
HETATM 11010 O O   . HOH H 4 .   ? 0.710   14.090  54.547  1.00 33.53 ? 2355 HOH B O   1 
HETATM 11011 O O   . HOH H 4 .   ? -35.035 -20.349 64.426  1.00 47.31 ? 2356 HOH B O   1 
HETATM 11012 O O   . HOH H 4 .   ? -5.229  -4.799  61.674  1.00 47.29 ? 2357 HOH B O   1 
HETATM 11013 O O   . HOH H 4 .   ? -10.823 -9.776  59.286  1.00 54.68 ? 2358 HOH B O   1 
HETATM 11014 O O   . HOH H 4 .   ? -20.995 14.939  37.663  1.00 60.52 ? 2359 HOH B O   1 
HETATM 11015 O O   . HOH H 4 .   ? -18.891 8.304   23.832  1.00 44.26 ? 2360 HOH B O   1 
HETATM 11016 O O   . HOH H 4 .   ? -11.437 6.728   53.779  1.00 52.18 ? 2361 HOH B O   1 
HETATM 11017 O O   . HOH H 4 .   ? -15.617 -23.857 64.618  1.00 47.68 ? 2362 HOH B O   1 
HETATM 11018 O O   . HOH H 4 .   ? -25.533 -20.348 18.313  1.00 41.39 ? 2363 HOH B O   1 
HETATM 11019 O O   . HOH H 4 .   ? -11.247 -5.442  18.421  1.00 38.63 ? 2364 HOH B O   1 
HETATM 11020 O O   . HOH H 4 .   ? -8.066  -24.493 31.855  1.00 48.24 ? 2365 HOH B O   1 
HETATM 11021 O O   . HOH H 4 .   ? -27.723 -31.766 37.236  1.00 52.78 ? 2366 HOH B O   1 
HETATM 11022 O O   . HOH H 4 .   ? -22.113 -12.367 73.798  1.00 48.57 ? 2367 HOH B O   1 
HETATM 11023 O O   . HOH H 4 .   ? -10.001 -10.656 54.596  1.00 38.45 ? 2368 HOH B O   1 
HETATM 11024 O O   . HOH H 4 .   ? -16.587 25.876  33.222  1.00 43.88 ? 2369 HOH B O   1 
HETATM 11025 O O   . HOH H 4 .   ? 5.430   32.828  29.309  1.00 49.20 ? 2370 HOH B O   1 
HETATM 11026 O O   . HOH H 4 .   ? -37.853 -21.433 33.176  1.00 42.13 ? 2371 HOH B O   1 
HETATM 11027 O O   . HOH H 4 .   ? -9.884  -17.651 54.882  1.00 40.92 ? 2372 HOH B O   1 
HETATM 11028 O O   . HOH H 4 .   ? 16.195  -3.440  59.876  1.00 44.08 ? 2373 HOH B O   1 
HETATM 11029 O O   . HOH H 4 .   ? 8.882   13.005  23.994  1.00 46.66 ? 2374 HOH B O   1 
HETATM 11030 O O   . HOH H 4 .   ? 0.976   -2.569  11.093  1.00 37.58 ? 2375 HOH B O   1 
HETATM 11031 O O   . HOH H 4 .   ? -32.621 -16.235 45.787  1.00 45.18 ? 2376 HOH B O   1 
HETATM 11032 O O   . HOH H 4 .   ? -11.538 -11.018 48.427  1.00 58.95 ? 2377 HOH B O   1 
HETATM 11033 O O   . HOH H 4 .   ? -9.727  25.720  46.111  1.00 50.68 ? 2378 HOH B O   1 
HETATM 11034 O O   . HOH H 4 .   ? -34.723 -24.097 38.110  1.00 46.54 ? 2379 HOH B O   1 
HETATM 11035 O O   . HOH H 4 .   ? 22.211  14.577  51.517  1.00 43.49 ? 2380 HOH B O   1 
HETATM 11036 O O   . HOH H 4 .   ? -32.543 -23.091 49.501  1.00 61.95 ? 2381 HOH B O   1 
HETATM 11037 O O   . HOH H 4 .   ? 8.666   -14.209 37.920  1.00 40.37 ? 2382 HOH B O   1 
HETATM 11038 O O   . HOH H 4 .   ? -22.037 12.277  35.195  1.00 53.43 ? 2383 HOH B O   1 
HETATM 11039 O O   . HOH H 4 .   ? -35.847 -5.847  59.820  1.00 46.40 ? 2384 HOH B O   1 
HETATM 11040 O O   . HOH H 4 .   ? -18.224 -31.359 36.616  1.00 50.10 ? 2385 HOH B O   1 
HETATM 11041 O O   . HOH H 4 .   ? 19.179  6.941   37.177  1.00 48.16 ? 2386 HOH B O   1 
HETATM 11042 O O   . HOH H 4 .   ? -30.153 3.672   37.211  1.00 49.59 ? 2387 HOH B O   1 
HETATM 11043 O O   . HOH H 4 .   ? 1.740   5.575   59.748  1.00 43.62 ? 2388 HOH B O   1 
HETATM 11044 O O   . HOH H 4 .   ? -22.954 -26.895 43.093  1.00 68.41 ? 2389 HOH B O   1 
HETATM 11045 O O   . HOH H 4 .   ? 13.026  9.606   28.874  1.00 42.98 ? 2390 HOH B O   1 
HETATM 11046 O O   . HOH H 4 .   ? -14.019 17.296  56.842  1.00 47.18 ? 2391 HOH B O   1 
HETATM 11047 O O   . HOH H 4 .   ? 4.457   -3.968  30.551  1.00 49.12 ? 2392 HOH B O   1 
HETATM 11048 O O   . HOH H 4 .   ? -30.187 -31.727 51.696  1.00 37.14 ? 2393 HOH B O   1 
HETATM 11049 O O   . HOH H 4 .   ? -5.997  -14.394 47.577  1.00 42.72 ? 2394 HOH B O   1 
HETATM 11050 O O   . HOH H 4 .   ? 2.542   -11.081 44.098  1.00 46.14 ? 2395 HOH B O   1 
HETATM 11051 O O   . HOH H 4 .   ? -23.466 4.762   24.557  1.00 52.93 ? 2396 HOH B O   1 
HETATM 11052 O O   . HOH H 4 .   ? 15.233  11.140  28.478  1.00 52.22 ? 2397 HOH B O   1 
HETATM 11053 O O   . HOH H 4 .   ? -1.107  2.273   17.703  1.00 41.20 ? 2398 HOH B O   1 
HETATM 11054 O O   . HOH H 4 .   ? -39.150 7.604   46.342  1.00 48.43 ? 2399 HOH B O   1 
HETATM 11055 O O   . HOH H 4 .   ? -9.387  -8.612  50.914  1.00 26.66 ? 2400 HOH B O   1 
HETATM 11056 O O   . HOH H 4 .   ? -17.995 0.100   68.277  1.00 28.27 ? 2401 HOH B O   1 
HETATM 11057 O O   . HOH H 4 .   ? 15.006  26.684  45.865  1.00 31.89 ? 2402 HOH B O   1 
HETATM 11058 O O   . HOH H 4 .   ? -13.560 -7.753  53.519  1.00 28.29 ? 2403 HOH B O   1 
HETATM 11059 O O   . HOH H 4 .   ? -39.088 -15.127 33.112  1.00 34.55 ? 2404 HOH B O   1 
HETATM 11060 O O   . HOH H 4 .   ? -20.831 17.168  35.723  1.00 39.44 ? 2405 HOH B O   1 
HETATM 11061 O O   . HOH H 4 .   ? 11.075  18.824  48.920  1.00 32.90 ? 2406 HOH B O   1 
HETATM 11062 O O   . HOH H 4 .   ? -21.249 -13.291 14.854  1.00 66.77 ? 2407 HOH B O   1 
HETATM 11063 O O   . HOH H 4 .   ? -23.969 4.384   19.146  1.00 34.52 ? 2408 HOH B O   1 
HETATM 11064 O O   . HOH H 4 .   ? 1.071   7.952   59.616  1.00 37.52 ? 2409 HOH B O   1 
HETATM 11065 O O   . HOH H 4 .   ? -36.389 -12.704 57.764  1.00 39.59 ? 2410 HOH B O   1 
HETATM 11066 O O   . HOH H 4 .   ? -20.686 -16.195 16.577  1.00 34.91 ? 2411 HOH B O   1 
HETATM 11067 O O   . HOH H 4 .   ? -40.396 -13.399 30.735  1.00 37.72 ? 2412 HOH B O   1 
HETATM 11068 O O   . HOH H 4 .   ? 9.717   11.536  26.918  1.00 52.84 ? 2413 HOH B O   1 
HETATM 11069 O O   . HOH H 4 .   ? -35.347 -22.756 16.379  1.00 70.86 ? 2414 HOH B O   1 
HETATM 11070 O O   . HOH H 4 .   ? -17.140 11.112  65.890  1.00 39.26 ? 2415 HOH B O   1 
HETATM 11071 O O   . HOH H 4 .   ? -6.624  36.448  38.331  1.00 48.33 ? 2416 HOH B O   1 
HETATM 11072 O O   . HOH H 4 .   ? -0.011  -15.533 41.416  1.00 63.61 ? 2417 HOH B O   1 
HETATM 11073 O O   . HOH H 4 .   ? -9.541  0.789   61.257  1.00 35.75 ? 2418 HOH B O   1 
HETATM 11074 O O   . HOH H 4 .   ? -35.115 -15.728 46.279  1.00 37.76 ? 2419 HOH B O   1 
HETATM 11075 O O   . HOH H 4 .   ? -19.799 -31.870 54.303  1.00 43.75 ? 2420 HOH B O   1 
HETATM 11076 O O   . HOH H 4 .   ? -9.299  -6.451  16.184  1.00 52.05 ? 2421 HOH B O   1 
HETATM 11077 O O   . HOH H 4 .   ? -42.221 -15.798 17.289  1.00 61.05 ? 2422 HOH B O   1 
HETATM 11078 O O   . HOH H 4 .   ? 8.744   -15.363 42.670  1.00 40.37 ? 2423 HOH B O   1 
HETATM 11079 O O   . HOH H 4 .   ? -21.585 -16.358 74.692  1.00 41.91 ? 2424 HOH B O   1 
HETATM 11080 O O   . HOH H 4 .   ? 14.754  0.429   59.036  1.00 49.58 ? 2425 HOH B O   1 
HETATM 11081 O O   . HOH H 4 .   ? -2.467  28.579  22.222  1.00 39.88 ? 2426 HOH B O   1 
HETATM 11082 O O   . HOH H 4 .   ? 6.301   6.043   20.007  1.00 51.39 ? 2427 HOH B O   1 
HETATM 11083 O O   . HOH H 4 .   ? -21.962 -22.088 20.474  1.00 36.61 ? 2428 HOH B O   1 
HETATM 11084 O O   . HOH H 4 .   ? -16.126 -25.193 24.484  1.00 51.94 ? 2429 HOH B O   1 
HETATM 11085 O O   . HOH H 4 .   ? 14.942  -5.487  38.963  1.00 43.29 ? 2430 HOH B O   1 
HETATM 11086 O O   . HOH H 4 .   ? 13.092  -4.690  36.296  1.00 39.83 ? 2431 HOH B O   1 
HETATM 11087 O O   . HOH H 4 .   ? -29.608 -21.699 76.033  1.00 68.66 ? 2432 HOH B O   1 
HETATM 11088 O O   . HOH H 4 .   ? -5.632  -11.354 55.593  1.00 60.97 ? 2433 HOH B O   1 
HETATM 11089 O O   . HOH H 4 .   ? -23.188 -30.321 22.2