data_2H6C
# 
_entry.id   2H6C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2H6C         
RCSB  RCSB037984   
WWPDB D_1000037984 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2H6B 
_pdbx_database_related.details        'Crystal structure of the oxidized CprK in complex with o-chlorophenolacetic acid' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2H6C 
_pdbx_database_status.recvd_initial_deposition_date   2006-05-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Levy, C.' 1 
'Leys, D.' 2 
# 
_citation.id                        primary 
_citation.title                     'CprK Crystal Structures Reveal Mechanism for Transcriptional Control of Halorespiration.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                28318 
_citation.page_last                 28325 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16803881 
_citation.pdbx_database_id_DOI      10.1074/jbc.M602654200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Joyce, M.G.'          1  
primary 'Levy, C.'             2  
primary 'Pop, S.M.'            3  
primary 'Biehl, B.D.'          4  
primary 'Doukov, T.I.'         5  
primary 'Ryter, J.M.'          6  
primary 'Mazon, H.'            7  
primary 'Smidt, H.'            8  
primary 'van den Heuvel, R.H.' 9  
primary 'Ragsdale, S.W.'       10 
primary 'van der Oost, J.'     11 
primary 'Leys, D.'             12 
# 
_cell.entry_id           2H6C 
_cell.length_a           72.637 
_cell.length_b           50.030 
_cell.length_c           76.415 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.54 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2H6C 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'ChloroPhenol Reduction gene K' 
_entity.formula_weight             26677.727 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CprK 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSAEGLDKDFCGAIIPDSFFPIEKLRNYTDMGIIREFAKGSAIIMPGEDTTSMIFLMDGKIKLDIIFEDGSEKLLYYAGS
NSLIGRLYPTGNNIYATAMEQTRTCWFSEECLRVIFRTDEDMIFEIFKNYLTKVAYYARQVAEINTYNPTIRILRLFYEL
CSSQGKRVGDTYEITMPLSQKSIGEITGAHHVTVSKVLACLKKENILDKKKNKFIVYNLEELKHLSEQTSYY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSAEGLDKDFCGAIIPDSFFPIEKLRNYTDMGIIREFAKGSAIIMPGEDTTSMIFLMDGKIKLDIIFEDGSEKLLYYAGS
NSLIGRLYPTGNNIYATAMEQTRTCWFSEECLRVIFRTDEDMIFEIFKNYLTKVAYYARQVAEINTYNPTIRILRLFYEL
CSSQGKRVGDTYEITMPLSQKSIGEITGAHHVTVSKVLACLKKENILDKKKNKFIVYNLEELKHLSEQTSYY
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ALA n 
1 4   GLU n 
1 5   GLY n 
1 6   LEU n 
1 7   ASP n 
1 8   LYS n 
1 9   ASP n 
1 10  PHE n 
1 11  CYS n 
1 12  GLY n 
1 13  ALA n 
1 14  ILE n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  SER n 
1 19  PHE n 
1 20  PHE n 
1 21  PRO n 
1 22  ILE n 
1 23  GLU n 
1 24  LYS n 
1 25  LEU n 
1 26  ARG n 
1 27  ASN n 
1 28  TYR n 
1 29  THR n 
1 30  ASP n 
1 31  MET n 
1 32  GLY n 
1 33  ILE n 
1 34  ILE n 
1 35  ARG n 
1 36  GLU n 
1 37  PHE n 
1 38  ALA n 
1 39  LYS n 
1 40  GLY n 
1 41  SER n 
1 42  ALA n 
1 43  ILE n 
1 44  ILE n 
1 45  MET n 
1 46  PRO n 
1 47  GLY n 
1 48  GLU n 
1 49  ASP n 
1 50  THR n 
1 51  THR n 
1 52  SER n 
1 53  MET n 
1 54  ILE n 
1 55  PHE n 
1 56  LEU n 
1 57  MET n 
1 58  ASP n 
1 59  GLY n 
1 60  LYS n 
1 61  ILE n 
1 62  LYS n 
1 63  LEU n 
1 64  ASP n 
1 65  ILE n 
1 66  ILE n 
1 67  PHE n 
1 68  GLU n 
1 69  ASP n 
1 70  GLY n 
1 71  SER n 
1 72  GLU n 
1 73  LYS n 
1 74  LEU n 
1 75  LEU n 
1 76  TYR n 
1 77  TYR n 
1 78  ALA n 
1 79  GLY n 
1 80  SER n 
1 81  ASN n 
1 82  SER n 
1 83  LEU n 
1 84  ILE n 
1 85  GLY n 
1 86  ARG n 
1 87  LEU n 
1 88  TYR n 
1 89  PRO n 
1 90  THR n 
1 91  GLY n 
1 92  ASN n 
1 93  ASN n 
1 94  ILE n 
1 95  TYR n 
1 96  ALA n 
1 97  THR n 
1 98  ALA n 
1 99  MET n 
1 100 GLU n 
1 101 GLN n 
1 102 THR n 
1 103 ARG n 
1 104 THR n 
1 105 CYS n 
1 106 TRP n 
1 107 PHE n 
1 108 SER n 
1 109 GLU n 
1 110 GLU n 
1 111 CYS n 
1 112 LEU n 
1 113 ARG n 
1 114 VAL n 
1 115 ILE n 
1 116 PHE n 
1 117 ARG n 
1 118 THR n 
1 119 ASP n 
1 120 GLU n 
1 121 ASP n 
1 122 MET n 
1 123 ILE n 
1 124 PHE n 
1 125 GLU n 
1 126 ILE n 
1 127 PHE n 
1 128 LYS n 
1 129 ASN n 
1 130 TYR n 
1 131 LEU n 
1 132 THR n 
1 133 LYS n 
1 134 VAL n 
1 135 ALA n 
1 136 TYR n 
1 137 TYR n 
1 138 ALA n 
1 139 ARG n 
1 140 GLN n 
1 141 VAL n 
1 142 ALA n 
1 143 GLU n 
1 144 ILE n 
1 145 ASN n 
1 146 THR n 
1 147 TYR n 
1 148 ASN n 
1 149 PRO n 
1 150 THR n 
1 151 ILE n 
1 152 ARG n 
1 153 ILE n 
1 154 LEU n 
1 155 ARG n 
1 156 LEU n 
1 157 PHE n 
1 158 TYR n 
1 159 GLU n 
1 160 LEU n 
1 161 CYS n 
1 162 SER n 
1 163 SER n 
1 164 GLN n 
1 165 GLY n 
1 166 LYS n 
1 167 ARG n 
1 168 VAL n 
1 169 GLY n 
1 170 ASP n 
1 171 THR n 
1 172 TYR n 
1 173 GLU n 
1 174 ILE n 
1 175 THR n 
1 176 MET n 
1 177 PRO n 
1 178 LEU n 
1 179 SER n 
1 180 GLN n 
1 181 LYS n 
1 182 SER n 
1 183 ILE n 
1 184 GLY n 
1 185 GLU n 
1 186 ILE n 
1 187 THR n 
1 188 GLY n 
1 189 ALA n 
1 190 HIS n 
1 191 HIS n 
1 192 VAL n 
1 193 THR n 
1 194 VAL n 
1 195 SER n 
1 196 LYS n 
1 197 VAL n 
1 198 LEU n 
1 199 ALA n 
1 200 CYS n 
1 201 LEU n 
1 202 LYS n 
1 203 LYS n 
1 204 GLU n 
1 205 ASN n 
1 206 ILE n 
1 207 LEU n 
1 208 ASP n 
1 209 LYS n 
1 210 LYS n 
1 211 LYS n 
1 212 ASN n 
1 213 LYS n 
1 214 PHE n 
1 215 ILE n 
1 216 VAL n 
1 217 TYR n 
1 218 ASN n 
1 219 LEU n 
1 220 GLU n 
1 221 GLU n 
1 222 LEU n 
1 223 LYS n 
1 224 HIS n 
1 225 LEU n 
1 226 SER n 
1 227 GLU n 
1 228 GLN n 
1 229 THR n 
1 230 SER n 
1 231 TYR n 
1 232 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Desulfitobacterium 
_entity_src_gen.pdbx_gene_src_gene                 cprK 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Desulfitobacterium dehalogenans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     36854 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9LAS2_9FIRM 
_struct_ref.pdbx_db_accession          Q9LAS2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2H6C A 1 ? 232 ? Q9LAS2 1 ? 232 ? 1 232 
2 1 2H6C B 1 ? 232 ? Q9LAS2 1 ? 232 ? 1 232 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2H6C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.density_percent_sol   50.93 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '8% PEG 3350, 115mM MgCl2, 10mM DTT, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
# 
_reflns.entry_id                     2H6C 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.9 
_reflns.d_resolution_low             30 
_reflns.number_all                   ? 
_reflns.number_obs                   16387 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.056 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.9 
_reflns_shell.d_res_low              2.97 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.257 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2H6C 
_refine.ls_number_reflns_obs                     11256 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.63 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    98.82 
_refine.ls_R_factor_obs                          0.2354 
_refine.ls_R_factor_all                          0.2354 
_refine.ls_R_factor_R_work                       0.23181 
_refine.ls_R_factor_R_free                       0.30723 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  582 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.933 
_refine.correlation_coeff_Fo_to_Fc_free          0.888 
_refine.B_iso_mean                               75.205 
_refine.aniso_B[1][1]                            -0.62 
_refine.aniso_B[2][2]                            -0.26 
_refine.aniso_B[3][3]                            0.75 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.24 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'pdb entry 2H6B' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.493 
_refine.overall_SU_ML                            0.275 
_refine.overall_SU_B                             30.826 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3281 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3281 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        29.63 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.019  0.022  ? 3365 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002  0.020  ? 3098 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2.075  1.964  ? 4546 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.963  3.000  ? 7172 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   10.955 5.000  ? 417  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   38.373 23.724 ? 145  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   24.274 15.000 ? 592  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   22.611 15.000 ? 19   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.107  0.200  ? 520  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006  0.020  ? 3710 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.002  0.020  ? 707  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.264  0.200  ? 911  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.226  0.200  ? 3389 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.216  0.200  ? 1686 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.108  0.200  ? 2140 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.224  0.200  ? 99   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      0.067  0.200  ? 2    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.239  0.200  ? 11   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.249  0.200  ? 41   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.126  0.200  ? 2    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.547  1.500  ? 2160 'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.098  1.500  ? 861  'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.927  2.000  ? 3348 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.477  3.000  ? 1406 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.299  4.500  ? 1198 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 331 0.13 5.00  'loose positional' 1 'X-RAY DIFFRACTION' 1  ? ? ? 
1 A 517 0.15 5.00  'loose positional' 2 'X-RAY DIFFRACTION' 2  ? ? ? 
1 A 215 0.15 5.00  'loose positional' 3 'X-RAY DIFFRACTION' 3  ? ? ? 
1 A 387 0.54 5.00  'loose positional' 4 'X-RAY DIFFRACTION' 4  ? ? ? 
1 A 884 0.21 5.00  'loose positional' 5 'X-RAY DIFFRACTION' 5  ? ? ? 
1 A 331 0.91 10.00 'loose thermal'    1 'X-RAY DIFFRACTION' 6  ? ? ? 
1 A 517 1.17 10.00 'loose thermal'    2 'X-RAY DIFFRACTION' 7  ? ? ? 
1 A 215 0.91 10.00 'loose thermal'    3 'X-RAY DIFFRACTION' 8  ? ? ? 
1 A 387 1.14 10.00 'loose thermal'    4 'X-RAY DIFFRACTION' 9  ? ? ? 
1 A 884 0.97 10.00 'loose thermal'    5 'X-RAY DIFFRACTION' 10 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.900 
_refine_ls_shell.d_res_low                        2.975 
_refine_ls_shell.number_reflns_R_work             832 
_refine_ls_shell.R_factor_R_work                  0.337 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.437 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             39 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
2 1 A 
2 2 B 
3 1 A 
3 2 B 
4 1 A 
4 2 B 
5 1 A 
5 2 B 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 20  A 40  1 6 A PHE 20  ? A GLY 40  ? 1 ? 
2 B 20  B 40  1 6 B PHE 20  ? B GLY 40  ? 1 ? 
1 A 50  A 84  1 6 A THR 50  ? A ILE 84  ? 2 ? 
2 B 50  B 84  1 6 B THR 50  ? B ILE 84  ? 2 ? 
1 A 93  A 106 1 6 A ASN 93  ? A TRP 106 ? 3 ? 
2 B 93  B 106 1 6 B ASN 93  ? B TRP 106 ? 3 ? 
1 A 112 A 135 1 6 A LEU 112 ? A ALA 135 ? 4 ? 
2 B 112 B 135 1 6 B LEU 112 ? B ALA 135 ? 4 ? 
1 A 153 A 215 1 6 A ILE 153 ? A ILE 215 ? 5 ? 
2 B 153 B 215 1 6 B ILE 153 ? B ILE 215 ? 5 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
5 ? 
# 
_struct.entry_id                  2H6C 
_struct.title                     'Crystal structure of reduced CprK in absence of any ligand' 
_struct.pdbx_descriptor           'ChloroPhenol Reduction gene K' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2H6C 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'DNA binding, helix-turn-helix, chlorophenol, halorespiration, CprK, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               ? 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE A 22  ? ASN A 27  ? ILE A 22  ASN A 27  1 ? 6  
HELX_P HELX_P2  2  TYR A 28  ? GLY A 32  ? TYR A 28  GLY A 32  5 ? 5  
HELX_P HELX_P3  3  SER A 108 ? ASP A 119 ? SER A 108 ASP A 119 1 ? 12 
HELX_P HELX_P4  4  GLU A 120 ? GLU A 143 ? GLU A 120 GLU A 143 1 ? 24 
HELX_P HELX_P5  5  TYR A 147 ? GLY A 165 ? TYR A 147 GLY A 165 1 ? 19 
HELX_P HELX_P6  6  SER A 179 ? GLY A 188 ? SER A 179 GLY A 188 1 ? 10 
HELX_P HELX_P7  7  HIS A 190 ? GLU A 204 ? HIS A 190 GLU A 204 1 ? 15 
HELX_P HELX_P8  8  ASN A 218 ? LYS A 223 ? ASN A 218 LYS A 223 1 ? 6  
HELX_P HELX_P9  9  ILE B 22  ? THR B 29  ? ILE B 22  THR B 29  5 ? 8  
HELX_P HELX_P10 10 SER B 108 ? ASP B 119 ? SER B 108 ASP B 119 1 ? 12 
HELX_P HELX_P11 11 GLU B 120 ? GLU B 143 ? GLU B 120 GLU B 143 1 ? 24 
HELX_P HELX_P12 12 PRO B 149 ? GLY B 165 ? PRO B 149 GLY B 165 1 ? 17 
HELX_P HELX_P13 13 SER B 179 ? GLY B 188 ? SER B 179 GLY B 188 1 ? 10 
HELX_P HELX_P14 14 HIS B 190 ? GLU B 204 ? HIS B 190 GLU B 204 1 ? 15 
HELX_P HELX_P15 15 ASN B 218 ? LEU B 225 ? ASN B 218 LEU B 225 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 33  ? PHE A 37  ? ILE A 33  PHE A 37  
A 2 THR A 102 ? PHE A 107 ? THR A 102 PHE A 107 
A 3 MET A 53  ? ASP A 58  ? MET A 53  ASP A 58  
A 4 SER A 82  ? ILE A 84  ? SER A 82  ILE A 84  
B 1 ALA A 42  ? ILE A 44  ? ALA A 42  ILE A 44  
B 2 ILE A 94  ? ALA A 98  ? ILE A 94  ALA A 98  
B 3 ILE A 61  ? ILE A 66  ? ILE A 61  ILE A 66  
B 4 GLU A 72  ? ALA A 78  ? GLU A 72  ALA A 78  
C 1 LYS A 166 ? VAL A 168 ? LYS A 166 VAL A 168 
C 2 THR A 171 ? ILE A 174 ? THR A 171 ILE A 174 
C 3 PHE A 214 ? VAL A 216 ? PHE A 214 VAL A 216 
C 4 LEU A 207 ? LYS A 209 ? LEU A 207 LYS A 209 
D 1 ILE B 33  ? PHE B 37  ? ILE B 33  PHE B 37  
D 2 THR B 102 ? PHE B 107 ? THR B 102 PHE B 107 
D 3 MET B 53  ? ASP B 58  ? MET B 53  ASP B 58  
D 4 SER B 82  ? ILE B 84  ? SER B 82  ILE B 84  
E 1 ALA B 42  ? ILE B 44  ? ALA B 42  ILE B 44  
E 2 ASN B 93  ? ALA B 98  ? ASN B 93  ALA B 98  
E 3 ILE B 61  ? ILE B 66  ? ILE B 61  ILE B 66  
E 4 GLU B 72  ? ALA B 78  ? GLU B 72  ALA B 78  
F 1 LYS B 166 ? VAL B 168 ? LYS B 166 VAL B 168 
F 2 THR B 171 ? ILE B 174 ? THR B 171 ILE B 174 
F 3 PHE B 214 ? VAL B 216 ? PHE B 214 VAL B 216 
F 4 LEU B 207 ? LYS B 209 ? LEU B 207 LYS B 209 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 33  ? N ILE A 33  O TRP A 106 ? O TRP A 106 
A 2 3 O CYS A 105 ? O CYS A 105 N PHE A 55  ? N PHE A 55  
A 3 4 N ILE A 54  ? N ILE A 54  O ILE A 84  ? O ILE A 84  
B 1 2 N ILE A 43  ? N ILE A 43  O ALA A 96  ? O ALA A 96  
B 2 3 O THR A 97  ? O THR A 97  N LYS A 62  ? N LYS A 62  
B 3 4 N ILE A 61  ? N ILE A 61  O ALA A 78  ? O ALA A 78  
C 1 2 N VAL A 168 ? N VAL A 168 O THR A 171 ? O THR A 171 
C 2 3 N TYR A 172 ? N TYR A 172 O VAL A 216 ? O VAL A 216 
C 3 4 O ILE A 215 ? O ILE A 215 N ASP A 208 ? N ASP A 208 
D 1 2 N ARG B 35  ? N ARG B 35  O THR B 104 ? O THR B 104 
D 2 3 O CYS B 105 ? O CYS B 105 N PHE B 55  ? N PHE B 55  
D 3 4 N ILE B 54  ? N ILE B 54  O ILE B 84  ? O ILE B 84  
E 1 2 N ILE B 43  ? N ILE B 43  O ALA B 96  ? O ALA B 96  
E 2 3 O THR B 97  ? O THR B 97  N LYS B 62  ? N LYS B 62  
E 3 4 N ILE B 61  ? N ILE B 61  O ALA B 78  ? O ALA B 78  
F 1 2 N VAL B 168 ? N VAL B 168 O THR B 171 ? O THR B 171 
F 2 3 N TYR B 172 ? N TYR B 172 O VAL B 216 ? O VAL B 216 
F 3 4 O ILE B 215 ? O ILE B 215 N ASP B 208 ? N ASP B 208 
# 
_database_PDB_matrix.entry_id          2H6C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2H6C 
_atom_sites.fract_transf_matrix[1][1]   0.013767 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003828 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019988 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013583 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . PHE A 1 19  ? 27.289 -13.442 -2.105  1.00 82.31 ? 19  PHE A N   1 
ATOM 2    C CA  . PHE A 1 19  ? 26.303 -12.390 -2.632  1.00 82.50 ? 19  PHE A CA  1 
ATOM 3    C C   . PHE A 1 19  ? 24.832 -12.750 -2.696  1.00 81.45 ? 19  PHE A C   1 
ATOM 4    O O   . PHE A 1 19  ? 23.996 -11.848 -2.558  1.00 81.92 ? 19  PHE A O   1 
ATOM 5    C CB  . PHE A 1 19  ? 26.627 -11.935 -4.047  1.00 83.47 ? 19  PHE A CB  1 
ATOM 6    C CG  . PHE A 1 19  ? 27.553 -10.763 -4.116  1.00 84.99 ? 19  PHE A CG  1 
ATOM 7    C CD1 . PHE A 1 19  ? 28.606 -10.602 -3.204  1.00 85.63 ? 19  PHE A CD1 1 
ATOM 8    C CD2 . PHE A 1 19  ? 27.427 -9.854  -5.152  1.00 87.18 ? 19  PHE A CD2 1 
ATOM 9    C CE1 . PHE A 1 19  ? 29.493 -9.539  -3.315  1.00 84.87 ? 19  PHE A CE1 1 
ATOM 10   C CE2 . PHE A 1 19  ? 28.324 -8.796  -5.277  1.00 86.71 ? 19  PHE A CE2 1 
ATOM 11   C CZ  . PHE A 1 19  ? 29.352 -8.641  -4.346  1.00 85.93 ? 19  PHE A CZ  1 
ATOM 12   N N   . PHE A 1 20  ? 24.523 -14.005 -3.014  1.00 79.90 ? 20  PHE A N   1 
ATOM 13   C CA  . PHE A 1 20  ? 23.187 -14.534 -2.812  1.00 78.85 ? 20  PHE A CA  1 
ATOM 14   C C   . PHE A 1 20  ? 22.147 -13.702 -3.531  1.00 78.05 ? 20  PHE A C   1 
ATOM 15   O O   . PHE A 1 20  ? 21.396 -12.949 -2.883  1.00 77.99 ? 20  PHE A O   1 
ATOM 16   C CB  . PHE A 1 20  ? 22.880 -14.557 -1.318  1.00 78.54 ? 20  PHE A CB  1 
ATOM 17   C CG  . PHE A 1 20  ? 23.945 -15.204 -0.509  1.00 77.65 ? 20  PHE A CG  1 
ATOM 18   C CD1 . PHE A 1 20  ? 24.729 -14.460 0.332   1.00 76.44 ? 20  PHE A CD1 1 
ATOM 19   C CD2 . PHE A 1 20  ? 24.171 -16.569 -0.610  1.00 78.12 ? 20  PHE A CD2 1 
ATOM 20   C CE1 . PHE A 1 20  ? 25.719 -15.058 1.083   1.00 77.23 ? 20  PHE A CE1 1 
ATOM 21   C CE2 . PHE A 1 20  ? 25.159 -17.173 0.135   1.00 77.27 ? 20  PHE A CE2 1 
ATOM 22   C CZ  . PHE A 1 20  ? 25.933 -16.411 0.989   1.00 76.84 ? 20  PHE A CZ  1 
ATOM 23   N N   . PRO A 1 21  ? 22.101 -13.833 -4.865  1.00 76.97 ? 21  PRO A N   1 
ATOM 24   C CA  . PRO A 1 21  ? 21.172 -13.051 -5.658  1.00 76.56 ? 21  PRO A CA  1 
ATOM 25   C C   . PRO A 1 21  ? 19.727 -13.560 -5.565  1.00 76.11 ? 21  PRO A C   1 
ATOM 26   O O   . PRO A 1 21  ? 19.509 -14.725 -5.205  1.00 76.48 ? 21  PRO A O   1 
ATOM 27   C CB  . PRO A 1 21  ? 21.718 -13.227 -7.096  1.00 76.62 ? 21  PRO A CB  1 
ATOM 28   C CG  . PRO A 1 21  ? 22.978 -14.007 -6.974  1.00 75.68 ? 21  PRO A CG  1 
ATOM 29   C CD  . PRO A 1 21  ? 22.903 -14.728 -5.716  1.00 76.58 ? 21  PRO A CD  1 
ATOM 30   N N   . ILE A 1 22  ? 18.774 -12.671 -5.856  1.00 75.53 ? 22  ILE A N   1 
ATOM 31   C CA  . ILE A 1 22  ? 17.353 -13.010 -6.123  1.00 75.48 ? 22  ILE A CA  1 
ATOM 32   C C   . ILE A 1 22  ? 16.895 -12.206 -7.351  1.00 75.89 ? 22  ILE A C   1 
ATOM 33   O O   . ILE A 1 22  ? 16.168 -11.251 -7.235  1.00 75.63 ? 22  ILE A O   1 
ATOM 34   C CB  . ILE A 1 22  ? 16.317 -12.614 -4.996  1.00 75.04 ? 22  ILE A CB  1 
ATOM 35   C CG1 . ILE A 1 22  ? 16.966 -12.099 -3.738  1.00 75.19 ? 22  ILE A CG1 1 
ATOM 36   C CG2 . ILE A 1 22  ? 15.360 -13.739 -4.697  1.00 73.70 ? 22  ILE A CG2 1 
ATOM 37   C CD1 . ILE A 1 22  ? 17.292 -13.150 -2.796  1.00 75.89 ? 22  ILE A CD1 1 
ATOM 38   N N   . GLU A 1 23  ? 17.346 -12.559 -8.531  1.00 76.64 ? 23  GLU A N   1 
ATOM 39   C CA  . GLU A 1 23  ? 16.785 -11.965 -9.702  1.00 77.19 ? 23  GLU A CA  1 
ATOM 40   C C   . GLU A 1 23  ? 15.283 -11.781 -9.520  1.00 77.27 ? 23  GLU A C   1 
ATOM 41   O O   . GLU A 1 23  ? 14.767 -10.656 -9.619  1.00 78.12 ? 23  GLU A O   1 
ATOM 42   C CB  . GLU A 1 23  ? 17.010 -12.877 -10.895 1.00 77.67 ? 23  GLU A CB  1 
ATOM 43   C CG  . GLU A 1 23  ? 17.720 -12.207 -12.040 1.00 80.40 ? 23  GLU A CG  1 
ATOM 44   C CD  . GLU A 1 23  ? 19.251 -12.336 -11.943 1.00 84.23 ? 23  GLU A CD  1 
ATOM 45   O OE1 . GLU A 1 23  ? 19.787 -12.206 -10.794 1.00 85.88 ? 23  GLU A OE1 1 
ATOM 46   O OE2 . GLU A 1 23  ? 19.913 -12.560 -13.011 1.00 85.17 ? 23  GLU A OE2 1 
ATOM 47   N N   . LYS A 1 24  ? 14.555 -12.867 -9.243  1.00 76.84 ? 24  LYS A N   1 
ATOM 48   C CA  . LYS A 1 24  ? 13.086 -12.823 -9.428  1.00 76.34 ? 24  LYS A CA  1 
ATOM 49   C C   . LYS A 1 24  ? 12.442 -11.576 -8.771  1.00 76.17 ? 24  LYS A C   1 
ATOM 50   O O   . LYS A 1 24  ? 11.327 -11.198 -9.079  1.00 76.53 ? 24  LYS A O   1 
ATOM 51   C CB  . LYS A 1 24  ? 12.415 -14.147 -8.984  1.00 75.65 ? 24  LYS A CB  1 
ATOM 52   N N   . LEU A 1 25  ? 13.175 -10.922 -7.886  1.00 76.13 ? 25  LEU A N   1 
ATOM 53   C CA  . LEU A 1 25  ? 12.681 -9.755  -7.193  1.00 76.23 ? 25  LEU A CA  1 
ATOM 54   C C   . LEU A 1 25  ? 12.685 -8.427  -7.985  1.00 76.02 ? 25  LEU A C   1 
ATOM 55   O O   . LEU A 1 25  ? 11.735 -7.658  -7.833  1.00 74.73 ? 25  LEU A O   1 
ATOM 56   C CB  . LEU A 1 25  ? 13.422 -9.596  -5.860  1.00 76.42 ? 25  LEU A CB  1 
ATOM 57   C CG  . LEU A 1 25  ? 12.538 -9.716  -4.621  1.00 76.78 ? 25  LEU A CG  1 
ATOM 58   C CD1 . LEU A 1 25  ? 13.340 -9.565  -3.320  1.00 77.00 ? 25  LEU A CD1 1 
ATOM 59   C CD2 . LEU A 1 25  ? 11.440 -8.671  -4.676  1.00 76.49 ? 25  LEU A CD2 1 
ATOM 60   N N   . ARG A 1 26  ? 13.714 -8.148  -8.810  1.00 76.09 ? 26  ARG A N   1 
ATOM 61   C CA  . ARG A 1 26  ? 13.619 -7.022  -9.792  1.00 76.62 ? 26  ARG A CA  1 
ATOM 62   C C   . ARG A 1 26  ? 12.162 -6.877  -10.267 1.00 76.70 ? 26  ARG A C   1 
ATOM 63   O O   . ARG A 1 26  ? 11.638 -5.782  -10.423 1.00 76.84 ? 26  ARG A O   1 
ATOM 64   C CB  . ARG A 1 26  ? 14.461 -7.180  -11.098 1.00 76.45 ? 26  ARG A CB  1 
ATOM 65   C CG  . ARG A 1 26  ? 15.790 -7.882  -11.045 1.00 76.98 ? 26  ARG A CG  1 
ATOM 66   C CD  . ARG A 1 26  ? 16.724 -7.437  -12.191 1.00 77.17 ? 26  ARG A CD  1 
ATOM 67   N NE  . ARG A 1 26  ? 17.113 -6.015  -12.150 1.00 76.95 ? 26  ARG A NE  1 
ATOM 68   C CZ  . ARG A 1 26  ? 17.989 -5.479  -11.293 1.00 78.44 ? 26  ARG A CZ  1 
ATOM 69   N NH1 . ARG A 1 26  ? 18.566 -6.230  -10.356 1.00 80.50 ? 26  ARG A NH1 1 
ATOM 70   N NH2 . ARG A 1 26  ? 18.273 -4.176  -11.344 1.00 77.38 ? 26  ARG A NH2 1 
ATOM 71   N N   . ASN A 1 27  ? 11.522 -8.004  -10.526 1.00 76.97 ? 27  ASN A N   1 
ATOM 72   C CA  . ASN A 1 27  ? 10.158 -8.020  -10.981 1.00 77.19 ? 27  ASN A CA  1 
ATOM 73   C C   . ASN A 1 27  ? 9.138  -7.235  -10.149 1.00 77.56 ? 27  ASN A C   1 
ATOM 74   O O   . ASN A 1 27  ? 7.997  -7.110  -10.568 1.00 78.15 ? 27  ASN A O   1 
ATOM 75   C CB  . ASN A 1 27  ? 9.718  -9.476  -11.141 1.00 77.24 ? 27  ASN A CB  1 
ATOM 76   C CG  . ASN A 1 27  ? 10.427 -10.155 -12.321 1.00 77.51 ? 27  ASN A CG  1 
ATOM 77   O OD1 . ASN A 1 27  ? 11.194 -11.123 -12.167 1.00 75.66 ? 27  ASN A OD1 1 
ATOM 78   N ND2 . ASN A 1 27  ? 10.204 -9.605  -13.510 1.00 76.21 ? 27  ASN A ND2 1 
ATOM 79   N N   . TYR A 1 28  ? 9.529  -6.678  -9.007  1.00 77.59 ? 28  TYR A N   1 
ATOM 80   C CA  . TYR A 1 28  ? 8.570  -6.092  -8.079  1.00 76.99 ? 28  TYR A CA  1 
ATOM 81   C C   . TYR A 1 28  ? 8.993  -4.767  -7.458  1.00 77.66 ? 28  TYR A C   1 
ATOM 82   O O   . TYR A 1 28  ? 8.272  -4.189  -6.644  1.00 78.03 ? 28  TYR A O   1 
ATOM 83   C CB  . TYR A 1 28  ? 8.360  -7.076  -6.950  1.00 76.47 ? 28  TYR A CB  1 
ATOM 84   C CG  . TYR A 1 28  ? 7.682  -8.339  -7.389  1.00 76.25 ? 28  TYR A CG  1 
ATOM 85   C CD1 . TYR A 1 28  ? 8.340  -9.569  -7.412  1.00 77.12 ? 28  TYR A CD1 1 
ATOM 86   C CD2 . TYR A 1 28  ? 6.371  -8.310  -7.774  1.00 75.93 ? 28  TYR A CD2 1 
ATOM 87   C CE1 . TYR A 1 28  ? 7.666  -10.730 -7.817  1.00 75.56 ? 28  TYR A CE1 1 
ATOM 88   C CE2 . TYR A 1 28  ? 5.702  -9.451  -8.167  1.00 75.12 ? 28  TYR A CE2 1 
ATOM 89   C CZ  . TYR A 1 28  ? 6.342  -10.645 -8.201  1.00 74.56 ? 28  TYR A CZ  1 
ATOM 90   O OH  . TYR A 1 28  ? 5.601  -11.721 -8.617  1.00 74.56 ? 28  TYR A OH  1 
ATOM 91   N N   . THR A 1 29  ? 10.152 -4.261  -7.832  1.00 78.02 ? 29  THR A N   1 
ATOM 92   C CA  . THR A 1 29  ? 10.697 -3.125  -7.145  1.00 78.28 ? 29  THR A CA  1 
ATOM 93   C C   . THR A 1 29  ? 9.714  -1.993  -7.351  1.00 79.56 ? 29  THR A C   1 
ATOM 94   O O   . THR A 1 29  ? 9.612  -1.071  -6.516  1.00 80.20 ? 29  THR A O   1 
ATOM 95   C CB  . THR A 1 29  ? 11.968 -2.771  -7.771  1.00 77.91 ? 29  THR A CB  1 
ATOM 96   O OG1 . THR A 1 29  ? 11.756 -2.830  -9.172  1.00 77.04 ? 29  THR A OG1 1 
ATOM 97   C CG2 . THR A 1 29  ? 13.039 -3.795  -7.413  1.00 78.33 ? 29  THR A CG2 1 
ATOM 98   N N   . ASP A 1 30  ? 8.950  -2.093  -8.447  1.00 80.26 ? 30  ASP A N   1 
ATOM 99   C CA  . ASP A 1 30  ? 7.914  -1.105  -8.774  1.00 80.44 ? 30  ASP A CA  1 
ATOM 100  C C   . ASP A 1 30  ? 6.828  -0.949  -7.726  1.00 80.04 ? 30  ASP A C   1 
ATOM 101  O O   . ASP A 1 30  ? 5.960  -0.059  -7.860  1.00 80.11 ? 30  ASP A O   1 
ATOM 102  C CB  . ASP A 1 30  ? 7.290  -1.416  -10.135 1.00 80.89 ? 30  ASP A CB  1 
ATOM 103  C CG  . ASP A 1 30  ? 8.019  -0.729  -11.237 1.00 82.20 ? 30  ASP A CG  1 
ATOM 104  O OD1 . ASP A 1 30  ? 9.134  -0.270  -10.955 1.00 86.47 ? 30  ASP A OD1 1 
ATOM 105  O OD2 . ASP A 1 30  ? 7.509  -0.623  -12.368 1.00 84.58 ? 30  ASP A OD2 1 
ATOM 106  N N   . MET A 1 31  ? 6.880  -1.812  -6.708  1.00 79.09 ? 31  MET A N   1 
ATOM 107  C CA  . MET A 1 31  ? 6.032  -1.697  -5.526  1.00 78.52 ? 31  MET A CA  1 
ATOM 108  C C   . MET A 1 31  ? 6.807  -1.301  -4.278  1.00 78.02 ? 31  MET A C   1 
ATOM 109  O O   . MET A 1 31  ? 6.201  -0.948  -3.295  1.00 77.86 ? 31  MET A O   1 
ATOM 110  C CB  . MET A 1 31  ? 5.330  -3.032  -5.271  1.00 78.52 ? 31  MET A CB  1 
ATOM 111  C CG  . MET A 1 31  ? 4.845  -3.723  -6.569  1.00 78.46 ? 31  MET A CG  1 
ATOM 112  S SD  . MET A 1 31  ? 4.080  -5.301  -6.221  1.00 78.53 ? 31  MET A SD  1 
ATOM 113  C CE  . MET A 1 31  ? 3.856  -6.068  -7.820  1.00 79.16 ? 31  MET A CE  1 
ATOM 114  N N   . GLY A 1 32  ? 8.136  -1.379  -4.284  1.00 77.70 ? 32  GLY A N   1 
ATOM 115  C CA  . GLY A 1 32  ? 8.898  -0.987  -3.098  1.00 77.25 ? 32  GLY A CA  1 
ATOM 116  C C   . GLY A 1 32  ? 9.135  0.497   -3.171  1.00 76.90 ? 32  GLY A C   1 
ATOM 117  O O   . GLY A 1 32  ? 8.607  1.147   -4.090  1.00 77.24 ? 32  GLY A O   1 
ATOM 118  N N   . ILE A 1 33  ? 9.909  1.067   -2.238  1.00 76.37 ? 33  ILE A N   1 
ATOM 119  C CA  . ILE A 1 33  ? 10.373 2.479   -2.450  1.00 75.72 ? 33  ILE A CA  1 
ATOM 120  C C   . ILE A 1 33  ? 11.861 2.524   -2.874  1.00 75.48 ? 33  ILE A C   1 
ATOM 121  O O   . ILE A 1 33  ? 12.721 1.801   -2.341  1.00 75.08 ? 33  ILE A O   1 
ATOM 122  C CB  . ILE A 1 33  ? 9.988  3.518   -1.302  1.00 75.05 ? 33  ILE A CB  1 
ATOM 123  C CG1 . ILE A 1 33  ? 11.211 4.088   -0.588  1.00 74.08 ? 33  ILE A CG1 1 
ATOM 124  C CG2 . ILE A 1 33  ? 8.983  2.943   -0.331  1.00 74.48 ? 33  ILE A CG2 1 
ATOM 125  N N   . ILE A 1 34  ? 12.128 3.341   -3.892  1.00 75.37 ? 34  ILE A N   1 
ATOM 126  C CA  . ILE A 1 34  ? 13.469 3.387   -4.494  1.00 75.49 ? 34  ILE A CA  1 
ATOM 127  C C   . ILE A 1 34  ? 14.273 4.501   -3.876  1.00 75.29 ? 34  ILE A C   1 
ATOM 128  O O   . ILE A 1 34  ? 13.818 5.649   -3.793  1.00 74.65 ? 34  ILE A O   1 
ATOM 129  C CB  . ILE A 1 34  ? 13.481 3.606   -6.022  1.00 75.02 ? 34  ILE A CB  1 
ATOM 130  C CG1 . ILE A 1 34  ? 12.638 2.554   -6.753  1.00 75.54 ? 34  ILE A CG1 1 
ATOM 131  C CG2 . ILE A 1 34  ? 14.918 3.605   -6.528  1.00 74.66 ? 34  ILE A CG2 1 
ATOM 132  C CD1 . ILE A 1 34  ? 12.549 1.181   -6.091  1.00 78.06 ? 34  ILE A CD1 1 
ATOM 133  N N   . ARG A 1 35  ? 15.469 4.136   -3.447  1.00 75.13 ? 35  ARG A N   1 
ATOM 134  C CA  . ARG A 1 35  ? 16.324 5.036   -2.775  1.00 75.34 ? 35  ARG A CA  1 
ATOM 135  C C   . ARG A 1 35  ? 17.614 4.831   -3.435  1.00 75.22 ? 35  ARG A C   1 
ATOM 136  O O   . ARG A 1 35  ? 17.899 3.740   -3.907  1.00 75.73 ? 35  ARG A O   1 
ATOM 137  C CB  . ARG A 1 35  ? 16.383 4.689   -1.302  1.00 75.72 ? 35  ARG A CB  1 
ATOM 138  C CG  . ARG A 1 35  ? 15.004 4.791   -0.661  1.00 76.83 ? 35  ARG A CG  1 
ATOM 139  C CD  . ARG A 1 35  ? 14.958 5.719   0.508   1.00 78.95 ? 35  ARG A CD  1 
ATOM 140  N NE  . ARG A 1 35  ? 14.978 4.939   1.731   1.00 81.26 ? 35  ARG A NE  1 
ATOM 141  C CZ  . ARG A 1 35  ? 15.759 5.170   2.794   1.00 83.56 ? 35  ARG A CZ  1 
ATOM 142  N NH1 . ARG A 1 35  ? 16.605 6.212   2.855   1.00 84.04 ? 35  ARG A NH1 1 
ATOM 143  N NH2 . ARG A 1 35  ? 15.667 4.348   3.837   1.00 83.59 ? 35  ARG A NH2 1 
ATOM 144  N N   . GLU A 1 36  ? 18.396 5.884   -3.477  1.00 75.26 ? 36  GLU A N   1 
ATOM 145  C CA  . GLU A 1 36  ? 19.563 5.880   -4.289  1.00 75.39 ? 36  GLU A CA  1 
ATOM 146  C C   . GLU A 1 36  ? 20.673 6.594   -3.519  1.00 75.52 ? 36  GLU A C   1 
ATOM 147  O O   . GLU A 1 36  ? 20.465 7.683   -2.982  1.00 75.11 ? 36  GLU A O   1 
ATOM 148  C CB  . GLU A 1 36  ? 19.221 6.535   -5.623  1.00 75.26 ? 36  GLU A CB  1 
ATOM 149  C CG  . GLU A 1 36  ? 19.665 5.746   -6.829  1.00 75.50 ? 36  GLU A CG  1 
ATOM 150  C CD  . GLU A 1 36  ? 19.036 6.248   -8.126  1.00 75.52 ? 36  GLU A CD  1 
ATOM 151  O OE1 . GLU A 1 36  ? 18.894 7.478   -8.299  1.00 74.53 ? 36  GLU A OE1 1 
ATOM 152  O OE2 . GLU A 1 36  ? 18.688 5.418   -8.984  1.00 74.01 ? 36  GLU A OE2 1 
ATOM 153  N N   . PHE A 1 37  ? 21.833 5.928   -3.436  1.00 75.92 ? 37  PHE A N   1 
ATOM 154  C CA  . PHE A 1 37  ? 22.976 6.342   -2.591  1.00 75.85 ? 37  PHE A CA  1 
ATOM 155  C C   . PHE A 1 37  ? 24.297 6.573   -3.413  1.00 76.65 ? 37  PHE A C   1 
ATOM 156  O O   . PHE A 1 37  ? 24.733 5.700   -4.188  1.00 77.16 ? 37  PHE A O   1 
ATOM 157  C CB  . PHE A 1 37  ? 23.200 5.321   -1.454  1.00 74.74 ? 37  PHE A CB  1 
ATOM 158  C CG  . PHE A 1 37  ? 21.961 5.035   -0.635  1.00 74.47 ? 37  PHE A CG  1 
ATOM 159  C CD1 . PHE A 1 37  ? 21.011 4.107   -1.071  1.00 75.08 ? 37  PHE A CD1 1 
ATOM 160  C CD2 . PHE A 1 37  ? 21.744 5.674   0.573   1.00 72.22 ? 37  PHE A CD2 1 
ATOM 161  C CE1 . PHE A 1 37  ? 19.859 3.859   -0.322  1.00 74.22 ? 37  PHE A CE1 1 
ATOM 162  C CE2 . PHE A 1 37  ? 20.600 5.438   1.311   1.00 71.72 ? 37  PHE A CE2 1 
ATOM 163  C CZ  . PHE A 1 37  ? 19.658 4.536   0.865   1.00 73.54 ? 37  PHE A CZ  1 
ATOM 164  N N   . ALA A 1 38  ? 24.933 7.748   -3.246  1.00 76.99 ? 38  ALA A N   1 
ATOM 165  C CA  . ALA A 1 38  ? 26.194 8.045   -3.937  1.00 76.52 ? 38  ALA A CA  1 
ATOM 166  C C   . ALA A 1 38  ? 27.343 7.340   -3.225  1.00 76.42 ? 38  ALA A C   1 
ATOM 167  O O   . ALA A 1 38  ? 27.166 6.799   -2.131  1.00 75.96 ? 38  ALA A O   1 
ATOM 168  C CB  . ALA A 1 38  ? 26.420 9.531   -4.034  1.00 76.34 ? 38  ALA A CB  1 
ATOM 169  N N   . LYS A 1 39  ? 28.507 7.297   -3.873  1.00 76.39 ? 39  LYS A N   1 
ATOM 170  C CA  . LYS A 1 39  ? 29.650 6.562   -3.329  1.00 76.47 ? 39  LYS A CA  1 
ATOM 171  C C   . LYS A 1 39  ? 29.968 7.199   -1.974  1.00 76.40 ? 39  LYS A C   1 
ATOM 172  O O   . LYS A 1 39  ? 29.845 8.403   -1.831  1.00 77.06 ? 39  LYS A O   1 
ATOM 173  C CB  . LYS A 1 39  ? 30.808 6.647   -4.322  1.00 76.36 ? 39  LYS A CB  1 
ATOM 174  C CG  . LYS A 1 39  ? 32.120 6.024   -3.868  1.00 76.85 ? 39  LYS A CG  1 
ATOM 175  C CD  . LYS A 1 39  ? 33.157 5.950   -5.010  1.00 76.84 ? 39  LYS A CD  1 
ATOM 176  C CE  . LYS A 1 39  ? 33.891 4.568   -5.109  1.00 77.04 ? 39  LYS A CE  1 
ATOM 177  N NZ  . LYS A 1 39  ? 35.331 4.651   -5.604  1.00 77.77 ? 39  LYS A NZ  1 
ATOM 178  N N   . GLY A 1 40  ? 30.284 6.432   -0.951  1.00 76.15 ? 40  GLY A N   1 
ATOM 179  C CA  . GLY A 1 40  ? 30.566 7.065   0.338   1.00 76.17 ? 40  GLY A CA  1 
ATOM 180  C C   . GLY A 1 40  ? 29.359 7.249   1.247   1.00 76.23 ? 40  GLY A C   1 
ATOM 181  O O   . GLY A 1 40  ? 29.530 7.268   2.467   1.00 76.57 ? 40  GLY A O   1 
ATOM 182  N N   . SER A 1 41  ? 28.151 7.366   0.674   1.00 76.18 ? 41  SER A N   1 
ATOM 183  C CA  . SER A 1 41  ? 26.907 7.612   1.441   1.00 75.94 ? 41  SER A CA  1 
ATOM 184  C C   . SER A 1 41  ? 26.572 6.456   2.343   1.00 76.43 ? 41  SER A C   1 
ATOM 185  O O   . SER A 1 41  ? 26.648 5.291   1.934   1.00 76.98 ? 41  SER A O   1 
ATOM 186  C CB  . SER A 1 41  ? 25.695 7.798   0.537   1.00 75.64 ? 41  SER A CB  1 
ATOM 187  O OG  . SER A 1 41  ? 25.661 9.067   -0.084  1.00 75.32 ? 41  SER A OG  1 
ATOM 188  N N   . ALA A 1 42  ? 26.183 6.789   3.569   1.00 76.54 ? 42  ALA A N   1 
ATOM 189  C CA  . ALA A 1 42  ? 25.797 5.803   4.563   1.00 76.28 ? 42  ALA A CA  1 
ATOM 190  C C   . ALA A 1 42  ? 24.374 5.427   4.304   1.00 76.38 ? 42  ALA A C   1 
ATOM 191  O O   . ALA A 1 42  ? 23.503 6.287   4.285   1.00 76.81 ? 42  ALA A O   1 
ATOM 192  C CB  . ALA A 1 42  ? 25.910 6.378   5.958   1.00 76.27 ? 42  ALA A CB  1 
ATOM 193  N N   . ILE A 1 43  ? 24.123 4.139   4.146   1.00 76.59 ? 43  ILE A N   1 
ATOM 194  C CA  . ILE A 1 43  ? 22.770 3.681   3.879   1.00 76.28 ? 43  ILE A CA  1 
ATOM 195  C C   . ILE A 1 43  ? 22.162 2.980   5.080   1.00 76.39 ? 43  ILE A C   1 
ATOM 196  O O   . ILE A 1 43  ? 20.928 3.003   5.268   1.00 76.65 ? 43  ILE A O   1 
ATOM 197  C CB  . ILE A 1 43  ? 22.653 2.809   2.588   1.00 76.03 ? 43  ILE A CB  1 
ATOM 198  C CG1 . ILE A 1 43  ? 21.756 1.617   2.883   1.00 75.45 ? 43  ILE A CG1 1 
ATOM 199  C CG2 . ILE A 1 43  ? 24.017 2.464   1.972   1.00 74.86 ? 43  ILE A CG2 1 
ATOM 200  C CD1 . ILE A 1 43  ? 22.089 0.454   2.148   1.00 77.25 ? 43  ILE A CD1 1 
ATOM 201  N N   . ILE A 1 44  ? 22.996 2.340   5.887   1.00 76.56 ? 44  ILE A N   1 
ATOM 202  C CA  . ILE A 1 44  ? 22.523 1.947   7.225   1.00 77.16 ? 44  ILE A CA  1 
ATOM 203  C C   . ILE A 1 44  ? 23.451 2.528   8.254   1.00 77.00 ? 44  ILE A C   1 
ATOM 204  O O   . ILE A 1 44  ? 24.670 2.548   8.094   1.00 76.77 ? 44  ILE A O   1 
ATOM 205  C CB  . ILE A 1 44  ? 22.343 0.399   7.437   1.00 77.47 ? 44  ILE A CB  1 
ATOM 206  C CG1 . ILE A 1 44  ? 21.478 -0.199  6.321   1.00 76.35 ? 44  ILE A CG1 1 
ATOM 207  C CG2 . ILE A 1 44  ? 21.721 0.098   8.838   1.00 76.07 ? 44  ILE A CG2 1 
ATOM 208  C CD1 . ILE A 1 44  ? 21.723 -1.618  6.119   1.00 76.74 ? 44  ILE A CD1 1 
ATOM 209  N N   . MET A 1 45  ? 22.836 3.028   9.305   1.00 77.41 ? 45  MET A N   1 
ATOM 210  C CA  . MET A 1 45  ? 23.559 3.728   10.325  1.00 77.86 ? 45  MET A CA  1 
ATOM 211  C C   . MET A 1 45  ? 23.680 2.854   11.516  1.00 78.43 ? 45  MET A C   1 
ATOM 212  O O   . MET A 1 45  ? 22.758 2.126   11.872  1.00 77.86 ? 45  MET A O   1 
ATOM 213  C CB  . MET A 1 45  ? 22.862 5.022   10.740  1.00 77.64 ? 45  MET A CB  1 
ATOM 214  C CG  . MET A 1 45  ? 23.171 6.159   9.853   1.00 77.59 ? 45  MET A CG  1 
ATOM 215  S SD  . MET A 1 45  ? 24.932 6.305   9.742   1.00 78.46 ? 45  MET A SD  1 
ATOM 216  C CE  . MET A 1 45  ? 25.088 8.028   10.095  1.00 78.99 ? 45  MET A CE  1 
ATOM 217  N N   . PRO A 1 46  ? 24.823 2.954   12.169  1.00 79.85 ? 46  PRO A N   1 
ATOM 218  C CA  . PRO A 1 46  ? 24.935 2.348   13.486  1.00 80.60 ? 46  PRO A CA  1 
ATOM 219  C C   . PRO A 1 46  ? 23.740 2.730   14.380  1.00 81.10 ? 46  PRO A C   1 
ATOM 220  O O   . PRO A 1 46  ? 23.115 3.784   14.196  1.00 81.56 ? 46  PRO A O   1 
ATOM 221  C CB  . PRO A 1 46  ? 26.245 2.934   14.046  1.00 80.68 ? 46  PRO A CB  1 
ATOM 222  C CG  . PRO A 1 46  ? 27.069 3.319   12.793  1.00 81.08 ? 46  PRO A CG  1 
ATOM 223  C CD  . PRO A 1 46  ? 26.041 3.677   11.742  1.00 80.35 ? 46  PRO A CD  1 
ATOM 224  N N   . GLY A 1 47  ? 23.422 1.858   15.326  1.00 81.45 ? 47  GLY A N   1 
ATOM 225  C CA  . GLY A 1 47  ? 22.440 2.152   16.356  1.00 81.68 ? 47  GLY A CA  1 
ATOM 226  C C   . GLY A 1 47  ? 21.171 2.763   15.794  1.00 81.87 ? 47  GLY A C   1 
ATOM 227  O O   . GLY A 1 47  ? 20.740 3.842   16.226  1.00 82.08 ? 47  GLY A O   1 
ATOM 228  N N   . GLU A 1 48  ? 20.582 2.067   14.828  1.00 81.97 ? 48  GLU A N   1 
ATOM 229  C CA  . GLU A 1 48  ? 19.355 2.521   14.186  1.00 82.18 ? 48  GLU A CA  1 
ATOM 230  C C   . GLU A 1 48  ? 18.434 1.348   13.944  1.00 82.27 ? 48  GLU A C   1 
ATOM 231  O O   . GLU A 1 48  ? 18.892 0.241   13.652  1.00 82.27 ? 48  GLU A O   1 
ATOM 232  N N   . ASP A 1 49  ? 17.130 1.595   14.060  1.00 82.42 ? 49  ASP A N   1 
ATOM 233  C CA  . ASP A 1 49  ? 16.135 0.509   14.062  1.00 82.21 ? 49  ASP A CA  1 
ATOM 234  C C   . ASP A 1 49  ? 15.558 0.219   12.648  1.00 81.96 ? 49  ASP A C   1 
ATOM 235  O O   . ASP A 1 49  ? 14.550 0.820   12.236  1.00 81.87 ? 49  ASP A O   1 
ATOM 236  C CB  . ASP A 1 49  ? 15.024 0.809   15.088  1.00 81.80 ? 49  ASP A CB  1 
ATOM 237  N N   . THR A 1 50  ? 16.200 -0.719  11.933  1.00 81.61 ? 50  THR A N   1 
ATOM 238  C CA  . THR A 1 50  ? 15.801 -1.106  10.564  1.00 81.46 ? 50  THR A CA  1 
ATOM 239  C C   . THR A 1 50  ? 14.487 -1.893  10.510  1.00 81.11 ? 50  THR A C   1 
ATOM 240  O O   . THR A 1 50  ? 14.199 -2.735  11.384  1.00 81.57 ? 50  THR A O   1 
ATOM 241  C CB  . THR A 1 50  ? 16.887 -1.982  9.865   1.00 81.62 ? 50  THR A CB  1 
ATOM 242  O OG1 . THR A 1 50  ? 18.188 -1.530  10.256  1.00 82.69 ? 50  THR A OG1 1 
ATOM 243  C CG2 . THR A 1 50  ? 16.762 -1.944  8.278   1.00 81.63 ? 50  THR A CG2 1 
ATOM 244  N N   . THR A 1 51  ? 13.704 -1.621  9.463   1.00 80.25 ? 51  THR A N   1 
ATOM 245  C CA  . THR A 1 51  ? 12.425 -2.292  9.264   1.00 79.44 ? 51  THR A CA  1 
ATOM 246  C C   . THR A 1 51  ? 12.059 -2.591  7.784   1.00 79.19 ? 51  THR A C   1 
ATOM 247  O O   . THR A 1 51  ? 10.877 -2.711  7.443   1.00 79.73 ? 51  THR A O   1 
ATOM 248  C CB  . THR A 1 51  ? 11.306 -1.470  9.889   1.00 79.05 ? 51  THR A CB  1 
ATOM 249  O OG1 . THR A 1 51  ? 11.060 -0.325  9.060   1.00 78.11 ? 51  THR A OG1 1 
ATOM 250  C CG2 . THR A 1 51  ? 11.667 -1.063  11.355  1.00 78.57 ? 51  THR A CG2 1 
ATOM 251  N N   . SER A 1 52  ? 13.042 -2.740  6.906   1.00 78.36 ? 52  SER A N   1 
ATOM 252  C CA  . SER A 1 52  ? 12.716 -3.056  5.515   1.00 77.80 ? 52  SER A CA  1 
ATOM 253  C C   . SER A 1 52  ? 13.782 -3.947  4.885   1.00 77.31 ? 52  SER A C   1 
ATOM 254  O O   . SER A 1 52  ? 14.971 -3.777  5.090   1.00 76.68 ? 52  SER A O   1 
ATOM 255  C CB  . SER A 1 52  ? 12.531 -1.777  4.674   1.00 77.59 ? 52  SER A CB  1 
ATOM 256  O OG  . SER A 1 52  ? 11.521 -0.913  5.193   1.00 77.96 ? 52  SER A OG  1 
ATOM 257  N N   . MET A 1 53  ? 13.342 -4.931  4.137   1.00 76.86 ? 53  MET A N   1 
ATOM 258  C CA  . MET A 1 53  ? 14.253 -5.612  3.297   1.00 77.47 ? 53  MET A CA  1 
ATOM 259  C C   . MET A 1 53  ? 14.827 -4.604  2.245   1.00 77.42 ? 53  MET A C   1 
ATOM 260  O O   . MET A 1 53  ? 14.125 -3.712  1.733   1.00 77.62 ? 53  MET A O   1 
ATOM 261  C CB  . MET A 1 53  ? 13.535 -6.807  2.663   1.00 77.98 ? 53  MET A CB  1 
ATOM 262  C CG  . MET A 1 53  ? 13.045 -7.825  3.673   1.00 79.97 ? 53  MET A CG  1 
ATOM 263  S SD  . MET A 1 53  ? 14.223 -8.147  5.060   1.00 86.85 ? 53  MET A SD  1 
ATOM 264  C CE  . MET A 1 53  ? 15.845 -8.545  4.302   1.00 83.83 ? 53  MET A CE  1 
ATOM 265  N N   . ILE A 1 54  ? 16.113 -4.693  1.946   1.00 76.78 ? 54  ILE A N   1 
ATOM 266  C CA  . ILE A 1 54  ? 16.672 -3.732  1.007   1.00 76.19 ? 54  ILE A CA  1 
ATOM 267  C C   . ILE A 1 54  ? 17.201 -4.491  -0.168  1.00 76.37 ? 54  ILE A C   1 
ATOM 268  O O   . ILE A 1 54  ? 18.223 -5.193  -0.076  1.00 75.86 ? 54  ILE A O   1 
ATOM 269  C CB  . ILE A 1 54  ? 17.795 -2.899  1.595   1.00 75.83 ? 54  ILE A CB  1 
ATOM 270  C CG1 . ILE A 1 54  ? 17.297 -2.140  2.821   1.00 75.53 ? 54  ILE A CG1 1 
ATOM 271  C CG2 . ILE A 1 54  ? 18.297 -1.947  0.539   1.00 74.82 ? 54  ILE A CG2 1 
ATOM 272  C CD1 . ILE A 1 54  ? 18.378 -1.753  3.810   1.00 75.69 ? 54  ILE A CD1 1 
ATOM 273  N N   . PHE A 1 55  ? 16.481 -4.354  -1.270  1.00 76.49 ? 55  PHE A N   1 
ATOM 274  C CA  . PHE A 1 55  ? 16.820 -5.066  -2.456  1.00 76.74 ? 55  PHE A CA  1 
ATOM 275  C C   . PHE A 1 55  ? 17.770 -4.198  -3.247  1.00 77.25 ? 55  PHE A C   1 
ATOM 276  O O   . PHE A 1 55  ? 17.490 -3.024  -3.555  1.00 77.57 ? 55  PHE A O   1 
ATOM 277  C CB  . PHE A 1 55  ? 15.600 -5.405  -3.292  1.00 76.76 ? 55  PHE A CB  1 
ATOM 278  C CG  . PHE A 1 55  ? 15.942 -6.165  -4.529  1.00 76.19 ? 55  PHE A CG  1 
ATOM 279  C CD1 . PHE A 1 55  ? 16.429 -7.449  -4.427  1.00 75.62 ? 55  PHE A CD1 1 
ATOM 280  C CD2 . PHE A 1 55  ? 15.822 -5.597  -5.764  1.00 75.81 ? 55  PHE A CD2 1 
ATOM 281  C CE1 . PHE A 1 55  ? 16.780 -8.162  -5.512  1.00 75.18 ? 55  PHE A CE1 1 
ATOM 282  C CE2 . PHE A 1 55  ? 16.177 -6.323  -6.872  1.00 77.94 ? 55  PHE A CE2 1 
ATOM 283  C CZ  . PHE A 1 55  ? 16.662 -7.620  -6.730  1.00 76.27 ? 55  PHE A CZ  1 
ATOM 284  N N   . LEU A 1 56  ? 18.896 -4.804  -3.588  1.00 77.15 ? 56  LEU A N   1 
ATOM 285  C CA  . LEU A 1 56  ? 19.991 -4.071  -4.149  1.00 76.89 ? 56  LEU A CA  1 
ATOM 286  C C   . LEU A 1 56  ? 19.944 -4.234  -5.677  1.00 76.83 ? 56  LEU A C   1 
ATOM 287  O O   . LEU A 1 56  ? 20.520 -5.157  -6.250  1.00 76.52 ? 56  LEU A O   1 
ATOM 288  C CB  . LEU A 1 56  ? 21.270 -4.572  -3.502  1.00 76.27 ? 56  LEU A CB  1 
ATOM 289  C CG  . LEU A 1 56  ? 22.312 -3.524  -3.213  1.00 76.04 ? 56  LEU A CG  1 
ATOM 290  C CD1 . LEU A 1 56  ? 23.125 -3.949  -2.072  1.00 76.19 ? 56  LEU A CD1 1 
ATOM 291  C CD2 . LEU A 1 56  ? 23.195 -3.323  -4.430  1.00 78.58 ? 56  LEU A CD2 1 
ATOM 292  N N   . MET A 1 57  ? 19.247 -3.319  -6.333  1.00 76.80 ? 57  MET A N   1 
ATOM 293  C CA  . MET A 1 57  ? 19.075 -3.426  -7.782  1.00 77.47 ? 57  MET A CA  1 
ATOM 294  C C   . MET A 1 57  ? 20.379 -3.220  -8.540  1.00 78.16 ? 57  MET A C   1 
ATOM 295  O O   . MET A 1 57  ? 20.627 -3.946  -9.488  1.00 78.31 ? 57  MET A O   1 
ATOM 296  C CB  . MET A 1 57  ? 18.062 -2.425  -8.340  1.00 77.47 ? 57  MET A CB  1 
ATOM 297  C CG  . MET A 1 57  ? 17.012 -1.968  -7.375  1.00 77.68 ? 57  MET A CG  1 
ATOM 298  S SD  . MET A 1 57  ? 15.601 -1.364  -8.250  1.00 76.01 ? 57  MET A SD  1 
ATOM 299  C CE  . MET A 1 57  ? 15.421 0.252   -7.613  1.00 77.66 ? 57  MET A CE  1 
ATOM 300  N N   . ASP A 1 58  ? 21.166 -2.204  -8.176  1.00 78.51 ? 58  ASP A N   1 
ATOM 301  C CA  . ASP A 1 58  ? 22.517 -2.076  -8.707  1.00 79.28 ? 58  ASP A CA  1 
ATOM 302  C C   . ASP A 1 58  ? 23.473 -1.202  -7.945  1.00 79.18 ? 58  ASP A C   1 
ATOM 303  O O   . ASP A 1 58  ? 23.196 -0.027  -7.675  1.00 79.65 ? 58  ASP A O   1 
ATOM 304  C CB  . ASP A 1 58  ? 22.533 -1.601  -10.157 1.00 79.69 ? 58  ASP A CB  1 
ATOM 305  C CG  . ASP A 1 58  ? 23.084 -2.690  -11.102 1.00 84.13 ? 58  ASP A CG  1 
ATOM 306  O OD1 . ASP A 1 58  ? 24.357 -2.943  -11.136 1.00 85.91 ? 58  ASP A OD1 1 
ATOM 307  O OD2 . ASP A 1 58  ? 22.217 -3.317  -11.792 1.00 88.43 ? 58  ASP A OD2 1 
ATOM 308  N N   . GLY A 1 59  ? 24.636 -1.798  -7.699  1.00 78.87 ? 59  GLY A N   1 
ATOM 309  C CA  . GLY A 1 59  ? 25.809 -1.156  -7.131  1.00 78.71 ? 59  GLY A CA  1 
ATOM 310  C C   . GLY A 1 59  ? 26.512 -2.134  -6.185  1.00 78.65 ? 59  GLY A C   1 
ATOM 311  O O   . GLY A 1 59  ? 26.637 -3.355  -6.456  1.00 78.49 ? 59  GLY A O   1 
ATOM 312  N N   . LYS A 1 60  ? 26.967 -1.619  -5.050  1.00 77.73 ? 60  LYS A N   1 
ATOM 313  C CA  . LYS A 1 60  ? 27.698 -2.452  -4.147  1.00 76.55 ? 60  LYS A CA  1 
ATOM 314  C C   . LYS A 1 60  ? 27.712 -1.830  -2.803  1.00 75.64 ? 60  LYS A C   1 
ATOM 315  O O   . LYS A 1 60  ? 27.932 -0.650  -2.671  1.00 74.90 ? 60  LYS A O   1 
ATOM 316  C CB  . LYS A 1 60  ? 29.114 -2.549  -4.621  1.00 76.58 ? 60  LYS A CB  1 
ATOM 317  C CG  . LYS A 1 60  ? 29.731 -3.887  -4.362  1.00 77.63 ? 60  LYS A CG  1 
ATOM 318  C CD  . LYS A 1 60  ? 29.865 -4.683  -5.666  1.00 77.42 ? 60  LYS A CD  1 
ATOM 319  C CE  . LYS A 1 60  ? 31.191 -5.382  -5.690  1.00 76.42 ? 60  LYS A CE  1 
ATOM 320  N NZ  . LYS A 1 60  ? 32.317 -4.385  -5.576  1.00 77.15 ? 60  LYS A NZ  1 
ATOM 321  N N   . ILE A 1 61  ? 27.516 -2.634  -1.785  1.00 75.03 ? 61  ILE A N   1 
ATOM 322  C CA  . ILE A 1 61  ? 27.458 -2.092  -0.454  1.00 74.48 ? 61  ILE A CA  1 
ATOM 323  C C   . ILE A 1 61  ? 28.415 -2.853  0.429   1.00 73.41 ? 61  ILE A C   1 
ATOM 324  O O   . ILE A 1 61  ? 28.554 -4.058  0.245   1.00 70.93 ? 61  ILE A O   1 
ATOM 325  C CB  . ILE A 1 61  ? 26.015 -2.147  0.042   1.00 75.07 ? 61  ILE A CB  1 
ATOM 326  C CG1 . ILE A 1 61  ? 25.214 -1.033  -0.624  1.00 74.28 ? 61  ILE A CG1 1 
ATOM 327  C CG2 . ILE A 1 61  ? 25.935 -2.007  1.551   1.00 77.01 ? 61  ILE A CG2 1 
ATOM 328  C CD1 . ILE A 1 61  ? 23.750 -1.053  -0.294  1.00 73.61 ? 61  ILE A CD1 1 
ATOM 329  N N   . LYS A 1 62  ? 29.115 -2.117  1.314   1.00 73.35 ? 62  LYS A N   1 
ATOM 330  C CA  . LYS A 1 62  ? 29.926 -2.706  2.408   1.00 74.19 ? 62  LYS A CA  1 
ATOM 331  C C   . LYS A 1 62  ? 29.141 -2.566  3.667   1.00 74.15 ? 62  LYS A C   1 
ATOM 332  O O   . LYS A 1 62  ? 28.641 -1.492  3.942   1.00 75.22 ? 62  LYS A O   1 
ATOM 333  C CB  . LYS A 1 62  ? 31.302 -2.012  2.590   1.00 74.12 ? 62  LYS A CB  1 
ATOM 334  N N   . LEU A 1 63  ? 29.026 -3.643  4.426   1.00 74.39 ? 63  LEU A N   1 
ATOM 335  C CA  . LEU A 1 63  ? 28.340 -3.604  5.723   1.00 74.61 ? 63  LEU A CA  1 
ATOM 336  C C   . LEU A 1 63  ? 29.329 -4.011  6.765   1.00 74.41 ? 63  LEU A C   1 
ATOM 337  O O   . LEU A 1 63  ? 29.841 -5.121  6.729   1.00 74.01 ? 63  LEU A O   1 
ATOM 338  C CB  . LEU A 1 63  ? 27.157 -4.577  5.771   1.00 75.06 ? 63  LEU A CB  1 
ATOM 339  C CG  . LEU A 1 63  ? 25.965 -4.350  4.818   1.00 74.56 ? 63  LEU A CG  1 
ATOM 340  C CD1 . LEU A 1 63  ? 26.220 -4.928  3.412   1.00 73.21 ? 63  LEU A CD1 1 
ATOM 341  C CD2 . LEU A 1 63  ? 24.754 -4.960  5.430   1.00 72.56 ? 63  LEU A CD2 1 
ATOM 342  N N   . ASP A 1 64  ? 29.611 -3.094  7.672   1.00 74.66 ? 64  ASP A N   1 
ATOM 343  C CA  . ASP A 1 64  ? 30.489 -3.359  8.786   1.00 75.04 ? 64  ASP A CA  1 
ATOM 344  C C   . ASP A 1 64  ? 29.645 -3.489  10.012  1.00 74.78 ? 64  ASP A C   1 
ATOM 345  O O   . ASP A 1 64  ? 28.664 -2.775  10.162  1.00 73.93 ? 64  ASP A O   1 
ATOM 346  C CB  . ASP A 1 64  ? 31.459 -2.213  9.007   1.00 75.33 ? 64  ASP A CB  1 
ATOM 347  C CG  . ASP A 1 64  ? 32.391 -1.992  7.834   1.00 76.62 ? 64  ASP A CG  1 
ATOM 348  O OD1 . ASP A 1 64  ? 32.782 -2.986  7.207   1.00 77.40 ? 64  ASP A OD1 1 
ATOM 349  O OD2 . ASP A 1 64  ? 32.748 -0.821  7.546   1.00 79.42 ? 64  ASP A OD2 1 
ATOM 350  N N   . ILE A 1 65  ? 30.057 -4.413  10.875  1.00 75.51 ? 65  ILE A N   1 
ATOM 351  C CA  . ILE A 1 65  ? 29.448 -4.634  12.200  1.00 75.74 ? 65  ILE A CA  1 
ATOM 352  C C   . ILE A 1 65  ? 30.218 -3.821  13.228  1.00 76.40 ? 65  ILE A C   1 
ATOM 353  O O   . ILE A 1 65  ? 31.434 -3.669  13.124  1.00 76.58 ? 65  ILE A O   1 
ATOM 354  C CB  . ILE A 1 65  ? 29.395 -6.146  12.652  1.00 75.35 ? 65  ILE A CB  1 
ATOM 355  C CG1 . ILE A 1 65  ? 28.725 -6.268  14.035  1.00 75.34 ? 65  ILE A CG1 1 
ATOM 356  C CG2 . ILE A 1 65  ? 30.784 -6.765  12.673  1.00 74.72 ? 65  ILE A CG2 1 
ATOM 357  C CD1 . ILE A 1 65  ? 28.130 -7.663  14.405  1.00 74.82 ? 65  ILE A CD1 1 
ATOM 358  N N   . ILE A 1 66  ? 29.487 -3.284  14.203  1.00 77.17 ? 66  ILE A N   1 
ATOM 359  C CA  . ILE A 1 66  ? 30.075 -2.550  15.321  1.00 77.56 ? 66  ILE A CA  1 
ATOM 360  C C   . ILE A 1 66  ? 29.679 -3.205  16.649  1.00 77.66 ? 66  ILE A C   1 
ATOM 361  O O   . ILE A 1 66  ? 28.502 -3.188  17.052  1.00 77.73 ? 66  ILE A O   1 
ATOM 362  C CB  . ILE A 1 66  ? 29.640 -1.087  15.295  1.00 77.62 ? 66  ILE A CB  1 
ATOM 363  C CG1 . ILE A 1 66  ? 30.050 -0.465  13.967  1.00 77.18 ? 66  ILE A CG1 1 
ATOM 364  C CG2 . ILE A 1 66  ? 30.273 -0.314  16.451  1.00 77.60 ? 66  ILE A CG2 1 
ATOM 365  C CD1 . ILE A 1 66  ? 29.223 0.686   13.608  1.00 77.44 ? 66  ILE A CD1 1 
ATOM 366  N N   . PHE A 1 67  ? 30.689 -3.760  17.315  1.00 77.80 ? 67  PHE A N   1 
ATOM 367  C CA  . PHE A 1 67  ? 30.511 -4.558  18.532  1.00 78.11 ? 67  PHE A CA  1 
ATOM 368  C C   . PHE A 1 67  ? 30.291 -3.717  19.773  1.00 77.97 ? 67  PHE A C   1 
ATOM 369  O O   . PHE A 1 67  ? 30.605 -2.535  19.797  1.00 78.26 ? 67  PHE A O   1 
ATOM 370  C CB  . PHE A 1 67  ? 31.743 -5.449  18.765  1.00 78.10 ? 67  PHE A CB  1 
ATOM 371  C CG  . PHE A 1 67  ? 31.864 -6.545  17.784  1.00 78.07 ? 67  PHE A CG  1 
ATOM 372  C CD1 . PHE A 1 67  ? 32.589 -6.363  16.620  1.00 78.71 ? 67  PHE A CD1 1 
ATOM 373  C CD2 . PHE A 1 67  ? 31.218 -7.750  17.998  1.00 78.04 ? 67  PHE A CD2 1 
ATOM 374  C CE1 . PHE A 1 67  ? 32.683 -7.375  15.678  1.00 78.72 ? 67  PHE A CE1 1 
ATOM 375  C CE2 . PHE A 1 67  ? 31.309 -8.755  17.078  1.00 78.58 ? 67  PHE A CE2 1 
ATOM 376  C CZ  . PHE A 1 67  ? 32.047 -8.567  15.905  1.00 78.63 ? 67  PHE A CZ  1 
ATOM 377  N N   . GLU A 1 68  ? 29.827 -4.367  20.832  1.00 77.90 ? 68  GLU A N   1 
ATOM 378  C CA  . GLU A 1 68  ? 29.577 -3.698  22.114  1.00 77.95 ? 68  GLU A CA  1 
ATOM 379  C C   . GLU A 1 68  ? 30.743 -2.833  22.597  1.00 77.44 ? 68  GLU A C   1 
ATOM 380  O O   . GLU A 1 68  ? 30.599 -2.146  23.598  1.00 77.61 ? 68  GLU A O   1 
ATOM 381  C CB  . GLU A 1 68  ? 29.227 -4.719  23.227  1.00 78.19 ? 68  GLU A CB  1 
ATOM 382  C CG  . GLU A 1 68  ? 27.914 -5.553  23.027  1.00 79.45 ? 68  GLU A CG  1 
ATOM 383  C CD  . GLU A 1 68  ? 28.047 -6.780  22.077  1.00 80.36 ? 68  GLU A CD  1 
ATOM 384  O OE1 . GLU A 1 68  ? 29.102 -7.479  22.071  1.00 81.67 ? 68  GLU A OE1 1 
ATOM 385  O OE2 . GLU A 1 68  ? 27.059 -7.041  21.346  1.00 79.13 ? 68  GLU A OE2 1 
ATOM 386  N N   . ASP A 1 69  ? 31.890 -2.870  21.916  1.00 77.07 ? 69  ASP A N   1 
ATOM 387  C CA  . ASP A 1 69  ? 33.082 -2.135  22.368  1.00 76.91 ? 69  ASP A CA  1 
ATOM 388  C C   . ASP A 1 69  ? 33.620 -1.210  21.264  1.00 76.70 ? 69  ASP A C   1 
ATOM 389  O O   . ASP A 1 69  ? 34.843 -1.066  21.092  1.00 76.10 ? 69  ASP A O   1 
ATOM 390  C CB  . ASP A 1 69  ? 34.176 -3.113  22.836  1.00 76.72 ? 69  ASP A CB  1 
ATOM 391  C CG  . ASP A 1 69  ? 34.805 -3.873  21.676  1.00 76.72 ? 69  ASP A CG  1 
ATOM 392  O OD1 . ASP A 1 69  ? 34.692 -3.375  20.540  1.00 74.93 ? 69  ASP A OD1 1 
ATOM 393  O OD2 . ASP A 1 69  ? 35.400 -4.956  21.885  1.00 76.98 ? 69  ASP A OD2 1 
ATOM 394  N N   . GLY A 1 70  ? 32.702 -0.605  20.510  1.00 76.59 ? 70  GLY A N   1 
ATOM 395  C CA  . GLY A 1 70  ? 33.047 0.417   19.519  1.00 76.70 ? 70  GLY A CA  1 
ATOM 396  C C   . GLY A 1 70  ? 33.995 -0.016  18.411  1.00 77.01 ? 70  GLY A C   1 
ATOM 397  O O   . GLY A 1 70  ? 34.331 0.759   17.523  1.00 76.19 ? 70  GLY A O   1 
ATOM 398  N N   . SER A 1 71  ? 34.445 -1.256  18.451  1.00 77.95 ? 71  SER A N   1 
ATOM 399  C CA  . SER A 1 71  ? 35.394 -1.704  17.467  1.00 78.71 ? 71  SER A CA  1 
ATOM 400  C C   . SER A 1 71  ? 34.580 -2.193  16.292  1.00 79.41 ? 71  SER A C   1 
ATOM 401  O O   . SER A 1 71  ? 33.599 -2.920  16.468  1.00 80.22 ? 71  SER A O   1 
ATOM 402  C CB  . SER A 1 71  ? 36.298 -2.809  18.012  1.00 78.71 ? 71  SER A CB  1 
ATOM 403  O OG  . SER A 1 71  ? 35.641 -4.061  18.029  1.00 78.90 ? 71  SER A OG  1 
ATOM 404  N N   . GLU A 1 72  ? 35.001 -1.771  15.105  1.00 79.89 ? 72  GLU A N   1 
ATOM 405  C CA  . GLU A 1 72  ? 34.296 -1.996  13.833  1.00 80.46 ? 72  GLU A CA  1 
ATOM 406  C C   . GLU A 1 72  ? 34.958 -3.221  13.207  1.00 79.40 ? 72  GLU A C   1 
ATOM 407  O O   . GLU A 1 72  ? 35.932 -3.692  13.790  1.00 80.34 ? 72  GLU A O   1 
ATOM 408  C CB  . GLU A 1 72  ? 34.461 -0.724  12.978  1.00 80.63 ? 72  GLU A CB  1 
ATOM 409  C CG  . GLU A 1 72  ? 33.834 -0.730  11.584  1.00 82.19 ? 72  GLU A CG  1 
ATOM 410  C CD  . GLU A 1 72  ? 33.425 0.661   11.091  1.00 82.84 ? 72  GLU A CD  1 
ATOM 411  O OE1 . GLU A 1 72  ? 33.208 0.785   9.860   1.00 84.37 ? 72  GLU A OE1 1 
ATOM 412  O OE2 . GLU A 1 72  ? 33.315 1.617   11.920  1.00 87.85 ? 72  GLU A OE2 1 
ATOM 413  N N   . LYS A 1 73  ? 34.442 -3.743  12.084  1.00 77.82 ? 73  LYS A N   1 
ATOM 414  C CA  . LYS A 1 73  ? 34.954 -4.964  11.433  1.00 76.90 ? 73  LYS A CA  1 
ATOM 415  C C   . LYS A 1 73  ? 34.042 -5.299  10.280  1.00 76.73 ? 73  LYS A C   1 
ATOM 416  O O   . LYS A 1 73  ? 32.827 -5.201  10.415  1.00 76.10 ? 73  LYS A O   1 
ATOM 417  C CB  . LYS A 1 73  ? 34.903 -6.156  12.373  1.00 76.77 ? 73  LYS A CB  1 
ATOM 418  C CG  . LYS A 1 73  ? 36.194 -6.529  13.041  1.00 76.59 ? 73  LYS A CG  1 
ATOM 419  C CD  . LYS A 1 73  ? 36.835 -7.672  12.322  1.00 78.16 ? 73  LYS A CD  1 
ATOM 420  C CE  . LYS A 1 73  ? 37.913 -8.325  13.147  1.00 77.54 ? 73  LYS A CE  1 
ATOM 421  N NZ  . LYS A 1 73  ? 38.027 -9.751  12.785  1.00 78.09 ? 73  LYS A NZ  1 
ATOM 422  N N   . LEU A 1 74  ? 34.597 -5.724  9.151   1.00 76.93 ? 74  LEU A N   1 
ATOM 423  C CA  . LEU A 1 74  ? 33.751 -5.963  7.986   1.00 77.02 ? 74  LEU A CA  1 
ATOM 424  C C   . LEU A 1 74  ? 32.873 -7.167  8.216   1.00 77.34 ? 74  LEU A C   1 
ATOM 425  O O   . LEU A 1 74  ? 33.199 -8.083  9.005   1.00 77.19 ? 74  LEU A O   1 
ATOM 426  C CB  . LEU A 1 74  ? 34.533 -6.111  6.695   1.00 77.05 ? 74  LEU A CB  1 
ATOM 427  C CG  . LEU A 1 74  ? 33.767 -6.755  5.527   1.00 78.26 ? 74  LEU A CG  1 
ATOM 428  C CD1 . LEU A 1 74  ? 34.150 -6.216  4.148   1.00 80.73 ? 74  LEU A CD1 1 
ATOM 429  C CD2 . LEU A 1 74  ? 33.975 -8.209  5.524   1.00 78.07 ? 74  LEU A CD2 1 
ATOM 430  N N   . LEU A 1 75  ? 31.735 -7.133  7.523   1.00 77.38 ? 75  LEU A N   1 
ATOM 431  C CA  . LEU A 1 75  ? 30.682 -8.105  7.721   1.00 76.95 ? 75  LEU A CA  1 
ATOM 432  C C   . LEU A 1 75  ? 30.306 -8.736  6.392   1.00 76.75 ? 75  LEU A C   1 
ATOM 433  O O   . LEU A 1 75  ? 30.429 -9.925  6.242   1.00 76.29 ? 75  LEU A O   1 
ATOM 434  C CB  . LEU A 1 75  ? 29.481 -7.452  8.393   1.00 76.80 ? 75  LEU A CB  1 
ATOM 435  C CG  . LEU A 1 75  ? 28.651 -8.351  9.296   1.00 75.84 ? 75  LEU A CG  1 
ATOM 436  C CD1 . LEU A 1 75  ? 27.193 -8.125  9.053   1.00 73.88 ? 75  LEU A CD1 1 
ATOM 437  C CD2 . LEU A 1 75  ? 28.962 -9.791  9.065   1.00 76.92 ? 75  LEU A CD2 1 
ATOM 438  N N   . TYR A 1 76  ? 29.862 -7.953  5.423   1.00 77.43 ? 76  TYR A N   1 
ATOM 439  C CA  . TYR A 1 76  ? 29.958 -8.395  4.006   1.00 77.94 ? 76  TYR A CA  1 
ATOM 440  C C   . TYR A 1 76  ? 29.665 -7.317  3.051   1.00 77.45 ? 76  TYR A C   1 
ATOM 441  O O   . TYR A 1 76  ? 29.069 -6.289  3.377   1.00 77.03 ? 76  TYR A O   1 
ATOM 442  C CB  . TYR A 1 76  ? 29.049 -9.574  3.628   1.00 78.63 ? 76  TYR A CB  1 
ATOM 443  C CG  . TYR A 1 76  ? 27.620 -9.466  4.143   1.00 80.49 ? 76  TYR A CG  1 
ATOM 444  C CD1 . TYR A 1 76  ? 27.262 -10.033 5.364   1.00 79.76 ? 76  TYR A CD1 1 
ATOM 445  C CD2 . TYR A 1 76  ? 26.616 -8.801  3.402   1.00 82.22 ? 76  TYR A CD2 1 
ATOM 446  C CE1 . TYR A 1 76  ? 25.966 -9.918  5.855   1.00 81.25 ? 76  TYR A CE1 1 
ATOM 447  C CE2 . TYR A 1 76  ? 25.292 -8.691  3.914   1.00 80.85 ? 76  TYR A CE2 1 
ATOM 448  C CZ  . TYR A 1 76  ? 24.994 -9.254  5.129   1.00 80.32 ? 76  TYR A CZ  1 
ATOM 449  O OH  . TYR A 1 76  ? 23.724 -9.182  5.654   1.00 81.84 ? 76  TYR A OH  1 
ATOM 450  N N   . TYR A 1 77  ? 30.101 -7.598  1.845   1.00 77.86 ? 77  TYR A N   1 
ATOM 451  C CA  . TYR A 1 77  ? 29.723 -6.840  0.696   1.00 78.15 ? 77  TYR A CA  1 
ATOM 452  C C   . TYR A 1 77  ? 28.398 -7.400  0.127   1.00 78.46 ? 77  TYR A C   1 
ATOM 453  O O   . TYR A 1 77  ? 28.110 -8.593  0.161   1.00 79.02 ? 77  TYR A O   1 
ATOM 454  C CB  . TYR A 1 77  ? 30.855 -6.892  -0.308  1.00 78.38 ? 77  TYR A CB  1 
ATOM 455  C CG  . TYR A 1 77  ? 32.096 -6.089  0.105   1.00 79.10 ? 77  TYR A CG  1 
ATOM 456  C CD1 . TYR A 1 77  ? 33.120 -6.679  0.817   1.00 78.60 ? 77  TYR A CD1 1 
ATOM 457  C CD2 . TYR A 1 77  ? 32.242 -4.736  -0.251  1.00 78.94 ? 77  TYR A CD2 1 
ATOM 458  C CE1 . TYR A 1 77  ? 34.253 -5.949  1.170   1.00 79.32 ? 77  TYR A CE1 1 
ATOM 459  C CE2 . TYR A 1 77  ? 33.360 -4.012  0.105   1.00 78.73 ? 77  TYR A CE2 1 
ATOM 460  C CZ  . TYR A 1 77  ? 34.373 -4.623  0.818   1.00 79.26 ? 77  TYR A CZ  1 
ATOM 461  O OH  . TYR A 1 77  ? 35.525 -3.928  1.168   1.00 79.00 ? 77  TYR A OH  1 
ATOM 462  N N   . ALA A 1 78  ? 27.539 -6.524  -0.341  1.00 78.34 ? 78  ALA A N   1 
ATOM 463  C CA  . ALA A 1 78  ? 26.377 -7.000  -1.042  1.00 77.91 ? 78  ALA A CA  1 
ATOM 464  C C   . ALA A 1 78  ? 26.410 -6.365  -2.418  1.00 77.78 ? 78  ALA A C   1 
ATOM 465  O O   . ALA A 1 78  ? 27.074 -5.355  -2.651  1.00 78.20 ? 78  ALA A O   1 
ATOM 466  C CB  . ALA A 1 78  ? 25.112 -6.665  -0.291  1.00 77.69 ? 78  ALA A CB  1 
ATOM 467  N N   . GLY A 1 79  ? 25.695 -6.972  -3.336  1.00 77.51 ? 79  GLY A N   1 
ATOM 468  C CA  . GLY A 1 79  ? 25.796 -6.581  -4.709  1.00 77.58 ? 79  GLY A CA  1 
ATOM 469  C C   . GLY A 1 79  ? 24.480 -6.662  -5.412  1.00 77.05 ? 79  GLY A C   1 
ATOM 470  O O   . GLY A 1 79  ? 23.438 -6.686  -4.785  1.00 77.37 ? 79  GLY A O   1 
ATOM 471  N N   . SER A 1 80  ? 24.546 -6.704  -6.726  1.00 76.18 ? 80  SER A N   1 
ATOM 472  C CA  . SER A 1 80  ? 23.367 -6.575  -7.520  1.00 76.08 ? 80  SER A CA  1 
ATOM 473  C C   . SER A 1 80  ? 22.472 -7.790  -7.269  1.00 75.53 ? 80  SER A C   1 
ATOM 474  O O   . SER A 1 80  ? 22.953 -8.906  -7.135  1.00 75.49 ? 80  SER A O   1 
ATOM 475  C CB  . SER A 1 80  ? 23.753 -6.399  -8.982  1.00 75.84 ? 80  SER A CB  1 
ATOM 476  O OG  . SER A 1 80  ? 23.058 -7.355  -9.742  1.00 77.95 ? 80  SER A OG  1 
ATOM 477  N N   . ASN A 1 81  ? 21.176 -7.537  -7.158  1.00 75.35 ? 81  ASN A N   1 
ATOM 478  C CA  . ASN A 1 81  ? 20.178 -8.514  -6.675  1.00 75.01 ? 81  ASN A CA  1 
ATOM 479  C C   . ASN A 1 81  ? 20.340 -9.049  -5.261  1.00 74.92 ? 81  ASN A C   1 
ATOM 480  O O   . ASN A 1 81  ? 19.744 -10.044 -4.891  1.00 75.92 ? 81  ASN A O   1 
ATOM 481  C CB  . ASN A 1 81  ? 20.096 -9.677  -7.639  1.00 74.83 ? 81  ASN A CB  1 
ATOM 482  C CG  . ASN A 1 81  ? 19.924 -9.225  -9.057  1.00 73.98 ? 81  ASN A CG  1 
ATOM 483  O OD1 . ASN A 1 81  ? 19.009 -8.466  -9.381  1.00 68.63 ? 81  ASN A OD1 1 
ATOM 484  N ND2 . ASN A 1 81  ? 20.796 -9.711  -9.925  1.00 75.04 ? 81  ASN A ND2 1 
ATOM 485  N N   . SER A 1 82  ? 21.141 -8.412  -4.446  1.00 74.88 ? 82  SER A N   1 
ATOM 486  C CA  . SER A 1 82  ? 21.356 -8.938  -3.121  1.00 74.86 ? 82  SER A CA  1 
ATOM 487  C C   . SER A 1 82  ? 20.203 -8.485  -2.262  1.00 75.23 ? 82  SER A C   1 
ATOM 488  O O   . SER A 1 82  ? 19.494 -7.556  -2.652  1.00 75.37 ? 82  SER A O   1 
ATOM 489  C CB  . SER A 1 82  ? 22.678 -8.442  -2.578  1.00 74.59 ? 82  SER A CB  1 
ATOM 490  O OG  . SER A 1 82  ? 23.701 -9.037  -3.331  1.00 72.27 ? 82  SER A OG  1 
ATOM 491  N N   . LEU A 1 83  ? 19.998 -9.145  -1.131  1.00 75.45 ? 83  LEU A N   1 
ATOM 492  C CA  . LEU A 1 83  ? 18.921 -8.759  -0.246  1.00 76.17 ? 83  LEU A CA  1 
ATOM 493  C C   . LEU A 1 83  ? 19.446 -8.634  1.154   1.00 76.56 ? 83  LEU A C   1 
ATOM 494  O O   . LEU A 1 83  ? 19.765 -9.606  1.802   1.00 77.15 ? 83  LEU A O   1 
ATOM 495  C CB  . LEU A 1 83  ? 17.763 -9.753  -0.289  1.00 76.13 ? 83  LEU A CB  1 
ATOM 496  C CG  . LEU A 1 83  ? 16.483 -9.337  0.420   1.00 75.86 ? 83  LEU A CG  1 
ATOM 497  C CD1 . LEU A 1 83  ? 15.900 -8.189  -0.295  1.00 75.77 ? 83  LEU A CD1 1 
ATOM 498  C CD2 . LEU A 1 83  ? 15.506 -10.491 0.467   1.00 76.53 ? 83  LEU A CD2 1 
ATOM 499  N N   . ILE A 1 84  ? 19.500 -7.404  1.602   1.00 77.05 ? 84  ILE A N   1 
ATOM 500  C CA  . ILE A 1 84  ? 19.992 -7.053  2.879   1.00 78.06 ? 84  ILE A CA  1 
ATOM 501  C C   . ILE A 1 84  ? 18.833 -6.735  3.776   1.00 78.83 ? 84  ILE A C   1 
ATOM 502  O O   . ILE A 1 84  ? 17.743 -6.347  3.303   1.00 78.93 ? 84  ILE A O   1 
ATOM 503  C CB  . ILE A 1 84  ? 20.649 -5.719  2.724   1.00 78.58 ? 84  ILE A CB  1 
ATOM 504  C CG1 . ILE A 1 84  ? 22.086 -5.847  2.273   1.00 80.11 ? 84  ILE A CG1 1 
ATOM 505  C CG2 . ILE A 1 84  ? 20.579 -4.869  4.000   1.00 79.71 ? 84  ILE A CG2 1 
ATOM 506  C CD1 . ILE A 1 84  ? 22.538 -4.473  1.590   1.00 80.86 ? 84  ILE A CD1 1 
ATOM 507  N N   . GLY A 1 85  ? 19.103 -6.781  5.080   1.00 79.13 ? 85  GLY A N   1 
ATOM 508  C CA  . GLY A 1 85  ? 18.355 -5.954  6.031   1.00 79.14 ? 85  GLY A CA  1 
ATOM 509  C C   . GLY A 1 85  ? 17.573 -6.656  7.117   1.00 79.00 ? 85  GLY A C   1 
ATOM 510  O O   . GLY A 1 85  ? 16.825 -7.574  6.854   1.00 78.81 ? 85  GLY A O   1 
ATOM 511  N N   . ARG A 1 86  ? 17.755 -6.207  8.347   1.00 79.35 ? 86  ARG A N   1 
ATOM 512  C CA  . ARG A 1 86  ? 16.800 -6.495  9.405   1.00 79.89 ? 86  ARG A CA  1 
ATOM 513  C C   . ARG A 1 86  ? 15.379 -6.079  8.937   1.00 80.32 ? 86  ARG A C   1 
ATOM 514  O O   . ARG A 1 86  ? 15.143 -4.921  8.582   1.00 81.11 ? 86  ARG A O   1 
ATOM 515  C CB  . ARG A 1 86  ? 17.217 -5.772  10.706  1.00 79.55 ? 86  ARG A CB  1 
ATOM 516  N N   . LEU A 1 87  ? 14.454 -7.036  8.871   1.00 80.66 ? 87  LEU A N   1 
ATOM 517  C CA  . LEU A 1 87  ? 12.999 -6.717  8.913   1.00 80.76 ? 87  LEU A CA  1 
ATOM 518  C C   . LEU A 1 87  ? 12.522 -6.587  10.381  1.00 80.12 ? 87  LEU A C   1 
ATOM 519  O O   . LEU A 1 87  ? 11.527 -5.947  10.607  1.00 78.67 ? 87  LEU A O   1 
ATOM 520  C CB  . LEU A 1 87  ? 12.110 -7.728  8.110   1.00 80.84 ? 87  LEU A CB  1 
ATOM 521  C CG  . LEU A 1 87  ? 10.680 -7.283  7.653   1.00 80.93 ? 87  LEU A CG  1 
ATOM 522  C CD1 . LEU A 1 87  ? 10.670 -6.035  6.704   1.00 81.07 ? 87  LEU A CD1 1 
ATOM 523  C CD2 . LEU A 1 87  ? 9.892  -8.423  6.984   1.00 80.76 ? 87  LEU A CD2 1 
ATOM 524  N N   . TYR A 1 88  ? 13.258 -7.211  11.328  1.00 80.98 ? 88  TYR A N   1 
ATOM 525  C CA  . TYR A 1 88  ? 13.083 -7.152  12.823  1.00 81.10 ? 88  TYR A CA  1 
ATOM 526  C C   . TYR A 1 88  ? 14.476 -7.019  13.448  1.00 80.96 ? 88  TYR A C   1 
ATOM 527  O O   . TYR A 1 88  ? 15.413 -7.601  12.929  1.00 81.26 ? 88  TYR A O   1 
ATOM 528  C CB  . TYR A 1 88  ? 12.447 -8.458  13.372  1.00 81.78 ? 88  TYR A CB  1 
ATOM 529  C CG  . TYR A 1 88  ? 11.140 -8.870  12.693  1.00 82.73 ? 88  TYR A CG  1 
ATOM 530  C CD1 . TYR A 1 88  ? 11.114 -9.164  11.316  1.00 83.00 ? 88  TYR A CD1 1 
ATOM 531  C CD2 . TYR A 1 88  ? 9.931  -8.952  13.409  1.00 82.87 ? 88  TYR A CD2 1 
ATOM 532  C CE1 . TYR A 1 88  ? 9.943  -9.516  10.661  1.00 83.02 ? 88  TYR A CE1 1 
ATOM 533  C CE2 . TYR A 1 88  ? 8.739  -9.314  12.754  1.00 84.08 ? 88  TYR A CE2 1 
ATOM 534  C CZ  . TYR A 1 88  ? 8.767  -9.588  11.363  1.00 83.63 ? 88  TYR A CZ  1 
ATOM 535  O OH  . TYR A 1 88  ? 7.650  -9.931  10.637  1.00 83.48 ? 88  TYR A OH  1 
ATOM 536  N N   . PRO A 1 89  ? 14.621 -6.325  14.588  1.00 81.14 ? 89  PRO A N   1 
ATOM 537  C CA  . PRO A 1 89  ? 15.962 -6.191  15.200  1.00 81.12 ? 89  PRO A CA  1 
ATOM 538  C C   . PRO A 1 89  ? 16.682 -7.520  15.371  1.00 80.79 ? 89  PRO A C   1 
ATOM 539  O O   . PRO A 1 89  ? 16.161 -8.442  15.997  1.00 80.74 ? 89  PRO A O   1 
ATOM 540  C CB  . PRO A 1 89  ? 15.706 -5.574  16.599  1.00 81.11 ? 89  PRO A CB  1 
ATOM 541  C CG  . PRO A 1 89  ? 14.283 -5.198  16.647  1.00 81.09 ? 89  PRO A CG  1 
ATOM 542  C CD  . PRO A 1 89  ? 13.573 -5.667  15.382  1.00 81.58 ? 89  PRO A CD  1 
ATOM 543  N N   . THR A 1 90  ? 17.890 -7.555  14.826  1.00 80.78 ? 90  THR A N   1 
ATOM 544  C CA  . THR A 1 90  ? 18.798 -8.678  14.865  1.00 80.87 ? 90  THR A CA  1 
ATOM 545  C C   . THR A 1 90  ? 20.022 -8.288  15.686  1.00 80.81 ? 90  THR A C   1 
ATOM 546  O O   . THR A 1 90  ? 21.028 -7.990  15.089  1.00 81.19 ? 90  THR A O   1 
ATOM 547  C CB  . THR A 1 90  ? 19.384 -8.957  13.421  1.00 81.61 ? 90  THR A CB  1 
ATOM 548  O OG1 . THR A 1 90  ? 20.088 -7.794  12.905  1.00 81.68 ? 90  THR A OG1 1 
ATOM 549  C CG2 . THR A 1 90  ? 18.300 -9.376  12.399  1.00 81.74 ? 90  THR A CG2 1 
ATOM 550  N N   . GLY A 1 91  ? 19.969 -8.229  17.015  1.00 80.91 ? 91  GLY A N   1 
ATOM 551  C CA  . GLY A 1 91  ? 21.172 -7.953  17.844  1.00 80.67 ? 91  GLY A CA  1 
ATOM 552  C C   . GLY A 1 91  ? 22.502 -7.576  17.167  1.00 80.50 ? 91  GLY A C   1 
ATOM 553  O O   . GLY A 1 91  ? 23.563 -7.986  17.630  1.00 80.89 ? 91  GLY A O   1 
ATOM 554  N N   . ASN A 1 92  ? 22.467 -6.809  16.078  1.00 79.92 ? 92  ASN A N   1 
ATOM 555  C CA  . ASN A 1 92  ? 23.688 -6.415  15.377  1.00 79.17 ? 92  ASN A CA  1 
ATOM 556  C C   . ASN A 1 92  ? 23.656 -4.942  15.056  1.00 78.66 ? 92  ASN A C   1 
ATOM 557  O O   . ASN A 1 92  ? 22.781 -4.488  14.352  1.00 79.02 ? 92  ASN A O   1 
ATOM 558  C CB  . ASN A 1 92  ? 23.878 -7.226  14.075  1.00 79.20 ? 92  ASN A CB  1 
ATOM 559  C CG  . ASN A 1 92  ? 24.622 -8.542  14.306  1.00 78.45 ? 92  ASN A CG  1 
ATOM 560  O OD1 . ASN A 1 92  ? 25.073 -8.827  15.410  1.00 77.74 ? 92  ASN A OD1 1 
ATOM 561  N ND2 . ASN A 1 92  ? 24.761 -9.336  13.258  1.00 77.88 ? 92  ASN A ND2 1 
ATOM 562  N N   . ASN A 1 93  ? 24.609 -4.192  15.569  1.00 77.97 ? 93  ASN A N   1 
ATOM 563  C CA  . ASN A 1 93  ? 24.766 -2.845  15.110  1.00 77.96 ? 93  ASN A CA  1 
ATOM 564  C C   . ASN A 1 93  ? 25.464 -2.868  13.760  1.00 77.69 ? 93  ASN A C   1 
ATOM 565  O O   . ASN A 1 93  ? 26.584 -3.328  13.668  1.00 77.89 ? 93  ASN A O   1 
ATOM 566  C CB  . ASN A 1 93  ? 25.595 -2.031  16.099  1.00 78.09 ? 93  ASN A CB  1 
ATOM 567  C CG  . ASN A 1 93  ? 25.283 -0.547  16.020  1.00 79.73 ? 93  ASN A CG  1 
ATOM 568  O OD1 . ASN A 1 93  ? 24.825 -0.059  14.978  1.00 81.80 ? 93  ASN A OD1 1 
ATOM 569  N ND2 . ASN A 1 93  ? 25.487 0.179   17.134  1.00 81.25 ? 93  ASN A ND2 1 
ATOM 570  N N   . ILE A 1 94  ? 24.826 -2.364  12.718  1.00 77.25 ? 94  ILE A N   1 
ATOM 571  C CA  . ILE A 1 94  ? 25.424 -2.408  11.404  1.00 77.27 ? 94  ILE A CA  1 
ATOM 572  C C   . ILE A 1 94  ? 25.817 -1.002  10.950  1.00 77.56 ? 94  ILE A C   1 
ATOM 573  O O   . ILE A 1 94  ? 25.567 0.001   11.623  1.00 77.57 ? 94  ILE A O   1 
ATOM 574  C CB  . ILE A 1 94  ? 24.481 -3.144  10.414  1.00 77.13 ? 94  ILE A CB  1 
ATOM 575  C CG1 . ILE A 1 94  ? 24.136 -4.551  10.980  1.00 79.06 ? 94  ILE A CG1 1 
ATOM 576  C CG2 . ILE A 1 94  ? 25.085 -3.288  9.013   1.00 76.00 ? 94  ILE A CG2 1 
ATOM 577  C CD1 . ILE A 1 94  ? 25.067 -5.769  10.506  1.00 79.49 ? 94  ILE A CD1 1 
ATOM 578  N N   . TYR A 1 95  ? 26.493 -0.936  9.821   1.00 77.59 ? 95  TYR A N   1 
ATOM 579  C CA  . TYR A 1 95  ? 26.880 0.305   9.293   1.00 77.32 ? 95  TYR A CA  1 
ATOM 580  C C   . TYR A 1 95  ? 27.259 0.152   7.850   1.00 76.61 ? 95  TYR A C   1 
ATOM 581  O O   . TYR A 1 95  ? 28.398 -0.165  7.513   1.00 76.03 ? 95  TYR A O   1 
ATOM 582  C CB  . TYR A 1 95  ? 28.075 0.730   10.076  1.00 78.32 ? 95  TYR A CB  1 
ATOM 583  C CG  . TYR A 1 95  ? 28.792 1.893   9.448   1.00 80.42 ? 95  TYR A CG  1 
ATOM 584  C CD1 . TYR A 1 95  ? 30.179 1.894   9.324   1.00 80.91 ? 95  TYR A CD1 1 
ATOM 585  C CD2 . TYR A 1 95  ? 28.080 2.997   8.954   1.00 81.40 ? 95  TYR A CD2 1 
ATOM 586  C CE1 . TYR A 1 95  ? 30.830 2.962   8.752   1.00 80.07 ? 95  TYR A CE1 1 
ATOM 587  C CE2 . TYR A 1 95  ? 28.722 4.046   8.378   1.00 80.77 ? 95  TYR A CE2 1 
ATOM 588  C CZ  . TYR A 1 95  ? 30.086 4.028   8.280   1.00 80.33 ? 95  TYR A CZ  1 
ATOM 589  O OH  . TYR A 1 95  ? 30.678 5.121   7.721   1.00 81.25 ? 95  TYR A OH  1 
ATOM 590  N N   . ALA A 1 96  ? 26.305 0.389   6.979   1.00 76.31 ? 96  ALA A N   1 
ATOM 591  C CA  . ALA A 1 96  ? 26.492 0.025   5.592   1.00 76.12 ? 96  ALA A CA  1 
ATOM 592  C C   . ALA A 1 96  ? 26.843 1.242   4.803   1.00 75.44 ? 96  ALA A C   1 
ATOM 593  O O   . ALA A 1 96  ? 26.434 2.332   5.138   1.00 75.08 ? 96  ALA A O   1 
ATOM 594  C CB  . ALA A 1 96  ? 25.226 -0.624  5.050   1.00 76.36 ? 96  ALA A CB  1 
ATOM 595  N N   . THR A 1 97  ? 27.587 1.048   3.738   1.00 75.41 ? 97  THR A N   1 
ATOM 596  C CA  . THR A 1 97  ? 28.081 2.158   2.962   1.00 76.08 ? 97  THR A CA  1 
ATOM 597  C C   . THR A 1 97  ? 27.958 1.833   1.538   1.00 75.89 ? 97  THR A C   1 
ATOM 598  O O   . THR A 1 97  ? 28.002 0.672   1.193   1.00 75.74 ? 97  THR A O   1 
ATOM 599  C CB  . THR A 1 97  ? 29.568 2.298   3.133   1.00 76.33 ? 97  THR A CB  1 
ATOM 600  O OG1 . THR A 1 97  ? 29.984 1.534   4.260   1.00 77.56 ? 97  THR A OG1 1 
ATOM 601  C CG2 . THR A 1 97  ? 29.950 3.752   3.296   1.00 77.33 ? 97  THR A CG2 1 
ATOM 602  N N   . ALA A 1 98  ? 27.875 2.843   0.694   1.00 76.25 ? 98  ALA A N   1 
ATOM 603  C CA  . ALA A 1 98  ? 27.895 2.580   -0.732  1.00 77.00 ? 98  ALA A CA  1 
ATOM 604  C C   . ALA A 1 98  ? 29.340 2.611   -1.297  1.00 77.89 ? 98  ALA A C   1 
ATOM 605  O O   . ALA A 1 98  ? 30.098 3.589   -1.115  1.00 77.91 ? 98  ALA A O   1 
ATOM 606  C CB  . ALA A 1 98  ? 26.978 3.555   -1.476  1.00 76.71 ? 98  ALA A CB  1 
ATOM 607  N N   . MET A 1 99  ? 29.703 1.537   -1.994  1.00 78.70 ? 99  MET A N   1 
ATOM 608  C CA  . MET A 1 99  ? 30.962 1.479   -2.741  1.00 79.54 ? 99  MET A CA  1 
ATOM 609  C C   . MET A 1 99  ? 30.862 2.231   -4.040  1.00 78.90 ? 99  MET A C   1 
ATOM 610  O O   . MET A 1 99  ? 31.755 2.990   -4.375  1.00 79.80 ? 99  MET A O   1 
ATOM 611  C CB  . MET A 1 99  ? 31.340 0.052   -3.090  1.00 80.32 ? 99  MET A CB  1 
ATOM 612  C CG  . MET A 1 99  ? 31.375 -0.893  -1.887  1.00 83.40 ? 99  MET A CG  1 
ATOM 613  S SD  . MET A 1 99  ? 32.741 -0.443  -0.796  1.00 90.80 ? 99  MET A SD  1 
ATOM 614  C CE  . MET A 1 99  ? 34.223 -0.930  -1.806  1.00 89.75 ? 99  MET A CE  1 
ATOM 615  N N   . GLU A 1 100 ? 29.820 1.977   -4.811  1.00 77.84 ? 100 GLU A N   1 
ATOM 616  C CA  . GLU A 1 100 ? 29.621 2.758   -6.007  1.00 77.61 ? 100 GLU A CA  1 
ATOM 617  C C   . GLU A 1 100 ? 28.230 3.347   -5.950  1.00 77.53 ? 100 GLU A C   1 
ATOM 618  O O   . GLU A 1 100 ? 27.574 3.264   -4.893  1.00 77.41 ? 100 GLU A O   1 
ATOM 619  C CB  . GLU A 1 100 ? 29.941 1.959   -7.283  1.00 77.40 ? 100 GLU A CB  1 
ATOM 620  C CG  . GLU A 1 100 ? 29.068 0.792   -7.641  1.00 77.54 ? 100 GLU A CG  1 
ATOM 621  C CD  . GLU A 1 100 ? 29.876 -0.400  -8.176  1.00 78.90 ? 100 GLU A CD  1 
ATOM 622  O OE1 . GLU A 1 100 ? 31.100 -0.441  -7.972  1.00 79.04 ? 100 GLU A OE1 1 
ATOM 623  O OE2 . GLU A 1 100 ? 29.296 -1.329  -8.772  1.00 81.63 ? 100 GLU A OE2 1 
ATOM 624  N N   . GLN A 1 101 ? 27.816 4.007   -7.033  1.00 77.21 ? 101 GLN A N   1 
ATOM 625  C CA  . GLN A 1 101 ? 26.479 4.533   -7.115  1.00 77.12 ? 101 GLN A CA  1 
ATOM 626  C C   . GLN A 1 101 ? 25.575 3.334   -7.210  1.00 77.08 ? 101 GLN A C   1 
ATOM 627  O O   . GLN A 1 101 ? 25.740 2.492   -8.091  1.00 77.04 ? 101 GLN A O   1 
ATOM 628  C CB  . GLN A 1 101 ? 26.318 5.451   -8.310  1.00 77.34 ? 101 GLN A CB  1 
ATOM 629  C CG  . GLN A 1 101 ? 24.974 6.167   -8.376  1.00 78.31 ? 101 GLN A CG  1 
ATOM 630  C CD  . GLN A 1 101 ? 24.731 7.073   -7.193  1.00 79.07 ? 101 GLN A CD  1 
ATOM 631  O OE1 . GLN A 1 101 ? 23.845 6.794   -6.379  1.00 80.89 ? 101 GLN A OE1 1 
ATOM 632  N NE2 . GLN A 1 101 ? 25.520 8.144   -7.069  1.00 77.93 ? 101 GLN A NE2 1 
ATOM 633  N N   . THR A 1 102 ? 24.640 3.272   -6.267  1.00 77.16 ? 102 THR A N   1 
ATOM 634  C CA  . THR A 1 102 ? 23.885 2.087   -5.967  1.00 76.96 ? 102 THR A CA  1 
ATOM 635  C C   . THR A 1 102 ? 22.454 2.481   -5.884  1.00 77.48 ? 102 THR A C   1 
ATOM 636  O O   . THR A 1 102 ? 22.151 3.484   -5.248  1.00 77.88 ? 102 THR A O   1 
ATOM 637  C CB  . THR A 1 102 ? 24.254 1.557   -4.607  1.00 76.73 ? 102 THR A CB  1 
ATOM 638  O OG1 . THR A 1 102 ? 25.658 1.384   -4.559  1.00 75.94 ? 102 THR A OG1 1 
ATOM 639  C CG2 . THR A 1 102 ? 23.603 0.205   -4.350  1.00 76.86 ? 102 THR A CG2 1 
ATOM 640  N N   . ARG A 1 103 ? 21.580 1.684   -6.499  1.00 77.53 ? 103 ARG A N   1 
ATOM 641  C CA  . ARG A 1 103 ? 20.132 1.938   -6.490  1.00 77.46 ? 103 ARG A CA  1 
ATOM 642  C C   . ARG A 1 103 ? 19.428 0.839   -5.704  1.00 77.10 ? 103 ARG A C   1 
ATOM 643  O O   . ARG A 1 103 ? 19.588 -0.340  -6.039  1.00 77.82 ? 103 ARG A O   1 
ATOM 644  C CB  . ARG A 1 103 ? 19.617 1.940   -7.929  1.00 77.55 ? 103 ARG A CB  1 
ATOM 645  C CG  . ARG A 1 103 ? 18.171 2.474   -8.126  1.00 77.85 ? 103 ARG A CG  1 
ATOM 646  C CD  . ARG A 1 103 ? 17.733 2.569   -9.662  1.00 76.99 ? 103 ARG A CD  1 
ATOM 647  N NE  . ARG A 1 103 ? 18.439 3.592   -10.452 1.00 74.83 ? 103 ARG A NE  1 
ATOM 648  C CZ  . ARG A 1 103 ? 18.496 3.601   -11.782 1.00 76.47 ? 103 ARG A CZ  1 
ATOM 649  N NH1 . ARG A 1 103 ? 17.903 2.644   -12.489 1.00 77.64 ? 103 ARG A NH1 1 
ATOM 650  N NH2 . ARG A 1 103 ? 19.162 4.559   -12.427 1.00 76.92 ? 103 ARG A NH2 1 
ATOM 651  N N   . THR A 1 104 ? 18.674 1.171   -4.666  1.00 75.71 ? 104 THR A N   1 
ATOM 652  C CA  . THR A 1 104 ? 18.048 0.091   -3.931  1.00 75.26 ? 104 THR A CA  1 
ATOM 653  C C   . THR A 1 104 ? 16.583 0.230   -4.028  1.00 75.28 ? 104 THR A C   1 
ATOM 654  O O   . THR A 1 104 ? 16.114 1.332   -4.279  1.00 75.30 ? 104 THR A O   1 
ATOM 655  C CB  . THR A 1 104 ? 18.372 0.102   -2.464  1.00 75.07 ? 104 THR A CB  1 
ATOM 656  O OG1 . THR A 1 104 ? 17.884 1.308   -1.869  1.00 73.23 ? 104 THR A OG1 1 
ATOM 657  C CG2 . THR A 1 104 ? 19.815 -0.019  -2.281  1.00 75.46 ? 104 THR A CG2 1 
ATOM 658  N N   . CYS A 1 105 ? 15.874 -0.886  -3.819  1.00 74.85 ? 105 CYS A N   1 
ATOM 659  C CA  . CYS A 1 105 ? 14.441 -0.864  -3.601  1.00 74.93 ? 105 CYS A CA  1 
ATOM 660  C C   . CYS A 1 105 ? 14.111 -1.403  -2.243  1.00 74.52 ? 105 CYS A C   1 
ATOM 661  O O   . CYS A 1 105 ? 14.472 -2.508  -1.938  1.00 74.21 ? 105 CYS A O   1 
ATOM 662  C CB  . CYS A 1 105 ? 13.709 -1.717  -4.610  1.00 75.24 ? 105 CYS A CB  1 
ATOM 663  S SG  . CYS A 1 105 ? 11.934 -1.671  -4.334  1.00 74.60 ? 105 CYS A SG  1 
ATOM 664  N N   . TRP A 1 106 ? 13.372 -0.631  -1.468  1.00 74.31 ? 106 TRP A N   1 
ATOM 665  C CA  . TRP A 1 106 ? 13.118 -0.947  -0.085  1.00 74.14 ? 106 TRP A CA  1 
ATOM 666  C C   . TRP A 1 106 ? 11.780 -1.593  -0.043  1.00 73.83 ? 106 TRP A C   1 
ATOM 667  O O   . TRP A 1 106 ? 10.843 -1.092  -0.651  1.00 73.97 ? 106 TRP A O   1 
ATOM 668  C CB  . TRP A 1 106 ? 13.140 0.324   0.784   1.00 74.16 ? 106 TRP A CB  1 
ATOM 669  C CG  . TRP A 1 106 ? 14.519 0.826   0.963   1.00 74.27 ? 106 TRP A CG  1 
ATOM 670  C CD1 . TRP A 1 106 ? 15.427 1.097   -0.038  1.00 75.28 ? 106 TRP A CD1 1 
ATOM 671  C CD2 . TRP A 1 106 ? 15.206 1.067   2.196   1.00 73.38 ? 106 TRP A CD2 1 
ATOM 672  N NE1 . TRP A 1 106 ? 16.626 1.511   0.512   1.00 75.47 ? 106 TRP A NE1 1 
ATOM 673  C CE2 . TRP A 1 106 ? 16.510 1.505   1.877   1.00 74.60 ? 106 TRP A CE2 1 
ATOM 674  C CE3 . TRP A 1 106 ? 14.855 0.955   3.533   1.00 74.20 ? 106 TRP A CE3 1 
ATOM 675  C CZ2 . TRP A 1 106 ? 17.450 1.834   2.855   1.00 74.83 ? 106 TRP A CZ2 1 
ATOM 676  C CZ3 . TRP A 1 106 ? 15.807 1.278   4.510   1.00 74.06 ? 106 TRP A CZ3 1 
ATOM 677  C CH2 . TRP A 1 106 ? 17.076 1.702   4.166   1.00 74.03 ? 106 TRP A CH2 1 
ATOM 678  N N   . PHE A 1 107 ? 11.697 -2.693  0.696   1.00 73.41 ? 107 PHE A N   1 
ATOM 679  C CA  . PHE A 1 107 ? 10.482 -3.493  0.777   1.00 73.24 ? 107 PHE A CA  1 
ATOM 680  C C   . PHE A 1 107 ? 9.991  -3.584  2.204   1.00 73.01 ? 107 PHE A C   1 
ATOM 681  O O   . PHE A 1 107 ? 10.656 -4.122  3.050   1.00 72.54 ? 107 PHE A O   1 
ATOM 682  C CB  . PHE A 1 107 ? 10.738 -4.914  0.251   1.00 72.87 ? 107 PHE A CB  1 
ATOM 683  C CG  . PHE A 1 107 ? 10.769 -5.017  -1.246  1.00 71.89 ? 107 PHE A CG  1 
ATOM 684  C CD1 . PHE A 1 107 ? 11.902 -5.438  -1.899  1.00 71.40 ? 107 PHE A CD1 1 
ATOM 685  C CD2 . PHE A 1 107 ? 9.661  -4.700  -2.004  1.00 71.41 ? 107 PHE A CD2 1 
ATOM 686  C CE1 . PHE A 1 107 ? 11.932 -5.530  -3.283  1.00 71.44 ? 107 PHE A CE1 1 
ATOM 687  C CE2 . PHE A 1 107 ? 9.691  -4.806  -3.412  1.00 71.58 ? 107 PHE A CE2 1 
ATOM 688  C CZ  . PHE A 1 107 ? 10.822 -5.211  -4.036  1.00 71.03 ? 107 PHE A CZ  1 
ATOM 689  N N   . SER A 1 108 ? 8.816  -3.047  2.469   1.00 73.60 ? 108 SER A N   1 
ATOM 690  C CA  . SER A 1 108 ? 8.236  -3.152  3.795   1.00 74.01 ? 108 SER A CA  1 
ATOM 691  C C   . SER A 1 108 ? 7.629  -4.523  3.994   1.00 75.01 ? 108 SER A C   1 
ATOM 692  O O   . SER A 1 108 ? 7.350  -5.245  3.011   1.00 75.69 ? 108 SER A O   1 
ATOM 693  C CB  . SER A 1 108 ? 7.110  -2.177  3.912   1.00 73.73 ? 108 SER A CB  1 
ATOM 694  O OG  . SER A 1 108 ? 6.221  -2.420  2.854   1.00 72.38 ? 108 SER A OG  1 
ATOM 695  N N   . GLU A 1 109 ? 7.370  -4.867  5.252   1.00 74.85 ? 109 GLU A N   1 
ATOM 696  C CA  . GLU A 1 109 ? 6.537  -6.014  5.508   1.00 75.29 ? 109 GLU A CA  1 
ATOM 697  C C   . GLU A 1 109 ? 5.265  -5.842  4.685   1.00 75.18 ? 109 GLU A C   1 
ATOM 698  O O   . GLU A 1 109 ? 4.975  -6.653  3.817   1.00 75.23 ? 109 GLU A O   1 
ATOM 699  C CB  . GLU A 1 109 ? 6.233  -6.162  6.998   1.00 75.14 ? 109 GLU A CB  1 
ATOM 700  C CG  . GLU A 1 109 ? 5.699  -7.517  7.394   1.00 75.46 ? 109 GLU A CG  1 
ATOM 701  C CD  . GLU A 1 109 ? 5.345  -7.559  8.869   1.00 76.95 ? 109 GLU A CD  1 
ATOM 702  O OE1 . GLU A 1 109 ? 6.247  -7.259  9.690   1.00 80.42 ? 109 GLU A OE1 1 
ATOM 703  O OE2 . GLU A 1 109 ? 4.172  -7.874  9.213   1.00 77.85 ? 109 GLU A OE2 1 
ATOM 704  N N   . GLU A 1 110 ? 4.549  -4.738  4.903   1.00 75.87 ? 110 GLU A N   1 
ATOM 705  C CA  . GLU A 1 110 ? 3.199  -4.553  4.327   1.00 75.97 ? 110 GLU A CA  1 
ATOM 706  C C   . GLU A 1 110 ? 3.305  -4.767  2.842   1.00 76.51 ? 110 GLU A C   1 
ATOM 707  O O   . GLU A 1 110 ? 2.498  -5.492  2.243   1.00 76.47 ? 110 GLU A O   1 
ATOM 708  C CB  . GLU A 1 110 ? 2.615  -3.171  4.634   1.00 75.45 ? 110 GLU A CB  1 
ATOM 709  N N   . CYS A 1 111 ? 4.349  -4.180  2.257   1.00 77.56 ? 111 CYS A N   1 
ATOM 710  C CA  . CYS A 1 111 ? 4.594  -4.349  0.839   1.00 77.50 ? 111 CYS A CA  1 
ATOM 711  C C   . CYS A 1 111 ? 4.786  -5.833  0.535   1.00 77.30 ? 111 CYS A C   1 
ATOM 712  O O   . CYS A 1 111 ? 4.227  -6.357  -0.450  1.00 76.47 ? 111 CYS A O   1 
ATOM 713  C CB  . CYS A 1 111 ? 5.814  -3.565  0.389   1.00 77.54 ? 111 CYS A CB  1 
ATOM 714  S SG  . CYS A 1 111 ? 6.037  -3.636  -1.395  1.00 80.26 ? 111 CYS A SG  1 
ATOM 715  N N   . LEU A 1 112 ? 5.558  -6.510  1.394   1.00 76.74 ? 112 LEU A N   1 
ATOM 716  C CA  . LEU A 1 112 ? 5.964  -7.853  1.071   1.00 76.52 ? 112 LEU A CA  1 
ATOM 717  C C   . LEU A 1 112 ? 4.730  -8.731  0.935   1.00 76.55 ? 112 LEU A C   1 
ATOM 718  O O   . LEU A 1 112 ? 4.606  -9.490  -0.038  1.00 77.33 ? 112 LEU A O   1 
ATOM 719  C CB  . LEU A 1 112 ? 6.979  -8.398  2.063   1.00 76.62 ? 112 LEU A CB  1 
ATOM 720  C CG  . LEU A 1 112 ? 8.431  -7.931  1.897   1.00 76.43 ? 112 LEU A CG  1 
ATOM 721  C CD1 . LEU A 1 112 ? 9.222  -8.370  3.157   1.00 76.90 ? 112 LEU A CD1 1 
ATOM 722  C CD2 . LEU A 1 112 ? 9.087  -8.425  0.591   1.00 74.59 ? 112 LEU A CD2 1 
ATOM 723  N N   . ARG A 1 113 ? 3.786  -8.577  1.857   1.00 75.90 ? 113 ARG A N   1 
ATOM 724  C CA  . ARG A 1 113 ? 2.549  -9.361  1.830   1.00 75.16 ? 113 ARG A CA  1 
ATOM 725  C C   . ARG A 1 113 ? 1.803  -9.395  0.510   1.00 74.83 ? 113 ARG A C   1 
ATOM 726  O O   . ARG A 1 113 ? 1.407  -10.454 0.080   1.00 75.35 ? 113 ARG A O   1 
ATOM 727  C CB  . ARG A 1 113 ? 1.595  -8.852  2.890   1.00 74.86 ? 113 ARG A CB  1 
ATOM 728  C CG  . ARG A 1 113 ? 1.952  -9.361  4.263   1.00 73.80 ? 113 ARG A CG  1 
ATOM 729  C CD  . ARG A 1 113 ? 1.317  -8.522  5.277   1.00 72.35 ? 113 ARG A CD  1 
ATOM 730  N NE  . ARG A 1 113 ? 1.818  -8.797  6.594   1.00 73.01 ? 113 ARG A NE  1 
ATOM 731  C CZ  . ARG A 1 113 ? 1.461  -9.842  7.329   1.00 74.44 ? 113 ARG A CZ  1 
ATOM 732  N NH1 . ARG A 1 113 ? 0.593  -10.760 6.869   1.00 75.60 ? 113 ARG A NH1 1 
ATOM 733  N NH2 . ARG A 1 113 ? 1.985  -9.974  8.535   1.00 73.68 ? 113 ARG A NH2 1 
ATOM 734  N N   . VAL A 1 114 ? 1.587  -8.200  -0.090  1.00 75.65 ? 114 VAL A N   1 
ATOM 735  C CA  . VAL A 1 114 ? 0.912  -8.065  -1.355  1.00 75.42 ? 114 VAL A CA  1 
ATOM 736  C C   . VAL A 1 114 ? 1.682  -8.876  -2.416  1.00 76.23 ? 114 VAL A C   1 
ATOM 737  O O   . VAL A 1 114 ? 1.115  -9.625  -3.206  1.00 75.34 ? 114 VAL A O   1 
ATOM 738  C CB  . VAL A 1 114 ? 0.838  -6.567  -1.777  1.00 75.08 ? 114 VAL A CB  1 
ATOM 739  C CG1 . VAL A 1 114 ? 0.233  -6.397  -3.198  1.00 75.90 ? 114 VAL A CG1 1 
ATOM 740  C CG2 . VAL A 1 114 ? 0.052  -5.790  -0.830  1.00 74.26 ? 114 VAL A CG2 1 
ATOM 741  N N   . ILE A 1 115 ? 2.993  -8.727  -2.410  1.00 77.58 ? 115 ILE A N   1 
ATOM 742  C CA  . ILE A 1 115 ? 3.803  -9.368  -3.407  1.00 79.30 ? 115 ILE A CA  1 
ATOM 743  C C   . ILE A 1 115 ? 3.500  -10.837 -3.388  1.00 78.87 ? 115 ILE A C   1 
ATOM 744  O O   . ILE A 1 115 ? 3.409  -11.481 -4.459  1.00 79.44 ? 115 ILE A O   1 
ATOM 745  C CB  . ILE A 1 115 ? 5.310  -9.224  -3.148  1.00 79.58 ? 115 ILE A CB  1 
ATOM 746  C CG1 . ILE A 1 115 ? 5.719  -7.749  -3.158  1.00 81.49 ? 115 ILE A CG1 1 
ATOM 747  C CG2 . ILE A 1 115 ? 6.075  -9.916  -4.261  1.00 80.49 ? 115 ILE A CG2 1 
ATOM 748  C CD1 . ILE A 1 115 ? 7.099  -7.493  -2.537  1.00 81.71 ? 115 ILE A CD1 1 
ATOM 749  N N   . PHE A 1 116 ? 3.406  -11.356 -2.180  1.00 76.37 ? 116 PHE A N   1 
ATOM 750  C CA  . PHE A 1 116 ? 3.278  -12.787 -1.968  1.00 75.88 ? 116 PHE A CA  1 
ATOM 751  C C   . PHE A 1 116 ? 1.921  -13.276 -2.440  1.00 75.91 ? 116 PHE A C   1 
ATOM 752  O O   . PHE A 1 116 ? 1.781  -14.429 -2.869  1.00 75.67 ? 116 PHE A O   1 
ATOM 753  C CB  . PHE A 1 116 ? 3.535  -13.164 -0.489  1.00 75.49 ? 116 PHE A CB  1 
ATOM 754  C CG  . PHE A 1 116 ? 4.983  -12.940 -0.008  1.00 74.17 ? 116 PHE A CG  1 
ATOM 755  C CD1 . PHE A 1 116 ? 6.078  -12.983 -0.898  1.00 74.33 ? 116 PHE A CD1 1 
ATOM 756  C CD2 . PHE A 1 116 ? 5.240  -12.719 1.351   1.00 71.91 ? 116 PHE A CD2 1 
ATOM 757  C CE1 . PHE A 1 116 ? 7.409  -12.784 -0.435  1.00 74.57 ? 116 PHE A CE1 1 
ATOM 758  C CE2 . PHE A 1 116 ? 6.537  -12.526 1.836   1.00 72.71 ? 116 PHE A CE2 1 
ATOM 759  C CZ  . PHE A 1 116 ? 7.631  -12.532 0.943   1.00 75.04 ? 116 PHE A CZ  1 
ATOM 760  N N   . ARG A 1 117 ? 0.938  -12.387 -2.409  1.00 75.90 ? 117 ARG A N   1 
ATOM 761  C CA  . ARG A 1 117 ? -0.405 -12.760 -2.763  1.00 76.10 ? 117 ARG A CA  1 
ATOM 762  C C   . ARG A 1 117 ? -0.562 -12.817 -4.253  1.00 76.05 ? 117 ARG A C   1 
ATOM 763  O O   . ARG A 1 117 ? -1.258 -13.667 -4.746  1.00 76.81 ? 117 ARG A O   1 
ATOM 764  C CB  . ARG A 1 117 ? -1.407 -11.813 -2.161  1.00 76.12 ? 117 ARG A CB  1 
ATOM 765  C CG  . ARG A 1 117 ? -1.405 -11.828 -0.654  1.00 78.16 ? 117 ARG A CG  1 
ATOM 766  C CD  . ARG A 1 117 ? -2.342 -10.764 -0.131  1.00 81.56 ? 117 ARG A CD  1 
ATOM 767  N NE  . ARG A 1 117 ? -2.312 -10.599 1.335   1.00 84.42 ? 117 ARG A NE  1 
ATOM 768  C CZ  . ARG A 1 117 ? -2.650 -9.465  1.977   1.00 84.84 ? 117 ARG A CZ  1 
ATOM 769  N NH1 . ARG A 1 117 ? -3.067 -8.374  1.302   1.00 84.44 ? 117 ARG A NH1 1 
ATOM 770  N NH2 . ARG A 1 117 ? -2.575 -9.416  3.313   1.00 83.37 ? 117 ARG A NH2 1 
ATOM 771  N N   . THR A 1 118 ? 0.070  -11.925 -4.989  1.00 76.11 ? 118 THR A N   1 
ATOM 772  C CA  . THR A 1 118 ? 0.065  -12.050 -6.419  1.00 76.00 ? 118 THR A CA  1 
ATOM 773  C C   . THR A 1 118 ? 0.761  -13.307 -6.737  1.00 76.32 ? 118 THR A C   1 
ATOM 774  O O   . THR A 1 118 ? 0.477  -13.943 -7.758  1.00 76.95 ? 118 THR A O   1 
ATOM 775  C CB  . THR A 1 118 ? 0.998  -11.063 -7.143  1.00 76.30 ? 118 THR A CB  1 
ATOM 776  O OG1 . THR A 1 118 ? 1.038  -9.815  -6.447  1.00 76.73 ? 118 THR A OG1 1 
ATOM 777  C CG2 . THR A 1 118 ? 0.578  -10.891 -8.650  1.00 75.64 ? 118 THR A CG2 1 
ATOM 778  N N   . ASP A 1 119 ? 1.772  -13.615 -5.931  1.00 76.32 ? 119 ASP A N   1 
ATOM 779  C CA  . ASP A 1 119 ? 2.764  -14.567 -6.386  1.00 75.94 ? 119 ASP A CA  1 
ATOM 780  C C   . ASP A 1 119 ? 3.604  -15.187 -5.272  1.00 75.67 ? 119 ASP A C   1 
ATOM 781  O O   . ASP A 1 119 ? 4.501  -14.569 -4.721  1.00 75.17 ? 119 ASP A O   1 
ATOM 782  C CB  . ASP A 1 119 ? 3.602  -13.880 -7.454  1.00 75.84 ? 119 ASP A CB  1 
ATOM 783  C CG  . ASP A 1 119 ? 4.856  -14.617 -7.757  1.00 75.65 ? 119 ASP A CG  1 
ATOM 784  O OD1 . ASP A 1 119 ? 4.836  -15.843 -8.010  1.00 73.68 ? 119 ASP A OD1 1 
ATOM 785  O OD2 . ASP A 1 119 ? 5.882  -13.939 -7.732  1.00 77.27 ? 119 ASP A OD2 1 
ATOM 786  N N   . GLU A 1 120 ? 3.314  -16.462 -5.042  1.00 76.15 ? 120 GLU A N   1 
ATOM 787  C CA  . GLU A 1 120 ? 3.498  -17.181 -3.747  1.00 76.96 ? 120 GLU A CA  1 
ATOM 788  C C   . GLU A 1 120 ? 4.781  -17.960 -3.764  1.00 76.28 ? 120 GLU A C   1 
ATOM 789  O O   . GLU A 1 120 ? 5.330  -18.304 -2.709  1.00 75.40 ? 120 GLU A O   1 
ATOM 790  C CB  . GLU A 1 120 ? 2.330  -18.164 -3.561  1.00 76.79 ? 120 GLU A CB  1 
ATOM 791  C CG  . GLU A 1 120 ? 2.363  -19.083 -2.359  1.00 77.87 ? 120 GLU A CG  1 
ATOM 792  C CD  . GLU A 1 120 ? 1.324  -20.221 -2.478  1.00 78.48 ? 120 GLU A CD  1 
ATOM 793  O OE1 . GLU A 1 120 ? 0.990  -20.545 -3.641  1.00 81.08 ? 120 GLU A OE1 1 
ATOM 794  O OE2 . GLU A 1 120 ? 0.883  -20.799 -1.440  1.00 76.98 ? 120 GLU A OE2 1 
ATOM 795  N N   . ASP A 1 121 ? 5.228  -18.253 -4.985  1.00 75.95 ? 121 ASP A N   1 
ATOM 796  C CA  . ASP A 1 121 ? 6.556  -18.798 -5.212  1.00 75.92 ? 121 ASP A CA  1 
ATOM 797  C C   . ASP A 1 121 ? 7.644  -17.846 -4.668  1.00 76.20 ? 121 ASP A C   1 
ATOM 798  O O   . ASP A 1 121 ? 8.756  -18.290 -4.323  1.00 75.47 ? 121 ASP A O   1 
ATOM 799  C CB  . ASP A 1 121 ? 6.802  -18.988 -6.709  1.00 75.64 ? 121 ASP A CB  1 
ATOM 800  C CG  . ASP A 1 121 ? 6.056  -20.136 -7.298  1.00 73.62 ? 121 ASP A CG  1 
ATOM 801  O OD1 . ASP A 1 121 ? 5.415  -20.905 -6.569  1.00 66.99 ? 121 ASP A OD1 1 
ATOM 802  O OD2 . ASP A 1 121 ? 6.160  -20.267 -8.545  1.00 77.06 ? 121 ASP A OD2 1 
ATOM 803  N N   . MET A 1 122 ? 7.328  -16.543 -4.637  1.00 76.63 ? 122 MET A N   1 
ATOM 804  C CA  . MET A 1 122 ? 8.252  -15.537 -4.119  1.00 77.09 ? 122 MET A CA  1 
ATOM 805  C C   . MET A 1 122 ? 8.567  -15.773 -2.647  1.00 77.37 ? 122 MET A C   1 
ATOM 806  O O   . MET A 1 122 ? 9.711  -15.606 -2.261  1.00 78.47 ? 122 MET A O   1 
ATOM 807  C CB  . MET A 1 122 ? 7.721  -14.127 -4.307  1.00 76.97 ? 122 MET A CB  1 
ATOM 808  C CG  . MET A 1 122 ? 8.831  -13.099 -4.356  1.00 78.73 ? 122 MET A CG  1 
ATOM 809  S SD  . MET A 1 122 ? 9.832  -13.046 -5.897  1.00 81.44 ? 122 MET A SD  1 
ATOM 810  C CE  . MET A 1 122 ? 8.724  -13.777 -7.071  1.00 82.92 ? 122 MET A CE  1 
ATOM 811  N N   . ILE A 1 123 ? 7.589  -16.184 -1.838  1.00 76.92 ? 123 ILE A N   1 
ATOM 812  C CA  . ILE A 1 123 ? 7.885  -16.556 -0.472  1.00 77.17 ? 123 ILE A CA  1 
ATOM 813  C C   . ILE A 1 123 ? 9.070  -17.502 -0.428  1.00 77.73 ? 123 ILE A C   1 
ATOM 814  O O   . ILE A 1 123 ? 9.979  -17.328 0.399   1.00 78.21 ? 123 ILE A O   1 
ATOM 815  C CB  . ILE A 1 123 ? 6.772  -17.337 0.233   1.00 77.00 ? 123 ILE A CB  1 
ATOM 816  C CG1 . ILE A 1 123 ? 5.512  -16.517 0.448   1.00 75.77 ? 123 ILE A CG1 1 
ATOM 817  C CG2 . ILE A 1 123 ? 7.244  -17.766 1.599   1.00 77.20 ? 123 ILE A CG2 1 
ATOM 818  C CD1 . ILE A 1 123 ? 4.258  -17.392 0.322   1.00 76.08 ? 123 ILE A CD1 1 
ATOM 819  N N   . PHE A 1 124 ? 9.057  -18.513 -1.287  1.00 77.87 ? 124 PHE A N   1 
ATOM 820  C CA  . PHE A 1 124 ? 10.127 -19.528 -1.272  1.00 78.03 ? 124 PHE A CA  1 
ATOM 821  C C   . PHE A 1 124 ? 11.471 -19.090 -1.832  1.00 78.37 ? 124 PHE A C   1 
ATOM 822  O O   . PHE A 1 124 ? 12.490 -19.657 -1.467  1.00 79.22 ? 124 PHE A O   1 
ATOM 823  C CB  . PHE A 1 124 ? 9.625  -20.814 -1.898  1.00 77.55 ? 124 PHE A CB  1 
ATOM 824  C CG  . PHE A 1 124 ? 8.512  -21.366 -1.121  1.00 77.99 ? 124 PHE A CG  1 
ATOM 825  C CD1 . PHE A 1 124 ? 7.214  -20.889 -1.331  1.00 78.76 ? 124 PHE A CD1 1 
ATOM 826  C CD2 . PHE A 1 124 ? 8.754  -22.206 -0.055  1.00 76.03 ? 124 PHE A CD2 1 
ATOM 827  C CE1 . PHE A 1 124 ? 6.149  -21.331 -0.561  1.00 75.89 ? 124 PHE A CE1 1 
ATOM 828  C CE2 . PHE A 1 124 ? 7.712  -22.628 0.718   1.00 76.66 ? 124 PHE A CE2 1 
ATOM 829  C CZ  . PHE A 1 124 ? 6.389  -22.192 0.443   1.00 77.12 ? 124 PHE A CZ  1 
ATOM 830  N N   . GLU A 1 125 ? 11.508 -18.080 -2.685  1.00 78.73 ? 125 GLU A N   1 
ATOM 831  C CA  . GLU A 1 125 ? 12.801 -17.641 -3.161  1.00 79.33 ? 125 GLU A CA  1 
ATOM 832  C C   . GLU A 1 125 ? 13.292 -16.773 -1.989  1.00 79.58 ? 125 GLU A C   1 
ATOM 833  O O   . GLU A 1 125 ? 14.377 -16.986 -1.489  1.00 80.67 ? 125 GLU A O   1 
ATOM 834  C CB  . GLU A 1 125 ? 12.790 -17.000 -4.589  1.00 79.09 ? 125 GLU A CB  1 
ATOM 835  C CG  . GLU A 1 125 ? 11.763 -17.656 -5.547  1.00 79.59 ? 125 GLU A CG  1 
ATOM 836  C CD  . GLU A 1 125 ? 12.301 -18.168 -6.907  1.00 83.65 ? 125 GLU A CD  1 
ATOM 837  O OE1 . GLU A 1 125 ? 11.466 -18.440 -7.832  1.00 85.86 ? 125 GLU A OE1 1 
ATOM 838  O OE2 . GLU A 1 125 ? 13.532 -18.333 -7.072  1.00 85.32 ? 125 GLU A OE2 1 
ATOM 839  N N   . ILE A 1 126 ? 12.514 -15.873 -1.428  1.00 79.35 ? 126 ILE A N   1 
ATOM 840  C CA  . ILE A 1 126 ? 13.080 -15.272 -0.231  1.00 79.47 ? 126 ILE A CA  1 
ATOM 841  C C   . ILE A 1 126 ? 13.569 -16.345 0.749   1.00 79.60 ? 126 ILE A C   1 
ATOM 842  O O   . ILE A 1 126 ? 14.616 -16.214 1.357   1.00 81.03 ? 126 ILE A O   1 
ATOM 843  C CB  . ILE A 1 126 ? 12.151 -14.355 0.500   1.00 79.06 ? 126 ILE A CB  1 
ATOM 844  C CG1 . ILE A 1 126 ? 12.193 -12.984 -0.145  1.00 78.50 ? 126 ILE A CG1 1 
ATOM 845  C CG2 . ILE A 1 126 ? 12.662 -14.155 1.907   1.00 80.31 ? 126 ILE A CG2 1 
ATOM 846  C CD1 . ILE A 1 126 ? 10.945 -12.173 0.100   1.00 78.30 ? 126 ILE A CD1 1 
ATOM 847  N N   . PHE A 1 127 ? 12.835 -17.411 0.925   1.00 79.47 ? 127 PHE A N   1 
ATOM 848  C CA  . PHE A 1 127 ? 13.285 -18.438 1.849   1.00 79.35 ? 127 PHE A CA  1 
ATOM 849  C C   . PHE A 1 127 ? 14.581 -19.214 1.393   1.00 79.31 ? 127 PHE A C   1 
ATOM 850  O O   . PHE A 1 127 ? 15.501 -19.410 2.217   1.00 78.65 ? 127 PHE A O   1 
ATOM 851  C CB  . PHE A 1 127 ? 12.102 -19.345 2.127   1.00 79.98 ? 127 PHE A CB  1 
ATOM 852  C CG  . PHE A 1 127 ? 12.318 -20.284 3.207   1.00 80.61 ? 127 PHE A CG  1 
ATOM 853  C CD1 . PHE A 1 127 ? 13.356 -20.096 4.136   1.00 82.64 ? 127 PHE A CD1 1 
ATOM 854  C CD2 . PHE A 1 127 ? 11.474 -21.390 3.321   1.00 83.13 ? 127 PHE A CD2 1 
ATOM 855  C CE1 . PHE A 1 127 ? 13.579 -21.025 5.166   1.00 84.34 ? 127 PHE A CE1 1 
ATOM 856  C CE2 . PHE A 1 127 ? 11.666 -22.344 4.350   1.00 84.98 ? 127 PHE A CE2 1 
ATOM 857  C CZ  . PHE A 1 127 ? 12.719 -22.156 5.293   1.00 84.16 ? 127 PHE A CZ  1 
ATOM 858  N N   . LYS A 1 128 ? 14.676 -19.623 0.112   1.00 78.73 ? 128 LYS A N   1 
ATOM 859  C CA  . LYS A 1 128 ? 15.944 -20.156 -0.444  1.00 79.41 ? 128 LYS A CA  1 
ATOM 860  C C   . LYS A 1 128 ? 17.112 -19.229 -0.083  1.00 79.23 ? 128 LYS A C   1 
ATOM 861  O O   . LYS A 1 128 ? 18.249 -19.669 0.171   1.00 79.36 ? 128 LYS A O   1 
ATOM 862  C CB  . LYS A 1 128 ? 15.960 -20.218 -1.995  1.00 79.37 ? 128 LYS A CB  1 
ATOM 863  C CG  . LYS A 1 128 ? 15.516 -21.507 -2.707  1.00 80.67 ? 128 LYS A CG  1 
ATOM 864  C CD  . LYS A 1 128 ? 16.346 -21.744 -4.071  1.00 81.15 ? 128 LYS A CD  1 
ATOM 865  C CE  . LYS A 1 128 ? 15.628 -21.303 -5.418  1.00 82.29 ? 128 LYS A CE  1 
ATOM 866  N NZ  . LYS A 1 128 ? 14.463 -22.145 -5.907  1.00 81.87 ? 128 LYS A NZ  1 
ATOM 867  N N   . ASN A 1 129 ? 16.844 -17.931 -0.154  1.00 79.07 ? 129 ASN A N   1 
ATOM 868  C CA  . ASN A 1 129 ? 17.908 -16.968 -0.186  1.00 79.02 ? 129 ASN A CA  1 
ATOM 869  C C   . ASN A 1 129 ? 18.607 -17.086 1.096   1.00 79.24 ? 129 ASN A C   1 
ATOM 870  O O   . ASN A 1 129 ? 19.839 -17.272 1.152   1.00 78.11 ? 129 ASN A O   1 
ATOM 871  C CB  . ASN A 1 129 ? 17.384 -15.559 -0.298  1.00 78.88 ? 129 ASN A CB  1 
ATOM 872  C CG  . ASN A 1 129 ? 18.490 -14.538 -0.192  1.00 79.16 ? 129 ASN A CG  1 
ATOM 873  O OD1 . ASN A 1 129 ? 18.599 -13.854 0.840   1.00 79.68 ? 129 ASN A OD1 1 
ATOM 874  N ND2 . ASN A 1 129 ? 19.321 -14.410 -1.262  1.00 76.08 ? 129 ASN A ND2 1 
ATOM 875  N N   . TYR A 1 130 ? 17.749 -17.005 2.113   1.00 79.92 ? 130 TYR A N   1 
ATOM 876  C CA  . TYR A 1 130 ? 18.098 -17.059 3.478   1.00 80.52 ? 130 TYR A CA  1 
ATOM 877  C C   . TYR A 1 130 ? 18.662 -18.425 3.838   1.00 79.96 ? 130 TYR A C   1 
ATOM 878  O O   . TYR A 1 130 ? 19.687 -18.521 4.510   1.00 80.67 ? 130 TYR A O   1 
ATOM 879  C CB  . TYR A 1 130 ? 16.834 -16.761 4.247   1.00 83.01 ? 130 TYR A CB  1 
ATOM 880  C CG  . TYR A 1 130 ? 16.427 -15.297 4.212   1.00 86.39 ? 130 TYR A CG  1 
ATOM 881  C CD1 . TYR A 1 130 ? 17.121 -14.384 3.392   1.00 87.71 ? 130 TYR A CD1 1 
ATOM 882  C CD2 . TYR A 1 130 ? 15.347 -14.814 5.018   1.00 88.88 ? 130 TYR A CD2 1 
ATOM 883  C CE1 . TYR A 1 130 ? 16.786 -13.069 3.350   1.00 88.02 ? 130 TYR A CE1 1 
ATOM 884  C CE2 . TYR A 1 130 ? 14.980 -13.474 4.972   1.00 89.55 ? 130 TYR A CE2 1 
ATOM 885  C CZ  . TYR A 1 130 ? 15.724 -12.619 4.116   1.00 89.57 ? 130 TYR A CZ  1 
ATOM 886  O OH  . TYR A 1 130 ? 15.446 -11.289 3.998   1.00 91.03 ? 130 TYR A OH  1 
ATOM 887  N N   . LEU A 1 131 ? 18.035 -19.500 3.375   1.00 79.08 ? 131 LEU A N   1 
ATOM 888  C CA  . LEU A 1 131 ? 18.597 -20.849 3.606   1.00 78.23 ? 131 LEU A CA  1 
ATOM 889  C C   . LEU A 1 131 ? 20.063 -20.989 3.201   1.00 77.44 ? 131 LEU A C   1 
ATOM 890  O O   . LEU A 1 131 ? 20.846 -21.558 3.921   1.00 77.72 ? 131 LEU A O   1 
ATOM 891  C CB  . LEU A 1 131 ? 17.832 -21.901 2.830   1.00 77.96 ? 131 LEU A CB  1 
ATOM 892  C CG  . LEU A 1 131 ? 16.623 -22.641 3.410   1.00 80.02 ? 131 LEU A CG  1 
ATOM 893  C CD1 . LEU A 1 131 ? 16.581 -23.911 2.549   1.00 80.40 ? 131 LEU A CD1 1 
ATOM 894  C CD2 . LEU A 1 131 ? 16.599 -22.961 5.005   1.00 79.37 ? 131 LEU A CD2 1 
ATOM 895  N N   . THR A 1 132 ? 20.443 -20.497 2.031   1.00 76.66 ? 132 THR A N   1 
ATOM 896  C CA  . THR A 1 132 ? 21.827 -20.566 1.652   1.00 75.42 ? 132 THR A CA  1 
ATOM 897  C C   . THR A 1 132 ? 22.636 -19.704 2.547   1.00 74.76 ? 132 THR A C   1 
ATOM 898  O O   . THR A 1 132 ? 23.675 -20.110 2.993   1.00 74.55 ? 132 THR A O   1 
ATOM 899  C CB  . THR A 1 132 ? 22.041 -20.094 0.260   1.00 75.66 ? 132 THR A CB  1 
ATOM 900  O OG1 . THR A 1 132 ? 20.987 -20.614 -0.543  1.00 73.11 ? 132 THR A OG1 1 
ATOM 901  C CG2 . THR A 1 132 ? 23.432 -20.585 -0.237  1.00 77.00 ? 132 THR A CG2 1 
ATOM 902  N N   . LYS A 1 133 ? 22.164 -18.495 2.801   1.00 74.69 ? 133 LYS A N   1 
ATOM 903  C CA  . LYS A 1 133 ? 22.870 -17.593 3.700   1.00 74.34 ? 133 LYS A CA  1 
ATOM 904  C C   . LYS A 1 133 ? 23.254 -18.297 5.005   1.00 74.75 ? 133 LYS A C   1 
ATOM 905  O O   . LYS A 1 133 ? 24.450 -18.324 5.350   1.00 74.79 ? 133 LYS A O   1 
ATOM 906  C CB  . LYS A 1 133 ? 22.063 -16.338 3.947   1.00 73.76 ? 133 LYS A CB  1 
ATOM 907  C CG  . LYS A 1 133 ? 22.288 -15.331 2.849   1.00 72.92 ? 133 LYS A CG  1 
ATOM 908  C CD  . LYS A 1 133 ? 21.461 -14.110 3.057   1.00 72.18 ? 133 LYS A CD  1 
ATOM 909  C CE  . LYS A 1 133 ? 21.485 -13.253 1.840   1.00 72.04 ? 133 LYS A CE  1 
ATOM 910  N NZ  . LYS A 1 133 ? 20.473 -12.153 1.968   1.00 73.34 ? 133 LYS A NZ  1 
ATOM 911  N N   . VAL A 1 134 ? 22.302 -18.946 5.676   1.00 74.21 ? 134 VAL A N   1 
ATOM 912  C CA  . VAL A 1 134 ? 22.675 -19.647 6.900   1.00 74.37 ? 134 VAL A CA  1 
ATOM 913  C C   . VAL A 1 134 ? 23.673 -20.752 6.700   1.00 74.25 ? 134 VAL A C   1 
ATOM 914  O O   . VAL A 1 134 ? 24.638 -20.851 7.441   1.00 73.54 ? 134 VAL A O   1 
ATOM 915  C CB  . VAL A 1 134 ? 21.530 -20.261 7.638   1.00 74.61 ? 134 VAL A CB  1 
ATOM 916  C CG1 . VAL A 1 134 ? 22.059 -20.878 8.920   1.00 73.68 ? 134 VAL A CG1 1 
ATOM 917  C CG2 . VAL A 1 134 ? 20.514 -19.182 8.014   1.00 76.25 ? 134 VAL A CG2 1 
ATOM 918  N N   . ALA A 1 135 ? 23.424 -21.608 5.719   1.00 74.57 ? 135 ALA A N   1 
ATOM 919  C CA  . ALA A 1 135 ? 24.378 -22.659 5.373   1.00 74.35 ? 135 ALA A CA  1 
ATOM 920  C C   . ALA A 1 135 ? 25.777 -22.054 5.212   1.00 74.60 ? 135 ALA A C   1 
ATOM 921  O O   . ALA A 1 135 ? 26.767 -22.476 5.813   1.00 74.01 ? 135 ALA A O   1 
ATOM 922  C CB  . ALA A 1 135 ? 23.949 -23.354 4.118   1.00 73.95 ? 135 ALA A CB  1 
ATOM 923  N N   . TYR A 1 136 ? 25.845 -20.996 4.445   1.00 75.23 ? 136 TYR A N   1 
ATOM 924  C CA  . TYR A 1 136 ? 27.124 -20.543 4.009   1.00 75.58 ? 136 TYR A CA  1 
ATOM 925  C C   . TYR A 1 136 ? 27.955 -20.050 5.136   1.00 75.13 ? 136 TYR A C   1 
ATOM 926  O O   . TYR A 1 136 ? 29.116 -20.411 5.230   1.00 76.12 ? 136 TYR A O   1 
ATOM 927  C CB  . TYR A 1 136 ? 26.950 -19.472 3.015   1.00 76.37 ? 136 TYR A CB  1 
ATOM 928  C CG  . TYR A 1 136 ? 28.198 -18.742 2.699   1.00 78.30 ? 136 TYR A CG  1 
ATOM 929  C CD1 . TYR A 1 136 ? 29.085 -19.200 1.744   1.00 78.61 ? 136 TYR A CD1 1 
ATOM 930  C CD2 . TYR A 1 136 ? 28.461 -17.538 3.327   1.00 80.29 ? 136 TYR A CD2 1 
ATOM 931  C CE1 . TYR A 1 136 ? 30.182 -18.482 1.440   1.00 78.18 ? 136 TYR A CE1 1 
ATOM 932  C CE2 . TYR A 1 136 ? 29.529 -16.839 3.038   1.00 78.54 ? 136 TYR A CE2 1 
ATOM 933  C CZ  . TYR A 1 136 ? 30.387 -17.298 2.106   1.00 78.89 ? 136 TYR A CZ  1 
ATOM 934  O OH  . TYR A 1 136 ? 31.470 -16.502 1.894   1.00 81.88 ? 136 TYR A OH  1 
ATOM 935  N N   . TYR A 1 137 ? 27.382 -19.225 6.000   1.00 74.29 ? 137 TYR A N   1 
ATOM 936  C CA  . TYR A 1 137 ? 28.123 -18.752 7.175   1.00 73.00 ? 137 TYR A CA  1 
ATOM 937  C C   . TYR A 1 137 ? 28.322 -19.792 8.233   1.00 72.15 ? 137 TYR A C   1 
ATOM 938  O O   . TYR A 1 137 ? 29.288 -19.730 8.970   1.00 71.22 ? 137 TYR A O   1 
ATOM 939  C CB  . TYR A 1 137 ? 27.424 -17.562 7.788   1.00 72.90 ? 137 TYR A CB  1 
ATOM 940  C CG  . TYR A 1 137 ? 27.374 -16.418 6.826   1.00 72.30 ? 137 TYR A CG  1 
ATOM 941  C CD1 . TYR A 1 137 ? 26.186 -15.989 6.314   1.00 71.65 ? 137 TYR A CD1 1 
ATOM 942  C CD2 . TYR A 1 137 ? 28.528 -15.833 6.370   1.00 71.53 ? 137 TYR A CD2 1 
ATOM 943  C CE1 . TYR A 1 137 ? 26.136 -14.985 5.443   1.00 71.17 ? 137 TYR A CE1 1 
ATOM 944  C CE2 . TYR A 1 137 ? 28.494 -14.827 5.497   1.00 70.98 ? 137 TYR A CE2 1 
ATOM 945  C CZ  . TYR A 1 137 ? 27.288 -14.394 5.046   1.00 72.29 ? 137 TYR A CZ  1 
ATOM 946  O OH  . TYR A 1 137 ? 27.210 -13.357 4.173   1.00 73.71 ? 137 TYR A OH  1 
ATOM 947  N N   . ALA A 1 138 ? 27.409 -20.755 8.302   1.00 71.90 ? 138 ALA A N   1 
ATOM 948  C CA  . ALA A 1 138 ? 27.510 -21.816 9.303   1.00 71.69 ? 138 ALA A CA  1 
ATOM 949  C C   . ALA A 1 138 ? 28.663 -22.744 8.982   1.00 71.26 ? 138 ALA A C   1 
ATOM 950  O O   . ALA A 1 138 ? 29.299 -23.260 9.878   1.00 71.29 ? 138 ALA A O   1 
ATOM 951  C CB  . ALA A 1 138 ? 26.226 -22.594 9.400   1.00 71.44 ? 138 ALA A CB  1 
ATOM 952  N N   . ARG A 1 139 ? 28.909 -22.946 7.700   1.00 71.02 ? 139 ARG A N   1 
ATOM 953  C CA  . ARG A 1 139 ? 30.001 -23.753 7.246   1.00 71.36 ? 139 ARG A CA  1 
ATOM 954  C C   . ARG A 1 139 ? 31.253 -23.108 7.735   1.00 71.24 ? 139 ARG A C   1 
ATOM 955  O O   . ARG A 1 139 ? 32.049 -23.709 8.444   1.00 72.09 ? 139 ARG A O   1 
ATOM 956  C CB  . ARG A 1 139 ? 30.000 -23.774 5.721   1.00 72.06 ? 139 ARG A CB  1 
ATOM 957  C CG  . ARG A 1 139 ? 31.167 -24.432 5.070   1.00 73.21 ? 139 ARG A CG  1 
ATOM 958  C CD  . ARG A 1 139 ? 30.760 -25.024 3.761   1.00 77.20 ? 139 ARG A CD  1 
ATOM 959  N NE  . ARG A 1 139 ? 31.696 -26.100 3.458   1.00 81.06 ? 139 ARG A NE  1 
ATOM 960  C CZ  . ARG A 1 139 ? 31.391 -27.305 2.961   1.00 83.51 ? 139 ARG A CZ  1 
ATOM 961  N NH1 . ARG A 1 139 ? 30.138 -27.662 2.670   1.00 84.72 ? 139 ARG A NH1 1 
ATOM 962  N NH2 . ARG A 1 139 ? 32.371 -28.185 2.764   1.00 83.03 ? 139 ARG A NH2 1 
ATOM 963  N N   . GLN A 1 140 ? 31.412 -21.849 7.378   1.00 70.83 ? 140 GLN A N   1 
ATOM 964  C CA  . GLN A 1 140 ? 32.607 -21.097 7.730   1.00 70.16 ? 140 GLN A CA  1 
ATOM 965  C C   . GLN A 1 140 ? 32.870 -20.943 9.200   1.00 68.80 ? 140 GLN A C   1 
ATOM 966  O O   . GLN A 1 140 ? 33.955 -20.600 9.556   1.00 68.37 ? 140 GLN A O   1 
ATOM 967  C CB  . GLN A 1 140 ? 32.495 -19.692 7.190   1.00 70.53 ? 140 GLN A CB  1 
ATOM 968  C CG  . GLN A 1 140 ? 32.549 -19.595 5.715   1.00 72.61 ? 140 GLN A CG  1 
ATOM 969  C CD  . GLN A 1 140 ? 33.053 -18.258 5.323   1.00 76.45 ? 140 GLN A CD  1 
ATOM 970  O OE1 . GLN A 1 140 ? 33.959 -17.711 5.975   1.00 81.70 ? 140 GLN A OE1 1 
ATOM 971  N NE2 . GLN A 1 140 ? 32.481 -17.693 4.278   1.00 76.32 ? 140 GLN A NE2 1 
ATOM 972  N N   . VAL A 1 141 ? 31.880 -21.093 10.058  1.00 68.01 ? 141 VAL A N   1 
ATOM 973  C CA  . VAL A 1 141 ? 32.197 -21.058 11.456  1.00 67.65 ? 141 VAL A CA  1 
ATOM 974  C C   . VAL A 1 141 ? 32.882 -22.363 11.695  1.00 67.24 ? 141 VAL A C   1 
ATOM 975  O O   . VAL A 1 141 ? 34.032 -22.383 12.065  1.00 67.06 ? 141 VAL A O   1 
ATOM 976  C CB  . VAL A 1 141 ? 30.979 -20.899 12.352  1.00 67.90 ? 141 VAL A CB  1 
ATOM 977  C CG1 . VAL A 1 141 ? 31.290 -21.356 13.773  1.00 67.23 ? 141 VAL A CG1 1 
ATOM 978  C CG2 . VAL A 1 141 ? 30.535 -19.448 12.355  1.00 68.40 ? 141 VAL A CG2 1 
ATOM 979  N N   . ALA A 1 142 ? 32.176 -23.449 11.429  1.00 66.84 ? 142 ALA A N   1 
ATOM 980  C CA  . ALA A 1 142 ? 32.736 -24.772 11.513  1.00 67.04 ? 142 ALA A CA  1 
ATOM 981  C C   . ALA A 1 142 ? 34.134 -24.936 10.920  1.00 67.71 ? 142 ALA A C   1 
ATOM 982  O O   . ALA A 1 142 ? 34.876 -25.776 11.400  1.00 68.07 ? 142 ALA A O   1 
ATOM 983  C CB  . ALA A 1 142 ? 31.816 -25.757 10.866  1.00 66.95 ? 142 ALA A CB  1 
ATOM 984  N N   . GLU A 1 143 ? 34.486 -24.187 9.873   1.00 68.31 ? 143 GLU A N   1 
ATOM 985  C CA  . GLU A 1 143 ? 35.834 -24.255 9.269   1.00 68.82 ? 143 GLU A CA  1 
ATOM 986  C C   . GLU A 1 143 ? 36.927 -23.537 10.058  1.00 69.41 ? 143 GLU A C   1 
ATOM 987  O O   . GLU A 1 143 ? 38.121 -23.707 9.809   1.00 69.52 ? 143 GLU A O   1 
ATOM 988  C CB  . GLU A 1 143 ? 35.812 -23.652 7.882   1.00 68.83 ? 143 GLU A CB  1 
ATOM 989  C CG  . GLU A 1 143 ? 34.939 -24.434 6.909   1.00 70.57 ? 143 GLU A CG  1 
ATOM 990  C CD  . GLU A 1 143 ? 34.943 -23.852 5.493   1.00 69.78 ? 143 GLU A CD  1 
ATOM 991  O OE1 . GLU A 1 143 ? 35.471 -22.739 5.310   1.00 67.31 ? 143 GLU A OE1 1 
ATOM 992  O OE2 . GLU A 1 143 ? 34.417 -24.525 4.575   1.00 72.10 ? 143 GLU A OE2 1 
ATOM 993  N N   . ILE A 1 144 ? 36.525 -22.691 10.989  1.00 70.32 ? 144 ILE A N   1 
ATOM 994  C CA  . ILE A 1 144 ? 37.461 -22.055 11.858  1.00 70.57 ? 144 ILE A CA  1 
ATOM 995  C C   . ILE A 1 144 ? 38.114 -23.198 12.539  1.00 71.25 ? 144 ILE A C   1 
ATOM 996  O O   . ILE A 1 144 ? 37.425 -24.085 13.051  1.00 70.95 ? 144 ILE A O   1 
ATOM 997  C CB  . ILE A 1 144 ? 36.732 -21.247 12.885  1.00 71.01 ? 144 ILE A CB  1 
ATOM 998  C CG1 . ILE A 1 144 ? 36.251 -19.930 12.298  1.00 70.49 ? 144 ILE A CG1 1 
ATOM 999  C CG2 . ILE A 1 144 ? 37.589 -21.006 14.109  1.00 72.20 ? 144 ILE A CG2 1 
ATOM 1000 C CD1 . ILE A 1 144 ? 34.997 -19.497 12.989  1.00 70.66 ? 144 ILE A CD1 1 
ATOM 1001 N N   . ASN A 1 145 ? 39.441 -23.204 12.508  1.00 72.70 ? 145 ASN A N   1 
ATOM 1002 C CA  . ASN A 1 145 ? 40.226 -24.197 13.251  1.00 73.42 ? 145 ASN A CA  1 
ATOM 1003 C C   . ASN A 1 145 ? 40.440 -23.758 14.683  1.00 74.05 ? 145 ASN A C   1 
ATOM 1004 O O   . ASN A 1 145 ? 41.302 -22.957 14.966  1.00 74.35 ? 145 ASN A O   1 
ATOM 1005 C CB  . ASN A 1 145 ? 41.570 -24.465 12.608  1.00 73.18 ? 145 ASN A CB  1 
ATOM 1006 C CG  . ASN A 1 145 ? 42.309 -25.562 13.314  1.00 74.15 ? 145 ASN A CG  1 
ATOM 1007 O OD1 . ASN A 1 145 ? 42.661 -26.575 12.703  1.00 78.02 ? 145 ASN A OD1 1 
ATOM 1008 N ND2 . ASN A 1 145 ? 42.524 -25.396 14.618  1.00 71.72 ? 145 ASN A ND2 1 
ATOM 1009 N N   . THR A 1 146 ? 39.649 -24.338 15.572  1.00 75.25 ? 146 THR A N   1 
ATOM 1010 C CA  . THR A 1 146 ? 39.609 -24.009 16.975  1.00 75.55 ? 146 THR A CA  1 
ATOM 1011 C C   . THR A 1 146 ? 40.532 -24.954 17.713  1.00 75.99 ? 146 THR A C   1 
ATOM 1012 O O   . THR A 1 146 ? 40.765 -24.795 18.914  1.00 75.58 ? 146 THR A O   1 
ATOM 1013 C CB  . THR A 1 146 ? 38.151 -24.146 17.489  1.00 75.91 ? 146 THR A CB  1 
ATOM 1014 O OG1 . THR A 1 146 ? 37.772 -25.532 17.586  1.00 75.46 ? 146 THR A OG1 1 
ATOM 1015 C CG2 . THR A 1 146 ? 37.203 -23.435 16.525  1.00 76.14 ? 146 THR A CG2 1 
ATOM 1016 N N   . TYR A 1 147 ? 41.075 -25.932 16.994  1.00 76.94 ? 147 TYR A N   1 
ATOM 1017 C CA  . TYR A 1 147 ? 41.978 -26.863 17.627  1.00 77.86 ? 147 TYR A CA  1 
ATOM 1018 C C   . TYR A 1 147 ? 43.369 -26.372 18.015  1.00 78.37 ? 147 TYR A C   1 
ATOM 1019 O O   . TYR A 1 147 ? 43.628 -26.336 19.214  1.00 78.33 ? 147 TYR A O   1 
ATOM 1020 C CB  . TYR A 1 147 ? 42.099 -28.195 16.901  1.00 78.27 ? 147 TYR A CB  1 
ATOM 1021 C CG  . TYR A 1 147 ? 42.938 -29.116 17.753  1.00 78.39 ? 147 TYR A CG  1 
ATOM 1022 C CD1 . TYR A 1 147 ? 42.489 -29.510 19.013  1.00 78.63 ? 147 TYR A CD1 1 
ATOM 1023 C CD2 . TYR A 1 147 ? 44.209 -29.517 17.352  1.00 78.81 ? 147 TYR A CD2 1 
ATOM 1024 C CE1 . TYR A 1 147 ? 43.258 -30.319 19.824  1.00 78.58 ? 147 TYR A CE1 1 
ATOM 1025 C CE2 . TYR A 1 147 ? 44.991 -30.334 18.163  1.00 78.94 ? 147 TYR A CE2 1 
ATOM 1026 C CZ  . TYR A 1 147 ? 44.507 -30.730 19.395  1.00 78.44 ? 147 TYR A CZ  1 
ATOM 1027 O OH  . TYR A 1 147 ? 45.262 -31.535 20.206  1.00 78.78 ? 147 TYR A OH  1 
ATOM 1028 N N   . ASN A 1 148 ? 44.285 -26.029 17.100  1.00 79.15 ? 148 ASN A N   1 
ATOM 1029 C CA  . ASN A 1 148 ? 45.557 -25.541 17.643  1.00 79.88 ? 148 ASN A CA  1 
ATOM 1030 C C   . ASN A 1 148 ? 45.242 -24.547 18.683  1.00 79.90 ? 148 ASN A C   1 
ATOM 1031 O O   . ASN A 1 148 ? 45.488 -24.817 19.865  1.00 80.75 ? 148 ASN A O   1 
ATOM 1032 C CB  . ASN A 1 148 ? 46.482 -24.838 16.666  1.00 80.07 ? 148 ASN A CB  1 
ATOM 1033 C CG  . ASN A 1 148 ? 46.954 -25.748 15.628  1.00 80.87 ? 148 ASN A CG  1 
ATOM 1034 O OD1 . ASN A 1 148 ? 47.500 -26.811 15.935  1.00 82.84 ? 148 ASN A OD1 1 
ATOM 1035 N ND2 . ASN A 1 148 ? 46.722 -25.383 14.369  1.00 79.97 ? 148 ASN A ND2 1 
ATOM 1036 N N   . PRO A 1 149 ? 44.590 -23.435 18.266  1.00 79.59 ? 149 PRO A N   1 
ATOM 1037 C CA  . PRO A 1 149 ? 44.524 -22.175 18.998  1.00 78.83 ? 149 PRO A CA  1 
ATOM 1038 C C   . PRO A 1 149 ? 44.111 -22.421 20.414  1.00 77.96 ? 149 PRO A C   1 
ATOM 1039 O O   . PRO A 1 149 ? 44.218 -21.542 21.216  1.00 78.20 ? 149 PRO A O   1 
ATOM 1040 C CB  . PRO A 1 149 ? 43.450 -21.369 18.249  1.00 78.49 ? 149 PRO A CB  1 
ATOM 1041 C CG  . PRO A 1 149 ? 42.726 -22.326 17.502  1.00 79.56 ? 149 PRO A CG  1 
ATOM 1042 C CD  . PRO A 1 149 ? 43.706 -23.378 17.091  1.00 79.82 ? 149 PRO A CD  1 
ATOM 1043 N N   . THR A 1 150 ? 43.677 -23.639 20.700  1.00 77.65 ? 150 THR A N   1 
ATOM 1044 C CA  . THR A 1 150 ? 43.361 -24.096 22.035  1.00 77.80 ? 150 THR A CA  1 
ATOM 1045 C C   . THR A 1 150 ? 44.586 -24.691 22.790  1.00 77.93 ? 150 THR A C   1 
ATOM 1046 O O   . THR A 1 150 ? 44.829 -24.364 23.964  1.00 77.53 ? 150 THR A O   1 
ATOM 1047 C CB  . THR A 1 150 ? 42.227 -25.112 21.910  1.00 77.89 ? 150 THR A CB  1 
ATOM 1048 O OG1 . THR A 1 150 ? 40.969 -24.420 21.882  1.00 78.11 ? 150 THR A OG1 1 
ATOM 1049 C CG2 . THR A 1 150 ? 42.227 -26.070 23.051  1.00 78.03 ? 150 THR A CG2 1 
ATOM 1050 N N   . ILE A 1 151 ? 45.310 -25.597 22.129  1.00 77.95 ? 151 ILE A N   1 
ATOM 1051 C CA  . ILE A 1 151 ? 46.666 -25.942 22.532  1.00 78.19 ? 151 ILE A CA  1 
ATOM 1052 C C   . ILE A 1 151 ? 47.507 -24.656 22.769  1.00 78.40 ? 151 ILE A C   1 
ATOM 1053 O O   . ILE A 1 151 ? 48.096 -24.490 23.827  1.00 78.62 ? 151 ILE A O   1 
ATOM 1054 C CB  . ILE A 1 151 ? 47.315 -26.925 21.501  1.00 78.27 ? 151 ILE A CB  1 
ATOM 1055 C CG1 . ILE A 1 151 ? 47.159 -28.373 21.967  1.00 79.13 ? 151 ILE A CG1 1 
ATOM 1056 C CG2 . ILE A 1 151 ? 48.805 -26.699 21.338  1.00 78.17 ? 151 ILE A CG2 1 
ATOM 1057 C CD1 . ILE A 1 151 ? 45.744 -28.779 22.373  1.00 79.77 ? 151 ILE A CD1 1 
ATOM 1058 N N   . ARG A 1 152 ? 47.552 -23.740 21.806  1.00 78.60 ? 152 ARG A N   1 
ATOM 1059 C CA  . ARG A 1 152 ? 48.298 -22.474 21.980  1.00 78.22 ? 152 ARG A CA  1 
ATOM 1060 C C   . ARG A 1 152 ? 47.940 -21.739 23.265  1.00 77.88 ? 152 ARG A C   1 
ATOM 1061 O O   . ARG A 1 152 ? 48.785 -21.153 23.922  1.00 77.38 ? 152 ARG A O   1 
ATOM 1062 C CB  . ARG A 1 152 ? 48.014 -21.526 20.816  1.00 78.54 ? 152 ARG A CB  1 
ATOM 1063 C CG  . ARG A 1 152 ? 49.057 -21.410 19.749  1.00 76.89 ? 152 ARG A CG  1 
ATOM 1064 C CD  . ARG A 1 152 ? 48.556 -20.383 18.743  1.00 77.69 ? 152 ARG A CD  1 
ATOM 1065 N NE  . ARG A 1 152 ? 48.301 -20.992 17.462  1.00 77.38 ? 152 ARG A NE  1 
ATOM 1066 C CZ  . ARG A 1 152 ? 47.444 -20.528 16.569  1.00 79.11 ? 152 ARG A CZ  1 
ATOM 1067 N NH1 . ARG A 1 152 ? 46.754 -19.427 16.819  1.00 78.47 ? 152 ARG A NH1 1 
ATOM 1068 N NH2 . ARG A 1 152 ? 47.291 -21.171 15.401  1.00 81.70 ? 152 ARG A NH2 1 
ATOM 1069 N N   . ILE A 1 153 ? 46.664 -21.730 23.605  1.00 78.24 ? 153 ILE A N   1 
ATOM 1070 C CA  . ILE A 1 153 ? 46.236 -21.041 24.837  1.00 78.40 ? 153 ILE A CA  1 
ATOM 1071 C C   . ILE A 1 153 ? 46.839 -21.645 26.075  1.00 77.86 ? 153 ILE A C   1 
ATOM 1072 O O   . ILE A 1 153 ? 47.286 -20.950 26.955  1.00 78.17 ? 153 ILE A O   1 
ATOM 1073 C CB  . ILE A 1 153 ? 44.724 -21.107 25.092  1.00 78.47 ? 153 ILE A CB  1 
ATOM 1074 C CG1 . ILE A 1 153 ? 43.966 -20.365 23.973  1.00 79.06 ? 153 ILE A CG1 1 
ATOM 1075 C CG2 . ILE A 1 153 ? 44.435 -20.578 26.518  1.00 78.18 ? 153 ILE A CG2 1 
ATOM 1076 C CD1 . ILE A 1 153 ? 42.869 -19.385 24.424  1.00 79.45 ? 153 ILE A CD1 1 
ATOM 1077 N N   . LEU A 1 154 ? 46.781 -22.951 26.173  1.00 77.76 ? 154 LEU A N   1 
ATOM 1078 C CA  . LEU A 1 154 ? 47.296 -23.614 27.353  1.00 77.76 ? 154 LEU A CA  1 
ATOM 1079 C C   . LEU A 1 154 ? 48.782 -23.300 27.484  1.00 77.70 ? 154 LEU A C   1 
ATOM 1080 O O   . LEU A 1 154 ? 49.277 -22.870 28.543  1.00 77.49 ? 154 LEU A O   1 
ATOM 1081 C CB  . LEU A 1 154 ? 47.083 -25.106 27.222  1.00 77.65 ? 154 LEU A CB  1 
ATOM 1082 C CG  . LEU A 1 154 ? 45.632 -25.486 26.994  1.00 77.21 ? 154 LEU A CG  1 
ATOM 1083 C CD1 . LEU A 1 154 ? 45.603 -26.793 26.286  1.00 77.21 ? 154 LEU A CD1 1 
ATOM 1084 C CD2 . LEU A 1 154 ? 44.906 -25.542 28.324  1.00 77.72 ? 154 LEU A CD2 1 
ATOM 1085 N N   . ARG A 1 155 ? 49.476 -23.503 26.375  1.00 77.45 ? 155 ARG A N   1 
ATOM 1086 C CA  . ARG A 1 155 ? 50.893 -23.256 26.299  1.00 77.64 ? 155 ARG A CA  1 
ATOM 1087 C C   . ARG A 1 155 ? 51.206 -21.950 26.966  1.00 76.98 ? 155 ARG A C   1 
ATOM 1088 O O   . ARG A 1 155 ? 52.019 -21.898 27.871  1.00 76.47 ? 155 ARG A O   1 
ATOM 1089 C CB  . ARG A 1 155 ? 51.289 -23.185 24.851  1.00 78.16 ? 155 ARG A CB  1 
ATOM 1090 C CG  . ARG A 1 155 ? 52.717 -23.338 24.628  1.00 80.99 ? 155 ARG A CG  1 
ATOM 1091 C CD  . ARG A 1 155 ? 52.995 -24.739 24.160  1.00 85.95 ? 155 ARG A CD  1 
ATOM 1092 N NE  . ARG A 1 155 ? 53.209 -25.651 25.287  1.00 89.50 ? 155 ARG A NE  1 
ATOM 1093 C CZ  . ARG A 1 155 ? 53.805 -26.837 25.183  1.00 90.06 ? 155 ARG A CZ  1 
ATOM 1094 N NH1 . ARG A 1 155 ? 54.241 -27.250 23.988  1.00 91.92 ? 155 ARG A NH1 1 
ATOM 1095 N NH2 . ARG A 1 155 ? 53.965 -27.607 26.263  1.00 87.96 ? 155 ARG A NH2 1 
ATOM 1096 N N   . LEU A 1 156 ? 50.509 -20.904 26.528  1.00 76.90 ? 156 LEU A N   1 
ATOM 1097 C CA  . LEU A 1 156 ? 50.586 -19.592 27.170  1.00 77.03 ? 156 LEU A CA  1 
ATOM 1098 C C   . LEU A 1 156 ? 50.498 -19.651 28.693  1.00 77.02 ? 156 LEU A C   1 
ATOM 1099 O O   . LEU A 1 156 ? 51.345 -19.092 29.377  1.00 77.35 ? 156 LEU A O   1 
ATOM 1100 C CB  . LEU A 1 156 ? 49.467 -18.681 26.677  1.00 77.23 ? 156 LEU A CB  1 
ATOM 1101 C CG  . LEU A 1 156 ? 49.387 -17.314 27.376  1.00 76.91 ? 156 LEU A CG  1 
ATOM 1102 C CD1 . LEU A 1 156 ? 50.635 -16.497 27.053  1.00 77.81 ? 156 LEU A CD1 1 
ATOM 1103 C CD2 . LEU A 1 156 ? 48.143 -16.529 26.956  1.00 76.38 ? 156 LEU A CD2 1 
ATOM 1104 N N   . PHE A 1 157 ? 49.472 -20.307 29.226  1.00 76.75 ? 157 PHE A N   1 
ATOM 1105 C CA  . PHE A 1 157 ? 49.318 -20.379 30.678  1.00 76.80 ? 157 PHE A CA  1 
ATOM 1106 C C   . PHE A 1 157 ? 50.418 -21.174 31.361  1.00 76.97 ? 157 PHE A C   1 
ATOM 1107 O O   . PHE A 1 157 ? 50.837 -20.839 32.453  1.00 76.79 ? 157 PHE A O   1 
ATOM 1108 C CB  . PHE A 1 157 ? 47.993 -21.010 31.062  1.00 76.53 ? 157 PHE A CB  1 
ATOM 1109 C CG  . PHE A 1 157 ? 46.830 -20.091 30.921  1.00 77.13 ? 157 PHE A CG  1 
ATOM 1110 C CD1 . PHE A 1 157 ? 45.933 -20.232 29.867  1.00 77.08 ? 157 PHE A CD1 1 
ATOM 1111 C CD2 . PHE A 1 157 ? 46.624 -19.069 31.845  1.00 76.37 ? 157 PHE A CD2 1 
ATOM 1112 C CE1 . PHE A 1 157 ? 44.854 -19.371 29.755  1.00 76.00 ? 157 PHE A CE1 1 
ATOM 1113 C CE2 . PHE A 1 157 ? 45.561 -18.218 31.728  1.00 74.54 ? 157 PHE A CE2 1 
ATOM 1114 C CZ  . PHE A 1 157 ? 44.678 -18.367 30.693  1.00 74.91 ? 157 PHE A CZ  1 
ATOM 1115 N N   . TYR A 1 158 ? 50.860 -22.262 30.751  1.00 77.35 ? 158 TYR A N   1 
ATOM 1116 C CA  . TYR A 1 158 ? 51.836 -23.103 31.430  1.00 77.19 ? 158 TYR A CA  1 
ATOM 1117 C C   . TYR A 1 158 ? 53.027 -22.184 31.512  1.00 77.32 ? 158 TYR A C   1 
ATOM 1118 O O   . TYR A 1 158 ? 53.450 -21.805 32.594  1.00 77.24 ? 158 TYR A O   1 
ATOM 1119 C CB  . TYR A 1 158 ? 52.114 -24.402 30.648  1.00 77.22 ? 158 TYR A CB  1 
ATOM 1120 C CG  . TYR A 1 158 ? 53.387 -25.083 31.043  1.00 77.13 ? 158 TYR A CG  1 
ATOM 1121 C CD1 . TYR A 1 158 ? 53.464 -25.831 32.195  1.00 77.06 ? 158 TYR A CD1 1 
ATOM 1122 C CD2 . TYR A 1 158 ? 54.526 -24.962 30.266  1.00 77.65 ? 158 TYR A CD2 1 
ATOM 1123 C CE1 . TYR A 1 158 ? 54.650 -26.436 32.562  1.00 77.36 ? 158 TYR A CE1 1 
ATOM 1124 C CE2 . TYR A 1 158 ? 55.708 -25.575 30.628  1.00 76.65 ? 158 TYR A CE2 1 
ATOM 1125 C CZ  . TYR A 1 158 ? 55.759 -26.297 31.767  1.00 76.37 ? 158 TYR A CZ  1 
ATOM 1126 O OH  . TYR A 1 158 ? 56.933 -26.874 32.118  1.00 77.42 ? 158 TYR A OH  1 
ATOM 1127 N N   . GLU A 1 159 ? 53.489 -21.768 30.339  1.00 77.54 ? 159 GLU A N   1 
ATOM 1128 C CA  . GLU A 1 159 ? 54.589 -20.849 30.195  1.00 77.71 ? 159 GLU A CA  1 
ATOM 1129 C C   . GLU A 1 159 ? 54.569 -19.666 31.151  1.00 77.42 ? 159 GLU A C   1 
ATOM 1130 O O   . GLU A 1 159 ? 55.553 -19.421 31.858  1.00 77.57 ? 159 GLU A O   1 
ATOM 1131 C CB  . GLU A 1 159 ? 54.614 -20.309 28.773  1.00 78.14 ? 159 GLU A CB  1 
ATOM 1132 C CG  . GLU A 1 159 ? 55.982 -19.790 28.386  1.00 79.98 ? 159 GLU A CG  1 
ATOM 1133 C CD  . GLU A 1 159 ? 57.089 -20.797 28.725  1.00 81.21 ? 159 GLU A CD  1 
ATOM 1134 O OE1 . GLU A 1 159 ? 56.932 -22.026 28.420  1.00 80.34 ? 159 GLU A OE1 1 
ATOM 1135 O OE2 . GLU A 1 159 ? 58.105 -20.334 29.301  1.00 81.67 ? 159 GLU A OE2 1 
ATOM 1136 N N   . LEU A 1 160 ? 53.479 -18.912 31.165  1.00 76.92 ? 160 LEU A N   1 
ATOM 1137 C CA  . LEU A 1 160 ? 53.376 -17.813 32.118  1.00 76.92 ? 160 LEU A CA  1 
ATOM 1138 C C   . LEU A 1 160 ? 53.694 -18.345 33.470  1.00 76.88 ? 160 LEU A C   1 
ATOM 1139 O O   . LEU A 1 160 ? 54.576 -17.860 34.164  1.00 77.31 ? 160 LEU A O   1 
ATOM 1140 C CB  . LEU A 1 160 ? 51.959 -17.261 32.219  1.00 76.81 ? 160 LEU A CB  1 
ATOM 1141 C CG  . LEU A 1 160 ? 51.608 -15.918 31.610  1.00 76.99 ? 160 LEU A CG  1 
ATOM 1142 C CD1 . LEU A 1 160 ? 52.834 -15.033 31.449  1.00 77.24 ? 160 LEU A CD1 1 
ATOM 1143 C CD2 . LEU A 1 160 ? 50.948 -16.130 30.300  1.00 77.95 ? 160 LEU A CD2 1 
ATOM 1144 N N   . CYS A 1 161 ? 52.949 -19.377 33.821  1.00 76.83 ? 161 CYS A N   1 
ATOM 1145 C CA  . CYS A 1 161 ? 52.993 -19.949 35.152  1.00 77.31 ? 161 CYS A CA  1 
ATOM 1146 C C   . CYS A 1 161 ? 54.359 -20.427 35.637  1.00 77.36 ? 161 CYS A C   1 
ATOM 1147 O O   . CYS A 1 161 ? 54.766 -20.126 36.766  1.00 77.29 ? 161 CYS A O   1 
ATOM 1148 C CB  . CYS A 1 161 ? 52.072 -21.160 35.246  1.00 77.51 ? 161 CYS A CB  1 
ATOM 1149 S SG  . CYS A 1 161 ? 52.582 -22.209 36.606  1.00 76.80 ? 161 CYS A SG  1 
ATOM 1150 N N   . SER A 1 162 ? 55.037 -21.217 34.816  1.00 76.94 ? 162 SER A N   1 
ATOM 1151 C CA  . SER A 1 162 ? 56.276 -21.797 35.250  1.00 77.06 ? 162 SER A CA  1 
ATOM 1152 C C   . SER A 1 162 ? 57.403 -20.841 34.951  1.00 77.02 ? 162 SER A C   1 
ATOM 1153 O O   . SER A 1 162 ? 58.292 -21.177 34.180  1.00 77.63 ? 162 SER A O   1 
ATOM 1154 C CB  . SER A 1 162 ? 56.503 -23.138 34.562  1.00 77.21 ? 162 SER A CB  1 
ATOM 1155 O OG  . SER A 1 162 ? 56.655 -22.960 33.176  1.00 77.72 ? 162 SER A OG  1 
ATOM 1156 N N   . SER A 1 163 ? 57.370 -19.671 35.592  1.00 76.77 ? 163 SER A N   1 
ATOM 1157 C CA  . SER A 1 163 ? 58.341 -18.565 35.394  1.00 76.49 ? 163 SER A CA  1 
ATOM 1158 C C   . SER A 1 163 ? 57.900 -17.309 36.131  1.00 76.65 ? 163 SER A C   1 
ATOM 1159 O O   . SER A 1 163 ? 58.710 -16.434 36.457  1.00 76.50 ? 163 SER A O   1 
ATOM 1160 C CB  . SER A 1 163 ? 58.513 -18.178 33.926  1.00 76.39 ? 163 SER A CB  1 
ATOM 1161 O OG  . SER A 1 163 ? 57.336 -17.586 33.442  1.00 75.66 ? 163 SER A OG  1 
ATOM 1162 N N   . GLN A 1 164 ? 56.596 -17.200 36.340  1.00 76.69 ? 164 GLN A N   1 
ATOM 1163 C CA  . GLN A 1 164 ? 56.019 -16.088 37.056  1.00 76.63 ? 164 GLN A CA  1 
ATOM 1164 C C   . GLN A 1 164 ? 55.232 -16.551 38.250  1.00 75.97 ? 164 GLN A C   1 
ATOM 1165 O O   . GLN A 1 164 ? 54.837 -15.746 39.063  1.00 75.50 ? 164 GLN A O   1 
ATOM 1166 C CB  . GLN A 1 164 ? 55.071 -15.385 36.099  1.00 77.22 ? 164 GLN A CB  1 
ATOM 1167 C CG  . GLN A 1 164 ? 55.468 -13.997 35.725  1.00 78.34 ? 164 GLN A CG  1 
ATOM 1168 C CD  . GLN A 1 164 ? 56.919 -13.900 35.354  1.00 80.36 ? 164 GLN A CD  1 
ATOM 1169 O OE1 . GLN A 1 164 ? 57.621 -13.016 35.833  1.00 82.98 ? 164 GLN A OE1 1 
ATOM 1170 N NE2 . GLN A 1 164 ? 57.390 -14.810 34.503  1.00 83.16 ? 164 GLN A NE2 1 
ATOM 1171 N N   . GLY A 1 165 ? 54.989 -17.855 38.315  1.00 75.62 ? 165 GLY A N   1 
ATOM 1172 C CA  . GLY A 1 165 ? 54.083 -18.448 39.275  1.00 75.48 ? 165 GLY A CA  1 
ATOM 1173 C C   . GLY A 1 165 ? 54.714 -18.589 40.632  1.00 74.96 ? 165 GLY A C   1 
ATOM 1174 O O   . GLY A 1 165 ? 55.933 -18.740 40.750  1.00 74.87 ? 165 GLY A O   1 
ATOM 1175 N N   . LYS A 1 166 ? 53.872 -18.526 41.653  1.00 74.29 ? 166 LYS A N   1 
ATOM 1176 C CA  . LYS A 1 166 ? 54.347 -18.400 43.011  1.00 74.07 ? 166 LYS A CA  1 
ATOM 1177 C C   . LYS A 1 166 ? 53.586 -19.371 43.852  1.00 73.49 ? 166 LYS A C   1 
ATOM 1178 O O   . LYS A 1 166 ? 52.420 -19.163 44.197  1.00 72.81 ? 166 LYS A O   1 
ATOM 1179 C CB  . LYS A 1 166 ? 54.197 -16.965 43.534  1.00 74.37 ? 166 LYS A CB  1 
ATOM 1180 C CG  . LYS A 1 166 ? 55.500 -16.112 43.460  1.00 74.83 ? 166 LYS A CG  1 
ATOM 1181 C CD  . LYS A 1 166 ? 55.984 -15.851 42.008  1.00 73.99 ? 166 LYS A CD  1 
ATOM 1182 C CE  . LYS A 1 166 ? 57.046 -14.774 41.956  1.00 73.59 ? 166 LYS A CE  1 
ATOM 1183 N NZ  . LYS A 1 166 ? 56.461 -13.448 42.283  1.00 72.30 ? 166 LYS A NZ  1 
ATOM 1184 N N   . ARG A 1 167 ? 54.264 -20.464 44.161  1.00 73.17 ? 167 ARG A N   1 
ATOM 1185 C CA  . ARG A 1 167 ? 53.629 -21.475 44.923  1.00 72.84 ? 167 ARG A CA  1 
ATOM 1186 C C   . ARG A 1 167 ? 53.211 -20.800 46.207  1.00 72.59 ? 167 ARG A C   1 
ATOM 1187 O O   . ARG A 1 167 ? 53.995 -20.139 46.884  1.00 71.45 ? 167 ARG A O   1 
ATOM 1188 C CB  . ARG A 1 167 ? 54.521 -22.694 45.130  1.00 72.86 ? 167 ARG A CB  1 
ATOM 1189 C CG  . ARG A 1 167 ? 53.929 -23.723 46.065  1.00 71.92 ? 167 ARG A CG  1 
ATOM 1190 C CD  . ARG A 1 167 ? 54.544 -23.516 47.416  1.00 69.54 ? 167 ARG A CD  1 
ATOM 1191 N NE  . ARG A 1 167 ? 53.922 -24.273 48.492  1.00 68.20 ? 167 ARG A NE  1 
ATOM 1192 C CZ  . ARG A 1 167 ? 54.380 -24.282 49.746  1.00 67.53 ? 167 ARG A CZ  1 
ATOM 1193 N NH1 . ARG A 1 167 ? 55.471 -23.601 50.081  1.00 65.64 ? 167 ARG A NH1 1 
ATOM 1194 N NH2 . ARG A 1 167 ? 53.754 -24.991 50.677  1.00 68.03 ? 167 ARG A NH2 1 
ATOM 1195 N N   . VAL A 1 168 ? 51.914 -20.873 46.415  1.00 72.72 ? 168 VAL A N   1 
ATOM 1196 C CA  . VAL A 1 168 ? 51.271 -20.418 47.596  1.00 72.88 ? 168 VAL A CA  1 
ATOM 1197 C C   . VAL A 1 168 ? 50.643 -21.718 48.023  1.00 73.24 ? 168 VAL A C   1 
ATOM 1198 O O   . VAL A 1 168 ? 49.704 -22.190 47.397  1.00 73.16 ? 168 VAL A O   1 
ATOM 1199 C CB  . VAL A 1 168 ? 50.251 -19.316 47.250  1.00 72.76 ? 168 VAL A CB  1 
ATOM 1200 C CG1 . VAL A 1 168 ? 49.059 -19.312 48.200  1.00 73.61 ? 168 VAL A CG1 1 
ATOM 1201 C CG2 . VAL A 1 168 ? 50.941 -17.955 47.224  1.00 72.22 ? 168 VAL A CG2 1 
ATOM 1202 N N   . GLY A 1 169 ? 51.227 -22.342 49.035  1.00 73.84 ? 169 GLY A N   1 
ATOM 1203 C CA  . GLY A 1 169 ? 50.741 -23.627 49.520  1.00 74.23 ? 169 GLY A CA  1 
ATOM 1204 C C   . GLY A 1 169 ? 50.615 -24.658 48.408  1.00 74.55 ? 169 GLY A C   1 
ATOM 1205 O O   . GLY A 1 169 ? 51.591 -25.045 47.777  1.00 74.73 ? 169 GLY A O   1 
ATOM 1206 N N   . ASP A 1 170 ? 49.388 -25.063 48.135  1.00 74.76 ? 170 ASP A N   1 
ATOM 1207 C CA  . ASP A 1 170 ? 49.110 -26.117 47.173  1.00 75.16 ? 170 ASP A CA  1 
ATOM 1208 C C   . ASP A 1 170 ? 49.303 -25.652 45.717  1.00 75.28 ? 170 ASP A C   1 
ATOM 1209 O O   . ASP A 1 170 ? 49.477 -26.440 44.782  1.00 74.79 ? 170 ASP A O   1 
ATOM 1210 C CB  . ASP A 1 170 ? 47.640 -26.522 47.351  1.00 75.45 ? 170 ASP A CB  1 
ATOM 1211 C CG  . ASP A 1 170 ? 47.472 -27.977 47.722  1.00 76.60 ? 170 ASP A CG  1 
ATOM 1212 O OD1 . ASP A 1 170 ? 48.408 -28.776 47.466  1.00 77.08 ? 170 ASP A OD1 1 
ATOM 1213 O OD2 . ASP A 1 170 ? 46.403 -28.324 48.289  1.00 78.25 ? 170 ASP A OD2 1 
ATOM 1214 N N   . THR A 1 171 ? 49.244 -24.352 45.536  1.00 75.49 ? 171 THR A N   1 
ATOM 1215 C CA  . THR A 1 171 ? 48.861 -23.816 44.273  1.00 76.12 ? 171 THR A CA  1 
ATOM 1216 C C   . THR A 1 171 ? 50.003 -22.995 43.715  1.00 76.83 ? 171 THR A C   1 
ATOM 1217 O O   . THR A 1 171 ? 51.100 -22.986 44.277  1.00 77.39 ? 171 THR A O   1 
ATOM 1218 C CB  . THR A 1 171 ? 47.617 -22.922 44.461  1.00 76.04 ? 171 THR A CB  1 
ATOM 1219 O OG1 . THR A 1 171 ? 47.943 -21.835 45.330  1.00 75.48 ? 171 THR A OG1 1 
ATOM 1220 C CG2 . THR A 1 171 ? 46.462 -23.715 45.066  1.00 75.83 ? 171 THR A CG2 1 
ATOM 1221 N N   . TYR A 1 172 ? 49.735 -22.323 42.601  1.00 77.14 ? 172 TYR A N   1 
ATOM 1222 C CA  . TYR A 1 172 ? 50.612 -21.277 42.088  1.00 77.68 ? 172 TYR A CA  1 
ATOM 1223 C C   . TYR A 1 172 ? 49.836 -20.033 41.588  1.00 77.82 ? 172 TYR A C   1 
ATOM 1224 O O   . TYR A 1 172 ? 48.871 -20.131 40.818  1.00 77.86 ? 172 TYR A O   1 
ATOM 1225 C CB  . TYR A 1 172 ? 51.434 -21.790 40.920  1.00 77.77 ? 172 TYR A CB  1 
ATOM 1226 C CG  . TYR A 1 172 ? 52.430 -22.902 41.175  1.00 77.48 ? 172 TYR A CG  1 
ATOM 1227 C CD1 . TYR A 1 172 ? 52.027 -24.240 41.276  1.00 76.67 ? 172 TYR A CD1 1 
ATOM 1228 C CD2 . TYR A 1 172 ? 53.790 -22.621 41.202  1.00 77.07 ? 172 TYR A CD2 1 
ATOM 1229 C CE1 . TYR A 1 172 ? 52.964 -25.257 41.430  1.00 77.26 ? 172 TYR A CE1 1 
ATOM 1230 C CE2 . TYR A 1 172 ? 54.728 -23.617 41.365  1.00 77.38 ? 172 TYR A CE2 1 
ATOM 1231 C CZ  . TYR A 1 172 ? 54.322 -24.935 41.477  1.00 77.88 ? 172 TYR A CZ  1 
ATOM 1232 O OH  . TYR A 1 172 ? 55.303 -25.899 41.649  1.00 77.82 ? 172 TYR A OH  1 
ATOM 1233 N N   . GLU A 1 173 ? 50.306 -18.863 42.005  1.00 77.81 ? 173 GLU A N   1 
ATOM 1234 C CA  . GLU A 1 173 ? 49.656 -17.610 41.707  1.00 77.26 ? 173 GLU A CA  1 
ATOM 1235 C C   . GLU A 1 173 ? 50.499 -16.866 40.706  1.00 77.00 ? 173 GLU A C   1 
ATOM 1236 O O   . GLU A 1 173 ? 51.708 -17.009 40.696  1.00 76.56 ? 173 GLU A O   1 
ATOM 1237 C CB  . GLU A 1 173 ? 49.504 -16.806 43.006  1.00 77.32 ? 173 GLU A CB  1 
ATOM 1238 C CG  . GLU A 1 173 ? 48.477 -17.427 43.950  1.00 76.52 ? 173 GLU A CG  1 
ATOM 1239 C CD  . GLU A 1 173 ? 48.172 -16.573 45.162  1.00 76.71 ? 173 GLU A CD  1 
ATOM 1240 O OE1 . GLU A 1 173 ? 48.646 -15.414 45.222  1.00 76.46 ? 173 GLU A OE1 1 
ATOM 1241 O OE2 . GLU A 1 173 ? 47.443 -17.070 46.058  1.00 75.58 ? 173 GLU A OE2 1 
ATOM 1242 N N   . ILE A 1 174 ? 49.848 -16.107 39.836  1.00 77.03 ? 174 ILE A N   1 
ATOM 1243 C CA  . ILE A 1 174 ? 50.524 -15.118 39.003  1.00 77.13 ? 174 ILE A CA  1 
ATOM 1244 C C   . ILE A 1 174 ? 49.767 -13.817 39.220  1.00 77.29 ? 174 ILE A C   1 
ATOM 1245 O O   . ILE A 1 174 ? 48.547 -13.811 39.228  1.00 77.47 ? 174 ILE A O   1 
ATOM 1246 C CB  . ILE A 1 174 ? 50.536 -15.510 37.500  1.00 77.12 ? 174 ILE A CB  1 
ATOM 1247 C CG1 . ILE A 1 174 ? 51.085 -16.927 37.314  1.00 77.23 ? 174 ILE A CG1 1 
ATOM 1248 C CG2 . ILE A 1 174 ? 51.405 -14.526 36.697  1.00 77.01 ? 174 ILE A CG2 1 
ATOM 1249 C CD1 . ILE A 1 174 ? 50.157 -18.039 37.723  1.00 76.97 ? 174 ILE A CD1 1 
ATOM 1250 N N   . THR A 1 175 ? 50.478 -12.721 39.440  1.00 77.59 ? 175 THR A N   1 
ATOM 1251 C CA  . THR A 1 175 ? 49.818 -11.450 39.745  1.00 77.94 ? 175 THR A CA  1 
ATOM 1252 C C   . THR A 1 175 ? 49.877 -10.621 38.485  1.00 78.15 ? 175 THR A C   1 
ATOM 1253 O O   . THR A 1 175 ? 50.697 -9.694  38.324  1.00 78.31 ? 175 THR A O   1 
ATOM 1254 C CB  . THR A 1 175 ? 50.417 -10.751 40.986  1.00 77.99 ? 175 THR A CB  1 
ATOM 1255 O OG1 . THR A 1 175 ? 50.321 -11.645 42.107  1.00 77.67 ? 175 THR A OG1 1 
ATOM 1256 C CG2 . THR A 1 175 ? 49.659 -9.449  41.311  1.00 77.68 ? 175 THR A CG2 1 
ATOM 1257 N N   . MET A 1 176 ? 48.944 -10.981 37.616  1.00 78.17 ? 176 MET A N   1 
ATOM 1258 C CA  . MET A 1 176 ? 49.020 -10.688 36.222  1.00 78.32 ? 176 MET A CA  1 
ATOM 1259 C C   . MET A 1 176 ? 47.607 -10.345 35.730  1.00 77.94 ? 176 MET A C   1 
ATOM 1260 O O   . MET A 1 176 ? 46.692 -11.171 35.772  1.00 77.63 ? 176 MET A O   1 
ATOM 1261 C CB  . MET A 1 176 ? 49.628 -11.916 35.522  1.00 78.54 ? 176 MET A CB  1 
ATOM 1262 C CG  . MET A 1 176 ? 49.541 -11.927 33.984  1.00 79.27 ? 176 MET A CG  1 
ATOM 1263 S SD  . MET A 1 176 ? 50.975 -12.632 33.132  1.00 79.11 ? 176 MET A SD  1 
ATOM 1264 C CE  . MET A 1 176 ? 51.402 -11.248 32.050  1.00 78.54 ? 176 MET A CE  1 
ATOM 1265 N N   . PRO A 1 177 ? 47.397 -9.081  35.349  1.00 77.77 ? 177 PRO A N   1 
ATOM 1266 C CA  . PRO A 1 177 ? 46.231 -8.778  34.524  1.00 77.29 ? 177 PRO A CA  1 
ATOM 1267 C C   . PRO A 1 177 ? 46.326 -9.557  33.242  1.00 76.62 ? 177 PRO A C   1 
ATOM 1268 O O   . PRO A 1 177 ? 47.406 -9.643  32.691  1.00 76.98 ? 177 PRO A O   1 
ATOM 1269 C CB  . PRO A 1 177 ? 46.370 -7.274  34.220  1.00 77.15 ? 177 PRO A CB  1 
ATOM 1270 C CG  . PRO A 1 177 ? 47.727 -6.887  34.628  1.00 78.03 ? 177 PRO A CG  1 
ATOM 1271 C CD  . PRO A 1 177 ? 48.158 -7.869  35.694  1.00 78.22 ? 177 PRO A CD  1 
ATOM 1272 N N   . LEU A 1 178 ? 45.229 -10.135 32.774  1.00 75.81 ? 178 LEU A N   1 
ATOM 1273 C CA  . LEU A 1 178 ? 45.245 -10.774 31.478  1.00 75.09 ? 178 LEU A CA  1 
ATOM 1274 C C   . LEU A 1 178 ? 43.851 -10.936 30.931  1.00 74.66 ? 178 LEU A C   1 
ATOM 1275 O O   . LEU A 1 178 ? 43.159 -11.906 31.206  1.00 74.03 ? 178 LEU A O   1 
ATOM 1276 C CB  . LEU A 1 178 ? 45.958 -12.122 31.552  1.00 75.21 ? 178 LEU A CB  1 
ATOM 1277 C CG  . LEU A 1 178 ? 46.439 -12.626 30.187  1.00 75.03 ? 178 LEU A CG  1 
ATOM 1278 C CD1 . LEU A 1 178 ? 47.453 -11.651 29.571  1.00 74.22 ? 178 LEU A CD1 1 
ATOM 1279 C CD2 . LEU A 1 178 ? 47.035 -14.052 30.324  1.00 74.89 ? 178 LEU A CD2 1 
ATOM 1280 N N   . SER A 1 179 ? 43.437 -9.969  30.135  1.00 74.70 ? 179 SER A N   1 
ATOM 1281 C CA  . SER A 1 179 ? 42.131 -10.028 29.517  1.00 74.52 ? 179 SER A CA  1 
ATOM 1282 C C   . SER A 1 179 ? 42.015 -11.179 28.495  1.00 74.57 ? 179 SER A C   1 
ATOM 1283 O O   . SER A 1 179 ? 42.980 -11.581 27.845  1.00 74.12 ? 179 SER A O   1 
ATOM 1284 C CB  . SER A 1 179 ? 41.858 -8.721  28.810  1.00 74.34 ? 179 SER A CB  1 
ATOM 1285 O OG  . SER A 1 179 ? 42.640 -8.658  27.640  1.00 74.76 ? 179 SER A OG  1 
ATOM 1286 N N   . GLN A 1 180 ? 40.802 -11.682 28.348  1.00 74.75 ? 180 GLN A N   1 
ATOM 1287 C CA  . GLN A 1 180 ? 40.480 -12.643 27.310  1.00 75.29 ? 180 GLN A CA  1 
ATOM 1288 C C   . GLN A 1 180 ? 40.799 -12.100 25.910  1.00 76.10 ? 180 GLN A C   1 
ATOM 1289 O O   . GLN A 1 180 ? 41.158 -12.872 24.994  1.00 76.38 ? 180 GLN A O   1 
ATOM 1290 C CB  . GLN A 1 180 ? 38.995 -12.981 27.374  1.00 75.10 ? 180 GLN A CB  1 
ATOM 1291 C CG  . GLN A 1 180 ? 38.492 -13.327 28.771  1.00 74.88 ? 180 GLN A CG  1 
ATOM 1292 C CD  . GLN A 1 180 ? 37.377 -14.372 28.791  1.00 74.69 ? 180 GLN A CD  1 
ATOM 1293 O OE1 . GLN A 1 180 ? 36.976 -14.821 29.861  1.00 76.31 ? 180 GLN A OE1 1 
ATOM 1294 N NE2 . GLN A 1 180 ? 36.879 -14.767 27.621  1.00 73.54 ? 180 GLN A NE2 1 
ATOM 1295 N N   . LYS A 1 181 ? 40.630 -10.775 25.766  1.00 76.38 ? 181 LYS A N   1 
ATOM 1296 C CA  . LYS A 1 181 ? 40.976 -10.026 24.570  1.00 76.43 ? 181 LYS A CA  1 
ATOM 1297 C C   . LYS A 1 181 ? 42.440 -10.231 24.296  1.00 75.89 ? 181 LYS A C   1 
ATOM 1298 O O   . LYS A 1 181 ? 42.782 -10.786 23.249  1.00 76.01 ? 181 LYS A O   1 
ATOM 1299 C CB  . LYS A 1 181 ? 40.683 -8.530  24.753  1.00 76.68 ? 181 LYS A CB  1 
ATOM 1300 C CG  . LYS A 1 181 ? 40.687 -7.710  23.442  1.00 77.57 ? 181 LYS A CG  1 
ATOM 1301 C CD  . LYS A 1 181 ? 40.729 -6.198  23.711  1.00 78.47 ? 181 LYS A CD  1 
ATOM 1302 C CE  . LYS A 1 181 ? 39.697 -5.439  22.877  1.00 81.44 ? 181 LYS A CE  1 
ATOM 1303 N NZ  . LYS A 1 181 ? 39.982 -5.489  21.398  1.00 83.50 ? 181 LYS A NZ  1 
ATOM 1304 N N   . SER A 1 182 ? 43.284 -9.804  25.246  1.00 75.22 ? 182 SER A N   1 
ATOM 1305 C CA  . SER A 1 182 ? 44.737 -10.028 25.213  1.00 75.25 ? 182 SER A CA  1 
ATOM 1306 C C   . SER A 1 182 ? 45.079 -11.450 24.888  1.00 75.14 ? 182 SER A C   1 
ATOM 1307 O O   . SER A 1 182 ? 46.046 -11.722 24.189  1.00 75.35 ? 182 SER A O   1 
ATOM 1308 C CB  . SER A 1 182 ? 45.369 -9.810  26.585  1.00 75.47 ? 182 SER A CB  1 
ATOM 1309 O OG  . SER A 1 182 ? 45.238 -8.494  27.079  1.00 76.32 ? 182 SER A OG  1 
ATOM 1310 N N   . ILE A 1 183 ? 44.312 -12.371 25.449  1.00 74.85 ? 183 ILE A N   1 
ATOM 1311 C CA  . ILE A 1 183 ? 44.596 -13.758 25.239  1.00 74.59 ? 183 ILE A CA  1 
ATOM 1312 C C   . ILE A 1 183 ? 44.312 -14.157 23.808  1.00 74.77 ? 183 ILE A C   1 
ATOM 1313 O O   . ILE A 1 183 ? 45.159 -14.777 23.149  1.00 74.91 ? 183 ILE A O   1 
ATOM 1314 C CB  . ILE A 1 183 ? 43.847 -14.603 26.219  1.00 74.43 ? 183 ILE A CB  1 
ATOM 1315 C CG1 . ILE A 1 183 ? 44.559 -14.465 27.561  1.00 74.51 ? 183 ILE A CG1 1 
ATOM 1316 C CG2 . ILE A 1 183 ? 43.860 -16.044 25.771  1.00 74.22 ? 183 ILE A CG2 1 
ATOM 1317 C CD1 . ILE A 1 183 ? 43.826 -15.034 28.728  1.00 74.06 ? 183 ILE A CD1 1 
ATOM 1318 N N   . GLY A 1 184 ? 43.131 -13.801 23.322  1.00 74.92 ? 184 GLY A N   1 
ATOM 1319 C CA  . GLY A 1 184 ? 42.795 -14.036 21.915  1.00 75.00 ? 184 GLY A CA  1 
ATOM 1320 C C   . GLY A 1 184 ? 43.719 -13.263 20.985  1.00 74.93 ? 184 GLY A C   1 
ATOM 1321 O O   . GLY A 1 184 ? 44.144 -13.746 19.940  1.00 74.26 ? 184 GLY A O   1 
ATOM 1322 N N   . GLU A 1 185 ? 44.051 -12.046 21.369  1.00 75.36 ? 185 GLU A N   1 
ATOM 1323 C CA  . GLU A 1 185 ? 44.949 -11.262 20.548  1.00 75.95 ? 185 GLU A CA  1 
ATOM 1324 C C   . GLU A 1 185 ? 46.301 -11.934 20.459  1.00 76.28 ? 185 GLU A C   1 
ATOM 1325 O O   . GLU A 1 185 ? 46.930 -11.924 19.403  1.00 76.65 ? 185 GLU A O   1 
ATOM 1326 C CB  . GLU A 1 185 ? 45.092 -9.875  21.110  1.00 75.87 ? 185 GLU A CB  1 
ATOM 1327 C CG  . GLU A 1 185 ? 43.876 -9.062  20.877  1.00 76.91 ? 185 GLU A CG  1 
ATOM 1328 C CD  . GLU A 1 185 ? 43.891 -7.766  21.636  1.00 79.12 ? 185 GLU A CD  1 
ATOM 1329 O OE1 . GLU A 1 185 ? 44.771 -7.586  22.514  1.00 79.37 ? 185 GLU A OE1 1 
ATOM 1330 O OE2 . GLU A 1 185 ? 43.008 -6.920  21.356  1.00 80.63 ? 185 GLU A OE2 1 
ATOM 1331 N N   . ILE A 1 186 ? 46.740 -12.542 21.555  1.00 76.00 ? 186 ILE A N   1 
ATOM 1332 C CA  . ILE A 1 186 ? 48.049 -13.153 21.561  1.00 75.75 ? 186 ILE A CA  1 
ATOM 1333 C C   . ILE A 1 186 ? 48.126 -14.489 20.867  1.00 75.44 ? 186 ILE A C   1 
ATOM 1334 O O   . ILE A 1 186 ? 49.152 -14.780 20.263  1.00 75.16 ? 186 ILE A O   1 
ATOM 1335 C CB  . ILE A 1 186 ? 48.558 -13.312 22.957  1.00 75.69 ? 186 ILE A CB  1 
ATOM 1336 C CG1 . ILE A 1 186 ? 48.968 -11.941 23.446  1.00 75.71 ? 186 ILE A CG1 1 
ATOM 1337 C CG2 . ILE A 1 186 ? 49.789 -14.215 22.986  1.00 76.18 ? 186 ILE A CG2 1 
ATOM 1338 C CD1 . ILE A 1 186 ? 49.211 -11.856 24.911  1.00 75.57 ? 186 ILE A CD1 1 
ATOM 1339 N N   . THR A 1 187 ? 47.080 -15.304 20.986  1.00 75.17 ? 187 THR A N   1 
ATOM 1340 C CA  . THR A 1 187 ? 47.082 -16.639 20.403  1.00 74.88 ? 187 THR A CA  1 
ATOM 1341 C C   . THR A 1 187 ? 46.335 -16.738 19.104  1.00 75.56 ? 187 THR A C   1 
ATOM 1342 O O   . THR A 1 187 ? 46.367 -17.767 18.468  1.00 75.92 ? 187 THR A O   1 
ATOM 1343 C CB  . THR A 1 187 ? 46.389 -17.574 21.295  1.00 74.61 ? 187 THR A CB  1 
ATOM 1344 O OG1 . THR A 1 187 ? 45.045 -17.134 21.446  1.00 70.56 ? 187 THR A OG1 1 
ATOM 1345 C CG2 . THR A 1 187 ? 47.080 -17.579 22.621  1.00 75.64 ? 187 THR A CG2 1 
ATOM 1346 N N   . GLY A 1 188 ? 45.634 -15.680 18.726  1.00 76.23 ? 188 GLY A N   1 
ATOM 1347 C CA  . GLY A 1 188 ? 44.776 -15.707 17.533  1.00 76.78 ? 188 GLY A CA  1 
ATOM 1348 C C   . GLY A 1 188 ? 43.598 -16.656 17.658  1.00 76.80 ? 188 GLY A C   1 
ATOM 1349 O O   . GLY A 1 188 ? 43.308 -17.432 16.753  1.00 77.01 ? 188 GLY A O   1 
ATOM 1350 N N   . ALA A 1 189 ? 42.932 -16.606 18.793  1.00 76.94 ? 189 ALA A N   1 
ATOM 1351 C CA  . ALA A 1 189 ? 41.905 -17.569 19.106  1.00 77.03 ? 189 ALA A CA  1 
ATOM 1352 C C   . ALA A 1 189 ? 40.666 -16.766 19.321  1.00 76.93 ? 189 ALA A C   1 
ATOM 1353 O O   . ALA A 1 189 ? 40.698 -15.669 19.845  1.00 77.31 ? 189 ALA A O   1 
ATOM 1354 C CB  . ALA A 1 189 ? 42.247 -18.357 20.332  1.00 77.00 ? 189 ALA A CB  1 
ATOM 1355 N N   . HIS A 1 190 ? 39.575 -17.342 18.883  1.00 76.80 ? 190 HIS A N   1 
ATOM 1356 C CA  . HIS A 1 190 ? 38.289 -16.716 18.878  1.00 76.93 ? 190 HIS A CA  1 
ATOM 1357 C C   . HIS A 1 190 ? 37.826 -16.545 20.330  1.00 77.31 ? 190 HIS A C   1 
ATOM 1358 O O   . HIS A 1 190 ? 38.168 -17.382 21.213  1.00 77.13 ? 190 HIS A O   1 
ATOM 1359 C CB  . HIS A 1 190 ? 37.364 -17.653 18.099  1.00 76.88 ? 190 HIS A CB  1 
ATOM 1360 C CG  . HIS A 1 190 ? 36.045 -17.071 17.758  1.00 76.37 ? 190 HIS A CG  1 
ATOM 1361 N ND1 . HIS A 1 190 ? 34.988 -17.079 18.639  1.00 76.64 ? 190 HIS A ND1 1 
ATOM 1362 C CD2 . HIS A 1 190 ? 35.602 -16.485 16.625  1.00 75.03 ? 190 HIS A CD2 1 
ATOM 1363 C CE1 . HIS A 1 190 ? 33.951 -16.494 18.066  1.00 77.14 ? 190 HIS A CE1 1 
ATOM 1364 N NE2 . HIS A 1 190 ? 34.298 -16.123 16.847  1.00 76.41 ? 190 HIS A NE2 1 
ATOM 1365 N N   . HIS A 1 191 ? 37.069 -15.474 20.585  1.00 77.12 ? 191 HIS A N   1 
ATOM 1366 C CA  . HIS A 1 191 ? 36.762 -15.115 21.961  1.00 77.44 ? 191 HIS A CA  1 
ATOM 1367 C C   . HIS A 1 191 ? 35.867 -16.177 22.575  1.00 76.77 ? 191 HIS A C   1 
ATOM 1368 O O   . HIS A 1 191 ? 35.798 -16.316 23.814  1.00 76.33 ? 191 HIS A O   1 
ATOM 1369 C CB  . HIS A 1 191 ? 36.154 -13.707 22.056  1.00 78.05 ? 191 HIS A CB  1 
ATOM 1370 C CG  . HIS A 1 191 ? 34.715 -13.614 21.620  1.00 79.17 ? 191 HIS A CG  1 
ATOM 1371 N ND1 . HIS A 1 191 ? 34.084 -14.585 20.870  1.00 79.82 ? 191 HIS A ND1 1 
ATOM 1372 C CD2 . HIS A 1 191 ? 33.792 -12.637 21.812  1.00 80.28 ? 191 HIS A CD2 1 
ATOM 1373 C CE1 . HIS A 1 191 ? 32.835 -14.221 20.634  1.00 78.66 ? 191 HIS A CE1 1 
ATOM 1374 N NE2 . HIS A 1 191 ? 32.635 -13.039 21.187  1.00 79.37 ? 191 HIS A NE2 1 
ATOM 1375 N N   . VAL A 1 192 ? 35.223 -16.942 21.688  1.00 76.00 ? 192 VAL A N   1 
ATOM 1376 C CA  . VAL A 1 192 ? 34.396 -18.066 22.088  1.00 75.99 ? 192 VAL A CA  1 
ATOM 1377 C C   . VAL A 1 192 ? 35.249 -19.185 22.618  1.00 75.90 ? 192 VAL A C   1 
ATOM 1378 O O   . VAL A 1 192 ? 35.004 -19.717 23.716  1.00 75.15 ? 192 VAL A O   1 
ATOM 1379 C CB  . VAL A 1 192 ? 33.617 -18.649 20.915  1.00 75.90 ? 192 VAL A CB  1 
ATOM 1380 C CG1 . VAL A 1 192 ? 33.111 -20.040 21.258  1.00 76.95 ? 192 VAL A CG1 1 
ATOM 1381 C CG2 . VAL A 1 192 ? 32.476 -17.790 20.592  1.00 75.13 ? 192 VAL A CG2 1 
ATOM 1382 N N   . THR A 1 193 ? 36.222 -19.570 21.794  1.00 75.80 ? 193 THR A N   1 
ATOM 1383 C CA  . THR A 1 193 ? 37.203 -20.521 22.222  1.00 75.95 ? 193 THR A CA  1 
ATOM 1384 C C   . THR A 1 193 ? 37.797 -20.055 23.546  1.00 76.05 ? 193 THR A C   1 
ATOM 1385 O O   . THR A 1 193 ? 37.744 -20.764 24.557  1.00 75.69 ? 193 THR A O   1 
ATOM 1386 C CB  . THR A 1 193 ? 38.290 -20.660 21.229  1.00 75.75 ? 193 THR A CB  1 
ATOM 1387 O OG1 . THR A 1 193 ? 37.774 -20.380 19.928  1.00 76.66 ? 193 THR A OG1 1 
ATOM 1388 C CG2 . THR A 1 193 ? 38.794 -22.064 21.270  1.00 76.13 ? 193 THR A CG2 1 
ATOM 1389 N N   . VAL A 1 194 ? 38.310 -18.837 23.562  1.00 76.03 ? 194 VAL A N   1 
ATOM 1390 C CA  . VAL A 1 194 ? 38.857 -18.327 24.789  1.00 76.07 ? 194 VAL A CA  1 
ATOM 1391 C C   . VAL A 1 194 ? 37.919 -18.553 25.954  1.00 76.19 ? 194 VAL A C   1 
ATOM 1392 O O   . VAL A 1 194 ? 38.374 -19.018 27.001  1.00 76.67 ? 194 VAL A O   1 
ATOM 1393 C CB  . VAL A 1 194 ? 39.144 -16.857 24.731  1.00 76.14 ? 194 VAL A CB  1 
ATOM 1394 C CG1 . VAL A 1 194 ? 39.530 -16.368 26.121  1.00 76.66 ? 194 VAL A CG1 1 
ATOM 1395 C CG2 . VAL A 1 194 ? 40.275 -16.587 23.764  1.00 76.82 ? 194 VAL A CG2 1 
ATOM 1396 N N   . SER A 1 195 ? 36.634 -18.215 25.804  1.00 76.13 ? 195 SER A N   1 
ATOM 1397 C CA  . SER A 1 195 ? 35.699 -18.299 26.945  1.00 75.88 ? 195 SER A CA  1 
ATOM 1398 C C   . SER A 1 195 ? 35.475 -19.723 27.372  1.00 76.02 ? 195 SER A C   1 
ATOM 1399 O O   . SER A 1 195 ? 35.529 -20.016 28.548  1.00 76.14 ? 195 SER A O   1 
ATOM 1400 C CB  . SER A 1 195 ? 34.350 -17.692 26.621  1.00 75.59 ? 195 SER A CB  1 
ATOM 1401 O OG  . SER A 1 195 ? 34.499 -16.361 26.206  1.00 75.76 ? 195 SER A OG  1 
ATOM 1402 N N   . LYS A 1 196 ? 35.248 -20.605 26.407  1.00 76.67 ? 196 LYS A N   1 
ATOM 1403 C CA  . LYS A 1 196 ? 34.908 -21.991 26.701  1.00 77.46 ? 196 LYS A CA  1 
ATOM 1404 C C   . LYS A 1 196 ? 36.166 -22.753 27.196  1.00 77.10 ? 196 LYS A C   1 
ATOM 1405 O O   . LYS A 1 196 ? 36.091 -23.585 28.114  1.00 77.34 ? 196 LYS A O   1 
ATOM 1406 C CB  . LYS A 1 196 ? 34.134 -22.656 25.509  1.00 77.75 ? 196 LYS A CB  1 
ATOM 1407 C CG  . LYS A 1 196 ? 34.808 -23.819 24.727  1.00 79.49 ? 196 LYS A CG  1 
ATOM 1408 C CD  . LYS A 1 196 ? 33.784 -24.857 24.120  1.00 79.36 ? 196 LYS A CD  1 
ATOM 1409 C CE  . LYS A 1 196 ? 34.506 -26.026 23.347  1.00 81.04 ? 196 LYS A CE  1 
ATOM 1410 N NZ  . LYS A 1 196 ? 35.300 -27.030 24.202  1.00 81.74 ? 196 LYS A NZ  1 
ATOM 1411 N N   . VAL A 1 197 ? 37.333 -22.438 26.637  1.00 76.86 ? 197 VAL A N   1 
ATOM 1412 C CA  . VAL A 1 197 ? 38.569 -23.098 27.082  1.00 75.95 ? 197 VAL A CA  1 
ATOM 1413 C C   . VAL A 1 197 ? 38.781 -22.699 28.497  1.00 75.72 ? 197 VAL A C   1 
ATOM 1414 O O   . VAL A 1 197 ? 39.126 -23.513 29.320  1.00 76.05 ? 197 VAL A O   1 
ATOM 1415 C CB  . VAL A 1 197 ? 39.827 -22.699 26.275  1.00 75.62 ? 197 VAL A CB  1 
ATOM 1416 C CG1 . VAL A 1 197 ? 41.072 -23.279 26.925  1.00 74.55 ? 197 VAL A CG1 1 
ATOM 1417 C CG2 . VAL A 1 197 ? 39.723 -23.157 24.826  1.00 74.69 ? 197 VAL A CG2 1 
ATOM 1418 N N   . LEU A 1 198 ? 38.590 -21.430 28.791  1.00 75.75 ? 198 LEU A N   1 
ATOM 1419 C CA  . LEU A 1 198 ? 38.748 -21.012 30.151  1.00 76.12 ? 198 LEU A CA  1 
ATOM 1420 C C   . LEU A 1 198 ? 37.840 -21.810 31.013  1.00 76.80 ? 198 LEU A C   1 
ATOM 1421 O O   . LEU A 1 198 ? 38.274 -22.481 31.934  1.00 77.14 ? 198 LEU A O   1 
ATOM 1422 C CB  . LEU A 1 198 ? 38.391 -19.562 30.326  1.00 75.67 ? 198 LEU A CB  1 
ATOM 1423 C CG  . LEU A 1 198 ? 39.563 -18.660 30.041  1.00 75.77 ? 198 LEU A CG  1 
ATOM 1424 C CD1 . LEU A 1 198 ? 39.080 -17.269 30.231  1.00 76.99 ? 198 LEU A CD1 1 
ATOM 1425 C CD2 . LEU A 1 198 ? 40.714 -18.921 30.979  1.00 75.87 ? 198 LEU A CD2 1 
ATOM 1426 N N   . ALA A 1 199 ? 36.562 -21.747 30.698  1.00 77.57 ? 199 ALA A N   1 
ATOM 1427 C CA  . ALA A 1 199 ? 35.559 -22.167 31.648  1.00 78.14 ? 199 ALA A CA  1 
ATOM 1428 C C   . ALA A 1 199 ? 35.768 -23.594 32.092  1.00 78.43 ? 199 ALA A C   1 
ATOM 1429 O O   . ALA A 1 199 ? 35.562 -23.903 33.265  1.00 78.74 ? 199 ALA A O   1 
ATOM 1430 C CB  . ALA A 1 199 ? 34.171 -21.999 31.068  1.00 78.31 ? 199 ALA A CB  1 
ATOM 1431 N N   . CYS A 1 200 ? 36.171 -24.466 31.174  1.00 78.57 ? 200 CYS A N   1 
ATOM 1432 C CA  . CYS A 1 200 ? 36.230 -25.887 31.499  1.00 79.16 ? 200 CYS A CA  1 
ATOM 1433 C C   . CYS A 1 200 ? 37.610 -26.350 32.039  1.00 78.84 ? 200 CYS A C   1 
ATOM 1434 O O   . CYS A 1 200 ? 37.749 -27.489 32.508  1.00 78.68 ? 200 CYS A O   1 
ATOM 1435 C CB  . CYS A 1 200 ? 35.812 -26.701 30.295  1.00 79.35 ? 200 CYS A CB  1 
ATOM 1436 S SG  . CYS A 1 200 ? 37.205 -27.093 29.309  1.00 82.21 ? 200 CYS A SG  1 
ATOM 1437 N N   . LEU A 1 201 ? 38.618 -25.472 31.923  1.00 78.67 ? 201 LEU A N   1 
ATOM 1438 C CA  . LEU A 1 201 ? 39.835 -25.476 32.781  1.00 78.33 ? 201 LEU A CA  1 
ATOM 1439 C C   . LEU A 1 201 ? 39.521 -25.225 34.271  1.00 77.99 ? 201 LEU A C   1 
ATOM 1440 O O   . LEU A 1 201 ? 40.107 -25.866 35.149  1.00 78.09 ? 201 LEU A O   1 
ATOM 1441 C CB  . LEU A 1 201 ? 40.831 -24.396 32.315  1.00 78.40 ? 201 LEU A CB  1 
ATOM 1442 C CG  . LEU A 1 201 ? 41.870 -24.741 31.255  1.00 77.47 ? 201 LEU A CG  1 
ATOM 1443 C CD1 . LEU A 1 201 ? 42.461 -23.478 30.690  1.00 77.06 ? 201 LEU A CD1 1 
ATOM 1444 C CD2 . LEU A 1 201 ? 42.952 -25.591 31.858  1.00 77.59 ? 201 LEU A CD2 1 
ATOM 1445 N N   . LYS A 1 202 ? 38.625 -24.269 34.535  1.00 77.76 ? 202 LYS A N   1 
ATOM 1446 C CA  . LYS A 1 202 ? 38.120 -23.978 35.894  1.00 77.66 ? 202 LYS A CA  1 
ATOM 1447 C C   . LYS A 1 202 ? 37.332 -25.138 36.423  1.00 77.50 ? 202 LYS A C   1 
ATOM 1448 O O   . LYS A 1 202 ? 37.507 -25.515 37.578  1.00 76.81 ? 202 LYS A O   1 
ATOM 1449 C CB  . LYS A 1 202 ? 37.205 -22.758 35.897  1.00 77.50 ? 202 LYS A CB  1 
ATOM 1450 C CG  . LYS A 1 202 ? 36.754 -22.284 37.260  1.00 77.46 ? 202 LYS A CG  1 
ATOM 1451 C CD  . LYS A 1 202 ? 35.579 -21.324 37.081  1.00 78.14 ? 202 LYS A CD  1 
ATOM 1452 C CE  . LYS A 1 202 ? 35.108 -20.698 38.389  1.00 79.25 ? 202 LYS A CE  1 
ATOM 1453 N NZ  . LYS A 1 202 ? 34.313 -19.471 38.123  1.00 79.69 ? 202 LYS A NZ  1 
ATOM 1454 N N   . LYS A 1 203 ? 36.450 -25.678 35.577  1.00 77.74 ? 203 LYS A N   1 
ATOM 1455 C CA  . LYS A 1 203 ? 35.623 -26.825 35.961  1.00 78.14 ? 203 LYS A CA  1 
ATOM 1456 C C   . LYS A 1 203 ? 36.545 -27.981 36.375  1.00 78.52 ? 203 LYS A C   1 
ATOM 1457 O O   . LYS A 1 203 ? 36.575 -28.365 37.549  1.00 78.57 ? 203 LYS A O   1 
ATOM 1458 C CB  . LYS A 1 203 ? 34.644 -27.233 34.847  1.00 77.70 ? 203 LYS A CB  1 
ATOM 1459 N N   . GLU A 1 204 ? 37.357 -28.473 35.442  1.00 78.97 ? 204 GLU A N   1 
ATOM 1460 C CA  . GLU A 1 204 ? 38.199 -29.655 35.700  1.00 79.20 ? 204 GLU A CA  1 
ATOM 1461 C C   . GLU A 1 204 ? 39.388 -29.469 36.706  1.00 79.44 ? 204 GLU A C   1 
ATOM 1462 O O   . GLU A 1 204 ? 40.255 -30.359 36.802  1.00 79.83 ? 204 GLU A O   1 
ATOM 1463 C CB  . GLU A 1 204 ? 38.686 -30.249 34.357  1.00 79.45 ? 204 GLU A CB  1 
ATOM 1464 C CG  . GLU A 1 204 ? 37.544 -30.820 33.481  1.00 79.29 ? 204 GLU A CG  1 
ATOM 1465 C CD  . GLU A 1 204 ? 38.021 -31.804 32.411  1.00 79.11 ? 204 GLU A CD  1 
ATOM 1466 O OE1 . GLU A 1 204 ? 38.648 -32.819 32.775  1.00 78.08 ? 204 GLU A OE1 1 
ATOM 1467 O OE2 . GLU A 1 204 ? 37.754 -31.570 31.204  1.00 79.15 ? 204 GLU A OE2 1 
ATOM 1468 N N   . ASN A 1 205 ? 39.406 -28.350 37.458  1.00 79.16 ? 205 ASN A N   1 
ATOM 1469 C CA  . ASN A 1 205 ? 40.416 -28.052 38.516  1.00 78.68 ? 205 ASN A CA  1 
ATOM 1470 C C   . ASN A 1 205 ? 41.867 -27.802 38.066  1.00 78.74 ? 205 ASN A C   1 
ATOM 1471 O O   . ASN A 1 205 ? 42.811 -28.060 38.808  1.00 79.12 ? 205 ASN A O   1 
ATOM 1472 C CB  . ASN A 1 205 ? 40.389 -29.124 39.602  1.00 78.26 ? 205 ASN A CB  1 
ATOM 1473 C CG  . ASN A 1 205 ? 39.416 -28.801 40.682  1.00 77.94 ? 205 ASN A CG  1 
ATOM 1474 O OD1 . ASN A 1 205 ? 39.793 -28.253 41.707  1.00 77.48 ? 205 ASN A OD1 1 
ATOM 1475 N ND2 . ASN A 1 205 ? 38.144 -29.102 40.454  1.00 78.28 ? 205 ASN A ND2 1 
ATOM 1476 N N   . ILE A 1 206 ? 42.067 -27.276 36.867  1.00 78.53 ? 206 ILE A N   1 
ATOM 1477 C CA  . ILE A 1 206 ? 43.425 -27.038 36.431  1.00 78.49 ? 206 ILE A CA  1 
ATOM 1478 C C   . ILE A 1 206 ? 43.830 -25.615 36.752  1.00 78.32 ? 206 ILE A C   1 
ATOM 1479 O O   . ILE A 1 206 ? 44.938 -25.375 37.230  1.00 78.74 ? 206 ILE A O   1 
ATOM 1480 C CB  . ILE A 1 206 ? 43.614 -27.358 34.960  1.00 78.46 ? 206 ILE A CB  1 
ATOM 1481 C CG1 . ILE A 1 206 ? 43.144 -28.806 34.720  1.00 78.69 ? 206 ILE A CG1 1 
ATOM 1482 C CG2 . ILE A 1 206 ? 45.101 -27.171 34.586  1.00 78.58 ? 206 ILE A CG2 1 
ATOM 1483 C CD1 . ILE A 1 206 ? 43.212 -29.288 33.278  1.00 78.62 ? 206 ILE A CD1 1 
ATOM 1484 N N   . LEU A 1 207 ? 42.926 -24.677 36.518  1.00 77.86 ? 207 LEU A N   1 
ATOM 1485 C CA  . LEU A 1 207 ? 43.222 -23.279 36.785  1.00 77.88 ? 207 LEU A CA  1 
ATOM 1486 C C   . LEU A 1 207 ? 41.974 -22.399 36.740  1.00 77.93 ? 207 LEU A C   1 
ATOM 1487 O O   . LEU A 1 207 ? 40.961 -22.776 36.174  1.00 78.20 ? 207 LEU A O   1 
ATOM 1488 C CB  . LEU A 1 207 ? 44.303 -22.796 35.814  1.00 77.87 ? 207 LEU A CB  1 
ATOM 1489 C CG  . LEU A 1 207 ? 44.171 -21.527 34.972  1.00 78.34 ? 207 LEU A CG  1 
ATOM 1490 C CD1 . LEU A 1 207 ? 45.478 -21.338 34.211  1.00 78.58 ? 207 LEU A CD1 1 
ATOM 1491 C CD2 . LEU A 1 207 ? 43.021 -21.599 33.958  1.00 78.28 ? 207 LEU A CD2 1 
ATOM 1492 N N   . ASP A 1 208 ? 42.054 -21.239 37.368  1.00 78.01 ? 208 ASP A N   1 
ATOM 1493 C CA  . ASP A 1 208 ? 40.974 -20.284 37.363  1.00 78.45 ? 208 ASP A CA  1 
ATOM 1494 C C   . ASP A 1 208 ? 41.640 -18.945 37.316  1.00 78.83 ? 208 ASP A C   1 
ATOM 1495 O O   . ASP A 1 208 ? 42.574 -18.692 38.092  1.00 78.93 ? 208 ASP A O   1 
ATOM 1496 C CB  . ASP A 1 208 ? 40.113 -20.398 38.635  1.00 78.85 ? 208 ASP A CB  1 
ATOM 1497 C CG  . ASP A 1 208 ? 39.244 -19.142 38.896  1.00 79.47 ? 208 ASP A CG  1 
ATOM 1498 O OD1 . ASP A 1 208 ? 37.984 -19.241 38.903  1.00 79.00 ? 208 ASP A OD1 1 
ATOM 1499 O OD2 . ASP A 1 208 ? 39.839 -18.054 39.097  1.00 80.36 ? 208 ASP A OD2 1 
ATOM 1500 N N   . LYS A 1 209 ? 41.150 -18.085 36.420  1.00 79.23 ? 209 LYS A N   1 
ATOM 1501 C CA  . LYS A 1 209 ? 41.689 -16.736 36.249  1.00 79.64 ? 209 LYS A CA  1 
ATOM 1502 C C   . LYS A 1 209 ? 40.771 -15.724 36.903  1.00 79.71 ? 209 LYS A C   1 
ATOM 1503 O O   . LYS A 1 209 ? 39.605 -15.608 36.535  1.00 79.15 ? 209 LYS A O   1 
ATOM 1504 C CB  . LYS A 1 209 ? 41.870 -16.363 34.766  1.00 79.60 ? 209 LYS A CB  1 
ATOM 1505 C CG  . LYS A 1 209 ? 42.832 -15.170 34.549  1.00 80.12 ? 209 LYS A CG  1 
ATOM 1506 C CD  . LYS A 1 209 ? 42.558 -14.376 33.270  1.00 80.40 ? 209 LYS A CD  1 
ATOM 1507 C CE  . LYS A 1 209 ? 41.444 -13.287 33.436  1.00 81.67 ? 209 LYS A CE  1 
ATOM 1508 N NZ  . LYS A 1 209 ? 41.873 -11.928 33.995  1.00 81.53 ? 209 LYS A NZ  1 
ATOM 1509 N N   . LYS A 1 210 ? 41.307 -15.006 37.886  1.00 80.30 ? 210 LYS A N   1 
ATOM 1510 C CA  . LYS A 1 210 ? 40.649 -13.807 38.415  1.00 80.76 ? 210 LYS A CA  1 
ATOM 1511 C C   . LYS A 1 210 ? 41.018 -12.544 37.566  1.00 80.87 ? 210 LYS A C   1 
ATOM 1512 O O   . LYS A 1 210 ? 41.594 -12.676 36.490  1.00 81.07 ? 210 LYS A O   1 
ATOM 1513 C CB  . LYS A 1 210 ? 40.948 -13.675 39.925  1.00 80.51 ? 210 LYS A CB  1 
ATOM 1514 C CG  . LYS A 1 210 ? 39.959 -14.494 40.779  1.00 80.77 ? 210 LYS A CG  1 
ATOM 1515 C CD  . LYS A 1 210 ? 40.525 -15.031 42.099  1.00 80.95 ? 210 LYS A CD  1 
ATOM 1516 C CE  . LYS A 1 210 ? 41.605 -14.144 42.744  1.00 80.72 ? 210 LYS A CE  1 
ATOM 1517 N NZ  . LYS A 1 210 ? 41.291 -12.679 42.754  1.00 80.67 ? 210 LYS A NZ  1 
ATOM 1518 N N   . LYS A 1 211 ? 40.646 -11.346 38.019  1.00 81.06 ? 211 LYS A N   1 
ATOM 1519 C CA  . LYS A 1 211 ? 41.016 -10.096 37.336  1.00 81.12 ? 211 LYS A CA  1 
ATOM 1520 C C   . LYS A 1 211 ? 42.488 -9.718  37.579  1.00 81.38 ? 211 LYS A C   1 
ATOM 1521 O O   . LYS A 1 211 ? 43.190 -9.347  36.637  1.00 81.69 ? 211 LYS A O   1 
ATOM 1522 C CB  . LYS A 1 211 ? 40.084 -8.945  37.775  1.00 81.04 ? 211 LYS A CB  1 
ATOM 1523 N N   . ASN A 1 212 ? 42.947 -9.819  38.837  1.00 81.63 ? 212 ASN A N   1 
ATOM 1524 C CA  . ASN A 1 212 ? 44.341 -9.448  39.235  1.00 81.42 ? 212 ASN A CA  1 
ATOM 1525 C C   . ASN A 1 212 ? 45.362 -10.592 39.197  1.00 81.14 ? 212 ASN A C   1 
ATOM 1526 O O   . ASN A 1 212 ? 46.578 -10.355 39.201  1.00 80.92 ? 212 ASN A O   1 
ATOM 1527 C CB  . ASN A 1 212 ? 44.381 -8.790  40.631  1.00 81.30 ? 212 ASN A CB  1 
ATOM 1528 C CG  . ASN A 1 212 ? 43.168 -9.122  41.487  1.00 81.85 ? 212 ASN A CG  1 
ATOM 1529 O OD1 . ASN A 1 212 ? 42.113 -9.506  40.966  1.00 81.23 ? 212 ASN A OD1 1 
ATOM 1530 N ND2 . ASN A 1 212 ? 43.301 -8.940  42.811  1.00 81.33 ? 212 ASN A ND2 1 
ATOM 1531 N N   . LYS A 1 213 ? 44.847 -11.815 39.097  1.00 80.98 ? 213 LYS A N   1 
ATOM 1532 C CA  . LYS A 1 213 ? 45.546 -13.014 39.531  1.00 80.80 ? 213 LYS A CA  1 
ATOM 1533 C C   . LYS A 1 213 ? 44.999 -14.197 38.738  1.00 80.77 ? 213 LYS A C   1 
ATOM 1534 O O   . LYS A 1 213 ? 43.780 -14.262 38.557  1.00 80.76 ? 213 LYS A O   1 
ATOM 1535 C CB  . LYS A 1 213 ? 45.205 -13.227 41.014  1.00 80.90 ? 213 LYS A CB  1 
ATOM 1536 C CG  . LYS A 1 213 ? 46.324 -13.736 41.920  1.00 81.00 ? 213 LYS A CG  1 
ATOM 1537 C CD  . LYS A 1 213 ? 46.863 -12.643 42.856  1.00 80.61 ? 213 LYS A CD  1 
ATOM 1538 N N   . PHE A 1 214 ? 45.846 -15.107 38.230  1.00 80.72 ? 214 PHE A N   1 
ATOM 1539 C CA  . PHE A 1 214 ? 45.349 -16.483 37.999  1.00 80.57 ? 214 PHE A CA  1 
ATOM 1540 C C   . PHE A 1 214 ? 45.932 -17.462 38.997  1.00 80.00 ? 214 PHE A C   1 
ATOM 1541 O O   . PHE A 1 214 ? 47.073 -17.316 39.444  1.00 80.67 ? 214 PHE A O   1 
ATOM 1542 C CB  . PHE A 1 214 ? 45.356 -17.012 36.534  1.00 80.81 ? 214 PHE A CB  1 
ATOM 1543 C CG  . PHE A 1 214 ? 46.698 -17.105 35.844  1.00 81.64 ? 214 PHE A CG  1 
ATOM 1544 C CD1 . PHE A 1 214 ? 47.495 -18.234 35.972  1.00 82.20 ? 214 PHE A CD1 1 
ATOM 1545 C CD2 . PHE A 1 214 ? 47.079 -16.148 34.917  1.00 81.66 ? 214 PHE A CD2 1 
ATOM 1546 C CE1 . PHE A 1 214 ? 48.710 -18.346 35.251  1.00 81.09 ? 214 PHE A CE1 1 
ATOM 1547 C CE2 . PHE A 1 214 ? 48.288 -16.266 34.230  1.00 81.41 ? 214 PHE A CE2 1 
ATOM 1548 C CZ  . PHE A 1 214 ? 49.092 -17.371 34.413  1.00 80.45 ? 214 PHE A CZ  1 
ATOM 1549 N N   . ILE A 1 215 ? 45.110 -18.422 39.401  1.00 78.88 ? 215 ILE A N   1 
ATOM 1550 C CA  . ILE A 1 215 ? 45.541 -19.408 40.374  1.00 78.23 ? 215 ILE A CA  1 
ATOM 1551 C C   . ILE A 1 215 ? 45.534 -20.724 39.676  1.00 77.51 ? 215 ILE A C   1 
ATOM 1552 O O   . ILE A 1 215 ? 44.541 -21.098 39.083  1.00 77.41 ? 215 ILE A O   1 
ATOM 1553 C CB  . ILE A 1 215 ? 44.605 -19.474 41.614  1.00 78.38 ? 215 ILE A CB  1 
ATOM 1554 C CG1 . ILE A 1 215 ? 44.892 -18.299 42.549  1.00 78.07 ? 215 ILE A CG1 1 
ATOM 1555 C CG2 . ILE A 1 215 ? 44.769 -20.806 42.382  1.00 78.01 ? 215 ILE A CG2 1 
ATOM 1556 C CD1 . ILE A 1 215 ? 44.348 -16.964 42.050  1.00 78.61 ? 215 ILE A CD1 1 
ATOM 1557 N N   . VAL A 1 216 ? 46.651 -21.423 39.765  1.00 77.23 ? 216 VAL A N   1 
ATOM 1558 C CA  . VAL A 1 216 ? 46.815 -22.713 39.114  1.00 77.32 ? 216 VAL A CA  1 
ATOM 1559 C C   . VAL A 1 216 ? 46.641 -23.817 40.142  1.00 77.41 ? 216 VAL A C   1 
ATOM 1560 O O   . VAL A 1 216 ? 47.200 -23.765 41.246  1.00 77.58 ? 216 VAL A O   1 
ATOM 1561 C CB  . VAL A 1 216 ? 48.176 -22.815 38.410  1.00 77.16 ? 216 VAL A CB  1 
ATOM 1562 C CG1 . VAL A 1 216 ? 48.572 -24.277 38.181  1.00 77.42 ? 216 VAL A CG1 1 
ATOM 1563 C CG2 . VAL A 1 216 ? 48.118 -22.032 37.088  1.00 76.78 ? 216 VAL A CG2 1 
ATOM 1564 N N   . TYR A 1 217 ? 45.831 -24.803 39.787  1.00 77.38 ? 217 TYR A N   1 
ATOM 1565 C CA  . TYR A 1 217 ? 45.478 -25.844 40.729  1.00 77.35 ? 217 TYR A CA  1 
ATOM 1566 C C   . TYR A 1 217 ? 46.193 -27.110 40.427  1.00 76.94 ? 217 TYR A C   1 
ATOM 1567 O O   . TYR A 1 217 ? 46.206 -28.021 41.248  1.00 77.20 ? 217 TYR A O   1 
ATOM 1568 C CB  . TYR A 1 217 ? 43.989 -26.104 40.649  1.00 77.54 ? 217 TYR A CB  1 
ATOM 1569 C CG  . TYR A 1 217 ? 43.193 -24.991 41.242  1.00 77.48 ? 217 TYR A CG  1 
ATOM 1570 C CD1 . TYR A 1 217 ? 42.321 -24.231 40.451  1.00 77.56 ? 217 TYR A CD1 1 
ATOM 1571 C CD2 . TYR A 1 217 ? 43.348 -24.663 42.592  1.00 75.10 ? 217 TYR A CD2 1 
ATOM 1572 C CE1 . TYR A 1 217 ? 41.593 -23.186 41.015  1.00 78.02 ? 217 TYR A CE1 1 
ATOM 1573 C CE2 . TYR A 1 217 ? 42.653 -23.642 43.155  1.00 75.09 ? 217 TYR A CE2 1 
ATOM 1574 C CZ  . TYR A 1 217 ? 41.769 -22.903 42.394  1.00 77.44 ? 217 TYR A CZ  1 
ATOM 1575 O OH  . TYR A 1 217 ? 41.078 -21.887 43.038  1.00 76.87 ? 217 TYR A OH  1 
ATOM 1576 N N   . ASN A 1 218 ? 46.784 -27.179 39.247  1.00 76.29 ? 218 ASN A N   1 
ATOM 1577 C CA  . ASN A 1 218 ? 47.295 -28.421 38.779  1.00 75.84 ? 218 ASN A CA  1 
ATOM 1578 C C   . ASN A 1 218 ? 48.312 -28.237 37.664  1.00 75.73 ? 218 ASN A C   1 
ATOM 1579 O O   . ASN A 1 218 ? 48.128 -28.711 36.551  1.00 75.67 ? 218 ASN A O   1 
ATOM 1580 C CB  . ASN A 1 218 ? 46.110 -29.257 38.314  1.00 75.77 ? 218 ASN A CB  1 
ATOM 1581 C CG  . ASN A 1 218 ? 46.410 -30.725 38.315  1.00 75.53 ? 218 ASN A CG  1 
ATOM 1582 O OD1 . ASN A 1 218 ? 47.564 -31.125 38.175  1.00 75.95 ? 218 ASN A OD1 1 
ATOM 1583 N ND2 . ASN A 1 218 ? 45.374 -31.547 38.478  1.00 73.71 ? 218 ASN A ND2 1 
ATOM 1584 N N   . LEU A 1 219 ? 49.402 -27.553 37.961  1.00 75.59 ? 219 LEU A N   1 
ATOM 1585 C CA  . LEU A 1 219 ? 50.454 -27.414 36.978  1.00 75.78 ? 219 LEU A CA  1 
ATOM 1586 C C   . LEU A 1 219 ? 50.779 -28.763 36.279  1.00 76.09 ? 219 LEU A C   1 
ATOM 1587 O O   . LEU A 1 219 ? 50.933 -28.794 35.055  1.00 75.98 ? 219 LEU A O   1 
ATOM 1588 C CB  . LEU A 1 219 ? 51.695 -26.776 37.608  1.00 75.45 ? 219 LEU A CB  1 
ATOM 1589 C CG  . LEU A 1 219 ? 52.828 -26.425 36.638  1.00 75.70 ? 219 LEU A CG  1 
ATOM 1590 C CD1 . LEU A 1 219 ? 52.347 -25.535 35.489  1.00 76.28 ? 219 LEU A CD1 1 
ATOM 1591 C CD2 . LEU A 1 219 ? 54.000 -25.780 37.366  1.00 75.30 ? 219 LEU A CD2 1 
ATOM 1592 N N   . GLU A 1 220 ? 50.846 -29.870 37.035  1.00 76.81 ? 220 GLU A N   1 
ATOM 1593 C CA  . GLU A 1 220 ? 51.070 -31.224 36.457  1.00 77.13 ? 220 GLU A CA  1 
ATOM 1594 C C   . GLU A 1 220 ? 50.227 -31.537 35.182  1.00 77.82 ? 220 GLU A C   1 
ATOM 1595 O O   . GLU A 1 220 ? 50.707 -32.141 34.221  1.00 77.51 ? 220 GLU A O   1 
ATOM 1596 N N   . GLU A 1 221 ? 48.973 -31.105 35.200  1.00 78.37 ? 221 GLU A N   1 
ATOM 1597 C CA  . GLU A 1 221 ? 47.990 -31.440 34.188  1.00 79.00 ? 221 GLU A CA  1 
ATOM 1598 C C   . GLU A 1 221 ? 47.984 -30.387 33.086  1.00 80.33 ? 221 GLU A C   1 
ATOM 1599 O O   . GLU A 1 221 ? 47.996 -30.717 31.896  1.00 80.69 ? 221 GLU A O   1 
ATOM 1600 C CB  . GLU A 1 221 ? 46.618 -31.480 34.848  1.00 78.86 ? 221 GLU A CB  1 
ATOM 1601 C CG  . GLU A 1 221 ? 45.425 -31.584 33.898  1.00 78.77 ? 221 GLU A CG  1 
ATOM 1602 C CD  . GLU A 1 221 ? 45.117 -32.996 33.455  1.00 78.10 ? 221 GLU A CD  1 
ATOM 1603 O OE1 . GLU A 1 221 ? 45.795 -33.941 33.901  1.00 78.83 ? 221 GLU A OE1 1 
ATOM 1604 O OE2 . GLU A 1 221 ? 44.171 -33.158 32.669  1.00 76.49 ? 221 GLU A OE2 1 
ATOM 1605 N N   . LEU A 1 222 ? 47.923 -29.114 33.478  1.00 81.33 ? 222 LEU A N   1 
ATOM 1606 C CA  . LEU A 1 222 ? 48.070 -28.010 32.530  1.00 81.79 ? 222 LEU A CA  1 
ATOM 1607 C C   . LEU A 1 222 ? 49.118 -28.381 31.480  1.00 82.86 ? 222 LEU A C   1 
ATOM 1608 O O   . LEU A 1 222 ? 48.801 -28.521 30.295  1.00 82.54 ? 222 LEU A O   1 
ATOM 1609 C CB  . LEU A 1 222 ? 48.478 -26.738 33.279  1.00 81.61 ? 222 LEU A CB  1 
ATOM 1610 C CG  . LEU A 1 222 ? 48.562 -25.411 32.533  1.00 81.10 ? 222 LEU A CG  1 
ATOM 1611 C CD1 . LEU A 1 222 ? 47.746 -25.388 31.256  1.00 82.63 ? 222 LEU A CD1 1 
ATOM 1612 C CD2 . LEU A 1 222 ? 48.073 -24.321 33.428  1.00 80.69 ? 222 LEU A CD2 1 
ATOM 1613 N N   . LYS A 1 223 ? 50.347 -28.601 31.952  1.00 84.41 ? 223 LYS A N   1 
ATOM 1614 C CA  . LYS A 1 223 ? 51.473 -29.014 31.114  1.00 85.82 ? 223 LYS A CA  1 
ATOM 1615 C C   . LYS A 1 223 ? 51.129 -30.229 30.299  1.00 86.41 ? 223 LYS A C   1 
ATOM 1616 O O   . LYS A 1 223 ? 51.570 -30.367 29.154  1.00 86.52 ? 223 LYS A O   1 
ATOM 1617 C CB  . LYS A 1 223 ? 52.688 -29.348 31.984  1.00 86.30 ? 223 LYS A CB  1 
ATOM 1618 C CG  . LYS A 1 223 ? 53.885 -29.898 31.210  1.00 87.69 ? 223 LYS A CG  1 
ATOM 1619 C CD  . LYS A 1 223 ? 55.180 -29.727 31.985  1.00 90.26 ? 223 LYS A CD  1 
ATOM 1620 C CE  . LYS A 1 223 ? 56.364 -29.552 31.024  1.00 91.86 ? 223 LYS A CE  1 
ATOM 1621 N NZ  . LYS A 1 223 ? 57.652 -29.321 31.771  1.00 93.42 ? 223 LYS A NZ  1 
ATOM 1622 N N   . HIS A 1 224 ? 50.351 -31.115 30.912  1.00 87.32 ? 224 HIS A N   1 
ATOM 1623 C CA  . HIS A 1 224 ? 49.989 -32.380 30.289  1.00 88.33 ? 224 HIS A CA  1 
ATOM 1624 C C   . HIS A 1 224 ? 49.194 -32.172 28.985  1.00 87.78 ? 224 HIS A C   1 
ATOM 1625 O O   . HIS A 1 224 ? 49.336 -32.984 28.065  1.00 88.18 ? 224 HIS A O   1 
ATOM 1626 C CB  . HIS A 1 224 ? 49.230 -33.315 31.272  1.00 89.02 ? 224 HIS A CB  1 
ATOM 1627 C CG  . HIS A 1 224 ? 49.527 -34.773 31.068  1.00 91.74 ? 224 HIS A CG  1 
ATOM 1628 N ND1 . HIS A 1 224 ? 49.755 -35.319 29.816  1.00 93.26 ? 224 HIS A ND1 1 
ATOM 1629 C CD2 . HIS A 1 224 ? 49.647 -35.796 31.953  1.00 93.71 ? 224 HIS A CD2 1 
ATOM 1630 C CE1 . HIS A 1 224 ? 50.008 -36.611 29.942  1.00 93.65 ? 224 HIS A CE1 1 
ATOM 1631 N NE2 . HIS A 1 224 ? 49.943 -36.928 31.225  1.00 94.43 ? 224 HIS A NE2 1 
ATOM 1632 N N   . LEU A 1 225 ? 48.394 -31.099 28.899  1.00 86.74 ? 225 LEU A N   1 
ATOM 1633 C CA  . LEU A 1 225 ? 47.563 -30.851 27.721  1.00 85.90 ? 225 LEU A CA  1 
ATOM 1634 C C   . LEU A 1 225 ? 48.348 -29.890 26.861  1.00 84.99 ? 225 LEU A C   1 
ATOM 1635 O O   . LEU A 1 225 ? 47.988 -28.745 26.753  1.00 85.45 ? 225 LEU A O   1 
ATOM 1636 C CB  . LEU A 1 225 ? 46.211 -30.227 28.086  1.00 86.00 ? 225 LEU A CB  1 
ATOM 1637 C CG  . LEU A 1 225 ? 45.723 -30.183 29.543  1.00 87.06 ? 225 LEU A CG  1 
ATOM 1638 C CD1 . LEU A 1 225 ? 44.329 -29.554 29.660  1.00 86.97 ? 225 LEU A CD1 1 
ATOM 1639 C CD2 . LEU A 1 225 ? 45.674 -31.536 30.152  1.00 87.36 ? 225 LEU A CD2 1 
ATOM 1640 N N   . SER A 1 226 ? 49.462 -30.350 26.302  1.00 83.76 ? 226 SER A N   1 
ATOM 1641 C CA  . SER A 1 226 ? 50.336 -29.534 25.437  1.00 82.00 ? 226 SER A CA  1 
ATOM 1642 C C   . SER A 1 226 ? 51.661 -30.282 25.142  1.00 81.74 ? 226 SER A C   1 
ATOM 1643 O O   . SER A 1 226 ? 51.669 -31.367 24.535  1.00 80.68 ? 226 SER A O   1 
ATOM 1644 C CB  . SER A 1 226 ? 50.593 -28.125 26.029  1.00 81.43 ? 226 SER A CB  1 
ATOM 1645 O OG  . SER A 1 226 ? 50.155 -27.976 27.365  1.00 77.65 ? 226 SER A OG  1 
ATOM 1646 N N   . PHE B 1 19  ? 19.794 -21.998 19.990  1.00 79.60 ? 19  PHE B N   1 
ATOM 1647 C CA  . PHE B 1 19  ? 18.583 -22.890 19.690  1.00 79.62 ? 19  PHE B CA  1 
ATOM 1648 C C   . PHE B 1 19  ? 17.524 -22.376 18.678  1.00 78.72 ? 19  PHE B C   1 
ATOM 1649 O O   . PHE B 1 19  ? 17.031 -23.147 17.847  1.00 78.80 ? 19  PHE B O   1 
ATOM 1650 C CB  . PHE B 1 19  ? 17.872 -23.283 20.979  1.00 79.82 ? 19  PHE B CB  1 
ATOM 1651 C CG  . PHE B 1 19  ? 18.317 -24.601 21.532  1.00 81.49 ? 19  PHE B CG  1 
ATOM 1652 C CD1 . PHE B 1 19  ? 19.635 -25.062 21.353  1.00 83.36 ? 19  PHE B CD1 1 
ATOM 1653 C CD2 . PHE B 1 19  ? 17.433 -25.389 22.285  1.00 83.49 ? 19  PHE B CD2 1 
ATOM 1654 C CE1 . PHE B 1 19  ? 20.057 -26.325 21.883  1.00 82.68 ? 19  PHE B CE1 1 
ATOM 1655 C CE2 . PHE B 1 19  ? 17.847 -26.619 22.854  1.00 82.53 ? 19  PHE B CE2 1 
ATOM 1656 C CZ  . PHE B 1 19  ? 19.159 -27.093 22.635  1.00 82.10 ? 19  PHE B CZ  1 
ATOM 1657 N N   . PHE B 1 20  ? 17.175 -21.094 18.780  1.00 77.53 ? 20  PHE B N   1 
ATOM 1658 C CA  . PHE B 1 20  ? 16.432 -20.374 17.743  1.00 76.60 ? 20  PHE B CA  1 
ATOM 1659 C C   . PHE B 1 20  ? 14.989 -20.822 17.586  1.00 76.39 ? 20  PHE B C   1 
ATOM 1660 O O   . PHE B 1 20  ? 14.557 -21.042 16.452  1.00 77.88 ? 20  PHE B O   1 
ATOM 1661 C CB  . PHE B 1 20  ? 17.147 -20.480 16.348  1.00 75.70 ? 20  PHE B CB  1 
ATOM 1662 C CG  . PHE B 1 20  ? 18.600 -20.021 16.352  1.00 73.82 ? 20  PHE B CG  1 
ATOM 1663 C CD1 . PHE B 1 20  ? 19.639 -20.943 16.280  1.00 73.34 ? 20  PHE B CD1 1 
ATOM 1664 C CD2 . PHE B 1 20  ? 18.917 -18.689 16.438  1.00 70.16 ? 20  PHE B CD2 1 
ATOM 1665 C CE1 . PHE B 1 20  ? 20.961 -20.520 16.314  1.00 72.28 ? 20  PHE B CE1 1 
ATOM 1666 C CE2 . PHE B 1 20  ? 20.218 -18.269 16.459  1.00 70.47 ? 20  PHE B CE2 1 
ATOM 1667 C CZ  . PHE B 1 20  ? 21.245 -19.173 16.405  1.00 71.47 ? 20  PHE B CZ  1 
ATOM 1668 N N   . PRO B 1 21  ? 14.224 -20.879 18.677  1.00 75.67 ? 21  PRO B N   1 
ATOM 1669 C CA  . PRO B 1 21  ? 12.936 -21.558 18.662  1.00 75.54 ? 21  PRO B CA  1 
ATOM 1670 C C   . PRO B 1 21  ? 11.895 -20.916 17.762  1.00 75.16 ? 21  PRO B C   1 
ATOM 1671 O O   . PRO B 1 21  ? 11.960 -19.729 17.511  1.00 75.03 ? 21  PRO B O   1 
ATOM 1672 C CB  . PRO B 1 21  ? 12.454 -21.445 20.138  1.00 75.71 ? 21  PRO B CB  1 
ATOM 1673 C CG  . PRO B 1 21  ? 13.631 -21.003 20.923  1.00 75.20 ? 21  PRO B CG  1 
ATOM 1674 C CD  . PRO B 1 21  ? 14.480 -20.241 19.982  1.00 75.94 ? 21  PRO B CD  1 
ATOM 1675 N N   . ILE B 1 22  ? 10.936 -21.708 17.311  1.00 75.10 ? 22  ILE B N   1 
ATOM 1676 C CA  . ILE B 1 22  ? 9.693  -21.194 16.796  1.00 75.50 ? 22  ILE B CA  1 
ATOM 1677 C C   . ILE B 1 22  ? 8.556  -21.917 17.516  1.00 76.21 ? 22  ILE B C   1 
ATOM 1678 O O   . ILE B 1 22  ? 8.045  -22.905 16.959  1.00 77.84 ? 22  ILE B O   1 
ATOM 1679 C CB  . ILE B 1 22  ? 9.463  -21.535 15.322  1.00 75.07 ? 22  ILE B CB  1 
ATOM 1680 C CG1 . ILE B 1 22  ? 10.668 -22.179 14.685  1.00 75.28 ? 22  ILE B CG1 1 
ATOM 1681 C CG2 . ILE B 1 22  ? 9.066  -20.317 14.552  1.00 75.68 ? 22  ILE B CG2 1 
ATOM 1682 C CD1 . ILE B 1 22  ? 11.629 -21.183 14.200  1.00 75.82 ? 22  ILE B CD1 1 
ATOM 1683 N N   . GLU B 1 23  ? 8.153  -21.479 18.712  1.00 75.41 ? 23  GLU B N   1 
ATOM 1684 C CA  . GLU B 1 23  ? 6.885  -21.950 19.283  1.00 75.26 ? 23  GLU B CA  1 
ATOM 1685 C C   . GLU B 1 23  ? 5.825  -22.035 18.226  1.00 74.77 ? 23  GLU B C   1 
ATOM 1686 O O   . GLU B 1 23  ? 5.224  -23.071 18.051  1.00 73.93 ? 23  GLU B O   1 
ATOM 1687 C CB  . GLU B 1 23  ? 6.272  -20.948 20.274  1.00 75.59 ? 23  GLU B CB  1 
ATOM 1688 C CG  . GLU B 1 23  ? 5.926  -21.504 21.569  1.00 76.20 ? 23  GLU B CG  1 
ATOM 1689 C CD  . GLU B 1 23  ? 7.008  -21.130 22.511  1.00 80.20 ? 23  GLU B CD  1 
ATOM 1690 O OE1 . GLU B 1 23  ? 8.179  -21.151 22.040  1.00 81.99 ? 23  GLU B OE1 1 
ATOM 1691 O OE2 . GLU B 1 23  ? 6.712  -20.768 23.689  1.00 82.74 ? 23  GLU B OE2 1 
ATOM 1692 N N   . LYS B 1 24  ? 5.574  -20.904 17.558  1.00 74.93 ? 24  LYS B N   1 
ATOM 1693 C CA  . LYS B 1 24  ? 4.291  -20.674 16.888  1.00 75.52 ? 24  LYS B CA  1 
ATOM 1694 C C   . LYS B 1 24  ? 3.944  -21.787 15.865  1.00 75.87 ? 24  LYS B C   1 
ATOM 1695 O O   . LYS B 1 24  ? 2.785  -21.988 15.506  1.00 75.61 ? 24  LYS B O   1 
ATOM 1696 C CB  . LYS B 1 24  ? 4.254  -19.260 16.261  1.00 75.61 ? 24  LYS B CB  1 
ATOM 1697 N N   . LEU B 1 25  ? 4.974  -22.518 15.446  1.00 76.11 ? 25  LEU B N   1 
ATOM 1698 C CA  . LEU B 1 25  ? 4.867  -23.753 14.663  1.00 75.91 ? 25  LEU B CA  1 
ATOM 1699 C C   . LEU B 1 25  ? 4.330  -25.089 15.309  1.00 75.97 ? 25  LEU B C   1 
ATOM 1700 O O   . LEU B 1 25  ? 3.962  -26.019 14.579  1.00 75.26 ? 25  LEU B O   1 
ATOM 1701 C CB  . LEU B 1 25  ? 6.263  -24.010 14.069  1.00 75.96 ? 25  LEU B CB  1 
ATOM 1702 C CG  . LEU B 1 25  ? 6.363  -23.876 12.543  1.00 75.61 ? 25  LEU B CG  1 
ATOM 1703 C CD1 . LEU B 1 25  ? 7.761  -24.211 12.033  1.00 73.90 ? 25  LEU B CD1 1 
ATOM 1704 C CD2 . LEU B 1 25  ? 5.328  -24.804 11.904  1.00 75.44 ? 25  LEU B CD2 1 
ATOM 1705 N N   . ARG B 1 26  ? 4.325  -25.224 16.643  1.00 76.33 ? 26  ARG B N   1 
ATOM 1706 C CA  . ARG B 1 26  ? 3.673  -26.382 17.299  1.00 76.53 ? 26  ARG B CA  1 
ATOM 1707 C C   . ARG B 1 26  ? 2.224  -26.375 16.928  1.00 76.92 ? 26  ARG B C   1 
ATOM 1708 O O   . ARG B 1 26  ? 1.548  -27.394 16.903  1.00 77.37 ? 26  ARG B O   1 
ATOM 1709 C CB  . ARG B 1 26  ? 3.674  -26.293 18.814  1.00 76.88 ? 26  ARG B CB  1 
ATOM 1710 C CG  . ARG B 1 26  ? 4.893  -25.730 19.465  1.00 77.74 ? 26  ARG B CG  1 
ATOM 1711 C CD  . ARG B 1 26  ? 4.901  -26.149 20.886  1.00 78.74 ? 26  ARG B CD  1 
ATOM 1712 N NE  . ARG B 1 26  ? 5.072  -27.603 21.019  1.00 80.24 ? 26  ARG B NE  1 
ATOM 1713 C CZ  . ARG B 1 26  ? 6.229  -28.271 20.877  1.00 80.06 ? 26  ARG B CZ  1 
ATOM 1714 N NH1 . ARG B 1 26  ? 7.353  -27.637 20.567  1.00 79.78 ? 26  ARG B NH1 1 
ATOM 1715 N NH2 . ARG B 1 26  ? 6.268  -29.592 21.043  1.00 78.87 ? 26  ARG B NH2 1 
ATOM 1716 N N   . ASN B 1 27  ? 1.745  -25.164 16.737  1.00 77.41 ? 27  ASN B N   1 
ATOM 1717 C CA  . ASN B 1 27  ? 0.444  -24.888 16.184  1.00 77.68 ? 27  ASN B CA  1 
ATOM 1718 C C   . ASN B 1 27  ? 0.088  -25.567 14.854  1.00 77.78 ? 27  ASN B C   1 
ATOM 1719 O O   . ASN B 1 27  ? -1.086 -25.502 14.467  1.00 78.52 ? 27  ASN B O   1 
ATOM 1720 C CB  . ASN B 1 27  ? 0.317  -23.369 16.019  1.00 77.61 ? 27  ASN B CB  1 
ATOM 1721 C CG  . ASN B 1 27  ? 0.293  -22.664 17.354  1.00 77.97 ? 27  ASN B CG  1 
ATOM 1722 O OD1 . ASN B 1 27  ? 1.127  -21.807 17.667  1.00 79.45 ? 27  ASN B OD1 1 
ATOM 1723 N ND2 . ASN B 1 27  ? -0.650 -23.062 18.173  1.00 78.60 ? 27  ASN B ND2 1 
ATOM 1724 N N   . TYR B 1 28  ? 1.034  -26.216 14.162  1.00 76.81 ? 28  TYR B N   1 
ATOM 1725 C CA  . TYR B 1 28  ? 0.735  -26.734 12.823  1.00 76.60 ? 28  TYR B CA  1 
ATOM 1726 C C   . TYR B 1 28  ? 1.315  -28.121 12.512  1.00 76.59 ? 28  TYR B C   1 
ATOM 1727 O O   . TYR B 1 28  ? 1.396  -28.546 11.342  1.00 75.98 ? 28  TYR B O   1 
ATOM 1728 C CB  . TYR B 1 28  ? 1.257  -25.751 11.777  1.00 77.04 ? 28  TYR B CB  1 
ATOM 1729 C CG  . TYR B 1 28  ? 0.612  -24.388 11.769  1.00 76.82 ? 28  TYR B CG  1 
ATOM 1730 C CD1 . TYR B 1 28  ? 1.321  -23.230 12.128  1.00 76.77 ? 28  TYR B CD1 1 
ATOM 1731 C CD2 . TYR B 1 28  ? -0.681 -24.248 11.333  1.00 76.60 ? 28  TYR B CD2 1 
ATOM 1732 C CE1 . TYR B 1 28  ? 0.712  -21.971 12.076  1.00 76.83 ? 28  TYR B CE1 1 
ATOM 1733 C CE2 . TYR B 1 28  ? -1.283 -23.015 11.280  1.00 77.83 ? 28  TYR B CE2 1 
ATOM 1734 C CZ  . TYR B 1 28  ? -0.598 -21.885 11.659  1.00 77.32 ? 28  TYR B CZ  1 
ATOM 1735 O OH  . TYR B 1 28  ? -1.291 -20.709 11.598  1.00 77.58 ? 28  TYR B OH  1 
ATOM 1736 N N   . THR B 1 29  ? 1.711  -28.836 13.559  1.00 76.74 ? 29  THR B N   1 
ATOM 1737 C CA  . THR B 1 29  ? 2.345  -30.157 13.401  1.00 76.25 ? 29  THR B CA  1 
ATOM 1738 C C   . THR B 1 29  ? 1.311  -31.069 12.834  1.00 76.50 ? 29  THR B C   1 
ATOM 1739 O O   . THR B 1 29  ? 1.613  -32.066 12.163  1.00 75.10 ? 29  THR B O   1 
ATOM 1740 C CB  . THR B 1 29  ? 2.801  -30.718 14.757  1.00 75.98 ? 29  THR B CB  1 
ATOM 1741 O OG1 . THR B 1 29  ? 1.677  -30.762 15.642  1.00 73.01 ? 29  THR B OG1 1 
ATOM 1742 C CG2 . THR B 1 29  ? 3.910  -29.840 15.355  1.00 75.29 ? 29  THR B CG2 1 
ATOM 1743 N N   . ASP B 1 30  ? 0.070  -30.698 13.139  1.00 77.48 ? 30  ASP B N   1 
ATOM 1744 C CA  . ASP B 1 30  ? -1.085 -31.459 12.707  1.00 78.33 ? 30  ASP B CA  1 
ATOM 1745 C C   . ASP B 1 30  ? -1.223 -31.510 11.190  1.00 78.09 ? 30  ASP B C   1 
ATOM 1746 O O   . ASP B 1 30  ? -1.920 -32.357 10.640  1.00 77.67 ? 30  ASP B O   1 
ATOM 1747 C CB  . ASP B 1 30  ? -2.344 -30.971 13.438  1.00 78.27 ? 30  ASP B CB  1 
ATOM 1748 C CG  . ASP B 1 30  ? -2.444 -31.577 14.819  1.00 80.10 ? 30  ASP B CG  1 
ATOM 1749 O OD1 . ASP B 1 30  ? -1.383 -32.082 15.291  1.00 81.39 ? 30  ASP B OD1 1 
ATOM 1750 O OD2 . ASP B 1 30  ? -3.553 -31.572 15.419  1.00 81.76 ? 30  ASP B OD2 1 
ATOM 1751 N N   . MET B 1 31  ? -0.518 -30.619 10.515  1.00 78.56 ? 31  MET B N   1 
ATOM 1752 C CA  . MET B 1 31  ? -0.494 -30.634 9.061   1.00 79.10 ? 31  MET B CA  1 
ATOM 1753 C C   . MET B 1 31  ? 0.728  -31.383 8.548   1.00 78.27 ? 31  MET B C   1 
ATOM 1754 O O   . MET B 1 31  ? 0.673  -31.932 7.473   1.00 78.79 ? 31  MET B O   1 
ATOM 1755 C CB  . MET B 1 31  ? -0.555 -29.201 8.502   1.00 78.80 ? 31  MET B CB  1 
ATOM 1756 C CG  . MET B 1 31  ? -1.663 -28.317 9.130   1.00 79.46 ? 31  MET B CG  1 
ATOM 1757 S SD  . MET B 1 31  ? -1.895 -26.663 8.353   1.00 82.78 ? 31  MET B SD  1 
ATOM 1758 C CE  . MET B 1 31  ? -3.276 -25.986 9.286   1.00 80.66 ? 31  MET B CE  1 
ATOM 1759 N N   . GLY B 1 32  ? 1.816  -31.418 9.321   1.00 77.76 ? 32  GLY B N   1 
ATOM 1760 C CA  . GLY B 1 32  ? 3.066  -32.086 8.916   1.00 76.91 ? 32  GLY B CA  1 
ATOM 1761 C C   . GLY B 1 32  ? 2.986  -33.597 8.975   1.00 75.92 ? 32  GLY B C   1 
ATOM 1762 O O   . GLY B 1 32  ? 1.903  -34.128 9.113   1.00 76.01 ? 32  GLY B O   1 
ATOM 1763 N N   . ILE B 1 33  ? 4.109  -34.298 8.817   1.00 75.32 ? 33  ILE B N   1 
ATOM 1764 C CA  . ILE B 1 33  ? 4.138  -35.734 9.126   1.00 74.65 ? 33  ILE B CA  1 
ATOM 1765 C C   . ILE B 1 33  ? 5.145  -35.999 10.239  1.00 74.49 ? 33  ILE B C   1 
ATOM 1766 O O   . ILE B 1 33  ? 6.320  -35.663 10.129  1.00 74.74 ? 33  ILE B O   1 
ATOM 1767 C CB  . ILE B 1 33  ? 4.357  -36.690 7.888   1.00 74.29 ? 33  ILE B CB  1 
ATOM 1768 C CG1 . ILE B 1 33  ? 5.647  -37.489 8.025   1.00 73.69 ? 33  ILE B CG1 1 
ATOM 1769 C CG2 . ILE B 1 33  ? 4.258  -35.969 6.530   1.00 73.60 ? 33  ILE B CG2 1 
ATOM 1770 N N   . ILE B 1 34  ? 4.657  -36.616 11.311  1.00 74.51 ? 34  ILE B N   1 
ATOM 1771 C CA  . ILE B 1 34  ? 5.395  -36.745 12.556  1.00 74.59 ? 34  ILE B CA  1 
ATOM 1772 C C   . ILE B 1 34  ? 6.243  -37.993 12.547  1.00 74.33 ? 34  ILE B C   1 
ATOM 1773 O O   . ILE B 1 34  ? 5.779  -39.059 12.218  1.00 73.76 ? 34  ILE B O   1 
ATOM 1774 C CB  . ILE B 1 34  ? 4.451  -36.852 13.761  1.00 74.81 ? 34  ILE B CB  1 
ATOM 1775 C CG1 . ILE B 1 34  ? 3.492  -35.656 13.831  1.00 75.18 ? 34  ILE B CG1 1 
ATOM 1776 C CG2 . ILE B 1 34  ? 5.251  -37.052 15.065  1.00 75.27 ? 34  ILE B CG2 1 
ATOM 1777 C CD1 . ILE B 1 34  ? 4.029  -34.381 13.265  1.00 76.62 ? 34  ILE B CD1 1 
ATOM 1778 N N   . ARG B 1 35  ? 7.497  -37.846 12.919  1.00 74.58 ? 35  ARG B N   1 
ATOM 1779 C CA  . ARG B 1 35  ? 8.408  -38.954 12.903  1.00 74.90 ? 35  ARG B CA  1 
ATOM 1780 C C   . ARG B 1 35  ? 9.099  -38.871 14.218  1.00 74.89 ? 35  ARG B C   1 
ATOM 1781 O O   . ARG B 1 35  ? 9.325  -37.793 14.745  1.00 74.23 ? 35  ARG B O   1 
ATOM 1782 C CB  . ARG B 1 35  ? 9.388  -38.881 11.722  1.00 75.26 ? 35  ARG B CB  1 
ATOM 1783 C CG  . ARG B 1 35  ? 8.660  -38.753 10.377  1.00 76.28 ? 35  ARG B CG  1 
ATOM 1784 C CD  . ARG B 1 35  ? 9.156  -39.685 9.309   1.00 78.36 ? 35  ARG B CD  1 
ATOM 1785 N NE  . ARG B 1 35  ? 9.998  -39.007 8.312   1.00 79.74 ? 35  ARG B NE  1 
ATOM 1786 C CZ  . ARG B 1 35  ? 11.275 -39.301 8.036   1.00 80.77 ? 35  ARG B CZ  1 
ATOM 1787 N NH1 . ARG B 1 35  ? 11.923 -40.276 8.672   1.00 80.67 ? 35  ARG B NH1 1 
ATOM 1788 N NH2 . ARG B 1 35  ? 11.927 -38.602 7.105   1.00 81.96 ? 35  ARG B NH2 1 
ATOM 1789 N N   . GLU B 1 36  ? 9.405  -40.049 14.735  1.00 75.41 ? 36  GLU B N   1 
ATOM 1790 C CA  . GLU B 1 36  ? 9.830  -40.233 16.080  1.00 75.36 ? 36  GLU B CA  1 
ATOM 1791 C C   . GLU B 1 36  ? 11.028 -41.120 16.026  1.00 75.47 ? 36  GLU B C   1 
ATOM 1792 O O   . GLU B 1 36  ? 10.941 -42.222 15.502  1.00 75.62 ? 36  GLU B O   1 
ATOM 1793 C CB  . GLU B 1 36  ? 8.723  -40.913 16.837  1.00 75.24 ? 36  GLU B CB  1 
ATOM 1794 C CG  . GLU B 1 36  ? 8.475  -40.281 18.174  1.00 76.12 ? 36  GLU B CG  1 
ATOM 1795 C CD  . GLU B 1 36  ? 7.064  -40.548 18.655  1.00 76.77 ? 36  GLU B CD  1 
ATOM 1796 O OE1 . GLU B 1 36  ? 6.646  -41.723 18.636  1.00 79.35 ? 36  GLU B OE1 1 
ATOM 1797 O OE2 . GLU B 1 36  ? 6.362  -39.603 19.049  1.00 75.46 ? 36  GLU B OE2 1 
ATOM 1798 N N   . PHE B 1 37  ? 12.139 -40.622 16.564  1.00 75.79 ? 37  PHE B N   1 
ATOM 1799 C CA  . PHE B 1 37  ? 13.450 -41.276 16.511  1.00 75.80 ? 37  PHE B CA  1 
ATOM 1800 C C   . PHE B 1 37  ? 13.988 -41.587 17.919  1.00 75.77 ? 37  PHE B C   1 
ATOM 1801 O O   . PHE B 1 37  ? 13.989 -40.701 18.777  1.00 75.20 ? 37  PHE B O   1 
ATOM 1802 C CB  . PHE B 1 37  ? 14.417 -40.330 15.807  1.00 75.95 ? 37  PHE B CB  1 
ATOM 1803 C CG  . PHE B 1 37  ? 13.975 -39.922 14.421  1.00 76.04 ? 37  PHE B CG  1 
ATOM 1804 C CD1 . PHE B 1 37  ? 13.117 -38.851 14.236  1.00 76.85 ? 37  PHE B CD1 1 
ATOM 1805 C CD2 . PHE B 1 37  ? 14.435 -40.612 13.295  1.00 75.98 ? 37  PHE B CD2 1 
ATOM 1806 C CE1 . PHE B 1 37  ? 12.714 -38.475 12.945  1.00 76.99 ? 37  PHE B CE1 1 
ATOM 1807 C CE2 . PHE B 1 37  ? 14.047 -40.252 12.015  1.00 75.36 ? 37  PHE B CE2 1 
ATOM 1808 C CZ  . PHE B 1 37  ? 13.184 -39.188 11.834  1.00 76.88 ? 37  PHE B CZ  1 
ATOM 1809 N N   . ALA B 1 38  ? 14.449 -42.823 18.166  1.00 76.04 ? 38  ALA B N   1 
ATOM 1810 C CA  . ALA B 1 38  ? 14.969 -43.194 19.512  1.00 76.12 ? 38  ALA B CA  1 
ATOM 1811 C C   . ALA B 1 38  ? 16.399 -42.685 19.713  1.00 76.13 ? 38  ALA B C   1 
ATOM 1812 O O   . ALA B 1 38  ? 17.015 -42.188 18.776  1.00 76.25 ? 38  ALA B O   1 
ATOM 1813 C CB  . ALA B 1 38  ? 14.869 -44.701 19.764  1.00 75.74 ? 38  ALA B CB  1 
ATOM 1814 N N   . LYS B 1 39  ? 16.929 -42.780 20.928  1.00 76.01 ? 39  LYS B N   1 
ATOM 1815 C CA  . LYS B 1 39  ? 18.297 -42.289 21.193  1.00 76.00 ? 39  LYS B CA  1 
ATOM 1816 C C   . LYS B 1 39  ? 19.314 -42.923 20.209  1.00 75.61 ? 39  LYS B C   1 
ATOM 1817 O O   . LYS B 1 39  ? 19.223 -44.096 19.911  1.00 75.39 ? 39  LYS B O   1 
ATOM 1818 C CB  . LYS B 1 39  ? 18.652 -42.567 22.664  1.00 75.86 ? 39  LYS B CB  1 
ATOM 1819 C CG  . LYS B 1 39  ? 19.945 -41.964 23.186  1.00 75.85 ? 39  LYS B CG  1 
ATOM 1820 C CD  . LYS B 1 39  ? 19.976 -42.031 24.718  1.00 76.21 ? 39  LYS B CD  1 
ATOM 1821 C CE  . LYS B 1 39  ? 20.731 -40.890 25.348  1.00 76.49 ? 39  LYS B CE  1 
ATOM 1822 N NZ  . LYS B 1 39  ? 21.463 -41.421 26.518  1.00 77.78 ? 39  LYS B NZ  1 
ATOM 1823 N N   . GLY B 1 40  ? 20.238 -42.154 19.649  1.00 75.59 ? 40  GLY B N   1 
ATOM 1824 C CA  . GLY B 1 40  ? 21.236 -42.745 18.734  1.00 75.77 ? 40  GLY B CA  1 
ATOM 1825 C C   . GLY B 1 40  ? 20.769 -42.956 17.303  1.00 75.69 ? 40  GLY B C   1 
ATOM 1826 O O   . GLY B 1 40  ? 21.578 -43.177 16.402  1.00 75.03 ? 40  GLY B O   1 
ATOM 1827 N N   . SER B 1 41  ? 19.458 -42.900 17.097  1.00 76.13 ? 41  SER B N   1 
ATOM 1828 C CA  . SER B 1 41  ? 18.878 -43.029 15.767  1.00 76.58 ? 41  SER B CA  1 
ATOM 1829 C C   . SER B 1 41  ? 19.386 -41.919 14.840  1.00 77.01 ? 41  SER B C   1 
ATOM 1830 O O   . SER B 1 41  ? 19.514 -40.751 15.224  1.00 77.11 ? 41  SER B O   1 
ATOM 1831 C CB  . SER B 1 41  ? 17.346 -42.962 15.819  1.00 76.48 ? 41  SER B CB  1 
ATOM 1832 O OG  . SER B 1 41  ? 16.787 -44.110 16.431  1.00 77.48 ? 41  SER B OG  1 
ATOM 1833 N N   . ALA B 1 42  ? 19.673 -42.300 13.604  1.00 77.39 ? 42  ALA B N   1 
ATOM 1834 C CA  . ALA B 1 42  ? 20.038 -41.336 12.582  1.00 77.28 ? 42  ALA B CA  1 
ATOM 1835 C C   . ALA B 1 42  ? 18.771 -40.790 11.948  1.00 77.28 ? 42  ALA B C   1 
ATOM 1836 O O   . ALA B 1 42  ? 17.820 -41.524 11.660  1.00 77.94 ? 42  ALA B O   1 
ATOM 1837 C CB  . ALA B 1 42  ? 20.916 -41.977 11.538  1.00 77.53 ? 42  ALA B CB  1 
ATOM 1838 N N   . ILE B 1 43  ? 18.772 -39.484 11.740  1.00 76.87 ? 43  ILE B N   1 
ATOM 1839 C CA  . ILE B 1 43  ? 17.629 -38.780 11.246  1.00 76.08 ? 43  ILE B CA  1 
ATOM 1840 C C   . ILE B 1 43  ? 17.992 -38.006 9.987   1.00 76.00 ? 43  ILE B C   1 
ATOM 1841 O O   . ILE B 1 43  ? 17.105 -37.576 9.260   1.00 76.56 ? 43  ILE B O   1 
ATOM 1842 C CB  . ILE B 1 43  ? 16.986 -37.938 12.360  1.00 75.72 ? 43  ILE B CB  1 
ATOM 1843 C CG1 . ILE B 1 43  ? 16.746 -36.531 11.885  1.00 76.56 ? 43  ILE B CG1 1 
ATOM 1844 C CG2 . ILE B 1 43  ? 17.817 -37.964 13.632  1.00 74.74 ? 43  ILE B CG2 1 
ATOM 1845 C CD1 . ILE B 1 43  ? 16.537 -35.623 13.014  1.00 78.64 ? 43  ILE B CD1 1 
ATOM 1846 N N   . ILE B 1 44  ? 19.283 -37.817 9.735   1.00 75.84 ? 44  ILE B N   1 
ATOM 1847 C CA  . ILE B 1 44  ? 19.792 -37.609 8.374   1.00 75.80 ? 44  ILE B CA  1 
ATOM 1848 C C   . ILE B 1 44  ? 21.043 -38.442 8.215   1.00 75.81 ? 44  ILE B C   1 
ATOM 1849 O O   . ILE B 1 44  ? 21.954 -38.362 9.031   1.00 76.38 ? 44  ILE B O   1 
ATOM 1850 C CB  . ILE B 1 44  ? 20.161 -36.133 8.095   1.00 75.94 ? 44  ILE B CB  1 
ATOM 1851 C CG1 . ILE B 1 44  ? 19.062 -35.205 8.679   1.00 76.75 ? 44  ILE B CG1 1 
ATOM 1852 C CG2 . ILE B 1 44  ? 20.436 -35.914 6.601   1.00 74.49 ? 44  ILE B CG2 1 
ATOM 1853 C CD1 . ILE B 1 44  ? 19.049 -33.782 8.173   1.00 76.30 ? 44  ILE B CD1 1 
ATOM 1854 N N   . MET B 1 45  ? 21.091 -39.255 7.174   1.00 75.72 ? 45  MET B N   1 
ATOM 1855 C CA  . MET B 1 45  ? 22.313 -39.973 6.844   1.00 75.40 ? 45  MET B CA  1 
ATOM 1856 C C   . MET B 1 45  ? 23.172 -39.018 6.025   1.00 75.42 ? 45  MET B C   1 
ATOM 1857 O O   . MET B 1 45  ? 22.663 -38.175 5.303   1.00 75.15 ? 45  MET B O   1 
ATOM 1858 C CB  . MET B 1 45  ? 22.013 -41.238 6.015   1.00 75.60 ? 45  MET B CB  1 
ATOM 1859 C CG  . MET B 1 45  ? 20.785 -42.053 6.458   1.00 74.92 ? 45  MET B CG  1 
ATOM 1860 S SD  . MET B 1 45  ? 21.166 -43.698 7.038   1.00 73.96 ? 45  MET B SD  1 
ATOM 1861 C CE  . MET B 1 45  ? 19.750 -44.637 6.448   1.00 74.65 ? 45  MET B CE  1 
ATOM 1862 N N   . PRO B 1 46  ? 24.486 -39.137 6.135   1.00 75.91 ? 46  PRO B N   1 
ATOM 1863 C CA  . PRO B 1 46  ? 25.358 -38.422 5.195   1.00 76.98 ? 46  PRO B CA  1 
ATOM 1864 C C   . PRO B 1 46  ? 24.963 -38.601 3.696   1.00 77.26 ? 46  PRO B C   1 
ATOM 1865 O O   . PRO B 1 46  ? 24.385 -39.608 3.348   1.00 77.59 ? 46  PRO B O   1 
ATOM 1866 C CB  . PRO B 1 46  ? 26.709 -39.048 5.468   1.00 76.97 ? 46  PRO B CB  1 
ATOM 1867 C CG  . PRO B 1 46  ? 26.614 -39.548 6.910   1.00 75.93 ? 46  PRO B CG  1 
ATOM 1868 C CD  . PRO B 1 46  ? 25.226 -39.902 7.153   1.00 75.50 ? 46  PRO B CD  1 
ATOM 1869 N N   . GLY B 1 47  ? 25.252 -37.623 2.839   1.00 77.81 ? 47  GLY B N   1 
ATOM 1870 C CA  . GLY B 1 47  ? 24.810 -37.628 1.432   1.00 78.00 ? 47  GLY B CA  1 
ATOM 1871 C C   . GLY B 1 47  ? 23.335 -37.920 1.228   1.00 78.44 ? 47  GLY B C   1 
ATOM 1872 O O   . GLY B 1 47  ? 22.933 -38.531 0.228   1.00 78.88 ? 47  GLY B O   1 
ATOM 1873 N N   . GLU B 1 48  ? 22.528 -37.500 2.188   1.00 78.94 ? 48  GLU B N   1 
ATOM 1874 C CA  . GLU B 1 48  ? 21.101 -37.665 2.105   1.00 79.71 ? 48  GLU B CA  1 
ATOM 1875 C C   . GLU B 1 48  ? 20.533 -36.342 1.655   1.00 80.83 ? 48  GLU B C   1 
ATOM 1876 O O   . GLU B 1 48  ? 20.683 -35.339 2.334   1.00 81.45 ? 48  GLU B O   1 
ATOM 1877 C CB  . GLU B 1 48  ? 20.513 -38.087 3.452   1.00 79.06 ? 48  GLU B CB  1 
ATOM 1878 C CG  . GLU B 1 48  ? 19.049 -38.479 3.361   1.00 79.72 ? 48  GLU B CG  1 
ATOM 1879 C CD  . GLU B 1 48  ? 18.553 -39.525 4.412   1.00 80.23 ? 48  GLU B CD  1 
ATOM 1880 O OE1 . GLU B 1 48  ? 18.390 -40.685 3.989   1.00 80.86 ? 48  GLU B OE1 1 
ATOM 1881 O OE2 . GLU B 1 48  ? 18.275 -39.203 5.615   1.00 79.00 ? 48  GLU B OE2 1 
ATOM 1882 N N   . ASP B 1 49  ? 19.876 -36.344 0.506   1.00 82.20 ? 49  ASP B N   1 
ATOM 1883 C CA  . ASP B 1 49  ? 19.262 -35.137 -0.070  1.00 82.73 ? 49  ASP B CA  1 
ATOM 1884 C C   . ASP B 1 49  ? 17.957 -34.777 0.640   1.00 82.28 ? 49  ASP B C   1 
ATOM 1885 O O   . ASP B 1 49  ? 16.965 -35.465 0.462   1.00 82.73 ? 49  ASP B O   1 
ATOM 1886 C CB  . ASP B 1 49  ? 18.979 -35.403 -1.549  1.00 83.44 ? 49  ASP B CB  1 
ATOM 1887 C CG  . ASP B 1 49  ? 18.967 -34.168 -2.361  1.00 85.57 ? 49  ASP B CG  1 
ATOM 1888 O OD1 . ASP B 1 49  ? 19.920 -33.351 -2.217  1.00 88.34 ? 49  ASP B OD1 1 
ATOM 1889 O OD2 . ASP B 1 49  ? 18.005 -34.050 -3.159  1.00 89.09 ? 49  ASP B OD2 1 
ATOM 1890 N N   . THR B 1 50  ? 17.952 -33.721 1.447   1.00 82.02 ? 50  THR B N   1 
ATOM 1891 C CA  . THR B 1 50  ? 16.793 -33.376 2.287   1.00 81.60 ? 50  THR B CA  1 
ATOM 1892 C C   . THR B 1 50  ? 15.886 -32.405 1.568   1.00 81.09 ? 50  THR B C   1 
ATOM 1893 O O   . THR B 1 50  ? 16.357 -31.512 0.863   1.00 81.04 ? 50  THR B O   1 
ATOM 1894 C CB  . THR B 1 50  ? 17.241 -32.774 3.610   1.00 81.48 ? 50  THR B CB  1 
ATOM 1895 O OG1 . THR B 1 50  ? 18.122 -33.701 4.237   1.00 83.14 ? 50  THR B OG1 1 
ATOM 1896 C CG2 . THR B 1 50  ? 16.084 -32.506 4.545   1.00 81.11 ? 50  THR B CG2 1 
ATOM 1897 N N   . THR B 1 51  ? 14.576 -32.586 1.761   1.00 80.76 ? 51  THR B N   1 
ATOM 1898 C CA  . THR B 1 51  ? 13.575 -31.717 1.133   1.00 79.77 ? 51  THR B CA  1 
ATOM 1899 C C   . THR B 1 51  ? 12.481 -31.282 2.099   1.00 78.79 ? 51  THR B C   1 
ATOM 1900 O O   . THR B 1 51  ? 11.438 -30.854 1.647   1.00 79.24 ? 51  THR B O   1 
ATOM 1901 C CB  . THR B 1 51  ? 12.949 -32.385 -0.147  1.00 79.74 ? 51  THR B CB  1 
ATOM 1902 O OG1 . THR B 1 51  ? 12.264 -33.611 0.188   1.00 81.51 ? 51  THR B OG1 1 
ATOM 1903 C CG2 . THR B 1 51  ? 14.017 -32.689 -1.179  1.00 78.97 ? 51  THR B CG2 1 
ATOM 1904 N N   . SER B 1 52  ? 12.702 -31.349 3.409   1.00 77.76 ? 52  SER B N   1 
ATOM 1905 C CA  . SER B 1 52  ? 11.646 -30.943 4.342   1.00 77.28 ? 52  SER B CA  1 
ATOM 1906 C C   . SER B 1 52  ? 12.169 -30.326 5.591   1.00 76.42 ? 52  SER B C   1 
ATOM 1907 O O   . SER B 1 52  ? 13.097 -30.836 6.158   1.00 76.03 ? 52  SER B O   1 
ATOM 1908 C CB  . SER B 1 52  ? 10.777 -32.148 4.682   1.00 77.50 ? 52  SER B CB  1 
ATOM 1909 O OG  . SER B 1 52  ? 10.256 -32.679 3.447   1.00 77.37 ? 52  SER B OG  1 
ATOM 1910 N N   . MET B 1 53  ? 11.584 -29.211 6.007   1.00 76.20 ? 53  MET B N   1 
ATOM 1911 C CA  . MET B 1 53  ? 12.010 -28.580 7.251   1.00 76.20 ? 53  MET B CA  1 
ATOM 1912 C C   . MET B 1 53  ? 11.637 -29.526 8.365   1.00 75.76 ? 53  MET B C   1 
ATOM 1913 O O   . MET B 1 53  ? 10.666 -30.249 8.267   1.00 75.57 ? 53  MET B O   1 
ATOM 1914 C CB  . MET B 1 53  ? 11.374 -27.200 7.437   1.00 76.48 ? 53  MET B CB  1 
ATOM 1915 C CG  . MET B 1 53  ? 11.657 -26.226 6.263   1.00 76.69 ? 53  MET B CG  1 
ATOM 1916 S SD  . MET B 1 53  ? 13.381 -26.197 5.678   1.00 76.18 ? 53  MET B SD  1 
ATOM 1917 C CE  . MET B 1 53  ? 14.116 -25.762 7.249   1.00 78.73 ? 53  MET B CE  1 
ATOM 1918 N N   . ILE B 1 54  ? 12.452 -29.578 9.397   1.00 75.67 ? 54  ILE B N   1 
ATOM 1919 C CA  . ILE B 1 54  ? 12.211 -30.519 10.464  1.00 76.10 ? 54  ILE B CA  1 
ATOM 1920 C C   . ILE B 1 54  ? 11.949 -29.804 11.773  1.00 76.14 ? 54  ILE B C   1 
ATOM 1921 O O   . ILE B 1 54  ? 12.812 -29.115 12.285  1.00 76.16 ? 54  ILE B O   1 
ATOM 1922 C CB  . ILE B 1 54  ? 13.373 -31.468 10.658  1.00 76.08 ? 54  ILE B CB  1 
ATOM 1923 C CG1 . ILE B 1 54  ? 13.656 -32.216 9.354   1.00 74.96 ? 54  ILE B CG1 1 
ATOM 1924 C CG2 . ILE B 1 54  ? 13.045 -32.435 11.820  1.00 75.96 ? 54  ILE B CG2 1 
ATOM 1925 C CD1 . ILE B 1 54  ? 15.087 -32.724 9.224   1.00 74.05 ? 54  ILE B CD1 1 
ATOM 1926 N N   . PHE B 1 55  ? 10.755 -29.967 12.308  1.00 76.11 ? 55  PHE B N   1 
ATOM 1927 C CA  . PHE B 1 55  ? 10.426 -29.235 13.499  1.00 76.79 ? 55  PHE B CA  1 
ATOM 1928 C C   . PHE B 1 55  ? 10.559 -30.117 14.711  1.00 76.72 ? 55  PHE B C   1 
ATOM 1929 O O   . PHE B 1 55  ? 9.774  -31.051 14.946  1.00 76.83 ? 55  PHE B O   1 
ATOM 1930 C CB  . PHE B 1 55  ? 9.036  -28.590 13.451  1.00 77.22 ? 55  PHE B CB  1 
ATOM 1931 C CG  . PHE B 1 55  ? 8.727  -27.751 14.663  1.00 75.76 ? 55  PHE B CG  1 
ATOM 1932 C CD1 . PHE B 1 55  ? 9.417  -26.587 14.901  1.00 75.12 ? 55  PHE B CD1 1 
ATOM 1933 C CD2 . PHE B 1 55  ? 7.771  -28.154 15.564  1.00 76.30 ? 55  PHE B CD2 1 
ATOM 1934 C CE1 . PHE B 1 55  ? 9.141  -25.832 16.012  1.00 76.77 ? 55  PHE B CE1 1 
ATOM 1935 C CE2 . PHE B 1 55  ? 7.493  -27.409 16.678  1.00 77.14 ? 55  PHE B CE2 1 
ATOM 1936 C CZ  . PHE B 1 55  ? 8.173  -26.245 16.904  1.00 76.94 ? 55  PHE B CZ  1 
ATOM 1937 N N   . LEU B 1 56  ? 11.546 -29.758 15.504  1.00 76.43 ? 56  LEU B N   1 
ATOM 1938 C CA  . LEU B 1 56  ? 11.960 -30.550 16.622  1.00 76.48 ? 56  LEU B CA  1 
ATOM 1939 C C   . LEU B 1 56  ? 11.049 -30.233 17.808  1.00 76.54 ? 56  LEU B C   1 
ATOM 1940 O O   . LEU B 1 56  ? 11.182 -29.172 18.414  1.00 76.04 ? 56  LEU B O   1 
ATOM 1941 C CB  . LEU B 1 56  ? 13.388 -30.174 16.928  1.00 76.31 ? 56  LEU B CB  1 
ATOM 1942 C CG  . LEU B 1 56  ? 14.291 -31.271 17.417  1.00 77.08 ? 56  LEU B CG  1 
ATOM 1943 C CD1 . LEU B 1 56  ? 15.701 -30.955 16.942  1.00 76.61 ? 56  LEU B CD1 1 
ATOM 1944 C CD2 . LEU B 1 56  ? 14.174 -31.417 18.978  1.00 76.99 ? 56  LEU B CD2 1 
ATOM 1945 N N   . MET B 1 57  ? 10.126 -31.150 18.122  1.00 76.76 ? 57  MET B N   1 
ATOM 1946 C CA  . MET B 1 57  ? 9.059  -30.892 19.108  1.00 77.11 ? 57  MET B CA  1 
ATOM 1947 C C   . MET B 1 57  ? 9.562  -31.082 20.524  1.00 76.77 ? 57  MET B C   1 
ATOM 1948 O O   . MET B 1 57  ? 9.353  -30.237 21.370  1.00 75.70 ? 57  MET B O   1 
ATOM 1949 C CB  . MET B 1 57  ? 7.848  -31.783 18.842  1.00 77.14 ? 57  MET B CB  1 
ATOM 1950 C CG  . MET B 1 57  ? 7.492  -31.889 17.367  1.00 78.06 ? 57  MET B CG  1 
ATOM 1951 S SD  . MET B 1 57  ? 5.749  -32.117 17.000  1.00 78.16 ? 57  MET B SD  1 
ATOM 1952 C CE  . MET B 1 57  ? 5.612  -33.890 16.815  1.00 78.53 ? 57  MET B CE  1 
ATOM 1953 N N   . ASP B 1 58  ? 10.233 -32.201 20.752  1.00 77.66 ? 58  ASP B N   1 
ATOM 1954 C CA  . ASP B 1 58  ? 11.014 -32.412 21.966  1.00 78.37 ? 58  ASP B CA  1 
ATOM 1955 C C   . ASP B 1 58  ? 12.122 -33.424 21.839  1.00 78.18 ? 58  ASP B C   1 
ATOM 1956 O O   . ASP B 1 58  ? 11.985 -34.430 21.148  1.00 78.65 ? 58  ASP B O   1 
ATOM 1957 C CB  . ASP B 1 58  ? 10.136 -32.818 23.130  1.00 78.85 ? 58  ASP B CB  1 
ATOM 1958 C CG  . ASP B 1 58  ? 10.225 -31.820 24.264  1.00 80.91 ? 58  ASP B CG  1 
ATOM 1959 O OD1 . ASP B 1 58  ? 11.216 -31.891 25.047  1.00 84.19 ? 58  ASP B OD1 1 
ATOM 1960 O OD2 . ASP B 1 58  ? 9.320  -30.950 24.340  1.00 80.87 ? 58  ASP B OD2 1 
ATOM 1961 N N   . GLY B 1 59  ? 13.206 -33.153 22.550  1.00 77.78 ? 59  GLY B N   1 
ATOM 1962 C CA  . GLY B 1 59  ? 14.368 -34.012 22.538  1.00 77.61 ? 59  GLY B CA  1 
ATOM 1963 C C   . GLY B 1 59  ? 15.586 -33.158 22.302  1.00 77.60 ? 59  GLY B C   1 
ATOM 1964 O O   . GLY B 1 59  ? 15.660 -32.018 22.786  1.00 77.25 ? 59  GLY B O   1 
ATOM 1965 N N   . LYS B 1 60  ? 16.532 -33.712 21.548  1.00 77.85 ? 60  LYS B N   1 
ATOM 1966 C CA  . LYS B 1 60  ? 17.784 -33.031 21.247  1.00 78.00 ? 60  LYS B CA  1 
ATOM 1967 C C   . LYS B 1 60  ? 18.408 -33.614 19.998  1.00 77.31 ? 60  LYS B C   1 
ATOM 1968 O O   . LYS B 1 60  ? 18.333 -34.819 19.769  1.00 77.19 ? 60  LYS B O   1 
ATOM 1969 C CB  . LYS B 1 60  ? 18.762 -33.176 22.422  1.00 78.25 ? 60  LYS B CB  1 
ATOM 1970 C CG  . LYS B 1 60  ? 19.705 -31.987 22.563  1.00 79.63 ? 60  LYS B CG  1 
ATOM 1971 C CD  . LYS B 1 60  ? 19.220 -31.004 23.621  1.00 80.47 ? 60  LYS B CD  1 
ATOM 1972 C CE  . LYS B 1 60  ? 20.378 -30.555 24.506  1.00 80.58 ? 60  LYS B CE  1 
ATOM 1973 N NZ  . LYS B 1 60  ? 21.201 -31.730 24.911  1.00 80.58 ? 60  LYS B NZ  1 
ATOM 1974 N N   . ILE B 1 61  ? 19.043 -32.775 19.197  1.00 76.96 ? 61  ILE B N   1 
ATOM 1975 C CA  . ILE B 1 61  ? 19.665 -33.281 17.984  1.00 76.79 ? 61  ILE B CA  1 
ATOM 1976 C C   . ILE B 1 61  ? 21.059 -32.772 17.755  1.00 76.98 ? 61  ILE B C   1 
ATOM 1977 O O   . ILE B 1 61  ? 21.358 -31.609 17.971  1.00 77.60 ? 61  ILE B O   1 
ATOM 1978 C CB  . ILE B 1 61  ? 18.825 -33.010 16.763  1.00 76.31 ? 61  ILE B CB  1 
ATOM 1979 C CG1 . ILE B 1 61  ? 17.745 -34.068 16.712  1.00 75.71 ? 61  ILE B CG1 1 
ATOM 1980 C CG2 . ILE B 1 61  ? 19.667 -33.099 15.503  1.00 76.48 ? 61  ILE B CG2 1 
ATOM 1981 C CD1 . ILE B 1 61  ? 16.750 -33.838 15.678  1.00 75.91 ? 61  ILE B CD1 1 
ATOM 1982 N N   . LYS B 1 62  ? 21.888 -33.682 17.276  1.00 76.79 ? 62  LYS B N   1 
ATOM 1983 C CA  . LYS B 1 62  ? 23.277 -33.446 17.026  1.00 76.90 ? 62  LYS B CA  1 
ATOM 1984 C C   . LYS B 1 62  ? 23.499 -33.269 15.503  1.00 76.23 ? 62  LYS B C   1 
ATOM 1985 O O   . LYS B 1 62  ? 23.214 -34.193 14.715  1.00 75.93 ? 62  LYS B O   1 
ATOM 1986 C CB  . LYS B 1 62  ? 24.009 -34.673 17.544  1.00 77.24 ? 62  LYS B CB  1 
ATOM 1987 C CG  . LYS B 1 62  ? 25.481 -34.494 17.748  1.00 78.93 ? 62  LYS B CG  1 
ATOM 1988 C CD  . LYS B 1 62  ? 26.242 -35.835 17.628  1.00 80.86 ? 62  LYS B CD  1 
ATOM 1989 C CE  . LYS B 1 62  ? 27.743 -35.674 17.926  1.00 81.02 ? 62  LYS B CE  1 
ATOM 1990 N NZ  . LYS B 1 62  ? 28.378 -34.455 17.288  1.00 82.24 ? 62  LYS B NZ  1 
ATOM 1991 N N   . LEU B 1 63  ? 23.976 -32.093 15.085  1.00 75.32 ? 63  LEU B N   1 
ATOM 1992 C CA  . LEU B 1 63  ? 24.357 -31.875 13.670  1.00 75.25 ? 63  LEU B CA  1 
ATOM 1993 C C   . LEU B 1 63  ? 25.878 -31.758 13.488  1.00 75.21 ? 63  LEU B C   1 
ATOM 1994 O O   . LEU B 1 63  ? 26.517 -30.913 14.114  1.00 75.84 ? 63  LEU B O   1 
ATOM 1995 C CB  . LEU B 1 63  ? 23.643 -30.672 13.033  1.00 74.46 ? 63  LEU B CB  1 
ATOM 1996 C CG  . LEU B 1 63  ? 22.143 -30.923 12.906  1.00 74.89 ? 63  LEU B CG  1 
ATOM 1997 C CD1 . LEU B 1 63  ? 21.393 -30.447 14.160  1.00 76.64 ? 63  LEU B CD1 1 
ATOM 1998 C CD2 . LEU B 1 63  ? 21.575 -30.239 11.730  1.00 74.60 ? 63  LEU B CD2 1 
ATOM 1999 N N   . ASP B 1 64  ? 26.433 -32.643 12.664  1.00 74.67 ? 64  ASP B N   1 
ATOM 2000 C CA  . ASP B 1 64  ? 27.803 -32.598 12.279  1.00 74.98 ? 64  ASP B CA  1 
ATOM 2001 C C   . ASP B 1 64  ? 27.835 -32.368 10.796  1.00 74.80 ? 64  ASP B C   1 
ATOM 2002 O O   . ASP B 1 64  ? 27.032 -32.910 10.049  1.00 73.84 ? 64  ASP B O   1 
ATOM 2003 C CB  . ASP B 1 64  ? 28.486 -33.923 12.562  1.00 75.48 ? 64  ASP B CB  1 
ATOM 2004 C CG  . ASP B 1 64  ? 28.394 -34.321 14.009  1.00 77.18 ? 64  ASP B CG  1 
ATOM 2005 O OD1 . ASP B 1 64  ? 28.704 -33.479 14.875  1.00 82.06 ? 64  ASP B OD1 1 
ATOM 2006 O OD2 . ASP B 1 64  ? 28.016 -35.477 14.294  1.00 78.69 ? 64  ASP B OD2 1 
ATOM 2007 N N   . ILE B 1 65  ? 28.777 -31.549 10.380  1.00 74.93 ? 65  ILE B N   1 
ATOM 2008 C CA  . ILE B 1 65  ? 28.938 -31.266 8.992   1.00 75.46 ? 65  ILE B CA  1 
ATOM 2009 C C   . ILE B 1 65  ? 30.081 -32.124 8.542   1.00 75.86 ? 65  ILE B C   1 
ATOM 2010 O O   . ILE B 1 65  ? 30.998 -32.356 9.329   1.00 76.60 ? 65  ILE B O   1 
ATOM 2011 C CB  . ILE B 1 65  ? 29.250 -29.794 8.710   1.00 75.22 ? 65  ILE B CB  1 
ATOM 2012 C CG1 . ILE B 1 65  ? 29.505 -29.646 7.187   1.00 76.15 ? 65  ILE B CG1 1 
ATOM 2013 C CG2 . ILE B 1 65  ? 30.414 -29.292 9.619   1.00 75.06 ? 65  ILE B CG2 1 
ATOM 2014 C CD1 . ILE B 1 65  ? 29.489 -28.221 6.627   1.00 75.91 ? 65  ILE B CD1 1 
ATOM 2015 N N   . ILE B 1 66  ? 30.034 -32.591 7.297   1.00 75.59 ? 66  ILE B N   1 
ATOM 2016 C CA  . ILE B 1 66  ? 31.124 -33.356 6.755   1.00 76.10 ? 66  ILE B CA  1 
ATOM 2017 C C   . ILE B 1 66  ? 31.685 -32.616 5.538   1.00 76.74 ? 66  ILE B C   1 
ATOM 2018 O O   . ILE B 1 66  ? 30.956 -32.323 4.596   1.00 78.02 ? 66  ILE B O   1 
ATOM 2019 C CB  . ILE B 1 66  ? 30.646 -34.752 6.405   1.00 75.75 ? 66  ILE B CB  1 
ATOM 2020 C CG1 . ILE B 1 66  ? 30.158 -35.451 7.660   1.00 76.12 ? 66  ILE B CG1 1 
ATOM 2021 C CG2 . ILE B 1 66  ? 31.775 -35.551 5.853   1.00 76.03 ? 66  ILE B CG2 1 
ATOM 2022 C CD1 . ILE B 1 66  ? 29.332 -36.691 7.407   1.00 76.86 ? 66  ILE B CD1 1 
ATOM 2023 N N   . PHE B 1 67  ? 32.968 -32.297 5.543   1.00 76.87 ? 67  PHE B N   1 
ATOM 2024 C CA  . PHE B 1 67  ? 33.523 -31.465 4.490   1.00 77.11 ? 67  PHE B CA  1 
ATOM 2025 C C   . PHE B 1 67  ? 33.857 -32.302 3.320   1.00 77.70 ? 67  PHE B C   1 
ATOM 2026 O O   . PHE B 1 67  ? 33.653 -33.495 3.374   1.00 78.71 ? 67  PHE B O   1 
ATOM 2027 C CB  . PHE B 1 67  ? 34.754 -30.773 5.007   1.00 77.45 ? 67  PHE B CB  1 
ATOM 2028 C CG  . PHE B 1 67  ? 34.422 -29.738 5.954   1.00 78.16 ? 67  PHE B CG  1 
ATOM 2029 C CD1 . PHE B 1 67  ? 34.320 -30.019 7.310   1.00 78.90 ? 67  PHE B CD1 1 
ATOM 2030 C CD2 . PHE B 1 67  ? 34.082 -28.493 5.498   1.00 79.59 ? 67  PHE B CD2 1 
ATOM 2031 C CE1 . PHE B 1 67  ? 33.943 -29.033 8.207   1.00 79.00 ? 67  PHE B CE1 1 
ATOM 2032 C CE2 . PHE B 1 67  ? 33.685 -27.495 6.400   1.00 80.27 ? 67  PHE B CE2 1 
ATOM 2033 C CZ  . PHE B 1 67  ? 33.615 -27.768 7.751   1.00 78.47 ? 67  PHE B CZ  1 
ATOM 2034 N N   . GLU B 1 68  ? 34.394 -31.693 2.266   1.00 78.21 ? 68  GLU B N   1 
ATOM 2035 C CA  . GLU B 1 68  ? 34.818 -32.419 1.061   1.00 78.63 ? 68  GLU B CA  1 
ATOM 2036 C C   . GLU B 1 68  ? 35.922 -33.454 1.291   1.00 78.30 ? 68  GLU B C   1 
ATOM 2037 O O   . GLU B 1 68  ? 36.147 -34.299 0.441   1.00 78.49 ? 68  GLU B O   1 
ATOM 2038 C CB  . GLU B 1 68  ? 35.341 -31.460 -0.019  1.00 79.26 ? 68  GLU B CB  1 
ATOM 2039 C CG  . GLU B 1 68  ? 34.341 -30.439 -0.541  1.00 81.60 ? 68  GLU B CG  1 
ATOM 2040 C CD  . GLU B 1 68  ? 34.261 -29.165 0.334   1.00 83.48 ? 68  GLU B CD  1 
ATOM 2041 O OE1 . GLU B 1 68  ? 35.350 -28.644 0.760   1.00 84.62 ? 68  GLU B OE1 1 
ATOM 2042 O OE2 . GLU B 1 68  ? 33.106 -28.698 0.560   1.00 81.28 ? 68  GLU B OE2 1 
ATOM 2043 N N   . ASP B 1 69  ? 36.632 -33.392 2.406   1.00 77.88 ? 69  ASP B N   1 
ATOM 2044 C CA  . ASP B 1 69  ? 37.772 -34.284 2.608   1.00 77.38 ? 69  ASP B CA  1 
ATOM 2045 C C   . ASP B 1 69  ? 37.449 -35.340 3.641   1.00 76.79 ? 69  ASP B C   1 
ATOM 2046 O O   . ASP B 1 69  ? 38.345 -35.907 4.248   1.00 76.95 ? 69  ASP B O   1 
ATOM 2047 C CB  . ASP B 1 69  ? 39.016 -33.482 3.025   1.00 77.30 ? 69  ASP B CB  1 
ATOM 2048 C CG  . ASP B 1 69  ? 38.747 -32.521 4.191   1.00 78.17 ? 69  ASP B CG  1 
ATOM 2049 O OD1 . ASP B 1 69  ? 37.841 -32.738 5.038   1.00 78.43 ? 69  ASP B OD1 1 
ATOM 2050 O OD2 . ASP B 1 69  ? 39.457 -31.514 4.253   1.00 79.29 ? 69  ASP B OD2 1 
ATOM 2051 N N   . GLY B 1 70  ? 36.173 -35.593 3.862   1.00 76.29 ? 70  GLY B N   1 
ATOM 2052 C CA  . GLY B 1 70  ? 35.783 -36.596 4.833   1.00 76.53 ? 70  GLY B CA  1 
ATOM 2053 C C   . GLY B 1 70  ? 36.009 -36.239 6.296   1.00 76.35 ? 70  GLY B C   1 
ATOM 2054 O O   . GLY B 1 70  ? 35.826 -37.072 7.178   1.00 76.09 ? 70  GLY B O   1 
ATOM 2055 N N   . SER B 1 71  ? 36.387 -35.008 6.583   1.00 76.37 ? 71  SER B N   1 
ATOM 2056 C CA  . SER B 1 71  ? 36.533 -34.638 7.971   1.00 76.47 ? 71  SER B CA  1 
ATOM 2057 C C   . SER B 1 71  ? 35.188 -34.129 8.501   1.00 76.57 ? 71  SER B C   1 
ATOM 2058 O O   . SER B 1 71  ? 34.495 -33.319 7.885   1.00 76.15 ? 71  SER B O   1 
ATOM 2059 C CB  . SER B 1 71  ? 37.683 -33.642 8.186   1.00 76.37 ? 71  SER B CB  1 
ATOM 2060 O OG  . SER B 1 71  ? 37.306 -32.310 7.892   1.00 76.45 ? 71  SER B OG  1 
ATOM 2061 N N   . GLU B 1 72  ? 34.848 -34.668 9.656   1.00 77.05 ? 72  GLU B N   1 
ATOM 2062 C CA  . GLU B 1 72  ? 33.645 -34.382 10.371  1.00 77.51 ? 72  GLU B CA  1 
ATOM 2063 C C   . GLU B 1 72  ? 33.991 -33.232 11.311  1.00 77.19 ? 72  GLU B C   1 
ATOM 2064 O O   . GLU B 1 72  ? 35.154 -32.946 11.550  1.00 75.99 ? 72  GLU B O   1 
ATOM 2065 C CB  . GLU B 1 72  ? 33.255 -35.663 11.134  1.00 77.99 ? 72  GLU B CB  1 
ATOM 2066 C CG  . GLU B 1 72  ? 31.965 -35.649 11.944  1.00 80.42 ? 72  GLU B CG  1 
ATOM 2067 C CD  . GLU B 1 72  ? 31.216 -36.955 11.788  1.00 84.41 ? 72  GLU B CD  1 
ATOM 2068 O OE1 . GLU B 1 72  ? 30.193 -37.173 12.469  1.00 87.61 ? 72  GLU B OE1 1 
ATOM 2069 O OE2 . GLU B 1 72  ? 31.651 -37.773 10.951  1.00 86.68 ? 72  GLU B OE2 1 
ATOM 2070 N N   . LYS B 1 73  ? 32.955 -32.583 11.828  1.00 77.80 ? 73  LYS B N   1 
ATOM 2071 C CA  . LYS B 1 73  ? 33.054 -31.558 12.868  1.00 77.75 ? 73  LYS B CA  1 
ATOM 2072 C C   . LYS B 1 73  ? 31.670 -31.391 13.407  1.00 78.16 ? 73  LYS B C   1 
ATOM 2073 O O   . LYS B 1 73  ? 30.695 -31.628 12.707  1.00 78.23 ? 73  LYS B O   1 
ATOM 2074 C CB  . LYS B 1 73  ? 33.478 -30.239 12.270  1.00 77.55 ? 73  LYS B CB  1 
ATOM 2075 C CG  . LYS B 1 73  ? 34.898 -29.876 12.496  1.00 77.23 ? 73  LYS B CG  1 
ATOM 2076 C CD  . LYS B 1 73  ? 35.008 -28.641 13.365  1.00 76.42 ? 73  LYS B CD  1 
ATOM 2077 C CE  . LYS B 1 73  ? 36.418 -28.068 13.332  1.00 76.73 ? 73  LYS B CE  1 
ATOM 2078 N NZ  . LYS B 1 73  ? 36.461 -26.619 13.671  1.00 76.65 ? 73  LYS B NZ  1 
ATOM 2079 N N   . LEU B 1 74  ? 31.555 -30.948 14.638  1.00 79.02 ? 74  LEU B N   1 
ATOM 2080 C CA  . LEU B 1 74  ? 30.236 -30.554 15.117  1.00 79.70 ? 74  LEU B CA  1 
ATOM 2081 C C   . LEU B 1 74  ? 29.855 -29.200 14.562  1.00 79.73 ? 74  LEU B C   1 
ATOM 2082 O O   . LEU B 1 74  ? 30.717 -28.333 14.321  1.00 80.20 ? 74  LEU B O   1 
ATOM 2083 C CB  . LEU B 1 74  ? 30.164 -30.490 16.623  1.00 79.91 ? 74  LEU B CB  1 
ATOM 2084 C CG  . LEU B 1 74  ? 28.911 -29.769 17.141  1.00 82.35 ? 74  LEU B CG  1 
ATOM 2085 C CD1 . LEU B 1 74  ? 28.565 -30.345 18.532  1.00 81.93 ? 74  LEU B CD1 1 
ATOM 2086 C CD2 . LEU B 1 74  ? 29.014 -28.171 17.140  1.00 83.34 ? 74  LEU B CD2 1 
ATOM 2087 N N   . LEU B 1 75  ? 28.546 -29.027 14.414  1.00 79.54 ? 75  LEU B N   1 
ATOM 2088 C CA  . LEU B 1 75  ? 27.999 -27.926 13.691  1.00 79.43 ? 75  LEU B CA  1 
ATOM 2089 C C   . LEU B 1 75  ? 27.072 -27.260 14.612  1.00 79.66 ? 75  LEU B C   1 
ATOM 2090 O O   . LEU B 1 75  ? 27.258 -26.104 14.883  1.00 79.29 ? 75  LEU B O   1 
ATOM 2091 C CB  . LEU B 1 75  ? 27.251 -28.424 12.467  1.00 79.04 ? 75  LEU B CB  1 
ATOM 2092 C CG  . LEU B 1 75  ? 27.236 -27.493 11.290  1.00 78.59 ? 75  LEU B CG  1 
ATOM 2093 C CD1 . LEU B 1 75  ? 25.907 -27.647 10.572  1.00 78.14 ? 75  LEU B CD1 1 
ATOM 2094 C CD2 . LEU B 1 75  ? 27.457 -26.055 11.699  1.00 80.26 ? 75  LEU B CD2 1 
ATOM 2095 N N   . TYR B 1 76  ? 26.066 -27.995 15.079  1.00 81.08 ? 76  TYR B N   1 
ATOM 2096 C CA  . TYR B 1 76  ? 25.251 -27.546 16.213  1.00 82.23 ? 76  TYR B CA  1 
ATOM 2097 C C   . TYR B 1 76  ? 24.286 -28.538 16.722  1.00 81.64 ? 76  TYR B C   1 
ATOM 2098 O O   . TYR B 1 76  ? 23.844 -29.409 15.987  1.00 81.67 ? 76  TYR B O   1 
ATOM 2099 C CB  . TYR B 1 76  ? 24.431 -26.253 15.963  1.00 83.74 ? 76  TYR B CB  1 
ATOM 2100 C CG  . TYR B 1 76  ? 23.467 -26.177 14.784  1.00 85.25 ? 76  TYR B CG  1 
ATOM 2101 C CD1 . TYR B 1 76  ? 23.932 -25.735 13.492  1.00 87.57 ? 76  TYR B CD1 1 
ATOM 2102 C CD2 . TYR B 1 76  ? 22.074 -26.408 14.956  1.00 86.84 ? 76  TYR B CD2 1 
ATOM 2103 C CE1 . TYR B 1 76  ? 23.039 -25.587 12.356  1.00 86.63 ? 76  TYR B CE1 1 
ATOM 2104 C CE2 . TYR B 1 76  ? 21.166 -26.262 13.832  1.00 87.93 ? 76  TYR B CE2 1 
ATOM 2105 C CZ  . TYR B 1 76  ? 21.665 -25.853 12.542  1.00 87.49 ? 76  TYR B CZ  1 
ATOM 2106 O OH  . TYR B 1 76  ? 20.791 -25.703 11.488  1.00 87.78 ? 76  TYR B OH  1 
ATOM 2107 N N   . TYR B 1 77  ? 23.958 -28.336 17.997  1.00 80.94 ? 77  TYR B N   1 
ATOM 2108 C CA  . TYR B 1 77  ? 22.811 -28.931 18.646  1.00 80.85 ? 77  TYR B CA  1 
ATOM 2109 C C   . TYR B 1 77  ? 21.492 -28.189 18.448  1.00 80.61 ? 77  TYR B C   1 
ATOM 2110 O O   . TYR B 1 77  ? 21.438 -26.962 18.396  1.00 81.62 ? 77  TYR B O   1 
ATOM 2111 C CB  . TYR B 1 77  ? 23.079 -28.984 20.124  1.00 81.32 ? 77  TYR B CB  1 
ATOM 2112 C CG  . TYR B 1 77  ? 24.214 -29.918 20.445  1.00 82.06 ? 77  TYR B CG  1 
ATOM 2113 C CD1 . TYR B 1 77  ? 25.487 -29.427 20.651  1.00 81.80 ? 77  TYR B CD1 1 
ATOM 2114 C CD2 . TYR B 1 77  ? 24.015 -31.303 20.513  1.00 82.03 ? 77  TYR B CD2 1 
ATOM 2115 C CE1 . TYR B 1 77  ? 26.527 -30.269 20.954  1.00 81.36 ? 77  TYR B CE1 1 
ATOM 2116 C CE2 . TYR B 1 77  ? 25.056 -32.148 20.802  1.00 81.33 ? 77  TYR B CE2 1 
ATOM 2117 C CZ  . TYR B 1 77  ? 26.315 -31.618 21.021  1.00 81.26 ? 77  TYR B CZ  1 
ATOM 2118 O OH  . TYR B 1 77  ? 27.388 -32.427 21.309  1.00 82.23 ? 77  TYR B OH  1 
ATOM 2119 N N   . ALA B 1 78  ? 20.418 -28.946 18.333  1.00 79.94 ? 78  ALA B N   1 
ATOM 2120 C CA  . ALA B 1 78  ? 19.122 -28.355 18.145  1.00 79.60 ? 78  ALA B CA  1 
ATOM 2121 C C   . ALA B 1 78  ? 18.282 -29.074 19.106  1.00 79.54 ? 78  ALA B C   1 
ATOM 2122 O O   . ALA B 1 78  ? 18.545 -30.238 19.429  1.00 79.88 ? 78  ALA B O   1 
ATOM 2123 C CB  . ALA B 1 78  ? 18.601 -28.558 16.748  1.00 79.85 ? 78  ALA B CB  1 
ATOM 2124 N N   . GLY B 1 79  ? 17.268 -28.365 19.568  1.00 79.22 ? 79  GLY B N   1 
ATOM 2125 C CA  . GLY B 1 79  ? 16.500 -28.779 20.712  1.00 78.67 ? 79  GLY B CA  1 
ATOM 2126 C C   . GLY B 1 79  ? 15.106 -28.300 20.490  1.00 78.35 ? 79  GLY B C   1 
ATOM 2127 O O   . GLY B 1 79  ? 14.708 -28.118 19.350  1.00 78.98 ? 79  GLY B O   1 
ATOM 2128 N N   . SER B 1 80  ? 14.365 -28.086 21.568  1.00 77.78 ? 80  SER B N   1 
ATOM 2129 C CA  . SER B 1 80  ? 12.913 -27.994 21.471  1.00 77.09 ? 80  SER B CA  1 
ATOM 2130 C C   . SER B 1 80  ? 12.481 -26.699 20.721  1.00 76.58 ? 80  SER B C   1 
ATOM 2131 O O   . SER B 1 80  ? 13.120 -25.637 20.837  1.00 76.18 ? 80  SER B O   1 
ATOM 2132 C CB  . SER B 1 80  ? 12.297 -28.212 22.867  1.00 77.43 ? 80  SER B CB  1 
ATOM 2133 O OG  . SER B 1 80  ? 11.180 -27.394 23.086  1.00 77.75 ? 80  SER B OG  1 
ATOM 2134 N N   . ASN B 1 81  ? 11.455 -26.839 19.871  1.00 76.12 ? 81  ASN B N   1 
ATOM 2135 C CA  . ASN B 1 81  ? 11.028 -25.808 18.908  1.00 75.23 ? 81  ASN B CA  1 
ATOM 2136 C C   . ASN B 1 81  ? 12.066 -25.379 17.838  1.00 74.77 ? 81  ASN B C   1 
ATOM 2137 O O   . ASN B 1 81  ? 11.872 -24.386 17.135  1.00 75.08 ? 81  ASN B O   1 
ATOM 2138 C CB  . ASN B 1 81  ? 10.542 -24.574 19.662  1.00 75.20 ? 81  ASN B CB  1 
ATOM 2139 C CG  . ASN B 1 81  ? 9.383  -24.865 20.595  1.00 75.06 ? 81  ASN B CG  1 
ATOM 2140 O OD1 . ASN B 1 81  ? 8.372  -25.452 20.198  1.00 74.34 ? 81  ASN B OD1 1 
ATOM 2141 N ND2 . ASN B 1 81  ? 9.508  -24.407 21.841  1.00 75.27 ? 81  ASN B ND2 1 
ATOM 2142 N N   . SER B 1 82  ? 13.167 -26.099 17.704  1.00 73.70 ? 82  SER B N   1 
ATOM 2143 C CA  . SER B 1 82  ? 14.153 -25.704 16.748  1.00 73.50 ? 82  SER B CA  1 
ATOM 2144 C C   . SER B 1 82  ? 13.723 -26.162 15.350  1.00 74.24 ? 82  SER B C   1 
ATOM 2145 O O   . SER B 1 82  ? 13.033 -27.184 15.192  1.00 74.02 ? 82  SER B O   1 
ATOM 2146 C CB  . SER B 1 82  ? 15.502 -26.304 17.089  1.00 73.28 ? 82  SER B CB  1 
ATOM 2147 O OG  . SER B 1 82  ? 16.029 -25.770 18.273  1.00 72.25 ? 82  SER B OG  1 
ATOM 2148 N N   . LEU B 1 83  ? 14.129 -25.405 14.333  1.00 74.40 ? 83  LEU B N   1 
ATOM 2149 C CA  . LEU B 1 83  ? 13.740 -25.719 12.978  1.00 74.63 ? 83  LEU B CA  1 
ATOM 2150 C C   . LEU B 1 83  ? 14.978 -25.893 12.191  1.00 75.33 ? 83  LEU B C   1 
ATOM 2151 O O   . LEU B 1 83  ? 15.673 -24.917 11.880  1.00 76.14 ? 83  LEU B O   1 
ATOM 2152 C CB  . LEU B 1 83  ? 12.918 -24.616 12.341  1.00 74.66 ? 83  LEU B CB  1 
ATOM 2153 C CG  . LEU B 1 83  ? 12.352 -24.956 10.972  1.00 74.42 ? 83  LEU B CG  1 
ATOM 2154 C CD1 . LEU B 1 83  ? 11.368 -26.140 11.096  1.00 75.99 ? 83  LEU B CD1 1 
ATOM 2155 C CD2 . LEU B 1 83  ? 11.654 -23.750 10.488  1.00 74.06 ? 83  LEU B CD2 1 
ATOM 2156 N N   . ILE B 1 84  ? 15.220 -27.165 11.900  1.00 75.39 ? 84  ILE B N   1 
ATOM 2157 C CA  . ILE B 1 84  ? 16.341 -27.697 11.199  1.00 74.93 ? 84  ILE B CA  1 
ATOM 2158 C C   . ILE B 1 84  ? 15.751 -28.069 9.899   1.00 75.95 ? 84  ILE B C   1 
ATOM 2159 O O   . ILE B 1 84  ? 14.551 -28.288 9.820   1.00 76.35 ? 84  ILE B O   1 
ATOM 2160 C CB  . ILE B 1 84  ? 16.629 -29.067 11.712  1.00 74.81 ? 84  ILE B CB  1 
ATOM 2161 C CG1 . ILE B 1 84  ? 17.479 -29.050 12.932  1.00 73.33 ? 84  ILE B CG1 1 
ATOM 2162 C CG2 . ILE B 1 84  ? 17.266 -29.976 10.643  1.00 75.62 ? 84  ILE B CG2 1 
ATOM 2163 C CD1 . ILE B 1 84  ? 17.397 -30.395 13.513  1.00 71.66 ? 84  ILE B CD1 1 
ATOM 2164 N N   . GLY B 1 85  ? 16.597 -28.243 8.898   1.00 76.70 ? 85  GLY B N   1 
ATOM 2165 C CA  . GLY B 1 85  ? 16.188 -28.851 7.703   1.00 77.16 ? 85  GLY B CA  1 
ATOM 2166 C C   . GLY B 1 85  ? 16.569 -27.911 6.620   1.00 78.52 ? 85  GLY B C   1 
ATOM 2167 O O   . GLY B 1 85  ? 16.804 -26.707 6.814   1.00 79.21 ? 85  GLY B O   1 
ATOM 2168 N N   . ARG B 1 86  ? 16.692 -28.507 5.463   1.00 79.25 ? 86  ARG B N   1 
ATOM 2169 C CA  . ARG B 1 86  ? 16.745 -27.772 4.301   1.00 79.54 ? 86  ARG B CA  1 
ATOM 2170 C C   . ARG B 1 86  ? 15.510 -28.232 3.571   1.00 79.57 ? 86  ARG B C   1 
ATOM 2171 O O   . ARG B 1 86  ? 15.050 -29.371 3.694   1.00 78.59 ? 86  ARG B O   1 
ATOM 2172 C CB  . ARG B 1 86  ? 18.039 -28.053 3.552   1.00 80.41 ? 86  ARG B CB  1 
ATOM 2173 C CG  . ARG B 1 86  ? 18.453 -29.562 3.363   1.00 81.49 ? 86  ARG B CG  1 
ATOM 2174 C CD  . ARG B 1 86  ? 19.875 -29.697 2.846   1.00 80.71 ? 86  ARG B CD  1 
ATOM 2175 N NE  . ARG B 1 86  ? 20.271 -31.058 2.491   1.00 82.46 ? 86  ARG B NE  1 
ATOM 2176 C CZ  . ARG B 1 86  ? 20.341 -31.535 1.237   1.00 84.03 ? 86  ARG B CZ  1 
ATOM 2177 N NH1 . ARG B 1 86  ? 19.967 -30.809 0.207   1.00 84.12 ? 86  ARG B NH1 1 
ATOM 2178 N NH2 . ARG B 1 86  ? 20.747 -32.774 0.995   1.00 84.25 ? 86  ARG B NH2 1 
ATOM 2179 N N   . LEU B 1 87  ? 14.950 -27.261 2.884   1.00 80.12 ? 87  LEU B N   1 
ATOM 2180 C CA  . LEU B 1 87  ? 13.990 -27.435 1.840   1.00 80.59 ? 87  LEU B CA  1 
ATOM 2181 C C   . LEU B 1 87  ? 14.661 -27.470 0.485   1.00 80.39 ? 87  LEU B C   1 
ATOM 2182 O O   . LEU B 1 87  ? 14.023 -27.790 -0.488  1.00 80.43 ? 87  LEU B O   1 
ATOM 2183 C CB  . LEU B 1 87  ? 13.085 -26.229 1.868   1.00 80.55 ? 87  LEU B CB  1 
ATOM 2184 C CG  . LEU B 1 87  ? 11.623 -26.382 1.549   1.00 81.53 ? 87  LEU B CG  1 
ATOM 2185 C CD1 . LEU B 1 87  ? 10.987 -27.305 2.611   1.00 82.90 ? 87  LEU B CD1 1 
ATOM 2186 C CD2 . LEU B 1 87  ? 10.978 -24.987 1.573   1.00 81.43 ? 87  LEU B CD2 1 
ATOM 2187 N N   . TYR B 1 88  ? 15.925 -27.086 0.409   1.00 80.91 ? 88  TYR B N   1 
ATOM 2188 C CA  . TYR B 1 88  ? 16.679 -27.112 -0.872  1.00 82.02 ? 88  TYR B CA  1 
ATOM 2189 C C   . TYR B 1 88  ? 18.134 -27.550 -0.556  1.00 82.14 ? 88  TYR B C   1 
ATOM 2190 O O   . TYR B 1 88  ? 18.504 -27.585 0.649   1.00 82.73 ? 88  TYR B O   1 
ATOM 2191 C CB  . TYR B 1 88  ? 16.665 -25.732 -1.602  1.00 82.34 ? 88  TYR B CB  1 
ATOM 2192 C CG  . TYR B 1 88  ? 15.299 -25.105 -1.711  1.00 82.28 ? 88  TYR B CG  1 
ATOM 2193 C CD1 . TYR B 1 88  ? 14.701 -24.557 -0.592  1.00 82.37 ? 88  TYR B CD1 1 
ATOM 2194 C CD2 . TYR B 1 88  ? 14.593 -25.085 -2.924  1.00 82.28 ? 88  TYR B CD2 1 
ATOM 2195 C CE1 . TYR B 1 88  ? 13.420 -24.014 -0.646  1.00 84.01 ? 88  TYR B CE1 1 
ATOM 2196 C CE2 . TYR B 1 88  ? 13.291 -24.531 -2.994  1.00 83.79 ? 88  TYR B CE2 1 
ATOM 2197 C CZ  . TYR B 1 88  ? 12.719 -24.001 -1.836  1.00 83.96 ? 88  TYR B CZ  1 
ATOM 2198 O OH  . TYR B 1 88  ? 11.472 -23.443 -1.820  1.00 83.64 ? 88  TYR B OH  1 
ATOM 2199 N N   . PRO B 1 89  ? 18.924 -27.948 -1.592  1.00 80.96 ? 89  PRO B N   1 
ATOM 2200 C CA  . PRO B 1 89  ? 20.346 -28.251 -1.408  1.00 81.02 ? 89  PRO B CA  1 
ATOM 2201 C C   . PRO B 1 89  ? 21.113 -27.039 -0.969  1.00 80.98 ? 89  PRO B C   1 
ATOM 2202 O O   . PRO B 1 89  ? 20.835 -25.968 -1.469  1.00 82.06 ? 89  PRO B O   1 
ATOM 2203 C CB  . PRO B 1 89  ? 20.821 -28.733 -2.787  1.00 81.37 ? 89  PRO B CB  1 
ATOM 2204 C CG  . PRO B 1 89  ? 19.625 -28.887 -3.636  1.00 81.11 ? 89  PRO B CG  1 
ATOM 2205 C CD  . PRO B 1 89  ? 18.464 -28.207 -2.963  1.00 81.22 ? 89  PRO B CD  1 
ATOM 2206 N N   . THR B 1 90  ? 22.044 -27.185 -0.024  1.00 80.80 ? 90  THR B N   1 
ATOM 2207 C CA  . THR B 1 90  ? 22.715 -26.012 0.578   1.00 80.36 ? 90  THR B CA  1 
ATOM 2208 C C   . THR B 1 90  ? 24.207 -25.986 0.291   1.00 80.29 ? 90  THR B C   1 
ATOM 2209 O O   . THR B 1 90  ? 24.852 -25.004 0.583   1.00 80.95 ? 90  THR B O   1 
ATOM 2210 C CB  . THR B 1 90  ? 22.541 -25.987 2.109   1.00 80.15 ? 90  THR B CB  1 
ATOM 2211 O OG1 . THR B 1 90  ? 22.802 -27.304 2.628   1.00 79.53 ? 90  THR B OG1 1 
ATOM 2212 C CG2 . THR B 1 90  ? 21.115 -25.514 2.500   1.00 79.58 ? 90  THR B CG2 1 
ATOM 2213 N N   . GLY B 1 91  ? 24.756 -27.046 -0.293  1.00 79.82 ? 91  GLY B N   1 
ATOM 2214 C CA  . GLY B 1 91  ? 26.199 -27.252 -0.243  1.00 79.43 ? 91  GLY B CA  1 
ATOM 2215 C C   . GLY B 1 91  ? 26.743 -27.963 0.999   1.00 79.16 ? 91  GLY B C   1 
ATOM 2216 O O   . GLY B 1 91  ? 27.908 -28.313 1.021   1.00 78.99 ? 91  GLY B O   1 
ATOM 2217 N N   . ASN B 1 92  ? 25.945 -28.176 2.045   1.00 78.69 ? 92  ASN B N   1 
ATOM 2218 C CA  . ASN B 1 92  ? 26.471 -28.861 3.198   1.00 78.04 ? 92  ASN B CA  1 
ATOM 2219 C C   . ASN B 1 92  ? 26.045 -30.336 3.236   1.00 78.63 ? 92  ASN B C   1 
ATOM 2220 O O   . ASN B 1 92  ? 24.867 -30.662 3.149   1.00 78.86 ? 92  ASN B O   1 
ATOM 2221 C CB  . ASN B 1 92  ? 26.080 -28.112 4.465   1.00 77.65 ? 92  ASN B CB  1 
ATOM 2222 C CG  . ASN B 1 92  ? 26.810 -26.768 4.602   1.00 77.22 ? 92  ASN B CG  1 
ATOM 2223 O OD1 . ASN B 1 92  ? 27.731 -26.517 3.855   1.00 78.75 ? 92  ASN B OD1 1 
ATOM 2224 N ND2 . ASN B 1 92  ? 26.404 -25.908 5.568   1.00 73.38 ? 92  ASN B ND2 1 
ATOM 2225 N N   . ASN B 1 93  ? 27.015 -31.244 3.339   1.00 79.16 ? 93  ASN B N   1 
ATOM 2226 C CA  . ASN B 1 93  ? 26.718 -32.578 3.864   1.00 79.59 ? 93  ASN B CA  1 
ATOM 2227 C C   . ASN B 1 93  ? 26.459 -32.576 5.397   1.00 80.15 ? 93  ASN B C   1 
ATOM 2228 O O   . ASN B 1 93  ? 27.346 -32.303 6.209   1.00 81.02 ? 93  ASN B O   1 
ATOM 2229 C CB  . ASN B 1 93  ? 27.824 -33.570 3.563   1.00 79.49 ? 93  ASN B CB  1 
ATOM 2230 C CG  . ASN B 1 93  ? 27.389 -35.003 3.837   1.00 80.99 ? 93  ASN B CG  1 
ATOM 2231 O OD1 . ASN B 1 93  ? 26.213 -35.253 4.191   1.00 80.43 ? 93  ASN B OD1 1 
ATOM 2232 N ND2 . ASN B 1 93  ? 28.327 -35.962 3.682   1.00 81.03 ? 93  ASN B ND2 1 
ATOM 2233 N N   . ILE B 1 94  ? 25.238 -32.913 5.775   1.00 80.31 ? 94  ILE B N   1 
ATOM 2234 C CA  . ILE B 1 94  ? 24.856 -33.001 7.164   1.00 80.48 ? 94  ILE B CA  1 
ATOM 2235 C C   . ILE B 1 94  ? 24.338 -34.384 7.598   1.00 80.27 ? 94  ILE B C   1 
ATOM 2236 O O   . ILE B 1 94  ? 23.841 -35.227 6.828   1.00 81.07 ? 94  ILE B O   1 
ATOM 2237 C CB  . ILE B 1 94  ? 23.837 -31.944 7.442   1.00 80.96 ? 94  ILE B CB  1 
ATOM 2238 C CG1 . ILE B 1 94  ? 24.360 -30.600 6.867   1.00 83.25 ? 94  ILE B CG1 1 
ATOM 2239 C CG2 . ILE B 1 94  ? 23.566 -31.821 8.926   1.00 80.07 ? 94  ILE B CG2 1 
ATOM 2240 C CD1 . ILE B 1 94  ? 24.712 -29.517 7.927   1.00 83.38 ? 94  ILE B CD1 1 
ATOM 2241 N N   . TYR B 1 95  ? 24.496 -34.604 8.872   1.00 79.49 ? 95  TYR B N   1 
ATOM 2242 C CA  . TYR B 1 95  ? 24.503 -35.889 9.389   1.00 78.85 ? 95  TYR B CA  1 
ATOM 2243 C C   . TYR B 1 95  ? 23.887 -35.517 10.724  1.00 78.16 ? 95  TYR B C   1 
ATOM 2244 O O   . TYR B 1 95  ? 24.444 -34.742 11.466  1.00 77.59 ? 95  TYR B O   1 
ATOM 2245 C CB  . TYR B 1 95  ? 25.981 -36.331 9.412   1.00 79.44 ? 95  TYR B CB  1 
ATOM 2246 C CG  . TYR B 1 95  ? 26.245 -37.406 10.379  1.00 80.66 ? 95  TYR B CG  1 
ATOM 2247 C CD1 . TYR B 1 95  ? 27.410 -37.442 11.156  1.00 81.52 ? 95  TYR B CD1 1 
ATOM 2248 C CD2 . TYR B 1 95  ? 25.305 -38.385 10.555  1.00 82.66 ? 95  TYR B CD2 1 
ATOM 2249 C CE1 . TYR B 1 95  ? 27.615 -38.465 12.085  1.00 81.55 ? 95  TYR B CE1 1 
ATOM 2250 C CE2 . TYR B 1 95  ? 25.477 -39.383 11.458  1.00 84.39 ? 95  TYR B CE2 1 
ATOM 2251 C CZ  . TYR B 1 95  ? 26.635 -39.448 12.231  1.00 83.41 ? 95  TYR B CZ  1 
ATOM 2252 O OH  . TYR B 1 95  ? 26.755 -40.516 13.136  1.00 83.09 ? 95  TYR B OH  1 
ATOM 2253 N N   . ALA B 1 96  ? 22.673 -35.949 10.985  1.00 77.83 ? 96  ALA B N   1 
ATOM 2254 C CA  . ALA B 1 96  ? 22.046 -35.559 12.246  1.00 78.15 ? 96  ALA B CA  1 
ATOM 2255 C C   . ALA B 1 96  ? 21.689 -36.772 13.050  1.00 77.77 ? 96  ALA B C   1 
ATOM 2256 O O   . ALA B 1 96  ? 21.351 -37.795 12.487  1.00 77.39 ? 96  ALA B O   1 
ATOM 2257 C CB  . ALA B 1 96  ? 20.813 -34.729 12.004  1.00 78.53 ? 96  ALA B CB  1 
ATOM 2258 N N   . THR B 1 97  ? 21.753 -36.644 14.369  1.00 77.59 ? 97  THR B N   1 
ATOM 2259 C CA  . THR B 1 97  ? 21.662 -37.806 15.267  1.00 77.62 ? 97  THR B CA  1 
ATOM 2260 C C   . THR B 1 97  ? 20.846 -37.457 16.470  1.00 77.78 ? 97  THR B C   1 
ATOM 2261 O O   . THR B 1 97  ? 20.920 -36.342 16.961  1.00 78.46 ? 97  THR B O   1 
ATOM 2262 C CB  . THR B 1 97  ? 23.018 -38.172 15.856  1.00 77.09 ? 97  THR B CB  1 
ATOM 2263 O OG1 . THR B 1 97  ? 24.048 -37.793 14.952  1.00 77.97 ? 97  THR B OG1 1 
ATOM 2264 C CG2 . THR B 1 97  ? 23.098 -39.615 16.088  1.00 76.87 ? 97  THR B CG2 1 
ATOM 2265 N N   . ALA B 1 98  ? 20.112 -38.412 17.004  1.00 77.92 ? 98  ALA B N   1 
ATOM 2266 C CA  . ALA B 1 98  ? 19.339 -38.111 18.185  1.00 78.39 ? 98  ALA B CA  1 
ATOM 2267 C C   . ALA B 1 98  ? 20.188 -38.317 19.436  1.00 78.72 ? 98  ALA B C   1 
ATOM 2268 O O   . ALA B 1 98  ? 20.933 -39.293 19.555  1.00 78.76 ? 98  ALA B O   1 
ATOM 2269 C CB  . ALA B 1 98  ? 18.058 -38.936 18.225  1.00 78.44 ? 98  ALA B CB  1 
ATOM 2270 N N   . MET B 1 99  ? 20.073 -37.358 20.345  1.00 79.19 ? 99  MET B N   1 
ATOM 2271 C CA  . MET B 1 99  ? 20.702 -37.413 21.664  1.00 79.73 ? 99  MET B CA  1 
ATOM 2272 C C   . MET B 1 99  ? 19.840 -38.178 22.632  1.00 78.85 ? 99  MET B C   1 
ATOM 2273 O O   . MET B 1 99  ? 20.340 -38.991 23.364  1.00 79.01 ? 99  MET B O   1 
ATOM 2274 C CB  . MET B 1 99  ? 20.869 -36.004 22.243  1.00 80.85 ? 99  MET B CB  1 
ATOM 2275 C CG  . MET B 1 99  ? 21.606 -35.000 21.318  1.00 83.14 ? 99  MET B CG  1 
ATOM 2276 S SD  . MET B 1 99  ? 23.311 -35.525 21.115  1.00 89.05 ? 99  MET B SD  1 
ATOM 2277 C CE  . MET B 1 99  ? 23.967 -35.204 22.780  1.00 88.14 ? 99  MET B CE  1 
ATOM 2278 N N   . GLU B 1 100 ? 18.554 -37.856 22.679  1.00 78.45 ? 100 GLU B N   1 
ATOM 2279 C CA  . GLU B 1 100 ? 17.589 -38.608 23.487  1.00 78.10 ? 100 GLU B CA  1 
ATOM 2280 C C   . GLU B 1 100 ? 16.452 -39.019 22.572  1.00 77.40 ? 100 GLU B C   1 
ATOM 2281 O O   . GLU B 1 100 ? 16.575 -38.871 21.372  1.00 77.74 ? 100 GLU B O   1 
ATOM 2282 C CB  . GLU B 1 100 ? 17.114 -37.772 24.680  1.00 78.46 ? 100 GLU B CB  1 
ATOM 2283 C CG  . GLU B 1 100 ? 16.487 -36.404 24.332  1.00 79.03 ? 100 GLU B CG  1 
ATOM 2284 C CD  . GLU B 1 100 ? 16.882 -35.280 25.314  1.00 79.85 ? 100 GLU B CD  1 
ATOM 2285 O OE1 . GLU B 1 100 ? 17.996 -35.292 25.867  1.00 79.20 ? 100 GLU B OE1 1 
ATOM 2286 O OE2 . GLU B 1 100 ? 16.074 -34.356 25.523  1.00 82.13 ? 100 GLU B OE2 1 
ATOM 2287 N N   . GLN B 1 101 ? 15.371 -39.574 23.102  1.00 76.89 ? 101 GLN B N   1 
ATOM 2288 C CA  . GLN B 1 101 ? 14.224 -39.873 22.263  1.00 76.84 ? 101 GLN B CA  1 
ATOM 2289 C C   . GLN B 1 101 ? 13.678 -38.513 21.908  1.00 77.40 ? 101 GLN B C   1 
ATOM 2290 O O   . GLN B 1 101 ? 13.667 -37.626 22.756  1.00 78.03 ? 101 GLN B O   1 
ATOM 2291 C CB  . GLN B 1 101 ? 13.186 -40.721 22.990  1.00 76.70 ? 101 GLN B CB  1 
ATOM 2292 C CG  . GLN B 1 101 ? 11.897 -41.061 22.198  1.00 76.62 ? 101 GLN B CG  1 
ATOM 2293 C CD  . GLN B 1 101 ? 12.015 -42.226 21.185  1.00 77.09 ? 101 GLN B CD  1 
ATOM 2294 O OE1 . GLN B 1 101 ? 11.423 -42.170 20.091  1.00 77.84 ? 101 GLN B OE1 1 
ATOM 2295 N NE2 . GLN B 1 101 ? 12.743 -43.286 21.555  1.00 76.21 ? 101 GLN B NE2 1 
ATOM 2296 N N   . THR B 1 102 ? 13.248 -38.362 20.652  1.00 77.56 ? 102 THR B N   1 
ATOM 2297 C CA  . THR B 1 102 ? 12.985 -37.074 20.029  1.00 77.54 ? 102 THR B CA  1 
ATOM 2298 C C   . THR B 1 102 ? 11.806 -37.251 19.051  1.00 77.96 ? 102 THR B C   1 
ATOM 2299 O O   . THR B 1 102 ? 11.705 -38.286 18.394  1.00 78.26 ? 102 THR B O   1 
ATOM 2300 C CB  . THR B 1 102 ? 14.266 -36.580 19.263  1.00 77.76 ? 102 THR B CB  1 
ATOM 2301 O OG1 . THR B 1 102 ? 15.404 -36.586 20.146  1.00 76.65 ? 102 THR B OG1 1 
ATOM 2302 C CG2 . THR B 1 102 ? 14.070 -35.169 18.649  1.00 77.58 ? 102 THR B CG2 1 
ATOM 2303 N N   . ARG B 1 103 ? 10.927 -36.249 18.955  1.00 78.11 ? 103 ARG B N   1 
ATOM 2304 C CA  . ARG B 1 103 ? 9.715  -36.311 18.114  1.00 77.97 ? 103 ARG B CA  1 
ATOM 2305 C C   . ARG B 1 103 ? 9.729  -35.122 17.186  1.00 77.99 ? 103 ARG B C   1 
ATOM 2306 O O   . ARG B 1 103 ? 9.759  -33.987 17.645  1.00 78.11 ? 103 ARG B O   1 
ATOM 2307 C CB  . ARG B 1 103 ? 8.457  -36.249 18.992  1.00 78.38 ? 103 ARG B CB  1 
ATOM 2308 C CG  . ARG B 1 103 ? 7.083  -36.560 18.299  1.00 78.75 ? 103 ARG B CG  1 
ATOM 2309 C CD  . ARG B 1 103 ? 5.846  -36.464 19.312  1.00 77.81 ? 103 ARG B CD  1 
ATOM 2310 N NE  . ARG B 1 103 ? 5.814  -37.599 20.241  1.00 79.20 ? 103 ARG B NE  1 
ATOM 2311 C CZ  . ARG B 1 103 ? 4.992  -37.744 21.298  1.00 80.59 ? 103 ARG B CZ  1 
ATOM 2312 N NH1 . ARG B 1 103 ? 4.111  -36.800 21.634  1.00 81.45 ? 103 ARG B NH1 1 
ATOM 2313 N NH2 . ARG B 1 103 ? 5.063  -38.850 22.052  1.00 78.49 ? 103 ARG B NH2 1 
ATOM 2314 N N   . THR B 1 104 ? 9.735  -35.377 15.881  1.00 77.90 ? 104 THR B N   1 
ATOM 2315 C CA  . THR B 1 104 ? 9.854  -34.313 14.896  1.00 77.30 ? 104 THR B CA  1 
ATOM 2316 C C   . THR B 1 104 ? 8.596  -34.249 14.016  1.00 77.44 ? 104 THR B C   1 
ATOM 2317 O O   . THR B 1 104 ? 7.867  -35.240 13.824  1.00 77.57 ? 104 THR B O   1 
ATOM 2318 C CB  . THR B 1 104 ? 11.085 -34.523 14.028  1.00 77.05 ? 104 THR B CB  1 
ATOM 2319 O OG1 . THR B 1 104 ? 10.935 -35.719 13.260  1.00 77.55 ? 104 THR B OG1 1 
ATOM 2320 C CG2 . THR B 1 104 ? 12.298 -34.662 14.897  1.00 76.04 ? 104 THR B CG2 1 
ATOM 2321 N N   . CYS B 1 105 ? 8.319  -33.064 13.516  1.00 76.71 ? 105 CYS B N   1 
ATOM 2322 C CA  . CYS B 1 105 ? 7.308  -32.940 12.528  1.00 76.24 ? 105 CYS B CA  1 
ATOM 2323 C C   . CYS B 1 105 ? 8.024  -32.448 11.292  1.00 75.50 ? 105 CYS B C   1 
ATOM 2324 O O   . CYS B 1 105 ? 8.837  -31.543 11.366  1.00 74.78 ? 105 CYS B O   1 
ATOM 2325 C CB  . CYS B 1 105 ? 6.241  -31.970 12.988  1.00 76.24 ? 105 CYS B CB  1 
ATOM 2326 S SG  . CYS B 1 105 ? 5.036  -31.736 11.729  1.00 76.62 ? 105 CYS B SG  1 
ATOM 2327 N N   . TRP B 1 106 ? 7.721  -33.077 10.167  1.00 75.30 ? 106 TRP B N   1 
ATOM 2328 C CA  . TRP B 1 106 ? 8.352  -32.772 8.889   1.00 75.07 ? 106 TRP B CA  1 
ATOM 2329 C C   . TRP B 1 106 ? 7.432  -32.005 7.945   1.00 74.97 ? 106 TRP B C   1 
ATOM 2330 O O   . TRP B 1 106 ? 6.367  -32.485 7.518   1.00 75.02 ? 106 TRP B O   1 
ATOM 2331 C CB  . TRP B 1 106 ? 8.816  -34.058 8.203   1.00 74.81 ? 106 TRP B CB  1 
ATOM 2332 C CG  . TRP B 1 106 ? 9.984  -34.738 8.877   1.00 74.63 ? 106 TRP B CG  1 
ATOM 2333 C CD1 . TRP B 1 106 ? 10.070 -35.108 10.193  1.00 75.31 ? 106 TRP B CD1 1 
ATOM 2334 C CD2 . TRP B 1 106 ? 11.210 -35.158 8.261   1.00 72.80 ? 106 TRP B CD2 1 
ATOM 2335 N NE1 . TRP B 1 106 ? 11.289 -35.708 10.428  1.00 75.54 ? 106 TRP B NE1 1 
ATOM 2336 C CE2 . TRP B 1 106 ? 11.994 -35.764 9.260   1.00 72.99 ? 106 TRP B CE2 1 
ATOM 2337 C CE3 . TRP B 1 106 ? 11.719 -35.073 6.960   1.00 74.09 ? 106 TRP B CE3 1 
ATOM 2338 C CZ2 . TRP B 1 106 ? 13.241 -36.288 9.010   1.00 73.45 ? 106 TRP B CZ2 1 
ATOM 2339 C CZ3 . TRP B 1 106 ? 12.967 -35.581 6.705   1.00 74.22 ? 106 TRP B CZ3 1 
ATOM 2340 C CH2 . TRP B 1 106 ? 13.719 -36.182 7.727   1.00 74.59 ? 106 TRP B CH2 1 
ATOM 2341 N N   . PHE B 1 107 ? 7.908  -30.839 7.559   1.00 74.88 ? 107 PHE B N   1 
ATOM 2342 C CA  . PHE B 1 107 ? 7.152  -29.937 6.739   1.00 75.22 ? 107 PHE B CA  1 
ATOM 2343 C C   . PHE B 1 107 ? 7.679  -29.814 5.317   1.00 75.03 ? 107 PHE B C   1 
ATOM 2344 O O   . PHE B 1 107 ? 8.706  -29.179 5.100   1.00 75.61 ? 107 PHE B O   1 
ATOM 2345 C CB  . PHE B 1 107 ? 7.202  -28.573 7.422   1.00 75.49 ? 107 PHE B CB  1 
ATOM 2346 C CG  . PHE B 1 107 ? 6.381  -28.504 8.676   1.00 75.25 ? 107 PHE B CG  1 
ATOM 2347 C CD1 . PHE B 1 107 ? 6.970  -28.210 9.901   1.00 75.01 ? 107 PHE B CD1 1 
ATOM 2348 C CD2 . PHE B 1 107 ? 5.016  -28.731 8.618   1.00 73.92 ? 107 PHE B CD2 1 
ATOM 2349 C CE1 . PHE B 1 107 ? 6.209  -28.157 11.062  1.00 75.70 ? 107 PHE B CE1 1 
ATOM 2350 C CE2 . PHE B 1 107 ? 4.245  -28.673 9.755   1.00 76.39 ? 107 PHE B CE2 1 
ATOM 2351 C CZ  . PHE B 1 107 ? 4.840  -28.382 10.997  1.00 75.80 ? 107 PHE B CZ  1 
ATOM 2352 N N   . SER B 1 108 ? 6.985  -30.384 4.338   1.00 75.27 ? 108 SER B N   1 
ATOM 2353 C CA  . SER B 1 108 ? 7.326  -30.129 2.902   1.00 75.83 ? 108 SER B CA  1 
ATOM 2354 C C   . SER B 1 108 ? 7.178  -28.663 2.470   1.00 75.71 ? 108 SER B C   1 
ATOM 2355 O O   . SER B 1 108 ? 6.625  -27.819 3.166   1.00 76.04 ? 108 SER B O   1 
ATOM 2356 C CB  . SER B 1 108 ? 6.435  -30.953 1.957   1.00 75.66 ? 108 SER B CB  1 
ATOM 2357 O OG  . SER B 1 108 ? 5.197  -31.250 2.604   1.00 77.59 ? 108 SER B OG  1 
ATOM 2358 N N   . GLU B 1 109 ? 7.658  -28.376 1.284   1.00 75.70 ? 109 GLU B N   1 
ATOM 2359 C CA  . GLU B 1 109 ? 7.308  -27.137 0.641   1.00 75.95 ? 109 GLU B CA  1 
ATOM 2360 C C   . GLU B 1 109 ? 5.805  -27.136 0.487   1.00 76.44 ? 109 GLU B C   1 
ATOM 2361 O O   . GLU B 1 109 ? 5.144  -26.167 0.894   1.00 76.28 ? 109 GLU B O   1 
ATOM 2362 C CB  . GLU B 1 109 ? 7.962  -27.019 -0.732  1.00 75.47 ? 109 GLU B CB  1 
ATOM 2363 C CG  . GLU B 1 109 ? 8.034  -25.609 -1.225  1.00 75.89 ? 109 GLU B CG  1 
ATOM 2364 C CD  . GLU B 1 109 ? 8.579  -25.491 -2.658  1.00 75.81 ? 109 GLU B CD  1 
ATOM 2365 O OE1 . GLU B 1 109 ? 9.813  -25.417 -2.818  1.00 78.40 ? 109 GLU B OE1 1 
ATOM 2366 O OE2 . GLU B 1 109 ? 7.792  -25.460 -3.627  1.00 73.00 ? 109 GLU B OE2 1 
ATOM 2367 N N   . GLU B 1 110 ? 5.278  -28.240 -0.076  1.00 77.10 ? 110 GLU B N   1 
ATOM 2368 C CA  . GLU B 1 110 ? 3.840  -28.355 -0.405  1.00 76.96 ? 110 GLU B CA  1 
ATOM 2369 C C   . GLU B 1 110 ? 3.060  -28.209 0.847   1.00 76.15 ? 110 GLU B C   1 
ATOM 2370 O O   . GLU B 1 110 ? 2.098  -27.470 0.882   1.00 76.41 ? 110 GLU B O   1 
ATOM 2371 C CB  . GLU B 1 110 ? 3.471  -29.646 -1.129  1.00 77.12 ? 110 GLU B CB  1 
ATOM 2372 C CG  . GLU B 1 110 ? 4.195  -29.823 -2.470  1.00 79.69 ? 110 GLU B CG  1 
ATOM 2373 C CD  . GLU B 1 110 ? 5.463  -30.631 -2.286  1.00 85.47 ? 110 GLU B CD  1 
ATOM 2374 O OE1 . GLU B 1 110 ? 5.367  -31.690 -1.618  1.00 89.93 ? 110 GLU B OE1 1 
ATOM 2375 O OE2 . GLU B 1 110 ? 6.559  -30.208 -2.753  1.00 86.67 ? 110 GLU B OE2 1 
ATOM 2376 N N   . CYS B 1 111 ? 3.526  -28.854 1.900   1.00 76.41 ? 111 CYS B N   1 
ATOM 2377 C CA  . CYS B 1 111 ? 2.996  -28.632 3.230   1.00 76.21 ? 111 CYS B CA  1 
ATOM 2378 C C   . CYS B 1 111 ? 3.091  -27.195 3.723   1.00 76.17 ? 111 CYS B C   1 
ATOM 2379 O O   . CYS B 1 111 ? 2.134  -26.631 4.252   1.00 74.85 ? 111 CYS B O   1 
ATOM 2380 C CB  . CYS B 1 111 ? 3.750  -29.475 4.206   1.00 76.25 ? 111 CYS B CB  1 
ATOM 2381 S SG  . CYS B 1 111 ? 3.075  -29.274 5.802   1.00 79.07 ? 111 CYS B SG  1 
ATOM 2382 N N   . LEU B 1 112 ? 4.266  -26.607 3.552   1.00 76.83 ? 112 LEU B N   1 
ATOM 2383 C CA  . LEU B 1 112 ? 4.461  -25.229 3.934   1.00 77.22 ? 112 LEU B CA  1 
ATOM 2384 C C   . LEU B 1 112 ? 3.533  -24.270 3.225   1.00 77.72 ? 112 LEU B C   1 
ATOM 2385 O O   . LEU B 1 112 ? 2.906  -23.453 3.904   1.00 79.18 ? 112 LEU B O   1 
ATOM 2386 C CB  . LEU B 1 112 ? 5.914  -24.804 3.756   1.00 77.15 ? 112 LEU B CB  1 
ATOM 2387 C CG  . LEU B 1 112 ? 6.712  -25.374 4.928   1.00 77.05 ? 112 LEU B CG  1 
ATOM 2388 C CD1 . LEU B 1 112 ? 8.173  -25.249 4.631   1.00 77.16 ? 112 LEU B CD1 1 
ATOM 2389 C CD2 . LEU B 1 112 ? 6.363  -24.692 6.236   1.00 76.49 ? 112 LEU B CD2 1 
ATOM 2390 N N   . ARG B 1 113 ? 3.399  -24.369 1.904   1.00 77.48 ? 113 ARG B N   1 
ATOM 2391 C CA  . ARG B 1 113 ? 2.552  -23.416 1.165   1.00 77.51 ? 113 ARG B CA  1 
ATOM 2392 C C   . ARG B 1 113 ? 1.168  -23.275 1.812   1.00 78.30 ? 113 ARG B C   1 
ATOM 2393 O O   . ARG B 1 113 ? 0.658  -22.151 2.022   1.00 78.00 ? 113 ARG B O   1 
ATOM 2394 C CB  . ARG B 1 113 ? 2.396  -23.823 -0.303  1.00 77.30 ? 113 ARG B CB  1 
ATOM 2395 C CG  . ARG B 1 113 ? 3.707  -23.925 -1.049  1.00 77.11 ? 113 ARG B CG  1 
ATOM 2396 C CD  . ARG B 1 113 ? 3.531  -24.620 -2.386  1.00 76.69 ? 113 ARG B CD  1 
ATOM 2397 N NE  . ARG B 1 113 ? 4.715  -24.454 -3.227  1.00 74.88 ? 113 ARG B NE  1 
ATOM 2398 C CZ  . ARG B 1 113 ? 5.042  -23.328 -3.862  1.00 75.53 ? 113 ARG B CZ  1 
ATOM 2399 N NH1 . ARG B 1 113 ? 4.281  -22.233 -3.780  1.00 74.73 ? 113 ARG B NH1 1 
ATOM 2400 N NH2 . ARG B 1 113 ? 6.142  -23.291 -4.593  1.00 77.55 ? 113 ARG B NH2 1 
ATOM 2401 N N   . VAL B 1 114 ? 0.582  -24.431 2.130   1.00 78.86 ? 114 VAL B N   1 
ATOM 2402 C CA  . VAL B 1 114 ? -0.686 -24.500 2.845   1.00 79.42 ? 114 VAL B CA  1 
ATOM 2403 C C   . VAL B 1 114 ? -0.630 -23.875 4.279   1.00 79.61 ? 114 VAL B C   1 
ATOM 2404 O O   . VAL B 1 114 ? -1.584 -23.225 4.701   1.00 80.19 ? 114 VAL B O   1 
ATOM 2405 C CB  . VAL B 1 114 ? -1.192 -25.971 2.891   1.00 79.50 ? 114 VAL B CB  1 
ATOM 2406 C CG1 . VAL B 1 114 ? -2.301 -26.118 3.866   1.00 79.33 ? 114 VAL B CG1 1 
ATOM 2407 C CG2 . VAL B 1 114 ? -1.641 -26.445 1.503   1.00 79.54 ? 114 VAL B CG2 1 
ATOM 2408 N N   . ILE B 1 115 ? 0.455  -24.038 5.029   1.00 79.39 ? 115 ILE B N   1 
ATOM 2409 C CA  . ILE B 1 115 ? 0.504  -23.381 6.330   1.00 79.66 ? 115 ILE B CA  1 
ATOM 2410 C C   . ILE B 1 115 ? 0.505  -21.872 6.124   1.00 78.91 ? 115 ILE B C   1 
ATOM 2411 O O   . ILE B 1 115 ? -0.083 -21.146 6.932   1.00 79.04 ? 115 ILE B O   1 
ATOM 2412 C CB  . ILE B 1 115 ? 1.704  -23.797 7.218   1.00 80.19 ? 115 ILE B CB  1 
ATOM 2413 C CG1 . ILE B 1 115 ? 1.718  -25.319 7.456   1.00 81.08 ? 115 ILE B CG1 1 
ATOM 2414 C CG2 . ILE B 1 115 ? 1.603  -23.137 8.608   1.00 79.52 ? 115 ILE B CG2 1 
ATOM 2415 C CD1 . ILE B 1 115 ? 3.087  -25.887 7.800   1.00 80.93 ? 115 ILE B CD1 1 
ATOM 2416 N N   . PHE B 1 116 ? 1.127  -21.391 5.043   1.00 77.96 ? 116 PHE B N   1 
ATOM 2417 C CA  . PHE B 1 116 ? 1.169  -19.932 4.770   1.00 77.29 ? 116 PHE B CA  1 
ATOM 2418 C C   . PHE B 1 116 ? -0.122 -19.293 4.188   1.00 77.61 ? 116 PHE B C   1 
ATOM 2419 O O   . PHE B 1 116 ? -0.184 -18.045 4.059   1.00 76.84 ? 116 PHE B O   1 
ATOM 2420 C CB  . PHE B 1 116 ? 2.292  -19.551 3.817   1.00 76.11 ? 116 PHE B CB  1 
ATOM 2421 C CG  . PHE B 1 116 ? 3.655  -19.940 4.255   1.00 75.33 ? 116 PHE B CG  1 
ATOM 2422 C CD1 . PHE B 1 116 ? 3.998  -20.054 5.613   1.00 75.33 ? 116 PHE B CD1 1 
ATOM 2423 C CD2 . PHE B 1 116 ? 4.638  -20.148 3.286   1.00 72.29 ? 116 PHE B CD2 1 
ATOM 2424 C CE1 . PHE B 1 116 ? 5.294  -20.415 5.982   1.00 73.01 ? 116 PHE B CE1 1 
ATOM 2425 C CE2 . PHE B 1 116 ? 5.892  -20.481 3.631   1.00 71.72 ? 116 PHE B CE2 1 
ATOM 2426 C CZ  . PHE B 1 116 ? 6.230  -20.631 4.993   1.00 73.79 ? 116 PHE B CZ  1 
ATOM 2427 N N   . ARG B 1 117 ? -1.112 -20.112 3.788   1.00 78.00 ? 117 ARG B N   1 
ATOM 2428 C CA  . ARG B 1 117 ? -2.412 -19.562 3.331   1.00 77.82 ? 117 ARG B CA  1 
ATOM 2429 C C   . ARG B 1 117 ? -3.364 -19.489 4.489   1.00 76.62 ? 117 ARG B C   1 
ATOM 2430 O O   . ARG B 1 117 ? -3.973 -18.451 4.696   1.00 75.20 ? 117 ARG B O   1 
ATOM 2431 C CB  . ARG B 1 117 ? -3.035 -20.347 2.179   1.00 78.39 ? 117 ARG B CB  1 
ATOM 2432 C CG  . ARG B 1 117 ? -2.149 -20.462 0.991   1.00 80.03 ? 117 ARG B CG  1 
ATOM 2433 C CD  . ARG B 1 117 ? -2.937 -20.441 -0.335  1.00 84.21 ? 117 ARG B CD  1 
ATOM 2434 N NE  . ARG B 1 117 ? -2.124 -20.998 -1.441  1.00 85.81 ? 117 ARG B NE  1 
ATOM 2435 C CZ  . ARG B 1 117 ? -1.919 -22.302 -1.634  1.00 85.26 ? 117 ARG B CZ  1 
ATOM 2436 N NH1 . ARG B 1 117 ? -2.467 -23.195 -0.812  1.00 86.37 ? 117 ARG B NH1 1 
ATOM 2437 N NH2 . ARG B 1 117 ? -1.145 -22.720 -2.624  1.00 83.95 ? 117 ARG B NH2 1 
ATOM 2438 N N   . THR B 1 118 ? -3.453 -20.567 5.264   1.00 76.42 ? 118 THR B N   1 
ATOM 2439 C CA  . THR B 1 118 ? -4.150 -20.493 6.568   1.00 76.93 ? 118 THR B CA  1 
ATOM 2440 C C   . THR B 1 118 ? -3.681 -19.256 7.242   1.00 76.71 ? 118 THR B C   1 
ATOM 2441 O O   . THR B 1 118 ? -4.439 -18.548 7.880   1.00 76.51 ? 118 THR B O   1 
ATOM 2442 C CB  . THR B 1 118 ? -3.772 -21.620 7.580   1.00 76.80 ? 118 THR B CB  1 
ATOM 2443 O OG1 . THR B 1 118 ? -3.911 -22.889 6.959   1.00 78.05 ? 118 THR B OG1 1 
ATOM 2444 C CG2 . THR B 1 118 ? -4.664 -21.598 8.859   1.00 76.81 ? 118 THR B CG2 1 
ATOM 2445 N N   . ASP B 1 119 ? -2.387 -19.040 7.142   1.00 77.06 ? 119 ASP B N   1 
ATOM 2446 C CA  . ASP B 1 119 ? -1.782 -18.145 8.053   1.00 77.73 ? 119 ASP B CA  1 
ATOM 2447 C C   . ASP B 1 119 ? -0.476 -17.635 7.512   1.00 77.44 ? 119 ASP B C   1 
ATOM 2448 O O   . ASP B 1 119 ? 0.514  -18.328 7.447   1.00 77.34 ? 119 ASP B O   1 
ATOM 2449 C CB  . ASP B 1 119 ? -1.620 -18.839 9.399   1.00 78.18 ? 119 ASP B CB  1 
ATOM 2450 C CG  . ASP B 1 119 ? -0.697 -18.105 10.310  1.00 78.95 ? 119 ASP B CG  1 
ATOM 2451 O OD1 . ASP B 1 119 ? -0.768 -16.869 10.350  1.00 83.52 ? 119 ASP B OD1 1 
ATOM 2452 O OD2 . ASP B 1 119 ? 0.112  -18.762 10.973  1.00 80.93 ? 119 ASP B OD2 1 
ATOM 2453 N N   . GLU B 1 120 ? -0.540 -16.351 7.208   1.00 77.90 ? 120 GLU B N   1 
ATOM 2454 C CA  . GLU B 1 120 ? 0.392  -15.577 6.401   1.00 77.86 ? 120 GLU B CA  1 
ATOM 2455 C C   . GLU B 1 120 ? 1.372  -14.963 7.414   1.00 77.51 ? 120 GLU B C   1 
ATOM 2456 O O   . GLU B 1 120 ? 2.517  -14.662 7.072   1.00 76.50 ? 120 GLU B O   1 
ATOM 2457 C CB  . GLU B 1 120 ? -0.477 -14.511 5.679   1.00 77.93 ? 120 GLU B CB  1 
ATOM 2458 C CG  . GLU B 1 120 ? 0.014  -13.846 4.393   1.00 79.44 ? 120 GLU B CG  1 
ATOM 2459 C CD  . GLU B 1 120 ? -1.053 -12.941 3.718   1.00 79.09 ? 120 GLU B CD  1 
ATOM 2460 O OE1 . GLU B 1 120 ? -0.660 -11.828 3.276   1.00 77.00 ? 120 GLU B OE1 1 
ATOM 2461 O OE2 . GLU B 1 120 ? -2.259 -13.341 3.640   1.00 81.84 ? 120 GLU B OE2 1 
ATOM 2462 N N   . ASP B 1 121 ? 0.925  -14.843 8.685   1.00 77.21 ? 121 ASP B N   1 
ATOM 2463 C CA  . ASP B 1 121 ? 1.802  -14.398 9.750   1.00 77.37 ? 121 ASP B CA  1 
ATOM 2464 C C   . ASP B 1 121 ? 2.923  -15.384 10.021  1.00 78.15 ? 121 ASP B C   1 
ATOM 2465 O O   . ASP B 1 121 ? 3.950  -14.994 10.558  1.00 79.41 ? 121 ASP B O   1 
ATOM 2466 C CB  . ASP B 1 121 ? 1.069  -14.170 11.057  1.00 77.28 ? 121 ASP B CB  1 
ATOM 2467 C CG  . ASP B 1 121 ? 0.038  -13.044 10.988  1.00 77.03 ? 121 ASP B CG  1 
ATOM 2468 O OD1 . ASP B 1 121 ? 0.221  -12.163 10.099  1.00 69.67 ? 121 ASP B OD1 1 
ATOM 2469 O OD2 . ASP B 1 121 ? -0.915 -13.061 11.868  1.00 72.97 ? 121 ASP B OD2 1 
ATOM 2470 N N   . MET B 1 122 ? 2.760  -16.661 9.686   1.00 78.69 ? 122 MET B N   1 
ATOM 2471 C CA  . MET B 1 122 ? 3.872  -17.595 9.896   1.00 78.51 ? 122 MET B CA  1 
ATOM 2472 C C   . MET B 1 122 ? 4.939  -17.438 8.798   1.00 78.26 ? 122 MET B C   1 
ATOM 2473 O O   . MET B 1 122 ? 6.084  -17.825 9.034   1.00 79.15 ? 122 MET B O   1 
ATOM 2474 C CB  . MET B 1 122 ? 3.427  -19.051 10.009  1.00 78.44 ? 122 MET B CB  1 
ATOM 2475 C CG  . MET B 1 122 ? 4.278  -19.857 10.968  1.00 79.81 ? 122 MET B CG  1 
ATOM 2476 S SD  . MET B 1 122 ? 3.553  -20.228 12.632  1.00 84.61 ? 122 MET B SD  1 
ATOM 2477 C CE  . MET B 1 122 ? 2.652  -18.712 13.105  1.00 83.77 ? 122 MET B CE  1 
ATOM 2478 N N   . ILE B 1 123 ? 4.636  -16.846 7.644   1.00 76.68 ? 123 ILE B N   1 
ATOM 2479 C CA  . ILE B 1 123 ? 5.765  -16.566 6.726   1.00 76.40 ? 123 ILE B CA  1 
ATOM 2480 C C   . ILE B 1 123 ? 6.845  -15.807 7.464   1.00 76.59 ? 123 ILE B C   1 
ATOM 2481 O O   . ILE B 1 123 ? 8.035  -16.078 7.311   1.00 77.00 ? 123 ILE B O   1 
ATOM 2482 C CB  . ILE B 1 123 ? 5.437  -15.689 5.424   1.00 75.43 ? 123 ILE B CB  1 
ATOM 2483 C CG1 . ILE B 1 123 ? 4.868  -16.523 4.293   1.00 72.90 ? 123 ILE B CG1 1 
ATOM 2484 C CG2 . ILE B 1 123 ? 6.667  -15.064 4.869   1.00 75.41 ? 123 ILE B CG2 1 
ATOM 2485 C CD1 . ILE B 1 123 ? 3.452  -16.166 3.963   1.00 71.32 ? 123 ILE B CD1 1 
ATOM 2486 N N   . PHE B 1 124 ? 6.455  -14.800 8.212   1.00 77.05 ? 124 PHE B N   1 
ATOM 2487 C CA  . PHE B 1 124 ? 7.458  -13.853 8.601   1.00 77.55 ? 124 PHE B CA  1 
ATOM 2488 C C   . PHE B 1 124 ? 8.241  -14.381 9.777   1.00 77.87 ? 124 PHE B C   1 
ATOM 2489 O O   . PHE B 1 124 ? 9.412  -14.027 9.951   1.00 77.63 ? 124 PHE B O   1 
ATOM 2490 C CB  . PHE B 1 124 ? 6.858  -12.461 8.773   1.00 78.12 ? 124 PHE B CB  1 
ATOM 2491 C CG  . PHE B 1 124 ? 6.337  -11.887 7.474   1.00 78.62 ? 124 PHE B CG  1 
ATOM 2492 C CD1 . PHE B 1 124 ? 5.032  -12.125 7.060   1.00 79.27 ? 124 PHE B CD1 1 
ATOM 2493 C CD2 . PHE B 1 124 ? 7.170  -11.164 6.638   1.00 80.17 ? 124 PHE B CD2 1 
ATOM 2494 C CE1 . PHE B 1 124 ? 4.560  -11.627 5.846   1.00 79.56 ? 124 PHE B CE1 1 
ATOM 2495 C CE2 . PHE B 1 124 ? 6.697  -10.658 5.407   1.00 80.85 ? 124 PHE B CE2 1 
ATOM 2496 C CZ  . PHE B 1 124 ? 5.391  -10.894 5.017   1.00 79.55 ? 124 PHE B CZ  1 
ATOM 2497 N N   . GLU B 1 125 ? 7.614  -15.285 10.523  1.00 78.25 ? 125 GLU B N   1 
ATOM 2498 C CA  . GLU B 1 125 ? 8.256  -15.971 11.622  1.00 78.73 ? 125 GLU B CA  1 
ATOM 2499 C C   . GLU B 1 125 ? 9.395  -16.832 11.122  1.00 77.81 ? 125 GLU B C   1 
ATOM 2500 O O   . GLU B 1 125 ? 10.491 -16.797 11.645  1.00 77.61 ? 125 GLU B O   1 
ATOM 2501 C CB  . GLU B 1 125 ? 7.232  -16.847 12.315  1.00 79.35 ? 125 GLU B CB  1 
ATOM 2502 C CG  . GLU B 1 125 ? 6.378  -16.076 13.270  1.00 81.58 ? 125 GLU B CG  1 
ATOM 2503 C CD  . GLU B 1 125 ? 7.048  -15.909 14.613  1.00 85.03 ? 125 GLU B CD  1 
ATOM 2504 O OE1 . GLU B 1 125 ? 6.646  -15.009 15.408  1.00 85.66 ? 125 GLU B OE1 1 
ATOM 2505 O OE2 . GLU B 1 125 ? 7.990  -16.694 14.862  1.00 87.62 ? 125 GLU B OE2 1 
ATOM 2506 N N   . ILE B 1 126 ? 9.140  -17.626 10.112  1.00 77.24 ? 126 ILE B N   1 
ATOM 2507 C CA  . ILE B 1 126 ? 10.235 -18.346 9.508   1.00 77.46 ? 126 ILE B CA  1 
ATOM 2508 C C   . ILE B 1 126 ? 11.287 -17.364 8.984   1.00 77.32 ? 126 ILE B C   1 
ATOM 2509 O O   . ILE B 1 126 ? 12.486 -17.616 9.147   1.00 77.57 ? 126 ILE B O   1 
ATOM 2510 C CB  . ILE B 1 126 ? 9.758  -19.278 8.404   1.00 77.60 ? 126 ILE B CB  1 
ATOM 2511 C CG1 . ILE B 1 126 ? 9.280  -20.601 9.008   1.00 77.61 ? 126 ILE B CG1 1 
ATOM 2512 C CG2 . ILE B 1 126 ? 10.889 -19.569 7.409   1.00 79.77 ? 126 ILE B CG2 1 
ATOM 2513 C CD1 . ILE B 1 126 ? 7.894  -20.970 8.608   1.00 78.05 ? 126 ILE B CD1 1 
ATOM 2514 N N   . PHE B 1 127 ? 10.869 -16.257 8.367   1.00 76.60 ? 127 PHE B N   1 
ATOM 2515 C CA  . PHE B 1 127 ? 11.821 -15.200 8.028   1.00 76.72 ? 127 PHE B CA  1 
ATOM 2516 C C   . PHE B 1 127 ? 12.615 -14.688 9.255   1.00 76.77 ? 127 PHE B C   1 
ATOM 2517 O O   . PHE B 1 127 ? 13.844 -14.699 9.204   1.00 76.72 ? 127 PHE B O   1 
ATOM 2518 C CB  . PHE B 1 127 ? 11.133 -13.990 7.411   1.00 77.46 ? 127 PHE B CB  1 
ATOM 2519 C CG  . PHE B 1 127 ? 10.826 -14.095 5.967   1.00 78.00 ? 127 PHE B CG  1 
ATOM 2520 C CD1 . PHE B 1 127 ? 10.729 -15.314 5.303   1.00 81.01 ? 127 PHE B CD1 1 
ATOM 2521 C CD2 . PHE B 1 127 ? 10.583 -12.932 5.256   1.00 80.53 ? 127 PHE B CD2 1 
ATOM 2522 C CE1 . PHE B 1 127 ? 10.419 -15.354 3.939   1.00 80.47 ? 127 PHE B CE1 1 
ATOM 2523 C CE2 . PHE B 1 127 ? 10.283 -12.948 3.871   1.00 79.38 ? 127 PHE B CE2 1 
ATOM 2524 C CZ  . PHE B 1 127 ? 10.168 -14.141 3.233   1.00 79.65 ? 127 PHE B CZ  1 
ATOM 2525 N N   . LYS B 1 128 ? 11.929 -14.209 10.317  1.00 76.13 ? 128 LYS B N   1 
ATOM 2526 C CA  . LYS B 1 128 ? 12.612 -13.682 11.512  1.00 75.90 ? 128 LYS B CA  1 
ATOM 2527 C C   . LYS B 1 128 ? 13.672 -14.691 11.928  1.00 76.32 ? 128 LYS B C   1 
ATOM 2528 O O   . LYS B 1 128 ? 14.851 -14.353 12.231  1.00 76.45 ? 128 LYS B O   1 
ATOM 2529 C CB  . LYS B 1 128 ? 11.613 -13.375 12.694  1.00 75.29 ? 128 LYS B CB  1 
ATOM 2530 N N   . ASN B 1 129 ? 13.271 -15.946 11.870  1.00 76.48 ? 129 ASN B N   1 
ATOM 2531 C CA  . ASN B 1 129 ? 14.072 -17.002 12.425  1.00 77.27 ? 129 ASN B CA  1 
ATOM 2532 C C   . ASN B 1 129 ? 15.405 -17.117 11.774  1.00 77.88 ? 129 ASN B C   1 
ATOM 2533 O O   . ASN B 1 129 ? 16.436 -17.067 12.421  1.00 77.95 ? 129 ASN B O   1 
ATOM 2534 C CB  . ASN B 1 129 ? 13.351 -18.309 12.238  1.00 77.11 ? 129 ASN B CB  1 
ATOM 2535 C CG  . ASN B 1 129 ? 14.013 -19.420 12.956  1.00 76.46 ? 129 ASN B CG  1 
ATOM 2536 O OD1 . ASN B 1 129 ? 14.670 -20.291 12.294  1.00 73.57 ? 129 ASN B OD1 1 
ATOM 2537 N ND2 . ASN B 1 129 ? 13.856 -19.435 14.329  1.00 65.98 ? 129 ASN B ND2 1 
ATOM 2538 N N   . TYR B 1 130 ? 15.356 -17.260 10.465  1.00 79.22 ? 130 TYR B N   1 
ATOM 2539 C CA  . TYR B 1 130 ? 16.519 -17.557 9.681   1.00 79.93 ? 130 TYR B CA  1 
ATOM 2540 C C   . TYR B 1 130 ? 17.359 -16.328 9.669   1.00 79.97 ? 130 TYR B C   1 
ATOM 2541 O O   . TYR B 1 130 ? 18.575 -16.366 9.769   1.00 80.54 ? 130 TYR B O   1 
ATOM 2542 C CB  . TYR B 1 130 ? 16.072 -18.041 8.291   1.00 81.18 ? 130 TYR B CB  1 
ATOM 2543 C CG  . TYR B 1 130 ? 15.757 -19.530 8.359   1.00 82.58 ? 130 TYR B CG  1 
ATOM 2544 C CD1 . TYR B 1 130 ? 14.469 -20.005 8.538   1.00 82.53 ? 130 TYR B CD1 1 
ATOM 2545 C CD2 . TYR B 1 130 ? 16.793 -20.465 8.339   1.00 84.78 ? 130 TYR B CD2 1 
ATOM 2546 C CE1 . TYR B 1 130 ? 14.225 -21.385 8.643   1.00 82.76 ? 130 TYR B CE1 1 
ATOM 2547 C CE2 . TYR B 1 130 ? 16.558 -21.828 8.456   1.00 84.24 ? 130 TYR B CE2 1 
ATOM 2548 C CZ  . TYR B 1 130 ? 15.282 -22.281 8.603   1.00 83.24 ? 130 TYR B CZ  1 
ATOM 2549 O OH  . TYR B 1 130 ? 15.101 -23.640 8.694   1.00 84.07 ? 130 TYR B OH  1 
ATOM 2550 N N   . LEU B 1 131 ? 16.680 -15.210 9.605   1.00 80.51 ? 131 LEU B N   1 
ATOM 2551 C CA  . LEU B 1 131 ? 17.325 -13.920 9.734   1.00 80.82 ? 131 LEU B CA  1 
ATOM 2552 C C   . LEU B 1 131 ? 18.109 -13.764 11.060  1.00 79.42 ? 131 LEU B C   1 
ATOM 2553 O O   . LEU B 1 131 ? 19.149 -13.105 11.082  1.00 80.02 ? 131 LEU B O   1 
ATOM 2554 C CB  . LEU B 1 131 ? 16.265 -12.826 9.651   1.00 81.59 ? 131 LEU B CB  1 
ATOM 2555 C CG  . LEU B 1 131 ? 16.781 -11.507 9.110   1.00 84.11 ? 131 LEU B CG  1 
ATOM 2556 C CD1 . LEU B 1 131 ? 16.499 -11.438 7.543   1.00 84.10 ? 131 LEU B CD1 1 
ATOM 2557 C CD2 . LEU B 1 131 ? 16.162 -10.326 9.974   1.00 84.69 ? 131 LEU B CD2 1 
ATOM 2558 N N   . THR B 1 132 ? 17.634 -14.333 12.166  1.00 77.18 ? 132 THR B N   1 
ATOM 2559 C CA  . THR B 1 132 ? 18.487 -14.325 13.350  1.00 75.41 ? 132 THR B CA  1 
ATOM 2560 C C   . THR B 1 132 ? 19.655 -15.218 13.126  1.00 74.85 ? 132 THR B C   1 
ATOM 2561 O O   . THR B 1 132 ? 20.815 -14.814 13.330  1.00 74.84 ? 132 THR B O   1 
ATOM 2562 C CB  . THR B 1 132 ? 17.845 -14.907 14.569  1.00 75.04 ? 132 THR B CB  1 
ATOM 2563 O OG1 . THR B 1 132 ? 16.726 -14.111 14.918  1.00 72.78 ? 132 THR B OG1 1 
ATOM 2564 C CG2 . THR B 1 132 ? 18.869 -14.953 15.707  1.00 73.95 ? 132 THR B CG2 1 
ATOM 2565 N N   . LYS B 1 133 ? 19.345 -16.460 12.774  1.00 73.95 ? 133 LYS B N   1 
ATOM 2566 C CA  . LYS B 1 133 ? 20.381 -17.415 12.493  1.00 73.98 ? 133 LYS B CA  1 
ATOM 2567 C C   . LYS B 1 133 ? 21.473 -16.725 11.579  1.00 74.82 ? 133 LYS B C   1 
ATOM 2568 O O   . LYS B 1 133 ? 22.642 -16.673 11.968  1.00 75.26 ? 133 LYS B O   1 
ATOM 2569 C CB  . LYS B 1 133 ? 19.774 -18.678 11.882  1.00 73.97 ? 133 LYS B CB  1 
ATOM 2570 C CG  . LYS B 1 133 ? 18.947 -19.578 12.841  1.00 72.96 ? 133 LYS B CG  1 
ATOM 2571 C CD  . LYS B 1 133 ? 18.136 -20.607 12.004  1.00 73.15 ? 133 LYS B CD  1 
ATOM 2572 C CE  . LYS B 1 133 ? 17.587 -21.838 12.751  1.00 72.78 ? 133 LYS B CE  1 
ATOM 2573 N NZ  . LYS B 1 133 ? 16.497 -22.616 11.990  1.00 70.29 ? 133 LYS B NZ  1 
ATOM 2574 N N   . VAL B 1 134 ? 21.109 -16.110 10.451  1.00 74.59 ? 134 VAL B N   1 
ATOM 2575 C CA  . VAL B 1 134 ? 22.121 -15.421 9.667   1.00 75.34 ? 134 VAL B CA  1 
ATOM 2576 C C   . VAL B 1 134 ? 22.920 -14.327 10.402  1.00 76.04 ? 134 VAL B C   1 
ATOM 2577 O O   . VAL B 1 134 ? 24.146 -14.367 10.410  1.00 76.50 ? 134 VAL B O   1 
ATOM 2578 C CB  . VAL B 1 134 ? 21.568 -14.868 8.371   1.00 76.08 ? 134 VAL B CB  1 
ATOM 2579 C CG1 . VAL B 1 134 ? 22.673 -14.053 7.623   1.00 73.91 ? 134 VAL B CG1 1 
ATOM 2580 C CG2 . VAL B 1 134 ? 21.056 -16.058 7.453   1.00 76.11 ? 134 VAL B CG2 1 
ATOM 2581 N N   . ALA B 1 135 ? 22.252 -13.337 10.988  1.00 76.56 ? 135 ALA B N   1 
ATOM 2582 C CA  . ALA B 1 135 ? 22.885 -12.467 12.009  1.00 76.42 ? 135 ALA B CA  1 
ATOM 2583 C C   . ALA B 1 135 ? 23.820 -13.224 12.967  1.00 76.00 ? 135 ALA B C   1 
ATOM 2584 O O   . ALA B 1 135 ? 24.953 -12.795 13.211  1.00 76.90 ? 135 ALA B O   1 
ATOM 2585 C CB  . ALA B 1 135 ? 21.822 -11.710 12.837  1.00 76.33 ? 135 ALA B CB  1 
ATOM 2586 N N   . TYR B 1 136 ? 23.375 -14.322 13.548  1.00 74.91 ? 136 TYR B N   1 
ATOM 2587 C CA  . TYR B 1 136 ? 24.243 -14.936 14.546  1.00 74.43 ? 136 TYR B CA  1 
ATOM 2588 C C   . TYR B 1 136 ? 25.549 -15.470 13.948  1.00 72.89 ? 136 TYR B C   1 
ATOM 2589 O O   . TYR B 1 136 ? 26.618 -15.179 14.450  1.00 72.60 ? 136 TYR B O   1 
ATOM 2590 C CB  . TYR B 1 136 ? 23.530 -16.032 15.348  1.00 75.12 ? 136 TYR B CB  1 
ATOM 2591 C CG  . TYR B 1 136 ? 24.505 -16.843 16.154  1.00 75.69 ? 136 TYR B CG  1 
ATOM 2592 C CD1 . TYR B 1 136 ? 24.887 -16.449 17.416  1.00 75.62 ? 136 TYR B CD1 1 
ATOM 2593 C CD2 . TYR B 1 136 ? 25.109 -17.979 15.608  1.00 78.07 ? 136 TYR B CD2 1 
ATOM 2594 C CE1 . TYR B 1 136 ? 25.804 -17.189 18.142  1.00 76.16 ? 136 TYR B CE1 1 
ATOM 2595 C CE2 . TYR B 1 136 ? 26.027 -18.709 16.319  1.00 76.93 ? 136 TYR B CE2 1 
ATOM 2596 C CZ  . TYR B 1 136 ? 26.366 -18.311 17.578  1.00 75.94 ? 136 TYR B CZ  1 
ATOM 2597 O OH  . TYR B 1 136 ? 27.271 -19.041 18.285  1.00 76.71 ? 136 TYR B OH  1 
ATOM 2598 N N   . TYR B 1 137 ? 25.484 -16.253 12.890  1.00 71.37 ? 137 TYR B N   1 
ATOM 2599 C CA  . TYR B 1 137 ? 26.710 -16.827 12.376  1.00 70.68 ? 137 TYR B CA  1 
ATOM 2600 C C   . TYR B 1 137 ? 27.644 -15.846 11.795  1.00 69.44 ? 137 TYR B C   1 
ATOM 2601 O O   . TYR B 1 137 ? 28.834 -16.035 11.859  1.00 68.61 ? 137 TYR B O   1 
ATOM 2602 C CB  . TYR B 1 137 ? 26.429 -17.841 11.302  1.00 71.47 ? 137 TYR B CB  1 
ATOM 2603 C CG  . TYR B 1 137 ? 25.851 -19.051 11.903  1.00 71.54 ? 137 TYR B CG  1 
ATOM 2604 C CD1 . TYR B 1 137 ? 24.507 -19.206 11.943  1.00 71.33 ? 137 TYR B CD1 1 
ATOM 2605 C CD2 . TYR B 1 137 ? 26.656 -19.996 12.497  1.00 71.42 ? 137 TYR B CD2 1 
ATOM 2606 C CE1 . TYR B 1 137 ? 23.954 -20.281 12.527  1.00 72.89 ? 137 TYR B CE1 1 
ATOM 2607 C CE2 . TYR B 1 137 ? 26.120 -21.078 13.086  1.00 72.65 ? 137 TYR B CE2 1 
ATOM 2608 C CZ  . TYR B 1 137 ? 24.747 -21.221 13.105  1.00 72.48 ? 137 TYR B CZ  1 
ATOM 2609 O OH  . TYR B 1 137 ? 24.120 -22.305 13.671  1.00 72.03 ? 137 TYR B OH  1 
ATOM 2610 N N   . ALA B 1 138 ? 27.100 -14.810 11.186  1.00 68.92 ? 138 ALA B N   1 
ATOM 2611 C CA  . ALA B 1 138 ? 27.934 -13.824 10.513  1.00 68.64 ? 138 ALA B CA  1 
ATOM 2612 C C   . ALA B 1 138 ? 28.755 -13.043 11.516  1.00 68.09 ? 138 ALA B C   1 
ATOM 2613 O O   . ALA B 1 138 ? 29.952 -12.915 11.349  1.00 68.11 ? 138 ALA B O   1 
ATOM 2614 C CB  . ALA B 1 138 ? 27.101 -12.909 9.653   1.00 68.44 ? 138 ALA B CB  1 
ATOM 2615 N N   . ARG B 1 139 ? 28.117 -12.556 12.573  1.00 68.24 ? 139 ARG B N   1 
ATOM 2616 C CA  . ARG B 1 139 ? 28.842 -11.912 13.688  1.00 68.30 ? 139 ARG B CA  1 
ATOM 2617 C C   . ARG B 1 139 ? 30.070 -12.753 14.032  1.00 66.63 ? 139 ARG B C   1 
ATOM 2618 O O   . ARG B 1 139 ? 31.178 -12.230 14.133  1.00 65.28 ? 139 ARG B O   1 
ATOM 2619 C CB  . ARG B 1 139 ? 27.914 -11.707 14.914  1.00 68.21 ? 139 ARG B CB  1 
ATOM 2620 C CG  . ARG B 1 139 ? 28.569 -11.039 16.149  1.00 69.59 ? 139 ARG B CG  1 
ATOM 2621 C CD  . ARG B 1 139 ? 27.539 -10.593 17.263  1.00 72.39 ? 139 ARG B CD  1 
ATOM 2622 N NE  . ARG B 1 139 ? 28.048 -9.399  17.974  1.00 76.57 ? 139 ARG B NE  1 
ATOM 2623 C CZ  . ARG B 1 139 ? 27.300 -8.400  18.452  1.00 79.09 ? 139 ARG B CZ  1 
ATOM 2624 N NH1 . ARG B 1 139 ? 25.978 -8.426  18.353  1.00 80.35 ? 139 ARG B NH1 1 
ATOM 2625 N NH2 . ARG B 1 139 ? 27.877 -7.347  19.031  1.00 79.08 ? 139 ARG B NH2 1 
ATOM 2626 N N   . GLN B 1 140 ? 29.848 -14.061 14.157  1.00 65.53 ? 140 GLN B N   1 
ATOM 2627 C CA  . GLN B 1 140 ? 30.886 -15.000 14.573  1.00 65.51 ? 140 GLN B CA  1 
ATOM 2628 C C   . GLN B 1 140 ? 32.038 -14.964 13.553  1.00 65.45 ? 140 GLN B C   1 
ATOM 2629 O O   . GLN B 1 140 ? 33.225 -14.956 13.958  1.00 65.41 ? 140 GLN B O   1 
ATOM 2630 C CB  . GLN B 1 140 ? 30.314 -16.442 14.702  1.00 65.56 ? 140 GLN B CB  1 
ATOM 2631 C CG  . GLN B 1 140 ? 29.840 -16.920 16.056  1.00 66.10 ? 140 GLN B CG  1 
ATOM 2632 C CD  . GLN B 1 140 ? 29.692 -15.800 17.097  1.00 68.56 ? 140 GLN B CD  1 
ATOM 2633 O OE1 . GLN B 1 140 ? 30.636 -15.491 17.816  1.00 71.98 ? 140 GLN B OE1 1 
ATOM 2634 N NE2 . GLN B 1 140 ? 28.503 -15.201 17.187  1.00 67.43 ? 140 GLN B NE2 1 
ATOM 2635 N N   . VAL B 1 141 ? 31.697 -14.951 12.245  1.00 64.55 ? 141 VAL B N   1 
ATOM 2636 C CA  . VAL B 1 141 ? 32.713 -14.832 11.196  1.00 64.11 ? 141 VAL B CA  1 
ATOM 2637 C C   . VAL B 1 141 ? 33.398 -13.485 11.327  1.00 64.55 ? 141 VAL B C   1 
ATOM 2638 O O   . VAL B 1 141 ? 34.577 -13.430 11.250  1.00 64.40 ? 141 VAL B O   1 
ATOM 2639 C CB  . VAL B 1 141 ? 32.196 -15.020 9.701   1.00 64.06 ? 141 VAL B CB  1 
ATOM 2640 C CG1 . VAL B 1 141 ? 33.207 -14.527 8.738   1.00 63.03 ? 141 VAL B CG1 1 
ATOM 2641 C CG2 . VAL B 1 141 ? 31.894 -16.475 9.349   1.00 62.95 ? 141 VAL B CG2 1 
ATOM 2642 N N   . ALA B 1 142 ? 32.689 -12.394 11.550  1.00 65.43 ? 142 ALA B N   1 
ATOM 2643 C CA  . ALA B 1 142 ? 33.377 -11.123 11.643  1.00 66.83 ? 142 ALA B CA  1 
ATOM 2644 C C   . ALA B 1 142 ? 34.316 -11.051 12.837  1.00 69.17 ? 142 ALA B C   1 
ATOM 2645 O O   . ALA B 1 142 ? 35.281 -10.305 12.831  1.00 69.16 ? 142 ALA B O   1 
ATOM 2646 C CB  . ALA B 1 142 ? 32.400 -10.055 11.728  1.00 66.98 ? 142 ALA B CB  1 
ATOM 2647 N N   . GLU B 1 143 ? 34.020 -11.853 13.857  1.00 72.13 ? 143 GLU B N   1 
ATOM 2648 C CA  . GLU B 1 143 ? 34.625 -11.774 15.173  1.00 74.13 ? 143 GLU B CA  1 
ATOM 2649 C C   . GLU B 1 143 ? 35.926 -12.612 15.099  1.00 75.59 ? 143 GLU B C   1 
ATOM 2650 O O   . GLU B 1 143 ? 36.015 -13.732 15.637  1.00 75.79 ? 143 GLU B O   1 
ATOM 2651 C CB  . GLU B 1 143 ? 33.603 -12.354 16.186  1.00 73.97 ? 143 GLU B CB  1 
ATOM 2652 C CG  . GLU B 1 143 ? 33.384 -11.556 17.468  1.00 75.63 ? 143 GLU B CG  1 
ATOM 2653 C CD  . GLU B 1 143 ? 31.997 -11.772 18.166  1.00 76.76 ? 143 GLU B CD  1 
ATOM 2654 O OE1 . GLU B 1 143 ? 31.151 -12.569 17.672  1.00 78.84 ? 143 GLU B OE1 1 
ATOM 2655 O OE2 . GLU B 1 143 ? 31.756 -11.103 19.224  1.00 80.75 ? 143 GLU B OE2 1 
ATOM 2656 N N   . ILE B 1 144 ? 36.961 -12.112 14.431  1.00 77.20 ? 144 ILE B N   1 
ATOM 2657 C CA  . ILE B 1 144 ? 37.989 -13.060 14.029  1.00 78.48 ? 144 ILE B CA  1 
ATOM 2658 C C   . ILE B 1 144 ? 39.158 -12.582 13.158  1.00 79.90 ? 144 ILE B C   1 
ATOM 2659 O O   . ILE B 1 144 ? 38.984 -11.688 12.299  1.00 80.34 ? 144 ILE B O   1 
ATOM 2660 C CB  . ILE B 1 144 ? 37.244 -14.104 13.096  1.00 78.73 ? 144 ILE B CB  1 
ATOM 2661 C CG1 . ILE B 1 144 ? 38.087 -15.311 12.676  1.00 77.76 ? 144 ILE B CG1 1 
ATOM 2662 C CG2 . ILE B 1 144 ? 36.816 -13.410 11.845  1.00 79.97 ? 144 ILE B CG2 1 
ATOM 2663 C CD1 . ILE B 1 144 ? 37.439 -16.110 11.549  1.00 77.41 ? 144 ILE B CD1 1 
ATOM 2664 N N   . ASN B 1 145 ? 40.373 -13.087 13.384  1.00 80.70 ? 145 ASN B N   1 
ATOM 2665 C CA  . ASN B 1 145 ? 41.407 -12.448 14.158  1.00 81.19 ? 145 ASN B CA  1 
ATOM 2666 C C   . ASN B 1 145 ? 42.411 -12.747 13.013  1.00 81.50 ? 145 ASN B C   1 
ATOM 2667 O O   . ASN B 1 145 ? 43.239 -13.658 13.141  1.00 81.76 ? 145 ASN B O   1 
ATOM 2668 C CB  . ASN B 1 145 ? 41.760 -13.145 15.486  1.00 81.26 ? 145 ASN B CB  1 
ATOM 2669 N N   . THR B 1 146 ? 42.229 -12.080 11.852  1.00 81.44 ? 146 THR B N   1 
ATOM 2670 C CA  . THR B 1 146 ? 43.002 -12.351 10.611  1.00 81.33 ? 146 THR B CA  1 
ATOM 2671 C C   . THR B 1 146 ? 44.487 -12.628 10.893  1.00 81.45 ? 146 THR B C   1 
ATOM 2672 O O   . THR B 1 146 ? 45.118 -11.848 11.613  1.00 81.39 ? 146 THR B O   1 
ATOM 2673 C CB  . THR B 1 146 ? 42.921 -11.154 9.599   1.00 81.04 ? 146 THR B CB  1 
ATOM 2674 N N   . TYR B 1 147 ? 45.040 -13.729 10.347  1.00 81.68 ? 147 TYR B N   1 
ATOM 2675 C CA  . TYR B 1 147 ? 46.474 -14.134 10.567  1.00 81.72 ? 147 TYR B CA  1 
ATOM 2676 C C   . TYR B 1 147 ? 47.486 -12.975 10.540  1.00 82.15 ? 147 TYR B C   1 
ATOM 2677 O O   . TYR B 1 147 ? 47.652 -12.250 9.539   1.00 82.46 ? 147 TYR B O   1 
ATOM 2678 C CB  . TYR B 1 147 ? 46.953 -15.246 9.620   1.00 81.36 ? 147 TYR B CB  1 
ATOM 2679 N N   . ASN B 1 148 ? 48.237 -12.947 11.638  1.00 82.00 ? 148 ASN B N   1 
ATOM 2680 C CA  . ASN B 1 148 ? 48.623 -11.752 12.352  1.00 81.94 ? 148 ASN B CA  1 
ATOM 2681 C C   . ASN B 1 148 ? 50.137 -11.595 12.268  1.00 81.56 ? 148 ASN B C   1 
ATOM 2682 O O   . ASN B 1 148 ? 50.607 -10.481 12.014  1.00 81.54 ? 148 ASN B O   1 
ATOM 2683 C CB  . ASN B 1 148 ? 48.121 -11.898 13.807  1.00 82.46 ? 148 ASN B CB  1 
ATOM 2684 C CG  . ASN B 1 148 ? 46.568 -12.048 13.908  1.00 83.02 ? 148 ASN B CG  1 
ATOM 2685 O OD1 . ASN B 1 148 ? 45.874 -11.199 14.491  1.00 83.73 ? 148 ASN B OD1 1 
ATOM 2686 N ND2 . ASN B 1 148 ? 46.046 -13.138 13.372  1.00 83.48 ? 148 ASN B ND2 1 
ATOM 2687 N N   . PRO B 1 149 ? 50.932 -12.656 12.588  1.00 81.25 ? 149 PRO B N   1 
ATOM 2688 C CA  . PRO B 1 149 ? 51.325 -13.617 13.643  1.00 81.15 ? 149 PRO B CA  1 
ATOM 2689 C C   . PRO B 1 149 ? 52.388 -12.863 14.355  1.00 80.83 ? 149 PRO B C   1 
ATOM 2690 O O   . PRO B 1 149 ? 53.082 -13.352 15.233  1.00 81.26 ? 149 PRO B O   1 
ATOM 2691 C CB  . PRO B 1 149 ? 52.012 -14.772 12.878  1.00 81.38 ? 149 PRO B CB  1 
ATOM 2692 C CG  . PRO B 1 149 ? 52.332 -14.241 11.544  1.00 81.16 ? 149 PRO B CG  1 
ATOM 2693 C CD  . PRO B 1 149 ? 51.263 -13.222 11.256  1.00 81.44 ? 149 PRO B CD  1 
ATOM 2694 N N   . THR B 1 150 ? 52.526 -11.649 13.889  1.00 80.18 ? 150 THR B N   1 
ATOM 2695 C CA  . THR B 1 150 ? 53.624 -10.838 14.200  1.00 79.51 ? 150 THR B CA  1 
ATOM 2696 C C   . THR B 1 150 ? 53.072 -9.728  15.050  1.00 79.09 ? 150 THR B C   1 
ATOM 2697 O O   . THR B 1 150 ? 53.661 -9.408  16.055  1.00 78.81 ? 150 THR B O   1 
ATOM 2698 C CB  . THR B 1 150 ? 54.260 -10.428 12.888  1.00 79.34 ? 150 THR B CB  1 
ATOM 2699 O OG1 . THR B 1 150 ? 55.288 -11.386 12.602  1.00 78.96 ? 150 THR B OG1 1 
ATOM 2700 C CG2 . THR B 1 150 ? 54.832 -9.031  12.941  1.00 79.21 ? 150 THR B CG2 1 
ATOM 2701 N N   . ILE B 1 151 ? 51.923 -9.169  14.661  1.00 79.01 ? 151 ILE B N   1 
ATOM 2702 C CA  . ILE B 1 151 ? 51.056 -8.423  15.597  1.00 78.67 ? 151 ILE B CA  1 
ATOM 2703 C C   . ILE B 1 151 ? 50.789 -9.265  16.882  1.00 78.43 ? 151 ILE B C   1 
ATOM 2704 O O   . ILE B 1 151 ? 50.593 -8.712  17.976  1.00 77.96 ? 151 ILE B O   1 
ATOM 2705 C CB  . ILE B 1 151 ? 49.718 -7.944  14.903  1.00 78.61 ? 151 ILE B CB  1 
ATOM 2706 C CG1 . ILE B 1 151 ? 49.834 -6.515  14.362  1.00 79.43 ? 151 ILE B CG1 1 
ATOM 2707 C CG2 . ILE B 1 151 ? 48.553 -7.877  15.861  1.00 78.82 ? 151 ILE B CG2 1 
ATOM 2708 C CD1 . ILE B 1 151 ? 51.081 -6.218  13.502  1.00 80.75 ? 151 ILE B CD1 1 
ATOM 2709 N N   . ARG B 1 152 ? 50.788 -10.591 16.767  1.00 77.87 ? 152 ARG B N   1 
ATOM 2710 C CA  . ARG B 1 152 ? 50.632 -11.419 17.958  1.00 77.52 ? 152 ARG B CA  1 
ATOM 2711 C C   . ARG B 1 152 ? 51.802 -11.344 18.929  1.00 76.83 ? 152 ARG B C   1 
ATOM 2712 O O   . ARG B 1 152 ? 51.636 -11.232 20.153  1.00 76.56 ? 152 ARG B O   1 
ATOM 2713 C CB  . ARG B 1 152 ? 50.464 -12.855 17.546  1.00 77.74 ? 152 ARG B CB  1 
ATOM 2714 C CG  . ARG B 1 152 ? 49.055 -13.269 17.526  1.00 79.28 ? 152 ARG B CG  1 
ATOM 2715 C CD  . ARG B 1 152 ? 49.002 -14.700 17.147  1.00 81.14 ? 152 ARG B CD  1 
ATOM 2716 N NE  . ARG B 1 152 ? 48.014 -14.941 16.118  1.00 82.32 ? 152 ARG B NE  1 
ATOM 2717 C CZ  . ARG B 1 152 ? 47.948 -16.061 15.415  1.00 83.51 ? 152 ARG B CZ  1 
ATOM 2718 N NH1 . ARG B 1 152 ? 48.843 -17.040 15.595  1.00 84.28 ? 152 ARG B NH1 1 
ATOM 2719 N NH2 . ARG B 1 152 ? 46.994 -16.188 14.516  1.00 83.30 ? 152 ARG B NH2 1 
ATOM 2720 N N   . ILE B 1 153 ? 52.990 -11.461 18.362  1.00 76.33 ? 153 ILE B N   1 
ATOM 2721 C CA  . ILE B 1 153 ? 54.230 -11.448 19.127  1.00 75.54 ? 153 ILE B CA  1 
ATOM 2722 C C   . ILE B 1 153 ? 54.394 -10.192 19.908  1.00 75.31 ? 153 ILE B C   1 
ATOM 2723 O O   . ILE B 1 153 ? 54.801 -10.241 21.048  1.00 75.92 ? 153 ILE B O   1 
ATOM 2724 C CB  . ILE B 1 153 ? 55.461 -11.501 18.219  1.00 75.35 ? 153 ILE B CB  1 
ATOM 2725 C CG1 . ILE B 1 153 ? 55.495 -12.842 17.466  1.00 74.02 ? 153 ILE B CG1 1 
ATOM 2726 C CG2 . ILE B 1 153 ? 56.694 -11.216 19.037  1.00 75.75 ? 153 ILE B CG2 1 
ATOM 2727 C CD1 . ILE B 1 153 ? 56.750 -13.627 17.532  1.00 71.57 ? 153 ILE B CD1 1 
ATOM 2728 N N   . LEU B 1 154 ? 54.123 -9.060  19.282  1.00 75.07 ? 154 LEU B N   1 
ATOM 2729 C CA  . LEU B 1 154 ? 54.318 -7.777  19.922  1.00 75.18 ? 154 LEU B CA  1 
ATOM 2730 C C   . LEU B 1 154 ? 53.367 -7.645  21.059  1.00 75.36 ? 154 LEU B C   1 
ATOM 2731 O O   . LEU B 1 154 ? 53.767 -7.418  22.190  1.00 76.02 ? 154 LEU B O   1 
ATOM 2732 C CB  . LEU B 1 154 ? 54.048 -6.653  18.962  1.00 75.43 ? 154 LEU B CB  1 
ATOM 2733 C CG  . LEU B 1 154 ? 54.926 -6.714  17.730  1.00 75.09 ? 154 LEU B CG  1 
ATOM 2734 C CD1 . LEU B 1 154 ? 54.240 -5.925  16.669  1.00 75.45 ? 154 LEU B CD1 1 
ATOM 2735 C CD2 . LEU B 1 154 ? 56.314 -6.195  18.021  1.00 74.64 ? 154 LEU B CD2 1 
ATOM 2736 N N   . ARG B 1 155 ? 52.095 -7.804  20.755  1.00 75.48 ? 155 ARG B N   1 
ATOM 2737 C CA  . ARG B 1 155 ? 51.070 -7.886  21.773  1.00 75.83 ? 155 ARG B CA  1 
ATOM 2738 C C   . ARG B 1 155 ? 51.527 -8.618  23.036  1.00 75.65 ? 155 ARG B C   1 
ATOM 2739 O O   . ARG B 1 155 ? 51.347 -8.134  24.165  1.00 75.53 ? 155 ARG B O   1 
ATOM 2740 C CB  . ARG B 1 155 ? 49.889 -8.633  21.216  1.00 75.96 ? 155 ARG B CB  1 
ATOM 2741 C CG  . ARG B 1 155 ? 48.622 -8.354  21.926  1.00 77.82 ? 155 ARG B CG  1 
ATOM 2742 C CD  . ARG B 1 155 ? 47.754 -7.501  21.054  1.00 81.26 ? 155 ARG B CD  1 
ATOM 2743 N NE  . ARG B 1 155 ? 48.114 -6.104  21.178  1.00 83.12 ? 155 ARG B NE  1 
ATOM 2744 C CZ  . ARG B 1 155 ? 47.321 -5.089  20.854  1.00 83.70 ? 155 ARG B CZ  1 
ATOM 2745 N NH1 . ARG B 1 155 ? 46.097 -5.314  20.353  1.00 82.13 ? 155 ARG B NH1 1 
ATOM 2746 N NH2 . ARG B 1 155 ? 47.766 -3.839  21.041  1.00 84.45 ? 155 ARG B NH2 1 
ATOM 2747 N N   . LEU B 1 156 ? 52.091 -9.801  22.844  1.00 75.31 ? 156 LEU B N   1 
ATOM 2748 C CA  . LEU B 1 156 ? 52.610 -10.554 23.963  1.00 75.18 ? 156 LEU B CA  1 
ATOM 2749 C C   . LEU B 1 156 ? 53.555 -9.669  24.744  1.00 75.12 ? 156 LEU B C   1 
ATOM 2750 O O   . LEU B 1 156 ? 53.372 -9.453  25.934  1.00 74.67 ? 156 LEU B O   1 
ATOM 2751 C CB  . LEU B 1 156 ? 53.343 -11.797 23.464  1.00 75.43 ? 156 LEU B CB  1 
ATOM 2752 C CG  . LEU B 1 156 ? 54.054 -12.713 24.467  1.00 75.06 ? 156 LEU B CG  1 
ATOM 2753 C CD1 . LEU B 1 156 ? 53.078 -13.409 25.372  1.00 73.81 ? 156 LEU B CD1 1 
ATOM 2754 C CD2 . LEU B 1 156 ? 54.884 -13.715 23.706  1.00 75.07 ? 156 LEU B CD2 1 
ATOM 2755 N N   . PHE B 1 157 ? 54.561 -9.144  24.051  1.00 75.19 ? 157 PHE B N   1 
ATOM 2756 C CA  . PHE B 1 157 ? 55.624 -8.392  24.702  1.00 75.09 ? 157 PHE B CA  1 
ATOM 2757 C C   . PHE B 1 157 ? 55.140 -7.123  25.340  1.00 74.95 ? 157 PHE B C   1 
ATOM 2758 O O   . PHE B 1 157 ? 55.672 -6.721  26.352  1.00 75.26 ? 157 PHE B O   1 
ATOM 2759 C CB  . PHE B 1 157 ? 56.692 -7.987  23.710  1.00 75.29 ? 157 PHE B CB  1 
ATOM 2760 C CG  . PHE B 1 157 ? 57.677 -9.072  23.357  1.00 75.69 ? 157 PHE B CG  1 
ATOM 2761 C CD1 . PHE B 1 157 ? 57.671 -9.650  22.101  1.00 75.43 ? 157 PHE B CD1 1 
ATOM 2762 C CD2 . PHE B 1 157 ? 58.674 -9.446  24.253  1.00 76.18 ? 157 PHE B CD2 1 
ATOM 2763 C CE1 . PHE B 1 157 ? 58.610 -10.610 21.759  1.00 75.62 ? 157 PHE B CE1 1 
ATOM 2764 C CE2 . PHE B 1 157 ? 59.621 -10.404 23.925  1.00 75.73 ? 157 PHE B CE2 1 
ATOM 2765 C CZ  . PHE B 1 157 ? 59.586 -10.988 22.676  1.00 75.76 ? 157 PHE B CZ  1 
ATOM 2766 N N   . TYR B 1 158 ? 54.180 -6.443  24.740  1.00 74.93 ? 158 TYR B N   1 
ATOM 2767 C CA  . TYR B 1 158 ? 53.626 -5.297  25.429  1.00 75.25 ? 158 TYR B CA  1 
ATOM 2768 C C   . TYR B 1 158 ? 53.013 -5.811  26.749  1.00 75.00 ? 158 TYR B C   1 
ATOM 2769 O O   . TYR B 1 158 ? 53.385 -5.382  27.828  1.00 74.62 ? 158 TYR B O   1 
ATOM 2770 C CB  . TYR B 1 158 ? 52.608 -4.552  24.559  1.00 75.36 ? 158 TYR B CB  1 
ATOM 2771 C CG  . TYR B 1 158 ? 51.786 -3.549  25.339  1.00 75.81 ? 158 TYR B CG  1 
ATOM 2772 C CD1 . TYR B 1 158 ? 52.241 -2.254  25.554  1.00 76.28 ? 158 TYR B CD1 1 
ATOM 2773 C CD2 . TYR B 1 158 ? 50.562 -3.915  25.893  1.00 75.88 ? 158 TYR B CD2 1 
ATOM 2774 C CE1 . TYR B 1 158 ? 51.480 -1.349  26.291  1.00 76.55 ? 158 TYR B CE1 1 
ATOM 2775 C CE2 . TYR B 1 158 ? 49.802 -3.024  26.624  1.00 75.94 ? 158 TYR B CE2 1 
ATOM 2776 C CZ  . TYR B 1 158 ? 50.260 -1.747  26.819  1.00 76.10 ? 158 TYR B CZ  1 
ATOM 2777 O OH  . TYR B 1 158 ? 49.483 -0.885  27.547  1.00 76.22 ? 158 TYR B OH  1 
ATOM 2778 N N   . GLU B 1 159 ? 52.114 -6.779  26.631  1.00 75.22 ? 159 GLU B N   1 
ATOM 2779 C CA  . GLU B 1 159 ? 51.381 -7.340  27.762  1.00 75.38 ? 159 GLU B CA  1 
ATOM 2780 C C   . GLU B 1 159 ? 52.283 -7.732  28.913  1.00 75.88 ? 159 GLU B C   1 
ATOM 2781 O O   . GLU B 1 159 ? 52.034 -7.379  30.078  1.00 76.30 ? 159 GLU B O   1 
ATOM 2782 C CB  . GLU B 1 159 ? 50.591 -8.565  27.307  1.00 75.12 ? 159 GLU B CB  1 
ATOM 2783 C CG  . GLU B 1 159 ? 49.600 -9.103  28.319  1.00 74.88 ? 159 GLU B CG  1 
ATOM 2784 C CD  . GLU B 1 159 ? 48.506 -8.114  28.679  1.00 75.50 ? 159 GLU B CD  1 
ATOM 2785 O OE1 . GLU B 1 159 ? 47.868 -7.541  27.772  1.00 76.06 ? 159 GLU B OE1 1 
ATOM 2786 O OE2 . GLU B 1 159 ? 48.273 -7.906  29.883  1.00 76.78 ? 159 GLU B OE2 1 
ATOM 2787 N N   . LEU B 1 160 ? 53.326 -8.486  28.590  1.00 76.33 ? 160 LEU B N   1 
ATOM 2788 C CA  . LEU B 1 160 ? 54.295 -8.909  29.600  1.00 76.25 ? 160 LEU B CA  1 
ATOM 2789 C C   . LEU B 1 160 ? 54.839 -7.677  30.221  1.00 76.48 ? 160 LEU B C   1 
ATOM 2790 O O   . LEU B 1 160 ? 54.791 -7.490  31.424  1.00 76.92 ? 160 LEU B O   1 
ATOM 2791 C CB  . LEU B 1 160 ? 55.491 -9.655  28.996  1.00 76.06 ? 160 LEU B CB  1 
ATOM 2792 C CG  . LEU B 1 160 ? 55.601 -11.180 29.039  1.00 74.96 ? 160 LEU B CG  1 
ATOM 2793 C CD1 . LEU B 1 160 ? 54.864 -11.728 30.239  1.00 73.73 ? 160 LEU B CD1 1 
ATOM 2794 C CD2 . LEU B 1 160 ? 55.116 -11.817 27.739  1.00 73.84 ? 160 LEU B CD2 1 
ATOM 2795 N N   . CYS B 1 161 ? 55.356 -6.828  29.354  1.00 76.84 ? 161 CYS B N   1 
ATOM 2796 C CA  . CYS B 1 161 ? 56.108 -5.689  29.777  1.00 76.94 ? 161 CYS B CA  1 
ATOM 2797 C C   . CYS B 1 161 ? 55.338 -4.740  30.710  1.00 77.01 ? 161 CYS B C   1 
ATOM 2798 O O   . CYS B 1 161 ? 55.884 -4.336  31.731  1.00 77.02 ? 161 CYS B O   1 
ATOM 2799 C CB  . CYS B 1 161 ? 56.608 -4.956  28.558  1.00 76.69 ? 161 CYS B CB  1 
ATOM 2800 S SG  . CYS B 1 161 ? 57.275 -3.387  28.973  1.00 78.00 ? 161 CYS B SG  1 
ATOM 2801 N N   . SER B 1 162 ? 54.095 -4.399  30.378  1.00 77.11 ? 162 SER B N   1 
ATOM 2802 C CA  . SER B 1 162 ? 53.322 -3.442  31.171  1.00 77.55 ? 162 SER B CA  1 
ATOM 2803 C C   . SER B 1 162 ? 52.444 -4.126  32.217  1.00 78.01 ? 162 SER B C   1 
ATOM 2804 O O   . SER B 1 162 ? 51.252 -4.294  31.979  1.00 78.36 ? 162 SER B O   1 
ATOM 2805 C CB  . SER B 1 162 ? 52.430 -2.648  30.242  1.00 77.72 ? 162 SER B CB  1 
ATOM 2806 O OG  . SER B 1 162 ? 51.642 -3.540  29.486  1.00 78.01 ? 162 SER B OG  1 
ATOM 2807 N N   . SER B 1 163 ? 53.038 -4.465  33.371  1.00 78.22 ? 163 SER B N   1 
ATOM 2808 C CA  . SER B 1 163 ? 52.479 -5.363  34.418  1.00 78.32 ? 163 SER B CA  1 
ATOM 2809 C C   . SER B 1 163 ? 53.590 -6.219  35.025  1.00 78.77 ? 163 SER B C   1 
ATOM 2810 O O   . SER B 1 163 ? 53.403 -6.828  36.080  1.00 79.22 ? 163 SER B O   1 
ATOM 2811 C CB  . SER B 1 163 ? 51.406 -6.352  33.920  1.00 78.29 ? 163 SER B CB  1 
ATOM 2812 O OG  . SER B 1 163 ? 51.968 -7.582  33.466  1.00 78.80 ? 163 SER B OG  1 
ATOM 2813 N N   . GLN B 1 164 ? 54.717 -6.332  34.322  1.00 79.13 ? 164 GLN B N   1 
ATOM 2814 C CA  . GLN B 1 164 ? 55.854 -7.140  34.784  1.00 79.44 ? 164 GLN B CA  1 
ATOM 2815 C C   . GLN B 1 164 ? 57.190 -6.356  34.758  1.00 79.31 ? 164 GLN B C   1 
ATOM 2816 O O   . GLN B 1 164 ? 58.206 -6.843  35.275  1.00 79.52 ? 164 GLN B O   1 
ATOM 2817 C CB  . GLN B 1 164 ? 55.945 -8.453  33.957  1.00 79.41 ? 164 GLN B CB  1 
ATOM 2818 C CG  . GLN B 1 164 ? 55.902 -9.769  34.793  1.00 80.70 ? 164 GLN B CG  1 
ATOM 2819 C CD  . GLN B 1 164 ? 54.586 -9.963  35.629  1.00 82.35 ? 164 GLN B CD  1 
ATOM 2820 O OE1 . GLN B 1 164 ? 54.634 -10.312 36.827  1.00 80.97 ? 164 GLN B OE1 1 
ATOM 2821 N NE2 . GLN B 1 164 ? 53.423 -9.734  34.989  1.00 82.45 ? 164 GLN B NE2 1 
ATOM 2822 N N   . GLY B 1 165 ? 57.188 -5.148  34.185  1.00 78.93 ? 165 GLY B N   1 
ATOM 2823 C CA  . GLY B 1 165 ? 58.416 -4.356  34.018  1.00 78.50 ? 165 GLY B CA  1 
ATOM 2824 C C   . GLY B 1 165 ? 58.710 -3.443  35.200  1.00 78.02 ? 165 GLY B C   1 
ATOM 2825 O O   . GLY B 1 165 ? 57.780 -2.871  35.765  1.00 78.26 ? 165 GLY B O   1 
ATOM 2826 N N   . LYS B 1 166 ? 59.987 -3.307  35.585  1.00 77.43 ? 166 LYS B N   1 
ATOM 2827 C CA  . LYS B 1 166 ? 60.400 -2.360  36.658  1.00 76.83 ? 166 LYS B CA  1 
ATOM 2828 C C   . LYS B 1 166 ? 61.225 -1.240  36.049  1.00 76.45 ? 166 LYS B C   1 
ATOM 2829 O O   . LYS B 1 166 ? 62.245 -1.498  35.403  1.00 76.63 ? 166 LYS B O   1 
ATOM 2830 C CB  . LYS B 1 166 ? 61.184 -3.046  37.745  1.00 76.51 ? 166 LYS B CB  1 
ATOM 2831 N N   . ARG B 1 167 ? 60.767 -0.001  36.245  1.00 75.78 ? 167 ARG B N   1 
ATOM 2832 C CA  . ARG B 1 167 ? 61.300 1.137   35.514  1.00 75.08 ? 167 ARG B CA  1 
ATOM 2833 C C   . ARG B 1 167 ? 62.737 1.310   35.964  1.00 74.59 ? 167 ARG B C   1 
ATOM 2834 O O   . ARG B 1 167 ? 62.967 1.819   37.040  1.00 74.40 ? 167 ARG B O   1 
ATOM 2835 C CB  . ARG B 1 167 ? 60.463 2.402   35.781  1.00 74.86 ? 167 ARG B CB  1 
ATOM 2836 N N   . VAL B 1 168 ? 63.687 0.811   35.168  1.00 74.14 ? 168 VAL B N   1 
ATOM 2837 C CA  . VAL B 1 168 ? 65.116 0.927   35.468  1.00 73.58 ? 168 VAL B CA  1 
ATOM 2838 C C   . VAL B 1 168 ? 65.748 2.085   34.705  1.00 73.76 ? 168 VAL B C   1 
ATOM 2839 O O   . VAL B 1 168 ? 66.299 1.916   33.626  1.00 73.57 ? 168 VAL B O   1 
ATOM 2840 C CB  . VAL B 1 168 ? 65.863 -0.376  35.183  1.00 73.23 ? 168 VAL B CB  1 
ATOM 2841 C CG1 . VAL B 1 168 ? 67.379 -0.152  35.065  1.00 72.68 ? 168 VAL B CG1 1 
ATOM 2842 C CG2 . VAL B 1 168 ? 65.577 -1.345  36.282  1.00 72.78 ? 168 VAL B CG2 1 
ATOM 2843 N N   . GLY B 1 169 ? 65.672 3.263   35.314  1.00 74.12 ? 169 GLY B N   1 
ATOM 2844 C CA  . GLY B 1 169 ? 66.188 4.484   34.749  1.00 74.40 ? 169 GLY B CA  1 
ATOM 2845 C C   . GLY B 1 169 ? 65.358 4.891   33.556  1.00 74.98 ? 169 GLY B C   1 
ATOM 2846 O O   . GLY B 1 169 ? 64.249 5.403   33.702  1.00 75.31 ? 169 GLY B O   1 
ATOM 2847 N N   . ASP B 1 170 ? 65.914 4.632   32.376  1.00 75.36 ? 170 ASP B N   1 
ATOM 2848 C CA  . ASP B 1 170 ? 65.327 4.963   31.069  1.00 75.74 ? 170 ASP B CA  1 
ATOM 2849 C C   . ASP B 1 170 ? 64.321 3.915   30.621  1.00 76.05 ? 170 ASP B C   1 
ATOM 2850 O O   . ASP B 1 170 ? 63.486 4.156   29.751  1.00 76.27 ? 170 ASP B O   1 
ATOM 2851 C CB  . ASP B 1 170 ? 66.451 4.890   30.021  1.00 75.81 ? 170 ASP B CB  1 
ATOM 2852 C CG  . ASP B 1 170 ? 66.599 6.125   29.217  1.00 75.61 ? 170 ASP B CG  1 
ATOM 2853 O OD1 . ASP B 1 170 ? 65.655 6.928   29.164  1.00 77.45 ? 170 ASP B OD1 1 
ATOM 2854 O OD2 . ASP B 1 170 ? 67.684 6.269   28.619  1.00 74.02 ? 170 ASP B OD2 1 
ATOM 2855 N N   . THR B 1 171 ? 64.453 2.734   31.205  1.00 76.35 ? 171 THR B N   1 
ATOM 2856 C CA  . THR B 1 171 ? 64.065 1.504   30.561  1.00 76.38 ? 171 THR B CA  1 
ATOM 2857 C C   . THR B 1 171 ? 63.106 0.715   31.453  1.00 77.01 ? 171 THR B C   1 
ATOM 2858 O O   . THR B 1 171 ? 62.788 1.142   32.576  1.00 76.90 ? 171 THR B O   1 
ATOM 2859 C CB  . THR B 1 171 ? 65.332 0.658   30.281  1.00 76.08 ? 171 THR B CB  1 
ATOM 2860 O OG1 . THR B 1 171 ? 66.020 0.399   31.512  1.00 75.25 ? 171 THR B OG1 1 
ATOM 2861 C CG2 . THR B 1 171 ? 66.265 1.389   29.336  1.00 75.06 ? 171 THR B CG2 1 
ATOM 2862 N N   . TYR B 1 172 ? 62.642 -0.423  30.932  1.00 77.30 ? 172 TYR B N   1 
ATOM 2863 C CA  . TYR B 1 172 ? 61.826 -1.354  31.693  1.00 77.65 ? 172 TYR B CA  1 
ATOM 2864 C C   . TYR B 1 172 ? 62.356 -2.737  31.476  1.00 77.70 ? 172 TYR B C   1 
ATOM 2865 O O   . TYR B 1 172 ? 62.506 -3.164  30.345  1.00 77.41 ? 172 TYR B O   1 
ATOM 2866 C CB  . TYR B 1 172 ? 60.385 -1.326  31.222  1.00 77.94 ? 172 TYR B CB  1 
ATOM 2867 C CG  . TYR B 1 172 ? 59.671 -0.047  31.544  1.00 78.13 ? 172 TYR B CG  1 
ATOM 2868 C CD1 . TYR B 1 172 ? 59.791 1.073   30.714  1.00 78.63 ? 172 TYR B CD1 1 
ATOM 2869 C CD2 . TYR B 1 172 ? 58.875 0.048   32.671  1.00 77.72 ? 172 TYR B CD2 1 
ATOM 2870 C CE1 . TYR B 1 172 ? 59.136 2.255   31.011  1.00 78.47 ? 172 TYR B CE1 1 
ATOM 2871 C CE2 . TYR B 1 172 ? 58.212 1.219   32.973  1.00 78.17 ? 172 TYR B CE2 1 
ATOM 2872 C CZ  . TYR B 1 172 ? 58.345 2.316   32.145  1.00 78.50 ? 172 TYR B CZ  1 
ATOM 2873 O OH  . TYR B 1 172 ? 57.681 3.469   32.480  1.00 78.79 ? 172 TYR B OH  1 
ATOM 2874 N N   . GLU B 1 173 ? 62.608 -3.439  32.570  1.00 78.06 ? 173 GLU B N   1 
ATOM 2875 C CA  . GLU B 1 173 ? 63.141 -4.780  32.511  1.00 78.32 ? 173 GLU B CA  1 
ATOM 2876 C C   . GLU B 1 173 ? 62.059 -5.769  32.874  1.00 78.74 ? 173 GLU B C   1 
ATOM 2877 O O   . GLU B 1 173 ? 61.127 -5.424  33.582  1.00 78.93 ? 173 GLU B O   1 
ATOM 2878 C CB  . GLU B 1 173 ? 64.274 -4.908  33.511  1.00 78.44 ? 173 GLU B CB  1 
ATOM 2879 C CG  . GLU B 1 173 ? 65.546 -4.259  33.070  1.00 78.20 ? 173 GLU B CG  1 
ATOM 2880 C CD  . GLU B 1 173 ? 66.708 -4.625  33.964  1.00 79.04 ? 173 GLU B CD  1 
ATOM 2881 O OE1 . GLU B 1 173 ? 66.913 -5.832  34.268  1.00 77.34 ? 173 GLU B OE1 1 
ATOM 2882 O OE2 . GLU B 1 173 ? 67.427 -3.692  34.369  1.00 81.62 ? 173 GLU B OE2 1 
ATOM 2883 N N   . ILE B 1 174 ? 62.171 -6.996  32.383  1.00 79.19 ? 174 ILE B N   1 
ATOM 2884 C CA  . ILE B 1 174 ? 61.337 -8.080  32.889  1.00 79.49 ? 174 ILE B CA  1 
ATOM 2885 C C   . ILE B 1 174 ? 62.183 -9.320  33.051  1.00 79.81 ? 174 ILE B C   1 
ATOM 2886 O O   . ILE B 1 174 ? 62.797 -9.803  32.093  1.00 79.88 ? 174 ILE B O   1 
ATOM 2887 C CB  . ILE B 1 174 ? 60.185 -8.445  31.973  1.00 79.51 ? 174 ILE B CB  1 
ATOM 2888 C CG1 . ILE B 1 174 ? 59.434 -7.201  31.468  1.00 79.53 ? 174 ILE B CG1 1 
ATOM 2889 C CG2 . ILE B 1 174 ? 59.238 -9.420  32.705  1.00 79.95 ? 174 ILE B CG2 1 
ATOM 2890 C CD1 . ILE B 1 174 ? 60.107 -6.431  30.296  1.00 79.33 ? 174 ILE B CD1 1 
ATOM 2891 N N   . THR B 1 175 ? 62.158 -9.856  34.263  1.00 80.36 ? 175 THR B N   1 
ATOM 2892 C CA  . THR B 1 175 ? 63.095 -10.892 34.675  1.00 80.64 ? 175 THR B CA  1 
ATOM 2893 C C   . THR B 1 175 ? 62.396 -12.206 34.432  1.00 80.40 ? 175 THR B C   1 
ATOM 2894 O O   . THR B 1 175 ? 61.784 -12.793 35.328  1.00 80.93 ? 175 THR B O   1 
ATOM 2895 C CB  . THR B 1 175 ? 63.494 -10.706 36.152  1.00 80.74 ? 175 THR B CB  1 
ATOM 2896 O OG1 . THR B 1 175 ? 64.028 -9.384  36.321  1.00 80.70 ? 175 THR B OG1 1 
ATOM 2897 C CG2 . THR B 1 175 ? 64.543 -11.749 36.575  1.00 81.38 ? 175 THR B CG2 1 
ATOM 2898 N N   . MET B 1 176 ? 62.474 -12.650 33.194  1.00 79.88 ? 176 MET B N   1 
ATOM 2899 C CA  . MET B 1 176 ? 61.469 -13.538 32.699  1.00 79.73 ? 176 MET B CA  1 
ATOM 2900 C C   . MET B 1 176 ? 62.052 -14.403 31.634  1.00 79.17 ? 176 MET B C   1 
ATOM 2901 O O   . MET B 1 176 ? 62.119 -13.993 30.488  1.00 78.70 ? 176 MET B O   1 
ATOM 2902 C CB  . MET B 1 176 ? 60.311 -12.713 32.157  1.00 79.77 ? 176 MET B CB  1 
ATOM 2903 C CG  . MET B 1 176 ? 59.271 -13.492 31.393  1.00 80.58 ? 176 MET B CG  1 
ATOM 2904 S SD  . MET B 1 176 ? 57.603 -13.128 31.990  1.00 80.45 ? 176 MET B SD  1 
ATOM 2905 C CE  . MET B 1 176 ? 56.822 -14.704 31.645  1.00 79.39 ? 176 MET B CE  1 
ATOM 2906 N N   . PRO B 1 177 ? 62.470 -15.621 32.013  1.00 79.13 ? 177 PRO B N   1 
ATOM 2907 C CA  . PRO B 1 177 ? 62.878 -16.547 30.962  1.00 78.90 ? 177 PRO B CA  1 
ATOM 2908 C C   . PRO B 1 177 ? 61.814 -16.580 29.882  1.00 78.38 ? 177 PRO B C   1 
ATOM 2909 O O   . PRO B 1 177 ? 60.605 -16.541 30.174  1.00 77.81 ? 177 PRO B O   1 
ATOM 2910 C CB  . PRO B 1 177 ? 62.961 -17.910 31.679  1.00 79.15 ? 177 PRO B CB  1 
ATOM 2911 C CG  . PRO B 1 177 ? 62.342 -17.692 33.065  1.00 78.77 ? 177 PRO B CG  1 
ATOM 2912 C CD  . PRO B 1 177 ? 62.551 -16.238 33.354  1.00 78.81 ? 177 PRO B CD  1 
ATOM 2913 N N   . LEU B 1 178 ? 62.265 -16.599 28.636  1.00 78.09 ? 178 LEU B N   1 
ATOM 2914 C CA  . LEU B 1 178 ? 61.344 -16.662 27.532  1.00 77.39 ? 178 LEU B CA  1 
ATOM 2915 C C   . LEU B 1 178 ? 62.068 -17.116 26.293  1.00 77.13 ? 178 LEU B C   1 
ATOM 2916 O O   . LEU B 1 178 ? 62.624 -16.322 25.524  1.00 77.31 ? 178 LEU B O   1 
ATOM 2917 C CB  . LEU B 1 178 ? 60.679 -15.311 27.330  1.00 77.36 ? 178 LEU B CB  1 
ATOM 2918 C CG  . LEU B 1 178 ? 59.279 -15.386 26.758  1.00 77.16 ? 178 LEU B CG  1 
ATOM 2919 C CD1 . LEU B 1 178 ? 58.372 -16.270 27.648  1.00 77.72 ? 178 LEU B CD1 1 
ATOM 2920 C CD2 . LEU B 1 178 ? 58.749 -13.953 26.572  1.00 76.14 ? 178 LEU B CD2 1 
ATOM 2921 N N   . SER B 1 179 ? 62.076 -18.423 26.110  1.00 76.63 ? 179 SER B N   1 
ATOM 2922 C CA  . SER B 1 179 ? 62.698 -18.968 24.953  1.00 76.43 ? 179 SER B CA  1 
ATOM 2923 C C   . SER B 1 179 ? 61.944 -18.437 23.771  1.00 76.41 ? 179 SER B C   1 
ATOM 2924 O O   . SER B 1 179 ? 60.798 -17.991 23.883  1.00 76.25 ? 179 SER B O   1 
ATOM 2925 C CB  . SER B 1 179 ? 62.620 -20.476 24.983  1.00 76.38 ? 179 SER B CB  1 
ATOM 2926 O OG  . SER B 1 179 ? 61.310 -20.864 25.314  1.00 76.15 ? 179 SER B OG  1 
ATOM 2927 N N   . GLN B 1 180 ? 62.601 -18.472 22.631  1.00 76.32 ? 180 GLN B N   1 
ATOM 2928 C CA  . GLN B 1 180 ? 61.909 -18.230 21.402  1.00 76.29 ? 180 GLN B CA  1 
ATOM 2929 C C   . GLN B 1 180 ? 60.970 -19.395 21.130  1.00 75.96 ? 180 GLN B C   1 
ATOM 2930 O O   . GLN B 1 180 ? 59.887 -19.192 20.578  1.00 75.92 ? 180 GLN B O   1 
ATOM 2931 C CB  . GLN B 1 180 ? 62.905 -18.073 20.283  1.00 76.72 ? 180 GLN B CB  1 
ATOM 2932 C CG  . GLN B 1 180 ? 63.939 -17.014 20.566  1.00 76.78 ? 180 GLN B CG  1 
ATOM 2933 C CD  . GLN B 1 180 ? 64.720 -16.644 19.335  1.00 77.42 ? 180 GLN B CD  1 
ATOM 2934 O OE1 . GLN B 1 180 ? 65.766 -16.018 19.444  1.00 77.89 ? 180 GLN B OE1 1 
ATOM 2935 N NE2 . GLN B 1 180 ? 64.231 -17.037 18.152  1.00 77.56 ? 180 GLN B NE2 1 
ATOM 2936 N N   . LYS B 1 181 ? 61.369 -20.603 21.536  1.00 75.80 ? 181 LYS B N   1 
ATOM 2937 C CA  . LYS B 1 181 ? 60.491 -21.777 21.420  1.00 76.00 ? 181 LYS B CA  1 
ATOM 2938 C C   . LYS B 1 181 ? 59.146 -21.495 22.079  1.00 75.95 ? 181 LYS B C   1 
ATOM 2939 O O   . LYS B 1 181 ? 58.112 -21.616 21.427  1.00 76.09 ? 181 LYS B O   1 
ATOM 2940 C CB  . LYS B 1 181 ? 61.106 -23.030 22.050  1.00 76.05 ? 181 LYS B CB  1 
ATOM 2941 C CG  . LYS B 1 181 ? 60.315 -24.313 21.741  1.00 76.25 ? 181 LYS B CG  1 
ATOM 2942 C CD  . LYS B 1 181 ? 60.773 -25.480 22.613  1.00 75.79 ? 181 LYS B CD  1 
ATOM 2943 C CE  . LYS B 1 181 ? 61.216 -26.694 21.790  1.00 75.07 ? 181 LYS B CE  1 
ATOM 2944 N NZ  . LYS B 1 181 ? 60.144 -27.662 21.487  1.00 74.11 ? 181 LYS B NZ  1 
ATOM 2945 N N   . SER B 1 182 ? 59.180 -21.107 23.362  1.00 75.62 ? 182 SER B N   1 
ATOM 2946 C CA  . SER B 1 182 ? 57.984 -20.685 24.095  1.00 75.26 ? 182 SER B CA  1 
ATOM 2947 C C   . SER B 1 182 ? 57.237 -19.607 23.358  1.00 75.09 ? 182 SER B C   1 
ATOM 2948 O O   . SER B 1 182 ? 56.017 -19.642 23.308  1.00 75.38 ? 182 SER B O   1 
ATOM 2949 C CB  . SER B 1 182 ? 58.309 -20.161 25.489  1.00 75.12 ? 182 SER B CB  1 
ATOM 2950 O OG  . SER B 1 182 ? 58.453 -21.233 26.406  1.00 75.64 ? 182 SER B OG  1 
ATOM 2951 N N   . ILE B 1 183 ? 57.943 -18.646 22.782  1.00 74.74 ? 183 ILE B N   1 
ATOM 2952 C CA  . ILE B 1 183 ? 57.245 -17.564 22.097  1.00 74.47 ? 183 ILE B CA  1 
ATOM 2953 C C   . ILE B 1 183 ? 56.471 -18.016 20.829  1.00 74.76 ? 183 ILE B C   1 
ATOM 2954 O O   . ILE B 1 183 ? 55.330 -17.575 20.624  1.00 74.90 ? 183 ILE B O   1 
ATOM 2955 C CB  . ILE B 1 183 ? 58.168 -16.377 21.834  1.00 74.34 ? 183 ILE B CB  1 
ATOM 2956 C CG1 . ILE B 1 183 ? 58.581 -15.770 23.180  1.00 73.14 ? 183 ILE B CG1 1 
ATOM 2957 C CG2 . ILE B 1 183 ? 57.453 -15.334 20.983  1.00 73.78 ? 183 ILE B CG2 1 
ATOM 2958 C CD1 . ILE B 1 183 ? 59.786 -14.880 23.135  1.00 72.78 ? 183 ILE B CD1 1 
ATOM 2959 N N   . GLY B 1 184 ? 57.059 -18.889 20.003  1.00 74.62 ? 184 GLY B N   1 
ATOM 2960 C CA  . GLY B 1 184 ? 56.356 -19.427 18.819  1.00 74.43 ? 184 GLY B CA  1 
ATOM 2961 C C   . GLY B 1 184 ? 55.249 -20.383 19.221  1.00 74.23 ? 184 GLY B C   1 
ATOM 2962 O O   . GLY B 1 184 ? 54.143 -20.345 18.720  1.00 73.75 ? 184 GLY B O   1 
ATOM 2963 N N   . GLU B 1 185 ? 55.551 -21.241 20.169  1.00 74.57 ? 185 GLU B N   1 
ATOM 2964 C CA  . GLU B 1 185 ? 54.543 -22.117 20.713  1.00 74.82 ? 185 GLU B CA  1 
ATOM 2965 C C   . GLU B 1 185 ? 53.294 -21.353 21.133  1.00 75.04 ? 185 GLU B C   1 
ATOM 2966 O O   . GLU B 1 185 ? 52.200 -21.790 20.848  1.00 75.39 ? 185 GLU B O   1 
ATOM 2967 C CB  . GLU B 1 185 ? 55.117 -22.919 21.871  1.00 74.62 ? 185 GLU B CB  1 
ATOM 2968 C CG  . GLU B 1 185 ? 55.968 -24.073 21.384  1.00 75.43 ? 185 GLU B CG  1 
ATOM 2969 C CD  . GLU B 1 185 ? 56.569 -24.886 22.504  1.00 77.13 ? 185 GLU B CD  1 
ATOM 2970 O OE1 . GLU B 1 185 ? 55.993 -24.879 23.627  1.00 75.58 ? 185 GLU B OE1 1 
ATOM 2971 O OE2 . GLU B 1 185 ? 57.622 -25.528 22.247  1.00 76.92 ? 185 GLU B OE2 1 
ATOM 2972 N N   . ILE B 1 186 ? 53.467 -20.209 21.788  1.00 75.18 ? 186 ILE B N   1 
ATOM 2973 C CA  . ILE B 1 186 ? 52.360 -19.430 22.315  1.00 74.56 ? 186 ILE B CA  1 
ATOM 2974 C C   . ILE B 1 186 ? 51.601 -18.704 21.217  1.00 74.48 ? 186 ILE B C   1 
ATOM 2975 O O   . ILE B 1 186 ? 50.368 -18.651 21.251  1.00 74.38 ? 186 ILE B O   1 
ATOM 2976 C CB  . ILE B 1 186 ? 52.843 -18.404 23.344  1.00 74.55 ? 186 ILE B CB  1 
ATOM 2977 C CG1 . ILE B 1 186 ? 53.212 -19.115 24.633  1.00 74.91 ? 186 ILE B CG1 1 
ATOM 2978 C CG2 . ILE B 1 186 ? 51.753 -17.392 23.660  1.00 74.79 ? 186 ILE B CG2 1 
ATOM 2979 C CD1 . ILE B 1 186 ? 53.928 -18.246 25.626  1.00 74.67 ? 186 ILE B CD1 1 
ATOM 2980 N N   . THR B 1 187 ? 52.317 -18.130 20.254  1.00 74.18 ? 187 THR B N   1 
ATOM 2981 C CA  . THR B 1 187 ? 51.671 -17.271 19.275  1.00 73.78 ? 187 THR B CA  1 
ATOM 2982 C C   . THR B 1 187 ? 51.417 -18.048 18.028  1.00 73.98 ? 187 THR B C   1 
ATOM 2983 O O   . THR B 1 187 ? 50.770 -17.575 17.106  1.00 73.76 ? 187 THR B O   1 
ATOM 2984 C CB  . THR B 1 187 ? 52.511 -16.059 18.954  1.00 73.35 ? 187 THR B CB  1 
ATOM 2985 O OG1 . THR B 1 187 ? 53.753 -16.492 18.419  1.00 71.36 ? 187 THR B OG1 1 
ATOM 2986 C CG2 . THR B 1 187 ? 52.758 -15.247 20.216  1.00 73.96 ? 187 THR B CG2 1 
ATOM 2987 N N   . GLY B 1 188 ? 51.904 -19.272 18.004  1.00 74.56 ? 188 GLY B N   1 
ATOM 2988 C CA  . GLY B 1 188 ? 51.830 -20.062 16.784  1.00 75.12 ? 188 GLY B CA  1 
ATOM 2989 C C   . GLY B 1 188 ? 52.483 -19.317 15.643  1.00 75.16 ? 188 GLY B C   1 
ATOM 2990 O O   . GLY B 1 188 ? 51.878 -19.123 14.603  1.00 76.01 ? 188 GLY B O   1 
ATOM 2991 N N   . ALA B 1 189 ? 53.707 -18.870 15.874  1.00 75.11 ? 189 ALA B N   1 
ATOM 2992 C CA  . ALA B 1 189 ? 54.488 -18.180 14.877  1.00 75.24 ? 189 ALA B CA  1 
ATOM 2993 C C   . ALA B 1 189 ? 55.727 -19.000 14.696  1.00 75.18 ? 189 ALA B C   1 
ATOM 2994 O O   . ALA B 1 189 ? 56.148 -19.714 15.612  1.00 74.55 ? 189 ALA B O   1 
ATOM 2995 C CB  . ALA B 1 189 ? 54.856 -16.804 15.329  1.00 75.19 ? 189 ALA B CB  1 
ATOM 2996 N N   . HIS B 1 190 ? 56.301 -18.880 13.505  1.00 75.11 ? 190 HIS B N   1 
ATOM 2997 C CA  . HIS B 1 190 ? 57.436 -19.674 13.092  1.00 75.04 ? 190 HIS B CA  1 
ATOM 2998 C C   . HIS B 1 190 ? 58.779 -19.151 13.651  1.00 75.37 ? 190 HIS B C   1 
ATOM 2999 O O   . HIS B 1 190 ? 59.068 -17.942 13.632  1.00 75.42 ? 190 HIS B O   1 
ATOM 3000 C CB  . HIS B 1 190 ? 57.482 -19.689 11.573  1.00 75.01 ? 190 HIS B CB  1 
ATOM 3001 C CG  . HIS B 1 190 ? 58.492 -20.643 11.023  1.00 75.69 ? 190 HIS B CG  1 
ATOM 3002 N ND1 . HIS B 1 190 ? 59.784 -20.271 10.703  1.00 74.85 ? 190 HIS B ND1 1 
ATOM 3003 C CD2 . HIS B 1 190 ? 58.409 -21.969 10.764  1.00 76.04 ? 190 HIS B CD2 1 
ATOM 3004 C CE1 . HIS B 1 190 ? 60.448 -21.328 10.267  1.00 73.75 ? 190 HIS B CE1 1 
ATOM 3005 N NE2 . HIS B 1 190 ? 59.636 -22.367 10.286  1.00 74.77 ? 190 HIS B NE2 1 
ATOM 3006 N N   . HIS B 1 191 ? 59.636 -20.061 14.100  1.00 75.33 ? 191 HIS B N   1 
ATOM 3007 C CA  . HIS B 1 191 ? 60.879 -19.639 14.721  1.00 75.43 ? 191 HIS B CA  1 
ATOM 3008 C C   . HIS B 1 191 ? 61.637 -18.589 13.916  1.00 75.41 ? 191 HIS B C   1 
ATOM 3009 O O   . HIS B 1 191 ? 62.383 -17.794 14.476  1.00 74.72 ? 191 HIS B O   1 
ATOM 3010 C CB  . HIS B 1 191 ? 61.767 -20.835 15.114  1.00 75.60 ? 191 HIS B CB  1 
ATOM 3011 C CG  . HIS B 1 191 ? 62.548 -21.456 13.991  1.00 77.40 ? 191 HIS B CG  1 
ATOM 3012 N ND1 . HIS B 1 191 ? 62.602 -20.940 12.712  1.00 80.33 ? 191 HIS B ND1 1 
ATOM 3013 C CD2 . HIS B 1 191 ? 63.347 -22.553 13.980  1.00 78.36 ? 191 HIS B CD2 1 
ATOM 3014 C CE1 . HIS B 1 191 ? 63.378 -21.703 11.958  1.00 79.53 ? 191 HIS B CE1 1 
ATOM 3015 N NE2 . HIS B 1 191 ? 63.845 -22.687 12.705  1.00 78.43 ? 191 HIS B NE2 1 
ATOM 3016 N N   . VAL B 1 192 ? 61.419 -18.563 12.608  1.00 76.04 ? 192 VAL B N   1 
ATOM 3017 C CA  . VAL B 1 192 ? 62.034 -17.563 11.758  1.00 76.49 ? 192 VAL B CA  1 
ATOM 3018 C C   . VAL B 1 192 ? 61.413 -16.236 12.076  1.00 76.45 ? 192 VAL B C   1 
ATOM 3019 O O   . VAL B 1 192 ? 62.112 -15.243 12.315  1.00 75.96 ? 192 VAL B O   1 
ATOM 3020 C CB  . VAL B 1 192 ? 61.716 -17.792 10.296  1.00 76.66 ? 192 VAL B CB  1 
ATOM 3021 C CG1 . VAL B 1 192 ? 61.981 -16.526 9.508   1.00 77.13 ? 192 VAL B CG1 1 
ATOM 3022 C CG2 . VAL B 1 192 ? 62.533 -18.908 9.759   1.00 77.59 ? 192 VAL B CG2 1 
ATOM 3023 N N   . THR B 1 193 ? 60.078 -16.230 12.016  1.00 76.21 ? 193 THR B N   1 
ATOM 3024 C CA  . THR B 1 193 ? 59.332 -15.008 12.147  1.00 75.94 ? 193 THR B CA  1 
ATOM 3025 C C   . THR B 1 193 ? 59.741 -14.443 13.478  1.00 75.97 ? 193 THR B C   1 
ATOM 3026 O O   . THR B 1 193 ? 60.250 -13.339 13.560  1.00 75.65 ? 193 THR B O   1 
ATOM 3027 C CB  . THR B 1 193 ? 57.839 -15.257 12.063  1.00 75.78 ? 193 THR B CB  1 
ATOM 3028 O OG1 . THR B 1 193 ? 57.592 -16.278 11.094  1.00 74.54 ? 193 THR B OG1 1 
ATOM 3029 C CG2 . THR B 1 193 ? 57.128 -13.994 11.646  1.00 76.16 ? 193 THR B CG2 1 
ATOM 3030 N N   . VAL B 1 194 ? 59.586 -15.244 14.518  1.00 76.35 ? 194 VAL B N   1 
ATOM 3031 C CA  . VAL B 1 194 ? 60.061 -14.844 15.817  1.00 76.42 ? 194 VAL B CA  1 
ATOM 3032 C C   . VAL B 1 194 ? 61.445 -14.223 15.614  1.00 76.67 ? 194 VAL B C   1 
ATOM 3033 O O   . VAL B 1 194 ? 61.590 -13.023 15.755  1.00 76.63 ? 194 VAL B O   1 
ATOM 3034 C CB  . VAL B 1 194 ? 60.148 -16.032 16.781  1.00 76.59 ? 194 VAL B CB  1 
ATOM 3035 C CG1 . VAL B 1 194 ? 60.886 -15.633 18.030  1.00 77.35 ? 194 VAL B CG1 1 
ATOM 3036 C CG2 . VAL B 1 194 ? 58.778 -16.574 17.132  1.00 75.74 ? 194 VAL B CG2 1 
ATOM 3037 N N   . SER B 1 195 ? 62.437 -15.027 15.216  1.00 77.13 ? 195 SER B N   1 
ATOM 3038 C CA  . SER B 1 195 ? 63.852 -14.568 15.121  1.00 77.21 ? 195 SER B CA  1 
ATOM 3039 C C   . SER B 1 195 ? 63.983 -13.230 14.445  1.00 76.74 ? 195 SER B C   1 
ATOM 3040 O O   . SER B 1 195 ? 64.638 -12.345 14.957  1.00 76.27 ? 195 SER B O   1 
ATOM 3041 C CB  . SER B 1 195 ? 64.721 -15.568 14.346  1.00 77.32 ? 195 SER B CB  1 
ATOM 3042 O OG  . SER B 1 195 ? 64.522 -16.891 14.822  1.00 78.88 ? 195 SER B OG  1 
ATOM 3043 N N   . LYS B 1 196 ? 63.349 -13.103 13.284  1.00 77.01 ? 196 LYS B N   1 
ATOM 3044 C CA  . LYS B 1 196 ? 63.401 -11.875 12.480  1.00 77.04 ? 196 LYS B CA  1 
ATOM 3045 C C   . LYS B 1 196 ? 62.651 -10.696 13.146  1.00 76.92 ? 196 LYS B C   1 
ATOM 3046 O O   . LYS B 1 196 ? 63.141 -9.556  13.135  1.00 76.65 ? 196 LYS B O   1 
ATOM 3047 C CB  . LYS B 1 196 ? 62.869 -12.136 11.056  1.00 76.81 ? 196 LYS B CB  1 
ATOM 3048 N N   . VAL B 1 197 ? 61.487 -10.974 13.737  1.00 76.92 ? 197 VAL B N   1 
ATOM 3049 C CA  . VAL B 1 197 ? 60.720 -9.951  14.461  1.00 76.99 ? 197 VAL B CA  1 
ATOM 3050 C C   . VAL B 1 197 ? 61.526 -9.424  15.643  1.00 77.14 ? 197 VAL B C   1 
ATOM 3051 O O   . VAL B 1 197 ? 61.485 -8.233  15.947  1.00 76.83 ? 197 VAL B O   1 
ATOM 3052 C CB  . VAL B 1 197 ? 59.365 -10.485 15.024  1.00 77.11 ? 197 VAL B CB  1 
ATOM 3053 C CG1 . VAL B 1 197 ? 58.740 -9.461  15.976  1.00 77.51 ? 197 VAL B CG1 1 
ATOM 3054 C CG2 . VAL B 1 197 ? 58.356 -10.829 13.909  1.00 76.95 ? 197 VAL B CG2 1 
ATOM 3055 N N   . LEU B 1 198 ? 62.239 -10.322 16.322  1.00 77.56 ? 198 LEU B N   1 
ATOM 3056 C CA  . LEU B 1 198 ? 63.075 -9.944  17.457  1.00 77.79 ? 198 LEU B CA  1 
ATOM 3057 C C   . LEU B 1 198 ? 64.177 -9.064  16.993  1.00 78.60 ? 198 LEU B C   1 
ATOM 3058 O O   . LEU B 1 198 ? 64.367 -7.978  17.516  1.00 79.27 ? 198 LEU B O   1 
ATOM 3059 C CB  . LEU B 1 198 ? 63.756 -11.138 18.111  1.00 77.47 ? 198 LEU B CB  1 
ATOM 3060 C CG  . LEU B 1 198 ? 62.956 -11.913 19.136  1.00 77.60 ? 198 LEU B CG  1 
ATOM 3061 C CD1 . LEU B 1 198 ? 63.797 -13.104 19.567  1.00 78.20 ? 198 LEU B CD1 1 
ATOM 3062 C CD2 . LEU B 1 198 ? 62.507 -11.072 20.346  1.00 76.50 ? 198 LEU B CD2 1 
ATOM 3063 N N   . ALA B 1 199 ? 64.941 -9.556  16.029  1.00 79.35 ? 199 ALA B N   1 
ATOM 3064 C CA  . ALA B 1 199 ? 66.172 -8.886  15.645  1.00 79.87 ? 199 ALA B CA  1 
ATOM 3065 C C   . ALA B 1 199 ? 65.959 -7.380  15.352  1.00 80.25 ? 199 ALA B C   1 
ATOM 3066 O O   . ALA B 1 199 ? 66.720 -6.521  15.836  1.00 80.01 ? 199 ALA B O   1 
ATOM 3067 C CB  . ALA B 1 199 ? 66.800 -9.595  14.447  1.00 80.03 ? 199 ALA B CB  1 
ATOM 3068 N N   . CYS B 1 200 ? 64.910 -7.066  14.591  1.00 80.57 ? 200 CYS B N   1 
ATOM 3069 C CA  . CYS B 1 200 ? 64.740 -5.711  14.062  1.00 80.87 ? 200 CYS B CA  1 
ATOM 3070 C C   . CYS B 1 200 ? 64.167 -4.763  15.127  1.00 80.28 ? 200 CYS B C   1 
ATOM 3071 O O   . CYS B 1 200 ? 64.552 -3.587  15.195  1.00 79.97 ? 200 CYS B O   1 
ATOM 3072 C CB  . CYS B 1 200 ? 63.890 -5.736  12.784  1.00 81.08 ? 200 CYS B CB  1 
ATOM 3073 S SG  . CYS B 1 200 ? 62.117 -5.778  13.090  1.00 83.19 ? 200 CYS B SG  1 
ATOM 3074 N N   . LEU B 1 201 ? 63.267 -5.285  15.959  1.00 79.93 ? 201 LEU B N   1 
ATOM 3075 C CA  . LEU B 1 201 ? 62.949 -4.652  17.261  1.00 79.96 ? 201 LEU B CA  1 
ATOM 3076 C C   . LEU B 1 201 ? 64.208 -4.223  18.057  1.00 79.83 ? 201 LEU B C   1 
ATOM 3077 O O   . LEU B 1 201 ? 64.146 -3.264  18.848  1.00 80.16 ? 201 LEU B O   1 
ATOM 3078 C CB  . LEU B 1 201 ? 62.148 -5.608  18.157  1.00 79.86 ? 201 LEU B CB  1 
ATOM 3079 C CG  . LEU B 1 201 ? 60.631 -5.661  18.019  1.00 80.05 ? 201 LEU B CG  1 
ATOM 3080 C CD1 . LEU B 1 201 ? 60.086 -6.924  18.665  1.00 80.48 ? 201 LEU B CD1 1 
ATOM 3081 C CD2 . LEU B 1 201 ? 59.984 -4.434  18.630  1.00 80.19 ? 201 LEU B CD2 1 
ATOM 3082 N N   . LYS B 1 202 ? 65.318 -4.959  17.887  1.00 79.31 ? 202 LYS B N   1 
ATOM 3083 C CA  . LYS B 1 202 ? 66.598 -4.600  18.516  1.00 78.99 ? 202 LYS B CA  1 
ATOM 3084 C C   . LYS B 1 202 ? 67.220 -3.402  17.816  1.00 79.17 ? 202 LYS B C   1 
ATOM 3085 O O   . LYS B 1 202 ? 67.568 -2.423  18.477  1.00 78.90 ? 202 LYS B O   1 
ATOM 3086 C CB  . LYS B 1 202 ? 67.577 -5.787  18.538  1.00 78.75 ? 202 LYS B CB  1 
ATOM 3087 C CG  . LYS B 1 202 ? 68.809 -5.647  19.466  1.00 78.76 ? 202 LYS B CG  1 
ATOM 3088 C CD  . LYS B 1 202 ? 69.842 -6.753  19.129  1.00 78.20 ? 202 LYS B CD  1 
ATOM 3089 C CE  . LYS B 1 202 ? 71.133 -6.694  19.932  1.00 76.46 ? 202 LYS B CE  1 
ATOM 3090 N NZ  . LYS B 1 202 ? 71.798 -8.031  19.915  1.00 74.27 ? 202 LYS B NZ  1 
ATOM 3091 N N   . LYS B 1 203 ? 67.350 -3.446  16.491  1.00 79.51 ? 203 LYS B N   1 
ATOM 3092 C CA  . LYS B 1 203 ? 68.042 -2.342  15.838  1.00 79.98 ? 203 LYS B CA  1 
ATOM 3093 C C   . LYS B 1 203 ? 67.175 -1.117  15.605  1.00 79.84 ? 203 LYS B C   1 
ATOM 3094 O O   . LYS B 1 203 ? 67.693 -0.040  15.282  1.00 80.22 ? 203 LYS B O   1 
ATOM 3095 C CB  . LYS B 1 203 ? 68.756 -2.728  14.545  1.00 80.14 ? 203 LYS B CB  1 
ATOM 3096 C CG  . LYS B 1 203 ? 70.178 -2.081  14.529  1.00 81.93 ? 203 LYS B CG  1 
ATOM 3097 C CD  . LYS B 1 203 ? 70.663 -1.549  13.185  1.00 84.72 ? 203 LYS B CD  1 
ATOM 3098 N N   . GLU B 1 204 ? 65.869 -1.260  15.773  1.00 79.48 ? 204 GLU B N   1 
ATOM 3099 C CA  . GLU B 1 204 ? 65.024 -0.083  15.778  1.00 79.22 ? 204 GLU B CA  1 
ATOM 3100 C C   . GLU B 1 204 ? 64.789 0.446   17.169  1.00 78.72 ? 204 GLU B C   1 
ATOM 3101 O O   . GLU B 1 204 ? 63.915 1.285   17.365  1.00 78.70 ? 204 GLU B O   1 
ATOM 3102 C CB  . GLU B 1 204 ? 63.701 -0.376  15.115  1.00 79.39 ? 204 GLU B CB  1 
ATOM 3103 C CG  . GLU B 1 204 ? 63.869 -0.551  13.627  1.00 79.96 ? 204 GLU B CG  1 
ATOM 3104 C CD  . GLU B 1 204 ? 62.696 -0.005  12.862  1.00 80.34 ? 204 GLU B CD  1 
ATOM 3105 O OE1 . GLU B 1 204 ? 61.877 0.705   13.501  1.00 79.24 ? 204 GLU B OE1 1 
ATOM 3106 O OE2 . GLU B 1 204 ? 62.604 -0.284  11.631  1.00 80.67 ? 204 GLU B OE2 1 
ATOM 3107 N N   . ASN B 1 205 ? 65.563 -0.045  18.133  1.00 78.21 ? 205 ASN B N   1 
ATOM 3108 C CA  . ASN B 1 205 ? 65.526 0.476   19.499  1.00 77.73 ? 205 ASN B CA  1 
ATOM 3109 C C   . ASN B 1 205 ? 64.179 0.393   20.215  1.00 77.66 ? 205 ASN B C   1 
ATOM 3110 O O   . ASN B 1 205 ? 63.813 1.328   20.931  1.00 77.85 ? 205 ASN B O   1 
ATOM 3111 C CB  . ASN B 1 205 ? 65.982 1.939   19.510  1.00 77.38 ? 205 ASN B CB  1 
ATOM 3112 C CG  . ASN B 1 205 ? 67.456 2.071   19.569  1.00 76.45 ? 205 ASN B CG  1 
ATOM 3113 O OD1 . ASN B 1 205 ? 68.058 1.804   20.606  1.00 73.77 ? 205 ASN B OD1 1 
ATOM 3114 N ND2 . ASN B 1 205 ? 68.067 2.477   18.455  1.00 75.36 ? 205 ASN B ND2 1 
ATOM 3115 N N   . ILE B 1 206 ? 63.428 -0.688  20.048  1.00 77.24 ? 206 ILE B N   1 
ATOM 3116 C CA  . ILE B 1 206 ? 62.198 -0.795  20.814  1.00 76.98 ? 206 ILE B CA  1 
ATOM 3117 C C   . ILE B 1 206 ? 62.401 -1.748  21.964  1.00 77.02 ? 206 ILE B C   1 
ATOM 3118 O O   . ILE B 1 206 ? 61.837 -1.539  23.044  1.00 76.62 ? 206 ILE B O   1 
ATOM 3119 C CB  . ILE B 1 206 ? 61.020 -1.201  19.969  1.00 76.88 ? 206 ILE B CB  1 
ATOM 3120 C CG1 . ILE B 1 206 ? 60.929 -0.263  18.763  1.00 77.49 ? 206 ILE B CG1 1 
ATOM 3121 C CG2 . ILE B 1 206 ? 59.742 -1.103  20.791  1.00 77.01 ? 206 ILE B CG2 1 
ATOM 3122 C CD1 . ILE B 1 206 ? 59.934 -0.671  17.683  1.00 77.84 ? 206 ILE B CD1 1 
ATOM 3123 N N   . LEU B 1 207 ? 63.216 -2.779  21.740  1.00 76.98 ? 207 LEU B N   1 
ATOM 3124 C CA  . LEU B 1 207 ? 63.461 -3.775  22.764  1.00 76.93 ? 207 LEU B CA  1 
ATOM 3125 C C   . LEU B 1 207 ? 64.496 -4.803  22.329  1.00 77.06 ? 207 LEU B C   1 
ATOM 3126 O O   . LEU B 1 207 ? 64.561 -5.158  21.161  1.00 76.35 ? 207 LEU B O   1 
ATOM 3127 C CB  . LEU B 1 207 ? 62.125 -4.450  23.121  1.00 76.90 ? 207 LEU B CB  1 
ATOM 3128 C CG  . LEU B 1 207 ? 61.985 -5.956  23.352  1.00 76.92 ? 207 LEU B CG  1 
ATOM 3129 C CD1 . LEU B 1 207 ? 60.606 -6.194  23.889  1.00 76.91 ? 207 LEU B CD1 1 
ATOM 3130 C CD2 . LEU B 1 207 ? 62.173 -6.785  22.097  1.00 77.17 ? 207 LEU B CD2 1 
ATOM 3131 N N   . ASP B 1 208 ? 65.292 -5.269  23.291  1.00 77.86 ? 208 ASP B N   1 
ATOM 3132 C CA  . ASP B 1 208 ? 66.087 -6.484  23.145  1.00 78.79 ? 208 ASP B CA  1 
ATOM 3133 C C   . ASP B 1 208 ? 65.762 -7.445  24.292  1.00 79.05 ? 208 ASP B C   1 
ATOM 3134 O O   . ASP B 1 208 ? 65.425 -6.994  25.379  1.00 79.16 ? 208 ASP B O   1 
ATOM 3135 C CB  . ASP B 1 208 ? 67.566 -6.172  23.190  1.00 79.29 ? 208 ASP B CB  1 
ATOM 3136 C CG  . ASP B 1 208 ? 68.422 -7.443  23.296  1.00 81.34 ? 208 ASP B CG  1 
ATOM 3137 O OD1 . ASP B 1 208 ? 69.132 -7.755  22.304  1.00 83.78 ? 208 ASP B OD1 1 
ATOM 3138 O OD2 . ASP B 1 208 ? 68.355 -8.146  24.352  1.00 81.62 ? 208 ASP B OD2 1 
ATOM 3139 N N   . LYS B 1 209 ? 65.881 -8.754  24.042  1.00 79.47 ? 209 LYS B N   1 
ATOM 3140 C CA  . LYS B 1 209 ? 65.550 -9.807  25.017  1.00 79.68 ? 209 LYS B CA  1 
ATOM 3141 C C   . LYS B 1 209 ? 66.819 -10.593 25.313  1.00 79.89 ? 209 LYS B C   1 
ATOM 3142 O O   . LYS B 1 209 ? 67.367 -11.246 24.451  1.00 79.90 ? 209 LYS B O   1 
ATOM 3143 C CB  . LYS B 1 209 ? 64.429 -10.751 24.479  1.00 79.71 ? 209 LYS B CB  1 
ATOM 3144 C CG  . LYS B 1 209 ? 63.783 -11.719 25.522  1.00 79.73 ? 209 LYS B CG  1 
ATOM 3145 C CD  . LYS B 1 209 ? 63.392 -13.122 24.963  1.00 79.60 ? 209 LYS B CD  1 
ATOM 3146 C CE  . LYS B 1 209 ? 64.532 -14.207 25.068  1.00 79.85 ? 209 LYS B CE  1 
ATOM 3147 N NZ  . LYS B 1 209 ? 64.536 -15.019 26.347  1.00 78.85 ? 209 LYS B NZ  1 
ATOM 3148 N N   . LYS B 1 210 ? 67.304 -10.509 26.539  1.00 80.63 ? 210 LYS B N   1 
ATOM 3149 C CA  . LYS B 1 210 ? 68.402 -11.377 26.971  1.00 80.79 ? 210 LYS B CA  1 
ATOM 3150 C C   . LYS B 1 210 ? 67.829 -12.749 27.484  1.00 81.01 ? 210 LYS B C   1 
ATOM 3151 O O   . LYS B 1 210 ? 66.653 -13.068 27.212  1.00 80.69 ? 210 LYS B O   1 
ATOM 3152 C CB  . LYS B 1 210 ? 69.290 -10.623 27.981  1.00 80.63 ? 210 LYS B CB  1 
ATOM 3153 C CG  . LYS B 1 210 ? 70.386 -9.750  27.313  1.00 79.80 ? 210 LYS B CG  1 
ATOM 3154 C CD  . LYS B 1 210 ? 70.785 -8.541  28.136  1.00 79.62 ? 210 LYS B CD  1 
ATOM 3155 C CE  . LYS B 1 210 ? 70.472 -8.678  29.647  1.00 80.65 ? 210 LYS B CE  1 
ATOM 3156 N NZ  . LYS B 1 210 ? 70.582 -10.058 30.232  1.00 80.52 ? 210 LYS B NZ  1 
ATOM 3157 N N   . LYS B 1 211 ? 68.650 -13.566 28.166  1.00 81.15 ? 211 LYS B N   1 
ATOM 3158 C CA  . LYS B 1 211 ? 68.236 -14.922 28.580  1.00 81.06 ? 211 LYS B CA  1 
ATOM 3159 C C   . LYS B 1 211 ? 67.338 -14.882 29.826  1.00 81.26 ? 211 LYS B C   1 
ATOM 3160 O O   . LYS B 1 211 ? 66.190 -15.338 29.785  1.00 81.31 ? 211 LYS B O   1 
ATOM 3161 C CB  . LYS B 1 211 ? 69.457 -15.828 28.801  1.00 81.01 ? 211 LYS B CB  1 
ATOM 3162 N N   . ASN B 1 212 ? 67.840 -14.323 30.927  1.00 81.31 ? 212 ASN B N   1 
ATOM 3163 C CA  . ASN B 1 212 ? 67.005 -14.143 32.130  1.00 81.28 ? 212 ASN B CA  1 
ATOM 3164 C C   . ASN B 1 212 ? 66.011 -12.961 32.012  1.00 81.43 ? 212 ASN B C   1 
ATOM 3165 O O   . ASN B 1 212 ? 65.075 -12.860 32.841  1.00 81.61 ? 212 ASN B O   1 
ATOM 3166 C CB  . ASN B 1 212 ? 67.887 -13.973 33.379  1.00 80.98 ? 212 ASN B CB  1 
ATOM 3167 N N   . LYS B 1 213 ? 66.197 -12.122 30.971  1.00 81.15 ? 213 LYS B N   1 
ATOM 3168 C CA  . LYS B 1 213 ? 65.801 -10.701 30.985  1.00 80.92 ? 213 LYS B CA  1 
ATOM 3169 C C   . LYS B 1 213 ? 65.437 -10.127 29.589  1.00 80.72 ? 213 LYS B C   1 
ATOM 3170 O O   . LYS B 1 213 ? 66.229 -10.247 28.649  1.00 80.52 ? 213 LYS B O   1 
ATOM 3171 C CB  . LYS B 1 213 ? 67.000 -9.881  31.540  1.00 80.87 ? 213 LYS B CB  1 
ATOM 3172 C CG  . LYS B 1 213 ? 66.670 -8.700  32.471  1.00 81.33 ? 213 LYS B CG  1 
ATOM 3173 C CD  . LYS B 1 213 ? 67.126 -8.938  33.925  1.00 81.38 ? 213 LYS B CD  1 
ATOM 3174 N N   . PHE B 1 214 ? 64.278 -9.470  29.453  1.00 80.27 ? 214 PHE B N   1 
ATOM 3175 C CA  . PHE B 1 214 ? 64.122 -8.490  28.349  1.00 79.74 ? 214 PHE B CA  1 
ATOM 3176 C C   . PHE B 1 214 ? 63.945 -7.045  28.820  1.00 78.75 ? 214 PHE B C   1 
ATOM 3177 O O   . PHE B 1 214 ? 63.261 -6.751  29.809  1.00 78.36 ? 214 PHE B O   1 
ATOM 3178 C CB  . PHE B 1 214 ? 63.105 -8.868  27.244  1.00 80.44 ? 214 PHE B CB  1 
ATOM 3179 C CG  . PHE B 1 214 ? 61.649 -8.853  27.651  1.00 81.04 ? 214 PHE B CG  1 
ATOM 3180 C CD1 . PHE B 1 214 ? 61.199 -9.465  28.798  1.00 82.91 ? 214 PHE B CD1 1 
ATOM 3181 C CD2 . PHE B 1 214 ? 60.708 -8.293  26.812  1.00 81.75 ? 214 PHE B CD2 1 
ATOM 3182 C CE1 . PHE B 1 214 ? 59.835 -9.468  29.113  1.00 83.46 ? 214 PHE B CE1 1 
ATOM 3183 C CE2 . PHE B 1 214 ? 59.361 -8.291  27.145  1.00 82.36 ? 214 PHE B CE2 1 
ATOM 3184 C CZ  . PHE B 1 214 ? 58.934 -8.876  28.282  1.00 82.53 ? 214 PHE B CZ  1 
ATOM 3185 N N   . ILE B 1 215 ? 64.632 -6.175  28.078  1.00 77.47 ? 215 ILE B N   1 
ATOM 3186 C CA  . ILE B 1 215 ? 64.721 -4.762  28.320  1.00 76.58 ? 215 ILE B CA  1 
ATOM 3187 C C   . ILE B 1 215 ? 63.998 -4.031  27.198  1.00 76.13 ? 215 ILE B C   1 
ATOM 3188 O O   . ILE B 1 215 ? 64.327 -4.170  26.011  1.00 75.95 ? 215 ILE B O   1 
ATOM 3189 C CB  . ILE B 1 215 ? 66.175 -4.284  28.317  1.00 76.42 ? 215 ILE B CB  1 
ATOM 3190 C CG1 . ILE B 1 215 ? 66.896 -4.775  29.562  1.00 77.53 ? 215 ILE B CG1 1 
ATOM 3191 C CG2 . ILE B 1 215 ? 66.244 -2.761  28.283  1.00 75.97 ? 215 ILE B CG2 1 
ATOM 3192 C CD1 . ILE B 1 215 ? 67.270 -6.271  29.570  1.00 78.49 ? 215 ILE B CD1 1 
ATOM 3193 N N   . VAL B 1 216 ? 63.036 -3.218  27.606  1.00 75.39 ? 216 VAL B N   1 
ATOM 3194 C CA  . VAL B 1 216 ? 62.206 -2.452  26.721  1.00 74.66 ? 216 VAL B CA  1 
ATOM 3195 C C   . VAL B 1 216 ? 62.750 -1.048  26.683  1.00 74.41 ? 216 VAL B C   1 
ATOM 3196 O O   . VAL B 1 216 ? 62.758 -0.369  27.684  1.00 74.79 ? 216 VAL B O   1 
ATOM 3197 C CB  . VAL B 1 216 ? 60.765 -2.453  27.255  1.00 74.57 ? 216 VAL B CB  1 
ATOM 3198 C CG1 . VAL B 1 216 ? 59.961 -1.281  26.728  1.00 74.72 ? 216 VAL B CG1 1 
ATOM 3199 C CG2 . VAL B 1 216 ? 60.101 -3.756  26.902  1.00 74.19 ? 216 VAL B CG2 1 
ATOM 3200 N N   . TYR B 1 217 ? 63.188 -0.610  25.513  1.00 74.43 ? 217 TYR B N   1 
ATOM 3201 C CA  . TYR B 1 217 ? 63.741 0.739   25.314  1.00 73.77 ? 217 TYR B CA  1 
ATOM 3202 C C   . TYR B 1 217 ? 62.702 1.817   25.052  1.00 74.04 ? 217 TYR B C   1 
ATOM 3203 O O   . TYR B 1 217 ? 63.006 2.994   25.147  1.00 73.64 ? 217 TYR B O   1 
ATOM 3204 C CB  . TYR B 1 217 ? 64.704 0.705   24.134  1.00 73.02 ? 217 TYR B CB  1 
ATOM 3205 C CG  . TYR B 1 217 ? 65.839 -0.223  24.395  1.00 71.96 ? 217 TYR B CG  1 
ATOM 3206 C CD1 . TYR B 1 217 ? 65.990 -1.380  23.683  1.00 71.55 ? 217 TYR B CD1 1 
ATOM 3207 C CD2 . TYR B 1 217 ? 66.723 0.028   25.400  1.00 71.97 ? 217 TYR B CD2 1 
ATOM 3208 C CE1 . TYR B 1 217 ? 67.007 -2.235  23.939  1.00 70.81 ? 217 TYR B CE1 1 
ATOM 3209 C CE2 . TYR B 1 217 ? 67.742 -0.825  25.657  1.00 71.92 ? 217 TYR B CE2 1 
ATOM 3210 C CZ  . TYR B 1 217 ? 67.874 -1.957  24.915  1.00 70.96 ? 217 TYR B CZ  1 
ATOM 3211 O OH  . TYR B 1 217 ? 68.881 -2.846  25.134  1.00 72.08 ? 217 TYR B OH  1 
ATOM 3212 N N   . ASN B 1 218 ? 61.479 1.414   24.722  1.00 74.71 ? 218 ASN B N   1 
ATOM 3213 C CA  . ASN B 1 218 ? 60.511 2.312   24.103  1.00 74.96 ? 218 ASN B CA  1 
ATOM 3214 C C   . ASN B 1 218 ? 59.113 1.758   24.176  1.00 74.83 ? 218 ASN B C   1 
ATOM 3215 O O   . ASN B 1 218 ? 58.534 1.392   23.162  1.00 74.39 ? 218 ASN B O   1 
ATOM 3216 C CB  . ASN B 1 218 ? 60.882 2.499   22.631  1.00 75.32 ? 218 ASN B CB  1 
ATOM 3217 C CG  . ASN B 1 218 ? 60.250 3.729   22.019  1.00 76.05 ? 218 ASN B CG  1 
ATOM 3218 O OD1 . ASN B 1 218 ? 59.268 4.274   22.539  1.00 77.31 ? 218 ASN B OD1 1 
ATOM 3219 N ND2 . ASN B 1 218 ? 60.817 4.183   20.901  1.00 77.06 ? 218 ASN B ND2 1 
ATOM 3220 N N   . LEU B 1 219 ? 58.571 1.685   25.381  1.00 75.20 ? 219 LEU B N   1 
ATOM 3221 C CA  . LEU B 1 219 ? 57.248 1.120   25.558  1.00 75.38 ? 219 LEU B CA  1 
ATOM 3222 C C   . LEU B 1 219 ? 56.211 1.885   24.723  1.00 76.30 ? 219 LEU B C   1 
ATOM 3223 O O   . LEU B 1 219 ? 55.239 1.280   24.250  1.00 76.25 ? 219 LEU B O   1 
ATOM 3224 C CB  . LEU B 1 219 ? 56.851 1.105   27.034  1.00 75.17 ? 219 LEU B CB  1 
ATOM 3225 C CG  . LEU B 1 219 ? 55.459 0.552   27.365  1.00 74.82 ? 219 LEU B CG  1 
ATOM 3226 C CD1 . LEU B 1 219 ? 55.329 -0.889  26.887  1.00 75.47 ? 219 LEU B CD1 1 
ATOM 3227 C CD2 . LEU B 1 219 ? 55.146 0.632   28.846  1.00 74.57 ? 219 LEU B CD2 1 
ATOM 3228 N N   . GLU B 1 220 ? 56.423 3.195   24.536  1.00 77.19 ? 220 GLU B N   1 
ATOM 3229 C CA  . GLU B 1 220 ? 55.519 4.045   23.730  1.00 77.84 ? 220 GLU B CA  1 
ATOM 3230 C C   . GLU B 1 220 ? 55.255 3.484   22.326  1.00 78.49 ? 220 GLU B C   1 
ATOM 3231 O O   . GLU B 1 220 ? 54.113 3.456   21.849  1.00 77.89 ? 220 GLU B O   1 
ATOM 3232 N N   . GLU B 1 221 ? 56.335 3.012   21.704  1.00 79.58 ? 221 GLU B N   1 
ATOM 3233 C CA  . GLU B 1 221 ? 56.334 2.468   20.345  1.00 80.69 ? 221 GLU B CA  1 
ATOM 3234 C C   . GLU B 1 221 ? 55.808 1.031   20.302  1.00 81.73 ? 221 GLU B C   1 
ATOM 3235 O O   . GLU B 1 221 ? 54.903 0.705   19.533  1.00 81.68 ? 221 GLU B O   1 
ATOM 3236 C CB  . GLU B 1 221 ? 57.766 2.517   19.790  1.00 80.69 ? 221 GLU B CB  1 
ATOM 3237 C CG  . GLU B 1 221 ? 57.947 2.023   18.348  1.00 80.99 ? 221 GLU B CG  1 
ATOM 3238 C CD  . GLU B 1 221 ? 57.394 2.973   17.280  1.00 80.54 ? 221 GLU B CD  1 
ATOM 3239 O OE1 . GLU B 1 221 ? 56.733 3.986   17.621  1.00 79.44 ? 221 GLU B OE1 1 
ATOM 3240 O OE2 . GLU B 1 221 ? 57.635 2.688   16.082  1.00 81.01 ? 221 GLU B OE2 1 
ATOM 3241 N N   . LEU B 1 222 ? 56.392 0.169   21.121  1.00 83.18 ? 222 LEU B N   1 
ATOM 3242 C CA  . LEU B 1 222 ? 55.864 -1.177  21.284  1.00 84.51 ? 222 LEU B CA  1 
ATOM 3243 C C   . LEU B 1 222 ? 54.326 -1.167  21.210  1.00 85.12 ? 222 LEU B C   1 
ATOM 3244 O O   . LEU B 1 222 ? 53.790 -1.680  20.242  1.00 85.14 ? 222 LEU B O   1 
ATOM 3245 C CB  . LEU B 1 222 ? 56.386 -1.815  22.586  1.00 84.27 ? 222 LEU B CB  1 
ATOM 3246 C CG  . LEU B 1 222 ? 56.236 -3.335  22.815  1.00 83.79 ? 222 LEU B CG  1 
ATOM 3247 C CD1 . LEU B 1 222 ? 56.063 -4.121  21.527  1.00 84.41 ? 222 LEU B CD1 1 
ATOM 3248 C CD2 . LEU B 1 222 ? 57.429 -3.893  23.568  1.00 83.51 ? 222 LEU B CD2 1 
ATOM 3249 N N   . LYS B 1 223 ? 53.636 -0.568  22.193  1.00 86.54 ? 223 LYS B N   1 
ATOM 3250 C CA  . LYS B 1 223 ? 52.151 -0.423  22.181  1.00 87.86 ? 223 LYS B CA  1 
ATOM 3251 C C   . LYS B 1 223 ? 51.532 0.065   20.826  1.00 89.54 ? 223 LYS B C   1 
ATOM 3252 O O   . LYS B 1 223 ? 50.432 -0.377  20.410  1.00 89.65 ? 223 LYS B O   1 
ATOM 3253 C CB  . LYS B 1 223 ? 51.730 0.535   23.290  1.00 87.60 ? 223 LYS B CB  1 
ATOM 3254 C CG  . LYS B 1 223 ? 50.252 0.862   23.309  1.00 87.68 ? 223 LYS B CG  1 
ATOM 3255 C CD  . LYS B 1 223 ? 49.799 1.503   24.638  1.00 87.67 ? 223 LYS B CD  1 
ATOM 3256 C CE  . LYS B 1 223 ? 48.283 1.335   24.825  1.00 86.93 ? 223 LYS B CE  1 
ATOM 3257 N NZ  . LYS B 1 223 ? 47.784 2.017   26.026  1.00 86.59 ? 223 LYS B NZ  1 
ATOM 3258 N N   . HIS B 1 224 ? 52.242 0.985   20.156  1.00 91.16 ? 224 HIS B N   1 
ATOM 3259 C CA  . HIS B 1 224 ? 51.866 1.464   18.802  1.00 91.68 ? 224 HIS B CA  1 
ATOM 3260 C C   . HIS B 1 224 ? 51.881 0.337   17.774  1.00 92.04 ? 224 HIS B C   1 
ATOM 3261 O O   . HIS B 1 224 ? 50.867 0.105   17.124  1.00 92.52 ? 224 HIS B O   1 
ATOM 3262 C CB  . HIS B 1 224 ? 52.785 2.597   18.318  1.00 92.70 ? 224 HIS B CB  1 
ATOM 3263 C CG  . HIS B 1 224 ? 52.051 3.693   17.619  1.00 95.08 ? 224 HIS B CG  1 
ATOM 3264 N ND1 . HIS B 1 224 ? 51.299 3.479   16.481  1.00 97.62 ? 224 HIS B ND1 1 
ATOM 3265 C CD2 . HIS B 1 224 ? 51.936 5.012   17.908  1.00 97.47 ? 224 HIS B CD2 1 
ATOM 3266 C CE1 . HIS B 1 224 ? 50.756 4.624   16.096  1.00 98.13 ? 224 HIS B CE1 1 
ATOM 3267 N NE2 . HIS B 1 224 ? 51.126 5.569   16.946  1.00 98.41 ? 224 HIS B NE2 1 
ATOM 3268 N N   . LEU B 1 225 ? 53.007 -0.369  17.640  1.00 91.78 ? 225 LEU B N   1 
ATOM 3269 C CA  . LEU B 1 225 ? 53.064 -1.534  16.767  1.00 91.67 ? 225 LEU B CA  1 
ATOM 3270 C C   . LEU B 1 225 ? 52.066 -2.580  17.294  1.00 91.95 ? 225 LEU B C   1 
ATOM 3271 O O   . LEU B 1 225 ? 52.438 -3.715  17.583  1.00 91.34 ? 225 LEU B O   1 
ATOM 3272 C CB  . LEU B 1 225 ? 54.475 -2.145  16.692  1.00 91.69 ? 225 LEU B CB  1 
ATOM 3273 C CG  . LEU B 1 225 ? 55.773 -1.346  16.453  1.00 91.27 ? 225 LEU B CG  1 
ATOM 3274 C CD1 . LEU B 1 225 ? 56.716 -2.068  15.440  1.00 90.85 ? 225 LEU B CD1 1 
ATOM 3275 C CD2 . LEU B 1 225 ? 55.486 0.049   15.982  1.00 91.69 ? 225 LEU B CD2 1 
ATOM 3276 N N   . SER B 1 226 ? 50.803 -2.159  17.411  1.00 92.64 ? 226 SER B N   1 
ATOM 3277 C CA  . SER B 1 226 ? 49.654 -2.965  17.880  1.00 93.38 ? 226 SER B CA  1 
ATOM 3278 C C   . SER B 1 226 ? 48.650 -2.072  18.654  1.00 93.64 ? 226 SER B C   1 
ATOM 3279 O O   . SER B 1 226 ? 47.496 -1.864  18.239  1.00 94.03 ? 226 SER B O   1 
ATOM 3280 C CB  . SER B 1 226 ? 50.084 -4.159  18.748  1.00 93.50 ? 226 SER B CB  1 
ATOM 3281 O OG  . SER B 1 226 ? 50.972 -3.767  19.792  1.00 93.85 ? 226 SER B OG  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   ASP 7   7   ?   ?   ?   A . n 
A 1 8   LYS 8   8   ?   ?   ?   A . n 
A 1 9   ASP 9   9   ?   ?   ?   A . n 
A 1 10  PHE 10  10  ?   ?   ?   A . n 
A 1 11  CYS 11  11  ?   ?   ?   A . n 
A 1 12  GLY 12  12  ?   ?   ?   A . n 
A 1 13  ALA 13  13  ?   ?   ?   A . n 
A 1 14  ILE 14  14  ?   ?   ?   A . n 
A 1 15  ILE 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  ASP 17  17  ?   ?   ?   A . n 
A 1 18  SER 18  18  ?   ?   ?   A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  PHE 20  20  20  PHE PHE A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  LYS 24  24  24  LYS ALA A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  MET 31  31  31  MET MET A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  MET 45  45  45  MET MET A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  GLU 48  48  48  GLU GLY A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  MET 53  53  53  MET MET A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  MET 57  57  57  MET MET A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  LYS 62  62  62  LYS ALA A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  MET 99  99  99  MET MET A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 CYS 105 105 105 CYS CYS A . n 
A 1 106 TRP 106 106 106 TRP TRP A . n 
A 1 107 PHE 107 107 107 PHE PHE A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 CYS 111 111 111 CYS CYS A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 MET 122 122 122 MET MET A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 PHE 127 127 127 PHE PHE A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 TYR 136 136 136 TYR TYR A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 TYR 147 147 147 TYR TYR A . n 
A 1 148 ASN 148 148 148 ASN ASN A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 TYR 158 158 158 TYR TYR A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 CYS 161 161 161 CYS CYS A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 THR 171 171 171 THR THR A . n 
A 1 172 TYR 172 172 172 TYR TYR A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 MET 176 176 176 MET MET A . n 
A 1 177 PRO 177 177 177 PRO PRO A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 THR 187 187 187 THR THR A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 HIS 190 190 190 HIS HIS A . n 
A 1 191 HIS 191 191 191 HIS HIS A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 CYS 200 200 200 CYS CYS A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 LYS 203 203 203 LYS LYS A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 LYS 211 211 211 LYS ALA A . n 
A 1 212 ASN 212 212 212 ASN ASN A . n 
A 1 213 LYS 213 213 213 LYS LYS A . n 
A 1 214 PHE 214 214 214 PHE PHE A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 VAL 216 216 216 VAL VAL A . n 
A 1 217 TYR 217 217 217 TYR TYR A . n 
A 1 218 ASN 218 218 218 ASN ASN A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 HIS 224 224 224 HIS HIS A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLU 227 227 ?   ?   ?   A . n 
A 1 228 GLN 228 228 ?   ?   ?   A . n 
A 1 229 THR 229 229 ?   ?   ?   A . n 
A 1 230 SER 230 230 ?   ?   ?   A . n 
A 1 231 TYR 231 231 ?   ?   ?   A . n 
A 1 232 TYR 232 232 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   ALA 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   ?   ?   ?   B . n 
B 1 5   GLY 5   5   ?   ?   ?   B . n 
B 1 6   LEU 6   6   ?   ?   ?   B . n 
B 1 7   ASP 7   7   ?   ?   ?   B . n 
B 1 8   LYS 8   8   ?   ?   ?   B . n 
B 1 9   ASP 9   9   ?   ?   ?   B . n 
B 1 10  PHE 10  10  ?   ?   ?   B . n 
B 1 11  CYS 11  11  ?   ?   ?   B . n 
B 1 12  GLY 12  12  ?   ?   ?   B . n 
B 1 13  ALA 13  13  ?   ?   ?   B . n 
B 1 14  ILE 14  14  ?   ?   ?   B . n 
B 1 15  ILE 15  15  ?   ?   ?   B . n 
B 1 16  PRO 16  16  ?   ?   ?   B . n 
B 1 17  ASP 17  17  ?   ?   ?   B . n 
B 1 18  SER 18  18  ?   ?   ?   B . n 
B 1 19  PHE 19  19  19  PHE PHE B . n 
B 1 20  PHE 20  20  20  PHE PHE B . n 
B 1 21  PRO 21  21  21  PRO PRO B . n 
B 1 22  ILE 22  22  22  ILE ILE B . n 
B 1 23  GLU 23  23  23  GLU GLU B . n 
B 1 24  LYS 24  24  24  LYS ALA B . n 
B 1 25  LEU 25  25  25  LEU LEU B . n 
B 1 26  ARG 26  26  26  ARG ARG B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  TYR 28  28  28  TYR TYR B . n 
B 1 29  THR 29  29  29  THR THR B . n 
B 1 30  ASP 30  30  30  ASP ASP B . n 
B 1 31  MET 31  31  31  MET MET B . n 
B 1 32  GLY 32  32  32  GLY GLY B . n 
B 1 33  ILE 33  33  33  ILE ILE B . n 
B 1 34  ILE 34  34  34  ILE ILE B . n 
B 1 35  ARG 35  35  35  ARG ARG B . n 
B 1 36  GLU 36  36  36  GLU GLU B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  LYS 39  39  39  LYS LYS B . n 
B 1 40  GLY 40  40  40  GLY GLY B . n 
B 1 41  SER 41  41  41  SER SER B . n 
B 1 42  ALA 42  42  42  ALA ALA B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  ILE 44  44  44  ILE ILE B . n 
B 1 45  MET 45  45  45  MET MET B . n 
B 1 46  PRO 46  46  46  PRO PRO B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  THR 50  50  50  THR THR B . n 
B 1 51  THR 51  51  51  THR THR B . n 
B 1 52  SER 52  52  52  SER SER B . n 
B 1 53  MET 53  53  53  MET MET B . n 
B 1 54  ILE 54  54  54  ILE ILE B . n 
B 1 55  PHE 55  55  55  PHE PHE B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  MET 57  57  57  MET MET B . n 
B 1 58  ASP 58  58  58  ASP ASP B . n 
B 1 59  GLY 59  59  59  GLY GLY B . n 
B 1 60  LYS 60  60  60  LYS LYS B . n 
B 1 61  ILE 61  61  61  ILE ILE B . n 
B 1 62  LYS 62  62  62  LYS LYS B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  ASP 64  64  64  ASP ASP B . n 
B 1 65  ILE 65  65  65  ILE ILE B . n 
B 1 66  ILE 66  66  66  ILE ILE B . n 
B 1 67  PHE 67  67  67  PHE PHE B . n 
B 1 68  GLU 68  68  68  GLU GLU B . n 
B 1 69  ASP 69  69  69  ASP ASP B . n 
B 1 70  GLY 70  70  70  GLY GLY B . n 
B 1 71  SER 71  71  71  SER SER B . n 
B 1 72  GLU 72  72  72  GLU GLU B . n 
B 1 73  LYS 73  73  73  LYS LYS B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  ALA 78  78  78  ALA ALA B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  SER 80  80  80  SER SER B . n 
B 1 81  ASN 81  81  81  ASN ASN B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  ILE 84  84  84  ILE ILE B . n 
B 1 85  GLY 85  85  85  GLY GLY B . n 
B 1 86  ARG 86  86  86  ARG ARG B . n 
B 1 87  LEU 87  87  87  LEU LEU B . n 
B 1 88  TYR 88  88  88  TYR TYR B . n 
B 1 89  PRO 89  89  89  PRO PRO B . n 
B 1 90  THR 90  90  90  THR THR B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  ASN 92  92  92  ASN ASN B . n 
B 1 93  ASN 93  93  93  ASN ASN B . n 
B 1 94  ILE 94  94  94  ILE ILE B . n 
B 1 95  TYR 95  95  95  TYR TYR B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  THR 97  97  97  THR THR B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  MET 99  99  99  MET MET B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 GLN 101 101 101 GLN GLN B . n 
B 1 102 THR 102 102 102 THR THR B . n 
B 1 103 ARG 103 103 103 ARG ARG B . n 
B 1 104 THR 104 104 104 THR THR B . n 
B 1 105 CYS 105 105 105 CYS CYS B . n 
B 1 106 TRP 106 106 106 TRP TRP B . n 
B 1 107 PHE 107 107 107 PHE PHE B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 GLU 109 109 109 GLU GLU B . n 
B 1 110 GLU 110 110 110 GLU GLU B . n 
B 1 111 CYS 111 111 111 CYS CYS B . n 
B 1 112 LEU 112 112 112 LEU LEU B . n 
B 1 113 ARG 113 113 113 ARG ARG B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 ILE 115 115 115 ILE ILE B . n 
B 1 116 PHE 116 116 116 PHE PHE B . n 
B 1 117 ARG 117 117 117 ARG ARG B . n 
B 1 118 THR 118 118 118 THR THR B . n 
B 1 119 ASP 119 119 119 ASP ASP B . n 
B 1 120 GLU 120 120 120 GLU GLU B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 MET 122 122 122 MET MET B . n 
B 1 123 ILE 123 123 123 ILE ILE B . n 
B 1 124 PHE 124 124 124 PHE PHE B . n 
B 1 125 GLU 125 125 125 GLU GLU B . n 
B 1 126 ILE 126 126 126 ILE ILE B . n 
B 1 127 PHE 127 127 127 PHE PHE B . n 
B 1 128 LYS 128 128 128 LYS ALA B . n 
B 1 129 ASN 129 129 129 ASN ASN B . n 
B 1 130 TYR 130 130 130 TYR TYR B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 THR 132 132 132 THR THR B . n 
B 1 133 LYS 133 133 133 LYS LYS B . n 
B 1 134 VAL 134 134 134 VAL VAL B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 TYR 136 136 136 TYR TYR B . n 
B 1 137 TYR 137 137 137 TYR TYR B . n 
B 1 138 ALA 138 138 138 ALA ALA B . n 
B 1 139 ARG 139 139 139 ARG ARG B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 ALA 142 142 142 ALA ALA B . n 
B 1 143 GLU 143 143 143 GLU GLU B . n 
B 1 144 ILE 144 144 144 ILE ILE B . n 
B 1 145 ASN 145 145 145 ASN ASN B . n 
B 1 146 THR 146 146 146 THR THR B . n 
B 1 147 TYR 147 147 147 TYR TYR B . n 
B 1 148 ASN 148 148 148 ASN ASN B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 THR 150 150 150 THR THR B . n 
B 1 151 ILE 151 151 151 ILE ILE B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 ILE 153 153 153 ILE ILE B . n 
B 1 154 LEU 154 154 154 LEU LEU B . n 
B 1 155 ARG 155 155 155 ARG ARG B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 PHE 157 157 157 PHE PHE B . n 
B 1 158 TYR 158 158 158 TYR TYR B . n 
B 1 159 GLU 159 159 159 GLU GLU B . n 
B 1 160 LEU 160 160 160 LEU LEU B . n 
B 1 161 CYS 161 161 161 CYS CYS B . n 
B 1 162 SER 162 162 162 SER SER B . n 
B 1 163 SER 163 163 163 SER SER B . n 
B 1 164 GLN 164 164 164 GLN GLN B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 LYS 166 166 166 LYS ALA B . n 
B 1 167 ARG 167 167 167 ARG ALA B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASP 170 170 170 ASP ASP B . n 
B 1 171 THR 171 171 171 THR THR B . n 
B 1 172 TYR 172 172 172 TYR TYR B . n 
B 1 173 GLU 173 173 173 GLU GLU B . n 
B 1 174 ILE 174 174 174 ILE ILE B . n 
B 1 175 THR 175 175 175 THR THR B . n 
B 1 176 MET 176 176 176 MET MET B . n 
B 1 177 PRO 177 177 177 PRO PRO B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 GLN 180 180 180 GLN GLN B . n 
B 1 181 LYS 181 181 181 LYS LYS B . n 
B 1 182 SER 182 182 182 SER SER B . n 
B 1 183 ILE 183 183 183 ILE ILE B . n 
B 1 184 GLY 184 184 184 GLY GLY B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ILE 186 186 186 ILE ILE B . n 
B 1 187 THR 187 187 187 THR THR B . n 
B 1 188 GLY 188 188 188 GLY GLY B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 HIS 190 190 190 HIS HIS B . n 
B 1 191 HIS 191 191 191 HIS HIS B . n 
B 1 192 VAL 192 192 192 VAL VAL B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 VAL 194 194 194 VAL VAL B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 LYS 196 196 196 LYS LYS B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 CYS 200 200 200 CYS CYS B . n 
B 1 201 LEU 201 201 201 LEU LEU B . n 
B 1 202 LYS 202 202 202 LYS LYS B . n 
B 1 203 LYS 203 203 203 LYS LYS B . n 
B 1 204 GLU 204 204 204 GLU GLU B . n 
B 1 205 ASN 205 205 205 ASN ASN B . n 
B 1 206 ILE 206 206 206 ILE ILE B . n 
B 1 207 LEU 207 207 207 LEU LEU B . n 
B 1 208 ASP 208 208 208 ASP ASP B . n 
B 1 209 LYS 209 209 209 LYS LYS B . n 
B 1 210 LYS 210 210 210 LYS LYS B . n 
B 1 211 LYS 211 211 211 LYS ALA B . n 
B 1 212 ASN 212 212 212 ASN ALA B . n 
B 1 213 LYS 213 213 213 LYS LYS B . n 
B 1 214 PHE 214 214 214 PHE PHE B . n 
B 1 215 ILE 215 215 215 ILE ILE B . n 
B 1 216 VAL 216 216 216 VAL VAL B . n 
B 1 217 TYR 217 217 217 TYR TYR B . n 
B 1 218 ASN 218 218 218 ASN ASN B . n 
B 1 219 LEU 219 219 219 LEU LEU B . n 
B 1 220 GLU 220 220 220 GLU GLU B . n 
B 1 221 GLU 221 221 221 GLU GLU B . n 
B 1 222 LEU 222 222 222 LEU LEU B . n 
B 1 223 LYS 223 223 223 LYS LYS B . n 
B 1 224 HIS 224 224 224 HIS HIS B . n 
B 1 225 LEU 225 225 225 LEU LEU B . n 
B 1 226 SER 226 226 226 SER SER B . n 
B 1 227 GLU 227 227 ?   ?   ?   B . n 
B 1 228 GLN 228 228 ?   ?   ?   B . n 
B 1 229 THR 229 229 ?   ?   ?   B . n 
B 1 230 SER 230 230 ?   ?   ?   B . n 
B 1 231 TYR 231 231 ?   ?   ?   B . n 
B 1 232 TYR 232 232 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5550  ? 
1 MORE         -34   ? 
1 'SSA (A^2)'  19620 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-07-04 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 44.7169 -20.0778 30.1483 0.0746  0.0385  -0.1169 0.1255  0.0183  0.0942 5.8450 1.0443 6.6189 0.4130  5.0098 -0.9337 
-0.1922 -0.7566 -0.2873 0.4880 0.1879 0.1626  -0.0355 -0.2201 0.0043  'X-RAY DIFFRACTION' 
2 ? refined 57.6133 -9.3626  22.3074 0.2056  0.2705  -0.0345 -0.0764 -0.1276 0.0295 3.7645 1.7470 1.3546 2.5256  0.3634 0.5073  
-0.2255 0.1163  0.1223  0.1391 0.0457 -0.5433 -0.6735 0.4267  0.1798  'X-RAY DIFFRACTION' 
3 ? refined 21.7009 -3.1275  2.1532  -0.2025 -0.2679 -0.1444 0.0275  0.0584  0.0380 8.4577 3.2661 3.2528 -0.7892 2.6295 0.1246  
-0.2058 -0.2183 0.6134  0.3420 0.0139 -0.0219 -0.2024 -0.1016 0.1920  'X-RAY DIFFRACTION' 
4 ? refined 16.8477 -31.7628 12.2682 -0.0467 -0.1103 -0.2028 -0.0328 0.0900  0.0680 5.9504 3.0812 1.0446 -0.0029 0.6314 -0.3078 
-0.0221 -0.3346 -0.7759 0.5338 0.2494 -0.0990 0.2398  -0.0580 -0.2273 'X-RAY DIFFRACTION' 
5 ? refined 9.4195  -16.9416 3.7806  -0.2127 -0.0876 -0.3669 -0.0098 0.1463  0.0900 5.2136 3.1931 0.2792 -0.7217 0.9750 0.4124  
0.1196  -0.2700 -0.0304 0.1355 0.1225 0.3629  0.0679  -0.2644 -0.2421 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 140 A 140 A 222 A 222 ? 'X-RAY DIFFRACTION' ? 
2 2 B 140 B 140 B 222 B 222 ? 'X-RAY DIFFRACTION' ? 
3 3 A 19  A 19  A 108 A 108 ? 'X-RAY DIFFRACTION' ? 
4 4 B 19  B 19  B 108 B 108 ? 'X-RAY DIFFRACTION' ? 
5 5 B 109 B 109 B 136 B 136 ? 'X-RAY DIFFRACTION' ? 
6 5 A 109 A 109 A 136 A 136 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC       refinement       5.2.0005       ? 1 
CrystalClear 'data reduction' '(MSC/RIGAKU)' ? 2 
DENZO        'data reduction' .              ? 3 
SCALEPACK    'data scaling'   .              ? 4 
PHASER       phasing          .              ? 5 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
THE SEQUENCE OF THE PROTEIN WAS NOT AVAILABLE IN ANY
UNIPROT SEQUENCE DATABASE AT THE TIME OF PROCESSING
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   THR 
_pdbx_validate_close_contact.auth_seq_id_1    90 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ASN 
_pdbx_validate_close_contact.auth_seq_id_2    92 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.11 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB B ILE 84  ? ? CA B ILE 84  ? ? C  B ILE 84  ? ? 98.55  111.60 -13.05 2.00 N 
2 1 N  B ASN 145 ? ? CA B ASN 145 ? ? C  B ASN 145 ? ? 89.00  111.00 -22.00 2.70 N 
3 1 C  B ASN 148 ? ? N  B PRO 149 ? ? CA B PRO 149 ? ? 145.80 127.00 18.80  2.40 Y 
4 1 C  B ASN 148 ? ? N  B PRO 149 ? ? CD B PRO 149 ? ? 102.48 120.60 -18.12 2.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 20  ? ? 56.51   73.77  
2  1 LYS A 24  ? ? -49.07  -16.17 
3  1 ASN A 27  ? ? -52.30  -5.44  
4  1 ASP A 30  ? ? -59.51  -6.11  
5  1 PRO A 46  ? ? -48.48  152.54 
6  1 THR A 51  ? ? -143.93 26.57  
7  1 GLU A 68  ? ? -49.06  -6.74  
8  1 LYS A 73  ? ? 174.85  139.58 
9  1 LEU A 75  ? ? -126.63 -59.74 
10 1 THR A 90  ? ? -114.30 75.86  
11 1 TYR A 95  ? ? -163.33 94.06  
12 1 ASP A 119 ? ? -161.31 108.35 
13 1 SER A 163 ? ? 171.92  -25.83 
14 1 THR A 175 ? ? -103.40 79.59  
15 1 LEU A 178 ? ? -160.30 93.90  
16 1 GLU A 204 ? ? -69.55  12.85  
17 1 ASN A 218 ? ? -161.21 61.18  
18 1 ASN B 27  ? ? -52.01  -9.74  
19 1 PRO B 46  ? ? -48.90  151.28 
20 1 LEU B 75  ? ? -124.91 -59.44 
21 1 ILE B 144 ? ? 175.10  142.58 
22 1 THR B 146 ? ? -39.80  129.68 
23 1 SER B 163 ? ? 142.61  -18.65 
24 1 ARG B 167 ? ? -66.30  99.25  
25 1 LEU B 178 ? ? -161.73 90.39  
26 1 LEU B 207 ? ? -175.92 145.49 
27 1 ASN B 218 ? ? -164.13 67.92  
28 1 LEU B 225 ? ? -61.91  56.34  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ILE B 144 ? ? ASN B 145 ? ? -98.31  
2 1 TYR B 147 ? ? ASN B 148 ? ? -139.34 
3 1 ASN B 148 ? ? PRO B 149 ? ? -60.18  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 24  ? CG  ? A LYS 24  CG  
2  1 Y 1 A LYS 24  ? CD  ? A LYS 24  CD  
3  1 Y 1 A LYS 24  ? CE  ? A LYS 24  CE  
4  1 Y 1 A LYS 24  ? NZ  ? A LYS 24  NZ  
5  1 Y 1 A ILE 33  ? CD1 ? A ILE 33  CD1 
6  1 Y 1 A GLU 48  ? CB  ? A GLU 48  CB  
7  1 Y 1 A GLU 48  ? CG  ? A GLU 48  CG  
8  1 Y 1 A GLU 48  ? CD  ? A GLU 48  CD  
9  1 Y 1 A GLU 48  ? OE1 ? A GLU 48  OE1 
10 1 Y 1 A GLU 48  ? OE2 ? A GLU 48  OE2 
11 1 Y 1 A ASP 49  ? CG  ? A ASP 49  CG  
12 1 Y 1 A ASP 49  ? OD1 ? A ASP 49  OD1 
13 1 Y 1 A ASP 49  ? OD2 ? A ASP 49  OD2 
14 1 Y 1 A LYS 62  ? CG  ? A LYS 62  CG  
15 1 Y 1 A LYS 62  ? CD  ? A LYS 62  CD  
16 1 Y 1 A LYS 62  ? CE  ? A LYS 62  CE  
17 1 Y 1 A LYS 62  ? NZ  ? A LYS 62  NZ  
18 1 Y 1 A ARG 86  ? CG  ? A ARG 86  CG  
19 1 Y 1 A ARG 86  ? CD  ? A ARG 86  CD  
20 1 Y 1 A ARG 86  ? NE  ? A ARG 86  NE  
21 1 Y 1 A ARG 86  ? CZ  ? A ARG 86  CZ  
22 1 Y 1 A ARG 86  ? NH1 ? A ARG 86  NH1 
23 1 Y 1 A ARG 86  ? NH2 ? A ARG 86  NH2 
24 1 Y 1 A GLU 110 ? CG  ? A GLU 110 CG  
25 1 Y 1 A GLU 110 ? CD  ? A GLU 110 CD  
26 1 Y 1 A GLU 110 ? OE1 ? A GLU 110 OE1 
27 1 Y 1 A GLU 110 ? OE2 ? A GLU 110 OE2 
28 1 Y 1 A LYS 203 ? CG  ? A LYS 203 CG  
29 1 Y 1 A LYS 203 ? CD  ? A LYS 203 CD  
30 1 Y 1 A LYS 203 ? CE  ? A LYS 203 CE  
31 1 Y 1 A LYS 203 ? NZ  ? A LYS 203 NZ  
32 1 Y 1 A LYS 211 ? CG  ? A LYS 211 CG  
33 1 Y 1 A LYS 211 ? CD  ? A LYS 211 CD  
34 1 Y 1 A LYS 211 ? CE  ? A LYS 211 CE  
35 1 Y 1 A LYS 211 ? NZ  ? A LYS 211 NZ  
36 1 Y 1 A LYS 213 ? CE  ? A LYS 213 CE  
37 1 Y 1 A LYS 213 ? NZ  ? A LYS 213 NZ  
38 1 Y 1 A GLU 220 ? CB  ? A GLU 220 CB  
39 1 Y 1 A GLU 220 ? CG  ? A GLU 220 CG  
40 1 Y 1 A GLU 220 ? CD  ? A GLU 220 CD  
41 1 Y 1 A GLU 220 ? OE1 ? A GLU 220 OE1 
42 1 Y 1 A GLU 220 ? OE2 ? A GLU 220 OE2 
43 1 Y 1 B LYS 24  ? CG  ? B LYS 24  CG  
44 1 Y 1 B LYS 24  ? CD  ? B LYS 24  CD  
45 1 Y 1 B LYS 24  ? CE  ? B LYS 24  CE  
46 1 Y 1 B LYS 24  ? NZ  ? B LYS 24  NZ  
47 1 Y 1 B ILE 33  ? CD1 ? B ILE 33  CD1 
48 1 Y 1 B LYS 128 ? CG  ? B LYS 128 CG  
49 1 Y 1 B LYS 128 ? CD  ? B LYS 128 CD  
50 1 Y 1 B LYS 128 ? CE  ? B LYS 128 CE  
51 1 Y 1 B LYS 128 ? NZ  ? B LYS 128 NZ  
52 1 Y 1 B ASN 145 ? CG  ? B ASN 145 CG  
53 1 Y 1 B ASN 145 ? OD1 ? B ASN 145 OD1 
54 1 Y 1 B ASN 145 ? ND2 ? B ASN 145 ND2 
55 1 Y 1 B THR 146 ? OG1 ? B THR 146 OG1 
56 1 Y 1 B THR 146 ? CG2 ? B THR 146 CG2 
57 1 Y 1 B TYR 147 ? CG  ? B TYR 147 CG  
58 1 Y 1 B TYR 147 ? CD1 ? B TYR 147 CD1 
59 1 Y 1 B TYR 147 ? CD2 ? B TYR 147 CD2 
60 1 Y 1 B TYR 147 ? CE1 ? B TYR 147 CE1 
61 1 Y 1 B TYR 147 ? CE2 ? B TYR 147 CE2 
62 1 Y 1 B TYR 147 ? CZ  ? B TYR 147 CZ  
63 1 Y 1 B TYR 147 ? OH  ? B TYR 147 OH  
64 1 Y 1 B LYS 166 ? CG  ? B LYS 166 CG  
65 1 Y 1 B LYS 166 ? CD  ? B LYS 166 CD  
66 1 Y 1 B LYS 166 ? CE  ? B LYS 166 CE  
67 1 Y 1 B LYS 166 ? NZ  ? B LYS 166 NZ  
68 1 Y 1 B ARG 167 ? CG  ? B ARG 167 CG  
69 1 Y 1 B ARG 167 ? CD  ? B ARG 167 CD  
70 1 Y 1 B ARG 167 ? NE  ? B ARG 167 NE  
71 1 Y 1 B ARG 167 ? CZ  ? B ARG 167 CZ  
72 1 Y 1 B ARG 167 ? NH1 ? B ARG 167 NH1 
73 1 Y 1 B ARG 167 ? NH2 ? B ARG 167 NH2 
74 1 Y 1 B LYS 196 ? CG  ? B LYS 196 CG  
75 1 Y 1 B LYS 196 ? CD  ? B LYS 196 CD  
76 1 Y 1 B LYS 196 ? CE  ? B LYS 196 CE  
77 1 Y 1 B LYS 196 ? NZ  ? B LYS 196 NZ  
78 1 Y 1 B LYS 203 ? CE  ? B LYS 203 CE  
79 1 Y 1 B LYS 203 ? NZ  ? B LYS 203 NZ  
80 1 Y 1 B LYS 211 ? CG  ? B LYS 211 CG  
81 1 Y 1 B LYS 211 ? CD  ? B LYS 211 CD  
82 1 Y 1 B LYS 211 ? CE  ? B LYS 211 CE  
83 1 Y 1 B LYS 211 ? NZ  ? B LYS 211 NZ  
84 1 Y 1 B ASN 212 ? CG  ? B ASN 212 CG  
85 1 Y 1 B ASN 212 ? OD1 ? B ASN 212 OD1 
86 1 Y 1 B ASN 212 ? ND2 ? B ASN 212 ND2 
87 1 Y 1 B LYS 213 ? CE  ? B LYS 213 CE  
88 1 Y 1 B LYS 213 ? NZ  ? B LYS 213 NZ  
89 1 Y 1 B GLU 220 ? CB  ? B GLU 220 CB  
90 1 Y 1 B GLU 220 ? CG  ? B GLU 220 CG  
91 1 Y 1 B GLU 220 ? CD  ? B GLU 220 CD  
92 1 Y 1 B GLU 220 ? OE1 ? B GLU 220 OE1 
93 1 Y 1 B GLU 220 ? OE2 ? B GLU 220 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A GLU 4   ? A GLU 4   
5  1 Y 1 A GLY 5   ? A GLY 5   
6  1 Y 1 A LEU 6   ? A LEU 6   
7  1 Y 1 A ASP 7   ? A ASP 7   
8  1 Y 1 A LYS 8   ? A LYS 8   
9  1 Y 1 A ASP 9   ? A ASP 9   
10 1 Y 1 A PHE 10  ? A PHE 10  
11 1 Y 1 A CYS 11  ? A CYS 11  
12 1 Y 1 A GLY 12  ? A GLY 12  
13 1 Y 1 A ALA 13  ? A ALA 13  
14 1 Y 1 A ILE 14  ? A ILE 14  
15 1 Y 1 A ILE 15  ? A ILE 15  
16 1 Y 1 A PRO 16  ? A PRO 16  
17 1 Y 1 A ASP 17  ? A ASP 17  
18 1 Y 1 A SER 18  ? A SER 18  
19 1 Y 1 A GLU 227 ? A GLU 227 
20 1 Y 1 A GLN 228 ? A GLN 228 
21 1 Y 1 A THR 229 ? A THR 229 
22 1 Y 1 A SER 230 ? A SER 230 
23 1 Y 1 A TYR 231 ? A TYR 231 
24 1 Y 1 A TYR 232 ? A TYR 232 
25 1 Y 1 B MET 1   ? B MET 1   
26 1 Y 1 B SER 2   ? B SER 2   
27 1 Y 1 B ALA 3   ? B ALA 3   
28 1 Y 1 B GLU 4   ? B GLU 4   
29 1 Y 1 B GLY 5   ? B GLY 5   
30 1 Y 1 B LEU 6   ? B LEU 6   
31 1 Y 1 B ASP 7   ? B ASP 7   
32 1 Y 1 B LYS 8   ? B LYS 8   
33 1 Y 1 B ASP 9   ? B ASP 9   
34 1 Y 1 B PHE 10  ? B PHE 10  
35 1 Y 1 B CYS 11  ? B CYS 11  
36 1 Y 1 B GLY 12  ? B GLY 12  
37 1 Y 1 B ALA 13  ? B ALA 13  
38 1 Y 1 B ILE 14  ? B ILE 14  
39 1 Y 1 B ILE 15  ? B ILE 15  
40 1 Y 1 B PRO 16  ? B PRO 16  
41 1 Y 1 B ASP 17  ? B ASP 17  
42 1 Y 1 B SER 18  ? B SER 18  
43 1 Y 1 B GLU 227 ? B GLU 227 
44 1 Y 1 B GLN 228 ? B GLN 228 
45 1 Y 1 B THR 229 ? B THR 229 
46 1 Y 1 B SER 230 ? B SER 230 
47 1 Y 1 B TYR 231 ? B TYR 231 
48 1 Y 1 B TYR 232 ? B TYR 232 
#