data_2H7C
# 
_entry.id   2H7C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2H7C         
RCSB  RCSB038020   
WWPDB D_1000038020 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1MX1 'The same protein complexed with tacrine.'                               unspecified 
PDB 1MX5 'The same protein complexed with cocaine analog, homatropine.'           unspecified 
PDB 1MX9 'The same protein complexed with heroin analog, naloxone.'               unspecified 
PDB 1YA4 'The same protein complexed with tamoxifen.'                             unspecified 
PDB 1YA8 'The same protein complexed with product of mevastatin.'                 unspecified 
PDB 1YAH 'The same protein complexed with ethyl acetate'                          unspecified 
PDB 2DQY 'The Same protein complexed with cholate and palmitate'                  unspecified 
PDB 2DQZ 'The Same protein complexed with homatropine, coenzyme A, and palmitate' unspecified 
PDB 2DR0 'The Same protein complexed with taurocholate'                           unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2H7C 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bencharit, S.'         1 
'Edwards, C.C.'         2 
'Morton, C.L.'          3 
'Howard-Williams, E.L.' 4 
'Potter, P.M.'          5 
'Redinbo, M.R.'         6 
# 
_citation.id                        primary 
_citation.title                     'Multisite promiscuity in the processing of endogenous substrates by human carboxylesterase 1' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            363 
_citation.page_first                201 
_citation.page_last                 214 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16962139 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2006.08.025 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bencharit, S.'         1 ? 
primary 'Edwards, C.C.'         2 ? 
primary 'Morton, C.L.'          3 ? 
primary 'Howard-Williams, E.L.' 4 ? 
primary 'Kuhn, P.'              5 ? 
primary 'Potter, P.M.'          6 ? 
primary 'Redinbo, M.R.'         7 ? 
# 
_cell.entry_id           2H7C 
_cell.length_a           88.990 
_cell.length_b           115.370 
_cell.length_c           175.530 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.05 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2H7C 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Liver carboxylesterase 1'                                                                59787.527 6    3.1.1.1 
? 'RESIDUES 19-561' ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2    ?       
? ?                 ? 
3 non-polymer syn 'SULFATE ION'                                                                             96.063    12   ?       
? ?                 ? 
4 non-polymer syn 'COENZYME A'                                                                              767.534   6    ?       
? ?                 ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208   4    ?       
? ?                 ? 
6 non-polymer man 'N-acetyl-alpha-neuraminic acid'                                                          309.270   2    ?       
? ?                 ? 
7 water       nat water                                                                                     18.015    2715 ?       
? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Acyl coenzyme A:cholesterol acyltransferase, ACAT, Monocyte/macrophage serine esterase, HMSE, Serine esterase 1, Brain carboxylesterase hBr1, Triacylglycerol hydrolase, TGH, Egasyn
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLS
ELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFF
STGDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKK
GDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAE
RNFHTVPYMVGINKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLD
LIADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKF
WANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLS
ELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFF
STGDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKK
GDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAE
RNFHTVPYMVGINKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLD
LIADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKF
WANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   PRO n 
1 3   SER n 
1 4   SER n 
1 5   PRO n 
1 6   PRO n 
1 7   VAL n 
1 8   VAL n 
1 9   ASP n 
1 10  THR n 
1 11  VAL n 
1 12  HIS n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  LEU n 
1 17  GLY n 
1 18  LYS n 
1 19  PHE n 
1 20  VAL n 
1 21  SER n 
1 22  LEU n 
1 23  GLU n 
1 24  GLY n 
1 25  PHE n 
1 26  ALA n 
1 27  GLN n 
1 28  PRO n 
1 29  VAL n 
1 30  ALA n 
1 31  ILE n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  LYS n 
1 40  PRO n 
1 41  PRO n 
1 42  LEU n 
1 43  GLY n 
1 44  PRO n 
1 45  LEU n 
1 46  ARG n 
1 47  PHE n 
1 48  THR n 
1 49  PRO n 
1 50  PRO n 
1 51  GLN n 
1 52  PRO n 
1 53  ALA n 
1 54  GLU n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  PHE n 
1 59  VAL n 
1 60  LYS n 
1 61  ASN n 
1 62  ALA n 
1 63  THR n 
1 64  SER n 
1 65  TYR n 
1 66  PRO n 
1 67  PRO n 
1 68  MET n 
1 69  CYS n 
1 70  THR n 
1 71  GLN n 
1 72  ASP n 
1 73  PRO n 
1 74  LYS n 
1 75  ALA n 
1 76  GLY n 
1 77  GLN n 
1 78  LEU n 
1 79  LEU n 
1 80  SER n 
1 81  GLU n 
1 82  LEU n 
1 83  PHE n 
1 84  THR n 
1 85  ASN n 
1 86  ARG n 
1 87  LYS n 
1 88  GLU n 
1 89  ASN n 
1 90  ILE n 
1 91  PRO n 
1 92  LEU n 
1 93  LYS n 
1 94  LEU n 
1 95  SER n 
1 96  GLU n 
1 97  ASP n 
1 98  CYS n 
1 99  LEU n 
1 100 TYR n 
1 101 LEU n 
1 102 ASN n 
1 103 ILE n 
1 104 TYR n 
1 105 THR n 
1 106 PRO n 
1 107 ALA n 
1 108 ASP n 
1 109 LEU n 
1 110 THR n 
1 111 LYS n 
1 112 LYS n 
1 113 ASN n 
1 114 ARG n 
1 115 LEU n 
1 116 PRO n 
1 117 VAL n 
1 118 MET n 
1 119 VAL n 
1 120 TRP n 
1 121 ILE n 
1 122 HIS n 
1 123 GLY n 
1 124 GLY n 
1 125 GLY n 
1 126 LEU n 
1 127 MET n 
1 128 VAL n 
1 129 GLY n 
1 130 ALA n 
1 131 ALA n 
1 132 SER n 
1 133 THR n 
1 134 TYR n 
1 135 ASP n 
1 136 GLY n 
1 137 LEU n 
1 138 ALA n 
1 139 LEU n 
1 140 ALA n 
1 141 ALA n 
1 142 HIS n 
1 143 GLU n 
1 144 ASN n 
1 145 VAL n 
1 146 VAL n 
1 147 VAL n 
1 148 VAL n 
1 149 THR n 
1 150 ILE n 
1 151 GLN n 
1 152 TYR n 
1 153 ARG n 
1 154 LEU n 
1 155 GLY n 
1 156 ILE n 
1 157 TRP n 
1 158 GLY n 
1 159 PHE n 
1 160 PHE n 
1 161 SER n 
1 162 THR n 
1 163 GLY n 
1 164 ASP n 
1 165 GLU n 
1 166 HIS n 
1 167 SER n 
1 168 ARG n 
1 169 GLY n 
1 170 ASN n 
1 171 TRP n 
1 172 GLY n 
1 173 HIS n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 VAL n 
1 178 ALA n 
1 179 ALA n 
1 180 LEU n 
1 181 ARG n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 ASP n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 SER n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASN n 
1 194 PRO n 
1 195 GLY n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 ILE n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 GLY n 
1 207 GLU n 
1 208 SER n 
1 209 VAL n 
1 210 SER n 
1 211 VAL n 
1 212 LEU n 
1 213 VAL n 
1 214 LEU n 
1 215 SER n 
1 216 PRO n 
1 217 LEU n 
1 218 ALA n 
1 219 LYS n 
1 220 ASN n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 ILE n 
1 227 SER n 
1 228 GLU n 
1 229 SER n 
1 230 GLY n 
1 231 VAL n 
1 232 ALA n 
1 233 LEU n 
1 234 THR n 
1 235 SER n 
1 236 VAL n 
1 237 LEU n 
1 238 VAL n 
1 239 LYS n 
1 240 LYS n 
1 241 GLY n 
1 242 ASP n 
1 243 VAL n 
1 244 LYS n 
1 245 PRO n 
1 246 LEU n 
1 247 ALA n 
1 248 GLU n 
1 249 GLN n 
1 250 ILE n 
1 251 ALA n 
1 252 ILE n 
1 253 THR n 
1 254 ALA n 
1 255 GLY n 
1 256 CYS n 
1 257 LYS n 
1 258 THR n 
1 259 THR n 
1 260 THR n 
1 261 SER n 
1 262 ALA n 
1 263 VAL n 
1 264 MET n 
1 265 VAL n 
1 266 HIS n 
1 267 CYS n 
1 268 LEU n 
1 269 ARG n 
1 270 GLN n 
1 271 LYS n 
1 272 THR n 
1 273 GLU n 
1 274 GLU n 
1 275 GLU n 
1 276 LEU n 
1 277 LEU n 
1 278 GLU n 
1 279 THR n 
1 280 THR n 
1 281 LEU n 
1 282 LYS n 
1 283 MET n 
1 284 LYS n 
1 285 PHE n 
1 286 LEU n 
1 287 SER n 
1 288 LEU n 
1 289 ASP n 
1 290 LEU n 
1 291 GLN n 
1 292 GLY n 
1 293 ASP n 
1 294 PRO n 
1 295 ARG n 
1 296 GLU n 
1 297 SER n 
1 298 GLN n 
1 299 PRO n 
1 300 LEU n 
1 301 LEU n 
1 302 GLY n 
1 303 THR n 
1 304 VAL n 
1 305 ILE n 
1 306 ASP n 
1 307 GLY n 
1 308 MET n 
1 309 LEU n 
1 310 LEU n 
1 311 LEU n 
1 312 LYS n 
1 313 THR n 
1 314 PRO n 
1 315 GLU n 
1 316 GLU n 
1 317 LEU n 
1 318 GLN n 
1 319 ALA n 
1 320 GLU n 
1 321 ARG n 
1 322 ASN n 
1 323 PHE n 
1 324 HIS n 
1 325 THR n 
1 326 VAL n 
1 327 PRO n 
1 328 TYR n 
1 329 MET n 
1 330 VAL n 
1 331 GLY n 
1 332 ILE n 
1 333 ASN n 
1 334 LYS n 
1 335 GLN n 
1 336 GLU n 
1 337 PHE n 
1 338 GLY n 
1 339 TRP n 
1 340 LEU n 
1 341 ILE n 
1 342 PRO n 
1 343 MET n 
1 344 LEU n 
1 345 MET n 
1 346 SER n 
1 347 TYR n 
1 348 PRO n 
1 349 LEU n 
1 350 SER n 
1 351 GLU n 
1 352 GLY n 
1 353 GLN n 
1 354 LEU n 
1 355 ASP n 
1 356 GLN n 
1 357 LYS n 
1 358 THR n 
1 359 ALA n 
1 360 MET n 
1 361 SER n 
1 362 LEU n 
1 363 LEU n 
1 364 TRP n 
1 365 LYS n 
1 366 SER n 
1 367 TYR n 
1 368 PRO n 
1 369 LEU n 
1 370 VAL n 
1 371 CYS n 
1 372 ILE n 
1 373 ALA n 
1 374 LYS n 
1 375 GLU n 
1 376 LEU n 
1 377 ILE n 
1 378 PRO n 
1 379 GLU n 
1 380 ALA n 
1 381 THR n 
1 382 GLU n 
1 383 LYS n 
1 384 TYR n 
1 385 LEU n 
1 386 GLY n 
1 387 GLY n 
1 388 THR n 
1 389 ASP n 
1 390 ASP n 
1 391 THR n 
1 392 VAL n 
1 393 LYS n 
1 394 LYS n 
1 395 LYS n 
1 396 ASP n 
1 397 LEU n 
1 398 PHE n 
1 399 LEU n 
1 400 ASP n 
1 401 LEU n 
1 402 ILE n 
1 403 ALA n 
1 404 ASP n 
1 405 VAL n 
1 406 MET n 
1 407 PHE n 
1 408 GLY n 
1 409 VAL n 
1 410 PRO n 
1 411 SER n 
1 412 VAL n 
1 413 ILE n 
1 414 VAL n 
1 415 ALA n 
1 416 ARG n 
1 417 ASN n 
1 418 HIS n 
1 419 ARG n 
1 420 ASP n 
1 421 ALA n 
1 422 GLY n 
1 423 ALA n 
1 424 PRO n 
1 425 THR n 
1 426 TYR n 
1 427 MET n 
1 428 TYR n 
1 429 GLU n 
1 430 PHE n 
1 431 GLN n 
1 432 TYR n 
1 433 ARG n 
1 434 PRO n 
1 435 SER n 
1 436 PHE n 
1 437 SER n 
1 438 SER n 
1 439 ASP n 
1 440 MET n 
1 441 LYS n 
1 442 PRO n 
1 443 LYS n 
1 444 THR n 
1 445 VAL n 
1 446 ILE n 
1 447 GLY n 
1 448 ASP n 
1 449 HIS n 
1 450 GLY n 
1 451 ASP n 
1 452 GLU n 
1 453 LEU n 
1 454 PHE n 
1 455 SER n 
1 456 VAL n 
1 457 PHE n 
1 458 GLY n 
1 459 ALA n 
1 460 PRO n 
1 461 PHE n 
1 462 LEU n 
1 463 LYS n 
1 464 GLU n 
1 465 GLY n 
1 466 ALA n 
1 467 SER n 
1 468 GLU n 
1 469 GLU n 
1 470 GLU n 
1 471 ILE n 
1 472 ARG n 
1 473 LEU n 
1 474 SER n 
1 475 LYS n 
1 476 MET n 
1 477 VAL n 
1 478 MET n 
1 479 LYS n 
1 480 PHE n 
1 481 TRP n 
1 482 ALA n 
1 483 ASN n 
1 484 PHE n 
1 485 ALA n 
1 486 ARG n 
1 487 ASN n 
1 488 GLY n 
1 489 ASN n 
1 490 PRO n 
1 491 ASN n 
1 492 GLY n 
1 493 GLU n 
1 494 GLY n 
1 495 LEU n 
1 496 PRO n 
1 497 HIS n 
1 498 TRP n 
1 499 PRO n 
1 500 GLU n 
1 501 TYR n 
1 502 ASN n 
1 503 GLN n 
1 504 LYS n 
1 505 GLU n 
1 506 GLY n 
1 507 TYR n 
1 508 LEU n 
1 509 GLN n 
1 510 ILE n 
1 511 GLY n 
1 512 ALA n 
1 513 ASN n 
1 514 THR n 
1 515 GLN n 
1 516 ALA n 
1 517 ALA n 
1 518 GLN n 
1 519 LYS n 
1 520 LEU n 
1 521 LYS n 
1 522 ASP n 
1 523 LYS n 
1 524 GLU n 
1 525 VAL n 
1 526 ALA n 
1 527 PHE n 
1 528 TRP n 
1 529 THR n 
1 530 ASN n 
1 531 LEU n 
1 532 PHE n 
1 533 ALA n 
1 534 LYS n 
1 535 LYS n 
1 536 ALA n 
1 537 VAL n 
1 538 GLU n 
1 539 LYS n 
1 540 PRO n 
1 541 PRO n 
1 542 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            sf9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    EST1_HUMAN 
_struct_ref.pdbx_db_accession          P23141 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           19 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2H7C A 1 ? 542 ? P23141 19 ? 561 ? 1019 1561 
2 1 2H7C B 1 ? 542 ? P23141 19 ? 561 ? 2019 2561 
3 1 2H7C C 1 ? 542 ? P23141 19 ? 561 ? 3019 3561 
4 1 2H7C D 1 ? 542 ? P23141 19 ? 561 ? 4019 4561 
5 1 2H7C E 1 ? 542 ? P23141 19 ? 561 ? 5019 5561 
6 1 2H7C F 1 ? 542 ? P23141 19 ? 561 ? 6019 6561 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2H7C ? A ? ? UNP P23141 GLN 362 deletion ? 1 
2 2H7C ? B ? ? UNP P23141 GLN 362 deletion ? 2 
3 2H7C ? C ? ? UNP P23141 GLN 362 deletion ? 3 
4 2H7C ? D ? ? UNP P23141 GLN 362 deletion ? 4 
5 2H7C ? E ? ? UNP P23141 GLN 362 deletion ? 5 
6 2H7C ? F ? ? UNP P23141 GLN 362 deletion ? 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'          133.103 
COA non-polymer                   . 'COENZYME A'                             ? 'C21 H36 N7 O16 P3 S' 767.534 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'                18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'       149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'         221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'          105.093 
SIA 'D-saccharide, alpha linking' . 'N-acetyl-alpha-neuraminic acid'         ? 'C11 H19 N O9'        309.270 
SO4 non-polymer                   . 'SULFATE ION'                            ? 'O4 S -2'             96.063  
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'         117.146 
# 
_exptl.entry_id          2H7C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.density_percent_sol   51.00 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
;8% PEG 3350, 0.4M Li2SO4, 0.1M NaCl, 0.1M LiCl, 0.1M citrate (pH 5.5), 5% glycerol, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2001-03-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2H7C 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   233023 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.082 
_reflns.pdbx_netI_over_sigmaI        12.7 
_reflns.B_iso_Wilson_estimate        15.5 
_reflns.pdbx_redundancy              7.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.13 
_reflns_shell.percent_possible_all   88.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.335 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2H7C 
_refine.ls_number_reflns_obs                     232335 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               3374696.62 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.10 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    97.1 
_refine.ls_R_factor_obs                          0.183 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.183 
_refine.ls_R_factor_R_free                       0.221 
_refine.ls_R_factor_R_free_error                 0.002 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  11633 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               28.4 
_refine.aniso_B[1][1]                            -1.51 
_refine.aniso_B[2][2]                            -3.19 
_refine.aniso_B[3][3]                            4.69 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.362937 
_refine.solvent_model_param_bsol                 48.2004 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1MX1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2H7C 
_refine_analyze.Luzzati_coordinate_error_obs    0.21 
_refine_analyze.Luzzati_sigma_a_obs             0.19 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.26 
_refine_analyze.Luzzati_sigma_a_free            0.22 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        24726 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         502 
_refine_hist.number_atoms_solvent             2715 
_refine_hist.number_atoms_total               27943 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        29.10 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.78  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.36  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.09  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.17  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.25  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             33146 
_refine_ls_shell.R_factor_R_work                  0.241 
_refine_ls_shell.percent_reflns_obs               88.1 
_refine_ls_shell.R_factor_R_free                  0.275 
_refine_ls_shell.R_factor_R_free_error            0.007 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             1771 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param  protein.top      'X-RAY DIFFRACTION' 
2 carbohydrate.param carbohydrate.top 'X-RAY DIFFRACTION' 
3 water_rep.param    water.top        'X-RAY DIFFRACTION' 
4 ion.param          ion.top          'X-RAY DIFFRACTION' 
5 coa.param          coa.top          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2H7C 
_struct.title                     'Crystal structure of human carboxylesterase in complex with Coenzyme A' 
_struct.pdbx_descriptor           'Liver carboxylesterase 1 (E.C.3.1.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2H7C 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'enzyme, esterase, cholesteryl esterase, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 4 ? 
L  N N 5 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 4 ? 
P  N N 5 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 5 ? 
U  N N 6 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 4 ? 
Z  N N 5 ? 
AA N N 6 ? 
BA N N 3 ? 
CA N N 4 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 4 ? 
GA N N 7 ? 
HA N N 7 ? 
IA N N 7 ? 
JA N N 7 ? 
KA N N 7 ? 
LA N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   LEU A 42  ? ARG A 46  ? LEU A 1060 ARG A 1064 5 ? 5  
HELX_P HELX_P2   2   ASP A 72  ? THR A 84  ? ASP A 1090 THR A 1102 1 ? 13 
HELX_P HELX_P3   3   GLY A 136 ? ASN A 144 ? GLY A 1154 ASN A 1162 1 ? 9  
HELX_P HELX_P4   4   LEU A 154 ? PHE A 160 ? LEU A 1172 PHE A 1178 1 ? 7  
HELX_P HELX_P5   5   ASN A 170 ? ILE A 187 ? ASN A 1188 ILE A 1205 1 ? 18 
HELX_P HELX_P6   6   ALA A 188 ? PHE A 190 ? ALA A 1206 PHE A 1208 5 ? 3  
HELX_P HELX_P7   7   SER A 203 ? SER A 215 ? SER A 1221 SER A 1233 1 ? 13 
HELX_P HELX_P8   8   PRO A 216 ? LYS A 219 ? PRO A 1234 LYS A 1237 5 ? 4  
HELX_P HELX_P9   9   THR A 234 ? VAL A 238 ? THR A 1252 VAL A 1256 5 ? 5  
HELX_P HELX_P10  10  VAL A 243 ? ALA A 254 ? VAL A 1261 ALA A 1272 1 ? 12 
HELX_P HELX_P11  11  THR A 260 ? LYS A 271 ? THR A 1278 LYS A 1289 1 ? 12 
HELX_P HELX_P12  12  THR A 272 ? LYS A 284 ? THR A 1290 LYS A 1302 1 ? 13 
HELX_P HELX_P13  13  ASP A 293 ? SER A 297 ? ASP A 1311 SER A 1315 5 ? 5  
HELX_P HELX_P14  14  THR A 313 ? GLN A 318 ? THR A 1331 GLN A 1336 1 ? 6  
HELX_P HELX_P15  15  TRP A 339 ? MET A 345 ? TRP A 1357 MET A 1364 1 ? 7  
HELX_P HELX_P16  16  ASP A 355 ? SER A 366 ? ASP A 1374 SER A 1385 1 ? 12 
HELX_P HELX_P17  17  SER A 366 ? CYS A 371 ? SER A 1385 CYS A 1390 1 ? 6  
HELX_P HELX_P18  18  ALA A 373 ? GLU A 375 ? ALA A 1392 GLU A 1394 5 ? 3  
HELX_P HELX_P19  19  LEU A 376 ? GLY A 386 ? LEU A 1395 GLY A 1405 1 ? 11 
HELX_P HELX_P20  20  ASP A 390 ? PHE A 407 ? ASP A 1409 PHE A 1426 1 ? 18 
HELX_P HELX_P21  21  PHE A 407 ? ALA A 421 ? PHE A 1426 ALA A 1440 1 ? 15 
HELX_P HELX_P22  22  GLU A 452 ? PHE A 457 ? GLU A 1471 PHE A 1476 1 ? 6  
HELX_P HELX_P23  23  GLY A 458 ? LEU A 462 ? GLY A 1477 LEU A 1481 5 ? 5  
HELX_P HELX_P24  24  SER A 467 ? GLY A 488 ? SER A 1486 GLY A 1507 1 ? 22 
HELX_P HELX_P25  25  LYS A 521 ? LYS A 534 ? LYS A 1540 LYS A 1553 1 ? 14 
HELX_P HELX_P26  26  LEU B 42  ? ARG B 46  ? LEU B 2060 ARG B 2064 5 ? 5  
HELX_P HELX_P27  27  ASP B 72  ? THR B 84  ? ASP B 2090 THR B 2102 1 ? 13 
HELX_P HELX_P28  28  ALA B 130 ? TYR B 134 ? ALA B 2148 TYR B 2152 5 ? 5  
HELX_P HELX_P29  29  GLY B 136 ? ASN B 144 ? GLY B 2154 ASN B 2162 1 ? 9  
HELX_P HELX_P30  30  LEU B 154 ? PHE B 160 ? LEU B 2172 PHE B 2178 1 ? 7  
HELX_P HELX_P31  31  ASN B 170 ? ILE B 187 ? ASN B 2188 ILE B 2205 1 ? 18 
HELX_P HELX_P32  32  ALA B 188 ? PHE B 190 ? ALA B 2206 PHE B 2208 5 ? 3  
HELX_P HELX_P33  33  SER B 203 ? LEU B 214 ? SER B 2221 LEU B 2232 1 ? 12 
HELX_P HELX_P34  34  SER B 215 ? LYS B 219 ? SER B 2233 LYS B 2237 5 ? 5  
HELX_P HELX_P35  35  THR B 234 ? VAL B 236 ? THR B 2252 VAL B 2254 5 ? 3  
HELX_P HELX_P36  36  VAL B 243 ? GLY B 255 ? VAL B 2261 GLY B 2273 1 ? 13 
HELX_P HELX_P37  37  THR B 260 ? LYS B 271 ? THR B 2278 LYS B 2289 1 ? 12 
HELX_P HELX_P38  38  THR B 272 ? LYS B 284 ? THR B 2290 LYS B 2302 1 ? 13 
HELX_P HELX_P39  39  ASP B 293 ? SER B 297 ? ASP B 2311 SER B 2315 5 ? 5  
HELX_P HELX_P40  40  THR B 313 ? GLU B 320 ? THR B 2331 GLU B 2338 1 ? 8  
HELX_P HELX_P41  41  TRP B 339 ? MET B 345 ? TRP B 2357 MET B 2364 1 ? 7  
HELX_P HELX_P42  42  ASP B 355 ? SER B 366 ? ASP B 2374 SER B 2385 1 ? 12 
HELX_P HELX_P43  43  SER B 366 ? CYS B 371 ? SER B 2385 CYS B 2390 1 ? 6  
HELX_P HELX_P44  44  ALA B 373 ? GLU B 375 ? ALA B 2392 GLU B 2394 5 ? 3  
HELX_P HELX_P45  45  LEU B 376 ? GLY B 386 ? LEU B 2395 GLY B 2405 1 ? 11 
HELX_P HELX_P46  46  ASP B 390 ? PHE B 407 ? ASP B 2409 PHE B 2426 1 ? 18 
HELX_P HELX_P47  47  PHE B 407 ? ALA B 421 ? PHE B 2426 ALA B 2440 1 ? 15 
HELX_P HELX_P48  48  GLU B 452 ? PHE B 457 ? GLU B 2471 PHE B 2476 1 ? 6  
HELX_P HELX_P49  49  GLY B 458 ? LEU B 462 ? GLY B 2477 LEU B 2481 5 ? 5  
HELX_P HELX_P50  50  SER B 467 ? GLY B 488 ? SER B 2486 GLY B 2507 1 ? 22 
HELX_P HELX_P51  51  LYS B 521 ? PHE B 532 ? LYS B 2540 PHE B 2551 1 ? 12 
HELX_P HELX_P52  52  LEU C 42  ? ARG C 46  ? LEU C 3060 ARG C 3064 5 ? 5  
HELX_P HELX_P53  53  ASP C 72  ? THR C 84  ? ASP C 3090 THR C 3102 1 ? 13 
HELX_P HELX_P54  54  GLY C 136 ? ASN C 144 ? GLY C 3154 ASN C 3162 1 ? 9  
HELX_P HELX_P55  55  LEU C 154 ? PHE C 160 ? LEU C 3172 PHE C 3178 1 ? 7  
HELX_P HELX_P56  56  ASN C 170 ? ILE C 187 ? ASN C 3188 ILE C 3205 1 ? 18 
HELX_P HELX_P57  57  ALA C 188 ? PHE C 190 ? ALA C 3206 PHE C 3208 5 ? 3  
HELX_P HELX_P58  58  SER C 203 ? SER C 215 ? SER C 3221 SER C 3233 1 ? 13 
HELX_P HELX_P59  59  PRO C 216 ? LYS C 219 ? PRO C 3234 LYS C 3237 5 ? 4  
HELX_P HELX_P60  60  THR C 234 ? VAL C 238 ? THR C 3252 VAL C 3256 5 ? 5  
HELX_P HELX_P61  61  VAL C 243 ? ALA C 254 ? VAL C 3261 ALA C 3272 1 ? 12 
HELX_P HELX_P62  62  THR C 260 ? LYS C 271 ? THR C 3278 LYS C 3289 1 ? 12 
HELX_P HELX_P63  63  THR C 272 ? LYS C 284 ? THR C 3290 LYS C 3302 1 ? 13 
HELX_P HELX_P64  64  ASP C 293 ? SER C 297 ? ASP C 3311 SER C 3315 5 ? 5  
HELX_P HELX_P65  65  THR C 313 ? GLU C 320 ? THR C 3331 GLU C 3338 1 ? 8  
HELX_P HELX_P66  66  TRP C 339 ? MET C 345 ? TRP C 3357 MET C 3364 1 ? 7  
HELX_P HELX_P67  67  ASP C 355 ? SER C 366 ? ASP C 3374 SER C 3385 1 ? 12 
HELX_P HELX_P68  68  SER C 366 ? CYS C 371 ? SER C 3385 CYS C 3390 1 ? 6  
HELX_P HELX_P69  69  ALA C 373 ? GLU C 375 ? ALA C 3392 GLU C 3394 5 ? 3  
HELX_P HELX_P70  70  LEU C 376 ? GLY C 386 ? LEU C 3395 GLY C 3405 1 ? 11 
HELX_P HELX_P71  71  ASP C 390 ? PHE C 407 ? ASP C 3409 PHE C 3426 1 ? 18 
HELX_P HELX_P72  72  PHE C 407 ? ASP C 420 ? PHE C 3426 ASP C 3439 1 ? 14 
HELX_P HELX_P73  73  GLU C 452 ? PHE C 457 ? GLU C 3471 PHE C 3476 1 ? 6  
HELX_P HELX_P74  74  GLY C 458 ? LEU C 462 ? GLY C 3477 LEU C 3481 5 ? 5  
HELX_P HELX_P75  75  SER C 467 ? GLY C 488 ? SER C 3486 GLY C 3507 1 ? 22 
HELX_P HELX_P76  76  LYS C 521 ? LYS C 534 ? LYS C 3540 LYS C 3553 1 ? 14 
HELX_P HELX_P77  77  LEU D 42  ? ARG D 46  ? LEU D 4060 ARG D 4064 5 ? 5  
HELX_P HELX_P78  78  ASP D 72  ? THR D 84  ? ASP D 4090 THR D 4102 1 ? 13 
HELX_P HELX_P79  79  GLY D 136 ? ASN D 144 ? GLY D 4154 ASN D 4162 1 ? 9  
HELX_P HELX_P80  80  LEU D 154 ? PHE D 160 ? LEU D 4172 PHE D 4178 1 ? 7  
HELX_P HELX_P81  81  ASN D 170 ? ILE D 187 ? ASN D 4188 ILE D 4205 1 ? 18 
HELX_P HELX_P82  82  ALA D 188 ? PHE D 190 ? ALA D 4206 PHE D 4208 5 ? 3  
HELX_P HELX_P83  83  SER D 203 ? LEU D 214 ? SER D 4221 LEU D 4232 1 ? 12 
HELX_P HELX_P84  84  SER D 215 ? LYS D 219 ? SER D 4233 LYS D 4237 5 ? 5  
HELX_P HELX_P85  85  THR D 234 ? VAL D 238 ? THR D 4252 VAL D 4256 5 ? 5  
HELX_P HELX_P86  86  VAL D 243 ? ALA D 254 ? VAL D 4261 ALA D 4272 1 ? 12 
HELX_P HELX_P87  87  THR D 260 ? LYS D 271 ? THR D 4278 LYS D 4289 1 ? 12 
HELX_P HELX_P88  88  THR D 272 ? LYS D 284 ? THR D 4290 LYS D 4302 1 ? 13 
HELX_P HELX_P89  89  ASP D 293 ? SER D 297 ? ASP D 4311 SER D 4315 5 ? 5  
HELX_P HELX_P90  90  THR D 313 ? ARG D 321 ? THR D 4331 ARG D 4339 1 ? 9  
HELX_P HELX_P91  91  TRP D 339 ? MET D 345 ? TRP D 4357 MET D 4364 1 ? 7  
HELX_P HELX_P92  92  ASP D 355 ? SER D 366 ? ASP D 4374 SER D 4385 1 ? 12 
HELX_P HELX_P93  93  SER D 366 ? CYS D 371 ? SER D 4385 CYS D 4390 1 ? 6  
HELX_P HELX_P94  94  LEU D 376 ? LEU D 385 ? LEU D 4395 LEU D 4404 1 ? 10 
HELX_P HELX_P95  95  ASP D 390 ? PHE D 407 ? ASP D 4409 PHE D 4426 1 ? 18 
HELX_P HELX_P96  96  PHE D 407 ? ALA D 421 ? PHE D 4426 ALA D 4440 1 ? 15 
HELX_P HELX_P97  97  GLU D 452 ? PHE D 457 ? GLU D 4471 PHE D 4476 1 ? 6  
HELX_P HELX_P98  98  GLY D 458 ? LEU D 462 ? GLY D 4477 LEU D 4481 5 ? 5  
HELX_P HELX_P99  99  SER D 467 ? GLY D 488 ? SER D 4486 GLY D 4507 1 ? 22 
HELX_P HELX_P100 100 LYS D 521 ? LYS D 534 ? LYS D 4540 LYS D 4553 1 ? 14 
HELX_P HELX_P101 101 LEU E 42  ? ARG E 46  ? LEU E 5060 ARG E 5064 5 ? 5  
HELX_P HELX_P102 102 ASP E 72  ? THR E 84  ? ASP E 5090 THR E 5102 1 ? 13 
HELX_P HELX_P103 103 GLY E 136 ? ASN E 144 ? GLY E 5154 ASN E 5162 1 ? 9  
HELX_P HELX_P104 104 LEU E 154 ? PHE E 160 ? LEU E 5172 PHE E 5178 1 ? 7  
HELX_P HELX_P105 105 ASN E 170 ? ILE E 187 ? ASN E 5188 ILE E 5205 1 ? 18 
HELX_P HELX_P106 106 ALA E 188 ? PHE E 190 ? ALA E 5206 PHE E 5208 5 ? 3  
HELX_P HELX_P107 107 SER E 203 ? SER E 215 ? SER E 5221 SER E 5233 1 ? 13 
HELX_P HELX_P108 108 PRO E 216 ? LYS E 219 ? PRO E 5234 LYS E 5237 5 ? 4  
HELX_P HELX_P109 109 THR E 234 ? VAL E 236 ? THR E 5252 VAL E 5254 5 ? 3  
HELX_P HELX_P110 110 VAL E 243 ? ALA E 254 ? VAL E 5261 ALA E 5272 1 ? 12 
HELX_P HELX_P111 111 THR E 260 ? LYS E 271 ? THR E 5278 LYS E 5289 1 ? 12 
HELX_P HELX_P112 112 THR E 272 ? LYS E 284 ? THR E 5290 LYS E 5302 1 ? 13 
HELX_P HELX_P113 113 ASP E 293 ? SER E 297 ? ASP E 5311 SER E 5315 5 ? 5  
HELX_P HELX_P114 114 THR E 313 ? GLU E 320 ? THR E 5331 GLU E 5338 1 ? 8  
HELX_P HELX_P115 115 TRP E 339 ? MET E 345 ? TRP E 5357 MET E 5364 1 ? 7  
HELX_P HELX_P116 116 ASP E 355 ? SER E 366 ? ASP E 5374 SER E 5385 1 ? 12 
HELX_P HELX_P117 117 SER E 366 ? CYS E 371 ? SER E 5385 CYS E 5390 1 ? 6  
HELX_P HELX_P118 118 ALA E 373 ? GLU E 375 ? ALA E 5392 GLU E 5394 5 ? 3  
HELX_P HELX_P119 119 LEU E 376 ? GLY E 386 ? LEU E 5395 GLY E 5405 1 ? 11 
HELX_P HELX_P120 120 ASP E 390 ? PHE E 407 ? ASP E 5409 PHE E 5426 1 ? 18 
HELX_P HELX_P121 121 PHE E 407 ? ASP E 420 ? PHE E 5426 ASP E 5439 1 ? 14 
HELX_P HELX_P122 122 GLU E 452 ? PHE E 457 ? GLU E 5471 PHE E 5476 1 ? 6  
HELX_P HELX_P123 123 GLY E 458 ? LEU E 462 ? GLY E 5477 LEU E 5481 5 ? 5  
HELX_P HELX_P124 124 SER E 467 ? GLY E 488 ? SER E 5486 GLY E 5507 1 ? 22 
HELX_P HELX_P125 125 LYS E 521 ? ALA E 533 ? LYS E 5540 ALA E 5552 1 ? 13 
HELX_P HELX_P126 126 LEU F 42  ? ARG F 46  ? LEU F 6060 ARG F 6064 5 ? 5  
HELX_P HELX_P127 127 ASP F 72  ? THR F 84  ? ASP F 6090 THR F 6102 1 ? 13 
HELX_P HELX_P128 128 GLY F 136 ? ASN F 144 ? GLY F 6154 ASN F 6162 1 ? 9  
HELX_P HELX_P129 129 LEU F 154 ? PHE F 160 ? LEU F 6172 PHE F 6178 1 ? 7  
HELX_P HELX_P130 130 ASN F 170 ? ILE F 187 ? ASN F 6188 ILE F 6205 1 ? 18 
HELX_P HELX_P131 131 ALA F 188 ? PHE F 190 ? ALA F 6206 PHE F 6208 5 ? 3  
HELX_P HELX_P132 132 SER F 203 ? LEU F 214 ? SER F 6221 LEU F 6232 1 ? 12 
HELX_P HELX_P133 133 SER F 215 ? LYS F 219 ? SER F 6233 LYS F 6237 5 ? 5  
HELX_P HELX_P134 134 THR F 234 ? VAL F 236 ? THR F 6252 VAL F 6254 5 ? 3  
HELX_P HELX_P135 135 VAL F 243 ? GLY F 255 ? VAL F 6261 GLY F 6273 1 ? 13 
HELX_P HELX_P136 136 THR F 260 ? LYS F 271 ? THR F 6278 LYS F 6289 1 ? 12 
HELX_P HELX_P137 137 THR F 272 ? LYS F 284 ? THR F 6290 LYS F 6302 1 ? 13 
HELX_P HELX_P138 138 ASP F 293 ? SER F 297 ? ASP F 6311 SER F 6315 5 ? 5  
HELX_P HELX_P139 139 THR F 313 ? GLU F 320 ? THR F 6331 GLU F 6338 1 ? 8  
HELX_P HELX_P140 140 TRP F 339 ? MET F 345 ? TRP F 6357 MET F 6364 1 ? 7  
HELX_P HELX_P141 141 ASP F 355 ? SER F 366 ? ASP F 6374 SER F 6385 1 ? 12 
HELX_P HELX_P142 142 SER F 366 ? CYS F 371 ? SER F 6385 CYS F 6390 1 ? 6  
HELX_P HELX_P143 143 ALA F 373 ? GLU F 375 ? ALA F 6392 GLU F 6394 5 ? 3  
HELX_P HELX_P144 144 LEU F 376 ? GLY F 386 ? LEU F 6395 GLY F 6405 1 ? 11 
HELX_P HELX_P145 145 VAL F 392 ? PHE F 407 ? VAL F 6411 PHE F 6426 1 ? 16 
HELX_P HELX_P146 146 PHE F 407 ? ASP F 420 ? PHE F 6426 ASP F 6439 1 ? 14 
HELX_P HELX_P147 147 GLU F 452 ? PHE F 457 ? GLU F 6471 PHE F 6476 1 ? 6  
HELX_P HELX_P148 148 GLY F 458 ? LEU F 462 ? GLY F 6477 LEU F 6481 5 ? 5  
HELX_P HELX_P149 149 SER F 467 ? GLY F 488 ? SER F 6486 GLY F 6507 1 ? 22 
HELX_P HELX_P150 150 LYS F 521 ? LYS F 534 ? LYS F 6540 LYS F 6553 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 98  SG  ? ? A CYS 1087 A CYS 1116 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf2  disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 267 SG  ? ? A CYS 1274 A CYS 1285 1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf3  disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 98  SG  ? ? B CYS 2087 B CYS 2116 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf4  disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 267 SG  ? ? B CYS 2274 B CYS 2285 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf5  disulf ?    ? C CYS 69  SG  ? ? ? 1_555 C CYS 98  SG  ? ? C CYS 3087 C CYS 3116 1_555 ? ? ? ? ? ? ? 2.027 ? ? 
disulf6  disulf ?    ? C CYS 256 SG  ? ? ? 1_555 C CYS 267 SG  ? ? C CYS 3274 C CYS 3285 1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf7  disulf ?    ? D CYS 69  SG  ? ? ? 1_555 D CYS 98  SG  ? ? D CYS 4087 D CYS 4116 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf8  disulf ?    ? D CYS 256 SG  ? ? ? 1_555 D CYS 267 SG  ? ? D CYS 4274 D CYS 4285 1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf9  disulf ?    ? E CYS 69  SG  ? ? ? 1_555 E CYS 98  SG  ? ? E CYS 5087 E CYS 5116 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf10 disulf ?    ? E CYS 256 SG  ? ? ? 1_555 E CYS 267 SG  ? ? E CYS 5274 E CYS 5285 1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf11 disulf ?    ? F CYS 69  SG  ? ? ? 1_555 F CYS 98  SG  ? ? F CYS 6087 F CYS 6116 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf12 disulf ?    ? F CYS 256 SG  ? ? ? 1_555 F CYS 267 SG  ? ? F CYS 6274 F CYS 6285 1_555 ? ? ? ? ? ? ? 2.041 ? ? 
covale1  covale one  ? A ASN 61  ND2 ? ? ? 1_555 G NAG .   C1  ? ? A ASN 1079 G NAG 1    1_555 ? ? ? ? ? ? ? 1.449 ? 
N-Glycosylation 
covale2  covale one  ? L NAG .   C1  ? ? ? 1_555 B ASN 61  ND2 ? ? B NAG 279  B ASN 2079 1_555 ? ? ? ? ? ? ? 1.452 ? 
N-Glycosylation 
covale3  covale one  ? P NAG .   C1  ? ? ? 1_555 C ASN 61  ND2 ? ? C NAG 379  C ASN 3079 1_555 ? ? ? ? ? ? ? 1.450 ? 
N-Glycosylation 
covale4  covale one  ? T NAG .   C1  ? ? ? 1_555 D ASN 61  ND2 ? ? D NAG 479  D ASN 4079 1_555 ? ? ? ? ? ? ? 1.450 ? 
N-Glycosylation 
covale5  covale one  ? Z NAG .   C1  ? ? ? 1_555 E ASN 61  ND2 ? ? E NAG 579  E ASN 5079 1_555 ? ? ? ? ? ? ? 1.454 ? 
N-Glycosylation 
covale6  covale one  ? F ASN 61  ND2 ? ? ? 1_555 H NAG .   C1  ? ? F ASN 6079 H NAG 1    1_555 ? ? ? ? ? ? ? 1.450 ? 
N-Glycosylation 
covale7  covale both ? G NAG .   O4  ? ? ? 1_555 G NAG .   C1  ? ? G NAG 1    G NAG 2    1_555 ? ? ? ? ? ? ? 1.390 ? ? 
covale8  covale both ? H NAG .   O4  ? ? ? 1_555 H NAG .   C1  ? ? H NAG 1    H NAG 2    1_555 ? ? ? ? ? ? ? 1.390 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 3  ? 
E ? 11 ? 
F ? 2  ? 
G ? 2  ? 
H ? 3  ? 
I ? 11 ? 
J ? 2  ? 
K ? 3  ? 
L ? 11 ? 
M ? 2  ? 
N ? 3  ? 
O ? 11 ? 
P ? 2  ? 
Q ? 2  ? 
R ? 3  ? 
S ? 11 ? 
T ? 2  ? 
U ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? parallel      
E 5  6  ? parallel      
E 6  7  ? parallel      
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? parallel      
E 10 11 ? anti-parallel 
F 1  2  ? parallel      
G 1  2  ? parallel      
H 1  2  ? anti-parallel 
H 2  3  ? parallel      
I 1  2  ? anti-parallel 
I 2  3  ? anti-parallel 
I 3  4  ? anti-parallel 
I 4  5  ? parallel      
I 5  6  ? parallel      
I 6  7  ? parallel      
I 7  8  ? parallel      
I 8  9  ? parallel      
I 9  10 ? parallel      
I 10 11 ? anti-parallel 
J 1  2  ? parallel      
K 1  2  ? anti-parallel 
K 2  3  ? parallel      
L 1  2  ? anti-parallel 
L 2  3  ? anti-parallel 
L 3  4  ? anti-parallel 
L 4  5  ? parallel      
L 5  6  ? parallel      
L 6  7  ? parallel      
L 7  8  ? parallel      
L 8  9  ? parallel      
L 9  10 ? parallel      
L 10 11 ? anti-parallel 
M 1  2  ? parallel      
N 1  2  ? anti-parallel 
N 2  3  ? parallel      
O 1  2  ? anti-parallel 
O 2  3  ? anti-parallel 
O 3  4  ? anti-parallel 
O 4  5  ? parallel      
O 5  6  ? parallel      
O 6  7  ? parallel      
O 7  8  ? parallel      
O 8  9  ? parallel      
O 9  10 ? parallel      
O 10 11 ? anti-parallel 
P 1  2  ? parallel      
Q 1  2  ? parallel      
R 1  2  ? anti-parallel 
R 2  3  ? parallel      
S 1  2  ? anti-parallel 
S 2  3  ? anti-parallel 
S 3  4  ? anti-parallel 
S 4  5  ? parallel      
S 5  6  ? parallel      
S 6  7  ? parallel      
S 7  8  ? parallel      
S 8  9  ? parallel      
S 9  10 ? parallel      
S 10 11 ? anti-parallel 
T 1  2  ? parallel      
U 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL A 7   ? THR A 10  ? VAL A 1025 THR A 1028 
A 2  GLY A 13  ? LEU A 16  ? GLY A 1031 LEU A 1034 
A 3  VAL A 59  ? ASN A 61  ? VAL A 1077 ASN A 1079 
B 1  LYS A 18  ? VAL A 20  ? LYS A 1036 VAL A 1038 
B 2  VAL A 29  ? PRO A 36  ? VAL A 1047 PRO A 1054 
B 3  TYR A 100 ? THR A 105 ? TYR A 1118 THR A 1123 
B 4  VAL A 146 ? ILE A 150 ? VAL A 1164 ILE A 1168 
B 5  LEU A 115 ? ILE A 121 ? LEU A 1133 ILE A 1139 
B 6  GLY A 192 ? GLU A 202 ? GLY A 1210 GLU A 1220 
B 7  ARG A 224 ? GLU A 228 ? ARG A 1242 GLU A 1246 
B 8  TYR A 328 ? ASN A 333 ? TYR A 1346 ASN A 1351 
B 9  THR A 425 ? GLN A 431 ? THR A 1444 GLN A 1450 
B 10 GLY A 506 ? GLY A 511 ? GLY A 1525 GLY A 1530 
B 11 GLN A 515 ? GLN A 518 ? GLN A 1534 GLN A 1537 
C 1  MET A 68  ? CYS A 69  ? MET A 1086 CYS A 1087 
C 2  LEU A 94  ? SER A 95  ? LEU A 1112 SER A 1113 
D 1  VAL B 7   ? THR B 10  ? VAL B 2025 THR B 2028 
D 2  GLY B 13  ? LEU B 16  ? GLY B 2031 LEU B 2034 
D 3  VAL B 59  ? ASN B 61  ? VAL B 2077 ASN B 2079 
E 1  LYS B 18  ? VAL B 20  ? LYS B 2036 VAL B 2038 
E 2  VAL B 29  ? PRO B 36  ? VAL B 2047 PRO B 2054 
E 3  TYR B 100 ? THR B 105 ? TYR B 2118 THR B 2123 
E 4  VAL B 146 ? ILE B 150 ? VAL B 2164 ILE B 2168 
E 5  LEU B 115 ? ILE B 121 ? LEU B 2133 ILE B 2139 
E 6  GLY B 192 ? GLU B 202 ? GLY B 2210 GLU B 2220 
E 7  ARG B 224 ? GLU B 228 ? ARG B 2242 GLU B 2246 
E 8  TYR B 328 ? ASN B 333 ? TYR B 2346 ASN B 2351 
E 9  THR B 425 ? PHE B 430 ? THR B 2444 PHE B 2449 
E 10 GLY B 506 ? ILE B 510 ? GLY B 2525 ILE B 2529 
E 11 GLN B 515 ? GLN B 518 ? GLN B 2534 GLN B 2537 
F 1  MET B 68  ? CYS B 69  ? MET B 2086 CYS B 2087 
F 2  LEU B 94  ? SER B 95  ? LEU B 2112 SER B 2113 
G 1  VAL B 238 ? LYS B 239 ? VAL B 2256 LYS B 2257 
G 2  THR B 303 ? VAL B 304 ? THR B 2321 VAL B 2322 
H 1  VAL C 7   ? THR C 10  ? VAL C 3025 THR C 3028 
H 2  GLY C 13  ? LEU C 16  ? GLY C 3031 LEU C 3034 
H 3  VAL C 59  ? ASN C 61  ? VAL C 3077 ASN C 3079 
I 1  LYS C 18  ? VAL C 20  ? LYS C 3036 VAL C 3038 
I 2  VAL C 29  ? PRO C 36  ? VAL C 3047 PRO C 3054 
I 3  TYR C 100 ? THR C 105 ? TYR C 3118 THR C 3123 
I 4  VAL C 146 ? ILE C 150 ? VAL C 3164 ILE C 3168 
I 5  LEU C 115 ? ILE C 121 ? LEU C 3133 ILE C 3139 
I 6  GLY C 192 ? GLU C 202 ? GLY C 3210 GLU C 3220 
I 7  ARG C 224 ? GLU C 228 ? ARG C 3242 GLU C 3246 
I 8  TYR C 328 ? ASN C 333 ? TYR C 3346 ASN C 3351 
I 9  THR C 425 ? PHE C 430 ? THR C 3444 PHE C 3449 
I 10 GLY C 506 ? ILE C 510 ? GLY C 3525 ILE C 3529 
I 11 GLN C 515 ? GLN C 518 ? GLN C 3534 GLN C 3537 
J 1  MET C 68  ? CYS C 69  ? MET C 3086 CYS C 3087 
J 2  LEU C 94  ? SER C 95  ? LEU C 3112 SER C 3113 
K 1  VAL D 7   ? THR D 10  ? VAL D 4025 THR D 4028 
K 2  GLY D 13  ? LEU D 16  ? GLY D 4031 LEU D 4034 
K 3  VAL D 59  ? ASN D 61  ? VAL D 4077 ASN D 4079 
L 1  LYS D 18  ? VAL D 20  ? LYS D 4036 VAL D 4038 
L 2  VAL D 29  ? PRO D 36  ? VAL D 4047 PRO D 4054 
L 3  TYR D 100 ? THR D 105 ? TYR D 4118 THR D 4123 
L 4  VAL D 146 ? ILE D 150 ? VAL D 4164 ILE D 4168 
L 5  LEU D 115 ? ILE D 121 ? LEU D 4133 ILE D 4139 
L 6  GLY D 192 ? GLU D 202 ? GLY D 4210 GLU D 4220 
L 7  ARG D 224 ? GLU D 228 ? ARG D 4242 GLU D 4246 
L 8  TYR D 328 ? ASN D 333 ? TYR D 4346 ASN D 4351 
L 9  THR D 425 ? GLN D 431 ? THR D 4444 GLN D 4450 
L 10 GLY D 506 ? GLY D 511 ? GLY D 4525 GLY D 4530 
L 11 GLN D 515 ? GLN D 518 ? GLN D 4534 GLN D 4537 
M 1  MET D 68  ? CYS D 69  ? MET D 4086 CYS D 4087 
M 2  LEU D 94  ? SER D 95  ? LEU D 4112 SER D 4113 
N 1  VAL E 7   ? THR E 10  ? VAL E 5025 THR E 5028 
N 2  GLY E 13  ? LEU E 16  ? GLY E 5031 LEU E 5034 
N 3  VAL E 59  ? ASN E 61  ? VAL E 5077 ASN E 5079 
O 1  LYS E 18  ? VAL E 20  ? LYS E 5036 VAL E 5038 
O 2  VAL E 29  ? PRO E 36  ? VAL E 5047 PRO E 5054 
O 3  TYR E 100 ? THR E 105 ? TYR E 5118 THR E 5123 
O 4  VAL E 146 ? ILE E 150 ? VAL E 5164 ILE E 5168 
O 5  LEU E 115 ? ILE E 121 ? LEU E 5133 ILE E 5139 
O 6  GLY E 192 ? GLU E 202 ? GLY E 5210 GLU E 5220 
O 7  ARG E 224 ? GLU E 228 ? ARG E 5242 GLU E 5246 
O 8  TYR E 328 ? ASN E 333 ? TYR E 5346 ASN E 5351 
O 9  THR E 425 ? GLN E 431 ? THR E 5444 GLN E 5450 
O 10 GLY E 506 ? GLY E 511 ? GLY E 5525 GLY E 5530 
O 11 GLN E 515 ? GLN E 518 ? GLN E 5534 GLN E 5537 
P 1  MET E 68  ? CYS E 69  ? MET E 5086 CYS E 5087 
P 2  LEU E 94  ? SER E 95  ? LEU E 5112 SER E 5113 
Q 1  VAL E 238 ? LYS E 239 ? VAL E 5256 LYS E 5257 
Q 2  THR E 303 ? VAL E 304 ? THR E 5321 VAL E 5322 
R 1  VAL F 7   ? THR F 10  ? VAL F 6025 THR F 6028 
R 2  GLY F 13  ? LEU F 16  ? GLY F 6031 LEU F 6034 
R 3  VAL F 59  ? ASN F 61  ? VAL F 6077 ASN F 6079 
S 1  LYS F 18  ? VAL F 20  ? LYS F 6036 VAL F 6038 
S 2  VAL F 29  ? PRO F 36  ? VAL F 6047 PRO F 6054 
S 3  TYR F 100 ? THR F 105 ? TYR F 6118 THR F 6123 
S 4  VAL F 146 ? ILE F 150 ? VAL F 6164 ILE F 6168 
S 5  LEU F 115 ? ILE F 121 ? LEU F 6133 ILE F 6139 
S 6  GLY F 192 ? GLU F 202 ? GLY F 6210 GLU F 6220 
S 7  ARG F 224 ? GLU F 228 ? ARG F 6242 GLU F 6246 
S 8  TYR F 328 ? ASN F 333 ? TYR F 6346 ASN F 6351 
S 9  THR F 425 ? PHE F 430 ? THR F 6444 PHE F 6449 
S 10 GLY F 506 ? ILE F 510 ? GLY F 6525 ILE F 6529 
S 11 GLN F 515 ? GLN F 518 ? GLN F 6534 GLN F 6537 
T 1  MET F 68  ? CYS F 69  ? MET F 6086 CYS F 6087 
T 2  LEU F 94  ? SER F 95  ? LEU F 6112 SER F 6113 
U 1  VAL F 238 ? LYS F 239 ? VAL F 6256 LYS F 6257 
U 2  THR F 303 ? VAL F 304 ? THR F 6321 VAL F 6322 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 8   ? N VAL A 1026 O VAL A 15  ? O VAL A 1033 
A 2  3  N LYS A 14  ? N LYS A 1032 O LYS A 60  ? O LYS A 1078 
B 1  2  N LYS A 18  ? N LYS A 1036 O ILE A 31  ? O ILE A 1049 
B 2  3  N PHE A 32  ? N PHE A 1050 O ILE A 103 ? O ILE A 1121 
B 3  4  N TYR A 104 ? N TYR A 1122 O VAL A 147 ? O VAL A 1165 
B 4  5  O VAL A 146 ? O VAL A 1164 N MET A 118 ? N MET A 1136 
B 5  6  N VAL A 117 ? N VAL A 1135 O THR A 198 ? O THR A 1216 
B 6  7  N GLY A 201 ? N GLY A 1219 O GLU A 228 ? O GLU A 1246 
B 7  8  N ALA A 225 ? N ALA A 1243 O MET A 329 ? O MET A 1347 
B 8  9  N VAL A 330 ? N VAL A 1348 O TYR A 426 ? O TYR A 1445 
B 9  10 N GLN A 431 ? N GLN A 1450 O ILE A 510 ? O ILE A 1529 
B 10 11 N TYR A 507 ? N TYR A 1526 O ALA A 517 ? O ALA A 1536 
C 1  2  N MET A 68  ? N MET A 1086 O SER A 95  ? O SER A 1113 
D 1  2  N VAL B 8   ? N VAL B 2026 O VAL B 15  ? O VAL B 2033 
D 2  3  N LEU B 16  ? N LEU B 2034 O LYS B 60  ? O LYS B 2078 
E 1  2  N LYS B 18  ? N LYS B 2036 O ILE B 31  ? O ILE B 2049 
E 2  3  N PHE B 32  ? N PHE B 2050 O ILE B 103 ? O ILE B 2121 
E 3  4  N TYR B 104 ? N TYR B 2122 O VAL B 147 ? O VAL B 2165 
E 4  5  O VAL B 146 ? O VAL B 2164 N MET B 118 ? N MET B 2136 
E 5  6  N VAL B 117 ? N VAL B 2135 O THR B 198 ? O THR B 2216 
E 6  7  N GLY B 201 ? N GLY B 2219 O GLU B 228 ? O GLU B 2246 
E 7  8  N ALA B 225 ? N ALA B 2243 O MET B 329 ? O MET B 2347 
E 8  9  N VAL B 330 ? N VAL B 2348 O TYR B 426 ? O TYR B 2445 
E 9  10 N GLU B 429 ? N GLU B 2448 O LEU B 508 ? O LEU B 2527 
E 10 11 N GLN B 509 ? N GLN B 2528 O GLN B 515 ? O GLN B 2534 
F 1  2  N MET B 68  ? N MET B 2086 O SER B 95  ? O SER B 2113 
G 1  2  N LYS B 239 ? N LYS B 2257 O THR B 303 ? O THR B 2321 
H 1  2  N VAL C 8   ? N VAL C 3026 O VAL C 15  ? O VAL C 3033 
H 2  3  N LYS C 14  ? N LYS C 3032 O LYS C 60  ? O LYS C 3078 
I 1  2  N LYS C 18  ? N LYS C 3036 O ILE C 31  ? O ILE C 3049 
I 2  3  N PHE C 32  ? N PHE C 3050 O ILE C 103 ? O ILE C 3121 
I 3  4  N TYR C 104 ? N TYR C 3122 O VAL C 147 ? O VAL C 3165 
I 4  5  O VAL C 148 ? O VAL C 3166 N TRP C 120 ? N TRP C 3138 
I 5  6  N VAL C 117 ? N VAL C 3135 O THR C 198 ? O THR C 3216 
I 6  7  N GLY C 201 ? N GLY C 3219 O GLU C 228 ? O GLU C 3246 
I 7  8  N ALA C 225 ? N ALA C 3243 O MET C 329 ? O MET C 3347 
I 8  9  N VAL C 330 ? N VAL C 3348 O TYR C 426 ? O TYR C 3445 
I 9  10 N MET C 427 ? N MET C 3446 O LEU C 508 ? O LEU C 3527 
I 10 11 N TYR C 507 ? N TYR C 3526 O ALA C 517 ? O ALA C 3536 
J 1  2  N MET C 68  ? N MET C 3086 O SER C 95  ? O SER C 3113 
K 1  2  N VAL D 8   ? N VAL D 4026 O VAL D 15  ? O VAL D 4033 
K 2  3  N LEU D 16  ? N LEU D 4034 O LYS D 60  ? O LYS D 4078 
L 1  2  N VAL D 20  ? N VAL D 4038 O VAL D 29  ? O VAL D 4047 
L 2  3  N PHE D 32  ? N PHE D 4050 O ILE D 103 ? O ILE D 4121 
L 3  4  N TYR D 104 ? N TYR D 4122 O VAL D 147 ? O VAL D 4165 
L 4  5  O VAL D 148 ? O VAL D 4166 N TRP D 120 ? N TRP D 4138 
L 5  6  N VAL D 117 ? N VAL D 4135 O THR D 198 ? O THR D 4216 
L 6  7  N GLY D 201 ? N GLY D 4219 O GLU D 228 ? O GLU D 4246 
L 7  8  N ALA D 225 ? N ALA D 4243 O MET D 329 ? O MET D 4347 
L 8  9  N VAL D 330 ? N VAL D 4348 O TYR D 426 ? O TYR D 4445 
L 9  10 N GLN D 431 ? N GLN D 4450 O ILE D 510 ? O ILE D 4529 
L 10 11 N GLN D 509 ? N GLN D 4528 O GLN D 515 ? O GLN D 4534 
M 1  2  N MET D 68  ? N MET D 4086 O SER D 95  ? O SER D 4113 
N 1  2  N VAL E 8   ? N VAL E 5026 O VAL E 15  ? O VAL E 5033 
N 2  3  N LYS E 14  ? N LYS E 5032 O LYS E 60  ? O LYS E 5078 
O 1  2  N LYS E 18  ? N LYS E 5036 O ILE E 31  ? O ILE E 5049 
O 2  3  N PHE E 32  ? N PHE E 5050 O ILE E 103 ? O ILE E 5121 
O 3  4  N TYR E 104 ? N TYR E 5122 O VAL E 147 ? O VAL E 5165 
O 4  5  O VAL E 148 ? O VAL E 5166 N TRP E 120 ? N TRP E 5138 
O 5  6  N VAL E 119 ? N VAL E 5137 O THR E 198 ? O THR E 5216 
O 6  7  N GLY E 201 ? N GLY E 5219 O GLU E 228 ? O GLU E 5246 
O 7  8  N ALA E 225 ? N ALA E 5243 O MET E 329 ? O MET E 5347 
O 8  9  N VAL E 330 ? N VAL E 5348 O TYR E 426 ? O TYR E 5445 
O 9  10 N GLN E 431 ? N GLN E 5450 O ILE E 510 ? O ILE E 5529 
O 10 11 N GLN E 509 ? N GLN E 5528 O GLN E 515 ? O GLN E 5534 
P 1  2  N MET E 68  ? N MET E 5086 O SER E 95  ? O SER E 5113 
Q 1  2  N LYS E 239 ? N LYS E 5257 O THR E 303 ? O THR E 5321 
R 1  2  N VAL F 8   ? N VAL F 6026 O VAL F 15  ? O VAL F 6033 
R 2  3  N LEU F 16  ? N LEU F 6034 O LYS F 60  ? O LYS F 6078 
S 1  2  N LYS F 18  ? N LYS F 6036 O ILE F 31  ? O ILE F 6049 
S 2  3  N PHE F 32  ? N PHE F 6050 O ILE F 103 ? O ILE F 6121 
S 3  4  N TYR F 104 ? N TYR F 6122 O VAL F 147 ? O VAL F 6165 
S 4  5  O VAL F 148 ? O VAL F 6166 N TRP F 120 ? N TRP F 6138 
S 5  6  N VAL F 117 ? N VAL F 6135 O THR F 198 ? O THR F 6216 
S 6  7  N GLY F 201 ? N GLY F 6219 O GLU F 228 ? O GLU F 6246 
S 7  8  N ALA F 225 ? N ALA F 6243 O MET F 329 ? O MET F 6347 
S 8  9  N VAL F 330 ? N VAL F 6348 O TYR F 426 ? O TYR F 6445 
S 9  10 N GLU F 429 ? N GLU F 6448 O LEU F 508 ? O LEU F 6527 
S 10 11 N GLN F 509 ? N GLN F 6528 O GLN F 515 ? O GLN F 6534 
T 1  2  N MET F 68  ? N MET F 6086 O SER F 95  ? O SER F 6113 
U 1  2  N LYS F 239 ? N LYS F 6257 O THR F 303 ? O THR F 6321 
# 
_database_PDB_matrix.entry_id          2H7C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2H7C 
_atom_sites.fract_transf_matrix[1][1]   0.011237 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000010 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008668 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005697 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . SER A  1 3   ? 35.422  -26.863 -0.107  1.00 60.71  ? 1021 SER A N   1 
ATOM   2     C CA  . SER A  1 3   ? 36.541  -25.917 -0.393  1.00 60.46  ? 1021 SER A CA  1 
ATOM   3     C C   . SER A  1 3   ? 37.651  -26.105 0.631   1.00 59.24  ? 1021 SER A C   1 
ATOM   4     O O   . SER A  1 3   ? 38.697  -25.455 0.557   1.00 60.16  ? 1021 SER A O   1 
ATOM   5     C CB  . SER A  1 3   ? 36.042  -24.470 -0.323  1.00 61.59  ? 1021 SER A CB  1 
ATOM   6     O OG  . SER A  1 3   ? 35.731  -24.102 1.013   1.00 61.83  ? 1021 SER A OG  1 
ATOM   7     N N   . SER A  1 4   ? 37.413  -27.001 1.583   1.00 56.91  ? 1022 SER A N   1 
ATOM   8     C CA  . SER A  1 4   ? 38.368  -27.271 2.649   1.00 53.78  ? 1022 SER A CA  1 
ATOM   9     C C   . SER A  1 4   ? 38.421  -26.044 3.554   1.00 51.00  ? 1022 SER A C   1 
ATOM   10    O O   . SER A  1 4   ? 39.335  -25.222 3.464   1.00 49.89  ? 1022 SER A O   1 
ATOM   11    C CB  . SER A  1 4   ? 39.758  -27.566 2.076   1.00 54.69  ? 1022 SER A CB  1 
ATOM   12    O OG  . SER A  1 4   ? 40.673  -27.882 3.110   1.00 55.04  ? 1022 SER A OG  1 
ATOM   13    N N   . PRO A  1 5   ? 37.414  -25.899 4.428   1.00 48.40  ? 1023 PRO A N   1 
ATOM   14    C CA  . PRO A  1 5   ? 37.310  -24.783 5.370   1.00 45.16  ? 1023 PRO A CA  1 
ATOM   15    C C   . PRO A  1 5   ? 38.582  -24.625 6.196   1.00 41.14  ? 1023 PRO A C   1 
ATOM   16    O O   . PRO A  1 5   ? 39.348  -25.575 6.363   1.00 40.00  ? 1023 PRO A O   1 
ATOM   17    C CB  . PRO A  1 5   ? 36.110  -25.171 6.226   1.00 46.46  ? 1023 PRO A CB  1 
ATOM   18    C CG  . PRO A  1 5   ? 35.243  -25.905 5.255   1.00 48.28  ? 1023 PRO A CG  1 
ATOM   19    C CD  . PRO A  1 5   ? 36.242  -26.785 4.541   1.00 48.77  ? 1023 PRO A CD  1 
ATOM   20    N N   . PRO A  1 6   ? 38.819  -23.417 6.724   1.00 37.88  ? 1024 PRO A N   1 
ATOM   21    C CA  . PRO A  1 6   ? 40.003  -23.122 7.537   1.00 35.80  ? 1024 PRO A CA  1 
ATOM   22    C C   . PRO A  1 6   ? 39.982  -23.859 8.873   1.00 33.49  ? 1024 PRO A C   1 
ATOM   23    O O   . PRO A  1 6   ? 38.951  -23.906 9.541   1.00 32.94  ? 1024 PRO A O   1 
ATOM   24    C CB  . PRO A  1 6   ? 39.921  -21.606 7.748   1.00 34.50  ? 1024 PRO A CB  1 
ATOM   25    C CG  . PRO A  1 6   ? 39.000  -21.129 6.676   1.00 36.72  ? 1024 PRO A CG  1 
ATOM   26    C CD  . PRO A  1 6   ? 37.982  -22.216 6.575   1.00 36.30  ? 1024 PRO A CD  1 
ATOM   27    N N   . VAL A  1 7   ? 41.119  -24.434 9.250   1.00 31.22  ? 1025 VAL A N   1 
ATOM   28    C CA  . VAL A  1 7   ? 41.247  -25.129 10.528  1.00 29.26  ? 1025 VAL A CA  1 
ATOM   29    C C   . VAL A  1 7   ? 42.477  -24.540 11.195  1.00 27.71  ? 1025 VAL A C   1 
ATOM   30    O O   . VAL A  1 7   ? 43.576  -24.583 10.641  1.00 28.35  ? 1025 VAL A O   1 
ATOM   31    C CB  . VAL A  1 7   ? 41.451  -26.651 10.362  1.00 28.68  ? 1025 VAL A CB  1 
ATOM   32    C CG1 . VAL A  1 7   ? 41.655  -27.297 11.731  1.00 27.84  ? 1025 VAL A CG1 1 
ATOM   33    C CG2 . VAL A  1 7   ? 40.247  -27.266 9.677   1.00 29.48  ? 1025 VAL A CG2 1 
ATOM   34    N N   . VAL A  1 8   ? 42.286  -23.984 12.382  1.00 24.78  ? 1026 VAL A N   1 
ATOM   35    C CA  . VAL A  1 8   ? 43.374  -23.357 13.110  1.00 23.61  ? 1026 VAL A CA  1 
ATOM   36    C C   . VAL A  1 8   ? 43.619  -24.039 14.446  1.00 24.94  ? 1026 VAL A C   1 
ATOM   37    O O   . VAL A  1 8   ? 42.677  -24.430 15.130  1.00 22.58  ? 1026 VAL A O   1 
ATOM   38    C CB  . VAL A  1 8   ? 43.059  -21.868 13.364  1.00 24.35  ? 1026 VAL A CB  1 
ATOM   39    C CG1 . VAL A  1 8   ? 44.175  -21.219 14.163  1.00 23.91  ? 1026 VAL A CG1 1 
ATOM   40    C CG2 . VAL A  1 8   ? 42.856  -21.152 12.034  1.00 27.28  ? 1026 VAL A CG2 1 
ATOM   41    N N   . ASP A  1 9   ? 44.887  -24.183 14.813  1.00 26.72  ? 1027 ASP A N   1 
ATOM   42    C CA  . ASP A  1 9   ? 45.229  -24.801 16.086  1.00 30.79  ? 1027 ASP A CA  1 
ATOM   43    C C   . ASP A  1 9   ? 45.439  -23.703 17.116  1.00 29.86  ? 1027 ASP A C   1 
ATOM   44    O O   . ASP A  1 9   ? 46.279  -22.828 16.932  1.00 32.74  ? 1027 ASP A O   1 
ATOM   45    C CB  . ASP A  1 9   ? 46.517  -25.622 15.978  1.00 35.16  ? 1027 ASP A CB  1 
ATOM   46    C CG  . ASP A  1 9   ? 46.543  -26.515 14.757  1.00 40.53  ? 1027 ASP A CG  1 
ATOM   47    O OD1 . ASP A  1 9   ? 45.469  -27.008 14.349  1.00 43.80  ? 1027 ASP A OD1 1 
ATOM   48    O OD2 . ASP A  1 9   ? 47.647  -26.732 14.212  1.00 43.56  ? 1027 ASP A OD2 1 
ATOM   49    N N   . THR A  1 10  ? 44.673  -23.744 18.198  1.00 28.77  ? 1028 THR A N   1 
ATOM   50    C CA  . THR A  1 10  ? 44.808  -22.751 19.254  1.00 26.90  ? 1028 THR A CA  1 
ATOM   51    C C   . THR A  1 10  ? 45.396  -23.464 20.463  1.00 25.88  ? 1028 THR A C   1 
ATOM   52    O O   . THR A  1 10  ? 45.524  -24.684 20.461  1.00 25.55  ? 1028 THR A O   1 
ATOM   53    C CB  . THR A  1 10  ? 43.442  -22.138 19.638  1.00 27.42  ? 1028 THR A CB  1 
ATOM   54    O OG1 . THR A  1 10  ? 42.644  -23.116 20.316  1.00 26.91  ? 1028 THR A OG1 1 
ATOM   55    C CG2 . THR A  1 10  ? 42.704  -21.670 18.391  1.00 23.64  ? 1028 THR A CG2 1 
ATOM   56    N N   . VAL A  1 11  ? 45.758  -22.712 21.491  1.00 24.92  ? 1029 VAL A N   1 
ATOM   57    C CA  . VAL A  1 11  ? 46.324  -23.331 22.680  1.00 25.90  ? 1029 VAL A CA  1 
ATOM   58    C C   . VAL A  1 11  ? 45.414  -24.431 23.227  1.00 25.34  ? 1029 VAL A C   1 
ATOM   59    O O   . VAL A  1 11  ? 45.889  -25.496 23.608  1.00 24.86  ? 1029 VAL A O   1 
ATOM   60    C CB  . VAL A  1 11  ? 46.565  -22.293 23.796  1.00 26.49  ? 1029 VAL A CB  1 
ATOM   61    C CG1 . VAL A  1 11  ? 47.066  -22.988 25.056  1.00 27.92  ? 1029 VAL A CG1 1 
ATOM   62    C CG2 . VAL A  1 11  ? 47.580  -21.255 23.328  1.00 28.78  ? 1029 VAL A CG2 1 
ATOM   63    N N   . HIS A  1 12  ? 44.106  -24.181 23.240  1.00 23.89  ? 1030 HIS A N   1 
ATOM   64    C CA  . HIS A  1 12  ? 43.157  -25.150 23.779  1.00 24.72  ? 1030 HIS A CA  1 
ATOM   65    C C   . HIS A  1 12  ? 42.639  -26.218 22.818  1.00 21.93  ? 1030 HIS A C   1 
ATOM   66    O O   . HIS A  1 12  ? 41.966  -27.158 23.246  1.00 22.34  ? 1030 HIS A O   1 
ATOM   67    C CB  . HIS A  1 12  ? 41.963  -24.419 24.408  1.00 25.21  ? 1030 HIS A CB  1 
ATOM   68    C CG  . HIS A  1 12  ? 42.338  -23.523 25.545  1.00 26.63  ? 1030 HIS A CG  1 
ATOM   69    N ND1 . HIS A  1 12  ? 43.197  -23.916 26.549  1.00 29.84  ? 1030 HIS A ND1 1 
ATOM   70    C CD2 . HIS A  1 12  ? 41.964  -22.258 25.846  1.00 27.37  ? 1030 HIS A CD2 1 
ATOM   71    C CE1 . HIS A  1 12  ? 43.338  -22.930 27.416  1.00 28.79  ? 1030 HIS A CE1 1 
ATOM   72    N NE2 . HIS A  1 12  ? 42.600  -21.911 27.012  1.00 28.70  ? 1030 HIS A NE2 1 
ATOM   73    N N   . GLY A  1 13  ? 42.943  -26.087 21.532  1.00 19.43  ? 1031 GLY A N   1 
ATOM   74    C CA  . GLY A  1 13  ? 42.477  -27.077 20.580  1.00 18.94  ? 1031 GLY A CA  1 
ATOM   75    C C   . GLY A  1 13  ? 42.245  -26.520 19.191  1.00 21.48  ? 1031 GLY A C   1 
ATOM   76    O O   . GLY A  1 13  ? 42.362  -25.313 18.965  1.00 22.02  ? 1031 GLY A O   1 
ATOM   77    N N   . LYS A  1 14  ? 41.900  -27.401 18.259  1.00 20.98  ? 1032 LYS A N   1 
ATOM   78    C CA  . LYS A  1 14  ? 41.664  -27.000 16.880  1.00 21.98  ? 1032 LYS A CA  1 
ATOM   79    C C   . LYS A  1 14  ? 40.262  -26.452 16.692  1.00 22.43  ? 1032 LYS A C   1 
ATOM   80    O O   . LYS A  1 14  ? 39.312  -26.921 17.325  1.00 20.59  ? 1032 LYS A O   1 
ATOM   81    C CB  . LYS A  1 14  ? 41.853  -28.190 15.940  1.00 23.53  ? 1032 LYS A CB  1 
ATOM   82    C CG  . LYS A  1 14  ? 43.179  -28.912 16.093  1.00 29.58  ? 1032 LYS A CG  1 
ATOM   83    C CD  . LYS A  1 14  ? 43.281  -30.073 15.108  1.00 33.24  ? 1032 LYS A CD  1 
ATOM   84    C CE  . LYS A  1 14  ? 44.542  -30.888 15.342  1.00 34.64  ? 1032 LYS A CE  1 
ATOM   85    N NZ  . LYS A  1 14  ? 45.770  -30.048 15.251  1.00 36.58  ? 1032 LYS A NZ  1 
ATOM   86    N N   . VAL A  1 15  ? 40.140  -25.456 15.817  1.00 21.36  ? 1033 VAL A N   1 
ATOM   87    C CA  . VAL A  1 15  ? 38.849  -24.854 15.512  1.00 21.24  ? 1033 VAL A CA  1 
ATOM   88    C C   . VAL A  1 15  ? 38.650  -24.776 14.000  1.00 22.63  ? 1033 VAL A C   1 
ATOM   89    O O   . VAL A  1 15  ? 39.579  -24.478 13.246  1.00 22.39  ? 1033 VAL A O   1 
ATOM   90    C CB  . VAL A  1 15  ? 38.725  -23.444 16.114  1.00 22.10  ? 1033 VAL A CB  1 
ATOM   91    C CG1 . VAL A  1 15  ? 38.745  -23.530 17.632  1.00 22.17  ? 1033 VAL A CG1 1 
ATOM   92    C CG2 . VAL A  1 15  ? 39.855  -22.560 15.611  1.00 23.21  ? 1033 VAL A CG2 1 
ATOM   93    N N   . LEU A  1 16  ? 37.432  -25.065 13.564  1.00 23.06  ? 1034 LEU A N   1 
ATOM   94    C CA  . LEU A  1 16  ? 37.091  -25.037 12.154  1.00 24.13  ? 1034 LEU A CA  1 
ATOM   95    C C   . LEU A  1 16  ? 36.202  -23.824 11.889  1.00 24.64  ? 1034 LEU A C   1 
ATOM   96    O O   . LEU A  1 16  ? 35.218  -23.602 12.595  1.00 23.10  ? 1034 LEU A O   1 
ATOM   97    C CB  . LEU A  1 16  ? 36.360  -26.333 11.783  1.00 26.57  ? 1034 LEU A CB  1 
ATOM   98    C CG  . LEU A  1 16  ? 35.892  -26.617 10.348  1.00 30.00  ? 1034 LEU A CG  1 
ATOM   99    C CD1 . LEU A  1 16  ? 34.696  -25.764 10.005  1.00 31.96  ? 1034 LEU A CD1 1 
ATOM   100   C CD2 . LEU A  1 16  ? 37.027  -26.378 9.376   1.00 32.91  ? 1034 LEU A CD2 1 
ATOM   101   N N   . GLY A  1 17  ? 36.558  -23.039 10.877  1.00 23.02  ? 1035 GLY A N   1 
ATOM   102   C CA  . GLY A  1 17  ? 35.777  -21.863 10.536  1.00 24.20  ? 1035 GLY A CA  1 
ATOM   103   C C   . GLY A  1 17  ? 35.234  -21.976 9.124   1.00 25.80  ? 1035 GLY A C   1 
ATOM   104   O O   . GLY A  1 17  ? 35.029  -23.082 8.621   1.00 24.74  ? 1035 GLY A O   1 
ATOM   105   N N   . LYS A  1 18  ? 35.003  -20.836 8.481   1.00 26.05  ? 1036 LYS A N   1 
ATOM   106   C CA  . LYS A  1 18  ? 34.480  -20.824 7.118   1.00 28.10  ? 1036 LYS A CA  1 
ATOM   107   C C   . LYS A  1 18  ? 35.032  -19.660 6.299   1.00 27.61  ? 1036 LYS A C   1 
ATOM   108   O O   . LYS A  1 18  ? 35.425  -18.629 6.847   1.00 24.99  ? 1036 LYS A O   1 
ATOM   109   C CB  . LYS A  1 18  ? 32.954  -20.736 7.140   1.00 30.68  ? 1036 LYS A CB  1 
ATOM   110   C CG  . LYS A  1 18  ? 32.423  -19.494 7.828   1.00 35.80  ? 1036 LYS A CG  1 
ATOM   111   C CD  . LYS A  1 18  ? 30.913  -19.369 7.673   1.00 40.32  ? 1036 LYS A CD  1 
ATOM   112   C CE  . LYS A  1 18  ? 30.388  -18.140 8.411   1.00 42.38  ? 1036 LYS A CE  1 
ATOM   113   N NZ  . LYS A  1 18  ? 28.929  -17.922 8.192   1.00 44.65  ? 1036 LYS A NZ  1 
ATOM   114   N N   . PHE A  1 19  ? 35.055  -19.838 4.980   1.00 27.93  ? 1037 PHE A N   1 
ATOM   115   C CA  . PHE A  1 19  ? 35.535  -18.806 4.068   1.00 29.00  ? 1037 PHE A CA  1 
ATOM   116   C C   . PHE A  1 19  ? 34.359  -18.020 3.497   1.00 29.70  ? 1037 PHE A C   1 
ATOM   117   O O   . PHE A  1 19  ? 33.365  -18.598 3.057   1.00 30.62  ? 1037 PHE A O   1 
ATOM   118   C CB  . PHE A  1 19  ? 36.320  -19.433 2.910   1.00 30.16  ? 1037 PHE A CB  1 
ATOM   119   C CG  . PHE A  1 19  ? 37.740  -19.784 3.248   1.00 30.56  ? 1037 PHE A CG  1 
ATOM   120   C CD1 . PHE A  1 19  ? 38.245  -21.045 2.948   1.00 31.64  ? 1037 PHE A CD1 1 
ATOM   121   C CD2 . PHE A  1 19  ? 38.582  -18.848 3.835   1.00 30.98  ? 1037 PHE A CD2 1 
ATOM   122   C CE1 . PHE A  1 19  ? 39.572  -21.367 3.229   1.00 32.38  ? 1037 PHE A CE1 1 
ATOM   123   C CE2 . PHE A  1 19  ? 39.909  -19.159 4.120   1.00 31.34  ? 1037 PHE A CE2 1 
ATOM   124   C CZ  . PHE A  1 19  ? 40.405  -20.421 3.816   1.00 31.23  ? 1037 PHE A CZ  1 
ATOM   125   N N   . VAL A  1 20  ? 34.473  -16.699 3.514   1.00 30.29  ? 1038 VAL A N   1 
ATOM   126   C CA  . VAL A  1 20  ? 33.431  -15.836 2.975   1.00 31.11  ? 1038 VAL A CA  1 
ATOM   127   C C   . VAL A  1 20  ? 34.073  -14.850 2.011   1.00 31.76  ? 1038 VAL A C   1 
ATOM   128   O O   . VAL A  1 20  ? 35.062  -14.196 2.341   1.00 30.27  ? 1038 VAL A O   1 
ATOM   129   C CB  . VAL A  1 20  ? 32.704  -15.055 4.084   1.00 30.35  ? 1038 VAL A CB  1 
ATOM   130   C CG1 . VAL A  1 20  ? 31.665  -14.130 3.470   1.00 29.74  ? 1038 VAL A CG1 1 
ATOM   131   C CG2 . VAL A  1 20  ? 32.038  -16.027 5.043   1.00 29.95  ? 1038 VAL A CG2 1 
ATOM   132   N N   . SER A  1 21  ? 33.511  -14.757 0.813   1.00 33.99  ? 1039 SER A N   1 
ATOM   133   C CA  . SER A  1 21  ? 34.042  -13.867 -0.203  1.00 36.95  ? 1039 SER A CA  1 
ATOM   134   C C   . SER A  1 21  ? 33.308  -12.541 -0.274  1.00 37.53  ? 1039 SER A C   1 
ATOM   135   O O   . SER A  1 21  ? 32.113  -12.450 0.012   1.00 39.05  ? 1039 SER A O   1 
ATOM   136   C CB  . SER A  1 21  ? 33.993  -14.548 -1.568  1.00 37.32  ? 1039 SER A CB  1 
ATOM   137   O OG  . SER A  1 21  ? 34.782  -15.724 -1.565  1.00 41.81  ? 1039 SER A OG  1 
ATOM   138   N N   . LEU A  1 22  ? 34.045  -11.510 -0.657  1.00 38.97  ? 1040 LEU A N   1 
ATOM   139   C CA  . LEU A  1 22  ? 33.489  -10.178 -0.789  1.00 40.71  ? 1040 LEU A CA  1 
ATOM   140   C C   . LEU A  1 22  ? 33.701  -9.757  -2.243  1.00 41.28  ? 1040 LEU A C   1 
ATOM   141   O O   . LEU A  1 22  ? 34.830  -9.739  -2.730  1.00 40.72  ? 1040 LEU A O   1 
ATOM   142   C CB  . LEU A  1 22  ? 34.211  -9.224  0.166   1.00 41.13  ? 1040 LEU A CB  1 
ATOM   143   C CG  . LEU A  1 22  ? 33.555  -7.874  0.457   1.00 42.60  ? 1040 LEU A CG  1 
ATOM   144   C CD1 . LEU A  1 22  ? 32.187  -8.088  1.100   1.00 42.85  ? 1040 LEU A CD1 1 
ATOM   145   C CD2 . LEU A  1 22  ? 34.456  -7.071  1.380   1.00 42.24  ? 1040 LEU A CD2 1 
ATOM   146   N N   . GLU A  1 23  ? 32.608  -9.442  -2.930  1.00 42.90  ? 1041 GLU A N   1 
ATOM   147   C CA  . GLU A  1 23  ? 32.646  -9.031  -4.334  1.00 45.06  ? 1041 GLU A CA  1 
ATOM   148   C C   . GLU A  1 23  ? 33.824  -8.104  -4.621  1.00 45.54  ? 1041 GLU A C   1 
ATOM   149   O O   . GLU A  1 23  ? 33.834  -6.953  -4.188  1.00 46.48  ? 1041 GLU A O   1 
ATOM   150   C CB  . GLU A  1 23  ? 31.336  -8.323  -4.699  1.00 46.26  ? 1041 GLU A CB  1 
ATOM   151   C CG  . GLU A  1 23  ? 31.172  -7.960  -6.175  1.00 48.80  ? 1041 GLU A CG  1 
ATOM   152   C CD  . GLU A  1 23  ? 30.912  -9.171  -7.060  1.00 50.81  ? 1041 GLU A CD  1 
ATOM   153   O OE1 . GLU A  1 23  ? 30.031  -9.989  -6.714  1.00 50.31  ? 1041 GLU A OE1 1 
ATOM   154   O OE2 . GLU A  1 23  ? 31.578  -9.299  -8.110  1.00 51.33  ? 1041 GLU A OE2 1 
ATOM   155   N N   . GLY A  1 24  ? 34.820  -8.609  -5.342  1.00 45.90  ? 1042 GLY A N   1 
ATOM   156   C CA  . GLY A  1 24  ? 35.968  -7.784  -5.673  1.00 45.38  ? 1042 GLY A CA  1 
ATOM   157   C C   . GLY A  1 24  ? 37.297  -8.196  -5.066  1.00 45.44  ? 1042 GLY A C   1 
ATOM   158   O O   . GLY A  1 24  ? 38.349  -7.878  -5.618  1.00 46.16  ? 1042 GLY A O   1 
ATOM   159   N N   . PHE A  1 25  ? 37.263  -8.887  -3.930  1.00 43.99  ? 1043 PHE A N   1 
ATOM   160   C CA  . PHE A  1 25  ? 38.492  -9.326  -3.277  1.00 42.70  ? 1043 PHE A CA  1 
ATOM   161   C C   . PHE A  1 25  ? 38.830  -10.762 -3.661  1.00 42.94  ? 1043 PHE A C   1 
ATOM   162   O O   . PHE A  1 25  ? 37.974  -11.645 -3.610  1.00 43.60  ? 1043 PHE A O   1 
ATOM   163   C CB  . PHE A  1 25  ? 38.362  -9.208  -1.755  1.00 41.06  ? 1043 PHE A CB  1 
ATOM   164   C CG  . PHE A  1 25  ? 38.236  -7.795  -1.272  1.00 38.49  ? 1043 PHE A CG  1 
ATOM   165   C CD1 . PHE A  1 25  ? 37.053  -7.086  -1.455  1.00 37.71  ? 1043 PHE A CD1 1 
ATOM   166   C CD2 . PHE A  1 25  ? 39.319  -7.152  -0.678  1.00 37.79  ? 1043 PHE A CD2 1 
ATOM   167   C CE1 . PHE A  1 25  ? 36.950  -5.755  -1.056  1.00 36.98  ? 1043 PHE A CE1 1 
ATOM   168   C CE2 . PHE A  1 25  ? 39.227  -5.823  -0.275  1.00 37.20  ? 1043 PHE A CE2 1 
ATOM   169   C CZ  . PHE A  1 25  ? 38.039  -5.122  -0.466  1.00 36.26  ? 1043 PHE A CZ  1 
ATOM   170   N N   . ALA A  1 26  ? 40.082  -10.987 -4.043  1.00 43.08  ? 1044 ALA A N   1 
ATOM   171   C CA  . ALA A  1 26  ? 40.538  -12.314 -4.454  1.00 43.25  ? 1044 ALA A CA  1 
ATOM   172   C C   . ALA A  1 26  ? 40.635  -13.296 -3.288  1.00 42.46  ? 1044 ALA A C   1 
ATOM   173   O O   . ALA A  1 26  ? 40.172  -14.432 -3.384  1.00 43.39  ? 1044 ALA A O   1 
ATOM   174   C CB  . ALA A  1 26  ? 41.888  -12.201 -5.154  1.00 42.96  ? 1044 ALA A CB  1 
ATOM   175   N N   . GLN A  1 27  ? 41.244  -12.854 -2.194  1.00 41.33  ? 1045 GLN A N   1 
ATOM   176   C CA  . GLN A  1 27  ? 41.409  -13.688 -1.005  1.00 40.65  ? 1045 GLN A CA  1 
ATOM   177   C C   . GLN A  1 27  ? 40.154  -13.656 -0.132  1.00 38.33  ? 1045 GLN A C   1 
ATOM   178   O O   . GLN A  1 27  ? 39.688  -12.587 0.264   1.00 37.74  ? 1045 GLN A O   1 
ATOM   179   C CB  . GLN A  1 27  ? 42.617  -13.194 -0.200  1.00 42.97  ? 1045 GLN A CB  1 
ATOM   180   C CG  . GLN A  1 27  ? 42.782  -13.804 1.191   1.00 46.89  ? 1045 GLN A CG  1 
ATOM   181   C CD  . GLN A  1 27  ? 43.300  -15.231 1.164   1.00 49.18  ? 1045 GLN A CD  1 
ATOM   182   O OE1 . GLN A  1 27  ? 44.332  -15.518 0.554   1.00 49.81  ? 1045 GLN A OE1 1 
ATOM   183   N NE2 . GLN A  1 27  ? 42.592  -16.131 1.841   1.00 50.04  ? 1045 GLN A NE2 1 
ATOM   184   N N   . PRO A  1 28  ? 39.578  -14.831 0.168   1.00 36.55  ? 1046 PRO A N   1 
ATOM   185   C CA  . PRO A  1 28  ? 38.376  -14.860 1.005   1.00 34.08  ? 1046 PRO A CA  1 
ATOM   186   C C   . PRO A  1 28  ? 38.735  -14.636 2.471   1.00 31.56  ? 1046 PRO A C   1 
ATOM   187   O O   . PRO A  1 28  ? 39.858  -14.910 2.891   1.00 32.07  ? 1046 PRO A O   1 
ATOM   188   C CB  . PRO A  1 28  ? 37.816  -16.256 0.752   1.00 35.32  ? 1046 PRO A CB  1 
ATOM   189   C CG  . PRO A  1 28  ? 39.057  -17.069 0.558   1.00 37.24  ? 1046 PRO A CG  1 
ATOM   190   C CD  . PRO A  1 28  ? 39.899  -16.179 -0.338  1.00 36.94  ? 1046 PRO A CD  1 
ATOM   191   N N   . VAL A  1 29  ? 37.786  -14.123 3.243   1.00 27.57  ? 1047 VAL A N   1 
ATOM   192   C CA  . VAL A  1 29  ? 38.026  -13.881 4.659   1.00 24.94  ? 1047 VAL A CA  1 
ATOM   193   C C   . VAL A  1 29  ? 37.664  -15.133 5.448   1.00 23.86  ? 1047 VAL A C   1 
ATOM   194   O O   . VAL A  1 29  ? 36.637  -15.763 5.189   1.00 25.19  ? 1047 VAL A O   1 
ATOM   195   C CB  . VAL A  1 29  ? 37.184  -12.685 5.166   1.00 24.92  ? 1047 VAL A CB  1 
ATOM   196   C CG1 . VAL A  1 29  ? 37.438  -12.448 6.654   1.00 24.29  ? 1047 VAL A CG1 1 
ATOM   197   C CG2 . VAL A  1 29  ? 37.539  -11.435 4.369   1.00 22.43  ? 1047 VAL A CG2 1 
ATOM   198   N N   . ALA A  1 30  ? 38.523  -15.514 6.387   1.00 22.14  ? 1048 ALA A N   1 
ATOM   199   C CA  . ALA A  1 30  ? 38.258  -16.689 7.211   1.00 21.45  ? 1048 ALA A CA  1 
ATOM   200   C C   . ALA A  1 30  ? 37.528  -16.206 8.465   1.00 20.76  ? 1048 ALA A C   1 
ATOM   201   O O   . ALA A  1 30  ? 38.009  -15.318 9.168   1.00 18.35  ? 1048 ALA A O   1 
ATOM   202   C CB  . ALA A  1 30  ? 39.569  -17.386 7.588   1.00 20.08  ? 1048 ALA A CB  1 
ATOM   203   N N   . ILE A  1 31  ? 36.362  -16.786 8.730   1.00 20.64  ? 1049 ILE A N   1 
ATOM   204   C CA  . ILE A  1 31  ? 35.564  -16.389 9.882   1.00 20.24  ? 1049 ILE A CA  1 
ATOM   205   C C   . ILE A  1 31  ? 35.385  -17.527 10.875  1.00 18.71  ? 1049 ILE A C   1 
ATOM   206   O O   . ILE A  1 31  ? 35.099  -18.660 10.494  1.00 17.34  ? 1049 ILE A O   1 
ATOM   207   C CB  . ILE A  1 31  ? 34.179  -15.882 9.424   1.00 22.63  ? 1049 ILE A CB  1 
ATOM   208   C CG1 . ILE A  1 31  ? 34.364  -14.693 8.471   1.00 23.60  ? 1049 ILE A CG1 1 
ATOM   209   C CG2 . ILE A  1 31  ? 33.339  -15.485 10.627  1.00 22.88  ? 1049 ILE A CG2 1 
ATOM   210   C CD1 . ILE A  1 31  ? 33.077  -14.128 7.919   1.00 25.57  ? 1049 ILE A CD1 1 
ATOM   211   N N   . PHE A  1 32  ? 35.572  -17.218 12.154  1.00 17.85  ? 1050 PHE A N   1 
ATOM   212   C CA  . PHE A  1 32  ? 35.413  -18.210 13.208  1.00 17.77  ? 1050 PHE A CA  1 
ATOM   213   C C   . PHE A  1 32  ? 34.437  -17.638 14.216  1.00 19.27  ? 1050 PHE A C   1 
ATOM   214   O O   . PHE A  1 32  ? 34.692  -16.592 14.820  1.00 18.42  ? 1050 PHE A O   1 
ATOM   215   C CB  . PHE A  1 32  ? 36.753  -18.513 13.881  1.00 18.02  ? 1050 PHE A CB  1 
ATOM   216   C CG  . PHE A  1 32  ? 37.800  -19.014 12.934  1.00 18.50  ? 1050 PHE A CG  1 
ATOM   217   C CD1 . PHE A  1 32  ? 38.481  -18.133 12.095  1.00 18.59  ? 1050 PHE A CD1 1 
ATOM   218   C CD2 . PHE A  1 32  ? 38.082  -20.377 12.850  1.00 18.58  ? 1050 PHE A CD2 1 
ATOM   219   C CE1 . PHE A  1 32  ? 39.430  -18.606 11.180  1.00 20.61  ? 1050 PHE A CE1 1 
ATOM   220   C CE2 . PHE A  1 32  ? 39.027  -20.861 11.938  1.00 19.61  ? 1050 PHE A CE2 1 
ATOM   221   C CZ  . PHE A  1 32  ? 39.701  -19.976 11.103  1.00 19.85  ? 1050 PHE A CZ  1 
ATOM   222   N N   . LEU A  1 33  ? 33.315  -18.330 14.389  1.00 18.25  ? 1051 LEU A N   1 
ATOM   223   C CA  . LEU A  1 33  ? 32.271  -17.880 15.291  1.00 17.19  ? 1051 LEU A CA  1 
ATOM   224   C C   . LEU A  1 33  ? 32.123  -18.729 16.549  1.00 18.20  ? 1051 LEU A C   1 
ATOM   225   O O   . LEU A  1 33  ? 32.131  -19.965 16.497  1.00 17.31  ? 1051 LEU A O   1 
ATOM   226   C CB  . LEU A  1 33  ? 30.935  -17.856 14.546  1.00 16.61  ? 1051 LEU A CB  1 
ATOM   227   C CG  . LEU A  1 33  ? 30.890  -17.073 13.229  1.00 18.09  ? 1051 LEU A CG  1 
ATOM   228   C CD1 . LEU A  1 33  ? 29.541  -17.287 12.576  1.00 18.38  ? 1051 LEU A CD1 1 
ATOM   229   C CD2 . LEU A  1 33  ? 31.128  -15.582 13.483  1.00 15.68  ? 1051 LEU A CD2 1 
ATOM   230   N N   . GLY A  1 34  ? 31.986  -18.049 17.678  1.00 16.01  ? 1052 GLY A N   1 
ATOM   231   C CA  . GLY A  1 34  ? 31.788  -18.741 18.932  1.00 14.96  ? 1052 GLY A CA  1 
ATOM   232   C C   . GLY A  1 34  ? 32.978  -19.455 19.534  1.00 15.77  ? 1052 GLY A C   1 
ATOM   233   O O   . GLY A  1 34  ? 32.841  -20.578 20.013  1.00 14.51  ? 1052 GLY A O   1 
ATOM   234   N N   . ILE A  1 35  ? 34.147  -18.823 19.517  1.00 13.83  ? 1053 ILE A N   1 
ATOM   235   C CA  . ILE A  1 35  ? 35.316  -19.445 20.124  1.00 14.88  ? 1053 ILE A CA  1 
ATOM   236   C C   . ILE A  1 35  ? 35.283  -19.077 21.607  1.00 13.49  ? 1053 ILE A C   1 
ATOM   237   O O   . ILE A  1 35  ? 35.180  -17.905 21.954  1.00 13.74  ? 1053 ILE A O   1 
ATOM   238   C CB  . ILE A  1 35  ? 36.621  -18.906 19.519  1.00 15.69  ? 1053 ILE A CB  1 
ATOM   239   C CG1 . ILE A  1 35  ? 36.690  -19.267 18.033  1.00 15.68  ? 1053 ILE A CG1 1 
ATOM   240   C CG2 . ILE A  1 35  ? 37.810  -19.467 20.273  1.00 16.87  ? 1053 ILE A CG2 1 
ATOM   241   C CD1 . ILE A  1 35  ? 37.845  -18.623 17.314  1.00 18.89  ? 1053 ILE A CD1 1 
ATOM   242   N N   . PRO A  1 36  ? 35.360  -20.070 22.501  1.00 12.86  ? 1054 PRO A N   1 
ATOM   243   C CA  . PRO A  1 36  ? 35.334  -19.758 23.935  1.00 13.41  ? 1054 PRO A CA  1 
ATOM   244   C C   . PRO A  1 36  ? 36.673  -19.230 24.450  1.00 15.15  ? 1054 PRO A C   1 
ATOM   245   O O   . PRO A  1 36  ? 37.723  -19.799 24.147  1.00 16.69  ? 1054 PRO A O   1 
ATOM   246   C CB  . PRO A  1 36  ? 34.964  -21.096 24.563  1.00 15.35  ? 1054 PRO A CB  1 
ATOM   247   C CG  . PRO A  1 36  ? 35.620  -22.077 23.636  1.00 14.25  ? 1054 PRO A CG  1 
ATOM   248   C CD  . PRO A  1 36  ? 35.284  -21.524 22.273  1.00 13.54  ? 1054 PRO A CD  1 
ATOM   249   N N   . PHE A  1 37  ? 36.644  -18.141 25.217  1.00 13.53  ? 1055 PHE A N   1 
ATOM   250   C CA  . PHE A  1 37  ? 37.875  -17.585 25.770  1.00 13.07  ? 1055 PHE A CA  1 
ATOM   251   C C   . PHE A  1 37  ? 37.934  -17.755 27.292  1.00 15.21  ? 1055 PHE A C   1 
ATOM   252   O O   . PHE A  1 37  ? 38.904  -17.356 27.943  1.00 16.17  ? 1055 PHE A O   1 
ATOM   253   C CB  . PHE A  1 37  ? 38.040  -16.104 25.366  1.00 13.52  ? 1055 PHE A CB  1 
ATOM   254   C CG  . PHE A  1 37  ? 37.014  -15.165 25.968  1.00 13.49  ? 1055 PHE A CG  1 
ATOM   255   C CD1 . PHE A  1 37  ? 37.131  -14.731 27.287  1.00 12.55  ? 1055 PHE A CD1 1 
ATOM   256   C CD2 . PHE A  1 37  ? 35.954  -14.688 25.199  1.00 14.08  ? 1055 PHE A CD2 1 
ATOM   257   C CE1 . PHE A  1 37  ? 36.207  -13.833 27.832  1.00 13.31  ? 1055 PHE A CE1 1 
ATOM   258   C CE2 . PHE A  1 37  ? 35.022  -13.792 25.732  1.00 11.89  ? 1055 PHE A CE2 1 
ATOM   259   C CZ  . PHE A  1 37  ? 35.149  -13.362 27.053  1.00 10.90  ? 1055 PHE A CZ  1 
ATOM   260   N N   . ALA A  1 38  ? 36.893  -18.362 27.853  1.00 14.64  ? 1056 ALA A N   1 
ATOM   261   C CA  . ALA A  1 38  ? 36.832  -18.604 29.294  1.00 16.49  ? 1056 ALA A CA  1 
ATOM   262   C C   . ALA A  1 38  ? 35.898  -19.774 29.582  1.00 18.04  ? 1056 ALA A C   1 
ATOM   263   O O   . ALA A  1 38  ? 35.186  -20.252 28.696  1.00 18.44  ? 1056 ALA A O   1 
ATOM   264   C CB  . ALA A  1 38  ? 36.333  -17.355 30.016  1.00 16.58  ? 1056 ALA A CB  1 
ATOM   265   N N   . LYS A  1 39  ? 35.906  -20.244 30.823  1.00 19.28  ? 1057 LYS A N   1 
ATOM   266   C CA  . LYS A  1 39  ? 35.023  -21.332 31.205  1.00 20.16  ? 1057 LYS A CA  1 
ATOM   267   C C   . LYS A  1 39  ? 33.638  -20.713 31.439  1.00 19.78  ? 1057 LYS A C   1 
ATOM   268   O O   . LYS A  1 39  ? 33.537  -19.591 31.926  1.00 20.64  ? 1057 LYS A O   1 
ATOM   269   C CB  . LYS A  1 39  ? 35.535  -21.991 32.486  1.00 23.14  ? 1057 LYS A CB  1 
ATOM   270   C CG  . LYS A  1 39  ? 34.722  -23.190 32.944  1.00 26.01  ? 1057 LYS A CG  1 
ATOM   271   C CD  . LYS A  1 39  ? 35.384  -23.864 34.128  1.00 29.70  ? 1057 LYS A CD  1 
ATOM   272   C CE  . LYS A  1 39  ? 34.605  -25.098 34.561  1.00 32.61  ? 1057 LYS A CE  1 
ATOM   273   N NZ  . LYS A  1 39  ? 35.312  -25.831 35.644  1.00 34.26  ? 1057 LYS A NZ  1 
ATOM   274   N N   . PRO A  1 40  ? 32.559  -21.420 31.060  1.00 19.96  ? 1058 PRO A N   1 
ATOM   275   C CA  . PRO A  1 40  ? 31.203  -20.891 31.260  1.00 19.50  ? 1058 PRO A CA  1 
ATOM   276   C C   . PRO A  1 40  ? 30.972  -20.553 32.742  1.00 19.60  ? 1058 PRO A C   1 
ATOM   277   O O   . PRO A  1 40  ? 31.033  -21.424 33.604  1.00 19.54  ? 1058 PRO A O   1 
ATOM   278   C CB  . PRO A  1 40  ? 30.320  -22.033 30.772  1.00 20.64  ? 1058 PRO A CB  1 
ATOM   279   C CG  . PRO A  1 40  ? 31.142  -22.620 29.657  1.00 20.93  ? 1058 PRO A CG  1 
ATOM   280   C CD  . PRO A  1 40  ? 32.526  -22.668 30.276  1.00 20.34  ? 1058 PRO A CD  1 
ATOM   281   N N   . PRO A  1 41  ? 30.694  -19.278 33.046  1.00 18.31  ? 1059 PRO A N   1 
ATOM   282   C CA  . PRO A  1 41  ? 30.465  -18.819 34.421  1.00 18.51  ? 1059 PRO A CA  1 
ATOM   283   C C   . PRO A  1 41  ? 29.121  -19.255 35.001  1.00 18.42  ? 1059 PRO A C   1 
ATOM   284   O O   . PRO A  1 41  ? 28.277  -18.417 35.325  1.00 20.53  ? 1059 PRO A O   1 
ATOM   285   C CB  . PRO A  1 41  ? 30.573  -17.308 34.281  1.00 17.22  ? 1059 PRO A CB  1 
ATOM   286   C CG  . PRO A  1 41  ? 29.886  -17.078 32.974  1.00 18.46  ? 1059 PRO A CG  1 
ATOM   287   C CD  . PRO A  1 41  ? 30.471  -18.178 32.088  1.00 17.35  ? 1059 PRO A CD  1 
ATOM   288   N N   . LEU A  1 42  ? 28.938  -20.563 35.134  1.00 17.63  ? 1060 LEU A N   1 
ATOM   289   C CA  . LEU A  1 42  ? 27.695  -21.127 35.645  1.00 20.54  ? 1060 LEU A CA  1 
ATOM   290   C C   . LEU A  1 42  ? 27.825  -21.606 37.087  1.00 20.63  ? 1060 LEU A C   1 
ATOM   291   O O   . LEU A  1 42  ? 28.920  -21.890 37.564  1.00 21.74  ? 1060 LEU A O   1 
ATOM   292   C CB  . LEU A  1 42  ? 27.263  -22.302 34.766  1.00 19.59  ? 1060 LEU A CB  1 
ATOM   293   C CG  . LEU A  1 42  ? 27.300  -22.083 33.251  1.00 20.38  ? 1060 LEU A CG  1 
ATOM   294   C CD1 . LEU A  1 42  ? 26.905  -23.374 32.547  1.00 20.01  ? 1060 LEU A CD1 1 
ATOM   295   C CD2 . LEU A  1 42  ? 26.367  -20.945 32.859  1.00 18.80  ? 1060 LEU A CD2 1 
ATOM   296   N N   . GLY A  1 43  ? 26.693  -21.701 37.774  1.00 23.16  ? 1061 GLY A N   1 
ATOM   297   C CA  . GLY A  1 43  ? 26.702  -22.162 39.152  1.00 22.71  ? 1061 GLY A CA  1 
ATOM   298   C C   . GLY A  1 43  ? 27.587  -21.349 40.082  1.00 23.92  ? 1061 GLY A C   1 
ATOM   299   O O   . GLY A  1 43  ? 27.385  -20.141 40.234  1.00 24.04  ? 1061 GLY A O   1 
ATOM   300   N N   . PRO A  1 44  ? 28.583  -21.984 40.721  1.00 23.12  ? 1062 PRO A N   1 
ATOM   301   C CA  . PRO A  1 44  ? 29.497  -21.305 41.646  1.00 23.87  ? 1062 PRO A CA  1 
ATOM   302   C C   . PRO A  1 44  ? 30.384  -20.230 41.015  1.00 24.32  ? 1062 PRO A C   1 
ATOM   303   O O   . PRO A  1 44  ? 30.956  -19.400 41.723  1.00 23.62  ? 1062 PRO A O   1 
ATOM   304   C CB  . PRO A  1 44  ? 30.312  -22.456 42.231  1.00 24.64  ? 1062 PRO A CB  1 
ATOM   305   C CG  . PRO A  1 44  ? 30.355  -23.444 41.089  1.00 26.64  ? 1062 PRO A CG  1 
ATOM   306   C CD  . PRO A  1 44  ? 28.921  -23.414 40.605  1.00 25.51  ? 1062 PRO A CD  1 
ATOM   307   N N   . LEU A  1 45  ? 30.498  -20.246 39.691  1.00 22.66  ? 1063 LEU A N   1 
ATOM   308   C CA  . LEU A  1 45  ? 31.320  -19.262 38.997  1.00 21.16  ? 1063 LEU A CA  1 
ATOM   309   C C   . LEU A  1 45  ? 30.591  -17.937 38.781  1.00 20.47  ? 1063 LEU A C   1 
ATOM   310   O O   . LEU A  1 45  ? 31.206  -16.942 38.397  1.00 20.38  ? 1063 LEU A O   1 
ATOM   311   C CB  . LEU A  1 45  ? 31.806  -19.833 37.658  1.00 20.19  ? 1063 LEU A CB  1 
ATOM   312   C CG  . LEU A  1 45  ? 32.781  -21.010 37.820  1.00 22.10  ? 1063 LEU A CG  1 
ATOM   313   C CD1 . LEU A  1 45  ? 33.294  -21.467 36.457  1.00 21.57  ? 1063 LEU A CD1 1 
ATOM   314   C CD2 . LEU A  1 45  ? 33.938  -20.589 38.703  1.00 21.56  ? 1063 LEU A CD2 1 
ATOM   315   N N   . ARG A  1 46  ? 29.282  -17.914 39.021  1.00 17.76  ? 1064 ARG A N   1 
ATOM   316   C CA  . ARG A  1 46  ? 28.544  -16.663 38.862  1.00 16.70  ? 1064 ARG A CA  1 
ATOM   317   C C   . ARG A  1 46  ? 29.114  -15.691 39.896  1.00 16.92  ? 1064 ARG A C   1 
ATOM   318   O O   . ARG A  1 46  ? 29.436  -16.085 41.015  1.00 17.63  ? 1064 ARG A O   1 
ATOM   319   C CB  . ARG A  1 46  ? 27.046  -16.883 39.095  1.00 15.06  ? 1064 ARG A CB  1 
ATOM   320   C CG  . ARG A  1 46  ? 26.183  -15.664 38.794  1.00 16.22  ? 1064 ARG A CG  1 
ATOM   321   C CD  . ARG A  1 46  ? 24.711  -15.921 39.135  1.00 17.78  ? 1064 ARG A CD  1 
ATOM   322   N NE  . ARG A  1 46  ? 24.056  -16.840 38.203  1.00 19.17  ? 1064 ARG A NE  1 
ATOM   323   C CZ  . ARG A  1 46  ? 22.945  -17.519 38.481  1.00 22.29  ? 1064 ARG A CZ  1 
ATOM   324   N NH1 . ARG A  1 46  ? 22.362  -17.390 39.672  1.00 20.30  ? 1064 ARG A NH1 1 
ATOM   325   N NH2 . ARG A  1 46  ? 22.405  -18.318 37.568  1.00 19.32  ? 1064 ARG A NH2 1 
ATOM   326   N N   . PHE A  1 47  ? 29.251  -14.426 39.514  1.00 16.65  ? 1065 PHE A N   1 
ATOM   327   C CA  . PHE A  1 47  ? 29.808  -13.410 40.398  1.00 17.79  ? 1065 PHE A CA  1 
ATOM   328   C C   . PHE A  1 47  ? 31.261  -13.697 40.820  1.00 17.72  ? 1065 PHE A C   1 
ATOM   329   O O   . PHE A  1 47  ? 31.652  -13.406 41.952  1.00 17.98  ? 1065 PHE A O   1 
ATOM   330   C CB  . PHE A  1 47  ? 28.932  -13.234 41.652  1.00 17.43  ? 1065 PHE A CB  1 
ATOM   331   C CG  . PHE A  1 47  ? 27.462  -13.068 41.351  1.00 18.00  ? 1065 PHE A CG  1 
ATOM   332   C CD1 . PHE A  1 47  ? 27.029  -12.154 40.390  1.00 15.26  ? 1065 PHE A CD1 1 
ATOM   333   C CD2 . PHE A  1 47  ? 26.512  -13.831 42.027  1.00 18.20  ? 1065 PHE A CD2 1 
ATOM   334   C CE1 . PHE A  1 47  ? 25.674  -12.003 40.102  1.00 16.10  ? 1065 PHE A CE1 1 
ATOM   335   C CE2 . PHE A  1 47  ? 25.150  -13.690 41.749  1.00 17.27  ? 1065 PHE A CE2 1 
ATOM   336   C CZ  . PHE A  1 47  ? 24.730  -12.773 40.784  1.00 17.53  ? 1065 PHE A CZ  1 
ATOM   337   N N   . THR A  1 48  ? 32.049  -14.281 39.920  1.00 18.01  ? 1066 THR A N   1 
ATOM   338   C CA  . THR A  1 48  ? 33.474  -14.552 40.183  1.00 17.07  ? 1066 THR A CA  1 
ATOM   339   C C   . THR A  1 48  ? 34.254  -14.233 38.909  1.00 16.45  ? 1066 THR A C   1 
ATOM   340   O O   . THR A  1 48  ? 33.682  -14.179 37.817  1.00 16.22  ? 1066 THR A O   1 
ATOM   341   C CB  . THR A  1 48  ? 33.784  -16.040 40.509  1.00 18.61  ? 1066 THR A CB  1 
ATOM   342   O OG1 . THR A  1 48  ? 33.591  -16.832 39.329  1.00 19.71  ? 1066 THR A OG1 1 
ATOM   343   C CG2 . THR A  1 48  ? 32.909  -16.557 41.639  1.00 18.23  ? 1066 THR A CG2 1 
ATOM   344   N N   . PRO A  1 49  ? 35.572  -14.016 39.033  1.00 16.65  ? 1067 PRO A N   1 
ATOM   345   C CA  . PRO A  1 49  ? 36.410  -13.708 37.871  1.00 15.54  ? 1067 PRO A CA  1 
ATOM   346   C C   . PRO A  1 49  ? 36.344  -14.857 36.865  1.00 17.35  ? 1067 PRO A C   1 
ATOM   347   O O   . PRO A  1 49  ? 36.152  -16.014 37.241  1.00 17.10  ? 1067 PRO A O   1 
ATOM   348   C CB  . PRO A  1 49  ? 37.802  -13.554 38.481  1.00 16.07  ? 1067 PRO A CB  1 
ATOM   349   C CG  . PRO A  1 49  ? 37.504  -13.041 39.864  1.00 17.68  ? 1067 PRO A CG  1 
ATOM   350   C CD  . PRO A  1 49  ? 36.346  -13.916 40.282  1.00 15.79  ? 1067 PRO A CD  1 
ATOM   351   N N   . PRO A  1 50  ? 36.496  -14.555 35.570  1.00 17.00  ? 1068 PRO A N   1 
ATOM   352   C CA  . PRO A  1 50  ? 36.439  -15.628 34.575  1.00 16.10  ? 1068 PRO A CA  1 
ATOM   353   C C   . PRO A  1 50  ? 37.657  -16.546 34.669  1.00 16.36  ? 1068 PRO A C   1 
ATOM   354   O O   . PRO A  1 50  ? 38.768  -16.097 34.929  1.00 16.08  ? 1068 PRO A O   1 
ATOM   355   C CB  . PRO A  1 50  ? 36.370  -14.867 33.250  1.00 15.77  ? 1068 PRO A CB  1 
ATOM   356   C CG  . PRO A  1 50  ? 37.200  -13.629 33.543  1.00 18.21  ? 1068 PRO A CG  1 
ATOM   357   C CD  . PRO A  1 50  ? 36.751  -13.245 34.940  1.00 17.36  ? 1068 PRO A CD  1 
ATOM   358   N N   . GLN A  1 51  ? 37.442  -17.839 34.479  1.00 16.16  ? 1069 GLN A N   1 
ATOM   359   C CA  . GLN A  1 51  ? 38.544  -18.784 34.545  1.00 18.26  ? 1069 GLN A CA  1 
ATOM   360   C C   . GLN A  1 51  ? 38.874  -19.223 33.127  1.00 18.18  ? 1069 GLN A C   1 
ATOM   361   O O   . GLN A  1 51  ? 38.063  -19.059 32.218  1.00 17.82  ? 1069 GLN A O   1 
ATOM   362   C CB  . GLN A  1 51  ? 38.159  -19.990 35.405  1.00 21.21  ? 1069 GLN A CB  1 
ATOM   363   C CG  . GLN A  1 51  ? 37.643  -19.606 36.785  1.00 26.39  ? 1069 GLN A CG  1 
ATOM   364   C CD  . GLN A  1 51  ? 37.460  -20.801 37.706  1.00 31.06  ? 1069 GLN A CD  1 
ATOM   365   O OE1 . GLN A  1 51  ? 37.087  -21.891 37.268  1.00 35.08  ? 1069 GLN A OE1 1 
ATOM   366   N NE2 . GLN A  1 51  ? 37.710  -20.596 38.994  1.00 33.85  ? 1069 GLN A NE2 1 
ATOM   367   N N   . PRO A  1 52  ? 40.078  -19.770 32.917  1.00 19.76  ? 1070 PRO A N   1 
ATOM   368   C CA  . PRO A  1 52  ? 40.505  -20.229 31.591  1.00 19.76  ? 1070 PRO A CA  1 
ATOM   369   C C   . PRO A  1 52  ? 39.562  -21.288 31.033  1.00 19.61  ? 1070 PRO A C   1 
ATOM   370   O O   . PRO A  1 52  ? 38.981  -22.058 31.788  1.00 17.43  ? 1070 PRO A O   1 
ATOM   371   C CB  . PRO A  1 52  ? 41.898  -20.793 31.858  1.00 21.43  ? 1070 PRO A CB  1 
ATOM   372   C CG  . PRO A  1 52  ? 42.378  -19.973 33.032  1.00 22.44  ? 1070 PRO A CG  1 
ATOM   373   C CD  . PRO A  1 52  ? 41.155  -19.944 33.907  1.00 20.92  ? 1070 PRO A CD  1 
ATOM   374   N N   . ALA A  1 53  ? 39.407  -21.314 29.712  1.00 18.57  ? 1071 ALA A N   1 
ATOM   375   C CA  . ALA A  1 53  ? 38.554  -22.295 29.065  1.00 18.17  ? 1071 ALA A CA  1 
ATOM   376   C C   . ALA A  1 53  ? 39.246  -23.656 29.106  1.00 18.88  ? 1071 ALA A C   1 
ATOM   377   O O   . ALA A  1 53  ? 40.473  -23.736 29.084  1.00 19.20  ? 1071 ALA A O   1 
ATOM   378   C CB  . ALA A  1 53  ? 38.289  -21.885 27.613  1.00 18.09  ? 1071 ALA A CB  1 
ATOM   379   N N   . GLU A  1 54  ? 38.462  -24.724 29.177  1.00 20.31  ? 1072 GLU A N   1 
ATOM   380   C CA  . GLU A  1 54  ? 39.024  -26.069 29.208  1.00 22.03  ? 1072 GLU A CA  1 
ATOM   381   C C   . GLU A  1 54  ? 39.417  -26.505 27.799  1.00 20.58  ? 1072 GLU A C   1 
ATOM   382   O O   . GLU A  1 54  ? 38.694  -26.250 26.833  1.00 19.32  ? 1072 GLU A O   1 
ATOM   383   C CB  . GLU A  1 54  ? 38.010  -27.059 29.786  1.00 27.49  ? 1072 GLU A CB  1 
ATOM   384   C CG  . GLU A  1 54  ? 37.844  -26.979 31.294  1.00 34.87  ? 1072 GLU A CG  1 
ATOM   385   C CD  . GLU A  1 54  ? 39.102  -27.395 32.039  1.00 41.41  ? 1072 GLU A CD  1 
ATOM   386   O OE1 . GLU A  1 54  ? 39.615  -28.505 31.774  1.00 44.04  ? 1072 GLU A OE1 1 
ATOM   387   O OE2 . GLU A  1 54  ? 39.574  -26.615 32.895  1.00 45.38  ? 1072 GLU A OE2 1 
ATOM   388   N N   . PRO A  1 55  ? 40.574  -27.170 27.663  1.00 20.58  ? 1073 PRO A N   1 
ATOM   389   C CA  . PRO A  1 55  ? 41.011  -27.619 26.340  1.00 20.15  ? 1073 PRO A CA  1 
ATOM   390   C C   . PRO A  1 55  ? 40.087  -28.702 25.799  1.00 22.01  ? 1073 PRO A C   1 
ATOM   391   O O   . PRO A  1 55  ? 39.443  -29.423 26.563  1.00 21.02  ? 1073 PRO A O   1 
ATOM   392   C CB  . PRO A  1 55  ? 42.427  -28.123 26.599  1.00 21.28  ? 1073 PRO A CB  1 
ATOM   393   C CG  . PRO A  1 55  ? 42.341  -28.644 28.004  1.00 21.71  ? 1073 PRO A CG  1 
ATOM   394   C CD  . PRO A  1 55  ? 41.544  -27.560 28.702  1.00 20.31  ? 1073 PRO A CD  1 
ATOM   395   N N   . TRP A  1 56  ? 40.018  -28.813 24.479  1.00 21.09  ? 1074 TRP A N   1 
ATOM   396   C CA  . TRP A  1 56  ? 39.160  -29.805 23.866  1.00 20.47  ? 1074 TRP A CA  1 
ATOM   397   C C   . TRP A  1 56  ? 39.906  -30.673 22.872  1.00 22.18  ? 1074 TRP A C   1 
ATOM   398   O O   . TRP A  1 56  ? 40.901  -30.251 22.271  1.00 21.13  ? 1074 TRP A O   1 
ATOM   399   C CB  . TRP A  1 56  ? 37.985  -29.118 23.172  1.00 20.49  ? 1074 TRP A CB  1 
ATOM   400   C CG  . TRP A  1 56  ? 38.399  -28.095 22.151  1.00 21.88  ? 1074 TRP A CG  1 
ATOM   401   C CD1 . TRP A  1 56  ? 38.675  -28.312 20.828  1.00 21.16  ? 1074 TRP A CD1 1 
ATOM   402   C CD2 . TRP A  1 56  ? 38.556  -26.687 22.370  1.00 19.85  ? 1074 TRP A CD2 1 
ATOM   403   N NE1 . TRP A  1 56  ? 38.986  -27.119 20.210  1.00 21.41  ? 1074 TRP A NE1 1 
ATOM   404   C CE2 . TRP A  1 56  ? 38.920  -26.108 21.133  1.00 20.23  ? 1074 TRP A CE2 1 
ATOM   405   C CE3 . TRP A  1 56  ? 38.422  -25.858 23.492  1.00 19.82  ? 1074 TRP A CE3 1 
ATOM   406   C CZ2 . TRP A  1 56  ? 39.147  -24.732 20.985  1.00 21.45  ? 1074 TRP A CZ2 1 
ATOM   407   C CZ3 . TRP A  1 56  ? 38.649  -24.487 23.346  1.00 20.46  ? 1074 TRP A CZ3 1 
ATOM   408   C CH2 . TRP A  1 56  ? 39.007  -23.942 22.100  1.00 19.27  ? 1074 TRP A CH2 1 
ATOM   409   N N   . SER A  1 57  ? 39.420  -31.897 22.711  1.00 20.80  ? 1075 SER A N   1 
ATOM   410   C CA  . SER A  1 57  ? 40.021  -32.832 21.781  1.00 23.30  ? 1075 SER A CA  1 
ATOM   411   C C   . SER A  1 57  ? 39.366  -32.639 20.417  1.00 23.49  ? 1075 SER A C   1 
ATOM   412   O O   . SER A  1 57  ? 38.322  -31.998 20.300  1.00 24.32  ? 1075 SER A O   1 
ATOM   413   C CB  . SER A  1 57  ? 39.796  -34.266 22.264  1.00 22.95  ? 1075 SER A CB  1 
ATOM   414   O OG  . SER A  1 57  ? 40.277  -34.435 23.585  1.00 25.50  ? 1075 SER A OG  1 
ATOM   415   N N   . PHE A  1 58  ? 39.992  -33.184 19.385  1.00 24.35  ? 1076 PHE A N   1 
ATOM   416   C CA  . PHE A  1 58  ? 39.451  -33.096 18.036  1.00 24.35  ? 1076 PHE A CA  1 
ATOM   417   C C   . PHE A  1 58  ? 39.274  -31.665 17.527  1.00 24.98  ? 1076 PHE A C   1 
ATOM   418   O O   . PHE A  1 58  ? 39.998  -30.759 17.932  1.00 27.28  ? 1076 PHE A O   1 
ATOM   419   C CB  . PHE A  1 58  ? 38.125  -33.860 17.980  1.00 27.01  ? 1076 PHE A CB  1 
ATOM   420   C CG  . PHE A  1 58  ? 38.182  -35.201 18.659  1.00 29.42  ? 1076 PHE A CG  1 
ATOM   421   C CD1 . PHE A  1 58  ? 37.390  -35.467 19.770  1.00 30.20  ? 1076 PHE A CD1 1 
ATOM   422   C CD2 . PHE A  1 58  ? 39.057  -36.186 18.210  1.00 31.53  ? 1076 PHE A CD2 1 
ATOM   423   C CE1 . PHE A  1 58  ? 37.467  -36.695 20.429  1.00 31.49  ? 1076 PHE A CE1 1 
ATOM   424   C CE2 . PHE A  1 58  ? 39.144  -37.420 18.862  1.00 31.62  ? 1076 PHE A CE2 1 
ATOM   425   C CZ  . PHE A  1 58  ? 38.345  -37.673 19.974  1.00 32.17  ? 1076 PHE A CZ  1 
ATOM   426   N N   . VAL A  1 59  ? 38.305  -31.464 16.643  1.00 23.33  ? 1077 VAL A N   1 
ATOM   427   C CA  . VAL A  1 59  ? 38.080  -30.151 16.058  1.00 23.68  ? 1077 VAL A CA  1 
ATOM   428   C C   . VAL A  1 59  ? 36.760  -29.513 16.455  1.00 22.88  ? 1077 VAL A C   1 
ATOM   429   O O   . VAL A  1 59  ? 35.687  -30.043 16.165  1.00 22.61  ? 1077 VAL A O   1 
ATOM   430   C CB  . VAL A  1 59  ? 38.133  -30.232 14.515  1.00 24.77  ? 1077 VAL A CB  1 
ATOM   431   C CG1 . VAL A  1 59  ? 38.017  -28.842 13.913  1.00 24.96  ? 1077 VAL A CG1 1 
ATOM   432   C CG2 . VAL A  1 59  ? 39.431  -30.896 14.075  1.00 24.38  ? 1077 VAL A CG2 1 
ATOM   433   N N   . LYS A  1 60  ? 36.843  -28.364 17.114  1.00 21.95  ? 1078 LYS A N   1 
ATOM   434   C CA  . LYS A  1 60  ? 35.645  -27.648 17.530  1.00 22.07  ? 1078 LYS A CA  1 
ATOM   435   C C   . LYS A  1 60  ? 35.097  -26.888 16.329  1.00 22.66  ? 1078 LYS A C   1 
ATOM   436   O O   . LYS A  1 60  ? 35.821  -26.144 15.669  1.00 24.08  ? 1078 LYS A O   1 
ATOM   437   C CB  . LYS A  1 60  ? 35.969  -26.669 18.666  1.00 22.81  ? 1078 LYS A CB  1 
ATOM   438   C CG  . LYS A  1 60  ? 34.770  -25.854 19.142  1.00 22.47  ? 1078 LYS A CG  1 
ATOM   439   C CD  . LYS A  1 60  ? 35.149  -24.846 20.227  1.00 25.60  ? 1078 LYS A CD  1 
ATOM   440   C CE  . LYS A  1 60  ? 35.511  -25.526 21.539  1.00 26.69  ? 1078 LYS A CE  1 
ATOM   441   N NZ  . LYS A  1 60  ? 34.390  -26.350 22.069  1.00 28.85  ? 1078 LYS A NZ  1 
ATOM   442   N N   . ASN A  1 61  ? 33.819  -27.092 16.040  1.00 23.79  ? 1079 ASN A N   1 
ATOM   443   C CA  . ASN A  1 61  ? 33.170  -26.427 14.923  1.00 27.36  ? 1079 ASN A CA  1 
ATOM   444   C C   . ASN A  1 61  ? 32.841  -25.001 15.358  1.00 25.25  ? 1079 ASN A C   1 
ATOM   445   O O   . ASN A  1 61  ? 32.112  -24.798 16.324  1.00 26.43  ? 1079 ASN A O   1 
ATOM   446   C CB  . ASN A  1 61  ? 31.884  -27.168 14.561  1.00 33.21  ? 1079 ASN A CB  1 
ATOM   447   C CG  . ASN A  1 61  ? 31.350  -26.773 13.209  1.00 40.79  ? 1079 ASN A CG  1 
ATOM   448   O OD1 . ASN A  1 61  ? 31.581  -25.655 12.748  1.00 40.65  ? 1079 ASN A OD1 1 
ATOM   449   N ND2 . ASN A  1 61  ? 30.615  -27.681 12.574  1.00 46.93  ? 1079 ASN A ND2 1 
ATOM   450   N N   . ALA A  1 62  ? 33.383  -24.016 14.657  1.00 22.51  ? 1080 ALA A N   1 
ATOM   451   C CA  . ALA A  1 62  ? 33.133  -22.624 15.006  1.00 21.24  ? 1080 ALA A CA  1 
ATOM   452   C C   . ALA A  1 62  ? 32.462  -21.884 13.861  1.00 20.78  ? 1080 ALA A C   1 
ATOM   453   O O   . ALA A  1 62  ? 32.990  -20.894 13.357  1.00 21.45  ? 1080 ALA A O   1 
ATOM   454   C CB  . ALA A  1 62  ? 34.446  -21.939 15.381  1.00 19.77  ? 1080 ALA A CB  1 
ATOM   455   N N   . THR A  1 63  ? 31.284  -22.353 13.465  1.00 22.26  ? 1081 THR A N   1 
ATOM   456   C CA  . THR A  1 63  ? 30.556  -21.733 12.364  1.00 24.09  ? 1081 THR A CA  1 
ATOM   457   C C   . THR A  1 63  ? 29.136  -21.321 12.746  1.00 24.63  ? 1081 THR A C   1 
ATOM   458   O O   . THR A  1 63  ? 28.310  -21.034 11.881  1.00 24.73  ? 1081 THR A O   1 
ATOM   459   C CB  . THR A  1 63  ? 30.495  -22.677 11.152  1.00 24.17  ? 1081 THR A CB  1 
ATOM   460   O OG1 . THR A  1 63  ? 29.792  -23.870 11.512  1.00 27.04  ? 1081 THR A OG1 1 
ATOM   461   C CG2 . THR A  1 63  ? 31.900  -23.057 10.707  1.00 26.46  ? 1081 THR A CG2 1 
ATOM   462   N N   . SER A  1 64  ? 28.858  -21.294 14.045  1.00 24.65  ? 1082 SER A N   1 
ATOM   463   C CA  . SER A  1 64  ? 27.545  -20.899 14.544  1.00 24.51  ? 1082 SER A CA  1 
ATOM   464   C C   . SER A  1 64  ? 27.691  -19.719 15.506  1.00 22.94  ? 1082 SER A C   1 
ATOM   465   O O   . SER A  1 64  ? 28.609  -19.688 16.326  1.00 20.23  ? 1082 SER A O   1 
ATOM   466   C CB  . SER A  1 64  ? 26.876  -22.065 15.282  1.00 25.61  ? 1082 SER A CB  1 
ATOM   467   O OG  . SER A  1 64  ? 26.559  -23.130 14.403  1.00 31.20  ? 1082 SER A OG  1 
ATOM   468   N N   . TYR A  1 65  ? 26.787  -18.750 15.405  1.00 21.88  ? 1083 TYR A N   1 
ATOM   469   C CA  . TYR A  1 65  ? 26.837  -17.595 16.293  1.00 22.17  ? 1083 TYR A CA  1 
ATOM   470   C C   . TYR A  1 65  ? 26.590  -18.066 17.715  1.00 20.62  ? 1083 TYR A C   1 
ATOM   471   O O   . TYR A  1 65  ? 25.718  -18.901 17.957  1.00 22.74  ? 1083 TYR A O   1 
ATOM   472   C CB  . TYR A  1 65  ? 25.776  -16.567 15.892  1.00 23.18  ? 1083 TYR A CB  1 
ATOM   473   C CG  . TYR A  1 65  ? 26.053  -15.941 14.551  1.00 26.22  ? 1083 TYR A CG  1 
ATOM   474   C CD1 . TYR A  1 65  ? 27.068  -15.000 14.403  1.00 27.53  ? 1083 TYR A CD1 1 
ATOM   475   C CD2 . TYR A  1 65  ? 25.343  -16.333 13.415  1.00 27.60  ? 1083 TYR A CD2 1 
ATOM   476   C CE1 . TYR A  1 65  ? 27.378  -14.465 13.160  1.00 29.42  ? 1083 TYR A CE1 1 
ATOM   477   C CE2 . TYR A  1 65  ? 25.644  -15.805 12.162  1.00 30.56  ? 1083 TYR A CE2 1 
ATOM   478   C CZ  . TYR A  1 65  ? 26.665  -14.870 12.045  1.00 30.33  ? 1083 TYR A CZ  1 
ATOM   479   O OH  . TYR A  1 65  ? 26.982  -14.343 10.816  1.00 33.91  ? 1083 TYR A OH  1 
ATOM   480   N N   . PRO A  1 66  ? 27.374  -17.559 18.676  1.00 18.34  ? 1084 PRO A N   1 
ATOM   481   C CA  . PRO A  1 66  ? 27.171  -17.979 20.064  1.00 18.30  ? 1084 PRO A CA  1 
ATOM   482   C C   . PRO A  1 66  ? 25.956  -17.271 20.661  1.00 19.67  ? 1084 PRO A C   1 
ATOM   483   O O   . PRO A  1 66  ? 25.376  -16.372 20.044  1.00 18.86  ? 1084 PRO A O   1 
ATOM   484   C CB  . PRO A  1 66  ? 28.462  -17.541 20.741  1.00 16.75  ? 1084 PRO A CB  1 
ATOM   485   C CG  . PRO A  1 66  ? 28.762  -16.257 20.033  1.00 15.25  ? 1084 PRO A CG  1 
ATOM   486   C CD  . PRO A  1 66  ? 28.531  -16.648 18.573  1.00 16.51  ? 1084 PRO A CD  1 
ATOM   487   N N   . PRO A  1 67  ? 25.542  -17.680 21.864  1.00 19.70  ? 1085 PRO A N   1 
ATOM   488   C CA  . PRO A  1 67  ? 24.389  -17.036 22.498  1.00 18.30  ? 1085 PRO A CA  1 
ATOM   489   C C   . PRO A  1 67  ? 24.864  -15.675 23.001  1.00 17.36  ? 1085 PRO A C   1 
ATOM   490   O O   . PRO A  1 67  ? 26.067  -15.479 23.187  1.00 15.74  ? 1085 PRO A O   1 
ATOM   491   C CB  . PRO A  1 67  ? 24.081  -17.952 23.680  1.00 20.28  ? 1085 PRO A CB  1 
ATOM   492   C CG  . PRO A  1 67  ? 24.732  -19.269 23.320  1.00 19.99  ? 1085 PRO A CG  1 
ATOM   493   C CD  . PRO A  1 67  ? 26.003  -18.833 22.654  1.00 20.11  ? 1085 PRO A CD  1 
ATOM   494   N N   . MET A  1 68  ? 23.943  -14.737 23.211  1.00 15.45  ? 1086 MET A N   1 
ATOM   495   C CA  . MET A  1 68  ? 24.336  -13.450 23.770  1.00 16.77  ? 1086 MET A CA  1 
ATOM   496   C C   . MET A  1 68  ? 24.111  -13.615 25.275  1.00 16.85  ? 1086 MET A C   1 
ATOM   497   O O   . MET A  1 68  ? 23.340  -14.478 25.690  1.00 15.33  ? 1086 MET A O   1 
ATOM   498   C CB  . MET A  1 68  ? 23.504  -12.290 23.184  1.00 18.19  ? 1086 MET A CB  1 
ATOM   499   C CG  . MET A  1 68  ? 21.994  -12.328 23.405  1.00 23.60  ? 1086 MET A CG  1 
ATOM   500   S SD  . MET A  1 68  ? 21.189  -10.944 22.509  1.00 28.87  ? 1086 MET A SD  1 
ATOM   501   C CE  . MET A  1 68  ? 19.471  -11.224 22.870  1.00 28.18  ? 1086 MET A CE  1 
ATOM   502   N N   . CYS A  1 69  ? 24.800  -12.828 26.095  1.00 16.33  ? 1087 CYS A N   1 
ATOM   503   C CA  . CYS A  1 69  ? 24.642  -12.957 27.537  1.00 15.94  ? 1087 CYS A CA  1 
ATOM   504   C C   . CYS A  1 69  ? 23.220  -12.613 27.970  1.00 16.87  ? 1087 CYS A C   1 
ATOM   505   O O   . CYS A  1 69  ? 22.548  -11.791 27.345  1.00 15.80  ? 1087 CYS A O   1 
ATOM   506   C CB  . CYS A  1 69  ? 25.659  -12.080 28.269  1.00 18.71  ? 1087 CYS A CB  1 
ATOM   507   S SG  . CYS A  1 69  ? 27.401  -12.493 27.900  1.00 24.28  ? 1087 CYS A SG  1 
ATOM   508   N N   . THR A  1 70  ? 22.765  -13.254 29.041  1.00 17.44  ? 1088 THR A N   1 
ATOM   509   C CA  . THR A  1 70  ? 21.410  -13.046 29.540  1.00 16.34  ? 1088 THR A CA  1 
ATOM   510   C C   . THR A  1 70  ? 21.099  -11.558 29.635  1.00 15.73  ? 1088 THR A C   1 
ATOM   511   O O   . THR A  1 70  ? 21.882  -10.783 30.188  1.00 15.44  ? 1088 THR A O   1 
ATOM   512   C CB  . THR A  1 70  ? 21.215  -13.715 30.918  1.00 17.68  ? 1088 THR A CB  1 
ATOM   513   O OG1 . THR A  1 70  ? 21.856  -15.000 30.919  1.00 18.97  ? 1088 THR A OG1 1 
ATOM   514   C CG2 . THR A  1 70  ? 19.723  -13.917 31.205  1.00 17.75  ? 1088 THR A CG2 1 
ATOM   515   N N   . GLN A  1 71  ? 19.951  -11.177 29.081  1.00 14.99  ? 1089 GLN A N   1 
ATOM   516   C CA  . GLN A  1 71  ? 19.509  -9.786  29.052  1.00 16.69  ? 1089 GLN A CA  1 
ATOM   517   C C   . GLN A  1 71  ? 18.042  -9.727  28.629  1.00 17.71  ? 1089 GLN A C   1 
ATOM   518   O O   . GLN A  1 71  ? 17.476  -10.725 28.184  1.00 15.52  ? 1089 GLN A O   1 
ATOM   519   C CB  . GLN A  1 71  ? 20.338  -9.005  28.023  1.00 15.77  ? 1089 GLN A CB  1 
ATOM   520   C CG  . GLN A  1 71  ? 20.264  -9.608  26.611  1.00 16.53  ? 1089 GLN A CG  1 
ATOM   521   C CD  . GLN A  1 71  ? 21.265  -8.991  25.640  1.00 16.45  ? 1089 GLN A CD  1 
ATOM   522   O OE1 . GLN A  1 71  ? 20.966  -8.021  24.949  1.00 16.53  ? 1089 GLN A OE1 1 
ATOM   523   N NE2 . GLN A  1 71  ? 22.466  -9.548  25.602  1.00 11.94  ? 1089 GLN A NE2 1 
ATOM   524   N N   . ASP A  1 72  ? 17.438  -8.550  28.777  1.00 20.47  ? 1090 ASP A N   1 
ATOM   525   C CA  . ASP A  1 72  ? 16.060  -8.328  28.355  1.00 21.51  ? 1090 ASP A CA  1 
ATOM   526   C C   . ASP A  1 72  ? 16.065  -8.690  26.870  1.00 22.93  ? 1090 ASP A C   1 
ATOM   527   O O   . ASP A  1 72  ? 16.608  -7.951  26.049  1.00 22.00  ? 1090 ASP A O   1 
ATOM   528   C CB  . ASP A  1 72  ? 15.703  -6.851  28.513  1.00 24.70  ? 1090 ASP A CB  1 
ATOM   529   C CG  . ASP A  1 72  ? 14.266  -6.552  28.142  1.00 27.34  ? 1090 ASP A CG  1 
ATOM   530   O OD1 . ASP A  1 72  ? 13.741  -7.161  27.187  1.00 28.83  ? 1090 ASP A OD1 1 
ATOM   531   O OD2 . ASP A  1 72  ? 13.660  -5.689  28.806  1.00 32.13  ? 1090 ASP A OD2 1 
ATOM   532   N N   . PRO A  1 73  ? 15.445  -9.823  26.504  1.00 23.40  ? 1091 PRO A N   1 
ATOM   533   C CA  . PRO A  1 73  ? 15.396  -10.279 25.113  1.00 23.13  ? 1091 PRO A CA  1 
ATOM   534   C C   . PRO A  1 73  ? 14.785  -9.332  24.092  1.00 24.58  ? 1091 PRO A C   1 
ATOM   535   O O   . PRO A  1 73  ? 15.226  -9.291  22.945  1.00 24.70  ? 1091 PRO A O   1 
ATOM   536   C CB  . PRO A  1 73  ? 14.638  -11.605 25.211  1.00 24.32  ? 1091 PRO A CB  1 
ATOM   537   C CG  . PRO A  1 73  ? 13.713  -11.369 26.356  1.00 25.31  ? 1091 PRO A CG  1 
ATOM   538   C CD  . PRO A  1 73  ? 14.620  -10.689 27.365  1.00 24.60  ? 1091 PRO A CD  1 
ATOM   539   N N   . LYS A  1 74  ? 13.774  -8.570  24.494  1.00 25.74  ? 1092 LYS A N   1 
ATOM   540   C CA  . LYS A  1 74  ? 13.136  -7.646  23.567  1.00 26.52  ? 1092 LYS A CA  1 
ATOM   541   C C   . LYS A  1 74  ? 14.032  -6.438  23.334  1.00 24.93  ? 1092 LYS A C   1 
ATOM   542   O O   . LYS A  1 74  ? 14.239  -6.010  22.202  1.00 24.03  ? 1092 LYS A O   1 
ATOM   543   C CB  . LYS A  1 74  ? 11.771  -7.215  24.112  1.00 31.07  ? 1092 LYS A CB  1 
ATOM   544   C CG  . LYS A  1 74  ? 10.836  -8.403  24.345  1.00 36.27  ? 1092 LYS A CG  1 
ATOM   545   C CD  . LYS A  1 74  ? 9.443   -7.986  24.786  1.00 40.28  ? 1092 LYS A CD  1 
ATOM   546   C CE  . LYS A  1 74  ? 8.517   -9.198  24.830  1.00 42.62  ? 1092 LYS A CE  1 
ATOM   547   N NZ  . LYS A  1 74  ? 7.101   -8.847  25.124  1.00 44.88  ? 1092 LYS A NZ  1 
ATOM   548   N N   . ALA A  1 75  ? 14.577  -5.899  24.414  1.00 23.69  ? 1093 ALA A N   1 
ATOM   549   C CA  . ALA A  1 75  ? 15.460  -4.747  24.316  1.00 24.72  ? 1093 ALA A CA  1 
ATOM   550   C C   . ALA A  1 75  ? 16.746  -5.105  23.570  1.00 24.59  ? 1093 ALA A C   1 
ATOM   551   O O   . ALA A  1 75  ? 17.256  -4.319  22.768  1.00 23.19  ? 1093 ALA A O   1 
ATOM   552   C CB  . ALA A  1 75  ? 15.789  -4.267  25.683  1.00 23.84  ? 1093 ALA A CB  1 
ATOM   553   N N   . GLY A  1 76  ? 17.267  -6.298  23.852  1.00 24.60  ? 1094 GLY A N   1 
ATOM   554   C CA  . GLY A  1 76  ? 18.486  -6.749  23.205  1.00 23.31  ? 1094 GLY A CA  1 
ATOM   555   C C   . GLY A  1 76  ? 18.319  -6.963  21.711  1.00 23.77  ? 1094 GLY A C   1 
ATOM   556   O O   . GLY A  1 76  ? 19.186  -6.590  20.928  1.00 20.21  ? 1094 GLY A O   1 
ATOM   557   N N   . GLN A  1 77  ? 17.207  -7.567  21.306  1.00 24.53  ? 1095 GLN A N   1 
ATOM   558   C CA  . GLN A  1 77  ? 16.980  -7.807  19.890  1.00 24.89  ? 1095 GLN A CA  1 
ATOM   559   C C   . GLN A  1 77  ? 16.740  -6.490  19.174  1.00 23.56  ? 1095 GLN A C   1 
ATOM   560   O O   . GLN A  1 77  ? 17.131  -6.327  18.025  1.00 23.07  ? 1095 GLN A O   1 
ATOM   561   C CB  . GLN A  1 77  ? 15.787  -8.741  19.672  1.00 27.46  ? 1095 GLN A CB  1 
ATOM   562   C CG  . GLN A  1 77  ? 15.468  -8.949  18.197  1.00 34.84  ? 1095 GLN A CG  1 
ATOM   563   C CD  . GLN A  1 77  ? 14.509  -10.096 17.950  1.00 40.00  ? 1095 GLN A CD  1 
ATOM   564   O OE1 . GLN A  1 77  ? 13.376  -10.092 18.439  1.00 41.40  ? 1095 GLN A OE1 1 
ATOM   565   N NE2 . GLN A  1 77  ? 14.955  -11.084 17.180  1.00 40.52  ? 1095 GLN A NE2 1 
ATOM   566   N N   . LEU A  1 78  ? 16.092  -5.549  19.850  1.00 22.64  ? 1096 LEU A N   1 
ATOM   567   C CA  . LEU A  1 78  ? 15.834  -4.249  19.241  1.00 22.74  ? 1096 LEU A CA  1 
ATOM   568   C C   . LEU A  1 78  ? 17.143  -3.508  18.981  1.00 22.57  ? 1096 LEU A C   1 
ATOM   569   O O   . LEU A  1 78  ? 17.354  -2.966  17.894  1.00 22.19  ? 1096 LEU A O   1 
ATOM   570   C CB  . LEU A  1 78  ? 14.932  -3.397  20.140  1.00 22.36  ? 1096 LEU A CB  1 
ATOM   571   C CG  . LEU A  1 78  ? 14.704  -1.966  19.638  1.00 24.80  ? 1096 LEU A CG  1 
ATOM   572   C CD1 . LEU A  1 78  ? 14.119  -2.003  18.228  1.00 26.32  ? 1096 LEU A CD1 1 
ATOM   573   C CD2 . LEU A  1 78  ? 13.781  -1.228  20.590  1.00 23.16  ? 1096 LEU A CD2 1 
ATOM   574   N N   . LEU A  1 79  ? 18.025  -3.484  19.976  1.00 20.64  ? 1097 LEU A N   1 
ATOM   575   C CA  . LEU A  1 79  ? 19.302  -2.798  19.807  1.00 20.54  ? 1097 LEU A CA  1 
ATOM   576   C C   . LEU A  1 79  ? 20.124  -3.437  18.689  1.00 20.71  ? 1097 LEU A C   1 
ATOM   577   O O   . LEU A  1 79  ? 20.752  -2.740  17.893  1.00 20.13  ? 1097 LEU A O   1 
ATOM   578   C CB  . LEU A  1 79  ? 20.117  -2.830  21.101  1.00 20.60  ? 1097 LEU A CB  1 
ATOM   579   C CG  . LEU A  1 79  ? 21.487  -2.157  20.953  1.00 22.19  ? 1097 LEU A CG  1 
ATOM   580   C CD1 . LEU A  1 79  ? 21.287  -0.649  20.797  1.00 23.88  ? 1097 LEU A CD1 1 
ATOM   581   C CD2 . LEU A  1 79  ? 22.364  -2.461  22.164  1.00 25.66  ? 1097 LEU A CD2 1 
ATOM   582   N N   . SER A  1 80  ? 20.120  -4.765  18.639  1.00 19.88  ? 1098 SER A N   1 
ATOM   583   C CA  . SER A  1 80  ? 20.870  -5.488  17.626  1.00 20.27  ? 1098 SER A CA  1 
ATOM   584   C C   . SER A  1 80  ? 20.376  -5.142  16.218  1.00 21.11  ? 1098 SER A C   1 
ATOM   585   O O   . SER A  1 80  ? 21.173  -4.956  15.302  1.00 20.60  ? 1098 SER A O   1 
ATOM   586   C CB  . SER A  1 80  ? 20.763  -6.998  17.871  1.00 21.20  ? 1098 SER A CB  1 
ATOM   587   O OG  . SER A  1 80  ? 21.576  -7.707  16.954  1.00 21.60  ? 1098 SER A OG  1 
ATOM   588   N N   . GLU A  1 81  ? 19.062  -5.051  16.050  1.00 22.00  ? 1099 GLU A N   1 
ATOM   589   C CA  . GLU A  1 81  ? 18.492  -4.709  14.754  1.00 23.21  ? 1099 GLU A CA  1 
ATOM   590   C C   . GLU A  1 81  ? 18.852  -3.269  14.365  1.00 23.49  ? 1099 GLU A C   1 
ATOM   591   O O   . GLU A  1 81  ? 19.055  -2.964  13.192  1.00 22.10  ? 1099 GLU A O   1 
ATOM   592   C CB  . GLU A  1 81  ? 16.967  -4.872  14.787  1.00 24.79  ? 1099 GLU A CB  1 
ATOM   593   N N   . LEU A  1 82  ? 18.941  -2.390  15.356  1.00 22.39  ? 1100 LEU A N   1 
ATOM   594   C CA  . LEU A  1 82  ? 19.269  -0.989  15.104  1.00 23.53  ? 1100 LEU A CA  1 
ATOM   595   C C   . LEU A  1 82  ? 20.740  -0.730  14.784  1.00 24.29  ? 1100 LEU A C   1 
ATOM   596   O O   . LEU A  1 82  ? 21.062  0.209   14.050  1.00 24.51  ? 1100 LEU A O   1 
ATOM   597   C CB  . LEU A  1 82  ? 18.866  -0.134  16.309  1.00 23.65  ? 1100 LEU A CB  1 
ATOM   598   C CG  . LEU A  1 82  ? 17.365  0.069   16.516  1.00 23.32  ? 1100 LEU A CG  1 
ATOM   599   C CD1 . LEU A  1 82  ? 17.103  0.708   17.868  1.00 23.93  ? 1100 LEU A CD1 1 
ATOM   600   C CD2 . LEU A  1 82  ? 16.826  0.933   15.389  1.00 24.28  ? 1100 LEU A CD2 1 
ATOM   601   N N   . PHE A  1 83  ? 21.629  -1.561  15.323  1.00 22.48  ? 1101 PHE A N   1 
ATOM   602   C CA  . PHE A  1 83  ? 23.065  -1.381  15.115  1.00 22.28  ? 1101 PHE A CA  1 
ATOM   603   C C   . PHE A  1 83  ? 23.776  -2.319  14.137  1.00 22.25  ? 1101 PHE A C   1 
ATOM   604   O O   . PHE A  1 83  ? 24.869  -1.999  13.667  1.00 23.29  ? 1101 PHE A O   1 
ATOM   605   C CB  . PHE A  1 83  ? 23.795  -1.467  16.459  1.00 23.44  ? 1101 PHE A CB  1 
ATOM   606   C CG  . PHE A  1 83  ? 23.638  -0.251  17.324  1.00 26.84  ? 1101 PHE A CG  1 
ATOM   607   C CD1 . PHE A  1 83  ? 23.036  0.905   16.836  1.00 28.45  ? 1101 PHE A CD1 1 
ATOM   608   C CD2 . PHE A  1 83  ? 24.141  -0.246  18.623  1.00 28.75  ? 1101 PHE A CD2 1 
ATOM   609   C CE1 . PHE A  1 83  ? 22.942  2.050   17.624  1.00 29.82  ? 1101 PHE A CE1 1 
ATOM   610   C CE2 . PHE A  1 83  ? 24.052  0.893   19.420  1.00 30.72  ? 1101 PHE A CE2 1 
ATOM   611   C CZ  . PHE A  1 83  ? 23.451  2.045   18.917  1.00 30.13  ? 1101 PHE A CZ  1 
ATOM   612   N N   . THR A  1 84  ? 23.181  -3.466  13.828  1.00 20.61  ? 1102 THR A N   1 
ATOM   613   C CA  . THR A  1 84  ? 23.838  -4.416  12.937  1.00 21.66  ? 1102 THR A CA  1 
ATOM   614   C C   . THR A  1 84  ? 24.175  -3.851  11.559  1.00 22.60  ? 1102 THR A C   1 
ATOM   615   O O   . THR A  1 84  ? 23.400  -3.093  10.980  1.00 22.91  ? 1102 THR A O   1 
ATOM   616   C CB  . THR A  1 84  ? 23.002  -5.710  12.771  1.00 21.69  ? 1102 THR A CB  1 
ATOM   617   O OG1 . THR A  1 84  ? 23.801  -6.702  12.120  1.00 20.65  ? 1102 THR A OG1 1 
ATOM   618   C CG2 . THR A  1 84  ? 21.744  -5.453  11.940  1.00 19.97  ? 1102 THR A CG2 1 
ATOM   619   N N   . ASN A  1 85  ? 25.345  -4.230  11.045  1.00 24.09  ? 1103 ASN A N   1 
ATOM   620   C CA  . ASN A  1 85  ? 25.817  -3.775  9.739   1.00 25.00  ? 1103 ASN A CA  1 
ATOM   621   C C   . ASN A  1 85  ? 25.585  -4.795  8.624   1.00 26.58  ? 1103 ASN A C   1 
ATOM   622   O O   . ASN A  1 85  ? 25.893  -4.529  7.463   1.00 26.02  ? 1103 ASN A O   1 
ATOM   623   C CB  . ASN A  1 85  ? 27.311  -3.432  9.814   1.00 24.42  ? 1103 ASN A CB  1 
ATOM   624   C CG  . ASN A  1 85  ? 28.168  -4.634  10.159  1.00 24.51  ? 1103 ASN A CG  1 
ATOM   625   O OD1 . ASN A  1 85  ? 27.805  -5.449  11.008  1.00 24.51  ? 1103 ASN A OD1 1 
ATOM   626   N ND2 . ASN A  1 85  ? 29.321  -4.744  9.511   1.00 24.43  ? 1103 ASN A ND2 1 
ATOM   627   N N   . ARG A  1 86  ? 25.052  -5.963  8.971   1.00 27.64  ? 1104 ARG A N   1 
ATOM   628   C CA  . ARG A  1 86  ? 24.789  -6.995  7.973   1.00 30.35  ? 1104 ARG A CA  1 
ATOM   629   C C   . ARG A  1 86  ? 23.403  -6.781  7.355   1.00 31.99  ? 1104 ARG A C   1 
ATOM   630   O O   . ARG A  1 86  ? 22.558  -6.108  7.941   1.00 30.56  ? 1104 ARG A O   1 
ATOM   631   C CB  . ARG A  1 86  ? 24.915  -8.388  8.609   1.00 30.26  ? 1104 ARG A CB  1 
ATOM   632   C CG  . ARG A  1 86  ? 24.199  -8.537  9.930   1.00 30.81  ? 1104 ARG A CG  1 
ATOM   633   C CD  . ARG A  1 86  ? 24.311  -9.951  10.497  1.00 31.31  ? 1104 ARG A CD  1 
ATOM   634   N NE  . ARG A  1 86  ? 25.372  -10.110 11.493  1.00 27.99  ? 1104 ARG A NE  1 
ATOM   635   C CZ  . ARG A  1 86  ? 26.530  -10.713 11.252  1.00 27.51  ? 1104 ARG A CZ  1 
ATOM   636   N NH1 . ARG A  1 86  ? 26.774  -11.210 10.047  1.00 25.81  ? 1104 ARG A NH1 1 
ATOM   637   N NH2 . ARG A  1 86  ? 27.436  -10.836 12.213  1.00 23.85  ? 1104 ARG A NH2 1 
ATOM   638   N N   . LYS A  1 87  ? 23.168  -7.337  6.169   1.00 35.12  ? 1105 LYS A N   1 
ATOM   639   C CA  . LYS A  1 87  ? 21.880  -7.139  5.503   1.00 39.28  ? 1105 LYS A CA  1 
ATOM   640   C C   . LYS A  1 87  ? 20.692  -7.751  6.244   1.00 40.75  ? 1105 LYS A C   1 
ATOM   641   O O   . LYS A  1 87  ? 19.548  -7.336  6.046   1.00 40.63  ? 1105 LYS A O   1 
ATOM   642   C CB  . LYS A  1 87  ? 21.927  -7.677  4.066   1.00 41.02  ? 1105 LYS A CB  1 
ATOM   643   C CG  . LYS A  1 87  ? 21.377  -9.077  3.891   1.00 44.39  ? 1105 LYS A CG  1 
ATOM   644   C CD  . LYS A  1 87  ? 20.944  -9.313  2.450   1.00 46.39  ? 1105 LYS A CD  1 
ATOM   645   C CE  . LYS A  1 87  ? 20.205  -10.636 2.308   1.00 47.79  ? 1105 LYS A CE  1 
ATOM   646   N NZ  . LYS A  1 87  ? 19.736  -10.877 0.909   1.00 50.28  ? 1105 LYS A NZ  1 
ATOM   647   N N   . GLU A  1 88  ? 20.968  -8.726  7.102   1.00 41.97  ? 1106 GLU A N   1 
ATOM   648   C CA  . GLU A  1 88  ? 19.921  -9.400  7.867   1.00 44.27  ? 1106 GLU A CA  1 
ATOM   649   C C   . GLU A  1 88  ? 20.303  -9.500  9.341   1.00 43.24  ? 1106 GLU A C   1 
ATOM   650   O O   . GLU A  1 88  ? 21.408  -9.930  9.664   1.00 42.46  ? 1106 GLU A O   1 
ATOM   651   C CB  . GLU A  1 88  ? 19.697  -10.805 7.300   1.00 48.09  ? 1106 GLU A CB  1 
ATOM   652   C CG  . GLU A  1 88  ? 20.852  -11.783 7.543   1.00 53.27  ? 1106 GLU A CG  1 
ATOM   653   C CD  . GLU A  1 88  ? 22.212  -11.205 7.186   1.00 56.92  ? 1106 GLU A CD  1 
ATOM   654   O OE1 . GLU A  1 88  ? 22.371  -10.699 6.055   1.00 59.92  ? 1106 GLU A OE1 1 
ATOM   655   O OE2 . GLU A  1 88  ? 23.128  -11.260 8.037   1.00 59.97  ? 1106 GLU A OE2 1 
ATOM   656   N N   . ASN A  1 89  ? 19.402  -9.102  10.236  1.00 43.34  ? 1107 ASN A N   1 
ATOM   657   C CA  . ASN A  1 89  ? 19.703  -9.190  11.662  1.00 43.57  ? 1107 ASN A CA  1 
ATOM   658   C C   . ASN A  1 89  ? 19.616  -10.646 12.094  1.00 42.96  ? 1107 ASN A C   1 
ATOM   659   O O   . ASN A  1 89  ? 18.645  -11.333 11.788  1.00 43.25  ? 1107 ASN A O   1 
ATOM   660   C CB  . ASN A  1 89  ? 18.728  -8.364  12.503  1.00 44.28  ? 1107 ASN A CB  1 
ATOM   661   C CG  . ASN A  1 89  ? 19.125  -8.334  13.977  1.00 45.62  ? 1107 ASN A CG  1 
ATOM   662   O OD1 . ASN A  1 89  ? 20.264  -8.000  14.306  1.00 42.12  ? 1107 ASN A OD1 1 
ATOM   663   N ND2 . ASN A  1 89  ? 18.198  -8.691  14.863  1.00 46.64  ? 1107 ASN A ND2 1 
ATOM   664   N N   . ILE A  1 90  ? 20.633  -11.106 12.810  1.00 42.78  ? 1108 ILE A N   1 
ATOM   665   C CA  . ILE A  1 90  ? 20.686  -12.484 13.277  1.00 42.48  ? 1108 ILE A CA  1 
ATOM   666   C C   . ILE A  1 90  ? 19.977  -12.654 14.618  1.00 41.89  ? 1108 ILE A C   1 
ATOM   667   O O   . ILE A  1 90  ? 20.382  -12.062 15.619  1.00 42.29  ? 1108 ILE A O   1 
ATOM   668   C CB  . ILE A  1 90  ? 22.156  -12.959 13.448  1.00 42.49  ? 1108 ILE A CB  1 
ATOM   669   C CG1 . ILE A  1 90  ? 22.925  -12.783 12.137  1.00 43.17  ? 1108 ILE A CG1 1 
ATOM   670   C CG2 . ILE A  1 90  ? 22.189  -14.415 13.881  1.00 42.12  ? 1108 ILE A CG2 1 
ATOM   671   C CD1 . ILE A  1 90  ? 22.335  -13.539 10.962  1.00 44.13  ? 1108 ILE A CD1 1 
ATOM   672   N N   . PRO A  1 91  ? 18.902  -13.460 14.655  1.00 41.25  ? 1109 PRO A N   1 
ATOM   673   C CA  . PRO A  1 91  ? 18.183  -13.673 15.915  1.00 39.72  ? 1109 PRO A CA  1 
ATOM   674   C C   . PRO A  1 91  ? 19.118  -14.473 16.813  1.00 37.84  ? 1109 PRO A C   1 
ATOM   675   O O   . PRO A  1 91  ? 19.609  -15.530 16.418  1.00 38.70  ? 1109 PRO A O   1 
ATOM   676   C CB  . PRO A  1 91  ? 16.965  -14.477 15.479  1.00 41.38  ? 1109 PRO A CB  1 
ATOM   677   C CG  . PRO A  1 91  ? 17.517  -15.305 14.351  1.00 41.96  ? 1109 PRO A CG  1 
ATOM   678   C CD  . PRO A  1 91  ? 18.327  -14.284 13.577  1.00 41.88  ? 1109 PRO A CD  1 
ATOM   679   N N   . LEU A  1 92  ? 19.379  -13.967 18.010  1.00 35.15  ? 1110 LEU A N   1 
ATOM   680   C CA  . LEU A  1 92  ? 20.290  -14.654 18.910  1.00 32.41  ? 1110 LEU A CA  1 
ATOM   681   C C   . LEU A  1 92  ? 19.595  -15.291 20.096  1.00 30.54  ? 1110 LEU A C   1 
ATOM   682   O O   . LEU A  1 92  ? 18.508  -14.879 20.494  1.00 29.40  ? 1110 LEU A O   1 
ATOM   683   C CB  . LEU A  1 92  ? 21.371  -13.686 19.405  1.00 31.91  ? 1110 LEU A CB  1 
ATOM   684   C CG  . LEU A  1 92  ? 22.255  -13.071 18.314  1.00 30.50  ? 1110 LEU A CG  1 
ATOM   685   C CD1 . LEU A  1 92  ? 23.281  -12.144 18.945  1.00 28.59  ? 1110 LEU A CD1 1 
ATOM   686   C CD2 . LEU A  1 92  ? 22.946  -14.178 17.531  1.00 29.20  ? 1110 LEU A CD2 1 
ATOM   687   N N   . LYS A  1 93  ? 20.240  -16.314 20.641  1.00 28.60  ? 1111 LYS A N   1 
ATOM   688   C CA  . LYS A  1 93  ? 19.734  -17.032 21.799  1.00 28.44  ? 1111 LYS A CA  1 
ATOM   689   C C   . LYS A  1 93  ? 20.330  -16.352 23.029  1.00 26.20  ? 1111 LYS A C   1 
ATOM   690   O O   . LYS A  1 93  ? 21.322  -15.638 22.919  1.00 25.37  ? 1111 LYS A O   1 
ATOM   691   C CB  . LYS A  1 93  ? 20.193  -18.493 21.742  1.00 30.58  ? 1111 LYS A CB  1 
ATOM   692   C CG  . LYS A  1 93  ? 19.078  -19.519 21.665  1.00 36.03  ? 1111 LYS A CG  1 
ATOM   693   C CD  . LYS A  1 93  ? 18.207  -19.333 20.436  1.00 39.31  ? 1111 LYS A CD  1 
ATOM   694   C CE  . LYS A  1 93  ? 17.128  -20.409 20.378  1.00 40.96  ? 1111 LYS A CE  1 
ATOM   695   N NZ  . LYS A  1 93  ? 16.173  -20.203 19.254  1.00 41.99  ? 1111 LYS A NZ  1 
ATOM   696   N N   . LEU A  1 94  ? 19.719  -16.569 24.189  1.00 25.09  ? 1112 LEU A N   1 
ATOM   697   C CA  . LEU A  1 94  ? 20.196  -15.993 25.444  1.00 23.42  ? 1112 LEU A CA  1 
ATOM   698   C C   . LEU A  1 94  ? 20.788  -17.096 26.299  1.00 21.93  ? 1112 LEU A C   1 
ATOM   699   O O   . LEU A  1 94  ? 20.278  -18.213 26.305  1.00 21.84  ? 1112 LEU A O   1 
ATOM   700   C CB  . LEU A  1 94  ? 19.046  -15.372 26.240  1.00 25.78  ? 1112 LEU A CB  1 
ATOM   701   C CG  . LEU A  1 94  ? 18.315  -14.108 25.800  1.00 29.40  ? 1112 LEU A CG  1 
ATOM   702   C CD1 . LEU A  1 94  ? 17.261  -13.780 26.854  1.00 31.09  ? 1112 LEU A CD1 1 
ATOM   703   C CD2 . LEU A  1 94  ? 19.290  -12.951 25.662  1.00 29.86  ? 1112 LEU A CD2 1 
ATOM   704   N N   . SER A  1 95  ? 21.844  -16.782 27.038  1.00 19.15  ? 1113 SER A N   1 
ATOM   705   C CA  . SER A  1 95  ? 22.453  -17.769 27.915  1.00 18.09  ? 1113 SER A CA  1 
ATOM   706   C C   . SER A  1 95  ? 23.523  -17.171 28.814  1.00 17.37  ? 1113 SER A C   1 
ATOM   707   O O   . SER A  1 95  ? 24.132  -16.159 28.477  1.00 17.08  ? 1113 SER A O   1 
ATOM   708   C CB  . SER A  1 95  ? 23.055  -18.912 27.088  1.00 18.60  ? 1113 SER A CB  1 
ATOM   709   O OG  . SER A  1 95  ? 23.647  -19.885 27.928  1.00 16.82  ? 1113 SER A OG  1 
ATOM   710   N N   . GLU A  1 96  ? 23.733  -17.790 29.972  1.00 18.00  ? 1114 GLU A N   1 
ATOM   711   C CA  . GLU A  1 96  ? 24.761  -17.337 30.895  1.00 17.81  ? 1114 GLU A CA  1 
ATOM   712   C C   . GLU A  1 96  ? 26.088  -17.852 30.336  1.00 17.35  ? 1114 GLU A C   1 
ATOM   713   O O   . GLU A  1 96  ? 27.164  -17.360 30.687  1.00 17.89  ? 1114 GLU A O   1 
ATOM   714   C CB  . GLU A  1 96  ? 24.515  -17.908 32.297  1.00 19.73  ? 1114 GLU A CB  1 
ATOM   715   C CG  . GLU A  1 96  ? 23.144  -17.579 32.854  1.00 20.87  ? 1114 GLU A CG  1 
ATOM   716   C CD  . GLU A  1 96  ? 22.881  -18.244 34.193  1.00 24.78  ? 1114 GLU A CD  1 
ATOM   717   O OE1 . GLU A  1 96  ? 23.005  -19.484 34.282  1.00 27.18  ? 1114 GLU A OE1 1 
ATOM   718   O OE2 . GLU A  1 96  ? 22.550  -17.525 35.157  1.00 26.60  ? 1114 GLU A OE2 1 
ATOM   719   N N   . ASP A  1 97  ? 25.999  -18.859 29.470  1.00 15.58  ? 1115 ASP A N   1 
ATOM   720   C CA  . ASP A  1 97  ? 27.179  -19.425 28.809  1.00 15.96  ? 1115 ASP A CA  1 
ATOM   721   C C   . ASP A  1 97  ? 27.345  -18.545 27.576  1.00 15.53  ? 1115 ASP A C   1 
ATOM   722   O O   . ASP A  1 97  ? 26.865  -18.871 26.487  1.00 15.49  ? 1115 ASP A O   1 
ATOM   723   C CB  . ASP A  1 97  ? 26.910  -20.878 28.405  1.00 16.06  ? 1115 ASP A CB  1 
ATOM   724   C CG  . ASP A  1 97  ? 28.020  -21.464 27.556  1.00 18.00  ? 1115 ASP A CG  1 
ATOM   725   O OD1 . ASP A  1 97  ? 29.100  -20.844 27.454  1.00 19.07  ? 1115 ASP A OD1 1 
ATOM   726   O OD2 . ASP A  1 97  ? 27.810  -22.555 26.993  1.00 21.41  ? 1115 ASP A OD2 1 
ATOM   727   N N   . CYS A  1 98  ? 28.022  -17.418 27.755  1.00 14.27  ? 1116 CYS A N   1 
ATOM   728   C CA  . CYS A  1 98  ? 28.171  -16.464 26.673  1.00 15.12  ? 1116 CYS A CA  1 
ATOM   729   C C   . CYS A  1 98  ? 29.565  -15.864 26.497  1.00 13.56  ? 1116 CYS A C   1 
ATOM   730   O O   . CYS A  1 98  ? 29.723  -14.891 25.759  1.00 13.65  ? 1116 CYS A O   1 
ATOM   731   C CB  . CYS A  1 98  ? 27.179  -15.333 26.910  1.00 15.47  ? 1116 CYS A CB  1 
ATOM   732   S SG  . CYS A  1 98  ? 27.565  -14.436 28.450  1.00 22.63  ? 1116 CYS A SG  1 
ATOM   733   N N   . LEU A  1 99  ? 30.571  -16.423 27.158  1.00 10.96  ? 1117 LEU A N   1 
ATOM   734   C CA  . LEU A  1 99  ? 31.909  -15.861 27.033  1.00 10.28  ? 1117 LEU A CA  1 
ATOM   735   C C   . LEU A  1 99  ? 32.628  -16.389 25.796  1.00 10.60  ? 1117 LEU A C   1 
ATOM   736   O O   . LEU A  1 99  ? 33.506  -17.251 25.868  1.00 9.80   ? 1117 LEU A O   1 
ATOM   737   C CB  . LEU A  1 99  ? 32.710  -16.125 28.305  1.00 9.84   ? 1117 LEU A CB  1 
ATOM   738   C CG  . LEU A  1 99  ? 32.124  -15.424 29.542  1.00 11.55  ? 1117 LEU A CG  1 
ATOM   739   C CD1 . LEU A  1 99  ? 33.026  -15.638 30.740  1.00 10.99  ? 1117 LEU A CD1 1 
ATOM   740   C CD2 . LEU A  1 99  ? 31.970  -13.933 29.268  1.00 9.12   ? 1117 LEU A CD2 1 
ATOM   741   N N   . TYR A  1 100 ? 32.224  -15.849 24.655  1.00 11.98  ? 1118 TYR A N   1 
ATOM   742   C CA  . TYR A  1 100 ? 32.791  -16.218 23.367  1.00 14.03  ? 1118 TYR A CA  1 
ATOM   743   C C   . TYR A  1 100 ? 33.231  -14.984 22.615  1.00 15.71  ? 1118 TYR A C   1 
ATOM   744   O O   . TYR A  1 100 ? 32.882  -13.861 22.985  1.00 15.10  ? 1118 TYR A O   1 
ATOM   745   C CB  . TYR A  1 100 ? 31.753  -16.938 22.509  1.00 16.70  ? 1118 TYR A CB  1 
ATOM   746   C CG  . TYR A  1 100 ? 31.235  -18.206 23.128  1.00 17.54  ? 1118 TYR A CG  1 
ATOM   747   C CD1 . TYR A  1 100 ? 30.158  -18.182 24.012  1.00 16.53  ? 1118 TYR A CD1 1 
ATOM   748   C CD2 . TYR A  1 100 ? 31.870  -19.424 22.887  1.00 18.17  ? 1118 TYR A CD2 1 
ATOM   749   C CE1 . TYR A  1 100 ? 29.728  -19.338 24.647  1.00 20.02  ? 1118 TYR A CE1 1 
ATOM   750   C CE2 . TYR A  1 100 ? 31.447  -20.590 23.520  1.00 19.30  ? 1118 TYR A CE2 1 
ATOM   751   C CZ  . TYR A  1 100 ? 30.380  -20.538 24.398  1.00 18.32  ? 1118 TYR A CZ  1 
ATOM   752   O OH  . TYR A  1 100 ? 29.986  -21.679 25.048  1.00 18.59  ? 1118 TYR A OH  1 
ATOM   753   N N   . LEU A  1 101 ? 34.003  -15.204 21.554  1.00 14.60  ? 1119 LEU A N   1 
ATOM   754   C CA  . LEU A  1 101 ? 34.456  -14.123 20.696  1.00 12.68  ? 1119 LEU A CA  1 
ATOM   755   C C   . LEU A  1 101 ? 34.406  -14.659 19.272  1.00 14.06  ? 1119 LEU A C   1 
ATOM   756   O O   . LEU A  1 101 ? 34.468  -15.878 19.058  1.00 13.58  ? 1119 LEU A O   1 
ATOM   757   C CB  . LEU A  1 101 ? 35.879  -13.666 21.073  1.00 11.57  ? 1119 LEU A CB  1 
ATOM   758   C CG  . LEU A  1 101 ? 37.031  -14.669 21.241  1.00 13.48  ? 1119 LEU A CG  1 
ATOM   759   C CD1 . LEU A  1 101 ? 37.585  -15.069 19.881  1.00 13.42  ? 1119 LEU A CD1 1 
ATOM   760   C CD2 . LEU A  1 101 ? 38.133  -14.027 22.074  1.00 12.01  ? 1119 LEU A CD2 1 
ATOM   761   N N   . ASN A  1 102 ? 34.255  -13.753 18.310  1.00 11.92  ? 1120 ASN A N   1 
ATOM   762   C CA  . ASN A  1 102 ? 34.202  -14.117 16.895  1.00 13.74  ? 1120 ASN A CA  1 
ATOM   763   C C   . ASN A  1 102 ? 35.412  -13.482 16.219  1.00 16.12  ? 1120 ASN A C   1 
ATOM   764   O O   . ASN A  1 102 ? 35.813  -12.368 16.576  1.00 14.46  ? 1120 ASN A O   1 
ATOM   765   C CB  . ASN A  1 102 ? 32.919  -13.590 16.243  1.00 12.88  ? 1120 ASN A CB  1 
ATOM   766   C CG  . ASN A  1 102 ? 31.655  -14.123 16.905  1.00 13.73  ? 1120 ASN A CG  1 
ATOM   767   O OD1 . ASN A  1 102 ? 31.584  -15.283 17.319  1.00 13.30  ? 1120 ASN A OD1 1 
ATOM   768   N ND2 . ASN A  1 102 ? 30.642  -13.278 16.984  1.00 13.24  ? 1120 ASN A ND2 1 
ATOM   769   N N   . ILE A  1 103 ? 35.992  -14.182 15.244  1.00 15.85  ? 1121 ILE A N   1 
ATOM   770   C CA  . ILE A  1 103 ? 37.170  -13.669 14.554  1.00 15.40  ? 1121 ILE A CA  1 
ATOM   771   C C   . ILE A  1 103 ? 36.994  -13.575 13.042  1.00 17.04  ? 1121 ILE A C   1 
ATOM   772   O O   . ILE A  1 103 ? 36.423  -14.461 12.408  1.00 17.20  ? 1121 ILE A O   1 
ATOM   773   C CB  . ILE A  1 103 ? 38.414  -14.537 14.859  1.00 15.01  ? 1121 ILE A CB  1 
ATOM   774   C CG1 . ILE A  1 103 ? 38.666  -14.555 16.369  1.00 16.19  ? 1121 ILE A CG1 1 
ATOM   775   C CG2 . ILE A  1 103 ? 39.651  -13.970 14.144  1.00 10.68  ? 1121 ILE A CG2 1 
ATOM   776   C CD1 . ILE A  1 103 ? 39.881  -15.363 16.785  1.00 17.66  ? 1121 ILE A CD1 1 
ATOM   777   N N   . TYR A  1 104 ? 37.481  -12.472 12.483  1.00 15.72  ? 1122 TYR A N   1 
ATOM   778   C CA  . TYR A  1 104 ? 37.427  -12.213 11.049  1.00 16.82  ? 1122 TYR A CA  1 
ATOM   779   C C   . TYR A  1 104 ? 38.856  -11.875 10.619  1.00 18.41  ? 1122 TYR A C   1 
ATOM   780   O O   . TYR A  1 104 ? 39.344  -10.773 10.891  1.00 17.80  ? 1122 TYR A O   1 
ATOM   781   C CB  . TYR A  1 104 ? 36.508  -11.019 10.750  1.00 16.29  ? 1122 TYR A CB  1 
ATOM   782   C CG  . TYR A  1 104 ? 35.101  -11.191 11.270  1.00 15.98  ? 1122 TYR A CG  1 
ATOM   783   C CD1 . TYR A  1 104 ? 34.814  -11.031 12.631  1.00 16.34  ? 1122 TYR A CD1 1 
ATOM   784   C CD2 . TYR A  1 104 ? 34.062  -11.556 10.415  1.00 15.59  ? 1122 TYR A CD2 1 
ATOM   785   C CE1 . TYR A  1 104 ? 33.522  -11.234 13.125  1.00 16.71  ? 1122 TYR A CE1 1 
ATOM   786   C CE2 . TYR A  1 104 ? 32.767  -11.763 10.899  1.00 16.82  ? 1122 TYR A CE2 1 
ATOM   787   C CZ  . TYR A  1 104 ? 32.509  -11.603 12.257  1.00 16.61  ? 1122 TYR A CZ  1 
ATOM   788   O OH  . TYR A  1 104 ? 31.243  -11.841 12.748  1.00 17.23  ? 1122 TYR A OH  1 
ATOM   789   N N   . THR A  1 105 ? 39.534  -12.829 9.982   1.00 18.73  ? 1123 THR A N   1 
ATOM   790   C CA  . THR A  1 105 ? 40.904  -12.606 9.525   1.00 18.58  ? 1123 THR A CA  1 
ATOM   791   C C   . THR A  1 105 ? 41.030  -12.719 8.007   1.00 18.73  ? 1123 THR A C   1 
ATOM   792   O O   . THR A  1 105 ? 40.603  -13.705 7.405   1.00 19.55  ? 1123 THR A O   1 
ATOM   793   C CB  . THR A  1 105 ? 41.890  -13.603 10.167  1.00 18.87  ? 1123 THR A CB  1 
ATOM   794   O OG1 . THR A  1 105 ? 43.208  -13.355 9.662   1.00 21.26  ? 1123 THR A OG1 1 
ATOM   795   C CG2 . THR A  1 105 ? 41.498  -15.032 9.847   1.00 16.18  ? 1123 THR A CG2 1 
ATOM   796   N N   . PRO A  1 106 ? 41.620  -11.699 7.369   1.00 19.91  ? 1124 PRO A N   1 
ATOM   797   C CA  . PRO A  1 106 ? 41.801  -11.691 5.914   1.00 20.67  ? 1124 PRO A CA  1 
ATOM   798   C C   . PRO A  1 106 ? 43.133  -12.332 5.522   1.00 23.24  ? 1124 PRO A C   1 
ATOM   799   O O   . PRO A  1 106 ? 43.452  -12.452 4.341   1.00 24.70  ? 1124 PRO A O   1 
ATOM   800   C CB  . PRO A  1 106 ? 41.764  -10.206 5.586   1.00 19.04  ? 1124 PRO A CB  1 
ATOM   801   C CG  . PRO A  1 106 ? 42.525  -9.620  6.746   1.00 18.25  ? 1124 PRO A CG  1 
ATOM   802   C CD  . PRO A  1 106 ? 41.987  -10.393 7.952   1.00 17.74  ? 1124 PRO A CD  1 
ATOM   803   N N   . ALA A  1 107 ? 43.902  -12.751 6.519   1.00 23.73  ? 1125 ALA A N   1 
ATOM   804   C CA  . ALA A  1 107 ? 45.208  -13.352 6.270   1.00 27.26  ? 1125 ALA A CA  1 
ATOM   805   C C   . ALA A  1 107 ? 45.148  -14.722 5.610   1.00 29.02  ? 1125 ALA A C   1 
ATOM   806   O O   . ALA A  1 107 ? 44.181  -15.470 5.768   1.00 28.34  ? 1125 ALA A O   1 
ATOM   807   C CB  . ALA A  1 107 ? 45.995  -13.446 7.579   1.00 25.61  ? 1125 ALA A CB  1 
ATOM   808   N N   . ASP A  1 108 ? 46.187  -15.036 4.844   1.00 32.08  ? 1126 ASP A N   1 
ATOM   809   C CA  . ASP A  1 108 ? 46.279  -16.336 4.200   1.00 34.34  ? 1126 ASP A CA  1 
ATOM   810   C C   . ASP A  1 108 ? 46.877  -17.212 5.287   1.00 33.51  ? 1126 ASP A C   1 
ATOM   811   O O   . ASP A  1 108 ? 48.066  -17.122 5.584   1.00 33.13  ? 1126 ASP A O   1 
ATOM   812   C CB  . ASP A  1 108 ? 47.209  -16.275 2.992   1.00 38.36  ? 1126 ASP A CB  1 
ATOM   813   C CG  . ASP A  1 108 ? 47.514  -17.647 2.429   1.00 41.16  ? 1126 ASP A CG  1 
ATOM   814   O OD1 . ASP A  1 108 ? 46.561  -18.375 2.077   1.00 43.47  ? 1126 ASP A OD1 1 
ATOM   815   O OD2 . ASP A  1 108 ? 48.709  -17.995 2.343   1.00 44.23  ? 1126 ASP A OD2 1 
ATOM   816   N N   . LEU A  1 109 ? 46.044  -18.051 5.889   1.00 34.88  ? 1127 LEU A N   1 
ATOM   817   C CA  . LEU A  1 109 ? 46.486  -18.902 6.984   1.00 35.71  ? 1127 LEU A CA  1 
ATOM   818   C C   . LEU A  1 109 ? 47.504  -19.985 6.629   1.00 37.94  ? 1127 LEU A C   1 
ATOM   819   O O   . LEU A  1 109 ? 48.046  -20.641 7.522   1.00 37.52  ? 1127 LEU A O   1 
ATOM   820   C CB  . LEU A  1 109 ? 45.263  -19.525 7.662   1.00 34.86  ? 1127 LEU A CB  1 
ATOM   821   C CG  . LEU A  1 109 ? 44.238  -18.499 8.170   1.00 33.87  ? 1127 LEU A CG  1 
ATOM   822   C CD1 . LEU A  1 109 ? 43.050  -19.217 8.776   1.00 33.85  ? 1127 LEU A CD1 1 
ATOM   823   C CD2 . LEU A  1 109 ? 44.879  -17.580 9.193   1.00 31.44  ? 1127 LEU A CD2 1 
ATOM   824   N N   . THR A  1 110 ? 47.769  -20.180 5.340   1.00 39.37  ? 1128 THR A N   1 
ATOM   825   C CA  . THR A  1 110 ? 48.738  -21.191 4.931   1.00 41.09  ? 1128 THR A CA  1 
ATOM   826   C C   . THR A  1 110 ? 50.146  -20.614 5.023   1.00 43.02  ? 1128 THR A C   1 
ATOM   827   O O   . THR A  1 110 ? 51.137  -21.331 4.892   1.00 44.49  ? 1128 THR A O   1 
ATOM   828   C CB  . THR A  1 110 ? 48.488  -21.679 3.489   1.00 40.32  ? 1128 THR A CB  1 
ATOM   829   O OG1 . THR A  1 110 ? 48.613  -20.582 2.576   1.00 38.88  ? 1128 THR A OG1 1 
ATOM   830   C CG2 . THR A  1 110 ? 47.098  -22.284 3.370   1.00 40.10  ? 1128 THR A CG2 1 
ATOM   831   N N   . LYS A  1 111 ? 50.222  -19.309 5.255   1.00 44.10  ? 1129 LYS A N   1 
ATOM   832   C CA  . LYS A  1 111 ? 51.497  -18.621 5.382   1.00 45.30  ? 1129 LYS A CA  1 
ATOM   833   C C   . LYS A  1 111 ? 51.538  -17.933 6.737   1.00 45.77  ? 1129 LYS A C   1 
ATOM   834   O O   . LYS A  1 111 ? 50.600  -18.040 7.526   1.00 46.51  ? 1129 LYS A O   1 
ATOM   835   C CB  . LYS A  1 111 ? 51.644  -17.577 4.275   1.00 46.50  ? 1129 LYS A CB  1 
ATOM   836   C CG  . LYS A  1 111 ? 51.571  -18.150 2.874   1.00 49.79  ? 1129 LYS A CG  1 
ATOM   837   C CD  . LYS A  1 111 ? 51.613  -17.054 1.823   1.00 51.19  ? 1129 LYS A CD  1 
ATOM   838   C CE  . LYS A  1 111 ? 51.538  -17.640 0.422   1.00 53.04  ? 1129 LYS A CE  1 
ATOM   839   N NZ  . LYS A  1 111 ? 51.558  -16.580 -0.626  1.00 55.18  ? 1129 LYS A NZ  1 
ATOM   840   N N   . LYS A  1 112 ? 52.627  -17.232 7.017   1.00 45.51  ? 1130 LYS A N   1 
ATOM   841   C CA  . LYS A  1 112 ? 52.736  -16.527 8.282   1.00 45.23  ? 1130 LYS A CA  1 
ATOM   842   C C   . LYS A  1 112 ? 52.309  -15.080 8.065   1.00 44.09  ? 1130 LYS A C   1 
ATOM   843   O O   . LYS A  1 112 ? 52.682  -14.450 7.071   1.00 44.22  ? 1130 LYS A O   1 
ATOM   844   C CB  . LYS A  1 112 ? 54.171  -16.570 8.805   1.00 46.89  ? 1130 LYS A CB  1 
ATOM   845   C CG  . LYS A  1 112 ? 54.353  -15.850 10.132  1.00 49.70  ? 1130 LYS A CG  1 
ATOM   846   C CD  . LYS A  1 112 ? 55.802  -15.873 10.599  1.00 52.10  ? 1130 LYS A CD  1 
ATOM   847   C CE  . LYS A  1 112 ? 55.961  -15.118 11.914  1.00 53.71  ? 1130 LYS A CE  1 
ATOM   848   N NZ  . LYS A  1 112 ? 57.356  -15.170 12.439  1.00 54.91  ? 1130 LYS A NZ  1 
ATOM   849   N N   . ASN A  1 113 ? 51.512  -14.567 8.991   1.00 40.61  ? 1131 ASN A N   1 
ATOM   850   C CA  . ASN A  1 113 ? 51.041  -13.195 8.913   1.00 37.85  ? 1131 ASN A CA  1 
ATOM   851   C C   . ASN A  1 113 ? 51.050  -12.599 10.311  1.00 35.31  ? 1131 ASN A C   1 
ATOM   852   O O   . ASN A  1 113 ? 50.970  -13.322 11.302  1.00 34.27  ? 1131 ASN A O   1 
ATOM   853   C CB  . ASN A  1 113 ? 49.613  -13.124 8.360   1.00 39.70  ? 1131 ASN A CB  1 
ATOM   854   C CG  . ASN A  1 113 ? 49.489  -13.698 6.964   1.00 41.23  ? 1131 ASN A CG  1 
ATOM   855   O OD1 . ASN A  1 113 ? 49.405  -14.918 6.788   1.00 45.12  ? 1131 ASN A OD1 1 
ATOM   856   N ND2 . ASN A  1 113 ? 49.471  -12.825 5.963   1.00 40.58  ? 1131 ASN A ND2 1 
ATOM   857   N N   . ARG A  1 114 ? 51.151  -11.279 10.383  1.00 31.48  ? 1132 ARG A N   1 
ATOM   858   C CA  . ARG A  1 114 ? 51.144  -10.574 11.656  1.00 30.15  ? 1132 ARG A CA  1 
ATOM   859   C C   . ARG A  1 114 ? 50.443  -9.240  11.433  1.00 26.96  ? 1132 ARG A C   1 
ATOM   860   O O   . ARG A  1 114 ? 51.037  -8.173  11.581  1.00 27.15  ? 1132 ARG A O   1 
ATOM   861   C CB  . ARG A  1 114 ? 52.577  -10.363 12.154  1.00 33.05  ? 1132 ARG A CB  1 
ATOM   862   C CG  . ARG A  1 114 ? 53.256  -11.646 12.651  1.00 38.31  ? 1132 ARG A CG  1 
ATOM   863   C CD  . ARG A  1 114 ? 52.599  -12.160 13.936  1.00 42.29  ? 1132 ARG A CD  1 
ATOM   864   N NE  . ARG A  1 114 ? 53.248  -13.360 14.466  1.00 45.69  ? 1132 ARG A NE  1 
ATOM   865   C CZ  . ARG A  1 114 ? 53.071  -14.591 13.990  1.00 47.02  ? 1132 ARG A CZ  1 
ATOM   866   N NH1 . ARG A  1 114 ? 52.254  -14.805 12.965  1.00 47.70  ? 1132 ARG A NH1 1 
ATOM   867   N NH2 . ARG A  1 114 ? 53.713  -15.613 14.541  1.00 48.33  ? 1132 ARG A NH2 1 
ATOM   868   N N   . LEU A  1 115 ? 49.169  -9.318  11.064  1.00 23.95  ? 1133 LEU A N   1 
ATOM   869   C CA  . LEU A  1 115 ? 48.366  -8.132  10.793  1.00 22.35  ? 1133 LEU A CA  1 
ATOM   870   C C   . LEU A  1 115 ? 47.900  -7.448  12.068  1.00 20.22  ? 1133 LEU A C   1 
ATOM   871   O O   . LEU A  1 115 ? 47.828  -8.068  13.124  1.00 19.89  ? 1133 LEU A O   1 
ATOM   872   C CB  . LEU A  1 115 ? 47.137  -8.516  9.968   1.00 22.20  ? 1133 LEU A CB  1 
ATOM   873   C CG  . LEU A  1 115 ? 47.394  -9.252  8.651   1.00 24.23  ? 1133 LEU A CG  1 
ATOM   874   C CD1 . LEU A  1 115 ? 46.076  -9.717  8.060   1.00 24.21  ? 1133 LEU A CD1 1 
ATOM   875   C CD2 . LEU A  1 115 ? 48.120  -8.330  7.687   1.00 23.23  ? 1133 LEU A CD2 1 
ATOM   876   N N   . PRO A  1 116 ? 47.586  -6.145  11.988  1.00 21.32  ? 1134 PRO A N   1 
ATOM   877   C CA  . PRO A  1 116 ? 47.126  -5.490  13.212  1.00 19.01  ? 1134 PRO A CA  1 
ATOM   878   C C   . PRO A  1 116 ? 45.795  -6.119  13.626  1.00 16.50  ? 1134 PRO A C   1 
ATOM   879   O O   . PRO A  1 116 ? 45.021  -6.573  12.782  1.00 13.98  ? 1134 PRO A O   1 
ATOM   880   C CB  . PRO A  1 116 ? 46.997  -4.021  12.798  1.00 19.43  ? 1134 PRO A CB  1 
ATOM   881   C CG  . PRO A  1 116 ? 46.766  -4.087  11.319  1.00 24.35  ? 1134 PRO A CG  1 
ATOM   882   C CD  . PRO A  1 116 ? 47.697  -5.186  10.875  1.00 20.03  ? 1134 PRO A CD  1 
ATOM   883   N N   . VAL A  1 117 ? 45.543  -6.162  14.928  1.00 15.95  ? 1135 VAL A N   1 
ATOM   884   C CA  . VAL A  1 117 ? 44.318  -6.748  15.445  1.00 17.08  ? 1135 VAL A CA  1 
ATOM   885   C C   . VAL A  1 117 ? 43.430  -5.668  16.047  1.00 16.62  ? 1135 VAL A C   1 
ATOM   886   O O   . VAL A  1 117 ? 43.900  -4.820  16.808  1.00 17.77  ? 1135 VAL A O   1 
ATOM   887   C CB  . VAL A  1 117 ? 44.634  -7.810  16.531  1.00 18.09  ? 1135 VAL A CB  1 
ATOM   888   C CG1 . VAL A  1 117 ? 43.339  -8.451  17.039  1.00 17.34  ? 1135 VAL A CG1 1 
ATOM   889   C CG2 . VAL A  1 117 ? 45.585  -8.878  15.959  1.00 14.66  ? 1135 VAL A CG2 1 
ATOM   890   N N   . MET A  1 118 ? 42.152  -5.690  15.687  1.00 15.28  ? 1136 MET A N   1 
ATOM   891   C CA  . MET A  1 118 ? 41.196  -4.726  16.221  1.00 14.94  ? 1136 MET A CA  1 
ATOM   892   C C   . MET A  1 118 ? 40.120  -5.491  17.003  1.00 14.01  ? 1136 MET A C   1 
ATOM   893   O O   . MET A  1 118 ? 39.335  -6.232  16.426  1.00 13.87  ? 1136 MET A O   1 
ATOM   894   C CB  . MET A  1 118 ? 40.584  -3.899  15.080  1.00 14.79  ? 1136 MET A CB  1 
ATOM   895   C CG  . MET A  1 118 ? 41.607  -2.986  14.387  1.00 14.88  ? 1136 MET A CG  1 
ATOM   896   S SD  . MET A  1 118 ? 40.903  -1.798  13.222  1.00 18.42  ? 1136 MET A SD  1 
ATOM   897   C CE  . MET A  1 118 ? 40.266  -0.581  14.348  1.00 15.87  ? 1136 MET A CE  1 
ATOM   898   N N   . VAL A  1 119 ? 40.119  -5.314  18.326  1.00 13.27  ? 1137 VAL A N   1 
ATOM   899   C CA  . VAL A  1 119 ? 39.181  -5.987  19.228  1.00 11.90  ? 1137 VAL A CA  1 
ATOM   900   C C   . VAL A  1 119 ? 38.027  -5.055  19.597  1.00 12.79  ? 1137 VAL A C   1 
ATOM   901   O O   . VAL A  1 119 ? 38.224  -4.047  20.273  1.00 12.30  ? 1137 VAL A O   1 
ATOM   902   C CB  . VAL A  1 119 ? 39.899  -6.443  20.526  1.00 13.71  ? 1137 VAL A CB  1 
ATOM   903   C CG1 . VAL A  1 119 ? 38.909  -7.141  21.460  1.00 14.27  ? 1137 VAL A CG1 1 
ATOM   904   C CG2 . VAL A  1 119 ? 41.063  -7.392  20.180  1.00 13.47  ? 1137 VAL A CG2 1 
ATOM   905   N N   . TRP A  1 120 ? 36.827  -5.418  19.158  1.00 11.27  ? 1138 TRP A N   1 
ATOM   906   C CA  . TRP A  1 120 ? 35.624  -4.622  19.380  1.00 11.40  ? 1138 TRP A CA  1 
ATOM   907   C C   . TRP A  1 120 ? 34.826  -4.996  20.621  1.00 12.37  ? 1138 TRP A C   1 
ATOM   908   O O   . TRP A  1 120 ? 34.529  -6.176  20.857  1.00 11.09  ? 1138 TRP A O   1 
ATOM   909   C CB  . TRP A  1 120 ? 34.720  -4.726  18.147  1.00 8.80   ? 1138 TRP A CB  1 
ATOM   910   C CG  . TRP A  1 120 ? 33.389  -4.062  18.292  1.00 11.82  ? 1138 TRP A CG  1 
ATOM   911   C CD1 . TRP A  1 120 ? 32.180  -4.673  18.520  1.00 11.13  ? 1138 TRP A CD1 1 
ATOM   912   C CD2 . TRP A  1 120 ? 33.123  -2.657  18.232  1.00 9.63   ? 1138 TRP A CD2 1 
ATOM   913   N NE1 . TRP A  1 120 ? 31.183  -3.730  18.604  1.00 10.44  ? 1138 TRP A NE1 1 
ATOM   914   C CE2 . TRP A  1 120 ? 31.731  -2.485  18.431  1.00 12.78  ? 1138 TRP A CE2 1 
ATOM   915   C CE3 . TRP A  1 120 ? 33.922  -1.527  18.026  1.00 13.25  ? 1138 TRP A CE3 1 
ATOM   916   C CZ2 . TRP A  1 120 ? 31.122  -1.222  18.432  1.00 10.59  ? 1138 TRP A CZ2 1 
ATOM   917   C CZ3 . TRP A  1 120 ? 33.314  -0.264  18.027  1.00 12.40  ? 1138 TRP A CZ3 1 
ATOM   918   C CH2 . TRP A  1 120 ? 31.929  -0.128  18.229  1.00 13.90  ? 1138 TRP A CH2 1 
ATOM   919   N N   . ILE A  1 121 ? 34.475  -3.977  21.400  1.00 10.83  ? 1139 ILE A N   1 
ATOM   920   C CA  . ILE A  1 121 ? 33.676  -4.155  22.614  1.00 10.73  ? 1139 ILE A CA  1 
ATOM   921   C C   . ILE A  1 121 ? 32.340  -3.452  22.368  1.00 12.70  ? 1139 ILE A C   1 
ATOM   922   O O   . ILE A  1 121 ? 32.267  -2.217  22.327  1.00 12.50  ? 1139 ILE A O   1 
ATOM   923   C CB  . ILE A  1 121 ? 34.384  -3.539  23.843  1.00 11.09  ? 1139 ILE A CB  1 
ATOM   924   C CG1 . ILE A  1 121 ? 35.791  -4.129  23.970  1.00 11.46  ? 1139 ILE A CG1 1 
ATOM   925   C CG2 . ILE A  1 121 ? 33.599  -3.856  25.133  1.00 11.27  ? 1139 ILE A CG2 1 
ATOM   926   C CD1 . ILE A  1 121 ? 36.578  -3.584  25.158  1.00 13.30  ? 1139 ILE A CD1 1 
ATOM   927   N N   . HIS A  1 122 ? 31.286  -4.241  22.183  1.00 13.08  ? 1140 HIS A N   1 
ATOM   928   C CA  . HIS A  1 122 ? 29.959  -3.697  21.900  1.00 13.98  ? 1140 HIS A CA  1 
ATOM   929   C C   . HIS A  1 122 ? 29.372  -2.876  23.043  1.00 12.94  ? 1140 HIS A C   1 
ATOM   930   O O   . HIS A  1 122 ? 29.791  -2.994  24.196  1.00 12.39  ? 1140 HIS A O   1 
ATOM   931   C CB  . HIS A  1 122 ? 28.995  -4.838  21.529  1.00 12.45  ? 1140 HIS A CB  1 
ATOM   932   C CG  . HIS A  1 122 ? 28.641  -5.728  22.682  1.00 14.17  ? 1140 HIS A CG  1 
ATOM   933   N ND1 . HIS A  1 122 ? 27.749  -5.352  23.662  1.00 13.99  ? 1140 HIS A ND1 1 
ATOM   934   C CD2 . HIS A  1 122 ? 29.089  -6.960  23.030  1.00 11.15  ? 1140 HIS A CD2 1 
ATOM   935   C CE1 . HIS A  1 122 ? 27.664  -6.313  24.568  1.00 12.19  ? 1140 HIS A CE1 1 
ATOM   936   N NE2 . HIS A  1 122 ? 28.467  -7.298  24.208  1.00 12.89  ? 1140 HIS A NE2 1 
ATOM   937   N N   . GLY A  1 123 ? 28.402  -2.031  22.704  1.00 15.70  ? 1141 GLY A N   1 
ATOM   938   C CA  . GLY A  1 123 ? 27.741  -1.209  23.701  1.00 15.31  ? 1141 GLY A CA  1 
ATOM   939   C C   . GLY A  1 123 ? 26.400  -1.813  24.102  1.00 17.66  ? 1141 GLY A C   1 
ATOM   940   O O   . GLY A  1 123 ? 26.073  -2.938  23.707  1.00 16.06  ? 1141 GLY A O   1 
ATOM   941   N N   . GLY A  1 124 ? 25.614  -1.057  24.864  1.00 17.21  ? 1142 GLY A N   1 
ATOM   942   C CA  . GLY A  1 124 ? 24.328  -1.545  25.335  1.00 17.38  ? 1142 GLY A CA  1 
ATOM   943   C C   . GLY A  1 124 ? 24.173  -1.247  26.819  1.00 17.28  ? 1142 GLY A C   1 
ATOM   944   O O   . GLY A  1 124 ? 23.525  -1.993  27.554  1.00 17.65  ? 1142 GLY A O   1 
ATOM   945   N N   . GLY A  1 125 ? 24.799  -0.157  27.257  1.00 16.21  ? 1143 GLY A N   1 
ATOM   946   C CA  . GLY A  1 125 ? 24.722  0.267   28.648  1.00 16.54  ? 1143 GLY A CA  1 
ATOM   947   C C   . GLY A  1 125 ? 25.144  -0.752  29.690  1.00 17.26  ? 1143 GLY A C   1 
ATOM   948   O O   . GLY A  1 125 ? 24.765  -0.635  30.855  1.00 16.80  ? 1143 GLY A O   1 
ATOM   949   N N   . LEU A  1 126 ? 25.945  -1.733  29.278  1.00 16.42  ? 1144 LEU A N   1 
ATOM   950   C CA  . LEU A  1 126 ? 26.408  -2.801  30.161  1.00 15.48  ? 1144 LEU A CA  1 
ATOM   951   C C   . LEU A  1 126 ? 25.232  -3.693  30.589  1.00 15.71  ? 1144 LEU A C   1 
ATOM   952   O O   . LEU A  1 126 ? 25.381  -4.546  31.461  1.00 15.04  ? 1144 LEU A O   1 
ATOM   953   C CB  . LEU A  1 126 ? 27.115  -2.227  31.399  1.00 14.35  ? 1144 LEU A CB  1 
ATOM   954   C CG  . LEU A  1 126 ? 28.347  -1.343  31.134  1.00 16.23  ? 1144 LEU A CG  1 
ATOM   955   C CD1 . LEU A  1 126 ? 28.954  -0.883  32.451  1.00 16.55  ? 1144 LEU A CD1 1 
ATOM   956   C CD2 . LEU A  1 126 ? 29.388  -2.118  30.327  1.00 15.41  ? 1144 LEU A CD2 1 
ATOM   957   N N   . MET A  1 127 ? 24.076  -3.500  29.955  1.00 16.05  ? 1145 MET A N   1 
ATOM   958   C CA  . MET A  1 127 ? 22.865  -4.274  30.262  1.00 16.06  ? 1145 MET A CA  1 
ATOM   959   C C   . MET A  1 127 ? 22.418  -5.171  29.101  1.00 16.42  ? 1145 MET A C   1 
ATOM   960   O O   . MET A  1 127 ? 21.809  -6.217  29.323  1.00 13.80  ? 1145 MET A O   1 
ATOM   961   C CB  . MET A  1 127 ? 21.700  -3.335  30.616  1.00 17.62  ? 1145 MET A CB  1 
ATOM   962   C CG  . MET A  1 127 ? 21.903  -2.450  31.844  1.00 21.98  ? 1145 MET A CG  1 
ATOM   963   S SD  . MET A  1 127 ? 22.009  -3.346  33.417  1.00 23.87  ? 1145 MET A SD  1 
ATOM   964   C CE  . MET A  1 127 ? 20.631  -4.517  33.232  1.00 21.24  ? 1145 MET A CE  1 
ATOM   965   N N   . VAL A  1 128 ? 22.692  -4.745  27.868  1.00 14.83  ? 1146 VAL A N   1 
ATOM   966   C CA  . VAL A  1 128 ? 22.310  -5.516  26.686  1.00 14.70  ? 1146 VAL A CA  1 
ATOM   967   C C   . VAL A  1 128 ? 23.417  -5.475  25.628  1.00 15.29  ? 1146 VAL A C   1 
ATOM   968   O O   . VAL A  1 128 ? 24.451  -4.838  25.821  1.00 14.88  ? 1146 VAL A O   1 
ATOM   969   C CB  . VAL A  1 128 ? 21.033  -4.959  26.022  1.00 16.91  ? 1146 VAL A CB  1 
ATOM   970   C CG1 . VAL A  1 128 ? 19.836  -5.089  26.954  1.00 16.34  ? 1146 VAL A CG1 1 
ATOM   971   C CG2 . VAL A  1 128 ? 21.263  -3.504  25.638  1.00 15.46  ? 1146 VAL A CG2 1 
ATOM   972   N N   . GLY A  1 129 ? 23.182  -6.154  24.509  1.00 15.28  ? 1147 GLY A N   1 
ATOM   973   C CA  . GLY A  1 129 ? 24.161  -6.173  23.436  1.00 15.40  ? 1147 GLY A CA  1 
ATOM   974   C C   . GLY A  1 129 ? 24.760  -7.544  23.181  1.00 15.61  ? 1147 GLY A C   1 
ATOM   975   O O   . GLY A  1 129 ? 24.622  -8.461  23.991  1.00 14.59  ? 1147 GLY A O   1 
ATOM   976   N N   . ALA A  1 130 ? 25.434  -7.678  22.043  1.00 14.00  ? 1148 ALA A N   1 
ATOM   977   C CA  . ALA A  1 130 ? 26.064  -8.931  21.659  1.00 13.86  ? 1148 ALA A CA  1 
ATOM   978   C C   . ALA A  1 130 ? 27.153  -8.649  20.629  1.00 14.50  ? 1148 ALA A C   1 
ATOM   979   O O   . ALA A  1 130 ? 27.097  -7.645  19.920  1.00 13.80  ? 1148 ALA A O   1 
ATOM   980   C CB  . ALA A  1 130 ? 25.020  -9.882  21.069  1.00 12.46  ? 1148 ALA A CB  1 
ATOM   981   N N   . ALA A  1 131 ? 28.143  -9.532  20.553  1.00 14.14  ? 1149 ALA A N   1 
ATOM   982   C CA  . ALA A  1 131 ? 29.235  -9.374  19.597  1.00 15.70  ? 1149 ALA A CA  1 
ATOM   983   C C   . ALA A  1 131 ? 28.767  -9.679  18.177  1.00 15.28  ? 1149 ALA A C   1 
ATOM   984   O O   . ALA A  1 131 ? 29.153  -9.007  17.223  1.00 16.05  ? 1149 ALA A O   1 
ATOM   985   C CB  . ALA A  1 131 ? 30.394  -10.311 19.963  1.00 14.88  ? 1149 ALA A CB  1 
ATOM   986   N N   . SER A  1 132 ? 27.917  -10.692 18.051  1.00 15.78  ? 1150 SER A N   1 
ATOM   987   C CA  . SER A  1 132 ? 27.430  -11.140 16.751  1.00 16.06  ? 1150 SER A CA  1 
ATOM   988   C C   . SER A  1 132 ? 26.668  -10.112 15.931  1.00 17.62  ? 1150 SER A C   1 
ATOM   989   O O   . SER A  1 132 ? 26.472  -10.285 14.727  1.00 18.14  ? 1150 SER A O   1 
ATOM   990   C CB  . SER A  1 132 ? 26.596  -12.402 16.939  1.00 15.66  ? 1150 SER A CB  1 
ATOM   991   O OG  . SER A  1 132 ? 27.375  -13.372 17.622  1.00 13.78  ? 1150 SER A OG  1 
ATOM   992   N N   . THR A  1 133 ? 26.242  -9.042  16.584  1.00 17.53  ? 1151 THR A N   1 
ATOM   993   C CA  . THR A  1 133 ? 25.534  -7.957  15.923  1.00 17.68  ? 1151 THR A CA  1 
ATOM   994   C C   . THR A  1 133 ? 26.451  -7.307  14.882  1.00 17.95  ? 1151 THR A C   1 
ATOM   995   O O   . THR A  1 133 ? 25.999  -6.848  13.835  1.00 17.30  ? 1151 THR A O   1 
ATOM   996   C CB  . THR A  1 133 ? 25.136  -6.882  16.957  1.00 16.26  ? 1151 THR A CB  1 
ATOM   997   O OG1 . THR A  1 133 ? 24.181  -7.433  17.870  1.00 17.48  ? 1151 THR A OG1 1 
ATOM   998   C CG2 . THR A  1 133 ? 24.550  -5.649  16.272  1.00 18.80  ? 1151 THR A CG2 1 
ATOM   999   N N   . TYR A  1 134 ? 27.747  -7.294  15.182  1.00 18.61  ? 1152 TYR A N   1 
ATOM   1000  C CA  . TYR A  1 134 ? 28.742  -6.667  14.322  1.00 17.72  ? 1152 TYR A CA  1 
ATOM   1001  C C   . TYR A  1 134 ? 29.552  -7.634  13.464  1.00 19.76  ? 1152 TYR A C   1 
ATOM   1002  O O   . TYR A  1 134 ? 30.324  -8.442  13.976  1.00 19.82  ? 1152 TYR A O   1 
ATOM   1003  C CB  . TYR A  1 134 ? 29.684  -5.824  15.185  1.00 17.99  ? 1152 TYR A CB  1 
ATOM   1004  C CG  . TYR A  1 134 ? 28.940  -4.957  16.175  1.00 17.24  ? 1152 TYR A CG  1 
ATOM   1005  C CD1 . TYR A  1 134 ? 28.444  -5.491  17.369  1.00 16.89  ? 1152 TYR A CD1 1 
ATOM   1006  C CD2 . TYR A  1 134 ? 28.667  -3.618  15.887  1.00 18.94  ? 1152 TYR A CD2 1 
ATOM   1007  C CE1 . TYR A  1 134 ? 27.687  -4.713  18.246  1.00 16.28  ? 1152 TYR A CE1 1 
ATOM   1008  C CE2 . TYR A  1 134 ? 27.912  -2.832  16.757  1.00 18.69  ? 1152 TYR A CE2 1 
ATOM   1009  C CZ  . TYR A  1 134 ? 27.422  -3.387  17.931  1.00 18.82  ? 1152 TYR A CZ  1 
ATOM   1010  O OH  . TYR A  1 134 ? 26.643  -2.627  18.768  1.00 19.60  ? 1152 TYR A OH  1 
ATOM   1011  N N   . ASP A  1 135 ? 29.370  -7.528  12.151  1.00 18.94  ? 1153 ASP A N   1 
ATOM   1012  C CA  . ASP A  1 135 ? 30.071  -8.371  11.187  1.00 19.66  ? 1153 ASP A CA  1 
ATOM   1013  C C   . ASP A  1 135 ? 31.409  -7.697  10.867  1.00 17.44  ? 1153 ASP A C   1 
ATOM   1014  O O   . ASP A  1 135 ? 31.434  -6.580  10.372  1.00 18.28  ? 1153 ASP A O   1 
ATOM   1015  C CB  . ASP A  1 135 ? 29.207  -8.501  9.931   1.00 19.48  ? 1153 ASP A CB  1 
ATOM   1016  C CG  . ASP A  1 135 ? 29.690  -9.582  8.988   1.00 22.04  ? 1153 ASP A CG  1 
ATOM   1017  O OD1 . ASP A  1 135 ? 28.838  -10.147 8.271   1.00 25.63  ? 1153 ASP A OD1 1 
ATOM   1018  O OD2 . ASP A  1 135 ? 30.907  -9.857  8.945   1.00 21.73  ? 1153 ASP A OD2 1 
ATOM   1019  N N   . GLY A  1 136 ? 32.515  -8.372  11.165  1.00 18.61  ? 1154 GLY A N   1 
ATOM   1020  C CA  . GLY A  1 136 ? 33.825  -7.793  10.909  1.00 17.86  ? 1154 GLY A CA  1 
ATOM   1021  C C   . GLY A  1 136 ? 34.366  -7.994  9.499   1.00 18.76  ? 1154 GLY A C   1 
ATOM   1022  O O   . GLY A  1 136 ? 35.469  -7.548  9.193   1.00 19.48  ? 1154 GLY A O   1 
ATOM   1023  N N   . LEU A  1 137 ? 33.587  -8.647  8.641   1.00 17.79  ? 1155 LEU A N   1 
ATOM   1024  C CA  . LEU A  1 137 ? 33.997  -8.931  7.259   1.00 19.94  ? 1155 LEU A CA  1 
ATOM   1025  C C   . LEU A  1 137 ? 34.544  -7.760  6.428   1.00 18.79  ? 1155 LEU A C   1 
ATOM   1026  O O   . LEU A  1 137 ? 35.665  -7.824  5.927   1.00 18.87  ? 1155 LEU A O   1 
ATOM   1027  C CB  . LEU A  1 137 ? 32.832  -9.576  6.501   1.00 22.35  ? 1155 LEU A CB  1 
ATOM   1028  C CG  . LEU A  1 137 ? 33.111  -10.026 5.061   1.00 25.55  ? 1155 LEU A CG  1 
ATOM   1029  C CD1 . LEU A  1 137 ? 34.166  -11.118 5.068   1.00 28.55  ? 1155 LEU A CD1 1 
ATOM   1030  C CD2 . LEU A  1 137 ? 31.831  -10.537 4.423   1.00 27.22  ? 1155 LEU A CD2 1 
ATOM   1031  N N   . ALA A  1 138 ? 33.758  -6.697  6.276   1.00 19.10  ? 1156 ALA A N   1 
ATOM   1032  C CA  . ALA A  1 138 ? 34.179  -5.547  5.474   1.00 19.11  ? 1156 ALA A CA  1 
ATOM   1033  C C   . ALA A  1 138 ? 35.432  -4.834  5.979   1.00 19.54  ? 1156 ALA A C   1 
ATOM   1034  O O   . ALA A  1 138 ? 36.321  -4.490  5.196   1.00 17.85  ? 1156 ALA A O   1 
ATOM   1035  C CB  . ALA A  1 138 ? 33.026  -4.544  5.342   1.00 18.78  ? 1156 ALA A CB  1 
ATOM   1036  N N   . LEU A  1 139 ? 35.502  -4.600  7.282   1.00 18.57  ? 1157 LEU A N   1 
ATOM   1037  C CA  . LEU A  1 139 ? 36.655  -3.927  7.853   1.00 18.61  ? 1157 LEU A CA  1 
ATOM   1038  C C   . LEU A  1 139 ? 37.906  -4.786  7.688   1.00 17.86  ? 1157 LEU A C   1 
ATOM   1039  O O   . LEU A  1 139 ? 38.977  -4.287  7.344   1.00 17.92  ? 1157 LEU A O   1 
ATOM   1040  C CB  . LEU A  1 139 ? 36.407  -3.633  9.337   1.00 17.87  ? 1157 LEU A CB  1 
ATOM   1041  C CG  . LEU A  1 139 ? 37.576  -3.029  10.113  1.00 19.76  ? 1157 LEU A CG  1 
ATOM   1042  C CD1 . LEU A  1 139 ? 38.031  -1.727  9.452   1.00 18.12  ? 1157 LEU A CD1 1 
ATOM   1043  C CD2 . LEU A  1 139 ? 37.141  -2.778  11.556  1.00 19.75  ? 1157 LEU A CD2 1 
ATOM   1044  N N   . ALA A  1 140 ? 37.764  -6.084  7.933   1.00 17.37  ? 1158 ALA A N   1 
ATOM   1045  C CA  . ALA A  1 140 ? 38.889  -6.997  7.813   1.00 16.18  ? 1158 ALA A CA  1 
ATOM   1046  C C   . ALA A  1 140 ? 39.441  -6.996  6.383   1.00 17.76  ? 1158 ALA A C   1 
ATOM   1047  O O   . ALA A  1 140 ? 40.636  -6.795  6.168   1.00 16.21  ? 1158 ALA A O   1 
ATOM   1048  C CB  . ALA A  1 140 ? 38.458  -8.396  8.199   1.00 15.89  ? 1158 ALA A CB  1 
ATOM   1049  N N   . ALA A  1 141 ? 38.561  -7.209  5.413   1.00 16.18  ? 1159 ALA A N   1 
ATOM   1050  C CA  . ALA A  1 141 ? 38.963  -7.254  4.010   1.00 18.52  ? 1159 ALA A CA  1 
ATOM   1051  C C   . ALA A  1 141 ? 39.489  -5.930  3.473   1.00 19.79  ? 1159 ALA A C   1 
ATOM   1052  O O   . ALA A  1 141 ? 40.529  -5.890  2.815   1.00 20.23  ? 1159 ALA A O   1 
ATOM   1053  C CB  . ALA A  1 141 ? 37.797  -7.720  3.151   1.00 18.36  ? 1159 ALA A CB  1 
ATOM   1054  N N   . HIS A  1 142 ? 38.771  -4.845  3.746   1.00 18.22  ? 1160 HIS A N   1 
ATOM   1055  C CA  . HIS A  1 142 ? 39.175  -3.540  3.241   1.00 19.20  ? 1160 HIS A CA  1 
ATOM   1056  C C   . HIS A  1 142 ? 40.462  -2.972  3.793   1.00 20.13  ? 1160 HIS A C   1 
ATOM   1057  O O   . HIS A  1 142 ? 41.192  -2.294  3.076   1.00 20.79  ? 1160 HIS A O   1 
ATOM   1058  C CB  . HIS A  1 142 ? 38.056  -2.520  3.460   1.00 18.51  ? 1160 HIS A CB  1 
ATOM   1059  C CG  . HIS A  1 142 ? 36.943  -2.640  2.471   1.00 20.73  ? 1160 HIS A CG  1 
ATOM   1060  N ND1 . HIS A  1 142 ? 36.793  -1.768  1.416   1.00 22.90  ? 1160 HIS A ND1 1 
ATOM   1061  C CD2 . HIS A  1 142 ? 35.954  -3.556  2.349   1.00 20.56  ? 1160 HIS A CD2 1 
ATOM   1062  C CE1 . HIS A  1 142 ? 35.757  -2.143  0.685   1.00 24.96  ? 1160 HIS A CE1 1 
ATOM   1063  N NE2 . HIS A  1 142 ? 35.232  -3.225  1.229   1.00 23.27  ? 1160 HIS A NE2 1 
ATOM   1064  N N   . GLU A  1 143 ? 40.747  -3.235  5.061   1.00 18.28  ? 1161 GLU A N   1 
ATOM   1065  C CA  . GLU A  1 143 ? 41.942  -2.673  5.654   1.00 19.91  ? 1161 GLU A CA  1 
ATOM   1066  C C   . GLU A  1 143 ? 43.018  -3.659  6.073   1.00 18.93  ? 1161 GLU A C   1 
ATOM   1067  O O   . GLU A  1 143 ? 44.016  -3.262  6.672   1.00 19.21  ? 1161 GLU A O   1 
ATOM   1068  C CB  . GLU A  1 143 ? 41.541  -1.792  6.837   1.00 20.39  ? 1161 GLU A CB  1 
ATOM   1069  C CG  . GLU A  1 143 ? 40.828  -0.506  6.412   1.00 21.29  ? 1161 GLU A CG  1 
ATOM   1070  C CD  . GLU A  1 143 ? 41.653  0.302   5.415   1.00 24.57  ? 1161 GLU A CD  1 
ATOM   1071  O OE1 . GLU A  1 143 ? 42.892  0.377   5.592   1.00 23.03  ? 1161 GLU A OE1 1 
ATOM   1072  O OE2 . GLU A  1 143 ? 41.070  0.863   4.459   1.00 25.26  ? 1161 GLU A OE2 1 
ATOM   1073  N N   . ASN A  1 144 ? 42.822  -4.936  5.758   1.00 19.81  ? 1162 ASN A N   1 
ATOM   1074  C CA  . ASN A  1 144 ? 43.804  -5.960  6.114   1.00 21.01  ? 1162 ASN A CA  1 
ATOM   1075  C C   . ASN A  1 144 ? 44.143  -5.956  7.603   1.00 20.56  ? 1162 ASN A C   1 
ATOM   1076  O O   . ASN A  1 144 ? 45.302  -5.786  7.987   1.00 19.44  ? 1162 ASN A O   1 
ATOM   1077  C CB  . ASN A  1 144 ? 45.092  -5.761  5.311   1.00 26.30  ? 1162 ASN A CB  1 
ATOM   1078  C CG  . ASN A  1 144 ? 44.964  -6.226  3.876   1.00 31.03  ? 1162 ASN A CG  1 
ATOM   1079  O OD1 . ASN A  1 144 ? 45.499  -5.597  2.962   1.00 37.43  ? 1162 ASN A OD1 1 
ATOM   1080  N ND2 . ASN A  1 144 ? 44.267  -7.343  3.669   1.00 33.17  ? 1162 ASN A ND2 1 
ATOM   1081  N N   . VAL A  1 145 ? 43.121  -6.119  8.436   1.00 18.37  ? 1163 VAL A N   1 
ATOM   1082  C CA  . VAL A  1 145 ? 43.303  -6.177  9.884   1.00 17.65  ? 1163 VAL A CA  1 
ATOM   1083  C C   . VAL A  1 145 ? 42.492  -7.374  10.363  1.00 17.15  ? 1163 VAL A C   1 
ATOM   1084  O O   . VAL A  1 145 ? 41.575  -7.813  9.680   1.00 17.24  ? 1163 VAL A O   1 
ATOM   1085  C CB  . VAL A  1 145 ? 42.776  -4.899  10.598  1.00 17.71  ? 1163 VAL A CB  1 
ATOM   1086  C CG1 . VAL A  1 145 ? 43.602  -3.684  10.187  1.00 18.63  ? 1163 VAL A CG1 1 
ATOM   1087  C CG2 . VAL A  1 145 ? 41.309  -4.680  10.270  1.00 16.84  ? 1163 VAL A CG2 1 
ATOM   1088  N N   . VAL A  1 146 ? 42.845  -7.924  11.516  1.00 17.58  ? 1164 VAL A N   1 
ATOM   1089  C CA  . VAL A  1 146 ? 42.088  -9.045  12.057  1.00 18.11  ? 1164 VAL A CA  1 
ATOM   1090  C C   . VAL A  1 146 ? 41.086  -8.401  13.008  1.00 16.61  ? 1164 VAL A C   1 
ATOM   1091  O O   . VAL A  1 146 ? 41.471  -7.644  13.895  1.00 17.16  ? 1164 VAL A O   1 
ATOM   1092  C CB  . VAL A  1 146 ? 43.000  -10.034 12.829  1.00 18.30  ? 1164 VAL A CB  1 
ATOM   1093  C CG1 . VAL A  1 146 ? 42.164  -11.141 13.457  1.00 15.67  ? 1164 VAL A CG1 1 
ATOM   1094  C CG2 . VAL A  1 146 ? 44.036  -10.636 11.871  1.00 17.20  ? 1164 VAL A CG2 1 
ATOM   1095  N N   . VAL A  1 147 ? 39.804  -8.676  12.801  1.00 17.66  ? 1165 VAL A N   1 
ATOM   1096  C CA  . VAL A  1 147 ? 38.755  -8.105  13.646  1.00 15.94  ? 1165 VAL A CA  1 
ATOM   1097  C C   . VAL A  1 147 ? 38.210  -9.152  14.613  1.00 17.26  ? 1165 VAL A C   1 
ATOM   1098  O O   . VAL A  1 147 ? 37.748  -10.215 14.194  1.00 17.21  ? 1165 VAL A O   1 
ATOM   1099  C CB  . VAL A  1 147 ? 37.584  -7.559  12.794  1.00 16.20  ? 1165 VAL A CB  1 
ATOM   1100  C CG1 . VAL A  1 147 ? 36.509  -6.968  13.700  1.00 15.77  ? 1165 VAL A CG1 1 
ATOM   1101  C CG2 . VAL A  1 147 ? 38.092  -6.498  11.812  1.00 14.77  ? 1165 VAL A CG2 1 
ATOM   1102  N N   . VAL A  1 148 ? 38.276  -8.843  15.907  1.00 16.12  ? 1166 VAL A N   1 
ATOM   1103  C CA  . VAL A  1 148 ? 37.787  -9.734  16.955  1.00 15.88  ? 1166 VAL A CA  1 
ATOM   1104  C C   . VAL A  1 148 ? 36.664  -9.015  17.709  1.00 17.36  ? 1166 VAL A C   1 
ATOM   1105  O O   . VAL A  1 148 ? 36.874  -7.930  18.241  1.00 17.81  ? 1166 VAL A O   1 
ATOM   1106  C CB  . VAL A  1 148 ? 38.912  -10.079 17.977  1.00 15.59  ? 1166 VAL A CB  1 
ATOM   1107  C CG1 . VAL A  1 148 ? 38.378  -11.011 19.078  1.00 10.38  ? 1166 VAL A CG1 1 
ATOM   1108  C CG2 . VAL A  1 148 ? 40.094  -10.729 17.265  1.00 14.54  ? 1166 VAL A CG2 1 
ATOM   1109  N N   . THR A  1 149 ? 35.471  -9.605  17.730  1.00 17.12  ? 1167 THR A N   1 
ATOM   1110  C CA  . THR A  1 149 ? 34.344  -9.021  18.455  1.00 15.27  ? 1167 THR A CA  1 
ATOM   1111  C C   . THR A  1 149 ? 34.150  -9.911  19.682  1.00 16.34  ? 1167 THR A C   1 
ATOM   1112  O O   . THR A  1 149 ? 34.002  -11.129 19.559  1.00 15.25  ? 1167 THR A O   1 
ATOM   1113  C CB  . THR A  1 149 ? 33.068  -9.001  17.594  1.00 15.31  ? 1167 THR A CB  1 
ATOM   1114  O OG1 . THR A  1 149 ? 32.727  -10.339 17.203  1.00 15.57  ? 1167 THR A OG1 1 
ATOM   1115  C CG2 . THR A  1 149 ? 33.297  -8.146  16.338  1.00 14.57  ? 1167 THR A CG2 1 
ATOM   1116  N N   . ILE A  1 150 ? 34.162  -9.307  20.865  1.00 14.49  ? 1168 ILE A N   1 
ATOM   1117  C CA  . ILE A  1 150 ? 34.040  -10.086 22.092  1.00 15.53  ? 1168 ILE A CA  1 
ATOM   1118  C C   . ILE A  1 150 ? 32.753  -9.871  22.877  1.00 15.42  ? 1168 ILE A C   1 
ATOM   1119  O O   . ILE A  1 150 ? 32.065  -8.865  22.714  1.00 15.72  ? 1168 ILE A O   1 
ATOM   1120  C CB  . ILE A  1 150 ? 35.215  -9.782  23.045  1.00 16.61  ? 1168 ILE A CB  1 
ATOM   1121  C CG1 . ILE A  1 150 ? 35.080  -8.358  23.593  1.00 16.59  ? 1168 ILE A CG1 1 
ATOM   1122  C CG2 . ILE A  1 150 ? 36.549  -9.911  22.293  1.00 15.38  ? 1168 ILE A CG2 1 
ATOM   1123  C CD1 . ILE A  1 150 ? 36.033  -8.037  24.737  1.00 18.17  ? 1168 ILE A CD1 1 
ATOM   1124  N N   . GLN A  1 151 ? 32.430  -10.839 23.725  1.00 14.89  ? 1169 GLN A N   1 
ATOM   1125  C CA  . GLN A  1 151 ? 31.260  -10.728 24.579  1.00 14.77  ? 1169 GLN A CA  1 
ATOM   1126  C C   . GLN A  1 151 ? 31.736  -10.715 26.025  1.00 14.16  ? 1169 GLN A C   1 
ATOM   1127  O O   . GLN A  1 151 ? 32.844  -11.149 26.322  1.00 13.38  ? 1169 GLN A O   1 
ATOM   1128  C CB  . GLN A  1 151 ? 30.274  -11.876 24.309  1.00 13.20  ? 1169 GLN A CB  1 
ATOM   1129  C CG  . GLN A  1 151 ? 29.505  -11.623 23.028  1.00 13.25  ? 1169 GLN A CG  1 
ATOM   1130  C CD  . GLN A  1 151 ? 28.369  -12.580 22.766  1.00 13.89  ? 1169 GLN A CD  1 
ATOM   1131  O OE1 . GLN A  1 151 ? 27.595  -12.376 21.832  1.00 17.04  ? 1169 GLN A OE1 1 
ATOM   1132  N NE2 . GLN A  1 151 ? 28.266  -13.636 23.570  1.00 15.29  ? 1169 GLN A NE2 1 
ATOM   1133  N N   . TYR A  1 152 ? 30.910  -10.175 26.909  1.00 11.40  ? 1170 TYR A N   1 
ATOM   1134  C CA  . TYR A  1 152 ? 31.238  -10.081 28.321  1.00 12.73  ? 1170 TYR A CA  1 
ATOM   1135  C C   . TYR A  1 152 ? 29.933  -10.129 29.111  1.00 13.27  ? 1170 TYR A C   1 
ATOM   1136  O O   . TYR A  1 152 ? 28.877  -9.741  28.598  1.00 15.57  ? 1170 TYR A O   1 
ATOM   1137  C CB  . TYR A  1 152 ? 31.986  -8.772  28.608  1.00 11.48  ? 1170 TYR A CB  1 
ATOM   1138  C CG  . TYR A  1 152 ? 31.297  -7.519  28.089  1.00 12.30  ? 1170 TYR A CG  1 
ATOM   1139  C CD1 . TYR A  1 152 ? 31.373  -7.163  26.741  1.00 12.35  ? 1170 TYR A CD1 1 
ATOM   1140  C CD2 . TYR A  1 152 ? 30.578  -6.683  28.951  1.00 12.57  ? 1170 TYR A CD2 1 
ATOM   1141  C CE1 . TYR A  1 152 ? 30.748  -5.997  26.261  1.00 14.09  ? 1170 TYR A CE1 1 
ATOM   1142  C CE2 . TYR A  1 152 ? 29.947  -5.516  28.483  1.00 12.74  ? 1170 TYR A CE2 1 
ATOM   1143  C CZ  . TYR A  1 152 ? 30.039  -5.184  27.136  1.00 13.66  ? 1170 TYR A CZ  1 
ATOM   1144  O OH  . TYR A  1 152 ? 29.427  -4.044  26.663  1.00 17.08  ? 1170 TYR A OH  1 
ATOM   1145  N N   . ARG A  1 153 ? 29.992  -10.617 30.345  1.00 13.69  ? 1171 ARG A N   1 
ATOM   1146  C CA  . ARG A  1 153 ? 28.783  -10.716 31.158  1.00 12.61  ? 1171 ARG A CA  1 
ATOM   1147  C C   . ARG A  1 153 ? 28.114  -9.358  31.305  1.00 11.77  ? 1171 ARG A C   1 
ATOM   1148  O O   . ARG A  1 153 ? 28.782  -8.342  31.491  1.00 9.48   ? 1171 ARG A O   1 
ATOM   1149  C CB  . ARG A  1 153 ? 29.109  -11.297 32.528  1.00 12.13  ? 1171 ARG A CB  1 
ATOM   1150  C CG  . ARG A  1 153 ? 29.257  -12.816 32.503  1.00 15.16  ? 1171 ARG A CG  1 
ATOM   1151  C CD  . ARG A  1 153 ? 29.735  -13.331 33.842  1.00 14.74  ? 1171 ARG A CD  1 
ATOM   1152  N NE  . ARG A  1 153 ? 31.181  -13.201 33.977  1.00 17.39  ? 1171 ARG A NE  1 
ATOM   1153  C CZ  . ARG A  1 153 ? 31.864  -13.591 35.046  1.00 17.22  ? 1171 ARG A CZ  1 
ATOM   1154  N NH1 . ARG A  1 153 ? 31.225  -14.126 36.076  1.00 15.62  ? 1171 ARG A NH1 1 
ATOM   1155  N NH2 . ARG A  1 153 ? 33.184  -13.466 35.077  1.00 19.09  ? 1171 ARG A NH2 1 
ATOM   1156  N N   . LEU A  1 154 ? 26.789  -9.358  31.218  1.00 10.98  ? 1172 LEU A N   1 
ATOM   1157  C CA  . LEU A  1 154 ? 26.000  -8.131  31.305  1.00 13.68  ? 1172 LEU A CA  1 
ATOM   1158  C C   . LEU A  1 154 ? 25.072  -8.069  32.521  1.00 15.88  ? 1172 LEU A C   1 
ATOM   1159  O O   . LEU A  1 154 ? 24.785  -9.084  33.153  1.00 15.64  ? 1172 LEU A O   1 
ATOM   1160  C CB  . LEU A  1 154 ? 25.148  -7.984  30.045  1.00 10.18  ? 1172 LEU A CB  1 
ATOM   1161  C CG  . LEU A  1 154 ? 25.878  -7.972  28.703  1.00 11.29  ? 1172 LEU A CG  1 
ATOM   1162  C CD1 . LEU A  1 154 ? 24.867  -8.112  27.575  1.00 8.51   ? 1172 LEU A CD1 1 
ATOM   1163  C CD2 . LEU A  1 154 ? 26.677  -6.672  28.565  1.00 13.08  ? 1172 LEU A CD2 1 
ATOM   1164  N N   . GLY A  1 155 ? 24.599  -6.860  32.822  1.00 17.24  ? 1173 GLY A N   1 
ATOM   1165  C CA  . GLY A  1 155 ? 23.681  -6.647  33.935  1.00 17.60  ? 1173 GLY A CA  1 
ATOM   1166  C C   . GLY A  1 155 ? 24.071  -7.232  35.276  1.00 15.97  ? 1173 GLY A C   1 
ATOM   1167  O O   . GLY A  1 155 ? 25.205  -7.088  35.721  1.00 17.77  ? 1173 GLY A O   1 
ATOM   1168  N N   . ILE A  1 156 ? 23.118  -7.891  35.930  1.00 16.22  ? 1174 ILE A N   1 
ATOM   1169  C CA  . ILE A  1 156 ? 23.364  -8.500  37.234  1.00 14.90  ? 1174 ILE A CA  1 
ATOM   1170  C C   . ILE A  1 156 ? 24.542  -9.472  37.169  1.00 13.54  ? 1174 ILE A C   1 
ATOM   1171  O O   . ILE A  1 156 ? 25.437  -9.440  38.009  1.00 13.32  ? 1174 ILE A O   1 
ATOM   1172  C CB  . ILE A  1 156 ? 22.107  -9.266  37.740  1.00 15.74  ? 1174 ILE A CB  1 
ATOM   1173  C CG1 . ILE A  1 156 ? 20.985  -8.274  38.054  1.00 17.73  ? 1174 ILE A CG1 1 
ATOM   1174  C CG2 . ILE A  1 156 ? 22.446  -10.073 38.988  1.00 15.69  ? 1174 ILE A CG2 1 
ATOM   1175  C CD1 . ILE A  1 156 ? 19.684  -8.932  38.492  1.00 19.52  ? 1174 ILE A CD1 1 
ATOM   1176  N N   . TRP A  1 157 ? 24.530  -10.336 36.164  1.00 13.70  ? 1175 TRP A N   1 
ATOM   1177  C CA  . TRP A  1 157 ? 25.591  -11.318 35.988  1.00 13.69  ? 1175 TRP A CA  1 
ATOM   1178  C C   . TRP A  1 157 ? 26.963  -10.659 35.853  1.00 13.78  ? 1175 TRP A C   1 
ATOM   1179  O O   . TRP A  1 157 ? 27.945  -11.117 36.442  1.00 14.34  ? 1175 TRP A O   1 
ATOM   1180  C CB  . TRP A  1 157 ? 25.303  -12.164 34.746  1.00 13.15  ? 1175 TRP A CB  1 
ATOM   1181  C CG  . TRP A  1 157 ? 24.029  -12.978 34.846  1.00 12.22  ? 1175 TRP A CG  1 
ATOM   1182  C CD1 . TRP A  1 157 ? 23.914  -14.275 35.260  1.00 12.78  ? 1175 TRP A CD1 1 
ATOM   1183  C CD2 . TRP A  1 157 ? 22.704  -12.544 34.513  1.00 11.74  ? 1175 TRP A CD2 1 
ATOM   1184  N NE1 . TRP A  1 157 ? 22.598  -14.679 35.198  1.00 10.07  ? 1175 TRP A NE1 1 
ATOM   1185  C CE2 . TRP A  1 157 ? 21.836  -13.635 34.745  1.00 11.78  ? 1175 TRP A CE2 1 
ATOM   1186  C CE3 . TRP A  1 157 ? 22.166  -11.339 34.041  1.00 11.61  ? 1175 TRP A CE3 1 
ATOM   1187  C CZ2 . TRP A  1 157 ? 20.458  -13.557 34.519  1.00 12.53  ? 1175 TRP A CZ2 1 
ATOM   1188  C CZ3 . TRP A  1 157 ? 20.793  -11.262 33.815  1.00 15.20  ? 1175 TRP A CZ3 1 
ATOM   1189  C CH2 . TRP A  1 157 ? 19.956  -12.366 34.055  1.00 15.35  ? 1175 TRP A CH2 1 
ATOM   1190  N N   . GLY A  1 158 ? 27.026  -9.581  35.082  1.00 14.46  ? 1176 GLY A N   1 
ATOM   1191  C CA  . GLY A  1 158 ? 28.298  -8.911  34.880  1.00 14.12  ? 1176 GLY A CA  1 
ATOM   1192  C C   . GLY A  1 158 ? 28.701  -7.824  35.853  1.00 15.01  ? 1176 GLY A C   1 
ATOM   1193  O O   . GLY A  1 158 ? 29.892  -7.519  35.980  1.00 14.85  ? 1176 GLY A O   1 
ATOM   1194  N N   . PHE A  1 159 ? 27.742  -7.239  36.563  1.00 14.62  ? 1177 PHE A N   1 
ATOM   1195  C CA  . PHE A  1 159 ? 28.104  -6.147  37.446  1.00 16.15  ? 1177 PHE A CA  1 
ATOM   1196  C C   . PHE A  1 159 ? 27.525  -6.106  38.860  1.00 18.21  ? 1177 PHE A C   1 
ATOM   1197  O O   . PHE A  1 159 ? 27.645  -5.097  39.547  1.00 16.35  ? 1177 PHE A O   1 
ATOM   1198  C CB  . PHE A  1 159 ? 27.826  -4.846  36.697  1.00 14.90  ? 1177 PHE A CB  1 
ATOM   1199  C CG  . PHE A  1 159 ? 28.613  -4.730  35.419  1.00 15.18  ? 1177 PHE A CG  1 
ATOM   1200  C CD1 . PHE A  1 159 ? 29.928  -4.269  35.438  1.00 13.11  ? 1177 PHE A CD1 1 
ATOM   1201  C CD2 . PHE A  1 159 ? 28.076  -5.184  34.212  1.00 13.10  ? 1177 PHE A CD2 1 
ATOM   1202  C CE1 . PHE A  1 159 ? 30.707  -4.269  34.267  1.00 14.78  ? 1177 PHE A CE1 1 
ATOM   1203  C CE2 . PHE A  1 159 ? 28.842  -5.189  33.039  1.00 13.54  ? 1177 PHE A CE2 1 
ATOM   1204  C CZ  . PHE A  1 159 ? 30.162  -4.731  33.071  1.00 12.63  ? 1177 PHE A CZ  1 
ATOM   1205  N N   . PHE A  1 160 ? 26.913  -7.195  39.310  1.00 18.61  ? 1178 PHE A N   1 
ATOM   1206  C CA  . PHE A  1 160 ? 26.383  -7.194  40.668  1.00 18.03  ? 1178 PHE A CA  1 
ATOM   1207  C C   . PHE A  1 160 ? 27.532  -7.019  41.655  1.00 18.70  ? 1178 PHE A C   1 
ATOM   1208  O O   . PHE A  1 160 ? 28.505  -7.773  41.625  1.00 17.79  ? 1178 PHE A O   1 
ATOM   1209  C CB  . PHE A  1 160 ? 25.637  -8.494  40.978  1.00 17.93  ? 1178 PHE A CB  1 
ATOM   1210  C CG  . PHE A  1 160 ? 25.175  -8.591  42.414  1.00 19.43  ? 1178 PHE A CG  1 
ATOM   1211  C CD1 . PHE A  1 160 ? 25.922  -9.295  43.356  1.00 18.37  ? 1178 PHE A CD1 1 
ATOM   1212  C CD2 . PHE A  1 160 ? 24.017  -7.936  42.831  1.00 18.05  ? 1178 PHE A CD2 1 
ATOM   1213  C CE1 . PHE A  1 160 ? 25.527  -9.345  44.699  1.00 20.44  ? 1178 PHE A CE1 1 
ATOM   1214  C CE2 . PHE A  1 160 ? 23.612  -7.977  44.173  1.00 19.19  ? 1178 PHE A CE2 1 
ATOM   1215  C CZ  . PHE A  1 160 ? 24.371  -8.683  45.107  1.00 19.15  ? 1178 PHE A CZ  1 
ATOM   1216  N N   . SER A  1 161 ? 27.407  -6.020  42.529  1.00 17.36  ? 1179 SER A N   1 
ATOM   1217  C CA  . SER A  1 161 ? 28.423  -5.728  43.528  1.00 17.75  ? 1179 SER A CA  1 
ATOM   1218  C C   . SER A  1 161 ? 27.840  -5.450  44.920  1.00 17.44  ? 1179 SER A C   1 
ATOM   1219  O O   . SER A  1 161 ? 26.817  -4.777  45.055  1.00 15.83  ? 1179 SER A O   1 
ATOM   1220  C CB  . SER A  1 161 ? 29.243  -4.509  43.095  1.00 18.30  ? 1179 SER A CB  1 
ATOM   1221  O OG  . SER A  1 161 ? 30.196  -4.167  44.087  1.00 16.46  ? 1179 SER A OG  1 
ATOM   1222  N N   . THR A  1 162 ? 28.503  -5.968  45.945  1.00 17.54  ? 1180 THR A N   1 
ATOM   1223  C CA  . THR A  1 162 ? 28.078  -5.744  47.319  1.00 20.06  ? 1180 THR A CA  1 
ATOM   1224  C C   . THR A  1 162 ? 29.021  -4.715  47.920  1.00 22.91  ? 1180 THR A C   1 
ATOM   1225  O O   . THR A  1 162 ? 28.918  -4.369  49.095  1.00 24.16  ? 1180 THR A O   1 
ATOM   1226  C CB  . THR A  1 162 ? 28.164  -7.020  48.168  1.00 18.77  ? 1180 THR A CB  1 
ATOM   1227  O OG1 . THR A  1 162 ? 29.477  -7.583  48.050  1.00 20.42  ? 1180 THR A OG1 1 
ATOM   1228  C CG2 . THR A  1 162 ? 27.117  -8.032  47.725  1.00 18.04  ? 1180 THR A CG2 1 
ATOM   1229  N N   . GLY A  1 163 ? 29.955  -4.237  47.106  1.00 21.93  ? 1181 GLY A N   1 
ATOM   1230  C CA  . GLY A  1 163 ? 30.899  -3.250  47.590  1.00 25.91  ? 1181 GLY A CA  1 
ATOM   1231  C C   . GLY A  1 163 ? 31.991  -3.822  48.476  1.00 26.80  ? 1181 GLY A C   1 
ATOM   1232  O O   . GLY A  1 163 ? 32.722  -3.069  49.113  1.00 27.84  ? 1181 GLY A O   1 
ATOM   1233  N N   . ASP A  1 164 ? 32.117  -5.143  48.530  1.00 26.04  ? 1182 ASP A N   1 
ATOM   1234  C CA  . ASP A  1 164 ? 33.156  -5.741  49.354  1.00 26.26  ? 1182 ASP A CA  1 
ATOM   1235  C C   . ASP A  1 164 ? 33.717  -7.016  48.739  1.00 24.67  ? 1182 ASP A C   1 
ATOM   1236  O O   . ASP A  1 164 ? 33.396  -7.357  47.599  1.00 24.51  ? 1182 ASP A O   1 
ATOM   1237  C CB  . ASP A  1 164 ? 32.640  -5.987  50.782  1.00 28.71  ? 1182 ASP A CB  1 
ATOM   1238  C CG  . ASP A  1 164 ? 31.499  -6.981  50.840  1.00 30.92  ? 1182 ASP A CG  1 
ATOM   1239  O OD1 . ASP A  1 164 ? 30.784  -6.981  51.867  1.00 31.24  ? 1182 ASP A OD1 1 
ATOM   1240  O OD2 . ASP A  1 164 ? 31.322  -7.764  49.878  1.00 31.37  ? 1182 ASP A OD2 1 
ATOM   1241  N N   . GLU A  1 165 ? 34.542  -7.731  49.493  1.00 23.31  ? 1183 GLU A N   1 
ATOM   1242  C CA  . GLU A  1 165 ? 35.183  -8.930  48.962  1.00 23.53  ? 1183 GLU A CA  1 
ATOM   1243  C C   . GLU A  1 165 ? 34.286  -10.105 48.562  1.00 24.19  ? 1183 GLU A C   1 
ATOM   1244  O O   . GLU A  1 165 ? 34.715  -10.986 47.816  1.00 23.75  ? 1183 GLU A O   1 
ATOM   1245  C CB  . GLU A  1 165 ? 36.275  -9.417  49.924  1.00 24.58  ? 1183 GLU A CB  1 
ATOM   1246  C CG  . GLU A  1 165 ? 35.813  -10.130 51.193  1.00 25.90  ? 1183 GLU A CG  1 
ATOM   1247  C CD  . GLU A  1 165 ? 35.380  -9.189  52.305  1.00 27.15  ? 1183 GLU A CD  1 
ATOM   1248  O OE1 . GLU A  1 165 ? 35.262  -9.666  53.453  1.00 27.60  ? 1183 GLU A OE1 1 
ATOM   1249  O OE2 . GLU A  1 165 ? 35.149  -7.988  52.046  1.00 26.39  ? 1183 GLU A OE2 1 
ATOM   1250  N N   . HIS A  1 166 ? 33.047  -10.125 49.037  1.00 23.46  ? 1184 HIS A N   1 
ATOM   1251  C CA  . HIS A  1 166 ? 32.148  -11.218 48.696  1.00 24.42  ? 1184 HIS A CA  1 
ATOM   1252  C C   . HIS A  1 166 ? 31.621  -11.143 47.262  1.00 24.94  ? 1184 HIS A C   1 
ATOM   1253  O O   . HIS A  1 166 ? 31.242  -12.160 46.673  1.00 24.73  ? 1184 HIS A O   1 
ATOM   1254  C CB  . HIS A  1 166 ? 31.025  -11.271 49.721  1.00 25.67  ? 1184 HIS A CB  1 
ATOM   1255  C CG  . HIS A  1 166 ? 31.524  -11.531 51.108  1.00 26.92  ? 1184 HIS A CG  1 
ATOM   1256  N ND1 . HIS A  1 166 ? 31.439  -10.607 52.128  1.00 28.68  ? 1184 HIS A ND1 1 
ATOM   1257  C CD2 . HIS A  1 166 ? 32.191  -12.594 51.618  1.00 25.89  ? 1184 HIS A CD2 1 
ATOM   1258  C CE1 . HIS A  1 166 ? 32.034  -11.089 53.207  1.00 27.17  ? 1184 HIS A CE1 1 
ATOM   1259  N NE2 . HIS A  1 166 ? 32.498  -12.292 52.923  1.00 28.72  ? 1184 HIS A NE2 1 
ATOM   1260  N N   . SER A  1 167 ? 31.620  -9.932  46.710  1.00 22.58  ? 1185 SER A N   1 
ATOM   1261  C CA  . SER A  1 167 ? 31.211  -9.688  45.331  1.00 20.02  ? 1185 SER A CA  1 
ATOM   1262  C C   . SER A  1 167 ? 31.698  -8.300  44.921  1.00 18.50  ? 1185 SER A C   1 
ATOM   1263  O O   . SER A  1 167 ? 30.922  -7.350  44.866  1.00 16.54  ? 1185 SER A O   1 
ATOM   1264  C CB  . SER A  1 167 ? 29.693  -9.772  45.177  1.00 19.68  ? 1185 SER A CB  1 
ATOM   1265  O OG  . SER A  1 167 ? 29.334  -9.733  43.804  1.00 21.98  ? 1185 SER A OG  1 
ATOM   1266  N N   . ARG A  1 168 ? 32.992  -8.201  44.629  1.00 17.50  ? 1186 ARG A N   1 
ATOM   1267  C CA  . ARG A  1 168 ? 33.609  -6.937  44.239  1.00 18.22  ? 1186 ARG A CA  1 
ATOM   1268  C C   . ARG A  1 168 ? 32.921  -6.231  43.088  1.00 16.73  ? 1186 ARG A C   1 
ATOM   1269  O O   . ARG A  1 168 ? 32.779  -5.012  43.104  1.00 16.47  ? 1186 ARG A O   1 
ATOM   1270  C CB  . ARG A  1 168 ? 35.076  -7.154  43.871  1.00 19.27  ? 1186 ARG A CB  1 
ATOM   1271  C CG  . ARG A  1 168 ? 36.018  -7.256  45.057  1.00 19.96  ? 1186 ARG A CG  1 
ATOM   1272  C CD  . ARG A  1 168 ? 37.453  -7.169  44.581  1.00 21.61  ? 1186 ARG A CD  1 
ATOM   1273  N NE  . ARG A  1 168 ? 38.390  -6.986  45.682  1.00 23.65  ? 1186 ARG A NE  1 
ATOM   1274  C CZ  . ARG A  1 168 ? 38.779  -7.951  46.505  1.00 24.09  ? 1186 ARG A CZ  1 
ATOM   1275  N NH1 . ARG A  1 168 ? 38.315  -9.188  46.354  1.00 25.47  ? 1186 ARG A NH1 1 
ATOM   1276  N NH2 . ARG A  1 168 ? 39.629  -7.675  47.486  1.00 24.84  ? 1186 ARG A NH2 1 
ATOM   1277  N N   . GLY A  1 169 ? 32.508  -6.997  42.084  1.00 15.59  ? 1187 GLY A N   1 
ATOM   1278  C CA  . GLY A  1 169 ? 31.847  -6.405  40.934  1.00 15.15  ? 1187 GLY A CA  1 
ATOM   1279  C C   . GLY A  1 169 ? 32.741  -6.378  39.706  1.00 13.24  ? 1187 GLY A C   1 
ATOM   1280  O O   . GLY A  1 169 ? 33.824  -6.965  39.707  1.00 15.65  ? 1187 GLY A O   1 
ATOM   1281  N N   . ASN A  1 170 ? 32.281  -5.699  38.657  1.00 13.86  ? 1188 ASN A N   1 
ATOM   1282  C CA  . ASN A  1 170 ? 33.035  -5.564  37.409  1.00 13.69  ? 1188 ASN A CA  1 
ATOM   1283  C C   . ASN A  1 170 ? 33.381  -6.874  36.697  1.00 14.77  ? 1188 ASN A C   1 
ATOM   1284  O O   . ASN A  1 170 ? 34.375  -6.948  35.964  1.00 15.57  ? 1188 ASN A O   1 
ATOM   1285  C CB  . ASN A  1 170 ? 34.329  -4.782  37.665  1.00 12.70  ? 1188 ASN A CB  1 
ATOM   1286  C CG  . ASN A  1 170 ? 34.071  -3.356  38.083  1.00 14.65  ? 1188 ASN A CG  1 
ATOM   1287  O OD1 . ASN A  1 170 ? 33.038  -2.775  37.745  1.00 17.88  ? 1188 ASN A OD1 1 
ATOM   1288  N ND2 . ASN A  1 170 ? 35.016  -2.772  38.808  1.00 17.15  ? 1188 ASN A ND2 1 
ATOM   1289  N N   . TRP A  1 171 ? 32.558  -7.899  36.892  1.00 14.19  ? 1189 TRP A N   1 
ATOM   1290  C CA  . TRP A  1 171 ? 32.803  -9.191  36.267  1.00 12.97  ? 1189 TRP A CA  1 
ATOM   1291  C C   . TRP A  1 171 ? 32.906  -9.060  34.744  1.00 13.24  ? 1189 TRP A C   1 
ATOM   1292  O O   . TRP A  1 171 ? 33.723  -9.730  34.121  1.00 13.03  ? 1189 TRP A O   1 
ATOM   1293  C CB  . TRP A  1 171 ? 31.679  -10.167 36.645  1.00 13.99  ? 1189 TRP A CB  1 
ATOM   1294  C CG  . TRP A  1 171 ? 31.367  -10.112 38.127  1.00 13.15  ? 1189 TRP A CG  1 
ATOM   1295  C CD1 . TRP A  1 171 ? 30.187  -9.723  38.706  1.00 16.23  ? 1189 TRP A CD1 1 
ATOM   1296  C CD2 . TRP A  1 171 ? 32.274  -10.374 39.201  1.00 14.03  ? 1189 TRP A CD2 1 
ATOM   1297  N NE1 . TRP A  1 171 ? 30.310  -9.723  40.079  1.00 15.46  ? 1189 TRP A NE1 1 
ATOM   1298  C CE2 . TRP A  1 171 ? 31.581  -10.118 40.409  1.00 13.62  ? 1189 TRP A CE2 1 
ATOM   1299  C CE3 . TRP A  1 171 ? 33.610  -10.799 39.264  1.00 13.34  ? 1189 TRP A CE3 1 
ATOM   1300  C CZ2 . TRP A  1 171 ? 32.178  -10.272 41.661  1.00 14.91  ? 1189 TRP A CZ2 1 
ATOM   1301  C CZ3 . TRP A  1 171 ? 34.203  -10.953 40.507  1.00 15.76  ? 1189 TRP A CZ3 1 
ATOM   1302  C CH2 . TRP A  1 171 ? 33.486  -10.689 41.693  1.00 17.46  ? 1189 TRP A CH2 1 
ATOM   1303  N N   . GLY A  1 172 ? 32.081  -8.193  34.159  1.00 11.40  ? 1190 GLY A N   1 
ATOM   1304  C CA  . GLY A  1 172 ? 32.091  -8.002  32.716  1.00 13.38  ? 1190 GLY A CA  1 
ATOM   1305  C C   . GLY A  1 172 ? 33.384  -7.378  32.209  1.00 14.77  ? 1190 GLY A C   1 
ATOM   1306  O O   . GLY A  1 172 ? 33.819  -7.644  31.086  1.00 13.40  ? 1190 GLY A O   1 
ATOM   1307  N N   . HIS A  1 173 ? 33.999  -6.528  33.023  1.00 15.24  ? 1191 HIS A N   1 
ATOM   1308  C CA  . HIS A  1 173 ? 35.253  -5.913  32.615  1.00 14.98  ? 1191 HIS A CA  1 
ATOM   1309  C C   . HIS A  1 173 ? 36.367  -6.951  32.722  1.00 16.17  ? 1191 HIS A C   1 
ATOM   1310  O O   . HIS A  1 173 ? 37.265  -6.991  31.878  1.00 15.80  ? 1191 HIS A O   1 
ATOM   1311  C CB  . HIS A  1 173 ? 35.571  -4.692  33.473  1.00 15.07  ? 1191 HIS A CB  1 
ATOM   1312  C CG  . HIS A  1 173 ? 34.627  -3.551  33.265  1.00 16.16  ? 1191 HIS A CG  1 
ATOM   1313  N ND1 . HIS A  1 173 ? 34.276  -3.098  32.010  1.00 16.37  ? 1191 HIS A ND1 1 
ATOM   1314  C CD2 . HIS A  1 173 ? 33.993  -2.741  34.146  1.00 15.07  ? 1191 HIS A CD2 1 
ATOM   1315  C CE1 . HIS A  1 173 ? 33.471  -2.058  32.128  1.00 16.74  ? 1191 HIS A CE1 1 
ATOM   1316  N NE2 . HIS A  1 173 ? 33.284  -1.819  33.415  1.00 16.78  ? 1191 HIS A NE2 1 
ATOM   1317  N N   . LEU A  1 174 ? 36.304  -7.796  33.751  1.00 14.33  ? 1192 LEU A N   1 
ATOM   1318  C CA  . LEU A  1 174 ? 37.304  -8.844  33.915  1.00 12.57  ? 1192 LEU A CA  1 
ATOM   1319  C C   . LEU A  1 174 ? 37.184  -9.809  32.738  1.00 13.50  ? 1192 LEU A C   1 
ATOM   1320  O O   . LEU A  1 174 ? 38.176  -10.407 32.331  1.00 11.37  ? 1192 LEU A O   1 
ATOM   1321  C CB  . LEU A  1 174 ? 37.113  -9.606  35.237  1.00 11.98  ? 1192 LEU A CB  1 
ATOM   1322  C CG  . LEU A  1 174 ? 37.347  -8.780  36.510  1.00 14.82  ? 1192 LEU A CG  1 
ATOM   1323  C CD1 . LEU A  1 174 ? 37.181  -9.661  37.750  1.00 14.72  ? 1192 LEU A CD1 1 
ATOM   1324  C CD2 . LEU A  1 174 ? 38.752  -8.172  36.481  1.00 15.67  ? 1192 LEU A CD2 1 
ATOM   1325  N N   . ASP A  1 175 ? 35.975  -9.966  32.197  1.00 12.66  ? 1193 ASP A N   1 
ATOM   1326  C CA  . ASP A  1 175 ? 35.778  -10.842 31.038  1.00 14.15  ? 1193 ASP A CA  1 
ATOM   1327  C C   . ASP A  1 175 ? 36.456  -10.194 29.825  1.00 12.23  ? 1193 ASP A C   1 
ATOM   1328  O O   . ASP A  1 175 ? 37.058  -10.874 29.007  1.00 12.59  ? 1193 ASP A O   1 
ATOM   1329  C CB  . ASP A  1 175 ? 34.291  -11.039 30.714  1.00 12.79  ? 1193 ASP A CB  1 
ATOM   1330  C CG  . ASP A  1 175 ? 33.536  -11.806 31.797  1.00 16.21  ? 1193 ASP A CG  1 
ATOM   1331  O OD1 . ASP A  1 175 ? 34.153  -12.629 32.511  1.00 15.77  ? 1193 ASP A OD1 1 
ATOM   1332  O OD2 . ASP A  1 175 ? 32.309  -11.594 31.911  1.00 13.16  ? 1193 ASP A OD2 1 
ATOM   1333  N N   . GLN A  1 176 ? 36.341  -8.872  29.713  1.00 13.00  ? 1194 GLN A N   1 
ATOM   1334  C CA  . GLN A  1 176 ? 36.968  -8.147  28.612  1.00 10.92  ? 1194 GLN A CA  1 
ATOM   1335  C C   . GLN A  1 176 ? 38.485  -8.344  28.730  1.00 12.96  ? 1194 GLN A C   1 
ATOM   1336  O O   . GLN A  1 176 ? 39.170  -8.576  27.733  1.00 12.82  ? 1194 GLN A O   1 
ATOM   1337  C CB  . GLN A  1 176 ? 36.590  -6.657  28.675  1.00 9.79   ? 1194 GLN A CB  1 
ATOM   1338  C CG  . GLN A  1 176 ? 35.084  -6.409  28.458  1.00 11.51  ? 1194 GLN A CG  1 
ATOM   1339  C CD  . GLN A  1 176 ? 34.638  -5.010  28.856  1.00 11.90  ? 1194 GLN A CD  1 
ATOM   1340  O OE1 . GLN A  1 176 ? 35.368  -4.284  29.526  1.00 14.36  ? 1194 GLN A OE1 1 
ATOM   1341  N NE2 . GLN A  1 176 ? 33.421  -4.637  28.459  1.00 11.43  ? 1194 GLN A NE2 1 
ATOM   1342  N N   . VAL A  1 177 ? 39.009  -8.270  29.949  1.00 11.41  ? 1195 VAL A N   1 
ATOM   1343  C CA  . VAL A  1 177 ? 40.439  -8.469  30.160  1.00 13.07  ? 1195 VAL A CA  1 
ATOM   1344  C C   . VAL A  1 177 ? 40.839  -9.905  29.802  1.00 14.55  ? 1195 VAL A C   1 
ATOM   1345  O O   . VAL A  1 177 ? 41.900  -10.135 29.223  1.00 16.46  ? 1195 VAL A O   1 
ATOM   1346  C CB  . VAL A  1 177 ? 40.834  -8.172  31.623  1.00 14.39  ? 1195 VAL A CB  1 
ATOM   1347  C CG1 . VAL A  1 177 ? 42.257  -8.661  31.897  1.00 16.35  ? 1195 VAL A CG1 1 
ATOM   1348  C CG2 . VAL A  1 177 ? 40.749  -6.667  31.883  1.00 12.75  ? 1195 VAL A CG2 1 
ATOM   1349  N N   . ALA A  1 178 ? 39.982  -10.869 30.132  1.00 14.45  ? 1196 ALA A N   1 
ATOM   1350  C CA  . ALA A  1 178 ? 40.262  -12.270 29.828  1.00 13.24  ? 1196 ALA A CA  1 
ATOM   1351  C C   . ALA A  1 178 ? 40.303  -12.479 28.312  1.00 14.07  ? 1196 ALA A C   1 
ATOM   1352  O O   . ALA A  1 178 ? 41.157  -13.207 27.800  1.00 13.87  ? 1196 ALA A O   1 
ATOM   1353  C CB  . ALA A  1 178 ? 39.197  -13.170 30.452  1.00 12.19  ? 1196 ALA A CB  1 
ATOM   1354  N N   . ALA A  1 179 ? 39.377  -11.850 27.595  1.00 12.26  ? 1197 ALA A N   1 
ATOM   1355  C CA  . ALA A  1 179 ? 39.351  -11.976 26.134  1.00 13.94  ? 1197 ALA A CA  1 
ATOM   1356  C C   . ALA A  1 179 ? 40.633  -11.399 25.519  1.00 14.77  ? 1197 ALA A C   1 
ATOM   1357  O O   . ALA A  1 179 ? 41.144  -11.936 24.533  1.00 15.41  ? 1197 ALA A O   1 
ATOM   1358  C CB  . ALA A  1 179 ? 38.126  -11.270 25.560  1.00 12.59  ? 1197 ALA A CB  1 
ATOM   1359  N N   . LEU A  1 180 ? 41.140  -10.307 26.093  1.00 14.07  ? 1198 LEU A N   1 
ATOM   1360  C CA  . LEU A  1 180 ? 42.372  -9.687  25.598  1.00 16.49  ? 1198 LEU A CA  1 
ATOM   1361  C C   . LEU A  1 180 ? 43.568  -10.599 25.864  1.00 16.88  ? 1198 LEU A C   1 
ATOM   1362  O O   . LEU A  1 180 ? 44.474  -10.693 25.039  1.00 17.59  ? 1198 LEU A O   1 
ATOM   1363  C CB  . LEU A  1 180 ? 42.610  -8.320  26.254  1.00 15.16  ? 1198 LEU A CB  1 
ATOM   1364  C CG  . LEU A  1 180 ? 41.658  -7.192  25.836  1.00 16.60  ? 1198 LEU A CG  1 
ATOM   1365  C CD1 . LEU A  1 180 ? 42.044  -5.910  26.565  1.00 18.10  ? 1198 LEU A CD1 1 
ATOM   1366  C CD2 . LEU A  1 180 ? 41.726  -6.984  24.325  1.00 17.09  ? 1198 LEU A CD2 1 
ATOM   1367  N N   . ARG A  1 181 ? 43.577  -11.257 27.021  1.00 17.32  ? 1199 ARG A N   1 
ATOM   1368  C CA  . ARG A  1 181 ? 44.657  -12.185 27.346  1.00 17.61  ? 1199 ARG A CA  1 
ATOM   1369  C C   . ARG A  1 181 ? 44.600  -13.338 26.361  1.00 16.52  ? 1199 ARG A C   1 
ATOM   1370  O O   . ARG A  1 181 ? 45.632  -13.871 25.954  1.00 18.83  ? 1199 ARG A O   1 
ATOM   1371  C CB  . ARG A  1 181 ? 44.514  -12.724 28.776  1.00 20.88  ? 1199 ARG A CB  1 
ATOM   1372  C CG  . ARG A  1 181 ? 44.789  -11.673 29.837  1.00 27.98  ? 1199 ARG A CG  1 
ATOM   1373  C CD  . ARG A  1 181 ? 44.944  -12.278 31.225  1.00 33.23  ? 1199 ARG A CD  1 
ATOM   1374  N NE  . ARG A  1 181 ? 45.726  -11.399 32.087  1.00 36.68  ? 1199 ARG A NE  1 
ATOM   1375  C CZ  . ARG A  1 181 ? 47.012  -11.119 31.887  1.00 40.04  ? 1199 ARG A CZ  1 
ATOM   1376  N NH1 . ARG A  1 181 ? 47.656  -11.655 30.857  1.00 40.68  ? 1199 ARG A NH1 1 
ATOM   1377  N NH2 . ARG A  1 181 ? 47.655  -10.295 32.706  1.00 41.69  ? 1199 ARG A NH2 1 
ATOM   1378  N N   . TRP A  1 182 ? 43.390  -13.727 25.977  1.00 15.20  ? 1200 TRP A N   1 
ATOM   1379  C CA  . TRP A  1 182 ? 43.229  -14.818 25.031  1.00 14.55  ? 1200 TRP A CA  1 
ATOM   1380  C C   . TRP A  1 182 ? 43.817  -14.398 23.680  1.00 15.39  ? 1200 TRP A C   1 
ATOM   1381  O O   . TRP A  1 182 ? 44.502  -15.177 23.023  1.00 14.30  ? 1200 TRP A O   1 
ATOM   1382  C CB  . TRP A  1 182 ? 41.752  -15.172 24.847  1.00 13.26  ? 1200 TRP A CB  1 
ATOM   1383  C CG  . TRP A  1 182 ? 41.544  -16.388 23.982  1.00 13.22  ? 1200 TRP A CG  1 
ATOM   1384  C CD1 . TRP A  1 182 ? 41.445  -17.685 24.398  1.00 13.25  ? 1200 TRP A CD1 1 
ATOM   1385  C CD2 . TRP A  1 182 ? 41.473  -16.419 22.551  1.00 12.95  ? 1200 TRP A CD2 1 
ATOM   1386  N NE1 . TRP A  1 182 ? 41.320  -18.522 23.314  1.00 16.00  ? 1200 TRP A NE1 1 
ATOM   1387  C CE2 . TRP A  1 182 ? 41.336  -17.770 22.169  1.00 13.41  ? 1200 TRP A CE2 1 
ATOM   1388  C CE3 . TRP A  1 182 ? 41.516  -15.433 21.556  1.00 13.35  ? 1200 TRP A CE3 1 
ATOM   1389  C CZ2 . TRP A  1 182 ? 41.241  -18.165 20.829  1.00 14.98  ? 1200 TRP A CZ2 1 
ATOM   1390  C CZ3 . TRP A  1 182 ? 41.423  -15.824 20.225  1.00 12.80  ? 1200 TRP A CZ3 1 
ATOM   1391  C CH2 . TRP A  1 182 ? 41.287  -17.183 19.876  1.00 15.25  ? 1200 TRP A CH2 1 
ATOM   1392  N N   . VAL A  1 183 ? 43.543  -13.164 23.272  1.00 14.49  ? 1201 VAL A N   1 
ATOM   1393  C CA  . VAL A  1 183 ? 44.050  -12.664 22.000  1.00 15.08  ? 1201 VAL A CA  1 
ATOM   1394  C C   . VAL A  1 183 ? 45.574  -12.682 22.016  1.00 15.46  ? 1201 VAL A C   1 
ATOM   1395  O O   . VAL A  1 183 ? 46.200  -13.064 21.033  1.00 15.32  ? 1201 VAL A O   1 
ATOM   1396  C CB  . VAL A  1 183 ? 43.529  -11.231 21.714  1.00 13.75  ? 1201 VAL A CB  1 
ATOM   1397  C CG1 . VAL A  1 183 ? 44.281  -10.610 20.521  1.00 15.56  ? 1201 VAL A CG1 1 
ATOM   1398  C CG2 . VAL A  1 183 ? 42.037  -11.287 21.406  1.00 10.68  ? 1201 VAL A CG2 1 
ATOM   1399  N N   . GLN A  1 184 ? 46.167  -12.290 23.140  1.00 17.59  ? 1202 GLN A N   1 
ATOM   1400  C CA  . GLN A  1 184 ? 47.621  -12.282 23.264  1.00 19.58  ? 1202 GLN A CA  1 
ATOM   1401  C C   . GLN A  1 184 ? 48.201  -13.678 23.055  1.00 21.47  ? 1202 GLN A C   1 
ATOM   1402  O O   . GLN A  1 184 ? 49.179  -13.853 22.329  1.00 21.29  ? 1202 GLN A O   1 
ATOM   1403  C CB  . GLN A  1 184 ? 48.041  -11.764 24.642  1.00 21.56  ? 1202 GLN A CB  1 
ATOM   1404  C CG  . GLN A  1 184 ? 48.030  -10.256 24.759  1.00 25.14  ? 1202 GLN A CG  1 
ATOM   1405  C CD  . GLN A  1 184 ? 48.958  -9.604  23.749  1.00 27.41  ? 1202 GLN A CD  1 
ATOM   1406  O OE1 . GLN A  1 184 ? 50.153  -9.896  23.713  1.00 28.75  ? 1202 GLN A OE1 1 
ATOM   1407  N NE2 . GLN A  1 184 ? 48.411  -8.726  22.920  1.00 26.38  ? 1202 GLN A NE2 1 
ATOM   1408  N N   . ASP A  1 185 ? 47.577  -14.670 23.676  1.00 20.83  ? 1203 ASP A N   1 
ATOM   1409  C CA  . ASP A  1 185 ? 48.055  -16.046 23.584  1.00 21.37  ? 1203 ASP A CA  1 
ATOM   1410  C C   . ASP A  1 185 ? 47.696  -16.826 22.313  1.00 19.33  ? 1203 ASP A C   1 
ATOM   1411  O O   . ASP A  1 185 ? 48.357  -17.815 22.000  1.00 19.91  ? 1203 ASP A O   1 
ATOM   1412  C CB  . ASP A  1 185 ? 47.560  -16.855 24.791  1.00 22.80  ? 1203 ASP A CB  1 
ATOM   1413  C CG  . ASP A  1 185 ? 47.893  -16.199 26.124  1.00 28.63  ? 1203 ASP A CG  1 
ATOM   1414  O OD1 . ASP A  1 185 ? 48.899  -15.461 26.209  1.00 31.54  ? 1203 ASP A OD1 1 
ATOM   1415  O OD2 . ASP A  1 185 ? 47.148  -16.438 27.100  1.00 31.34  ? 1203 ASP A OD2 1 
ATOM   1416  N N   . ASN A  1 186 ? 46.687  -16.378 21.569  1.00 17.06  ? 1204 ASN A N   1 
ATOM   1417  C CA  . ASN A  1 186 ? 46.235  -17.117 20.390  1.00 17.77  ? 1204 ASN A CA  1 
ATOM   1418  C C   . ASN A  1 186 ? 46.136  -16.420 19.039  1.00 18.14  ? 1204 ASN A C   1 
ATOM   1419  O O   . ASN A  1 186 ? 46.102  -17.090 18.007  1.00 17.29  ? 1204 ASN A O   1 
ATOM   1420  C CB  . ASN A  1 186 ? 44.845  -17.707 20.672  1.00 17.45  ? 1204 ASN A CB  1 
ATOM   1421  C CG  . ASN A  1 186 ? 44.849  -18.714 21.803  1.00 22.87  ? 1204 ASN A CG  1 
ATOM   1422  O OD1 . ASN A  1 186 ? 45.115  -19.897 21.587  1.00 22.74  ? 1204 ASN A OD1 1 
ATOM   1423  N ND2 . ASN A  1 186 ? 44.562  -18.248 23.021  1.00 17.39  ? 1204 ASN A ND2 1 
ATOM   1424  N N   . ILE A  1 187 ? 46.079  -15.095 19.022  1.00 17.12  ? 1205 ILE A N   1 
ATOM   1425  C CA  . ILE A  1 187 ? 45.869  -14.406 17.759  1.00 17.24  ? 1205 ILE A CA  1 
ATOM   1426  C C   . ILE A  1 187 ? 46.864  -14.675 16.628  1.00 18.47  ? 1205 ILE A C   1 
ATOM   1427  O O   . ILE A  1 187 ? 46.503  -14.586 15.452  1.00 16.40  ? 1205 ILE A O   1 
ATOM   1428  C CB  . ILE A  1 187 ? 45.696  -12.883 17.991  1.00 16.39  ? 1205 ILE A CB  1 
ATOM   1429  C CG1 . ILE A  1 187 ? 44.775  -12.314 16.912  1.00 14.78  ? 1205 ILE A CG1 1 
ATOM   1430  C CG2 . ILE A  1 187 ? 47.038  -12.181 17.996  1.00 14.41  ? 1205 ILE A CG2 1 
ATOM   1431  C CD1 . ILE A  1 187 ? 43.389  -12.948 16.888  1.00 13.58  ? 1205 ILE A CD1 1 
ATOM   1432  N N   . ALA A  1 188 ? 48.097  -15.035 16.972  1.00 21.62  ? 1206 ALA A N   1 
ATOM   1433  C CA  . ALA A  1 188 ? 49.105  -15.323 15.957  1.00 21.33  ? 1206 ALA A CA  1 
ATOM   1434  C C   . ALA A  1 188 ? 48.643  -16.450 15.036  1.00 22.65  ? 1206 ALA A C   1 
ATOM   1435  O O   . ALA A  1 188 ? 48.956  -16.455 13.843  1.00 23.71  ? 1206 ALA A O   1 
ATOM   1436  C CB  . ALA A  1 188 ? 50.423  -15.696 16.620  1.00 22.56  ? 1206 ALA A CB  1 
ATOM   1437  N N   . SER A  1 189 ? 47.887  -17.396 15.587  1.00 22.24  ? 1207 SER A N   1 
ATOM   1438  C CA  . SER A  1 189 ? 47.387  -18.530 14.815  1.00 21.22  ? 1207 SER A CA  1 
ATOM   1439  C C   . SER A  1 189 ? 46.356  -18.118 13.779  1.00 20.93  ? 1207 SER A C   1 
ATOM   1440  O O   . SER A  1 189 ? 46.052  -18.879 12.858  1.00 20.04  ? 1207 SER A O   1 
ATOM   1441  C CB  . SER A  1 189 ? 46.765  -19.570 15.747  1.00 24.16  ? 1207 SER A CB  1 
ATOM   1442  O OG  . SER A  1 189 ? 47.708  -20.015 16.701  1.00 28.38  ? 1207 SER A OG  1 
ATOM   1443  N N   . PHE A  1 190 ? 45.804  -16.919 13.934  1.00 18.09  ? 1208 PHE A N   1 
ATOM   1444  C CA  . PHE A  1 190 ? 44.807  -16.423 12.995  1.00 17.62  ? 1208 PHE A CA  1 
ATOM   1445  C C   . PHE A  1 190 ? 45.390  -15.337 12.101  1.00 17.41  ? 1208 PHE A C   1 
ATOM   1446  O O   . PHE A  1 190 ? 44.662  -14.588 11.444  1.00 16.15  ? 1208 PHE A O   1 
ATOM   1447  C CB  . PHE A  1 190 ? 43.585  -15.893 13.754  1.00 18.08  ? 1208 PHE A CB  1 
ATOM   1448  C CG  . PHE A  1 190 ? 42.849  -16.953 14.524  1.00 15.10  ? 1208 PHE A CG  1 
ATOM   1449  C CD1 . PHE A  1 190 ? 43.217  -17.273 15.827  1.00 15.97  ? 1208 PHE A CD1 1 
ATOM   1450  C CD2 . PHE A  1 190 ? 41.804  -17.652 13.934  1.00 15.31  ? 1208 PHE A CD2 1 
ATOM   1451  C CE1 . PHE A  1 190 ? 42.551  -18.279 16.534  1.00 17.57  ? 1208 PHE A CE1 1 
ATOM   1452  C CE2 . PHE A  1 190 ? 41.133  -18.660 14.630  1.00 16.58  ? 1208 PHE A CE2 1 
ATOM   1453  C CZ  . PHE A  1 190 ? 41.509  -18.972 15.933  1.00 14.76  ? 1208 PHE A CZ  1 
ATOM   1454  N N   . GLY A  1 191 ? 46.715  -15.257 12.084  1.00 18.36  ? 1209 GLY A N   1 
ATOM   1455  C CA  . GLY A  1 191 ? 47.387  -14.273 11.258  1.00 19.61  ? 1209 GLY A CA  1 
ATOM   1456  C C   . GLY A  1 191 ? 47.503  -12.907 11.897  1.00 20.27  ? 1209 GLY A C   1 
ATOM   1457  O O   . GLY A  1 191 ? 47.840  -11.936 11.228  1.00 21.74  ? 1209 GLY A O   1 
ATOM   1458  N N   . GLY A  1 192 ? 47.233  -12.826 13.197  1.00 20.47  ? 1210 GLY A N   1 
ATOM   1459  C CA  . GLY A  1 192 ? 47.315  -11.550 13.874  1.00 17.64  ? 1210 GLY A CA  1 
ATOM   1460  C C   . GLY A  1 192 ? 48.606  -11.319 14.630  1.00 18.72  ? 1210 GLY A C   1 
ATOM   1461  O O   . GLY A  1 192 ? 49.283  -12.257 15.049  1.00 20.30  ? 1210 GLY A O   1 
ATOM   1462  N N   . ASN A  1 193 ? 48.951  -10.049 14.797  1.00 18.39  ? 1211 ASN A N   1 
ATOM   1463  C CA  . ASN A  1 193 ? 50.147  -9.659  15.523  1.00 18.87  ? 1211 ASN A CA  1 
ATOM   1464  C C   . ASN A  1 193 ? 49.768  -9.320  16.968  1.00 19.68  ? 1211 ASN A C   1 
ATOM   1465  O O   . ASN A  1 193 ? 49.154  -8.285  17.228  1.00 20.73  ? 1211 ASN A O   1 
ATOM   1466  C CB  . ASN A  1 193 ? 50.785  -8.436  14.851  1.00 19.23  ? 1211 ASN A CB  1 
ATOM   1467  C CG  . ASN A  1 193 ? 52.006  -7.937  15.585  1.00 19.20  ? 1211 ASN A CG  1 
ATOM   1468  O OD1 . ASN A  1 193 ? 52.488  -8.578  16.516  1.00 21.70  ? 1211 ASN A OD1 1 
ATOM   1469  N ND2 . ASN A  1 193 ? 52.522  -6.787  15.163  1.00 19.54  ? 1211 ASN A ND2 1 
ATOM   1470  N N   . PRO A  1 194 ? 50.118  -10.198 17.926  1.00 19.60  ? 1212 PRO A N   1 
ATOM   1471  C CA  . PRO A  1 194 ? 49.782  -9.915  19.327  1.00 18.87  ? 1212 PRO A CA  1 
ATOM   1472  C C   . PRO A  1 194 ? 50.482  -8.653  19.830  1.00 19.84  ? 1212 PRO A C   1 
ATOM   1473  O O   . PRO A  1 194 ? 50.098  -8.083  20.851  1.00 19.73  ? 1212 PRO A O   1 
ATOM   1474  C CB  . PRO A  1 194 ? 50.234  -11.178 20.059  1.00 19.06  ? 1212 PRO A CB  1 
ATOM   1475  C CG  . PRO A  1 194 ? 51.349  -11.716 19.182  1.00 21.01  ? 1212 PRO A CG  1 
ATOM   1476  C CD  . PRO A  1 194 ? 50.799  -11.501 17.792  1.00 18.27  ? 1212 PRO A CD  1 
ATOM   1477  N N   . GLY A  1 195 ? 51.506  -8.219  19.098  1.00 18.94  ? 1213 GLY A N   1 
ATOM   1478  C CA  . GLY A  1 195 ? 52.235  -7.021  19.477  1.00 19.47  ? 1213 GLY A CA  1 
ATOM   1479  C C   . GLY A  1 195 ? 51.580  -5.731  18.993  1.00 21.06  ? 1213 GLY A C   1 
ATOM   1480  O O   . GLY A  1 195 ? 52.114  -4.643  19.213  1.00 22.36  ? 1213 GLY A O   1 
ATOM   1481  N N   . SER A  1 196 ? 50.429  -5.840  18.335  1.00 19.07  ? 1214 SER A N   1 
ATOM   1482  C CA  . SER A  1 196 ? 49.719  -4.659  17.841  1.00 20.07  ? 1214 SER A CA  1 
ATOM   1483  C C   . SER A  1 196 ? 48.207  -4.838  17.953  1.00 17.97  ? 1214 SER A C   1 
ATOM   1484  O O   . SER A  1 196 ? 47.520  -5.068  16.955  1.00 17.80  ? 1214 SER A O   1 
ATOM   1485  C CB  . SER A  1 196 ? 50.087  -4.380  16.382  1.00 20.49  ? 1214 SER A CB  1 
ATOM   1486  O OG  . SER A  1 196 ? 49.461  -3.185  15.939  1.00 24.15  ? 1214 SER A OG  1 
ATOM   1487  N N   . VAL A  1 197 ? 47.694  -4.724  19.174  1.00 17.46  ? 1215 VAL A N   1 
ATOM   1488  C CA  . VAL A  1 197 ? 46.268  -4.891  19.424  1.00 16.97  ? 1215 VAL A CA  1 
ATOM   1489  C C   . VAL A  1 197 ? 45.599  -3.566  19.761  1.00 16.34  ? 1215 VAL A C   1 
ATOM   1490  O O   . VAL A  1 197 ? 46.018  -2.862  20.675  1.00 17.70  ? 1215 VAL A O   1 
ATOM   1491  C CB  . VAL A  1 197 ? 46.019  -5.870  20.589  1.00 16.37  ? 1215 VAL A CB  1 
ATOM   1492  C CG1 . VAL A  1 197 ? 44.517  -5.986  20.864  1.00 17.08  ? 1215 VAL A CG1 1 
ATOM   1493  C CG2 . VAL A  1 197 ? 46.610  -7.235  20.253  1.00 17.32  ? 1215 VAL A CG2 1 
ATOM   1494  N N   . THR A  1 198 ? 44.555  -3.238  19.013  1.00 17.30  ? 1216 THR A N   1 
ATOM   1495  C CA  . THR A  1 198 ? 43.810  -2.008  19.236  1.00 15.30  ? 1216 THR A CA  1 
ATOM   1496  C C   . THR A  1 198 ? 42.440  -2.370  19.799  1.00 14.27  ? 1216 THR A C   1 
ATOM   1497  O O   . THR A  1 198 ? 41.763  -3.245  19.269  1.00 15.30  ? 1216 THR A O   1 
ATOM   1498  C CB  . THR A  1 198 ? 43.605  -1.227  17.911  1.00 15.73  ? 1216 THR A CB  1 
ATOM   1499  O OG1 . THR A  1 198 ? 44.878  -0.850  17.383  1.00 15.88  ? 1216 THR A OG1 1 
ATOM   1500  C CG2 . THR A  1 198 ? 42.762  0.045   18.136  1.00 14.67  ? 1216 THR A CG2 1 
ATOM   1501  N N   . ILE A  1 199 ? 42.040  -1.726  20.890  1.00 14.82  ? 1217 ILE A N   1 
ATOM   1502  C CA  . ILE A  1 199 ? 40.715  -1.989  21.430  1.00 13.19  ? 1217 ILE A CA  1 
ATOM   1503  C C   . ILE A  1 199 ? 39.849  -0.790  21.070  1.00 12.80  ? 1217 ILE A C   1 
ATOM   1504  O O   . ILE A  1 199 ? 40.296  0.361   21.144  1.00 12.45  ? 1217 ILE A O   1 
ATOM   1505  C CB  . ILE A  1 199 ? 40.713  -2.196  22.985  1.00 14.44  ? 1217 ILE A CB  1 
ATOM   1506  C CG1 . ILE A  1 199 ? 41.428  -1.039  23.688  1.00 12.11  ? 1217 ILE A CG1 1 
ATOM   1507  C CG2 . ILE A  1 199 ? 41.345  -3.548  23.328  1.00 14.09  ? 1217 ILE A CG2 1 
ATOM   1508  C CD1 . ILE A  1 199 ? 41.332  -1.069  25.233  1.00 16.09  ? 1217 ILE A CD1 1 
ATOM   1509  N N   . PHE A  1 200 ? 38.628  -1.060  20.626  1.00 11.84  ? 1218 PHE A N   1 
ATOM   1510  C CA  . PHE A  1 200 ? 37.709  0.011   20.290  1.00 12.40  ? 1218 PHE A CA  1 
ATOM   1511  C C   . PHE A  1 200 ? 36.305  -0.434  20.609  1.00 13.72  ? 1218 PHE A C   1 
ATOM   1512  O O   . PHE A  1 200 ? 35.999  -1.631  20.594  1.00 12.26  ? 1218 PHE A O   1 
ATOM   1513  C CB  . PHE A  1 200 ? 37.851  0.462   18.812  1.00 12.17  ? 1218 PHE A CB  1 
ATOM   1514  C CG  . PHE A  1 200 ? 37.447  -0.564  17.782  1.00 12.76  ? 1218 PHE A CG  1 
ATOM   1515  C CD1 . PHE A  1 200 ? 37.873  -1.890  17.868  1.00 14.23  ? 1218 PHE A CD1 1 
ATOM   1516  C CD2 . PHE A  1 200 ? 36.709  -0.171  16.664  1.00 15.51  ? 1218 PHE A CD2 1 
ATOM   1517  C CE1 . PHE A  1 200 ? 37.571  -2.811  16.850  1.00 13.04  ? 1218 PHE A CE1 1 
ATOM   1518  C CE2 . PHE A  1 200 ? 36.402  -1.079  15.642  1.00 15.36  ? 1218 PHE A CE2 1 
ATOM   1519  C CZ  . PHE A  1 200 ? 36.836  -2.405  15.736  1.00 15.75  ? 1218 PHE A CZ  1 
ATOM   1520  N N   . GLY A  1 201 ? 35.458  0.531   20.944  1.00 13.47  ? 1219 GLY A N   1 
ATOM   1521  C CA  . GLY A  1 201 ? 34.090  0.208   21.295  1.00 14.22  ? 1219 GLY A CA  1 
ATOM   1522  C C   . GLY A  1 201 ? 33.258  1.463   21.322  1.00 14.54  ? 1219 GLY A C   1 
ATOM   1523  O O   . GLY A  1 201 ? 33.791  2.573   21.390  1.00 13.34  ? 1219 GLY A O   1 
ATOM   1524  N N   . GLU A  1 202 ? 31.946  1.282   21.273  1.00 15.43  ? 1220 GLU A N   1 
ATOM   1525  C CA  . GLU A  1 202 ? 31.017  2.400   21.266  1.00 14.28  ? 1220 GLU A CA  1 
ATOM   1526  C C   . GLU A  1 202 ? 30.098  2.369   22.479  1.00 14.34  ? 1220 GLU A C   1 
ATOM   1527  O O   . GLU A  1 202 ? 29.658  1.297   22.917  1.00 13.70  ? 1220 GLU A O   1 
ATOM   1528  C CB  . GLU A  1 202 ? 30.195  2.367   19.977  1.00 13.71  ? 1220 GLU A CB  1 
ATOM   1529  C CG  . GLU A  1 202 ? 29.202  3.515   19.800  1.00 20.71  ? 1220 GLU A CG  1 
ATOM   1530  C CD  . GLU A  1 202 ? 27.813  3.205   20.345  1.00 22.50  ? 1220 GLU A CD  1 
ATOM   1531  O OE1 . GLU A  1 202 ? 27.551  2.038   20.725  1.00 24.02  ? 1220 GLU A OE1 1 
ATOM   1532  O OE2 . GLU A  1 202 ? 26.973  4.132   20.381  1.00 25.89  ? 1220 GLU A OE2 1 
ATOM   1533  N N   . SER A  1 203 ? 29.820  3.558   23.012  1.00 13.89  ? 1221 SER A N   1 
ATOM   1534  C CA  . SER A  1 203 ? 28.948  3.739   24.172  1.00 13.70  ? 1221 SER A CA  1 
ATOM   1535  C C   . SER A  1 203 ? 29.499  2.993   25.391  1.00 13.80  ? 1221 SER A C   1 
ATOM   1536  O O   . SER A  1 203 ? 30.614  3.279   25.826  1.00 14.93  ? 1221 SER A O   1 
ATOM   1537  C CB  . SER A  1 203 ? 27.528  3.279   23.817  1.00 14.61  ? 1221 SER A CB  1 
ATOM   1538  O OG  . SER A  1 203 ? 26.570  3.862   24.686  1.00 21.14  ? 1221 SER A OG  1 
ATOM   1539  N N   . ALA A  1 204 ? 28.737  2.054   25.959  1.00 13.92  ? 1222 ALA A N   1 
ATOM   1540  C CA  . ALA A  1 204 ? 29.237  1.304   27.115  1.00 13.42  ? 1222 ALA A CA  1 
ATOM   1541  C C   . ALA A  1 204 ? 30.529  0.598   26.696  1.00 12.28  ? 1222 ALA A C   1 
ATOM   1542  O O   . ALA A  1 204 ? 31.382  0.292   27.525  1.00 12.55  ? 1222 ALA A O   1 
ATOM   1543  C CB  . ALA A  1 204 ? 28.211  0.278   27.585  1.00 13.11  ? 1222 ALA A CB  1 
ATOM   1544  N N   . GLY A  1 205 ? 30.660  0.339   25.397  1.00 12.10  ? 1223 GLY A N   1 
ATOM   1545  C CA  . GLY A  1 205 ? 31.867  -0.295  24.899  1.00 11.08  ? 1223 GLY A CA  1 
ATOM   1546  C C   . GLY A  1 205 ? 32.992  0.726   24.926  1.00 10.69  ? 1223 GLY A C   1 
ATOM   1547  O O   . GLY A  1 205 ? 34.148  0.386   25.159  1.00 11.10  ? 1223 GLY A O   1 
ATOM   1548  N N   . GLY A  1 206 ? 32.644  1.988   24.688  1.00 12.08  ? 1224 GLY A N   1 
ATOM   1549  C CA  . GLY A  1 206 ? 33.634  3.054   24.713  1.00 11.09  ? 1224 GLY A CA  1 
ATOM   1550  C C   . GLY A  1 206 ? 34.078  3.315   26.142  1.00 13.25  ? 1224 GLY A C   1 
ATOM   1551  O O   . GLY A  1 206 ? 35.253  3.566   26.403  1.00 14.01  ? 1224 GLY A O   1 
ATOM   1552  N N   . GLU A  1 207 ? 33.133  3.261   27.079  1.00 14.32  ? 1225 GLU A N   1 
ATOM   1553  C CA  . GLU A  1 207 ? 33.457  3.458   28.490  1.00 13.54  ? 1225 GLU A CA  1 
ATOM   1554  C C   . GLU A  1 207 ? 34.346  2.302   28.956  1.00 13.40  ? 1225 GLU A C   1 
ATOM   1555  O O   . GLU A  1 207 ? 35.253  2.495   29.764  1.00 15.03  ? 1225 GLU A O   1 
ATOM   1556  C CB  . GLU A  1 207 ? 32.177  3.496   29.335  1.00 14.77  ? 1225 GLU A CB  1 
ATOM   1557  C CG  . GLU A  1 207 ? 32.422  3.670   30.829  1.00 15.28  ? 1225 GLU A CG  1 
ATOM   1558  C CD  . GLU A  1 207 ? 32.306  2.369   31.622  1.00 21.22  ? 1225 GLU A CD  1 
ATOM   1559  O OE1 . GLU A  1 207 ? 32.239  1.277   31.009  1.00 18.71  ? 1225 GLU A OE1 1 
ATOM   1560  O OE2 . GLU A  1 207 ? 32.289  2.442   32.874  1.00 20.18  ? 1225 GLU A OE2 1 
ATOM   1561  N N   . SER A  1 208 ? 34.074  1.098   28.453  1.00 12.58  ? 1226 SER A N   1 
ATOM   1562  C CA  . SER A  1 208 ? 34.875  -0.069  28.817  1.00 12.60  ? 1226 SER A CA  1 
ATOM   1563  C C   . SER A  1 208 ? 36.320  0.136   28.362  1.00 13.47  ? 1226 SER A C   1 
ATOM   1564  O O   . SER A  1 208 ? 37.260  -0.158  29.098  1.00 14.62  ? 1226 SER A O   1 
ATOM   1565  C CB  . SER A  1 208 ? 34.318  -1.341  28.167  1.00 12.01  ? 1226 SER A CB  1 
ATOM   1566  O OG  . SER A  1 208 ? 33.044  -1.676  28.691  1.00 13.79  ? 1226 SER A OG  1 
ATOM   1567  N N   . VAL A  1 209 ? 36.490  0.619   27.135  1.00 12.77  ? 1227 VAL A N   1 
ATOM   1568  C CA  . VAL A  1 209 ? 37.823  0.879   26.606  1.00 12.22  ? 1227 VAL A CA  1 
ATOM   1569  C C   . VAL A  1 209 ? 38.511  1.901   27.505  1.00 12.49  ? 1227 VAL A C   1 
ATOM   1570  O O   . VAL A  1 209 ? 39.676  1.745   27.870  1.00 12.46  ? 1227 VAL A O   1 
ATOM   1571  C CB  . VAL A  1 209 ? 37.750  1.441   25.163  1.00 12.68  ? 1227 VAL A CB  1 
ATOM   1572  C CG1 . VAL A  1 209 ? 39.066  2.123   24.793  1.00 10.88  ? 1227 VAL A CG1 1 
ATOM   1573  C CG2 . VAL A  1 209 ? 37.455  0.307   24.180  1.00 12.71  ? 1227 VAL A CG2 1 
ATOM   1574  N N   . SER A  1 210 ? 37.768  2.941   27.870  1.00 11.35  ? 1228 SER A N   1 
ATOM   1575  C CA  . SER A  1 210 ? 38.288  4.002   28.718  1.00 12.87  ? 1228 SER A CA  1 
ATOM   1576  C C   . SER A  1 210 ? 38.711  3.467   30.086  1.00 13.60  ? 1228 SER A C   1 
ATOM   1577  O O   . SER A  1 210 ? 39.714  3.907   30.654  1.00 13.78  ? 1228 SER A O   1 
ATOM   1578  C CB  . SER A  1 210 ? 37.230  5.099   28.868  1.00 12.69  ? 1228 SER A CB  1 
ATOM   1579  O OG  . SER A  1 210 ? 37.746  6.203   29.582  1.00 18.14  ? 1228 SER A OG  1 
ATOM   1580  N N   . VAL A  1 211 ? 37.956  2.506   30.606  1.00 14.96  ? 1229 VAL A N   1 
ATOM   1581  C CA  . VAL A  1 211 ? 38.282  1.893   31.891  1.00 15.25  ? 1229 VAL A CA  1 
ATOM   1582  C C   . VAL A  1 211 ? 39.529  1.011   31.746  1.00 14.60  ? 1229 VAL A C   1 
ATOM   1583  O O   . VAL A  1 211 ? 40.405  1.026   32.607  1.00 14.69  ? 1229 VAL A O   1 
ATOM   1584  C CB  . VAL A  1 211 ? 37.097  1.039   32.424  1.00 16.77  ? 1229 VAL A CB  1 
ATOM   1585  C CG1 . VAL A  1 211 ? 37.550  0.161   33.582  1.00 18.10  ? 1229 VAL A CG1 1 
ATOM   1586  C CG2 . VAL A  1 211 ? 35.971  1.957   32.889  1.00 16.10  ? 1229 VAL A CG2 1 
ATOM   1587  N N   . LEU A  1 212 ? 39.624  0.255   30.653  1.00 14.96  ? 1230 LEU A N   1 
ATOM   1588  C CA  . LEU A  1 212 ? 40.794  -0.602  30.449  1.00 13.26  ? 1230 LEU A CA  1 
ATOM   1589  C C   . LEU A  1 212 ? 42.068  0.248   30.367  1.00 14.22  ? 1230 LEU A C   1 
ATOM   1590  O O   . LEU A  1 212 ? 43.126  -0.140  30.870  1.00 16.44  ? 1230 LEU A O   1 
ATOM   1591  C CB  . LEU A  1 212 ? 40.615  -1.449  29.181  1.00 14.04  ? 1230 LEU A CB  1 
ATOM   1592  C CG  . LEU A  1 212 ? 39.472  -2.477  29.278  1.00 15.30  ? 1230 LEU A CG  1 
ATOM   1593  C CD1 . LEU A  1 212 ? 39.282  -3.206  27.951  1.00 13.62  ? 1230 LEU A CD1 1 
ATOM   1594  C CD2 . LEU A  1 212 ? 39.792  -3.469  30.394  1.00 15.07  ? 1230 LEU A CD2 1 
ATOM   1595  N N   . VAL A  1 213 ? 41.960  1.415   29.743  1.00 14.67  ? 1231 VAL A N   1 
ATOM   1596  C CA  . VAL A  1 213 ? 43.092  2.330   29.610  1.00 16.18  ? 1231 VAL A CA  1 
ATOM   1597  C C   . VAL A  1 213 ? 43.585  2.780   30.990  1.00 18.64  ? 1231 VAL A C   1 
ATOM   1598  O O   . VAL A  1 213 ? 44.754  3.114   31.165  1.00 21.04  ? 1231 VAL A O   1 
ATOM   1599  C CB  . VAL A  1 213 ? 42.694  3.574   28.760  1.00 15.02  ? 1231 VAL A CB  1 
ATOM   1600  C CG1 . VAL A  1 213 ? 43.714  4.712   28.939  1.00 15.03  ? 1231 VAL A CG1 1 
ATOM   1601  C CG2 . VAL A  1 213 ? 42.598  3.172   27.288  1.00 13.10  ? 1231 VAL A CG2 1 
ATOM   1602  N N   . LEU A  1 214 ? 42.691  2.764   31.972  1.00 19.84  ? 1232 LEU A N   1 
ATOM   1603  C CA  . LEU A  1 214 ? 43.029  3.190   33.325  1.00 20.22  ? 1232 LEU A CA  1 
ATOM   1604  C C   . LEU A  1 214 ? 43.326  2.037   34.274  1.00 21.28  ? 1232 LEU A C   1 
ATOM   1605  O O   . LEU A  1 214 ? 43.718  2.265   35.418  1.00 21.50  ? 1232 LEU A O   1 
ATOM   1606  C CB  . LEU A  1 214 ? 41.875  4.009   33.911  1.00 20.54  ? 1232 LEU A CB  1 
ATOM   1607  C CG  . LEU A  1 214 ? 41.454  5.297   33.203  1.00 22.51  ? 1232 LEU A CG  1 
ATOM   1608  C CD1 . LEU A  1 214 ? 40.197  5.846   33.867  1.00 23.02  ? 1232 LEU A CD1 1 
ATOM   1609  C CD2 . LEU A  1 214 ? 42.590  6.316   33.255  1.00 23.59  ? 1232 LEU A CD2 1 
ATOM   1610  N N   . SER A  1 215 ? 43.140  0.804   33.812  1.00 21.12  ? 1233 SER A N   1 
ATOM   1611  C CA  . SER A  1 215 ? 43.354  -0.353  34.677  1.00 21.85  ? 1233 SER A CA  1 
ATOM   1612  C C   . SER A  1 215 ? 44.700  -1.072  34.604  1.00 22.76  ? 1233 SER A C   1 
ATOM   1613  O O   . SER A  1 215 ? 45.190  -1.407  33.520  1.00 21.99  ? 1233 SER A O   1 
ATOM   1614  C CB  . SER A  1 215 ? 42.247  -1.380  34.446  1.00 21.95  ? 1233 SER A CB  1 
ATOM   1615  O OG  . SER A  1 215 ? 42.499  -2.550  35.205  1.00 22.74  ? 1233 SER A OG  1 
ATOM   1616  N N   . PRO A  1 216 ? 45.309  -1.331  35.773  1.00 22.13  ? 1234 PRO A N   1 
ATOM   1617  C CA  . PRO A  1 216 ? 46.598  -2.021  35.847  1.00 22.53  ? 1234 PRO A CA  1 
ATOM   1618  C C   . PRO A  1 216 ? 46.465  -3.430  35.284  1.00 21.68  ? 1234 PRO A C   1 
ATOM   1619  O O   . PRO A  1 216 ? 47.426  -3.994  34.768  1.00 19.95  ? 1234 PRO A O   1 
ATOM   1620  C CB  . PRO A  1 216 ? 46.894  -2.046  37.345  1.00 23.37  ? 1234 PRO A CB  1 
ATOM   1621  C CG  . PRO A  1 216 ? 46.222  -0.806  37.839  1.00 26.57  ? 1234 PRO A CG  1 
ATOM   1622  C CD  . PRO A  1 216 ? 44.904  -0.846  37.103  1.00 23.78  ? 1234 PRO A CD  1 
ATOM   1623  N N   . LEU A  1 217 ? 45.264  -3.990  35.388  1.00 19.86  ? 1235 LEU A N   1 
ATOM   1624  C CA  . LEU A  1 217 ? 45.013  -5.345  34.911  1.00 21.15  ? 1235 LEU A CA  1 
ATOM   1625  C C   . LEU A  1 217 ? 45.090  -5.492  33.396  1.00 20.89  ? 1235 LEU A C   1 
ATOM   1626  O O   . LEU A  1 217 ? 45.352  -6.584  32.889  1.00 19.71  ? 1235 LEU A O   1 
ATOM   1627  C CB  . LEU A  1 217 ? 43.636  -5.828  35.379  1.00 21.92  ? 1235 LEU A CB  1 
ATOM   1628  C CG  . LEU A  1 217 ? 43.366  -5.897  36.885  1.00 22.69  ? 1235 LEU A CG  1 
ATOM   1629  C CD1 . LEU A  1 217 ? 41.958  -6.437  37.111  1.00 21.67  ? 1235 LEU A CD1 1 
ATOM   1630  C CD2 . LEU A  1 217 ? 44.393  -6.793  37.564  1.00 23.02  ? 1235 LEU A CD2 1 
ATOM   1631  N N   . ALA A  1 218 ? 44.862  -4.401  32.675  1.00 19.41  ? 1236 ALA A N   1 
ATOM   1632  C CA  . ALA A  1 218 ? 44.871  -4.449  31.218  1.00 20.04  ? 1236 ALA A CA  1 
ATOM   1633  C C   . ALA A  1 218 ? 46.172  -3.972  30.582  1.00 21.46  ? 1236 ALA A C   1 
ATOM   1634  O O   . ALA A  1 218 ? 46.305  -3.969  29.352  1.00 21.73  ? 1236 ALA A O   1 
ATOM   1635  C CB  . ALA A  1 218 ? 43.700  -3.635  30.675  1.00 19.62  ? 1236 ALA A CB  1 
ATOM   1636  N N   . LYS A  1 219 ? 47.129  -3.577  31.415  1.00 21.63  ? 1237 LYS A N   1 
ATOM   1637  C CA  . LYS A  1 219 ? 48.411  -3.086  30.923  1.00 26.00  ? 1237 LYS A CA  1 
ATOM   1638  C C   . LYS A  1 219 ? 49.105  -4.116  30.037  1.00 25.35  ? 1237 LYS A C   1 
ATOM   1639  O O   . LYS A  1 219 ? 49.234  -5.286  30.406  1.00 24.32  ? 1237 LYS A O   1 
ATOM   1640  C CB  . LYS A  1 219 ? 49.329  -2.726  32.095  1.00 28.99  ? 1237 LYS A CB  1 
ATOM   1641  C CG  . LYS A  1 219 ? 49.682  -3.918  32.964  1.00 35.37  ? 1237 LYS A CG  1 
ATOM   1642  C CD  . LYS A  1 219 ? 50.519  -3.533  34.174  1.00 42.37  ? 1237 LYS A CD  1 
ATOM   1643  C CE  . LYS A  1 219 ? 50.774  -4.756  35.053  1.00 45.38  ? 1237 LYS A CE  1 
ATOM   1644  N NZ  . LYS A  1 219 ? 51.609  -4.444  36.250  1.00 48.89  ? 1237 LYS A NZ  1 
ATOM   1645  N N   . ASN A  1 220 ? 49.537  -3.667  28.863  1.00 26.10  ? 1238 ASN A N   1 
ATOM   1646  C CA  . ASN A  1 220 ? 50.244  -4.512  27.905  1.00 26.19  ? 1238 ASN A CA  1 
ATOM   1647  C C   . ASN A  1 220 ? 49.383  -5.540  27.178  1.00 24.76  ? 1238 ASN A C   1 
ATOM   1648  O O   . ASN A  1 220 ? 49.910  -6.462  26.556  1.00 25.20  ? 1238 ASN A O   1 
ATOM   1649  C CB  . ASN A  1 220 ? 51.414  -5.222  28.594  1.00 27.80  ? 1238 ASN A CB  1 
ATOM   1650  C CG  . ASN A  1 220 ? 52.384  -4.249  29.235  1.00 31.07  ? 1238 ASN A CG  1 
ATOM   1651  O OD1 . ASN A  1 220 ? 52.894  -3.334  28.577  1.00 31.75  ? 1238 ASN A OD1 1 
ATOM   1652  N ND2 . ASN A  1 220 ? 52.644  -4.437  30.525  1.00 30.14  ? 1238 ASN A ND2 1 
ATOM   1653  N N   . LEU A  1 221 ? 48.066  -5.381  27.251  1.00 21.46  ? 1239 LEU A N   1 
ATOM   1654  C CA  . LEU A  1 221 ? 47.159  -6.291  26.565  1.00 19.42  ? 1239 LEU A CA  1 
ATOM   1655  C C   . LEU A  1 221 ? 46.603  -5.618  25.305  1.00 17.51  ? 1239 LEU A C   1 
ATOM   1656  O O   . LEU A  1 221 ? 45.876  -6.231  24.522  1.00 17.11  ? 1239 LEU A O   1 
ATOM   1657  C CB  . LEU A  1 221 ? 46.028  -6.727  27.505  1.00 20.46  ? 1239 LEU A CB  1 
ATOM   1658  C CG  . LEU A  1 221 ? 46.472  -7.646  28.651  1.00 20.79  ? 1239 LEU A CG  1 
ATOM   1659  C CD1 . LEU A  1 221 ? 45.281  -8.005  29.530  1.00 19.98  ? 1239 LEU A CD1 1 
ATOM   1660  C CD2 . LEU A  1 221 ? 47.097  -8.899  28.071  1.00 22.17  ? 1239 LEU A CD2 1 
ATOM   1661  N N   . PHE A  1 222 ? 46.947  -4.346  25.124  1.00 15.66  ? 1240 PHE A N   1 
ATOM   1662  C CA  . PHE A  1 222 ? 46.534  -3.583  23.947  1.00 15.72  ? 1240 PHE A CA  1 
ATOM   1663  C C   . PHE A  1 222 ? 47.557  -2.469  23.726  1.00 15.79  ? 1240 PHE A C   1 
ATOM   1664  O O   . PHE A  1 222 ? 48.263  -2.075  24.655  1.00 15.84  ? 1240 PHE A O   1 
ATOM   1665  C CB  . PHE A  1 222 ? 45.116  -3.015  24.106  1.00 15.41  ? 1240 PHE A CB  1 
ATOM   1666  C CG  . PHE A  1 222 ? 44.951  -2.088  25.268  1.00 15.26  ? 1240 PHE A CG  1 
ATOM   1667  C CD1 . PHE A  1 222 ? 44.842  -2.582  26.567  1.00 17.53  ? 1240 PHE A CD1 1 
ATOM   1668  C CD2 . PHE A  1 222 ? 44.901  -0.713  25.067  1.00 16.67  ? 1240 PHE A CD2 1 
ATOM   1669  C CE1 . PHE A  1 222 ? 44.685  -1.714  27.649  1.00 17.66  ? 1240 PHE A CE1 1 
ATOM   1670  C CE2 . PHE A  1 222 ? 44.747  0.162   26.138  1.00 15.99  ? 1240 PHE A CE2 1 
ATOM   1671  C CZ  . PHE A  1 222 ? 44.639  -0.340  27.437  1.00 16.27  ? 1240 PHE A CZ  1 
ATOM   1672  N N   . HIS A  1 223 ? 47.629  -1.957  22.502  1.00 16.26  ? 1241 HIS A N   1 
ATOM   1673  C CA  . HIS A  1 223 ? 48.626  -0.948  22.161  1.00 16.26  ? 1241 HIS A CA  1 
ATOM   1674  C C   . HIS A  1 223 ? 48.071  0.384   21.655  1.00 15.74  ? 1241 HIS A C   1 
ATOM   1675  O O   . HIS A  1 223 ? 48.801  1.368   21.537  1.00 15.31  ? 1241 HIS A O   1 
ATOM   1676  C CB  . HIS A  1 223 ? 49.574  -1.577  21.143  1.00 13.86  ? 1241 HIS A CB  1 
ATOM   1677  C CG  . HIS A  1 223 ? 50.131  -2.888  21.600  1.00 14.83  ? 1241 HIS A CG  1 
ATOM   1678  N ND1 . HIS A  1 223 ? 49.500  -4.093  21.371  1.00 13.33  ? 1241 HIS A ND1 1 
ATOM   1679  C CD2 . HIS A  1 223 ? 51.222  -3.171  22.350  1.00 15.13  ? 1241 HIS A CD2 1 
ATOM   1680  C CE1 . HIS A  1 223 ? 50.178  -5.061  21.963  1.00 17.37  ? 1241 HIS A CE1 1 
ATOM   1681  N NE2 . HIS A  1 223 ? 51.228  -4.528  22.565  1.00 17.72  ? 1241 HIS A NE2 1 
ATOM   1682  N N   . ARG A  1 224 ? 46.779  0.394   21.346  1.00 14.31  ? 1242 ARG A N   1 
ATOM   1683  C CA  . ARG A  1 224 ? 46.077  1.596   20.897  1.00 15.28  ? 1242 ARG A CA  1 
ATOM   1684  C C   . ARG A  1 224 ? 44.647  1.460   21.415  1.00 14.10  ? 1242 ARG A C   1 
ATOM   1685  O O   . ARG A  1 224 ? 44.179  0.355   21.681  1.00 11.99  ? 1242 ARG A O   1 
ATOM   1686  C CB  . ARG A  1 224 ? 46.025  1.712   19.365  1.00 15.03  ? 1242 ARG A CB  1 
ATOM   1687  C CG  . ARG A  1 224 ? 47.364  1.899   18.664  1.00 20.67  ? 1242 ARG A CG  1 
ATOM   1688  C CD  . ARG A  1 224 ? 47.952  0.552   18.260  1.00 20.69  ? 1242 ARG A CD  1 
ATOM   1689  N NE  . ARG A  1 224 ? 49.006  0.689   17.260  1.00 19.73  ? 1242 ARG A NE  1 
ATOM   1690  C CZ  . ARG A  1 224 ? 50.199  1.227   17.490  1.00 20.86  ? 1242 ARG A CZ  1 
ATOM   1691  N NH1 . ARG A  1 224 ? 50.508  1.685   18.696  1.00 19.16  ? 1242 ARG A NH1 1 
ATOM   1692  N NH2 . ARG A  1 224 ? 51.089  1.300   16.509  1.00 20.03  ? 1242 ARG A NH2 1 
ATOM   1693  N N   . ALA A  1 225 ? 43.946  2.576   21.541  1.00 12.46  ? 1243 ALA A N   1 
ATOM   1694  C CA  . ALA A  1 225 ? 42.583  2.518   22.035  1.00 13.11  ? 1243 ALA A CA  1 
ATOM   1695  C C   . ALA A  1 225 ? 41.691  3.536   21.356  1.00 12.03  ? 1243 ALA A C   1 
ATOM   1696  O O   . ALA A  1 225 ? 42.136  4.629   21.001  1.00 11.12  ? 1243 ALA A O   1 
ATOM   1697  C CB  . ALA A  1 225 ? 42.575  2.738   23.542  1.00 10.90  ? 1243 ALA A CB  1 
ATOM   1698  N N   . ILE A  1 226 ? 40.431  3.160   21.162  1.00 9.74   ? 1244 ILE A N   1 
ATOM   1699  C CA  . ILE A  1 226 ? 39.451  4.049   20.559  1.00 10.62  ? 1244 ILE A CA  1 
ATOM   1700  C C   . ILE A  1 226 ? 38.144  3.993   21.356  1.00 12.91  ? 1244 ILE A C   1 
ATOM   1701  O O   . ILE A  1 226 ? 37.559  2.915   21.511  1.00 9.29   ? 1244 ILE A O   1 
ATOM   1702  C CB  . ILE A  1 226 ? 39.113  3.642   19.102  1.00 11.36  ? 1244 ILE A CB  1 
ATOM   1703  C CG1 . ILE A  1 226 ? 40.376  3.590   18.240  1.00 10.51  ? 1244 ILE A CG1 1 
ATOM   1704  C CG2 . ILE A  1 226 ? 38.121  4.640   18.519  1.00 10.80  ? 1244 ILE A CG2 1 
ATOM   1705  C CD1 . ILE A  1 226 ? 40.101  3.153   16.798  1.00 10.81  ? 1244 ILE A CD1 1 
ATOM   1706  N N   . SER A  1 227 ? 37.702  5.140   21.871  1.00 12.34  ? 1245 SER A N   1 
ATOM   1707  C CA  . SER A  1 227 ? 36.435  5.222   22.596  1.00 13.18  ? 1245 SER A CA  1 
ATOM   1708  C C   . SER A  1 227 ? 35.458  6.021   21.733  1.00 14.74  ? 1245 SER A C   1 
ATOM   1709  O O   . SER A  1 227 ? 35.682  7.202   21.448  1.00 14.99  ? 1245 SER A O   1 
ATOM   1710  C CB  . SER A  1 227 ? 36.605  5.920   23.956  1.00 13.23  ? 1245 SER A CB  1 
ATOM   1711  O OG  . SER A  1 227 ? 37.204  5.062   24.920  1.00 11.85  ? 1245 SER A OG  1 
ATOM   1712  N N   . GLU A  1 228 ? 34.382  5.368   21.308  1.00 15.21  ? 1246 GLU A N   1 
ATOM   1713  C CA  . GLU A  1 228 ? 33.368  6.008   20.479  1.00 17.59  ? 1246 GLU A CA  1 
ATOM   1714  C C   . GLU A  1 228 ? 32.111  6.295   21.304  1.00 18.17  ? 1246 GLU A C   1 
ATOM   1715  O O   . GLU A  1 228 ? 31.420  5.372   21.741  1.00 17.99  ? 1246 GLU A O   1 
ATOM   1716  C CB  . GLU A  1 228 ? 32.999  5.099   19.295  1.00 16.98  ? 1246 GLU A CB  1 
ATOM   1717  C CG  . GLU A  1 228 ? 34.099  4.900   18.260  1.00 20.67  ? 1246 GLU A CG  1 
ATOM   1718  C CD  . GLU A  1 228 ? 33.776  3.785   17.263  1.00 20.46  ? 1246 GLU A CD  1 
ATOM   1719  O OE1 . GLU A  1 228 ? 32.602  3.651   16.862  1.00 23.38  ? 1246 GLU A OE1 1 
ATOM   1720  O OE2 . GLU A  1 228 ? 34.699  3.046   16.874  1.00 19.43  ? 1246 GLU A OE2 1 
ATOM   1721  N N   . SER A  1 229 ? 31.828  7.575   21.521  1.00 17.62  ? 1247 SER A N   1 
ATOM   1722  C CA  . SER A  1 229 ? 30.644  7.992   22.265  1.00 17.65  ? 1247 SER A CA  1 
ATOM   1723  C C   . SER A  1 229 ? 30.535  7.374   23.653  1.00 16.41  ? 1247 SER A C   1 
ATOM   1724  O O   . SER A  1 229 ? 29.530  6.747   23.982  1.00 16.36  ? 1247 SER A O   1 
ATOM   1725  C CB  . SER A  1 229 ? 29.382  7.652   21.470  1.00 18.69  ? 1247 SER A CB  1 
ATOM   1726  O OG  . SER A  1 229 ? 29.377  8.309   20.215  1.00 22.23  ? 1247 SER A OG  1 
ATOM   1727  N N   . GLY A  1 230 ? 31.563  7.554   24.468  1.00 15.22  ? 1248 GLY A N   1 
ATOM   1728  C CA  . GLY A  1 230 ? 31.511  7.006   25.809  1.00 15.25  ? 1248 GLY A CA  1 
ATOM   1729  C C   . GLY A  1 230 ? 32.878  6.841   26.418  1.00 14.18  ? 1248 GLY A C   1 
ATOM   1730  O O   . GLY A  1 230 ? 33.781  6.305   25.780  1.00 12.19  ? 1248 GLY A O   1 
ATOM   1731  N N   . VAL A  1 231 ? 33.026  7.307   27.656  1.00 11.02  ? 1249 VAL A N   1 
ATOM   1732  C CA  . VAL A  1 231 ? 34.286  7.221   28.372  1.00 11.78  ? 1249 VAL A CA  1 
ATOM   1733  C C   . VAL A  1 231 ? 33.998  6.968   29.849  1.00 13.60  ? 1249 VAL A C   1 
ATOM   1734  O O   . VAL A  1 231 ? 32.841  6.964   30.267  1.00 13.18  ? 1249 VAL A O   1 
ATOM   1735  C CB  . VAL A  1 231 ? 35.111  8.535   28.236  1.00 15.68  ? 1249 VAL A CB  1 
ATOM   1736  C CG1 . VAL A  1 231 ? 35.659  8.680   26.804  1.00 14.57  ? 1249 VAL A CG1 1 
ATOM   1737  C CG2 . VAL A  1 231 ? 34.237  9.734   28.593  1.00 13.36  ? 1249 VAL A CG2 1 
ATOM   1738  N N   . ALA A  1 232 ? 35.055  6.775   30.629  1.00 15.08  ? 1250 ALA A N   1 
ATOM   1739  C CA  . ALA A  1 232 ? 34.935  6.503   32.057  1.00 17.51  ? 1250 ALA A CA  1 
ATOM   1740  C C   . ALA A  1 232 ? 34.335  7.661   32.843  1.00 19.56  ? 1250 ALA A C   1 
ATOM   1741  O O   . ALA A  1 232 ? 33.961  7.492   34.004  1.00 19.72  ? 1250 ALA A O   1 
ATOM   1742  C CB  . ALA A  1 232 ? 36.302  6.135   32.632  1.00 20.99  ? 1250 ALA A CB  1 
ATOM   1743  N N   . LEU A  1 233 ? 34.258  8.838   32.226  1.00 19.80  ? 1251 LEU A N   1 
ATOM   1744  C CA  . LEU A  1 233 ? 33.664  9.994   32.894  1.00 20.86  ? 1251 LEU A CA  1 
ATOM   1745  C C   . LEU A  1 233 ? 32.166  10.123  32.578  1.00 20.51  ? 1251 LEU A C   1 
ATOM   1746  O O   . LEU A  1 233 ? 31.512  11.062  33.025  1.00 21.67  ? 1251 LEU A O   1 
ATOM   1747  C CB  . LEU A  1 233 ? 34.407  11.290  32.529  1.00 19.71  ? 1251 LEU A CB  1 
ATOM   1748  C CG  . LEU A  1 233 ? 35.791  11.498  33.167  1.00 21.00  ? 1251 LEU A CG  1 
ATOM   1749  C CD1 . LEU A  1 233 ? 36.254  12.929  32.931  1.00 18.11  ? 1251 LEU A CD1 1 
ATOM   1750  C CD2 . LEU A  1 233 ? 35.727  11.231  34.663  1.00 22.83  ? 1251 LEU A CD2 1 
ATOM   1751  N N   . THR A  1 234 ? 31.628  9.187   31.797  1.00 21.98  ? 1252 THR A N   1 
ATOM   1752  C CA  . THR A  1 234 ? 30.192  9.180   31.491  1.00 21.64  ? 1252 THR A CA  1 
ATOM   1753  C C   . THR A  1 234 ? 29.578  8.539   32.745  1.00 23.67  ? 1252 THR A C   1 
ATOM   1754  O O   . THR A  1 234 ? 29.323  7.333   32.793  1.00 24.45  ? 1252 THR A O   1 
ATOM   1755  C CB  . THR A  1 234 ? 29.892  8.333   30.229  1.00 22.52  ? 1252 THR A CB  1 
ATOM   1756  O OG1 . THR A  1 234 ? 30.407  9.009   29.068  1.00 21.47  ? 1252 THR A OG1 1 
ATOM   1757  C CG2 . THR A  1 234 ? 28.394  8.119   30.058  1.00 22.23  ? 1252 THR A CG2 1 
ATOM   1758  N N   . SER A  1 235 ? 29.377  9.376   33.761  1.00 23.43  ? 1253 SER A N   1 
ATOM   1759  C CA  . SER A  1 235 ? 28.870  8.981   35.077  1.00 25.08  ? 1253 SER A CA  1 
ATOM   1760  C C   . SER A  1 235 ? 27.752  7.952   35.215  1.00 23.52  ? 1253 SER A C   1 
ATOM   1761  O O   . SER A  1 235 ? 27.773  7.168   36.158  1.00 25.74  ? 1253 SER A O   1 
ATOM   1762  C CB  . SER A  1 235 ? 28.491  10.236  35.879  1.00 25.92  ? 1253 SER A CB  1 
ATOM   1763  O OG  . SER A  1 235 ? 27.561  11.045  35.178  1.00 31.30  ? 1253 SER A OG  1 
ATOM   1764  N N   . VAL A  1 236 ? 26.781  7.944   34.308  1.00 22.71  ? 1254 VAL A N   1 
ATOM   1765  C CA  . VAL A  1 236 ? 25.684  6.984   34.414  1.00 23.17  ? 1254 VAL A CA  1 
ATOM   1766  C C   . VAL A  1 236 ? 26.170  5.529   34.383  1.00 23.53  ? 1254 VAL A C   1 
ATOM   1767  O O   . VAL A  1 236 ? 25.436  4.618   34.771  1.00 24.10  ? 1254 VAL A O   1 
ATOM   1768  C CB  . VAL A  1 236 ? 24.632  7.181   33.286  1.00 24.93  ? 1254 VAL A CB  1 
ATOM   1769  C CG1 . VAL A  1 236 ? 25.208  6.768   31.932  1.00 23.92  ? 1254 VAL A CG1 1 
ATOM   1770  C CG2 . VAL A  1 236 ? 23.370  6.374   33.601  1.00 27.05  ? 1254 VAL A CG2 1 
ATOM   1771  N N   . LEU A  1 237 ? 27.404  5.314   33.936  1.00 21.07  ? 1255 LEU A N   1 
ATOM   1772  C CA  . LEU A  1 237 ? 27.957  3.964   33.851  1.00 21.90  ? 1255 LEU A CA  1 
ATOM   1773  C C   . LEU A  1 237 ? 28.912  3.610   34.979  1.00 21.94  ? 1255 LEU A C   1 
ATOM   1774  O O   . LEU A  1 237 ? 29.283  2.449   35.134  1.00 22.24  ? 1255 LEU A O   1 
ATOM   1775  C CB  . LEU A  1 237 ? 28.678  3.773   32.517  1.00 20.50  ? 1255 LEU A CB  1 
ATOM   1776  C CG  . LEU A  1 237 ? 27.801  3.798   31.264  1.00 22.63  ? 1255 LEU A CG  1 
ATOM   1777  C CD1 . LEU A  1 237 ? 28.675  3.972   30.044  1.00 21.46  ? 1255 LEU A CD1 1 
ATOM   1778  C CD2 . LEU A  1 237 ? 26.981  2.515   31.178  1.00 22.90  ? 1255 LEU A CD2 1 
ATOM   1779  N N   . VAL A  1 238 ? 29.318  4.602   35.763  1.00 23.15  ? 1256 VAL A N   1 
ATOM   1780  C CA  . VAL A  1 238 ? 30.251  4.352   36.857  1.00 25.81  ? 1256 VAL A CA  1 
ATOM   1781  C C   . VAL A  1 238 ? 29.620  4.657   38.215  1.00 27.54  ? 1256 VAL A C   1 
ATOM   1782  O O   . VAL A  1 238 ? 29.198  5.783   38.477  1.00 29.04  ? 1256 VAL A O   1 
ATOM   1783  C CB  . VAL A  1 238 ? 31.533  5.202   36.687  1.00 24.30  ? 1256 VAL A CB  1 
ATOM   1784  C CG1 . VAL A  1 238 ? 32.516  4.906   37.812  1.00 23.80  ? 1256 VAL A CG1 1 
ATOM   1785  C CG2 . VAL A  1 238 ? 32.163  4.923   35.329  1.00 23.86  ? 1256 VAL A CG2 1 
ATOM   1786  N N   . LYS A  1 239 ? 29.565  3.648   39.076  1.00 29.80  ? 1257 LYS A N   1 
ATOM   1787  C CA  . LYS A  1 239 ? 28.978  3.805   40.400  1.00 33.91  ? 1257 LYS A CA  1 
ATOM   1788  C C   . LYS A  1 239 ? 29.958  4.383   41.406  1.00 35.62  ? 1257 LYS A C   1 
ATOM   1789  O O   . LYS A  1 239 ? 31.036  3.838   41.624  1.00 37.11  ? 1257 LYS A O   1 
ATOM   1790  C CB  . LYS A  1 239 ? 28.467  2.458   40.911  1.00 36.48  ? 1257 LYS A CB  1 
ATOM   1791  C CG  . LYS A  1 239 ? 27.450  1.809   39.998  1.00 38.77  ? 1257 LYS A CG  1 
ATOM   1792  C CD  . LYS A  1 239 ? 26.275  2.735   39.770  1.00 43.27  ? 1257 LYS A CD  1 
ATOM   1793  C CE  . LYS A  1 239 ? 25.310  2.166   38.753  1.00 45.13  ? 1257 LYS A CE  1 
ATOM   1794  N NZ  . LYS A  1 239 ? 24.189  3.116   38.510  1.00 48.33  ? 1257 LYS A NZ  1 
ATOM   1795  N N   . LYS A  1 240 ? 29.575  5.489   42.026  1.00 38.10  ? 1258 LYS A N   1 
ATOM   1796  C CA  . LYS A  1 240 ? 30.426  6.120   43.020  1.00 40.42  ? 1258 LYS A CA  1 
ATOM   1797  C C   . LYS A  1 240 ? 29.758  6.130   44.386  1.00 40.03  ? 1258 LYS A C   1 
ATOM   1798  O O   . LYS A  1 240 ? 28.540  6.270   44.492  1.00 40.54  ? 1258 LYS A O   1 
ATOM   1799  C CB  . LYS A  1 240 ? 30.769  7.542   42.589  1.00 43.72  ? 1258 LYS A CB  1 
ATOM   1800  C CG  . LYS A  1 240 ? 31.611  7.588   41.328  1.00 46.56  ? 1258 LYS A CG  1 
ATOM   1801  C CD  . LYS A  1 240 ? 32.242  8.946   41.157  1.00 50.55  ? 1258 LYS A CD  1 
ATOM   1802  C CE  . LYS A  1 240 ? 33.278  8.934   40.059  1.00 50.71  ? 1258 LYS A CE  1 
ATOM   1803  N NZ  . LYS A  1 240 ? 34.076  10.183  40.125  1.00 54.21  ? 1258 LYS A NZ  1 
ATOM   1804  N N   . GLY A  1 241 ? 30.563  5.969   45.429  1.00 39.21  ? 1259 GLY A N   1 
ATOM   1805  C CA  . GLY A  1 241 ? 30.022  5.955   46.774  1.00 38.79  ? 1259 GLY A CA  1 
ATOM   1806  C C   . GLY A  1 241 ? 29.662  4.553   47.229  1.00 38.55  ? 1259 GLY A C   1 
ATOM   1807  O O   . GLY A  1 241 ? 30.308  3.578   46.844  1.00 39.34  ? 1259 GLY A O   1 
ATOM   1808  N N   . ASP A  1 242 ? 28.616  4.449   48.041  1.00 37.06  ? 1260 ASP A N   1 
ATOM   1809  C CA  . ASP A  1 242 ? 28.179  3.163   48.569  1.00 34.15  ? 1260 ASP A CA  1 
ATOM   1810  C C   . ASP A  1 242 ? 27.227  2.458   47.606  1.00 31.49  ? 1260 ASP A C   1 
ATOM   1811  O O   . ASP A  1 242 ? 26.176  2.991   47.255  1.00 31.14  ? 1260 ASP A O   1 
ATOM   1812  C CB  . ASP A  1 242 ? 27.513  3.379   49.933  1.00 35.46  ? 1260 ASP A CB  1 
ATOM   1813  C CG  . ASP A  1 242 ? 27.134  2.080   50.615  1.00 37.54  ? 1260 ASP A CG  1 
ATOM   1814  O OD1 . ASP A  1 242 ? 27.729  1.028   50.294  1.00 36.88  ? 1260 ASP A OD1 1 
ATOM   1815  O OD2 . ASP A  1 242 ? 26.246  2.119   51.492  1.00 39.53  ? 1260 ASP A OD2 1 
ATOM   1816  N N   . VAL A  1 243 ? 27.605  1.257   47.177  1.00 28.26  ? 1261 VAL A N   1 
ATOM   1817  C CA  . VAL A  1 243 ? 26.786  0.493   46.244  1.00 27.36  ? 1261 VAL A CA  1 
ATOM   1818  C C   . VAL A  1 243 ? 25.939  -0.546  46.965  1.00 26.70  ? 1261 VAL A C   1 
ATOM   1819  O O   . VAL A  1 243 ? 25.108  -1.211  46.357  1.00 24.84  ? 1261 VAL A O   1 
ATOM   1820  C CB  . VAL A  1 243 ? 27.662  -0.229  45.193  1.00 28.57  ? 1261 VAL A CB  1 
ATOM   1821  C CG1 . VAL A  1 243 ? 28.525  0.783   44.461  1.00 28.74  ? 1261 VAL A CG1 1 
ATOM   1822  C CG2 . VAL A  1 243 ? 28.526  -1.296  45.864  1.00 25.35  ? 1261 VAL A CG2 1 
ATOM   1823  N N   . LYS A  1 244 ? 26.158  -0.673  48.268  1.00 26.92  ? 1262 LYS A N   1 
ATOM   1824  C CA  . LYS A  1 244 ? 25.431  -1.630  49.094  1.00 28.84  ? 1262 LYS A CA  1 
ATOM   1825  C C   . LYS A  1 244 ? 23.909  -1.523  48.958  1.00 28.29  ? 1262 LYS A C   1 
ATOM   1826  O O   . LYS A  1 244 ? 23.221  -2.533  48.796  1.00 29.59  ? 1262 LYS A O   1 
ATOM   1827  C CB  . LYS A  1 244 ? 25.840  -1.449  50.556  1.00 31.72  ? 1262 LYS A CB  1 
ATOM   1828  C CG  . LYS A  1 244 ? 25.231  -2.455  51.506  1.00 37.31  ? 1262 LYS A CG  1 
ATOM   1829  C CD  . LYS A  1 244 ? 25.654  -3.869  51.148  1.00 41.07  ? 1262 LYS A CD  1 
ATOM   1830  C CE  . LYS A  1 244 ? 25.166  -4.860  52.192  1.00 44.98  ? 1262 LYS A CE  1 
ATOM   1831  N NZ  . LYS A  1 244 ? 25.762  -4.610  53.539  1.00 46.85  ? 1262 LYS A NZ  1 
ATOM   1832  N N   . PRO A  1 245 ? 23.360  -0.298  49.026  1.00 27.83  ? 1263 PRO A N   1 
ATOM   1833  C CA  . PRO A  1 245 ? 21.910  -0.128  48.903  1.00 26.91  ? 1263 PRO A CA  1 
ATOM   1834  C C   . PRO A  1 245 ? 21.337  -0.755  47.637  1.00 25.39  ? 1263 PRO A C   1 
ATOM   1835  O O   . PRO A  1 245 ? 20.313  -1.437  47.683  1.00 25.41  ? 1263 PRO A O   1 
ATOM   1836  C CB  . PRO A  1 245 ? 21.744  1.388   48.929  1.00 28.07  ? 1263 PRO A CB  1 
ATOM   1837  C CG  . PRO A  1 245 ? 22.844  1.814   49.855  1.00 28.11  ? 1263 PRO A CG  1 
ATOM   1838  C CD  . PRO A  1 245 ? 24.006  0.987   49.356  1.00 28.68  ? 1263 PRO A CD  1 
ATOM   1839  N N   . LEU A  1 246 ? 21.996  -0.521  46.507  1.00 24.21  ? 1264 LEU A N   1 
ATOM   1840  C CA  . LEU A  1 246 ? 21.540  -1.078  45.236  1.00 22.18  ? 1264 LEU A CA  1 
ATOM   1841  C C   . LEU A  1 246 ? 21.556  -2.602  45.315  1.00 20.71  ? 1264 LEU A C   1 
ATOM   1842  O O   . LEU A  1 246 ? 20.611  -3.264  44.899  1.00 21.82  ? 1264 LEU A O   1 
ATOM   1843  C CB  . LEU A  1 246 ? 22.457  -0.631  44.092  1.00 23.95  ? 1264 LEU A CB  1 
ATOM   1844  C CG  . LEU A  1 246 ? 21.911  -0.657  42.656  1.00 26.75  ? 1264 LEU A CG  1 
ATOM   1845  C CD1 . LEU A  1 246 ? 23.088  -0.670  41.684  1.00 26.27  ? 1264 LEU A CD1 1 
ATOM   1846  C CD2 . LEU A  1 246 ? 21.039  -1.866  42.420  1.00 25.20  ? 1264 LEU A CD2 1 
ATOM   1847  N N   . ALA A  1 247 ? 22.644  -3.154  45.839  1.00 19.86  ? 1265 ALA A N   1 
ATOM   1848  C CA  . ALA A  1 247 ? 22.773  -4.599  45.959  1.00 19.27  ? 1265 ALA A CA  1 
ATOM   1849  C C   . ALA A  1 247 ? 21.621  -5.181  46.770  1.00 21.25  ? 1265 ALA A C   1 
ATOM   1850  O O   . ALA A  1 247 ? 21.052  -6.209  46.405  1.00 19.69  ? 1265 ALA A O   1 
ATOM   1851  C CB  . ALA A  1 247 ? 24.099  -4.947  46.608  1.00 17.27  ? 1265 ALA A CB  1 
ATOM   1852  N N   . GLU A  1 248 ? 21.279  -4.521  47.872  1.00 22.13  ? 1266 GLU A N   1 
ATOM   1853  C CA  . GLU A  1 248 ? 20.194  -4.985  48.725  1.00 24.94  ? 1266 GLU A CA  1 
ATOM   1854  C C   . GLU A  1 248 ? 18.841  -4.898  48.029  1.00 23.59  ? 1266 GLU A C   1 
ATOM   1855  O O   . GLU A  1 248 ? 17.978  -5.745  48.240  1.00 24.61  ? 1266 GLU A O   1 
ATOM   1856  C CB  . GLU A  1 248 ? 20.186  -4.190  50.036  1.00 27.03  ? 1266 GLU A CB  1 
ATOM   1857  C CG  . GLU A  1 248 ? 21.516  -4.294  50.776  1.00 33.90  ? 1266 GLU A CG  1 
ATOM   1858  C CD  . GLU A  1 248 ? 21.509  -3.615  52.133  1.00 37.76  ? 1266 GLU A CD  1 
ATOM   1859  O OE1 . GLU A  1 248 ? 21.107  -2.435  52.210  1.00 41.66  ? 1266 GLU A OE1 1 
ATOM   1860  O OE2 . GLU A  1 248 ? 21.918  -4.263  53.120  1.00 40.22  ? 1266 GLU A OE2 1 
ATOM   1861  N N   . GLN A  1 249 ? 18.649  -3.879  47.200  1.00 23.79  ? 1267 GLN A N   1 
ATOM   1862  C CA  . GLN A  1 249 ? 17.396  -3.743  46.474  1.00 24.81  ? 1267 GLN A CA  1 
ATOM   1863  C C   . GLN A  1 249 ? 17.272  -4.912  45.487  1.00 24.57  ? 1267 GLN A C   1 
ATOM   1864  O O   . GLN A  1 249 ? 16.190  -5.474  45.307  1.00 22.53  ? 1267 GLN A O   1 
ATOM   1865  C CB  . GLN A  1 249 ? 17.349  -2.399  45.731  1.00 28.63  ? 1267 GLN A CB  1 
ATOM   1866  C CG  . GLN A  1 249 ? 16.203  -2.282  44.723  1.00 34.77  ? 1267 GLN A CG  1 
ATOM   1867  C CD  . GLN A  1 249 ? 16.038  -0.877  44.153  1.00 37.36  ? 1267 GLN A CD  1 
ATOM   1868  O OE1 . GLN A  1 249 ? 17.012  -0.235  43.756  1.00 41.20  ? 1267 GLN A OE1 1 
ATOM   1869  N NE2 . GLN A  1 249 ? 14.798  -0.402  44.099  1.00 37.59  ? 1267 GLN A NE2 1 
ATOM   1870  N N   . ILE A  1 250 ? 18.384  -5.284  44.856  1.00 23.47  ? 1268 ILE A N   1 
ATOM   1871  C CA  . ILE A  1 250 ? 18.374  -6.399  43.912  1.00 23.11  ? 1268 ILE A CA  1 
ATOM   1872  C C   . ILE A  1 250 ? 18.100  -7.698  44.664  1.00 21.42  ? 1268 ILE A C   1 
ATOM   1873  O O   . ILE A  1 250 ? 17.245  -8.490  44.263  1.00 20.11  ? 1268 ILE A O   1 
ATOM   1874  C CB  . ILE A  1 250 ? 19.722  -6.525  43.153  1.00 23.75  ? 1268 ILE A CB  1 
ATOM   1875  C CG1 . ILE A  1 250 ? 19.906  -5.320  42.227  1.00 21.90  ? 1268 ILE A CG1 1 
ATOM   1876  C CG2 . ILE A  1 250 ? 19.757  -7.833  42.349  1.00 21.36  ? 1268 ILE A CG2 1 
ATOM   1877  C CD1 . ILE A  1 250 ? 21.243  -5.285  41.518  1.00 24.77  ? 1268 ILE A CD1 1 
ATOM   1878  N N   . ALA A  1 251 ? 18.815  -7.908  45.765  1.00 21.46  ? 1269 ALA A N   1 
ATOM   1879  C CA  . ALA A  1 251 ? 18.633  -9.115  46.564  1.00 20.75  ? 1269 ALA A CA  1 
ATOM   1880  C C   . ALA A  1 251 ? 17.175  -9.239  47.000  1.00 21.77  ? 1269 ALA A C   1 
ATOM   1881  O O   . ALA A  1 251 ? 16.568  -10.308 46.897  1.00 19.90  ? 1269 ALA A O   1 
ATOM   1882  C CB  . ALA A  1 251 ? 19.544  -9.079  47.792  1.00 20.66  ? 1269 ALA A CB  1 
ATOM   1883  N N   . ILE A  1 252 ? 16.613  -8.138  47.486  1.00 21.53  ? 1270 ILE A N   1 
ATOM   1884  C CA  . ILE A  1 252 ? 15.229  -8.136  47.938  1.00 23.77  ? 1270 ILE A CA  1 
ATOM   1885  C C   . ILE A  1 252 ? 14.245  -8.431  46.804  1.00 24.78  ? 1270 ILE A C   1 
ATOM   1886  O O   . ILE A  1 252 ? 13.326  -9.239  46.967  1.00 26.06  ? 1270 ILE A O   1 
ATOM   1887  C CB  . ILE A  1 252 ? 14.879  -6.786  48.610  1.00 24.34  ? 1270 ILE A CB  1 
ATOM   1888  C CG1 . ILE A  1 252 ? 15.583  -6.697  49.968  1.00 24.40  ? 1270 ILE A CG1 1 
ATOM   1889  C CG2 . ILE A  1 252 ? 13.373  -6.659  48.788  1.00 25.72  ? 1270 ILE A CG2 1 
ATOM   1890  C CD1 . ILE A  1 252 ? 15.441  -5.353  50.656  1.00 28.59  ? 1270 ILE A CD1 1 
ATOM   1891  N N   . THR A  1 253 ? 14.430  -7.791  45.653  1.00 22.60  ? 1271 THR A N   1 
ATOM   1892  C CA  . THR A  1 253 ? 13.531  -8.027  44.527  1.00 22.74  ? 1271 THR A CA  1 
ATOM   1893  C C   . THR A  1 253 ? 13.586  -9.488  44.089  1.00 22.44  ? 1271 THR A C   1 
ATOM   1894  O O   . THR A  1 253 ? 12.595  -10.041 43.607  1.00 21.97  ? 1271 THR A O   1 
ATOM   1895  C CB  . THR A  1 253 ? 13.890  -7.139  43.320  1.00 22.72  ? 1271 THR A CB  1 
ATOM   1896  O OG1 . THR A  1 253 ? 14.003  -5.779  43.748  1.00 24.44  ? 1271 THR A OG1 1 
ATOM   1897  C CG2 . THR A  1 253 ? 12.802  -7.223  42.250  1.00 22.35  ? 1271 THR A CG2 1 
ATOM   1898  N N   . ALA A  1 254 ? 14.748  -10.109 44.272  1.00 21.83  ? 1272 ALA A N   1 
ATOM   1899  C CA  . ALA A  1 254 ? 14.957  -11.501 43.893  1.00 23.13  ? 1272 ALA A CA  1 
ATOM   1900  C C   . ALA A  1 254 ? 14.431  -12.474 44.945  1.00 24.59  ? 1272 ALA A C   1 
ATOM   1901  O O   . ALA A  1 254 ? 14.383  -13.679 44.708  1.00 25.58  ? 1272 ALA A O   1 
ATOM   1902  C CB  . ALA A  1 254 ? 16.445  -11.752 43.644  1.00 21.18  ? 1272 ALA A CB  1 
ATOM   1903  N N   . GLY A  1 255 ? 14.038  -11.946 46.102  1.00 26.62  ? 1273 GLY A N   1 
ATOM   1904  C CA  . GLY A  1 255 ? 13.516  -12.789 47.167  1.00 26.79  ? 1273 GLY A CA  1 
ATOM   1905  C C   . GLY A  1 255 ? 14.583  -13.287 48.128  1.00 28.12  ? 1273 GLY A C   1 
ATOM   1906  O O   . GLY A  1 255 ? 14.400  -14.299 48.805  1.00 28.53  ? 1273 GLY A O   1 
ATOM   1907  N N   . CYS A  1 256 ? 15.696  -12.566 48.198  1.00 27.91  ? 1274 CYS A N   1 
ATOM   1908  C CA  . CYS A  1 256 ? 16.802  -12.939 49.066  1.00 29.66  ? 1274 CYS A CA  1 
ATOM   1909  C C   . CYS A  1 256 ? 16.882  -12.132 50.350  1.00 30.27  ? 1274 CYS A C   1 
ATOM   1910  O O   . CYS A  1 256 ? 16.374  -11.014 50.430  1.00 31.06  ? 1274 CYS A O   1 
ATOM   1911  C CB  . CYS A  1 256 ? 18.126  -12.773 48.327  1.00 30.52  ? 1274 CYS A CB  1 
ATOM   1912  S SG  . CYS A  1 256 ? 18.434  -13.993 47.019  1.00 34.61  ? 1274 CYS A SG  1 
ATOM   1913  N N   . LYS A  1 257 ? 17.535  -12.711 51.351  1.00 30.17  ? 1275 LYS A N   1 
ATOM   1914  C CA  . LYS A  1 257 ? 17.738  -12.033 52.623  1.00 32.14  ? 1275 LYS A CA  1 
ATOM   1915  C C   . LYS A  1 257 ? 18.927  -11.091 52.438  1.00 30.53  ? 1275 LYS A C   1 
ATOM   1916  O O   . LYS A  1 257 ? 19.779  -11.324 51.580  1.00 30.54  ? 1275 LYS A O   1 
ATOM   1917  C CB  . LYS A  1 257 ? 18.052  -13.038 53.734  1.00 33.75  ? 1275 LYS A CB  1 
ATOM   1918  C CG  . LYS A  1 257 ? 16.842  -13.788 54.264  1.00 38.77  ? 1275 LYS A CG  1 
ATOM   1919  C CD  . LYS A  1 257 ? 17.179  -14.496 55.571  1.00 41.77  ? 1275 LYS A CD  1 
ATOM   1920  C CE  . LYS A  1 257 ? 15.925  -14.994 56.274  1.00 44.08  ? 1275 LYS A CE  1 
ATOM   1921  N NZ  . LYS A  1 257 ? 16.231  -15.545 57.627  1.00 45.16  ? 1275 LYS A NZ  1 
ATOM   1922  N N   . THR A  1 258 ? 18.983  -10.036 53.243  1.00 29.40  ? 1276 THR A N   1 
ATOM   1923  C CA  . THR A  1 258 ? 20.061  -9.056  53.161  1.00 28.57  ? 1276 THR A CA  1 
ATOM   1924  C C   . THR A  1 258 ? 20.864  -9.001  54.458  1.00 29.32  ? 1276 THR A C   1 
ATOM   1925  O O   . THR A  1 258 ? 21.504  -7.993  54.763  1.00 27.17  ? 1276 THR A O   1 
ATOM   1926  C CB  . THR A  1 258 ? 19.497  -7.657  52.887  1.00 30.17  ? 1276 THR A CB  1 
ATOM   1927  O OG1 . THR A  1 258 ? 18.530  -7.333  53.895  1.00 27.21  ? 1276 THR A OG1 1 
ATOM   1928  C CG2 . THR A  1 258 ? 18.828  -7.610  51.518  1.00 29.03  ? 1276 THR A CG2 1 
ATOM   1929  N N   . THR A  1 259 ? 20.832  -10.097 55.211  1.00 29.20  ? 1277 THR A N   1 
ATOM   1930  C CA  . THR A  1 259 ? 21.537  -10.186 56.486  1.00 28.17  ? 1277 THR A CA  1 
ATOM   1931  C C   . THR A  1 259 ? 22.987  -9.732  56.375  1.00 27.92  ? 1277 THR A C   1 
ATOM   1932  O O   . THR A  1 259 ? 23.443  -8.899  57.155  1.00 27.13  ? 1277 THR A O   1 
ATOM   1933  C CB  . THR A  1 259 ? 21.511  -11.621 57.016  1.00 27.98  ? 1277 THR A CB  1 
ATOM   1934  O OG1 . THR A  1 259 ? 20.173  -12.125 56.935  1.00 29.94  ? 1277 THR A OG1 1 
ATOM   1935  C CG2 . THR A  1 259 ? 21.977  -11.660 58.472  1.00 28.19  ? 1277 THR A CG2 1 
ATOM   1936  N N   . THR A  1 260 ? 23.713  -10.301 55.417  1.00 25.33  ? 1278 THR A N   1 
ATOM   1937  C CA  . THR A  1 260 ? 25.109  -9.941  55.189  1.00 25.26  ? 1278 THR A CA  1 
ATOM   1938  C C   . THR A  1 260 ? 25.373  -10.007 53.688  1.00 23.87  ? 1278 THR A C   1 
ATOM   1939  O O   . THR A  1 260 ? 24.537  -10.495 52.928  1.00 23.34  ? 1278 THR A O   1 
ATOM   1940  C CB  . THR A  1 260 ? 26.095  -10.918 55.877  1.00 27.61  ? 1278 THR A CB  1 
ATOM   1941  O OG1 . THR A  1 260 ? 26.050  -12.189 55.215  1.00 28.14  ? 1278 THR A OG1 1 
ATOM   1942  C CG2 . THR A  1 260 ? 25.747  -11.096 57.353  1.00 28.44  ? 1278 THR A CG2 1 
ATOM   1943  N N   . SER A  1 261 ? 26.533  -9.516  53.268  1.00 22.16  ? 1279 SER A N   1 
ATOM   1944  C CA  . SER A  1 261 ? 26.898  -9.545  51.858  1.00 21.56  ? 1279 SER A CA  1 
ATOM   1945  C C   . SER A  1 261 ? 27.056  -10.990 51.391  1.00 19.07  ? 1279 SER A C   1 
ATOM   1946  O O   . SER A  1 261 ? 26.549  -11.364 50.336  1.00 21.21  ? 1279 SER A O   1 
ATOM   1947  C CB  . SER A  1 261 ? 28.205  -8.786  51.635  1.00 22.18  ? 1279 SER A CB  1 
ATOM   1948  O OG  . SER A  1 261 ? 28.073  -7.434  52.028  1.00 27.55  ? 1279 SER A OG  1 
ATOM   1949  N N   . ALA A  1 262 ? 27.753  -11.800 52.186  1.00 18.11  ? 1280 ALA A N   1 
ATOM   1950  C CA  . ALA A  1 262 ? 27.976  -13.200 51.845  1.00 17.14  ? 1280 ALA A CA  1 
ATOM   1951  C C   . ALA A  1 262 ? 26.643  -13.920 51.667  1.00 18.63  ? 1280 ALA A C   1 
ATOM   1952  O O   . ALA A  1 262 ? 26.488  -14.743 50.762  1.00 17.67  ? 1280 ALA A O   1 
ATOM   1953  C CB  . ALA A  1 262 ? 28.802  -13.880 52.930  1.00 15.32  ? 1280 ALA A CB  1 
ATOM   1954  N N   . VAL A  1 263 ? 25.682  -13.607 52.533  1.00 18.41  ? 1281 VAL A N   1 
ATOM   1955  C CA  . VAL A  1 263 ? 24.362  -14.221 52.451  1.00 18.22  ? 1281 VAL A CA  1 
ATOM   1956  C C   . VAL A  1 263 ? 23.666  -13.805 51.161  1.00 16.71  ? 1281 VAL A C   1 
ATOM   1957  O O   . VAL A  1 263 ? 23.089  -14.640 50.472  1.00 16.09  ? 1281 VAL A O   1 
ATOM   1958  C CB  . VAL A  1 263 ? 23.482  -13.830 53.671  1.00 18.96  ? 1281 VAL A CB  1 
ATOM   1959  C CG1 . VAL A  1 263 ? 22.025  -14.213 53.428  1.00 19.51  ? 1281 VAL A CG1 1 
ATOM   1960  C CG2 . VAL A  1 263 ? 23.995  -14.539 54.909  1.00 19.38  ? 1281 VAL A CG2 1 
ATOM   1961  N N   . MET A  1 264 ? 23.718  -12.517 50.835  1.00 16.77  ? 1282 MET A N   1 
ATOM   1962  C CA  . MET A  1 264 ? 23.092  -12.027 49.606  1.00 19.31  ? 1282 MET A CA  1 
ATOM   1963  C C   . MET A  1 264 ? 23.667  -12.713 48.366  1.00 18.67  ? 1282 MET A C   1 
ATOM   1964  O O   . MET A  1 264 ? 22.921  -13.150 47.491  1.00 18.92  ? 1282 MET A O   1 
ATOM   1965  C CB  . MET A  1 264 ? 23.282  -10.515 49.444  1.00 20.14  ? 1282 MET A CB  1 
ATOM   1966  C CG  . MET A  1 264 ? 22.484  -9.645  50.392  1.00 23.50  ? 1282 MET A CG  1 
ATOM   1967  S SD  . MET A  1 264 ? 22.528  -7.896  49.883  1.00 30.96  ? 1282 MET A SD  1 
ATOM   1968  C CE  . MET A  1 264 ? 24.080  -7.401  50.572  1.00 24.59  ? 1282 MET A CE  1 
ATOM   1969  N N   . VAL A  1 265 ? 24.993  -12.793 48.294  1.00 19.39  ? 1283 VAL A N   1 
ATOM   1970  C CA  . VAL A  1 265 ? 25.666  -13.404 47.150  1.00 20.55  ? 1283 VAL A CA  1 
ATOM   1971  C C   . VAL A  1 265 ? 25.365  -14.895 47.044  1.00 19.79  ? 1283 VAL A C   1 
ATOM   1972  O O   . VAL A  1 265 ? 25.091  -15.407 45.958  1.00 15.89  ? 1283 VAL A O   1 
ATOM   1973  C CB  . VAL A  1 265 ? 27.195  -13.209 47.229  1.00 20.96  ? 1283 VAL A CB  1 
ATOM   1974  C CG1 . VAL A  1 265 ? 27.869  -13.863 46.028  1.00 23.39  ? 1283 VAL A CG1 1 
ATOM   1975  C CG2 . VAL A  1 265 ? 27.523  -11.726 47.270  1.00 24.36  ? 1283 VAL A CG2 1 
ATOM   1976  N N   . HIS A  1 266 ? 25.414  -15.590 48.174  1.00 18.89  ? 1284 HIS A N   1 
ATOM   1977  C CA  . HIS A  1 266 ? 25.136  -17.020 48.183  1.00 20.81  ? 1284 HIS A CA  1 
ATOM   1978  C C   . HIS A  1 266 ? 23.731  -17.299 47.643  1.00 20.18  ? 1284 HIS A C   1 
ATOM   1979  O O   . HIS A  1 266 ? 23.540  -18.165 46.790  1.00 20.97  ? 1284 HIS A O   1 
ATOM   1980  C CB  . HIS A  1 266 ? 25.262  -17.566 49.603  1.00 23.12  ? 1284 HIS A CB  1 
ATOM   1981  C CG  . HIS A  1 266 ? 24.856  -18.998 49.730  1.00 27.10  ? 1284 HIS A CG  1 
ATOM   1982  N ND1 . HIS A  1 266 ? 25.534  -20.020 49.102  1.00 26.21  ? 1284 HIS A ND1 1 
ATOM   1983  C CD2 . HIS A  1 266 ? 23.829  -19.577 50.396  1.00 27.73  ? 1284 HIS A CD2 1 
ATOM   1984  C CE1 . HIS A  1 266 ? 24.941  -21.170 49.376  1.00 29.33  ? 1284 HIS A CE1 1 
ATOM   1985  N NE2 . HIS A  1 266 ? 23.905  -20.928 50.159  1.00 29.73  ? 1284 HIS A NE2 1 
ATOM   1986  N N   . CYS A  1 267 ? 22.751  -16.558 48.147  1.00 19.72  ? 1285 CYS A N   1 
ATOM   1987  C CA  . CYS A  1 267 ? 21.364  -16.707 47.718  1.00 22.28  ? 1285 CYS A CA  1 
ATOM   1988  C C   . CYS A  1 267 ? 21.222  -16.445 46.214  1.00 21.56  ? 1285 CYS A C   1 
ATOM   1989  O O   . CYS A  1 267 ? 20.627  -17.241 45.483  1.00 20.95  ? 1285 CYS A O   1 
ATOM   1990  C CB  . CYS A  1 267 ? 20.479  -15.732 48.499  1.00 24.74  ? 1285 CYS A CB  1 
ATOM   1991  S SG  . CYS A  1 267 ? 18.704  -15.720 48.074  1.00 35.28  ? 1285 CYS A SG  1 
ATOM   1992  N N   . LEU A  1 268 ? 21.770  -15.326 45.757  1.00 19.47  ? 1286 LEU A N   1 
ATOM   1993  C CA  . LEU A  1 268 ? 21.690  -14.967 44.344  1.00 20.76  ? 1286 LEU A CA  1 
ATOM   1994  C C   . LEU A  1 268 ? 22.333  -16.006 43.432  1.00 20.45  ? 1286 LEU A C   1 
ATOM   1995  O O   . LEU A  1 268 ? 21.908  -16.185 42.292  1.00 21.97  ? 1286 LEU A O   1 
ATOM   1996  C CB  . LEU A  1 268 ? 22.322  -13.590 44.116  1.00 20.42  ? 1286 LEU A CB  1 
ATOM   1997  C CG  . LEU A  1 268 ? 21.473  -12.423 44.630  1.00 24.52  ? 1286 LEU A CG  1 
ATOM   1998  C CD1 . LEU A  1 268 ? 22.212  -11.105 44.456  1.00 24.36  ? 1286 LEU A CD1 1 
ATOM   1999  C CD2 . LEU A  1 268 ? 20.147  -12.394 43.866  1.00 23.05  ? 1286 LEU A CD2 1 
ATOM   2000  N N   . ARG A  1 269 ? 23.359  -16.692 43.924  1.00 20.67  ? 1287 ARG A N   1 
ATOM   2001  C CA  . ARG A  1 269 ? 24.004  -17.719 43.118  1.00 23.08  ? 1287 ARG A CA  1 
ATOM   2002  C C   . ARG A  1 269 ? 23.113  -18.955 42.966  1.00 24.80  ? 1287 ARG A C   1 
ATOM   2003  O O   . ARG A  1 269 ? 23.284  -19.740 42.032  1.00 23.79  ? 1287 ARG A O   1 
ATOM   2004  C CB  . ARG A  1 269 ? 25.349  -18.119 43.727  1.00 21.74  ? 1287 ARG A CB  1 
ATOM   2005  C CG  . ARG A  1 269 ? 26.466  -17.134 43.434  1.00 23.38  ? 1287 ARG A CG  1 
ATOM   2006  C CD  . ARG A  1 269 ? 27.787  -17.613 44.011  1.00 25.26  ? 1287 ARG A CD  1 
ATOM   2007  N NE  . ARG A  1 269 ? 28.892  -16.719 43.673  1.00 25.49  ? 1287 ARG A NE  1 
ATOM   2008  C CZ  . ARG A  1 269 ? 29.873  -16.408 44.511  1.00 26.43  ? 1287 ARG A CZ  1 
ATOM   2009  N NH1 . ARG A  1 269 ? 29.881  -16.915 45.737  1.00 27.68  ? 1287 ARG A NH1 1 
ATOM   2010  N NH2 . ARG A  1 269 ? 30.845  -15.592 44.131  1.00 25.91  ? 1287 ARG A NH2 1 
ATOM   2011  N N   . GLN A  1 270 ? 22.159  -19.126 43.875  1.00 23.68  ? 1288 GLN A N   1 
ATOM   2012  C CA  . GLN A  1 270 ? 21.265  -20.278 43.804  1.00 25.36  ? 1288 GLN A CA  1 
ATOM   2013  C C   . GLN A  1 270 ? 20.060  -20.016 42.907  1.00 24.05  ? 1288 GLN A C   1 
ATOM   2014  O O   . GLN A  1 270 ? 19.325  -20.939 42.560  1.00 24.32  ? 1288 GLN A O   1 
ATOM   2015  C CB  . GLN A  1 270 ? 20.783  -20.668 45.203  1.00 28.02  ? 1288 GLN A CB  1 
ATOM   2016  C CG  . GLN A  1 270 ? 21.894  -21.061 46.154  1.00 31.98  ? 1288 GLN A CG  1 
ATOM   2017  C CD  . GLN A  1 270 ? 21.377  -21.333 47.552  1.00 37.33  ? 1288 GLN A CD  1 
ATOM   2018  O OE1 . GLN A  1 270 ? 20.749  -20.471 48.171  1.00 40.55  ? 1288 GLN A OE1 1 
ATOM   2019  N NE2 . GLN A  1 270 ? 21.636  -22.535 48.058  1.00 37.79  ? 1288 GLN A NE2 1 
ATOM   2020  N N   . LYS A  1 271 ? 19.849  -18.759 42.534  1.00 22.63  ? 1289 LYS A N   1 
ATOM   2021  C CA  . LYS A  1 271 ? 18.721  -18.429 41.673  1.00 23.07  ? 1289 LYS A CA  1 
ATOM   2022  C C   . LYS A  1 271 ? 18.993  -18.943 40.264  1.00 22.55  ? 1289 LYS A C   1 
ATOM   2023  O O   . LYS A  1 271 ? 20.145  -19.044 39.840  1.00 21.36  ? 1289 LYS A O   1 
ATOM   2024  C CB  . LYS A  1 271 ? 18.497  -16.913 41.634  1.00 23.29  ? 1289 LYS A CB  1 
ATOM   2025  C CG  . LYS A  1 271 ? 18.110  -16.298 42.979  1.00 24.92  ? 1289 LYS A CG  1 
ATOM   2026  C CD  . LYS A  1 271 ? 16.732  -16.761 43.428  1.00 27.64  ? 1289 LYS A CD  1 
ATOM   2027  C CE  . LYS A  1 271 ? 16.424  -16.287 44.840  1.00 31.26  ? 1289 LYS A CE  1 
ATOM   2028  N NZ  . LYS A  1 271 ? 15.074  -16.729 45.288  1.00 33.64  ? 1289 LYS A NZ  1 
ATOM   2029  N N   . THR A  1 272 ? 17.928  -19.280 39.549  1.00 21.92  ? 1290 THR A N   1 
ATOM   2030  C CA  . THR A  1 272 ? 18.053  -19.760 38.181  1.00 22.72  ? 1290 THR A CA  1 
ATOM   2031  C C   . THR A  1 272 ? 18.204  -18.556 37.262  1.00 23.45  ? 1290 THR A C   1 
ATOM   2032  O O   . THR A  1 272 ? 17.908  -17.423 37.648  1.00 22.83  ? 1290 THR A O   1 
ATOM   2033  C CB  . THR A  1 272 ? 16.794  -20.513 37.724  1.00 23.98  ? 1290 THR A CB  1 
ATOM   2034  O OG1 . THR A  1 272 ? 15.683  -19.607 37.733  1.00 22.04  ? 1290 THR A OG1 1 
ATOM   2035  C CG2 . THR A  1 272 ? 16.500  -21.698 38.640  1.00 21.50  ? 1290 THR A CG2 1 
ATOM   2036  N N   . GLU A  1 273 ? 18.646  -18.808 36.037  1.00 22.94  ? 1291 GLU A N   1 
ATOM   2037  C CA  . GLU A  1 273 ? 18.804  -17.740 35.071  1.00 23.11  ? 1291 GLU A CA  1 
ATOM   2038  C C   . GLU A  1 273 ? 17.483  -16.999 34.911  1.00 20.84  ? 1291 GLU A C   1 
ATOM   2039  O O   . GLU A  1 273 ? 17.441  -15.766 34.910  1.00 19.24  ? 1291 GLU A O   1 
ATOM   2040  C CB  . GLU A  1 273 ? 19.244  -18.314 33.722  1.00 25.64  ? 1291 GLU A CB  1 
ATOM   2041  C CG  . GLU A  1 273 ? 19.203  -17.305 32.583  1.00 29.73  ? 1291 GLU A CG  1 
ATOM   2042  C CD  . GLU A  1 273 ? 19.702  -17.886 31.270  1.00 32.70  ? 1291 GLU A CD  1 
ATOM   2043  O OE1 . GLU A  1 273 ? 19.320  -19.030 30.942  1.00 34.13  ? 1291 GLU A OE1 1 
ATOM   2044  O OE2 . GLU A  1 273 ? 20.466  -17.194 30.563  1.00 34.41  ? 1291 GLU A OE2 1 
ATOM   2045  N N   . GLU A  1 274 ? 16.399  -17.753 34.785  1.00 20.35  ? 1292 GLU A N   1 
ATOM   2046  C CA  . GLU A  1 274 ? 15.086  -17.150 34.614  1.00 22.44  ? 1292 GLU A CA  1 
ATOM   2047  C C   . GLU A  1 274 ? 14.734  -16.239 35.789  1.00 19.75  ? 1292 GLU A C   1 
ATOM   2048  O O   . GLU A  1 274 ? 14.229  -15.135 35.594  1.00 20.79  ? 1292 GLU A O   1 
ATOM   2049  C CB  . GLU A  1 274 ? 14.015  -18.237 34.452  1.00 27.02  ? 1292 GLU A CB  1 
ATOM   2050  C CG  . GLU A  1 274 ? 12.647  -17.688 34.068  1.00 35.11  ? 1292 GLU A CG  1 
ATOM   2051  C CD  . GLU A  1 274 ? 12.700  -16.810 32.824  1.00 41.71  ? 1292 GLU A CD  1 
ATOM   2052  O OE1 . GLU A  1 274 ? 13.184  -17.288 31.772  1.00 44.47  ? 1292 GLU A OE1 1 
ATOM   2053  O OE2 . GLU A  1 274 ? 12.257  -15.640 32.896  1.00 45.40  ? 1292 GLU A OE2 1 
ATOM   2054  N N   . GLU A  1 275 ? 15.012  -16.695 37.005  1.00 19.69  ? 1293 GLU A N   1 
ATOM   2055  C CA  . GLU A  1 275 ? 14.720  -15.897 38.193  1.00 20.78  ? 1293 GLU A CA  1 
ATOM   2056  C C   . GLU A  1 275 ? 15.454  -14.558 38.178  1.00 20.63  ? 1293 GLU A C   1 
ATOM   2057  O O   . GLU A  1 275 ? 14.859  -13.526 38.487  1.00 21.09  ? 1293 GLU A O   1 
ATOM   2058  C CB  . GLU A  1 275 ? 15.067  -16.684 39.465  1.00 20.23  ? 1293 GLU A CB  1 
ATOM   2059  C CG  . GLU A  1 275 ? 13.906  -17.531 39.955  1.00 24.70  ? 1293 GLU A CG  1 
ATOM   2060  C CD  . GLU A  1 275 ? 14.306  -18.590 40.968  1.00 28.08  ? 1293 GLU A CD  1 
ATOM   2061  O OE1 . GLU A  1 275 ? 13.421  -19.010 41.740  1.00 32.25  ? 1293 GLU A OE1 1 
ATOM   2062  O OE2 . GLU A  1 275 ? 15.483  -19.017 40.988  1.00 25.48  ? 1293 GLU A OE2 1 
ATOM   2063  N N   . LEU A  1 276 ? 16.736  -14.569 37.812  1.00 19.92  ? 1294 LEU A N   1 
ATOM   2064  C CA  . LEU A  1 276 ? 17.511  -13.332 37.760  1.00 19.54  ? 1294 LEU A CA  1 
ATOM   2065  C C   . LEU A  1 276 ? 17.053  -12.428 36.617  1.00 19.18  ? 1294 LEU A C   1 
ATOM   2066  O O   . LEU A  1 276 ? 17.169  -11.202 36.702  1.00 18.81  ? 1294 LEU A O   1 
ATOM   2067  C CB  . LEU A  1 276 ? 19.012  -13.634 37.636  1.00 18.96  ? 1294 LEU A CB  1 
ATOM   2068  C CG  . LEU A  1 276 ? 19.651  -14.274 38.872  1.00 20.17  ? 1294 LEU A CG  1 
ATOM   2069  C CD1 . LEU A  1 276 ? 21.162  -14.373 38.688  1.00 20.90  ? 1294 LEU A CD1 1 
ATOM   2070  C CD2 . LEU A  1 276 ? 19.333  -13.431 40.104  1.00 18.84  ? 1294 LEU A CD2 1 
ATOM   2071  N N   . LEU A  1 277 ? 16.521  -13.030 35.557  1.00 20.64  ? 1295 LEU A N   1 
ATOM   2072  C CA  . LEU A  1 277 ? 16.022  -12.264 34.421  1.00 22.27  ? 1295 LEU A CA  1 
ATOM   2073  C C   . LEU A  1 277 ? 14.734  -11.557 34.837  1.00 23.27  ? 1295 LEU A C   1 
ATOM   2074  O O   . LEU A  1 277 ? 14.496  -10.403 34.474  1.00 22.12  ? 1295 LEU A O   1 
ATOM   2075  C CB  . LEU A  1 277 ? 15.752  -13.180 33.221  1.00 22.50  ? 1295 LEU A CB  1 
ATOM   2076  C CG  . LEU A  1 277 ? 15.268  -12.473 31.948  1.00 26.85  ? 1295 LEU A CG  1 
ATOM   2077  C CD1 . LEU A  1 277 ? 16.191  -11.303 31.615  1.00 26.46  ? 1295 LEU A CD1 1 
ATOM   2078  C CD2 . LEU A  1 277 ? 15.230  -13.462 30.794  1.00 28.27  ? 1295 LEU A CD2 1 
ATOM   2079  N N   . GLU A  1 278 ? 13.905  -12.255 35.604  1.00 24.55  ? 1296 GLU A N   1 
ATOM   2080  C CA  . GLU A  1 278 ? 12.662  -11.672 36.090  1.00 25.21  ? 1296 GLU A CA  1 
ATOM   2081  C C   . GLU A  1 278 ? 13.012  -10.515 37.022  1.00 22.72  ? 1296 GLU A C   1 
ATOM   2082  O O   . GLU A  1 278 ? 12.384  -9.458  36.976  1.00 21.42  ? 1296 GLU A O   1 
ATOM   2083  C CB  . GLU A  1 278 ? 11.839  -12.730 36.825  1.00 29.88  ? 1296 GLU A CB  1 
ATOM   2084  C CG  . GLU A  1 278 ? 11.412  -13.874 35.916  1.00 37.62  ? 1296 GLU A CG  1 
ATOM   2085  C CD  . GLU A  1 278 ? 10.553  -14.907 36.619  1.00 42.28  ? 1296 GLU A CD  1 
ATOM   2086  O OE1 . GLU A  1 278 ? 10.136  -15.879 35.951  1.00 43.90  ? 1296 GLU A OE1 1 
ATOM   2087  O OE2 . GLU A  1 278 ? 10.297  -14.747 37.835  1.00 45.65  ? 1296 GLU A OE2 1 
ATOM   2088  N N   . THR A  1 279 ? 14.026  -10.722 37.859  1.00 20.91  ? 1297 THR A N   1 
ATOM   2089  C CA  . THR A  1 279 ? 14.483  -9.686  38.781  1.00 22.31  ? 1297 THR A CA  1 
ATOM   2090  C C   . THR A  1 279 ? 14.911  -8.468  37.962  1.00 23.01  ? 1297 THR A C   1 
ATOM   2091  O O   . THR A  1 279 ? 14.606  -7.326  38.315  1.00 22.91  ? 1297 THR A O   1 
ATOM   2092  C CB  . THR A  1 279 ? 15.680  -10.177 39.614  1.00 22.69  ? 1297 THR A CB  1 
ATOM   2093  O OG1 . THR A  1 279 ? 15.255  -11.236 40.481  1.00 23.83  ? 1297 THR A OG1 1 
ATOM   2094  C CG2 . THR A  1 279 ? 16.262  -9.041  40.448  1.00 24.15  ? 1297 THR A CG2 1 
ATOM   2095  N N   . THR A  1 280 ? 15.613  -8.722  36.861  1.00 23.19  ? 1298 THR A N   1 
ATOM   2096  C CA  . THR A  1 280 ? 16.076  -7.655  35.981  1.00 22.00  ? 1298 THR A CA  1 
ATOM   2097  C C   . THR A  1 280 ? 14.886  -6.883  35.422  1.00 21.34  ? 1298 THR A C   1 
ATOM   2098  O O   . THR A  1 280 ? 14.866  -5.654  35.448  1.00 21.94  ? 1298 THR A O   1 
ATOM   2099  C CB  . THR A  1 280 ? 16.901  -8.211  34.795  1.00 21.52  ? 1298 THR A CB  1 
ATOM   2100  O OG1 . THR A  1 280 ? 18.070  -8.880  35.290  1.00 20.00  ? 1298 THR A OG1 1 
ATOM   2101  C CG2 . THR A  1 280 ? 17.324  -7.075  33.870  1.00 21.79  ? 1298 THR A CG2 1 
ATOM   2102  N N   . LEU A  1 281 ? 13.892  -7.607  34.919  1.00 22.32  ? 1299 LEU A N   1 
ATOM   2103  C CA  . LEU A  1 281 ? 12.708  -6.971  34.356  1.00 24.15  ? 1299 LEU A CA  1 
ATOM   2104  C C   . LEU A  1 281 ? 11.962  -6.165  35.417  1.00 24.57  ? 1299 LEU A C   1 
ATOM   2105  O O   . LEU A  1 281 ? 11.493  -5.054  35.146  1.00 24.08  ? 1299 LEU A O   1 
ATOM   2106  C CB  . LEU A  1 281 ? 11.785  -8.028  33.748  1.00 27.19  ? 1299 LEU A CB  1 
ATOM   2107  C CG  . LEU A  1 281 ? 12.441  -8.953  32.712  1.00 29.64  ? 1299 LEU A CG  1 
ATOM   2108  C CD1 . LEU A  1 281 ? 11.392  -9.890  32.132  1.00 31.13  ? 1299 LEU A CD1 1 
ATOM   2109  C CD2 . LEU A  1 281 ? 13.086  -8.129  31.595  1.00 32.10  ? 1299 LEU A CD2 1 
ATOM   2110  N N   . LYS A  1 282 ? 11.859  -6.718  36.623  1.00 24.03  ? 1300 LYS A N   1 
ATOM   2111  C CA  . LYS A  1 282 ? 11.178  -6.023  37.711  1.00 25.92  ? 1300 LYS A CA  1 
ATOM   2112  C C   . LYS A  1 282 ? 11.893  -4.721  38.047  1.00 26.72  ? 1300 LYS A C   1 
ATOM   2113  O O   . LYS A  1 282 ? 11.253  -3.729  38.391  1.00 27.74  ? 1300 LYS A O   1 
ATOM   2114  C CB  . LYS A  1 282 ? 11.117  -6.899  38.969  1.00 26.95  ? 1300 LYS A CB  1 
ATOM   2115  C CG  . LYS A  1 282 ? 10.133  -8.056  38.893  1.00 30.92  ? 1300 LYS A CG  1 
ATOM   2116  C CD  . LYS A  1 282 ? 10.140  -8.864  40.188  1.00 33.81  ? 1300 LYS A CD  1 
ATOM   2117  C CE  . LYS A  1 282 ? 9.321   -10.141 40.053  1.00 36.87  ? 1300 LYS A CE  1 
ATOM   2118  N NZ  . LYS A  1 282 ? 9.391   -10.980 41.284  1.00 38.04  ? 1300 LYS A NZ  1 
ATOM   2119  N N   . MET A  1 283 ? 13.220  -4.731  37.945  1.00 27.00  ? 1301 MET A N   1 
ATOM   2120  C CA  . MET A  1 283 ? 14.033  -3.552  38.248  1.00 27.61  ? 1301 MET A CA  1 
ATOM   2121  C C   . MET A  1 283 ? 13.844  -2.413  37.249  1.00 27.40  ? 1301 MET A C   1 
ATOM   2122  O O   . MET A  1 283 ? 14.187  -1.270  37.542  1.00 27.35  ? 1301 MET A O   1 
ATOM   2123  C CB  . MET A  1 283 ? 15.518  -3.927  38.289  1.00 28.77  ? 1301 MET A CB  1 
ATOM   2124  C CG  . MET A  1 283 ? 15.938  -4.903  39.391  1.00 30.71  ? 1301 MET A CG  1 
ATOM   2125  S SD  . MET A  1 283 ? 15.910  -4.240  41.073  1.00 33.95  ? 1301 MET A SD  1 
ATOM   2126  C CE  . MET A  1 283 ? 17.116  -2.918  40.968  1.00 29.70  ? 1301 MET A CE  1 
ATOM   2127  N N   . LYS A  1 284 ? 13.319  -2.733  36.069  1.00 28.39  ? 1302 LYS A N   1 
ATOM   2128  C CA  . LYS A  1 284 ? 13.080  -1.748  35.014  1.00 31.04  ? 1302 LYS A CA  1 
ATOM   2129  C C   . LYS A  1 284 ? 14.335  -0.930  34.689  1.00 29.77  ? 1302 LYS A C   1 
ATOM   2130  O O   . LYS A  1 284 ? 14.288  0.298   34.638  1.00 28.23  ? 1302 LYS A O   1 
ATOM   2131  C CB  . LYS A  1 284 ? 11.942  -0.797  35.420  1.00 35.21  ? 1302 LYS A CB  1 
ATOM   2132  C CG  . LYS A  1 284 ? 12.311  0.210   36.509  1.00 42.05  ? 1302 LYS A CG  1 
ATOM   2133  C CD  . LYS A  1 284 ? 11.189  1.175   36.841  1.00 46.69  ? 1302 LYS A CD  1 
ATOM   2134  C CE  . LYS A  1 284 ? 11.591  2.051   38.022  1.00 49.05  ? 1302 LYS A CE  1 
ATOM   2135  N NZ  . LYS A  1 284 ? 10.471  2.894   38.529  1.00 51.09  ? 1302 LYS A NZ  1 
ATOM   2136  N N   . PHE A  1 285 ? 15.457  -1.607  34.469  1.00 28.10  ? 1303 PHE A N   1 
ATOM   2137  C CA  . PHE A  1 285 ? 16.697  -0.905  34.153  1.00 28.77  ? 1303 PHE A CA  1 
ATOM   2138  C C   . PHE A  1 285 ? 16.596  -0.268  32.775  1.00 31.29  ? 1303 PHE A C   1 
ATOM   2139  O O   . PHE A  1 285 ? 15.738  -0.627  31.990  1.00 31.69  ? 1303 PHE A O   1 
ATOM   2140  C CB  . PHE A  1 285 ? 17.887  -1.868  34.159  1.00 25.64  ? 1303 PHE A CB  1 
ATOM   2141  C CG  . PHE A  1 285 ? 18.237  -2.401  35.516  1.00 23.70  ? 1303 PHE A CG  1 
ATOM   2142  C CD1 . PHE A  1 285 ? 18.121  -3.759  35.788  1.00 22.09  ? 1303 PHE A CD1 1 
ATOM   2143  C CD2 . PHE A  1 285 ? 18.710  -1.554  36.513  1.00 19.80  ? 1303 PHE A CD2 1 
ATOM   2144  C CE1 . PHE A  1 285 ? 18.476  -4.270  37.034  1.00 22.87  ? 1303 PHE A CE1 1 
ATOM   2145  C CE2 . PHE A  1 285 ? 19.067  -2.050  37.764  1.00 21.17  ? 1303 PHE A CE2 1 
ATOM   2146  C CZ  . PHE A  1 285 ? 18.950  -3.415  38.027  1.00 22.65  ? 1303 PHE A CZ  1 
ATOM   2147  N N   . LEU A  1 286 ? 17.466  0.691   32.489  1.00 32.46  ? 1304 LEU A N   1 
ATOM   2148  C CA  . LEU A  1 286 ? 17.474  1.330   31.182  1.00 34.25  ? 1304 LEU A CA  1 
ATOM   2149  C C   . LEU A  1 286 ? 16.200  2.088   30.816  1.00 34.56  ? 1304 LEU A C   1 
ATOM   2150  O O   . LEU A  1 286 ? 15.920  2.308   29.639  1.00 34.07  ? 1304 LEU A O   1 
ATOM   2151  C CB  . LEU A  1 286 ? 17.769  0.276   30.118  1.00 37.43  ? 1304 LEU A CB  1 
ATOM   2152  C CG  . LEU A  1 286 ? 19.177  -0.327  30.148  1.00 40.30  ? 1304 LEU A CG  1 
ATOM   2153  C CD1 . LEU A  1 286 ? 19.206  -1.617  29.353  1.00 43.06  ? 1304 LEU A CD1 1 
ATOM   2154  C CD2 . LEU A  1 286 ? 20.172  0.668   29.582  1.00 43.23  ? 1304 LEU A CD2 1 
ATOM   2155  N N   . SER A  1 287 ? 15.428  2.471   31.824  1.00 34.62  ? 1305 SER A N   1 
ATOM   2156  C CA  . SER A  1 287 ? 14.205  3.236   31.616  1.00 34.50  ? 1305 SER A CA  1 
ATOM   2157  C C   . SER A  1 287 ? 14.228  4.429   32.554  1.00 33.79  ? 1305 SER A C   1 
ATOM   2158  O O   . SER A  1 287 ? 14.759  4.340   33.658  1.00 34.45  ? 1305 SER A O   1 
ATOM   2159  C CB  . SER A  1 287 ? 12.973  2.391   31.921  1.00 35.49  ? 1305 SER A CB  1 
ATOM   2160  O OG  . SER A  1 287 ? 12.545  1.681   30.778  1.00 38.86  ? 1305 SER A OG  1 
ATOM   2161  N N   . LEU A  1 288 ? 13.660  5.546   32.118  1.00 32.31  ? 1306 LEU A N   1 
ATOM   2162  C CA  . LEU A  1 288 ? 13.631  6.731   32.959  1.00 32.92  ? 1306 LEU A CA  1 
ATOM   2163  C C   . LEU A  1 288 ? 12.460  6.639   33.927  1.00 32.60  ? 1306 LEU A C   1 
ATOM   2164  O O   . LEU A  1 288 ? 11.307  6.653   33.509  1.00 31.01  ? 1306 LEU A O   1 
ATOM   2165  C CB  . LEU A  1 288 ? 13.478  7.991   32.108  1.00 34.60  ? 1306 LEU A CB  1 
ATOM   2166  C CG  . LEU A  1 288 ? 13.538  9.314   32.877  1.00 35.51  ? 1306 LEU A CG  1 
ATOM   2167  C CD1 . LEU A  1 288 ? 14.918  9.490   33.482  1.00 36.10  ? 1306 LEU A CD1 1 
ATOM   2168  C CD2 . LEU A  1 288 ? 13.219  10.468  31.941  1.00 37.34  ? 1306 LEU A CD2 1 
ATOM   2169  N N   . ASP A  1 289 ? 12.758  6.541   35.218  1.00 33.03  ? 1307 ASP A N   1 
ATOM   2170  C CA  . ASP A  1 289 ? 11.713  6.463   36.236  1.00 34.58  ? 1307 ASP A CA  1 
ATOM   2171  C C   . ASP A  1 289 ? 11.120  7.861   36.458  1.00 34.33  ? 1307 ASP A C   1 
ATOM   2172  O O   . ASP A  1 289 ? 11.809  8.772   36.922  1.00 34.15  ? 1307 ASP A O   1 
ATOM   2173  C CB  . ASP A  1 289 ? 12.299  5.928   37.544  1.00 35.70  ? 1307 ASP A CB  1 
ATOM   2174  C CG  . ASP A  1 289 ? 11.246  5.713   38.613  1.00 39.28  ? 1307 ASP A CG  1 
ATOM   2175  O OD1 . ASP A  1 289 ? 11.622  5.378   39.758  1.00 41.57  ? 1307 ASP A OD1 1 
ATOM   2176  O OD2 . ASP A  1 289 ? 10.044  5.875   38.312  1.00 40.06  ? 1307 ASP A OD2 1 
ATOM   2177  N N   . LEU A  1 290 ? 9.841   8.018   36.128  1.00 33.13  ? 1308 LEU A N   1 
ATOM   2178  C CA  . LEU A  1 290 ? 9.151   9.299   36.260  1.00 33.99  ? 1308 LEU A CA  1 
ATOM   2179  C C   . LEU A  1 290 ? 8.429   9.468   37.590  1.00 35.38  ? 1308 LEU A C   1 
ATOM   2180  O O   . LEU A  1 290 ? 7.753   10.471  37.812  1.00 35.54  ? 1308 LEU A O   1 
ATOM   2181  C CB  . LEU A  1 290 ? 8.131   9.451   35.127  1.00 33.28  ? 1308 LEU A CB  1 
ATOM   2182  C CG  . LEU A  1 290 ? 8.656   9.319   33.694  1.00 35.21  ? 1308 LEU A CG  1 
ATOM   2183  C CD1 . LEU A  1 290 ? 7.505   9.437   32.711  1.00 34.43  ? 1308 LEU A CD1 1 
ATOM   2184  C CD2 . LEU A  1 290 ? 9.695   10.399  33.427  1.00 35.02  ? 1308 LEU A CD2 1 
ATOM   2185  N N   . GLN A  1 291 ? 8.581   8.496   38.478  1.00 37.16  ? 1309 GLN A N   1 
ATOM   2186  C CA  . GLN A  1 291 ? 7.896   8.537   39.763  1.00 40.24  ? 1309 GLN A CA  1 
ATOM   2187  C C   . GLN A  1 291 ? 8.870   8.483   40.937  1.00 40.33  ? 1309 GLN A C   1 
ATOM   2188  O O   . GLN A  1 291 ? 9.779   7.656   40.965  1.00 41.05  ? 1309 GLN A O   1 
ATOM   2189  C CB  . GLN A  1 291 ? 6.905   7.363   39.815  1.00 41.93  ? 1309 GLN A CB  1 
ATOM   2190  C CG  . GLN A  1 291 ? 5.919   7.350   40.970  1.00 45.90  ? 1309 GLN A CG  1 
ATOM   2191  C CD  . GLN A  1 291 ? 6.564   6.955   42.277  1.00 47.51  ? 1309 GLN A CD  1 
ATOM   2192  O OE1 . GLN A  1 291 ? 7.540   6.202   42.293  1.00 49.20  ? 1309 GLN A OE1 1 
ATOM   2193  N NE2 . GLN A  1 291 ? 6.015   7.448   43.387  1.00 48.40  ? 1309 GLN A NE2 1 
ATOM   2194  N N   . GLY A  1 292 ? 8.683   9.382   41.898  1.00 41.10  ? 1310 GLY A N   1 
ATOM   2195  C CA  . GLY A  1 292 ? 9.542   9.398   43.070  1.00 42.18  ? 1310 GLY A CA  1 
ATOM   2196  C C   . GLY A  1 292 ? 10.727  10.343  43.012  1.00 42.79  ? 1310 GLY A C   1 
ATOM   2197  O O   . GLY A  1 292 ? 10.750  11.284  42.216  1.00 42.67  ? 1310 GLY A O   1 
ATOM   2198  N N   . ASP A  1 293 ? 11.708  10.088  43.874  1.00 43.11  ? 1311 ASP A N   1 
ATOM   2199  C CA  . ASP A  1 293 ? 12.917  10.901  43.950  1.00 43.73  ? 1311 ASP A CA  1 
ATOM   2200  C C   . ASP A  1 293 ? 13.924  10.391  42.925  1.00 42.77  ? 1311 ASP A C   1 
ATOM   2201  O O   . ASP A  1 293 ? 14.481  9.302   43.077  1.00 42.00  ? 1311 ASP A O   1 
ATOM   2202  C CB  . ASP A  1 293 ? 13.528  10.817  45.352  1.00 44.86  ? 1311 ASP A CB  1 
ATOM   2203  C CG  . ASP A  1 293 ? 14.632  11.836  45.569  1.00 47.49  ? 1311 ASP A CG  1 
ATOM   2204  O OD1 . ASP A  1 293 ? 15.496  11.978  44.679  1.00 48.05  ? 1311 ASP A OD1 1 
ATOM   2205  O OD2 . ASP A  1 293 ? 14.642  12.491  46.633  1.00 49.50  ? 1311 ASP A OD2 1 
ATOM   2206  N N   . PRO A  1 294 ? 14.180  11.182  41.872  1.00 41.73  ? 1312 PRO A N   1 
ATOM   2207  C CA  . PRO A  1 294 ? 15.122  10.810  40.813  1.00 41.34  ? 1312 PRO A CA  1 
ATOM   2208  C C   . PRO A  1 294 ? 16.523  10.440  41.299  1.00 42.17  ? 1312 PRO A C   1 
ATOM   2209  O O   . PRO A  1 294 ? 17.286  9.801   40.573  1.00 42.36  ? 1312 PRO A O   1 
ATOM   2210  C CB  . PRO A  1 294 ? 15.119  12.037  39.905  1.00 40.49  ? 1312 PRO A CB  1 
ATOM   2211  C CG  . PRO A  1 294 ? 14.837  13.151  40.853  1.00 41.50  ? 1312 PRO A CG  1 
ATOM   2212  C CD  . PRO A  1 294 ? 13.739  12.578  41.708  1.00 40.59  ? 1312 PRO A CD  1 
ATOM   2213  N N   . ARG A  1 295 ? 16.859  10.835  42.523  1.00 42.03  ? 1313 ARG A N   1 
ATOM   2214  C CA  . ARG A  1 295 ? 18.170  10.524  43.080  1.00 43.06  ? 1313 ARG A CA  1 
ATOM   2215  C C   . ARG A  1 295 ? 18.262  9.076   43.541  1.00 43.54  ? 1313 ARG A C   1 
ATOM   2216  O O   . ARG A  1 295 ? 19.328  8.608   43.932  1.00 44.73  ? 1313 ARG A O   1 
ATOM   2217  C CB  . ARG A  1 295 ? 18.489  11.462  44.243  1.00 43.73  ? 1313 ARG A CB  1 
ATOM   2218  C CG  . ARG A  1 295 ? 18.745  12.895  43.807  1.00 45.95  ? 1313 ARG A CG  1 
ATOM   2219  C CD  . ARG A  1 295 ? 18.847  13.825  44.995  1.00 47.35  ? 1313 ARG A CD  1 
ATOM   2220  N NE  . ARG A  1 295 ? 17.641  13.759  45.815  1.00 50.09  ? 1313 ARG A NE  1 
ATOM   2221  C CZ  . ARG A  1 295 ? 17.386  14.566  46.838  1.00 52.21  ? 1313 ARG A CZ  1 
ATOM   2222  N NH1 . ARG A  1 295 ? 18.256  15.512  47.173  1.00 52.79  ? 1313 ARG A NH1 1 
ATOM   2223  N NH2 . ARG A  1 295 ? 16.261  14.425  47.527  1.00 52.75  ? 1313 ARG A NH2 1 
ATOM   2224  N N   . GLU A  1 296 ? 17.144  8.363   43.493  1.00 44.12  ? 1314 GLU A N   1 
ATOM   2225  C CA  . GLU A  1 296 ? 17.134  6.965   43.900  1.00 44.76  ? 1314 GLU A CA  1 
ATOM   2226  C C   . GLU A  1 296 ? 16.934  6.066   42.683  1.00 43.53  ? 1314 GLU A C   1 
ATOM   2227  O O   . GLU A  1 296 ? 16.854  4.843   42.804  1.00 42.80  ? 1314 GLU A O   1 
ATOM   2228  C CB  . GLU A  1 296 ? 16.026  6.718   44.925  1.00 47.28  ? 1314 GLU A CB  1 
ATOM   2229  C CG  . GLU A  1 296 ? 16.059  7.680   46.102  1.00 52.06  ? 1314 GLU A CG  1 
ATOM   2230  C CD  . GLU A  1 296 ? 15.219  7.204   47.270  1.00 55.02  ? 1314 GLU A CD  1 
ATOM   2231  O OE1 . GLU A  1 296 ? 14.021  6.906   47.067  1.00 56.42  ? 1314 GLU A OE1 1 
ATOM   2232  O OE2 . GLU A  1 296 ? 15.760  7.131   48.395  1.00 56.38  ? 1314 GLU A OE2 1 
ATOM   2233  N N   . SER A  1 297 ? 16.858  6.685   41.509  1.00 41.41  ? 1315 SER A N   1 
ATOM   2234  C CA  . SER A  1 297 ? 16.669  5.952   40.264  1.00 40.98  ? 1315 SER A CA  1 
ATOM   2235  C C   . SER A  1 297 ? 17.958  5.252   39.854  1.00 40.46  ? 1315 SER A C   1 
ATOM   2236  O O   . SER A  1 297 ? 19.030  5.854   39.854  1.00 39.81  ? 1315 SER A O   1 
ATOM   2237  C CB  . SER A  1 297 ? 16.232  6.904   39.152  1.00 40.37  ? 1315 SER A CB  1 
ATOM   2238  O OG  . SER A  1 297 ? 15.047  7.591   39.514  1.00 41.63  ? 1315 SER A OG  1 
ATOM   2239  N N   . GLN A  1 298 ? 17.841  3.977   39.502  1.00 39.71  ? 1316 GLN A N   1 
ATOM   2240  C CA  . GLN A  1 298 ? 18.990  3.184   39.087  1.00 38.58  ? 1316 GLN A CA  1 
ATOM   2241  C C   . GLN A  1 298 ? 18.711  2.532   37.735  1.00 35.49  ? 1316 GLN A C   1 
ATOM   2242  O O   . GLN A  1 298 ? 18.238  1.397   37.672  1.00 34.20  ? 1316 GLN A O   1 
ATOM   2243  C CB  . GLN A  1 298 ? 19.277  2.109   40.135  1.00 41.76  ? 1316 GLN A CB  1 
ATOM   2244  C CG  . GLN A  1 298 ? 20.402  1.158   39.763  1.00 46.36  ? 1316 GLN A CG  1 
ATOM   2245  C CD  . GLN A  1 298 ? 21.747  1.848   39.610  1.00 49.60  ? 1316 GLN A CD  1 
ATOM   2246  O OE1 . GLN A  1 298 ? 22.767  1.191   39.398  1.00 51.54  ? 1316 GLN A OE1 1 
ATOM   2247  N NE2 . GLN A  1 298 ? 21.757  3.175   39.718  1.00 51.62  ? 1316 GLN A NE2 1 
ATOM   2248  N N   . PRO A  1 299 ? 19.003  3.244   36.635  1.00 33.00  ? 1317 PRO A N   1 
ATOM   2249  C CA  . PRO A  1 299 ? 18.774  2.732   35.283  1.00 31.51  ? 1317 PRO A CA  1 
ATOM   2250  C C   . PRO A  1 299 ? 19.713  1.628   34.807  1.00 30.71  ? 1317 PRO A C   1 
ATOM   2251  O O   . PRO A  1 299 ? 19.327  0.814   33.974  1.00 28.04  ? 1317 PRO A O   1 
ATOM   2252  C CB  . PRO A  1 299 ? 18.870  3.989   34.424  1.00 32.32  ? 1317 PRO A CB  1 
ATOM   2253  C CG  . PRO A  1 299 ? 19.902  4.788   35.139  1.00 32.62  ? 1317 PRO A CG  1 
ATOM   2254  C CD  . PRO A  1 299 ? 19.493  4.635   36.588  1.00 34.29  ? 1317 PRO A CD  1 
ATOM   2255  N N   . LEU A  1 300 ? 20.940  1.590   35.317  1.00 31.25  ? 1318 LEU A N   1 
ATOM   2256  C CA  . LEU A  1 300 ? 21.877  0.558   34.883  1.00 32.85  ? 1318 LEU A CA  1 
ATOM   2257  C C   . LEU A  1 300 ? 22.700  -0.006  36.032  1.00 33.49  ? 1318 LEU A C   1 
ATOM   2258  O O   . LEU A  1 300 ? 22.807  0.604   37.093  1.00 34.27  ? 1318 LEU A O   1 
ATOM   2259  C CB  . LEU A  1 300 ? 22.851  1.118   33.837  1.00 33.65  ? 1318 LEU A CB  1 
ATOM   2260  C CG  . LEU A  1 300 ? 22.423  2.232   32.872  1.00 34.67  ? 1318 LEU A CG  1 
ATOM   2261  C CD1 . LEU A  1 300 ? 23.546  2.514   31.895  1.00 34.10  ? 1318 LEU A CD1 1 
ATOM   2262  C CD2 . LEU A  1 300 ? 21.185  1.832   32.117  1.00 33.96  ? 1318 LEU A CD2 1 
ATOM   2263  N N   . LEU A  1 301 ? 23.271  -1.183  35.808  1.00 31.83  ? 1319 LEU A N   1 
ATOM   2264  C CA  . LEU A  1 301 ? 24.147  -1.825  36.780  1.00 32.32  ? 1319 LEU A CA  1 
ATOM   2265  C C   . LEU A  1 301 ? 25.497  -1.720  36.091  1.00 30.84  ? 1319 LEU A C   1 
ATOM   2266  O O   . LEU A  1 301 ? 25.715  -2.365  35.067  1.00 32.76  ? 1319 LEU A O   1 
ATOM   2267  C CB  . LEU A  1 301 ? 23.783  -3.298  36.965  1.00 33.62  ? 1319 LEU A CB  1 
ATOM   2268  C CG  . LEU A  1 301 ? 22.440  -3.596  37.621  1.00 35.45  ? 1319 LEU A CG  1 
ATOM   2269  C CD1 . LEU A  1 301 ? 22.173  -5.090  37.590  1.00 36.04  ? 1319 LEU A CD1 1 
ATOM   2270  C CD2 . LEU A  1 301 ? 22.451  -3.074  39.051  1.00 36.85  ? 1319 LEU A CD2 1 
ATOM   2271  N N   . GLY A  1 302 ? 26.402  -0.916  36.634  1.00 27.93  ? 1320 GLY A N   1 
ATOM   2272  C CA  . GLY A  1 302 ? 27.678  -0.764  35.968  1.00 24.62  ? 1320 GLY A CA  1 
ATOM   2273  C C   . GLY A  1 302 ? 28.969  -0.903  36.740  1.00 21.98  ? 1320 GLY A C   1 
ATOM   2274  O O   . GLY A  1 302 ? 29.061  -1.598  37.749  1.00 22.13  ? 1320 GLY A O   1 
ATOM   2275  N N   . THR A  1 303 ? 29.978  -0.216  36.220  1.00 20.80  ? 1321 THR A N   1 
ATOM   2276  C CA  . THR A  1 303 ? 31.329  -0.207  36.758  1.00 18.11  ? 1321 THR A CA  1 
ATOM   2277  C C   . THR A  1 303 ? 31.396  0.345   38.178  1.00 18.04  ? 1321 THR A C   1 
ATOM   2278  O O   . THR A  1 303 ? 30.739  1.330   38.496  1.00 19.30  ? 1321 THR A O   1 
ATOM   2279  C CB  . THR A  1 303 ? 32.236  0.646   35.844  1.00 16.74  ? 1321 THR A CB  1 
ATOM   2280  O OG1 . THR A  1 303 ? 32.019  0.267   34.476  1.00 16.91  ? 1321 THR A OG1 1 
ATOM   2281  C CG2 . THR A  1 303 ? 33.701  0.461   36.204  1.00 14.30  ? 1321 THR A CG2 1 
ATOM   2282  N N   . VAL A  1 304 ? 32.191  -0.299  39.024  1.00 17.67  ? 1322 VAL A N   1 
ATOM   2283  C CA  . VAL A  1 304 ? 32.370  0.152   40.397  1.00 19.95  ? 1322 VAL A CA  1 
ATOM   2284  C C   . VAL A  1 304 ? 33.866  0.210   40.685  1.00 21.65  ? 1322 VAL A C   1 
ATOM   2285  O O   . VAL A  1 304 ? 34.669  -0.332  39.924  1.00 21.61  ? 1322 VAL A O   1 
ATOM   2286  C CB  . VAL A  1 304 ? 31.710  -0.814  41.423  1.00 21.83  ? 1322 VAL A CB  1 
ATOM   2287  C CG1 . VAL A  1 304 ? 30.222  -0.956  41.123  1.00 20.40  ? 1322 VAL A CG1 1 
ATOM   2288  C CG2 . VAL A  1 304 ? 32.408  -2.183  41.391  1.00 19.85  ? 1322 VAL A CG2 1 
ATOM   2289  N N   . ILE A  1 305 ? 34.240  0.886   41.767  1.00 21.16  ? 1323 ILE A N   1 
ATOM   2290  C CA  . ILE A  1 305 ? 35.642  0.970   42.164  1.00 22.49  ? 1323 ILE A CA  1 
ATOM   2291  C C   . ILE A  1 305 ? 35.858  -0.218  43.101  1.00 25.10  ? 1323 ILE A C   1 
ATOM   2292  O O   . ILE A  1 305 ? 35.592  -0.130  44.299  1.00 25.24  ? 1323 ILE A O   1 
ATOM   2293  C CB  . ILE A  1 305 ? 35.932  2.286   42.915  1.00 22.10  ? 1323 ILE A CB  1 
ATOM   2294  C CG1 . ILE A  1 305 ? 35.339  3.462   42.140  1.00 21.93  ? 1323 ILE A CG1 1 
ATOM   2295  C CG2 . ILE A  1 305 ? 37.429  2.468   43.094  1.00 20.50  ? 1323 ILE A CG2 1 
ATOM   2296  C CD1 . ILE A  1 305 ? 35.760  3.521   40.685  1.00 21.61  ? 1323 ILE A CD1 1 
ATOM   2297  N N   . ASP A  1 306 ? 36.342  -1.324  42.541  1.00 26.75  ? 1324 ASP A N   1 
ATOM   2298  C CA  . ASP A  1 306 ? 36.551  -2.570  43.278  1.00 27.17  ? 1324 ASP A CA  1 
ATOM   2299  C C   . ASP A  1 306 ? 37.900  -2.786  43.954  1.00 27.97  ? 1324 ASP A C   1 
ATOM   2300  O O   . ASP A  1 306 ? 38.008  -3.602  44.868  1.00 29.91  ? 1324 ASP A O   1 
ATOM   2301  C CB  . ASP A  1 306 ? 36.295  -3.758  42.347  1.00 28.65  ? 1324 ASP A CB  1 
ATOM   2302  C CG  . ASP A  1 306 ? 37.229  -3.767  41.141  1.00 28.98  ? 1324 ASP A CG  1 
ATOM   2303  O OD1 . ASP A  1 306 ? 37.464  -4.856  40.578  1.00 28.47  ? 1324 ASP A OD1 1 
ATOM   2304  O OD2 . ASP A  1 306 ? 37.722  -2.685  40.751  1.00 28.68  ? 1324 ASP A OD2 1 
ATOM   2305  N N   . GLY A  1 307 ? 38.931  -2.086  43.499  1.00 26.85  ? 1325 GLY A N   1 
ATOM   2306  C CA  . GLY A  1 307 ? 40.243  -2.258  44.093  1.00 26.46  ? 1325 GLY A CA  1 
ATOM   2307  C C   . GLY A  1 307 ? 41.088  -3.275  43.345  1.00 26.47  ? 1325 GLY A C   1 
ATOM   2308  O O   . GLY A  1 307 ? 42.224  -3.557  43.727  1.00 26.26  ? 1325 GLY A O   1 
ATOM   2309  N N   . MET A  1 308 ? 40.525  -3.835  42.280  1.00 26.51  ? 1326 MET A N   1 
ATOM   2310  C CA  . MET A  1 308 ? 41.224  -4.813  41.454  1.00 26.66  ? 1326 MET A CA  1 
ATOM   2311  C C   . MET A  1 308 ? 41.391  -4.201  40.066  1.00 24.94  ? 1326 MET A C   1 
ATOM   2312  O O   . MET A  1 308 ? 42.504  -3.920  39.624  1.00 24.07  ? 1326 MET A O   1 
ATOM   2313  C CB  . MET A  1 308 ? 40.411  -6.109  41.350  1.00 30.76  ? 1326 MET A CB  1 
ATOM   2314  C CG  . MET A  1 308 ? 40.241  -6.866  42.660  1.00 36.47  ? 1326 MET A CG  1 
ATOM   2315  S SD  . MET A  1 308 ? 41.808  -7.426  43.360  1.00 41.71  ? 1326 MET A SD  1 
ATOM   2316  C CE  . MET A  1 308 ? 42.124  -8.855  42.352  1.00 41.44  ? 1326 MET A CE  1 
ATOM   2317  N N   . LEU A  1 309 ? 40.270  -3.999  39.386  1.00 23.02  ? 1327 LEU A N   1 
ATOM   2318  C CA  . LEU A  1 309 ? 40.272  -3.404  38.059  1.00 24.23  ? 1327 LEU A CA  1 
ATOM   2319  C C   . LEU A  1 309 ? 40.595  -1.921  38.205  1.00 24.48  ? 1327 LEU A C   1 
ATOM   2320  O O   . LEU A  1 309 ? 41.460  -1.389  37.509  1.00 25.67  ? 1327 LEU A O   1 
ATOM   2321  C CB  . LEU A  1 309 ? 38.898  -3.566  37.406  1.00 23.59  ? 1327 LEU A CB  1 
ATOM   2322  C CG  . LEU A  1 309 ? 38.736  -2.920  36.030  1.00 24.15  ? 1327 LEU A CG  1 
ATOM   2323  C CD1 . LEU A  1 309 ? 39.396  -3.790  34.968  1.00 25.57  ? 1327 LEU A CD1 1 
ATOM   2324  C CD2 . LEU A  1 309 ? 37.261  -2.739  35.731  1.00 23.84  ? 1327 LEU A CD2 1 
ATOM   2325  N N   . LEU A  1 310 ? 39.885  -1.263  39.117  1.00 23.93  ? 1328 LEU A N   1 
ATOM   2326  C CA  . LEU A  1 310 ? 40.074  0.158   39.383  1.00 23.76  ? 1328 LEU A CA  1 
ATOM   2327  C C   . LEU A  1 310 ? 40.421  0.376   40.854  1.00 25.35  ? 1328 LEU A C   1 
ATOM   2328  O O   . LEU A  1 310 ? 39.727  -0.117  41.743  1.00 24.94  ? 1328 LEU A O   1 
ATOM   2329  C CB  . LEU A  1 310 ? 38.800  0.934   39.033  1.00 23.13  ? 1328 LEU A CB  1 
ATOM   2330  C CG  . LEU A  1 310 ? 38.403  0.975   37.554  1.00 24.55  ? 1328 LEU A CG  1 
ATOM   2331  C CD1 . LEU A  1 310 ? 37.117  1.772   37.395  1.00 23.98  ? 1328 LEU A CD1 1 
ATOM   2332  C CD2 . LEU A  1 310 ? 39.526  1.601   36.734  1.00 23.52  ? 1328 LEU A CD2 1 
ATOM   2333  N N   . LEU A  1 311 ? 41.494  1.120   41.105  1.00 26.29  ? 1329 LEU A N   1 
ATOM   2334  C CA  . LEU A  1 311 ? 41.928  1.391   42.471  1.00 27.95  ? 1329 LEU A CA  1 
ATOM   2335  C C   . LEU A  1 311 ? 41.352  2.701   43.003  1.00 26.22  ? 1329 LEU A C   1 
ATOM   2336  O O   . LEU A  1 311 ? 41.295  2.920   44.210  1.00 27.16  ? 1329 LEU A O   1 
ATOM   2337  C CB  . LEU A  1 311 ? 43.456  1.436   42.524  1.00 30.68  ? 1329 LEU A CB  1 
ATOM   2338  C CG  . LEU A  1 311 ? 44.177  0.185   42.006  1.00 34.91  ? 1329 LEU A CG  1 
ATOM   2339  C CD1 . LEU A  1 311 ? 45.680  0.409   42.021  1.00 34.62  ? 1329 LEU A CD1 1 
ATOM   2340  C CD2 . LEU A  1 311 ? 43.806  -1.013  42.864  1.00 36.34  ? 1329 LEU A CD2 1 
ATOM   2341  N N   . LYS A  1 312 ? 40.923  3.567   42.094  1.00 25.64  ? 1330 LYS A N   1 
ATOM   2342  C CA  . LYS A  1 312 ? 40.354  4.862   42.461  1.00 23.91  ? 1330 LYS A CA  1 
ATOM   2343  C C   . LYS A  1 312 ? 39.330  5.255   41.409  1.00 22.51  ? 1330 LYS A C   1 
ATOM   2344  O O   . LYS A  1 312 ? 39.199  4.590   40.382  1.00 20.65  ? 1330 LYS A O   1 
ATOM   2345  C CB  . LYS A  1 312 ? 41.448  5.937   42.494  1.00 26.90  ? 1330 LYS A CB  1 
ATOM   2346  C CG  . LYS A  1 312 ? 42.641  5.626   43.379  1.00 30.25  ? 1330 LYS A CG  1 
ATOM   2347  C CD  . LYS A  1 312 ? 43.666  6.751   43.303  1.00 34.46  ? 1330 LYS A CD  1 
ATOM   2348  C CE  . LYS A  1 312 ? 44.857  6.487   44.216  1.00 37.25  ? 1330 LYS A CE  1 
ATOM   2349  N NZ  . LYS A  1 312 ? 45.856  7.599   44.164  1.00 39.91  ? 1330 LYS A NZ  1 
ATOM   2350  N N   . THR A  1 313 ? 38.612  6.344   41.657  1.00 20.61  ? 1331 THR A N   1 
ATOM   2351  C CA  . THR A  1 313 ? 37.622  6.812   40.698  1.00 20.53  ? 1331 THR A CA  1 
ATOM   2352  C C   . THR A  1 313 ? 38.349  7.246   39.432  1.00 20.85  ? 1331 THR A C   1 
ATOM   2353  O O   . THR A  1 313 ? 39.516  7.644   39.479  1.00 19.57  ? 1331 THR A O   1 
ATOM   2354  C CB  . THR A  1 313 ? 36.855  8.026   41.218  1.00 21.55  ? 1331 THR A CB  1 
ATOM   2355  O OG1 . THR A  1 313 ? 37.774  9.104   41.434  1.00 23.30  ? 1331 THR A OG1 1 
ATOM   2356  C CG2 . THR A  1 313 ? 36.132  7.693   42.526  1.00 23.57  ? 1331 THR A CG2 1 
ATOM   2357  N N   . PRO A  1 314 ? 37.674  7.164   38.280  1.00 21.23  ? 1332 PRO A N   1 
ATOM   2358  C CA  . PRO A  1 314 ? 38.298  7.568   37.017  1.00 22.92  ? 1332 PRO A CA  1 
ATOM   2359  C C   . PRO A  1 314 ? 38.806  9.009   37.095  1.00 26.28  ? 1332 PRO A C   1 
ATOM   2360  O O   . PRO A  1 314 ? 39.854  9.337   36.536  1.00 27.73  ? 1332 PRO A O   1 
ATOM   2361  C CB  . PRO A  1 314 ? 37.164  7.402   36.011  1.00 21.15  ? 1332 PRO A CB  1 
ATOM   2362  C CG  . PRO A  1 314 ? 36.417  6.225   36.567  1.00 21.75  ? 1332 PRO A CG  1 
ATOM   2363  C CD  . PRO A  1 314 ? 36.354  6.553   38.044  1.00 20.11  ? 1332 PRO A CD  1 
ATOM   2364  N N   . GLU A  1 315 ? 38.065  9.869   37.789  1.00 27.69  ? 1333 GLU A N   1 
ATOM   2365  C CA  . GLU A  1 315 ? 38.475  11.263  37.929  1.00 32.34  ? 1333 GLU A CA  1 
ATOM   2366  C C   . GLU A  1 315 ? 39.826  11.366  38.631  1.00 33.13  ? 1333 GLU A C   1 
ATOM   2367  O O   . GLU A  1 315 ? 40.688  12.142  38.220  1.00 32.31  ? 1333 GLU A O   1 
ATOM   2368  C CB  . GLU A  1 315 ? 37.428  12.065  38.707  1.00 34.98  ? 1333 GLU A CB  1 
ATOM   2369  C CG  . GLU A  1 315 ? 36.197  12.434  37.890  1.00 40.47  ? 1333 GLU A CG  1 
ATOM   2370  C CD  . GLU A  1 315 ? 35.111  11.376  37.929  1.00 44.41  ? 1333 GLU A CD  1 
ATOM   2371  O OE1 . GLU A  1 315 ? 35.433  10.170  37.835  1.00 46.22  ? 1333 GLU A OE1 1 
ATOM   2372  O OE2 . GLU A  1 315 ? 33.923  11.755  38.045  1.00 46.20  ? 1333 GLU A OE2 1 
ATOM   2373  N N   . GLU A  1 316 ? 40.011  10.582  39.688  1.00 32.92  ? 1334 GLU A N   1 
ATOM   2374  C CA  . GLU A  1 316 ? 41.269  10.597  40.420  1.00 35.53  ? 1334 GLU A CA  1 
ATOM   2375  C C   . GLU A  1 316 ? 42.402  9.926   39.646  1.00 35.35  ? 1334 GLU A C   1 
ATOM   2376  O O   . GLU A  1 316 ? 43.559  10.318  39.774  1.00 35.64  ? 1334 GLU A O   1 
ATOM   2377  C CB  . GLU A  1 316 ? 41.112  9.896   41.771  1.00 38.60  ? 1334 GLU A CB  1 
ATOM   2378  C CG  . GLU A  1 316 ? 40.220  10.620  42.762  1.00 42.98  ? 1334 GLU A CG  1 
ATOM   2379  C CD  . GLU A  1 316 ? 40.180  9.928   44.114  1.00 47.48  ? 1334 GLU A CD  1 
ATOM   2380  O OE1 . GLU A  1 316 ? 41.259  9.745   44.722  1.00 49.68  ? 1334 GLU A OE1 1 
ATOM   2381  O OE2 . GLU A  1 316 ? 39.072  9.568   44.571  1.00 49.34  ? 1334 GLU A OE2 1 
ATOM   2382  N N   . LEU A  1 317 ? 42.065  8.920   38.844  1.00 34.92  ? 1335 LEU A N   1 
ATOM   2383  C CA  . LEU A  1 317 ? 43.060  8.177   38.072  1.00 34.94  ? 1335 LEU A CA  1 
ATOM   2384  C C   . LEU A  1 317 ? 43.634  8.890   36.857  1.00 37.16  ? 1335 LEU A C   1 
ATOM   2385  O O   . LEU A  1 317 ? 44.794  8.682   36.505  1.00 38.73  ? 1335 LEU A O   1 
ATOM   2386  C CB  . LEU A  1 317 ? 42.479  6.837   37.615  1.00 31.48  ? 1335 LEU A CB  1 
ATOM   2387  C CG  . LEU A  1 317 ? 42.290  5.748   38.670  1.00 29.29  ? 1335 LEU A CG  1 
ATOM   2388  C CD1 . LEU A  1 317 ? 41.593  4.559   38.037  1.00 26.07  ? 1335 LEU A CD1 1 
ATOM   2389  C CD2 . LEU A  1 317 ? 43.642  5.333   39.240  1.00 25.95  ? 1335 LEU A CD2 1 
ATOM   2390  N N   . GLN A  1 318 ? 42.834  9.721   36.205  1.00 37.60  ? 1336 GLN A N   1 
ATOM   2391  C CA  . GLN A  1 318 ? 43.312  10.402  35.014  1.00 39.82  ? 1336 GLN A CA  1 
ATOM   2392  C C   . GLN A  1 318 ? 44.315  11.499  35.332  1.00 39.86  ? 1336 GLN A C   1 
ATOM   2393  O O   . GLN A  1 318 ? 44.821  12.164  34.432  1.00 39.87  ? 1336 GLN A O   1 
ATOM   2394  C CB  . GLN A  1 318 ? 42.135  10.966  34.227  1.00 39.35  ? 1336 GLN A CB  1 
ATOM   2395  C CG  . GLN A  1 318 ? 41.288  11.945  34.999  1.00 39.66  ? 1336 GLN A CG  1 
ATOM   2396  C CD  . GLN A  1 318 ? 40.056  12.340  34.232  1.00 40.48  ? 1336 GLN A CD  1 
ATOM   2397  O OE1 . GLN A  1 318 ? 39.239  13.121  34.711  1.00 43.70  ? 1336 GLN A OE1 1 
ATOM   2398  N NE2 . GLN A  1 318 ? 39.912  11.801  33.027  1.00 40.04  ? 1336 GLN A NE2 1 
ATOM   2399  N N   . ALA A  1 319 ? 44.597  11.675  36.619  1.00 40.54  ? 1337 ALA A N   1 
ATOM   2400  C CA  . ALA A  1 319 ? 45.560  12.668  37.078  1.00 41.38  ? 1337 ALA A CA  1 
ATOM   2401  C C   . ALA A  1 319 ? 46.949  12.023  37.135  1.00 41.40  ? 1337 ALA A C   1 
ATOM   2402  O O   . ALA A  1 319 ? 47.966  12.714  37.158  1.00 40.42  ? 1337 ALA A O   1 
ATOM   2403  C CB  . ALA A  1 319 ? 45.161  13.174  38.459  1.00 42.18  ? 1337 ALA A CB  1 
ATOM   2404  N N   . GLU A  1 320 ? 46.969  10.692  37.160  1.00 41.20  ? 1338 GLU A N   1 
ATOM   2405  C CA  . GLU A  1 320 ? 48.202  9.907   37.213  1.00 42.39  ? 1338 GLU A CA  1 
ATOM   2406  C C   . GLU A  1 320 ? 49.150  10.202  36.052  1.00 40.73  ? 1338 GLU A C   1 
ATOM   2407  O O   . GLU A  1 320 ? 48.737  10.253  34.893  1.00 40.48  ? 1338 GLU A O   1 
ATOM   2408  C CB  . GLU A  1 320 ? 47.863  8.407   37.218  1.00 44.97  ? 1338 GLU A CB  1 
ATOM   2409  C CG  . GLU A  1 320 ? 49.016  7.477   36.808  1.00 49.84  ? 1338 GLU A CG  1 
ATOM   2410  C CD  . GLU A  1 320 ? 50.109  7.355   37.865  1.00 52.51  ? 1338 GLU A CD  1 
ATOM   2411  O OE1 . GLU A  1 320 ? 50.609  8.393   38.346  1.00 55.49  ? 1338 GLU A OE1 1 
ATOM   2412  O OE2 . GLU A  1 320 ? 50.480  6.212   38.209  1.00 55.16  ? 1338 GLU A OE2 1 
ATOM   2413  N N   . ARG A  1 321 ? 50.427  10.382  36.373  1.00 39.60  ? 1339 ARG A N   1 
ATOM   2414  C CA  . ARG A  1 321 ? 51.444  10.653  35.363  1.00 39.46  ? 1339 ARG A CA  1 
ATOM   2415  C C   . ARG A  1 321 ? 52.580  9.634   35.410  1.00 37.13  ? 1339 ARG A C   1 
ATOM   2416  O O   . ARG A  1 321 ? 53.688  9.913   34.960  1.00 36.06  ? 1339 ARG A O   1 
ATOM   2417  C CB  . ARG A  1 321 ? 52.006  12.069  35.545  1.00 41.20  ? 1339 ARG A CB  1 
ATOM   2418  C CG  . ARG A  1 321 ? 51.366  13.119  34.639  1.00 45.14  ? 1339 ARG A CG  1 
ATOM   2419  C CD  . ARG A  1 321 ? 49.854  12.990  34.611  1.00 46.31  ? 1339 ARG A CD  1 
ATOM   2420  N NE  . ARG A  1 321 ? 49.218  14.053  33.841  1.00 49.01  ? 1339 ARG A NE  1 
ATOM   2421  C CZ  . ARG A  1 321 ? 47.924  14.080  33.539  1.00 51.04  ? 1339 ARG A CZ  1 
ATOM   2422  N NH1 . ARG A  1 321 ? 47.127  13.097  33.938  1.00 49.98  ? 1339 ARG A NH1 1 
ATOM   2423  N NH2 . ARG A  1 321 ? 47.422  15.096  32.852  1.00 52.06  ? 1339 ARG A NH2 1 
ATOM   2424  N N   . ASN A  1 322 ? 52.300  8.454   35.954  1.00 35.47  ? 1340 ASN A N   1 
ATOM   2425  C CA  . ASN A  1 322 ? 53.307  7.400   36.044  1.00 35.07  ? 1340 ASN A CA  1 
ATOM   2426  C C   . ASN A  1 322 ? 52.797  6.063   35.522  1.00 35.25  ? 1340 ASN A C   1 
ATOM   2427  O O   . ASN A  1 322 ? 53.476  5.043   35.649  1.00 37.54  ? 1340 ASN A O   1 
ATOM   2428  C CB  . ASN A  1 322 ? 53.773  7.213   37.492  1.00 32.97  ? 1340 ASN A CB  1 
ATOM   2429  C CG  . ASN A  1 322 ? 54.574  8.389   38.004  1.00 32.75  ? 1340 ASN A CG  1 
ATOM   2430  O OD1 . ASN A  1 322 ? 54.014  9.401   38.437  1.00 31.86  ? 1340 ASN A OD1 1 
ATOM   2431  N ND2 . ASN A  1 322 ? 55.896  8.267   37.948  1.00 31.06  ? 1340 ASN A ND2 1 
ATOM   2432  N N   . PHE A  1 323 ? 51.607  6.063   34.932  1.00 34.26  ? 1341 PHE A N   1 
ATOM   2433  C CA  . PHE A  1 323 ? 51.039  4.825   34.423  1.00 33.36  ? 1341 PHE A CA  1 
ATOM   2434  C C   . PHE A  1 323 ? 51.281  4.633   32.928  1.00 32.54  ? 1341 PHE A C   1 
ATOM   2435  O O   . PHE A  1 323 ? 51.488  5.594   32.186  1.00 31.73  ? 1341 PHE A O   1 
ATOM   2436  C CB  . PHE A  1 323 ? 49.536  4.776   34.718  1.00 33.91  ? 1341 PHE A CB  1 
ATOM   2437  C CG  . PHE A  1 323 ? 48.905  3.445   34.419  1.00 35.06  ? 1341 PHE A CG  1 
ATOM   2438  C CD1 . PHE A  1 323 ? 49.307  2.301   35.104  1.00 35.95  ? 1341 PHE A CD1 1 
ATOM   2439  C CD2 . PHE A  1 323 ? 47.919  3.330   33.444  1.00 36.06  ? 1341 PHE A CD2 1 
ATOM   2440  C CE1 . PHE A  1 323 ? 48.734  1.059   34.821  1.00 35.76  ? 1341 PHE A CE1 1 
ATOM   2441  C CE2 . PHE A  1 323 ? 47.341  2.093   33.154  1.00 35.25  ? 1341 PHE A CE2 1 
ATOM   2442  C CZ  . PHE A  1 323 ? 47.750  0.958   33.845  1.00 35.75  ? 1341 PHE A CZ  1 
ATOM   2443  N N   . HIS A  1 324 ? 51.261  3.373   32.507  1.00 32.13  ? 1342 HIS A N   1 
ATOM   2444  C CA  . HIS A  1 324 ? 51.462  2.997   31.114  1.00 32.24  ? 1342 HIS A CA  1 
ATOM   2445  C C   . HIS A  1 324 ? 50.495  3.766   30.208  1.00 31.75  ? 1342 HIS A C   1 
ATOM   2446  O O   . HIS A  1 324 ? 49.316  3.936   30.531  1.00 33.06  ? 1342 HIS A O   1 
ATOM   2447  C CB  . HIS A  1 324 ? 51.259  1.483   30.972  1.00 33.83  ? 1342 HIS A CB  1 
ATOM   2448  C CG  . HIS A  1 324 ? 51.529  0.960   29.598  1.00 34.69  ? 1342 HIS A CG  1 
ATOM   2449  N ND1 . HIS A  1 324 ? 50.524  0.670   28.702  1.00 36.50  ? 1342 HIS A ND1 1 
ATOM   2450  C CD2 . HIS A  1 324 ? 52.692  0.689   28.959  1.00 35.39  ? 1342 HIS A CD2 1 
ATOM   2451  C CE1 . HIS A  1 324 ? 51.055  0.243   27.571  1.00 35.65  ? 1342 HIS A CE1 1 
ATOM   2452  N NE2 . HIS A  1 324 ? 52.369  0.246   27.700  1.00 34.90  ? 1342 HIS A NE2 1 
ATOM   2453  N N   . THR A  1 325 ? 50.998  4.232   29.073  1.00 30.49  ? 1343 THR A N   1 
ATOM   2454  C CA  . THR A  1 325 ? 50.182  5.001   28.140  1.00 28.31  ? 1343 THR A CA  1 
ATOM   2455  C C   . THR A  1 325 ? 50.152  4.379   26.747  1.00 25.67  ? 1343 THR A C   1 
ATOM   2456  O O   . THR A  1 325 ? 51.005  3.558   26.399  1.00 27.31  ? 1343 THR A O   1 
ATOM   2457  C CB  . THR A  1 325 ? 50.718  6.450   28.002  1.00 29.03  ? 1343 THR A CB  1 
ATOM   2458  O OG1 . THR A  1 325 ? 52.031  6.424   27.420  1.00 29.47  ? 1343 THR A OG1 1 
ATOM   2459  C CG2 . THR A  1 325 ? 50.792  7.126   29.362  1.00 30.20  ? 1343 THR A CG2 1 
ATOM   2460  N N   . VAL A  1 326 ? 49.158  4.777   25.961  1.00 21.13  ? 1344 VAL A N   1 
ATOM   2461  C CA  . VAL A  1 326 ? 49.003  4.296   24.599  1.00 16.81  ? 1344 VAL A CA  1 
ATOM   2462  C C   . VAL A  1 326 ? 48.279  5.350   23.776  1.00 16.71  ? 1344 VAL A C   1 
ATOM   2463  O O   . VAL A  1 326 ? 47.601  6.218   24.326  1.00 15.02  ? 1344 VAL A O   1 
ATOM   2464  C CB  . VAL A  1 326 ? 48.160  2.987   24.535  1.00 18.67  ? 1344 VAL A CB  1 
ATOM   2465  C CG1 . VAL A  1 326 ? 48.772  1.915   25.418  1.00 19.02  ? 1344 VAL A CG1 1 
ATOM   2466  C CG2 . VAL A  1 326 ? 46.721  3.264   24.937  1.00 17.60  ? 1344 VAL A CG2 1 
ATOM   2467  N N   . PRO A  1 327 ? 48.442  5.314   22.443  1.00 16.00  ? 1345 PRO A N   1 
ATOM   2468  C CA  . PRO A  1 327 ? 47.752  6.291   21.597  1.00 14.24  ? 1345 PRO A CA  1 
ATOM   2469  C C   . PRO A  1 327 ? 46.260  6.075   21.866  1.00 14.10  ? 1345 PRO A C   1 
ATOM   2470  O O   . PRO A  1 327 ? 45.816  4.933   21.984  1.00 13.82  ? 1345 PRO A O   1 
ATOM   2471  C CB  . PRO A  1 327 ? 48.145  5.859   20.188  1.00 13.65  ? 1345 PRO A CB  1 
ATOM   2472  C CG  . PRO A  1 327 ? 49.542  5.340   20.385  1.00 14.40  ? 1345 PRO A CG  1 
ATOM   2473  C CD  . PRO A  1 327 ? 49.433  4.545   21.669  1.00 15.16  ? 1345 PRO A CD  1 
ATOM   2474  N N   . TYR A  1 328 ? 45.489  7.156   21.934  1.00 14.50  ? 1346 TYR A N   1 
ATOM   2475  C CA  . TYR A  1 328 ? 44.064  7.052   22.245  1.00 14.67  ? 1346 TYR A CA  1 
ATOM   2476  C C   . TYR A  1 328 ? 43.218  7.979   21.374  1.00 12.50  ? 1346 TYR A C   1 
ATOM   2477  O O   . TYR A  1 328 ? 43.455  9.184   21.327  1.00 14.75  ? 1346 TYR A O   1 
ATOM   2478  C CB  . TYR A  1 328 ? 43.884  7.410   23.727  1.00 13.79  ? 1346 TYR A CB  1 
ATOM   2479  C CG  . TYR A  1 328 ? 42.535  7.146   24.366  1.00 14.68  ? 1346 TYR A CG  1 
ATOM   2480  C CD1 . TYR A  1 328 ? 42.255  7.661   25.635  1.00 17.08  ? 1346 TYR A CD1 1 
ATOM   2481  C CD2 . TYR A  1 328 ? 41.564  6.351   23.748  1.00 15.66  ? 1346 TYR A CD2 1 
ATOM   2482  C CE1 . TYR A  1 328 ? 41.057  7.395   26.277  1.00 15.84  ? 1346 TYR A CE1 1 
ATOM   2483  C CE2 . TYR A  1 328 ? 40.354  6.077   24.383  1.00 16.34  ? 1346 TYR A CE2 1 
ATOM   2484  C CZ  . TYR A  1 328 ? 40.111  6.605   25.653  1.00 17.53  ? 1346 TYR A CZ  1 
ATOM   2485  O OH  . TYR A  1 328 ? 38.934  6.344   26.307  1.00 15.00  ? 1346 TYR A OH  1 
ATOM   2486  N N   . MET A  1 329 ? 42.240  7.412   20.682  1.00 12.24  ? 1347 MET A N   1 
ATOM   2487  C CA  . MET A  1 329 ? 41.343  8.200   19.846  1.00 14.30  ? 1347 MET A CA  1 
ATOM   2488  C C   . MET A  1 329 ? 40.011  8.281   20.582  1.00 14.73  ? 1347 MET A C   1 
ATOM   2489  O O   . MET A  1 329 ? 39.439  7.252   20.949  1.00 12.98  ? 1347 MET A O   1 
ATOM   2490  C CB  . MET A  1 329 ? 41.126  7.536   18.477  1.00 12.66  ? 1347 MET A CB  1 
ATOM   2491  C CG  . MET A  1 329 ? 40.097  8.269   17.599  1.00 16.02  ? 1347 MET A CG  1 
ATOM   2492  S SD  . MET A  1 329 ? 39.604  7.354   16.093  1.00 20.19  ? 1347 MET A SD  1 
ATOM   2493  C CE  . MET A  1 329 ? 41.164  7.345   15.209  1.00 17.59  ? 1347 MET A CE  1 
ATOM   2494  N N   . VAL A  1 330 ? 39.520  9.500   20.789  1.00 15.14  ? 1348 VAL A N   1 
ATOM   2495  C CA  . VAL A  1 330 ? 38.260  9.716   21.490  1.00 14.86  ? 1348 VAL A CA  1 
ATOM   2496  C C   . VAL A  1 330 ? 37.331  10.592  20.656  1.00 17.27  ? 1348 VAL A C   1 
ATOM   2497  O O   . VAL A  1 330 ? 37.702  11.703  20.279  1.00 16.92  ? 1348 VAL A O   1 
ATOM   2498  C CB  . VAL A  1 330 ? 38.495  10.421  22.848  1.00 13.94  ? 1348 VAL A CB  1 
ATOM   2499  C CG1 . VAL A  1 330 ? 37.182  10.550  23.594  1.00 13.63  ? 1348 VAL A CG1 1 
ATOM   2500  C CG2 . VAL A  1 330 ? 39.512  9.659   23.665  1.00 12.89  ? 1348 VAL A CG2 1 
ATOM   2501  N N   . GLY A  1 331 ? 36.124  10.102  20.379  1.00 16.17  ? 1349 GLY A N   1 
ATOM   2502  C CA  . GLY A  1 331 ? 35.196  10.887  19.587  1.00 17.42  ? 1349 GLY A CA  1 
ATOM   2503  C C   . GLY A  1 331 ? 33.739  10.841  20.019  1.00 17.06  ? 1349 GLY A C   1 
ATOM   2504  O O   . GLY A  1 331 ? 33.330  9.975   20.798  1.00 15.45  ? 1349 GLY A O   1 
ATOM   2505  N N   . ILE A  1 332 ? 32.960  11.790  19.503  1.00 16.26  ? 1350 ILE A N   1 
ATOM   2506  C CA  . ILE A  1 332 ? 31.531  11.883  19.799  1.00 17.36  ? 1350 ILE A CA  1 
ATOM   2507  C C   . ILE A  1 332 ? 30.739  12.162  18.534  1.00 16.75  ? 1350 ILE A C   1 
ATOM   2508  O O   . ILE A  1 332 ? 31.305  12.524  17.507  1.00 16.20  ? 1350 ILE A O   1 
ATOM   2509  C CB  . ILE A  1 332 ? 31.215  13.030  20.790  1.00 17.94  ? 1350 ILE A CB  1 
ATOM   2510  C CG1 . ILE A  1 332 ? 31.691  14.373  20.212  1.00 18.94  ? 1350 ILE A CG1 1 
ATOM   2511  C CG2 . ILE A  1 332 ? 31.857  12.752  22.139  1.00 17.10  ? 1350 ILE A CG2 1 
ATOM   2512  C CD1 . ILE A  1 332 ? 31.366  15.574  21.103  1.00 20.09  ? 1350 ILE A CD1 1 
ATOM   2513  N N   . ASN A  1 333 ? 29.426  11.971  18.614  1.00 16.68  ? 1351 ASN A N   1 
ATOM   2514  C CA  . ASN A  1 333 ? 28.553  12.240  17.484  1.00 18.95  ? 1351 ASN A CA  1 
ATOM   2515  C C   . ASN A  1 333 ? 27.903  13.588  17.745  1.00 18.52  ? 1351 ASN A C   1 
ATOM   2516  O O   . ASN A  1 333 ? 27.791  14.005  18.898  1.00 17.22  ? 1351 ASN A O   1 
ATOM   2517  C CB  . ASN A  1 333 ? 27.500  11.134  17.337  1.00 19.06  ? 1351 ASN A CB  1 
ATOM   2518  C CG  . ASN A  1 333 ? 28.104  9.841   16.827  1.00 21.91  ? 1351 ASN A CG  1 
ATOM   2519  O OD1 . ASN A  1 333 ? 29.277  9.810   16.457  1.00 24.76  ? 1351 ASN A OD1 1 
ATOM   2520  N ND2 . ASN A  1 333 ? 27.318  8.776   16.800  1.00 19.62  ? 1351 ASN A ND2 1 
ATOM   2521  N N   . LYS A  1 334 ? 27.489  14.266  16.679  1.00 17.54  ? 1352 LYS A N   1 
ATOM   2522  C CA  . LYS A  1 334 ? 26.874  15.591  16.791  1.00 20.86  ? 1352 LYS A CA  1 
ATOM   2523  C C   . LYS A  1 334 ? 25.684  15.654  17.756  1.00 20.91  ? 1352 LYS A C   1 
ATOM   2524  O O   . LYS A  1 334 ? 25.584  16.585  18.558  1.00 21.03  ? 1352 LYS A O   1 
ATOM   2525  C CB  . LYS A  1 334 ? 26.429  16.074  15.407  1.00 20.67  ? 1352 LYS A CB  1 
ATOM   2526  C CG  . LYS A  1 334 ? 26.009  17.536  15.362  1.00 25.35  ? 1352 LYS A CG  1 
ATOM   2527  C CD  . LYS A  1 334 ? 27.203  18.457  15.562  1.00 28.74  ? 1352 LYS A CD  1 
ATOM   2528  C CE  . LYS A  1 334 ? 26.780  19.920  15.527  1.00 33.69  ? 1352 LYS A CE  1 
ATOM   2529  N NZ  . LYS A  1 334 ? 26.064  20.276  14.268  1.00 36.22  ? 1352 LYS A NZ  1 
ATOM   2530  N N   . GLN A  1 335 ? 24.786  14.673  17.675  1.00 21.02  ? 1353 GLN A N   1 
ATOM   2531  C CA  . GLN A  1 335 ? 23.605  14.638  18.544  1.00 21.63  ? 1353 GLN A CA  1 
ATOM   2532  C C   . GLN A  1 335 ? 23.482  13.304  19.276  1.00 20.97  ? 1353 GLN A C   1 
ATOM   2533  O O   . GLN A  1 335 ? 22.604  12.500  18.966  1.00 19.28  ? 1353 GLN A O   1 
ATOM   2534  C CB  . GLN A  1 335 ? 22.334  14.876  17.727  1.00 24.46  ? 1353 GLN A CB  1 
ATOM   2535  C CG  . GLN A  1 335 ? 22.236  16.250  17.089  1.00 30.00  ? 1353 GLN A CG  1 
ATOM   2536  C CD  . GLN A  1 335 ? 20.964  16.409  16.275  1.00 34.21  ? 1353 GLN A CD  1 
ATOM   2537  O OE1 . GLN A  1 335 ? 19.860  16.209  16.785  1.00 37.31  ? 1353 GLN A OE1 1 
ATOM   2538  N NE2 . GLN A  1 335 ? 21.112  16.769  15.004  1.00 34.42  ? 1353 GLN A NE2 1 
ATOM   2539  N N   . GLU A  1 336 ? 24.350  13.088  20.260  1.00 20.22  ? 1354 GLU A N   1 
ATOM   2540  C CA  . GLU A  1 336 ? 24.361  11.848  21.036  1.00 21.73  ? 1354 GLU A CA  1 
ATOM   2541  C C   . GLU A  1 336 ? 23.020  11.502  21.683  1.00 20.59  ? 1354 GLU A C   1 
ATOM   2542  O O   . GLU A  1 336 ? 22.724  10.333  21.916  1.00 18.70  ? 1354 GLU A O   1 
ATOM   2543  C CB  . GLU A  1 336 ? 25.437  11.927  22.126  1.00 23.45  ? 1354 GLU A CB  1 
ATOM   2544  C CG  . GLU A  1 336 ? 26.864  12.001  21.605  1.00 25.35  ? 1354 GLU A CG  1 
ATOM   2545  C CD  . GLU A  1 336 ? 27.372  10.664  21.102  1.00 28.39  ? 1354 GLU A CD  1 
ATOM   2546  O OE1 . GLU A  1 336 ? 26.578  9.694   21.079  1.00 27.80  ? 1354 GLU A OE1 1 
ATOM   2547  O OE2 . GLU A  1 336 ? 28.567  10.583  20.729  1.00 26.42  ? 1354 GLU A OE2 1 
ATOM   2548  N N   . PHE A  1 337 ? 22.209  12.514  21.966  1.00 20.65  ? 1355 PHE A N   1 
ATOM   2549  C CA  . PHE A  1 337 ? 20.915  12.288  22.606  1.00 21.60  ? 1355 PHE A CA  1 
ATOM   2550  C C   . PHE A  1 337 ? 19.772  12.711  21.692  1.00 22.36  ? 1355 PHE A C   1 
ATOM   2551  O O   . PHE A  1 337 ? 18.693  13.071  22.159  1.00 23.48  ? 1355 PHE A O   1 
ATOM   2552  C CB  . PHE A  1 337 ? 20.859  13.076  23.918  1.00 23.66  ? 1355 PHE A CB  1 
ATOM   2553  C CG  . PHE A  1 337 ? 19.987  12.453  24.974  1.00 24.95  ? 1355 PHE A CG  1 
ATOM   2554  C CD1 . PHE A  1 337 ? 18.735  12.983  25.269  1.00 25.95  ? 1355 PHE A CD1 1 
ATOM   2555  C CD2 . PHE A  1 337 ? 20.432  11.349  25.694  1.00 25.99  ? 1355 PHE A CD2 1 
ATOM   2556  C CE1 . PHE A  1 337 ? 17.943  12.422  26.272  1.00 28.96  ? 1355 PHE A CE1 1 
ATOM   2557  C CE2 . PHE A  1 337 ? 19.648  10.778  26.698  1.00 26.90  ? 1355 PHE A CE2 1 
ATOM   2558  C CZ  . PHE A  1 337 ? 18.402  11.317  26.988  1.00 27.11  ? 1355 PHE A CZ  1 
ATOM   2559  N N   . GLY A  1 338 ? 20.010  12.638  20.386  1.00 20.83  ? 1356 GLY A N   1 
ATOM   2560  C CA  . GLY A  1 338 ? 19.010  13.053  19.421  1.00 21.61  ? 1356 GLY A CA  1 
ATOM   2561  C C   . GLY A  1 338 ? 17.759  12.215  19.222  1.00 23.49  ? 1356 GLY A C   1 
ATOM   2562  O O   . GLY A  1 338 ? 16.705  12.768  18.913  1.00 23.11  ? 1356 GLY A O   1 
ATOM   2563  N N   . TRP A  1 339 ? 17.850  10.897  19.384  1.00 21.66  ? 1357 TRP A N   1 
ATOM   2564  C CA  . TRP A  1 339 ? 16.678  10.047  19.178  1.00 22.39  ? 1357 TRP A CA  1 
ATOM   2565  C C   . TRP A  1 339 ? 16.792  8.679   19.842  1.00 22.24  ? 1357 TRP A C   1 
ATOM   2566  O O   . TRP A  1 339 ? 15.996  8.336   20.712  1.00 22.77  ? 1357 TRP A O   1 
ATOM   2567  C CB  . TRP A  1 339 ? 16.441  9.840   17.676  1.00 22.29  ? 1357 TRP A CB  1 
ATOM   2568  C CG  . TRP A  1 339 ? 15.191  9.069   17.363  1.00 23.63  ? 1357 TRP A CG  1 
ATOM   2569  C CD1 . TRP A  1 339 ? 13.909  9.538   17.400  1.00 23.69  ? 1357 TRP A CD1 1 
ATOM   2570  C CD2 . TRP A  1 339 ? 15.102  7.683   17.006  1.00 22.61  ? 1357 TRP A CD2 1 
ATOM   2571  N NE1 . TRP A  1 339 ? 13.027  8.530   17.089  1.00 24.97  ? 1357 TRP A NE1 1 
ATOM   2572  C CE2 . TRP A  1 339 ? 13.732  7.382   16.843  1.00 23.30  ? 1357 TRP A CE2 1 
ATOM   2573  C CE3 . TRP A  1 339 ? 16.048  6.667   16.809  1.00 22.08  ? 1357 TRP A CE3 1 
ATOM   2574  C CZ2 . TRP A  1 339 ? 13.280  6.102   16.491  1.00 24.18  ? 1357 TRP A CZ2 1 
ATOM   2575  C CZ3 . TRP A  1 339 ? 15.599  5.392   16.459  1.00 24.05  ? 1357 TRP A CZ3 1 
ATOM   2576  C CH2 . TRP A  1 339 ? 14.224  5.124   16.304  1.00 22.82  ? 1357 TRP A CH2 1 
ATOM   2577  N N   . LEU A  1 340 ? 17.793  7.910   19.422  1.00 21.80  ? 1358 LEU A N   1 
ATOM   2578  C CA  . LEU A  1 340 ? 18.020  6.557   19.925  1.00 20.12  ? 1358 LEU A CA  1 
ATOM   2579  C C   . LEU A  1 340 ? 17.912  6.357   21.434  1.00 19.95  ? 1358 LEU A C   1 
ATOM   2580  O O   . LEU A  1 340 ? 17.046  5.618   21.903  1.00 20.32  ? 1358 LEU A O   1 
ATOM   2581  C CB  . LEU A  1 340 ? 19.387  6.046   19.479  1.00 22.10  ? 1358 LEU A CB  1 
ATOM   2582  C CG  . LEU A  1 340 ? 19.576  4.556   19.791  1.00 24.31  ? 1358 LEU A CG  1 
ATOM   2583  C CD1 . LEU A  1 340 ? 19.066  3.746   18.610  1.00 24.13  ? 1358 LEU A CD1 1 
ATOM   2584  C CD2 . LEU A  1 340 ? 21.036  4.243   20.062  1.00 24.89  ? 1358 LEU A CD2 1 
ATOM   2585  N N   . ILE A  1 341 ? 18.797  6.998   22.191  1.00 19.90  ? 1359 ILE A N   1 
ATOM   2586  C CA  . ILE A  1 341 ? 18.799  6.846   23.643  1.00 18.50  ? 1359 ILE A CA  1 
ATOM   2587  C C   . ILE A  1 341 ? 17.480  7.258   24.297  1.00 19.68  ? 1359 ILE A C   1 
ATOM   2588  O O   . ILE A  1 341 ? 16.899  6.476   25.047  1.00 19.68  ? 1359 ILE A O   1 
ATOM   2589  C CB  . ILE A  1 341 ? 19.989  7.603   24.286  1.00 18.00  ? 1359 ILE A CB  1 
ATOM   2590  C CG1 . ILE A  1 341 ? 21.304  6.990   23.786  1.00 20.57  ? 1359 ILE A CG1 1 
ATOM   2591  C CG2 . ILE A  1 341 ? 19.929  7.496   25.817  1.00 16.27  ? 1359 ILE A CG2 1 
ATOM   2592  C CD1 . ILE A  1 341 ? 22.559  7.683   24.302  1.00 22.55  ? 1359 ILE A CD1 1 
ATOM   2593  N N   . PRO A  1 342 ? 16.987  8.484   24.032  1.00 19.78  ? 1360 PRO A N   1 
ATOM   2594  C CA  . PRO A  1 342 ? 15.715  8.837   24.672  1.00 21.03  ? 1360 PRO A CA  1 
ATOM   2595  C C   . PRO A  1 342 ? 14.557  7.920   24.255  1.00 22.79  ? 1360 PRO A C   1 
ATOM   2596  O O   . PRO A  1 342 ? 13.605  7.734   25.004  1.00 23.72  ? 1360 PRO A O   1 
ATOM   2597  C CB  . PRO A  1 342 ? 15.502  10.299  24.261  1.00 21.51  ? 1360 PRO A CB  1 
ATOM   2598  C CG  . PRO A  1 342 ? 16.349  10.461  23.013  1.00 21.51  ? 1360 PRO A CG  1 
ATOM   2599  C CD  . PRO A  1 342 ? 17.573  9.651   23.349  1.00 20.22  ? 1360 PRO A CD  1 
ATOM   2600  N N   . MET A  1 343 ? 14.637  7.349   23.060  1.00 23.56  ? 1361 MET A N   1 
ATOM   2601  C CA  . MET A  1 343 ? 13.597  6.438   22.591  1.00 25.40  ? 1361 MET A CA  1 
ATOM   2602  C C   . MET A  1 343 ? 13.677  5.154   23.416  1.00 24.97  ? 1361 MET A C   1 
ATOM   2603  O O   . MET A  1 343 ? 12.674  4.666   23.932  1.00 24.66  ? 1361 MET A O   1 
ATOM   2604  C CB  . MET A  1 343 ? 13.802  6.121   21.105  1.00 27.48  ? 1361 MET A CB  1 
ATOM   2605  C CG  . MET A  1 343 ? 12.839  5.097   20.515  1.00 30.31  ? 1361 MET A CG  1 
ATOM   2606  S SD  . MET A  1 343 ? 13.257  3.375   20.893  1.00 35.58  ? 1361 MET A SD  1 
ATOM   2607  C CE  . MET A  1 343 ? 14.517  3.036   19.653  1.00 34.60  ? 1361 MET A CE  1 
ATOM   2608  N N   . LEU A  1 344 ? 14.885  4.620   23.542  1.00 23.21  ? 1363 LEU A N   1 
ATOM   2609  C CA  . LEU A  1 344 ? 15.110  3.398   24.294  1.00 23.43  ? 1363 LEU A CA  1 
ATOM   2610  C C   . LEU A  1 344 ? 14.804  3.561   25.782  1.00 24.11  ? 1363 LEU A C   1 
ATOM   2611  O O   . LEU A  1 344 ? 14.404  2.611   26.445  1.00 22.57  ? 1363 LEU A O   1 
ATOM   2612  C CB  . LEU A  1 344 ? 16.557  2.933   24.110  1.00 24.81  ? 1363 LEU A CB  1 
ATOM   2613  C CG  . LEU A  1 344 ? 16.947  2.513   22.688  1.00 24.78  ? 1363 LEU A CG  1 
ATOM   2614  C CD1 . LEU A  1 344 ? 18.439  2.229   22.631  1.00 26.65  ? 1363 LEU A CD1 1 
ATOM   2615  C CD2 . LEU A  1 344 ? 16.136  1.288   22.262  1.00 25.01  ? 1363 LEU A CD2 1 
ATOM   2616  N N   . MET A  1 345 ? 14.968  4.763   26.314  1.00 22.98  ? 1364 MET A N   1 
ATOM   2617  C CA  . MET A  1 345 ? 14.701  4.965   27.733  1.00 24.04  ? 1364 MET A CA  1 
ATOM   2618  C C   . MET A  1 345 ? 13.300  5.487   28.033  1.00 23.93  ? 1364 MET A C   1 
ATOM   2619  O O   . MET A  1 345 ? 12.964  5.749   29.192  1.00 23.45  ? 1364 MET A O   1 
ATOM   2620  C CB  . MET A  1 345 ? 15.731  5.920   28.323  1.00 25.70  ? 1364 MET A CB  1 
ATOM   2621  C CG  . MET A  1 345 ? 17.149  5.482   28.106  1.00 30.93  ? 1364 MET A CG  1 
ATOM   2622  S SD  . MET A  1 345 ? 18.225  6.420   29.159  1.00 35.64  ? 1364 MET A SD  1 
ATOM   2623  C CE  . MET A  1 345 ? 17.954  5.552   30.724  1.00 35.24  ? 1364 MET A CE  1 
ATOM   2624  N N   . SER A  1 346 ? 12.494  5.649   26.990  1.00 23.36  ? 1365 SER A N   1 
ATOM   2625  C CA  . SER A  1 346 ? 11.130  6.141   27.140  1.00 26.32  ? 1365 SER A CA  1 
ATOM   2626  C C   . SER A  1 346 ? 11.038  7.546   27.736  1.00 27.84  ? 1365 SER A C   1 
ATOM   2627  O O   . SER A  1 346 ? 10.323  7.758   28.717  1.00 26.89  ? 1365 SER A O   1 
ATOM   2628  C CB  . SER A  1 346 ? 10.310  5.182   28.012  1.00 27.34  ? 1365 SER A CB  1 
ATOM   2629  O OG  . SER A  1 346 ? 10.262  3.880   27.459  1.00 27.56  ? 1365 SER A OG  1 
ATOM   2630  N N   . TYR A  1 347 ? 11.761  8.502   27.157  1.00 30.52  ? 1366 TYR A N   1 
ATOM   2631  C CA  . TYR A  1 347 ? 11.703  9.882   27.636  1.00 33.69  ? 1366 TYR A CA  1 
ATOM   2632  C C   . TYR A  1 347 ? 10.362  10.463  27.203  1.00 36.02  ? 1366 TYR A C   1 
ATOM   2633  O O   . TYR A  1 347 ? 9.932   10.262  26.070  1.00 35.98  ? 1366 TYR A O   1 
ATOM   2634  C CB  . TYR A  1 347 ? 12.845  10.721  27.049  1.00 34.08  ? 1366 TYR A CB  1 
ATOM   2635  C CG  . TYR A  1 347 ? 13.946  11.024  28.040  1.00 33.80  ? 1366 TYR A CG  1 
ATOM   2636  C CD1 . TYR A  1 347 ? 14.666  9.995   28.636  1.00 35.52  ? 1366 TYR A CD1 1 
ATOM   2637  C CD2 . TYR A  1 347 ? 14.254  12.337  28.401  1.00 35.11  ? 1366 TYR A CD2 1 
ATOM   2638  C CE1 . TYR A  1 347 ? 15.661  10.252  29.562  1.00 36.48  ? 1366 TYR A CE1 1 
ATOM   2639  C CE2 . TYR A  1 347 ? 15.255  12.610  29.336  1.00 34.62  ? 1366 TYR A CE2 1 
ATOM   2640  C CZ  . TYR A  1 347 ? 15.953  11.556  29.911  1.00 36.31  ? 1366 TYR A CZ  1 
ATOM   2641  O OH  . TYR A  1 347 ? 16.942  11.781  30.842  1.00 38.70  ? 1366 TYR A OH  1 
ATOM   2642  N N   . PRO A  1 348 ? 9.681   11.185  28.106  1.00 38.93  ? 1367 PRO A N   1 
ATOM   2643  C CA  . PRO A  1 348 ? 8.375   11.806  27.842  1.00 43.06  ? 1367 PRO A CA  1 
ATOM   2644  C C   . PRO A  1 348 ? 8.450   13.046  26.948  1.00 45.01  ? 1367 PRO A C   1 
ATOM   2645  O O   . PRO A  1 348 ? 8.119   14.145  27.389  1.00 46.14  ? 1367 PRO A O   1 
ATOM   2646  C CB  . PRO A  1 348 ? 7.867   12.164  29.243  1.00 41.70  ? 1367 PRO A CB  1 
ATOM   2647  C CG  . PRO A  1 348 ? 8.697   11.316  30.171  1.00 42.24  ? 1367 PRO A CG  1 
ATOM   2648  C CD  . PRO A  1 348 ? 10.043  11.334  29.522  1.00 39.71  ? 1367 PRO A CD  1 
ATOM   2649  N N   . LEU A  1 349 ? 8.863   12.873  25.697  1.00 47.30  ? 1368 LEU A N   1 
ATOM   2650  C CA  . LEU A  1 349 ? 8.979   14.006  24.782  1.00 50.20  ? 1368 LEU A CA  1 
ATOM   2651  C C   . LEU A  1 349 ? 8.077   13.884  23.559  1.00 51.99  ? 1368 LEU A C   1 
ATOM   2652  O O   . LEU A  1 349 ? 8.459   14.272  22.456  1.00 52.33  ? 1368 LEU A O   1 
ATOM   2653  C CB  . LEU A  1 349 ? 10.432  14.155  24.330  1.00 50.78  ? 1368 LEU A CB  1 
ATOM   2654  C CG  . LEU A  1 349 ? 11.436  14.555  25.412  1.00 52.06  ? 1368 LEU A CG  1 
ATOM   2655  C CD1 . LEU A  1 349 ? 12.852  14.408  24.876  1.00 53.81  ? 1368 LEU A CD1 1 
ATOM   2656  C CD2 . LEU A  1 349 ? 11.169  15.989  25.854  1.00 52.56  ? 1368 LEU A CD2 1 
ATOM   2657  N N   . SER A  1 350 ? 6.873   13.361  23.760  1.00 54.37  ? 1369 SER A N   1 
ATOM   2658  C CA  . SER A  1 350 ? 5.932   13.175  22.662  1.00 56.55  ? 1369 SER A CA  1 
ATOM   2659  C C   . SER A  1 350 ? 5.499   14.460  21.956  1.00 57.58  ? 1369 SER A C   1 
ATOM   2660  O O   . SER A  1 350 ? 5.222   14.437  20.758  1.00 57.68  ? 1369 SER A O   1 
ATOM   2661  C CB  . SER A  1 350 ? 4.690   12.421  23.153  1.00 57.54  ? 1369 SER A CB  1 
ATOM   2662  O OG  . SER A  1 350 ? 4.001   13.149  24.152  1.00 58.78  ? 1369 SER A OG  1 
ATOM   2663  N N   . GLU A  1 351 ? 5.442   15.574  22.680  1.00 59.02  ? 1370 GLU A N   1 
ATOM   2664  C CA  . GLU A  1 351 ? 5.019   16.834  22.070  1.00 60.46  ? 1370 GLU A CA  1 
ATOM   2665  C C   . GLU A  1 351 ? 6.091   17.579  21.277  1.00 60.82  ? 1370 GLU A C   1 
ATOM   2666  O O   . GLU A  1 351 ? 5.819   18.630  20.692  1.00 60.74  ? 1370 GLU A O   1 
ATOM   2667  C CB  . GLU A  1 351 ? 4.420   17.766  23.125  1.00 61.17  ? 1370 GLU A CB  1 
ATOM   2668  C CG  . GLU A  1 351 ? 2.923   17.571  23.336  1.00 62.01  ? 1370 GLU A CG  1 
ATOM   2669  C CD  . GLU A  1 351 ? 2.121   17.736  22.051  1.00 61.70  ? 1370 GLU A CD  1 
ATOM   2670  O OE1 . GLU A  1 351 ? 2.391   18.693  21.298  1.00 61.91  ? 1370 GLU A OE1 1 
ATOM   2671  O OE2 . GLU A  1 351 ? 1.213   16.917  21.797  1.00 61.14  ? 1370 GLU A OE2 1 
ATOM   2672  N N   . GLY A  1 352 ? 7.303   17.038  21.251  1.00 60.50  ? 1371 GLY A N   1 
ATOM   2673  C CA  . GLY A  1 352 ? 8.371   17.664  20.491  1.00 61.36  ? 1371 GLY A CA  1 
ATOM   2674  C C   . GLY A  1 352 ? 8.873   19.013  20.972  1.00 61.09  ? 1371 GLY A C   1 
ATOM   2675  O O   . GLY A  1 352 ? 10.079  19.232  21.033  1.00 62.42  ? 1371 GLY A O   1 
ATOM   2676  N N   . GLN A  1 353 ? 7.967   19.931  21.292  1.00 61.28  ? 1372 GLN A N   1 
ATOM   2677  C CA  . GLN A  1 353 ? 8.376   21.251  21.767  1.00 59.91  ? 1372 GLN A CA  1 
ATOM   2678  C C   . GLN A  1 353 ? 8.634   21.200  23.267  1.00 57.80  ? 1372 GLN A C   1 
ATOM   2679  O O   . GLN A  1 353 ? 8.342   20.197  23.920  1.00 56.40  ? 1372 GLN A O   1 
ATOM   2680  C CB  . GLN A  1 353 ? 7.298   22.285  21.456  1.00 61.27  ? 1372 GLN A CB  1 
ATOM   2681  C CG  . GLN A  1 353 ? 5.937   21.926  22.008  1.00 63.36  ? 1372 GLN A CG  1 
ATOM   2682  C CD  . GLN A  1 353 ? 4.837   22.167  21.006  1.00 63.90  ? 1372 GLN A CD  1 
ATOM   2683  O OE1 . GLN A  1 353 ? 4.556   23.313  20.641  1.00 64.76  ? 1372 GLN A OE1 1 
ATOM   2684  N NE2 . GLN A  1 353 ? 4.210   21.085  20.543  1.00 64.88  ? 1372 GLN A NE2 1 
ATOM   2685  N N   . LEU A  1 354 ? 9.175   22.283  23.814  1.00 56.15  ? 1373 LEU A N   1 
ATOM   2686  C CA  . LEU A  1 354 ? 9.484   22.314  25.233  1.00 54.88  ? 1373 LEU A CA  1 
ATOM   2687  C C   . LEU A  1 354 ? 9.726   23.725  25.761  1.00 53.45  ? 1373 LEU A C   1 
ATOM   2688  O O   . LEU A  1 354 ? 10.487  24.494  25.175  1.00 53.36  ? 1373 LEU A O   1 
ATOM   2689  C CB  . LEU A  1 354 ? 10.723  21.453  25.495  1.00 55.50  ? 1373 LEU A CB  1 
ATOM   2690  C CG  . LEU A  1 354 ? 11.116  21.171  26.945  1.00 55.60  ? 1373 LEU A CG  1 
ATOM   2691  C CD1 . LEU A  1 354 ? 10.056  20.300  27.589  1.00 56.45  ? 1373 LEU A CD1 1 
ATOM   2692  C CD2 . LEU A  1 354 ? 12.463  20.468  26.986  1.00 56.48  ? 1373 LEU A CD2 1 
ATOM   2693  N N   . ASP A  1 355 ? 9.066   24.056  26.867  1.00 52.08  ? 1374 ASP A N   1 
ATOM   2694  C CA  . ASP A  1 355 ? 9.228   25.357  27.508  1.00 51.46  ? 1374 ASP A CA  1 
ATOM   2695  C C   . ASP A  1 355 ? 10.233  25.140  28.631  1.00 50.24  ? 1374 ASP A C   1 
ATOM   2696  O O   . ASP A  1 355 ? 10.402  24.014  29.096  1.00 49.94  ? 1374 ASP A O   1 
ATOM   2697  C CB  . ASP A  1 355 ? 7.895   25.849  28.079  1.00 51.72  ? 1374 ASP A CB  1 
ATOM   2698  C CG  . ASP A  1 355 ? 7.207   24.806  28.944  1.00 52.38  ? 1374 ASP A CG  1 
ATOM   2699  O OD1 . ASP A  1 355 ? 6.619   23.856  28.382  1.00 53.22  ? 1374 ASP A OD1 1 
ATOM   2700  O OD2 . ASP A  1 355 ? 7.261   24.934  30.185  1.00 51.48  ? 1374 ASP A OD2 1 
ATOM   2701  N N   . GLN A  1 356 ? 10.894  26.202  29.076  1.00 48.72  ? 1375 GLN A N   1 
ATOM   2702  C CA  . GLN A  1 356 ? 11.894  26.049  30.124  1.00 48.18  ? 1375 GLN A CA  1 
ATOM   2703  C C   . GLN A  1 356 ? 11.413  25.455  31.447  1.00 46.71  ? 1375 GLN A C   1 
ATOM   2704  O O   . GLN A  1 356 ? 12.188  24.799  32.145  1.00 46.06  ? 1375 GLN A O   1 
ATOM   2705  C CB  . GLN A  1 356 ? 12.613  27.377  30.378  1.00 49.63  ? 1375 GLN A CB  1 
ATOM   2706  C CG  . GLN A  1 356 ? 13.642  27.731  29.313  1.00 51.46  ? 1375 GLN A CG  1 
ATOM   2707  C CD  . GLN A  1 356 ? 14.557  28.847  29.751  1.00 52.26  ? 1375 GLN A CD  1 
ATOM   2708  O OE1 . GLN A  1 356 ? 15.119  28.802  30.843  1.00 53.56  ? 1375 GLN A OE1 1 
ATOM   2709  N NE2 . GLN A  1 356 ? 14.708  29.863  28.905  1.00 53.70  ? 1375 GLN A NE2 1 
ATOM   2710  N N   . LYS A  1 357 ? 10.151  25.669  31.801  1.00 44.86  ? 1376 LYS A N   1 
ATOM   2711  C CA  . LYS A  1 357 ? 9.643   25.108  33.049  1.00 42.81  ? 1376 LYS A CA  1 
ATOM   2712  C C   . LYS A  1 357 ? 9.586   23.589  32.934  1.00 39.68  ? 1376 LYS A C   1 
ATOM   2713  O O   . LYS A  1 357 ? 9.970   22.873  33.856  1.00 39.63  ? 1376 LYS A O   1 
ATOM   2714  C CB  . LYS A  1 357 ? 8.245   25.645  33.369  1.00 44.95  ? 1376 LYS A CB  1 
ATOM   2715  C CG  . LYS A  1 357 ? 7.680   25.099  34.675  1.00 48.50  ? 1376 LYS A CG  1 
ATOM   2716  C CD  . LYS A  1 357 ? 6.304   25.662  34.985  1.00 50.98  ? 1376 LYS A CD  1 
ATOM   2717  C CE  . LYS A  1 357 ? 5.757   25.062  36.272  1.00 52.14  ? 1376 LYS A CE  1 
ATOM   2718  N NZ  . LYS A  1 357 ? 4.394   25.568  36.603  1.00 54.43  ? 1376 LYS A NZ  1 
ATOM   2719  N N   . THR A  1 358 ? 9.104   23.104  31.795  1.00 36.86  ? 1377 THR A N   1 
ATOM   2720  C CA  . THR A  1 358 ? 9.003   21.668  31.568  1.00 35.83  ? 1377 THR A CA  1 
ATOM   2721  C C   . THR A  1 358 ? 10.405  21.070  31.499  1.00 34.52  ? 1377 THR A C   1 
ATOM   2722  O O   . THR A  1 358 ? 10.665  20.000  32.048  1.00 33.65  ? 1377 THR A O   1 
ATOM   2723  C CB  . THR A  1 358 ? 8.257   21.364  30.254  1.00 36.27  ? 1377 THR A CB  1 
ATOM   2724  O OG1 . THR A  1 358 ? 6.997   22.047  30.252  1.00 37.20  ? 1377 THR A OG1 1 
ATOM   2725  C CG2 . THR A  1 358 ? 8.007   19.867  30.115  1.00 36.46  ? 1377 THR A CG2 1 
ATOM   2726  N N   . ALA A  1 359 ? 11.304  21.782  30.827  1.00 33.64  ? 1378 ALA A N   1 
ATOM   2727  C CA  . ALA A  1 359 ? 12.688  21.349  30.684  1.00 33.13  ? 1378 ALA A CA  1 
ATOM   2728  C C   . ALA A  1 359 ? 13.340  21.130  32.049  1.00 31.56  ? 1378 ALA A C   1 
ATOM   2729  O O   . ALA A  1 359 ? 13.999  20.113  32.273  1.00 29.87  ? 1378 ALA A O   1 
ATOM   2730  C CB  . ALA A  1 359 ? 13.474  22.384  29.880  1.00 31.78  ? 1378 ALA A CB  1 
ATOM   2731  N N   . MET A  1 360 ? 13.154  22.078  32.965  1.00 31.13  ? 1379 MET A N   1 
ATOM   2732  C CA  . MET A  1 360 ? 13.736  21.951  34.299  1.00 29.57  ? 1379 MET A CA  1 
ATOM   2733  C C   . MET A  1 360 ? 13.227  20.712  35.019  1.00 29.33  ? 1379 MET A C   1 
ATOM   2734  O O   . MET A  1 360 ? 13.979  20.041  35.729  1.00 27.07  ? 1379 MET A O   1 
ATOM   2735  C CB  . MET A  1 360 ? 13.430  23.184  35.149  1.00 31.56  ? 1379 MET A CB  1 
ATOM   2736  C CG  . MET A  1 360 ? 14.077  24.464  34.651  1.00 34.11  ? 1379 MET A CG  1 
ATOM   2737  S SD  . MET A  1 360 ? 14.020  25.741  35.915  1.00 38.32  ? 1379 MET A SD  1 
ATOM   2738  C CE  . MET A  1 360 ? 12.288  26.176  35.857  1.00 36.17  ? 1379 MET A CE  1 
ATOM   2739  N N   . SER A  1 361 ? 11.944  20.412  34.844  1.00 28.36  ? 1380 SER A N   1 
ATOM   2740  C CA  . SER A  1 361 ? 11.353  19.240  35.481  1.00 28.86  ? 1380 SER A CA  1 
ATOM   2741  C C   . SER A  1 361 ? 11.996  17.972  34.930  1.00 26.62  ? 1380 SER A C   1 
ATOM   2742  O O   . SER A  1 361 ? 12.402  17.092  35.691  1.00 26.28  ? 1380 SER A O   1 
ATOM   2743  C CB  . SER A  1 361 ? 9.839   19.196  35.237  1.00 30.59  ? 1380 SER A CB  1 
ATOM   2744  O OG  . SER A  1 361 ? 9.279   17.985  35.730  1.00 32.91  ? 1380 SER A OG  1 
ATOM   2745  N N   . LEU A  1 362 ? 12.087  17.885  33.606  1.00 27.07  ? 1381 LEU A N   1 
ATOM   2746  C CA  . LEU A  1 362 ? 12.684  16.723  32.962  1.00 26.89  ? 1381 LEU A CA  1 
ATOM   2747  C C   . LEU A  1 362 ? 14.149  16.577  33.355  1.00 24.84  ? 1381 LEU A C   1 
ATOM   2748  O O   . LEU A  1 362 ? 14.621  15.464  33.584  1.00 25.19  ? 1381 LEU A O   1 
ATOM   2749  C CB  . LEU A  1 362 ? 12.565  16.829  31.440  1.00 28.99  ? 1381 LEU A CB  1 
ATOM   2750  C CG  . LEU A  1 362 ? 11.164  16.688  30.835  1.00 31.14  ? 1381 LEU A CG  1 
ATOM   2751  C CD1 . LEU A  1 362 ? 11.261  16.813  29.330  1.00 31.29  ? 1381 LEU A CD1 1 
ATOM   2752  C CD2 . LEU A  1 362 ? 10.553  15.346  31.217  1.00 31.00  ? 1381 LEU A CD2 1 
ATOM   2753  N N   . LEU A  1 363 ? 14.861  17.699  33.444  1.00 23.96  ? 1382 LEU A N   1 
ATOM   2754  C CA  . LEU A  1 363 ? 16.273  17.665  33.814  1.00 23.20  ? 1382 LEU A CA  1 
ATOM   2755  C C   . LEU A  1 363 ? 16.431  17.077  35.209  1.00 23.08  ? 1382 LEU A C   1 
ATOM   2756  O O   . LEU A  1 363 ? 17.397  16.365  35.483  1.00 22.43  ? 1382 LEU A O   1 
ATOM   2757  C CB  . LEU A  1 363 ? 16.888  19.073  33.761  1.00 23.65  ? 1382 LEU A CB  1 
ATOM   2758  C CG  . LEU A  1 363 ? 18.423  19.137  33.821  1.00 26.20  ? 1382 LEU A CG  1 
ATOM   2759  C CD1 . LEU A  1 363 ? 19.013  18.289  32.701  1.00 25.36  ? 1382 LEU A CD1 1 
ATOM   2760  C CD2 . LEU A  1 363 ? 18.898  20.582  33.693  1.00 25.58  ? 1382 LEU A CD2 1 
ATOM   2761  N N   . TRP A  1 364 ? 15.483  17.373  36.095  1.00 23.09  ? 1383 TRP A N   1 
ATOM   2762  C CA  . TRP A  1 364 ? 15.538  16.835  37.450  1.00 23.11  ? 1383 TRP A CA  1 
ATOM   2763  C C   . TRP A  1 364 ? 15.277  15.329  37.373  1.00 23.27  ? 1383 TRP A C   1 
ATOM   2764  O O   . TRP A  1 364 ? 15.977  14.533  38.002  1.00 22.84  ? 1383 TRP A O   1 
ATOM   2765  C CB  . TRP A  1 364 ? 14.491  17.515  38.343  1.00 25.05  ? 1383 TRP A CB  1 
ATOM   2766  C CG  . TRP A  1 364 ? 14.429  16.970  39.754  1.00 26.10  ? 1383 TRP A CG  1 
ATOM   2767  C CD1 . TRP A  1 364 ? 13.304  16.598  40.438  1.00 26.50  ? 1383 TRP A CD1 1 
ATOM   2768  C CD2 . TRP A  1 364 ? 15.532  16.741  40.645  1.00 27.15  ? 1383 TRP A CD2 1 
ATOM   2769  N NE1 . TRP A  1 364 ? 13.637  16.150  41.696  1.00 26.65  ? 1383 TRP A NE1 1 
ATOM   2770  C CE2 . TRP A  1 364 ? 14.996  16.226  41.849  1.00 27.75  ? 1383 TRP A CE2 1 
ATOM   2771  C CE3 . TRP A  1 364 ? 16.919  16.918  40.543  1.00 28.37  ? 1383 TRP A CE3 1 
ATOM   2772  C CZ2 . TRP A  1 364 ? 15.800  15.886  42.943  1.00 27.55  ? 1383 TRP A CZ2 1 
ATOM   2773  C CZ3 . TRP A  1 364 ? 17.716  16.581  41.629  1.00 29.17  ? 1383 TRP A CZ3 1 
ATOM   2774  C CH2 . TRP A  1 364 ? 17.152  16.069  42.816  1.00 29.34  ? 1383 TRP A CH2 1 
ATOM   2775  N N   . LYS A  1 365 ? 14.273  14.936  36.595  1.00 22.76  ? 1384 LYS A N   1 
ATOM   2776  C CA  . LYS A  1 365 ? 13.972  13.514  36.447  1.00 26.00  ? 1384 LYS A CA  1 
ATOM   2777  C C   . LYS A  1 365 ? 15.174  12.798  35.834  1.00 25.86  ? 1384 LYS A C   1 
ATOM   2778  O O   . LYS A  1 365 ? 15.398  11.616  36.088  1.00 26.36  ? 1384 LYS A O   1 
ATOM   2779  C CB  . LYS A  1 365 ? 12.740  13.303  35.558  1.00 28.03  ? 1384 LYS A CB  1 
ATOM   2780  C CG  . LYS A  1 365 ? 11.409  13.688  36.209  1.00 31.71  ? 1384 LYS A CG  1 
ATOM   2781  C CD  . LYS A  1 365 ? 11.204  12.949  37.528  1.00 31.35  ? 1384 LYS A CD  1 
ATOM   2782  C CE  . LYS A  1 365 ? 9.849   13.264  38.142  1.00 33.84  ? 1384 LYS A CE  1 
ATOM   2783  N NZ  . LYS A  1 365 ? 9.701   12.624  39.484  1.00 36.17  ? 1384 LYS A NZ  1 
ATOM   2784  N N   . SER A  1 366 ? 15.949  13.530  35.036  1.00 25.70  ? 1385 SER A N   1 
ATOM   2785  C CA  . SER A  1 366 ? 17.132  12.981  34.377  1.00 25.09  ? 1385 SER A CA  1 
ATOM   2786  C C   . SER A  1 366 ? 18.352  12.867  35.294  1.00 26.31  ? 1385 SER A C   1 
ATOM   2787  O O   . SER A  1 366 ? 19.457  12.585  34.826  1.00 25.91  ? 1385 SER A O   1 
ATOM   2788  C CB  . SER A  1 366 ? 17.498  13.846  33.171  1.00 25.73  ? 1385 SER A CB  1 
ATOM   2789  O OG  . SER A  1 366 ? 16.459  13.852  32.206  1.00 24.52  ? 1385 SER A OG  1 
ATOM   2790  N N   . TYR A  1 367 ? 18.156  13.070  36.595  1.00 26.19  ? 1386 TYR A N   1 
ATOM   2791  C CA  . TYR A  1 367 ? 19.258  13.007  37.550  1.00 27.20  ? 1386 TYR A CA  1 
ATOM   2792  C C   . TYR A  1 367 ? 20.182  11.791  37.410  1.00 28.08  ? 1386 TYR A C   1 
ATOM   2793  O O   . TYR A  1 367 ? 21.406  11.933  37.436  1.00 27.31  ? 1386 TYR A O   1 
ATOM   2794  C CB  . TYR A  1 367 ? 18.732  13.053  38.983  1.00 29.38  ? 1386 TYR A CB  1 
ATOM   2795  C CG  . TYR A  1 367 ? 19.832  13.243  39.999  1.00 32.10  ? 1386 TYR A CG  1 
ATOM   2796  C CD1 . TYR A  1 367 ? 20.346  14.512  40.265  1.00 33.62  ? 1386 TYR A CD1 1 
ATOM   2797  C CD2 . TYR A  1 367 ? 20.381  12.155  40.670  1.00 33.58  ? 1386 TYR A CD2 1 
ATOM   2798  C CE1 . TYR A  1 367 ? 21.379  14.693  41.178  1.00 35.13  ? 1386 TYR A CE1 1 
ATOM   2799  C CE2 . TYR A  1 367 ? 21.418  12.323  41.585  1.00 35.63  ? 1386 TYR A CE2 1 
ATOM   2800  C CZ  . TYR A  1 367 ? 21.911  13.595  41.833  1.00 36.34  ? 1386 TYR A CZ  1 
ATOM   2801  O OH  . TYR A  1 367 ? 22.938  13.770  42.733  1.00 39.27  ? 1386 TYR A OH  1 
ATOM   2802  N N   . PRO A  1 368 ? 19.616  10.579  37.278  1.00 28.35  ? 1387 PRO A N   1 
ATOM   2803  C CA  . PRO A  1 368 ? 20.493  9.409   37.143  1.00 29.34  ? 1387 PRO A CA  1 
ATOM   2804  C C   . PRO A  1 368 ? 21.420  9.465   35.926  1.00 30.17  ? 1387 PRO A C   1 
ATOM   2805  O O   . PRO A  1 368 ? 22.495  8.859   35.929  1.00 31.09  ? 1387 PRO A O   1 
ATOM   2806  C CB  . PRO A  1 368 ? 19.506  8.239   37.083  1.00 28.39  ? 1387 PRO A CB  1 
ATOM   2807  C CG  . PRO A  1 368 ? 18.269  8.857   36.514  1.00 28.53  ? 1387 PRO A CG  1 
ATOM   2808  C CD  . PRO A  1 368 ? 18.199  10.179  37.238  1.00 27.10  ? 1387 PRO A CD  1 
ATOM   2809  N N   . LEU A  1 369 ? 21.008  10.199  34.896  1.00 28.81  ? 1388 LEU A N   1 
ATOM   2810  C CA  . LEU A  1 369 ? 21.805  10.327  33.681  1.00 28.23  ? 1388 LEU A CA  1 
ATOM   2811  C C   . LEU A  1 369 ? 22.814  11.475  33.697  1.00 28.09  ? 1388 LEU A C   1 
ATOM   2812  O O   . LEU A  1 369 ? 23.952  11.304  33.265  1.00 28.01  ? 1388 LEU A O   1 
ATOM   2813  C CB  . LEU A  1 369 ? 20.897  10.503  32.461  1.00 28.04  ? 1388 LEU A CB  1 
ATOM   2814  C CG  . LEU A  1 369 ? 20.065  9.311   31.985  1.00 30.30  ? 1388 LEU A CG  1 
ATOM   2815  C CD1 . LEU A  1 369 ? 19.401  9.667   30.673  1.00 30.62  ? 1388 LEU A CD1 1 
ATOM   2816  C CD2 . LEU A  1 369 ? 20.948  8.092   31.801  1.00 31.35  ? 1388 LEU A CD2 1 
ATOM   2817  N N   . VAL A  1 370 ? 22.394  12.642  34.183  1.00 26.76  ? 1389 VAL A N   1 
ATOM   2818  C CA  . VAL A  1 370 ? 23.257  13.824  34.215  1.00 24.77  ? 1389 VAL A CA  1 
ATOM   2819  C C   . VAL A  1 370 ? 23.770  14.225  35.596  1.00 27.12  ? 1389 VAL A C   1 
ATOM   2820  O O   . VAL A  1 370 ? 24.737  14.981  35.713  1.00 26.45  ? 1389 VAL A O   1 
ATOM   2821  C CB  . VAL A  1 370 ? 22.541  15.035  33.595  1.00 22.61  ? 1389 VAL A CB  1 
ATOM   2822  C CG1 . VAL A  1 370 ? 22.395  14.836  32.101  1.00 20.34  ? 1389 VAL A CG1 1 
ATOM   2823  C CG2 . VAL A  1 370 ? 21.167  15.215  34.237  1.00 21.14  ? 1389 VAL A CG2 1 
ATOM   2824  N N   A CYS A  1 371 ? 23.109  13.728  36.637  0.50 28.64  ? 1390 CYS A N   1 
ATOM   2825  N N   B CYS A  1 371 ? 23.024  13.909  36.721  0.50 48.21  ? 1390 CYS A N   1 
ATOM   2826  C CA  A CYS A  1 371 ? 23.504  14.008  38.014  0.50 30.13  ? 1390 CYS A CA  1 
ATOM   2827  C CA  B CYS A  1 371 ? 23.571  14.138  38.056  0.50 48.31  ? 1390 CYS A CA  1 
ATOM   2828  C C   A CYS A  1 371 ? 23.685  15.496  38.320  0.50 30.02  ? 1390 CYS A C   1 
ATOM   2829  C C   B CYS A  1 371 ? 23.510  15.649  38.310  0.50 47.84  ? 1390 CYS A C   1 
ATOM   2830  O O   A CYS A  1 371 ? 24.735  15.907  38.818  0.50 30.96  ? 1390 CYS A O   1 
ATOM   2831  O O   B CYS A  1 371 ? 24.444  16.250  38.890  0.50 47.95  ? 1390 CYS A O   1 
ATOM   2832  C CB  A CYS A  1 371 ? 24.800  13.260  38.334  0.50 31.28  ? 1390 CYS A CB  1 
ATOM   2833  C CB  B CYS A  1 371 ? 25.024  13.603  38.149  0.50 48.79  ? 1390 CYS A CB  1 
ATOM   2834  S SG  A CYS A  1 371 ? 25.325  13.346  40.064  0.50 37.06  ? 1390 CYS A SG  1 
ATOM   2835  S SG  B CYS A  1 371 ? 25.162  11.788  37.903  0.50 55.46  ? 1390 CYS A SG  1 
ATOM   2836  N N   . ILE A  1 372 ? 22.661  16.294  38.025  1.00 28.71  ? 1391 ILE A N   1 
ATOM   2837  C CA  . ILE A  1 372 ? 22.696  17.731  38.279  1.00 28.20  ? 1391 ILE A CA  1 
ATOM   2838  C C   . ILE A  1 372 ? 21.801  18.076  39.474  1.00 30.34  ? 1391 ILE A C   1 
ATOM   2839  O O   . ILE A  1 372 ? 20.581  17.907  39.414  1.00 29.21  ? 1391 ILE A O   1 
ATOM   2840  C CB  . ILE A  1 372 ? 22.201  18.525  37.052  1.00 26.88  ? 1391 ILE A CB  1 
ATOM   2841  C CG1 . ILE A  1 372 ? 23.104  18.248  35.848  1.00 24.22  ? 1391 ILE A CG1 1 
ATOM   2842  C CG2 . ILE A  1 372 ? 22.193  20.018  37.362  1.00 26.47  ? 1391 ILE A CG2 1 
ATOM   2843  C CD1 . ILE A  1 372 ? 22.587  18.829  34.560  1.00 21.63  ? 1391 ILE A CD1 1 
ATOM   2844  N N   . ALA A  1 373 ? 22.411  18.554  40.555  1.00 32.18  ? 1392 ALA A N   1 
ATOM   2845  C CA  . ALA A  1 373 ? 21.667  18.930  41.755  1.00 35.14  ? 1392 ALA A CA  1 
ATOM   2846  C C   . ALA A  1 373 ? 20.529  19.879  41.390  1.00 35.98  ? 1392 ALA A C   1 
ATOM   2847  O O   . ALA A  1 373 ? 20.708  20.805  40.597  1.00 35.43  ? 1392 ALA A O   1 
ATOM   2848  C CB  . ALA A  1 373 ? 22.601  19.590  42.765  1.00 35.61  ? 1392 ALA A CB  1 
ATOM   2849  N N   . LYS A  1 374 ? 19.360  19.642  41.975  1.00 36.99  ? 1393 LYS A N   1 
ATOM   2850  C CA  . LYS A  1 374 ? 18.176  20.451  41.706  1.00 38.53  ? 1393 LYS A CA  1 
ATOM   2851  C C   . LYS A  1 374 ? 18.445  21.950  41.800  1.00 39.26  ? 1393 LYS A C   1 
ATOM   2852  O O   . LYS A  1 374 ? 17.897  22.740  41.033  1.00 38.85  ? 1393 LYS A O   1 
ATOM   2853  C CB  . LYS A  1 374 ? 17.059  20.059  42.678  1.00 41.09  ? 1393 LYS A CB  1 
ATOM   2854  C CG  . LYS A  1 374 ? 15.706  20.656  42.344  1.00 43.87  ? 1393 LYS A CG  1 
ATOM   2855  C CD  . LYS A  1 374 ? 14.596  19.956  43.113  1.00 45.91  ? 1393 LYS A CD  1 
ATOM   2856  C CE  . LYS A  1 374 ? 13.241  20.565  42.794  1.00 48.40  ? 1393 LYS A CE  1 
ATOM   2857  N NZ  . LYS A  1 374 ? 12.968  20.582  41.330  1.00 49.81  ? 1393 LYS A NZ  1 
ATOM   2858  N N   . GLU A  1 375 ? 19.296  22.331  42.743  1.00 39.79  ? 1394 GLU A N   1 
ATOM   2859  C CA  . GLU A  1 375 ? 19.649  23.731  42.950  1.00 42.29  ? 1394 GLU A CA  1 
ATOM   2860  C C   . GLU A  1 375 ? 20.383  24.327  41.749  1.00 41.00  ? 1394 GLU A C   1 
ATOM   2861  O O   . GLU A  1 375 ? 20.343  25.536  41.525  1.00 42.73  ? 1394 GLU A O   1 
ATOM   2862  C CB  . GLU A  1 375 ? 20.527  23.853  44.194  1.00 45.69  ? 1394 GLU A CB  1 
ATOM   2863  C CG  . GLU A  1 375 ? 21.728  22.920  44.160  1.00 51.76  ? 1394 GLU A CG  1 
ATOM   2864  C CD  . GLU A  1 375 ? 22.581  23.005  45.408  1.00 54.93  ? 1394 GLU A CD  1 
ATOM   2865  O OE1 . GLU A  1 375 ? 22.035  22.817  46.518  1.00 57.25  ? 1394 GLU A OE1 1 
ATOM   2866  O OE2 . GLU A  1 375 ? 23.800  23.252  45.278  1.00 57.75  ? 1394 GLU A OE2 1 
ATOM   2867  N N   . LEU A  1 376 ? 21.047  23.474  40.976  1.00 38.82  ? 1395 LEU A N   1 
ATOM   2868  C CA  . LEU A  1 376 ? 21.806  23.923  39.813  1.00 35.51  ? 1395 LEU A CA  1 
ATOM   2869  C C   . LEU A  1 376 ? 21.023  23.865  38.511  1.00 33.97  ? 1395 LEU A C   1 
ATOM   2870  O O   . LEU A  1 376 ? 21.440  24.442  37.506  1.00 33.87  ? 1395 LEU A O   1 
ATOM   2871  C CB  . LEU A  1 376 ? 23.074  23.079  39.663  1.00 35.02  ? 1395 LEU A CB  1 
ATOM   2872  C CG  . LEU A  1 376 ? 24.088  23.112  40.806  1.00 34.83  ? 1395 LEU A CG  1 
ATOM   2873  C CD1 . LEU A  1 376 ? 25.179  22.090  40.545  1.00 33.17  ? 1395 LEU A CD1 1 
ATOM   2874  C CD2 . LEU A  1 376 ? 24.674  24.512  40.936  1.00 35.53  ? 1395 LEU A CD2 1 
ATOM   2875  N N   . ILE A  1 377 ? 19.891  23.170  38.525  1.00 31.97  ? 1396 ILE A N   1 
ATOM   2876  C CA  . ILE A  1 377 ? 19.077  23.023  37.325  1.00 30.58  ? 1396 ILE A CA  1 
ATOM   2877  C C   . ILE A  1 377 ? 18.643  24.326  36.654  1.00 30.11  ? 1396 ILE A C   1 
ATOM   2878  O O   . ILE A  1 377 ? 18.694  24.445  35.426  1.00 30.46  ? 1396 ILE A O   1 
ATOM   2879  C CB  . ILE A  1 377 ? 17.842  22.142  37.611  1.00 29.72  ? 1396 ILE A CB  1 
ATOM   2880  C CG1 . ILE A  1 377 ? 18.303  20.700  37.836  1.00 30.05  ? 1396 ILE A CG1 1 
ATOM   2881  C CG2 . ILE A  1 377 ? 16.848  22.228  36.459  1.00 29.01  ? 1396 ILE A CG2 1 
ATOM   2882  C CD1 . ILE A  1 377 ? 17.184  19.702  38.002  1.00 33.27  ? 1396 ILE A CD1 1 
ATOM   2883  N N   . PRO A  1 378 ? 18.208  25.320  37.440  1.00 30.39  ? 1397 PRO A N   1 
ATOM   2884  C CA  . PRO A  1 378 ? 17.784  26.592  36.838  1.00 29.59  ? 1397 PRO A CA  1 
ATOM   2885  C C   . PRO A  1 378 ? 18.913  27.217  36.013  1.00 28.69  ? 1397 PRO A C   1 
ATOM   2886  O O   . PRO A  1 378 ? 18.712  27.667  34.885  1.00 28.19  ? 1397 PRO A O   1 
ATOM   2887  C CB  . PRO A  1 378 ? 17.430  27.444  38.056  1.00 30.31  ? 1397 PRO A CB  1 
ATOM   2888  C CG  . PRO A  1 378 ? 16.960  26.430  39.049  1.00 30.25  ? 1397 PRO A CG  1 
ATOM   2889  C CD  . PRO A  1 378 ? 17.978  25.325  38.894  1.00 29.05  ? 1397 PRO A CD  1 
ATOM   2890  N N   . GLU A  1 379 ? 20.106  27.227  36.597  1.00 30.12  ? 1398 GLU A N   1 
ATOM   2891  C CA  . GLU A  1 379 ? 21.292  27.790  35.958  1.00 31.32  ? 1398 GLU A CA  1 
ATOM   2892  C C   . GLU A  1 379 ? 21.623  27.054  34.659  1.00 29.93  ? 1398 GLU A C   1 
ATOM   2893  O O   . GLU A  1 379 ? 21.834  27.673  33.618  1.00 28.75  ? 1398 GLU A O   1 
ATOM   2894  C CB  . GLU A  1 379 ? 22.470  27.701  36.930  1.00 33.75  ? 1398 GLU A CB  1 
ATOM   2895  C CG  . GLU A  1 379 ? 23.654  28.587  36.593  1.00 38.89  ? 1398 GLU A CG  1 
ATOM   2896  C CD  . GLU A  1 379 ? 24.541  28.818  37.800  1.00 40.86  ? 1398 GLU A CD  1 
ATOM   2897  O OE1 . GLU A  1 379 ? 23.998  29.179  38.866  1.00 44.00  ? 1398 GLU A OE1 1 
ATOM   2898  O OE2 . GLU A  1 379 ? 25.773  28.647  37.692  1.00 44.60  ? 1398 GLU A OE2 1 
ATOM   2899  N N   . ALA A  1 380 ? 21.651  25.727  34.726  1.00 28.72  ? 1399 ALA A N   1 
ATOM   2900  C CA  . ALA A  1 380 ? 21.961  24.911  33.562  1.00 27.75  ? 1399 ALA A CA  1 
ATOM   2901  C C   . ALA A  1 380 ? 20.952  25.130  32.445  1.00 28.61  ? 1399 ALA A C   1 
ATOM   2902  O O   . ALA A  1 380 ? 21.320  25.390  31.297  1.00 26.77  ? 1399 ALA A O   1 
ATOM   2903  C CB  . ALA A  1 380 ? 21.998  23.438  33.960  1.00 27.08  ? 1399 ALA A CB  1 
ATOM   2904  N N   . THR A  1 381 ? 19.674  25.025  32.786  1.00 29.75  ? 1400 THR A N   1 
ATOM   2905  C CA  . THR A  1 381 ? 18.609  25.201  31.812  1.00 32.02  ? 1400 THR A CA  1 
ATOM   2906  C C   . THR A  1 381 ? 18.653  26.582  31.165  1.00 33.52  ? 1400 THR A C   1 
ATOM   2907  O O   . THR A  1 381 ? 18.450  26.721  29.955  1.00 34.00  ? 1400 THR A O   1 
ATOM   2908  C CB  . THR A  1 381 ? 17.235  25.002  32.470  1.00 32.73  ? 1400 THR A CB  1 
ATOM   2909  O OG1 . THR A  1 381 ? 17.220  23.748  33.161  1.00 33.41  ? 1400 THR A OG1 1 
ATOM   2910  C CG2 . THR A  1 381 ? 16.141  25.003  31.419  1.00 32.99  ? 1400 THR A CG2 1 
ATOM   2911  N N   . GLU A  1 382 ? 18.914  27.604  31.972  1.00 34.93  ? 1401 GLU A N   1 
ATOM   2912  C CA  . GLU A  1 382 ? 18.990  28.966  31.455  1.00 37.27  ? 1401 GLU A CA  1 
ATOM   2913  C C   . GLU A  1 382 ? 20.124  29.079  30.437  1.00 36.12  ? 1401 GLU A C   1 
ATOM   2914  O O   . GLU A  1 382 ? 19.942  29.610  29.337  1.00 34.34  ? 1401 GLU A O   1 
ATOM   2915  C CB  . GLU A  1 382 ? 19.225  29.951  32.603  1.00 39.69  ? 1401 GLU A CB  1 
ATOM   2916  C CG  . GLU A  1 382 ? 19.429  31.390  32.150  1.00 46.68  ? 1401 GLU A CG  1 
ATOM   2917  C CD  . GLU A  1 382 ? 18.259  31.920  31.344  1.00 49.93  ? 1401 GLU A CD  1 
ATOM   2918  O OE1 . GLU A  1 382 ? 17.135  31.983  31.894  1.00 52.35  ? 1401 GLU A OE1 1 
ATOM   2919  O OE2 . GLU A  1 382 ? 18.463  32.271  30.159  1.00 51.58  ? 1401 GLU A OE2 1 
ATOM   2920  N N   . LYS A  1 383 ? 21.289  28.559  30.815  1.00 35.06  ? 1402 LYS A N   1 
ATOM   2921  C CA  . LYS A  1 383 ? 22.474  28.593  29.965  1.00 33.49  ? 1402 LYS A CA  1 
ATOM   2922  C C   . LYS A  1 383 ? 22.215  28.044  28.566  1.00 33.55  ? 1402 LYS A C   1 
ATOM   2923  O O   . LYS A  1 383 ? 22.621  28.645  27.570  1.00 33.56  ? 1402 LYS A O   1 
ATOM   2924  C CB  . LYS A  1 383 ? 23.608  27.803  30.631  1.00 32.12  ? 1402 LYS A CB  1 
ATOM   2925  C CG  . LYS A  1 383 ? 24.887  27.705  29.807  1.00 31.17  ? 1402 LYS A CG  1 
ATOM   2926  C CD  . LYS A  1 383 ? 25.537  29.064  29.601  1.00 30.71  ? 1402 LYS A CD  1 
ATOM   2927  C CE  . LYS A  1 383 ? 26.792  28.941  28.752  1.00 30.85  ? 1402 LYS A CE  1 
ATOM   2928  N NZ  . LYS A  1 383 ? 27.502  30.242  28.579  1.00 28.06  ? 1402 LYS A NZ  1 
ATOM   2929  N N   . TYR A  1 384 ? 21.528  26.907  28.492  1.00 33.14  ? 1403 TYR A N   1 
ATOM   2930  C CA  . TYR A  1 384 ? 21.242  26.276  27.210  1.00 33.71  ? 1403 TYR A CA  1 
ATOM   2931  C C   . TYR A  1 384 ? 19.969  26.710  26.491  1.00 35.86  ? 1403 TYR A C   1 
ATOM   2932  O O   . TYR A  1 384 ? 19.965  26.856  25.267  1.00 35.37  ? 1403 TYR A O   1 
ATOM   2933  C CB  . TYR A  1 384 ? 21.207  24.751  27.370  1.00 30.48  ? 1403 TYR A CB  1 
ATOM   2934  C CG  . TYR A  1 384 ? 22.566  24.087  27.373  1.00 27.50  ? 1403 TYR A CG  1 
ATOM   2935  C CD1 . TYR A  1 384 ? 23.426  24.200  28.468  1.00 24.87  ? 1403 TYR A CD1 1 
ATOM   2936  C CD2 . TYR A  1 384 ? 22.992  23.342  26.275  1.00 25.85  ? 1403 TYR A CD2 1 
ATOM   2937  C CE1 . TYR A  1 384 ? 24.676  23.584  28.466  1.00 23.76  ? 1403 TYR A CE1 1 
ATOM   2938  C CE2 . TYR A  1 384 ? 24.236  22.725  26.260  1.00 25.38  ? 1403 TYR A CE2 1 
ATOM   2939  C CZ  . TYR A  1 384 ? 25.073  22.848  27.354  1.00 24.74  ? 1403 TYR A CZ  1 
ATOM   2940  O OH  . TYR A  1 384 ? 26.308  22.238  27.328  1.00 25.33  ? 1403 TYR A OH  1 
ATOM   2941  N N   . LEU A  1 385 ? 18.888  26.908  27.237  1.00 39.23  ? 1404 LEU A N   1 
ATOM   2942  C CA  . LEU A  1 385 ? 17.618  27.272  26.618  1.00 43.57  ? 1404 LEU A CA  1 
ATOM   2943  C C   . LEU A  1 385 ? 17.297  28.766  26.558  1.00 46.86  ? 1404 LEU A C   1 
ATOM   2944  O O   . LEU A  1 385 ? 16.399  29.175  25.822  1.00 47.31  ? 1404 LEU A O   1 
ATOM   2945  C CB  . LEU A  1 385 ? 16.476  26.530  27.319  1.00 43.48  ? 1404 LEU A CB  1 
ATOM   2946  C CG  . LEU A  1 385 ? 16.680  25.026  27.535  1.00 44.42  ? 1404 LEU A CG  1 
ATOM   2947  C CD1 . LEU A  1 385 ? 15.395  24.421  28.062  1.00 44.91  ? 1404 LEU A CD1 1 
ATOM   2948  C CD2 . LEU A  1 385 ? 17.085  24.352  26.236  1.00 43.81  ? 1404 LEU A CD2 1 
ATOM   2949  N N   . GLY A  1 386 ? 18.024  29.574  27.324  1.00 50.50  ? 1405 GLY A N   1 
ATOM   2950  C CA  . GLY A  1 386 ? 17.780  31.008  27.324  1.00 54.69  ? 1405 GLY A CA  1 
ATOM   2951  C C   . GLY A  1 386 ? 17.594  31.598  25.935  1.00 57.76  ? 1405 GLY A C   1 
ATOM   2952  O O   . GLY A  1 386 ? 16.468  31.829  25.498  1.00 59.02  ? 1405 GLY A O   1 
ATOM   2953  N N   . GLY A  1 387 ? 18.705  31.835  25.245  1.00 60.61  ? 1406 GLY A N   1 
ATOM   2954  C CA  . GLY A  1 387 ? 18.680  32.398  23.902  1.00 63.64  ? 1406 GLY A CA  1 
ATOM   2955  C C   . GLY A  1 387 ? 17.355  32.450  23.159  1.00 65.97  ? 1406 GLY A C   1 
ATOM   2956  O O   . GLY A  1 387 ? 16.513  33.306  23.439  1.00 67.36  ? 1406 GLY A O   1 
ATOM   2957  N N   . THR A  1 388 ? 17.170  31.536  22.209  1.00 66.94  ? 1407 THR A N   1 
ATOM   2958  C CA  . THR A  1 388 ? 15.953  31.488  21.398  1.00 68.09  ? 1407 THR A CA  1 
ATOM   2959  C C   . THR A  1 388 ? 14.660  31.310  22.189  1.00 68.58  ? 1407 THR A C   1 
ATOM   2960  O O   . THR A  1 388 ? 14.676  31.106  23.405  1.00 68.52  ? 1407 THR A O   1 
ATOM   2961  C CB  . THR A  1 388 ? 16.024  30.363  20.348  1.00 68.53  ? 1407 THR A CB  1 
ATOM   2962  O OG1 . THR A  1 388 ? 16.117  29.094  21.008  1.00 69.06  ? 1407 THR A OG1 1 
ATOM   2963  C CG2 . THR A  1 388 ? 17.235  30.554  19.445  1.00 69.27  ? 1407 THR A CG2 1 
ATOM   2964  N N   . ASP A  1 389 ? 13.538  31.388  21.476  1.00 68.66  ? 1408 ASP A N   1 
ATOM   2965  C CA  . ASP A  1 389 ? 12.218  31.245  22.081  1.00 68.74  ? 1408 ASP A CA  1 
ATOM   2966  C C   . ASP A  1 389 ? 11.465  30.068  21.465  1.00 68.64  ? 1408 ASP A C   1 
ATOM   2967  O O   . ASP A  1 389 ? 10.507  29.559  22.044  1.00 69.15  ? 1408 ASP A O   1 
ATOM   2968  C CB  . ASP A  1 389 ? 11.412  32.531  21.885  1.00 69.16  ? 1408 ASP A CB  1 
ATOM   2969  C CG  . ASP A  1 389 ? 12.155  33.763  22.368  1.00 70.30  ? 1408 ASP A CG  1 
ATOM   2970  O OD1 . ASP A  1 389 ? 12.549  33.799  23.552  1.00 70.92  ? 1408 ASP A OD1 1 
ATOM   2971  O OD2 . ASP A  1 389 ? 12.344  34.698  21.562  1.00 71.46  ? 1408 ASP A OD2 1 
ATOM   2972  N N   . ASP A  1 390 ? 11.904  29.643  20.286  1.00 67.62  ? 1409 ASP A N   1 
ATOM   2973  C CA  . ASP A  1 390 ? 11.282  28.526  19.586  1.00 66.60  ? 1409 ASP A CA  1 
ATOM   2974  C C   . ASP A  1 390 ? 11.248  27.300  20.504  1.00 66.08  ? 1409 ASP A C   1 
ATOM   2975  O O   . ASP A  1 390 ? 12.285  26.702  20.793  1.00 65.95  ? 1409 ASP A O   1 
ATOM   2976  C CB  . ASP A  1 390 ? 12.082  28.219  18.316  1.00 66.91  ? 1409 ASP A CB  1 
ATOM   2977  C CG  . ASP A  1 390 ? 11.360  27.274  17.380  1.00 67.39  ? 1409 ASP A CG  1 
ATOM   2978  O OD1 . ASP A  1 390 ? 11.015  26.153  17.807  1.00 67.62  ? 1409 ASP A OD1 1 
ATOM   2979  O OD2 . ASP A  1 390 ? 11.140  27.655  16.211  1.00 68.31  ? 1409 ASP A OD2 1 
ATOM   2980  N N   . THR A  1 391 ? 10.055  26.932  20.963  1.00 65.29  ? 1410 THR A N   1 
ATOM   2981  C CA  . THR A  1 391 ? 9.900   25.783  21.854  1.00 64.35  ? 1410 THR A CA  1 
ATOM   2982  C C   . THR A  1 391 ? 10.430  24.489  21.243  1.00 62.76  ? 1410 THR A C   1 
ATOM   2983  O O   . THR A  1 391 ? 10.785  23.556  21.963  1.00 62.21  ? 1410 THR A O   1 
ATOM   2984  C CB  . THR A  1 391 ? 8.425   25.572  22.258  1.00 64.54  ? 1410 THR A CB  1 
ATOM   2985  O OG1 . THR A  1 391 ? 7.608   25.494  21.083  1.00 65.41  ? 1410 THR A OG1 1 
ATOM   2986  C CG2 . THR A  1 391 ? 7.949   26.714  23.141  1.00 64.93  ? 1410 THR A CG2 1 
ATOM   2987  N N   . VAL A  1 392 ? 10.472  24.429  19.916  1.00 61.52  ? 1411 VAL A N   1 
ATOM   2988  C CA  . VAL A  1 392 ? 10.989  23.249  19.236  1.00 60.15  ? 1411 VAL A CA  1 
ATOM   2989  C C   . VAL A  1 392 ? 12.508  23.289  19.367  1.00 59.32  ? 1411 VAL A C   1 
ATOM   2990  O O   . VAL A  1 392 ? 13.158  22.252  19.502  1.00 58.82  ? 1411 VAL A O   1 
ATOM   2991  C CB  . VAL A  1 392 ? 10.611  23.239  17.738  1.00 60.22  ? 1411 VAL A CB  1 
ATOM   2992  C CG1 . VAL A  1 392 ? 11.174  21.996  17.067  1.00 60.06  ? 1411 VAL A CG1 1 
ATOM   2993  C CG2 . VAL A  1 392 ? 9.099   23.286  17.585  1.00 61.01  ? 1411 VAL A CG2 1 
ATOM   2994  N N   . LYS A  1 393 ? 13.061  24.501  19.330  1.00 57.81  ? 1412 LYS A N   1 
ATOM   2995  C CA  . LYS A  1 393 ? 14.499  24.701  19.464  1.00 56.15  ? 1412 LYS A CA  1 
ATOM   2996  C C   . LYS A  1 393 ? 14.936  24.410  20.891  1.00 54.23  ? 1412 LYS A C   1 
ATOM   2997  O O   . LYS A  1 393 ? 15.895  23.674  21.113  1.00 54.47  ? 1412 LYS A O   1 
ATOM   2998  C CB  . LYS A  1 393 ? 14.888  26.137  19.101  1.00 56.52  ? 1412 LYS A CB  1 
ATOM   2999  C CG  . LYS A  1 393 ? 14.950  26.420  17.609  1.00 57.67  ? 1412 LYS A CG  1 
ATOM   3000  C CD  . LYS A  1 393 ? 15.516  27.808  17.348  1.00 58.54  ? 1412 LYS A CD  1 
ATOM   3001  C CE  . LYS A  1 393 ? 15.683  28.076  15.860  1.00 59.23  ? 1412 LYS A CE  1 
ATOM   3002  N NZ  . LYS A  1 393 ? 16.278  29.421  15.613  1.00 60.12  ? 1412 LYS A NZ  1 
ATOM   3003  N N   . LYS A  1 394 ? 14.231  24.996  21.855  1.00 51.38  ? 1413 LYS A N   1 
ATOM   3004  C CA  . LYS A  1 394 ? 14.549  24.786  23.262  1.00 48.58  ? 1413 LYS A CA  1 
ATOM   3005  C C   . LYS A  1 394 ? 14.649  23.294  23.534  1.00 47.12  ? 1413 LYS A C   1 
ATOM   3006  O O   . LYS A  1 394 ? 15.484  22.849  24.315  1.00 46.82  ? 1413 LYS A O   1 
ATOM   3007  C CB  . LYS A  1 394 ? 13.466  25.383  24.159  1.00 47.77  ? 1413 LYS A CB  1 
ATOM   3008  C CG  . LYS A  1 394 ? 13.317  26.884  24.067  1.00 47.24  ? 1413 LYS A CG  1 
ATOM   3009  C CD  . LYS A  1 394 ? 12.252  27.372  25.038  1.00 46.66  ? 1413 LYS A CD  1 
ATOM   3010  C CE  . LYS A  1 394 ? 12.163  28.889  25.055  1.00 45.90  ? 1413 LYS A CE  1 
ATOM   3011  N NZ  . LYS A  1 394 ? 13.433  29.526  25.497  1.00 44.48  ? 1413 LYS A NZ  1 
ATOM   3012  N N   . LYS A  1 395 ? 13.783  22.524  22.886  1.00 45.64  ? 1414 LYS A N   1 
ATOM   3013  C CA  . LYS A  1 395 ? 13.782  21.081  23.058  1.00 45.19  ? 1414 LYS A CA  1 
ATOM   3014  C C   . LYS A  1 395 ? 15.064  20.492  22.475  1.00 43.46  ? 1414 LYS A C   1 
ATOM   3015  O O   . LYS A  1 395 ? 15.678  19.608  23.075  1.00 41.55  ? 1414 LYS A O   1 
ATOM   3016  C CB  . LYS A  1 395 ? 12.543  20.479  22.389  1.00 46.00  ? 1414 LYS A CB  1 
ATOM   3017  C CG  . LYS A  1 395 ? 12.514  18.965  22.345  1.00 47.40  ? 1414 LYS A CG  1 
ATOM   3018  C CD  . LYS A  1 395 ? 13.112  18.476  21.047  1.00 49.84  ? 1414 LYS A CD  1 
ATOM   3019  C CE  . LYS A  1 395 ? 12.869  17.002  20.846  1.00 51.19  ? 1414 LYS A CE  1 
ATOM   3020  N NZ  . LYS A  1 395 ? 13.331  16.593  19.494  1.00 52.09  ? 1414 LYS A NZ  1 
ATOM   3021  N N   . ASP A  1 396 ? 15.466  20.994  21.309  1.00 42.34  ? 1415 ASP A N   1 
ATOM   3022  C CA  . ASP A  1 396 ? 16.686  20.534  20.658  1.00 41.36  ? 1415 ASP A CA  1 
ATOM   3023  C C   . ASP A  1 396 ? 17.884  20.926  21.515  1.00 38.23  ? 1415 ASP A C   1 
ATOM   3024  O O   . ASP A  1 396 ? 18.788  20.122  21.742  1.00 36.33  ? 1415 ASP A O   1 
ATOM   3025  C CB  . ASP A  1 396 ? 16.830  21.159  19.267  1.00 45.24  ? 1415 ASP A CB  1 
ATOM   3026  C CG  . ASP A  1 396 ? 15.751  20.699  18.300  1.00 49.04  ? 1415 ASP A CG  1 
ATOM   3027  O OD1 . ASP A  1 396 ? 15.581  19.471  18.128  1.00 49.95  ? 1415 ASP A OD1 1 
ATOM   3028  O OD2 . ASP A  1 396 ? 15.078  21.569  17.705  1.00 52.04  ? 1415 ASP A OD2 1 
ATOM   3029  N N   . LEU A  1 397 ? 17.886  22.169  21.984  1.00 35.07  ? 1416 LEU A N   1 
ATOM   3030  C CA  . LEU A  1 397 ? 18.968  22.656  22.824  1.00 33.79  ? 1416 LEU A CA  1 
ATOM   3031  C C   . LEU A  1 397 ? 18.972  21.887  24.137  1.00 31.97  ? 1416 LEU A C   1 
ATOM   3032  O O   . LEU A  1 397 ? 20.002  21.767  24.798  1.00 30.72  ? 1416 LEU A O   1 
ATOM   3033  C CB  . LEU A  1 397 ? 18.804  24.156  23.087  1.00 35.74  ? 1416 LEU A CB  1 
ATOM   3034  C CG  . LEU A  1 397 ? 18.998  25.044  21.854  1.00 37.71  ? 1416 LEU A CG  1 
ATOM   3035  C CD1 . LEU A  1 397 ? 18.758  26.502  22.207  1.00 39.17  ? 1416 LEU A CD1 1 
ATOM   3036  C CD2 . LEU A  1 397 ? 20.412  24.859  21.321  1.00 39.34  ? 1416 LEU A CD2 1 
ATOM   3037  N N   . PHE A  1 398 ? 17.810  21.358  24.506  1.00 29.67  ? 1417 PHE A N   1 
ATOM   3038  C CA  . PHE A  1 398 ? 17.688  20.586  25.730  1.00 27.36  ? 1417 PHE A CA  1 
ATOM   3039  C C   . PHE A  1 398 ? 18.368  19.230  25.537  1.00 26.23  ? 1417 PHE A C   1 
ATOM   3040  O O   . PHE A  1 398 ? 18.998  18.694  26.450  1.00 22.40  ? 1417 PHE A O   1 
ATOM   3041  C CB  . PHE A  1 398 ? 16.217  20.373  26.078  1.00 28.01  ? 1417 PHE A CB  1 
ATOM   3042  C CG  . PHE A  1 398 ? 16.010  19.531  27.293  1.00 28.78  ? 1417 PHE A CG  1 
ATOM   3043  C CD1 . PHE A  1 398 ? 16.276  20.040  28.559  1.00 30.18  ? 1417 PHE A CD1 1 
ATOM   3044  C CD2 . PHE A  1 398 ? 15.591  18.212  27.173  1.00 28.90  ? 1417 PHE A CD2 1 
ATOM   3045  C CE1 . PHE A  1 398 ? 16.129  19.245  29.688  1.00 29.82  ? 1417 PHE A CE1 1 
ATOM   3046  C CE2 . PHE A  1 398 ? 15.442  17.410  28.296  1.00 30.31  ? 1417 PHE A CE2 1 
ATOM   3047  C CZ  . PHE A  1 398 ? 15.713  17.928  29.556  1.00 29.81  ? 1417 PHE A CZ  1 
ATOM   3048  N N   . LEU A  1 399 ? 18.226  18.672  24.341  1.00 24.38  ? 1418 LEU A N   1 
ATOM   3049  C CA  . LEU A  1 399 ? 18.848  17.393  24.051  1.00 25.47  ? 1418 LEU A CA  1 
ATOM   3050  C C   . LEU A  1 399 ? 20.367  17.583  23.957  1.00 24.47  ? 1418 LEU A C   1 
ATOM   3051  O O   . LEU A  1 399 ? 21.131  16.655  24.222  1.00 23.68  ? 1418 LEU A O   1 
ATOM   3052  C CB  . LEU A  1 399 ? 18.279  16.814  22.751  1.00 26.40  ? 1418 LEU A CB  1 
ATOM   3053  C CG  . LEU A  1 399 ? 16.777  16.495  22.774  1.00 28.94  ? 1418 LEU A CG  1 
ATOM   3054  C CD1 . LEU A  1 399 ? 16.350  15.948  21.423  1.00 29.33  ? 1418 LEU A CD1 1 
ATOM   3055  C CD2 . LEU A  1 399 ? 16.466  15.491  23.877  1.00 26.38  ? 1418 LEU A CD2 1 
ATOM   3056  N N   . ASP A  1 400 ? 20.795  18.789  23.585  1.00 23.85  ? 1419 ASP A N   1 
ATOM   3057  C CA  . ASP A  1 400 ? 22.222  19.110  23.488  1.00 25.07  ? 1419 ASP A CA  1 
ATOM   3058  C C   . ASP A  1 400 ? 22.827  19.165  24.885  1.00 22.67  ? 1419 ASP A C   1 
ATOM   3059  O O   . ASP A  1 400 ? 23.962  18.739  25.102  1.00 21.15  ? 1419 ASP A O   1 
ATOM   3060  C CB  . ASP A  1 400 ? 22.446  20.476  22.828  1.00 27.52  ? 1419 ASP A CB  1 
ATOM   3061  C CG  . ASP A  1 400 ? 22.250  20.446  21.329  1.00 31.73  ? 1419 ASP A CG  1 
ATOM   3062  O OD1 . ASP A  1 400 ? 22.198  19.337  20.753  1.00 33.25  ? 1419 ASP A OD1 1 
ATOM   3063  O OD2 . ASP A  1 400 ? 22.164  21.539  20.726  1.00 34.06  ? 1419 ASP A OD2 1 
ATOM   3064  N N   . LEU A  1 401 ? 22.064  19.715  25.824  1.00 20.84  ? 1420 LEU A N   1 
ATOM   3065  C CA  . LEU A  1 401 ? 22.513  19.835  27.205  1.00 18.96  ? 1420 LEU A CA  1 
ATOM   3066  C C   . LEU A  1 401 ? 22.829  18.453  27.773  1.00 18.90  ? 1420 LEU A C   1 
ATOM   3067  O O   . LEU A  1 401 ? 23.894  18.233  28.353  1.00 17.50  ? 1420 LEU A O   1 
ATOM   3068  C CB  . LEU A  1 401 ? 21.425  20.525  28.042  1.00 20.84  ? 1420 LEU A CB  1 
ATOM   3069  C CG  . LEU A  1 401 ? 21.691  20.831  29.520  1.00 20.47  ? 1420 LEU A CG  1 
ATOM   3070  C CD1 . LEU A  1 401 ? 20.630  21.794  30.021  1.00 22.29  ? 1420 LEU A CD1 1 
ATOM   3071  C CD2 . LEU A  1 401 ? 21.685  19.555  30.349  1.00 19.07  ? 1420 LEU A CD2 1 
ATOM   3072  N N   . ILE A  1 402 ? 21.893  17.524  27.604  1.00 16.88  ? 1421 ILE A N   1 
ATOM   3073  C CA  . ILE A  1 402 ? 22.071  16.164  28.098  1.00 17.81  ? 1421 ILE A CA  1 
ATOM   3074  C C   . ILE A  1 402 ? 23.248  15.479  27.402  1.00 15.51  ? 1421 ILE A C   1 
ATOM   3075  O O   . ILE A  1 402 ? 24.094  14.876  28.058  1.00 14.76  ? 1421 ILE A O   1 
ATOM   3076  C CB  . ILE A  1 402 ? 20.785  15.336  27.885  1.00 18.54  ? 1421 ILE A CB  1 
ATOM   3077  C CG1 . ILE A  1 402 ? 19.642  15.950  28.700  1.00 19.35  ? 1421 ILE A CG1 1 
ATOM   3078  C CG2 . ILE A  1 402 ? 21.012  13.896  28.306  1.00 19.58  ? 1421 ILE A CG2 1 
ATOM   3079  C CD1 . ILE A  1 402 ? 18.275  15.415  28.332  1.00 25.09  ? 1421 ILE A CD1 1 
ATOM   3080  N N   . ALA A  1 403 ? 23.302  15.582  26.077  1.00 14.73  ? 1422 ALA A N   1 
ATOM   3081  C CA  . ALA A  1 403 ? 24.387  14.973  25.317  1.00 15.21  ? 1422 ALA A CA  1 
ATOM   3082  C C   . ALA A  1 403 ? 25.732  15.521  25.789  1.00 16.75  ? 1422 ALA A C   1 
ATOM   3083  O O   . ALA A  1 403 ? 26.705  14.772  25.921  1.00 16.89  ? 1422 ALA A O   1 
ATOM   3084  C CB  . ALA A  1 403 ? 24.201  15.242  23.826  1.00 14.46  ? 1422 ALA A CB  1 
ATOM   3085  N N   . ASP A  1 404 ? 25.783  16.827  26.051  1.00 14.83  ? 1423 ASP A N   1 
ATOM   3086  C CA  . ASP A  1 404 ? 27.012  17.454  26.513  1.00 15.25  ? 1423 ASP A CA  1 
ATOM   3087  C C   . ASP A  1 404 ? 27.463  16.934  27.875  1.00 15.49  ? 1423 ASP A C   1 
ATOM   3088  O O   . ASP A  1 404 ? 28.656  16.703  28.084  1.00 14.06  ? 1423 ASP A O   1 
ATOM   3089  C CB  . ASP A  1 404 ? 26.854  18.979  26.581  1.00 15.75  ? 1423 ASP A CB  1 
ATOM   3090  C CG  . ASP A  1 404 ? 26.930  19.639  25.216  1.00 20.58  ? 1423 ASP A CG  1 
ATOM   3091  O OD1 . ASP A  1 404 ? 27.133  18.921  24.212  1.00 21.10  ? 1423 ASP A OD1 1 
ATOM   3092  O OD2 . ASP A  1 404 ? 26.789  20.881  25.146  1.00 22.24  ? 1423 ASP A OD2 1 
ATOM   3093  N N   . VAL A  1 405 ? 26.524  16.740  28.801  1.00 14.65  ? 1424 VAL A N   1 
ATOM   3094  C CA  . VAL A  1 405 ? 26.885  16.264  30.137  1.00 14.27  ? 1424 VAL A CA  1 
ATOM   3095  C C   . VAL A  1 405 ? 27.262  14.784  30.159  1.00 16.18  ? 1424 VAL A C   1 
ATOM   3096  O O   . VAL A  1 405 ? 28.162  14.379  30.890  1.00 16.86  ? 1424 VAL A O   1 
ATOM   3097  C CB  . VAL A  1 405 ? 25.734  16.478  31.150  1.00 17.03  ? 1424 VAL A CB  1 
ATOM   3098  C CG1 . VAL A  1 405 ? 26.175  16.035  32.538  1.00 17.13  ? 1424 VAL A CG1 1 
ATOM   3099  C CG2 . VAL A  1 405 ? 25.318  17.939  31.173  1.00 16.17  ? 1424 VAL A CG2 1 
ATOM   3100  N N   . MET A  1 406 ? 26.576  13.979  29.356  1.00 16.87  ? 1425 MET A N   1 
ATOM   3101  C CA  . MET A  1 406 ? 26.849  12.543  29.314  1.00 19.37  ? 1425 MET A CA  1 
ATOM   3102  C C   . MET A  1 406 ? 28.040  12.134  28.443  1.00 18.73  ? 1425 MET A C   1 
ATOM   3103  O O   . MET A  1 406 ? 28.798  11.228  28.804  1.00 19.17  ? 1425 MET A O   1 
ATOM   3104  C CB  . MET A  1 406 ? 25.621  11.786  28.807  1.00 19.65  ? 1425 MET A CB  1 
ATOM   3105  C CG  . MET A  1 406 ? 24.352  12.019  29.584  1.00 25.83  ? 1425 MET A CG  1 
ATOM   3106  S SD  . MET A  1 406 ? 23.072  10.851  29.070  1.00 31.53  ? 1425 MET A SD  1 
ATOM   3107  C CE  . MET A  1 406 ? 23.040  11.139  27.357  1.00 31.87  ? 1425 MET A CE  1 
ATOM   3108  N N   . PHE A  1 407 ? 28.201  12.794  27.298  1.00 18.04  ? 1426 PHE A N   1 
ATOM   3109  C CA  . PHE A  1 407 ? 29.270  12.439  26.371  1.00 18.15  ? 1426 PHE A CA  1 
ATOM   3110  C C   . PHE A  1 407 ? 30.266  13.533  26.004  1.00 17.62  ? 1426 PHE A C   1 
ATOM   3111  O O   . PHE A  1 407 ? 31.467  13.360  26.184  1.00 16.75  ? 1426 PHE A O   1 
ATOM   3112  C CB  . PHE A  1 407 ? 28.664  11.895  25.077  1.00 16.82  ? 1426 PHE A CB  1 
ATOM   3113  C CG  . PHE A  1 407 ? 27.690  10.769  25.289  1.00 18.43  ? 1426 PHE A CG  1 
ATOM   3114  C CD1 . PHE A  1 407 ? 26.322  11.010  25.293  1.00 18.69  ? 1426 PHE A CD1 1 
ATOM   3115  C CD2 . PHE A  1 407 ? 28.144  9.469   25.498  1.00 18.70  ? 1426 PHE A CD2 1 
ATOM   3116  C CE1 . PHE A  1 407 ? 25.410  9.973   25.503  1.00 20.41  ? 1426 PHE A CE1 1 
ATOM   3117  C CE2 . PHE A  1 407 ? 27.244  8.421   25.711  1.00 20.95  ? 1426 PHE A CE2 1 
ATOM   3118  C CZ  . PHE A  1 407 ? 25.872  8.673   25.714  1.00 21.22  ? 1426 PHE A CZ  1 
ATOM   3119  N N   . GLY A  1 408 ? 29.760  14.639  25.465  1.00 16.53  ? 1427 GLY A N   1 
ATOM   3120  C CA  . GLY A  1 408 ? 30.615  15.738  25.035  1.00 16.46  ? 1427 GLY A CA  1 
ATOM   3121  C C   . GLY A  1 408 ? 31.713  16.198  25.976  1.00 16.55  ? 1427 GLY A C   1 
ATOM   3122  O O   . GLY A  1 408 ? 32.901  16.108  25.655  1.00 17.43  ? 1427 GLY A O   1 
ATOM   3123  N N   . VAL A  1 409 ? 31.315  16.703  27.138  1.00 16.61  ? 1428 VAL A N   1 
ATOM   3124  C CA  . VAL A  1 409 ? 32.261  17.201  28.129  1.00 16.36  ? 1428 VAL A CA  1 
ATOM   3125  C C   . VAL A  1 409 ? 33.164  16.099  28.692  1.00 17.00  ? 1428 VAL A C   1 
ATOM   3126  O O   . VAL A  1 409 ? 34.385  16.263  28.754  1.00 16.58  ? 1428 VAL A O   1 
ATOM   3127  C CB  . VAL A  1 409 ? 31.501  17.934  29.264  1.00 17.49  ? 1428 VAL A CB  1 
ATOM   3128  C CG1 . VAL A  1 409 ? 32.428  18.239  30.432  1.00 17.12  ? 1428 VAL A CG1 1 
ATOM   3129  C CG2 . VAL A  1 409 ? 30.916  19.231  28.711  1.00 18.86  ? 1428 VAL A CG2 1 
ATOM   3130  N N   . PRO A  1 410 ? 32.582  14.961  29.109  1.00 16.23  ? 1429 PRO A N   1 
ATOM   3131  C CA  . PRO A  1 410 ? 33.422  13.880  29.645  1.00 15.33  ? 1429 PRO A CA  1 
ATOM   3132  C C   . PRO A  1 410 ? 34.513  13.469  28.643  1.00 13.69  ? 1429 PRO A C   1 
ATOM   3133  O O   . PRO A  1 410 ? 35.665  13.253  29.015  1.00 14.03  ? 1429 PRO A O   1 
ATOM   3134  C CB  . PRO A  1 410 ? 32.421  12.753  29.890  1.00 14.08  ? 1429 PRO A CB  1 
ATOM   3135  C CG  . PRO A  1 410 ? 31.165  13.496  30.236  1.00 17.27  ? 1429 PRO A CG  1 
ATOM   3136  C CD  . PRO A  1 410 ? 31.151  14.621  29.217  1.00 15.05  ? 1429 PRO A CD  1 
ATOM   3137  N N   . SER A  1 411 ? 34.139  13.363  27.373  1.00 14.69  ? 1430 SER A N   1 
ATOM   3138  C CA  . SER A  1 411 ? 35.087  12.971  26.340  1.00 15.65  ? 1430 SER A CA  1 
ATOM   3139  C C   . SER A  1 411 ? 36.244  13.947  26.192  1.00 15.55  ? 1430 SER A C   1 
ATOM   3140  O O   . SER A  1 411 ? 37.406  13.534  26.148  1.00 15.56  ? 1430 SER A O   1 
ATOM   3141  C CB  . SER A  1 411 ? 34.378  12.810  24.998  1.00 16.69  ? 1430 SER A CB  1 
ATOM   3142  O OG  . SER A  1 411 ? 33.512  11.690  25.029  1.00 20.36  ? 1430 SER A OG  1 
ATOM   3143  N N   . VAL A  1 412 ? 35.941  15.237  26.114  1.00 13.94  ? 1431 VAL A N   1 
ATOM   3144  C CA  . VAL A  1 412 ? 37.002  16.223  25.968  1.00 13.96  ? 1431 VAL A CA  1 
ATOM   3145  C C   . VAL A  1 412 ? 37.909  16.252  27.191  1.00 13.94  ? 1431 VAL A C   1 
ATOM   3146  O O   . VAL A  1 412 ? 39.123  16.384  27.056  1.00 16.49  ? 1431 VAL A O   1 
ATOM   3147  C CB  . VAL A  1 412 ? 36.434  17.644  25.693  1.00 13.23  ? 1431 VAL A CB  1 
ATOM   3148  C CG1 . VAL A  1 412 ? 37.545  18.689  25.783  1.00 14.88  ? 1431 VAL A CG1 1 
ATOM   3149  C CG2 . VAL A  1 412 ? 35.825  17.679  24.306  1.00 13.76  ? 1431 VAL A CG2 1 
ATOM   3150  N N   . ILE A  1 413 ? 37.333  16.119  28.382  1.00 13.45  ? 1432 ILE A N   1 
ATOM   3151  C CA  . ILE A  1 413 ? 38.145  16.123  29.596  1.00 13.85  ? 1432 ILE A CA  1 
ATOM   3152  C C   . ILE A  1 413 ? 39.090  14.922  29.590  1.00 14.24  ? 1432 ILE A C   1 
ATOM   3153  O O   . ILE A  1 413 ? 40.267  15.052  29.903  1.00 15.22  ? 1432 ILE A O   1 
ATOM   3154  C CB  . ILE A  1 413 ? 37.274  16.058  30.872  1.00 14.79  ? 1432 ILE A CB  1 
ATOM   3155  C CG1 . ILE A  1 413 ? 36.436  17.333  31.001  1.00 18.09  ? 1432 ILE A CG1 1 
ATOM   3156  C CG2 . ILE A  1 413 ? 38.164  15.911  32.106  1.00 16.04  ? 1432 ILE A CG2 1 
ATOM   3157  C CD1 . ILE A  1 413 ? 35.411  17.271  32.120  1.00 18.74  ? 1432 ILE A CD1 1 
ATOM   3158  N N   . VAL A  1 414 ? 38.567  13.751  29.245  1.00 14.09  ? 1433 VAL A N   1 
ATOM   3159  C CA  . VAL A  1 414 ? 39.394  12.548  29.194  1.00 15.54  ? 1433 VAL A CA  1 
ATOM   3160  C C   . VAL A  1 414 ? 40.511  12.740  28.168  1.00 15.95  ? 1433 VAL A C   1 
ATOM   3161  O O   . VAL A  1 414 ? 41.663  12.405  28.424  1.00 16.80  ? 1433 VAL A O   1 
ATOM   3162  C CB  . VAL A  1 414 ? 38.545  11.306  28.826  1.00 17.26  ? 1433 VAL A CB  1 
ATOM   3163  C CG1 . VAL A  1 414 ? 39.444  10.143  28.389  1.00 17.83  ? 1433 VAL A CG1 1 
ATOM   3164  C CG2 . VAL A  1 414 ? 37.721  10.886  30.041  1.00 17.34  ? 1433 VAL A CG2 1 
ATOM   3165  N N   . ALA A  1 415 ? 40.172  13.306  27.015  1.00 15.98  ? 1434 ALA A N   1 
ATOM   3166  C CA  . ALA A  1 415 ? 41.162  13.531  25.972  1.00 16.60  ? 1434 ALA A CA  1 
ATOM   3167  C C   . ALA A  1 415 ? 42.259  14.497  26.430  1.00 18.38  ? 1434 ALA A C   1 
ATOM   3168  O O   . ALA A  1 415 ? 43.438  14.264  26.165  1.00 17.25  ? 1434 ALA A O   1 
ATOM   3169  C CB  . ALA A  1 415 ? 40.488  14.061  24.717  1.00 16.02  ? 1434 ALA A CB  1 
ATOM   3170  N N   . ARG A  1 416 ? 41.871  15.573  27.113  1.00 18.49  ? 1435 ARG A N   1 
ATOM   3171  C CA  . ARG A  1 416 ? 42.836  16.563  27.601  1.00 19.34  ? 1435 ARG A CA  1 
ATOM   3172  C C   . ARG A  1 416 ? 43.795  15.975  28.616  1.00 18.04  ? 1435 ARG A C   1 
ATOM   3173  O O   . ARG A  1 416 ? 44.988  16.273  28.590  1.00 16.76  ? 1435 ARG A O   1 
ATOM   3174  C CB  . ARG A  1 416 ? 42.119  17.767  28.226  1.00 18.41  ? 1435 ARG A CB  1 
ATOM   3175  C CG  . ARG A  1 416 ? 41.424  18.661  27.212  1.00 18.59  ? 1435 ARG A CG  1 
ATOM   3176  C CD  . ARG A  1 416 ? 40.632  19.781  27.889  1.00 18.76  ? 1435 ARG A CD  1 
ATOM   3177  N NE  . ARG A  1 416 ? 40.155  20.756  26.913  1.00 17.96  ? 1435 ARG A NE  1 
ATOM   3178  C CZ  . ARG A  1 416 ? 39.352  21.778  27.198  1.00 20.22  ? 1435 ARG A CZ  1 
ATOM   3179  N NH1 . ARG A  1 416 ? 38.922  21.967  28.439  1.00 15.45  ? 1435 ARG A NH1 1 
ATOM   3180  N NH2 . ARG A  1 416 ? 38.986  22.617  26.239  1.00 18.00  ? 1435 ARG A NH2 1 
ATOM   3181  N N   . ASN A  1 417 ? 43.275  15.145  29.519  1.00 18.86  ? 1436 ASN A N   1 
ATOM   3182  C CA  . ASN A  1 417 ? 44.117  14.521  30.531  1.00 18.53  ? 1436 ASN A CA  1 
ATOM   3183  C C   . ASN A  1 417 ? 45.074  13.525  29.890  1.00 18.18  ? 1436 ASN A C   1 
ATOM   3184  O O   . ASN A  1 417 ? 46.221  13.404  30.305  1.00 17.39  ? 1436 ASN A O   1 
ATOM   3185  C CB  . ASN A  1 417 ? 43.263  13.814  31.588  1.00 21.36  ? 1436 ASN A CB  1 
ATOM   3186  C CG  . ASN A  1 417 ? 42.698  14.778  32.613  1.00 25.52  ? 1436 ASN A CG  1 
ATOM   3187  O OD1 . ASN A  1 417 ? 41.497  15.050  32.640  1.00 26.74  ? 1436 ASN A OD1 1 
ATOM   3188  N ND2 . ASN A  1 417 ? 43.571  15.309  33.460  1.00 25.82  ? 1436 ASN A ND2 1 
ATOM   3189  N N   . HIS A  1 418 ? 44.593  12.804  28.885  1.00 19.04  ? 1437 HIS A N   1 
ATOM   3190  C CA  . HIS A  1 418 ? 45.424  11.834  28.180  1.00 19.95  ? 1437 HIS A CA  1 
ATOM   3191  C C   . HIS A  1 418 ? 46.544  12.582  27.473  1.00 19.79  ? 1437 HIS A C   1 
ATOM   3192  O O   . HIS A  1 418 ? 47.713  12.189  27.531  1.00 18.66  ? 1437 HIS A O   1 
ATOM   3193  C CB  . HIS A  1 418 ? 44.601  11.083  27.144  1.00 18.16  ? 1437 HIS A CB  1 
ATOM   3194  C CG  . HIS A  1 418 ? 45.334  9.944   26.515  1.00 19.74  ? 1437 HIS A CG  1 
ATOM   3195  N ND1 . HIS A  1 418 ? 45.973  10.043  25.296  1.00 18.63  ? 1437 HIS A ND1 1 
ATOM   3196  C CD2 . HIS A  1 418 ? 45.570  8.689   26.964  1.00 18.46  ? 1437 HIS A CD2 1 
ATOM   3197  C CE1 . HIS A  1 418 ? 46.572  8.898   25.024  1.00 20.57  ? 1437 HIS A CE1 1 
ATOM   3198  N NE2 . HIS A  1 418 ? 46.343  8.060   26.020  1.00 19.06  ? 1437 HIS A NE2 1 
ATOM   3199  N N   . ARG A  1 419 ? 46.168  13.656  26.789  1.00 18.50  ? 1438 ARG A N   1 
ATOM   3200  C CA  . ARG A  1 419 ? 47.132  14.485  26.084  1.00 20.25  ? 1438 ARG A CA  1 
ATOM   3201  C C   . ARG A  1 419 ? 48.205  14.918  27.079  1.00 21.02  ? 1438 ARG A C   1 
ATOM   3202  O O   . ARG A  1 419 ? 49.399  14.747  26.839  1.00 20.30  ? 1438 ARG A O   1 
ATOM   3203  C CB  . ARG A  1 419 ? 46.435  15.723  25.500  1.00 19.90  ? 1438 ARG A CB  1 
ATOM   3204  C CG  . ARG A  1 419 ? 47.387  16.805  24.963  1.00 20.37  ? 1438 ARG A CG  1 
ATOM   3205  C CD  . ARG A  1 419 ? 46.654  18.135  24.753  1.00 19.72  ? 1438 ARG A CD  1 
ATOM   3206  N NE  . ARG A  1 419 ? 46.172  18.669  26.028  1.00 19.83  ? 1438 ARG A NE  1 
ATOM   3207  C CZ  . ARG A  1 419 ? 45.319  19.679  26.163  1.00 17.05  ? 1438 ARG A CZ  1 
ATOM   3208  N NH1 . ARG A  1 419 ? 44.827  20.291  25.097  1.00 17.26  ? 1438 ARG A NH1 1 
ATOM   3209  N NH2 . ARG A  1 419 ? 44.965  20.086  27.378  1.00 18.58  ? 1438 ARG A NH2 1 
ATOM   3210  N N   . ASP A  1 420 ? 47.774  15.459  28.212  1.00 21.08  ? 1439 ASP A N   1 
ATOM   3211  C CA  . ASP A  1 420 ? 48.720  15.931  29.213  1.00 23.80  ? 1439 ASP A CA  1 
ATOM   3212  C C   . ASP A  1 420 ? 49.569  14.836  29.841  1.00 24.17  ? 1439 ASP A C   1 
ATOM   3213  O O   . ASP A  1 420 ? 50.597  15.119  30.453  1.00 24.46  ? 1439 ASP A O   1 
ATOM   3214  C CB  . ASP A  1 420 ? 47.986  16.723  30.296  1.00 25.56  ? 1439 ASP A CB  1 
ATOM   3215  C CG  . ASP A  1 420 ? 47.292  17.954  29.737  1.00 27.17  ? 1439 ASP A CG  1 
ATOM   3216  O OD1 . ASP A  1 420 ? 47.668  18.393  28.626  1.00 29.08  ? 1439 ASP A OD1 1 
ATOM   3217  O OD2 . ASP A  1 420 ? 46.382  18.486  30.405  1.00 28.96  ? 1439 ASP A OD2 1 
ATOM   3218  N N   . ALA A  1 421 ? 49.141  13.588  29.684  1.00 25.57  ? 1440 ALA A N   1 
ATOM   3219  C CA  . ALA A  1 421 ? 49.885  12.459  30.222  1.00 25.73  ? 1440 ALA A CA  1 
ATOM   3220  C C   . ALA A  1 421 ? 51.034  12.090  29.279  1.00 27.02  ? 1440 ALA A C   1 
ATOM   3221  O O   . ALA A  1 421 ? 51.883  11.268  29.621  1.00 28.24  ? 1440 ALA A O   1 
ATOM   3222  C CB  . ALA A  1 421 ? 48.958  11.267  30.425  1.00 28.26  ? 1440 ALA A CB  1 
ATOM   3223  N N   . GLY A  1 422 ? 51.043  12.676  28.084  1.00 26.11  ? 1441 GLY A N   1 
ATOM   3224  C CA  . GLY A  1 422 ? 52.131  12.419  27.157  1.00 25.53  ? 1441 GLY A CA  1 
ATOM   3225  C C   . GLY A  1 422 ? 51.944  11.582  25.903  1.00 25.11  ? 1441 GLY A C   1 
ATOM   3226  O O   . GLY A  1 422 ? 52.716  11.733  24.958  1.00 25.34  ? 1441 GLY A O   1 
ATOM   3227  N N   . ALA A  1 423 ? 50.951  10.701  25.866  1.00 24.74  ? 1442 ALA A N   1 
ATOM   3228  C CA  . ALA A  1 423 ? 50.760  9.866   24.681  1.00 23.83  ? 1442 ALA A CA  1 
ATOM   3229  C C   . ALA A  1 423 ? 49.927  10.553  23.604  1.00 21.26  ? 1442 ALA A C   1 
ATOM   3230  O O   . ALA A  1 423 ? 49.236  11.538  23.872  1.00 22.29  ? 1442 ALA A O   1 
ATOM   3231  C CB  . ALA A  1 423 ? 50.121  8.525   25.069  1.00 24.28  ? 1442 ALA A CB  1 
ATOM   3232  N N   . PRO A  1 424 ? 49.991  10.040  22.364  1.00 19.70  ? 1443 PRO A N   1 
ATOM   3233  C CA  . PRO A  1 424 ? 49.252  10.587  21.223  1.00 18.04  ? 1443 PRO A CA  1 
ATOM   3234  C C   . PRO A  1 424 ? 47.747  10.528  21.458  1.00 17.30  ? 1443 PRO A C   1 
ATOM   3235  O O   . PRO A  1 424 ? 47.218  9.483   21.855  1.00 15.03  ? 1443 PRO A O   1 
ATOM   3236  C CB  . PRO A  1 424 ? 49.684  9.687   20.065  1.00 17.35  ? 1443 PRO A CB  1 
ATOM   3237  C CG  . PRO A  1 424 ? 51.053  9.253   20.469  1.00 21.17  ? 1443 PRO A CG  1 
ATOM   3238  C CD  . PRO A  1 424 ? 50.871  8.942   21.931  1.00 18.83  ? 1443 PRO A CD  1 
ATOM   3239  N N   . THR A  1 425 ? 47.074  11.647  21.201  1.00 15.04  ? 1444 THR A N   1 
ATOM   3240  C CA  . THR A  1 425 ? 45.629  11.759  21.385  1.00 15.06  ? 1444 THR A CA  1 
ATOM   3241  C C   . THR A  1 425 ? 44.964  12.370  20.150  1.00 14.94  ? 1444 THR A C   1 
ATOM   3242  O O   . THR A  1 425 ? 45.464  13.341  19.578  1.00 15.45  ? 1444 THR A O   1 
ATOM   3243  C CB  . THR A  1 425 ? 45.280  12.662  22.600  1.00 16.75  ? 1444 THR A CB  1 
ATOM   3244  O OG1 . THR A  1 425 ? 46.065  12.281  23.736  1.00 16.98  ? 1444 THR A OG1 1 
ATOM   3245  C CG2 . THR A  1 425 ? 43.798  12.525  22.958  1.00 16.97  ? 1444 THR A CG2 1 
ATOM   3246  N N   . TYR A  1 426 ? 43.832  11.799  19.750  1.00 12.46  ? 1445 TYR A N   1 
ATOM   3247  C CA  . TYR A  1 426 ? 43.081  12.281  18.601  1.00 15.19  ? 1445 TYR A CA  1 
ATOM   3248  C C   . TYR A  1 426 ? 41.602  12.358  18.962  1.00 16.37  ? 1445 TYR A C   1 
ATOM   3249  O O   . TYR A  1 426 ? 41.104  11.529  19.722  1.00 16.83  ? 1445 TYR A O   1 
ATOM   3250  C CB  . TYR A  1 426 ? 43.265  11.331  17.411  1.00 15.66  ? 1445 TYR A CB  1 
ATOM   3251  C CG  . TYR A  1 426 ? 44.660  11.355  16.838  1.00 18.20  ? 1445 TYR A CG  1 
ATOM   3252  C CD1 . TYR A  1 426 ? 45.017  12.299  15.871  1.00 18.74  ? 1445 TYR A CD1 1 
ATOM   3253  C CD2 . TYR A  1 426 ? 45.645  10.481  17.307  1.00 16.40  ? 1445 TYR A CD2 1 
ATOM   3254  C CE1 . TYR A  1 426 ? 46.323  12.375  15.388  1.00 19.35  ? 1445 TYR A CE1 1 
ATOM   3255  C CE2 . TYR A  1 426 ? 46.957  10.553  16.832  1.00 19.56  ? 1445 TYR A CE2 1 
ATOM   3256  C CZ  . TYR A  1 426 ? 47.281  11.503  15.873  1.00 19.20  ? 1445 TYR A CZ  1 
ATOM   3257  O OH  . TYR A  1 426 ? 48.559  11.579  15.393  1.00 22.90  ? 1445 TYR A OH  1 
ATOM   3258  N N   . MET A  1 427 ? 40.908  13.363  18.435  1.00 15.86  ? 1446 MET A N   1 
ATOM   3259  C CA  . MET A  1 427 ? 39.478  13.510  18.690  1.00 15.37  ? 1446 MET A CA  1 
ATOM   3260  C C   . MET A  1 427 ? 38.713  13.751  17.398  1.00 15.66  ? 1446 MET A C   1 
ATOM   3261  O O   . MET A  1 427 ? 39.263  14.262  16.422  1.00 14.93  ? 1446 MET A O   1 
ATOM   3262  C CB  . MET A  1 427 ? 39.192  14.676  19.645  1.00 15.55  ? 1446 MET A CB  1 
ATOM   3263  C CG  . MET A  1 427 ? 39.487  14.402  21.115  1.00 15.94  ? 1446 MET A CG  1 
ATOM   3264  S SD  . MET A  1 427 ? 38.572  15.545  22.180  1.00 16.02  ? 1446 MET A SD  1 
ATOM   3265  C CE  . MET A  1 427 ? 37.006  14.685  22.318  1.00 14.54  ? 1446 MET A CE  1 
ATOM   3266  N N   . TYR A  1 428 ? 37.445  13.354  17.390  1.00 15.35  ? 1447 TYR A N   1 
ATOM   3267  C CA  . TYR A  1 428 ? 36.590  13.581  16.237  1.00 16.20  ? 1447 TYR A CA  1 
ATOM   3268  C C   . TYR A  1 428 ? 35.169  13.873  16.700  1.00 17.03  ? 1447 TYR A C   1 
ATOM   3269  O O   . TYR A  1 428 ? 34.809  13.624  17.861  1.00 14.73  ? 1447 TYR A O   1 
ATOM   3270  C CB  . TYR A  1 428 ? 36.574  12.371  15.279  1.00 14.27  ? 1447 TYR A CB  1 
ATOM   3271  C CG  . TYR A  1 428 ? 35.823  11.151  15.782  1.00 14.78  ? 1447 TYR A CG  1 
ATOM   3272  C CD1 . TYR A  1 428 ? 36.507  10.066  16.328  1.00 14.31  ? 1447 TYR A CD1 1 
ATOM   3273  C CD2 . TYR A  1 428 ? 34.423  11.098  15.742  1.00 13.87  ? 1447 TYR A CD2 1 
ATOM   3274  C CE1 . TYR A  1 428 ? 35.817  8.953   16.827  1.00 14.87  ? 1447 TYR A CE1 1 
ATOM   3275  C CE2 . TYR A  1 428 ? 33.723  9.997   16.239  1.00 13.68  ? 1447 TYR A CE2 1 
ATOM   3276  C CZ  . TYR A  1 428 ? 34.431  8.926   16.781  1.00 17.44  ? 1447 TYR A CZ  1 
ATOM   3277  O OH  . TYR A  1 428 ? 33.756  7.834   17.280  1.00 17.94  ? 1447 TYR A OH  1 
ATOM   3278  N N   . GLU A  1 429 ? 34.386  14.439  15.788  1.00 16.69  ? 1448 GLU A N   1 
ATOM   3279  C CA  . GLU A  1 429 ? 32.978  14.722  16.025  1.00 17.08  ? 1448 GLU A CA  1 
ATOM   3280  C C   . GLU A  1 429 ? 32.309  14.247  14.751  1.00 16.70  ? 1448 GLU A C   1 
ATOM   3281  O O   . GLU A  1 429 ? 32.575  14.782  13.673  1.00 16.28  ? 1448 GLU A O   1 
ATOM   3282  C CB  . GLU A  1 429 ? 32.709  16.212  16.223  1.00 19.86  ? 1448 GLU A CB  1 
ATOM   3283  C CG  . GLU A  1 429 ? 31.261  16.462  16.615  1.00 22.98  ? 1448 GLU A CG  1 
ATOM   3284  C CD  . GLU A  1 429 ? 30.946  17.920  16.842  1.00 28.11  ? 1448 GLU A CD  1 
ATOM   3285  O OE1 . GLU A  1 429 ? 30.199  18.213  17.799  1.00 28.58  ? 1448 GLU A OE1 1 
ATOM   3286  O OE2 . GLU A  1 429 ? 31.435  18.765  16.063  1.00 31.34  ? 1448 GLU A OE2 1 
ATOM   3287  N N   . PHE A  1 430 ? 31.463  13.228  14.878  1.00 15.78  ? 1449 PHE A N   1 
ATOM   3288  C CA  . PHE A  1 430 ? 30.771  12.631  13.744  1.00 16.66  ? 1449 PHE A CA  1 
ATOM   3289  C C   . PHE A  1 430 ? 29.406  13.269  13.493  1.00 19.83  ? 1449 PHE A C   1 
ATOM   3290  O O   . PHE A  1 430 ? 28.572  13.359  14.402  1.00 20.48  ? 1449 PHE A O   1 
ATOM   3291  C CB  . PHE A  1 430 ? 30.597  11.129  13.996  1.00 15.88  ? 1449 PHE A CB  1 
ATOM   3292  C CG  . PHE A  1 430 ? 30.148  10.354  12.791  1.00 18.80  ? 1449 PHE A CG  1 
ATOM   3293  C CD1 . PHE A  1 430 ? 31.050  10.021  11.789  1.00 16.73  ? 1449 PHE A CD1 1 
ATOM   3294  C CD2 . PHE A  1 430 ? 28.822  9.952   12.661  1.00 18.31  ? 1449 PHE A CD2 1 
ATOM   3295  C CE1 . PHE A  1 430 ? 30.638  9.295   10.674  1.00 18.60  ? 1449 PHE A CE1 1 
ATOM   3296  C CE2 . PHE A  1 430 ? 28.402  9.227   11.548  1.00 19.41  ? 1449 PHE A CE2 1 
ATOM   3297  C CZ  . PHE A  1 430 ? 29.314  8.899   10.555  1.00 16.23  ? 1449 PHE A CZ  1 
ATOM   3298  N N   . GLN A  1 431 ? 29.179  13.695  12.253  1.00 19.00  ? 1450 GLN A N   1 
ATOM   3299  C CA  . GLN A  1 431 ? 27.922  14.324  11.867  1.00 22.05  ? 1450 GLN A CA  1 
ATOM   3300  C C   . GLN A  1 431 ? 27.438  13.800  10.520  1.00 24.46  ? 1450 GLN A C   1 
ATOM   3301  O O   . GLN A  1 431 ? 27.853  14.282  9.463   1.00 24.67  ? 1450 GLN A O   1 
ATOM   3302  C CB  . GLN A  1 431 ? 28.085  15.843  11.788  1.00 23.68  ? 1450 GLN A CB  1 
ATOM   3303  C CG  . GLN A  1 431 ? 26.857  16.569  11.262  1.00 31.47  ? 1450 GLN A CG  1 
ATOM   3304  C CD  . GLN A  1 431 ? 27.021  18.077  11.310  1.00 34.42  ? 1450 GLN A CD  1 
ATOM   3305  O OE1 . GLN A  1 431 ? 28.115  18.583  11.564  1.00 36.88  ? 1450 GLN A OE1 1 
ATOM   3306  N NE2 . GLN A  1 431 ? 25.935  18.802  11.061  1.00 37.57  ? 1450 GLN A NE2 1 
ATOM   3307  N N   . TYR A  1 432 ? 26.554  12.812  10.561  1.00 24.06  ? 1451 TYR A N   1 
ATOM   3308  C CA  . TYR A  1 432 ? 26.014  12.231  9.343   1.00 25.09  ? 1451 TYR A CA  1 
ATOM   3309  C C   . TYR A  1 432 ? 24.776  11.414  9.669   1.00 24.99  ? 1451 TYR A C   1 
ATOM   3310  O O   . TYR A  1 432 ? 24.651  10.880  10.770  1.00 26.76  ? 1451 TYR A O   1 
ATOM   3311  C CB  . TYR A  1 432 ? 27.054  11.318  8.686   1.00 23.83  ? 1451 TYR A CB  1 
ATOM   3312  C CG  . TYR A  1 432 ? 26.657  10.848  7.309   1.00 25.79  ? 1451 TYR A CG  1 
ATOM   3313  C CD1 . TYR A  1 432 ? 26.693  11.717  6.222   1.00 24.67  ? 1451 TYR A CD1 1 
ATOM   3314  C CD2 . TYR A  1 432 ? 26.227  9.538   7.093   1.00 26.36  ? 1451 TYR A CD2 1 
ATOM   3315  C CE1 . TYR A  1 432 ? 26.313  11.299  4.952   1.00 28.11  ? 1451 TYR A CE1 1 
ATOM   3316  C CE2 . TYR A  1 432 ? 25.842  9.106   5.824   1.00 27.67  ? 1451 TYR A CE2 1 
ATOM   3317  C CZ  . TYR A  1 432 ? 25.889  9.991   4.760   1.00 29.08  ? 1451 TYR A CZ  1 
ATOM   3318  O OH  . TYR A  1 432 ? 25.518  9.575   3.503   1.00 31.19  ? 1451 TYR A OH  1 
ATOM   3319  N N   . ARG A  1 433 ? 23.858  11.318  8.715   1.00 25.53  ? 1452 ARG A N   1 
ATOM   3320  C CA  . ARG A  1 433 ? 22.657  10.526  8.929   1.00 27.37  ? 1452 ARG A CA  1 
ATOM   3321  C C   . ARG A  1 433 ? 22.706  9.298   8.034   1.00 26.71  ? 1452 ARG A C   1 
ATOM   3322  O O   . ARG A  1 433 ? 22.529  9.393   6.819   1.00 27.24  ? 1452 ARG A O   1 
ATOM   3323  C CB  . ARG A  1 433 ? 21.396  11.335  8.623   1.00 30.24  ? 1452 ARG A CB  1 
ATOM   3324  C CG  . ARG A  1 433 ? 20.117  10.588  8.992   1.00 34.17  ? 1452 ARG A CG  1 
ATOM   3325  C CD  . ARG A  1 433 ? 18.885  11.458  8.837   1.00 36.59  ? 1452 ARG A CD  1 
ATOM   3326  N NE  . ARG A  1 433 ? 17.671  10.784  9.295   1.00 39.49  ? 1452 ARG A NE  1 
ATOM   3327  C CZ  . ARG A  1 433 ? 17.135  9.719   8.706   1.00 39.83  ? 1452 ARG A CZ  1 
ATOM   3328  N NH1 . ARG A  1 433 ? 17.702  9.192   7.629   1.00 39.70  ? 1452 ARG A NH1 1 
ATOM   3329  N NH2 . ARG A  1 433 ? 16.022  9.183   9.191   1.00 41.23  ? 1452 ARG A NH2 1 
ATOM   3330  N N   . PRO A  1 434 ? 22.957  8.122   8.626   1.00 26.12  ? 1453 PRO A N   1 
ATOM   3331  C CA  . PRO A  1 434 ? 23.029  6.873   7.865   1.00 24.72  ? 1453 PRO A CA  1 
ATOM   3332  C C   . PRO A  1 434 ? 21.684  6.530   7.239   1.00 24.75  ? 1453 PRO A C   1 
ATOM   3333  O O   . PRO A  1 434 ? 20.637  6.782   7.831   1.00 24.76  ? 1453 PRO A O   1 
ATOM   3334  C CB  . PRO A  1 434 ? 23.434  5.842   8.922   1.00 23.36  ? 1453 PRO A CB  1 
ATOM   3335  C CG  . PRO A  1 434 ? 24.136  6.658   9.959   1.00 24.96  ? 1453 PRO A CG  1 
ATOM   3336  C CD  . PRO A  1 434 ? 23.268  7.881   10.044  1.00 25.53  ? 1453 PRO A CD  1 
ATOM   3337  N N   . SER A  1 435 ? 21.718  5.961   6.042   1.00 24.25  ? 1454 SER A N   1 
ATOM   3338  C CA  . SER A  1 435 ? 20.495  5.560   5.364   1.00 25.95  ? 1454 SER A CA  1 
ATOM   3339  C C   . SER A  1 435 ? 19.962  4.339   6.101   1.00 26.91  ? 1454 SER A C   1 
ATOM   3340  O O   . SER A  1 435 ? 18.808  3.948   5.937   1.00 27.80  ? 1454 SER A O   1 
ATOM   3341  C CB  . SER A  1 435 ? 20.785  5.191   3.907   1.00 25.79  ? 1454 SER A CB  1 
ATOM   3342  O OG  . SER A  1 435 ? 21.709  4.116   3.827   1.00 25.21  ? 1454 SER A OG  1 
ATOM   3343  N N   . PHE A  1 436 ? 20.822  3.746   6.923   1.00 26.51  ? 1455 PHE A N   1 
ATOM   3344  C CA  . PHE A  1 436 ? 20.472  2.558   7.690   1.00 27.04  ? 1455 PHE A CA  1 
ATOM   3345  C C   . PHE A  1 436 ? 19.681  2.892   8.951   1.00 26.65  ? 1455 PHE A C   1 
ATOM   3346  O O   . PHE A  1 436 ? 19.355  2.007   9.740   1.00 27.21  ? 1455 PHE A O   1 
ATOM   3347  C CB  . PHE A  1 436 ? 21.748  1.796   8.055   1.00 25.74  ? 1455 PHE A CB  1 
ATOM   3348  C CG  . PHE A  1 436 ? 22.686  1.616   6.900   1.00 26.93  ? 1455 PHE A CG  1 
ATOM   3349  C CD1 . PHE A  1 436 ? 23.903  2.286   6.864   1.00 25.91  ? 1455 PHE A CD1 1 
ATOM   3350  C CD2 . PHE A  1 436 ? 22.337  0.800   5.825   1.00 27.67  ? 1455 PHE A CD2 1 
ATOM   3351  C CE1 . PHE A  1 436 ? 24.762  2.149   5.773   1.00 28.34  ? 1455 PHE A CE1 1 
ATOM   3352  C CE2 . PHE A  1 436 ? 23.189  0.655   4.728   1.00 28.70  ? 1455 PHE A CE2 1 
ATOM   3353  C CZ  . PHE A  1 436 ? 24.402  1.331   4.702   1.00 26.21  ? 1455 PHE A CZ  1 
ATOM   3354  N N   . SER A  1 437 ? 19.370  4.171   9.131   1.00 25.93  ? 1456 SER A N   1 
ATOM   3355  C CA  . SER A  1 437 ? 18.614  4.621   10.298  1.00 26.97  ? 1456 SER A CA  1 
ATOM   3356  C C   . SER A  1 437 ? 17.254  3.937   10.358  1.00 25.64  ? 1456 SER A C   1 
ATOM   3357  O O   . SER A  1 437 ? 16.748  3.450   9.353   1.00 24.01  ? 1456 SER A O   1 
ATOM   3358  C CB  . SER A  1 437 ? 18.397  6.139   10.244  1.00 27.35  ? 1456 SER A CB  1 
ATOM   3359  O OG  . SER A  1 437 ? 19.622  6.846   10.211  1.00 28.42  ? 1456 SER A OG  1 
ATOM   3360  N N   . SER A  1 438 ? 16.667  3.911   11.546  1.00 26.51  ? 1457 SER A N   1 
ATOM   3361  C CA  . SER A  1 438 ? 15.352  3.318   11.738  1.00 28.98  ? 1457 SER A CA  1 
ATOM   3362  C C   . SER A  1 438 ? 14.325  4.174   10.999  1.00 30.08  ? 1457 SER A C   1 
ATOM   3363  O O   . SER A  1 438 ? 14.483  5.393   10.905  1.00 28.33  ? 1457 SER A O   1 
ATOM   3364  C CB  . SER A  1 438 ? 15.015  3.280   13.231  1.00 28.82  ? 1457 SER A CB  1 
ATOM   3365  O OG  . SER A  1 438 ? 13.673  2.877   13.449  1.00 29.67  ? 1457 SER A OG  1 
ATOM   3366  N N   . ASP A  1 439 ? 13.283  3.537   10.470  1.00 32.66  ? 1458 ASP A N   1 
ATOM   3367  C CA  . ASP A  1 439 ? 12.227  4.259   9.761   1.00 34.93  ? 1458 ASP A CA  1 
ATOM   3368  C C   . ASP A  1 439 ? 11.473  5.184   10.709  1.00 34.04  ? 1458 ASP A C   1 
ATOM   3369  O O   . ASP A  1 439 ? 10.904  6.190   10.287  1.00 34.15  ? 1458 ASP A O   1 
ATOM   3370  C CB  . ASP A  1 439 ? 11.231  3.284   9.130   1.00 39.11  ? 1458 ASP A CB  1 
ATOM   3371  C CG  . ASP A  1 439 ? 11.873  2.379   8.104   1.00 42.75  ? 1458 ASP A CG  1 
ATOM   3372  O OD1 . ASP A  1 439 ? 12.598  2.898   7.227   1.00 45.18  ? 1458 ASP A OD1 1 
ATOM   3373  O OD2 . ASP A  1 439 ? 11.645  1.151   8.171   1.00 45.27  ? 1458 ASP A OD2 1 
ATOM   3374  N N   . MET A  1 440 ? 11.471  4.835   11.991  1.00 32.08  ? 1459 MET A N   1 
ATOM   3375  C CA  . MET A  1 440 ? 10.781  5.634   12.998  1.00 32.52  ? 1459 MET A CA  1 
ATOM   3376  C C   . MET A  1 440 ? 11.591  6.870   13.366  1.00 31.86  ? 1459 MET A C   1 
ATOM   3377  O O   . MET A  1 440 ? 11.116  7.746   14.087  1.00 31.24  ? 1459 MET A O   1 
ATOM   3378  C CB  . MET A  1 440 ? 10.538  4.799   14.253  1.00 34.33  ? 1459 MET A CB  1 
ATOM   3379  C CG  . MET A  1 440 ? 9.716   3.549   14.021  1.00 37.57  ? 1459 MET A CG  1 
ATOM   3380  S SD  . MET A  1 440 ? 9.703   2.509   15.487  1.00 42.69  ? 1459 MET A SD  1 
ATOM   3381  C CE  . MET A  1 440 ? 11.142  1.492   15.179  1.00 41.41  ? 1459 MET A CE  1 
ATOM   3382  N N   . LYS A  1 441 ? 12.820  6.933   12.871  1.00 31.43  ? 1460 LYS A N   1 
ATOM   3383  C CA  . LYS A  1 441 ? 13.700  8.057   13.159  1.00 31.79  ? 1460 LYS A CA  1 
ATOM   3384  C C   . LYS A  1 441 ? 13.485  9.172   12.140  1.00 32.37  ? 1460 LYS A C   1 
ATOM   3385  O O   . LYS A  1 441 ? 13.677  8.970   10.942  1.00 32.25  ? 1460 LYS A O   1 
ATOM   3386  C CB  . LYS A  1 441 ? 15.149  7.576   13.129  1.00 31.23  ? 1460 LYS A CB  1 
ATOM   3387  C CG  . LYS A  1 441 ? 16.206  8.620   13.418  1.00 32.90  ? 1460 LYS A CG  1 
ATOM   3388  C CD  . LYS A  1 441 ? 17.575  7.965   13.288  1.00 32.71  ? 1460 LYS A CD  1 
ATOM   3389  C CE  . LYS A  1 441 ? 18.713  8.952   13.404  1.00 35.80  ? 1460 LYS A CE  1 
ATOM   3390  N NZ  . LYS A  1 441 ? 20.011  8.267   13.135  1.00 33.76  ? 1460 LYS A NZ  1 
ATOM   3391  N N   . PRO A  1 442 ? 13.076  10.364  12.605  1.00 33.53  ? 1461 PRO A N   1 
ATOM   3392  C CA  . PRO A  1 442 ? 12.842  11.499  11.705  1.00 35.37  ? 1461 PRO A CA  1 
ATOM   3393  C C   . PRO A  1 442 ? 14.106  11.905  10.944  1.00 37.15  ? 1461 PRO A C   1 
ATOM   3394  O O   . PRO A  1 442 ? 15.200  11.961  11.507  1.00 35.95  ? 1461 PRO A O   1 
ATOM   3395  C CB  . PRO A  1 442 ? 12.335  12.591  12.649  1.00 35.52  ? 1461 PRO A CB  1 
ATOM   3396  C CG  . PRO A  1 442 ? 12.997  12.250  13.956  1.00 36.44  ? 1461 PRO A CG  1 
ATOM   3397  C CD  . PRO A  1 442 ? 12.853  10.749  14.010  1.00 34.06  ? 1461 PRO A CD  1 
ATOM   3398  N N   . LYS A  1 443 ? 13.939  12.188  9.657   1.00 39.32  ? 1462 LYS A N   1 
ATOM   3399  C CA  . LYS A  1 443 ? 15.048  12.562  8.791   1.00 39.54  ? 1462 LYS A CA  1 
ATOM   3400  C C   . LYS A  1 443 ? 15.895  13.740  9.268   1.00 38.39  ? 1462 LYS A C   1 
ATOM   3401  O O   . LYS A  1 443 ? 17.023  13.912  8.811   1.00 39.21  ? 1462 LYS A O   1 
ATOM   3402  C CB  . LYS A  1 443 ? 14.525  12.844  7.384   1.00 43.17  ? 1462 LYS A CB  1 
ATOM   3403  C CG  . LYS A  1 443 ? 13.821  11.658  6.747   1.00 47.71  ? 1462 LYS A CG  1 
ATOM   3404  C CD  . LYS A  1 443 ? 13.243  12.040  5.399   1.00 51.25  ? 1462 LYS A CD  1 
ATOM   3405  C CE  . LYS A  1 443 ? 12.478  10.890  4.764   1.00 52.92  ? 1462 LYS A CE  1 
ATOM   3406  N NZ  . LYS A  1 443 ? 11.867  11.311  3.469   1.00 55.47  ? 1462 LYS A NZ  1 
ATOM   3407  N N   . THR A  1 444 ? 15.370  14.543  10.186  1.00 36.64  ? 1463 THR A N   1 
ATOM   3408  C CA  . THR A  1 444 ? 16.117  15.694  10.680  1.00 35.72  ? 1463 THR A CA  1 
ATOM   3409  C C   . THR A  1 444 ? 17.183  15.349  11.719  1.00 35.08  ? 1463 THR A C   1 
ATOM   3410  O O   . THR A  1 444 ? 18.007  16.193  12.063  1.00 35.77  ? 1463 THR A O   1 
ATOM   3411  C CB  . THR A  1 444 ? 15.179  16.753  11.289  1.00 36.89  ? 1463 THR A CB  1 
ATOM   3412  O OG1 . THR A  1 444 ? 14.438  16.179  12.371  1.00 38.26  ? 1463 THR A OG1 1 
ATOM   3413  C CG2 . THR A  1 444 ? 14.217  17.273  10.237  1.00 37.92  ? 1463 THR A CG2 1 
ATOM   3414  N N   . VAL A  1 445 ? 17.170  14.120  12.227  1.00 33.24  ? 1464 VAL A N   1 
ATOM   3415  C CA  . VAL A  1 445 ? 18.164  13.718  13.221  1.00 31.54  ? 1464 VAL A CA  1 
ATOM   3416  C C   . VAL A  1 445 ? 19.465  13.361  12.509  1.00 29.05  ? 1464 VAL A C   1 
ATOM   3417  O O   . VAL A  1 445 ? 19.498  12.454  11.678  1.00 28.62  ? 1464 VAL A O   1 
ATOM   3418  C CB  . VAL A  1 445 ? 17.694  12.498  14.039  1.00 32.02  ? 1464 VAL A CB  1 
ATOM   3419  C CG1 . VAL A  1 445 ? 18.735  12.153  15.096  1.00 31.40  ? 1464 VAL A CG1 1 
ATOM   3420  C CG2 . VAL A  1 445 ? 16.351  12.791  14.689  1.00 31.04  ? 1464 VAL A CG2 1 
ATOM   3421  N N   . ILE A  1 446 ? 20.533  14.078  12.841  1.00 27.76  ? 1465 ILE A N   1 
ATOM   3422  C CA  . ILE A  1 446 ? 21.832  13.859  12.215  1.00 26.82  ? 1465 ILE A CA  1 
ATOM   3423  C C   . ILE A  1 446 ? 22.921  13.620  13.253  1.00 23.97  ? 1465 ILE A C   1 
ATOM   3424  O O   . ILE A  1 446 ? 23.096  14.413  14.175  1.00 25.43  ? 1465 ILE A O   1 
ATOM   3425  C CB  . ILE A  1 446 ? 22.223  15.073  11.342  1.00 28.59  ? 1465 ILE A CB  1 
ATOM   3426  C CG1 . ILE A  1 446 ? 21.193  15.249  10.222  1.00 31.48  ? 1465 ILE A CG1 1 
ATOM   3427  C CG2 . ILE A  1 446 ? 23.622  14.880  10.768  1.00 31.33  ? 1465 ILE A CG2 1 
ATOM   3428  C CD1 . ILE A  1 446 ? 21.464  16.422  9.298   1.00 35.43  ? 1465 ILE A CD1 1 
ATOM   3429  N N   . GLY A  1 447 ? 23.661  12.530  13.093  1.00 20.70  ? 1466 GLY A N   1 
ATOM   3430  C CA  . GLY A  1 447 ? 24.712  12.229  14.045  1.00 18.70  ? 1466 GLY A CA  1 
ATOM   3431  C C   . GLY A  1 447 ? 24.152  11.777  15.381  1.00 18.53  ? 1466 GLY A C   1 
ATOM   3432  O O   . GLY A  1 447 ? 24.609  12.207  16.439  1.00 15.64  ? 1466 GLY A O   1 
ATOM   3433  N N   . ASP A  1 448 ? 23.142  10.918  15.332  1.00 18.22  ? 1467 ASP A N   1 
ATOM   3434  C CA  . ASP A  1 448 ? 22.536  10.388  16.547  1.00 19.31  ? 1467 ASP A CA  1 
ATOM   3435  C C   . ASP A  1 448 ? 23.507  9.362   17.125  1.00 19.58  ? 1467 ASP A C   1 
ATOM   3436  O O   . ASP A  1 448 ? 24.476  8.964   16.470  1.00 17.73  ? 1467 ASP A O   1 
ATOM   3437  C CB  . ASP A  1 448 ? 21.188  9.728   16.215  1.00 18.16  ? 1467 ASP A CB  1 
ATOM   3438  C CG  . ASP A  1 448 ? 20.407  9.296   17.454  1.00 18.84  ? 1467 ASP A CG  1 
ATOM   3439  O OD1 . ASP A  1 448 ? 20.647  9.826   18.563  1.00 19.65  ? 1467 ASP A OD1 1 
ATOM   3440  O OD2 . ASP A  1 448 ? 19.524  8.428   17.307  1.00 19.26  ? 1467 ASP A OD2 1 
ATOM   3441  N N   . HIS A  1 449 ? 23.259  8.960   18.364  1.00 19.64  ? 1468 HIS A N   1 
ATOM   3442  C CA  . HIS A  1 449 ? 24.090  7.978   19.040  1.00 20.30  ? 1468 HIS A CA  1 
ATOM   3443  C C   . HIS A  1 449 ? 24.196  6.716   18.177  1.00 19.17  ? 1468 HIS A C   1 
ATOM   3444  O O   . HIS A  1 449 ? 23.188  6.191   17.709  1.00 19.29  ? 1468 HIS A O   1 
ATOM   3445  C CB  . HIS A  1 449 ? 23.458  7.632   20.388  1.00 20.61  ? 1468 HIS A CB  1 
ATOM   3446  C CG  . HIS A  1 449 ? 24.341  6.822   21.281  1.00 21.10  ? 1468 HIS A CG  1 
ATOM   3447  N ND1 . HIS A  1 449 ? 25.484  7.332   21.855  1.00 20.42  ? 1468 HIS A ND1 1 
ATOM   3448  C CD2 . HIS A  1 449 ? 24.239  5.543   21.714  1.00 22.03  ? 1468 HIS A CD2 1 
ATOM   3449  C CE1 . HIS A  1 449 ? 26.048  6.404   22.606  1.00 22.67  ? 1468 HIS A CE1 1 
ATOM   3450  N NE2 . HIS A  1 449 ? 25.312  5.308   22.538  1.00 23.98  ? 1468 HIS A NE2 1 
ATOM   3451  N N   . GLY A  1 450 ? 25.417  6.242   17.958  1.00 19.87  ? 1469 GLY A N   1 
ATOM   3452  C CA  . GLY A  1 450 ? 25.619  5.042   17.160  1.00 18.92  ? 1469 GLY A CA  1 
ATOM   3453  C C   . GLY A  1 450 ? 25.670  5.182   15.640  1.00 19.40  ? 1469 GLY A C   1 
ATOM   3454  O O   . GLY A  1 450 ? 25.924  4.199   14.944  1.00 18.79  ? 1469 GLY A O   1 
ATOM   3455  N N   . ASP A  1 451 ? 25.448  6.381   15.108  1.00 19.29  ? 1470 ASP A N   1 
ATOM   3456  C CA  . ASP A  1 451 ? 25.460  6.568   13.650  1.00 19.77  ? 1470 ASP A CA  1 
ATOM   3457  C C   . ASP A  1 451 ? 26.804  6.279   12.970  1.00 19.74  ? 1470 ASP A C   1 
ATOM   3458  O O   . ASP A  1 451 ? 26.845  5.923   11.783  1.00 16.57  ? 1470 ASP A O   1 
ATOM   3459  C CB  . ASP A  1 451 ? 25.016  7.992   13.282  1.00 19.74  ? 1470 ASP A CB  1 
ATOM   3460  C CG  . ASP A  1 451 ? 23.502  8.163   13.307  1.00 23.80  ? 1470 ASP A CG  1 
ATOM   3461  O OD1 . ASP A  1 451 ? 22.784  7.142   13.378  1.00 22.65  ? 1470 ASP A OD1 1 
ATOM   3462  O OD2 . ASP A  1 451 ? 23.029  9.319   13.238  1.00 23.47  ? 1470 ASP A OD2 1 
ATOM   3463  N N   . GLU A  1 452 ? 27.897  6.429   13.713  1.00 17.46  ? 1471 GLU A N   1 
ATOM   3464  C CA  . GLU A  1 452 ? 29.224  6.194   13.152  1.00 19.73  ? 1471 GLU A CA  1 
ATOM   3465  C C   . GLU A  1 452 ? 29.516  4.708   12.931  1.00 19.33  ? 1471 GLU A C   1 
ATOM   3466  O O   . GLU A  1 452 ? 30.336  4.349   12.082  1.00 19.33  ? 1471 GLU A O   1 
ATOM   3467  C CB  . GLU A  1 452 ? 30.302  6.798   14.061  1.00 20.44  ? 1471 GLU A CB  1 
ATOM   3468  C CG  . GLU A  1 452 ? 30.821  5.868   15.166  1.00 23.61  ? 1471 GLU A CG  1 
ATOM   3469  C CD  . GLU A  1 452 ? 29.812  5.599   16.277  1.00 26.01  ? 1471 GLU A CD  1 
ATOM   3470  O OE1 . GLU A  1 452 ? 30.142  4.808   17.191  1.00 29.62  ? 1471 GLU A OE1 1 
ATOM   3471  O OE2 . GLU A  1 452 ? 28.699  6.169   16.248  1.00 23.37  ? 1471 GLU A OE2 1 
ATOM   3472  N N   . LEU A  1 453 ? 28.841  3.851   13.689  1.00 18.52  ? 1472 LEU A N   1 
ATOM   3473  C CA  . LEU A  1 453 ? 29.041  2.405   13.586  1.00 16.82  ? 1472 LEU A CA  1 
ATOM   3474  C C   . LEU A  1 453 ? 28.926  1.868   12.166  1.00 15.76  ? 1472 LEU A C   1 
ATOM   3475  O O   . LEU A  1 453 ? 29.693  0.993   11.766  1.00 16.93  ? 1472 LEU A O   1 
ATOM   3476  C CB  . LEU A  1 453 ? 28.034  1.667   14.463  1.00 17.30  ? 1472 LEU A CB  1 
ATOM   3477  C CG  . LEU A  1 453 ? 28.157  1.890   15.970  1.00 20.09  ? 1472 LEU A CG  1 
ATOM   3478  C CD1 . LEU A  1 453 ? 27.015  1.183   16.689  1.00 19.96  ? 1472 LEU A CD1 1 
ATOM   3479  C CD2 . LEU A  1 453 ? 29.494  1.380   16.443  1.00 20.12  ? 1472 LEU A CD2 1 
ATOM   3480  N N   . PHE A  1 454 ? 27.954  2.374   11.416  1.00 16.22  ? 1473 PHE A N   1 
ATOM   3481  C CA  . PHE A  1 454 ? 27.748  1.920   10.044  1.00 16.72  ? 1473 PHE A CA  1 
ATOM   3482  C C   . PHE A  1 454 ? 28.944  2.201   9.149   1.00 17.47  ? 1473 PHE A C   1 
ATOM   3483  O O   . PHE A  1 454 ? 29.222  1.432   8.225   1.00 20.09  ? 1473 PHE A O   1 
ATOM   3484  C CB  . PHE A  1 454 ? 26.480  2.550   9.461   1.00 17.92  ? 1473 PHE A CB  1 
ATOM   3485  C CG  . PHE A  1 454 ? 25.232  2.173   10.209  1.00 21.23  ? 1473 PHE A CG  1 
ATOM   3486  C CD1 . PHE A  1 454 ? 24.669  3.044   11.139  1.00 23.74  ? 1473 PHE A CD1 1 
ATOM   3487  C CD2 . PHE A  1 454 ? 24.664  0.912   10.043  1.00 20.16  ? 1473 PHE A CD2 1 
ATOM   3488  C CE1 . PHE A  1 454 ? 23.563  2.664   11.896  1.00 24.66  ? 1473 PHE A CE1 1 
ATOM   3489  C CE2 . PHE A  1 454 ? 23.557  0.519   10.795  1.00 22.14  ? 1473 PHE A CE2 1 
ATOM   3490  C CZ  . PHE A  1 454 ? 23.007  1.395   11.723  1.00 24.02  ? 1473 PHE A CZ  1 
ATOM   3491  N N   . SER A  1 455 ? 29.654  3.295   9.419   1.00 16.41  ? 1474 SER A N   1 
ATOM   3492  C CA  . SER A  1 455 ? 30.831  3.643   8.629   1.00 15.64  ? 1474 SER A CA  1 
ATOM   3493  C C   . SER A  1 455 ? 32.023  2.801   9.072   1.00 15.56  ? 1474 SER A C   1 
ATOM   3494  O O   . SER A  1 455 ? 32.716  2.199   8.246   1.00 14.66  ? 1474 SER A O   1 
ATOM   3495  C CB  . SER A  1 455 ? 31.165  5.131   8.785   1.00 14.50  ? 1474 SER A CB  1 
ATOM   3496  O OG  . SER A  1 455 ? 30.105  5.943   8.306   1.00 16.66  ? 1474 SER A OG  1 
ATOM   3497  N N   . VAL A  1 456 ? 32.245  2.754   10.383  1.00 13.77  ? 1475 VAL A N   1 
ATOM   3498  C CA  . VAL A  1 456 ? 33.348  2.004   10.964  1.00 14.36  ? 1475 VAL A CA  1 
ATOM   3499  C C   . VAL A  1 456 ? 33.351  0.522   10.593  1.00 13.70  ? 1475 VAL A C   1 
ATOM   3500  O O   . VAL A  1 456 ? 34.412  -0.044  10.329  1.00 14.06  ? 1475 VAL A O   1 
ATOM   3501  C CB  . VAL A  1 456 ? 33.347  2.134   12.510  1.00 15.19  ? 1475 VAL A CB  1 
ATOM   3502  C CG1 . VAL A  1 456 ? 34.391  1.200   13.124  1.00 17.21  ? 1475 VAL A CG1 1 
ATOM   3503  C CG2 . VAL A  1 456 ? 33.631  3.576   12.906  1.00 14.70  ? 1475 VAL A CG2 1 
ATOM   3504  N N   . PHE A  1 457 ? 32.176  -0.106  10.578  1.00 13.38  ? 1476 PHE A N   1 
ATOM   3505  C CA  . PHE A  1 457 ? 32.090  -1.524  10.233  1.00 15.12  ? 1476 PHE A CA  1 
ATOM   3506  C C   . PHE A  1 457 ? 31.701  -1.774  8.783   1.00 15.53  ? 1476 PHE A C   1 
ATOM   3507  O O   . PHE A  1 457 ? 31.312  -2.888  8.419   1.00 16.29  ? 1476 PHE A O   1 
ATOM   3508  C CB  . PHE A  1 457 ? 31.114  -2.267  11.157  1.00 13.13  ? 1476 PHE A CB  1 
ATOM   3509  C CG  . PHE A  1 457 ? 31.699  -2.606  12.502  1.00 16.03  ? 1476 PHE A CG  1 
ATOM   3510  C CD1 . PHE A  1 457 ? 31.555  -1.746  13.580  1.00 13.34  ? 1476 PHE A CD1 1 
ATOM   3511  C CD2 . PHE A  1 457 ? 32.438  -3.776  12.674  1.00 17.90  ? 1476 PHE A CD2 1 
ATOM   3512  C CE1 . PHE A  1 457 ? 32.134  -2.038  14.804  1.00 13.53  ? 1476 PHE A CE1 1 
ATOM   3513  C CE2 . PHE A  1 457 ? 33.025  -4.075  13.904  1.00 17.28  ? 1476 PHE A CE2 1 
ATOM   3514  C CZ  . PHE A  1 457 ? 32.871  -3.205  14.966  1.00 15.81  ? 1476 PHE A CZ  1 
ATOM   3515  N N   . GLY A  1 458 ? 31.803  -0.732  7.963   1.00 14.75  ? 1477 GLY A N   1 
ATOM   3516  C CA  . GLY A  1 458 ? 31.499  -0.867  6.548   1.00 15.57  ? 1477 GLY A CA  1 
ATOM   3517  C C   . GLY A  1 458 ? 30.162  -1.457  6.137   1.00 17.58  ? 1477 GLY A C   1 
ATOM   3518  O O   . GLY A  1 458 ? 30.112  -2.347  5.279   1.00 18.51  ? 1477 GLY A O   1 
ATOM   3519  N N   . ALA A  1 459 ? 29.079  -0.961  6.727   1.00 16.16  ? 1478 ALA A N   1 
ATOM   3520  C CA  . ALA A  1 459 ? 27.747  -1.429  6.377   1.00 17.70  ? 1478 ALA A CA  1 
ATOM   3521  C C   . ALA A  1 459 ? 27.474  -1.203  4.881   1.00 18.64  ? 1478 ALA A C   1 
ATOM   3522  O O   . ALA A  1 459 ? 26.818  -2.023  4.237   1.00 19.58  ? 1478 ALA A O   1 
ATOM   3523  C CB  . ALA A  1 459 ? 26.701  -0.709  7.212   1.00 17.24  ? 1478 ALA A CB  1 
ATOM   3524  N N   . PRO A  1 460 ? 27.972  -0.088  4.310   1.00 18.77  ? 1479 PRO A N   1 
ATOM   3525  C CA  . PRO A  1 460 ? 27.749  0.185   2.884   1.00 19.40  ? 1479 PRO A CA  1 
ATOM   3526  C C   . PRO A  1 460 ? 28.315  -0.886  1.952   1.00 22.56  ? 1479 PRO A C   1 
ATOM   3527  O O   . PRO A  1 460 ? 28.032  -0.883  0.751   1.00 25.57  ? 1479 PRO A O   1 
ATOM   3528  C CB  . PRO A  1 460 ? 28.435  1.533   2.681   1.00 18.86  ? 1479 PRO A CB  1 
ATOM   3529  C CG  . PRO A  1 460 ? 28.237  2.198   4.002   1.00 18.08  ? 1479 PRO A CG  1 
ATOM   3530  C CD  . PRO A  1 460 ? 28.567  1.090   4.970   1.00 16.14  ? 1479 PRO A CD  1 
ATOM   3531  N N   . PHE A  1 461 ? 29.118  -1.793  2.501   1.00 22.32  ? 1480 PHE A N   1 
ATOM   3532  C CA  . PHE A  1 461 ? 29.721  -2.856  1.704   1.00 23.78  ? 1480 PHE A CA  1 
ATOM   3533  C C   . PHE A  1 461 ? 29.094  -4.219  1.962   1.00 25.99  ? 1480 PHE A C   1 
ATOM   3534  O O   . PHE A  1 461 ? 29.376  -5.188  1.253   1.00 28.40  ? 1480 PHE A O   1 
ATOM   3535  C CB  . PHE A  1 461 ? 31.231  -2.912  1.958   1.00 22.61  ? 1480 PHE A CB  1 
ATOM   3536  C CG  . PHE A  1 461 ? 31.931  -1.614  1.672   1.00 23.11  ? 1480 PHE A CG  1 
ATOM   3537  C CD1 . PHE A  1 461 ? 32.286  -0.757  2.706   1.00 22.28  ? 1480 PHE A CD1 1 
ATOM   3538  C CD2 . PHE A  1 461 ? 32.166  -1.216  0.359   1.00 23.04  ? 1480 PHE A CD2 1 
ATOM   3539  C CE1 . PHE A  1 461 ? 32.860  0.484   2.439   1.00 24.93  ? 1480 PHE A CE1 1 
ATOM   3540  C CE2 . PHE A  1 461 ? 32.737  0.018   0.079   1.00 23.22  ? 1480 PHE A CE2 1 
ATOM   3541  C CZ  . PHE A  1 461 ? 33.085  0.873   1.120   1.00 24.24  ? 1480 PHE A CZ  1 
ATOM   3542  N N   . LEU A  1 462 ? 28.233  -4.289  2.971   1.00 26.59  ? 1481 LEU A N   1 
ATOM   3543  C CA  . LEU A  1 462 ? 27.561  -5.533  3.309   1.00 28.24  ? 1481 LEU A CA  1 
ATOM   3544  C C   . LEU A  1 462 ? 26.079  -5.427  2.993   1.00 30.39  ? 1481 LEU A C   1 
ATOM   3545  O O   . LEU A  1 462 ? 25.448  -6.405  2.590   1.00 31.04  ? 1481 LEU A O   1 
ATOM   3546  C CB  . LEU A  1 462 ? 27.772  -5.859  4.791   1.00 25.96  ? 1481 LEU A CB  1 
ATOM   3547  C CG  . LEU A  1 462 ? 29.251  -5.971  5.169   1.00 26.93  ? 1481 LEU A CG  1 
ATOM   3548  C CD1 . LEU A  1 462 ? 29.392  -6.285  6.653   1.00 25.88  ? 1481 LEU A CD1 1 
ATOM   3549  C CD2 . LEU A  1 462 ? 29.907  -7.054  4.329   1.00 24.49  ? 1481 LEU A CD2 1 
ATOM   3550  N N   . LYS A  1 463 ? 25.518  -4.237  3.174   1.00 31.46  ? 1482 LYS A N   1 
ATOM   3551  C CA  . LYS A  1 463 ? 24.108  -4.034  2.875   1.00 33.79  ? 1482 LYS A CA  1 
ATOM   3552  C C   . LYS A  1 463 ? 23.950  -3.637  1.415   1.00 35.00  ? 1482 LYS A C   1 
ATOM   3553  O O   . LYS A  1 463 ? 24.925  -3.306  0.746   1.00 35.10  ? 1482 LYS A O   1 
ATOM   3554  C CB  . LYS A  1 463 ? 23.508  -2.978  3.800   1.00 35.15  ? 1482 LYS A CB  1 
ATOM   3555  C CG  . LYS A  1 463 ? 23.460  -3.442  5.247   1.00 37.07  ? 1482 LYS A CG  1 
ATOM   3556  C CD  . LYS A  1 463 ? 22.645  -2.512  6.118   1.00 39.93  ? 1482 LYS A CD  1 
ATOM   3557  C CE  . LYS A  1 463 ? 22.506  -3.084  7.514   1.00 41.46  ? 1482 LYS A CE  1 
ATOM   3558  N NZ  . LYS A  1 463 ? 21.733  -2.192  8.410   1.00 44.40  ? 1482 LYS A NZ  1 
ATOM   3559  N N   . GLU A  1 464 ? 22.718  -3.671  0.924   1.00 36.44  ? 1483 GLU A N   1 
ATOM   3560  C CA  . GLU A  1 464 ? 22.446  -3.365  -0.474  1.00 37.83  ? 1483 GLU A CA  1 
ATOM   3561  C C   . GLU A  1 464 ? 22.198  -1.901  -0.838  1.00 36.94  ? 1483 GLU A C   1 
ATOM   3562  O O   . GLU A  1 464 ? 21.505  -1.170  -0.129  1.00 36.05  ? 1483 GLU A O   1 
ATOM   3563  C CB  . GLU A  1 464 ? 21.262  -4.212  -0.951  1.00 40.36  ? 1483 GLU A CB  1 
ATOM   3564  C CG  . GLU A  1 464 ? 21.535  -5.012  -2.216  1.00 44.16  ? 1483 GLU A CG  1 
ATOM   3565  C CD  . GLU A  1 464 ? 20.385  -5.929  -2.590  1.00 44.90  ? 1483 GLU A CD  1 
ATOM   3566  O OE1 . GLU A  1 464 ? 20.523  -6.673  -3.582  1.00 47.77  ? 1483 GLU A OE1 1 
ATOM   3567  O OE2 . GLU A  1 464 ? 19.345  -5.909  -1.897  1.00 44.81  ? 1483 GLU A OE2 1 
ATOM   3568  N N   . GLY A  1 465 ? 22.792  -1.502  -1.961  1.00 37.08  ? 1484 GLY A N   1 
ATOM   3569  C CA  . GLY A  1 465 ? 22.647  -0.163  -2.511  1.00 36.11  ? 1484 GLY A CA  1 
ATOM   3570  C C   . GLY A  1 465 ? 22.802  1.111   -1.696  1.00 35.25  ? 1484 GLY A C   1 
ATOM   3571  O O   . GLY A  1 465 ? 22.105  2.088   -1.977  1.00 36.48  ? 1484 GLY A O   1 
ATOM   3572  N N   . ALA A  1 466 ? 23.693  1.137   -0.708  1.00 32.87  ? 1485 ALA A N   1 
ATOM   3573  C CA  . ALA A  1 466 ? 23.890  2.359   0.075   1.00 29.50  ? 1485 ALA A CA  1 
ATOM   3574  C C   . ALA A  1 466 ? 24.247  3.462   -0.916  1.00 26.53  ? 1485 ALA A C   1 
ATOM   3575  O O   . ALA A  1 466 ? 24.683  3.173   -2.030  1.00 25.90  ? 1485 ALA A O   1 
ATOM   3576  C CB  . ALA A  1 466 ? 25.022  2.173   1.080   1.00 29.44  ? 1485 ALA A CB  1 
ATOM   3577  N N   . SER A  1 467 ? 24.066  4.721   -0.525  1.00 24.57  ? 1486 SER A N   1 
ATOM   3578  C CA  . SER A  1 467 ? 24.378  5.823   -1.430  1.00 22.96  ? 1486 SER A CA  1 
ATOM   3579  C C   . SER A  1 467 ? 25.880  5.903   -1.675  1.00 22.18  ? 1486 SER A C   1 
ATOM   3580  O O   . SER A  1 467 ? 26.682  5.425   -0.873  1.00 20.85  ? 1486 SER A O   1 
ATOM   3581  C CB  . SER A  1 467 ? 23.885  7.158   -0.860  1.00 22.11  ? 1486 SER A CB  1 
ATOM   3582  O OG  . SER A  1 467 ? 24.664  7.549   0.258   1.00 21.55  ? 1486 SER A OG  1 
ATOM   3583  N N   . GLU A  1 468 ? 26.247  6.511   -2.796  1.00 22.37  ? 1487 GLU A N   1 
ATOM   3584  C CA  . GLU A  1 468 ? 27.641  6.679   -3.176  1.00 23.26  ? 1487 GLU A CA  1 
ATOM   3585  C C   . GLU A  1 468 ? 28.362  7.517   -2.115  1.00 21.19  ? 1487 GLU A C   1 
ATOM   3586  O O   . GLU A  1 468 ? 29.520  7.265   -1.783  1.00 21.78  ? 1487 GLU A O   1 
ATOM   3587  C CB  . GLU A  1 468 ? 27.700  7.369   -4.543  1.00 26.41  ? 1487 GLU A CB  1 
ATOM   3588  C CG  . GLU A  1 468 ? 28.974  7.156   -5.323  1.00 30.49  ? 1487 GLU A CG  1 
ATOM   3589  C CD  . GLU A  1 468 ? 29.337  5.689   -5.477  1.00 31.25  ? 1487 GLU A CD  1 
ATOM   3590  O OE1 . GLU A  1 468 ? 28.426  4.832   -5.537  1.00 34.57  ? 1487 GLU A OE1 1 
ATOM   3591  O OE2 . GLU A  1 468 ? 30.543  5.393   -5.551  1.00 33.98  ? 1487 GLU A OE2 1 
ATOM   3592  N N   . GLU A  1 469 ? 27.666  8.512   -1.581  1.00 19.49  ? 1488 GLU A N   1 
ATOM   3593  C CA  . GLU A  1 469 ? 28.234  9.380   -0.554  1.00 21.21  ? 1488 GLU A CA  1 
ATOM   3594  C C   . GLU A  1 469 ? 28.526  8.597   0.733   1.00 21.20  ? 1488 GLU A C   1 
ATOM   3595  O O   . GLU A  1 469 ? 29.525  8.846   1.408   1.00 20.10  ? 1488 GLU A O   1 
ATOM   3596  C CB  . GLU A  1 469 ? 27.265  10.537  -0.264  1.00 24.52  ? 1488 GLU A CB  1 
ATOM   3597  C CG  . GLU A  1 469 ? 27.562  11.337  1.001   1.00 27.13  ? 1488 GLU A CG  1 
ATOM   3598  C CD  . GLU A  1 469 ? 26.590  12.490  1.196   1.00 31.20  ? 1488 GLU A CD  1 
ATOM   3599  O OE1 . GLU A  1 469 ? 26.839  13.580  0.638   1.00 32.51  ? 1488 GLU A OE1 1 
ATOM   3600  O OE2 . GLU A  1 469 ? 25.567  12.301  1.894   1.00 32.32  ? 1488 GLU A OE2 1 
ATOM   3601  N N   . GLU A  1 470 ? 27.661  7.637   1.050   1.00 19.22  ? 1489 GLU A N   1 
ATOM   3602  C CA  . GLU A  1 470 ? 27.800  6.818   2.256   1.00 20.22  ? 1489 GLU A CA  1 
ATOM   3603  C C   . GLU A  1 470 ? 28.963  5.830   2.124   1.00 19.89  ? 1489 GLU A C   1 
ATOM   3604  O O   . GLU A  1 470 ? 29.654  5.514   3.104   1.00 14.97  ? 1489 GLU A O   1 
ATOM   3605  C CB  . GLU A  1 470 ? 26.495  6.053   2.498   1.00 22.79  ? 1489 GLU A CB  1 
ATOM   3606  C CG  . GLU A  1 470 ? 26.125  5.868   3.954   1.00 27.43  ? 1489 GLU A CG  1 
ATOM   3607  C CD  . GLU A  1 470 ? 24.689  5.391   4.131   1.00 29.91  ? 1489 GLU A CD  1 
ATOM   3608  O OE1 . GLU A  1 470 ? 24.210  5.366   5.284   1.00 30.88  ? 1489 GLU A OE1 1 
ATOM   3609  O OE2 . GLU A  1 470 ? 24.038  5.041   3.120   1.00 30.45  ? 1489 GLU A OE2 1 
ATOM   3610  N N   . ILE A  1 471 ? 29.160  5.338   0.904   1.00 18.85  ? 1490 ILE A N   1 
ATOM   3611  C CA  . ILE A  1 471 ? 30.232  4.396   0.603   1.00 19.99  ? 1490 ILE A CA  1 
ATOM   3612  C C   . ILE A  1 471 ? 31.573  5.109   0.742   1.00 19.84  ? 1490 ILE A C   1 
ATOM   3613  O O   . ILE A  1 471 ? 32.532  4.562   1.288   1.00 20.58  ? 1490 ILE A O   1 
ATOM   3614  C CB  . ILE A  1 471 ? 30.093  3.851   -0.841  1.00 20.21  ? 1490 ILE A CB  1 
ATOM   3615  C CG1 . ILE A  1 471 ? 28.862  2.945   -0.936  1.00 20.59  ? 1490 ILE A CG1 1 
ATOM   3616  C CG2 . ILE A  1 471 ? 31.355  3.098   -1.245  1.00 22.04  ? 1490 ILE A CG2 1 
ATOM   3617  C CD1 . ILE A  1 471 ? 28.559  2.461   -2.354  1.00 21.69  ? 1490 ILE A CD1 1 
ATOM   3618  N N   . ARG A  1 472 ? 31.632  6.338   0.245   1.00 18.95  ? 1491 ARG A N   1 
ATOM   3619  C CA  . ARG A  1 472 ? 32.853  7.128   0.315   1.00 20.42  ? 1491 ARG A CA  1 
ATOM   3620  C C   . ARG A  1 472 ? 33.207  7.424   1.769   1.00 18.08  ? 1491 ARG A C   1 
ATOM   3621  O O   . ARG A  1 472 ? 34.373  7.379   2.160   1.00 17.08  ? 1491 ARG A O   1 
ATOM   3622  C CB  . ARG A  1 472 ? 32.671  8.437   -0.455  1.00 25.62  ? 1491 ARG A CB  1 
ATOM   3623  C CG  . ARG A  1 472 ? 33.849  9.401   -0.359  1.00 32.90  ? 1491 ARG A CG  1 
ATOM   3624  C CD  . ARG A  1 472 ? 33.662  10.596  -1.292  1.00 37.89  ? 1491 ARG A CD  1 
ATOM   3625  N NE  . ARG A  1 472 ? 33.456  10.171  -2.676  1.00 44.47  ? 1491 ARG A NE  1 
ATOM   3626  C CZ  . ARG A  1 472 ? 32.288  10.216  -3.314  1.00 47.76  ? 1491 ARG A CZ  1 
ATOM   3627  N NH1 . ARG A  1 472 ? 31.204  10.675  -2.699  1.00 49.32  ? 1491 ARG A NH1 1 
ATOM   3628  N NH2 . ARG A  1 472 ? 32.202  9.795   -4.570  1.00 49.37  ? 1491 ARG A NH2 1 
ATOM   3629  N N   . LEU A  1 473 ? 32.194  7.725   2.569   1.00 16.78  ? 1492 LEU A N   1 
ATOM   3630  C CA  . LEU A  1 473 ? 32.413  8.023   3.976   1.00 16.24  ? 1492 LEU A CA  1 
ATOM   3631  C C   . LEU A  1 473 ? 32.968  6.812   4.722   1.00 14.72  ? 1492 LEU A C   1 
ATOM   3632  O O   . LEU A  1 473 ? 33.918  6.936   5.497   1.00 15.89  ? 1492 LEU A O   1 
ATOM   3633  C CB  . LEU A  1 473 ? 31.102  8.475   4.627   1.00 17.37  ? 1492 LEU A CB  1 
ATOM   3634  C CG  . LEU A  1 473 ? 31.132  8.706   6.144   1.00 17.96  ? 1492 LEU A CG  1 
ATOM   3635  C CD1 . LEU A  1 473 ? 32.194  9.755   6.499   1.00 19.58  ? 1492 LEU A CD1 1 
ATOM   3636  C CD2 . LEU A  1 473 ? 29.754  9.162   6.609   1.00 16.67  ? 1492 LEU A CD2 1 
ATOM   3637  N N   . SER A  1 474 ? 32.379  5.644   4.485   1.00 14.55  ? 1493 SER A N   1 
ATOM   3638  C CA  . SER A  1 474 ? 32.820  4.429   5.162   1.00 15.93  ? 1493 SER A CA  1 
ATOM   3639  C C   . SER A  1 474 ? 34.262  4.064   4.806   1.00 16.88  ? 1493 SER A C   1 
ATOM   3640  O O   . SER A  1 474 ? 35.039  3.682   5.678   1.00 15.55  ? 1493 SER A O   1 
ATOM   3641  C CB  . SER A  1 474 ? 31.889  3.257   4.830   1.00 16.07  ? 1493 SER A CB  1 
ATOM   3642  O OG  . SER A  1 474 ? 32.274  2.100   5.555   1.00 14.31  ? 1493 SER A OG  1 
ATOM   3643  N N   . LYS A  1 475 ? 34.610  4.167   3.526   1.00 17.72  ? 1494 LYS A N   1 
ATOM   3644  C CA  . LYS A  1 475 ? 35.969  3.865   3.088   1.00 18.38  ? 1494 LYS A CA  1 
ATOM   3645  C C   . LYS A  1 475 ? 36.955  4.746   3.847   1.00 16.30  ? 1494 LYS A C   1 
ATOM   3646  O O   . LYS A  1 475 ? 37.966  4.262   4.352   1.00 16.95  ? 1494 LYS A O   1 
ATOM   3647  C CB  . LYS A  1 475 ? 36.130  4.121   1.585   1.00 20.91  ? 1494 LYS A CB  1 
ATOM   3648  C CG  . LYS A  1 475 ? 35.382  3.155   0.690   1.00 26.06  ? 1494 LYS A CG  1 
ATOM   3649  C CD  . LYS A  1 475 ? 35.622  3.500   -0.776  1.00 29.73  ? 1494 LYS A CD  1 
ATOM   3650  C CE  . LYS A  1 475 ? 34.827  2.602   -1.711  1.00 32.19  ? 1494 LYS A CE  1 
ATOM   3651  N NZ  . LYS A  1 475 ? 34.928  3.059   -3.131  1.00 34.17  ? 1494 LYS A NZ  1 
ATOM   3652  N N   . MET A  1 476 ? 36.658  6.043   3.924   1.00 13.80  ? 1495 MET A N   1 
ATOM   3653  C CA  . MET A  1 476 ? 37.529  6.983   4.624   1.00 13.26  ? 1495 MET A CA  1 
ATOM   3654  C C   . MET A  1 476 ? 37.645  6.669   6.126   1.00 14.11  ? 1495 MET A C   1 
ATOM   3655  O O   . MET A  1 476 ? 38.737  6.692   6.690   1.00 13.97  ? 1495 MET A O   1 
ATOM   3656  C CB  . MET A  1 476 ? 37.015  8.417   4.449   1.00 14.44  ? 1495 MET A CB  1 
ATOM   3657  C CG  . MET A  1 476 ? 37.881  9.459   5.142   1.00 16.48  ? 1495 MET A CG  1 
ATOM   3658  S SD  . MET A  1 476 ? 37.095  11.084  5.271   1.00 20.43  ? 1495 MET A SD  1 
ATOM   3659  C CE  . MET A  1 476 ? 36.063  10.811  6.727   1.00 20.99  ? 1495 MET A CE  1 
ATOM   3660  N N   . VAL A  1 477 ? 36.518  6.387   6.772   1.00 13.29  ? 1496 VAL A N   1 
ATOM   3661  C CA  . VAL A  1 477 ? 36.529  6.073   8.205   1.00 13.44  ? 1496 VAL A CA  1 
ATOM   3662  C C   . VAL A  1 477 ? 37.305  4.793   8.523   1.00 13.75  ? 1496 VAL A C   1 
ATOM   3663  O O   . VAL A  1 477 ? 38.121  4.765   9.446   1.00 15.44  ? 1496 VAL A O   1 
ATOM   3664  C CB  . VAL A  1 477 ? 35.092  5.922   8.764   1.00 12.25  ? 1496 VAL A CB  1 
ATOM   3665  C CG1 . VAL A  1 477 ? 35.146  5.389   10.204  1.00 11.86  ? 1496 VAL A CG1 1 
ATOM   3666  C CG2 . VAL A  1 477 ? 34.371  7.276   8.732   1.00 10.81  ? 1496 VAL A CG2 1 
ATOM   3667  N N   . MET A  1 478 ? 37.041  3.725   7.777   1.00 15.55  ? 1497 MET A N   1 
ATOM   3668  C CA  . MET A  1 478 ? 37.747  2.471   8.027   1.00 18.21  ? 1497 MET A CA  1 
ATOM   3669  C C   . MET A  1 478 ? 39.246  2.689   7.856   1.00 17.85  ? 1497 MET A C   1 
ATOM   3670  O O   . MET A  1 478 ? 40.047  2.139   8.610   1.00 18.91  ? 1497 MET A O   1 
ATOM   3671  C CB  . MET A  1 478 ? 37.261  1.367   7.083   1.00 17.75  ? 1497 MET A CB  1 
ATOM   3672  C CG  . MET A  1 478 ? 35.794  0.994   7.279   1.00 20.61  ? 1497 MET A CG  1 
ATOM   3673  S SD  . MET A  1 478 ? 35.351  -0.576  6.505   1.00 20.09  ? 1497 MET A SD  1 
ATOM   3674  C CE  . MET A  1 478 ? 35.338  -0.106  4.772   1.00 18.46  ? 1497 MET A CE  1 
ATOM   3675  N N   . LYS A  1 479 ? 39.608  3.503   6.864   1.00 19.02  ? 1498 LYS A N   1 
ATOM   3676  C CA  . LYS A  1 479 ? 41.002  3.841   6.580   1.00 20.36  ? 1498 LYS A CA  1 
ATOM   3677  C C   . LYS A  1 479 ? 41.647  4.506   7.791   1.00 16.94  ? 1498 LYS A C   1 
ATOM   3678  O O   . LYS A  1 479 ? 42.735  4.119   8.228   1.00 15.90  ? 1498 LYS A O   1 
ATOM   3679  C CB  . LYS A  1 479 ? 41.072  4.816   5.406   1.00 24.08  ? 1498 LYS A CB  1 
ATOM   3680  C CG  . LYS A  1 479 ? 41.468  4.218   4.086   1.00 29.48  ? 1498 LYS A CG  1 
ATOM   3681  C CD  . LYS A  1 479 ? 42.959  3.965   4.019   1.00 33.34  ? 1498 LYS A CD  1 
ATOM   3682  C CE  . LYS A  1 479 ? 43.337  3.540   2.611   1.00 35.38  ? 1498 LYS A CE  1 
ATOM   3683  N NZ  . LYS A  1 479 ? 42.424  2.454   2.134   1.00 35.77  ? 1498 LYS A NZ  1 
ATOM   3684  N N   . PHE A  1 480 ? 40.983  5.539   8.301   1.00 16.04  ? 1499 PHE A N   1 
ATOM   3685  C CA  . PHE A  1 480 ? 41.468  6.268   9.472   1.00 16.39  ? 1499 PHE A CA  1 
ATOM   3686  C C   . PHE A  1 480 ? 41.625  5.313   10.655  1.00 15.19  ? 1499 PHE A C   1 
ATOM   3687  O O   . PHE A  1 480 ? 42.664  5.296   11.312  1.00 15.73  ? 1499 PHE A O   1 
ATOM   3688  C CB  . PHE A  1 480 ? 40.482  7.375   9.870   1.00 15.28  ? 1499 PHE A CB  1 
ATOM   3689  C CG  . PHE A  1 480 ? 40.657  8.675   9.115   1.00 17.12  ? 1499 PHE A CG  1 
ATOM   3690  C CD1 . PHE A  1 480 ? 39.543  9.379   8.661   1.00 15.83  ? 1499 PHE A CD1 1 
ATOM   3691  C CD2 . PHE A  1 480 ? 41.920  9.223   8.911   1.00 17.17  ? 1499 PHE A CD2 1 
ATOM   3692  C CE1 . PHE A  1 480 ? 39.683  10.613  8.017   1.00 16.73  ? 1499 PHE A CE1 1 
ATOM   3693  C CE2 . PHE A  1 480 ? 42.070  10.460  8.267   1.00 17.90  ? 1499 PHE A CE2 1 
ATOM   3694  C CZ  . PHE A  1 480 ? 40.948  11.153  7.823   1.00 16.94  ? 1499 PHE A CZ  1 
ATOM   3695  N N   . TRP A  1 481 ? 40.581  4.532   10.928  1.00 15.97  ? 1500 TRP A N   1 
ATOM   3696  C CA  . TRP A  1 481 ? 40.613  3.585   12.047  1.00 15.53  ? 1500 TRP A CA  1 
ATOM   3697  C C   . TRP A  1 481 ? 41.748  2.567   11.932  1.00 13.92  ? 1500 TRP A C   1 
ATOM   3698  O O   . TRP A  1 481 ? 42.477  2.336   12.895  1.00 13.63  ? 1500 TRP A O   1 
ATOM   3699  C CB  . TRP A  1 481 ? 39.271  2.837   12.169  1.00 14.74  ? 1500 TRP A CB  1 
ATOM   3700  C CG  . TRP A  1 481 ? 38.276  3.457   13.141  1.00 17.18  ? 1500 TRP A CG  1 
ATOM   3701  C CD1 . TRP A  1 481 ? 37.596  2.810   14.143  1.00 16.86  ? 1500 TRP A CD1 1 
ATOM   3702  C CD2 . TRP A  1 481 ? 37.823  4.820   13.170  1.00 15.70  ? 1500 TRP A CD2 1 
ATOM   3703  N NE1 . TRP A  1 481 ? 36.750  3.685   14.787  1.00 16.12  ? 1500 TRP A NE1 1 
ATOM   3704  C CE2 . TRP A  1 481 ? 36.868  4.924   14.211  1.00 17.23  ? 1500 TRP A CE2 1 
ATOM   3705  C CE3 . TRP A  1 481 ? 38.128  5.964   12.418  1.00 16.77  ? 1500 TRP A CE3 1 
ATOM   3706  C CZ2 . TRP A  1 481 ? 36.216  6.126   14.517  1.00 17.17  ? 1500 TRP A CZ2 1 
ATOM   3707  C CZ3 . TRP A  1 481 ? 37.479  7.161   12.722  1.00 16.44  ? 1500 TRP A CZ3 1 
ATOM   3708  C CH2 . TRP A  1 481 ? 36.534  7.229   13.763  1.00 17.85  ? 1500 TRP A CH2 1 
ATOM   3709  N N   . ALA A  1 482 ? 41.893  1.964   10.753  1.00 14.14  ? 1501 ALA A N   1 
ATOM   3710  C CA  . ALA A  1 482 ? 42.935  0.964   10.532  1.00 14.58  ? 1501 ALA A CA  1 
ATOM   3711  C C   . ALA A  1 482 ? 44.314  1.615   10.535  1.00 13.08  ? 1501 ALA A C   1 
ATOM   3712  O O   . ALA A  1 482 ? 45.276  1.022   11.018  1.00 13.31  ? 1501 ALA A O   1 
ATOM   3713  C CB  . ALA A  1 482 ? 42.690  0.216   9.213   1.00 15.01  ? 1501 ALA A CB  1 
ATOM   3714  N N   . ASN A  1 483 ? 44.420  2.826   9.998   1.00 13.29  ? 1502 ASN A N   1 
ATOM   3715  C CA  . ASN A  1 483 ? 45.709  3.515   10.028  1.00 13.85  ? 1502 ASN A CA  1 
ATOM   3716  C C   . ASN A  1 483 ? 46.076  3.710   11.498  1.00 13.91  ? 1502 ASN A C   1 
ATOM   3717  O O   . ASN A  1 483 ? 47.217  3.488   11.902  1.00 14.33  ? 1502 ASN A O   1 
ATOM   3718  C CB  . ASN A  1 483 ? 45.634  4.875   9.322   1.00 12.85  ? 1502 ASN A CB  1 
ATOM   3719  C CG  . ASN A  1 483 ? 45.697  4.750   7.800   1.00 15.19  ? 1502 ASN A CG  1 
ATOM   3720  O OD1 . ASN A  1 483 ? 45.945  3.668   7.265   1.00 15.14  ? 1502 ASN A OD1 1 
ATOM   3721  N ND2 . ASN A  1 483 ? 45.478  5.859   7.104   1.00 11.36  ? 1502 ASN A ND2 1 
ATOM   3722  N N   . PHE A  1 484 ? 45.097  4.112   12.300  1.00 13.61  ? 1503 PHE A N   1 
ATOM   3723  C CA  . PHE A  1 484 ? 45.332  4.312   13.729  1.00 12.66  ? 1503 PHE A CA  1 
ATOM   3724  C C   . PHE A  1 484 ? 45.777  2.997   14.360  1.00 13.38  ? 1503 PHE A C   1 
ATOM   3725  O O   . PHE A  1 484 ? 46.707  2.970   15.173  1.00 15.46  ? 1503 PHE A O   1 
ATOM   3726  C CB  . PHE A  1 484 ? 44.061  4.814   14.427  1.00 12.19  ? 1503 PHE A CB  1 
ATOM   3727  C CG  . PHE A  1 484 ? 44.276  5.181   15.875  1.00 13.04  ? 1503 PHE A CG  1 
ATOM   3728  C CD1 . PHE A  1 484 ? 45.026  6.303   16.216  1.00 11.26  ? 1503 PHE A CD1 1 
ATOM   3729  C CD2 . PHE A  1 484 ? 43.764  4.383   16.892  1.00 10.66  ? 1503 PHE A CD2 1 
ATOM   3730  C CE1 . PHE A  1 484 ? 45.265  6.623   17.558  1.00 16.49  ? 1503 PHE A CE1 1 
ATOM   3731  C CE2 . PHE A  1 484 ? 43.999  4.694   18.238  1.00 11.11  ? 1503 PHE A CE2 1 
ATOM   3732  C CZ  . PHE A  1 484 ? 44.748  5.811   18.569  1.00 11.17  ? 1503 PHE A CZ  1 
ATOM   3733  N N   . ALA A  1 485 ? 45.122  1.902   13.982  1.00 13.67  ? 1504 ALA A N   1 
ATOM   3734  C CA  . ALA A  1 485 ? 45.479  0.597   14.525  1.00 15.58  ? 1504 ALA A CA  1 
ATOM   3735  C C   . ALA A  1 485 ? 46.918  0.257   14.151  1.00 17.19  ? 1504 ALA A C   1 
ATOM   3736  O O   . ALA A  1 485 ? 47.671  -0.279  14.963  1.00 18.59  ? 1504 ALA A O   1 
ATOM   3737  C CB  . ALA A  1 485 ? 44.525  -0.489  13.994  1.00 14.12  ? 1504 ALA A CB  1 
ATOM   3738  N N   . ARG A  1 486 ? 47.297  0.564   12.915  1.00 17.10  ? 1505 ARG A N   1 
ATOM   3739  C CA  . ARG A  1 486 ? 48.653  0.283   12.464  1.00 17.83  ? 1505 ARG A CA  1 
ATOM   3740  C C   . ARG A  1 486 ? 49.737  1.163   13.095  1.00 16.92  ? 1505 ARG A C   1 
ATOM   3741  O O   . ARG A  1 486 ? 50.755  0.651   13.558  1.00 17.38  ? 1505 ARG A O   1 
ATOM   3742  C CB  . ARG A  1 486 ? 48.744  0.415   10.937  1.00 15.86  ? 1505 ARG A CB  1 
ATOM   3743  C CG  . ARG A  1 486 ? 48.185  -0.759  10.157  1.00 16.01  ? 1505 ARG A CG  1 
ATOM   3744  C CD  . ARG A  1 486 ? 48.391  -0.559  8.651   1.00 18.96  ? 1505 ARG A CD  1 
ATOM   3745  N NE  . ARG A  1 486 ? 47.396  0.339   8.071   1.00 18.82  ? 1505 ARG A NE  1 
ATOM   3746  C CZ  . ARG A  1 486 ? 46.191  -0.051  7.665   1.00 20.21  ? 1505 ARG A CZ  1 
ATOM   3747  N NH1 . ARG A  1 486 ? 45.835  -1.326  7.771   1.00 21.66  ? 1505 ARG A NH1 1 
ATOM   3748  N NH2 . ARG A  1 486 ? 45.337  0.829   7.160   1.00 19.73  ? 1505 ARG A NH2 1 
ATOM   3749  N N   . ASN A  1 487 ? 49.513  2.476   13.136  1.00 16.99  ? 1506 ASN A N   1 
ATOM   3750  C CA  . ASN A  1 487 ? 50.534  3.398   13.638  1.00 19.53  ? 1506 ASN A CA  1 
ATOM   3751  C C   . ASN A  1 487 ? 50.236  4.295   14.835  1.00 18.81  ? 1506 ASN A C   1 
ATOM   3752  O O   . ASN A  1 487 ? 51.099  5.073   15.233  1.00 19.14  ? 1506 ASN A O   1 
ATOM   3753  C CB  . ASN A  1 487 ? 50.990  4.308   12.491  1.00 21.41  ? 1506 ASN A CB  1 
ATOM   3754  C CG  . ASN A  1 487 ? 51.091  3.575   11.179  1.00 25.29  ? 1506 ASN A CG  1 
ATOM   3755  O OD1 . ASN A  1 487 ? 51.667  2.491   11.112  1.00 28.25  ? 1506 ASN A OD1 1 
ATOM   3756  N ND2 . ASN A  1 487 ? 50.536  4.161   10.120  1.00 29.03  ? 1506 ASN A ND2 1 
ATOM   3757  N N   . GLY A  1 488 ? 49.042  4.216   15.406  1.00 17.78  ? 1507 GLY A N   1 
ATOM   3758  C CA  . GLY A  1 488 ? 48.743  5.090   16.529  1.00 16.55  ? 1507 GLY A CA  1 
ATOM   3759  C C   . GLY A  1 488 ? 48.563  6.516   16.030  1.00 16.10  ? 1507 GLY A C   1 
ATOM   3760  O O   . GLY A  1 488 ? 48.604  7.474   16.797  1.00 15.71  ? 1507 GLY A O   1 
ATOM   3761  N N   . ASN A  1 489 ? 48.376  6.641   14.720  1.00 16.56  ? 1508 ASN A N   1 
ATOM   3762  C CA  . ASN A  1 489 ? 48.174  7.921   14.049  1.00 15.93  ? 1508 ASN A CA  1 
ATOM   3763  C C   . ASN A  1 489 ? 47.242  7.550   12.908  1.00 14.85  ? 1508 ASN A C   1 
ATOM   3764  O O   . ASN A  1 489 ? 47.549  6.660   12.119  1.00 14.58  ? 1508 ASN A O   1 
ATOM   3765  C CB  . ASN A  1 489 ? 49.500  8.455   13.493  1.00 18.86  ? 1508 ASN A CB  1 
ATOM   3766  C CG  . ASN A  1 489 ? 49.355  9.819   12.824  1.00 20.93  ? 1508 ASN A CG  1 
ATOM   3767  O OD1 . ASN A  1 489 ? 48.337  10.119  12.199  1.00 20.47  ? 1508 ASN A OD1 1 
ATOM   3768  N ND2 . ASN A  1 489 ? 50.390  10.645  12.944  1.00 21.37  ? 1508 ASN A ND2 1 
ATOM   3769  N N   . PRO A  1 490 ? 46.090  8.225   12.801  1.00 14.23  ? 1509 PRO A N   1 
ATOM   3770  C CA  . PRO A  1 490 ? 45.123  7.927   11.743  1.00 15.17  ? 1509 PRO A CA  1 
ATOM   3771  C C   . PRO A  1 490 ? 45.464  8.416   10.339  1.00 16.96  ? 1509 PRO A C   1 
ATOM   3772  O O   . PRO A  1 490 ? 44.887  7.944   9.367   1.00 16.25  ? 1509 PRO A O   1 
ATOM   3773  C CB  . PRO A  1 490 ? 43.851  8.578   12.265  1.00 15.34  ? 1509 PRO A CB  1 
ATOM   3774  C CG  . PRO A  1 490 ? 44.385  9.826   12.916  1.00 15.14  ? 1509 PRO A CG  1 
ATOM   3775  C CD  . PRO A  1 490 ? 45.624  9.342   13.647  1.00 14.78  ? 1509 PRO A CD  1 
ATOM   3776  N N   . ASN A  1 491 ? 46.395  9.356   10.232  1.00 18.85  ? 1510 ASN A N   1 
ATOM   3777  C CA  . ASN A  1 491 ? 46.736  9.926   8.929   1.00 19.89  ? 1510 ASN A CA  1 
ATOM   3778  C C   . ASN A  1 491 ? 47.330  8.984   7.890   1.00 19.99  ? 1510 ASN A C   1 
ATOM   3779  O O   . ASN A  1 491 ? 47.944  7.970   8.216   1.00 17.10  ? 1510 ASN A O   1 
ATOM   3780  C CB  . ASN A  1 491 ? 47.644  11.145  9.133   1.00 18.97  ? 1510 ASN A CB  1 
ATOM   3781  C CG  . ASN A  1 491 ? 46.899  12.312  9.760   1.00 19.70  ? 1510 ASN A CG  1 
ATOM   3782  O OD1 . ASN A  1 491 ? 46.052  12.930  9.119   1.00 19.50  ? 1510 ASN A OD1 1 
ATOM   3783  N ND2 . ASN A  1 491 ? 47.193  12.601  11.024  1.00 17.74  ? 1510 ASN A ND2 1 
ATOM   3784  N N   . GLY A  1 492 ? 47.119  9.330   6.624   1.00 22.12  ? 1511 GLY A N   1 
ATOM   3785  C CA  . GLY A  1 492 ? 47.632  8.516   5.540   1.00 23.55  ? 1511 GLY A CA  1 
ATOM   3786  C C   . GLY A  1 492 ? 47.354  9.166   4.201   1.00 25.98  ? 1511 GLY A C   1 
ATOM   3787  O O   . GLY A  1 492 ? 46.555  10.098  4.110   1.00 23.70  ? 1511 GLY A O   1 
ATOM   3788  N N   . GLU A  1 493 ? 48.015  8.678   3.157   1.00 28.62  ? 1512 GLU A N   1 
ATOM   3789  C CA  . GLU A  1 493 ? 47.827  9.221   1.817   1.00 31.98  ? 1512 GLU A CA  1 
ATOM   3790  C C   . GLU A  1 493 ? 46.385  9.050   1.357   1.00 30.54  ? 1512 GLU A C   1 
ATOM   3791  O O   . GLU A  1 493 ? 45.796  7.976   1.511   1.00 32.00  ? 1512 GLU A O   1 
ATOM   3792  C CB  . GLU A  1 493 ? 48.750  8.518   0.816   1.00 37.34  ? 1512 GLU A CB  1 
ATOM   3793  C CG  . GLU A  1 493 ? 50.246  8.782   0.989   1.00 46.73  ? 1512 GLU A CG  1 
ATOM   3794  C CD  . GLU A  1 493 ? 50.809  8.243   2.298   1.00 52.34  ? 1512 GLU A CD  1 
ATOM   3795  O OE1 . GLU A  1 493 ? 50.321  7.192   2.774   1.00 56.03  ? 1512 GLU A OE1 1 
ATOM   3796  O OE2 . GLU A  1 493 ? 51.754  8.859   2.842   1.00 55.55  ? 1512 GLU A OE2 1 
ATOM   3797  N N   . GLY A  1 494 ? 45.821  10.112  0.794   1.00 28.92  ? 1513 GLY A N   1 
ATOM   3798  C CA  . GLY A  1 494 ? 44.457  10.047  0.299   1.00 30.56  ? 1513 GLY A CA  1 
ATOM   3799  C C   . GLY A  1 494 ? 43.387  10.362  1.328   1.00 29.79  ? 1513 GLY A C   1 
ATOM   3800  O O   . GLY A  1 494 ? 42.196  10.208  1.057   1.00 32.20  ? 1513 GLY A O   1 
ATOM   3801  N N   . LEU A  1 495 ? 43.803  10.809  2.507   1.00 27.51  ? 1514 LEU A N   1 
ATOM   3802  C CA  . LEU A  1 495 ? 42.857  11.134  3.568   1.00 25.35  ? 1514 LEU A CA  1 
ATOM   3803  C C   . LEU A  1 495 ? 43.008  12.573  4.042   1.00 24.21  ? 1514 LEU A C   1 
ATOM   3804  O O   . LEU A  1 495 ? 44.109  13.115  4.062   1.00 24.59  ? 1514 LEU A O   1 
ATOM   3805  C CB  . LEU A  1 495 ? 43.069  10.204  4.766   1.00 23.86  ? 1514 LEU A CB  1 
ATOM   3806  C CG  . LEU A  1 495 ? 42.821  8.709   4.556   1.00 21.79  ? 1514 LEU A CG  1 
ATOM   3807  C CD1 . LEU A  1 495 ? 43.348  7.931   5.751   1.00 23.48  ? 1514 LEU A CD1 1 
ATOM   3808  C CD2 . LEU A  1 495 ? 41.334  8.463   4.361   1.00 21.20  ? 1514 LEU A CD2 1 
ATOM   3809  N N   . PRO A  1 496 ? 41.895  13.212  4.427   1.00 23.27  ? 1515 PRO A N   1 
ATOM   3810  C CA  . PRO A  1 496 ? 41.986  14.593  4.906   1.00 23.17  ? 1515 PRO A CA  1 
ATOM   3811  C C   . PRO A  1 496 ? 42.956  14.600  6.085   1.00 22.74  ? 1515 PRO A C   1 
ATOM   3812  O O   . PRO A  1 496 ? 43.154  13.568  6.733   1.00 22.45  ? 1515 PRO A O   1 
ATOM   3813  C CB  . PRO A  1 496 ? 40.557  14.897  5.346   1.00 23.58  ? 1515 PRO A CB  1 
ATOM   3814  C CG  . PRO A  1 496 ? 39.737  14.083  4.397   1.00 22.97  ? 1515 PRO A CG  1 
ATOM   3815  C CD  . PRO A  1 496 ? 40.493  12.773  4.329   1.00 22.03  ? 1515 PRO A CD  1 
ATOM   3816  N N   . HIS A  1 497 ? 43.562  15.746  6.367   1.00 19.34  ? 1516 HIS A N   1 
ATOM   3817  C CA  . HIS A  1 497 ? 44.494  15.832  7.480   1.00 18.63  ? 1516 HIS A CA  1 
ATOM   3818  C C   . HIS A  1 497 ? 43.760  15.827  8.824   1.00 17.86  ? 1516 HIS A C   1 
ATOM   3819  O O   . HIS A  1 497 ? 42.825  16.597  9.038   1.00 16.70  ? 1516 HIS A O   1 
ATOM   3820  C CB  . HIS A  1 497 ? 45.337  17.105  7.381   1.00 20.16  ? 1516 HIS A CB  1 
ATOM   3821  C CG  . HIS A  1 497 ? 46.347  17.237  8.475   1.00 22.13  ? 1516 HIS A CG  1 
ATOM   3822  N ND1 . HIS A  1 497 ? 47.413  16.372  8.610   1.00 23.01  ? 1516 HIS A ND1 1 
ATOM   3823  C CD2 . HIS A  1 497 ? 46.432  18.101  9.513   1.00 22.25  ? 1516 HIS A CD2 1 
ATOM   3824  C CE1 . HIS A  1 497 ? 48.107  16.696  9.685   1.00 22.87  ? 1516 HIS A CE1 1 
ATOM   3825  N NE2 . HIS A  1 497 ? 47.532  17.743  10.253  1.00 24.18  ? 1516 HIS A NE2 1 
ATOM   3826  N N   . TRP A  1 498 ? 44.199  14.958  9.725   1.00 17.23  ? 1517 TRP A N   1 
ATOM   3827  C CA  . TRP A  1 498 ? 43.600  14.849  11.052  1.00 18.00  ? 1517 TRP A CA  1 
ATOM   3828  C C   . TRP A  1 498 ? 44.689  15.290  12.021  1.00 15.72  ? 1517 TRP A C   1 
ATOM   3829  O O   . TRP A  1 498 ? 45.630  14.548  12.288  1.00 15.90  ? 1517 TRP A O   1 
ATOM   3830  C CB  . TRP A  1 498 ? 43.203  13.394  11.337  1.00 16.38  ? 1517 TRP A CB  1 
ATOM   3831  C CG  . TRP A  1 498 ? 42.369  13.189  12.595  1.00 16.99  ? 1517 TRP A CG  1 
ATOM   3832  C CD1 . TRP A  1 498 ? 42.393  13.938  13.744  1.00 15.00  ? 1517 TRP A CD1 1 
ATOM   3833  C CD2 . TRP A  1 498 ? 41.437  12.125  12.832  1.00 12.96  ? 1517 TRP A CD2 1 
ATOM   3834  N NE1 . TRP A  1 498 ? 41.535  13.400  14.676  1.00 14.00  ? 1517 TRP A NE1 1 
ATOM   3835  C CE2 . TRP A  1 498 ? 40.936  12.289  14.141  1.00 14.17  ? 1517 TRP A CE2 1 
ATOM   3836  C CE3 . TRP A  1 498 ? 40.979  11.048  12.062  1.00 12.61  ? 1517 TRP A CE3 1 
ATOM   3837  C CZ2 . TRP A  1 498 ? 39.996  11.413  14.701  1.00 12.81  ? 1517 TRP A CZ2 1 
ATOM   3838  C CZ3 . TRP A  1 498 ? 40.046  10.177  12.616  1.00 14.27  ? 1517 TRP A CZ3 1 
ATOM   3839  C CH2 . TRP A  1 498 ? 39.564  10.367  13.927  1.00 14.14  ? 1517 TRP A CH2 1 
ATOM   3840  N N   . PRO A  1 499 ? 44.578  16.513  12.556  1.00 17.63  ? 1518 PRO A N   1 
ATOM   3841  C CA  . PRO A  1 499 ? 45.588  17.009  13.489  1.00 19.05  ? 1518 PRO A CA  1 
ATOM   3842  C C   . PRO A  1 499 ? 45.554  16.279  14.822  1.00 21.01  ? 1518 PRO A C   1 
ATOM   3843  O O   . PRO A  1 499 ? 44.509  15.794  15.246  1.00 21.57  ? 1518 PRO A O   1 
ATOM   3844  C CB  . PRO A  1 499 ? 45.223  18.481  13.631  1.00 18.98  ? 1518 PRO A CB  1 
ATOM   3845  C CG  . PRO A  1 499 ? 43.725  18.449  13.542  1.00 19.68  ? 1518 PRO A CG  1 
ATOM   3846  C CD  . PRO A  1 499 ? 43.479  17.485  12.397  1.00 17.67  ? 1518 PRO A CD  1 
ATOM   3847  N N   . GLU A  1 500 ? 46.705  16.187  15.473  1.00 20.42  ? 1519 GLU A N   1 
ATOM   3848  C CA  . GLU A  1 500 ? 46.769  15.541  16.769  1.00 23.62  ? 1519 GLU A CA  1 
ATOM   3849  C C   . GLU A  1 500 ? 46.102  16.481  17.767  1.00 22.05  ? 1519 GLU A C   1 
ATOM   3850  O O   . GLU A  1 500 ? 46.162  17.707  17.621  1.00 21.25  ? 1519 GLU A O   1 
ATOM   3851  C CB  . GLU A  1 500 ? 48.223  15.293  17.185  1.00 27.52  ? 1519 GLU A CB  1 
ATOM   3852  C CG  . GLU A  1 500 ? 48.367  14.766  18.611  1.00 35.04  ? 1519 GLU A CG  1 
ATOM   3853  C CD  . GLU A  1 500 ? 49.809  14.537  19.015  1.00 40.13  ? 1519 GLU A CD  1 
ATOM   3854  O OE1 . GLU A  1 500 ? 50.422  13.569  18.522  1.00 42.52  ? 1519 GLU A OE1 1 
ATOM   3855  O OE2 . GLU A  1 500 ? 50.334  15.331  19.824  1.00 44.39  ? 1519 GLU A OE2 1 
ATOM   3856  N N   . TYR A  1 501 ? 45.453  15.908  18.772  1.00 19.96  ? 1520 TYR A N   1 
ATOM   3857  C CA  . TYR A  1 501 ? 44.786  16.711  19.783  1.00 18.86  ? 1520 TYR A CA  1 
ATOM   3858  C C   . TYR A  1 501 ? 45.840  17.160  20.790  1.00 19.19  ? 1520 TYR A C   1 
ATOM   3859  O O   . TYR A  1 501 ? 46.071  16.502  21.801  1.00 19.06  ? 1520 TYR A O   1 
ATOM   3860  C CB  . TYR A  1 501 ? 43.702  15.887  20.482  1.00 17.79  ? 1520 TYR A CB  1 
ATOM   3861  C CG  . TYR A  1 501 ? 42.829  16.701  21.402  1.00 18.38  ? 1520 TYR A CG  1 
ATOM   3862  C CD1 . TYR A  1 501 ? 41.820  17.524  20.893  1.00 18.61  ? 1520 TYR A CD1 1 
ATOM   3863  C CD2 . TYR A  1 501 ? 43.026  16.673  22.779  1.00 17.57  ? 1520 TYR A CD2 1 
ATOM   3864  C CE1 . TYR A  1 501 ? 41.032  18.299  21.736  1.00 19.23  ? 1520 TYR A CE1 1 
ATOM   3865  C CE2 . TYR A  1 501 ? 42.243  17.444  23.630  1.00 20.25  ? 1520 TYR A CE2 1 
ATOM   3866  C CZ  . TYR A  1 501 ? 41.251  18.253  23.102  1.00 19.42  ? 1520 TYR A CZ  1 
ATOM   3867  O OH  . TYR A  1 501 ? 40.483  19.016  23.942  1.00 23.17  ? 1520 TYR A OH  1 
ATOM   3868  N N   . ASN A  1 502 ? 46.494  18.276  20.489  1.00 20.11  ? 1521 ASN A N   1 
ATOM   3869  C CA  . ASN A  1 502 ? 47.530  18.823  21.353  1.00 19.82  ? 1521 ASN A CA  1 
ATOM   3870  C C   . ASN A  1 502 ? 47.023  20.098  22.017  1.00 20.96  ? 1521 ASN A C   1 
ATOM   3871  O O   . ASN A  1 502 ? 45.816  20.272  22.193  1.00 19.94  ? 1521 ASN A O   1 
ATOM   3872  C CB  . ASN A  1 502 ? 48.793  19.126  20.539  1.00 22.11  ? 1521 ASN A CB  1 
ATOM   3873  C CG  . ASN A  1 502 ? 48.507  19.969  19.309  1.00 22.77  ? 1521 ASN A CG  1 
ATOM   3874  O OD1 . ASN A  1 502 ? 47.690  20.890  19.344  1.00 22.17  ? 1521 ASN A OD1 1 
ATOM   3875  N ND2 . ASN A  1 502 ? 49.193  19.662  18.212  1.00 26.05  ? 1521 ASN A ND2 1 
ATOM   3876  N N   . GLN A  1 503 ? 47.931  21.001  22.374  1.00 20.62  ? 1522 GLN A N   1 
ATOM   3877  C CA  . GLN A  1 503 ? 47.509  22.235  23.028  1.00 23.84  ? 1522 GLN A CA  1 
ATOM   3878  C C   . GLN A  1 503 ? 46.569  23.079  22.168  1.00 23.04  ? 1522 GLN A C   1 
ATOM   3879  O O   . GLN A  1 503 ? 45.790  23.866  22.696  1.00 25.19  ? 1522 GLN A O   1 
ATOM   3880  C CB  . GLN A  1 503 ? 48.725  23.061  23.457  1.00 26.99  ? 1522 GLN A CB  1 
ATOM   3881  C CG  . GLN A  1 503 ? 49.575  22.394  24.543  1.00 32.96  ? 1522 GLN A CG  1 
ATOM   3882  C CD  . GLN A  1 503 ? 48.752  21.889  25.724  1.00 34.76  ? 1522 GLN A CD  1 
ATOM   3883  O OE1 . GLN A  1 503 ? 47.923  22.614  26.274  1.00 38.77  ? 1522 GLN A OE1 1 
ATOM   3884  N NE2 . GLN A  1 503 ? 48.988  20.644  26.122  1.00 34.87  ? 1522 GLN A NE2 1 
ATOM   3885  N N   . LYS A  1 504 ? 46.640  22.919  20.849  1.00 22.23  ? 1523 LYS A N   1 
ATOM   3886  C CA  . LYS A  1 504 ? 45.760  23.662  19.949  1.00 22.34  ? 1523 LYS A CA  1 
ATOM   3887  C C   . LYS A  1 504 ? 44.386  22.988  19.926  1.00 21.24  ? 1523 LYS A C   1 
ATOM   3888  O O   . LYS A  1 504 ? 43.415  23.542  19.407  1.00 20.27  ? 1523 LYS A O   1 
ATOM   3889  C CB  . LYS A  1 504 ? 46.320  23.684  18.520  1.00 24.56  ? 1523 LYS A CB  1 
ATOM   3890  C CG  . LYS A  1 504 ? 47.625  24.453  18.322  1.00 28.53  ? 1523 LYS A CG  1 
ATOM   3891  C CD  . LYS A  1 504 ? 48.013  24.436  16.838  1.00 31.90  ? 1523 LYS A CD  1 
ATOM   3892  C CE  . LYS A  1 504 ? 49.421  24.961  16.591  1.00 35.24  ? 1523 LYS A CE  1 
ATOM   3893  N NZ  . LYS A  1 504 ? 49.546  26.407  16.914  1.00 38.32  ? 1523 LYS A NZ  1 
ATOM   3894  N N   . GLU A  1 505 ? 44.324  21.781  20.481  1.00 19.79  ? 1524 GLU A N   1 
ATOM   3895  C CA  . GLU A  1 505 ? 43.090  21.003  20.544  1.00 19.19  ? 1524 GLU A CA  1 
ATOM   3896  C C   . GLU A  1 505 ? 42.401  20.827  19.202  1.00 18.98  ? 1524 GLU A C   1 
ATOM   3897  O O   . GLU A  1 505 ? 41.192  21.029  19.069  1.00 18.09  ? 1524 GLU A O   1 
ATOM   3898  C CB  . GLU A  1 505 ? 42.133  21.626  21.562  1.00 21.71  ? 1524 GLU A CB  1 
ATOM   3899  C CG  . GLU A  1 505 ? 42.738  21.635  22.956  1.00 25.26  ? 1524 GLU A CG  1 
ATOM   3900  C CD  . GLU A  1 505 ? 41.765  22.032  24.050  1.00 30.78  ? 1524 GLU A CD  1 
ATOM   3901  O OE1 . GLU A  1 505 ? 42.165  21.947  25.231  1.00 33.52  ? 1524 GLU A OE1 1 
ATOM   3902  O OE2 . GLU A  1 505 ? 40.615  22.425  23.743  1.00 30.82  ? 1524 GLU A OE2 1 
ATOM   3903  N N   . GLY A  1 506 ? 43.177  20.438  18.199  1.00 17.30  ? 1525 GLY A N   1 
ATOM   3904  C CA  . GLY A  1 506 ? 42.596  20.214  16.894  1.00 16.39  ? 1525 GLY A CA  1 
ATOM   3905  C C   . GLY A  1 506 ? 41.864  18.882  16.910  1.00 17.15  ? 1525 GLY A C   1 
ATOM   3906  O O   . GLY A  1 506 ? 42.235  17.973  17.656  1.00 15.11  ? 1525 GLY A O   1 
ATOM   3907  N N   . TYR A  1 507 ? 40.819  18.772  16.099  1.00 14.98  ? 1526 TYR A N   1 
ATOM   3908  C CA  . TYR A  1 507 ? 40.039  17.544  16.012  1.00 17.05  ? 1526 TYR A CA  1 
ATOM   3909  C C   . TYR A  1 507 ? 39.459  17.455  14.611  1.00 15.59  ? 1526 TYR A C   1 
ATOM   3910  O O   . TYR A  1 507 ? 39.473  18.434  13.871  1.00 17.34  ? 1526 TYR A O   1 
ATOM   3911  C CB  . TYR A  1 507 ? 38.915  17.538  17.067  1.00 14.96  ? 1526 TYR A CB  1 
ATOM   3912  C CG  . TYR A  1 507 ? 37.793  18.523  16.813  1.00 15.01  ? 1526 TYR A CG  1 
ATOM   3913  C CD1 . TYR A  1 507 ? 36.578  18.102  16.273  1.00 15.39  ? 1526 TYR A CD1 1 
ATOM   3914  C CD2 . TYR A  1 507 ? 37.944  19.874  17.120  1.00 15.47  ? 1526 TYR A CD2 1 
ATOM   3915  C CE1 . TYR A  1 507 ? 35.538  19.005  16.045  1.00 16.75  ? 1526 TYR A CE1 1 
ATOM   3916  C CE2 . TYR A  1 507 ? 36.910  20.787  16.899  1.00 16.81  ? 1526 TYR A CE2 1 
ATOM   3917  C CZ  . TYR A  1 507 ? 35.715  20.346  16.365  1.00 15.98  ? 1526 TYR A CZ  1 
ATOM   3918  O OH  . TYR A  1 507 ? 34.693  21.238  16.174  1.00 18.11  ? 1526 TYR A OH  1 
ATOM   3919  N N   . LEU A  1 508 ? 38.961  16.283  14.232  1.00 16.61  ? 1527 LEU A N   1 
ATOM   3920  C CA  . LEU A  1 508 ? 38.390  16.124  12.899  1.00 14.92  ? 1527 LEU A CA  1 
ATOM   3921  C C   . LEU A  1 508 ? 36.867  16.068  12.923  1.00 15.99  ? 1527 LEU A C   1 
ATOM   3922  O O   . LEU A  1 508 ? 36.278  15.295  13.676  1.00 14.67  ? 1527 LEU A O   1 
ATOM   3923  C CB  . LEU A  1 508 ? 38.923  14.847  12.234  1.00 14.43  ? 1527 LEU A CB  1 
ATOM   3924  C CG  . LEU A  1 508 ? 38.525  14.631  10.765  1.00 15.39  ? 1527 LEU A CG  1 
ATOM   3925  C CD1 . LEU A  1 508 ? 39.129  15.736  9.900   1.00 11.46  ? 1527 LEU A CD1 1 
ATOM   3926  C CD2 . LEU A  1 508 ? 39.022  13.274  10.290  1.00 13.84  ? 1527 LEU A CD2 1 
ATOM   3927  N N   . GLN A  1 509 ? 36.237  16.907  12.108  1.00 15.76  ? 1528 GLN A N   1 
ATOM   3928  C CA  . GLN A  1 509 ? 34.785  16.910  11.985  1.00 16.08  ? 1528 GLN A CA  1 
ATOM   3929  C C   . GLN A  1 509 ? 34.552  15.939  10.835  1.00 16.18  ? 1528 GLN A C   1 
ATOM   3930  O O   . GLN A  1 509 ? 34.926  16.218  9.691   1.00 17.61  ? 1528 GLN A O   1 
ATOM   3931  C CB  . GLN A  1 509 ? 34.268  18.306  11.609  1.00 17.11  ? 1528 GLN A CB  1 
ATOM   3932  C CG  . GLN A  1 509 ? 34.682  19.402  12.581  1.00 17.96  ? 1528 GLN A CG  1 
ATOM   3933  C CD  . GLN A  1 509 ? 34.158  20.768  12.182  1.00 20.52  ? 1528 GLN A CD  1 
ATOM   3934  O OE1 . GLN A  1 509 ? 34.230  21.154  11.018  1.00 23.08  ? 1528 GLN A OE1 1 
ATOM   3935  N NE2 . GLN A  1 509 ? 33.642  21.513  13.151  1.00 18.47  ? 1528 GLN A NE2 1 
ATOM   3936  N N   . ILE A  1 510 ? 33.955  14.795  11.142  1.00 15.91  ? 1529 ILE A N   1 
ATOM   3937  C CA  . ILE A  1 510 ? 33.706  13.760  10.148  1.00 14.57  ? 1529 ILE A CA  1 
ATOM   3938  C C   . ILE A  1 510 ? 32.264  13.746  9.660   1.00 16.31  ? 1529 ILE A C   1 
ATOM   3939  O O   . ILE A  1 510 ? 31.328  13.714  10.459  1.00 16.22  ? 1529 ILE A O   1 
ATOM   3940  C CB  . ILE A  1 510 ? 34.056  12.364  10.729  1.00 15.65  ? 1529 ILE A CB  1 
ATOM   3941  C CG1 . ILE A  1 510 ? 35.528  12.340  11.156  1.00 14.27  ? 1529 ILE A CG1 1 
ATOM   3942  C CG2 . ILE A  1 510 ? 33.762  11.274  9.699   1.00 15.53  ? 1529 ILE A CG2 1 
ATOM   3943  C CD1 . ILE A  1 510 ? 35.969  11.032  11.825  1.00 17.24  ? 1529 ILE A CD1 1 
ATOM   3944  N N   . GLY A  1 511 ? 32.088  13.766  8.341   1.00 15.35  ? 1530 GLY A N   1 
ATOM   3945  C CA  . GLY A  1 511 ? 30.753  13.752  7.776   1.00 18.52  ? 1530 GLY A CA  1 
ATOM   3946  C C   . GLY A  1 511 ? 30.785  13.857  6.264   1.00 20.88  ? 1530 GLY A C   1 
ATOM   3947  O O   . GLY A  1 511 ? 31.786  13.505  5.640   1.00 19.63  ? 1530 GLY A O   1 
ATOM   3948  N N   . ALA A  1 512 ? 29.692  14.331  5.674   1.00 23.26  ? 1531 ALA A N   1 
ATOM   3949  C CA  . ALA A  1 512 ? 29.621  14.492  4.224   1.00 25.74  ? 1531 ALA A CA  1 
ATOM   3950  C C   . ALA A  1 512 ? 30.828  15.333  3.838   1.00 26.27  ? 1531 ALA A C   1 
ATOM   3951  O O   . ALA A  1 512 ? 31.521  15.047  2.866   1.00 27.42  ? 1531 ALA A O   1 
ATOM   3952  C CB  . ALA A  1 512 ? 28.335  15.196  3.837   1.00 26.50  ? 1531 ALA A CB  1 
ATOM   3953  N N   . ASN A  1 513 ? 31.068  16.379  4.617   1.00 26.56  ? 1532 ASN A N   1 
ATOM   3954  C CA  . ASN A  1 513 ? 32.220  17.241  4.412   1.00 26.70  ? 1532 ASN A CA  1 
ATOM   3955  C C   . ASN A  1 513 ? 33.105  16.990  5.624   1.00 25.56  ? 1532 ASN A C   1 
ATOM   3956  O O   . ASN A  1 513 ? 32.678  17.197  6.764   1.00 26.07  ? 1532 ASN A O   1 
ATOM   3957  C CB  . ASN A  1 513 ? 31.812  18.715  4.373   1.00 29.96  ? 1532 ASN A CB  1 
ATOM   3958  C CG  . ASN A  1 513 ? 30.915  19.039  3.200   1.00 33.93  ? 1532 ASN A CG  1 
ATOM   3959  O OD1 . ASN A  1 513 ? 31.235  18.721  2.050   1.00 36.15  ? 1532 ASN A OD1 1 
ATOM   3960  N ND2 . ASN A  1 513 ? 29.784  19.681  3.480   1.00 34.96  ? 1532 ASN A ND2 1 
ATOM   3961  N N   . THR A  1 514 ? 34.326  16.533  5.389   1.00 22.57  ? 1533 THR A N   1 
ATOM   3962  C CA  . THR A  1 514 ? 35.233  16.259  6.492   1.00 20.95  ? 1533 THR A CA  1 
ATOM   3963  C C   . THR A  1 514 ? 36.418  17.218  6.464   1.00 22.49  ? 1533 THR A C   1 
ATOM   3964  O O   . THR A  1 514 ? 37.050  17.405  5.423   1.00 22.15  ? 1533 THR A O   1 
ATOM   3965  C CB  . THR A  1 514 ? 35.733  14.799  6.430   1.00 20.83  ? 1533 THR A CB  1 
ATOM   3966  O OG1 . THR A  1 514 ? 34.609  13.911  6.519   1.00 18.48  ? 1533 THR A OG1 1 
ATOM   3967  C CG2 . THR A  1 514 ? 36.697  14.504  7.572   1.00 18.88  ? 1533 THR A CG2 1 
ATOM   3968  N N   . GLN A  1 515 ? 36.698  17.841  7.607   1.00 20.61  ? 1534 GLN A N   1 
ATOM   3969  C CA  . GLN A  1 515 ? 37.816  18.771  7.726   1.00 21.83  ? 1534 GLN A CA  1 
ATOM   3970  C C   . GLN A  1 515 ? 38.171  19.006  9.190   1.00 21.30  ? 1534 GLN A C   1 
ATOM   3971  O O   . GLN A  1 515 ? 37.357  18.777  10.083  1.00 21.24  ? 1534 GLN A O   1 
ATOM   3972  C CB  . GLN A  1 515 ? 37.488  20.113  7.058   1.00 23.25  ? 1534 GLN A CB  1 
ATOM   3973  C CG  . GLN A  1 515 ? 36.351  20.898  7.691   1.00 24.98  ? 1534 GLN A CG  1 
ATOM   3974  C CD  . GLN A  1 515 ? 34.990  20.300  7.402   1.00 29.63  ? 1534 GLN A CD  1 
ATOM   3975  O OE1 . GLN A  1 515 ? 34.673  19.982  6.256   1.00 30.28  ? 1534 GLN A OE1 1 
ATOM   3976  N NE2 . GLN A  1 515 ? 34.169  20.157  8.441   1.00 30.35  ? 1534 GLN A NE2 1 
ATOM   3977  N N   . ALA A  1 516 ? 39.391  19.468  9.433   1.00 20.77  ? 1535 ALA A N   1 
ATOM   3978  C CA  . ALA A  1 516 ? 39.841  19.729  10.795  1.00 20.83  ? 1535 ALA A CA  1 
ATOM   3979  C C   . ALA A  1 516 ? 39.230  21.008  11.352  1.00 21.25  ? 1535 ALA A C   1 
ATOM   3980  O O   . ALA A  1 516 ? 38.801  21.885  10.602  1.00 20.62  ? 1535 ALA A O   1 
ATOM   3981  C CB  . ALA A  1 516 ? 41.362  19.822  10.831  1.00 21.19  ? 1535 ALA A CB  1 
ATOM   3982  N N   . ALA A  1 517 ? 39.186  21.090  12.677  1.00 20.83  ? 1536 ALA A N   1 
ATOM   3983  C CA  . ALA A  1 517 ? 38.665  22.248  13.395  1.00 20.84  ? 1536 ALA A CA  1 
ATOM   3984  C C   . ALA A  1 517 ? 39.387  22.228  14.735  1.00 20.19  ? 1536 ALA A C   1 
ATOM   3985  O O   . ALA A  1 517 ? 40.175  21.315  14.992  1.00 21.76  ? 1536 ALA A O   1 
ATOM   3986  C CB  . ALA A  1 517 ? 37.153  22.130  13.598  1.00 19.21  ? 1536 ALA A CB  1 
ATOM   3987  N N   . GLN A  1 518 ? 39.124  23.214  15.589  1.00 18.57  ? 1537 GLN A N   1 
ATOM   3988  C CA  . GLN A  1 518 ? 39.801  23.280  16.881  1.00 19.48  ? 1537 GLN A CA  1 
ATOM   3989  C C   . GLN A  1 518 ? 38.884  23.561  18.073  1.00 19.21  ? 1537 GLN A C   1 
ATOM   3990  O O   . GLN A  1 518 ? 37.801  24.128  17.923  1.00 20.34  ? 1537 GLN A O   1 
ATOM   3991  C CB  . GLN A  1 518 ? 40.890  24.364  16.848  1.00 19.70  ? 1537 GLN A CB  1 
ATOM   3992  C CG  . GLN A  1 518 ? 41.977  24.192  15.790  1.00 22.15  ? 1537 GLN A CG  1 
ATOM   3993  C CD  . GLN A  1 518 ? 42.981  25.338  15.825  1.00 24.66  ? 1537 GLN A CD  1 
ATOM   3994  O OE1 . GLN A  1 518 ? 42.595  26.498  15.920  1.00 26.04  ? 1537 GLN A OE1 1 
ATOM   3995  N NE2 . GLN A  1 518 ? 44.269  25.015  15.761  1.00 23.31  ? 1537 GLN A NE2 1 
ATOM   3996  N N   . LYS A  1 519 ? 39.341  23.158  19.256  1.00 17.91  ? 1538 LYS A N   1 
ATOM   3997  C CA  . LYS A  1 519 ? 38.626  23.387  20.512  1.00 19.71  ? 1538 LYS A CA  1 
ATOM   3998  C C   . LYS A  1 519 ? 37.215  22.813  20.621  1.00 19.91  ? 1538 LYS A C   1 
ATOM   3999  O O   . LYS A  1 519 ? 36.258  23.529  20.926  1.00 21.46  ? 1538 LYS A O   1 
ATOM   4000  C CB  . LYS A  1 519 ? 38.591  24.887  20.805  1.00 23.30  ? 1538 LYS A CB  1 
ATOM   4001  C CG  . LYS A  1 519 ? 39.969  25.515  20.924  1.00 26.22  ? 1538 LYS A CG  1 
ATOM   4002  C CD  . LYS A  1 519 ? 39.877  27.021  21.123  1.00 33.37  ? 1538 LYS A CD  1 
ATOM   4003  C CE  . LYS A  1 519 ? 41.263  27.642  21.219  1.00 37.24  ? 1538 LYS A CE  1 
ATOM   4004  N NZ  . LYS A  1 519 ? 41.203  29.128  21.293  1.00 40.35  ? 1538 LYS A NZ  1 
ATOM   4005  N N   . LEU A  1 520 ? 37.089  21.515  20.378  1.00 17.98  ? 1539 LEU A N   1 
ATOM   4006  C CA  . LEU A  1 520 ? 35.800  20.841  20.477  1.00 15.73  ? 1539 LEU A CA  1 
ATOM   4007  C C   . LEU A  1 520 ? 35.223  21.014  21.894  1.00 15.73  ? 1539 LEU A C   1 
ATOM   4008  O O   . LEU A  1 520 ? 35.913  20.751  22.875  1.00 13.42  ? 1539 LEU A O   1 
ATOM   4009  C CB  . LEU A  1 520 ? 35.996  19.352  20.185  1.00 15.78  ? 1539 LEU A CB  1 
ATOM   4010  C CG  . LEU A  1 520 ? 34.801  18.415  20.318  1.00 14.75  ? 1539 LEU A CG  1 
ATOM   4011  C CD1 . LEU A  1 520 ? 33.729  18.784  19.300  1.00 15.24  ? 1539 LEU A CD1 1 
ATOM   4012  C CD2 . LEU A  1 520 ? 35.280  16.982  20.112  1.00 17.05  ? 1539 LEU A CD2 1 
ATOM   4013  N N   . LYS A  1 521 ? 33.970  21.462  21.986  1.00 16.63  ? 1540 LYS A N   1 
ATOM   4014  C CA  . LYS A  1 521 ? 33.268  21.646  23.267  1.00 18.53  ? 1540 LYS A CA  1 
ATOM   4015  C C   . LYS A  1 521 ? 33.995  22.459  24.329  1.00 18.98  ? 1540 LYS A C   1 
ATOM   4016  O O   . LYS A  1 521 ? 33.703  22.326  25.517  1.00 19.88  ? 1540 LYS A O   1 
ATOM   4017  C CB  . LYS A  1 521 ? 32.915  20.285  23.885  1.00 18.92  ? 1540 LYS A CB  1 
ATOM   4018  C CG  . LYS A  1 521 ? 32.067  19.369  23.009  1.00 18.55  ? 1540 LYS A CG  1 
ATOM   4019  C CD  . LYS A  1 521 ? 30.683  19.940  22.751  1.00 20.92  ? 1540 LYS A CD  1 
ATOM   4020  C CE  . LYS A  1 521 ? 29.867  18.994  21.875  1.00 19.32  ? 1540 LYS A CE  1 
ATOM   4021  N NZ  . LYS A  1 521 ? 28.458  19.450  21.701  1.00 20.86  ? 1540 LYS A NZ  1 
ATOM   4022  N N   . ASP A  1 522 ? 34.928  23.305  23.913  1.00 20.17  ? 1541 ASP A N   1 
ATOM   4023  C CA  . ASP A  1 522 ? 35.691  24.111  24.855  1.00 21.12  ? 1541 ASP A CA  1 
ATOM   4024  C C   . ASP A  1 522 ? 34.806  24.959  25.776  1.00 22.08  ? 1541 ASP A C   1 
ATOM   4025  O O   . ASP A  1 522 ? 34.970  24.942  26.998  1.00 20.48  ? 1541 ASP A O   1 
ATOM   4026  C CB  . ASP A  1 522 ? 36.664  25.005  24.088  1.00 24.48  ? 1541 ASP A CB  1 
ATOM   4027  C CG  . ASP A  1 522 ? 37.470  25.897  24.998  1.00 26.51  ? 1541 ASP A CG  1 
ATOM   4028  O OD1 . ASP A  1 522 ? 37.272  27.128  24.948  1.00 30.11  ? 1541 ASP A OD1 1 
ATOM   4029  O OD2 . ASP A  1 522 ? 38.298  25.365  25.768  1.00 31.80  ? 1541 ASP A OD2 1 
ATOM   4030  N N   . LYS A  1 523 ? 33.868  25.693  25.185  1.00 22.14  ? 1542 LYS A N   1 
ATOM   4031  C CA  . LYS A  1 523 ? 32.954  26.548  25.942  1.00 24.65  ? 1542 LYS A CA  1 
ATOM   4032  C C   . LYS A  1 523 ? 32.153  25.738  26.953  1.00 22.42  ? 1542 LYS A C   1 
ATOM   4033  O O   . LYS A  1 523 ? 32.001  26.132  28.108  1.00 19.20  ? 1542 LYS A O   1 
ATOM   4034  C CB  . LYS A  1 523 ? 31.981  27.243  24.988  1.00 25.99  ? 1542 LYS A CB  1 
ATOM   4035  C CG  . LYS A  1 523 ? 32.616  28.280  24.083  1.00 32.24  ? 1542 LYS A CG  1 
ATOM   4036  C CD  . LYS A  1 523 ? 31.808  28.484  22.797  1.00 35.48  ? 1542 LYS A CD  1 
ATOM   4037  C CE  . LYS A  1 523 ? 30.308  28.533  23.065  1.00 37.58  ? 1542 LYS A CE  1 
ATOM   4038  N NZ  . LYS A  1 523 ? 29.983  29.490  24.158  1.00 40.85  ? 1542 LYS A NZ  1 
ATOM   4039  N N   . GLU A  1 524 ? 31.642  24.599  26.502  1.00 21.81  ? 1543 GLU A N   1 
ATOM   4040  C CA  . GLU A  1 524 ? 30.840  23.737  27.350  1.00 20.97  ? 1543 GLU A CA  1 
ATOM   4041  C C   . GLU A  1 524 ? 31.628  23.147  28.506  1.00 19.42  ? 1543 GLU A C   1 
ATOM   4042  O O   . GLU A  1 524 ? 31.138  23.115  29.634  1.00 18.08  ? 1543 GLU A O   1 
ATOM   4043  C CB  . GLU A  1 524 ? 30.199  22.630  26.514  1.00 23.30  ? 1543 GLU A CB  1 
ATOM   4044  C CG  . GLU A  1 524 ? 29.177  23.146  25.502  1.00 26.09  ? 1543 GLU A CG  1 
ATOM   4045  C CD  . GLU A  1 524 ? 29.805  23.742  24.246  1.00 27.46  ? 1543 GLU A CD  1 
ATOM   4046  O OE1 . GLU A  1 524 ? 29.047  24.262  23.400  1.00 28.96  ? 1543 GLU A OE1 1 
ATOM   4047  O OE2 . GLU A  1 524 ? 31.046  23.687  24.093  1.00 26.22  ? 1543 GLU A OE2 1 
ATOM   4048  N N   . VAL A  1 525 ? 32.851  22.689  28.244  1.00 18.89  ? 1544 VAL A N   1 
ATOM   4049  C CA  . VAL A  1 525 ? 33.665  22.127  29.319  1.00 18.08  ? 1544 VAL A CA  1 
ATOM   4050  C C   . VAL A  1 525 ? 33.848  23.171  30.424  1.00 19.49  ? 1544 VAL A C   1 
ATOM   4051  O O   . VAL A  1 525 ? 33.723  22.863  31.611  1.00 19.01  ? 1544 VAL A O   1 
ATOM   4052  C CB  . VAL A  1 525 ? 35.062  21.673  28.814  1.00 17.74  ? 1544 VAL A CB  1 
ATOM   4053  C CG1 . VAL A  1 525 ? 35.940  21.273  29.994  1.00 16.31  ? 1544 VAL A CG1 1 
ATOM   4054  C CG2 . VAL A  1 525 ? 34.912  20.488  27.856  1.00 18.67  ? 1544 VAL A CG2 1 
ATOM   4055  N N   . ALA A  1 526 ? 34.145  24.408  30.031  1.00 18.75  ? 1545 ALA A N   1 
ATOM   4056  C CA  . ALA A  1 526 ? 34.338  25.479  31.004  1.00 19.22  ? 1545 ALA A CA  1 
ATOM   4057  C C   . ALA A  1 526 ? 33.064  25.688  31.839  1.00 18.52  ? 1545 ALA A C   1 
ATOM   4058  O O   . ALA A  1 526 ? 33.113  25.713  33.071  1.00 19.97  ? 1545 ALA A O   1 
ATOM   4059  C CB  . ALA A  1 526 ? 34.723  26.781  30.284  1.00 19.32  ? 1545 ALA A CB  1 
ATOM   4060  N N   . PHE A  1 527 ? 31.927  25.830  31.167  1.00 17.36  ? 1546 PHE A N   1 
ATOM   4061  C CA  . PHE A  1 527 ? 30.660  26.036  31.868  1.00 18.92  ? 1546 PHE A CA  1 
ATOM   4062  C C   . PHE A  1 527 ? 30.339  24.935  32.883  1.00 18.55  ? 1546 PHE A C   1 
ATOM   4063  O O   . PHE A  1 527 ? 30.053  25.214  34.054  1.00 15.62  ? 1546 PHE A O   1 
ATOM   4064  C CB  . PHE A  1 527 ? 29.496  26.130  30.876  1.00 19.91  ? 1546 PHE A CB  1 
ATOM   4065  C CG  . PHE A  1 527 ? 28.147  26.199  31.544  1.00 21.07  ? 1546 PHE A CG  1 
ATOM   4066  C CD1 . PHE A  1 527 ? 27.732  27.363  32.187  1.00 21.98  ? 1546 PHE A CD1 1 
ATOM   4067  C CD2 . PHE A  1 527 ? 27.320  25.076  31.589  1.00 21.41  ? 1546 PHE A CD2 1 
ATOM   4068  C CE1 . PHE A  1 527 ? 26.511  27.408  32.873  1.00 21.53  ? 1546 PHE A CE1 1 
ATOM   4069  C CE2 . PHE A  1 527 ? 26.103  25.107  32.267  1.00 22.47  ? 1546 PHE A CE2 1 
ATOM   4070  C CZ  . PHE A  1 527 ? 25.698  26.278  32.913  1.00 22.17  ? 1546 PHE A CZ  1 
ATOM   4071  N N   . TRP A  1 528 ? 30.381  23.683  32.437  1.00 17.73  ? 1547 TRP A N   1 
ATOM   4072  C CA  . TRP A  1 528 ? 30.062  22.575  33.329  1.00 19.22  ? 1547 TRP A CA  1 
ATOM   4073  C C   . TRP A  1 528 ? 31.075  22.365  34.446  1.00 20.45  ? 1547 TRP A C   1 
ATOM   4074  O O   . TRP A  1 528 ? 30.694  22.089  35.588  1.00 19.83  ? 1547 TRP A O   1 
ATOM   4075  C CB  . TRP A  1 528 ? 29.857  21.283  32.525  1.00 16.49  ? 1547 TRP A CB  1 
ATOM   4076  C CG  . TRP A  1 528 ? 28.589  21.322  31.720  1.00 16.31  ? 1547 TRP A CG  1 
ATOM   4077  C CD1 . TRP A  1 528 ? 28.473  21.524  30.375  1.00 17.55  ? 1547 TRP A CD1 1 
ATOM   4078  C CD2 . TRP A  1 528 ? 27.250  21.237  32.227  1.00 15.71  ? 1547 TRP A CD2 1 
ATOM   4079  N NE1 . TRP A  1 528 ? 27.145  21.574  30.014  1.00 17.34  ? 1547 TRP A NE1 1 
ATOM   4080  C CE2 . TRP A  1 528 ? 26.376  21.402  31.134  1.00 14.88  ? 1547 TRP A CE2 1 
ATOM   4081  C CE3 . TRP A  1 528 ? 26.706  21.041  33.504  1.00 15.61  ? 1547 TRP A CE3 1 
ATOM   4082  C CZ2 . TRP A  1 528 ? 24.982  21.378  31.277  1.00 16.15  ? 1547 TRP A CZ2 1 
ATOM   4083  C CZ3 . TRP A  1 528 ? 25.321  21.017  33.646  1.00 14.49  ? 1547 TRP A CZ3 1 
ATOM   4084  C CH2 . TRP A  1 528 ? 24.477  21.186  32.537  1.00 15.28  ? 1547 TRP A CH2 1 
ATOM   4085  N N   . THR A  1 529 ? 32.359  22.518  34.136  1.00 20.50  ? 1548 THR A N   1 
ATOM   4086  C CA  . THR A  1 529 ? 33.391  22.345  35.147  1.00 22.85  ? 1548 THR A CA  1 
ATOM   4087  C C   . THR A  1 529 ? 33.218  23.373  36.264  1.00 23.76  ? 1548 THR A C   1 
ATOM   4088  O O   . THR A  1 529 ? 33.375  23.053  37.442  1.00 21.98  ? 1548 THR A O   1 
ATOM   4089  C CB  . THR A  1 529 ? 34.807  22.485  34.537  1.00 24.96  ? 1548 THR A CB  1 
ATOM   4090  O OG1 . THR A  1 529 ? 34.994  21.480  33.531  1.00 26.03  ? 1548 THR A OG1 1 
ATOM   4091  C CG2 . THR A  1 529 ? 35.876  22.317  35.615  1.00 25.17  ? 1548 THR A CG2 1 
ATOM   4092  N N   . ASN A  1 530 ? 32.895  24.611  35.900  1.00 25.08  ? 1549 ASN A N   1 
ATOM   4093  C CA  . ASN A  1 530 ? 32.704  25.646  36.909  1.00 25.17  ? 1549 ASN A CA  1 
ATOM   4094  C C   . ASN A  1 530 ? 31.372  25.463  37.634  1.00 25.60  ? 1549 ASN A C   1 
ATOM   4095  O O   . ASN A  1 530 ? 31.271  25.710  38.837  1.00 26.00  ? 1549 ASN A O   1 
ATOM   4096  C CB  . ASN A  1 530 ? 32.765  27.037  36.272  1.00 26.04  ? 1549 ASN A CB  1 
ATOM   4097  C CG  . ASN A  1 530 ? 34.100  27.312  35.605  1.00 28.92  ? 1549 ASN A CG  1 
ATOM   4098  O OD1 . ASN A  1 530 ? 35.158  27.008  36.158  1.00 28.19  ? 1549 ASN A OD1 1 
ATOM   4099  N ND2 . ASN A  1 530 ? 34.057  27.895  34.414  1.00 30.55  ? 1549 ASN A ND2 1 
ATOM   4100  N N   . LEU A  1 531 ? 30.353  25.019  36.908  1.00 25.16  ? 1550 LEU A N   1 
ATOM   4101  C CA  . LEU A  1 531 ? 29.042  24.818  37.518  1.00 27.38  ? 1550 LEU A CA  1 
ATOM   4102  C C   . LEU A  1 531 ? 29.078  23.737  38.595  1.00 29.64  ? 1550 LEU A C   1 
ATOM   4103  O O   . LEU A  1 531 ? 28.445  23.872  39.641  1.00 29.09  ? 1550 LEU A O   1 
ATOM   4104  C CB  . LEU A  1 531 ? 28.007  24.438  36.458  1.00 26.48  ? 1550 LEU A CB  1 
ATOM   4105  C CG  . LEU A  1 531 ? 26.574  24.312  36.982  1.00 27.73  ? 1550 LEU A CG  1 
ATOM   4106  C CD1 . LEU A  1 531 ? 26.122  25.660  37.520  1.00 28.97  ? 1550 LEU A CD1 1 
ATOM   4107  C CD2 . LEU A  1 531 ? 25.640  23.845  35.871  1.00 27.11  ? 1550 LEU A CD2 1 
ATOM   4108  N N   . PHE A  1 532 ? 29.832  22.673  38.339  1.00 31.60  ? 1551 PHE A N   1 
ATOM   4109  C CA  . PHE A  1 532 ? 29.941  21.558  39.275  1.00 36.40  ? 1551 PHE A CA  1 
ATOM   4110  C C   . PHE A  1 532 ? 30.971  21.784  40.377  1.00 39.32  ? 1551 PHE A C   1 
ATOM   4111  O O   . PHE A  1 532 ? 30.911  21.150  41.430  1.00 39.66  ? 1551 PHE A O   1 
ATOM   4112  C CB  . PHE A  1 532 ? 30.298  20.276  38.516  1.00 35.77  ? 1551 PHE A CB  1 
ATOM   4113  C CG  . PHE A  1 532 ? 29.182  19.734  37.668  1.00 35.41  ? 1551 PHE A CG  1 
ATOM   4114  C CD1 . PHE A  1 532 ? 29.459  19.110  36.455  1.00 35.17  ? 1551 PHE A CD1 1 
ATOM   4115  C CD2 . PHE A  1 532 ? 27.859  19.818  38.090  1.00 36.82  ? 1551 PHE A CD2 1 
ATOM   4116  C CE1 . PHE A  1 532 ? 28.435  18.576  35.673  1.00 34.33  ? 1551 PHE A CE1 1 
ATOM   4117  C CE2 . PHE A  1 532 ? 26.827  19.287  37.317  1.00 36.32  ? 1551 PHE A CE2 1 
ATOM   4118  C CZ  . PHE A  1 532 ? 27.117  18.664  36.106  1.00 35.31  ? 1551 PHE A CZ  1 
ATOM   4119  N N   . ALA A  1 533 ? 31.915  22.686  40.134  1.00 43.03  ? 1552 ALA A N   1 
ATOM   4120  C CA  . ALA A  1 533 ? 32.967  22.970  41.104  1.00 47.35  ? 1552 ALA A CA  1 
ATOM   4121  C C   . ALA A  1 533 ? 32.532  23.886  42.242  1.00 50.52  ? 1552 ALA A C   1 
ATOM   4122  O O   . ALA A  1 533 ? 33.187  23.930  43.284  1.00 51.97  ? 1552 ALA A O   1 
ATOM   4123  C CB  . ALA A  1 533 ? 34.170  23.572  40.396  1.00 47.30  ? 1552 ALA A CB  1 
ATOM   4124  N N   . LYS A  1 534 ? 31.436  24.614  42.044  1.00 53.21  ? 1553 LYS A N   1 
ATOM   4125  C CA  . LYS A  1 534 ? 30.934  25.537  43.059  1.00 56.65  ? 1553 LYS A CA  1 
ATOM   4126  C C   . LYS A  1 534 ? 31.198  25.067  44.492  1.00 57.74  ? 1553 LYS A C   1 
ATOM   4127  O O   . LYS A  1 534 ? 30.462  24.243  45.038  1.00 58.93  ? 1553 LYS A O   1 
ATOM   4128  C CB  . LYS A  1 534 ? 29.434  25.770  42.866  1.00 58.23  ? 1553 LYS A CB  1 
ATOM   4129  C CG  . LYS A  1 534 ? 29.079  26.491  41.580  1.00 60.65  ? 1553 LYS A CG  1 
ATOM   4130  C CD  . LYS A  1 534 ? 27.607  26.868  41.562  1.00 63.02  ? 1553 LYS A CD  1 
ATOM   4131  C CE  . LYS A  1 534 ? 27.247  27.651  40.309  1.00 64.54  ? 1553 LYS A CE  1 
ATOM   4132  N NZ  . LYS A  1 534 ? 25.839  28.137  40.350  1.00 65.13  ? 1553 LYS A NZ  1 
ATOM   4133  N N   . SER B  1 4   ? 39.853  -63.568 65.833  1.00 46.54  ? 2022 SER B N   1 
ATOM   4134  C CA  . SER B  1 4   ? 39.585  -62.153 65.607  1.00 45.32  ? 2022 SER B CA  1 
ATOM   4135  C C   . SER B  1 4   ? 39.509  -61.842 64.114  1.00 43.44  ? 2022 SER B C   1 
ATOM   4136  O O   . SER B  1 4   ? 40.324  -62.323 63.325  1.00 43.77  ? 2022 SER B O   1 
ATOM   4137  C CB  . SER B  1 4   ? 40.675  -61.302 66.260  1.00 46.92  ? 2022 SER B CB  1 
ATOM   4138  O OG  . SER B  1 4   ? 41.964  -61.756 65.881  1.00 50.23  ? 2022 SER B OG  1 
ATOM   4139  N N   . PRO B  1 5   ? 38.526  -61.026 63.709  1.00 41.30  ? 2023 PRO B N   1 
ATOM   4140  C CA  . PRO B  1 5   ? 38.362  -60.666 62.298  1.00 38.66  ? 2023 PRO B CA  1 
ATOM   4141  C C   . PRO B  1 5   ? 39.616  -60.029 61.707  1.00 35.75  ? 2023 PRO B C   1 
ATOM   4142  O O   . PRO B  1 5   ? 40.432  -59.446 62.424  1.00 34.79  ? 2023 PRO B O   1 
ATOM   4143  C CB  . PRO B  1 5   ? 37.171  -59.712 62.325  1.00 39.01  ? 2023 PRO B CB  1 
ATOM   4144  C CG  . PRO B  1 5   ? 37.290  -59.069 63.673  1.00 39.90  ? 2023 PRO B CG  1 
ATOM   4145  C CD  . PRO B  1 5   ? 37.605  -60.249 64.556  1.00 40.48  ? 2023 PRO B CD  1 
ATOM   4146  N N   . PRO B  1 6   ? 39.787  -60.138 60.383  1.00 33.02  ? 2024 PRO B N   1 
ATOM   4147  C CA  . PRO B  1 6   ? 40.951  -59.568 59.705  1.00 31.45  ? 2024 PRO B CA  1 
ATOM   4148  C C   . PRO B  1 6   ? 40.886  -58.047 59.577  1.00 30.18  ? 2024 PRO B C   1 
ATOM   4149  O O   . PRO B  1 6   ? 39.853  -57.484 59.209  1.00 28.88  ? 2024 PRO B O   1 
ATOM   4150  C CB  . PRO B  1 6   ? 40.928  -60.272 58.353  1.00 31.10  ? 2024 PRO B CB  1 
ATOM   4151  C CG  . PRO B  1 6   ? 39.461  -60.404 58.092  1.00 31.57  ? 2024 PRO B CG  1 
ATOM   4152  C CD  . PRO B  1 6   ? 38.933  -60.873 59.433  1.00 31.99  ? 2024 PRO B CD  1 
ATOM   4153  N N   . VAL B  1 7   ? 42.003  -57.395 59.890  1.00 29.87  ? 2025 VAL B N   1 
ATOM   4154  C CA  . VAL B  1 7   ? 42.123  -55.942 59.816  1.00 29.41  ? 2025 VAL B CA  1 
ATOM   4155  C C   . VAL B  1 7   ? 43.332  -55.637 58.941  1.00 29.00  ? 2025 VAL B C   1 
ATOM   4156  O O   . VAL B  1 7   ? 44.445  -56.077 59.229  1.00 30.44  ? 2025 VAL B O   1 
ATOM   4157  C CB  . VAL B  1 7   ? 42.349  -55.317 61.213  1.00 30.20  ? 2025 VAL B CB  1 
ATOM   4158  C CG1 . VAL B  1 7   ? 42.537  -53.814 61.090  1.00 28.26  ? 2025 VAL B CG1 1 
ATOM   4159  C CG2 . VAL B  1 7   ? 41.171  -55.630 62.120  1.00 29.91  ? 2025 VAL B CG2 1 
ATOM   4160  N N   . VAL B  1 8   ? 43.110  -54.882 57.874  1.00 26.99  ? 2026 VAL B N   1 
ATOM   4161  C CA  . VAL B  1 8   ? 44.179  -54.548 56.947  1.00 24.86  ? 2026 VAL B CA  1 
ATOM   4162  C C   . VAL B  1 8   ? 44.453  -53.053 56.857  1.00 25.44  ? 2026 VAL B C   1 
ATOM   4163  O O   . VAL B  1 8   ? 43.532  -52.236 56.841  1.00 25.00  ? 2026 VAL B O   1 
ATOM   4164  C CB  . VAL B  1 8   ? 43.839  -55.072 55.533  1.00 23.98  ? 2026 VAL B CB  1 
ATOM   4165  C CG1 . VAL B  1 8   ? 44.861  -54.572 54.526  1.00 25.40  ? 2026 VAL B CG1 1 
ATOM   4166  C CG2 . VAL B  1 8   ? 43.800  -56.594 55.543  1.00 23.06  ? 2026 VAL B CG2 1 
ATOM   4167  N N   . ASP B  1 9   ? 45.730  -52.705 56.790  1.00 26.28  ? 2027 ASP B N   1 
ATOM   4168  C CA  . ASP B  1 9   ? 46.132  -51.314 56.664  1.00 28.22  ? 2027 ASP B CA  1 
ATOM   4169  C C   . ASP B  1 9   ? 46.256  -50.942 55.190  1.00 27.51  ? 2027 ASP B C   1 
ATOM   4170  O O   . ASP B  1 9   ? 47.107  -51.470 54.478  1.00 29.54  ? 2027 ASP B O   1 
ATOM   4171  C CB  . ASP B  1 9   ? 47.471  -51.096 57.366  1.00 31.98  ? 2027 ASP B CB  1 
ATOM   4172  C CG  . ASP B  1 9   ? 47.308  -50.707 58.819  1.00 36.24  ? 2027 ASP B CG  1 
ATOM   4173  O OD1 . ASP B  1 9   ? 47.222  -49.490 59.096  1.00 39.82  ? 2027 ASP B OD1 1 
ATOM   4174  O OD2 . ASP B  1 9   ? 47.251  -51.613 59.680  1.00 40.04  ? 2027 ASP B OD2 1 
ATOM   4175  N N   . THR B  1 10  ? 45.387  -50.053 54.724  1.00 25.90  ? 2028 THR B N   1 
ATOM   4176  C CA  . THR B  1 10  ? 45.447  -49.612 53.337  1.00 22.87  ? 2028 THR B CA  1 
ATOM   4177  C C   . THR B  1 10  ? 46.029  -48.204 53.341  1.00 23.35  ? 2028 THR B C   1 
ATOM   4178  O O   . THR B  1 10  ? 46.231  -47.616 54.406  1.00 21.00  ? 2028 THR B O   1 
ATOM   4179  C CB  . THR B  1 10  ? 44.052  -49.585 52.675  1.00 22.47  ? 2028 THR B CB  1 
ATOM   4180  O OG1 . THR B  1 10  ? 43.307  -48.452 53.141  1.00 20.18  ? 2028 THR B OG1 1 
ATOM   4181  C CG2 . THR B  1 10  ? 43.290  -50.861 53.003  1.00 20.62  ? 2028 THR B CG2 1 
ATOM   4182  N N   . VAL B  1 11  ? 46.306  -47.665 52.160  1.00 23.74  ? 2029 VAL B N   1 
ATOM   4183  C CA  . VAL B  1 11  ? 46.873  -46.326 52.073  1.00 24.82  ? 2029 VAL B CA  1 
ATOM   4184  C C   . VAL B  1 11  ? 46.018  -45.292 52.797  1.00 23.96  ? 2029 VAL B C   1 
ATOM   4185  O O   . VAL B  1 11  ? 46.538  -44.470 53.546  1.00 23.13  ? 2029 VAL B O   1 
ATOM   4186  C CB  . VAL B  1 11  ? 47.046  -45.885 50.602  1.00 26.54  ? 2029 VAL B CB  1 
ATOM   4187  C CG1 . VAL B  1 11  ? 47.550  -44.445 50.541  1.00 27.67  ? 2029 VAL B CG1 1 
ATOM   4188  C CG2 . VAL B  1 11  ? 48.018  -46.819 49.896  1.00 24.68  ? 2029 VAL B CG2 1 
ATOM   4189  N N   . HIS B  1 12  ? 44.707  -45.351 52.589  1.00 22.97  ? 2030 HIS B N   1 
ATOM   4190  C CA  . HIS B  1 12  ? 43.797  -44.391 53.202  1.00 23.32  ? 2030 HIS B CA  1 
ATOM   4191  C C   . HIS B  1 12  ? 43.304  -44.718 54.612  1.00 22.41  ? 2030 HIS B C   1 
ATOM   4192  O O   . HIS B  1 12  ? 42.592  -43.919 55.216  1.00 23.50  ? 2030 HIS B O   1 
ATOM   4193  C CB  . HIS B  1 12  ? 42.598  -44.154 52.277  1.00 24.52  ? 2030 HIS B CB  1 
ATOM   4194  C CG  . HIS B  1 12  ? 42.977  -43.594 50.940  1.00 26.30  ? 2030 HIS B CG  1 
ATOM   4195  N ND1 . HIS B  1 12  ? 43.927  -42.606 50.793  1.00 29.23  ? 2030 HIS B ND1 1 
ATOM   4196  C CD2 . HIS B  1 12  ? 42.535  -43.880 49.693  1.00 27.39  ? 2030 HIS B CD2 1 
ATOM   4197  C CE1 . HIS B  1 12  ? 44.057  -42.309 49.511  1.00 28.11  ? 2030 HIS B CE1 1 
ATOM   4198  N NE2 . HIS B  1 12  ? 43.224  -43.068 48.823  1.00 28.84  ? 2030 HIS B NE2 1 
ATOM   4199  N N   . GLY B  1 13  ? 43.679  -45.880 55.139  1.00 21.47  ? 2031 GLY B N   1 
ATOM   4200  C CA  . GLY B  1 13  ? 43.245  -46.239 56.481  1.00 21.85  ? 2031 GLY B CA  1 
ATOM   4201  C C   . GLY B  1 13  ? 43.012  -47.726 56.659  1.00 23.79  ? 2031 GLY B C   1 
ATOM   4202  O O   . GLY B  1 13  ? 43.059  -48.489 55.691  1.00 21.82  ? 2031 GLY B O   1 
ATOM   4203  N N   . LYS B  1 14  ? 42.754  -48.137 57.899  1.00 23.73  ? 2032 LYS B N   1 
ATOM   4204  C CA  . LYS B  1 14  ? 42.522  -49.544 58.220  1.00 23.85  ? 2032 LYS B CA  1 
ATOM   4205  C C   . LYS B  1 14  ? 41.109  -49.991 57.869  1.00 23.06  ? 2032 LYS B C   1 
ATOM   4206  O O   . LYS B  1 14  ? 40.157  -49.222 57.979  1.00 23.34  ? 2032 LYS B O   1 
ATOM   4207  C CB  . LYS B  1 14  ? 42.759  -49.789 59.714  1.00 26.15  ? 2032 LYS B CB  1 
ATOM   4208  C CG  . LYS B  1 14  ? 44.118  -49.348 60.224  1.00 30.41  ? 2032 LYS B CG  1 
ATOM   4209  C CD  . LYS B  1 14  ? 44.224  -49.565 61.732  1.00 34.96  ? 2032 LYS B CD  1 
ATOM   4210  C CE  . LYS B  1 14  ? 45.570  -49.108 62.276  1.00 37.68  ? 2032 LYS B CE  1 
ATOM   4211  N NZ  . LYS B  1 14  ? 46.708  -49.883 61.704  1.00 40.20  ? 2032 LYS B NZ  1 
ATOM   4212  N N   . VAL B  1 15  ? 40.975  -51.239 57.439  1.00 22.62  ? 2033 VAL B N   1 
ATOM   4213  C CA  . VAL B  1 15  ? 39.670  -51.783 57.104  1.00 22.57  ? 2033 VAL B CA  1 
ATOM   4214  C C   . VAL B  1 15  ? 39.501  -53.123 57.802  1.00 23.95  ? 2033 VAL B C   1 
ATOM   4215  O O   . VAL B  1 15  ? 40.439  -53.916 57.886  1.00 23.75  ? 2033 VAL B O   1 
ATOM   4216  C CB  . VAL B  1 15  ? 39.493  -51.981 55.580  1.00 23.57  ? 2033 VAL B CB  1 
ATOM   4217  C CG1 . VAL B  1 15  ? 39.744  -50.664 54.858  1.00 24.68  ? 2033 VAL B CG1 1 
ATOM   4218  C CG2 . VAL B  1 15  ? 40.429  -53.067 55.074  1.00 22.56  ? 2033 VAL B CG2 1 
ATOM   4219  N N   . LEU B  1 16  ? 38.296  -53.361 58.307  1.00 24.75  ? 2034 LEU B N   1 
ATOM   4220  C CA  . LEU B  1 16  ? 37.973  -54.590 59.012  1.00 25.53  ? 2034 LEU B CA  1 
ATOM   4221  C C   . LEU B  1 16  ? 37.091  -55.460 58.127  1.00 23.79  ? 2034 LEU B C   1 
ATOM   4222  O O   . LEU B  1 16  ? 36.059  -55.007 57.635  1.00 24.41  ? 2034 LEU B O   1 
ATOM   4223  C CB  . LEU B  1 16  ? 37.249  -54.249 60.324  1.00 27.53  ? 2034 LEU B CB  1 
ATOM   4224  C CG  . LEU B  1 16  ? 36.777  -55.356 61.274  1.00 29.69  ? 2034 LEU B CG  1 
ATOM   4225  C CD1 . LEU B  1 16  ? 35.518  -56.012 60.736  1.00 32.32  ? 2034 LEU B CD1 1 
ATOM   4226  C CD2 . LEU B  1 16  ? 37.888  -56.366 61.473  1.00 32.42  ? 2034 LEU B CD2 1 
ATOM   4227  N N   . GLY B  1 17  ? 37.504  -56.706 57.921  1.00 23.03  ? 2035 GLY B N   1 
ATOM   4228  C CA  . GLY B  1 17  ? 36.726  -57.605 57.091  1.00 22.47  ? 2035 GLY B CA  1 
ATOM   4229  C C   . GLY B  1 17  ? 36.207  -58.778 57.897  1.00 23.92  ? 2035 GLY B C   1 
ATOM   4230  O O   . GLY B  1 17  ? 36.040  -58.678 59.115  1.00 23.29  ? 2035 GLY B O   1 
ATOM   4231  N N   . LYS B  1 18  ? 35.951  -59.894 57.226  1.00 23.44  ? 2036 LYS B N   1 
ATOM   4232  C CA  . LYS B  1 18  ? 35.455  -61.082 57.907  1.00 24.99  ? 2036 LYS B CA  1 
ATOM   4233  C C   . LYS B  1 18  ? 36.007  -62.360 57.287  1.00 25.47  ? 2036 LYS B C   1 
ATOM   4234  O O   . LYS B  1 18  ? 36.278  -62.419 56.084  1.00 24.02  ? 2036 LYS B O   1 
ATOM   4235  C CB  . LYS B  1 18  ? 33.924  -61.119 57.863  1.00 27.47  ? 2036 LYS B CB  1 
ATOM   4236  C CG  . LYS B  1 18  ? 33.351  -61.267 56.466  1.00 32.98  ? 2036 LYS B CG  1 
ATOM   4237  C CD  . LYS B  1 18  ? 31.830  -61.279 56.475  1.00 36.77  ? 2036 LYS B CD  1 
ATOM   4238  C CE  . LYS B  1 18  ? 31.276  -61.311 55.054  1.00 39.55  ? 2036 LYS B CE  1 
ATOM   4239  N NZ  . LYS B  1 18  ? 29.787  -61.235 55.026  1.00 42.56  ? 2036 LYS B NZ  1 
ATOM   4240  N N   . PHE B  1 19  ? 36.177  -63.379 58.121  1.00 24.83  ? 2037 PHE B N   1 
ATOM   4241  C CA  . PHE B  1 19  ? 36.673  -64.674 57.670  1.00 25.14  ? 2037 PHE B CA  1 
ATOM   4242  C C   . PHE B  1 19  ? 35.503  -65.575 57.298  1.00 27.21  ? 2037 PHE B C   1 
ATOM   4243  O O   . PHE B  1 19  ? 34.496  -65.622 58.003  1.00 26.74  ? 2037 PHE B O   1 
ATOM   4244  C CB  . PHE B  1 19  ? 37.487  -65.355 58.776  1.00 25.79  ? 2037 PHE B CB  1 
ATOM   4245  C CG  . PHE B  1 19  ? 38.876  -64.808 58.942  1.00 26.81  ? 2037 PHE B CG  1 
ATOM   4246  C CD1 . PHE B  1 19  ? 39.362  -64.489 60.205  1.00 26.36  ? 2037 PHE B CD1 1 
ATOM   4247  C CD2 . PHE B  1 19  ? 39.712  -64.647 57.843  1.00 25.66  ? 2037 PHE B CD2 1 
ATOM   4248  C CE1 . PHE B  1 19  ? 40.659  -64.017 60.371  1.00 27.58  ? 2037 PHE B CE1 1 
ATOM   4249  C CE2 . PHE B  1 19  ? 41.010  -64.177 57.996  1.00 26.27  ? 2037 PHE B CE2 1 
ATOM   4250  C CZ  . PHE B  1 19  ? 41.487  -63.861 59.262  1.00 28.15  ? 2037 PHE B CZ  1 
ATOM   4251  N N   . VAL B  1 20  ? 35.635  -66.281 56.181  1.00 27.91  ? 2038 VAL B N   1 
ATOM   4252  C CA  . VAL B  1 20  ? 34.605  -67.210 55.737  1.00 29.09  ? 2038 VAL B CA  1 
ATOM   4253  C C   . VAL B  1 20  ? 35.314  -68.465 55.253  1.00 31.10  ? 2038 VAL B C   1 
ATOM   4254  O O   . VAL B  1 20  ? 36.204  -68.395 54.402  1.00 31.06  ? 2038 VAL B O   1 
ATOM   4255  C CB  . VAL B  1 20  ? 33.756  -66.635 54.583  1.00 27.58  ? 2038 VAL B CB  1 
ATOM   4256  C CG1 . VAL B  1 20  ? 32.748  -67.676 54.118  1.00 27.33  ? 2038 VAL B CG1 1 
ATOM   4257  C CG2 . VAL B  1 20  ? 33.030  -65.379 55.043  1.00 27.09  ? 2038 VAL B CG2 1 
ATOM   4258  N N   . SER B  1 21  ? 34.930  -69.608 55.808  1.00 32.63  ? 2039 SER B N   1 
ATOM   4259  C CA  . SER B  1 21  ? 35.541  -70.875 55.433  1.00 34.82  ? 2039 SER B CA  1 
ATOM   4260  C C   . SER B  1 21  ? 34.750  -71.601 54.357  1.00 35.12  ? 2039 SER B C   1 
ATOM   4261  O O   . SER B  1 21  ? 33.521  -71.569 54.346  1.00 36.35  ? 2039 SER B O   1 
ATOM   4262  C CB  . SER B  1 21  ? 35.671  -71.779 56.658  1.00 35.58  ? 2039 SER B CB  1 
ATOM   4263  O OG  . SER B  1 21  ? 36.591  -71.240 57.587  1.00 38.39  ? 2039 SER B OG  1 
ATOM   4264  N N   . LEU B  1 22  ? 35.466  -72.250 53.448  1.00 35.50  ? 2040 LEU B N   1 
ATOM   4265  C CA  . LEU B  1 22  ? 34.829  -73.005 52.379  1.00 35.84  ? 2040 LEU B CA  1 
ATOM   4266  C C   . LEU B  1 22  ? 35.199  -74.477 52.537  1.00 36.01  ? 2040 LEU B C   1 
ATOM   4267  O O   . LEU B  1 22  ? 36.360  -74.810 52.782  1.00 34.03  ? 2040 LEU B O   1 
ATOM   4268  C CB  . LEU B  1 22  ? 35.292  -72.495 51.010  1.00 34.62  ? 2040 LEU B CB  1 
ATOM   4269  C CG  . LEU B  1 22  ? 34.617  -73.135 49.791  1.00 34.38  ? 2040 LEU B CG  1 
ATOM   4270  C CD1 . LEU B  1 22  ? 33.111  -72.919 49.861  1.00 34.03  ? 2040 LEU B CD1 1 
ATOM   4271  C CD2 . LEU B  1 22  ? 35.179  -72.529 48.510  1.00 34.83  ? 2040 LEU B CD2 1 
ATOM   4272  N N   . GLU B  1 23  ? 34.205  -75.352 52.407  1.00 38.22  ? 2041 GLU B N   1 
ATOM   4273  C CA  . GLU B  1 23  ? 34.430  -76.786 52.532  1.00 39.79  ? 2041 GLU B CA  1 
ATOM   4274  C C   . GLU B  1 23  ? 35.612  -77.215 51.670  1.00 38.68  ? 2041 GLU B C   1 
ATOM   4275  O O   . GLU B  1 23  ? 35.667  -76.899 50.478  1.00 36.96  ? 2041 GLU B O   1 
ATOM   4276  C CB  . GLU B  1 23  ? 33.188  -77.570 52.093  1.00 44.52  ? 2041 GLU B CB  1 
ATOM   4277  C CG  . GLU B  1 23  ? 31.925  -77.330 52.917  1.00 51.12  ? 2041 GLU B CG  1 
ATOM   4278  C CD  . GLU B  1 23  ? 31.371  -75.919 52.773  1.00 54.21  ? 2041 GLU B CD  1 
ATOM   4279  O OE1 . GLU B  1 23  ? 31.329  -75.408 51.631  1.00 55.13  ? 2041 GLU B OE1 1 
ATOM   4280  O OE2 . GLU B  1 23  ? 30.962  -75.329 53.801  1.00 56.88  ? 2041 GLU B OE2 1 
ATOM   4281  N N   . GLY B  1 24  ? 36.553  -77.930 52.282  1.00 37.45  ? 2042 GLY B N   1 
ATOM   4282  C CA  . GLY B  1 24  ? 37.713  -78.411 51.555  1.00 36.78  ? 2042 GLY B CA  1 
ATOM   4283  C C   . GLY B  1 24  ? 38.976  -77.583 51.700  1.00 36.59  ? 2042 GLY B C   1 
ATOM   4284  O O   . GLY B  1 24  ? 40.042  -77.997 51.245  1.00 36.36  ? 2042 GLY B O   1 
ATOM   4285  N N   . PHE B  1 25  ? 38.872  -76.416 52.331  1.00 35.51  ? 2043 PHE B N   1 
ATOM   4286  C CA  . PHE B  1 25  ? 40.038  -75.557 52.498  1.00 34.56  ? 2043 PHE B CA  1 
ATOM   4287  C C   . PHE B  1 25  ? 40.226  -75.105 53.933  1.00 34.72  ? 2043 PHE B C   1 
ATOM   4288  O O   . PHE B  1 25  ? 39.358  -74.462 54.517  1.00 35.55  ? 2043 PHE B O   1 
ATOM   4289  C CB  . PHE B  1 25  ? 39.929  -74.352 51.565  1.00 32.36  ? 2043 PHE B CB  1 
ATOM   4290  C CG  . PHE B  1 25  ? 39.735  -74.732 50.126  1.00 29.15  ? 2043 PHE B CG  1 
ATOM   4291  C CD1 . PHE B  1 25  ? 38.482  -75.110 49.658  1.00 29.48  ? 2043 PHE B CD1 1 
ATOM   4292  C CD2 . PHE B  1 25  ? 40.816  -74.778 49.256  1.00 27.50  ? 2043 PHE B CD2 1 
ATOM   4293  C CE1 . PHE B  1 25  ? 38.309  -75.531 48.345  1.00 29.35  ? 2043 PHE B CE1 1 
ATOM   4294  C CE2 . PHE B  1 25  ? 40.654  -75.198 47.940  1.00 27.24  ? 2043 PHE B CE2 1 
ATOM   4295  C CZ  . PHE B  1 25  ? 39.400  -75.576 47.484  1.00 29.17  ? 2043 PHE B CZ  1 
ATOM   4296  N N   . ALA B  1 26  ? 41.379  -75.452 54.492  1.00 35.73  ? 2044 ALA B N   1 
ATOM   4297  C CA  . ALA B  1 26  ? 41.710  -75.119 55.871  1.00 36.98  ? 2044 ALA B CA  1 
ATOM   4298  C C   . ALA B  1 26  ? 41.809  -73.619 56.130  1.00 36.25  ? 2044 ALA B C   1 
ATOM   4299  O O   . ALA B  1 26  ? 41.234  -73.110 57.092  1.00 37.33  ? 2044 ALA B O   1 
ATOM   4300  C CB  . ALA B  1 26  ? 43.019  -75.802 56.262  1.00 36.50  ? 2044 ALA B CB  1 
ATOM   4301  N N   . GLN B  1 27  ? 42.538  -72.914 55.272  1.00 35.71  ? 2045 GLN B N   1 
ATOM   4302  C CA  . GLN B  1 27  ? 42.716  -71.476 55.433  1.00 35.05  ? 2045 GLN B CA  1 
ATOM   4303  C C   . GLN B  1 27  ? 41.457  -70.690 55.085  1.00 33.20  ? 2045 GLN B C   1 
ATOM   4304  O O   . GLN B  1 27  ? 40.988  -70.722 53.949  1.00 33.55  ? 2045 GLN B O   1 
ATOM   4305  C CB  . GLN B  1 27  ? 43.881  -70.996 54.564  1.00 36.38  ? 2045 GLN B CB  1 
ATOM   4306  C CG  . GLN B  1 27  ? 44.104  -69.483 54.562  1.00 40.79  ? 2045 GLN B CG  1 
ATOM   4307  C CD  . GLN B  1 27  ? 44.561  -68.943 55.904  1.00 42.11  ? 2045 GLN B CD  1 
ATOM   4308  O OE1 . GLN B  1 27  ? 45.566  -69.389 56.453  1.00 42.90  ? 2045 GLN B OE1 1 
ATOM   4309  N NE2 . GLN B  1 27  ? 43.828  -67.968 56.433  1.00 44.51  ? 2045 GLN B NE2 1 
ATOM   4310  N N   . PRO B  1 28  ? 40.888  -69.980 56.070  1.00 32.31  ? 2046 PRO B N   1 
ATOM   4311  C CA  . PRO B  1 28  ? 39.677  -69.180 55.849  1.00 31.48  ? 2046 PRO B CA  1 
ATOM   4312  C C   . PRO B  1 28  ? 39.953  -68.043 54.863  1.00 28.77  ? 2046 PRO B C   1 
ATOM   4313  O O   . PRO B  1 28  ? 41.048  -67.487 54.837  1.00 29.55  ? 2046 PRO B O   1 
ATOM   4314  C CB  . PRO B  1 28  ? 39.356  -68.640 57.243  1.00 32.31  ? 2046 PRO B CB  1 
ATOM   4315  C CG  . PRO B  1 28  ? 39.949  -69.665 58.160  1.00 32.97  ? 2046 PRO B CG  1 
ATOM   4316  C CD  . PRO B  1 28  ? 41.264  -69.974 57.493  1.00 32.44  ? 2046 PRO B CD  1 
ATOM   4317  N N   . VAL B  1 29  ? 38.958  -67.703 54.056  1.00 27.08  ? 2047 VAL B N   1 
ATOM   4318  C CA  . VAL B  1 29  ? 39.105  -66.619 53.094  1.00 25.48  ? 2047 VAL B CA  1 
ATOM   4319  C C   . VAL B  1 29  ? 38.716  -65.300 53.761  1.00 24.53  ? 2047 VAL B C   1 
ATOM   4320  O O   . VAL B  1 29  ? 37.656  -65.206 54.383  1.00 24.47  ? 2047 VAL B O   1 
ATOM   4321  C CB  . VAL B  1 29  ? 38.203  -66.852 51.864  1.00 24.71  ? 2047 VAL B CB  1 
ATOM   4322  C CG1 . VAL B  1 29  ? 38.192  -65.618 50.975  1.00 23.39  ? 2047 VAL B CG1 1 
ATOM   4323  C CG2 . VAL B  1 29  ? 38.698  -68.066 51.088  1.00 22.77  ? 2047 VAL B CG2 1 
ATOM   4324  N N   . ALA B  1 30  ? 39.577  -64.293 53.648  1.00 22.00  ? 2048 ALA B N   1 
ATOM   4325  C CA  . ALA B  1 30  ? 39.288  -62.988 54.231  1.00 19.84  ? 2048 ALA B CA  1 
ATOM   4326  C C   . ALA B  1 30  ? 38.501  -62.186 53.206  1.00 19.79  ? 2048 ALA B C   1 
ATOM   4327  O O   . ALA B  1 30  ? 38.951  -61.987 52.069  1.00 18.52  ? 2048 ALA B O   1 
ATOM   4328  C CB  . ALA B  1 30  ? 40.575  -62.265 54.593  1.00 20.79  ? 2048 ALA B CB  1 
ATOM   4329  N N   . ILE B  1 31  ? 37.323  -61.733 53.614  1.00 18.08  ? 2049 ILE B N   1 
ATOM   4330  C CA  . ILE B  1 31  ? 36.447  -60.976 52.743  1.00 17.51  ? 2049 ILE B CA  1 
ATOM   4331  C C   . ILE B  1 31  ? 36.249  -59.545 53.231  1.00 18.67  ? 2049 ILE B C   1 
ATOM   4332  O O   . ILE B  1 31  ? 36.017  -59.302 54.421  1.00 16.78  ? 2049 ILE B O   1 
ATOM   4333  C CB  . ILE B  1 31  ? 35.080  -61.677 52.626  1.00 17.66  ? 2049 ILE B CB  1 
ATOM   4334  C CG1 . ILE B  1 31  ? 35.286  -63.101 52.096  1.00 18.71  ? 2049 ILE B CG1 1 
ATOM   4335  C CG2 . ILE B  1 31  ? 34.159  -60.889 51.701  1.00 19.57  ? 2049 ILE B CG2 1 
ATOM   4336  C CD1 . ILE B  1 31  ? 34.002  -63.868 51.863  1.00 19.39  ? 2049 ILE B CD1 1 
ATOM   4337  N N   . PHE B  1 32  ? 36.352  -58.603 52.301  1.00 16.87  ? 2050 PHE B N   1 
ATOM   4338  C CA  . PHE B  1 32  ? 36.186  -57.189 52.608  1.00 17.44  ? 2050 PHE B CA  1 
ATOM   4339  C C   . PHE B  1 32  ? 35.170  -56.624 51.631  1.00 18.53  ? 2050 PHE B C   1 
ATOM   4340  O O   . PHE B  1 32  ? 35.397  -56.623 50.414  1.00 18.20  ? 2050 PHE B O   1 
ATOM   4341  C CB  . PHE B  1 32  ? 37.518  -56.449 52.465  1.00 16.48  ? 2050 PHE B CB  1 
ATOM   4342  C CG  . PHE B  1 32  ? 38.615  -57.013 53.320  1.00 18.75  ? 2050 PHE B CG  1 
ATOM   4343  C CD1 . PHE B  1 32  ? 39.295  -58.165 52.932  1.00 17.31  ? 2050 PHE B CD1 1 
ATOM   4344  C CD2 . PHE B  1 32  ? 38.934  -56.421 54.542  1.00 17.95  ? 2050 PHE B CD2 1 
ATOM   4345  C CE1 . PHE B  1 32  ? 40.274  -58.724 53.745  1.00 17.63  ? 2050 PHE B CE1 1 
ATOM   4346  C CE2 . PHE B  1 32  ? 39.913  -56.972 55.370  1.00 18.13  ? 2050 PHE B CE2 1 
ATOM   4347  C CZ  . PHE B  1 32  ? 40.586  -58.129 54.972  1.00 21.33  ? 2050 PHE B CZ  1 
ATOM   4348  N N   . LEU B  1 33  ? 34.049  -56.148 52.166  1.00 17.37  ? 2051 LEU B N   1 
ATOM   4349  C CA  . LEU B  1 33  ? 32.981  -55.606 51.341  1.00 16.32  ? 2051 LEU B CA  1 
ATOM   4350  C C   . LEU B  1 33  ? 32.820  -54.093 51.446  1.00 17.08  ? 2051 LEU B C   1 
ATOM   4351  O O   . LEU B  1 33  ? 32.907  -53.515 52.529  1.00 17.46  ? 2051 LEU B O   1 
ATOM   4352  C CB  . LEU B  1 33  ? 31.658  -56.274 51.713  1.00 16.19  ? 2051 LEU B CB  1 
ATOM   4353  C CG  . LEU B  1 33  ? 31.611  -57.808 51.714  1.00 17.57  ? 2051 LEU B CG  1 
ATOM   4354  C CD1 . LEU B  1 33  ? 30.234  -58.257 52.187  1.00 19.75  ? 2051 LEU B CD1 1 
ATOM   4355  C CD2 . LEU B  1 33  ? 31.898  -58.350 50.322  1.00 16.82  ? 2051 LEU B CD2 1 
ATOM   4356  N N   . GLY B  1 34  ? 32.586  -53.457 50.305  1.00 15.44  ? 2052 GLY B N   1 
ATOM   4357  C CA  . GLY B  1 34  ? 32.373  -52.024 50.283  1.00 14.95  ? 2052 GLY B CA  1 
ATOM   4358  C C   . GLY B  1 34  ? 33.546  -51.115 50.579  1.00 17.46  ? 2052 GLY B C   1 
ATOM   4359  O O   . GLY B  1 34  ? 33.392  -50.143 51.322  1.00 17.02  ? 2052 GLY B O   1 
ATOM   4360  N N   . ILE B  1 35  ? 34.718  -51.415 50.023  1.00 16.47  ? 2053 ILE B N   1 
ATOM   4361  C CA  . ILE B  1 35  ? 35.875  -50.544 50.223  1.00 16.41  ? 2053 ILE B CA  1 
ATOM   4362  C C   . ILE B  1 35  ? 35.795  -49.440 49.167  1.00 17.34  ? 2053 ILE B C   1 
ATOM   4363  O O   . ILE B  1 35  ? 35.725  -49.716 47.970  1.00 18.59  ? 2053 ILE B O   1 
ATOM   4364  C CB  . ILE B  1 35  ? 37.215  -51.294 50.040  1.00 17.31  ? 2053 ILE B CB  1 
ATOM   4365  C CG1 . ILE B  1 35  ? 37.345  -52.403 51.083  1.00 17.04  ? 2053 ILE B CG1 1 
ATOM   4366  C CG2 . ILE B  1 35  ? 38.384  -50.314 50.166  1.00 18.76  ? 2053 ILE B CG2 1 
ATOM   4367  C CD1 . ILE B  1 35  ? 38.639  -53.188 50.992  1.00 15.16  ? 2053 ILE B CD1 1 
ATOM   4368  N N   . PRO B  1 36  ? 35.787  -48.172 49.595  1.00 18.28  ? 2054 PRO B N   1 
ATOM   4369  C CA  . PRO B  1 36  ? 35.712  -47.073 48.627  1.00 18.83  ? 2054 PRO B CA  1 
ATOM   4370  C C   . PRO B  1 36  ? 37.027  -46.878 47.875  1.00 19.33  ? 2054 PRO B C   1 
ATOM   4371  O O   . PRO B  1 36  ? 38.087  -46.807 48.496  1.00 20.30  ? 2054 PRO B O   1 
ATOM   4372  C CB  . PRO B  1 36  ? 35.366  -45.874 49.504  1.00 19.26  ? 2054 PRO B CB  1 
ATOM   4373  C CG  . PRO B  1 36  ? 36.091  -46.194 50.792  1.00 19.09  ? 2054 PRO B CG  1 
ATOM   4374  C CD  . PRO B  1 36  ? 35.785  -47.666 50.981  1.00 17.82  ? 2054 PRO B CD  1 
ATOM   4375  N N   . PHE B  1 37  ? 36.970  -46.806 46.545  1.00 17.53  ? 2055 PHE B N   1 
ATOM   4376  C CA  . PHE B  1 37  ? 38.196  -46.593 45.775  1.00 17.79  ? 2055 PHE B CA  1 
ATOM   4377  C C   . PHE B  1 37  ? 38.265  -45.191 45.165  1.00 18.38  ? 2055 PHE B C   1 
ATOM   4378  O O   . PHE B  1 37  ? 39.247  -44.825 44.516  1.00 19.05  ? 2055 PHE B O   1 
ATOM   4379  C CB  . PHE B  1 37  ? 38.359  -47.671 44.691  1.00 16.76  ? 2055 PHE B CB  1 
ATOM   4380  C CG  . PHE B  1 37  ? 37.322  -47.631 43.606  1.00 13.75  ? 2055 PHE B CG  1 
ATOM   4381  C CD1 . PHE B  1 37  ? 37.435  -46.736 42.547  1.00 11.68  ? 2055 PHE B CD1 1 
ATOM   4382  C CD2 . PHE B  1 37  ? 36.261  -48.537 43.612  1.00 11.50  ? 2055 PHE B CD2 1 
ATOM   4383  C CE1 . PHE B  1 37  ? 36.514  -46.738 41.503  1.00 12.43  ? 2055 PHE B CE1 1 
ATOM   4384  C CE2 . PHE B  1 37  ? 35.337  -48.551 42.583  1.00 11.21  ? 2055 PHE B CE2 1 
ATOM   4385  C CZ  . PHE B  1 37  ? 35.459  -47.648 41.517  1.00 12.72  ? 2055 PHE B CZ  1 
ATOM   4386  N N   . ALA B  1 38  ? 37.217  -44.408 45.389  1.00 16.31  ? 2056 ALA B N   1 
ATOM   4387  C CA  . ALA B  1 38  ? 37.146  -43.046 44.880  1.00 19.10  ? 2056 ALA B CA  1 
ATOM   4388  C C   . ALA B  1 38  ? 36.198  -42.236 45.746  1.00 19.85  ? 2056 ALA B C   1 
ATOM   4389  O O   . ALA B  1 38  ? 35.494  -42.786 46.592  1.00 21.25  ? 2056 ALA B O   1 
ATOM   4390  C CB  . ALA B  1 38  ? 36.652  -43.043 43.436  1.00 15.85  ? 2056 ALA B CB  1 
ATOM   4391  N N   . LYS B  1 39  ? 36.195  -40.926 45.534  1.00 20.42  ? 2057 LYS B N   1 
ATOM   4392  C CA  . LYS B  1 39  ? 35.311  -40.041 46.271  1.00 21.11  ? 2057 LYS B CA  1 
ATOM   4393  C C   . LYS B  1 39  ? 33.914  -40.179 45.666  1.00 20.90  ? 2057 LYS B C   1 
ATOM   4394  O O   . LYS B  1 39  ? 33.765  -40.272 44.445  1.00 18.19  ? 2057 LYS B O   1 
ATOM   4395  C CB  . LYS B  1 39  ? 35.799  -38.598 46.141  1.00 22.08  ? 2057 LYS B CB  1 
ATOM   4396  C CG  . LYS B  1 39  ? 34.989  -37.594 46.926  1.00 28.00  ? 2057 LYS B CG  1 
ATOM   4397  C CD  . LYS B  1 39  ? 35.670  -36.234 46.948  1.00 31.80  ? 2057 LYS B CD  1 
ATOM   4398  C CE  . LYS B  1 39  ? 34.888  -35.254 47.816  1.00 35.61  ? 2057 LYS B CE  1 
ATOM   4399  N NZ  . LYS B  1 39  ? 35.565  -33.928 47.912  1.00 40.01  ? 2057 LYS B NZ  1 
ATOM   4400  N N   . PRO B  1 40  ? 32.871  -40.224 46.513  1.00 20.73  ? 2058 PRO B N   1 
ATOM   4401  C CA  . PRO B  1 40  ? 31.498  -40.350 46.009  1.00 20.85  ? 2058 PRO B CA  1 
ATOM   4402  C C   . PRO B  1 40  ? 31.236  -39.262 44.964  1.00 21.39  ? 2058 PRO B C   1 
ATOM   4403  O O   . PRO B  1 40  ? 31.331  -38.076 45.261  1.00 21.89  ? 2058 PRO B O   1 
ATOM   4404  C CB  . PRO B  1 40  ? 30.659  -40.170 47.271  1.00 21.90  ? 2058 PRO B CB  1 
ATOM   4405  C CG  . PRO B  1 40  ? 31.518  -40.816 48.314  1.00 20.15  ? 2058 PRO B CG  1 
ATOM   4406  C CD  . PRO B  1 40  ? 32.903  -40.292 47.985  1.00 20.50  ? 2058 PRO B CD  1 
ATOM   4407  N N   . PRO B  1 41  ? 30.896  -39.659 43.725  1.00 20.56  ? 2059 PRO B N   1 
ATOM   4408  C CA  . PRO B  1 41  ? 30.630  -38.721 42.628  1.00 19.73  ? 2059 PRO B CA  1 
ATOM   4409  C C   . PRO B  1 41  ? 29.282  -38.009 42.732  1.00 20.31  ? 2059 PRO B C   1 
ATOM   4410  O O   . PRO B  1 41  ? 28.437  -38.129 41.843  1.00 19.40  ? 2059 PRO B O   1 
ATOM   4411  C CB  . PRO B  1 41  ? 30.724  -39.616 41.401  1.00 19.16  ? 2059 PRO B CB  1 
ATOM   4412  C CG  . PRO B  1 41  ? 30.064  -40.876 41.893  1.00 18.53  ? 2059 PRO B CG  1 
ATOM   4413  C CD  . PRO B  1 41  ? 30.663  -41.051 43.293  1.00 18.52  ? 2059 PRO B CD  1 
ATOM   4414  N N   . LEU B  1 42  ? 29.108  -37.255 43.815  1.00 20.72  ? 2060 LEU B N   1 
ATOM   4415  C CA  . LEU B  1 42  ? 27.875  -36.516 44.083  1.00 20.23  ? 2060 LEU B CA  1 
ATOM   4416  C C   . LEU B  1 42  ? 28.021  -35.032 43.763  1.00 21.27  ? 2060 LEU B C   1 
ATOM   4417  O O   . LEU B  1 42  ? 29.134  -34.512 43.662  1.00 19.87  ? 2060 LEU B O   1 
ATOM   4418  C CB  . LEU B  1 42  ? 27.492  -36.663 45.562  1.00 18.91  ? 2060 LEU B CB  1 
ATOM   4419  C CG  . LEU B  1 42  ? 27.481  -38.096 46.096  1.00 18.29  ? 2060 LEU B CG  1 
ATOM   4420  C CD1 . LEU B  1 42  ? 27.152  -38.109 47.588  1.00 18.50  ? 2060 LEU B CD1 1 
ATOM   4421  C CD2 . LEU B  1 42  ? 26.458  -38.897 45.317  1.00 17.24  ? 2060 LEU B CD2 1 
ATOM   4422  N N   . GLY B  1 43  ? 26.883  -34.359 43.619  1.00 21.28  ? 2061 GLY B N   1 
ATOM   4423  C CA  . GLY B  1 43  ? 26.880  -32.935 43.331  1.00 23.38  ? 2061 GLY B CA  1 
ATOM   4424  C C   . GLY B  1 43  ? 27.662  -32.544 42.094  1.00 24.16  ? 2061 GLY B C   1 
ATOM   4425  O O   . GLY B  1 43  ? 27.402  -33.058 41.004  1.00 23.51  ? 2061 GLY B O   1 
ATOM   4426  N N   . PRO B  1 44  ? 28.626  -31.619 42.232  1.00 24.95  ? 2062 PRO B N   1 
ATOM   4427  C CA  . PRO B  1 44  ? 29.452  -31.156 41.113  1.00 26.32  ? 2062 PRO B CA  1 
ATOM   4428  C C   . PRO B  1 44  ? 30.343  -32.244 40.515  1.00 24.36  ? 2062 PRO B C   1 
ATOM   4429  O O   . PRO B  1 44  ? 30.844  -32.093 39.403  1.00 25.40  ? 2062 PRO B O   1 
ATOM   4430  C CB  . PRO B  1 44  ? 30.267  -30.025 41.734  1.00 28.69  ? 2062 PRO B CB  1 
ATOM   4431  C CG  . PRO B  1 44  ? 30.411  -30.470 43.165  1.00 28.64  ? 2062 PRO B CG  1 
ATOM   4432  C CD  . PRO B  1 44  ? 29.007  -30.929 43.478  1.00 26.84  ? 2062 PRO B CD  1 
ATOM   4433  N N   . LEU B  1 45  ? 30.536  -33.333 41.255  1.00 22.77  ? 2063 LEU B N   1 
ATOM   4434  C CA  . LEU B  1 45  ? 31.373  -34.435 40.786  1.00 20.98  ? 2063 LEU B CA  1 
ATOM   4435  C C   . LEU B  1 45  ? 30.659  -35.330 39.782  1.00 19.38  ? 2063 LEU B C   1 
ATOM   4436  O O   . LEU B  1 45  ? 31.273  -36.221 39.193  1.00 19.59  ? 2063 LEU B O   1 
ATOM   4437  C CB  . LEU B  1 45  ? 31.868  -35.270 41.971  1.00 19.80  ? 2063 LEU B CB  1 
ATOM   4438  C CG  . LEU B  1 45  ? 32.864  -34.559 42.898  1.00 23.96  ? 2063 LEU B CG  1 
ATOM   4439  C CD1 . LEU B  1 45  ? 33.259  -35.465 44.050  1.00 24.65  ? 2063 LEU B CD1 1 
ATOM   4440  C CD2 . LEU B  1 45  ? 34.088  -34.164 42.105  1.00 24.29  ? 2063 LEU B CD2 1 
ATOM   4441  N N   . ARG B  1 46  ? 29.361  -35.103 39.594  1.00 15.32  ? 2064 ARG B N   1 
ATOM   4442  C CA  . ARG B  1 46  ? 28.604  -35.890 38.636  1.00 15.59  ? 2064 ARG B CA  1 
ATOM   4443  C C   . ARG B  1 46  ? 29.115  -35.479 37.252  1.00 16.74  ? 2064 ARG B C   1 
ATOM   4444  O O   . ARG B  1 46  ? 29.374  -34.298 36.999  1.00 16.15  ? 2064 ARG B O   1 
ATOM   4445  C CB  . ARG B  1 46  ? 27.101  -35.597 38.753  1.00 17.21  ? 2064 ARG B CB  1 
ATOM   4446  C CG  . ARG B  1 46  ? 26.225  -36.484 37.865  1.00 18.00  ? 2064 ARG B CG  1 
ATOM   4447  C CD  . ARG B  1 46  ? 24.750  -36.081 37.928  1.00 20.19  ? 2064 ARG B CD  1 
ATOM   4448  N NE  . ARG B  1 46  ? 24.130  -36.359 39.226  1.00 20.06  ? 2064 ARG B NE  1 
ATOM   4449  C CZ  . ARG B  1 46  ? 22.961  -35.855 39.616  1.00 20.23  ? 2064 ARG B CZ  1 
ATOM   4450  N NH1 . ARG B  1 46  ? 22.296  -35.045 38.808  1.00 18.72  ? 2064 ARG B NH1 1 
ATOM   4451  N NH2 . ARG B  1 46  ? 22.446  -36.173 40.803  1.00 19.94  ? 2064 ARG B NH2 1 
ATOM   4452  N N   . PHE B  1 47  ? 29.262  -36.455 36.367  1.00 14.93  ? 2065 PHE B N   1 
ATOM   4453  C CA  . PHE B  1 47  ? 29.765  -36.217 35.018  1.00 15.27  ? 2065 PHE B CA  1 
ATOM   4454  C C   . PHE B  1 47  ? 31.204  -35.677 34.995  1.00 15.30  ? 2065 PHE B C   1 
ATOM   4455  O O   . PHE B  1 47  ? 31.539  -34.846 34.156  1.00 17.54  ? 2065 PHE B O   1 
ATOM   4456  C CB  . PHE B  1 47  ? 28.859  -35.244 34.247  1.00 16.17  ? 2065 PHE B CB  1 
ATOM   4457  C CG  . PHE B  1 47  ? 27.397  -35.613 34.260  1.00 17.61  ? 2065 PHE B CG  1 
ATOM   4458  C CD1 . PHE B  1 47  ? 26.986  -36.924 34.018  1.00 17.01  ? 2065 PHE B CD1 1 
ATOM   4459  C CD2 . PHE B  1 47  ? 26.427  -34.636 34.498  1.00 15.64  ? 2065 PHE B CD2 1 
ATOM   4460  C CE1 . PHE B  1 47  ? 25.628  -37.262 34.011  1.00 15.96  ? 2065 PHE B CE1 1 
ATOM   4461  C CE2 . PHE B  1 47  ? 25.069  -34.958 34.493  1.00 17.79  ? 2065 PHE B CE2 1 
ATOM   4462  C CZ  . PHE B  1 47  ? 24.666  -36.278 34.249  1.00 15.68  ? 2065 PHE B CZ  1 
ATOM   4463  N N   . THR B  1 48  ? 32.041  -36.127 35.925  1.00 15.50  ? 2066 THR B N   1 
ATOM   4464  C CA  . THR B  1 48  ? 33.452  -35.716 35.964  1.00 16.59  ? 2066 THR B CA  1 
ATOM   4465  C C   . THR B  1 48  ? 34.277  -36.948 36.325  1.00 15.32  ? 2066 THR B C   1 
ATOM   4466  O O   . THR B  1 48  ? 33.737  -37.924 36.859  1.00 16.29  ? 2066 THR B O   1 
ATOM   4467  C CB  . THR B  1 48  ? 33.755  -34.619 37.032  1.00 16.83  ? 2066 THR B CB  1 
ATOM   4468  O OG1 . THR B  1 48  ? 33.688  -35.189 38.345  1.00 21.00  ? 2066 THR B OG1 1 
ATOM   4469  C CG2 . THR B  1 48  ? 32.770  -33.462 36.929  1.00 18.23  ? 2066 THR B CG2 1 
ATOM   4470  N N   . PRO B  1 49  ? 35.594  -36.920 36.046  1.00 14.74  ? 2067 PRO B N   1 
ATOM   4471  C CA  . PRO B  1 49  ? 36.451  -38.065 36.364  1.00 15.04  ? 2067 PRO B CA  1 
ATOM   4472  C C   . PRO B  1 49  ? 36.446  -38.333 37.863  1.00 16.16  ? 2067 PRO B C   1 
ATOM   4473  O O   . PRO B  1 49  ? 36.265  -37.413 38.661  1.00 16.08  ? 2067 PRO B O   1 
ATOM   4474  C CB  . PRO B  1 49  ? 37.832  -37.619 35.872  1.00 12.82  ? 2067 PRO B CB  1 
ATOM   4475  C CG  . PRO B  1 49  ? 37.503  -36.686 34.736  1.00 15.60  ? 2067 PRO B CG  1 
ATOM   4476  C CD  . PRO B  1 49  ? 36.358  -35.884 35.320  1.00 16.05  ? 2067 PRO B CD  1 
ATOM   4477  N N   . PRO B  1 50  ? 36.641  -39.597 38.263  1.00 16.65  ? 2068 PRO B N   1 
ATOM   4478  C CA  . PRO B  1 50  ? 36.651  -39.925 39.692  1.00 18.56  ? 2068 PRO B CA  1 
ATOM   4479  C C   . PRO B  1 50  ? 37.874  -39.342 40.383  1.00 19.86  ? 2068 PRO B C   1 
ATOM   4480  O O   . PRO B  1 50  ? 38.953  -39.286 39.796  1.00 20.37  ? 2068 PRO B O   1 
ATOM   4481  C CB  . PRO B  1 50  ? 36.665  -41.453 39.693  1.00 16.37  ? 2068 PRO B CB  1 
ATOM   4482  C CG  . PRO B  1 50  ? 37.437  -41.775 38.423  1.00 17.03  ? 2068 PRO B CG  1 
ATOM   4483  C CD  . PRO B  1 50  ? 36.799  -40.813 37.441  1.00 16.01  ? 2068 PRO B CD  1 
ATOM   4484  N N   . GLN B  1 51  ? 37.699  -38.901 41.626  1.00 21.50  ? 2069 GLN B N   1 
ATOM   4485  C CA  . GLN B  1 51  ? 38.800  -38.345 42.405  1.00 21.58  ? 2069 GLN B CA  1 
ATOM   4486  C C   . GLN B  1 51  ? 39.153  -39.355 43.493  1.00 20.64  ? 2069 GLN B C   1 
ATOM   4487  O O   . GLN B  1 51  ? 38.364  -40.246 43.795  1.00 20.06  ? 2069 GLN B O   1 
ATOM   4488  C CB  . GLN B  1 51  ? 38.392  -37.017 43.043  1.00 25.57  ? 2069 GLN B CB  1 
ATOM   4489  C CG  . GLN B  1 51  ? 37.768  -36.023 42.078  1.00 29.75  ? 2069 GLN B CG  1 
ATOM   4490  C CD  . GLN B  1 51  ? 37.724  -34.622 42.653  1.00 34.92  ? 2069 GLN B CD  1 
ATOM   4491  O OE1 . GLN B  1 51  ? 37.534  -34.437 43.857  1.00 36.63  ? 2069 GLN B OE1 1 
ATOM   4492  N NE2 . GLN B  1 51  ? 37.889  -33.624 41.792  1.00 36.40  ? 2069 GLN B NE2 1 
ATOM   4493  N N   . PRO B  1 52  ? 40.350  -39.237 44.088  1.00 21.48  ? 2070 PRO B N   1 
ATOM   4494  C CA  . PRO B  1 52  ? 40.760  -40.170 45.140  1.00 21.12  ? 2070 PRO B CA  1 
ATOM   4495  C C   . PRO B  1 52  ? 39.832  -40.120 46.355  1.00 20.76  ? 2070 PRO B C   1 
ATOM   4496  O O   . PRO B  1 52  ? 39.239  -39.087 46.652  1.00 19.33  ? 2070 PRO B O   1 
ATOM   4497  C CB  . PRO B  1 52  ? 42.176  -39.701 45.490  1.00 22.82  ? 2070 PRO B CB  1 
ATOM   4498  C CG  . PRO B  1 52  ? 42.652  -39.052 44.216  1.00 22.21  ? 2070 PRO B CG  1 
ATOM   4499  C CD  . PRO B  1 52  ? 41.433  -38.286 43.780  1.00 20.96  ? 2070 PRO B CD  1 
ATOM   4500  N N   . ALA B  1 53  ? 39.707  -41.244 47.047  1.00 19.43  ? 2071 ALA B N   1 
ATOM   4501  C CA  . ALA B  1 53  ? 38.875  -41.310 48.240  1.00 21.87  ? 2071 ALA B CA  1 
ATOM   4502  C C   . ALA B  1 53  ? 39.615  -40.611 49.382  1.00 23.25  ? 2071 ALA B C   1 
ATOM   4503  O O   . ALA B  1 53  ? 40.842  -40.677 49.469  1.00 23.37  ? 2071 ALA B O   1 
ATOM   4504  C CB  . ALA B  1 53  ? 38.597  -42.764 48.602  1.00 21.36  ? 2071 ALA B CB  1 
ATOM   4505  N N   . GLU B  1 54  ? 38.866  -39.926 50.241  1.00 25.22  ? 2072 GLU B N   1 
ATOM   4506  C CA  . GLU B  1 54  ? 39.451  -39.221 51.379  1.00 26.24  ? 2072 GLU B CA  1 
ATOM   4507  C C   . GLU B  1 54  ? 39.887  -40.237 52.433  1.00 23.89  ? 2072 GLU B C   1 
ATOM   4508  O O   . GLU B  1 54  ? 39.196  -41.226 52.672  1.00 24.83  ? 2072 GLU B O   1 
ATOM   4509  C CB  . GLU B  1 54  ? 38.424  -38.273 52.004  1.00 30.07  ? 2072 GLU B CB  1 
ATOM   4510  C CG  . GLU B  1 54  ? 37.861  -37.203 51.078  1.00 37.12  ? 2072 GLU B CG  1 
ATOM   4511  C CD  . GLU B  1 54  ? 38.926  -36.269 50.540  1.00 41.51  ? 2072 GLU B CD  1 
ATOM   4512  O OE1 . GLU B  1 54  ? 39.863  -35.928 51.298  1.00 43.69  ? 2072 GLU B OE1 1 
ATOM   4513  O OE2 . GLU B  1 54  ? 38.817  -35.863 49.363  1.00 45.70  ? 2072 GLU B OE2 1 
ATOM   4514  N N   . PRO B  1 55  ? 41.038  -40.008 53.081  1.00 23.17  ? 2073 PRO B N   1 
ATOM   4515  C CA  . PRO B  1 55  ? 41.510  -40.943 54.106  1.00 22.20  ? 2073 PRO B CA  1 
ATOM   4516  C C   . PRO B  1 55  ? 40.614  -40.909 55.348  1.00 22.54  ? 2073 PRO B C   1 
ATOM   4517  O O   . PRO B  1 55  ? 39.903  -39.935 55.579  1.00 22.06  ? 2073 PRO B O   1 
ATOM   4518  C CB  . PRO B  1 55  ? 42.926  -40.453 54.386  1.00 21.68  ? 2073 PRO B CB  1 
ATOM   4519  C CG  . PRO B  1 55  ? 42.810  -38.974 54.169  1.00 23.32  ? 2073 PRO B CG  1 
ATOM   4520  C CD  . PRO B  1 55  ? 41.986  -38.893 52.906  1.00 23.76  ? 2073 PRO B CD  1 
ATOM   4521  N N   . TRP B  1 56  ? 40.647  -41.976 56.140  1.00 21.92  ? 2074 TRP B N   1 
ATOM   4522  C CA  . TRP B  1 56  ? 39.827  -42.051 57.342  1.00 20.73  ? 2074 TRP B CA  1 
ATOM   4523  C C   . TRP B  1 56  ? 40.636  -42.452 58.563  1.00 22.23  ? 2074 TRP B C   1 
ATOM   4524  O O   . TRP B  1 56  ? 41.683  -43.088 58.449  1.00 23.71  ? 2074 TRP B O   1 
ATOM   4525  C CB  . TRP B  1 56  ? 38.677  -43.040 57.138  1.00 18.18  ? 2074 TRP B CB  1 
ATOM   4526  C CG  . TRP B  1 56  ? 39.116  -44.425 56.754  1.00 19.06  ? 2074 TRP B CG  1 
ATOM   4527  C CD1 . TRP B  1 56  ? 39.481  -45.435 57.596  1.00 19.44  ? 2074 TRP B CD1 1 
ATOM   4528  C CD2 . TRP B  1 56  ? 39.242  -44.942 55.427  1.00 18.83  ? 2074 TRP B CD2 1 
ATOM   4529  N NE1 . TRP B  1 56  ? 39.826  -46.553 56.876  1.00 18.75  ? 2074 TRP B NE1 1 
ATOM   4530  C CE2 . TRP B  1 56  ? 39.688  -46.279 55.541  1.00 18.79  ? 2074 TRP B CE2 1 
ATOM   4531  C CE3 . TRP B  1 56  ? 39.022  -44.407 54.149  1.00 17.96  ? 2074 TRP B CE3 1 
ATOM   4532  C CZ2 . TRP B  1 56  ? 39.919  -47.092 54.422  1.00 18.25  ? 2074 TRP B CZ2 1 
ATOM   4533  C CZ3 . TRP B  1 56  ? 39.250  -45.215 53.036  1.00 18.00  ? 2074 TRP B CZ3 1 
ATOM   4534  C CH2 . TRP B  1 56  ? 39.695  -46.544 53.183  1.00 17.77  ? 2074 TRP B CH2 1 
ATOM   4535  N N   . SER B  1 57  ? 40.138  -42.068 59.733  1.00 22.94  ? 2075 SER B N   1 
ATOM   4536  C CA  . SER B  1 57  ? 40.792  -42.379 60.995  1.00 24.90  ? 2075 SER B CA  1 
ATOM   4537  C C   . SER B  1 57  ? 40.189  -43.664 61.548  1.00 26.17  ? 2075 SER B C   1 
ATOM   4538  O O   . SER B  1 57  ? 39.095  -44.057 61.157  1.00 29.78  ? 2075 SER B O   1 
ATOM   4539  C CB  . SER B  1 57  ? 40.557  -41.246 62.002  1.00 25.94  ? 2075 SER B CB  1 
ATOM   4540  O OG  . SER B  1 57  ? 40.918  -39.982 61.465  1.00 26.33  ? 2075 SER B OG  1 
ATOM   4541  N N   . PHE B  1 58  ? 40.901  -44.321 62.452  1.00 26.91  ? 2076 PHE B N   1 
ATOM   4542  C CA  . PHE B  1 58  ? 40.395  -45.544 63.065  1.00 27.33  ? 2076 PHE B CA  1 
ATOM   4543  C C   . PHE B  1 58  ? 40.175  -46.660 62.044  1.00 28.02  ? 2076 PHE B C   1 
ATOM   4544  O O   . PHE B  1 58  ? 40.840  -46.697 61.008  1.00 28.92  ? 2076 PHE B O   1 
ATOM   4545  C CB  . PHE B  1 58  ? 39.096  -45.231 63.812  1.00 27.71  ? 2076 PHE B CB  1 
ATOM   4546  C CG  . PHE B  1 58  ? 39.165  -43.965 64.618  1.00 28.48  ? 2076 PHE B CG  1 
ATOM   4547  C CD1 . PHE B  1 58  ? 38.274  -42.924 64.379  1.00 27.49  ? 2076 PHE B CD1 1 
ATOM   4548  C CD2 . PHE B  1 58  ? 40.157  -43.790 65.575  1.00 28.84  ? 2076 PHE B CD2 1 
ATOM   4549  C CE1 . PHE B  1 58  ? 38.375  -41.723 65.079  1.00 28.84  ? 2076 PHE B CE1 1 
ATOM   4550  C CE2 . PHE B  1 58  ? 40.265  -42.592 66.280  1.00 30.69  ? 2076 PHE B CE2 1 
ATOM   4551  C CZ  . PHE B  1 58  ? 39.372  -41.558 66.029  1.00 27.85  ? 2076 PHE B CZ  1 
ATOM   4552  N N   . VAL B  1 59  ? 39.235  -47.555 62.330  1.00 26.31  ? 2077 VAL B N   1 
ATOM   4553  C CA  . VAL B  1 59  ? 38.973  -48.690 61.454  1.00 25.60  ? 2077 VAL B CA  1 
ATOM   4554  C C   . VAL B  1 59  ? 37.630  -48.662 60.737  1.00 25.15  ? 2077 VAL B C   1 
ATOM   4555  O O   . VAL B  1 59  ? 36.581  -48.573 61.368  1.00 24.59  ? 2077 VAL B O   1 
ATOM   4556  C CB  . VAL B  1 59  ? 39.056  -50.009 62.246  1.00 27.12  ? 2077 VAL B CB  1 
ATOM   4557  C CG1 . VAL B  1 59  ? 38.956  -51.197 61.298  1.00 27.07  ? 2077 VAL B CG1 1 
ATOM   4558  C CG2 . VAL B  1 59  ? 40.352  -50.054 63.039  1.00 26.84  ? 2077 VAL B CG2 1 
ATOM   4559  N N   . LYS B  1 60  ? 37.665  -48.747 59.411  1.00 23.12  ? 2078 LYS B N   1 
ATOM   4560  C CA  . LYS B  1 60  ? 36.433  -48.759 58.640  1.00 22.31  ? 2078 LYS B CA  1 
ATOM   4561  C C   . LYS B  1 60  ? 35.903  -50.193 58.571  1.00 25.09  ? 2078 LYS B C   1 
ATOM   4562  O O   . LYS B  1 60  ? 36.639  -51.130 58.245  1.00 24.93  ? 2078 LYS B O   1 
ATOM   4563  C CB  . LYS B  1 60  ? 36.675  -48.228 57.230  1.00 22.68  ? 2078 LYS B CB  1 
ATOM   4564  C CG  . LYS B  1 60  ? 35.448  -48.293 56.334  1.00 21.97  ? 2078 LYS B CG  1 
ATOM   4565  C CD  . LYS B  1 60  ? 35.752  -47.789 54.929  1.00 24.80  ? 2078 LYS B CD  1 
ATOM   4566  C CE  . LYS B  1 60  ? 36.093  -46.296 54.923  1.00 26.42  ? 2078 LYS B CE  1 
ATOM   4567  N NZ  . LYS B  1 60  ? 34.951  -45.453 55.386  1.00 25.38  ? 2078 LYS B NZ  1 
ATOM   4568  N N   . ASN B  1 61  ? 34.624  -50.350 58.892  1.00 25.52  ? 2079 ASN B N   1 
ATOM   4569  C CA  . ASN B  1 61  ? 33.960  -51.646 58.870  1.00 27.27  ? 2079 ASN B CA  1 
ATOM   4570  C C   . ASN B  1 61  ? 33.628  -51.972 57.416  1.00 25.47  ? 2079 ASN B C   1 
ATOM   4571  O O   . ASN B  1 61  ? 32.860  -51.257 56.778  1.00 24.50  ? 2079 ASN B O   1 
ATOM   4572  C CB  . ASN B  1 61  ? 32.669  -51.576 59.691  1.00 32.91  ? 2079 ASN B CB  1 
ATOM   4573  C CG  . ASN B  1 61  ? 32.076  -52.943 59.979  1.00 40.98  ? 2079 ASN B CG  1 
ATOM   4574  O OD1 . ASN B  1 61  ? 32.253  -53.886 59.205  1.00 41.96  ? 2079 ASN B OD1 1 
ATOM   4575  N ND2 . ASN B  1 61  ? 31.354  -53.040 61.093  1.00 46.11  ? 2079 ASN B ND2 1 
ATOM   4576  N N   . ALA B  1 62  ? 34.225  -53.036 56.889  1.00 23.31  ? 2080 ALA B N   1 
ATOM   4577  C CA  . ALA B  1 62  ? 33.966  -53.442 55.511  1.00 22.80  ? 2080 ALA B CA  1 
ATOM   4578  C C   . ALA B  1 62  ? 33.305  -54.813 55.520  1.00 22.64  ? 2080 ALA B C   1 
ATOM   4579  O O   . ALA B  1 62  ? 33.841  -55.770 54.960  1.00 20.28  ? 2080 ALA B O   1 
ATOM   4580  C CB  . ALA B  1 62  ? 35.275  -53.497 54.724  1.00 23.08  ? 2080 ALA B CB  1 
ATOM   4581  N N   . THR B  1 63  ? 32.142  -54.910 56.160  1.00 21.50  ? 2081 THR B N   1 
ATOM   4582  C CA  . THR B  1 63  ? 31.447  -56.190 56.239  1.00 22.58  ? 2081 THR B CA  1 
ATOM   4583  C C   . THR B  1 63  ? 30.024  -56.173 55.704  1.00 21.10  ? 2081 THR B C   1 
ATOM   4584  O O   . THR B  1 63  ? 29.302  -57.157 55.829  1.00 23.45  ? 2081 THR B O   1 
ATOM   4585  C CB  . THR B  1 63  ? 31.435  -56.732 57.684  1.00 24.57  ? 2081 THR B CB  1 
ATOM   4586  O OG1 . THR B  1 63  ? 30.779  -55.795 58.548  1.00 27.18  ? 2081 THR B OG1 1 
ATOM   4587  C CG2 . THR B  1 63  ? 32.855  -56.956 58.175  1.00 25.21  ? 2081 THR B CG2 1 
ATOM   4588  N N   . SER B  1 64  ? 29.614  -55.062 55.108  1.00 20.90  ? 2082 SER B N   1 
ATOM   4589  C CA  . SER B  1 64  ? 28.280  -54.992 54.528  1.00 22.78  ? 2082 SER B CA  1 
ATOM   4590  C C   . SER B  1 64  ? 28.407  -54.657 53.042  1.00 22.83  ? 2082 SER B C   1 
ATOM   4591  O O   . SER B  1 64  ? 29.305  -53.917 52.633  1.00 21.91  ? 2082 SER B O   1 
ATOM   4592  C CB  . SER B  1 64  ? 27.425  -53.940 55.245  1.00 22.26  ? 2082 SER B CB  1 
ATOM   4593  O OG  . SER B  1 64  ? 27.956  -52.641 55.082  1.00 28.98  ? 2082 SER B OG  1 
ATOM   4594  N N   . TYR B  1 65  ? 27.516  -55.217 52.235  1.00 22.16  ? 2083 TYR B N   1 
ATOM   4595  C CA  . TYR B  1 65  ? 27.537  -54.974 50.801  1.00 23.08  ? 2083 TYR B CA  1 
ATOM   4596  C C   . TYR B  1 65  ? 27.233  -53.514 50.487  1.00 22.99  ? 2083 TYR B C   1 
ATOM   4597  O O   . TYR B  1 65  ? 26.356  -52.899 51.096  1.00 22.42  ? 2083 TYR B O   1 
ATOM   4598  C CB  . TYR B  1 65  ? 26.531  -55.896 50.102  1.00 24.00  ? 2083 TYR B CB  1 
ATOM   4599  C CG  . TYR B  1 65  ? 26.925  -57.356 50.173  1.00 27.00  ? 2083 TYR B CG  1 
ATOM   4600  C CD1 . TYR B  1 65  ? 27.947  -57.861 49.369  1.00 27.39  ? 2083 TYR B CD1 1 
ATOM   4601  C CD2 . TYR B  1 65  ? 26.306  -58.223 51.073  1.00 29.67  ? 2083 TYR B CD2 1 
ATOM   4602  C CE1 . TYR B  1 65  ? 28.347  -59.194 49.459  1.00 29.81  ? 2083 TYR B CE1 1 
ATOM   4603  C CE2 . TYR B  1 65  ? 26.698  -59.561 51.174  1.00 30.98  ? 2083 TYR B CE2 1 
ATOM   4604  C CZ  . TYR B  1 65  ? 27.718  -60.038 50.363  1.00 31.99  ? 2083 TYR B CZ  1 
ATOM   4605  O OH  . TYR B  1 65  ? 28.110  -61.356 50.457  1.00 33.52  ? 2083 TYR B OH  1 
ATOM   4606  N N   . PRO B  1 66  ? 27.966  -52.935 49.529  1.00 21.28  ? 2084 PRO B N   1 
ATOM   4607  C CA  . PRO B  1 66  ? 27.736  -51.536 49.166  1.00 20.26  ? 2084 PRO B CA  1 
ATOM   4608  C C   . PRO B  1 66  ? 26.512  -51.407 48.270  1.00 17.89  ? 2084 PRO B C   1 
ATOM   4609  O O   . PRO B  1 66  ? 25.996  -52.403 47.762  1.00 16.67  ? 2084 PRO B O   1 
ATOM   4610  C CB  . PRO B  1 66  ? 29.013  -51.174 48.420  1.00 20.90  ? 2084 PRO B CB  1 
ATOM   4611  C CG  . PRO B  1 66  ? 29.280  -52.458 47.645  1.00 19.96  ? 2084 PRO B CG  1 
ATOM   4612  C CD  . PRO B  1 66  ? 29.062  -53.516 48.725  1.00 22.34  ? 2084 PRO B CD  1 
ATOM   4613  N N   . PRO B  1 67  ? 26.018  -50.178 48.082  1.00 16.42  ? 2085 PRO B N   1 
ATOM   4614  C CA  . PRO B  1 67  ? 24.852  -49.996 47.217  1.00 16.57  ? 2085 PRO B CA  1 
ATOM   4615  C C   . PRO B  1 67  ? 25.322  -50.246 45.784  1.00 16.93  ? 2085 PRO B C   1 
ATOM   4616  O O   . PRO B  1 67  ? 26.524  -50.253 45.514  1.00 16.50  ? 2085 PRO B O   1 
ATOM   4617  C CB  . PRO B  1 67  ? 24.491  -48.519 47.404  1.00 17.53  ? 2085 PRO B CB  1 
ATOM   4618  C CG  . PRO B  1 67  ? 25.170  -48.117 48.690  1.00 17.34  ? 2085 PRO B CG  1 
ATOM   4619  C CD  . PRO B  1 67  ? 26.448  -48.898 48.671  1.00 18.24  ? 2085 PRO B CD  1 
ATOM   4620  N N   . MET B  1 68  ? 24.387  -50.458 44.871  1.00 15.80  ? 2086 MET B N   1 
ATOM   4621  C CA  . MET B  1 68  ? 24.758  -50.636 43.480  1.00 17.63  ? 2086 MET B CA  1 
ATOM   4622  C C   . MET B  1 68  ? 24.442  -49.289 42.851  1.00 17.29  ? 2086 MET B C   1 
ATOM   4623  O O   . MET B  1 68  ? 23.518  -48.595 43.289  1.00 18.20  ? 2086 MET B O   1 
ATOM   4624  C CB  . MET B  1 68  ? 23.949  -51.764 42.823  1.00 18.11  ? 2086 MET B CB  1 
ATOM   4625  C CG  . MET B  1 68  ? 22.443  -51.544 42.716  1.00 19.43  ? 2086 MET B CG  1 
ATOM   4626  S SD  . MET B  1 68  ? 21.654  -53.043 42.051  1.00 27.83  ? 2086 MET B SD  1 
ATOM   4627  C CE  . MET B  1 68  ? 19.975  -52.503 41.838  1.00 23.24  ? 2086 MET B CE  1 
ATOM   4628  N N   . CYS B  1 69  ? 25.216  -48.897 41.851  1.00 16.24  ? 2087 CYS B N   1 
ATOM   4629  C CA  . CYS B  1 69  ? 24.991  -47.609 41.207  1.00 17.22  ? 2087 CYS B CA  1 
ATOM   4630  C C   . CYS B  1 69  ? 23.544  -47.489 40.739  1.00 15.56  ? 2087 CYS B C   1 
ATOM   4631  O O   . CYS B  1 69  ? 22.907  -48.487 40.396  1.00 15.91  ? 2087 CYS B O   1 
ATOM   4632  C CB  . CYS B  1 69  ? 25.955  -47.426 40.027  1.00 17.19  ? 2087 CYS B CB  1 
ATOM   4633  S SG  . CYS B  1 69  ? 27.722  -47.499 40.488  1.00 25.99  ? 2087 CYS B SG  1 
ATOM   4634  N N   . THR B  1 70  ? 23.031  -46.262 40.726  1.00 14.83  ? 2088 THR B N   1 
ATOM   4635  C CA  . THR B  1 70  ? 21.655  -46.010 40.320  1.00 16.19  ? 2088 THR B CA  1 
ATOM   4636  C C   . THR B  1 70  ? 21.350  -46.631 38.964  1.00 18.06  ? 2088 THR B C   1 
ATOM   4637  O O   . THR B  1 70  ? 22.094  -46.448 37.996  1.00 16.59  ? 2088 THR B O   1 
ATOM   4638  C CB  . THR B  1 70  ? 21.349  -44.498 40.253  1.00 17.83  ? 2088 THR B CB  1 
ATOM   4639  O OG1 . THR B  1 70  ? 21.958  -43.831 41.367  1.00 17.46  ? 2088 THR B OG1 1 
ATOM   4640  C CG2 . THR B  1 70  ? 19.841  -44.267 40.317  1.00 15.07  ? 2088 THR B CG2 1 
ATOM   4641  N N   . GLN B  1 71  ? 20.237  -47.355 38.911  1.00 16.95  ? 2089 GLN B N   1 
ATOM   4642  C CA  . GLN B  1 71  ? 19.808  -48.050 37.703  1.00 17.99  ? 2089 GLN B CA  1 
ATOM   4643  C C   . GLN B  1 71  ? 18.361  -48.485 37.904  1.00 19.84  ? 2089 GLN B C   1 
ATOM   4644  O O   . GLN B  1 71  ? 17.833  -48.395 39.012  1.00 18.63  ? 2089 GLN B O   1 
ATOM   4645  C CB  . GLN B  1 71  ? 20.670  -49.294 37.522  1.00 16.31  ? 2089 GLN B CB  1 
ATOM   4646  C CG  . GLN B  1 71  ? 20.652  -50.177 38.778  1.00 15.25  ? 2089 GLN B CG  1 
ATOM   4647  C CD  . GLN B  1 71  ? 21.583  -51.368 38.700  1.00 14.80  ? 2089 GLN B CD  1 
ATOM   4648  O OE1 . GLN B  1 71  ? 21.233  -52.418 38.151  1.00 15.57  ? 2089 GLN B OE1 1 
ATOM   4649  N NE2 . GLN B  1 71  ? 22.781  -51.213 39.254  1.00 11.64  ? 2089 GLN B NE2 1 
ATOM   4650  N N   . ASP B  1 72  ? 17.724  -48.954 36.837  1.00 20.62  ? 2090 ASP B N   1 
ATOM   4651  C CA  . ASP B  1 72  ? 16.358  -49.455 36.943  1.00 25.00  ? 2090 ASP B CA  1 
ATOM   4652  C C   . ASP B  1 72  ? 16.424  -50.518 38.045  1.00 25.59  ? 2090 ASP B C   1 
ATOM   4653  O O   . ASP B  1 72  ? 17.132  -51.515 37.909  1.00 26.60  ? 2090 ASP B O   1 
ATOM   4654  C CB  . ASP B  1 72  ? 15.936  -50.104 35.633  1.00 29.01  ? 2090 ASP B CB  1 
ATOM   4655  C CG  . ASP B  1 72  ? 14.505  -50.578 35.660  1.00 33.30  ? 2090 ASP B CG  1 
ATOM   4656  O OD1 . ASP B  1 72  ? 14.063  -51.093 36.707  1.00 36.96  ? 2090 ASP B OD1 1 
ATOM   4657  O OD2 . ASP B  1 72  ? 13.825  -50.445 34.625  1.00 35.82  ? 2090 ASP B OD2 1 
ATOM   4658  N N   . PRO B  1 73  ? 15.689  -50.319 39.150  1.00 26.01  ? 2091 PRO B N   1 
ATOM   4659  C CA  . PRO B  1 73  ? 15.702  -51.276 40.261  1.00 25.13  ? 2091 PRO B CA  1 
ATOM   4660  C C   . PRO B  1 73  ? 15.209  -52.680 39.920  1.00 23.91  ? 2091 PRO B C   1 
ATOM   4661  O O   . PRO B  1 73  ? 15.772  -53.669 40.382  1.00 25.03  ? 2091 PRO B O   1 
ATOM   4662  C CB  . PRO B  1 73  ? 14.811  -50.609 41.315  1.00 25.95  ? 2091 PRO B CB  1 
ATOM   4663  C CG  . PRO B  1 73  ? 14.769  -49.159 40.910  1.00 25.91  ? 2091 PRO B CG  1 
ATOM   4664  C CD  . PRO B  1 73  ? 14.735  -49.231 39.415  1.00 25.92  ? 2091 PRO B CD  1 
ATOM   4665  N N   . LYS B  1 74  ? 14.154  -52.772 39.122  1.00 23.48  ? 2092 LYS B N   1 
ATOM   4666  C CA  . LYS B  1 74  ? 13.602  -54.077 38.775  1.00 24.86  ? 2092 LYS B CA  1 
ATOM   4667  C C   . LYS B  1 74  ? 14.519  -54.839 37.836  1.00 23.36  ? 2092 LYS B C   1 
ATOM   4668  O O   . LYS B  1 74  ? 14.803  -56.022 38.036  1.00 20.71  ? 2092 LYS B O   1 
ATOM   4669  C CB  . LYS B  1 74  ? 12.220  -53.906 38.146  1.00 27.64  ? 2092 LYS B CB  1 
ATOM   4670  C CG  . LYS B  1 74  ? 11.254  -53.184 39.067  1.00 34.30  ? 2092 LYS B CG  1 
ATOM   4671  C CD  . LYS B  1 74  ? 9.838   -53.184 38.532  1.00 38.31  ? 2092 LYS B CD  1 
ATOM   4672  C CE  . LYS B  1 74  ? 8.883   -52.605 39.565  1.00 42.28  ? 2092 LYS B CE  1 
ATOM   4673  N NZ  . LYS B  1 74  ? 7.455   -52.751 39.175  1.00 43.88  ? 2092 LYS B NZ  1 
ATOM   4674  N N   . ALA B  1 75  ? 14.986  -54.144 36.812  1.00 22.88  ? 2093 ALA B N   1 
ATOM   4675  C CA  . ALA B  1 75  ? 15.878  -54.736 35.841  1.00 23.48  ? 2093 ALA B CA  1 
ATOM   4676  C C   . ALA B  1 75  ? 17.168  -55.182 36.522  1.00 22.59  ? 2093 ALA B C   1 
ATOM   4677  O O   . ALA B  1 75  ? 17.665  -56.281 36.275  1.00 23.44  ? 2093 ALA B O   1 
ATOM   4678  C CB  . ALA B  1 75  ? 16.174  -53.733 34.787  1.00 23.59  ? 2093 ALA B CB  1 
ATOM   4679  N N   . GLY B  1 76  ? 17.699  -54.318 37.383  1.00 23.18  ? 2094 GLY B N   1 
ATOM   4680  C CA  . GLY B  1 76  ? 18.927  -54.625 38.093  1.00 22.47  ? 2094 GLY B CA  1 
ATOM   4681  C C   . GLY B  1 76  ? 18.822  -55.832 39.006  1.00 24.21  ? 2094 GLY B C   1 
ATOM   4682  O O   . GLY B  1 76  ? 19.738  -56.658 39.055  1.00 21.59  ? 2094 GLY B O   1 
ATOM   4683  N N   . GLN B  1 77  ? 17.717  -55.940 39.741  1.00 23.72  ? 2095 GLN B N   1 
ATOM   4684  C CA  . GLN B  1 77  ? 17.535  -57.075 40.638  1.00 25.56  ? 2095 GLN B CA  1 
ATOM   4685  C C   . GLN B  1 77  ? 17.335  -58.361 39.836  1.00 23.96  ? 2095 GLN B C   1 
ATOM   4686  O O   . GLN B  1 77  ? 17.806  -59.424 40.231  1.00 23.70  ? 2095 GLN B O   1 
ATOM   4687  C CB  . GLN B  1 77  ? 16.345  -56.851 41.581  1.00 28.55  ? 2095 GLN B CB  1 
ATOM   4688  C CG  . GLN B  1 77  ? 16.092  -58.027 42.532  1.00 36.39  ? 2095 GLN B CG  1 
ATOM   4689  C CD  . GLN B  1 77  ? 15.405  -57.618 43.833  1.00 41.74  ? 2095 GLN B CD  1 
ATOM   4690  O OE1 . GLN B  1 77  ? 14.345  -56.990 43.824  1.00 44.17  ? 2095 GLN B OE1 1 
ATOM   4691  N NE2 . GLN B  1 77  ? 16.011  -57.984 44.962  1.00 42.15  ? 2095 GLN B NE2 1 
ATOM   4692  N N   . LEU B  1 78  ? 16.637  -58.264 38.708  1.00 23.65  ? 2096 LEU B N   1 
ATOM   4693  C CA  . LEU B  1 78  ? 16.414  -59.440 37.871  1.00 23.30  ? 2096 LEU B CA  1 
ATOM   4694  C C   . LEU B  1 78  ? 17.739  -59.990 37.336  1.00 22.43  ? 2096 LEU B C   1 
ATOM   4695  O O   . LEU B  1 78  ? 18.012  -61.188 37.446  1.00 22.94  ? 2096 LEU B O   1 
ATOM   4696  C CB  . LEU B  1 78  ? 15.494  -59.098 36.702  1.00 22.69  ? 2096 LEU B CB  1 
ATOM   4697  C CG  . LEU B  1 78  ? 15.274  -60.221 35.686  1.00 22.53  ? 2096 LEU B CG  1 
ATOM   4698  C CD1 . LEU B  1 78  ? 14.654  -61.432 36.371  1.00 25.48  ? 2096 LEU B CD1 1 
ATOM   4699  C CD2 . LEU B  1 78  ? 14.381  -59.722 34.576  1.00 23.44  ? 2096 LEU B CD2 1 
ATOM   4700  N N   . LEU B  1 79  ? 18.563  -59.121 36.755  1.00 21.25  ? 2097 LEU B N   1 
ATOM   4701  C CA  . LEU B  1 79  ? 19.848  -59.571 36.226  1.00 20.14  ? 2097 LEU B CA  1 
ATOM   4702  C C   . LEU B  1 79  ? 20.691  -60.186 37.337  1.00 19.95  ? 2097 LEU B C   1 
ATOM   4703  O O   . LEU B  1 79  ? 21.327  -61.218 37.144  1.00 21.90  ? 2097 LEU B O   1 
ATOM   4704  C CB  . LEU B  1 79  ? 20.622  -58.414 35.589  1.00 21.01  ? 2097 LEU B CB  1 
ATOM   4705  C CG  . LEU B  1 79  ? 21.977  -58.827 35.000  1.00 21.96  ? 2097 LEU B CG  1 
ATOM   4706  C CD1 . LEU B  1 79  ? 21.755  -59.800 33.847  1.00 22.73  ? 2097 LEU B CD1 1 
ATOM   4707  C CD2 . LEU B  1 79  ? 22.748  -57.603 34.541  1.00 23.98  ? 2097 LEU B CD2 1 
ATOM   4708  N N   . SER B  1 80  ? 20.689  -59.551 38.503  1.00 18.38  ? 2098 SER B N   1 
ATOM   4709  C CA  . SER B  1 80  ? 21.459  -60.052 39.634  1.00 18.36  ? 2098 SER B CA  1 
ATOM   4710  C C   . SER B  1 80  ? 21.035  -61.476 40.010  1.00 19.31  ? 2098 SER B C   1 
ATOM   4711  O O   . SER B  1 80  ? 21.875  -62.348 40.226  1.00 18.27  ? 2098 SER B O   1 
ATOM   4712  C CB  . SER B  1 80  ? 21.286  -59.124 40.837  1.00 16.74  ? 2098 SER B CB  1 
ATOM   4713  O OG  . SER B  1 80  ? 22.118  -59.530 41.906  1.00 19.75  ? 2098 SER B OG  1 
ATOM   4714  N N   . GLU B  1 81  ? 19.727  -61.709 40.082  1.00 18.99  ? 2099 GLU B N   1 
ATOM   4715  C CA  . GLU B  1 81  ? 19.213  -63.028 40.437  1.00 19.50  ? 2099 GLU B CA  1 
ATOM   4716  C C   . GLU B  1 81  ? 19.564  -64.067 39.374  1.00 18.85  ? 2099 GLU B C   1 
ATOM   4717  O O   . GLU B  1 81  ? 19.802  -65.226 39.695  1.00 18.82  ? 2099 GLU B O   1 
ATOM   4718  C CB  . GLU B  1 81  ? 17.690  -62.978 40.618  1.00 22.14  ? 2099 GLU B CB  1 
ATOM   4719  N N   . LEU B  1 82  ? 19.590  -63.646 38.113  1.00 18.58  ? 2100 LEU B N   1 
ATOM   4720  C CA  . LEU B  1 82  ? 19.916  -64.546 37.007  1.00 19.48  ? 2100 LEU B CA  1 
ATOM   4721  C C   . LEU B  1 82  ? 21.401  -64.904 36.921  1.00 22.25  ? 2100 LEU B C   1 
ATOM   4722  O O   . LEU B  1 82  ? 21.755  -66.009 36.499  1.00 21.76  ? 2100 LEU B O   1 
ATOM   4723  C CB  . LEU B  1 82  ? 19.485  -63.920 35.678  1.00 19.62  ? 2100 LEU B CB  1 
ATOM   4724  C CG  . LEU B  1 82  ? 17.985  -63.858 35.378  1.00 21.63  ? 2100 LEU B CG  1 
ATOM   4725  C CD1 . LEU B  1 82  ? 17.738  -62.957 34.176  1.00 22.70  ? 2100 LEU B CD1 1 
ATOM   4726  C CD2 . LEU B  1 82  ? 17.452  -65.265 35.118  1.00 21.73  ? 2100 LEU B CD2 1 
ATOM   4727  N N   . PHE B  1 83  ? 22.266  -63.976 37.324  1.00 20.79  ? 2101 PHE B N   1 
ATOM   4728  C CA  . PHE B  1 83  ? 23.709  -64.193 37.246  1.00 21.83  ? 2101 PHE B CA  1 
ATOM   4729  C C   . PHE B  1 83  ? 24.442  -64.556 38.531  1.00 21.00  ? 2101 PHE B C   1 
ATOM   4730  O O   . PHE B  1 83  ? 25.565  -65.062 38.478  1.00 22.40  ? 2101 PHE B O   1 
ATOM   4731  C CB  . PHE B  1 83  ? 24.390  -62.956 36.644  1.00 22.90  ? 2101 PHE B CB  1 
ATOM   4732  C CG  . PHE B  1 83  ? 24.276  -62.857 35.149  1.00 26.69  ? 2101 PHE B CG  1 
ATOM   4733  C CD1 . PHE B  1 83  ? 23.640  -63.850 34.409  1.00 27.73  ? 2101 PHE B CD1 1 
ATOM   4734  C CD2 . PHE B  1 83  ? 24.839  -61.777 34.473  1.00 28.31  ? 2101 PHE B CD2 1 
ATOM   4735  C CE1 . PHE B  1 83  ? 23.571  -63.770 33.021  1.00 29.29  ? 2101 PHE B CE1 1 
ATOM   4736  C CE2 . PHE B  1 83  ? 24.776  -61.688 33.083  1.00 30.07  ? 2101 PHE B CE2 1 
ATOM   4737  C CZ  . PHE B  1 83  ? 24.142  -62.686 32.356  1.00 29.92  ? 2101 PHE B CZ  1 
ATOM   4738  N N   . THR B  1 84  ? 23.838  -64.308 39.685  1.00 19.49  ? 2102 THR B N   1 
ATOM   4739  C CA  . THR B  1 84  ? 24.538  -64.605 40.923  1.00 18.08  ? 2102 THR B CA  1 
ATOM   4740  C C   . THR B  1 84  ? 24.920  -66.074 41.096  1.00 20.43  ? 2102 THR B C   1 
ATOM   4741  O O   . THR B  1 84  ? 24.175  -66.976 40.707  1.00 20.20  ? 2102 THR B O   1 
ATOM   4742  C CB  . THR B  1 84  ? 23.737  -64.144 42.149  1.00 18.76  ? 2102 THR B CB  1 
ATOM   4743  O OG1 . THR B  1 84  ? 24.584  -64.204 43.296  1.00 16.59  ? 2102 THR B OG1 1 
ATOM   4744  C CG2 . THR B  1 84  ? 22.521  -65.036 42.381  1.00 19.58  ? 2102 THR B CG2 1 
ATOM   4745  N N   . ASN B  1 85  ? 26.098  -66.297 41.674  1.00 20.15  ? 2103 ASN B N   1 
ATOM   4746  C CA  . ASN B  1 85  ? 26.615  -67.638 41.914  1.00 22.92  ? 2103 ASN B CA  1 
ATOM   4747  C C   . ASN B  1 85  ? 26.400  -68.058 43.362  1.00 24.53  ? 2103 ASN B C   1 
ATOM   4748  O O   . ASN B  1 85  ? 26.762  -69.166 43.738  1.00 26.08  ? 2103 ASN B O   1 
ATOM   4749  C CB  . ASN B  1 85  ? 28.111  -67.693 41.597  1.00 20.30  ? 2103 ASN B CB  1 
ATOM   4750  C CG  . ASN B  1 85  ? 28.920  -66.743 42.459  1.00 20.34  ? 2103 ASN B CG  1 
ATOM   4751  O OD1 . ASN B  1 85  ? 28.513  -65.603 42.690  1.00 22.45  ? 2103 ASN B OD1 1 
ATOM   4752  N ND2 . ASN B  1 85  ? 30.077  -67.197 42.924  1.00 17.96  ? 2103 ASN B ND2 1 
ATOM   4753  N N   . ARG B  1 86  ? 25.826  -67.171 44.173  1.00 26.07  ? 2104 ARG B N   1 
ATOM   4754  C CA  . ARG B  1 86  ? 25.577  -67.488 45.576  1.00 29.37  ? 2104 ARG B CA  1 
ATOM   4755  C C   . ARG B  1 86  ? 24.224  -68.194 45.760  1.00 29.67  ? 2104 ARG B C   1 
ATOM   4756  O O   . ARG B  1 86  ? 23.341  -68.115 44.901  1.00 27.72  ? 2104 ARG B O   1 
ATOM   4757  C CB  . ARG B  1 86  ? 25.664  -66.212 46.443  1.00 29.41  ? 2104 ARG B CB  1 
ATOM   4758  C CG  . ARG B  1 86  ? 24.867  -65.025 45.925  1.00 32.36  ? 2104 ARG B CG  1 
ATOM   4759  C CD  . ARG B  1 86  ? 24.960  -63.774 46.826  1.00 32.36  ? 2104 ARG B CD  1 
ATOM   4760  N NE  . ARG B  1 86  ? 26.111  -62.904 46.555  1.00 27.01  ? 2104 ARG B NE  1 
ATOM   4761  C CZ  . ARG B  1 86  ? 27.233  -62.907 47.266  1.00 26.73  ? 2104 ARG B CZ  1 
ATOM   4762  N NH1 . ARG B  1 86  ? 27.364  -63.734 48.290  1.00 28.01  ? 2104 ARG B NH1 1 
ATOM   4763  N NH2 . ARG B  1 86  ? 28.219  -62.068 46.973  1.00 24.68  ? 2104 ARG B NH2 1 
ATOM   4764  N N   . LYS B  1 87  ? 24.080  -68.898 46.878  1.00 30.99  ? 2105 LYS B N   1 
ATOM   4765  C CA  . LYS B  1 87  ? 22.859  -69.643 47.182  1.00 34.74  ? 2105 LYS B CA  1 
ATOM   4766  C C   . LYS B  1 87  ? 21.608  -68.772 47.100  1.00 34.82  ? 2105 LYS B C   1 
ATOM   4767  O O   . LYS B  1 87  ? 20.607  -69.160 46.496  1.00 35.08  ? 2105 LYS B O   1 
ATOM   4768  C CB  . LYS B  1 87  ? 22.964  -70.274 48.574  1.00 35.62  ? 2105 LYS B CB  1 
ATOM   4769  C CG  . LYS B  1 87  ? 21.869  -71.280 48.873  1.00 41.30  ? 2105 LYS B CG  1 
ATOM   4770  C CD  . LYS B  1 87  ? 22.047  -71.918 50.246  1.00 43.12  ? 2105 LYS B CD  1 
ATOM   4771  C CE  . LYS B  1 87  ? 20.948  -72.942 50.517  1.00 46.40  ? 2105 LYS B CE  1 
ATOM   4772  N NZ  . LYS B  1 87  ? 21.010  -73.514 51.895  1.00 47.57  ? 2105 LYS B NZ  1 
ATOM   4773  N N   . GLU B  1 88  ? 21.663  -67.594 47.709  1.00 36.29  ? 2106 GLU B N   1 
ATOM   4774  C CA  . GLU B  1 88  ? 20.527  -66.676 47.685  1.00 38.91  ? 2106 GLU B CA  1 
ATOM   4775  C C   . GLU B  1 88  ? 20.955  -65.292 47.220  1.00 37.45  ? 2106 GLU B C   1 
ATOM   4776  O O   . GLU B  1 88  ? 21.963  -64.764 47.682  1.00 36.58  ? 2106 GLU B O   1 
ATOM   4777  C CB  . GLU B  1 88  ? 19.895  -66.579 49.078  1.00 43.14  ? 2106 GLU B CB  1 
ATOM   4778  C CG  . GLU B  1 88  ? 18.748  -65.573 49.180  1.00 48.41  ? 2106 GLU B CG  1 
ATOM   4779  C CD  . GLU B  1 88  ? 18.124  -65.529 50.568  1.00 51.75  ? 2106 GLU B CD  1 
ATOM   4780  O OE1 . GLU B  1 88  ? 18.855  -65.263 51.549  1.00 53.84  ? 2106 GLU B OE1 1 
ATOM   4781  O OE2 . GLU B  1 88  ? 16.900  -65.757 50.676  1.00 54.70  ? 2106 GLU B OE2 1 
ATOM   4782  N N   . ASN B  1 89  ? 20.195  -64.709 46.298  1.00 37.20  ? 2107 ASN B N   1 
ATOM   4783  C CA  . ASN B  1 89  ? 20.524  -63.376 45.809  1.00 37.67  ? 2107 ASN B CA  1 
ATOM   4784  C C   . ASN B  1 89  ? 20.253  -62.386 46.923  1.00 36.82  ? 2107 ASN B C   1 
ATOM   4785  O O   . ASN B  1 89  ? 19.214  -62.445 47.577  1.00 37.23  ? 2107 ASN B O   1 
ATOM   4786  C CB  . ASN B  1 89  ? 19.667  -62.992 44.598  1.00 37.55  ? 2107 ASN B CB  1 
ATOM   4787  C CG  . ASN B  1 89  ? 20.157  -61.712 43.931  1.00 38.65  ? 2107 ASN B CG  1 
ATOM   4788  O OD1 . ASN B  1 89  ? 21.326  -61.618 43.560  1.00 35.94  ? 2107 ASN B OD1 1 
ATOM   4789  N ND2 . ASN B  1 89  ? 19.277  -60.720 43.787  1.00 38.65  ? 2107 ASN B ND2 1 
ATOM   4790  N N   . ILE B  1 90  ? 21.189  -61.475 47.140  1.00 36.30  ? 2108 ILE B N   1 
ATOM   4791  C CA  . ILE B  1 90  ? 21.028  -60.474 48.181  1.00 35.55  ? 2108 ILE B CA  1 
ATOM   4792  C C   . ILE B  1 90  ? 20.478  -59.184 47.579  1.00 35.17  ? 2108 ILE B C   1 
ATOM   4793  O O   . ILE B  1 90  ? 21.025  -58.656 46.610  1.00 35.75  ? 2108 ILE B O   1 
ATOM   4794  C CB  . ILE B  1 90  ? 22.380  -60.185 48.881  1.00 37.25  ? 2108 ILE B CB  1 
ATOM   4795  C CG1 . ILE B  1 90  ? 23.352  -59.523 47.904  1.00 37.45  ? 2108 ILE B CG1 1 
ATOM   4796  C CG2 . ILE B  1 90  ? 22.996  -61.491 49.381  1.00 36.18  ? 2108 ILE B CG2 1 
ATOM   4797  N N   . PRO B  1 91  ? 19.375  -58.665 48.136  1.00 34.77  ? 2109 PRO B N   1 
ATOM   4798  C CA  . PRO B  1 91  ? 18.806  -57.426 47.600  1.00 33.73  ? 2109 PRO B CA  1 
ATOM   4799  C C   . PRO B  1 91  ? 19.791  -56.293 47.850  1.00 31.43  ? 2109 PRO B C   1 
ATOM   4800  O O   . PRO B  1 91  ? 20.432  -56.249 48.895  1.00 30.89  ? 2109 PRO B O   1 
ATOM   4801  C CB  . PRO B  1 91  ? 17.524  -57.266 48.407  1.00 35.16  ? 2109 PRO B CB  1 
ATOM   4802  C CG  . PRO B  1 91  ? 17.938  -57.794 49.751  1.00 37.00  ? 2109 PRO B CG  1 
ATOM   4803  C CD  . PRO B  1 91  ? 18.684  -59.065 49.375  1.00 36.77  ? 2109 PRO B CD  1 
ATOM   4804  N N   . LEU B  1 92  ? 19.924  -55.391 46.886  1.00 29.65  ? 2110 LEU B N   1 
ATOM   4805  C CA  . LEU B  1 92  ? 20.853  -54.278 47.029  1.00 27.98  ? 2110 LEU B CA  1 
ATOM   4806  C C   . LEU B  1 92  ? 20.120  -52.947 46.929  1.00 25.81  ? 2110 LEU B C   1 
ATOM   4807  O O   . LEU B  1 92  ? 19.070  -52.859 46.297  1.00 26.47  ? 2110 LEU B O   1 
ATOM   4808  C CB  . LEU B  1 92  ? 21.939  -54.354 45.943  1.00 26.81  ? 2110 LEU B CB  1 
ATOM   4809  C CG  . LEU B  1 92  ? 22.869  -55.577 45.941  1.00 25.44  ? 2110 LEU B CG  1 
ATOM   4810  C CD1 . LEU B  1 92  ? 23.712  -55.573 44.674  1.00 23.88  ? 2110 LEU B CD1 1 
ATOM   4811  C CD2 . LEU B  1 92  ? 23.755  -55.569 47.181  1.00 22.07  ? 2110 LEU B CD2 1 
ATOM   4812  N N   . LYS B  1 93  ? 20.674  -51.921 47.568  1.00 25.13  ? 2111 LYS B N   1 
ATOM   4813  C CA  . LYS B  1 93  ? 20.095  -50.578 47.538  1.00 24.39  ? 2111 LYS B CA  1 
ATOM   4814  C C   . LYS B  1 93  ? 20.707  -49.775 46.385  1.00 24.12  ? 2111 LYS B C   1 
ATOM   4815  O O   . LYS B  1 93  ? 21.827  -50.056 45.953  1.00 24.95  ? 2111 LYS B O   1 
ATOM   4816  C CB  . LYS B  1 93  ? 20.377  -49.850 48.859  1.00 25.09  ? 2111 LYS B CB  1 
ATOM   4817  C CG  . LYS B  1 93  ? 19.816  -50.539 50.095  1.00 27.40  ? 2111 LYS B CG  1 
ATOM   4818  N N   . LEU B  1 94  ? 19.967  -48.790 45.887  1.00 22.80  ? 2112 LEU B N   1 
ATOM   4819  C CA  . LEU B  1 94  ? 20.443  -47.934 44.807  1.00 23.90  ? 2112 LEU B CA  1 
ATOM   4820  C C   . LEU B  1 94  ? 21.101  -46.699 45.398  1.00 23.19  ? 2112 LEU B C   1 
ATOM   4821  O O   . LEU B  1 94  ? 20.667  -46.200 46.433  1.00 22.93  ? 2112 LEU B O   1 
ATOM   4822  C CB  . LEU B  1 94  ? 19.287  -47.455 43.922  1.00 25.83  ? 2112 LEU B CB  1 
ATOM   4823  C CG  . LEU B  1 94  ? 18.474  -48.438 43.086  1.00 29.64  ? 2112 LEU B CG  1 
ATOM   4824  C CD1 . LEU B  1 94  ? 17.504  -47.653 42.216  1.00 30.17  ? 2112 LEU B CD1 1 
ATOM   4825  C CD2 . LEU B  1 94  ? 19.391  -49.275 42.223  1.00 31.14  ? 2112 LEU B CD2 1 
ATOM   4826  N N   . SER B  1 95  ? 22.142  -46.203 44.741  1.00 20.37  ? 2113 SER B N   1 
ATOM   4827  C CA  . SER B  1 95  ? 22.804  -44.995 45.206  1.00 18.18  ? 2113 SER B CA  1 
ATOM   4828  C C   . SER B  1 95  ? 23.830  -44.468 44.227  1.00 17.24  ? 2113 SER B C   1 
ATOM   4829  O O   . SER B  1 95  ? 24.480  -45.235 43.523  1.00 15.17  ? 2113 SER B O   1 
ATOM   4830  C CB  . SER B  1 95  ? 23.493  -45.228 46.547  1.00 16.49  ? 2113 SER B CB  1 
ATOM   4831  O OG  . SER B  1 95  ? 24.075  -44.021 47.009  1.00 17.97  ? 2113 SER B OG  1 
ATOM   4832  N N   . GLU B  1 96  ? 23.965  -43.147 44.189  1.00 16.41  ? 2114 GLU B N   1 
ATOM   4833  C CA  . GLU B  1 96  ? 24.941  -42.512 43.329  1.00 17.71  ? 2114 GLU B CA  1 
ATOM   4834  C C   . GLU B  1 96  ? 26.303  -42.727 43.981  1.00 18.26  ? 2114 GLU B C   1 
ATOM   4835  O O   . GLU B  1 96  ? 27.334  -42.650 43.319  1.00 16.23  ? 2114 GLU B O   1 
ATOM   4836  C CB  . GLU B  1 96  ? 24.629  -41.020 43.186  1.00 18.07  ? 2114 GLU B CB  1 
ATOM   4837  C CG  . GLU B  1 96  ? 23.322  -40.755 42.454  1.00 21.34  ? 2114 GLU B CG  1 
ATOM   4838  C CD  . GLU B  1 96  ? 22.961  -39.285 42.413  1.00 24.29  ? 2114 GLU B CD  1 
ATOM   4839  O OE1 . GLU B  1 96  ? 22.965  -38.646 43.488  1.00 26.10  ? 2114 GLU B OE1 1 
ATOM   4840  O OE2 . GLU B  1 96  ? 22.670  -38.774 41.312  1.00 24.46  ? 2114 GLU B OE2 1 
ATOM   4841  N N   . ASP B  1 97  ? 26.287  -42.991 45.291  1.00 15.69  ? 2115 ASP B N   1 
ATOM   4842  C CA  . ASP B  1 97  ? 27.500  -43.268 46.062  1.00 16.83  ? 2115 ASP B CA  1 
ATOM   4843  C C   . ASP B  1 97  ? 27.698  -44.772 45.891  1.00 16.04  ? 2115 ASP B C   1 
ATOM   4844  O O   . ASP B  1 97  ? 27.219  -45.572 46.696  1.00 14.12  ? 2115 ASP B O   1 
ATOM   4845  C CB  . ASP B  1 97  ? 27.279  -42.920 47.542  1.00 18.76  ? 2115 ASP B CB  1 
ATOM   4846  C CG  . ASP B  1 97  ? 28.450  -43.330 48.428  1.00 23.03  ? 2115 ASP B CG  1 
ATOM   4847  O OD1 . ASP B  1 97  ? 29.540  -43.627 47.894  1.00 24.26  ? 2115 ASP B OD1 1 
ATOM   4848  O OD2 . ASP B  1 97  ? 28.282  -43.347 49.668  1.00 24.29  ? 2115 ASP B OD2 1 
ATOM   4849  N N   . CYS B  1 98  ? 28.407  -45.148 44.830  1.00 14.82  ? 2116 CYS B N   1 
ATOM   4850  C CA  . CYS B  1 98  ? 28.598  -46.552 44.514  1.00 14.48  ? 2116 CYS B CA  1 
ATOM   4851  C C   . CYS B  1 98  ? 29.995  -46.955 44.060  1.00 14.54  ? 2116 CYS B C   1 
ATOM   4852  O O   . CYS B  1 98  ? 30.186  -48.074 43.581  1.00 15.08  ? 2116 CYS B O   1 
ATOM   4853  C CB  . CYS B  1 98  ? 27.614  -46.929 43.425  1.00 17.30  ? 2116 CYS B CB  1 
ATOM   4854  S SG  . CYS B  1 98  ? 27.931  -46.028 41.871  1.00 21.59  ? 2116 CYS B SG  1 
ATOM   4855  N N   . LEU B  1 99  ? 30.974  -46.072 44.199  1.00 12.33  ? 2117 LEU B N   1 
ATOM   4856  C CA  . LEU B  1 99  ? 32.314  -46.430 43.765  1.00 13.81  ? 2117 LEU B CA  1 
ATOM   4857  C C   . LEU B  1 99  ? 33.035  -47.250 44.828  1.00 12.75  ? 2117 LEU B C   1 
ATOM   4858  O O   . LEU B  1 99  ? 33.896  -46.752 45.556  1.00 13.43  ? 2117 LEU B O   1 
ATOM   4859  C CB  . LEU B  1 99  ? 33.102  -45.172 43.373  1.00 13.23  ? 2117 LEU B CB  1 
ATOM   4860  C CG  . LEU B  1 99  ? 32.492  -44.416 42.176  1.00 14.96  ? 2117 LEU B CG  1 
ATOM   4861  C CD1 . LEU B  1 99  ? 33.402  -43.273 41.778  1.00 13.55  ? 2117 LEU B CD1 1 
ATOM   4862  C CD2 . LEU B  1 99  ? 32.277  -45.359 40.981  1.00 14.06  ? 2117 LEU B CD2 1 
ATOM   4863  N N   . TYR B  1 100 ? 32.664  -48.526 44.898  1.00 11.50  ? 2118 TYR B N   1 
ATOM   4864  C CA  . TYR B  1 100 ? 33.241  -49.464 45.855  1.00 14.84  ? 2118 TYR B CA  1 
ATOM   4865  C C   . TYR B  1 100 ? 33.704  -50.757 45.193  1.00 14.02  ? 2118 TYR B C   1 
ATOM   4866  O O   . TYR B  1 100 ? 33.323  -51.076 44.067  1.00 13.19  ? 2118 TYR B O   1 
ATOM   4867  C CB  . TYR B  1 100 ? 32.209  -49.844 46.921  1.00 17.40  ? 2118 TYR B CB  1 
ATOM   4868  C CG  . TYR B  1 100 ? 31.681  -48.689 47.718  1.00 16.69  ? 2118 TYR B CG  1 
ATOM   4869  C CD1 . TYR B  1 100 ? 30.644  -47.894 47.234  1.00 17.79  ? 2118 TYR B CD1 1 
ATOM   4870  C CD2 . TYR B  1 100 ? 32.237  -48.372 48.955  1.00 19.32  ? 2118 TYR B CD2 1 
ATOM   4871  C CE1 . TYR B  1 100 ? 30.173  -46.806 47.964  1.00 18.87  ? 2118 TYR B CE1 1 
ATOM   4872  C CE2 . TYR B  1 100 ? 31.781  -47.291 49.693  1.00 21.75  ? 2118 TYR B CE2 1 
ATOM   4873  C CZ  . TYR B  1 100 ? 30.751  -46.511 49.196  1.00 22.60  ? 2118 TYR B CZ  1 
ATOM   4874  O OH  . TYR B  1 100 ? 30.313  -45.431 49.934  1.00 26.40  ? 2118 TYR B OH  1 
ATOM   4875  N N   . LEU B  1 101 ? 34.528  -51.504 45.911  1.00 14.79  ? 2119 LEU B N   1 
ATOM   4876  C CA  . LEU B  1 101 ? 35.000  -52.790 45.418  1.00 14.14  ? 2119 LEU B CA  1 
ATOM   4877  C C   . LEU B  1 101 ? 35.032  -53.779 46.573  1.00 15.09  ? 2119 LEU B C   1 
ATOM   4878  O O   . LEU B  1 101 ? 35.197  -53.388 47.736  1.00 15.22  ? 2119 LEU B O   1 
ATOM   4879  C CB  . LEU B  1 101 ? 36.386  -52.655 44.765  1.00 12.89  ? 2119 LEU B CB  1 
ATOM   4880  C CG  . LEU B  1 101 ? 37.522  -51.956 45.512  1.00 15.36  ? 2119 LEU B CG  1 
ATOM   4881  C CD1 . LEU B  1 101 ? 38.132  -52.907 46.554  1.00 15.63  ? 2119 LEU B CD1 1 
ATOM   4882  C CD2 . LEU B  1 101 ? 38.583  -51.532 44.496  1.00 12.81  ? 2119 LEU B CD2 1 
ATOM   4883  N N   . ASN B  1 102 ? 34.839  -55.056 46.251  1.00 13.09  ? 2120 ASN B N   1 
ATOM   4884  C CA  . ASN B  1 102 ? 34.851  -56.118 47.250  1.00 13.62  ? 2120 ASN B CA  1 
ATOM   4885  C C   . ASN B  1 102 ? 36.089  -56.968 46.999  1.00 13.69  ? 2120 ASN B C   1 
ATOM   4886  O O   . ASN B  1 102 ? 36.477  -57.190 45.848  1.00 13.45  ? 2120 ASN B O   1 
ATOM   4887  C CB  . ASN B  1 102 ? 33.593  -56.993 47.130  1.00 11.26  ? 2120 ASN B CB  1 
ATOM   4888  C CG  . ASN B  1 102 ? 32.304  -56.198 47.291  1.00 15.53  ? 2120 ASN B CG  1 
ATOM   4889  O OD1 . ASN B  1 102 ? 32.249  -55.219 48.042  1.00 15.79  ? 2120 ASN B OD1 1 
ATOM   4890  N ND2 . ASN B  1 102 ? 31.255  -56.630 46.603  1.00 15.80  ? 2120 ASN B ND2 1 
ATOM   4891  N N   . ILE B  1 103 ? 36.693  -57.458 48.072  1.00 12.52  ? 2121 ILE B N   1 
ATOM   4892  C CA  . ILE B  1 103 ? 37.899  -58.261 47.965  1.00 13.63  ? 2121 ILE B CA  1 
ATOM   4893  C C   . ILE B  1 103 ? 37.787  -59.615 48.655  1.00 16.99  ? 2121 ILE B C   1 
ATOM   4894  O O   . ILE B  1 103 ? 37.327  -59.717 49.803  1.00 15.23  ? 2121 ILE B O   1 
ATOM   4895  C CB  . ILE B  1 103 ? 39.111  -57.523 48.579  1.00 12.74  ? 2121 ILE B CB  1 
ATOM   4896  C CG1 . ILE B  1 103 ? 39.306  -56.173 47.884  1.00 14.25  ? 2121 ILE B CG1 1 
ATOM   4897  C CG2 . ILE B  1 103 ? 40.367  -58.389 48.467  1.00 16.01  ? 2121 ILE B CG2 1 
ATOM   4898  C CD1 . ILE B  1 103 ? 40.506  -55.390 48.388  1.00 15.76  ? 2121 ILE B CD1 1 
ATOM   4899  N N   . TYR B  1 104 ? 38.217  -60.654 47.946  1.00 15.59  ? 2122 TYR B N   1 
ATOM   4900  C CA  . TYR B  1 104 ? 38.219  -62.005 48.488  1.00 16.80  ? 2122 TYR B CA  1 
ATOM   4901  C C   . TYR B  1 104 ? 39.655  -62.506 48.376  1.00 16.68  ? 2122 TYR B C   1 
ATOM   4902  O O   . TYR B  1 104 ? 40.149  -62.764 47.270  1.00 17.20  ? 2122 TYR B O   1 
ATOM   4903  C CB  . TYR B  1 104 ? 37.279  -62.921 47.692  1.00 15.70  ? 2122 TYR B CB  1 
ATOM   4904  C CG  . TYR B  1 104 ? 35.861  -62.399 47.583  1.00 17.91  ? 2122 TYR B CG  1 
ATOM   4905  C CD1 . TYR B  1 104 ? 35.557  -61.334 46.740  1.00 16.14  ? 2122 TYR B CD1 1 
ATOM   4906  C CD2 . TYR B  1 104 ? 34.825  -62.954 48.342  1.00 17.42  ? 2122 TYR B CD2 1 
ATOM   4907  C CE1 . TYR B  1 104 ? 34.265  -60.829 46.651  1.00 16.28  ? 2122 TYR B CE1 1 
ATOM   4908  C CE2 . TYR B  1 104 ? 33.523  -62.453 48.259  1.00 16.50  ? 2122 TYR B CE2 1 
ATOM   4909  C CZ  . TYR B  1 104 ? 33.254  -61.390 47.409  1.00 17.26  ? 2122 TYR B CZ  1 
ATOM   4910  O OH  . TYR B  1 104 ? 31.975  -60.887 47.299  1.00 18.32  ? 2122 TYR B OH  1 
ATOM   4911  N N   . THR B  1 105 ? 40.336  -62.610 49.512  1.00 14.37  ? 2123 THR B N   1 
ATOM   4912  C CA  . THR B  1 105 ? 41.713  -63.080 49.520  1.00 17.27  ? 2123 THR B CA  1 
ATOM   4913  C C   . THR B  1 105 ? 41.887  -64.330 50.374  1.00 17.83  ? 2123 THR B C   1 
ATOM   4914  O O   . THR B  1 105 ? 41.549  -64.343 51.558  1.00 19.09  ? 2123 THR B O   1 
ATOM   4915  C CB  . THR B  1 105 ? 42.687  -61.983 50.008  1.00 16.16  ? 2123 THR B CB  1 
ATOM   4916  O OG1 . THR B  1 105 ? 44.020  -62.509 50.021  1.00 18.99  ? 2123 THR B OG1 1 
ATOM   4917  C CG2 . THR B  1 105 ? 42.322  -61.508 51.414  1.00 20.29  ? 2123 THR B CG2 1 
ATOM   4918  N N   . PRO B  1 106 ? 42.419  -65.404 49.773  1.00 20.12  ? 2124 PRO B N   1 
ATOM   4919  C CA  . PRO B  1 106 ? 42.646  -66.678 50.458  1.00 21.18  ? 2124 PRO B CA  1 
ATOM   4920  C C   . PRO B  1 106 ? 44.001  -66.706 51.144  1.00 22.69  ? 2124 PRO B C   1 
ATOM   4921  O O   . PRO B  1 106 ? 44.357  -67.689 51.785  1.00 24.12  ? 2124 PRO B O   1 
ATOM   4922  C CB  . PRO B  1 106 ? 42.569  -67.683 49.318  1.00 22.01  ? 2124 PRO B CB  1 
ATOM   4923  C CG  . PRO B  1 106 ? 43.288  -66.946 48.226  1.00 21.27  ? 2124 PRO B CG  1 
ATOM   4924  C CD  . PRO B  1 106 ? 42.735  -65.523 48.334  1.00 19.29  ? 2124 PRO B CD  1 
ATOM   4925  N N   . ALA B  1 107 ? 44.755  -65.621 51.005  1.00 24.58  ? 2125 ALA B N   1 
ATOM   4926  C CA  . ALA B  1 107 ? 46.082  -65.544 51.602  1.00 25.98  ? 2125 ALA B CA  1 
ATOM   4927  C C   . ALA B  1 107 ? 46.035  -65.431 53.120  1.00 27.78  ? 2125 ALA B C   1 
ATOM   4928  O O   . ALA B  1 107 ? 45.105  -64.853 53.681  1.00 26.32  ? 2125 ALA B O   1 
ATOM   4929  C CB  . ALA B  1 107 ? 46.842  -64.358 51.024  1.00 27.06  ? 2125 ALA B CB  1 
ATOM   4930  N N   . ASP B  1 108 ? 47.034  -66.006 53.782  1.00 28.95  ? 2126 ASP B N   1 
ATOM   4931  C CA  . ASP B  1 108 ? 47.126  -65.912 55.234  1.00 31.08  ? 2126 ASP B CA  1 
ATOM   4932  C C   . ASP B  1 108 ? 47.772  -64.553 55.469  1.00 30.72  ? 2126 ASP B C   1 
ATOM   4933  O O   . ASP B  1 108 ? 48.974  -64.381 55.270  1.00 29.72  ? 2126 ASP B O   1 
ATOM   4934  C CB  . ASP B  1 108 ? 48.004  -67.033 55.793  1.00 34.06  ? 2126 ASP B CB  1 
ATOM   4935  C CG  . ASP B  1 108 ? 48.367  -66.819 57.253  1.00 37.87  ? 2126 ASP B CG  1 
ATOM   4936  O OD1 . ASP B  1 108 ? 47.506  -66.340 58.025  1.00 37.87  ? 2126 ASP B OD1 1 
ATOM   4937  O OD2 . ASP B  1 108 ? 49.514  -67.142 57.630  1.00 40.88  ? 2126 ASP B OD2 1 
ATOM   4938  N N   . LEU B  1 109 ? 46.962  -63.585 55.882  1.00 30.96  ? 2127 LEU B N   1 
ATOM   4939  C CA  . LEU B  1 109 ? 47.438  -62.227 56.093  1.00 33.27  ? 2127 LEU B CA  1 
ATOM   4940  C C   . LEU B  1 109 ? 48.497  -62.027 57.171  1.00 34.01  ? 2127 LEU B C   1 
ATOM   4941  O O   . LEU B  1 109 ? 49.021  -60.923 57.314  1.00 33.53  ? 2127 LEU B O   1 
ATOM   4942  C CB  . LEU B  1 109 ? 46.244  -61.302 56.352  1.00 33.66  ? 2127 LEU B CB  1 
ATOM   4943  C CG  . LEU B  1 109 ? 45.237  -61.266 55.196  1.00 33.80  ? 2127 LEU B CG  1 
ATOM   4944  C CD1 . LEU B  1 109 ? 44.079  -60.349 55.545  1.00 34.95  ? 2127 LEU B CD1 1 
ATOM   4945  C CD2 . LEU B  1 109 ? 45.927  -60.787 53.928  1.00 32.86  ? 2127 LEU B CD2 1 
ATOM   4946  N N   . THR B  1 110 ? 48.820  -63.077 57.922  1.00 35.50  ? 2128 THR B N   1 
ATOM   4947  C CA  . THR B  1 110 ? 49.837  -62.957 58.966  1.00 37.52  ? 2128 THR B CA  1 
ATOM   4948  C C   . THR B  1 110 ? 51.217  -63.266 58.396  1.00 39.09  ? 2128 THR B C   1 
ATOM   4949  O O   . THR B  1 110 ? 52.211  -63.304 59.120  1.00 39.31  ? 2128 THR B O   1 
ATOM   4950  C CB  . THR B  1 110 ? 49.561  -63.904 60.151  1.00 36.78  ? 2128 THR B CB  1 
ATOM   4951  O OG1 . THR B  1 110 ? 49.679  -65.264 59.722  1.00 36.37  ? 2128 THR B OG1 1 
ATOM   4952  C CG2 . THR B  1 110 ? 48.164  -63.665 60.700  1.00 37.05  ? 2128 THR B CG2 1 
ATOM   4953  N N   . LYS B  1 111 ? 51.265  -63.479 57.087  1.00 39.93  ? 2129 LYS B N   1 
ATOM   4954  C CA  . LYS B  1 111 ? 52.510  -63.771 56.392  1.00 41.38  ? 2129 LYS B CA  1 
ATOM   4955  C C   . LYS B  1 111 ? 52.507  -62.971 55.098  1.00 40.97  ? 2129 LYS B C   1 
ATOM   4956  O O   . LYS B  1 111 ? 51.463  -62.476 54.678  1.00 41.03  ? 2129 LYS B O   1 
ATOM   4957  C CB  . LYS B  1 111 ? 52.600  -65.269 56.082  1.00 43.26  ? 2129 LYS B CB  1 
ATOM   4958  C CG  . LYS B  1 111 ? 52.458  -66.151 57.313  1.00 47.33  ? 2129 LYS B CG  1 
ATOM   4959  C CD  . LYS B  1 111 ? 52.546  -67.629 56.972  1.00 49.77  ? 2129 LYS B CD  1 
ATOM   4960  C CE  . LYS B  1 111 ? 52.363  -68.486 58.221  1.00 51.68  ? 2129 LYS B CE  1 
ATOM   4961  N NZ  . LYS B  1 111 ? 52.449  -69.946 57.925  1.00 52.51  ? 2129 LYS B NZ  1 
ATOM   4962  N N   . LYS B  1 112 ? 53.667  -62.826 54.469  1.00 40.69  ? 2130 LYS B N   1 
ATOM   4963  C CA  . LYS B  1 112 ? 53.732  -62.084 53.217  1.00 40.27  ? 2130 LYS B CA  1 
ATOM   4964  C C   . LYS B  1 112 ? 53.285  -62.985 52.075  1.00 37.54  ? 2130 LYS B C   1 
ATOM   4965  O O   . LYS B  1 112 ? 53.663  -64.155 52.013  1.00 38.20  ? 2130 LYS B O   1 
ATOM   4966  C CB  . LYS B  1 112 ? 55.154  -61.583 52.944  1.00 42.97  ? 2130 LYS B CB  1 
ATOM   4967  C CG  . LYS B  1 112 ? 55.269  -60.797 51.639  1.00 46.85  ? 2130 LYS B CG  1 
ATOM   4968  C CD  . LYS B  1 112 ? 56.678  -60.270 51.395  1.00 48.90  ? 2130 LYS B CD  1 
ATOM   4969  C CE  . LYS B  1 112 ? 56.750  -59.513 50.075  1.00 49.87  ? 2130 LYS B CE  1 
ATOM   4970  N NZ  . LYS B  1 112 ? 58.100  -58.940 49.807  1.00 52.47  ? 2130 LYS B NZ  1 
ATOM   4971  N N   . ASN B  1 113 ? 52.472  -62.433 51.180  1.00 34.13  ? 2131 ASN B N   1 
ATOM   4972  C CA  . ASN B  1 113 ? 51.965  -63.170 50.031  1.00 30.93  ? 2131 ASN B CA  1 
ATOM   4973  C C   . ASN B  1 113 ? 51.967  -62.259 48.820  1.00 29.06  ? 2131 ASN B C   1 
ATOM   4974  O O   . ASN B  1 113 ? 51.844  -61.047 48.952  1.00 29.04  ? 2131 ASN B O   1 
ATOM   4975  C CB  . ASN B  1 113 ? 50.530  -63.642 50.276  1.00 31.91  ? 2131 ASN B CB  1 
ATOM   4976  C CG  . ASN B  1 113 ? 50.419  -64.600 51.436  1.00 34.59  ? 2131 ASN B CG  1 
ATOM   4977  O OD1 . ASN B  1 113 ? 50.764  -65.775 51.321  1.00 35.45  ? 2131 ASN B OD1 1 
ATOM   4978  N ND2 . ASN B  1 113 ? 49.941  -64.100 52.570  1.00 35.75  ? 2131 ASN B ND2 1 
ATOM   4979  N N   . ARG B  1 114 ? 52.100  -62.854 47.641  1.00 27.94  ? 2132 ARG B N   1 
ATOM   4980  C CA  . ARG B  1 114 ? 52.094  -62.111 46.387  1.00 28.23  ? 2132 ARG B CA  1 
ATOM   4981  C C   . ARG B  1 114 ? 51.329  -62.957 45.383  1.00 26.17  ? 2132 ARG B C   1 
ATOM   4982  O O   . ARG B  1 114 ? 51.866  -63.374 44.357  1.00 26.13  ? 2132 ARG B O   1 
ATOM   4983  C CB  . ARG B  1 114 ? 53.520  -61.867 45.882  1.00 31.09  ? 2132 ARG B CB  1 
ATOM   4984  C CG  . ARG B  1 114 ? 54.276  -60.742 46.594  1.00 37.65  ? 2132 ARG B CG  1 
ATOM   4985  C CD  . ARG B  1 114 ? 53.661  -59.367 46.305  1.00 42.19  ? 2132 ARG B CD  1 
ATOM   4986  N NE  . ARG B  1 114 ? 52.720  -58.945 47.341  1.00 45.91  ? 2132 ARG B NE  1 
ATOM   4987  C CZ  . ARG B  1 114 ? 53.080  -58.492 48.539  1.00 47.93  ? 2132 ARG B CZ  1 
ATOM   4988  N NH1 . ARG B  1 114 ? 54.363  -58.393 48.857  1.00 48.94  ? 2132 ARG B NH1 1 
ATOM   4989  N NH2 . ARG B  1 114 ? 52.157  -58.151 49.428  1.00 49.15  ? 2132 ARG B NH2 1 
ATOM   4990  N N   . LEU B  1 115 ? 50.063  -63.204 45.694  1.00 23.48  ? 2133 LEU B N   1 
ATOM   4991  C CA  . LEU B  1 115 ? 49.215  -64.011 44.840  1.00 21.14  ? 2133 LEU B CA  1 
ATOM   4992  C C   . LEU B  1 115 ? 48.723  -63.246 43.624  1.00 19.53  ? 2133 LEU B C   1 
ATOM   4993  O O   . LEU B  1 115 ? 48.681  -62.015 43.615  1.00 19.90  ? 2133 LEU B O   1 
ATOM   4994  C CB  . LEU B  1 115 ? 48.009  -64.512 45.630  1.00 20.76  ? 2133 LEU B CB  1 
ATOM   4995  C CG  . LEU B  1 115 ? 48.294  -65.314 46.900  1.00 23.67  ? 2133 LEU B CG  1 
ATOM   4996  C CD1 . LEU B  1 115 ? 46.974  -65.655 47.575  1.00 24.43  ? 2133 LEU B CD1 1 
ATOM   4997  C CD2 . LEU B  1 115 ? 49.073  -66.588 46.551  1.00 24.21  ? 2133 LEU B CD2 1 
ATOM   4998  N N   . PRO B  1 116 ? 48.359  -63.973 42.564  1.00 18.64  ? 2134 PRO B N   1 
ATOM   4999  C CA  . PRO B  1 116 ? 47.865  -63.280 41.373  1.00 18.22  ? 2134 PRO B CA  1 
ATOM   5000  C C   . PRO B  1 116 ? 46.539  -62.599 41.721  1.00 17.21  ? 2134 PRO B C   1 
ATOM   5001  O O   . PRO B  1 116 ? 45.799  -63.061 42.597  1.00 17.50  ? 2134 PRO B O   1 
ATOM   5002  C CB  . PRO B  1 116 ? 47.713  -64.407 40.347  1.00 20.13  ? 2134 PRO B CB  1 
ATOM   5003  C CG  . PRO B  1 116 ? 47.548  -65.648 41.195  1.00 23.07  ? 2134 PRO B CG  1 
ATOM   5004  C CD  . PRO B  1 116 ? 48.513  -65.418 42.324  1.00 19.53  ? 2134 PRO B CD  1 
ATOM   5005  N N   . VAL B  1 117 ? 46.248  -61.493 41.051  1.00 16.16  ? 2135 VAL B N   1 
ATOM   5006  C CA  . VAL B  1 117 ? 45.021  -60.749 41.316  1.00 13.78  ? 2135 VAL B CA  1 
ATOM   5007  C C   . VAL B  1 117 ? 44.099  -60.767 40.114  1.00 14.19  ? 2135 VAL B C   1 
ATOM   5008  O O   . VAL B  1 117 ? 44.522  -60.461 38.997  1.00 15.80  ? 2135 VAL B O   1 
ATOM   5009  C CB  . VAL B  1 117 ? 45.337  -59.275 41.668  1.00 12.92  ? 2135 VAL B CB  1 
ATOM   5010  C CG1 . VAL B  1 117 ? 44.046  -58.518 41.990  1.00 11.74  ? 2135 VAL B CG1 1 
ATOM   5011  C CG2 . VAL B  1 117 ? 46.307  -59.224 42.833  1.00 11.47  ? 2135 VAL B CG2 1 
ATOM   5012  N N   . MET B  1 118 ? 42.840  -61.137 40.342  1.00 12.66  ? 2136 MET B N   1 
ATOM   5013  C CA  . MET B  1 118 ? 41.847  -61.173 39.282  1.00 11.99  ? 2136 MET B CA  1 
ATOM   5014  C C   . MET B  1 118 ? 40.768  -60.141 39.603  1.00 13.60  ? 2136 MET B C   1 
ATOM   5015  O O   . MET B  1 118 ? 40.052  -60.258 40.606  1.00 12.86  ? 2136 MET B O   1 
ATOM   5016  C CB  . MET B  1 118 ? 41.254  -62.581 39.164  1.00 12.80  ? 2136 MET B CB  1 
ATOM   5017  C CG  . MET B  1 118 ? 42.290  -63.621 38.728  1.00 14.55  ? 2136 MET B CG  1 
ATOM   5018  S SD  . MET B  1 118 ? 41.582  -65.210 38.249  1.00 16.00  ? 2136 MET B SD  1 
ATOM   5019  C CE  . MET B  1 118 ? 40.929  -64.830 36.642  1.00 11.50  ? 2136 MET B CE  1 
ATOM   5020  N N   . VAL B  1 119 ? 40.683  -59.114 38.761  1.00 12.90  ? 2137 VAL B N   1 
ATOM   5021  C CA  . VAL B  1 119 ? 39.728  -58.017 38.943  1.00 12.34  ? 2137 VAL B CA  1 
ATOM   5022  C C   . VAL B  1 119 ? 38.570  -58.173 37.973  1.00 13.41  ? 2137 VAL B C   1 
ATOM   5023  O O   . VAL B  1 119 ? 38.738  -58.048 36.756  1.00 12.97  ? 2137 VAL B O   1 
ATOM   5024  C CB  . VAL B  1 119 ? 40.421  -56.648 38.713  1.00 12.60  ? 2137 VAL B CB  1 
ATOM   5025  C CG1 . VAL B  1 119 ? 39.439  -55.505 38.950  1.00 11.53  ? 2137 VAL B CG1 1 
ATOM   5026  C CG2 . VAL B  1 119 ? 41.620  -56.520 39.624  1.00 9.09   ? 2137 VAL B CG2 1 
ATOM   5027  N N   . TRP B  1 120 ? 37.391  -58.439 38.526  1.00 12.66  ? 2138 TRP B N   1 
ATOM   5028  C CA  . TRP B  1 120 ? 36.178  -58.657 37.748  1.00 11.02  ? 2138 TRP B CA  1 
ATOM   5029  C C   . TRP B  1 120 ? 35.372  -57.392 37.484  1.00 11.78  ? 2138 TRP B C   1 
ATOM   5030  O O   . TRP B  1 120 ? 35.124  -56.598 38.393  1.00 11.28  ? 2138 TRP B O   1 
ATOM   5031  C CB  . TRP B  1 120 ? 35.291  -59.686 38.472  1.00 11.83  ? 2138 TRP B CB  1 
ATOM   5032  C CG  . TRP B  1 120 ? 33.943  -59.932 37.828  1.00 12.37  ? 2138 TRP B CG  1 
ATOM   5033  C CD1 . TRP B  1 120 ? 32.728  -59.451 38.246  1.00 13.03  ? 2138 TRP B CD1 1 
ATOM   5034  C CD2 . TRP B  1 120 ? 33.681  -60.700 36.643  1.00 13.20  ? 2138 TRP B CD2 1 
ATOM   5035  N NE1 . TRP B  1 120 ? 31.732  -59.872 37.394  1.00 12.60  ? 2138 TRP B NE1 1 
ATOM   5036  C CE2 . TRP B  1 120 ? 32.289  -60.637 36.402  1.00 13.25  ? 2138 TRP B CE2 1 
ATOM   5037  C CE3 . TRP B  1 120 ? 34.488  -61.433 35.761  1.00 14.73  ? 2138 TRP B CE3 1 
ATOM   5038  C CZ2 . TRP B  1 120 ? 31.687  -61.280 35.313  1.00 14.61  ? 2138 TRP B CZ2 1 
ATOM   5039  C CZ3 . TRP B  1 120 ? 33.889  -62.076 34.677  1.00 14.58  ? 2138 TRP B CZ3 1 
ATOM   5040  C CH2 . TRP B  1 120 ? 32.501  -61.993 34.464  1.00 15.72  ? 2138 TRP B CH2 1 
ATOM   5041  N N   . ILE B  1 121 ? 34.966  -57.225 36.228  1.00 9.78   ? 2139 ILE B N   1 
ATOM   5042  C CA  . ILE B  1 121 ? 34.156  -56.096 35.807  1.00 13.01  ? 2139 ILE B CA  1 
ATOM   5043  C C   . ILE B  1 121 ? 32.841  -56.688 35.312  1.00 13.70  ? 2139 ILE B C   1 
ATOM   5044  O O   . ILE B  1 121 ? 32.793  -57.373 34.279  1.00 14.20  ? 2139 ILE B O   1 
ATOM   5045  C CB  . ILE B  1 121 ? 34.834  -55.303 34.668  1.00 13.78  ? 2139 ILE B CB  1 
ATOM   5046  C CG1 . ILE B  1 121 ? 36.256  -54.903 35.097  1.00 14.47  ? 2139 ILE B CG1 1 
ATOM   5047  C CG2 . ILE B  1 121 ? 34.009  -54.060 34.340  1.00 11.57  ? 2139 ILE B CG2 1 
ATOM   5048  C CD1 . ILE B  1 121 ? 37.015  -54.109 34.045  1.00 16.11  ? 2139 ILE B CD1 1 
ATOM   5049  N N   . HIS B  1 122 ? 31.768  -56.415 36.046  1.00 12.78  ? 2140 HIS B N   1 
ATOM   5050  C CA  . HIS B  1 122 ? 30.449  -56.952 35.711  1.00 11.72  ? 2140 HIS B CA  1 
ATOM   5051  C C   . HIS B  1 122 ? 29.799  -56.371 34.467  1.00 12.95  ? 2140 HIS B C   1 
ATOM   5052  O O   . HIS B  1 122 ? 30.074  -55.237 34.058  1.00 12.90  ? 2140 HIS B O   1 
ATOM   5053  C CB  . HIS B  1 122 ? 29.494  -56.784 36.908  1.00 11.56  ? 2140 HIS B CB  1 
ATOM   5054  C CG  . HIS B  1 122 ? 29.056  -55.370 37.137  1.00 10.14  ? 2140 HIS B CG  1 
ATOM   5055  N ND1 . HIS B  1 122 ? 28.119  -54.744 36.343  1.00 12.89  ? 2140 HIS B ND1 1 
ATOM   5056  C CD2 . HIS B  1 122 ? 29.454  -54.447 38.045  1.00 10.45  ? 2140 HIS B CD2 1 
ATOM   5057  C CE1 . HIS B  1 122 ? 27.960  -53.497 36.750  1.00 11.34  ? 2140 HIS B CE1 1 
ATOM   5058  N NE2 . HIS B  1 122 ? 28.760  -53.291 37.781  1.00 12.42  ? 2140 HIS B NE2 1 
ATOM   5059  N N   . GLY B  1 123 ? 28.915  -57.171 33.880  1.00 10.56  ? 2141 GLY B N   1 
ATOM   5060  C CA  . GLY B  1 123 ? 28.193  -56.756 32.700  1.00 14.43  ? 2141 GLY B CA  1 
ATOM   5061  C C   . GLY B  1 123 ? 26.836  -56.182 33.074  1.00 14.41  ? 2141 GLY B C   1 
ATOM   5062  O O   . GLY B  1 123 ? 26.521  -56.017 34.256  1.00 14.77  ? 2141 GLY B O   1 
ATOM   5063  N N   . GLY B  1 124 ? 26.032  -55.887 32.061  1.00 15.54  ? 2142 GLY B N   1 
ATOM   5064  C CA  . GLY B  1 124 ? 24.722  -55.306 32.292  1.00 16.30  ? 2142 GLY B CA  1 
ATOM   5065  C C   . GLY B  1 124 ? 24.488  -54.138 31.351  1.00 16.75  ? 2142 GLY B C   1 
ATOM   5066  O O   . GLY B  1 124 ? 23.831  -53.158 31.709  1.00 17.05  ? 2142 GLY B O   1 
ATOM   5067  N N   . GLY B  1 125 ? 25.048  -54.241 30.146  1.00 16.01  ? 2143 GLY B N   1 
ATOM   5068  C CA  . GLY B  1 125 ? 24.880  -53.213 29.133  1.00 13.80  ? 2143 GLY B CA  1 
ATOM   5069  C C   . GLY B  1 125 ? 25.306  -51.807 29.511  1.00 13.84  ? 2143 GLY B C   1 
ATOM   5070  O O   . GLY B  1 125 ? 24.890  -50.850 28.857  1.00 15.08  ? 2143 GLY B O   1 
ATOM   5071  N N   . LEU B  1 126 ? 26.147  -51.683 30.535  1.00 11.96  ? 2144 LEU B N   1 
ATOM   5072  C CA  . LEU B  1 126 ? 26.614  -50.381 31.020  1.00 13.77  ? 2144 LEU B CA  1 
ATOM   5073  C C   . LEU B  1 126 ? 25.437  -49.576 31.611  1.00 14.72  ? 2144 LEU B C   1 
ATOM   5074  O O   . LEU B  1 126 ? 25.567  -48.387 31.920  1.00 12.14  ? 2144 LEU B O   1 
ATOM   5075  C CB  . LEU B  1 126 ? 27.289  -49.585 29.888  1.00 12.08  ? 2144 LEU B CB  1 
ATOM   5076  C CG  . LEU B  1 126 ? 28.522  -50.228 29.224  1.00 14.41  ? 2144 LEU B CG  1 
ATOM   5077  C CD1 . LEU B  1 126 ? 29.110  -49.283 28.186  1.00 13.68  ? 2144 LEU B CD1 1 
ATOM   5078  C CD2 . LEU B  1 126 ? 29.569  -50.556 30.282  1.00 13.31  ? 2144 LEU B CD2 1 
ATOM   5079  N N   . MET B  1 127 ? 24.299  -50.247 31.785  1.00 14.56  ? 2145 MET B N   1 
ATOM   5080  C CA  . MET B  1 127 ? 23.091  -49.614 32.319  1.00 15.84  ? 2145 MET B CA  1 
ATOM   5081  C C   . MET B  1 127 ? 22.697  -50.170 33.687  1.00 16.13  ? 2145 MET B C   1 
ATOM   5082  O O   . MET B  1 127 ? 22.116  -49.456 34.503  1.00 16.74  ? 2145 MET B O   1 
ATOM   5083  C CB  . MET B  1 127 ? 21.921  -49.808 31.354  1.00 14.96  ? 2145 MET B CB  1 
ATOM   5084  C CG  . MET B  1 127 ? 22.132  -49.228 29.955  1.00 19.29  ? 2145 MET B CG  1 
ATOM   5085  S SD  . MET B  1 127 ? 22.274  -47.420 29.927  1.00 24.61  ? 2145 MET B SD  1 
ATOM   5086  C CE  . MET B  1 127 ? 20.815  -46.966 30.905  1.00 21.96  ? 2145 MET B CE  1 
ATOM   5087  N N   . VAL B  1 128 ? 22.997  -51.446 33.924  1.00 14.24  ? 2146 VAL B N   1 
ATOM   5088  C CA  . VAL B  1 128 ? 22.677  -52.086 35.194  1.00 16.59  ? 2146 VAL B CA  1 
ATOM   5089  C C   . VAL B  1 128 ? 23.799  -53.024 35.617  1.00 16.46  ? 2146 VAL B C   1 
ATOM   5090  O O   . VAL B  1 128 ? 24.780  -53.188 34.902  1.00 16.19  ? 2146 VAL B O   1 
ATOM   5091  C CB  . VAL B  1 128 ? 21.386  -52.918 35.097  1.00 17.00  ? 2146 VAL B CB  1 
ATOM   5092  C CG1 . VAL B  1 128 ? 20.219  -52.027 34.695  1.00 17.70  ? 2146 VAL B CG1 1 
ATOM   5093  C CG2 . VAL B  1 128 ? 21.582  -54.056 34.087  1.00 17.30  ? 2146 VAL B CG2 1 
ATOM   5094  N N   . GLY B  1 129 ? 23.639  -53.643 36.783  1.00 16.26  ? 2147 GLY B N   1 
ATOM   5095  C CA  . GLY B  1 129 ? 24.640  -54.570 37.272  1.00 13.69  ? 2147 GLY B CA  1 
ATOM   5096  C C   . GLY B  1 129 ? 25.204  -54.141 38.607  1.00 14.35  ? 2147 GLY B C   1 
ATOM   5097  O O   . GLY B  1 129 ? 24.980  -53.017 39.046  1.00 16.52  ? 2147 GLY B O   1 
ATOM   5098  N N   . ALA B  1 130 ? 25.942  -55.036 39.246  1.00 13.65  ? 2148 ALA B N   1 
ATOM   5099  C CA  . ALA B  1 130 ? 26.547  -54.757 40.538  1.00 13.76  ? 2148 ALA B CA  1 
ATOM   5100  C C   . ALA B  1 130 ? 27.660  -55.760 40.814  1.00 14.04  ? 2148 ALA B C   1 
ATOM   5101  O O   . ALA B  1 130 ? 27.608  -56.898 40.359  1.00 13.27  ? 2148 ALA B O   1 
ATOM   5102  C CB  . ALA B  1 130 ? 25.487  -54.837 41.642  1.00 14.55  ? 2148 ALA B CB  1 
ATOM   5103  N N   . ALA B  1 131 ? 28.663  -55.333 41.571  1.00 14.43  ? 2149 ALA B N   1 
ATOM   5104  C CA  . ALA B  1 131 ? 29.777  -56.199 41.913  1.00 14.07  ? 2149 ALA B CA  1 
ATOM   5105  C C   . ALA B  1 131 ? 29.362  -57.298 42.890  1.00 16.24  ? 2149 ALA B C   1 
ATOM   5106  O O   . ALA B  1 131 ? 29.794  -58.455 42.764  1.00 15.44  ? 2149 ALA B O   1 
ATOM   5107  C CB  . ALA B  1 131 ? 30.891  -55.376 42.515  1.00 12.29  ? 2149 ALA B CB  1 
ATOM   5108  N N   . SER B  1 132 ? 28.514  -56.934 43.854  1.00 14.89  ? 2150 SER B N   1 
ATOM   5109  C CA  . SER B  1 132 ? 28.062  -57.857 44.892  1.00 17.92  ? 2150 SER B CA  1 
ATOM   5110  C C   . SER B  1 132 ? 27.319  -59.091 44.395  1.00 19.08  ? 2150 SER B C   1 
ATOM   5111  O O   . SER B  1 132 ? 27.180  -60.079 45.121  1.00 18.32  ? 2150 SER B O   1 
ATOM   5112  C CB  . SER B  1 132 ? 27.200  -57.106 45.909  1.00 17.32  ? 2150 SER B CB  1 
ATOM   5113  O OG  . SER B  1 132 ? 27.951  -56.057 46.493  1.00 18.07  ? 2150 SER B OG  1 
ATOM   5114  N N   . THR B  1 133 ? 26.836  -59.031 43.163  1.00 19.17  ? 2151 THR B N   1 
ATOM   5115  C CA  . THR B  1 133 ? 26.138  -60.159 42.567  1.00 18.55  ? 2151 THR B CA  1 
ATOM   5116  C C   . THR B  1 133 ? 27.084  -61.361 42.488  1.00 18.38  ? 2151 THR B C   1 
ATOM   5117  O O   . THR B  1 133 ? 26.651  -62.521 42.544  1.00 18.68  ? 2151 THR B O   1 
ATOM   5118  C CB  . THR B  1 133 ? 25.665  -59.803 41.143  1.00 20.64  ? 2151 THR B CB  1 
ATOM   5119  O OG1 . THR B  1 133 ? 24.618  -58.828 41.220  1.00 20.48  ? 2151 THR B OG1 1 
ATOM   5120  C CG2 . THR B  1 133 ? 25.167  -61.050 40.400  1.00 21.61  ? 2151 THR B CG2 1 
ATOM   5121  N N   . TYR B  1 134 ? 28.380  -61.076 42.383  1.00 17.47  ? 2152 TYR B N   1 
ATOM   5122  C CA  . TYR B  1 134 ? 29.389  -62.119 42.249  1.00 15.73  ? 2152 TYR B CA  1 
ATOM   5123  C C   . TYR B  1 134 ? 30.215  -62.398 43.495  1.00 17.50  ? 2152 TYR B C   1 
ATOM   5124  O O   . TYR B  1 134 ? 30.970  -61.550 43.967  1.00 20.04  ? 2152 TYR B O   1 
ATOM   5125  C CB  . TYR B  1 134 ? 30.322  -61.780 41.085  1.00 14.07  ? 2152 TYR B CB  1 
ATOM   5126  C CG  . TYR B  1 134 ? 29.573  -61.353 39.852  1.00 13.96  ? 2152 TYR B CG  1 
ATOM   5127  C CD1 . TYR B  1 134 ? 29.109  -60.043 39.717  1.00 13.82  ? 2152 TYR B CD1 1 
ATOM   5128  C CD2 . TYR B  1 134 ? 29.275  -62.270 38.841  1.00 11.22  ? 2152 TYR B CD2 1 
ATOM   5129  C CE1 . TYR B  1 134 ? 28.358  -59.658 38.608  1.00 14.72  ? 2152 TYR B CE1 1 
ATOM   5130  C CE2 . TYR B  1 134 ? 28.528  -61.898 37.731  1.00 15.28  ? 2152 TYR B CE2 1 
ATOM   5131  C CZ  . TYR B  1 134 ? 28.070  -60.588 37.622  1.00 15.90  ? 2152 TYR B CZ  1 
ATOM   5132  O OH  . TYR B  1 134 ? 27.313  -60.216 36.539  1.00 18.95  ? 2152 TYR B OH  1 
ATOM   5133  N N   . ASP B  1 135 ? 30.069  -63.614 44.008  1.00 17.59  ? 2153 ASP B N   1 
ATOM   5134  C CA  . ASP B  1 135 ? 30.781  -64.052 45.193  1.00 18.74  ? 2153 ASP B CA  1 
ATOM   5135  C C   . ASP B  1 135 ? 32.109  -64.656 44.755  1.00 17.99  ? 2153 ASP B C   1 
ATOM   5136  O O   . ASP B  1 135 ? 32.140  -65.652 44.033  1.00 17.20  ? 2153 ASP B O   1 
ATOM   5137  C CB  . ASP B  1 135 ? 29.932  -65.090 45.932  1.00 22.57  ? 2153 ASP B CB  1 
ATOM   5138  C CG  . ASP B  1 135 ? 30.529  -65.501 47.266  1.00 25.28  ? 2153 ASP B CG  1 
ATOM   5139  O OD1 . ASP B  1 135 ? 29.804  -66.155 48.049  1.00 30.20  ? 2153 ASP B OD1 1 
ATOM   5140  O OD2 . ASP B  1 135 ? 31.709  -65.186 47.531  1.00 25.03  ? 2153 ASP B OD2 1 
ATOM   5141  N N   . GLY B  1 136 ? 33.210  -64.052 45.187  1.00 17.77  ? 2154 GLY B N   1 
ATOM   5142  C CA  . GLY B  1 136 ? 34.517  -64.552 44.793  1.00 17.77  ? 2154 GLY B CA  1 
ATOM   5143  C C   . GLY B  1 136 ? 35.096  -65.634 45.685  1.00 18.69  ? 2154 GLY B C   1 
ATOM   5144  O O   . GLY B  1 136 ? 36.214  -66.106 45.452  1.00 17.38  ? 2154 GLY B O   1 
ATOM   5145  N N   . LEU B  1 137 ? 34.338  -66.037 46.701  1.00 17.23  ? 2155 LEU B N   1 
ATOM   5146  C CA  . LEU B  1 137 ? 34.792  -67.048 47.658  1.00 18.08  ? 2155 LEU B CA  1 
ATOM   5147  C C   . LEU B  1 137 ? 35.359  -68.342 47.061  1.00 18.42  ? 2155 LEU B C   1 
ATOM   5148  O O   . LEU B  1 137 ? 36.469  -68.756 47.398  1.00 18.69  ? 2155 LEU B O   1 
ATOM   5149  C CB  . LEU B  1 137 ? 33.654  -67.419 48.615  1.00 18.34  ? 2155 LEU B CB  1 
ATOM   5150  C CG  . LEU B  1 137 ? 33.953  -68.592 49.565  1.00 19.97  ? 2155 LEU B CG  1 
ATOM   5151  C CD1 . LEU B  1 137 ? 35.119  -68.218 50.475  1.00 20.07  ? 2155 LEU B CD1 1 
ATOM   5152  C CD2 . LEU B  1 137 ? 32.715  -68.914 50.395  1.00 21.45  ? 2155 LEU B CD2 1 
ATOM   5153  N N   . ALA B  1 138 ? 34.596  -68.987 46.188  1.00 18.75  ? 2156 ALA B N   1 
ATOM   5154  C CA  . ALA B  1 138 ? 35.041  -70.244 45.603  1.00 18.20  ? 2156 ALA B CA  1 
ATOM   5155  C C   . ALA B  1 138 ? 36.271  -70.129 44.700  1.00 18.90  ? 2156 ALA B C   1 
ATOM   5156  O O   . ALA B  1 138 ? 37.196  -70.941 44.800  1.00 18.40  ? 2156 ALA B O   1 
ATOM   5157  C CB  . ALA B  1 138 ? 33.894  -70.882 44.855  1.00 14.79  ? 2156 ALA B CB  1 
ATOM   5158  N N   . LEU B  1 139 ? 36.287  -69.137 43.816  1.00 19.16  ? 2157 LEU B N   1 
ATOM   5159  C CA  . LEU B  1 139 ? 37.427  -68.960 42.917  1.00 17.75  ? 2157 LEU B CA  1 
ATOM   5160  C C   . LEU B  1 139 ? 38.693  -68.674 43.713  1.00 19.67  ? 2157 LEU B C   1 
ATOM   5161  O O   . LEU B  1 139 ? 39.741  -69.282 43.473  1.00 19.12  ? 2157 LEU B O   1 
ATOM   5162  C CB  . LEU B  1 139 ? 37.169  -67.815 41.932  1.00 17.04  ? 2157 LEU B CB  1 
ATOM   5163  C CG  . LEU B  1 139 ? 38.303  -67.471 40.953  1.00 18.26  ? 2157 LEU B CG  1 
ATOM   5164  C CD1 . LEU B  1 139 ? 38.712  -68.712 40.153  1.00 15.90  ? 2157 LEU B CD1 1 
ATOM   5165  C CD2 . LEU B  1 139 ? 37.843  -66.363 40.016  1.00 16.01  ? 2157 LEU B CD2 1 
ATOM   5166  N N   . ALA B  1 140 ? 38.595  -67.755 44.669  1.00 18.51  ? 2158 ALA B N   1 
ATOM   5167  C CA  . ALA B  1 140 ? 39.741  -67.403 45.494  1.00 17.57  ? 2158 ALA B CA  1 
ATOM   5168  C C   . ALA B  1 140 ? 40.331  -68.618 46.218  1.00 19.43  ? 2158 ALA B C   1 
ATOM   5169  O O   . ALA B  1 140 ? 41.543  -68.828 46.212  1.00 18.24  ? 2158 ALA B O   1 
ATOM   5170  C CB  . ALA B  1 140 ? 39.339  -66.340 46.503  1.00 19.80  ? 2158 ALA B CB  1 
ATOM   5171  N N   . ALA B  1 141 ? 39.469  -69.417 46.836  1.00 20.08  ? 2159 ALA B N   1 
ATOM   5172  C CA  . ALA B  1 141 ? 39.903  -70.597 47.580  1.00 21.29  ? 2159 ALA B CA  1 
ATOM   5173  C C   . ALA B  1 141 ? 40.434  -71.726 46.698  1.00 22.41  ? 2159 ALA B C   1 
ATOM   5174  O O   . ALA B  1 141 ? 41.507  -72.274 46.955  1.00 23.50  ? 2159 ALA B O   1 
ATOM   5175  C CB  . ALA B  1 141 ? 38.749  -71.115 48.441  1.00 20.24  ? 2159 ALA B CB  1 
ATOM   5176  N N   . HIS B  1 142 ? 39.677  -72.082 45.667  1.00 22.99  ? 2160 HIS B N   1 
ATOM   5177  C CA  . HIS B  1 142 ? 40.078  -73.164 44.773  1.00 23.62  ? 2160 HIS B CA  1 
ATOM   5178  C C   . HIS B  1 142 ? 41.350  -72.915 43.976  1.00 24.04  ? 2160 HIS B C   1 
ATOM   5179  O O   . HIS B  1 142 ? 42.143  -73.834 43.783  1.00 25.22  ? 2160 HIS B O   1 
ATOM   5180  C CB  . HIS B  1 142 ? 38.939  -73.493 43.809  1.00 23.72  ? 2160 HIS B CB  1 
ATOM   5181  C CG  . HIS B  1 142 ? 37.855  -74.318 44.424  1.00 25.40  ? 2160 HIS B CG  1 
ATOM   5182  N ND1 . HIS B  1 142 ? 37.713  -75.667 44.171  1.00 27.33  ? 2160 HIS B ND1 1 
ATOM   5183  C CD2 . HIS B  1 142 ? 36.874  -73.993 45.298  1.00 25.68  ? 2160 HIS B CD2 1 
ATOM   5184  C CE1 . HIS B  1 142 ? 36.689  -76.135 44.862  1.00 26.84  ? 2160 HIS B CE1 1 
ATOM   5185  N NE2 . HIS B  1 142 ? 36.163  -75.140 45.555  1.00 26.36  ? 2160 HIS B NE2 1 
ATOM   5186  N N   . GLU B  1 143 ? 41.560  -71.682 43.524  1.00 21.13  ? 2161 GLU B N   1 
ATOM   5187  C CA  . GLU B  1 143 ? 42.747  -71.391 42.724  1.00 20.46  ? 2161 GLU B CA  1 
ATOM   5188  C C   . GLU B  1 143 ? 43.800  -70.518 43.390  1.00 19.85  ? 2161 GLU B C   1 
ATOM   5189  O O   . GLU B  1 143 ? 44.799  -70.145 42.771  1.00 17.77  ? 2161 GLU B O   1 
ATOM   5190  C CB  . GLU B  1 143 ? 42.327  -70.781 41.390  1.00 21.11  ? 2161 GLU B CB  1 
ATOM   5191  C CG  . GLU B  1 143 ? 41.708  -71.790 40.439  1.00 20.76  ? 2161 GLU B CG  1 
ATOM   5192  C CD  . GLU B  1 143 ? 42.593  -73.017 40.231  1.00 23.09  ? 2161 GLU B CD  1 
ATOM   5193  O OE1 . GLU B  1 143 ? 43.836  -72.868 40.174  1.00 20.60  ? 2161 GLU B OE1 1 
ATOM   5194  O OE2 . GLU B  1 143 ? 42.044  -74.131 40.113  1.00 23.14  ? 2161 GLU B OE2 1 
ATOM   5195  N N   . ASN B  1 144 ? 43.581  -70.200 44.658  1.00 18.17  ? 2162 ASN B N   1 
ATOM   5196  C CA  . ASN B  1 144 ? 44.527  -69.390 45.402  1.00 19.53  ? 2162 ASN B CA  1 
ATOM   5197  C C   . ASN B  1 144 ? 44.888  -68.071 44.714  1.00 18.61  ? 2162 ASN B C   1 
ATOM   5198  O O   . ASN B  1 144 ? 46.065  -67.750 44.519  1.00 18.03  ? 2162 ASN B O   1 
ATOM   5199  C CB  . ASN B  1 144 ? 45.793  -70.198 45.675  1.00 24.19  ? 2162 ASN B CB  1 
ATOM   5200  C CG  . ASN B  1 144 ? 46.348  -69.940 47.050  1.00 30.60  ? 2162 ASN B CG  1 
ATOM   5201  O OD1 . ASN B  1 144 ? 47.042  -68.953 47.278  1.00 36.02  ? 2162 ASN B OD1 1 
ATOM   5202  N ND2 . ASN B  1 144 ? 46.024  -70.820 47.989  1.00 34.79  ? 2162 ASN B ND2 1 
ATOM   5203  N N   . VAL B  1 145 ? 43.863  -67.315 44.342  1.00 16.72  ? 2163 VAL B N   1 
ATOM   5204  C CA  . VAL B  1 145 ? 44.057  -66.019 43.721  1.00 16.31  ? 2163 VAL B CA  1 
ATOM   5205  C C   . VAL B  1 145 ? 43.216  -64.999 44.491  1.00 15.51  ? 2163 VAL B C   1 
ATOM   5206  O O   . VAL B  1 145 ? 42.197  -65.349 45.080  1.00 14.83  ? 2163 VAL B O   1 
ATOM   5207  C CB  . VAL B  1 145 ? 43.601  -66.016 42.228  1.00 18.49  ? 2163 VAL B CB  1 
ATOM   5208  C CG1 . VAL B  1 145 ? 44.294  -67.138 41.465  1.00 16.85  ? 2163 VAL B CG1 1 
ATOM   5209  C CG2 . VAL B  1 145 ? 42.082  -66.168 42.131  1.00 18.45  ? 2163 VAL B CG2 1 
ATOM   5210  N N   . VAL B  1 146 ? 43.656  -63.745 44.500  1.00 16.17  ? 2164 VAL B N   1 
ATOM   5211  C CA  . VAL B  1 146 ? 42.904  -62.684 45.153  1.00 14.17  ? 2164 VAL B CA  1 
ATOM   5212  C C   . VAL B  1 146 ? 41.867  -62.222 44.146  1.00 15.75  ? 2164 VAL B C   1 
ATOM   5213  O O   . VAL B  1 146 ? 42.218  -61.846 43.024  1.00 17.10  ? 2164 VAL B O   1 
ATOM   5214  C CB  . VAL B  1 146 ? 43.796  -61.478 45.502  1.00 15.13  ? 2164 VAL B CB  1 
ATOM   5215  C CG1 . VAL B  1 146 ? 42.939  -60.347 46.059  1.00 12.49  ? 2164 VAL B CG1 1 
ATOM   5216  C CG2 . VAL B  1 146 ? 44.867  -61.894 46.506  1.00 14.76  ? 2164 VAL B CG2 1 
ATOM   5217  N N   . VAL B  1 147 ? 40.594  -62.258 44.531  1.00 13.88  ? 2165 VAL B N   1 
ATOM   5218  C CA  . VAL B  1 147 ? 39.528  -61.831 43.636  1.00 14.36  ? 2165 VAL B CA  1 
ATOM   5219  C C   . VAL B  1 147 ? 38.970  -60.479 44.082  1.00 14.95  ? 2165 VAL B C   1 
ATOM   5220  O O   . VAL B  1 147 ? 38.634  -60.285 45.257  1.00 14.63  ? 2165 VAL B O   1 
ATOM   5221  C CB  . VAL B  1 147 ? 38.381  -62.866 43.582  1.00 14.07  ? 2165 VAL B CB  1 
ATOM   5222  C CG1 . VAL B  1 147 ? 37.331  -62.425 42.575  1.00 16.21  ? 2165 VAL B CG1 1 
ATOM   5223  C CG2 . VAL B  1 147 ? 38.932  -64.241 43.198  1.00 13.98  ? 2165 VAL B CG2 1 
ATOM   5224  N N   . VAL B  1 148 ? 38.876  -59.554 43.131  1.00 12.83  ? 2166 VAL B N   1 
ATOM   5225  C CA  . VAL B  1 148 ? 38.377  -58.202 43.381  1.00 11.50  ? 2166 VAL B CA  1 
ATOM   5226  C C   . VAL B  1 148 ? 37.212  -57.878 42.450  1.00 13.99  ? 2166 VAL B C   1 
ATOM   5227  O O   . VAL B  1 148 ? 37.365  -57.922 41.229  1.00 13.60  ? 2166 VAL B O   1 
ATOM   5228  C CB  . VAL B  1 148 ? 39.474  -57.140 43.115  1.00 13.59  ? 2166 VAL B CB  1 
ATOM   5229  C CG1 . VAL B  1 148 ? 38.921  -55.739 43.389  1.00 13.03  ? 2166 VAL B CG1 1 
ATOM   5230  C CG2 . VAL B  1 148 ? 40.715  -57.427 43.954  1.00 10.36  ? 2166 VAL B CG2 1 
ATOM   5231  N N   . THR B  1 149 ? 36.047  -57.563 43.012  1.00 11.57  ? 2167 THR B N   1 
ATOM   5232  C CA  . THR B  1 149 ? 34.899  -57.204 42.187  1.00 10.55  ? 2167 THR B CA  1 
ATOM   5233  C C   . THR B  1 149 ? 34.726  -55.696 42.320  1.00 10.22  ? 2167 THR B C   1 
ATOM   5234  O O   . THR B  1 149 ? 34.684  -55.166 43.429  1.00 11.10  ? 2167 THR B O   1 
ATOM   5235  C CB  . THR B  1 149 ? 33.601  -57.928 42.636  1.00 11.00  ? 2167 THR B CB  1 
ATOM   5236  O OG1 . THR B  1 149 ? 33.368  -57.685 44.028  1.00 14.10  ? 2167 THR B OG1 1 
ATOM   5237  C CG2 . THR B  1 149 ? 33.719  -59.429 42.403  1.00 11.63  ? 2167 THR B CG2 1 
ATOM   5238  N N   . ILE B  1 150 ? 34.621  -55.005 41.192  1.00 8.71   ? 2168 ILE B N   1 
ATOM   5239  C CA  . ILE B  1 150 ? 34.500  -53.551 41.216  1.00 10.48  ? 2168 ILE B CA  1 
ATOM   5240  C C   . ILE B  1 150 ? 33.190  -53.013 40.671  1.00 10.72  ? 2168 ILE B C   1 
ATOM   5241  O O   . ILE B  1 150 ? 32.486  -53.680 39.912  1.00 11.84  ? 2168 ILE B O   1 
ATOM   5242  C CB  . ILE B  1 150 ? 35.633  -52.899 40.394  1.00 10.18  ? 2168 ILE B CB  1 
ATOM   5243  C CG1 . ILE B  1 150 ? 35.454  -53.241 38.909  1.00 11.67  ? 2168 ILE B CG1 1 
ATOM   5244  C CG2 . ILE B  1 150 ? 36.988  -53.414 40.871  1.00 8.73   ? 2168 ILE B CG2 1 
ATOM   5245  C CD1 . ILE B  1 150 ? 36.337  -52.437 37.977  1.00 14.10  ? 2168 ILE B CD1 1 
ATOM   5246  N N   . GLN B  1 151 ? 32.869  -51.783 41.053  1.00 11.70  ? 2169 GLN B N   1 
ATOM   5247  C CA  . GLN B  1 151 ? 31.666  -51.144 40.543  1.00 11.98  ? 2169 GLN B CA  1 
ATOM   5248  C C   . GLN B  1 151 ? 32.094  -49.894 39.793  1.00 12.22  ? 2169 GLN B C   1 
ATOM   5249  O O   . GLN B  1 151 ? 33.214  -49.435 39.954  1.00 13.35  ? 2169 GLN B O   1 
ATOM   5250  C CB  . GLN B  1 151 ? 30.684  -50.836 41.688  1.00 12.21  ? 2169 GLN B CB  1 
ATOM   5251  C CG  . GLN B  1 151 ? 30.008  -52.122 42.164  1.00 14.32  ? 2169 GLN B CG  1 
ATOM   5252  C CD  . GLN B  1 151 ? 28.868  -51.926 43.142  1.00 16.89  ? 2169 GLN B CD  1 
ATOM   5253  O OE1 . GLN B  1 151 ? 28.149  -52.879 43.446  1.00 14.07  ? 2169 GLN B OE1 1 
ATOM   5254  N NE2 . GLN B  1 151 ? 28.699  -50.698 43.646  1.00 15.44  ? 2169 GLN B NE2 1 
ATOM   5255  N N   . TYR B  1 152 ? 31.217  -49.374 38.944  1.00 9.52   ? 2170 TYR B N   1 
ATOM   5256  C CA  . TYR B  1 152 ? 31.522  -48.185 38.165  1.00 13.24  ? 2170 TYR B CA  1 
ATOM   5257  C C   . TYR B  1 152 ? 30.205  -47.537 37.787  1.00 12.38  ? 2170 TYR B C   1 
ATOM   5258  O O   . TYR B  1 152 ? 29.189  -48.222 37.660  1.00 12.56  ? 2170 TYR B O   1 
ATOM   5259  C CB  . TYR B  1 152 ? 32.303  -48.561 36.889  1.00 10.80  ? 2170 TYR B CB  1 
ATOM   5260  C CG  . TYR B  1 152 ? 31.641  -49.648 36.078  1.00 12.06  ? 2170 TYR B CG  1 
ATOM   5261  C CD1 . TYR B  1 152 ? 31.793  -50.991 36.421  1.00 13.09  ? 2170 TYR B CD1 1 
ATOM   5262  C CD2 . TYR B  1 152 ? 30.847  -49.334 34.981  1.00 11.14  ? 2170 TYR B CD2 1 
ATOM   5263  C CE1 . TYR B  1 152 ? 31.166  -51.991 35.690  1.00 13.75  ? 2170 TYR B CE1 1 
ATOM   5264  C CE2 . TYR B  1 152 ? 30.219  -50.318 34.247  1.00 11.87  ? 2170 TYR B CE2 1 
ATOM   5265  C CZ  . TYR B  1 152 ? 30.378  -51.645 34.608  1.00 13.05  ? 2170 TYR B CZ  1 
ATOM   5266  O OH  . TYR B  1 152 ? 29.720  -52.615 33.897  1.00 16.69  ? 2170 TYR B OH  1 
ATOM   5267  N N   . ARG B  1 153 ? 30.209  -46.220 37.622  1.00 11.60  ? 2171 ARG B N   1 
ATOM   5268  C CA  . ARG B  1 153 ? 28.983  -45.523 37.262  1.00 11.93  ? 2171 ARG B CA  1 
ATOM   5269  C C   . ARG B  1 153 ? 28.325  -46.097 36.018  1.00 14.97  ? 2171 ARG B C   1 
ATOM   5270  O O   . ARG B  1 153 ? 29.004  -46.437 35.040  1.00 14.26  ? 2171 ARG B O   1 
ATOM   5271  C CB  . ARG B  1 153 ? 29.258  -44.028 37.097  1.00 12.30  ? 2171 ARG B CB  1 
ATOM   5272  C CG  . ARG B  1 153 ? 29.362  -43.313 38.440  1.00 12.01  ? 2171 ARG B CG  1 
ATOM   5273  C CD  . ARG B  1 153 ? 29.839  -41.883 38.282  1.00 12.21  ? 2171 ARG B CD  1 
ATOM   5274  N NE  . ARG B  1 153 ? 31.282  -41.840 38.072  1.00 12.94  ? 2171 ARG B NE  1 
ATOM   5275  C CZ  . ARG B  1 153 ? 31.960  -40.729 37.803  1.00 12.89  ? 2171 ARG B CZ  1 
ATOM   5276  N NH1 . ARG B  1 153 ? 31.326  -39.569 37.702  1.00 8.44   ? 2171 ARG B NH1 1 
ATOM   5277  N NH2 . ARG B  1 153 ? 33.275  -40.776 37.661  1.00 11.68  ? 2171 ARG B NH2 1 
ATOM   5278  N N   . LEU B  1 154 ? 26.995  -46.196 36.073  1.00 13.12  ? 2172 LEU B N   1 
ATOM   5279  C CA  . LEU B  1 154 ? 26.186  -46.756 35.000  1.00 14.02  ? 2172 LEU B CA  1 
ATOM   5280  C C   . LEU B  1 154 ? 25.201  -45.757 34.407  1.00 15.47  ? 2172 LEU B C   1 
ATOM   5281  O O   . LEU B  1 154 ? 24.923  -44.708 34.988  1.00 14.18  ? 2172 LEU B O   1 
ATOM   5282  C CB  . LEU B  1 154 ? 25.388  -47.959 35.525  1.00 14.59  ? 2172 LEU B CB  1 
ATOM   5283  C CG  . LEU B  1 154 ? 26.124  -49.086 36.259  1.00 15.55  ? 2172 LEU B CG  1 
ATOM   5284  C CD1 . LEU B  1 154 ? 25.108  -50.013 36.945  1.00 10.28  ? 2172 LEU B CD1 1 
ATOM   5285  C CD2 . LEU B  1 154 ? 26.986  -49.871 35.266  1.00 11.57  ? 2172 LEU B CD2 1 
ATOM   5286  N N   . GLY B  1 155 ? 24.672  -46.112 33.239  1.00 16.82  ? 2173 GLY B N   1 
ATOM   5287  C CA  . GLY B  1 155 ? 23.698  -45.281 32.556  1.00 14.80  ? 2173 GLY B CA  1 
ATOM   5288  C C   . GLY B  1 155 ? 24.090  -43.828 32.397  1.00 16.11  ? 2173 GLY B C   1 
ATOM   5289  O O   . GLY B  1 155 ? 25.238  -43.504 32.090  1.00 16.09  ? 2173 GLY B O   1 
ATOM   5290  N N   . ILE B  1 156 ? 23.125  -42.941 32.613  1.00 15.67  ? 2174 ILE B N   1 
ATOM   5291  C CA  . ILE B  1 156 ? 23.373  -41.514 32.482  1.00 15.14  ? 2174 ILE B CA  1 
ATOM   5292  C C   . ILE B  1 156 ? 24.567  -41.075 33.323  1.00 14.97  ? 2174 ILE B C   1 
ATOM   5293  O O   . ILE B  1 156 ? 25.444  -40.367 32.831  1.00 14.70  ? 2174 ILE B O   1 
ATOM   5294  C CB  . ILE B  1 156 ? 22.114  -40.693 32.879  1.00 15.32  ? 2174 ILE B CB  1 
ATOM   5295  C CG1 . ILE B  1 156 ? 20.977  -41.001 31.902  1.00 17.72  ? 2174 ILE B CG1 1 
ATOM   5296  C CG2 . ILE B  1 156 ? 22.428  -39.199 32.874  1.00 14.45  ? 2174 ILE B CG2 1 
ATOM   5297  C CD1 . ILE B  1 156 ? 19.651  -40.334 32.258  1.00 22.02  ? 2174 ILE B CD1 1 
ATOM   5298  N N   . TRP B  1 157 ? 24.611  -41.510 34.581  1.00 13.21  ? 2175 TRP B N   1 
ATOM   5299  C CA  . TRP B  1 157 ? 25.701  -41.141 35.485  1.00 14.06  ? 2175 TRP B CA  1 
ATOM   5300  C C   . TRP B  1 157 ? 27.088  -41.581 34.996  1.00 14.50  ? 2175 TRP B C   1 
ATOM   5301  O O   . TRP B  1 157 ? 28.086  -40.894 35.220  1.00 11.63  ? 2175 TRP B O   1 
ATOM   5302  C CB  . TRP B  1 157 ? 25.474  -41.759 36.873  1.00 13.45  ? 2175 TRP B CB  1 
ATOM   5303  C CG  . TRP B  1 157 ? 24.226  -41.299 37.574  1.00 14.71  ? 2175 TRP B CG  1 
ATOM   5304  C CD1 . TRP B  1 157 ? 24.123  -40.293 38.502  1.00 16.39  ? 2175 TRP B CD1 1 
ATOM   5305  C CD2 . TRP B  1 157 ? 22.903  -41.829 37.410  1.00 15.44  ? 2175 TRP B CD2 1 
ATOM   5306  N NE1 . TRP B  1 157 ? 22.816  -40.169 38.924  1.00 17.22  ? 2175 TRP B NE1 1 
ATOM   5307  C CE2 . TRP B  1 157 ? 22.047  -41.098 38.270  1.00 16.15  ? 2175 TRP B CE2 1 
ATOM   5308  C CE3 . TRP B  1 157 ? 22.355  -42.853 36.621  1.00 16.26  ? 2175 TRP B CE3 1 
ATOM   5309  C CZ2 . TRP B  1 157 ? 20.676  -41.358 38.361  1.00 17.63  ? 2175 TRP B CZ2 1 
ATOM   5310  C CZ3 . TRP B  1 157 ? 20.986  -43.112 36.714  1.00 19.87  ? 2175 TRP B CZ3 1 
ATOM   5311  C CH2 . TRP B  1 157 ? 20.165  -42.365 37.579  1.00 15.59  ? 2175 TRP B CH2 1 
ATOM   5312  N N   . GLY B  1 158 ? 27.156  -42.736 34.348  1.00 13.32  ? 2176 GLY B N   1 
ATOM   5313  C CA  . GLY B  1 158 ? 28.451  -43.212 33.905  1.00 13.17  ? 2176 GLY B CA  1 
ATOM   5314  C C   . GLY B  1 158 ? 28.812  -42.930 32.459  1.00 12.80  ? 2176 GLY B C   1 
ATOM   5315  O O   . GLY B  1 158 ? 29.991  -42.964 32.111  1.00 11.90  ? 2176 GLY B O   1 
ATOM   5316  N N   . PHE B  1 159 ? 27.826  -42.622 31.623  1.00 12.40  ? 2177 PHE B N   1 
ATOM   5317  C CA  . PHE B  1 159 ? 28.122  -42.413 30.213  1.00 13.97  ? 2177 PHE B CA  1 
ATOM   5318  C C   . PHE B  1 159 ? 27.492  -41.229 29.482  1.00 15.32  ? 2177 PHE B C   1 
ATOM   5319  O O   . PHE B  1 159 ? 27.554  -41.158 28.252  1.00 15.47  ? 2177 PHE B O   1 
ATOM   5320  C CB  . PHE B  1 159 ? 27.839  -43.728 29.477  1.00 10.73  ? 2177 PHE B CB  1 
ATOM   5321  C CG  . PHE B  1 159 ? 28.656  -44.881 30.006  1.00 14.96  ? 2177 PHE B CG  1 
ATOM   5322  C CD1 . PHE B  1 159 ? 29.975  -45.064 29.595  1.00 13.47  ? 2177 PHE B CD1 1 
ATOM   5323  C CD2 . PHE B  1 159 ? 28.154  -45.701 31.019  1.00 12.70  ? 2177 PHE B CD2 1 
ATOM   5324  C CE1 . PHE B  1 159 ? 30.789  -46.036 30.190  1.00 12.02  ? 2177 PHE B CE1 1 
ATOM   5325  C CE2 . PHE B  1 159 ? 28.954  -46.673 31.620  1.00 13.70  ? 2177 PHE B CE2 1 
ATOM   5326  C CZ  . PHE B  1 159 ? 30.281  -46.839 31.205  1.00 14.06  ? 2177 PHE B CZ  1 
ATOM   5327  N N   . PHE B  1 160 ? 26.905  -40.287 30.216  1.00 15.89  ? 2178 PHE B N   1 
ATOM   5328  C CA  . PHE B  1 160 ? 26.330  -39.122 29.551  1.00 16.24  ? 2178 PHE B CA  1 
ATOM   5329  C C   . PHE B  1 160 ? 27.435  -38.350 28.830  1.00 16.62  ? 2178 PHE B C   1 
ATOM   5330  O O   . PHE B  1 160 ? 28.439  -37.983 29.433  1.00 15.06  ? 2178 PHE B O   1 
ATOM   5331  C CB  . PHE B  1 160 ? 25.653  -38.177 30.546  1.00 16.37  ? 2178 PHE B CB  1 
ATOM   5332  C CG  . PHE B  1 160 ? 25.057  -36.951 29.895  1.00 14.63  ? 2178 PHE B CG  1 
ATOM   5333  C CD1 . PHE B  1 160 ? 25.681  -35.716 30.001  1.00 16.24  ? 2178 PHE B CD1 1 
ATOM   5334  C CD2 . PHE B  1 160 ? 23.885  -37.050 29.143  1.00 16.51  ? 2178 PHE B CD2 1 
ATOM   5335  C CE1 . PHE B  1 160 ? 25.151  -34.587 29.365  1.00 16.65  ? 2178 PHE B CE1 1 
ATOM   5336  C CE2 . PHE B  1 160 ? 23.344  -35.936 28.505  1.00 14.43  ? 2178 PHE B CE2 1 
ATOM   5337  C CZ  . PHE B  1 160 ? 23.982  -34.698 28.616  1.00 16.52  ? 2178 PHE B CZ  1 
ATOM   5338  N N   . SER B  1 161 ? 27.237  -38.093 27.543  1.00 17.15  ? 2179 SER B N   1 
ATOM   5339  C CA  . SER B  1 161 ? 28.226  -37.367 26.758  1.00 18.70  ? 2179 SER B CA  1 
ATOM   5340  C C   . SER B  1 161 ? 27.618  -36.304 25.847  1.00 18.13  ? 2179 SER B C   1 
ATOM   5341  O O   . SER B  1 161 ? 26.623  -36.551 25.167  1.00 19.97  ? 2179 SER B O   1 
ATOM   5342  C CB  . SER B  1 161 ? 29.033  -38.338 25.887  1.00 18.89  ? 2179 SER B CB  1 
ATOM   5343  O OG  . SER B  1 161 ? 29.939  -37.622 25.056  1.00 19.22  ? 2179 SER B OG  1 
ATOM   5344  N N   . THR B  1 162 ? 28.218  -35.120 25.848  1.00 18.22  ? 2180 THR B N   1 
ATOM   5345  C CA  . THR B  1 162 ? 27.761  -34.046 24.980  1.00 20.41  ? 2180 THR B CA  1 
ATOM   5346  C C   . THR B  1 162 ? 28.622  -34.063 23.721  1.00 21.87  ? 2180 THR B C   1 
ATOM   5347  O O   . THR B  1 162 ? 28.408  -33.276 22.804  1.00 23.65  ? 2180 THR B O   1 
ATOM   5348  C CB  . THR B  1 162 ? 27.900  -32.665 25.643  1.00 19.74  ? 2180 THR B CB  1 
ATOM   5349  O OG1 . THR B  1 162 ? 29.236  -32.497 26.130  1.00 19.40  ? 2180 THR B OG1 1 
ATOM   5350  C CG2 . THR B  1 162 ? 26.908  -32.524 26.785  1.00 20.22  ? 2180 THR B CG2 1 
ATOM   5351  N N   . GLY B  1 163 ? 29.603  -34.963 23.688  1.00 21.12  ? 2181 GLY B N   1 
ATOM   5352  C CA  . GLY B  1 163 ? 30.473  -35.057 22.532  1.00 22.19  ? 2181 GLY B CA  1 
ATOM   5353  C C   . GLY B  1 163 ? 31.574  -34.011 22.514  1.00 23.79  ? 2181 GLY B C   1 
ATOM   5354  O O   . GLY B  1 163 ? 32.284  -33.867 21.514  1.00 24.35  ? 2181 GLY B O   1 
ATOM   5355  N N   . ASP B  1 164 ? 31.721  -33.267 23.606  1.00 21.36  ? 2182 ASP B N   1 
ATOM   5356  C CA  . ASP B  1 164 ? 32.763  -32.253 23.678  1.00 21.69  ? 2182 ASP B CA  1 
ATOM   5357  C C   . ASP B  1 164 ? 33.327  -32.127 25.086  1.00 20.14  ? 2182 ASP B C   1 
ATOM   5358  O O   . ASP B  1 164 ? 32.988  -32.916 25.964  1.00 18.06  ? 2182 ASP B O   1 
ATOM   5359  C CB  . ASP B  1 164 ? 32.240  -30.901 23.164  1.00 24.79  ? 2182 ASP B CB  1 
ATOM   5360  C CG  . ASP B  1 164 ? 31.131  -30.325 24.025  1.00 26.85  ? 2182 ASP B CG  1 
ATOM   5361  O OD1 . ASP B  1 164 ? 30.381  -29.470 23.507  1.00 29.85  ? 2182 ASP B OD1 1 
ATOM   5362  O OD2 . ASP B  1 164 ? 31.013  -30.708 25.211  1.00 28.20  ? 2182 ASP B OD2 1 
ATOM   5363  N N   . GLU B  1 165 ? 34.171  -31.124 25.303  1.00 19.88  ? 2183 GLU B N   1 
ATOM   5364  C CA  . GLU B  1 165 ? 34.831  -30.948 26.590  1.00 19.34  ? 2183 GLU B CA  1 
ATOM   5365  C C   . GLU B  1 165 ? 33.963  -30.696 27.820  1.00 19.29  ? 2183 GLU B C   1 
ATOM   5366  O O   . GLU B  1 165 ? 34.417  -30.885 28.945  1.00 19.13  ? 2183 GLU B O   1 
ATOM   5367  C CB  . GLU B  1 165 ? 35.899  -29.846 26.488  1.00 21.99  ? 2183 GLU B CB  1 
ATOM   5368  C CG  . GLU B  1 165 ? 35.388  -28.407 26.473  1.00 23.35  ? 2183 GLU B CG  1 
ATOM   5369  C CD  . GLU B  1 165 ? 34.933  -27.919 25.107  1.00 25.64  ? 2183 GLU B CD  1 
ATOM   5370  O OE1 . GLU B  1 165 ? 34.834  -26.685 24.932  1.00 27.25  ? 2183 GLU B OE1 1 
ATOM   5371  O OE2 . GLU B  1 165 ? 34.665  -28.747 24.212  1.00 26.07  ? 2183 GLU B OE2 1 
ATOM   5372  N N   . HIS B  1 166 ? 32.719  -30.285 27.627  1.00 19.76  ? 2184 HIS B N   1 
ATOM   5373  C CA  . HIS B  1 166 ? 31.857  -30.015 28.771  1.00 22.12  ? 2184 HIS B CA  1 
ATOM   5374  C C   . HIS B  1 166 ? 31.360  -31.292 29.450  1.00 22.47  ? 2184 HIS B C   1 
ATOM   5375  O O   . HIS B  1 166 ? 30.967  -31.268 30.614  1.00 23.97  ? 2184 HIS B O   1 
ATOM   5376  C CB  . HIS B  1 166 ? 30.709  -29.114 28.325  1.00 21.21  ? 2184 HIS B CB  1 
ATOM   5377  C CG  . HIS B  1 166 ? 31.181  -27.815 27.749  1.00 23.23  ? 2184 HIS B CG  1 
ATOM   5378  N ND1 . HIS B  1 166 ? 31.886  -26.890 28.489  1.00 23.63  ? 2184 HIS B ND1 1 
ATOM   5379  C CD2 . HIS B  1 166 ? 31.122  -27.323 26.489  1.00 23.95  ? 2184 HIS B CD2 1 
ATOM   5380  C CE1 . HIS B  1 166 ? 32.244  -25.885 27.708  1.00 23.89  ? 2184 HIS B CE1 1 
ATOM   5381  N NE2 . HIS B  1 166 ? 31.794  -26.124 26.490  1.00 23.75  ? 2184 HIS B NE2 1 
ATOM   5382  N N   . SER B  1 167 ? 31.385  -32.401 28.712  1.00 21.89  ? 2185 SER B N   1 
ATOM   5383  C CA  . SER B  1 167 ? 31.004  -33.719 29.229  1.00 18.75  ? 2185 SER B CA  1 
ATOM   5384  C C   . SER B  1 167 ? 31.482  -34.749 28.219  1.00 17.08  ? 2185 SER B C   1 
ATOM   5385  O O   . SER B  1 167 ? 30.704  -35.262 27.411  1.00 16.99  ? 2185 SER B O   1 
ATOM   5386  C CB  . SER B  1 167 ? 29.496  -33.850 29.418  1.00 20.19  ? 2185 SER B CB  1 
ATOM   5387  O OG  . SER B  1 167 ? 29.205  -35.092 30.042  1.00 20.91  ? 2185 SER B OG  1 
ATOM   5388  N N   . ARG B  1 168 ? 32.779  -35.031 28.271  1.00 15.56  ? 2186 ARG B N   1 
ATOM   5389  C CA  . ARG B  1 168 ? 33.411  -35.971 27.357  1.00 16.55  ? 2186 ARG B CA  1 
ATOM   5390  C C   . ARG B  1 168 ? 32.745  -37.334 27.328  1.00 15.85  ? 2186 ARG B C   1 
ATOM   5391  O O   . ARG B  1 168 ? 32.556  -37.913 26.259  1.00 17.24  ? 2186 ARG B O   1 
ATOM   5392  C CB  . ARG B  1 168 ? 34.892  -36.130 27.710  1.00 18.07  ? 2186 ARG B CB  1 
ATOM   5393  C CG  . ARG B  1 168 ? 35.797  -35.006 27.188  1.00 19.71  ? 2186 ARG B CG  1 
ATOM   5394  C CD  . ARG B  1 168 ? 37.256  -35.429 27.291  1.00 21.91  ? 2186 ARG B CD  1 
ATOM   5395  N NE  . ARG B  1 168 ? 38.185  -34.543 26.589  1.00 25.13  ? 2186 ARG B NE  1 
ATOM   5396  C CZ  . ARG B  1 168 ? 38.497  -33.316 26.987  1.00 26.85  ? 2186 ARG B CZ  1 
ATOM   5397  N NH1 . ARG B  1 168 ? 37.949  -32.821 28.089  1.00 28.14  ? 2186 ARG B NH1 1 
ATOM   5398  N NH2 . ARG B  1 168 ? 39.368  -32.590 26.290  1.00 23.28  ? 2186 ARG B NH2 1 
ATOM   5399  N N   . GLY B  1 169 ? 32.389  -37.836 28.507  1.00 14.88  ? 2187 GLY B N   1 
ATOM   5400  C CA  . GLY B  1 169 ? 31.750  -39.135 28.599  1.00 12.10  ? 2187 GLY B CA  1 
ATOM   5401  C C   . GLY B  1 169 ? 32.681  -40.177 29.191  1.00 12.67  ? 2187 GLY B C   1 
ATOM   5402  O O   . GLY B  1 169 ? 33.766  -39.849 29.681  1.00 13.89  ? 2187 GLY B O   1 
ATOM   5403  N N   . ASN B  1 170 ? 32.246  -41.434 29.148  1.00 11.05  ? 2188 ASN B N   1 
ATOM   5404  C CA  . ASN B  1 170 ? 33.015  -42.569 29.658  1.00 10.79  ? 2188 ASN B CA  1 
ATOM   5405  C C   . ASN B  1 170 ? 33.409  -42.500 31.124  1.00 11.69  ? 2188 ASN B C   1 
ATOM   5406  O O   . ASN B  1 170 ? 34.449  -43.036 31.505  1.00 8.98   ? 2188 ASN B O   1 
ATOM   5407  C CB  . ASN B  1 170 ? 34.282  -42.788 28.824  1.00 12.00  ? 2188 ASN B CB  1 
ATOM   5408  C CG  . ASN B  1 170 ? 33.976  -43.154 27.387  1.00 13.85  ? 2188 ASN B CG  1 
ATOM   5409  O OD1 . ASN B  1 170 ? 32.935  -43.745 27.094  1.00 15.92  ? 2188 ASN B OD1 1 
ATOM   5410  N ND2 . ASN B  1 170 ? 34.887  -42.817 26.482  1.00 16.59  ? 2188 ASN B ND2 1 
ATOM   5411  N N   . TRP B  1 171 ? 32.584  -41.860 31.950  1.00 10.39  ? 2189 TRP B N   1 
ATOM   5412  C CA  . TRP B  1 171 ? 32.892  -41.754 33.380  1.00 11.63  ? 2189 TRP B CA  1 
ATOM   5413  C C   . TRP B  1 171 ? 33.002  -43.151 34.004  1.00 11.49  ? 2189 TRP B C   1 
ATOM   5414  O O   . TRP B  1 171 ? 33.827  -43.386 34.892  1.00 12.39  ? 2189 TRP B O   1 
ATOM   5415  C CB  . TRP B  1 171 ? 31.805  -40.944 34.089  1.00 12.77  ? 2189 TRP B CB  1 
ATOM   5416  C CG  . TRP B  1 171 ? 31.383  -39.728 33.304  1.00 14.70  ? 2189 TRP B CG  1 
ATOM   5417  C CD1 . TRP B  1 171 ? 30.149  -39.484 32.772  1.00 14.44  ? 2189 TRP B CD1 1 
ATOM   5418  C CD2 . TRP B  1 171 ? 32.216  -38.625 32.909  1.00 15.36  ? 2189 TRP B CD2 1 
ATOM   5419  N NE1 . TRP B  1 171 ? 30.161  -38.299 32.068  1.00 16.45  ? 2189 TRP B NE1 1 
ATOM   5420  C CE2 . TRP B  1 171 ? 31.417  -37.753 32.134  1.00 15.19  ? 2189 TRP B CE2 1 
ATOM   5421  C CE3 . TRP B  1 171 ? 33.562  -38.294 33.131  1.00 16.49  ? 2189 TRP B CE3 1 
ATOM   5422  C CZ2 . TRP B  1 171 ? 31.920  -36.565 31.574  1.00 19.43  ? 2189 TRP B CZ2 1 
ATOM   5423  C CZ3 . TRP B  1 171 ? 34.064  -37.111 32.571  1.00 17.14  ? 2189 TRP B CZ3 1 
ATOM   5424  C CH2 . TRP B  1 171 ? 33.241  -36.263 31.803  1.00 17.99  ? 2189 TRP B CH2 1 
ATOM   5425  N N   . GLY B  1 172 ? 32.162  -44.069 33.530  1.00 11.42  ? 2190 GLY B N   1 
ATOM   5426  C CA  . GLY B  1 172 ? 32.173  -45.436 34.024  1.00 12.45  ? 2190 GLY B CA  1 
ATOM   5427  C C   . GLY B  1 172 ? 33.498  -46.142 33.770  1.00 13.22  ? 2190 GLY B C   1 
ATOM   5428  O O   . GLY B  1 172 ? 33.955  -46.928 34.602  1.00 12.44  ? 2190 GLY B O   1 
ATOM   5429  N N   . HIS B  1 173 ? 34.115  -45.876 32.619  1.00 12.37  ? 2191 HIS B N   1 
ATOM   5430  C CA  . HIS B  1 173 ? 35.397  -46.493 32.300  1.00 11.75  ? 2191 HIS B CA  1 
ATOM   5431  C C   . HIS B  1 173 ? 36.499  -45.838 33.117  1.00 10.50  ? 2191 HIS B C   1 
ATOM   5432  O O   . HIS B  1 173 ? 37.446  -46.501 33.527  1.00 11.88  ? 2191 HIS B O   1 
ATOM   5433  C CB  . HIS B  1 173 ? 35.705  -46.377 30.798  1.00 12.17  ? 2191 HIS B CB  1 
ATOM   5434  C CG  . HIS B  1 173 ? 34.764  -47.151 29.926  1.00 11.18  ? 2191 HIS B CG  1 
ATOM   5435  N ND1 . HIS B  1 173 ? 34.518  -48.496 30.105  1.00 12.90  ? 2191 HIS B ND1 1 
ATOM   5436  C CD2 . HIS B  1 173 ? 34.016  -46.771 28.862  1.00 13.54  ? 2191 HIS B CD2 1 
ATOM   5437  C CE1 . HIS B  1 173 ? 33.660  -48.912 29.191  1.00 11.80  ? 2191 HIS B CE1 1 
ATOM   5438  N NE2 . HIS B  1 173 ? 33.340  -47.886 28.424  1.00 14.93  ? 2191 HIS B NE2 1 
ATOM   5439  N N   . LEU B  1 174 ? 36.382  -44.537 33.360  1.00 10.08  ? 2192 LEU B N   1 
ATOM   5440  C CA  . LEU B  1 174 ? 37.383  -43.849 34.164  1.00 10.83  ? 2192 LEU B CA  1 
ATOM   5441  C C   . LEU B  1 174 ? 37.312  -44.380 35.592  1.00 11.96  ? 2192 LEU B C   1 
ATOM   5442  O O   . LEU B  1 174 ? 38.309  -44.375 36.311  1.00 13.03  ? 2192 LEU B O   1 
ATOM   5443  C CB  . LEU B  1 174 ? 37.146  -42.330 34.152  1.00 12.15  ? 2192 LEU B CB  1 
ATOM   5444  C CG  . LEU B  1 174 ? 37.312  -41.668 32.776  1.00 16.28  ? 2192 LEU B CG  1 
ATOM   5445  C CD1 . LEU B  1 174 ? 37.080  -40.163 32.885  1.00 14.82  ? 2192 LEU B CD1 1 
ATOM   5446  C CD2 . LEU B  1 174 ? 38.713  -41.948 32.248  1.00 15.64  ? 2192 LEU B CD2 1 
ATOM   5447  N N   . ASP B  1 175 ? 36.128  -44.828 36.007  1.00 10.76  ? 2193 ASP B N   1 
ATOM   5448  C CA  . ASP B  1 175 ? 35.976  -45.402 37.346  1.00 12.54  ? 2193 ASP B CA  1 
ATOM   5449  C C   . ASP B  1 175 ? 36.686  -46.763 37.386  1.00 11.50  ? 2193 ASP B C   1 
ATOM   5450  O O   . ASP B  1 175 ? 37.279  -47.130 38.395  1.00 10.23  ? 2193 ASP B O   1 
ATOM   5451  C CB  . ASP B  1 175 ? 34.494  -45.602 37.700  1.00 12.87  ? 2193 ASP B CB  1 
ATOM   5452  C CG  . ASP B  1 175 ? 33.721  -44.290 37.764  1.00 15.34  ? 2193 ASP B CG  1 
ATOM   5453  O OD1 . ASP B  1 175 ? 34.340  -43.248 38.059  1.00 16.88  ? 2193 ASP B OD1 1 
ATOM   5454  O OD2 . ASP B  1 175 ? 32.497  -44.305 37.532  1.00 15.21  ? 2193 ASP B OD2 1 
ATOM   5455  N N   . GLN B  1 176 ? 36.615  -47.516 36.290  1.00 12.36  ? 2194 GLN B N   1 
ATOM   5456  C CA  . GLN B  1 176 ? 37.270  -48.828 36.244  1.00 11.67  ? 2194 GLN B CA  1 
ATOM   5457  C C   . GLN B  1 176 ? 38.785  -48.612 36.342  1.00 12.24  ? 2194 GLN B C   1 
ATOM   5458  O O   . GLN B  1 176 ? 39.487  -49.352 37.030  1.00 12.97  ? 2194 GLN B O   1 
ATOM   5459  C CB  . GLN B  1 176 ? 36.883  -49.563 34.954  1.00 12.31  ? 2194 GLN B CB  1 
ATOM   5460  C CG  . GLN B  1 176 ? 35.378  -49.846 34.864  1.00 12.24  ? 2194 GLN B CG  1 
ATOM   5461  C CD  . GLN B  1 176 ? 34.897  -50.175 33.461  1.00 13.34  ? 2194 GLN B CD  1 
ATOM   5462  O OE1 . GLN B  1 176 ? 35.590  -49.918 32.477  1.00 16.20  ? 2194 GLN B OE1 1 
ATOM   5463  N NE2 . GLN B  1 176 ? 33.690  -50.729 33.362  1.00 15.27  ? 2194 GLN B NE2 1 
ATOM   5464  N N   . VAL B  1 177 ? 39.279  -47.578 35.668  1.00 12.27  ? 2195 VAL B N   1 
ATOM   5465  C CA  . VAL B  1 177 ? 40.700  -47.248 35.714  1.00 12.59  ? 2195 VAL B CA  1 
ATOM   5466  C C   . VAL B  1 177 ? 41.082  -46.871 37.148  1.00 12.91  ? 2195 VAL B C   1 
ATOM   5467  O O   . VAL B  1 177 ? 42.115  -47.302 37.658  1.00 13.36  ? 2195 VAL B O   1 
ATOM   5468  C CB  . VAL B  1 177 ? 41.023  -46.069 34.768  1.00 11.89  ? 2195 VAL B CB  1 
ATOM   5469  C CG1 . VAL B  1 177 ? 42.447  -45.567 35.010  1.00 13.76  ? 2195 VAL B CG1 1 
ATOM   5470  C CG2 . VAL B  1 177 ? 40.861  -46.517 33.313  1.00 11.78  ? 2195 VAL B CG2 1 
ATOM   5471  N N   . ALA B  1 178 ? 40.235  -46.076 37.798  1.00 13.25  ? 2196 ALA B N   1 
ATOM   5472  C CA  . ALA B  1 178 ? 40.490  -45.646 39.173  1.00 13.35  ? 2196 ALA B CA  1 
ATOM   5473  C C   . ALA B  1 178 ? 40.544  -46.843 40.122  1.00 12.56  ? 2196 ALA B C   1 
ATOM   5474  O O   . ALA B  1 178 ? 41.344  -46.869 41.052  1.00 14.37  ? 2196 ALA B O   1 
ATOM   5475  C CB  . ALA B  1 178 ? 39.411  -44.658 39.627  1.00 11.49  ? 2196 ALA B CB  1 
ATOM   5476  N N   . ALA B  1 179 ? 39.694  -47.835 39.888  1.00 11.41  ? 2197 ALA B N   1 
ATOM   5477  C CA  . ALA B  1 179 ? 39.696  -49.016 40.734  1.00 11.52  ? 2197 ALA B CA  1 
ATOM   5478  C C   . ALA B  1 179 ? 41.001  -49.792 40.521  1.00 12.28  ? 2197 ALA B C   1 
ATOM   5479  O O   . ALA B  1 179 ? 41.584  -50.313 41.476  1.00 10.86  ? 2197 ALA B O   1 
ATOM   5480  C CB  . ALA B  1 179 ? 38.499  -49.894 40.409  1.00 12.86  ? 2197 ALA B CB  1 
ATOM   5481  N N   . LEU B  1 180 ? 41.456  -49.878 39.270  1.00 10.68  ? 2198 LEU B N   1 
ATOM   5482  C CA  . LEU B  1 180 ? 42.697  -50.593 38.982  1.00 11.86  ? 2198 LEU B CA  1 
ATOM   5483  C C   . LEU B  1 180 ? 43.885  -49.860 39.599  1.00 10.80  ? 2198 LEU B C   1 
ATOM   5484  O O   . LEU B  1 180 ? 44.850  -50.478 40.035  1.00 13.82  ? 2198 LEU B O   1 
ATOM   5485  C CB  . LEU B  1 180 ? 42.883  -50.752 37.471  1.00 12.20  ? 2198 LEU B CB  1 
ATOM   5486  C CG  . LEU B  1 180 ? 41.943  -51.764 36.811  1.00 12.37  ? 2198 LEU B CG  1 
ATOM   5487  C CD1 . LEU B  1 180 ? 42.013  -51.624 35.290  1.00 12.55  ? 2198 LEU B CD1 1 
ATOM   5488  C CD2 . LEU B  1 180 ? 42.335  -53.184 37.243  1.00 13.21  ? 2198 LEU B CD2 1 
ATOM   5489  N N   . ARG B  1 181 ? 43.807  -48.537 39.654  1.00 12.49  ? 2199 ARG B N   1 
ATOM   5490  C CA  . ARG B  1 181 ? 44.880  -47.751 40.259  1.00 15.17  ? 2199 ARG B CA  1 
ATOM   5491  C C   . ARG B  1 181 ? 44.900  -48.032 41.760  1.00 14.79  ? 2199 ARG B C   1 
ATOM   5492  O O   . ARG B  1 181 ? 45.964  -48.123 42.384  1.00 12.16  ? 2199 ARG B O   1 
ATOM   5493  C CB  . ARG B  1 181 ? 44.638  -46.261 40.034  1.00 18.41  ? 2199 ARG B CB  1 
ATOM   5494  C CG  . ARG B  1 181 ? 45.783  -45.374 40.481  1.00 25.76  ? 2199 ARG B CG  1 
ATOM   5495  C CD  . ARG B  1 181 ? 46.444  -44.785 39.256  1.00 32.51  ? 2199 ARG B CD  1 
ATOM   5496  N NE  . ARG B  1 181 ? 45.447  -44.108 38.432  1.00 36.35  ? 2199 ARG B NE  1 
ATOM   5497  C CZ  . ARG B  1 181 ? 45.601  -43.835 37.143  1.00 38.54  ? 2199 ARG B CZ  1 
ATOM   5498  N NH1 . ARG B  1 181 ? 46.720  -44.185 36.519  1.00 40.61  ? 2199 ARG B NH1 1 
ATOM   5499  N NH2 . ARG B  1 181 ? 44.638  -43.213 36.480  1.00 38.44  ? 2199 ARG B NH2 1 
ATOM   5500  N N   . TRP B  1 182 ? 43.714  -48.155 42.343  1.00 12.97  ? 2200 TRP B N   1 
ATOM   5501  C CA  . TRP B  1 182 ? 43.613  -48.446 43.768  1.00 13.27  ? 2200 TRP B CA  1 
ATOM   5502  C C   . TRP B  1 182 ? 44.254  -49.817 44.021  1.00 12.96  ? 2200 TRP B C   1 
ATOM   5503  O O   . TRP B  1 182 ? 45.011  -49.989 44.974  1.00 13.20  ? 2200 TRP B O   1 
ATOM   5504  C CB  . TRP B  1 182 ? 42.146  -48.478 44.206  1.00 15.34  ? 2200 TRP B CB  1 
ATOM   5505  C CG  . TRP B  1 182 ? 41.974  -48.628 45.699  1.00 16.21  ? 2200 TRP B CG  1 
ATOM   5506  C CD1 . TRP B  1 182 ? 41.859  -47.621 46.621  1.00 16.66  ? 2200 TRP B CD1 1 
ATOM   5507  C CD2 . TRP B  1 182 ? 41.945  -49.853 46.439  1.00 15.88  ? 2200 TRP B CD2 1 
ATOM   5508  N NE1 . TRP B  1 182 ? 41.763  -48.146 47.889  1.00 16.76  ? 2200 TRP B NE1 1 
ATOM   5509  C CE2 . TRP B  1 182 ? 41.813  -49.513 47.806  1.00 18.02  ? 2200 TRP B CE2 1 
ATOM   5510  C CE3 . TRP B  1 182 ? 42.022  -51.205 46.081  1.00 16.67  ? 2200 TRP B CE3 1 
ATOM   5511  C CZ2 . TRP B  1 182 ? 41.754  -50.480 48.816  1.00 17.09  ? 2200 TRP B CZ2 1 
ATOM   5512  C CZ3 . TRP B  1 182 ? 41.965  -52.167 47.087  1.00 18.55  ? 2200 TRP B CZ3 1 
ATOM   5513  C CH2 . TRP B  1 182 ? 41.832  -51.796 48.439  1.00 17.96  ? 2200 TRP B CH2 1 
ATOM   5514  N N   . VAL B  1 183 ? 43.952  -50.787 43.158  1.00 14.38  ? 2201 VAL B N   1 
ATOM   5515  C CA  . VAL B  1 183 ? 44.506  -52.140 43.294  1.00 15.08  ? 2201 VAL B CA  1 
ATOM   5516  C C   . VAL B  1 183 ? 46.031  -52.110 43.282  1.00 16.22  ? 2201 VAL B C   1 
ATOM   5517  O O   . VAL B  1 183 ? 46.676  -52.774 44.093  1.00 17.75  ? 2201 VAL B O   1 
ATOM   5518  C CB  . VAL B  1 183 ? 43.994  -53.077 42.169  1.00 15.86  ? 2201 VAL B CB  1 
ATOM   5519  C CG1 . VAL B  1 183 ? 44.798  -54.391 42.147  1.00 15.02  ? 2201 VAL B CG1 1 
ATOM   5520  C CG2 . VAL B  1 183 ? 42.516  -53.377 42.395  1.00 16.50  ? 2201 VAL B CG2 1 
ATOM   5521  N N   . GLN B  1 184 ? 46.603  -51.336 42.365  1.00 17.09  ? 2202 GLN B N   1 
ATOM   5522  C CA  . GLN B  1 184 ? 48.053  -51.207 42.282  1.00 18.08  ? 2202 GLN B CA  1 
ATOM   5523  C C   . GLN B  1 184 ? 48.641  -50.705 43.599  1.00 17.33  ? 2202 GLN B C   1 
ATOM   5524  O O   . GLN B  1 184 ? 49.601  -51.273 44.118  1.00 18.08  ? 2202 GLN B O   1 
ATOM   5525  C CB  . GLN B  1 184 ? 48.438  -50.235 41.163  1.00 18.03  ? 2202 GLN B CB  1 
ATOM   5526  C CG  . GLN B  1 184 ? 48.351  -50.828 39.774  1.00 21.24  ? 2202 GLN B CG  1 
ATOM   5527  C CD  . GLN B  1 184 ? 49.289  -52.006 39.609  1.00 26.22  ? 2202 GLN B CD  1 
ATOM   5528  O OE1 . GLN B  1 184 ? 50.514  -51.860 39.702  1.00 30.38  ? 2202 GLN B OE1 1 
ATOM   5529  N NE2 . GLN B  1 184 ? 48.724  -53.181 39.370  1.00 21.90  ? 2202 GLN B NE2 1 
ATOM   5530  N N   . ASP B  1 185 ? 48.053  -49.644 44.138  1.00 17.10  ? 2203 ASP B N   1 
ATOM   5531  C CA  . ASP B  1 185 ? 48.530  -49.036 45.379  1.00 18.52  ? 2203 ASP B CA  1 
ATOM   5532  C C   . ASP B  1 185 ? 48.195  -49.739 46.693  1.00 19.16  ? 2203 ASP B C   1 
ATOM   5533  O O   . ASP B  1 185 ? 48.817  -49.440 47.714  1.00 18.97  ? 2203 ASP B O   1 
ATOM   5534  C CB  . ASP B  1 185 ? 48.008  -47.597 45.503  1.00 20.76  ? 2203 ASP B CB  1 
ATOM   5535  C CG  . ASP B  1 185 ? 48.255  -46.770 44.265  1.00 26.40  ? 2203 ASP B CG  1 
ATOM   5536  O OD1 . ASP B  1 185 ? 49.249  -47.039 43.555  1.00 28.45  ? 2203 ASP B OD1 1 
ATOM   5537  O OD2 . ASP B  1 185 ? 47.456  -45.837 44.011  1.00 29.81  ? 2203 ASP B OD2 1 
ATOM   5538  N N   . ASN B  1 186 ? 47.234  -50.661 46.688  1.00 19.27  ? 2204 ASN B N   1 
ATOM   5539  C CA  . ASN B  1 186 ? 46.819  -51.303 47.941  1.00 18.85  ? 2204 ASN B CA  1 
ATOM   5540  C C   . ASN B  1 186 ? 46.750  -52.827 48.008  1.00 18.69  ? 2204 ASN B C   1 
ATOM   5541  O O   . ASN B  1 186 ? 46.799  -53.393 49.100  1.00 18.41  ? 2204 ASN B O   1 
ATOM   5542  C CB  . ASN B  1 186 ? 45.424  -50.795 48.335  1.00 19.50  ? 2204 ASN B CB  1 
ATOM   5543  C CG  . ASN B  1 186 ? 45.386  -49.301 48.594  1.00 19.75  ? 2204 ASN B CG  1 
ATOM   5544  O OD1 . ASN B  1 186 ? 45.609  -48.847 49.720  1.00 21.83  ? 2204 ASN B OD1 1 
ATOM   5545  N ND2 . ASN B  1 186 ? 45.099  -48.528 47.551  1.00 17.38  ? 2204 ASN B ND2 1 
ATOM   5546  N N   . ILE B  1 187 ? 46.630  -53.494 46.865  1.00 18.01  ? 2205 ILE B N   1 
ATOM   5547  C CA  . ILE B  1 187 ? 46.456  -54.945 46.876  1.00 16.42  ? 2205 ILE B CA  1 
ATOM   5548  C C   . ILE B  1 187 ? 47.521  -55.769 47.591  1.00 16.06  ? 2205 ILE B C   1 
ATOM   5549  O O   . ILE B  1 187 ? 47.242  -56.883 48.033  1.00 16.43  ? 2205 ILE B O   1 
ATOM   5550  C CB  . ILE B  1 187 ? 46.245  -55.496 45.436  1.00 18.24  ? 2205 ILE B CB  1 
ATOM   5551  C CG1 . ILE B  1 187 ? 45.411  -56.782 45.494  1.00 19.60  ? 2205 ILE B CG1 1 
ATOM   5552  C CG2 . ILE B  1 187 ? 47.581  -55.777 44.762  1.00 17.52  ? 2205 ILE B CG2 1 
ATOM   5553  C CD1 . ILE B  1 187 ? 43.982  -56.573 46.004  1.00 18.35  ? 2205 ILE B CD1 1 
ATOM   5554  N N   . ALA B  1 188 ? 48.728  -55.233 47.729  1.00 15.30  ? 2206 ALA B N   1 
ATOM   5555  C CA  . ALA B  1 188 ? 49.787  -55.975 48.407  1.00 18.69  ? 2206 ALA B CA  1 
ATOM   5556  C C   . ALA B  1 188 ? 49.417  -56.186 49.870  1.00 20.85  ? 2206 ALA B C   1 
ATOM   5557  O O   . ALA B  1 188 ? 49.827  -57.178 50.483  1.00 20.82  ? 2206 ALA B O   1 
ATOM   5558  C CB  . ALA B  1 188 ? 51.114  -55.230 48.308  1.00 19.67  ? 2206 ALA B CB  1 
ATOM   5559  N N   . SER B  1 189 ? 48.646  -55.250 50.424  1.00 19.15  ? 2207 SER B N   1 
ATOM   5560  C CA  . SER B  1 189 ? 48.217  -55.344 51.819  1.00 19.76  ? 2207 SER B CA  1 
ATOM   5561  C C   . SER B  1 189 ? 47.225  -56.494 51.997  1.00 18.15  ? 2207 SER B C   1 
ATOM   5562  O O   . SER B  1 189 ? 46.971  -56.921 53.118  1.00 19.69  ? 2207 SER B O   1 
ATOM   5563  C CB  . SER B  1 189 ? 47.560  -54.034 52.275  1.00 19.68  ? 2207 SER B CB  1 
ATOM   5564  O OG  . SER B  1 189 ? 48.467  -52.944 52.225  1.00 23.66  ? 2207 SER B OG  1 
ATOM   5565  N N   . PHE B  1 190 ? 46.658  -56.983 50.896  1.00 17.35  ? 2208 PHE B N   1 
ATOM   5566  C CA  . PHE B  1 190 ? 45.702  -58.088 50.963  1.00 17.08  ? 2208 PHE B CA  1 
ATOM   5567  C C   . PHE B  1 190 ? 46.293  -59.413 50.479  1.00 17.42  ? 2208 PHE B C   1 
ATOM   5568  O O   . PHE B  1 190 ? 45.564  -60.363 50.193  1.00 18.50  ? 2208 PHE B O   1 
ATOM   5569  C CB  . PHE B  1 190 ? 44.438  -57.759 50.160  1.00 17.67  ? 2208 PHE B CB  1 
ATOM   5570  C CG  . PHE B  1 190 ? 43.688  -56.560 50.678  1.00 20.87  ? 2208 PHE B CG  1 
ATOM   5571  C CD1 . PHE B  1 190 ? 44.078  -55.271 50.325  1.00 20.97  ? 2208 PHE B CD1 1 
ATOM   5572  C CD2 . PHE B  1 190 ? 42.615  -56.719 51.556  1.00 21.56  ? 2208 PHE B CD2 1 
ATOM   5573  C CE1 . PHE B  1 190 ? 43.416  -54.155 50.837  1.00 20.17  ? 2208 PHE B CE1 1 
ATOM   5574  C CE2 . PHE B  1 190 ? 41.948  -55.612 52.075  1.00 21.23  ? 2208 PHE B CE2 1 
ATOM   5575  C CZ  . PHE B  1 190 ? 42.349  -54.327 51.715  1.00 20.08  ? 2208 PHE B CZ  1 
ATOM   5576  N N   . GLY B  1 191 ? 47.616  -59.479 50.394  1.00 17.28  ? 2209 GLY B N   1 
ATOM   5577  C CA  . GLY B  1 191 ? 48.261  -60.703 49.948  1.00 18.03  ? 2209 GLY B CA  1 
ATOM   5578  C C   . GLY B  1 191 ? 48.332  -60.828 48.437  1.00 18.63  ? 2209 GLY B C   1 
ATOM   5579  O O   . GLY B  1 191 ? 48.650  -61.891 47.909  1.00 20.64  ? 2209 GLY B O   1 
ATOM   5580  N N   . GLY B  1 192 ? 48.051  -59.736 47.738  1.00 16.97  ? 2210 GLY B N   1 
ATOM   5581  C CA  . GLY B  1 192 ? 48.082  -59.767 46.290  1.00 18.73  ? 2210 GLY B CA  1 
ATOM   5582  C C   . GLY B  1 192 ? 49.321  -59.146 45.681  1.00 18.90  ? 2210 GLY B C   1 
ATOM   5583  O O   . GLY B  1 192 ? 49.993  -58.311 46.288  1.00 19.29  ? 2210 GLY B O   1 
ATOM   5584  N N   . ASN B  1 193 ? 49.616  -59.555 44.456  1.00 20.94  ? 2211 ASN B N   1 
ATOM   5585  C CA  . ASN B  1 193 ? 50.774  -59.056 43.735  1.00 20.52  ? 2211 ASN B CA  1 
ATOM   5586  C C   . ASN B  1 193 ? 50.340  -57.995 42.728  1.00 19.38  ? 2211 ASN B C   1 
ATOM   5587  O O   . ASN B  1 193 ? 49.719  -58.310 41.716  1.00 18.91  ? 2211 ASN B O   1 
ATOM   5588  C CB  . ASN B  1 193 ? 51.464  -60.230 43.027  1.00 23.49  ? 2211 ASN B CB  1 
ATOM   5589  C CG  . ASN B  1 193 ? 52.655  -59.801 42.191  1.00 25.09  ? 2211 ASN B CG  1 
ATOM   5590  O OD1 . ASN B  1 193 ? 53.193  -58.708 42.362  1.00 24.84  ? 2211 ASN B OD1 1 
ATOM   5591  N ND2 . ASN B  1 193 ? 53.084  -60.678 41.288  1.00 25.50  ? 2211 ASN B ND2 1 
ATOM   5592  N N   . PRO B  1 194 ? 50.664  -56.716 42.995  1.00 18.88  ? 2212 PRO B N   1 
ATOM   5593  C CA  . PRO B  1 194 ? 50.280  -55.644 42.071  1.00 18.47  ? 2212 PRO B CA  1 
ATOM   5594  C C   . PRO B  1 194 ? 50.940  -55.812 40.701  1.00 18.34  ? 2212 PRO B C   1 
ATOM   5595  O O   . PRO B  1 194 ? 50.493  -55.233 39.715  1.00 17.39  ? 2212 PRO B O   1 
ATOM   5596  C CB  . PRO B  1 194 ? 50.736  -54.381 42.800  1.00 19.31  ? 2212 PRO B CB  1 
ATOM   5597  C CG  . PRO B  1 194 ? 51.944  -54.853 43.548  1.00 20.21  ? 2212 PRO B CG  1 
ATOM   5598  C CD  . PRO B  1 194 ? 51.502  -56.194 44.090  1.00 17.78  ? 2212 PRO B CD  1 
ATOM   5599  N N   . GLY B  1 195 ? 51.999  -56.617 40.651  1.00 19.26  ? 2213 GLY B N   1 
ATOM   5600  C CA  . GLY B  1 195 ? 52.697  -56.863 39.399  1.00 20.82  ? 2213 GLY B CA  1 
ATOM   5601  C C   . GLY B  1 195 ? 52.068  -57.968 38.559  1.00 22.13  ? 2213 GLY B C   1 
ATOM   5602  O O   . GLY B  1 195 ? 52.572  -58.301 37.480  1.00 22.00  ? 2213 GLY B O   1 
ATOM   5603  N N   . SER B  1 196 ? 50.972  -58.546 39.049  1.00 19.77  ? 2214 SER B N   1 
ATOM   5604  C CA  . SER B  1 196 ? 50.276  -59.598 38.318  1.00 19.45  ? 2214 SER B CA  1 
ATOM   5605  C C   . SER B  1 196 ? 48.766  -59.446 38.453  1.00 18.56  ? 2214 SER B C   1 
ATOM   5606  O O   . SER B  1 196 ? 48.115  -60.193 39.185  1.00 19.74  ? 2214 SER B O   1 
ATOM   5607  C CB  . SER B  1 196 ? 50.694  -60.979 38.821  1.00 21.52  ? 2214 SER B CB  1 
ATOM   5608  O OG  . SER B  1 196 ? 49.953  -61.981 38.149  1.00 24.18  ? 2214 SER B OG  1 
ATOM   5609  N N   . VAL B  1 197 ? 48.219  -58.474 37.735  1.00 17.92  ? 2215 VAL B N   1 
ATOM   5610  C CA  . VAL B  1 197 ? 46.793  -58.192 37.762  1.00 14.45  ? 2215 VAL B CA  1 
ATOM   5611  C C   . VAL B  1 197 ? 46.112  -58.592 36.462  1.00 15.60  ? 2215 VAL B C   1 
ATOM   5612  O O   . VAL B  1 197 ? 46.518  -58.179 35.374  1.00 13.99  ? 2215 VAL B O   1 
ATOM   5613  C CB  . VAL B  1 197 ? 46.545  -56.687 38.020  1.00 15.49  ? 2215 VAL B CB  1 
ATOM   5614  C CG1 . VAL B  1 197 ? 45.042  -56.372 37.969  1.00 13.57  ? 2215 VAL B CG1 1 
ATOM   5615  C CG2 . VAL B  1 197 ? 47.128  -56.303 39.374  1.00 13.18  ? 2215 VAL B CG2 1 
ATOM   5616  N N   . THR B  1 198 ? 45.077  -59.412 36.582  1.00 12.65  ? 2216 THR B N   1 
ATOM   5617  C CA  . THR B  1 198 ? 44.324  -59.850 35.421  1.00 12.62  ? 2216 THR B CA  1 
ATOM   5618  C C   . THR B  1 198 ? 42.962  -59.176 35.489  1.00 12.99  ? 2216 THR B C   1 
ATOM   5619  O O   . THR B  1 198 ? 42.355  -59.105 36.555  1.00 11.76  ? 2216 THR B O   1 
ATOM   5620  C CB  . THR B  1 198 ? 44.127  -61.381 35.437  1.00 13.36  ? 2216 THR B CB  1 
ATOM   5621  O OG1 . THR B  1 198 ? 45.399  -62.025 35.273  1.00 14.57  ? 2216 THR B OG1 1 
ATOM   5622  C CG2 . THR B  1 198 ? 43.177  -61.816 34.330  1.00 13.52  ? 2216 THR B CG2 1 
ATOM   5623  N N   . ILE B  1 199 ? 42.498  -58.631 34.375  1.00 10.22  ? 2217 ILE B N   1 
ATOM   5624  C CA  . ILE B  1 199 ? 41.174  -58.028 34.378  1.00 13.11  ? 2217 ILE B CA  1 
ATOM   5625  C C   . ILE B  1 199 ? 40.285  -58.919 33.530  1.00 13.50  ? 2217 ILE B C   1 
ATOM   5626  O O   . ILE B  1 199 ? 40.678  -59.356 32.445  1.00 15.26  ? 2217 ILE B O   1 
ATOM   5627  C CB  . ILE B  1 199 ? 41.163  -56.584 33.807  1.00 13.31  ? 2217 ILE B CB  1 
ATOM   5628  C CG1 . ILE B  1 199 ? 41.769  -56.558 32.405  1.00 14.35  ? 2217 ILE B CG1 1 
ATOM   5629  C CG2 . ILE B  1 199 ? 41.920  -55.648 34.739  1.00 13.52  ? 2217 ILE B CG2 1 
ATOM   5630  C CD1 . ILE B  1 199 ? 41.767  -55.180 31.771  1.00 16.68  ? 2217 ILE B CD1 1 
ATOM   5631  N N   . PHE B  1 200 ? 39.106  -59.237 34.043  1.00 12.00  ? 2218 PHE B N   1 
ATOM   5632  C CA  . PHE B  1 200 ? 38.180  -60.057 33.293  1.00 12.61  ? 2218 PHE B CA  1 
ATOM   5633  C C   . PHE B  1 200 ? 36.763  -59.568 33.526  1.00 12.65  ? 2218 PHE B C   1 
ATOM   5634  O O   . PHE B  1 200 ? 36.449  -59.021 34.582  1.00 14.09  ? 2218 PHE B O   1 
ATOM   5635  C CB  . PHE B  1 200 ? 38.361  -61.565 33.622  1.00 12.22  ? 2218 PHE B CB  1 
ATOM   5636  C CG  . PHE B  1 200 ? 38.019  -61.975 35.049  1.00 13.10  ? 2218 PHE B CG  1 
ATOM   5637  C CD1 . PHE B  1 200 ? 38.485  -61.259 36.151  1.00 10.76  ? 2218 PHE B CD1 1 
ATOM   5638  C CD2 . PHE B  1 200 ? 37.270  -63.137 35.278  1.00 14.70  ? 2218 PHE B CD2 1 
ATOM   5639  C CE1 . PHE B  1 200 ? 38.214  -61.693 37.465  1.00 11.27  ? 2218 PHE B CE1 1 
ATOM   5640  C CE2 . PHE B  1 200 ? 36.989  -63.586 36.595  1.00 14.24  ? 2218 PHE B CE2 1 
ATOM   5641  C CZ  . PHE B  1 200 ? 37.460  -62.862 37.685  1.00 11.96  ? 2218 PHE B CZ  1 
ATOM   5642  N N   . GLY B  1 201 ? 35.927  -59.719 32.508  1.00 13.35  ? 2219 GLY B N   1 
ATOM   5643  C CA  . GLY B  1 201 ? 34.551  -59.280 32.600  1.00 12.37  ? 2219 GLY B CA  1 
ATOM   5644  C C   . GLY B  1 201 ? 33.718  -59.937 31.521  1.00 15.10  ? 2219 GLY B C   1 
ATOM   5645  O O   . GLY B  1 201 ? 34.252  -60.443 30.526  1.00 14.92  ? 2219 GLY B O   1 
ATOM   5646  N N   . GLU B  1 202 ? 32.405  -59.914 31.704  1.00 14.07  ? 2220 GLU B N   1 
ATOM   5647  C CA  . GLU B  1 202 ? 31.486  -60.527 30.754  1.00 16.22  ? 2220 GLU B CA  1 
ATOM   5648  C C   . GLU B  1 202 ? 30.504  -59.494 30.196  1.00 17.28  ? 2220 GLU B C   1 
ATOM   5649  O O   . GLU B  1 202 ? 30.091  -58.562 30.894  1.00 18.65  ? 2220 GLU B O   1 
ATOM   5650  C CB  . GLU B  1 202 ? 30.751  -61.682 31.453  1.00 18.19  ? 2220 GLU B CB  1 
ATOM   5651  C CG  . GLU B  1 202 ? 29.827  -62.512 30.573  1.00 20.89  ? 2220 GLU B CG  1 
ATOM   5652  C CD  . GLU B  1 202 ? 28.431  -61.925 30.478  1.00 26.02  ? 2220 GLU B CD  1 
ATOM   5653  O OE1 . GLU B  1 202 ? 28.119  -60.999 31.262  1.00 27.24  ? 2220 GLU B OE1 1 
ATOM   5654  O OE2 . GLU B  1 202 ? 27.642  -62.397 29.628  1.00 28.09  ? 2220 GLU B OE2 1 
ATOM   5655  N N   . SER B  1 203 ? 30.156  -59.653 28.925  1.00 16.63  ? 2221 SER B N   1 
ATOM   5656  C CA  . SER B  1 203 ? 29.239  -58.750 28.242  1.00 16.88  ? 2221 SER B CA  1 
ATOM   5657  C C   . SER B  1 203 ? 29.790  -57.316 28.273  1.00 16.62  ? 2221 SER B C   1 
ATOM   5658  O O   . SER B  1 203 ? 30.913  -57.078 27.825  1.00 18.21  ? 2221 SER B O   1 
ATOM   5659  C CB  . SER B  1 203 ? 27.853  -58.838 28.892  1.00 17.45  ? 2221 SER B CB  1 
ATOM   5660  O OG  . SER B  1 203 ? 26.844  -58.485 27.964  1.00 20.83  ? 2221 SER B OG  1 
ATOM   5661  N N   . ALA B  1 204 ? 29.027  -56.355 28.784  1.00 15.24  ? 2222 ALA B N   1 
ATOM   5662  C CA  . ALA B  1 204 ? 29.533  -54.984 28.843  1.00 14.37  ? 2222 ALA B CA  1 
ATOM   5663  C C   . ALA B  1 204 ? 30.826  -54.961 29.648  1.00 13.24  ? 2222 ALA B C   1 
ATOM   5664  O O   . ALA B  1 204 ? 31.622  -54.028 29.537  1.00 13.65  ? 2222 ALA B O   1 
ATOM   5665  C CB  . ALA B  1 204 ? 28.506  -54.054 29.472  1.00 15.38  ? 2222 ALA B CB  1 
ATOM   5666  N N   . GLY B  1 205 ? 31.028  -55.993 30.464  1.00 12.31  ? 2223 GLY B N   1 
ATOM   5667  C CA  . GLY B  1 205 ? 32.240  -56.088 31.259  1.00 12.69  ? 2223 GLY B CA  1 
ATOM   5668  C C   . GLY B  1 205 ? 33.381  -56.534 30.362  1.00 12.86  ? 2223 GLY B C   1 
ATOM   5669  O O   . GLY B  1 205 ? 34.538  -56.145 30.549  1.00 13.81  ? 2223 GLY B O   1 
ATOM   5670  N N   . GLY B  1 206 ? 33.046  -57.369 29.386  1.00 14.00  ? 2224 GLY B N   1 
ATOM   5671  C CA  . GLY B  1 206 ? 34.040  -57.846 28.442  1.00 14.81  ? 2224 GLY B CA  1 
ATOM   5672  C C   . GLY B  1 206 ? 34.405  -56.694 27.529  1.00 14.11  ? 2224 GLY B C   1 
ATOM   5673  O O   . GLY B  1 206 ? 35.560  -56.533 27.142  1.00 13.73  ? 2224 GLY B O   1 
ATOM   5674  N N   . GLU B  1 207 ? 33.413  -55.881 27.183  1.00 13.96  ? 2225 GLU B N   1 
ATOM   5675  C CA  . GLU B  1 207 ? 33.647  -54.724 26.323  1.00 14.61  ? 2225 GLU B CA  1 
ATOM   5676  C C   . GLU B  1 207 ? 34.566  -53.756 27.059  1.00 14.72  ? 2225 GLU B C   1 
ATOM   5677  O O   . GLU B  1 207 ? 35.477  -53.171 26.465  1.00 15.80  ? 2225 GLU B O   1 
ATOM   5678  C CB  . GLU B  1 207 ? 32.314  -54.053 25.962  1.00 14.79  ? 2225 GLU B CB  1 
ATOM   5679  C CG  . GLU B  1 207 ? 32.437  -52.847 25.037  1.00 16.40  ? 2225 GLU B CG  1 
ATOM   5680  C CD  . GLU B  1 207 ? 32.373  -51.520 25.783  1.00 19.73  ? 2225 GLU B CD  1 
ATOM   5681  O OE1 . GLU B  1 207 ? 32.383  -51.533 27.033  1.00 18.61  ? 2225 GLU B OE1 1 
ATOM   5682  O OE2 . GLU B  1 207 ? 32.314  -50.463 25.116  1.00 19.70  ? 2225 GLU B OE2 1 
ATOM   5683  N N   . SER B  1 208 ? 34.342  -53.608 28.363  1.00 13.08  ? 2226 SER B N   1 
ATOM   5684  C CA  . SER B  1 208 ? 35.162  -52.727 29.182  1.00 11.71  ? 2226 SER B CA  1 
ATOM   5685  C C   . SER B  1 208 ? 36.615  -53.192 29.184  1.00 10.88  ? 2226 SER B C   1 
ATOM   5686  O O   . SER B  1 208 ? 37.525  -52.383 29.057  1.00 9.68   ? 2226 SER B O   1 
ATOM   5687  C CB  . SER B  1 208 ? 34.614  -52.673 30.621  1.00 9.42   ? 2226 SER B CB  1 
ATOM   5688  O OG  . SER B  1 208 ? 33.330  -52.060 30.626  1.00 10.24  ? 2226 SER B OG  1 
ATOM   5689  N N   . VAL B  1 209 ? 36.828  -54.497 29.347  1.00 11.22  ? 2227 VAL B N   1 
ATOM   5690  C CA  . VAL B  1 209 ? 38.176  -55.047 29.327  1.00 10.92  ? 2227 VAL B CA  1 
ATOM   5691  C C   . VAL B  1 209 ? 38.797  -54.702 27.963  1.00 11.72  ? 2227 VAL B C   1 
ATOM   5692  O O   . VAL B  1 209 ? 39.927  -54.216 27.886  1.00 11.89  ? 2227 VAL B O   1 
ATOM   5693  C CB  . VAL B  1 209 ? 38.154  -56.590 29.527  1.00 11.36  ? 2227 VAL B CB  1 
ATOM   5694  C CG1 . VAL B  1 209 ? 39.482  -57.201 29.103  1.00 9.17   ? 2227 VAL B CG1 1 
ATOM   5695  C CG2 . VAL B  1 209 ? 37.882  -56.915 31.015  1.00 8.78   ? 2227 VAL B CG2 1 
ATOM   5696  N N   . SER B  1 210 ? 38.038  -54.920 26.896  1.00 10.16  ? 2228 SER B N   1 
ATOM   5697  C CA  . SER B  1 210 ? 38.518  -54.632 25.543  1.00 12.19  ? 2228 SER B CA  1 
ATOM   5698  C C   . SER B  1 210 ? 38.908  -53.154 25.383  1.00 15.00  ? 2228 SER B C   1 
ATOM   5699  O O   . SER B  1 210 ? 39.945  -52.832 24.792  1.00 15.68  ? 2228 SER B O   1 
ATOM   5700  C CB  . SER B  1 210 ? 37.445  -55.019 24.525  1.00 10.56  ? 2228 SER B CB  1 
ATOM   5701  O OG  . SER B  1 210 ? 37.925  -54.893 23.195  1.00 15.78  ? 2228 SER B OG  1 
ATOM   5702  N N   . VAL B  1 211 ? 38.083  -52.259 25.923  1.00 15.35  ? 2229 VAL B N   1 
ATOM   5703  C CA  . VAL B  1 211 ? 38.351  -50.824 25.859  1.00 15.67  ? 2229 VAL B CA  1 
ATOM   5704  C C   . VAL B  1 211 ? 39.624  -50.447 26.627  1.00 15.36  ? 2229 VAL B C   1 
ATOM   5705  O O   . VAL B  1 211 ? 40.443  -49.676 26.132  1.00 16.70  ? 2229 VAL B O   1 
ATOM   5706  C CB  . VAL B  1 211 ? 37.145  -50.013 26.418  1.00 16.91  ? 2229 VAL B CB  1 
ATOM   5707  C CG1 . VAL B  1 211 ? 37.545  -48.565 26.681  1.00 18.29  ? 2229 VAL B CG1 1 
ATOM   5708  C CG2 . VAL B  1 211 ? 35.990  -50.067 25.423  1.00 15.85  ? 2229 VAL B CG2 1 
ATOM   5709  N N   . LEU B  1 212 ? 39.790  -50.987 27.832  1.00 15.79  ? 2230 LEU B N   1 
ATOM   5710  C CA  . LEU B  1 212 ? 40.972  -50.694 28.648  1.00 16.95  ? 2230 LEU B CA  1 
ATOM   5711  C C   . LEU B  1 212 ? 42.242  -51.176 27.936  1.00 18.50  ? 2230 LEU B C   1 
ATOM   5712  O O   . LEU B  1 212 ? 43.302  -50.562 28.054  1.00 18.30  ? 2230 LEU B O   1 
ATOM   5713  C CB  . LEU B  1 212 ? 40.846  -51.358 30.031  1.00 14.96  ? 2230 LEU B CB  1 
ATOM   5714  C CG  . LEU B  1 212 ? 39.681  -50.828 30.890  1.00 17.59  ? 2230 LEU B CG  1 
ATOM   5715  C CD1 . LEU B  1 212 ? 39.487  -51.688 32.127  1.00 16.32  ? 2230 LEU B CD1 1 
ATOM   5716  C CD2 . LEU B  1 212 ? 39.956  -49.389 31.287  1.00 17.27  ? 2230 LEU B CD2 1 
ATOM   5717  N N   . VAL B  1 213 ? 42.128  -52.280 27.202  1.00 16.85  ? 2231 VAL B N   1 
ATOM   5718  C CA  . VAL B  1 213 ? 43.259  -52.816 26.451  1.00 17.52  ? 2231 VAL B CA  1 
ATOM   5719  C C   . VAL B  1 213 ? 43.704  -51.776 25.414  1.00 18.10  ? 2231 VAL B C   1 
ATOM   5720  O O   . VAL B  1 213 ? 44.892  -51.631 25.123  1.00 16.71  ? 2231 VAL B O   1 
ATOM   5721  C CB  . VAL B  1 213 ? 42.864  -54.133 25.735  1.00 19.61  ? 2231 VAL B CB  1 
ATOM   5722  C CG1 . VAL B  1 213 ? 43.889  -54.491 24.656  1.00 17.64  ? 2231 VAL B CG1 1 
ATOM   5723  C CG2 . VAL B  1 213 ? 42.762  -55.261 26.757  1.00 17.07  ? 2231 VAL B CG2 1 
ATOM   5724  N N   . LEU B  1 214 ? 42.735  -51.032 24.894  1.00 18.48  ? 2232 LEU B N   1 
ATOM   5725  C CA  . LEU B  1 214 ? 42.981  -50.011 23.885  1.00 20.68  ? 2232 LEU B CA  1 
ATOM   5726  C C   . LEU B  1 214 ? 43.232  -48.621 24.452  1.00 21.75  ? 2232 LEU B C   1 
ATOM   5727  O O   . LEU B  1 214 ? 43.467  -47.684 23.692  1.00 24.07  ? 2232 LEU B O   1 
ATOM   5728  C CB  . LEU B  1 214 ? 41.785  -49.935 22.935  1.00 21.52  ? 2232 LEU B CB  1 
ATOM   5729  C CG  . LEU B  1 214 ? 41.417  -51.190 22.139  1.00 23.83  ? 2232 LEU B CG  1 
ATOM   5730  C CD1 . LEU B  1 214 ? 40.047  -50.996 21.506  1.00 22.62  ? 2232 LEU B CD1 1 
ATOM   5731  C CD2 . LEU B  1 214 ? 42.471  -51.468 21.079  1.00 23.97  ? 2232 LEU B CD2 1 
ATOM   5732  N N   . SER B  1 215 ? 43.203  -48.476 25.774  1.00 21.37  ? 2233 SER B N   1 
ATOM   5733  C CA  . SER B  1 215 ? 43.390  -47.160 26.380  1.00 22.12  ? 2233 SER B CA  1 
ATOM   5734  C C   . SER B  1 215 ? 44.746  -46.872 27.013  1.00 22.04  ? 2233 SER B C   1 
ATOM   5735  O O   . SER B  1 215 ? 45.255  -47.659 27.810  1.00 21.81  ? 2233 SER B O   1 
ATOM   5736  C CB  . SER B  1 215 ? 42.301  -46.915 27.429  1.00 23.10  ? 2233 SER B CB  1 
ATOM   5737  O OG  . SER B  1 215 ? 42.488  -45.662 28.064  1.00 23.93  ? 2233 SER B OG  1 
ATOM   5738  N N   . PRO B  1 216 ? 45.342  -45.718 26.677  1.00 21.63  ? 2234 PRO B N   1 
ATOM   5739  C CA  . PRO B  1 216 ? 46.643  -45.356 27.243  1.00 21.64  ? 2234 PRO B CA  1 
ATOM   5740  C C   . PRO B  1 216 ? 46.557  -45.072 28.744  1.00 22.23  ? 2234 PRO B C   1 
ATOM   5741  O O   . PRO B  1 216 ? 47.568  -45.099 29.441  1.00 20.88  ? 2234 PRO B O   1 
ATOM   5742  C CB  . PRO B  1 216 ? 47.039  -44.121 26.437  1.00 22.51  ? 2234 PRO B CB  1 
ATOM   5743  C CG  . PRO B  1 216 ? 45.706  -43.500 26.103  1.00 23.61  ? 2234 PRO B CG  1 
ATOM   5744  C CD  . PRO B  1 216 ? 44.890  -44.706 25.706  1.00 21.58  ? 2234 PRO B CD  1 
ATOM   5745  N N   . LEU B  1 217 ? 45.347  -44.813 29.237  1.00 22.34  ? 2235 LEU B N   1 
ATOM   5746  C CA  . LEU B  1 217 ? 45.144  -44.522 30.658  1.00 22.16  ? 2235 LEU B CA  1 
ATOM   5747  C C   . LEU B  1 217 ? 45.277  -45.753 31.548  1.00 21.55  ? 2235 LEU B C   1 
ATOM   5748  O O   . LEU B  1 217 ? 45.489  -45.630 32.755  1.00 21.42  ? 2235 LEU B O   1 
ATOM   5749  C CB  . LEU B  1 217 ? 43.765  -43.897 30.880  1.00 24.20  ? 2235 LEU B CB  1 
ATOM   5750  C CG  . LEU B  1 217 ? 43.486  -42.557 30.198  1.00 25.35  ? 2235 LEU B CG  1 
ATOM   5751  C CD1 . LEU B  1 217 ? 42.039  -42.151 30.442  1.00 26.85  ? 2235 LEU B CD1 1 
ATOM   5752  C CD2 . LEU B  1 217 ? 44.436  -41.503 30.738  1.00 27.63  ? 2235 LEU B CD2 1 
ATOM   5753  N N   . ALA B  1 218 ? 45.147  -46.936 30.954  1.00 21.38  ? 2236 ALA B N   1 
ATOM   5754  C CA  . ALA B  1 218 ? 45.246  -48.187 31.707  1.00 22.18  ? 2236 ALA B CA  1 
ATOM   5755  C C   . ALA B  1 218 ? 46.602  -48.869 31.520  1.00 23.46  ? 2236 ALA B C   1 
ATOM   5756  O O   . ALA B  1 218 ? 46.802  -50.012 31.942  1.00 21.47  ? 2236 ALA B O   1 
ATOM   5757  C CB  . ALA B  1 218 ? 44.121  -49.133 31.284  1.00 18.65  ? 2236 ALA B CB  1 
ATOM   5758  N N   . LYS B  1 219 ? 47.530  -48.140 30.905  1.00 25.09  ? 2237 LYS B N   1 
ATOM   5759  C CA  . LYS B  1 219 ? 48.882  -48.616 30.607  1.00 29.04  ? 2237 LYS B CA  1 
ATOM   5760  C C   . LYS B  1 219 ? 49.535  -49.636 31.540  1.00 30.50  ? 2237 LYS B C   1 
ATOM   5761  O O   . LYS B  1 219 ? 49.821  -50.759 31.128  1.00 34.28  ? 2237 LYS B O   1 
ATOM   5762  C CB  . LYS B  1 219 ? 49.828  -47.416 30.451  1.00 31.57  ? 2237 LYS B CB  1 
ATOM   5763  N N   . ASN B  1 220 ? 49.797  -49.259 32.784  1.00 29.92  ? 2238 ASN B N   1 
ATOM   5764  C CA  . ASN B  1 220 ? 50.461  -50.188 33.700  1.00 29.07  ? 2238 ASN B CA  1 
ATOM   5765  C C   . ASN B  1 220 ? 49.561  -50.708 34.811  1.00 26.71  ? 2238 ASN B C   1 
ATOM   5766  O O   . ASN B  1 220 ? 50.040  -51.029 35.896  1.00 27.65  ? 2238 ASN B O   1 
ATOM   5767  C CB  . ASN B  1 220 ? 51.665  -49.498 34.329  1.00 32.04  ? 2238 ASN B CB  1 
ATOM   5768  C CG  . ASN B  1 220 ? 52.586  -48.902 33.299  1.00 33.53  ? 2238 ASN B CG  1 
ATOM   5769  O OD1 . ASN B  1 220 ? 53.249  -49.624 32.553  1.00 37.19  ? 2238 ASN B OD1 1 
ATOM   5770  N ND2 . ASN B  1 220 ? 52.623  -47.576 33.237  1.00 36.49  ? 2238 ASN B ND2 1 
ATOM   5771  N N   . LEU B  1 221 ? 48.268  -50.819 34.531  1.00 22.80  ? 2239 LEU B N   1 
ATOM   5772  C CA  . LEU B  1 221 ? 47.315  -51.252 35.534  1.00 21.47  ? 2239 LEU B CA  1 
ATOM   5773  C C   . LEU B  1 221 ? 46.915  -52.722 35.485  1.00 20.41  ? 2239 LEU B C   1 
ATOM   5774  O O   . LEU B  1 221 ? 46.226  -53.196 36.382  1.00 20.89  ? 2239 LEU B O   1 
ATOM   5775  C CB  . LEU B  1 221 ? 46.074  -50.352 35.467  1.00 20.34  ? 2239 LEU B CB  1 
ATOM   5776  C CG  . LEU B  1 221 ? 46.384  -48.858 35.639  1.00 22.04  ? 2239 LEU B CG  1 
ATOM   5777  C CD1 . LEU B  1 221 ? 45.100  -48.050 35.578  1.00 20.35  ? 2239 LEU B CD1 1 
ATOM   5778  C CD2 . LEU B  1 221 ? 47.100  -48.633 36.965  1.00 21.58  ? 2239 LEU B CD2 1 
ATOM   5779  N N   . PHE B  1 222 ? 47.332  -53.439 34.443  1.00 18.14  ? 2240 PHE B N   1 
ATOM   5780  C CA  . PHE B  1 222 ? 47.029  -54.867 34.333  1.00 17.93  ? 2240 PHE B CA  1 
ATOM   5781  C C   . PHE B  1 222 ? 48.048  -55.596 33.453  1.00 17.98  ? 2240 PHE B C   1 
ATOM   5782  O O   . PHE B  1 222 ? 48.736  -54.973 32.637  1.00 18.19  ? 2240 PHE B O   1 
ATOM   5783  C CB  . PHE B  1 222 ? 45.605  -55.095 33.813  1.00 15.78  ? 2240 PHE B CB  1 
ATOM   5784  C CG  . PHE B  1 222 ? 45.345  -54.506 32.466  1.00 15.43  ? 2240 PHE B CG  1 
ATOM   5785  C CD1 . PHE B  1 222 ? 45.100  -53.144 32.321  1.00 18.09  ? 2240 PHE B CD1 1 
ATOM   5786  C CD2 . PHE B  1 222 ? 45.309  -55.317 31.341  1.00 15.89  ? 2240 PHE B CD2 1 
ATOM   5787  C CE1 . PHE B  1 222 ? 44.816  -52.599 31.065  1.00 18.47  ? 2240 PHE B CE1 1 
ATOM   5788  C CE2 . PHE B  1 222 ? 45.029  -54.790 30.085  1.00 16.77  ? 2240 PHE B CE2 1 
ATOM   5789  C CZ  . PHE B  1 222 ? 44.780  -53.424 29.945  1.00 19.43  ? 2240 PHE B CZ  1 
ATOM   5790  N N   . HIS B  1 223 ? 48.120  -56.915 33.603  1.00 15.71  ? 2241 HIS B N   1 
ATOM   5791  C CA  . HIS B  1 223 ? 49.104  -57.717 32.889  1.00 16.77  ? 2241 HIS B CA  1 
ATOM   5792  C C   . HIS B  1 223 ? 48.539  -58.888 32.092  1.00 17.26  ? 2241 HIS B C   1 
ATOM   5793  O O   . HIS B  1 223 ? 49.281  -59.611 31.427  1.00 16.79  ? 2241 HIS B O   1 
ATOM   5794  C CB  . HIS B  1 223 ? 50.118  -58.212 33.912  1.00 15.49  ? 2241 HIS B CB  1 
ATOM   5795  C CG  . HIS B  1 223 ? 50.576  -57.139 34.852  1.00 19.93  ? 2241 HIS B CG  1 
ATOM   5796  N ND1 . HIS B  1 223 ? 49.930  -56.854 36.039  1.00 20.83  ? 2241 HIS B ND1 1 
ATOM   5797  C CD2 . HIS B  1 223 ? 51.577  -56.234 34.740  1.00 17.95  ? 2241 HIS B CD2 1 
ATOM   5798  C CE1 . HIS B  1 223 ? 50.515  -55.818 36.617  1.00 20.80  ? 2241 HIS B CE1 1 
ATOM   5799  N NE2 . HIS B  1 223 ? 51.516  -55.423 35.849  1.00 23.22  ? 2241 HIS B NE2 1 
ATOM   5800  N N   . ARG B  1 224 ? 47.227  -59.075 32.183  1.00 15.72  ? 2242 ARG B N   1 
ATOM   5801  C CA  . ARG B  1 224 ? 46.510  -60.128 31.465  1.00 15.70  ? 2242 ARG B CA  1 
ATOM   5802  C C   . ARG B  1 224 ? 45.068  -59.648 31.362  1.00 16.79  ? 2242 ARG B C   1 
ATOM   5803  O O   . ARG B  1 224 ? 44.583  -58.952 32.256  1.00 14.62  ? 2242 ARG B O   1 
ATOM   5804  C CB  . ARG B  1 224 ? 46.519  -61.463 32.229  1.00 17.71  ? 2242 ARG B CB  1 
ATOM   5805  C CG  . ARG B  1 224 ? 47.876  -62.149 32.379  1.00 18.06  ? 2242 ARG B CG  1 
ATOM   5806  C CD  . ARG B  1 224 ? 48.438  -61.900 33.761  1.00 17.23  ? 2242 ARG B CD  1 
ATOM   5807  N NE  . ARG B  1 224 ? 49.569  -62.761 34.093  1.00 18.12  ? 2242 ARG B NE  1 
ATOM   5808  C CZ  . ARG B  1 224 ? 50.721  -62.789 33.430  1.00 18.03  ? 2242 ARG B CZ  1 
ATOM   5809  N NH1 . ARG B  1 224 ? 50.914  -62.000 32.380  1.00 17.85  ? 2242 ARG B NH1 1 
ATOM   5810  N NH2 . ARG B  1 224 ? 51.683  -63.612 33.820  1.00 18.37  ? 2242 ARG B NH2 1 
ATOM   5811  N N   . ALA B  1 225 ? 44.388  -60.018 30.284  1.00 13.80  ? 2243 ALA B N   1 
ATOM   5812  C CA  . ALA B  1 225 ? 43.004  -59.617 30.093  1.00 14.62  ? 2243 ALA B CA  1 
ATOM   5813  C C   . ALA B  1 225 ? 42.157  -60.767 29.563  1.00 14.93  ? 2243 ALA B C   1 
ATOM   5814  O O   . ALA B  1 225 ? 42.633  -61.609 28.794  1.00 15.04  ? 2243 ALA B O   1 
ATOM   5815  C CB  . ALA B  1 225 ? 42.930  -58.439 29.139  1.00 14.12  ? 2243 ALA B CB  1 
ATOM   5816  N N   . ILE B  1 226 ? 40.899  -60.798 29.992  1.00 13.24  ? 2244 ILE B N   1 
ATOM   5817  C CA  . ILE B  1 226 ? 39.949  -61.814 29.555  1.00 10.51  ? 2244 ILE B CA  1 
ATOM   5818  C C   . ILE B  1 226 ? 38.613  -61.141 29.264  1.00 12.88  ? 2244 ILE B C   1 
ATOM   5819  O O   . ILE B  1 226 ? 38.019  -60.516 30.152  1.00 10.72  ? 2244 ILE B O   1 
ATOM   5820  C CB  . ILE B  1 226 ? 39.670  -62.889 30.639  1.00 10.53  ? 2244 ILE B CB  1 
ATOM   5821  C CG1 . ILE B  1 226 ? 40.969  -63.570 31.078  1.00 10.64  ? 2244 ILE B CG1 1 
ATOM   5822  C CG2 . ILE B  1 226 ? 38.664  -63.928 30.084  1.00 9.36   ? 2244 ILE B CG2 1 
ATOM   5823  C CD1 . ILE B  1 226 ? 40.788  -64.608 32.182  1.00 13.10  ? 2244 ILE B CD1 1 
ATOM   5824  N N   . SER B  1 227 ? 38.148  -61.256 28.024  1.00 9.86   ? 2245 SER B N   1 
ATOM   5825  C CA  . SER B  1 227 ? 36.857  -60.702 27.639  1.00 14.10  ? 2245 SER B CA  1 
ATOM   5826  C C   . SER B  1 227 ? 35.937  -61.874 27.347  1.00 15.46  ? 2245 SER B C   1 
ATOM   5827  O O   . SER B  1 227 ? 36.191  -62.660 26.429  1.00 15.04  ? 2245 SER B O   1 
ATOM   5828  C CB  . SER B  1 227 ? 36.967  -59.829 26.386  1.00 12.19  ? 2245 SER B CB  1 
ATOM   5829  O OG  . SER B  1 227 ? 37.524  -58.569 26.699  1.00 13.82  ? 2245 SER B OG  1 
ATOM   5830  N N   . GLU B  1 228 ? 34.874  -61.990 28.135  1.00 14.46  ? 2246 GLU B N   1 
ATOM   5831  C CA  . GLU B  1 228 ? 33.902  -63.068 27.979  1.00 15.34  ? 2246 GLU B CA  1 
ATOM   5832  C C   . GLU B  1 228 ? 32.632  -62.501 27.352  1.00 16.62  ? 2246 GLU B C   1 
ATOM   5833  O O   . GLU B  1 228 ? 31.942  -61.690 27.964  1.00 17.76  ? 2246 GLU B O   1 
ATOM   5834  C CB  . GLU B  1 228 ? 33.582  -63.687 29.350  1.00 13.18  ? 2246 GLU B CB  1 
ATOM   5835  C CG  . GLU B  1 228 ? 34.778  -64.314 30.070  1.00 15.09  ? 2246 GLU B CG  1 
ATOM   5836  C CD  . GLU B  1 228 ? 34.509  -64.584 31.556  1.00 19.74  ? 2246 GLU B CD  1 
ATOM   5837  O OE1 . GLU B  1 228 ? 33.365  -64.952 31.909  1.00 22.07  ? 2246 GLU B OE1 1 
ATOM   5838  O OE2 . GLU B  1 228 ? 35.444  -64.439 32.372  1.00 17.81  ? 2246 GLU B OE2 1 
ATOM   5839  N N   . SER B  1 229 ? 32.349  -62.916 26.119  1.00 15.92  ? 2247 SER B N   1 
ATOM   5840  C CA  . SER B  1 229 ? 31.166  -62.476 25.384  1.00 17.86  ? 2247 SER B CA  1 
ATOM   5841  C C   . SER B  1 229 ? 30.980  -60.959 25.315  1.00 17.69  ? 2247 SER B C   1 
ATOM   5842  O O   . SER B  1 229 ? 29.958  -60.424 25.749  1.00 16.58  ? 2247 SER B O   1 
ATOM   5843  C CB  . SER B  1 229 ? 29.906  -63.106 25.984  1.00 18.14  ? 2247 SER B CB  1 
ATOM   5844  O OG  . SER B  1 229 ? 30.026  -64.517 26.057  1.00 23.56  ? 2247 SER B OG  1 
ATOM   5845  N N   . GLY B  1 230 ? 31.961  -60.274 24.744  1.00 17.36  ? 2248 GLY B N   1 
ATOM   5846  C CA  . GLY B  1 230 ? 31.868  -58.835 24.617  1.00 14.92  ? 2248 GLY B CA  1 
ATOM   5847  C C   . GLY B  1 230 ? 33.218  -58.194 24.388  1.00 14.53  ? 2248 GLY B C   1 
ATOM   5848  O O   . GLY B  1 230 ? 34.156  -58.438 25.145  1.00 16.07  ? 2248 GLY B O   1 
ATOM   5849  N N   . VAL B  1 231 ? 33.317  -57.385 23.335  1.00 14.07  ? 2249 VAL B N   1 
ATOM   5850  C CA  . VAL B  1 231 ? 34.551  -56.678 23.015  1.00 14.21  ? 2249 VAL B CA  1 
ATOM   5851  C C   . VAL B  1 231 ? 34.224  -55.277 22.498  1.00 13.21  ? 2249 VAL B C   1 
ATOM   5852  O O   . VAL B  1 231 ? 33.061  -54.929 22.316  1.00 15.33  ? 2249 VAL B O   1 
ATOM   5853  C CB  . VAL B  1 231 ? 35.407  -57.438 21.958  1.00 14.25  ? 2249 VAL B CB  1 
ATOM   5854  C CG1 . VAL B  1 231 ? 35.897  -58.751 22.536  1.00 12.32  ? 2249 VAL B CG1 1 
ATOM   5855  C CG2 . VAL B  1 231 ? 34.600  -57.678 20.703  1.00 13.88  ? 2249 VAL B CG2 1 
ATOM   5856  N N   . ALA B  1 232 ? 35.254  -54.476 22.262  1.00 15.10  ? 2250 ALA B N   1 
ATOM   5857  C CA  . ALA B  1 232 ? 35.065  -53.102 21.807  1.00 15.79  ? 2250 ALA B CA  1 
ATOM   5858  C C   . ALA B  1 232 ? 34.430  -52.994 20.430  1.00 19.07  ? 2250 ALA B C   1 
ATOM   5859  O O   . ALA B  1 232 ? 34.057  -51.896 20.005  1.00 19.20  ? 2250 ALA B O   1 
ATOM   5860  C CB  . ALA B  1 232 ? 36.399  -52.352 21.838  1.00 15.10  ? 2250 ALA B CB  1 
ATOM   5861  N N   . LEU B  1 233 ? 34.306  -54.122 19.732  1.00 18.65  ? 2251 LEU B N   1 
ATOM   5862  C CA  . LEU B  1 233 ? 33.675  -54.111 18.420  1.00 19.20  ? 2251 LEU B CA  1 
ATOM   5863  C C   . LEU B  1 233 ? 32.204  -54.527 18.501  1.00 19.46  ? 2251 LEU B C   1 
ATOM   5864  O O   . LEU B  1 233 ? 31.537  -54.656 17.477  1.00 17.65  ? 2251 LEU B O   1 
ATOM   5865  C CB  . LEU B  1 233 ? 34.432  -55.009 17.429  1.00 19.86  ? 2251 LEU B CB  1 
ATOM   5866  C CG  . LEU B  1 233 ? 35.827  -54.527 16.998  1.00 20.53  ? 2251 LEU B CG  1 
ATOM   5867  C CD1 . LEU B  1 233 ? 36.288  -55.337 15.787  1.00 20.50  ? 2251 LEU B CD1 1 
ATOM   5868  C CD2 . LEU B  1 233 ? 35.792  -53.052 16.635  1.00 23.19  ? 2251 LEU B CD2 1 
ATOM   5869  N N   . THR B  1 234 ? 31.703  -54.750 19.717  1.00 18.97  ? 2252 THR B N   1 
ATOM   5870  C CA  . THR B  1 234 ? 30.289  -55.086 19.899  1.00 18.98  ? 2252 THR B CA  1 
ATOM   5871  C C   . THR B  1 234 ? 29.620  -53.712 19.795  1.00 19.72  ? 2252 THR B C   1 
ATOM   5872  O O   . THR B  1 234 ? 29.476  -52.996 20.786  1.00 20.13  ? 2252 THR B O   1 
ATOM   5873  C CB  . THR B  1 234 ? 30.036  -55.724 21.288  1.00 18.97  ? 2252 THR B CB  1 
ATOM   5874  O OG1 . THR B  1 234 ? 30.720  -56.984 21.362  1.00 17.77  ? 2252 THR B OG1 1 
ATOM   5875  C CG2 . THR B  1 234 ? 28.546  -55.962 21.512  1.00 19.66  ? 2252 THR B CG2 1 
ATOM   5876  N N   . SER B  1 235 ? 29.229  -53.361 18.572  1.00 19.46  ? 2253 SER B N   1 
ATOM   5877  C CA  . SER B  1 235 ? 28.652  -52.060 18.243  1.00 22.49  ? 2253 SER B CA  1 
ATOM   5878  C C   . SER B  1 235 ? 27.563  -51.460 19.124  1.00 21.15  ? 2253 SER B C   1 
ATOM   5879  O O   . SER B  1 235 ? 27.539  -50.247 19.313  1.00 22.61  ? 2253 SER B O   1 
ATOM   5880  C CB  . SER B  1 235 ? 28.169  -52.055 16.786  1.00 21.19  ? 2253 SER B CB  1 
ATOM   5881  O OG  . SER B  1 235 ? 26.987  -52.816 16.627  1.00 26.34  ? 2253 SER B OG  1 
ATOM   5882  N N   . VAL B  1 236 ? 26.663  -52.275 19.656  1.00 21.42  ? 2254 VAL B N   1 
ATOM   5883  C CA  . VAL B  1 236 ? 25.607  -51.718 20.488  1.00 22.90  ? 2254 VAL B CA  1 
ATOM   5884  C C   . VAL B  1 236 ? 26.143  -50.987 21.730  1.00 22.68  ? 2254 VAL B C   1 
ATOM   5885  O O   . VAL B  1 236 ? 25.471  -50.111 22.276  1.00 20.77  ? 2254 VAL B O   1 
ATOM   5886  C CB  . VAL B  1 236 ? 24.580  -52.810 20.915  1.00 23.53  ? 2254 VAL B CB  1 
ATOM   5887  C CG1 . VAL B  1 236 ? 25.192  -53.769 21.921  1.00 22.05  ? 2254 VAL B CG1 1 
ATOM   5888  C CG2 . VAL B  1 236 ? 23.327  -52.145 21.473  1.00 26.28  ? 2254 VAL B CG2 1 
ATOM   5889  N N   . LEU B  1 237 ? 27.362  -51.318 22.152  1.00 21.79  ? 2255 LEU B N   1 
ATOM   5890  C CA  . LEU B  1 237 ? 27.960  -50.690 23.337  1.00 21.38  ? 2255 LEU B CA  1 
ATOM   5891  C C   . LEU B  1 237 ? 28.895  -49.517 23.033  1.00 22.34  ? 2255 LEU B C   1 
ATOM   5892  O O   . LEU B  1 237 ? 29.395  -48.860 23.953  1.00 19.11  ? 2255 LEU B O   1 
ATOM   5893  C CB  . LEU B  1 237 ? 28.724  -51.736 24.153  1.00 21.43  ? 2255 LEU B CB  1 
ATOM   5894  C CG  . LEU B  1 237 ? 27.918  -52.875 24.788  1.00 24.54  ? 2255 LEU B CG  1 
ATOM   5895  C CD1 . LEU B  1 237 ? 28.863  -53.955 25.302  1.00 21.80  ? 2255 LEU B CD1 1 
ATOM   5896  C CD2 . LEU B  1 237 ? 27.062  -52.324 25.922  1.00 24.88  ? 2255 LEU B CD2 1 
ATOM   5897  N N   . VAL B  1 238 ? 29.137  -49.258 21.750  1.00 22.04  ? 2256 VAL B N   1 
ATOM   5898  C CA  . VAL B  1 238 ? 30.023  -48.169 21.345  1.00 25.06  ? 2256 VAL B CA  1 
ATOM   5899  C C   . VAL B  1 238 ? 29.314  -47.181 20.419  1.00 27.24  ? 2256 VAL B C   1 
ATOM   5900  O O   . VAL B  1 238 ? 28.805  -47.556 19.361  1.00 26.78  ? 2256 VAL B O   1 
ATOM   5901  C CB  . VAL B  1 238 ? 31.278  -48.706 20.617  1.00 25.48  ? 2256 VAL B CB  1 
ATOM   5902  C CG1 . VAL B  1 238 ? 32.208  -47.555 20.267  1.00 24.37  ? 2256 VAL B CG1 1 
ATOM   5903  C CG2 . VAL B  1 238 ? 31.997  -49.722 21.496  1.00 23.50  ? 2256 VAL B CG2 1 
ATOM   5904  N N   . LYS B  1 239 ? 29.289  -45.915 20.824  1.00 28.41  ? 2257 LYS B N   1 
ATOM   5905  C CA  . LYS B  1 239 ? 28.641  -44.878 20.037  1.00 30.89  ? 2257 LYS B CA  1 
ATOM   5906  C C   . LYS B  1 239 ? 29.632  -44.215 19.091  1.00 32.93  ? 2257 LYS B C   1 
ATOM   5907  O O   . LYS B  1 239 ? 30.626  -43.627 19.522  1.00 34.78  ? 2257 LYS B O   1 
ATOM   5908  C CB  . LYS B  1 239 ? 28.018  -43.827 20.957  1.00 31.11  ? 2257 LYS B CB  1 
ATOM   5909  N N   . LYS B  1 240 ? 29.352  -44.320 17.798  1.00 33.94  ? 2258 LYS B N   1 
ATOM   5910  C CA  . LYS B  1 240 ? 30.199  -43.729 16.774  1.00 35.64  ? 2258 LYS B CA  1 
ATOM   5911  C C   . LYS B  1 240 ? 29.481  -42.541 16.145  1.00 36.15  ? 2258 LYS B C   1 
ATOM   5912  O O   . LYS B  1 240 ? 28.252  -42.509 16.070  1.00 36.06  ? 2258 LYS B O   1 
ATOM   5913  C CB  . LYS B  1 240 ? 30.519  -44.766 15.693  1.00 36.43  ? 2258 LYS B CB  1 
ATOM   5914  N N   . GLY B  1 241 ? 30.252  -41.562 15.692  1.00 36.21  ? 2259 GLY B N   1 
ATOM   5915  C CA  . GLY B  1 241 ? 29.649  -40.398 15.076  1.00 37.53  ? 2259 GLY B CA  1 
ATOM   5916  C C   . GLY B  1 241 ? 29.245  -39.348 16.090  1.00 36.90  ? 2259 GLY B C   1 
ATOM   5917  O O   . GLY B  1 241 ? 29.780  -39.299 17.199  1.00 37.76  ? 2259 GLY B O   1 
ATOM   5918  N N   . ASP B  1 242 ? 28.290  -38.508 15.710  1.00 36.97  ? 2260 ASP B N   1 
ATOM   5919  C CA  . ASP B  1 242 ? 27.821  -37.439 16.580  1.00 35.14  ? 2260 ASP B CA  1 
ATOM   5920  C C   . ASP B  1 242 ? 26.911  -37.966 17.680  1.00 32.99  ? 2260 ASP B C   1 
ATOM   5921  O O   . ASP B  1 242 ? 25.873  -38.565 17.408  1.00 33.23  ? 2260 ASP B O   1 
ATOM   5922  C CB  . ASP B  1 242 ? 27.090  -36.385 15.748  1.00 38.84  ? 2260 ASP B CB  1 
ATOM   5923  C CG  . ASP B  1 242 ? 26.648  -35.200 16.575  1.00 40.78  ? 2260 ASP B CG  1 
ATOM   5924  O OD1 . ASP B  1 242 ? 27.434  -34.753 17.437  1.00 41.87  ? 2260 ASP B OD1 1 
ATOM   5925  O OD2 . ASP B  1 242 ? 25.521  -34.710 16.352  1.00 44.26  ? 2260 ASP B OD2 1 
ATOM   5926  N N   . VAL B  1 243 ? 27.309  -37.739 18.925  1.00 30.11  ? 2261 VAL B N   1 
ATOM   5927  C CA  . VAL B  1 243 ? 26.534  -38.198 20.071  1.00 29.41  ? 2261 VAL B CA  1 
ATOM   5928  C C   . VAL B  1 243 ? 25.640  -37.079 20.602  1.00 29.37  ? 2261 VAL B C   1 
ATOM   5929  O O   . VAL B  1 243 ? 24.911  -37.264 21.571  1.00 26.29  ? 2261 VAL B O   1 
ATOM   5930  C CB  . VAL B  1 243 ? 27.468  -38.679 21.204  1.00 29.68  ? 2261 VAL B CB  1 
ATOM   5931  C CG1 . VAL B  1 243 ? 28.438  -39.724 20.667  1.00 28.38  ? 2261 VAL B CG1 1 
ATOM   5932  C CG2 . VAL B  1 243 ? 28.235  -37.503 21.786  1.00 28.48  ? 2261 VAL B CG2 1 
ATOM   5933  N N   . LYS B  1 244 ? 25.711  -35.921 19.951  1.00 30.47  ? 2262 LYS B N   1 
ATOM   5934  C CA  . LYS B  1 244 ? 24.935  -34.739 20.326  1.00 30.79  ? 2262 LYS B CA  1 
ATOM   5935  C C   . LYS B  1 244 ? 23.421  -34.971 20.398  1.00 29.49  ? 2262 LYS B C   1 
ATOM   5936  O O   . LYS B  1 244 ? 22.775  -34.575 21.367  1.00 28.30  ? 2262 LYS B O   1 
ATOM   5937  C CB  . LYS B  1 244 ? 25.220  -33.607 19.338  1.00 35.33  ? 2262 LYS B CB  1 
ATOM   5938  C CG  . LYS B  1 244 ? 24.543  -32.287 19.666  1.00 40.42  ? 2262 LYS B CG  1 
ATOM   5939  C CD  . LYS B  1 244 ? 25.240  -31.589 20.820  1.00 43.98  ? 2262 LYS B CD  1 
ATOM   5940  C CE  . LYS B  1 244 ? 24.679  -30.193 21.040  1.00 45.84  ? 2262 LYS B CE  1 
ATOM   5941  N NZ  . LYS B  1 244 ? 25.481  -29.427 22.040  1.00 48.73  ? 2262 LYS B NZ  1 
ATOM   5942  N N   . PRO B  1 245 ? 22.834  -35.604 19.368  1.00 28.58  ? 2263 PRO B N   1 
ATOM   5943  C CA  . PRO B  1 245 ? 21.390  -35.865 19.354  1.00 27.55  ? 2263 PRO B CA  1 
ATOM   5944  C C   . PRO B  1 245 ? 20.871  -36.612 20.584  1.00 26.14  ? 2263 PRO B C   1 
ATOM   5945  O O   . PRO B  1 245 ? 19.820  -36.270 21.125  1.00 25.26  ? 2263 PRO B O   1 
ATOM   5946  C CB  . PRO B  1 245 ? 21.201  -36.669 18.071  1.00 29.03  ? 2263 PRO B CB  1 
ATOM   5947  C CG  . PRO B  1 245 ? 22.270  -36.103 17.173  1.00 28.83  ? 2263 PRO B CG  1 
ATOM   5948  C CD  . PRO B  1 245 ? 23.452  -36.045 18.103  1.00 28.17  ? 2263 PRO B CD  1 
ATOM   5949  N N   . LEU B  1 246 ? 21.598  -37.637 21.016  1.00 23.99  ? 2264 LEU B N   1 
ATOM   5950  C CA  . LEU B  1 246 ? 21.179  -38.406 22.181  1.00 23.80  ? 2264 LEU B CA  1 
ATOM   5951  C C   . LEU B  1 246 ? 21.273  -37.568 23.454  1.00 20.90  ? 2264 LEU B C   1 
ATOM   5952  O O   . LEU B  1 246 ? 20.396  -37.636 24.311  1.00 23.06  ? 2264 LEU B O   1 
ATOM   5953  C CB  . LEU B  1 246 ? 22.025  -39.675 22.322  1.00 24.79  ? 2264 LEU B CB  1 
ATOM   5954  C CG  . LEU B  1 246 ? 21.738  -40.540 23.555  1.00 26.63  ? 2264 LEU B CG  1 
ATOM   5955  C CD1 . LEU B  1 246 ? 20.282  -40.984 23.566  1.00 26.44  ? 2264 LEU B CD1 1 
ATOM   5956  C CD2 . LEU B  1 246 ? 22.663  -41.745 23.547  1.00 28.12  ? 2264 LEU B CD2 1 
ATOM   5957  N N   . ALA B  1 247 ? 22.337  -36.783 23.582  1.00 18.69  ? 2265 ALA B N   1 
ATOM   5958  C CA  . ALA B  1 247 ? 22.501  -35.936 24.756  1.00 17.81  ? 2265 ALA B CA  1 
ATOM   5959  C C   . ALA B  1 247 ? 21.332  -34.957 24.830  1.00 19.67  ? 2265 ALA B C   1 
ATOM   5960  O O   . ALA B  1 247 ? 20.800  -34.698 25.907  1.00 16.33  ? 2265 ALA B O   1 
ATOM   5961  C CB  . ALA B  1 247 ? 23.822  -35.172 24.684  1.00 18.72  ? 2265 ALA B CB  1 
ATOM   5962  N N   . GLU B  1 248 ? 20.931  -34.417 23.683  1.00 19.17  ? 2266 GLU B N   1 
ATOM   5963  C CA  . GLU B  1 248 ? 19.821  -33.477 23.653  1.00 23.46  ? 2266 GLU B CA  1 
ATOM   5964  C C   . GLU B  1 248 ? 18.489  -34.133 24.004  1.00 23.30  ? 2266 GLU B C   1 
ATOM   5965  O O   . GLU B  1 248 ? 17.660  -33.535 24.685  1.00 24.43  ? 2266 GLU B O   1 
ATOM   5966  C CB  . GLU B  1 248 ? 19.735  -32.787 22.286  1.00 27.55  ? 2266 GLU B CB  1 
ATOM   5967  C CG  . GLU B  1 248 ? 20.789  -31.698 22.105  1.00 34.32  ? 2266 GLU B CG  1 
ATOM   5968  C CD  . GLU B  1 248 ? 20.648  -30.945 20.794  1.00 39.39  ? 2266 GLU B CD  1 
ATOM   5969  O OE1 . GLU B  1 248 ? 19.584  -30.331 20.566  1.00 43.02  ? 2266 GLU B OE1 1 
ATOM   5970  O OE2 . GLU B  1 248 ? 21.604  -30.967 19.991  1.00 43.85  ? 2266 GLU B OE2 1 
ATOM   5971  N N   . GLN B  1 249 ? 18.287  -35.363 23.551  1.00 23.16  ? 2267 GLN B N   1 
ATOM   5972  C CA  . GLN B  1 249 ? 17.053  -36.078 23.852  1.00 24.16  ? 2267 GLN B CA  1 
ATOM   5973  C C   . GLN B  1 249 ? 16.961  -36.322 25.363  1.00 23.28  ? 2267 GLN B C   1 
ATOM   5974  O O   . GLN B  1 249 ? 15.898  -36.176 25.966  1.00 22.58  ? 2267 GLN B O   1 
ATOM   5975  C CB  . GLN B  1 249 ? 17.025  -37.402 23.087  1.00 27.42  ? 2267 GLN B CB  1 
ATOM   5976  C CG  . GLN B  1 249 ? 15.886  -38.329 23.460  1.00 32.71  ? 2267 GLN B CG  1 
ATOM   5977  C CD  . GLN B  1 249 ? 15.800  -39.539 22.546  1.00 35.74  ? 2267 GLN B CD  1 
ATOM   5978  O OE1 . GLN B  1 249 ? 16.817  -40.123 22.176  1.00 37.83  ? 2267 GLN B OE1 1 
ATOM   5979  N NE2 . GLN B  1 249 ? 14.581  -39.927 22.187  1.00 38.15  ? 2267 GLN B NE2 1 
ATOM   5980  N N   . ILE B  1 250 ? 18.087  -36.678 25.971  1.00 21.34  ? 2268 ILE B N   1 
ATOM   5981  C CA  . ILE B  1 250 ? 18.143  -36.931 27.405  1.00 19.56  ? 2268 ILE B CA  1 
ATOM   5982  C C   . ILE B  1 250 ? 17.869  -35.644 28.189  1.00 20.93  ? 2268 ILE B C   1 
ATOM   5983  O O   . ILE B  1 250 ? 17.122  -35.656 29.173  1.00 17.59  ? 2268 ILE B O   1 
ATOM   5984  C CB  . ILE B  1 250 ? 19.528  -37.501 27.801  1.00 18.18  ? 2268 ILE B CB  1 
ATOM   5985  C CG1 . ILE B  1 250 ? 19.672  -38.919 27.239  1.00 19.41  ? 2268 ILE B CG1 1 
ATOM   5986  C CG2 . ILE B  1 250 ? 19.696  -37.498 29.321  1.00 17.34  ? 2268 ILE B CG2 1 
ATOM   5987  C CD1 . ILE B  1 250 ? 21.054  -39.499 27.372  1.00 18.26  ? 2268 ILE B CD1 1 
ATOM   5988  N N   . ALA B  1 251 ? 18.473  -34.540 27.754  1.00 19.23  ? 2269 ALA B N   1 
ATOM   5989  C CA  . ALA B  1 251 ? 18.278  -33.262 28.427  1.00 21.13  ? 2269 ALA B CA  1 
ATOM   5990  C C   . ALA B  1 251 ? 16.819  -32.820 28.347  1.00 21.35  ? 2269 ALA B C   1 
ATOM   5991  O O   . ALA B  1 251 ? 16.237  -32.404 29.350  1.00 22.26  ? 2269 ALA B O   1 
ATOM   5992  C CB  . ALA B  1 251 ? 19.182  -32.199 27.822  1.00 18.88  ? 2269 ALA B CB  1 
ATOM   5993  N N   . ILE B  1 252 ? 16.231  -32.914 27.158  1.00 20.18  ? 2270 ILE B N   1 
ATOM   5994  C CA  . ILE B  1 252 ? 14.838  -32.530 26.971  1.00 22.01  ? 2270 ILE B CA  1 
ATOM   5995  C C   . ILE B  1 252 ? 13.921  -33.394 27.838  1.00 22.74  ? 2270 ILE B C   1 
ATOM   5996  O O   . ILE B  1 252 ? 12.995  -32.888 28.481  1.00 22.46  ? 2270 ILE B O   1 
ATOM   5997  C CB  . ILE B  1 252 ? 14.423  -32.662 25.484  1.00 23.24  ? 2270 ILE B CB  1 
ATOM   5998  C CG1 . ILE B  1 252 ? 15.116  -31.567 24.667  1.00 24.88  ? 2270 ILE B CG1 1 
ATOM   5999  C CG2 . ILE B  1 252 ? 12.912  -32.567 25.341  1.00 24.59  ? 2270 ILE B CG2 1 
ATOM   6000  C CD1 . ILE B  1 252 ? 14.886  -31.670 23.173  1.00 27.37  ? 2270 ILE B CD1 1 
ATOM   6001  N N   . THR B  1 253 ? 14.188  -34.696 27.858  1.00 20.63  ? 2271 THR B N   1 
ATOM   6002  C CA  . THR B  1 253 ? 13.390  -35.624 28.646  1.00 19.67  ? 2271 THR B CA  1 
ATOM   6003  C C   . THR B  1 253 ? 13.495  -35.303 30.138  1.00 19.92  ? 2271 THR B C   1 
ATOM   6004  O O   . THR B  1 253 ? 12.551  -35.520 30.895  1.00 20.68  ? 2271 THR B O   1 
ATOM   6005  C CB  . THR B  1 253 ? 13.837  -37.081 28.397  1.00 21.41  ? 2271 THR B CB  1 
ATOM   6006  O OG1 . THR B  1 253 ? 13.710  -37.383 27.000  1.00 22.71  ? 2271 THR B OG1 1 
ATOM   6007  C CG2 . THR B  1 253 ? 12.967  -38.053 29.189  1.00 21.83  ? 2271 THR B CG2 1 
ATOM   6008  N N   . ALA B  1 254 ? 14.640  -34.776 30.557  1.00 19.31  ? 2272 ALA B N   1 
ATOM   6009  C CA  . ALA B  1 254 ? 14.844  -34.424 31.958  1.00 21.00  ? 2272 ALA B CA  1 
ATOM   6010  C C   . ALA B  1 254 ? 14.287  -33.029 32.242  1.00 22.45  ? 2272 ALA B C   1 
ATOM   6011  O O   . ALA B  1 254 ? 14.217  -32.601 33.394  1.00 24.08  ? 2272 ALA B O   1 
ATOM   6012  C CB  . ALA B  1 254 ? 16.327  -34.479 32.303  1.00 18.83  ? 2272 ALA B CB  1 
ATOM   6013  N N   . GLY B  1 255 ? 13.890  -32.327 31.185  1.00 22.80  ? 2273 GLY B N   1 
ATOM   6014  C CA  . GLY B  1 255 ? 13.337  -30.992 31.342  1.00 25.24  ? 2273 GLY B CA  1 
ATOM   6015  C C   . GLY B  1 255 ? 14.367  -29.884 31.246  1.00 26.25  ? 2273 GLY B C   1 
ATOM   6016  O O   . GLY B  1 255 ? 14.148  -28.777 31.735  1.00 27.52  ? 2273 GLY B O   1 
ATOM   6017  N N   . CYS B  1 256 ? 15.490  -30.172 30.602  1.00 27.55  ? 2274 CYS B N   1 
ATOM   6018  C CA  . CYS B  1 256 ? 16.560  -29.194 30.456  1.00 28.19  ? 2274 CYS B CA  1 
ATOM   6019  C C   . CYS B  1 256 ? 16.587  -28.533 29.090  1.00 28.86  ? 2274 CYS B C   1 
ATOM   6020  O O   . CYS B  1 256 ? 16.159  -29.124 28.100  1.00 27.49  ? 2274 CYS B O   1 
ATOM   6021  C CB  . CYS B  1 256 ? 17.911  -29.865 30.690  1.00 30.15  ? 2274 CYS B CB  1 
ATOM   6022  S SG  . CYS B  1 256 ? 18.238  -30.308 32.420  1.00 32.90  ? 2274 CYS B SG  1 
ATOM   6023  N N   . LYS B  1 257 ? 17.097  -27.304 29.044  1.00 28.57  ? 2275 LYS B N   1 
ATOM   6024  C CA  . LYS B  1 257 ? 17.218  -26.581 27.784  1.00 29.52  ? 2275 LYS B CA  1 
ATOM   6025  C C   . LYS B  1 257 ? 18.440  -27.137 27.069  1.00 27.98  ? 2275 LYS B C   1 
ATOM   6026  O O   . LYS B  1 257 ? 19.336  -27.690 27.707  1.00 27.91  ? 2275 LYS B O   1 
ATOM   6027  C CB  . LYS B  1 257 ? 17.403  -25.080 28.025  1.00 33.00  ? 2275 LYS B CB  1 
ATOM   6028  C CG  . LYS B  1 257 ? 16.147  -24.361 28.504  1.00 37.29  ? 2275 LYS B CG  1 
ATOM   6029  C CD  . LYS B  1 257 ? 16.342  -22.850 28.475  1.00 40.34  ? 2275 LYS B CD  1 
ATOM   6030  C CE  . LYS B  1 257 ? 15.077  -22.112 28.889  1.00 43.09  ? 2275 LYS B CE  1 
ATOM   6031  N NZ  . LYS B  1 257 ? 15.221  -20.632 28.734  1.00 44.08  ? 2275 LYS B NZ  1 
ATOM   6032  N N   . THR B  1 258 ? 18.481  -26.982 25.751  1.00 26.28  ? 2276 THR B N   1 
ATOM   6033  C CA  . THR B  1 258 ? 19.589  -27.492 24.959  1.00 25.70  ? 2276 THR B CA  1 
ATOM   6034  C C   . THR B  1 258 ? 20.398  -26.378 24.288  1.00 26.67  ? 2276 THR B C   1 
ATOM   6035  O O   . THR B  1 258 ? 21.082  -26.611 23.286  1.00 24.33  ? 2276 THR B O   1 
ATOM   6036  C CB  . THR B  1 258 ? 19.055  -28.442 23.876  1.00 27.43  ? 2276 THR B CB  1 
ATOM   6037  O OG1 . THR B  1 258 ? 18.300  -27.697 22.913  1.00 26.77  ? 2276 THR B OG1 1 
ATOM   6038  C CG2 . THR B  1 258 ? 18.133  -29.479 24.500  1.00 26.58  ? 2276 THR B CG2 1 
ATOM   6039  N N   . THR B  1 259 ? 20.325  -25.176 24.851  1.00 25.15  ? 2277 THR B N   1 
ATOM   6040  C CA  . THR B  1 259 ? 21.026  -24.010 24.306  1.00 24.75  ? 2277 THR B CA  1 
ATOM   6041  C C   . THR B  1 259 ? 22.493  -24.285 23.952  1.00 22.72  ? 2277 THR B C   1 
ATOM   6042  O O   . THR B  1 259 ? 22.932  -24.001 22.836  1.00 23.48  ? 2277 THR B O   1 
ATOM   6043  C CB  . THR B  1 259 ? 20.949  -22.838 25.291  1.00 23.68  ? 2277 THR B CB  1 
ATOM   6044  O OG1 . THR B  1 259 ? 19.626  -22.779 25.835  1.00 25.37  ? 2277 THR B OG1 1 
ATOM   6045  C CG2 . THR B  1 259 ? 21.245  -21.520 24.579  1.00 25.46  ? 2277 THR B CG2 1 
ATOM   6046  N N   . THR B  1 260 ? 23.245  -24.831 24.900  1.00 19.95  ? 2278 THR B N   1 
ATOM   6047  C CA  . THR B  1 260 ? 24.651  -25.167 24.677  1.00 19.73  ? 2278 THR B CA  1 
ATOM   6048  C C   . THR B  1 260 ? 24.964  -26.445 25.458  1.00 19.67  ? 2278 THR B C   1 
ATOM   6049  O O   . THR B  1 260 ? 24.150  -26.893 26.267  1.00 18.91  ? 2278 THR B O   1 
ATOM   6050  C CB  . THR B  1 260 ? 25.600  -24.052 25.187  1.00 19.78  ? 2278 THR B CB  1 
ATOM   6051  O OG1 . THR B  1 260 ? 25.646  -24.080 26.623  1.00 18.88  ? 2278 THR B OG1 1 
ATOM   6052  C CG2 . THR B  1 260 ? 25.111  -22.670 24.722  1.00 21.80  ? 2278 THR B CG2 1 
ATOM   6053  N N   . SER B  1 261 ? 26.139  -27.019 25.223  1.00 18.98  ? 2279 SER B N   1 
ATOM   6054  C CA  . SER B  1 261 ? 26.548  -28.234 25.925  1.00 18.84  ? 2279 SER B CA  1 
ATOM   6055  C C   . SER B  1 261 ? 26.736  -27.951 27.405  1.00 17.28  ? 2279 SER B C   1 
ATOM   6056  O O   . SER B  1 261 ? 26.322  -28.737 28.247  1.00 16.74  ? 2279 SER B O   1 
ATOM   6057  C CB  . SER B  1 261 ? 27.861  -28.771 25.358  1.00 19.65  ? 2279 SER B CB  1 
ATOM   6058  O OG  . SER B  1 261 ? 27.693  -29.213 24.029  1.00 26.39  ? 2279 SER B OG  1 
ATOM   6059  N N   . ALA B  1 262 ? 27.381  -26.831 27.711  1.00 15.67  ? 2280 ALA B N   1 
ATOM   6060  C CA  . ALA B  1 262 ? 27.622  -26.444 29.093  1.00 16.92  ? 2280 ALA B CA  1 
ATOM   6061  C C   . ALA B  1 262 ? 26.301  -26.234 29.833  1.00 17.21  ? 2280 ALA B C   1 
ATOM   6062  O O   . ALA B  1 262 ? 26.189  -26.544 31.017  1.00 18.37  ? 2280 ALA B O   1 
ATOM   6063  C CB  . ALA B  1 262 ? 28.468  -25.161 29.142  1.00 14.86  ? 2280 ALA B CB  1 
ATOM   6064  N N   . VAL B  1 263 ? 25.307  -25.691 29.140  1.00 18.90  ? 2281 VAL B N   1 
ATOM   6065  C CA  . VAL B  1 263 ? 24.009  -25.457 29.759  1.00 19.05  ? 2281 VAL B CA  1 
ATOM   6066  C C   . VAL B  1 263 ? 23.351  -26.798 30.098  1.00 18.61  ? 2281 VAL B C   1 
ATOM   6067  O O   . VAL B  1 263 ? 22.894  -26.999 31.219  1.00 19.77  ? 2281 VAL B O   1 
ATOM   6068  C CB  . VAL B  1 263 ? 23.082  -24.624 28.834  1.00 19.86  ? 2281 VAL B CB  1 
ATOM   6069  C CG1 . VAL B  1 263 ? 21.636  -24.705 29.320  1.00 19.17  ? 2281 VAL B CG1 1 
ATOM   6070  C CG2 . VAL B  1 263 ? 23.539  -23.158 28.830  1.00 19.17  ? 2281 VAL B CG2 1 
ATOM   6071  N N   . MET B  1 264 ? 23.327  -27.716 29.136  1.00 17.21  ? 2282 MET B N   1 
ATOM   6072  C CA  . MET B  1 264 ? 22.735  -29.034 29.357  1.00 19.30  ? 2282 MET B CA  1 
ATOM   6073  C C   . MET B  1 264 ? 23.358  -29.754 30.545  1.00 17.41  ? 2282 MET B C   1 
ATOM   6074  O O   . MET B  1 264 ? 22.650  -30.279 31.398  1.00 16.91  ? 2282 MET B O   1 
ATOM   6075  C CB  . MET B  1 264 ? 22.897  -29.925 28.119  1.00 20.21  ? 2282 MET B CB  1 
ATOM   6076  C CG  . MET B  1 264 ? 22.066  -29.522 26.919  1.00 23.41  ? 2282 MET B CG  1 
ATOM   6077  S SD  . MET B  1 264 ? 22.273  -30.716 25.570  1.00 31.70  ? 2282 MET B SD  1 
ATOM   6078  C CE  . MET B  1 264 ? 23.903  -30.257 24.980  1.00 27.61  ? 2282 MET B CE  1 
ATOM   6079  N N   . VAL B  1 265 ? 24.685  -29.789 30.588  1.00 16.61  ? 2283 VAL B N   1 
ATOM   6080  C CA  . VAL B  1 265 ? 25.386  -30.467 31.667  1.00 16.54  ? 2283 VAL B CA  1 
ATOM   6081  C C   . VAL B  1 265 ? 25.158  -29.800 33.023  1.00 17.17  ? 2283 VAL B C   1 
ATOM   6082  O O   . VAL B  1 265 ? 24.971  -30.482 34.034  1.00 16.62  ? 2283 VAL B O   1 
ATOM   6083  C CB  . VAL B  1 265 ? 26.900  -30.554 31.372  1.00 17.28  ? 2283 VAL B CB  1 
ATOM   6084  C CG1 . VAL B  1 265 ? 27.623  -31.253 32.514  1.00 19.86  ? 2283 VAL B CG1 1 
ATOM   6085  C CG2 . VAL B  1 265 ? 27.120  -31.324 30.078  1.00 20.50  ? 2283 VAL B CG2 1 
ATOM   6086  N N   . HIS B  1 266 ? 25.176  -28.472 33.053  1.00 16.77  ? 2284 HIS B N   1 
ATOM   6087  C CA  . HIS B  1 266 ? 24.953  -27.755 34.304  1.00 17.65  ? 2284 HIS B CA  1 
ATOM   6088  C C   . HIS B  1 266 ? 23.546  -28.060 34.835  1.00 19.57  ? 2284 HIS B C   1 
ATOM   6089  O O   . HIS B  1 266 ? 23.356  -28.273 36.036  1.00 19.88  ? 2284 HIS B O   1 
ATOM   6090  C CB  . HIS B  1 266 ? 25.113  -26.246 34.087  1.00 16.81  ? 2284 HIS B CB  1 
ATOM   6091  C CG  . HIS B  1 266 ? 24.698  -25.422 35.267  1.00 20.76  ? 2284 HIS B CG  1 
ATOM   6092  N ND1 . HIS B  1 266 ? 25.336  -25.495 36.487  1.00 21.23  ? 2284 HIS B ND1 1 
ATOM   6093  C CD2 . HIS B  1 266 ? 23.696  -24.525 35.419  1.00 20.86  ? 2284 HIS B CD2 1 
ATOM   6094  C CE1 . HIS B  1 266 ? 24.744  -24.679 37.341  1.00 21.05  ? 2284 HIS B CE1 1 
ATOM   6095  N NE2 . HIS B  1 266 ? 23.747  -24.079 36.719  1.00 22.52  ? 2284 HIS B NE2 1 
ATOM   6096  N N   . CYS B  1 267 ? 22.567  -28.076 33.933  1.00 19.77  ? 2285 CYS B N   1 
ATOM   6097  C CA  . CYS B  1 267 ? 21.176  -28.360 34.293  1.00 22.19  ? 2285 CYS B CA  1 
ATOM   6098  C C   . CYS B  1 267 ? 21.030  -29.800 34.799  1.00 21.42  ? 2285 CYS B C   1 
ATOM   6099  O O   . CYS B  1 267 ? 20.440  -30.042 35.854  1.00 19.80  ? 2285 CYS B O   1 
ATOM   6100  C CB  . CYS B  1 267 ? 20.271  -28.126 33.078  1.00 24.86  ? 2285 CYS B CB  1 
ATOM   6101  S SG  . CYS B  1 267 ? 18.491  -28.484 33.298  1.00 34.55  ? 2285 CYS B SG  1 
ATOM   6102  N N   . LEU B  1 268 ? 21.575  -30.756 34.054  1.00 19.36  ? 2286 LEU B N   1 
ATOM   6103  C CA  . LEU B  1 268 ? 21.490  -32.157 34.464  1.00 18.93  ? 2286 LEU B CA  1 
ATOM   6104  C C   . LEU B  1 268 ? 22.158  -32.383 35.813  1.00 19.69  ? 2286 LEU B C   1 
ATOM   6105  O O   . LEU B  1 268 ? 21.741  -33.251 36.580  1.00 19.17  ? 2286 LEU B O   1 
ATOM   6106  C CB  . LEU B  1 268 ? 22.120  -33.059 33.407  1.00 18.16  ? 2286 LEU B CB  1 
ATOM   6107  C CG  . LEU B  1 268 ? 21.287  -33.147 32.127  1.00 18.43  ? 2286 LEU B CG  1 
ATOM   6108  C CD1 . LEU B  1 268 ? 22.055  -33.889 31.056  1.00 21.59  ? 2286 LEU B CD1 1 
ATOM   6109  C CD2 . LEU B  1 268 ? 19.969  -33.847 32.423  1.00 21.31  ? 2286 LEU B CD2 1 
ATOM   6110  N N   . ARG B  1 269 ? 23.192  -31.598 36.105  1.00 19.85  ? 2287 ARG B N   1 
ATOM   6111  C CA  . ARG B  1 269 ? 23.895  -31.719 37.374  1.00 22.27  ? 2287 ARG B CA  1 
ATOM   6112  C C   . ARG B  1 269 ? 23.037  -31.262 38.545  1.00 21.96  ? 2287 ARG B C   1 
ATOM   6113  O O   . ARG B  1 269 ? 23.296  -31.632 39.691  1.00 21.58  ? 2287 ARG B O   1 
ATOM   6114  C CB  . ARG B  1 269 ? 25.187  -30.898 37.369  1.00 24.42  ? 2287 ARG B CB  1 
ATOM   6115  C CG  . ARG B  1 269 ? 26.349  -31.581 36.678  1.00 27.61  ? 2287 ARG B CG  1 
ATOM   6116  C CD  . ARG B  1 269 ? 27.676  -31.053 37.205  1.00 28.13  ? 2287 ARG B CD  1 
ATOM   6117  N NE  . ARG B  1 269 ? 28.819  -31.702 36.572  1.00 27.60  ? 2287 ARG B NE  1 
ATOM   6118  C CZ  . ARG B  1 269 ? 29.531  -31.173 35.584  1.00 26.82  ? 2287 ARG B CZ  1 
ATOM   6119  N NH1 . ARG B  1 269 ? 29.224  -29.975 35.102  1.00 28.01  ? 2287 ARG B NH1 1 
ATOM   6120  N NH2 . ARG B  1 269 ? 30.563  -31.839 35.087  1.00 26.76  ? 2287 ARG B NH2 1 
ATOM   6121  N N   . GLN B  1 270 ? 22.017  -30.457 38.266  1.00 22.92  ? 2288 GLN B N   1 
ATOM   6122  C CA  . GLN B  1 270 ? 21.154  -29.969 39.332  1.00 25.89  ? 2288 GLN B CA  1 
ATOM   6123  C C   . GLN B  1 270 ? 20.007  -30.940 39.620  1.00 24.52  ? 2288 GLN B C   1 
ATOM   6124  O O   . GLN B  1 270 ? 19.368  -30.856 40.666  1.00 25.80  ? 2288 GLN B O   1 
ATOM   6125  C CB  . GLN B  1 270 ? 20.596  -28.588 38.974  1.00 28.83  ? 2288 GLN B CB  1 
ATOM   6126  C CG  . GLN B  1 270 ? 21.634  -27.583 38.477  1.00 34.81  ? 2288 GLN B CG  1 
ATOM   6127  C CD  . GLN B  1 270 ? 21.034  -26.206 38.270  1.00 39.62  ? 2288 GLN B CD  1 
ATOM   6128  O OE1 . GLN B  1 270 ? 19.882  -26.084 37.844  1.00 44.86  ? 2288 GLN B OE1 1 
ATOM   6129  N NE2 . GLN B  1 270 ? 21.809  -25.160 38.562  1.00 42.71  ? 2288 GLN B NE2 1 
ATOM   6130  N N   . LYS B  1 271 ? 19.758  -31.862 38.694  1.00 22.86  ? 2289 LYS B N   1 
ATOM   6131  C CA  . LYS B  1 271 ? 18.689  -32.848 38.855  1.00 20.72  ? 2289 LYS B CA  1 
ATOM   6132  C C   . LYS B  1 271 ? 18.991  -33.808 40.000  1.00 19.99  ? 2289 LYS B C   1 
ATOM   6133  O O   . LYS B  1 271 ? 20.148  -34.143 40.245  1.00 18.61  ? 2289 LYS B O   1 
ATOM   6134  C CB  . LYS B  1 271 ? 18.509  -33.652 37.564  1.00 22.30  ? 2289 LYS B CB  1 
ATOM   6135  C CG  . LYS B  1 271 ? 18.163  -32.807 36.347  1.00 23.68  ? 2289 LYS B CG  1 
ATOM   6136  C CD  . LYS B  1 271 ? 16.806  -32.137 36.501  1.00 27.34  ? 2289 LYS B CD  1 
ATOM   6137  C CE  . LYS B  1 271 ? 16.550  -31.146 35.377  1.00 25.86  ? 2289 LYS B CE  1 
ATOM   6138  N NZ  . LYS B  1 271 ? 15.172  -30.588 35.443  1.00 29.84  ? 2289 LYS B NZ  1 
ATOM   6139  N N   . THR B  1 272 ? 17.950  -34.258 40.696  1.00 19.24  ? 2290 THR B N   1 
ATOM   6140  C CA  . THR B  1 272 ? 18.132  -35.194 41.805  1.00 20.02  ? 2290 THR B CA  1 
ATOM   6141  C C   . THR B  1 272 ? 18.325  -36.598 41.243  1.00 19.49  ? 2290 THR B C   1 
ATOM   6142  O O   . THR B  1 272 ? 18.067  -36.844 40.064  1.00 17.74  ? 2290 THR B O   1 
ATOM   6143  C CB  . THR B  1 272 ? 16.898  -35.235 42.736  1.00 19.15  ? 2290 THR B CB  1 
ATOM   6144  O OG1 . THR B  1 272 ? 15.780  -35.767 42.014  1.00 16.97  ? 2290 THR B OG1 1 
ATOM   6145  C CG2 . THR B  1 272 ? 16.554  -33.832 43.240  1.00 22.19  ? 2290 THR B CG2 1 
ATOM   6146  N N   . GLU B  1 273 ? 18.776  -37.517 42.089  1.00 18.66  ? 2291 GLU B N   1 
ATOM   6147  C CA  . GLU B  1 273 ? 18.962  -38.894 41.664  1.00 20.82  ? 2291 GLU B CA  1 
ATOM   6148  C C   . GLU B  1 273 ? 17.638  -39.428 41.123  1.00 20.57  ? 2291 GLU B C   1 
ATOM   6149  O O   . GLU B  1 273 ? 17.592  -40.039 40.054  1.00 21.34  ? 2291 GLU B O   1 
ATOM   6150  C CB  . GLU B  1 273 ? 19.433  -39.759 42.836  1.00 22.45  ? 2291 GLU B CB  1 
ATOM   6151  C CG  . GLU B  1 273 ? 19.485  -41.255 42.536  1.00 25.40  ? 2291 GLU B CG  1 
ATOM   6152  C CD  . GLU B  1 273 ? 19.915  -42.083 43.741  1.00 30.56  ? 2291 GLU B CD  1 
ATOM   6153  O OE1 . GLU B  1 273 ? 19.533  -41.727 44.876  1.00 32.40  ? 2291 GLU B OE1 1 
ATOM   6154  O OE2 . GLU B  1 273 ? 20.622  -43.098 43.557  1.00 30.85  ? 2291 GLU B OE2 1 
ATOM   6155  N N   . GLU B  1 274 ? 16.558  -39.185 41.858  1.00 20.38  ? 2292 GLU B N   1 
ATOM   6156  C CA  . GLU B  1 274 ? 15.243  -39.659 41.438  1.00 19.85  ? 2292 GLU B CA  1 
ATOM   6157  C C   . GLU B  1 274 ? 14.829  -39.105 40.077  1.00 19.15  ? 2292 GLU B C   1 
ATOM   6158  O O   . GLU B  1 274 ? 14.235  -39.818 39.271  1.00 18.81  ? 2292 GLU B O   1 
ATOM   6159  C CB  . GLU B  1 274 ? 14.184  -39.288 42.481  1.00 23.28  ? 2292 GLU B CB  1 
ATOM   6160  C CG  . GLU B  1 274 ? 12.782  -39.784 42.136  1.00 23.79  ? 2292 GLU B CG  1 
ATOM   6161  N N   . GLU B  1 275 ? 15.139  -37.838 39.820  1.00 18.40  ? 2293 GLU B N   1 
ATOM   6162  C CA  . GLU B  1 275 ? 14.779  -37.219 38.546  1.00 18.41  ? 2293 GLU B CA  1 
ATOM   6163  C C   . GLU B  1 275 ? 15.545  -37.833 37.375  1.00 17.21  ? 2293 GLU B C   1 
ATOM   6164  O O   . GLU B  1 275 ? 14.989  -38.018 36.289  1.00 16.72  ? 2293 GLU B O   1 
ATOM   6165  C CB  . GLU B  1 275 ? 15.009  -35.702 38.608  1.00 20.93  ? 2293 GLU B CB  1 
ATOM   6166  C CG  . GLU B  1 275 ? 13.932  -34.979 39.413  1.00 24.22  ? 2293 GLU B CG  1 
ATOM   6167  C CD  . GLU B  1 275 ? 14.241  -33.515 39.688  1.00 26.20  ? 2293 GLU B CD  1 
ATOM   6168  O OE1 . GLU B  1 275 ? 13.286  -32.774 39.999  1.00 30.58  ? 2293 GLU B OE1 1 
ATOM   6169  O OE2 . GLU B  1 275 ? 15.419  -33.101 39.612  1.00 24.03  ? 2293 GLU B OE2 1 
ATOM   6170  N N   . LEU B  1 276 ? 16.816  -38.154 37.591  1.00 17.90  ? 2294 LEU B N   1 
ATOM   6171  C CA  . LEU B  1 276 ? 17.608  -38.770 36.532  1.00 18.65  ? 2294 LEU B CA  1 
ATOM   6172  C C   . LEU B  1 276 ? 17.146  -40.217 36.340  1.00 18.18  ? 2294 LEU B C   1 
ATOM   6173  O O   . LEU B  1 276 ? 17.185  -40.753 35.230  1.00 16.54  ? 2294 LEU B O   1 
ATOM   6174  C CB  . LEU B  1 276 ? 19.102  -38.716 36.875  1.00 17.93  ? 2294 LEU B CB  1 
ATOM   6175  C CG  . LEU B  1 276 ? 19.705  -37.307 36.853  1.00 18.69  ? 2294 LEU B CG  1 
ATOM   6176  C CD1 . LEU B  1 276 ? 21.215  -37.399 37.012  1.00 18.17  ? 2294 LEU B CD1 1 
ATOM   6177  C CD2 . LEU B  1 276 ? 19.360  -36.620 35.535  1.00 19.06  ? 2294 LEU B CD2 1 
ATOM   6178  N N   . LEU B  1 277 ? 16.691  -40.842 37.421  1.00 17.33  ? 2295 LEU B N   1 
ATOM   6179  C CA  . LEU B  1 277 ? 16.184  -42.207 37.332  1.00 19.09  ? 2295 LEU B CA  1 
ATOM   6180  C C   . LEU B  1 277 ? 14.858  -42.199 36.569  1.00 19.31  ? 2295 LEU B C   1 
ATOM   6181  O O   . LEU B  1 277 ? 14.570  -43.103 35.785  1.00 18.43  ? 2295 LEU B O   1 
ATOM   6182  C CB  . LEU B  1 277 ? 15.985  -42.800 38.731  1.00 18.71  ? 2295 LEU B CB  1 
ATOM   6183  C CG  . LEU B  1 277 ? 15.434  -44.231 38.815  1.00 22.06  ? 2295 LEU B CG  1 
ATOM   6184  C CD1 . LEU B  1 277 ? 16.249  -45.172 37.932  1.00 20.59  ? 2295 LEU B CD1 1 
ATOM   6185  C CD2 . LEU B  1 277 ? 15.470  -44.694 40.268  1.00 22.72  ? 2295 LEU B CD2 1 
ATOM   6186  N N   . GLU B  1 278 ? 14.050  -41.167 36.786  1.00 20.49  ? 2296 GLU B N   1 
ATOM   6187  C CA  . GLU B  1 278 ? 12.769  -41.077 36.092  1.00 20.87  ? 2296 GLU B CA  1 
ATOM   6188  C C   . GLU B  1 278 ? 13.018  -40.826 34.605  1.00 19.04  ? 2296 GLU B C   1 
ATOM   6189  O O   . GLU B  1 278 ? 12.270  -41.304 33.754  1.00 17.72  ? 2296 GLU B O   1 
ATOM   6190  C CB  . GLU B  1 278 ? 11.908  -39.962 36.706  1.00 25.30  ? 2296 GLU B CB  1 
ATOM   6191  C CG  . GLU B  1 278 ? 11.607  -40.197 38.188  1.00 31.03  ? 2296 GLU B CG  1 
ATOM   6192  C CD  . GLU B  1 278 ? 10.745  -39.113 38.826  1.00 36.67  ? 2296 GLU B CD  1 
ATOM   6193  O OE1 . GLU B  1 278 ? 11.091  -37.915 38.705  1.00 36.37  ? 2296 GLU B OE1 1 
ATOM   6194  O OE2 . GLU B  1 278 ? 9.724   -39.465 39.464  1.00 37.96  ? 2296 GLU B OE2 1 
ATOM   6195  N N   . THR B  1 279 ? 14.073  -40.080 34.294  1.00 18.46  ? 2297 THR B N   1 
ATOM   6196  C CA  . THR B  1 279 ? 14.417  -39.805 32.903  1.00 19.47  ? 2297 THR B CA  1 
ATOM   6197  C C   . THR B  1 279 ? 14.854  -41.130 32.266  1.00 19.55  ? 2297 THR B C   1 
ATOM   6198  O O   . THR B  1 279 ? 14.491  -41.439 31.133  1.00 22.50  ? 2297 THR B O   1 
ATOM   6199  C CB  . THR B  1 279 ? 15.571  -38.776 32.795  1.00 19.52  ? 2297 THR B CB  1 
ATOM   6200  O OG1 . THR B  1 279 ? 15.176  -37.543 33.410  1.00 19.24  ? 2297 THR B OG1 1 
ATOM   6201  C CG2 . THR B  1 279 ? 15.920  -38.510 31.333  1.00 18.58  ? 2297 THR B CG2 1 
ATOM   6202  N N   . THR B  1 280 ? 15.626  -41.913 33.010  1.00 20.02  ? 2298 THR B N   1 
ATOM   6203  C CA  . THR B  1 280 ? 16.096  -43.205 32.527  1.00 21.14  ? 2298 THR B CA  1 
ATOM   6204  C C   . THR B  1 280 ? 14.905  -44.085 32.145  1.00 22.63  ? 2298 THR B C   1 
ATOM   6205  O O   . THR B  1 280 ? 14.886  -44.689 31.072  1.00 20.44  ? 2298 THR B O   1 
ATOM   6206  C CB  . THR B  1 280 ? 16.941  -43.919 33.602  1.00 21.67  ? 2298 THR B CB  1 
ATOM   6207  O OG1 . THR B  1 280 ? 18.135  -43.165 33.844  1.00 22.31  ? 2298 THR B OG1 1 
ATOM   6208  C CG2 . THR B  1 280 ? 17.323  -45.324 33.147  1.00 22.04  ? 2298 THR B CG2 1 
ATOM   6209  N N   . LEU B  1 281 ? 13.904  -44.140 33.020  1.00 24.05  ? 2299 LEU B N   1 
ATOM   6210  C CA  . LEU B  1 281 ? 12.710  -44.948 32.771  1.00 24.64  ? 2299 LEU B CA  1 
ATOM   6211  C C   . LEU B  1 281 ? 11.928  -44.476 31.553  1.00 23.18  ? 2299 LEU B C   1 
ATOM   6212  O O   . LEU B  1 281 ? 11.490  -45.293 30.745  1.00 21.12  ? 2299 LEU B O   1 
ATOM   6213  C CB  . LEU B  1 281 ? 11.802  -44.947 34.003  1.00 26.45  ? 2299 LEU B CB  1 
ATOM   6214  C CG  . LEU B  1 281 ? 12.157  -45.926 35.127  1.00 31.58  ? 2299 LEU B CG  1 
ATOM   6215  C CD1 . LEU B  1 281 ? 13.641  -45.865 35.465  1.00 33.56  ? 2299 LEU B CD1 1 
ATOM   6216  C CD2 . LEU B  1 281 ? 11.311  -45.599 36.352  1.00 33.25  ? 2299 LEU B CD2 1 
ATOM   6217  N N   . LYS B  1 282 ? 11.748  -43.164 31.418  1.00 22.43  ? 2300 LYS B N   1 
ATOM   6218  C CA  . LYS B  1 282 ? 11.021  -42.615 30.273  1.00 24.70  ? 2300 LYS B CA  1 
ATOM   6219  C C   . LYS B  1 282 ? 11.741  -42.926 28.965  1.00 24.95  ? 2300 LYS B C   1 
ATOM   6220  O O   . LYS B  1 282 ? 11.100  -43.085 27.929  1.00 27.20  ? 2300 LYS B O   1 
ATOM   6221  C CB  . LYS B  1 282 ? 10.864  -41.090 30.392  1.00 24.61  ? 2300 LYS B CB  1 
ATOM   6222  C CG  . LYS B  1 282 ? 9.949   -40.617 31.507  1.00 29.16  ? 2300 LYS B CG  1 
ATOM   6223  C CD  . LYS B  1 282 ? 9.899   -39.088 31.587  1.00 29.73  ? 2300 LYS B CD  1 
ATOM   6224  C CE  . LYS B  1 282 ? 9.187   -38.633 32.860  1.00 33.76  ? 2300 LYS B CE  1 
ATOM   6225  N NZ  . LYS B  1 282 ? 9.256   -37.155 33.078  1.00 35.54  ? 2300 LYS B NZ  1 
ATOM   6226  N N   . MET B  1 283 ? 13.071  -42.999 29.019  1.00 27.36  ? 2301 MET B N   1 
ATOM   6227  C CA  . MET B  1 283 ? 13.897  -43.282 27.841  1.00 31.14  ? 2301 MET B CA  1 
ATOM   6228  C C   . MET B  1 283 ? 13.753  -44.726 27.346  1.00 31.44  ? 2301 MET B C   1 
ATOM   6229  O O   . MET B  1 283 ? 14.005  -45.008 26.175  1.00 30.46  ? 2301 MET B O   1 
ATOM   6230  C CB  . MET B  1 283 ? 15.376  -43.006 28.141  1.00 31.65  ? 2301 MET B CB  1 
ATOM   6231  C CG  . MET B  1 283 ? 15.747  -41.543 28.407  1.00 36.08  ? 2301 MET B CG  1 
ATOM   6232  S SD  . MET B  1 283 ? 15.775  -40.473 26.950  1.00 37.96  ? 2301 MET B SD  1 
ATOM   6233  C CE  . MET B  1 283 ? 17.166  -41.127 26.029  1.00 38.23  ? 2301 MET B CE  1 
ATOM   6234  N N   . LYS B  1 284 ? 13.371  -45.632 28.245  1.00 32.41  ? 2302 LYS B N   1 
ATOM   6235  C CA  . LYS B  1 284 ? 13.173  -47.049 27.919  1.00 34.19  ? 2302 LYS B CA  1 
ATOM   6236  C C   . LYS B  1 284 ? 14.444  -47.750 27.425  1.00 32.81  ? 2302 LYS B C   1 
ATOM   6237  O O   . LYS B  1 284 ? 14.386  -48.560 26.500  1.00 31.60  ? 2302 LYS B O   1 
ATOM   6238  C CB  . LYS B  1 284 ? 12.067  -47.200 26.857  1.00 37.77  ? 2302 LYS B CB  1 
ATOM   6239  C CG  . LYS B  1 284 ? 12.541  -46.942 25.422  1.00 43.70  ? 2302 LYS B CG  1 
ATOM   6240  C CD  . LYS B  1 284 ? 11.416  -46.734 24.419  1.00 47.04  ? 2302 LYS B CD  1 
ATOM   6241  C CE  . LYS B  1 284 ? 11.985  -46.264 23.082  1.00 48.90  ? 2302 LYS B CE  1 
ATOM   6242  N NZ  . LYS B  1 284 ? 10.945  -45.719 22.160  1.00 51.46  ? 2302 LYS B NZ  1 
ATOM   6243  N N   . PHE B  1 285 ? 15.584  -47.451 28.039  1.00 30.13  ? 2303 PHE B N   1 
ATOM   6244  C CA  . PHE B  1 285 ? 16.844  -48.074 27.636  1.00 29.73  ? 2303 PHE B CA  1 
ATOM   6245  C C   . PHE B  1 285 ? 16.795  -49.591 27.802  1.00 32.09  ? 2303 PHE B C   1 
ATOM   6246  O O   . PHE B  1 285 ? 16.089  -50.088 28.650  1.00 32.57  ? 2303 PHE B O   1 
ATOM   6247  C CB  . PHE B  1 285 ? 17.993  -47.531 28.482  1.00 26.59  ? 2303 PHE B CB  1 
ATOM   6248  C CG  . PHE B  1 285 ? 18.300  -46.087 28.237  1.00 22.61  ? 2303 PHE B CG  1 
ATOM   6249  C CD1 . PHE B  1 285 ? 18.389  -45.196 29.301  1.00 23.42  ? 2303 PHE B CD1 1 
ATOM   6250  C CD2 . PHE B  1 285 ? 18.532  -45.620 26.952  1.00 21.69  ? 2303 PHE B CD2 1 
ATOM   6251  C CE1 . PHE B  1 285 ? 18.707  -43.857 29.087  1.00 21.24  ? 2303 PHE B CE1 1 
ATOM   6252  C CE2 . PHE B  1 285 ? 18.851  -44.278 26.725  1.00 22.07  ? 2303 PHE B CE2 1 
ATOM   6253  C CZ  . PHE B  1 285 ? 18.938  -43.400 27.796  1.00 22.21  ? 2303 PHE B CZ  1 
ATOM   6254  N N   . LEU B  1 286 ? 17.544  -50.325 26.990  1.00 34.07  ? 2304 LEU B N   1 
ATOM   6255  C CA  . LEU B  1 286 ? 17.591  -51.781 27.104  1.00 35.47  ? 2304 LEU B CA  1 
ATOM   6256  C C   . LEU B  1 286 ? 16.328  -52.529 26.691  1.00 35.60  ? 2304 LEU B C   1 
ATOM   6257  O O   . LEU B  1 286 ? 16.136  -53.684 27.061  1.00 36.00  ? 2304 LEU B O   1 
ATOM   6258  C CB  . LEU B  1 286 ? 17.982  -52.170 28.532  1.00 37.51  ? 2304 LEU B CB  1 
ATOM   6259  C CG  . LEU B  1 286 ? 19.485  -52.120 28.831  1.00 39.36  ? 2304 LEU B CG  1 
ATOM   6260  C CD1 . LEU B  1 286 ? 19.753  -52.254 30.322  1.00 41.16  ? 2304 LEU B CD1 1 
ATOM   6261  C CD2 . LEU B  1 286 ? 20.168  -53.245 28.068  1.00 41.00  ? 2304 LEU B CD2 1 
ATOM   6262  N N   . SER B  1 287 ? 15.474  -51.863 25.924  1.00 35.92  ? 2305 SER B N   1 
ATOM   6263  C CA  . SER B  1 287 ? 14.242  -52.457 25.420  1.00 36.41  ? 2305 SER B CA  1 
ATOM   6264  C C   . SER B  1 287 ? 14.245  -52.215 23.922  1.00 35.38  ? 2305 SER B C   1 
ATOM   6265  O O   . SER B  1 287 ? 14.679  -51.158 23.472  1.00 35.97  ? 2305 SER B O   1 
ATOM   6266  C CB  . SER B  1 287 ? 13.019  -51.784 26.041  1.00 37.79  ? 2305 SER B CB  1 
ATOM   6267  O OG  . SER B  1 287 ? 12.848  -52.167 27.394  1.00 42.46  ? 2305 SER B OG  1 
ATOM   6268  N N   . LEU B  1 288 ? 13.774  -53.181 23.144  1.00 33.71  ? 2306 LEU B N   1 
ATOM   6269  C CA  . LEU B  1 288 ? 13.754  -52.999 21.699  1.00 34.57  ? 2306 LEU B CA  1 
ATOM   6270  C C   . LEU B  1 288 ? 12.547  -52.165 21.279  1.00 34.82  ? 2306 LEU B C   1 
ATOM   6271  O O   . LEU B  1 288 ? 11.406  -52.612 21.395  1.00 33.39  ? 2306 LEU B O   1 
ATOM   6272  C CB  . LEU B  1 288 ? 13.715  -54.350 20.984  1.00 34.92  ? 2306 LEU B CB  1 
ATOM   6273  C CG  . LEU B  1 288 ? 13.965  -54.255 19.477  1.00 36.95  ? 2306 LEU B CG  1 
ATOM   6274  C CD1 . LEU B  1 288 ? 15.381  -53.744 19.241  1.00 36.37  ? 2306 LEU B CD1 1 
ATOM   6275  C CD2 . LEU B  1 288 ? 13.772  -55.616 18.826  1.00 37.77  ? 2306 LEU B CD2 1 
ATOM   6276  N N   . ASP B  1 289 ? 12.806  -50.950 20.799  1.00 33.74  ? 2307 ASP B N   1 
ATOM   6277  C CA  . ASP B  1 289 ? 11.746  -50.051 20.355  1.00 34.41  ? 2307 ASP B CA  1 
ATOM   6278  C C   . ASP B  1 289 ? 11.198  -50.512 19.005  1.00 35.22  ? 2307 ASP B C   1 
ATOM   6279  O O   . ASP B  1 289 ? 11.874  -50.395 17.981  1.00 35.38  ? 2307 ASP B O   1 
ATOM   6280  C CB  . ASP B  1 289 ? 12.293  -48.627 20.236  1.00 36.30  ? 2307 ASP B CB  1 
ATOM   6281  C CG  . ASP B  1 289 ? 11.216  -47.609 19.914  1.00 38.37  ? 2307 ASP B CG  1 
ATOM   6282  O OD1 . ASP B  1 289 ? 11.556  -46.412 19.794  1.00 41.47  ? 2307 ASP B OD1 1 
ATOM   6283  O OD2 . ASP B  1 289 ? 10.035  -47.999 19.783  1.00 38.21  ? 2307 ASP B OD2 1 
ATOM   6284  N N   . LEU B  1 290 ? 9.970   -51.024 19.010  1.00 35.66  ? 2308 LEU B N   1 
ATOM   6285  C CA  . LEU B  1 290 ? 9.325   -51.528 17.799  1.00 36.59  ? 2308 LEU B CA  1 
ATOM   6286  C C   . LEU B  1 290 ? 8.523   -50.437 17.107  1.00 37.23  ? 2308 LEU B C   1 
ATOM   6287  O O   . LEU B  1 290 ? 7.699   -50.711 16.235  1.00 35.94  ? 2308 LEU B O   1 
ATOM   6288  C CB  . LEU B  1 290 ? 8.385   -52.682 18.154  1.00 37.42  ? 2308 LEU B CB  1 
ATOM   6289  C CG  . LEU B  1 290 ? 8.912   -53.738 19.127  1.00 39.48  ? 2308 LEU B CG  1 
ATOM   6290  C CD1 . LEU B  1 290 ? 7.838   -54.787 19.359  1.00 39.94  ? 2308 LEU B CD1 1 
ATOM   6291  C CD2 . LEU B  1 290 ? 10.173  -54.381 18.571  1.00 40.25  ? 2308 LEU B CD2 1 
ATOM   6292  N N   . GLN B  1 291 ? 8.787   -49.194 17.482  1.00 38.21  ? 2309 GLN B N   1 
ATOM   6293  C CA  . GLN B  1 291 ? 8.056   -48.071 16.926  1.00 40.28  ? 2309 GLN B CA  1 
ATOM   6294  C C   . GLN B  1 291 ? 8.970   -47.031 16.280  1.00 39.58  ? 2309 GLN B C   1 
ATOM   6295  O O   . GLN B  1 291 ? 10.046  -46.732 16.796  1.00 39.55  ? 2309 GLN B O   1 
ATOM   6296  C CB  . GLN B  1 291 ? 7.252   -47.437 18.051  1.00 43.57  ? 2309 GLN B CB  1 
ATOM   6297  C CG  . GLN B  1 291 ? 6.041   -46.669 17.625  1.00 47.41  ? 2309 GLN B CG  1 
ATOM   6298  C CD  . GLN B  1 291 ? 5.190   -46.285 18.816  1.00 49.92  ? 2309 GLN B CD  1 
ATOM   6299  O OE1 . GLN B  1 291 ? 4.145   -45.666 18.662  1.00 50.76  ? 2309 GLN B OE1 1 
ATOM   6300  N NE2 . GLN B  1 291 ? 5.637   -46.657 20.017  1.00 49.10  ? 2309 GLN B NE2 1 
ATOM   6301  N N   . GLY B  1 292 ? 8.533   -46.485 15.149  1.00 38.33  ? 2310 GLY B N   1 
ATOM   6302  C CA  . GLY B  1 292 ? 9.318   -45.473 14.461  1.00 38.24  ? 2310 GLY B CA  1 
ATOM   6303  C C   . GLY B  1 292 ? 10.504  -45.999 13.671  1.00 37.19  ? 2310 GLY B C   1 
ATOM   6304  O O   . GLY B  1 292 ? 10.556  -47.177 13.317  1.00 37.05  ? 2310 GLY B O   1 
ATOM   6305  N N   . ASP B  1 293 ? 11.458  -45.115 13.388  1.00 35.98  ? 2311 ASP B N   1 
ATOM   6306  C CA  . ASP B  1 293 ? 12.655  -45.480 12.636  1.00 36.14  ? 2311 ASP B CA  1 
ATOM   6307  C C   . ASP B  1 293 ? 13.656  -46.184 13.554  1.00 34.68  ? 2311 ASP B C   1 
ATOM   6308  O O   . ASP B  1 293 ? 14.145  -45.594 14.520  1.00 32.08  ? 2311 ASP B O   1 
ATOM   6309  C CB  . ASP B  1 293 ? 13.310  -44.231 12.043  1.00 37.47  ? 2311 ASP B CB  1 
ATOM   6310  C CG  . ASP B  1 293 ? 14.436  -44.564 11.081  1.00 39.56  ? 2311 ASP B CG  1 
ATOM   6311  O OD1 . ASP B  1 293 ? 15.094  -45.611 11.263  1.00 39.18  ? 2311 ASP B OD1 1 
ATOM   6312  O OD2 . ASP B  1 293 ? 14.674  -43.771 10.147  1.00 42.63  ? 2311 ASP B OD2 1 
ATOM   6313  N N   . PRO B  1 294 ? 13.985  -47.450 13.250  1.00 33.15  ? 2312 PRO B N   1 
ATOM   6314  C CA  . PRO B  1 294 ? 14.930  -48.242 14.046  1.00 33.00  ? 2312 PRO B CA  1 
ATOM   6315  C C   . PRO B  1 294 ? 16.278  -47.549 14.211  1.00 32.54  ? 2312 PRO B C   1 
ATOM   6316  O O   . PRO B  1 294 ? 16.946  -47.695 15.235  1.00 32.67  ? 2312 PRO B O   1 
ATOM   6317  C CB  . PRO B  1 294 ? 15.064  -49.537 13.244  1.00 33.23  ? 2312 PRO B CB  1 
ATOM   6318  C CG  . PRO B  1 294 ? 13.762  -49.631 12.512  1.00 33.78  ? 2312 PRO B CG  1 
ATOM   6319  C CD  . PRO B  1 294 ? 13.530  -48.209 12.074  1.00 33.04  ? 2312 PRO B CD  1 
ATOM   6320  N N   . ARG B  1 295 ? 16.668  -46.791 13.194  1.00 31.74  ? 2313 ARG B N   1 
ATOM   6321  C CA  . ARG B  1 295 ? 17.944  -46.088 13.203  1.00 33.39  ? 2313 ARG B CA  1 
ATOM   6322  C C   . ARG B  1 295 ? 18.071  -44.989 14.252  1.00 32.77  ? 2313 ARG B C   1 
ATOM   6323  O O   . ARG B  1 295 ? 19.178  -44.542 14.546  1.00 33.15  ? 2313 ARG B O   1 
ATOM   6324  C CB  . ARG B  1 295 ? 18.225  -45.506 11.817  1.00 33.47  ? 2313 ARG B CB  1 
ATOM   6325  C CG  . ARG B  1 295 ? 18.503  -46.565 10.761  1.00 36.44  ? 2313 ARG B CG  1 
ATOM   6326  C CD  . ARG B  1 295 ? 18.628  -45.946 9.382   1.00 39.34  ? 2313 ARG B CD  1 
ATOM   6327  N NE  . ARG B  1 295 ? 17.369  -45.346 8.950   1.00 42.11  ? 2313 ARG B NE  1 
ATOM   6328  C CZ  . ARG B  1 295 ? 17.208  -44.694 7.804   1.00 44.40  ? 2313 ARG B CZ  1 
ATOM   6329  N NH1 . ARG B  1 295 ? 18.230  -44.554 6.969   1.00 44.76  ? 2313 ARG B NH1 1 
ATOM   6330  N NH2 . ARG B  1 295 ? 16.023  -44.184 7.490   1.00 43.97  ? 2313 ARG B NH2 1 
ATOM   6331  N N   . GLU B  1 296 ? 16.954  -44.552 14.820  1.00 32.35  ? 2314 GLU B N   1 
ATOM   6332  C CA  . GLU B  1 296 ? 17.013  -43.500 15.824  1.00 34.33  ? 2314 GLU B CA  1 
ATOM   6333  C C   . GLU B  1 296 ? 16.819  -43.990 17.261  1.00 34.66  ? 2314 GLU B C   1 
ATOM   6334  O O   . GLU B  1 296 ? 16.777  -43.184 18.191  1.00 35.37  ? 2314 GLU B O   1 
ATOM   6335  C CB  . GLU B  1 296 ? 15.999  -42.391 15.495  1.00 35.07  ? 2314 GLU B CB  1 
ATOM   6336  C CG  . GLU B  1 296 ? 14.563  -42.854 15.338  1.00 36.29  ? 2314 GLU B CG  1 
ATOM   6337  N N   . SER B  1 297 ? 16.713  -45.303 17.451  1.00 34.37  ? 2315 SER B N   1 
ATOM   6338  C CA  . SER B  1 297 ? 16.546  -45.837 18.799  1.00 35.40  ? 2315 SER B CA  1 
ATOM   6339  C C   . SER B  1 297 ? 17.907  -46.028 19.462  1.00 35.19  ? 2315 SER B C   1 
ATOM   6340  O O   . SER B  1 297 ? 18.894  -46.362 18.804  1.00 34.12  ? 2315 SER B O   1 
ATOM   6341  C CB  . SER B  1 297 ? 15.773  -47.164 18.778  1.00 35.51  ? 2315 SER B CB  1 
ATOM   6342  O OG  . SER B  1 297 ? 16.438  -48.148 18.014  1.00 39.68  ? 2315 SER B OG  1 
ATOM   6343  N N   . GLN B  1 298 ? 17.947  -45.801 20.770  1.00 35.01  ? 2316 GLN B N   1 
ATOM   6344  C CA  . GLN B  1 298 ? 19.170  -45.919 21.550  1.00 35.06  ? 2316 GLN B CA  1 
ATOM   6345  C C   . GLN B  1 298 ? 18.895  -46.744 22.802  1.00 32.38  ? 2316 GLN B C   1 
ATOM   6346  O O   . GLN B  1 298 ? 18.574  -46.195 23.855  1.00 30.71  ? 2316 GLN B O   1 
ATOM   6347  C CB  . GLN B  1 298 ? 19.653  -44.523 21.956  1.00 40.17  ? 2316 GLN B CB  1 
ATOM   6348  C CG  . GLN B  1 298 ? 20.060  -43.631 20.791  1.00 45.29  ? 2316 GLN B CG  1 
ATOM   6349  C CD  . GLN B  1 298 ? 21.511  -43.821 20.398  1.00 48.25  ? 2316 GLN B CD  1 
ATOM   6350  O OE1 . GLN B  1 298 ? 21.976  -44.947 20.212  1.00 51.44  ? 2316 GLN B OE1 1 
ATOM   6351  N NE2 . GLN B  1 298 ? 22.238  -42.716 20.267  1.00 50.01  ? 2316 GLN B NE2 1 
ATOM   6352  N N   . PRO B  1 299 ? 19.024  -48.077 22.706  1.00 30.75  ? 2317 PRO B N   1 
ATOM   6353  C CA  . PRO B  1 299 ? 18.776  -48.951 23.855  1.00 29.05  ? 2317 PRO B CA  1 
ATOM   6354  C C   . PRO B  1 299 ? 19.786  -48.842 24.997  1.00 28.85  ? 2317 PRO B C   1 
ATOM   6355  O O   . PRO B  1 299 ? 19.517  -49.293 26.104  1.00 27.08  ? 2317 PRO B O   1 
ATOM   6356  C CB  . PRO B  1 299 ? 18.748  -50.344 23.225  1.00 30.12  ? 2317 PRO B CB  1 
ATOM   6357  C CG  . PRO B  1 299 ? 19.714  -50.211 22.090  1.00 30.41  ? 2317 PRO B CG  1 
ATOM   6358  C CD  . PRO B  1 299 ? 19.346  -48.869 21.504  1.00 31.22  ? 2317 PRO B CD  1 
ATOM   6359  N N   . LEU B  1 300 ? 20.939  -48.234 24.739  1.00 29.12  ? 2318 LEU B N   1 
ATOM   6360  C CA  . LEU B  1 300 ? 21.959  -48.108 25.776  1.00 30.03  ? 2318 LEU B CA  1 
ATOM   6361  C C   . LEU B  1 300 ? 22.768  -46.827 25.667  1.00 29.60  ? 2318 LEU B C   1 
ATOM   6362  O O   . LEU B  1 300 ? 22.895  -46.251 24.590  1.00 30.31  ? 2318 LEU B O   1 
ATOM   6363  C CB  . LEU B  1 300 ? 22.951  -49.273 25.690  1.00 30.62  ? 2318 LEU B CB  1 
ATOM   6364  C CG  . LEU B  1 300 ? 22.486  -50.720 25.808  1.00 33.56  ? 2318 LEU B CG  1 
ATOM   6365  C CD1 . LEU B  1 300 ? 23.601  -51.652 25.368  1.00 33.33  ? 2318 LEU B CD1 1 
ATOM   6366  C CD2 . LEU B  1 300 ? 22.093  -51.001 27.236  1.00 34.32  ? 2318 LEU B CD2 1 
ATOM   6367  N N   . LEU B  1 301 ? 23.306  -46.387 26.797  1.00 28.86  ? 2319 LEU B N   1 
ATOM   6368  C CA  . LEU B  1 301 ? 24.188  -45.232 26.821  1.00 29.73  ? 2319 LEU B CA  1 
ATOM   6369  C C   . LEU B  1 301 ? 25.523  -45.922 27.048  1.00 29.37  ? 2319 LEU B C   1 
ATOM   6370  O O   . LEU B  1 301 ? 25.672  -46.684 28.007  1.00 32.53  ? 2319 LEU B O   1 
ATOM   6371  C CB  . LEU B  1 301 ? 23.892  -44.302 27.995  1.00 30.83  ? 2319 LEU B CB  1 
ATOM   6372  C CG  . LEU B  1 301 ? 22.657  -43.412 27.921  1.00 32.77  ? 2319 LEU B CG  1 
ATOM   6373  C CD1 . LEU B  1 301 ? 22.773  -42.333 28.982  1.00 32.18  ? 2319 LEU B CD1 1 
ATOM   6374  C CD2 . LEU B  1 301 ? 22.550  -42.780 26.540  1.00 32.28  ? 2319 LEU B CD2 1 
ATOM   6375  N N   . GLY B  1 302 ? 26.491  -45.686 26.177  1.00 26.18  ? 2320 GLY B N   1 
ATOM   6376  C CA  . GLY B  1 302 ? 27.755  -46.367 26.362  1.00 23.88  ? 2320 GLY B CA  1 
ATOM   6377  C C   . GLY B  1 302 ? 29.022  -45.610 26.046  1.00 21.20  ? 2320 GLY B C   1 
ATOM   6378  O O   . GLY B  1 302 ? 29.097  -44.382 26.155  1.00 18.96  ? 2320 GLY B O   1 
ATOM   6379  N N   . THR B  1 303 ? 30.029  -46.381 25.655  1.00 18.37  ? 2321 THR B N   1 
ATOM   6380  C CA  . THR B  1 303 ? 31.342  -45.866 25.324  1.00 17.17  ? 2321 THR B CA  1 
ATOM   6381  C C   . THR B  1 303 ? 31.313  -44.954 24.112  1.00 16.52  ? 2321 THR B C   1 
ATOM   6382  O O   . THR B  1 303 ? 30.607  -45.220 23.145  1.00 17.14  ? 2321 THR B O   1 
ATOM   6383  C CB  . THR B  1 303 ? 32.312  -47.023 25.018  1.00 17.78  ? 2321 THR B CB  1 
ATOM   6384  O OG1 . THR B  1 303 ? 32.090  -48.087 25.952  1.00 15.56  ? 2321 THR B OG1 1 
ATOM   6385  C CG2 . THR B  1 303 ? 33.760  -46.548 25.123  1.00 17.90  ? 2321 THR B CG2 1 
ATOM   6386  N N   . VAL B  1 304 ? 32.087  -43.876 24.179  1.00 17.59  ? 2322 VAL B N   1 
ATOM   6387  C CA  . VAL B  1 304 ? 32.204  -42.934 23.075  1.00 18.08  ? 2322 VAL B CA  1 
ATOM   6388  C C   . VAL B  1 304 ? 33.695  -42.658 22.901  1.00 18.59  ? 2322 VAL B C   1 
ATOM   6389  O O   . VAL B  1 304 ? 34.494  -42.995 23.772  1.00 18.64  ? 2322 VAL B O   1 
ATOM   6390  C CB  . VAL B  1 304 ? 31.480  -41.590 23.376  1.00 18.85  ? 2322 VAL B CB  1 
ATOM   6391  C CG1 . VAL B  1 304 ? 29.997  -41.839 23.621  1.00 18.78  ? 2322 VAL B CG1 1 
ATOM   6392  C CG2 . VAL B  1 304 ? 32.116  -40.908 24.586  1.00 17.36  ? 2322 VAL B CG2 1 
ATOM   6393  N N   . ILE B  1 305 ? 34.073  -42.062 21.775  1.00 19.32  ? 2323 ILE B N   1 
ATOM   6394  C CA  . ILE B  1 305 ? 35.469  -41.718 21.534  1.00 21.90  ? 2323 ILE B CA  1 
ATOM   6395  C C   . ILE B  1 305 ? 35.623  -40.319 22.139  1.00 24.02  ? 2323 ILE B C   1 
ATOM   6396  O O   . ILE B  1 305 ? 35.390  -39.312 21.470  1.00 25.11  ? 2323 ILE B O   1 
ATOM   6397  C CB  . ILE B  1 305 ? 35.774  -41.677 20.023  1.00 21.91  ? 2323 ILE B CB  1 
ATOM   6398  C CG1 . ILE B  1 305 ? 35.147  -42.897 19.336  1.00 22.40  ? 2323 ILE B CG1 1 
ATOM   6399  C CG2 . ILE B  1 305 ? 37.280  -41.655 19.794  1.00 20.28  ? 2323 ILE B CG2 1 
ATOM   6400  C CD1 . ILE B  1 305 ? 35.522  -44.231 19.962  1.00 19.01  ? 2323 ILE B CD1 1 
ATOM   6401  N N   . ASP B  1 306 ? 36.009  -40.274 23.412  1.00 25.29  ? 2324 ASP B N   1 
ATOM   6402  C CA  . ASP B  1 306 ? 36.142  -39.023 24.163  1.00 26.66  ? 2324 ASP B CA  1 
ATOM   6403  C C   . ASP B  1 306 ? 37.424  -38.217 23.986  1.00 26.57  ? 2324 ASP B C   1 
ATOM   6404  O O   . ASP B  1 306 ? 37.424  -37.003 24.192  1.00 25.89  ? 2324 ASP B O   1 
ATOM   6405  C CB  . ASP B  1 306 ? 35.958  -39.306 25.656  1.00 28.23  ? 2324 ASP B CB  1 
ATOM   6406  C CG  . ASP B  1 306 ? 37.007  -40.262 26.197  1.00 29.69  ? 2324 ASP B CG  1 
ATOM   6407  O OD1 . ASP B  1 306 ? 37.330  -40.175 27.398  1.00 29.24  ? 2324 ASP B OD1 1 
ATOM   6408  O OD2 . ASP B  1 306 ? 37.508  -41.105 25.420  1.00 31.52  ? 2324 ASP B OD2 1 
ATOM   6409  N N   . GLY B  1 307 ? 38.518  -38.884 23.635  1.00 26.41  ? 2325 GLY B N   1 
ATOM   6410  C CA  . GLY B  1 307 ? 39.772  -38.175 23.455  1.00 26.33  ? 2325 GLY B CA  1 
ATOM   6411  C C   . GLY B  1 307 ? 40.710  -38.314 24.638  1.00 26.30  ? 2325 GLY B C   1 
ATOM   6412  O O   . GLY B  1 307 ? 41.870  -37.909 24.569  1.00 28.28  ? 2325 GLY B O   1 
ATOM   6413  N N   . MET B  1 308 ? 40.208  -38.877 25.733  1.00 25.65  ? 2326 MET B N   1 
ATOM   6414  C CA  . MET B  1 308 ? 41.019  -39.084 26.928  1.00 24.24  ? 2326 MET B CA  1 
ATOM   6415  C C   . MET B  1 308 ? 41.235  -40.586 27.131  1.00 22.67  ? 2326 MET B C   1 
ATOM   6416  O O   . MET B  1 308 ? 42.370  -41.062 27.173  1.00 20.11  ? 2326 MET B O   1 
ATOM   6417  C CB  . MET B  1 308 ? 40.328  -38.485 28.157  1.00 26.84  ? 2326 MET B CB  1 
ATOM   6418  C CG  . MET B  1 308 ? 40.197  -36.964 28.130  1.00 32.49  ? 2326 MET B CG  1 
ATOM   6419  S SD  . MET B  1 308 ? 41.796  -36.113 28.170  1.00 38.62  ? 2326 MET B SD  1 
ATOM   6420  C CE  . MET B  1 308 ? 42.169  -36.182 29.918  1.00 38.41  ? 2326 MET B CE  1 
ATOM   6421  N N   . LEU B  1 309 ? 40.136  -41.323 27.265  1.00 21.91  ? 2327 LEU B N   1 
ATOM   6422  C CA  . LEU B  1 309 ? 40.201  -42.770 27.443  1.00 21.49  ? 2327 LEU B CA  1 
ATOM   6423  C C   . LEU B  1 309 ? 40.535  -43.399 26.093  1.00 19.80  ? 2327 LEU B C   1 
ATOM   6424  O O   . LEU B  1 309 ? 41.466  -44.195 25.985  1.00 19.75  ? 2327 LEU B O   1 
ATOM   6425  C CB  . LEU B  1 309 ? 38.862  -43.315 27.936  1.00 20.55  ? 2327 LEU B CB  1 
ATOM   6426  C CG  . LEU B  1 309 ? 38.826  -44.838 28.087  1.00 20.30  ? 2327 LEU B CG  1 
ATOM   6427  C CD1 . LEU B  1 309 ? 39.555  -45.235 29.355  1.00 19.62  ? 2327 LEU B CD1 1 
ATOM   6428  C CD2 . LEU B  1 309 ? 37.381  -45.315 28.125  1.00 22.67  ? 2327 LEU B CD2 1 
ATOM   6429  N N   . LEU B  1 310 ? 39.753  -43.038 25.078  1.00 21.24  ? 2328 LEU B N   1 
ATOM   6430  C CA  . LEU B  1 310 ? 39.941  -43.529 23.713  1.00 21.68  ? 2328 LEU B CA  1 
ATOM   6431  C C   . LEU B  1 310 ? 40.171  -42.336 22.788  1.00 22.81  ? 2328 LEU B C   1 
ATOM   6432  O O   . LEU B  1 310 ? 39.341  -41.428 22.721  1.00 21.77  ? 2328 LEU B O   1 
ATOM   6433  C CB  . LEU B  1 310 ? 38.708  -44.299 23.235  1.00 23.21  ? 2328 LEU B CB  1 
ATOM   6434  C CG  . LEU B  1 310 ? 38.437  -45.699 23.786  1.00 24.24  ? 2328 LEU B CG  1 
ATOM   6435  C CD1 . LEU B  1 310 ? 37.180  -46.254 23.128  1.00 21.38  ? 2328 LEU B CD1 1 
ATOM   6436  C CD2 . LEU B  1 310 ? 39.633  -46.609 23.514  1.00 22.71  ? 2328 LEU B CD2 1 
ATOM   6437  N N   . LEU B  1 311 ? 41.293  -42.352 22.072  1.00 23.21  ? 2329 LEU B N   1 
ATOM   6438  C CA  . LEU B  1 311 ? 41.661  -41.265 21.171  1.00 24.49  ? 2329 LEU B CA  1 
ATOM   6439  C C   . LEU B  1 311 ? 41.101  -41.448 19.769  1.00 24.03  ? 2329 LEU B C   1 
ATOM   6440  O O   . LEU B  1 311 ? 40.970  -40.489 19.013  1.00 23.87  ? 2329 LEU B O   1 
ATOM   6441  C CB  . LEU B  1 311 ? 43.187  -41.148 21.095  1.00 26.82  ? 2329 LEU B CB  1 
ATOM   6442  C CG  . LEU B  1 311 ? 43.961  -41.179 22.417  1.00 29.42  ? 2329 LEU B CG  1 
ATOM   6443  C CD1 . LEU B  1 311 ? 45.444  -40.926 22.150  1.00 28.85  ? 2329 LEU B CD1 1 
ATOM   6444  C CD2 . LEU B  1 311 ? 43.413  -40.134 23.365  1.00 28.05  ? 2329 LEU B CD2 1 
ATOM   6445  N N   . LYS B  1 312 ? 40.783  -42.686 19.417  1.00 23.24  ? 2330 LYS B N   1 
ATOM   6446  C CA  . LYS B  1 312 ? 40.239  -42.976 18.103  1.00 22.45  ? 2330 LYS B CA  1 
ATOM   6447  C C   . LYS B  1 312 ? 39.268  -44.137 18.245  1.00 21.34  ? 2330 LYS B C   1 
ATOM   6448  O O   . LYS B  1 312 ? 39.137  -44.705 19.325  1.00 21.62  ? 2330 LYS B O   1 
ATOM   6449  C CB  . LYS B  1 312 ? 41.369  -43.356 17.140  1.00 25.80  ? 2330 LYS B CB  1 
ATOM   6450  C CG  . LYS B  1 312 ? 42.461  -42.303 17.014  1.00 29.38  ? 2330 LYS B CG  1 
ATOM   6451  C CD  . LYS B  1 312 ? 43.481  -42.690 15.959  1.00 35.01  ? 2330 LYS B CD  1 
ATOM   6452  C CE  . LYS B  1 312 ? 44.608  -41.672 15.891  1.00 37.98  ? 2330 LYS B CE  1 
ATOM   6453  N NZ  . LYS B  1 312 ? 45.569  -41.991 14.798  1.00 41.36  ? 2330 LYS B NZ  1 
ATOM   6454  N N   . THR B  1 313 ? 38.578  -44.482 17.167  1.00 20.56  ? 2331 THR B N   1 
ATOM   6455  C CA  . THR B  1 313 ? 37.643  -45.600 17.210  1.00 21.30  ? 2331 THR B CA  1 
ATOM   6456  C C   . THR B  1 313 ? 38.436  -46.890 17.439  1.00 21.94  ? 2331 THR B C   1 
ATOM   6457  O O   . THR B  1 313 ? 39.611  -46.976 17.088  1.00 21.34  ? 2331 THR B O   1 
ATOM   6458  C CB  . THR B  1 313 ? 36.888  -45.744 15.890  1.00 22.35  ? 2331 THR B CB  1 
ATOM   6459  O OG1 . THR B  1 313 ? 37.820  -46.052 14.849  1.00 24.50  ? 2331 THR B OG1 1 
ATOM   6460  C CG2 . THR B  1 313 ? 36.153  -44.453 15.547  1.00 24.07  ? 2331 THR B CG2 1 
ATOM   6461  N N   . PRO B  1 314 ? 37.808  -47.907 18.046  1.00 21.94  ? 2332 PRO B N   1 
ATOM   6462  C CA  . PRO B  1 314 ? 38.518  -49.167 18.284  1.00 22.12  ? 2332 PRO B CA  1 
ATOM   6463  C C   . PRO B  1 314 ? 39.114  -49.758 17.002  1.00 23.45  ? 2332 PRO B C   1 
ATOM   6464  O O   . PRO B  1 314 ? 40.214  -50.310 17.019  1.00 22.45  ? 2332 PRO B O   1 
ATOM   6465  C CB  . PRO B  1 314 ? 37.439  -50.048 18.891  1.00 22.17  ? 2332 PRO B CB  1 
ATOM   6466  C CG  . PRO B  1 314 ? 36.665  -49.059 19.719  1.00 21.96  ? 2332 PRO B CG  1 
ATOM   6467  C CD  . PRO B  1 314 ? 36.519  -47.889 18.760  1.00 22.53  ? 2332 PRO B CD  1 
ATOM   6468  N N   . GLU B  1 315 ? 38.391  -49.629 15.893  1.00 23.46  ? 2333 GLU B N   1 
ATOM   6469  C CA  . GLU B  1 315 ? 38.862  -50.156 14.616  1.00 27.36  ? 2333 GLU B CA  1 
ATOM   6470  C C   . GLU B  1 315 ? 40.179  -49.506 14.193  1.00 28.53  ? 2333 GLU B C   1 
ATOM   6471  O O   . GLU B  1 315 ? 41.090  -50.183 13.715  1.00 28.77  ? 2333 GLU B O   1 
ATOM   6472  C CB  . GLU B  1 315 ? 37.809  -49.944 13.525  1.00 29.71  ? 2333 GLU B CB  1 
ATOM   6473  C CG  . GLU B  1 315 ? 36.461  -50.605 13.807  1.00 35.90  ? 2333 GLU B CG  1 
ATOM   6474  C CD  . GLU B  1 315 ? 35.482  -49.698 14.548  1.00 39.27  ? 2333 GLU B CD  1 
ATOM   6475  O OE1 . GLU B  1 315 ? 35.781  -49.263 15.682  1.00 36.79  ? 2333 GLU B OE1 1 
ATOM   6476  O OE2 . GLU B  1 315 ? 34.400  -49.421 13.985  1.00 43.92  ? 2333 GLU B OE2 1 
ATOM   6477  N N   . GLU B  1 316 ? 40.278  -48.191 14.371  1.00 29.36  ? 2334 GLU B N   1 
ATOM   6478  C CA  . GLU B  1 316 ? 41.492  -47.467 14.006  1.00 30.00  ? 2334 GLU B CA  1 
ATOM   6479  C C   . GLU B  1 316 ? 42.650  -47.793 14.936  1.00 29.41  ? 2334 GLU B C   1 
ATOM   6480  O O   . GLU B  1 316 ? 43.789  -47.932 14.491  1.00 30.22  ? 2334 GLU B O   1 
ATOM   6481  C CB  . GLU B  1 316 ? 41.233  -45.961 14.009  1.00 32.33  ? 2334 GLU B CB  1 
ATOM   6482  C CG  . GLU B  1 316 ? 40.368  -45.500 12.848  1.00 38.04  ? 2334 GLU B CG  1 
ATOM   6483  C CD  . GLU B  1 316 ? 40.057  -44.018 12.901  1.00 42.66  ? 2334 GLU B CD  1 
ATOM   6484  O OE1 . GLU B  1 316 ? 41.005  -43.209 13.006  1.00 44.33  ? 2334 GLU B OE1 1 
ATOM   6485  O OE2 . GLU B  1 316 ? 38.861  -43.662 12.831  1.00 45.84  ? 2334 GLU B OE2 1 
ATOM   6486  N N   . LEU B  1 317 ? 42.363  -47.914 16.228  1.00 27.50  ? 2335 LEU B N   1 
ATOM   6487  C CA  . LEU B  1 317 ? 43.402  -48.229 17.200  1.00 27.61  ? 2335 LEU B CA  1 
ATOM   6488  C C   . LEU B  1 317 ? 43.986  -49.611 16.918  1.00 29.19  ? 2335 LEU B C   1 
ATOM   6489  O O   . LEU B  1 317 ? 45.165  -49.855 17.160  1.00 29.59  ? 2335 LEU B O   1 
ATOM   6490  C CB  . LEU B  1 317 ? 42.832  -48.174 18.621  1.00 24.31  ? 2335 LEU B CB  1 
ATOM   6491  C CG  . LEU B  1 317 ? 42.321  -46.795 19.049  1.00 25.60  ? 2335 LEU B CG  1 
ATOM   6492  C CD1 . LEU B  1 317 ? 41.622  -46.891 20.394  1.00 21.73  ? 2335 LEU B CD1 1 
ATOM   6493  C CD2 . LEU B  1 317 ? 43.493  -45.819 19.119  1.00 24.69  ? 2335 LEU B CD2 1 
ATOM   6494  N N   . GLN B  1 318 ? 43.158  -50.510 16.395  1.00 30.61  ? 2336 GLN B N   1 
ATOM   6495  C CA  . GLN B  1 318 ? 43.610  -51.859 16.077  1.00 33.42  ? 2336 GLN B CA  1 
ATOM   6496  C C   . GLN B  1 318 ? 44.504  -51.862 14.849  1.00 35.61  ? 2336 GLN B C   1 
ATOM   6497  O O   . GLN B  1 318 ? 45.451  -52.642 14.766  1.00 35.51  ? 2336 GLN B O   1 
ATOM   6498  C CB  . GLN B  1 318 ? 42.421  -52.772 15.812  1.00 34.15  ? 2336 GLN B CB  1 
ATOM   6499  C CG  . GLN B  1 318 ? 41.540  -53.008 16.999  1.00 36.20  ? 2336 GLN B CG  1 
ATOM   6500  C CD  . GLN B  1 318 ? 40.395  -53.922 16.654  1.00 38.96  ? 2336 GLN B CD  1 
ATOM   6501  O OE1 . GLN B  1 318 ? 39.670  -53.687 15.683  1.00 40.89  ? 2336 GLN B OE1 1 
ATOM   6502  N NE2 . GLN B  1 318 ? 40.223  -54.976 17.440  1.00 40.24  ? 2336 GLN B NE2 1 
ATOM   6503  N N   . ALA B  1 319 ? 44.185  -50.996 13.891  1.00 37.61  ? 2337 ALA B N   1 
ATOM   6504  C CA  . ALA B  1 319 ? 44.959  -50.891 12.661  1.00 39.90  ? 2337 ALA B CA  1 
ATOM   6505  C C   . ALA B  1 319 ? 46.357  -50.363 12.968  1.00 41.70  ? 2337 ALA B C   1 
ATOM   6506  O O   . ALA B  1 319 ? 47.351  -50.862 12.439  1.00 43.02  ? 2337 ALA B O   1 
ATOM   6507  C CB  . ALA B  1 319 ? 44.251  -49.968 11.673  1.00 39.05  ? 2337 ALA B CB  1 
ATOM   6508  N N   . GLU B  1 320 ? 46.429  -49.355 13.831  1.00 43.00  ? 2338 GLU B N   1 
ATOM   6509  C CA  . GLU B  1 320 ? 47.707  -48.767 14.208  1.00 44.60  ? 2338 GLU B CA  1 
ATOM   6510  C C   . GLU B  1 320 ? 48.367  -49.640 15.265  1.00 45.09  ? 2338 GLU B C   1 
ATOM   6511  O O   . GLU B  1 320 ? 49.400  -49.278 15.834  1.00 44.04  ? 2338 GLU B O   1 
ATOM   6512  C CB  . GLU B  1 320 ? 47.490  -47.365 14.769  1.00 45.35  ? 2338 GLU B CB  1 
ATOM   6513  C CG  . GLU B  1 320 ? 46.531  -46.530 13.951  1.00 49.17  ? 2338 GLU B CG  1 
ATOM   6514  C CD  . GLU B  1 320 ? 46.356  -45.138 14.511  1.00 51.57  ? 2338 GLU B CD  1 
ATOM   6515  O OE1 . GLU B  1 320 ? 46.145  -45.014 15.736  1.00 53.02  ? 2338 GLU B OE1 1 
ATOM   6516  O OE2 . GLU B  1 320 ? 46.424  -44.171 13.727  1.00 53.22  ? 2338 GLU B OE2 1 
ATOM   6517  N N   . ARG B  1 321 ? 47.757  -50.794 15.521  1.00 46.16  ? 2339 ARG B N   1 
ATOM   6518  C CA  . ARG B  1 321 ? 48.257  -51.732 16.517  1.00 47.07  ? 2339 ARG B CA  1 
ATOM   6519  C C   . ARG B  1 321 ? 48.838  -50.983 17.700  1.00 46.55  ? 2339 ARG B C   1 
ATOM   6520  O O   . ARG B  1 321 ? 49.929  -51.277 18.182  1.00 47.67  ? 2339 ARG B O   1 
ATOM   6521  C CB  . ARG B  1 321 ? 49.290  -52.664 15.887  1.00 47.01  ? 2339 ARG B CB  1 
ATOM   6522  C CG  . ARG B  1 321 ? 48.650  -53.556 14.854  1.00 49.30  ? 2339 ARG B CG  1 
ATOM   6523  C CD  . ARG B  1 321 ? 49.626  -54.416 14.098  1.00 50.50  ? 2339 ARG B CD  1 
ATOM   6524  N NE  . ARG B  1 321 ? 48.906  -55.238 13.130  1.00 52.99  ? 2339 ARG B NE  1 
ATOM   6525  C CZ  . ARG B  1 321 ? 49.483  -56.048 12.250  1.00 53.92  ? 2339 ARG B CZ  1 
ATOM   6526  N NH1 . ARG B  1 321 ? 50.805  -56.153 12.204  1.00 54.07  ? 2339 ARG B NH1 1 
ATOM   6527  N NH2 . ARG B  1 321 ? 48.733  -56.754 11.414  1.00 54.61  ? 2339 ARG B NH2 1 
ATOM   6528  N N   . ASN B  1 322 ? 48.083  -49.992 18.148  1.00 46.96  ? 2340 ASN B N   1 
ATOM   6529  C CA  . ASN B  1 322 ? 48.473  -49.183 19.283  1.00 47.62  ? 2340 ASN B CA  1 
ATOM   6530  C C   . ASN B  1 322 ? 47.546  -49.555 20.435  1.00 46.65  ? 2340 ASN B C   1 
ATOM   6531  O O   . ASN B  1 322 ? 46.414  -49.067 20.523  1.00 47.60  ? 2340 ASN B O   1 
ATOM   6532  C CB  . ASN B  1 322 ? 48.341  -47.698 18.934  1.00 49.60  ? 2340 ASN B CB  1 
ATOM   6533  C CG  . ASN B  1 322 ? 48.826  -46.794 20.044  1.00 50.71  ? 2340 ASN B CG  1 
ATOM   6534  O OD1 . ASN B  1 322 ? 49.810  -47.096 20.722  1.00 52.69  ? 2340 ASN B OD1 1 
ATOM   6535  N ND2 . ASN B  1 322 ? 48.148  -45.667 20.225  1.00 51.67  ? 2340 ASN B ND2 1 
ATOM   6536  N N   . PHE B  1 323 ? 48.029  -50.448 21.294  1.00 42.90  ? 2341 PHE B N   1 
ATOM   6537  C CA  . PHE B  1 323 ? 47.276  -50.914 22.454  1.00 40.14  ? 2341 PHE B CA  1 
ATOM   6538  C C   . PHE B  1 323 ? 48.122  -51.861 23.299  1.00 38.49  ? 2341 PHE B C   1 
ATOM   6539  O O   . PHE B  1 323 ? 49.169  -52.329 22.853  1.00 36.77  ? 2341 PHE B O   1 
ATOM   6540  C CB  . PHE B  1 323 ? 45.974  -51.598 22.011  1.00 38.08  ? 2341 PHE B CB  1 
ATOM   6541  C CG  . PHE B  1 323 ? 46.159  -52.680 20.978  1.00 35.80  ? 2341 PHE B CG  1 
ATOM   6542  C CD1 . PHE B  1 323 ? 46.603  -53.946 21.342  1.00 34.42  ? 2341 PHE B CD1 1 
ATOM   6543  C CD2 . PHE B  1 323 ? 45.846  -52.440 19.642  1.00 33.82  ? 2341 PHE B CD2 1 
ATOM   6544  C CE1 . PHE B  1 323 ? 46.725  -54.959 20.397  1.00 34.62  ? 2341 PHE B CE1 1 
ATOM   6545  C CE2 . PHE B  1 323 ? 45.964  -53.445 18.687  1.00 33.51  ? 2341 PHE B CE2 1 
ATOM   6546  C CZ  . PHE B  1 323 ? 46.403  -54.707 19.062  1.00 33.70  ? 2341 PHE B CZ  1 
ATOM   6547  N N   . HIS B  1 324 ? 47.668  -52.131 24.521  1.00 36.83  ? 2342 HIS B N   1 
ATOM   6548  C CA  . HIS B  1 324 ? 48.398  -53.002 25.440  1.00 35.61  ? 2342 HIS B CA  1 
ATOM   6549  C C   . HIS B  1 324 ? 48.493  -54.429 24.917  1.00 33.20  ? 2342 HIS B C   1 
ATOM   6550  O O   . HIS B  1 324 ? 47.491  -55.143 24.826  1.00 31.38  ? 2342 HIS B O   1 
ATOM   6551  C CB  . HIS B  1 324 ? 47.729  -52.994 26.817  1.00 38.79  ? 2342 HIS B CB  1 
ATOM   6552  C CG  . HIS B  1 324 ? 47.381  -51.624 27.307  1.00 43.67  ? 2342 HIS B CG  1 
ATOM   6553  N ND1 . HIS B  1 324 ? 48.235  -50.548 27.177  1.00 45.80  ? 2342 HIS B ND1 1 
ATOM   6554  C CD2 . HIS B  1 324 ? 46.269  -51.149 27.918  1.00 44.74  ? 2342 HIS B CD2 1 
ATOM   6555  C CE1 . HIS B  1 324 ? 47.662  -49.471 27.684  1.00 46.94  ? 2342 HIS B CE1 1 
ATOM   6556  N NE2 . HIS B  1 324 ? 46.469  -49.809 28.141  1.00 45.34  ? 2342 HIS B NE2 1 
ATOM   6557  N N   . THR B  1 325 ? 49.711  -54.844 24.585  1.00 29.93  ? 2343 THR B N   1 
ATOM   6558  C CA  . THR B  1 325 ? 49.933  -56.180 24.053  1.00 28.79  ? 2343 THR B CA  1 
ATOM   6559  C C   . THR B  1 325 ? 50.172  -57.219 25.140  1.00 27.30  ? 2343 THR B C   1 
ATOM   6560  O O   . THR B  1 325 ? 51.134  -57.982 25.080  1.00 28.82  ? 2343 THR B O   1 
ATOM   6561  C CB  . THR B  1 325 ? 51.122  -56.192 23.070  1.00 29.42  ? 2343 THR B CB  1 
ATOM   6562  O OG1 . THR B  1 325 ? 52.260  -55.584 23.691  1.00 29.04  ? 2343 THR B OG1 1 
ATOM   6563  C CG2 . THR B  1 325 ? 50.769  -55.431 21.795  1.00 29.84  ? 2343 THR B CG2 1 
ATOM   6564  N N   . VAL B  1 326 ? 49.293  -57.238 26.136  1.00 23.61  ? 2344 VAL B N   1 
ATOM   6565  C CA  . VAL B  1 326 ? 49.389  -58.204 27.221  1.00 20.33  ? 2344 VAL B CA  1 
ATOM   6566  C C   . VAL B  1 326 ? 48.641  -59.460 26.777  1.00 16.11  ? 2344 VAL B C   1 
ATOM   6567  O O   . VAL B  1 326 ? 47.883  -59.420 25.813  1.00 16.04  ? 2344 VAL B O   1 
ATOM   6568  C CB  . VAL B  1 326 ? 48.705  -57.680 28.504  1.00 22.82  ? 2344 VAL B CB  1 
ATOM   6569  C CG1 . VAL B  1 326 ? 49.407  -56.428 29.002  1.00 22.76  ? 2344 VAL B CG1 1 
ATOM   6570  C CG2 . VAL B  1 326 ? 47.231  -57.398 28.222  1.00 21.15  ? 2344 VAL B CG2 1 
ATOM   6571  N N   . PRO B  1 327 ? 48.867  -60.598 27.455  1.00 14.40  ? 2345 PRO B N   1 
ATOM   6572  C CA  . PRO B  1 327 ? 48.152  -61.822 27.066  1.00 14.23  ? 2345 PRO B CA  1 
ATOM   6573  C C   . PRO B  1 327 ? 46.647  -61.522 27.116  1.00 14.99  ? 2345 PRO B C   1 
ATOM   6574  O O   . PRO B  1 327 ? 46.172  -60.887 28.062  1.00 14.86  ? 2345 PRO B O   1 
ATOM   6575  C CB  . PRO B  1 327 ? 48.594  -62.823 28.126  1.00 11.84  ? 2345 PRO B CB  1 
ATOM   6576  C CG  . PRO B  1 327 ? 50.019  -62.419 28.368  1.00 15.22  ? 2345 PRO B CG  1 
ATOM   6577  C CD  . PRO B  1 327 ? 49.933  -60.894 28.430  1.00 14.43  ? 2345 PRO B CD  1 
ATOM   6578  N N   . TYR B  1 328 ? 45.902  -61.993 26.120  1.00 14.46  ? 2346 TYR B N   1 
ATOM   6579  C CA  . TYR B  1 328 ? 44.470  -61.708 26.032  1.00 13.60  ? 2346 TYR B CA  1 
ATOM   6580  C C   . TYR B  1 328 ? 43.643  -62.926 25.624  1.00 16.11  ? 2346 TYR B C   1 
ATOM   6581  O O   . TYR B  1 328 ? 43.866  -63.510 24.563  1.00 16.62  ? 2346 TYR B O   1 
ATOM   6582  C CB  . TYR B  1 328 ? 44.265  -60.586 25.003  1.00 14.88  ? 2346 TYR B CB  1 
ATOM   6583  C CG  . TYR B  1 328 ? 42.913  -59.887 24.965  1.00 15.08  ? 2346 TYR B CG  1 
ATOM   6584  C CD1 . TYR B  1 328 ? 42.615  -59.000 23.930  1.00 14.40  ? 2346 TYR B CD1 1 
ATOM   6585  C CD2 . TYR B  1 328 ? 41.953  -60.077 25.965  1.00 16.65  ? 2346 TYR B CD2 1 
ATOM   6586  C CE1 . TYR B  1 328 ? 41.401  -58.313 23.881  1.00 15.25  ? 2346 TYR B CE1 1 
ATOM   6587  C CE2 . TYR B  1 328 ? 40.723  -59.391 25.925  1.00 13.91  ? 2346 TYR B CE2 1 
ATOM   6588  C CZ  . TYR B  1 328 ? 40.459  -58.512 24.878  1.00 16.09  ? 2346 TYR B CZ  1 
ATOM   6589  O OH  . TYR B  1 328 ? 39.255  -57.841 24.803  1.00 17.65  ? 2346 TYR B OH  1 
ATOM   6590  N N   . MET B  1 329 ? 42.684  -63.294 26.472  1.00 15.72  ? 2347 MET B N   1 
ATOM   6591  C CA  . MET B  1 329 ? 41.781  -64.412 26.208  1.00 15.25  ? 2347 MET B CA  1 
ATOM   6592  C C   . MET B  1 329 ? 40.421  -63.823 25.844  1.00 16.82  ? 2347 MET B C   1 
ATOM   6593  O O   . MET B  1 329 ? 39.821  -63.084 26.635  1.00 15.48  ? 2347 MET B O   1 
ATOM   6594  C CB  . MET B  1 329 ? 41.641  -65.299 27.453  1.00 14.90  ? 2347 MET B CB  1 
ATOM   6595  C CG  . MET B  1 329 ? 40.620  -66.433 27.316  1.00 15.03  ? 2347 MET B CG  1 
ATOM   6596  S SD  . MET B  1 329 ? 40.266  -67.262 28.896  1.00 20.20  ? 2347 MET B SD  1 
ATOM   6597  C CE  . MET B  1 329 ? 41.904  -67.979 29.253  1.00 14.23  ? 2347 MET B CE  1 
ATOM   6598  N N   . VAL B  1 330 ? 39.945  -64.143 24.646  1.00 15.17  ? 2348 VAL B N   1 
ATOM   6599  C CA  . VAL B  1 330 ? 38.659  -63.655 24.158  1.00 15.05  ? 2348 VAL B CA  1 
ATOM   6600  C C   . VAL B  1 330 ? 37.757  -64.854 23.882  1.00 16.41  ? 2348 VAL B C   1 
ATOM   6601  O O   . VAL B  1 330 ? 38.141  -65.769 23.153  1.00 17.52  ? 2348 VAL B O   1 
ATOM   6602  C CB  . VAL B  1 330 ? 38.830  -62.845 22.843  1.00 14.42  ? 2348 VAL B CB  1 
ATOM   6603  C CG1 . VAL B  1 330 ? 37.476  -62.349 22.351  1.00 13.25  ? 2348 VAL B CG1 1 
ATOM   6604  C CG2 . VAL B  1 330 ? 39.776  -61.662 23.074  1.00 15.60  ? 2348 VAL B CG2 1 
ATOM   6605  N N   . GLY B  1 331 ? 36.557  -64.851 24.454  1.00 15.51  ? 2349 GLY B N   1 
ATOM   6606  C CA  . GLY B  1 331 ? 35.663  -65.974 24.235  1.00 16.61  ? 2349 GLY B CA  1 
ATOM   6607  C C   . GLY B  1 331 ? 34.205  -65.623 24.046  1.00 19.03  ? 2349 GLY B C   1 
ATOM   6608  O O   . GLY B  1 331 ? 33.778  -64.504 24.346  1.00 16.62  ? 2349 GLY B O   1 
ATOM   6609  N N   . ILE B  1 332 ? 33.444  -66.588 23.532  1.00 17.48  ? 2350 ILE B N   1 
ATOM   6610  C CA  . ILE B  1 332 ? 32.014  -66.418 23.309  1.00 18.90  ? 2350 ILE B CA  1 
ATOM   6611  C C   . ILE B  1 332 ? 31.284  -67.706 23.675  1.00 19.03  ? 2350 ILE B C   1 
ATOM   6612  O O   . ILE B  1 332 ? 31.905  -68.752 23.855  1.00 18.31  ? 2350 ILE B O   1 
ATOM   6613  C CB  . ILE B  1 332 ? 31.690  -66.110 21.825  1.00 20.86  ? 2350 ILE B CB  1 
ATOM   6614  C CG1 . ILE B  1 332 ? 32.199  -67.247 20.935  1.00 21.32  ? 2350 ILE B CG1 1 
ATOM   6615  C CG2 . ILE B  1 332 ? 32.302  -64.780 21.411  1.00 22.59  ? 2350 ILE B CG2 1 
ATOM   6616  C CD1 . ILE B  1 332 ? 31.715  -67.159 19.497  1.00 25.15  ? 2350 ILE B CD1 1 
ATOM   6617  N N   . ASN B  1 333 ? 29.964  -67.619 23.789  1.00 18.88  ? 2351 ASN B N   1 
ATOM   6618  C CA  . ASN B  1 333 ? 29.150  -68.781 24.105  1.00 18.26  ? 2351 ASN B CA  1 
ATOM   6619  C C   . ASN B  1 333 ? 28.436  -69.250 22.844  1.00 18.68  ? 2351 ASN B C   1 
ATOM   6620  O O   . ASN B  1 333 ? 28.202  -68.461 21.928  1.00 18.60  ? 2351 ASN B O   1 
ATOM   6621  C CB  . ASN B  1 333 ? 28.158  -68.438 25.214  1.00 20.11  ? 2351 ASN B CB  1 
ATOM   6622  C CG  . ASN B  1 333 ? 28.850  -68.193 26.542  1.00 20.59  ? 2351 ASN B CG  1 
ATOM   6623  O OD1 . ASN B  1 333 ? 30.071  -68.295 26.635  1.00 24.74  ? 2351 ASN B OD1 1 
ATOM   6624  N ND2 . ASN B  1 333 ? 28.082  -67.874 27.571  1.00 23.13  ? 2351 ASN B ND2 1 
ATOM   6625  N N   . LYS B  1 334 ? 28.096  -70.535 22.801  1.00 20.26  ? 2352 LYS B N   1 
ATOM   6626  C CA  . LYS B  1 334 ? 27.441  -71.130 21.637  1.00 19.46  ? 2352 LYS B CA  1 
ATOM   6627  C C   . LYS B  1 334 ? 26.183  -70.406 21.156  1.00 19.33  ? 2352 LYS B C   1 
ATOM   6628  O O   . LYS B  1 334 ? 26.001  -70.231 19.952  1.00 18.22  ? 2352 LYS B O   1 
ATOM   6629  C CB  . LYS B  1 334 ? 27.105  -72.595 21.930  1.00 23.19  ? 2352 LYS B CB  1 
ATOM   6630  C CG  . LYS B  1 334 ? 26.739  -73.417 20.699  1.00 25.84  ? 2352 LYS B CG  1 
ATOM   6631  C CD  . LYS B  1 334 ? 27.950  -73.616 19.805  1.00 30.39  ? 2352 LYS B CD  1 
ATOM   6632  C CE  . LYS B  1 334 ? 27.651  -74.571 18.654  1.00 33.98  ? 2352 LYS B CE  1 
ATOM   6633  N NZ  . LYS B  1 334 ? 28.886  -74.864 17.861  1.00 36.17  ? 2352 LYS B NZ  1 
ATOM   6634  N N   . GLN B  1 335 ? 25.315  -69.996 22.082  1.00 18.64  ? 2353 GLN B N   1 
ATOM   6635  C CA  . GLN B  1 335 ? 24.074  -69.297 21.718  1.00 20.79  ? 2353 GLN B CA  1 
ATOM   6636  C C   . GLN B  1 335 ? 23.922  -67.958 22.451  1.00 20.84  ? 2353 GLN B C   1 
ATOM   6637  O O   . GLN B  1 335 ? 23.027  -67.797 23.280  1.00 21.12  ? 2353 GLN B O   1 
ATOM   6638  C CB  . GLN B  1 335 ? 22.853  -70.163 22.046  1.00 21.96  ? 2353 GLN B CB  1 
ATOM   6639  C CG  . GLN B  1 335 ? 22.854  -71.570 21.467  1.00 27.80  ? 2353 GLN B CG  1 
ATOM   6640  C CD  . GLN B  1 335 ? 21.563  -72.323 21.779  1.00 28.54  ? 2353 GLN B CD  1 
ATOM   6641  O OE1 . GLN B  1 335 ? 21.581  -73.516 22.072  1.00 33.23  ? 2353 GLN B OE1 1 
ATOM   6642  N NE2 . GLN B  1 335 ? 20.441  -71.624 21.712  1.00 30.75  ? 2353 GLN B NE2 1 
ATOM   6643  N N   . GLU B  1 336 ? 24.786  -67.001 22.138  1.00 21.06  ? 2354 GLU B N   1 
ATOM   6644  C CA  . GLU B  1 336 ? 24.764  -65.688 22.782  1.00 21.89  ? 2354 GLU B CA  1 
ATOM   6645  C C   . GLU B  1 336 ? 23.395  -65.001 22.813  1.00 22.02  ? 2354 GLU B C   1 
ATOM   6646  O O   . GLU B  1 336 ? 23.075  -64.286 23.766  1.00 20.77  ? 2354 GLU B O   1 
ATOM   6647  C CB  . GLU B  1 336 ? 25.782  -64.766 22.103  1.00 22.05  ? 2354 GLU B CB  1 
ATOM   6648  C CG  . GLU B  1 336 ? 27.228  -65.224 22.239  1.00 21.54  ? 2354 GLU B CG  1 
ATOM   6649  C CD  . GLU B  1 336 ? 27.789  -64.977 23.631  1.00 24.50  ? 2354 GLU B CD  1 
ATOM   6650  O OE1 . GLU B  1 336 ? 27.018  -64.542 24.515  1.00 23.18  ? 2354 GLU B OE1 1 
ATOM   6651  O OE2 . GLU B  1 336 ? 29.003  -65.217 23.839  1.00 22.89  ? 2354 GLU B OE2 1 
ATOM   6652  N N   . PHE B  1 337 ? 22.590  -65.212 21.777  1.00 20.49  ? 2355 PHE B N   1 
ATOM   6653  C CA  . PHE B  1 337 ? 21.273  -64.589 21.710  1.00 21.09  ? 2355 PHE B CA  1 
ATOM   6654  C C   . PHE B  1 337 ? 20.179  -65.647 21.847  1.00 21.59  ? 2355 PHE B C   1 
ATOM   6655  O O   . PHE B  1 337 ? 19.070  -65.485 21.340  1.00 20.71  ? 2355 PHE B O   1 
ATOM   6656  C CB  . PHE B  1 337 ? 21.140  -63.836 20.382  1.00 20.97  ? 2355 PHE B CB  1 
ATOM   6657  C CG  . PHE B  1 337 ? 20.230  -62.640 20.444  1.00 21.20  ? 2355 PHE B CG  1 
ATOM   6658  C CD1 . PHE B  1 337 ? 18.932  -62.709 19.949  1.00 21.68  ? 2355 PHE B CD1 1 
ATOM   6659  C CD2 . PHE B  1 337 ? 20.679  -61.437 20.984  1.00 21.24  ? 2355 PHE B CD2 1 
ATOM   6660  C CE1 . PHE B  1 337 ? 18.090  -61.592 19.988  1.00 22.12  ? 2355 PHE B CE1 1 
ATOM   6661  C CE2 . PHE B  1 337 ? 19.849  -60.314 21.030  1.00 20.60  ? 2355 PHE B CE2 1 
ATOM   6662  C CZ  . PHE B  1 337 ? 18.551  -60.393 20.530  1.00 23.02  ? 2355 PHE B CZ  1 
ATOM   6663  N N   . GLY B  1 338 ? 20.498  -66.719 22.566  1.00 22.66  ? 2356 GLY B N   1 
ATOM   6664  C CA  . GLY B  1 338 ? 19.556  -67.811 22.754  1.00 23.96  ? 2356 GLY B CA  1 
ATOM   6665  C C   . GLY B  1 338 ? 18.336  -67.581 23.634  1.00 25.47  ? 2356 GLY B C   1 
ATOM   6666  O O   . GLY B  1 338 ? 17.289  -68.181 23.393  1.00 26.11  ? 2356 GLY B O   1 
ATOM   6667  N N   . TRP B  1 339 ? 18.442  -66.728 24.648  1.00 25.11  ? 2357 TRP B N   1 
ATOM   6668  C CA  . TRP B  1 339 ? 17.295  -66.491 25.518  1.00 23.71  ? 2357 TRP B CA  1 
ATOM   6669  C C   . TRP B  1 339 ? 17.412  -65.277 26.432  1.00 23.01  ? 2357 TRP B C   1 
ATOM   6670  O O   . TRP B  1 339 ? 16.539  -64.410 26.433  1.00 22.09  ? 2357 TRP B O   1 
ATOM   6671  C CB  . TRP B  1 339 ? 17.035  -67.723 26.388  1.00 23.83  ? 2357 TRP B CB  1 
ATOM   6672  C CG  . TRP B  1 339 ? 15.857  -67.569 27.299  1.00 24.34  ? 2357 TRP B CG  1 
ATOM   6673  C CD1 . TRP B  1 339 ? 14.537  -67.726 26.973  1.00 24.50  ? 2357 TRP B CD1 1 
ATOM   6674  C CD2 . TRP B  1 339 ? 15.887  -67.195 28.681  1.00 23.58  ? 2357 TRP B CD2 1 
ATOM   6675  N NE1 . TRP B  1 339 ? 13.746  -67.475 28.069  1.00 23.76  ? 2357 TRP B NE1 1 
ATOM   6676  C CE2 . TRP B  1 339 ? 14.548  -67.145 29.130  1.00 25.29  ? 2357 TRP B CE2 1 
ATOM   6677  C CE3 . TRP B  1 339 ? 16.916  -66.897 29.586  1.00 23.71  ? 2357 TRP B CE3 1 
ATOM   6678  C CZ2 . TRP B  1 339 ? 14.209  -66.805 30.450  1.00 25.89  ? 2357 TRP B CZ2 1 
ATOM   6679  C CZ3 . TRP B  1 339 ? 16.580  -66.560 30.898  1.00 23.62  ? 2357 TRP B CZ3 1 
ATOM   6680  C CH2 . TRP B  1 339 ? 15.236  -66.517 31.314  1.00 24.03  ? 2357 TRP B CH2 1 
ATOM   6681  N N   . LEU B  1 340 ? 18.484  -65.233 27.216  1.00 21.96  ? 2358 LEU B N   1 
ATOM   6682  C CA  . LEU B  1 340 ? 18.708  -64.147 28.164  1.00 21.91  ? 2358 LEU B CA  1 
ATOM   6683  C C   . LEU B  1 340 ? 18.553  -62.735 27.608  1.00 21.14  ? 2358 LEU B C   1 
ATOM   6684  O O   . LEU B  1 340 ? 17.734  -61.959 28.101  1.00 21.22  ? 2358 LEU B O   1 
ATOM   6685  C CB  . LEU B  1 340 ? 20.091  -64.274 28.791  1.00 24.70  ? 2358 LEU B CB  1 
ATOM   6686  C CG  . LEU B  1 340 ? 20.383  -63.221 29.863  1.00 28.13  ? 2358 LEU B CG  1 
ATOM   6687  C CD1 . LEU B  1 340 ? 19.650  -63.578 31.144  1.00 30.57  ? 2358 LEU B CD1 1 
ATOM   6688  C CD2 . LEU B  1 340 ? 21.868  -63.161 30.117  1.00 30.32  ? 2358 LEU B CD2 1 
ATOM   6689  N N   . ILE B  1 341 ? 19.342  -62.395 26.596  1.00 20.12  ? 2359 ILE B N   1 
ATOM   6690  C CA  . ILE B  1 341 ? 19.277  -61.057 26.006  1.00 18.74  ? 2359 ILE B CA  1 
ATOM   6691  C C   . ILE B  1 341 ? 17.908  -60.736 25.415  1.00 18.50  ? 2359 ILE B C   1 
ATOM   6692  O O   . ILE B  1 341 ? 17.321  -59.705 25.740  1.00 17.15  ? 2359 ILE B O   1 
ATOM   6693  C CB  . ILE B  1 341 ? 20.375  -60.865 24.928  1.00 18.55  ? 2359 ILE B CB  1 
ATOM   6694  C CG1 . ILE B  1 341 ? 21.755  -60.968 25.588  1.00 18.96  ? 2359 ILE B CG1 1 
ATOM   6695  C CG2 . ILE B  1 341 ? 20.213  -59.512 24.240  1.00 17.05  ? 2359 ILE B CG2 1 
ATOM   6696  C CD1 . ILE B  1 341 ? 22.917  -60.857 24.620  1.00 20.13  ? 2359 ILE B CD1 1 
ATOM   6697  N N   . PRO B  1 342 ? 17.377  -61.608 24.537  1.00 18.80  ? 2360 PRO B N   1 
ATOM   6698  C CA  . PRO B  1 342 ? 16.058  -61.296 23.973  1.00 20.01  ? 2360 PRO B CA  1 
ATOM   6699  C C   . PRO B  1 342 ? 14.951  -61.178 25.027  1.00 22.66  ? 2360 PRO B C   1 
ATOM   6700  O O   . PRO B  1 342 ? 14.000  -60.408 24.855  1.00 23.58  ? 2360 PRO B O   1 
ATOM   6701  C CB  . PRO B  1 342 ? 15.822  -62.432 22.973  1.00 19.94  ? 2360 PRO B CB  1 
ATOM   6702  C CG  . PRO B  1 342 ? 16.680  -63.565 23.501  1.00 18.60  ? 2360 PRO B CG  1 
ATOM   6703  C CD  . PRO B  1 342 ? 17.928  -62.845 23.954  1.00 18.58  ? 2360 PRO B CD  1 
ATOM   6704  N N   . MET B  1 343 ? 15.071  -61.932 26.114  1.00 22.91  ? 2361 MET B N   1 
ATOM   6705  C CA  . MET B  1 343 ? 14.082  -61.868 27.184  1.00 24.81  ? 2361 MET B CA  1 
ATOM   6706  C C   . MET B  1 343 ? 14.187  -60.494 27.841  1.00 24.48  ? 2361 MET B C   1 
ATOM   6707  O O   . MET B  1 343 ? 13.191  -59.790 28.018  1.00 24.37  ? 2361 MET B O   1 
ATOM   6708  C CB  . MET B  1 343 ? 14.350  -62.967 28.221  1.00 27.78  ? 2361 MET B CB  1 
ATOM   6709  C CG  . MET B  1 343 ? 13.484  -62.899 29.485  1.00 30.15  ? 2361 MET B CG  1 
ATOM   6710  S SD  . MET B  1 343 ? 14.084  -61.737 30.743  1.00 35.49  ? 2361 MET B SD  1 
ATOM   6711  C CE  . MET B  1 343 ? 15.291  -62.759 31.610  1.00 32.49  ? 2361 MET B CE  1 
ATOM   6712  N N   . LEU B  1 344 ? 15.409  -60.114 28.187  1.00 24.18  ? 2363 LEU B N   1 
ATOM   6713  C CA  . LEU B  1 344 ? 15.654  -58.836 28.828  1.00 25.93  ? 2363 LEU B CA  1 
ATOM   6714  C C   . LEU B  1 344 ? 15.292  -57.641 27.949  1.00 24.64  ? 2363 LEU B C   1 
ATOM   6715  O O   . LEU B  1 344 ? 14.906  -56.594 28.452  1.00 25.12  ? 2363 LEU B O   1 
ATOM   6716  C CB  . LEU B  1 344 ? 17.116  -58.759 29.264  1.00 28.47  ? 2363 LEU B CB  1 
ATOM   6717  C CG  . LEU B  1 344 ? 17.479  -59.858 30.268  1.00 32.36  ? 2363 LEU B CG  1 
ATOM   6718  C CD1 . LEU B  1 344 ? 18.967  -59.849 30.532  1.00 32.77  ? 2363 LEU B CD1 1 
ATOM   6719  C CD2 . LEU B  1 344 ? 16.690  -59.657 31.558  1.00 34.48  ? 2363 LEU B CD2 1 
ATOM   6720  N N   . MET B  1 345 ? 15.382  -57.790 26.636  1.00 21.93  ? 2364 MET B N   1 
ATOM   6721  C CA  . MET B  1 345 ? 15.053  -56.666 25.765  1.00 24.33  ? 2364 MET B CA  1 
ATOM   6722  C C   . MET B  1 345 ? 13.631  -56.677 25.216  1.00 23.25  ? 2364 MET B C   1 
ATOM   6723  O O   . MET B  1 345 ? 13.289  -55.857 24.364  1.00 22.94  ? 2364 MET B O   1 
ATOM   6724  C CB  . MET B  1 345 ? 16.040  -56.601 24.607  1.00 25.98  ? 2364 MET B CB  1 
ATOM   6725  C CG  . MET B  1 345 ? 17.469  -56.417 25.061  1.00 29.40  ? 2364 MET B CG  1 
ATOM   6726  S SD  . MET B  1 345 ? 18.520  -55.999 23.674  1.00 38.83  ? 2364 MET B SD  1 
ATOM   6727  C CE  . MET B  1 345 ? 18.208  -54.229 23.583  1.00 35.00  ? 2364 MET B CE  1 
ATOM   6728  N N   . SER B  1 346 ? 12.807  -57.597 25.710  1.00 22.27  ? 2365 SER B N   1 
ATOM   6729  C CA  . SER B  1 346 ? 11.426  -57.714 25.253  1.00 22.76  ? 2365 SER B CA  1 
ATOM   6730  C C   . SER B  1 346 ? 11.407  -57.896 23.739  1.00 24.45  ? 2365 SER B C   1 
ATOM   6731  O O   . SER B  1 346 ? 10.594  -57.294 23.029  1.00 22.64  ? 2365 SER B O   1 
ATOM   6732  C CB  . SER B  1 346 ? 10.617  -56.470 25.637  1.00 22.18  ? 2365 SER B CB  1 
ATOM   6733  O OG  . SER B  1 346 ? 10.604  -56.280 27.041  1.00 24.80  ? 2365 SER B OG  1 
ATOM   6734  N N   . TYR B  1 347 ? 12.315  -58.732 23.252  1.00 25.24  ? 2366 TYR B N   1 
ATOM   6735  C CA  . TYR B  1 347 ? 12.408  -59.011 21.827  1.00 28.66  ? 2366 TYR B CA  1 
ATOM   6736  C C   . TYR B  1 347 ? 11.082  -59.620 21.378  1.00 30.45  ? 2366 TYR B C   1 
ATOM   6737  O O   . TYR B  1 347 ? 10.525  -60.481 22.063  1.00 29.62  ? 2366 TYR B O   1 
ATOM   6738  C CB  . TYR B  1 347 ? 13.548  -59.994 21.563  1.00 29.19  ? 2366 TYR B CB  1 
ATOM   6739  C CG  . TYR B  1 347 ? 14.108  -59.897 20.173  1.00 28.56  ? 2366 TYR B CG  1 
ATOM   6740  C CD1 . TYR B  1 347 ? 14.915  -58.825 19.803  1.00 29.46  ? 2366 TYR B CD1 1 
ATOM   6741  C CD2 . TYR B  1 347 ? 13.802  -60.856 19.214  1.00 30.30  ? 2366 TYR B CD2 1 
ATOM   6742  C CE1 . TYR B  1 347 ? 15.408  -58.710 18.504  1.00 30.67  ? 2366 TYR B CE1 1 
ATOM   6743  C CE2 . TYR B  1 347 ? 14.287  -60.754 17.913  1.00 32.93  ? 2366 TYR B CE2 1 
ATOM   6744  C CZ  . TYR B  1 347 ? 15.088  -59.679 17.564  1.00 31.48  ? 2366 TYR B CZ  1 
ATOM   6745  O OH  . TYR B  1 347 ? 15.556  -59.574 16.271  1.00 32.18  ? 2366 TYR B OH  1 
ATOM   6746  N N   . PRO B  1 348 ? 10.555  -59.175 20.224  1.00 32.86  ? 2367 PRO B N   1 
ATOM   6747  C CA  . PRO B  1 348 ? 9.287   -59.672 19.684  1.00 34.57  ? 2367 PRO B CA  1 
ATOM   6748  C C   . PRO B  1 348 ? 9.406   -60.952 18.859  1.00 37.20  ? 2367 PRO B C   1 
ATOM   6749  O O   . PRO B  1 348 ? 9.155   -60.956 17.654  1.00 37.72  ? 2367 PRO B O   1 
ATOM   6750  C CB  . PRO B  1 348 ? 8.801   -58.498 18.850  1.00 34.48  ? 2367 PRO B CB  1 
ATOM   6751  C CG  . PRO B  1 348 ? 10.078  -58.011 18.250  1.00 33.87  ? 2367 PRO B CG  1 
ATOM   6752  C CD  . PRO B  1 348 ? 11.035  -58.025 19.436  1.00 34.35  ? 2367 PRO B CD  1 
ATOM   6753  N N   . LEU B  1 349 ? 9.795   -62.034 19.520  1.00 39.65  ? 2368 LEU B N   1 
ATOM   6754  C CA  . LEU B  1 349 ? 9.934   -63.333 18.878  1.00 41.98  ? 2368 LEU B CA  1 
ATOM   6755  C C   . LEU B  1 349 ? 9.258   -64.276 19.861  1.00 42.68  ? 2368 LEU B C   1 
ATOM   6756  O O   . LEU B  1 349 ? 9.670   -64.357 21.016  1.00 44.66  ? 2368 LEU B O   1 
ATOM   6757  C CB  . LEU B  1 349 ? 11.416  -63.694 18.725  1.00 43.20  ? 2368 LEU B CB  1 
ATOM   6758  C CG  . LEU B  1 349 ? 11.759  -64.802 17.725  1.00 44.55  ? 2368 LEU B CG  1 
ATOM   6759  C CD1 . LEU B  1 349 ? 11.504  -64.309 16.313  1.00 44.39  ? 2368 LEU B CD1 1 
ATOM   6760  C CD2 . LEU B  1 349 ? 13.217  -65.206 17.876  1.00 46.63  ? 2368 LEU B CD2 1 
ATOM   6761  N N   . SER B  1 350 ? 8.223   -64.983 19.417  1.00 43.79  ? 2369 SER B N   1 
ATOM   6762  C CA  . SER B  1 350 ? 7.497   -65.872 20.318  1.00 45.21  ? 2369 SER B CA  1 
ATOM   6763  C C   . SER B  1 350 ? 6.858   -67.116 19.690  1.00 46.16  ? 2369 SER B C   1 
ATOM   6764  O O   . SER B  1 350 ? 6.207   -67.897 20.387  1.00 45.97  ? 2369 SER B O   1 
ATOM   6765  C CB  . SER B  1 350 ? 6.415   -65.060 21.035  1.00 45.48  ? 2369 SER B CB  1 
ATOM   6766  O OG  . SER B  1 350 ? 5.597   -65.874 21.856  1.00 48.49  ? 2369 SER B OG  1 
ATOM   6767  N N   . GLU B  1 351 ? 7.045   -67.322 18.392  1.00 47.03  ? 2370 GLU B N   1 
ATOM   6768  C CA  . GLU B  1 351 ? 6.435   -68.475 17.743  1.00 49.52  ? 2370 GLU B CA  1 
ATOM   6769  C C   . GLU B  1 351 ? 7.226   -69.775 17.739  1.00 50.11  ? 2370 GLU B C   1 
ATOM   6770  O O   . GLU B  1 351 ? 6.742   -70.798 18.222  1.00 51.35  ? 2370 GLU B O   1 
ATOM   6771  C CB  . GLU B  1 351 ? 6.042   -68.120 16.312  1.00 50.22  ? 2370 GLU B CB  1 
ATOM   6772  C CG  . GLU B  1 351 ? 4.735   -67.371 16.244  1.00 52.10  ? 2370 GLU B CG  1 
ATOM   6773  C CD  . GLU B  1 351 ? 3.559   -68.219 16.681  1.00 53.81  ? 2370 GLU B CD  1 
ATOM   6774  O OE1 . GLU B  1 351 ? 3.165   -69.127 15.917  1.00 54.74  ? 2370 GLU B OE1 1 
ATOM   6775  O OE2 . GLU B  1 351 ? 3.031   -67.982 17.788  1.00 55.35  ? 2370 GLU B OE2 1 
ATOM   6776  N N   . GLY B  1 352 ? 8.438   -69.745 17.202  1.00 49.93  ? 2371 GLY B N   1 
ATOM   6777  C CA  . GLY B  1 352 ? 9.222   -70.964 17.140  1.00 50.94  ? 2371 GLY B CA  1 
ATOM   6778  C C   . GLY B  1 352 ? 9.481   -71.244 15.677  1.00 50.90  ? 2371 GLY B C   1 
ATOM   6779  O O   . GLY B  1 352 ? 10.510  -71.808 15.309  1.00 51.79  ? 2371 GLY B O   1 
ATOM   6780  N N   . GLN B  1 353 ? 8.521   -70.863 14.841  1.00 50.57  ? 2372 GLN B N   1 
ATOM   6781  C CA  . GLN B  1 353 ? 8.660   -71.009 13.403  1.00 50.82  ? 2372 GLN B CA  1 
ATOM   6782  C C   . GLN B  1 353 ? 8.764   -69.580 12.885  1.00 49.50  ? 2372 GLN B C   1 
ATOM   6783  O O   . GLN B  1 353 ? 8.001   -68.705 13.303  1.00 51.02  ? 2372 GLN B O   1 
ATOM   6784  C CB  . GLN B  1 353 ? 7.451   -71.719 12.780  1.00 52.70  ? 2372 GLN B CB  1 
ATOM   6785  C CG  . GLN B  1 353 ? 6.090   -71.108 13.077  1.00 55.90  ? 2372 GLN B CG  1 
ATOM   6786  C CD  . GLN B  1 353 ? 5.407   -71.788 14.241  1.00 56.64  ? 2372 GLN B CD  1 
ATOM   6787  O OE1 . GLN B  1 353 ? 5.498   -73.008 14.394  1.00 58.16  ? 2372 GLN B OE1 1 
ATOM   6788  N NE2 . GLN B  1 353 ? 4.709   -71.008 15.063  1.00 57.22  ? 2372 GLN B NE2 1 
ATOM   6789  N N   . LEU B  1 354 ? 9.717   -69.337 11.994  1.00 46.25  ? 2373 LEU B N   1 
ATOM   6790  C CA  . LEU B  1 354 ? 9.921   -67.998 11.458  1.00 43.05  ? 2373 LEU B CA  1 
ATOM   6791  C C   . LEU B  1 354 ? 10.108  -68.008 9.947   1.00 41.27  ? 2373 LEU B C   1 
ATOM   6792  O O   . LEU B  1 354 ? 10.960  -68.722 9.428   1.00 40.32  ? 2373 LEU B O   1 
ATOM   6793  C CB  . LEU B  1 354 ? 11.151  -67.366 12.124  1.00 42.44  ? 2373 LEU B CB  1 
ATOM   6794  C CG  . LEU B  1 354 ? 11.465  -65.895 11.835  1.00 41.43  ? 2373 LEU B CG  1 
ATOM   6795  C CD1 . LEU B  1 354 ? 10.345  -65.026 12.373  1.00 41.24  ? 2373 LEU B CD1 1 
ATOM   6796  C CD2 . LEU B  1 354 ? 12.788  -65.509 12.480  1.00 40.50  ? 2373 LEU B CD2 1 
ATOM   6797  N N   . ASP B  1 355 ? 9.297   -67.222 9.248   1.00 40.63  ? 2374 ASP B N   1 
ATOM   6798  C CA  . ASP B  1 355 ? 9.400   -67.112 7.796   1.00 40.57  ? 2374 ASP B CA  1 
ATOM   6799  C C   . ASP B  1 355 ? 10.409  -66.002 7.522   1.00 40.11  ? 2374 ASP B C   1 
ATOM   6800  O O   . ASP B  1 355 ? 10.617  -65.132 8.370   1.00 39.38  ? 2374 ASP B O   1 
ATOM   6801  C CB  . ASP B  1 355 ? 8.046   -66.749 7.186   1.00 41.68  ? 2374 ASP B CB  1 
ATOM   6802  C CG  . ASP B  1 355 ? 7.375   -65.592 7.902   1.00 43.39  ? 2374 ASP B CG  1 
ATOM   6803  O OD1 . ASP B  1 355 ? 6.885   -65.794 9.037   1.00 44.04  ? 2374 ASP B OD1 1 
ATOM   6804  O OD2 . ASP B  1 355 ? 7.346   -64.479 7.335   1.00 44.05  ? 2374 ASP B OD2 1 
ATOM   6805  N N   . GLN B  1 356 ? 11.039  -66.020 6.353   1.00 38.94  ? 2375 GLN B N   1 
ATOM   6806  C CA  . GLN B  1 356 ? 12.031  -64.998 6.044   1.00 38.01  ? 2375 GLN B CA  1 
ATOM   6807  C C   . GLN B  1 356 ? 11.451  -63.596 5.988   1.00 36.22  ? 2375 GLN B C   1 
ATOM   6808  O O   . GLN B  1 356 ? 12.103  -62.639 6.398   1.00 35.35  ? 2375 GLN B O   1 
ATOM   6809  C CB  . GLN B  1 356 ? 12.749  -65.318 4.731   1.00 38.91  ? 2375 GLN B CB  1 
ATOM   6810  C CG  . GLN B  1 356 ? 13.569  -66.590 4.799   1.00 41.81  ? 2375 GLN B CG  1 
ATOM   6811  C CD  . GLN B  1 356 ? 14.554  -66.718 3.656   1.00 44.59  ? 2375 GLN B CD  1 
ATOM   6812  O OE1 . GLN B  1 356 ? 15.135  -67.782 3.445   1.00 46.04  ? 2375 GLN B OE1 1 
ATOM   6813  N NE2 . GLN B  1 356 ? 14.756  -65.632 2.918   1.00 44.97  ? 2375 GLN B NE2 1 
ATOM   6814  N N   . LYS B  1 357 ? 10.228  -63.465 5.487   1.00 35.13  ? 2376 LYS B N   1 
ATOM   6815  C CA  . LYS B  1 357 ? 9.614   -62.150 5.412   1.00 34.10  ? 2376 LYS B CA  1 
ATOM   6816  C C   . LYS B  1 357 ? 9.584   -61.535 6.806   1.00 32.76  ? 2376 LYS B C   1 
ATOM   6817  O O   . LYS B  1 357 ? 9.972   -60.382 6.995   1.00 32.50  ? 2376 LYS B O   1 
ATOM   6818  C CB  . LYS B  1 357 ? 8.195   -62.242 4.851   1.00 36.14  ? 2376 LYS B CB  1 
ATOM   6819  C CG  . LYS B  1 357 ? 7.542   -60.883 4.656   1.00 38.71  ? 2376 LYS B CG  1 
ATOM   6820  C CD  . LYS B  1 357 ? 6.223   -60.996 3.909   1.00 42.90  ? 2376 LYS B CD  1 
ATOM   6821  C CE  . LYS B  1 357 ? 5.597   -59.624 3.695   1.00 44.19  ? 2376 LYS B CE  1 
ATOM   6822  N NZ  . LYS B  1 357 ? 4.357   -59.699 2.873   1.00 47.48  ? 2376 LYS B NZ  1 
ATOM   6823  N N   . THR B  1 358 ? 9.131   -62.315 7.783   1.00 30.75  ? 2377 THR B N   1 
ATOM   6824  C CA  . THR B  1 358 ? 9.058   -61.848 9.163   1.00 29.24  ? 2377 THR B CA  1 
ATOM   6825  C C   . THR B  1 358 ? 10.459  -61.567 9.700   1.00 28.27  ? 2377 THR B C   1 
ATOM   6826  O O   . THR B  1 358 ? 10.677  -60.591 10.415  1.00 26.28  ? 2377 THR B O   1 
ATOM   6827  C CB  . THR B  1 358 ? 8.377   -62.896 10.067  1.00 30.47  ? 2377 THR B CB  1 
ATOM   6828  O OG1 . THR B  1 358 ? 7.080   -63.205 9.541   1.00 32.09  ? 2377 THR B OG1 1 
ATOM   6829  C CG2 . THR B  1 358 ? 8.227   -62.365 11.493  1.00 28.96  ? 2377 THR B CG2 1 
ATOM   6830  N N   . ALA B  1 359 ? 11.408  -62.429 9.344   1.00 26.61  ? 2378 ALA B N   1 
ATOM   6831  C CA  . ALA B  1 359 ? 12.787  -62.277 9.789   1.00 26.12  ? 2378 ALA B CA  1 
ATOM   6832  C C   . ALA B  1 359 ? 13.375  -60.941 9.349   1.00 24.45  ? 2378 ALA B C   1 
ATOM   6833  O O   . ALA B  1 359 ? 14.008  -60.248 10.142  1.00 23.25  ? 2378 ALA B O   1 
ATOM   6834  C CB  . ALA B  1 359 ? 13.641  -63.428 9.257   1.00 27.03  ? 2378 ALA B CB  1 
ATOM   6835  N N   . MET B  1 360 ? 13.165  -60.579 8.088   1.00 24.14  ? 2379 MET B N   1 
ATOM   6836  C CA  . MET B  1 360 ? 13.689  -59.322 7.573   1.00 25.84  ? 2379 MET B CA  1 
ATOM   6837  C C   . MET B  1 360 ? 13.122  -58.137 8.350   1.00 25.42  ? 2379 MET B C   1 
ATOM   6838  O O   . MET B  1 360 ? 13.839  -57.182 8.641   1.00 26.49  ? 2379 MET B O   1 
ATOM   6839  C CB  . MET B  1 360 ? 13.356  -59.167 6.085   1.00 26.38  ? 2379 MET B CB  1 
ATOM   6840  C CG  . MET B  1 360 ? 13.857  -60.311 5.215   1.00 28.70  ? 2379 MET B CG  1 
ATOM   6841  S SD  . MET B  1 360 ? 13.902  -59.871 3.455   1.00 32.23  ? 2379 MET B SD  1 
ATOM   6842  C CE  . MET B  1 360 ? 12.202  -60.200 2.972   1.00 31.93  ? 2379 MET B CE  1 
ATOM   6843  N N   . SER B  1 361 ? 11.833  -58.199 8.674   1.00 26.47  ? 2380 SER B N   1 
ATOM   6844  C CA  . SER B  1 361 ? 11.180  -57.130 9.424   1.00 27.41  ? 2380 SER B CA  1 
ATOM   6845  C C   . SER B  1 361 ? 11.806  -57.039 10.807  1.00 26.27  ? 2380 SER B C   1 
ATOM   6846  O O   . SER B  1 361 ? 12.096  -55.950 11.301  1.00 26.47  ? 2380 SER B O   1 
ATOM   6847  C CB  . SER B  1 361 ? 9.681   -57.411 9.564   1.00 30.07  ? 2380 SER B CB  1 
ATOM   6848  O OG  . SER B  1 361 ? 9.040   -57.432 8.298   1.00 34.45  ? 2380 SER B OG  1 
ATOM   6849  N N   . LEU B  1 362 ? 12.017  -58.192 11.427  1.00 25.28  ? 2381 LEU B N   1 
ATOM   6850  C CA  . LEU B  1 362 ? 12.616  -58.231 12.749  1.00 25.13  ? 2381 LEU B CA  1 
ATOM   6851  C C   . LEU B  1 362 ? 14.057  -57.735 12.715  1.00 23.64  ? 2381 LEU B C   1 
ATOM   6852  O O   . LEU B  1 362 ? 14.491  -57.025 13.621  1.00 21.91  ? 2381 LEU B O   1 
ATOM   6853  C CB  . LEU B  1 362 ? 12.572  -59.652 13.314  1.00 27.51  ? 2381 LEU B CB  1 
ATOM   6854  C CG  . LEU B  1 362 ? 11.219  -60.174 13.811  1.00 29.05  ? 2381 LEU B CG  1 
ATOM   6855  C CD1 . LEU B  1 362 ? 11.345  -61.635 14.215  1.00 30.15  ? 2381 LEU B CD1 1 
ATOM   6856  C CD2 . LEU B  1 362 ? 10.749  -59.331 14.994  1.00 30.77  ? 2381 LEU B CD2 1 
ATOM   6857  N N   . LEU B  1 363 ? 14.793  -58.097 11.667  1.00 22.21  ? 2382 LEU B N   1 
ATOM   6858  C CA  . LEU B  1 363 ? 16.193  -57.687 11.550  1.00 20.21  ? 2382 LEU B CA  1 
ATOM   6859  C C   . LEU B  1 363 ? 16.304  -56.172 11.397  1.00 17.63  ? 2382 LEU B C   1 
ATOM   6860  O O   . LEU B  1 363 ? 17.243  -55.565 11.894  1.00 20.20  ? 2382 LEU B O   1 
ATOM   6861  C CB  . LEU B  1 363 ? 16.862  -58.397 10.362  1.00 20.57  ? 2382 LEU B CB  1 
ATOM   6862  C CG  . LEU B  1 363 ? 18.396  -58.409 10.339  1.00 22.08  ? 2382 LEU B CG  1 
ATOM   6863  C CD1 . LEU B  1 363 ? 18.922  -59.077 11.611  1.00 21.97  ? 2382 LEU B CD1 1 
ATOM   6864  C CD2 . LEU B  1 363 ? 18.897  -59.160 9.106   1.00 24.06  ? 2382 LEU B CD2 1 
ATOM   6865  N N   . TRP B  1 364 ? 15.344  -55.565 10.707  1.00 18.80  ? 2383 TRP B N   1 
ATOM   6866  C CA  . TRP B  1 364 ? 15.337  -54.112 10.529  1.00 20.29  ? 2383 TRP B CA  1 
ATOM   6867  C C   . TRP B  1 364 ? 15.098  -53.437 11.892  1.00 20.93  ? 2383 TRP B C   1 
ATOM   6868  O O   . TRP B  1 364 ? 15.782  -52.473 12.255  1.00 20.60  ? 2383 TRP B O   1 
ATOM   6869  C CB  . TRP B  1 364 ? 14.242  -53.712 9.532   1.00 20.72  ? 2383 TRP B CB  1 
ATOM   6870  C CG  . TRP B  1 364 ? 14.087  -52.226 9.351   1.00 23.31  ? 2383 TRP B CG  1 
ATOM   6871  C CD1 . TRP B  1 364 ? 12.930  -51.507 9.451   1.00 24.53  ? 2383 TRP B CD1 1 
ATOM   6872  C CD2 . TRP B  1 364 ? 15.121  -51.280 9.052   1.00 23.77  ? 2383 TRP B CD2 1 
ATOM   6873  N NE1 . TRP B  1 364 ? 13.177  -50.173 9.238   1.00 24.11  ? 2383 TRP B NE1 1 
ATOM   6874  C CE2 . TRP B  1 364 ? 14.514  -50.004 8.990   1.00 24.92  ? 2383 TRP B CE2 1 
ATOM   6875  C CE3 . TRP B  1 364 ? 16.502  -51.383 8.833   1.00 24.66  ? 2383 TRP B CE3 1 
ATOM   6876  C CZ2 . TRP B  1 364 ? 15.239  -48.841 8.718   1.00 24.46  ? 2383 TRP B CZ2 1 
ATOM   6877  C CZ3 . TRP B  1 364 ? 17.223  -50.226 8.563   1.00 24.21  ? 2383 TRP B CZ3 1 
ATOM   6878  C CH2 . TRP B  1 364 ? 16.590  -48.971 8.508   1.00 26.46  ? 2383 TRP B CH2 1 
ATOM   6879  N N   . LYS B  1 365 ? 14.133  -53.953 12.649  1.00 20.13  ? 2384 LYS B N   1 
ATOM   6880  C CA  . LYS B  1 365 ? 13.832  -53.410 13.971  1.00 21.62  ? 2384 LYS B CA  1 
ATOM   6881  C C   . LYS B  1 365 ? 15.006  -53.595 14.928  1.00 22.02  ? 2384 LYS B C   1 
ATOM   6882  O O   . LYS B  1 365 ? 15.131  -52.871 15.917  1.00 24.15  ? 2384 LYS B O   1 
ATOM   6883  C CB  . LYS B  1 365 ? 12.586  -54.084 14.561  1.00 22.66  ? 2384 LYS B CB  1 
ATOM   6884  C CG  . LYS B  1 365 ? 11.272  -53.664 13.909  1.00 23.71  ? 2384 LYS B CG  1 
ATOM   6885  C CD  . LYS B  1 365 ? 11.040  -52.170 14.075  1.00 28.75  ? 2384 LYS B CD  1 
ATOM   6886  C CE  . LYS B  1 365 ? 9.725   -51.719 13.447  1.00 29.81  ? 2384 LYS B CE  1 
ATOM   6887  N NZ  . LYS B  1 365 ? 9.557   -50.237 13.572  1.00 30.56  ? 2384 LYS B NZ  1 
ATOM   6888  N N   . SER B  1 366 ? 15.863  -54.568 14.631  1.00 21.61  ? 2385 SER B N   1 
ATOM   6889  C CA  . SER B  1 366 ? 17.023  -54.850 15.467  1.00 20.46  ? 2385 SER B CA  1 
ATOM   6890  C C   . SER B  1 366 ? 18.223  -53.975 15.100  1.00 20.98  ? 2385 SER B C   1 
ATOM   6891  O O   . SER B  1 366 ? 19.319  -54.173 15.621  1.00 20.74  ? 2385 SER B O   1 
ATOM   6892  C CB  . SER B  1 366 ? 17.421  -56.323 15.333  1.00 19.79  ? 2385 SER B CB  1 
ATOM   6893  O OG  . SER B  1 366 ? 16.347  -57.195 15.662  1.00 18.93  ? 2385 SER B OG  1 
ATOM   6894  N N   . TYR B  1 367 ? 18.016  -53.008 14.211  1.00 21.30  ? 2386 TYR B N   1 
ATOM   6895  C CA  . TYR B  1 367 ? 19.104  -52.135 13.772  1.00 23.40  ? 2386 TYR B CA  1 
ATOM   6896  C C   . TYR B  1 367 ? 20.038  -51.685 14.890  1.00 24.39  ? 2386 TYR B C   1 
ATOM   6897  O O   . TYR B  1 367 ? 21.256  -51.769 14.756  1.00 24.50  ? 2386 TYR B O   1 
ATOM   6898  C CB  . TYR B  1 367 ? 18.565  -50.892 13.069  1.00 24.41  ? 2386 TYR B CB  1 
ATOM   6899  C CG  . TYR B  1 367 ? 19.651  -50.077 12.405  1.00 27.07  ? 2386 TYR B CG  1 
ATOM   6900  C CD1 . TYR B  1 367 ? 20.103  -50.395 11.125  1.00 28.49  ? 2386 TYR B CD1 1 
ATOM   6901  C CD2 . TYR B  1 367 ? 20.245  -49.003 13.067  1.00 29.70  ? 2386 TYR B CD2 1 
ATOM   6902  C CE1 . TYR B  1 367 ? 21.119  -49.662 10.516  1.00 29.83  ? 2386 TYR B CE1 1 
ATOM   6903  C CE2 . TYR B  1 367 ? 21.264  -48.264 12.471  1.00 28.93  ? 2386 TYR B CE2 1 
ATOM   6904  C CZ  . TYR B  1 367 ? 21.695  -48.599 11.196  1.00 31.00  ? 2386 TYR B CZ  1 
ATOM   6905  O OH  . TYR B  1 367 ? 22.702  -47.873 10.602  1.00 31.99  ? 2386 TYR B OH  1 
ATOM   6906  N N   . PRO B  1 368 ? 19.485  -51.186 16.007  1.00 25.60  ? 2387 PRO B N   1 
ATOM   6907  C CA  . PRO B  1 368 ? 20.382  -50.751 17.080  1.00 25.96  ? 2387 PRO B CA  1 
ATOM   6908  C C   . PRO B  1 368 ? 21.334  -51.838 17.573  1.00 25.32  ? 2387 PRO B C   1 
ATOM   6909  O O   . PRO B  1 368 ? 22.433  -51.541 18.035  1.00 26.49  ? 2387 PRO B O   1 
ATOM   6910  C CB  . PRO B  1 368 ? 19.415  -50.260 18.162  1.00 26.48  ? 2387 PRO B CB  1 
ATOM   6911  C CG  . PRO B  1 368 ? 18.168  -51.045 17.902  1.00 26.39  ? 2387 PRO B CG  1 
ATOM   6912  C CD  . PRO B  1 368 ? 18.076  -51.009 16.395  1.00 25.33  ? 2387 PRO B CD  1 
ATOM   6913  N N   . LEU B  1 369 ? 20.918  -53.095 17.456  1.00 24.84  ? 2388 LEU B N   1 
ATOM   6914  C CA  . LEU B  1 369 ? 21.737  -54.222 17.897  1.00 24.35  ? 2388 LEU B CA  1 
ATOM   6915  C C   . LEU B  1 369 ? 22.733  -54.718 16.847  1.00 23.85  ? 2388 LEU B C   1 
ATOM   6916  O O   . LEU B  1 369 ? 23.847  -55.101 17.184  1.00 21.89  ? 2388 LEU B O   1 
ATOM   6917  C CB  . LEU B  1 369 ? 20.854  -55.410 18.291  1.00 23.61  ? 2388 LEU B CB  1 
ATOM   6918  C CG  . LEU B  1 369 ? 19.848  -55.314 19.443  1.00 26.43  ? 2388 LEU B CG  1 
ATOM   6919  C CD1 . LEU B  1 369 ? 19.043  -56.610 19.502  1.00 24.38  ? 2388 LEU B CD1 1 
ATOM   6920  C CD2 . LEU B  1 369 ? 20.569  -55.071 20.760  1.00 24.46  ? 2388 LEU B CD2 1 
ATOM   6921  N N   . VAL B  1 370 ? 22.327  -54.715 15.581  1.00 24.98  ? 2389 VAL B N   1 
ATOM   6922  C CA  . VAL B  1 370 ? 23.183  -55.232 14.516  1.00 25.53  ? 2389 VAL B CA  1 
ATOM   6923  C C   . VAL B  1 370 ? 23.633  -54.237 13.450  1.00 27.21  ? 2389 VAL B C   1 
ATOM   6924  O O   . VAL B  1 370 ? 24.586  -54.498 12.715  1.00 26.95  ? 2389 VAL B O   1 
ATOM   6925  C CB  . VAL B  1 370 ? 22.494  -56.440 13.829  1.00 24.02  ? 2389 VAL B CB  1 
ATOM   6926  C CG1 . VAL B  1 370 ? 22.351  -57.583 14.829  1.00 21.79  ? 2389 VAL B CG1 1 
ATOM   6927  C CG2 . VAL B  1 370 ? 21.121  -56.039 13.309  1.00 20.72  ? 2389 VAL B CG2 1 
ATOM   6928  N N   A CYS B  1 371 ? 22.943  -53.105 13.362  0.50 28.00  ? 2390 CYS B N   1 
ATOM   6929  N N   B CYS B  1 371 ? 22.806  -52.922 13.318  0.50 44.61  ? 2390 CYS B N   1 
ATOM   6930  C CA  A CYS B  1 371 ? 23.288  -52.060 12.402  0.50 28.94  ? 2390 CYS B CA  1 
ATOM   6931  C CA  B CYS B  1 371 ? 23.386  -52.015 12.363  0.50 44.69  ? 2390 CYS B CA  1 
ATOM   6932  C C   A CYS B  1 371 ? 23.430  -52.549 10.963  0.50 28.39  ? 2390 CYS B C   1 
ATOM   6933  C C   B CYS B  1 371 ? 23.384  -52.595 10.957  0.50 43.90  ? 2390 CYS B C   1 
ATOM   6934  O O   A CYS B  1 371 ? 24.452  -52.303 10.320  0.50 28.06  ? 2390 CYS B O   1 
ATOM   6935  O O   B CYS B  1 371 ? 24.255  -52.248 10.139  0.50 42.36  ? 2390 CYS B O   1 
ATOM   6936  C CB  A CYS B  1 371 ? 24.592  -51.377 12.828  0.50 30.27  ? 2390 CYS B CB  1 
ATOM   6937  C CB  B CYS B  1 371 ? 24.816  -51.613 12.778  0.50 45.12  ? 2390 CYS B CB  1 
ATOM   6938  S SG  A CYS B  1 371 ? 25.000  -49.876 11.899  0.50 35.64  ? 2390 CYS B SG  1 
ATOM   6939  S SG  B CYS B  1 371 ? 24.874  -50.826 14.391  0.50 52.03  ? 2390 CYS B SG  1 
ATOM   6940  N N   . ILE B  1 372 ? 22.408  -53.231 10.455  1.00 26.96  ? 2391 ILE B N   1 
ATOM   6941  C CA  . ILE B  1 372 ? 22.432  -53.732 9.088   1.00 26.21  ? 2391 ILE B CA  1 
ATOM   6942  C C   . ILE B  1 372 ? 21.507  -52.869 8.231   1.00 26.97  ? 2391 ILE B C   1 
ATOM   6943  O O   . ILE B  1 372 ? 20.284  -52.907 8.394   1.00 25.94  ? 2391 ILE B O   1 
ATOM   6944  C CB  . ILE B  1 372 ? 21.963  -55.201 9.032   1.00 25.18  ? 2391 ILE B CB  1 
ATOM   6945  C CG1 . ILE B  1 372 ? 22.835  -56.051 9.959   1.00 25.16  ? 2391 ILE B CG1 1 
ATOM   6946  C CG2 . ILE B  1 372 ? 22.032  -55.724 7.599   1.00 25.21  ? 2391 ILE B CG2 1 
ATOM   6947  C CD1 . ILE B  1 372 ? 22.351  -57.471 10.151  1.00 22.94  ? 2391 ILE B CD1 1 
ATOM   6948  N N   . ALA B  1 373 ? 22.099  -52.081 7.334   1.00 26.62  ? 2392 ALA B N   1 
ATOM   6949  C CA  . ALA B  1 373 ? 21.328  -51.201 6.454   1.00 28.29  ? 2392 ALA B CA  1 
ATOM   6950  C C   . ALA B  1 373 ? 20.158  -51.975 5.861   1.00 28.35  ? 2392 ALA B C   1 
ATOM   6951  O O   . ALA B  1 373 ? 20.269  -53.170 5.599   1.00 27.17  ? 2392 ALA B O   1 
ATOM   6952  C CB  . ALA B  1 373 ? 22.220  -50.651 5.344   1.00 28.28  ? 2392 ALA B CB  1 
ATOM   6953  N N   . LYS B  1 374 ? 19.036  -51.295 5.655   1.00 29.28  ? 2393 LYS B N   1 
ATOM   6954  C CA  . LYS B  1 374 ? 17.850  -51.958 5.127   1.00 32.17  ? 2393 LYS B CA  1 
ATOM   6955  C C   . LYS B  1 374 ? 18.074  -52.618 3.771   1.00 31.63  ? 2393 LYS B C   1 
ATOM   6956  O O   . LYS B  1 374 ? 17.467  -53.643 3.469   1.00 29.27  ? 2393 LYS B O   1 
ATOM   6957  C CB  . LYS B  1 374 ? 16.681  -50.974 5.035   1.00 34.14  ? 2393 LYS B CB  1 
ATOM   6958  C CG  . LYS B  1 374 ? 15.360  -51.665 4.729   1.00 37.79  ? 2393 LYS B CG  1 
ATOM   6959  C CD  . LYS B  1 374 ? 14.162  -50.884 5.240   1.00 41.24  ? 2393 LYS B CD  1 
ATOM   6960  C CE  . LYS B  1 374 ? 12.910  -51.755 5.199   1.00 43.92  ? 2393 LYS B CE  1 
ATOM   6961  N NZ  . LYS B  1 374 ? 11.717  -51.062 5.757   1.00 46.79  ? 2393 LYS B NZ  1 
ATOM   6962  N N   . GLU B  1 375 ? 18.948  -52.031 2.962   1.00 32.23  ? 2394 GLU B N   1 
ATOM   6963  C CA  . GLU B  1 375 ? 19.248  -52.566 1.635   1.00 34.60  ? 2394 GLU B CA  1 
ATOM   6964  C C   . GLU B  1 375 ? 20.024  -53.884 1.716   1.00 33.33  ? 2394 GLU B C   1 
ATOM   6965  O O   . GLU B  1 375 ? 20.057  -54.652 0.754   1.00 32.38  ? 2394 GLU B O   1 
ATOM   6966  C CB  . GLU B  1 375 ? 20.068  -51.545 0.843   1.00 37.96  ? 2394 GLU B CB  1 
ATOM   6967  C CG  . GLU B  1 375 ? 21.300  -51.066 1.603   1.00 45.13  ? 2394 GLU B CG  1 
ATOM   6968  C CD  . GLU B  1 375 ? 22.160  -50.108 0.808   1.00 49.18  ? 2394 GLU B CD  1 
ATOM   6969  O OE1 . GLU B  1 375 ? 23.181  -49.639 1.360   1.00 51.99  ? 2394 GLU B OE1 1 
ATOM   6970  O OE2 . GLU B  1 375 ? 21.822  -49.825 -0.364  1.00 51.17  ? 2394 GLU B OE2 1 
ATOM   6971  N N   . LEU B  1 376 ? 20.639  -54.139 2.868   1.00 31.15  ? 2395 LEU B N   1 
ATOM   6972  C CA  . LEU B  1 376 ? 21.432  -55.348 3.069   1.00 30.61  ? 2395 LEU B CA  1 
ATOM   6973  C C   . LEU B  1 376 ? 20.704  -56.461 3.819   1.00 30.20  ? 2395 LEU B C   1 
ATOM   6974  O O   . LEU B  1 376 ? 21.210  -57.577 3.918   1.00 29.49  ? 2395 LEU B O   1 
ATOM   6975  C CB  . LEU B  1 376 ? 22.725  -55.005 3.816   1.00 31.17  ? 2395 LEU B CB  1 
ATOM   6976  C CG  . LEU B  1 376 ? 23.619  -53.936 3.180   1.00 32.62  ? 2395 LEU B CG  1 
ATOM   6977  C CD1 . LEU B  1 376 ? 24.851  -53.714 4.045   1.00 32.32  ? 2395 LEU B CD1 1 
ATOM   6978  C CD2 . LEU B  1 376 ? 24.022  -54.374 1.779   1.00 32.73  ? 2395 LEU B CD2 1 
ATOM   6979  N N   . ILE B  1 377 ? 19.520  -56.159 4.347   1.00 29.75  ? 2396 ILE B N   1 
ATOM   6980  C CA  . ILE B  1 377 ? 18.744  -57.149 5.091   1.00 29.51  ? 2396 ILE B CA  1 
ATOM   6981  C C   . ILE B  1 377 ? 18.471  -58.431 4.295   1.00 27.97  ? 2396 ILE B C   1 
ATOM   6982  O O   . ILE B  1 377 ? 18.703  -59.533 4.786   1.00 27.59  ? 2396 ILE B O   1 
ATOM   6983  C CB  . ILE B  1 377 ? 17.391  -56.557 5.568   1.00 30.22  ? 2396 ILE B CB  1 
ATOM   6984  C CG1 . ILE B  1 377 ? 17.636  -55.314 6.426   1.00 31.84  ? 2396 ILE B CG1 1 
ATOM   6985  C CG2 . ILE B  1 377 ? 16.618  -57.597 6.361   1.00 29.85  ? 2396 ILE B CG2 1 
ATOM   6986  C CD1 . ILE B  1 377 ? 18.456  -55.571 7.670   1.00 32.57  ? 2396 ILE B CD1 1 
ATOM   6987  N N   . PRO B  1 378 ? 17.976  -58.305 3.053   1.00 28.12  ? 2397 PRO B N   1 
ATOM   6988  C CA  . PRO B  1 378 ? 17.699  -59.508 2.258   1.00 28.09  ? 2397 PRO B CA  1 
ATOM   6989  C C   . PRO B  1 378 ? 18.881  -60.483 2.171   1.00 27.98  ? 2397 PRO B C   1 
ATOM   6990  O O   . PRO B  1 378 ? 18.735  -61.675 2.464   1.00 26.55  ? 2397 PRO B O   1 
ATOM   6991  C CB  . PRO B  1 378 ? 17.304  -58.931 0.900   1.00 29.35  ? 2397 PRO B CB  1 
ATOM   6992  C CG  . PRO B  1 378 ? 16.625  -57.646 1.280   1.00 28.98  ? 2397 PRO B CG  1 
ATOM   6993  C CD  . PRO B  1 378 ? 17.573  -57.090 2.323   1.00 27.80  ? 2397 PRO B CD  1 
ATOM   6994  N N   . GLU B  1 379 ? 20.048  -59.976 1.784   1.00 28.21  ? 2398 GLU B N   1 
ATOM   6995  C CA  . GLU B  1 379 ? 21.244  -60.814 1.662   1.00 30.95  ? 2398 GLU B CA  1 
ATOM   6996  C C   . GLU B  1 379 ? 21.555  -61.515 2.977   1.00 29.39  ? 2398 GLU B C   1 
ATOM   6997  O O   . GLU B  1 379 ? 21.713  -62.735 3.027   1.00 30.08  ? 2398 GLU B O   1 
ATOM   6998  C CB  . GLU B  1 379 ? 22.454  -59.970 1.266   1.00 34.70  ? 2398 GLU B CB  1 
ATOM   6999  C CG  . GLU B  1 379 ? 22.204  -59.023 0.117   1.00 43.21  ? 2398 GLU B CG  1 
ATOM   7000  C CD  . GLU B  1 379 ? 23.400  -58.138 -0.169  1.00 46.75  ? 2398 GLU B CD  1 
ATOM   7001  O OE1 . GLU B  1 379 ? 23.219  -57.088 -0.823  1.00 48.05  ? 2398 GLU B OE1 1 
ATOM   7002  O OE2 . GLU B  1 379 ? 24.521  -58.499 0.254   1.00 49.65  ? 2398 GLU B OE2 1 
ATOM   7003  N N   . ALA B  1 380 ? 21.654  -60.728 4.042   1.00 29.22  ? 2399 ALA B N   1 
ATOM   7004  C CA  . ALA B  1 380 ? 21.949  -61.264 5.363   1.00 26.57  ? 2399 ALA B CA  1 
ATOM   7005  C C   . ALA B  1 380 ? 20.972  -62.374 5.735   1.00 26.20  ? 2399 ALA B C   1 
ATOM   7006  O O   . ALA B  1 380 ? 21.369  -63.440 6.201   1.00 24.49  ? 2399 ALA B O   1 
ATOM   7007  C CB  . ALA B  1 380 ? 21.893  -60.146 6.391   1.00 28.15  ? 2399 ALA B CB  1 
ATOM   7008  N N   . THR B  1 381 ? 19.687  -62.126 5.515   1.00 27.78  ? 2400 THR B N   1 
ATOM   7009  C CA  . THR B  1 381 ? 18.660  -63.104 5.850   1.00 28.59  ? 2400 THR B CA  1 
ATOM   7010  C C   . THR B  1 381 ? 18.713  -64.371 4.993   1.00 28.79  ? 2400 THR B C   1 
ATOM   7011  O O   . THR B  1 381 ? 18.648  -65.486 5.516   1.00 29.35  ? 2400 THR B O   1 
ATOM   7012  C CB  . THR B  1 381 ? 17.256  -62.473 5.743   1.00 28.86  ? 2400 THR B CB  1 
ATOM   7013  O OG1 . THR B  1 381 ? 17.195  -61.314 6.584   1.00 30.00  ? 2400 THR B OG1 1 
ATOM   7014  C CG2 . THR B  1 381 ? 16.190  -63.457 6.190   1.00 30.08  ? 2400 THR B CG2 1 
ATOM   7015  N N   . GLU B  1 382 ? 18.832  -64.206 3.681   1.00 29.04  ? 2401 GLU B N   1 
ATOM   7016  C CA  . GLU B  1 382 ? 18.889  -65.358 2.784   1.00 30.87  ? 2401 GLU B CA  1 
ATOM   7017  C C   . GLU B  1 382 ? 20.125  -66.191 3.109   1.00 29.95  ? 2401 GLU B C   1 
ATOM   7018  O O   . GLU B  1 382 ? 20.080  -67.421 3.105   1.00 30.03  ? 2401 GLU B O   1 
ATOM   7019  C CB  . GLU B  1 382 ? 18.929  -64.888 1.324   1.00 34.73  ? 2401 GLU B CB  1 
ATOM   7020  C CG  . GLU B  1 382 ? 18.932  -66.008 0.278   1.00 39.61  ? 2401 GLU B CG  1 
ATOM   7021  C CD  . GLU B  1 382 ? 17.732  -66.941 0.397   1.00 43.67  ? 2401 GLU B CD  1 
ATOM   7022  O OE1 . GLU B  1 382 ? 16.650  -66.483 0.823   1.00 44.90  ? 2401 GLU B OE1 1 
ATOM   7023  O OE2 . GLU B  1 382 ? 17.867  -68.134 0.049   1.00 46.80  ? 2401 GLU B OE2 1 
ATOM   7024  N N   . LYS B  1 383 ? 21.222  -65.507 3.411   1.00 28.88  ? 2402 LYS B N   1 
ATOM   7025  C CA  . LYS B  1 383 ? 22.474  -66.172 3.747   1.00 29.64  ? 2402 LYS B CA  1 
ATOM   7026  C C   . LYS B  1 383 ? 22.330  -67.120 4.937   1.00 29.30  ? 2402 LYS B C   1 
ATOM   7027  O O   . LYS B  1 383 ? 22.835  -68.242 4.909   1.00 28.71  ? 2402 LYS B O   1 
ATOM   7028  C CB  . LYS B  1 383 ? 23.551  -65.130 4.056   1.00 31.15  ? 2402 LYS B CB  1 
ATOM   7029  C CG  . LYS B  1 383 ? 24.890  -65.726 4.470   1.00 33.01  ? 2402 LYS B CG  1 
ATOM   7030  C CD  . LYS B  1 383 ? 25.585  -66.441 3.313   1.00 35.41  ? 2402 LYS B CD  1 
ATOM   7031  C CE  . LYS B  1 383 ? 26.917  -67.047 3.799   1.00 38.06  ? 2402 LYS B CE  1 
ATOM   7032  N NZ  . LYS B  1 383 ? 27.657  -67.693 2.671   1.00 39.43  ? 2402 LYS B NZ  1 
ATOM   7033  N N   . TYR B  1 384 ? 21.639  -66.675 5.985   1.00 28.97  ? 2403 TYR B N   1 
ATOM   7034  C CA  . TYR B  1 384 ? 21.465  -67.514 7.169   1.00 27.67  ? 2403 TYR B CA  1 
ATOM   7035  C C   . TYR B  1 384 ? 20.263  -68.454 7.139   1.00 29.20  ? 2403 TYR B C   1 
ATOM   7036  O O   . TYR B  1 384 ? 20.362  -69.596 7.591   1.00 28.45  ? 2403 TYR B O   1 
ATOM   7037  C CB  . TYR B  1 384 ? 21.386  -66.652 8.435   1.00 25.67  ? 2403 TYR B CB  1 
ATOM   7038  C CG  . TYR B  1 384 ? 22.733  -66.284 9.020   1.00 22.40  ? 2403 TYR B CG  1 
ATOM   7039  C CD1 . TYR B  1 384 ? 23.552  -65.342 8.403   1.00 20.80  ? 2403 TYR B CD1 1 
ATOM   7040  C CD2 . TYR B  1 384 ? 23.206  -66.911 10.174  1.00 22.33  ? 2403 TYR B CD2 1 
ATOM   7041  C CE1 . TYR B  1 384 ? 24.815  -65.031 8.919   1.00 20.45  ? 2403 TYR B CE1 1 
ATOM   7042  C CE2 . TYR B  1 384 ? 24.465  -66.611 10.697  1.00 19.89  ? 2403 TYR B CE2 1 
ATOM   7043  C CZ  . TYR B  1 384 ? 25.263  -65.672 10.065  1.00 20.00  ? 2403 TYR B CZ  1 
ATOM   7044  O OH  . TYR B  1 384 ? 26.512  -65.379 10.575  1.00 20.35  ? 2403 TYR B OH  1 
ATOM   7045  N N   . LEU B  1 385 ? 19.138  -67.984 6.608   1.00 30.24  ? 2404 LEU B N   1 
ATOM   7046  C CA  . LEU B  1 385 ? 17.920  -68.793 6.575   1.00 33.32  ? 2404 LEU B CA  1 
ATOM   7047  C C   . LEU B  1 385 ? 17.576  -69.449 5.239   1.00 35.22  ? 2404 LEU B C   1 
ATOM   7048  O O   . LEU B  1 385 ? 16.789  -70.394 5.198   1.00 35.47  ? 2404 LEU B O   1 
ATOM   7049  C CB  . LEU B  1 385 ? 16.717  -67.948 7.007   1.00 33.07  ? 2404 LEU B CB  1 
ATOM   7050  C CG  . LEU B  1 385 ? 16.799  -67.084 8.265   1.00 33.62  ? 2404 LEU B CG  1 
ATOM   7051  C CD1 . LEU B  1 385 ? 15.385  -66.712 8.681   1.00 32.89  ? 2404 LEU B CD1 1 
ATOM   7052  C CD2 . LEU B  1 385 ? 17.495  -67.827 9.386   1.00 34.85  ? 2404 LEU B CD2 1 
ATOM   7053  N N   . GLY B  1 386 ? 18.159  -68.952 4.155   1.00 37.20  ? 2405 GLY B N   1 
ATOM   7054  C CA  . GLY B  1 386 ? 17.856  -69.487 2.840   1.00 40.57  ? 2405 GLY B CA  1 
ATOM   7055  C C   . GLY B  1 386 ? 18.210  -70.931 2.532   1.00 43.36  ? 2405 GLY B C   1 
ATOM   7056  O O   . GLY B  1 386 ? 17.861  -71.426 1.462   1.00 44.26  ? 2405 GLY B O   1 
ATOM   7057  N N   . GLY B  1 387 ? 18.883  -71.615 3.450   1.00 45.55  ? 2406 GLY B N   1 
ATOM   7058  C CA  . GLY B  1 387 ? 19.269  -72.994 3.195   1.00 48.61  ? 2406 GLY B CA  1 
ATOM   7059  C C   . GLY B  1 387 ? 18.335  -74.076 3.710   1.00 50.93  ? 2406 GLY B C   1 
ATOM   7060  O O   . GLY B  1 387 ? 18.720  -75.243 3.790   1.00 52.08  ? 2406 GLY B O   1 
ATOM   7061  N N   . THR B  1 388 ? 17.109  -73.703 4.056   1.00 52.29  ? 2407 THR B N   1 
ATOM   7062  C CA  . THR B  1 388 ? 16.138  -74.665 4.566   1.00 54.36  ? 2407 THR B CA  1 
ATOM   7063  C C   . THR B  1 388 ? 14.778  -73.996 4.704   1.00 56.07  ? 2407 THR B C   1 
ATOM   7064  O O   . THR B  1 388 ? 14.699  -72.816 5.040   1.00 56.00  ? 2407 THR B O   1 
ATOM   7065  C CB  . THR B  1 388 ? 16.567  -75.202 5.948   1.00 54.24  ? 2407 THR B CB  1 
ATOM   7066  O OG1 . THR B  1 388 ? 15.527  -76.025 6.490   1.00 54.09  ? 2407 THR B OG1 1 
ATOM   7067  C CG2 . THR B  1 388 ? 16.845  -74.051 6.904   1.00 53.70  ? 2407 THR B CG2 1 
ATOM   7068  N N   . ASP B  1 389 ? 13.705  -74.737 4.444   1.00 57.87  ? 2408 ASP B N   1 
ATOM   7069  C CA  . ASP B  1 389 ? 12.379  -74.150 4.572   1.00 59.68  ? 2408 ASP B CA  1 
ATOM   7070  C C   . ASP B  1 389 ? 11.740  -74.549 5.894   1.00 59.69  ? 2408 ASP B C   1 
ATOM   7071  O O   . ASP B  1 389 ? 10.547  -74.334 6.108   1.00 60.55  ? 2408 ASP B O   1 
ATOM   7072  C CB  . ASP B  1 389 ? 11.475  -74.562 3.407   1.00 62.12  ? 2408 ASP B CB  1 
ATOM   7073  C CG  . ASP B  1 389 ? 10.333  -73.573 3.178   1.00 64.09  ? 2408 ASP B CG  1 
ATOM   7074  O OD1 . ASP B  1 389 ? 9.521   -73.359 4.105   1.00 63.80  ? 2408 ASP B OD1 1 
ATOM   7075  O OD2 . ASP B  1 389 ? 10.247  -73.002 2.069   1.00 65.74  ? 2408 ASP B OD2 1 
ATOM   7076  N N   . ASP B  1 390 ? 12.537  -75.132 6.784   1.00 59.43  ? 2409 ASP B N   1 
ATOM   7077  C CA  . ASP B  1 390 ? 12.030  -75.523 8.092   1.00 58.76  ? 2409 ASP B CA  1 
ATOM   7078  C C   . ASP B  1 390 ? 11.917  -74.250 8.923   1.00 58.23  ? 2409 ASP B C   1 
ATOM   7079  O O   . ASP B  1 390 ? 12.904  -73.786 9.496   1.00 58.86  ? 2409 ASP B O   1 
ATOM   7080  C CB  . ASP B  1 390 ? 12.988  -76.495 8.778   1.00 59.01  ? 2409 ASP B CB  1 
ATOM   7081  C CG  . ASP B  1 390 ? 12.400  -77.095 10.040  1.00 59.53  ? 2409 ASP B CG  1 
ATOM   7082  O OD1 . ASP B  1 390 ? 11.808  -76.343 10.842  1.00 59.51  ? 2409 ASP B OD1 1 
ATOM   7083  O OD2 . ASP B  1 390 ? 12.533  -78.322 10.233  1.00 61.50  ? 2409 ASP B OD2 1 
ATOM   7084  N N   . THR B  1 391 ? 10.715  -73.686 8.977   1.00 56.34  ? 2410 THR B N   1 
ATOM   7085  C CA  . THR B  1 391 ? 10.477  -72.458 9.724   1.00 54.80  ? 2410 THR B CA  1 
ATOM   7086  C C   . THR B  1 391 ? 11.033  -72.500 11.143  1.00 53.31  ? 2410 THR B C   1 
ATOM   7087  O O   . THR B  1 391 ? 11.373  -71.461 11.713  1.00 53.32  ? 2410 THR B O   1 
ATOM   7088  C CB  . THR B  1 391 ? 8.972   -72.132 9.786   1.00 55.15  ? 2410 THR B CB  1 
ATOM   7089  O OG1 . THR B  1 391 ? 8.241   -73.314 10.135  1.00 55.98  ? 2410 THR B OG1 1 
ATOM   7090  C CG2 . THR B  1 391 ? 8.487   -71.609 8.444   1.00 54.79  ? 2410 THR B CG2 1 
ATOM   7091  N N   . VAL B  1 392 ? 11.124  -73.694 11.717  1.00 51.22  ? 2411 VAL B N   1 
ATOM   7092  C CA  . VAL B  1 392 ? 11.652  -73.825 13.068  1.00 49.71  ? 2411 VAL B CA  1 
ATOM   7093  C C   . VAL B  1 392 ? 13.169  -73.666 13.030  1.00 47.75  ? 2411 VAL B C   1 
ATOM   7094  O O   . VAL B  1 392 ? 13.761  -73.049 13.915  1.00 46.55  ? 2411 VAL B O   1 
ATOM   7095  C CB  . VAL B  1 392 ? 11.291  -75.189 13.687  1.00 50.61  ? 2411 VAL B CB  1 
ATOM   7096  C CG1 . VAL B  1 392 ? 11.810  -75.266 15.117  1.00 50.75  ? 2411 VAL B CG1 1 
ATOM   7097  C CG2 . VAL B  1 392 ? 9.783   -75.382 13.666  1.00 51.42  ? 2411 VAL B CG2 1 
ATOM   7098  N N   . LYS B  1 393 ? 13.792  -74.218 11.993  1.00 45.62  ? 2412 LYS B N   1 
ATOM   7099  C CA  . LYS B  1 393 ? 15.235  -74.118 11.839  1.00 43.45  ? 2412 LYS B CA  1 
ATOM   7100  C C   . LYS B  1 393 ? 15.628  -72.699 11.434  1.00 41.05  ? 2412 LYS B C   1 
ATOM   7101  O O   . LYS B  1 393 ? 16.705  -72.224 11.792  1.00 39.71  ? 2412 LYS B O   1 
ATOM   7102  C CB  . LYS B  1 393 ? 15.730  -75.130 10.805  1.00 45.84  ? 2412 LYS B CB  1 
ATOM   7103  C CG  . LYS B  1 393 ? 15.589  -76.571 11.269  1.00 48.44  ? 2412 LYS B CG  1 
ATOM   7104  C CD  . LYS B  1 393 ? 16.138  -77.558 10.250  1.00 51.20  ? 2412 LYS B CD  1 
ATOM   7105  C CE  . LYS B  1 393 ? 15.968  -78.992 10.737  1.00 52.24  ? 2412 LYS B CE  1 
ATOM   7106  N NZ  . LYS B  1 393 ? 16.459  -79.989 9.745   1.00 54.65  ? 2412 LYS B NZ  1 
ATOM   7107  N N   . LYS B  1 394 ? 14.753  -72.025 10.691  1.00 38.01  ? 2413 LYS B N   1 
ATOM   7108  C CA  . LYS B  1 394 ? 15.013  -70.648 10.279  1.00 36.23  ? 2413 LYS B CA  1 
ATOM   7109  C C   . LYS B  1 394 ? 15.073  -69.772 11.525  1.00 35.34  ? 2413 LYS B C   1 
ATOM   7110  O O   . LYS B  1 394 ? 15.891  -68.859 11.624  1.00 34.62  ? 2413 LYS B O   1 
ATOM   7111  C CB  . LYS B  1 394 ? 13.904  -70.130 9.356   1.00 35.13  ? 2413 LYS B CB  1 
ATOM   7112  C CG  . LYS B  1 394 ? 13.959  -70.655 7.925   1.00 34.74  ? 2413 LYS B CG  1 
ATOM   7113  C CD  . LYS B  1 394 ? 12.934  -69.947 7.052   1.00 33.51  ? 2413 LYS B CD  1 
ATOM   7114  C CE  . LYS B  1 394 ? 12.868  -70.533 5.647   1.00 33.77  ? 2413 LYS B CE  1 
ATOM   7115  N NZ  . LYS B  1 394 ? 14.108  -70.300 4.854   1.00 34.12  ? 2413 LYS B NZ  1 
ATOM   7116  N N   . LYS B  1 395 ? 14.194  -70.059 12.476  1.00 34.14  ? 2414 LYS B N   1 
ATOM   7117  C CA  . LYS B  1 395 ? 14.144  -69.305 13.719  1.00 35.10  ? 2414 LYS B CA  1 
ATOM   7118  C C   . LYS B  1 395 ? 15.448  -69.420 14.514  1.00 33.78  ? 2414 LYS B C   1 
ATOM   7119  O O   . LYS B  1 395 ? 15.971  -68.418 15.002  1.00 32.40  ? 2414 LYS B O   1 
ATOM   7120  C CB  . LYS B  1 395 ? 12.939  -69.768 14.545  1.00 36.35  ? 2414 LYS B CB  1 
ATOM   7121  C CG  . LYS B  1 395 ? 13.078  -69.640 16.044  1.00 39.60  ? 2414 LYS B CG  1 
ATOM   7122  C CD  . LYS B  1 395 ? 13.513  -70.973 16.620  1.00 43.62  ? 2414 LYS B CD  1 
ATOM   7123  C CE  . LYS B  1 395 ? 13.262  -71.052 18.107  1.00 45.55  ? 2414 LYS B CE  1 
ATOM   7124  N NZ  . LYS B  1 395 ? 13.528  -72.429 18.609  1.00 46.70  ? 2414 LYS B NZ  1 
ATOM   7125  N N   . ASP B  1 396 ? 15.982  -70.631 14.636  1.00 33.79  ? 2415 ASP B N   1 
ATOM   7126  C CA  . ASP B  1 396 ? 17.235  -70.814 15.366  1.00 33.61  ? 2415 ASP B CA  1 
ATOM   7127  C C   . ASP B  1 396 ? 18.412  -70.198 14.611  1.00 30.47  ? 2415 ASP B C   1 
ATOM   7128  O O   . ASP B  1 396 ? 19.346  -69.682 15.221  1.00 29.05  ? 2415 ASP B O   1 
ATOM   7129  C CB  . ASP B  1 396 ? 17.504  -72.301 15.617  1.00 37.56  ? 2415 ASP B CB  1 
ATOM   7130  C CG  . ASP B  1 396 ? 16.580  -72.889 16.663  1.00 41.94  ? 2415 ASP B CG  1 
ATOM   7131  O OD1 . ASP B  1 396 ? 16.539  -72.352 17.793  1.00 45.01  ? 2415 ASP B OD1 1 
ATOM   7132  O OD2 . ASP B  1 396 ? 15.897  -73.889 16.359  1.00 45.86  ? 2415 ASP B OD2 1 
ATOM   7133  N N   . LEU B  1 397 ? 18.367  -70.254 13.284  1.00 27.70  ? 2416 LEU B N   1 
ATOM   7134  C CA  . LEU B  1 397 ? 19.437  -69.686 12.477  1.00 27.15  ? 2416 LEU B CA  1 
ATOM   7135  C C   . LEU B  1 397 ? 19.388  -68.162 12.552  1.00 25.42  ? 2416 LEU B C   1 
ATOM   7136  O O   . LEU B  1 397 ? 20.404  -67.487 12.376  1.00 23.25  ? 2416 LEU B O   1 
ATOM   7137  C CB  . LEU B  1 397 ? 19.313  -70.155 11.025  1.00 28.43  ? 2416 LEU B CB  1 
ATOM   7138  C CG  . LEU B  1 397 ? 19.587  -71.645 10.787  1.00 31.14  ? 2416 LEU B CG  1 
ATOM   7139  C CD1 . LEU B  1 397 ? 19.339  -71.994 9.325   1.00 31.05  ? 2416 LEU B CD1 1 
ATOM   7140  C CD2 . LEU B  1 397 ? 21.020  -71.968 11.177  1.00 30.31  ? 2416 LEU B CD2 1 
ATOM   7141  N N   . PHE B  1 398 ? 18.198  -67.628 12.821  1.00 24.54  ? 2417 PHE B N   1 
ATOM   7142  C CA  . PHE B  1 398 ? 18.010  -66.187 12.940  1.00 23.93  ? 2417 PHE B CA  1 
ATOM   7143  C C   . PHE B  1 398 ? 18.690  -65.717 14.223  1.00 23.84  ? 2417 PHE B C   1 
ATOM   7144  O O   . PHE B  1 398 ? 19.306  -64.652 14.262  1.00 22.97  ? 2417 PHE B O   1 
ATOM   7145  C CB  . PHE B  1 398 ? 16.517  -65.841 13.000  1.00 23.45  ? 2417 PHE B CB  1 
ATOM   7146  C CG  . PHE B  1 398 ? 16.245  -64.364 13.089  1.00 25.62  ? 2417 PHE B CG  1 
ATOM   7147  C CD1 . PHE B  1 398 ? 16.460  -63.533 11.988  1.00 26.13  ? 2417 PHE B CD1 1 
ATOM   7148  C CD2 . PHE B  1 398 ? 15.800  -63.796 14.281  1.00 25.59  ? 2417 PHE B CD2 1 
ATOM   7149  C CE1 . PHE B  1 398 ? 16.237  -62.156 12.074  1.00 27.31  ? 2417 PHE B CE1 1 
ATOM   7150  C CE2 . PHE B  1 398 ? 15.576  -62.423 14.379  1.00 25.97  ? 2417 PHE B CE2 1 
ATOM   7151  C CZ  . PHE B  1 398 ? 15.794  -61.600 13.274  1.00 25.88  ? 2417 PHE B CZ  1 
ATOM   7152  N N   . LEU B  1 399 ? 18.568  -66.517 15.278  1.00 24.33  ? 2418 LEU B N   1 
ATOM   7153  C CA  . LEU B  1 399 ? 19.186  -66.169 16.550  1.00 25.28  ? 2418 LEU B CA  1 
ATOM   7154  C C   . LEU B  1 399 ? 20.704  -66.262 16.414  1.00 25.68  ? 2418 LEU B C   1 
ATOM   7155  O O   . LEU B  1 399 ? 21.438  -65.522 17.074  1.00 25.07  ? 2418 LEU B O   1 
ATOM   7156  C CB  . LEU B  1 399 ? 18.695  -67.105 17.661  1.00 25.95  ? 2418 LEU B CB  1 
ATOM   7157  C CG  . LEU B  1 399 ? 17.188  -67.128 17.948  1.00 26.85  ? 2418 LEU B CG  1 
ATOM   7158  C CD1 . LEU B  1 399 ? 16.901  -68.101 19.088  1.00 27.02  ? 2418 LEU B CD1 1 
ATOM   7159  C CD2 . LEU B  1 399 ? 16.703  -65.732 18.309  1.00 26.14  ? 2418 LEU B CD2 1 
ATOM   7160  N N   . ASP B  1 400 ? 21.173  -67.173 15.560  1.00 26.62  ? 2419 ASP B N   1 
ATOM   7161  C CA  . ASP B  1 400 ? 22.615  -67.330 15.334  1.00 25.99  ? 2419 ASP B CA  1 
ATOM   7162  C C   . ASP B  1 400 ? 23.146  -66.092 14.630  1.00 23.60  ? 2419 ASP B C   1 
ATOM   7163  O O   . ASP B  1 400 ? 24.247  -65.617 14.921  1.00 23.09  ? 2419 ASP B O   1 
ATOM   7164  C CB  . ASP B  1 400 ? 22.919  -68.544 14.456  1.00 28.01  ? 2419 ASP B CB  1 
ATOM   7165  C CG  . ASP B  1 400 ? 22.735  -69.860 15.183  1.00 31.32  ? 2419 ASP B CG  1 
ATOM   7166  O OD1 . ASP B  1 400 ? 22.695  -69.861 16.432  1.00 33.97  ? 2419 ASP B OD1 1 
ATOM   7167  O OD2 . ASP B  1 400 ? 22.648  -70.899 14.496  1.00 33.50  ? 2419 ASP B OD2 1 
ATOM   7168  N N   . LEU B  1 401 ? 22.354  -65.592 13.687  1.00 22.59  ? 2420 LEU B N   1 
ATOM   7169  C CA  . LEU B  1 401 ? 22.707  -64.407 12.919  1.00 21.75  ? 2420 LEU B CA  1 
ATOM   7170  C C   . LEU B  1 401 ? 22.924  -63.210 13.843  1.00 21.46  ? 2420 LEU B C   1 
ATOM   7171  O O   . LEU B  1 401 ? 23.945  -62.531 13.744  1.00 20.91  ? 2420 LEU B O   1 
ATOM   7172  C CB  . LEU B  1 401 ? 21.619  -64.132 11.870  1.00 19.95  ? 2420 LEU B CB  1 
ATOM   7173  C CG  . LEU B  1 401 ? 21.210  -62.739 11.358  1.00 24.81  ? 2420 LEU B CG  1 
ATOM   7174  C CD1 . LEU B  1 401 ? 22.334  -61.730 11.370  1.00 23.05  ? 2420 LEU B CD1 1 
ATOM   7175  C CD2 . LEU B  1 401 ? 20.663  -62.922 9.961   1.00 22.94  ? 2420 LEU B CD2 1 
ATOM   7176  N N   . ILE B  1 402 ? 21.981  -62.954 14.746  1.00 20.54  ? 2421 ILE B N   1 
ATOM   7177  C CA  . ILE B  1 402 ? 22.134  -61.838 15.677  1.00 20.80  ? 2421 ILE B CA  1 
ATOM   7178  C C   . ILE B  1 402 ? 23.371  -62.058 16.556  1.00 19.25  ? 2421 ILE B C   1 
ATOM   7179  O O   . ILE B  1 402 ? 24.153  -61.140 16.784  1.00 20.63  ? 2421 ILE B O   1 
ATOM   7180  C CB  . ILE B  1 402 ? 20.899  -61.688 16.602  1.00 22.09  ? 2421 ILE B CB  1 
ATOM   7181  C CG1 . ILE B  1 402 ? 19.646  -61.385 15.777  1.00 22.10  ? 2421 ILE B CG1 1 
ATOM   7182  C CG2 . ILE B  1 402 ? 21.152  -60.594 17.628  1.00 21.66  ? 2421 ILE B CG2 1 
ATOM   7183  C CD1 . ILE B  1 402 ? 19.698  -60.085 15.021  1.00 25.35  ? 2421 ILE B CD1 1 
ATOM   7184  N N   . ALA B  1 403 ? 23.539  -63.283 17.045  1.00 18.87  ? 2422 ALA B N   1 
ATOM   7185  C CA  . ALA B  1 403 ? 24.668  -63.628 17.902  1.00 18.18  ? 2422 ALA B CA  1 
ATOM   7186  C C   . ALA B  1 403 ? 26.017  -63.431 17.209  1.00 19.33  ? 2422 ALA B C   1 
ATOM   7187  O O   . ALA B  1 403 ? 26.976  -62.960 17.826  1.00 17.59  ? 2422 ALA B O   1 
ATOM   7188  C CB  . ALA B  1 403 ? 24.539  -65.071 18.377  1.00 17.81  ? 2422 ALA B CB  1 
ATOM   7189  N N   . ASP B  1 404 ? 26.090  -63.800 15.932  1.00 18.55  ? 2423 ASP B N   1 
ATOM   7190  C CA  . ASP B  1 404 ? 27.330  -63.654 15.175  1.00 18.47  ? 2423 ASP B CA  1 
ATOM   7191  C C   . ASP B  1 404 ? 27.712  -62.194 14.977  1.00 17.32  ? 2423 ASP B C   1 
ATOM   7192  O O   . ASP B  1 404 ? 28.883  -61.834 15.091  1.00 16.35  ? 2423 ASP B O   1 
ATOM   7193  C CB  . ASP B  1 404 ? 27.213  -64.330 13.804  1.00 17.88  ? 2423 ASP B CB  1 
ATOM   7194  C CG  . ASP B  1 404 ? 27.241  -65.846 13.897  1.00 21.10  ? 2423 ASP B CG  1 
ATOM   7195  O OD1 . ASP B  1 404 ? 27.646  -66.378 14.959  1.00 18.95  ? 2423 ASP B OD1 1 
ATOM   7196  O OD2 . ASP B  1 404 ? 26.866  -66.504 12.903  1.00 21.78  ? 2423 ASP B OD2 1 
ATOM   7197  N N   . VAL B  1 405 ? 26.721  -61.361 14.675  1.00 16.02  ? 2424 VAL B N   1 
ATOM   7198  C CA  . VAL B  1 405 ? 26.964  -59.939 14.455  1.00 15.57  ? 2424 VAL B CA  1 
ATOM   7199  C C   . VAL B  1 405 ? 27.344  -59.206 15.738  1.00 16.65  ? 2424 VAL B C   1 
ATOM   7200  O O   . VAL B  1 405 ? 28.237  -58.355 15.736  1.00 15.15  ? 2424 VAL B O   1 
ATOM   7201  C CB  . VAL B  1 405 ? 25.716  -59.258 13.849  1.00 18.02  ? 2424 VAL B CB  1 
ATOM   7202  C CG1 . VAL B  1 405 ? 25.936  -57.748 13.746  1.00 21.08  ? 2424 VAL B CG1 1 
ATOM   7203  C CG2 . VAL B  1 405 ? 25.426  -59.843 12.471  1.00 20.40  ? 2424 VAL B CG2 1 
ATOM   7204  N N   . MET B  1 406 ? 26.667  -59.539 16.833  1.00 15.93  ? 2425 MET B N   1 
ATOM   7205  C CA  . MET B  1 406 ? 26.928  -58.884 18.112  1.00 18.33  ? 2425 MET B CA  1 
ATOM   7206  C C   . MET B  1 406 ? 28.178  -59.333 18.852  1.00 17.87  ? 2425 MET B C   1 
ATOM   7207  O O   . MET B  1 406 ? 28.913  -58.497 19.385  1.00 16.32  ? 2425 MET B O   1 
ATOM   7208  C CB  . MET B  1 406 ? 25.733  -59.056 19.056  1.00 19.49  ? 2425 MET B CB  1 
ATOM   7209  C CG  . MET B  1 406 ? 24.448  -58.386 18.593  1.00 25.14  ? 2425 MET B CG  1 
ATOM   7210  S SD  . MET B  1 406 ? 23.126  -58.584 19.822  1.00 26.53  ? 2425 MET B SD  1 
ATOM   7211  C CE  . MET B  1 406 ? 23.612  -57.334 21.035  1.00 27.99  ? 2425 MET B CE  1 
ATOM   7212  N N   . PHE B  1 407 ? 28.414  -60.643 18.899  1.00 16.76  ? 2426 PHE B N   1 
ATOM   7213  C CA  . PHE B  1 407 ? 29.556  -61.172 19.634  1.00 18.32  ? 2426 PHE B CA  1 
ATOM   7214  C C   . PHE B  1 407 ? 30.575  -62.019 18.866  1.00 17.48  ? 2426 PHE B C   1 
ATOM   7215  O O   . PHE B  1 407 ? 31.778  -61.777 18.950  1.00 16.94  ? 2426 PHE B O   1 
ATOM   7216  C CB  . PHE B  1 407 ? 29.057  -61.996 20.826  1.00 19.15  ? 2426 PHE B CB  1 
ATOM   7217  C CG  . PHE B  1 407 ? 28.043  -61.281 21.676  1.00 20.15  ? 2426 PHE B CG  1 
ATOM   7218  C CD1 . PHE B  1 407 ? 26.682  -61.434 21.435  1.00 20.04  ? 2426 PHE B CD1 1 
ATOM   7219  C CD2 . PHE B  1 407 ? 28.452  -60.443 22.708  1.00 20.84  ? 2426 PHE B CD2 1 
ATOM   7220  C CE1 . PHE B  1 407 ? 25.732  -60.759 22.215  1.00 23.09  ? 2426 PHE B CE1 1 
ATOM   7221  C CE2 . PHE B  1 407 ? 27.516  -59.760 23.495  1.00 21.73  ? 2426 PHE B CE2 1 
ATOM   7222  C CZ  . PHE B  1 407 ? 26.153  -59.919 23.248  1.00 21.66  ? 2426 PHE B CZ  1 
ATOM   7223  N N   . GLY B  1 408 ? 30.088  -63.024 18.148  1.00 16.25  ? 2427 GLY B N   1 
ATOM   7224  C CA  . GLY B  1 408 ? 30.973  -63.919 17.418  1.00 17.15  ? 2427 GLY B CA  1 
ATOM   7225  C C   . GLY B  1 408 ? 31.997  -63.286 16.493  1.00 18.28  ? 2427 GLY B C   1 
ATOM   7226  O O   . GLY B  1 408 ? 33.204  -63.477 16.662  1.00 17.81  ? 2427 GLY B O   1 
ATOM   7227  N N   . VAL B  1 409 ? 31.521  -62.536 15.508  1.00 16.79  ? 2428 VAL B N   1 
ATOM   7228  C CA  . VAL B  1 409 ? 32.411  -61.908 14.553  1.00 18.42  ? 2428 VAL B CA  1 
ATOM   7229  C C   . VAL B  1 409 ? 33.281  -60.837 15.205  1.00 17.96  ? 2428 VAL B C   1 
ATOM   7230  O O   . VAL B  1 409 ? 34.498  -60.818 15.006  1.00 16.85  ? 2428 VAL B O   1 
ATOM   7231  C CB  . VAL B  1 409 ? 31.607  -61.327 13.370  1.00 19.33  ? 2428 VAL B CB  1 
ATOM   7232  C CG1 . VAL B  1 409 ? 32.506  -60.488 12.479  1.00 21.49  ? 2428 VAL B CG1 1 
ATOM   7233  C CG2 . VAL B  1 409 ? 30.997  -62.476 12.563  1.00 20.87  ? 2428 VAL B CG2 1 
ATOM   7234  N N   . PRO B  1 410 ? 32.679  -59.938 16.005  1.00 17.76  ? 2429 PRO B N   1 
ATOM   7235  C CA  . PRO B  1 410 ? 33.509  -58.909 16.640  1.00 17.34  ? 2429 PRO B CA  1 
ATOM   7236  C C   . PRO B  1 410 ? 34.617  -59.504 17.512  1.00 16.54  ? 2429 PRO B C   1 
ATOM   7237  O O   . PRO B  1 410 ? 35.718  -58.961 17.587  1.00 16.19  ? 2429 PRO B O   1 
ATOM   7238  C CB  . PRO B  1 410 ? 32.498  -58.111 17.461  1.00 19.46  ? 2429 PRO B CB  1 
ATOM   7239  C CG  . PRO B  1 410 ? 31.258  -58.197 16.634  1.00 18.28  ? 2429 PRO B CG  1 
ATOM   7240  C CD  . PRO B  1 410 ? 31.247  -59.665 16.228  1.00 16.24  ? 2429 PRO B CD  1 
ATOM   7241  N N   . SER B  1 411 ? 34.329  -60.625 18.167  1.00 15.84  ? 2430 SER B N   1 
ATOM   7242  C CA  . SER B  1 411 ? 35.315  -61.257 19.042  1.00 15.78  ? 2430 SER B CA  1 
ATOM   7243  C C   . SER B  1 411 ? 36.512  -61.821 18.280  1.00 14.93  ? 2430 SER B C   1 
ATOM   7244  O O   . SER B  1 411 ? 37.652  -61.646 18.699  1.00 15.10  ? 2430 SER B O   1 
ATOM   7245  C CB  . SER B  1 411 ? 34.658  -62.364 19.878  1.00 17.34  ? 2430 SER B CB  1 
ATOM   7246  O OG  . SER B  1 411 ? 33.857  -61.812 20.917  1.00 19.23  ? 2430 SER B OG  1 
ATOM   7247  N N   . VAL B  1 412 ? 36.250  -62.492 17.165  1.00 15.34  ? 2431 VAL B N   1 
ATOM   7248  C CA  . VAL B  1 412 ? 37.320  -63.066 16.360  1.00 17.98  ? 2431 VAL B CA  1 
ATOM   7249  C C   . VAL B  1 412 ? 38.169  -61.961 15.726  1.00 17.73  ? 2431 VAL B C   1 
ATOM   7250  O O   . VAL B  1 412 ? 39.388  -62.077 15.648  1.00 19.48  ? 2431 VAL B O   1 
ATOM   7251  C CB  . VAL B  1 412 ? 36.748  -63.985 15.257  1.00 17.32  ? 2431 VAL B CB  1 
ATOM   7252  C CG1 . VAL B  1 412 ? 37.863  -64.446 14.326  1.00 18.93  ? 2431 VAL B CG1 1 
ATOM   7253  C CG2 . VAL B  1 412 ? 36.068  -65.187 15.890  1.00 17.18  ? 2431 VAL B CG2 1 
ATOM   7254  N N   . ILE B  1 413 ? 37.525  -60.886 15.278  1.00 19.37  ? 2432 ILE B N   1 
ATOM   7255  C CA  . ILE B  1 413 ? 38.249  -59.772 14.668  1.00 17.49  ? 2432 ILE B CA  1 
ATOM   7256  C C   . ILE B  1 413 ? 39.191  -59.138 15.692  1.00 18.04  ? 2432 ILE B C   1 
ATOM   7257  O O   . ILE B  1 413 ? 40.346  -58.832 15.380  1.00 17.70  ? 2432 ILE B O   1 
ATOM   7258  C CB  . ILE B  1 413 ? 37.261  -58.720 14.095  1.00 18.73  ? 2432 ILE B CB  1 
ATOM   7259  C CG1 . ILE B  1 413 ? 36.534  -59.322 12.888  1.00 18.77  ? 2432 ILE B CG1 1 
ATOM   7260  C CG2 . ILE B  1 413 ? 38.000  -57.444 13.691  1.00 17.02  ? 2432 ILE B CG2 1 
ATOM   7261  C CD1 . ILE B  1 413 ? 35.501  -58.407 12.258  1.00 21.34  ? 2432 ILE B CD1 1 
ATOM   7262  N N   . VAL B  1 414 ? 38.708  -58.960 16.921  1.00 15.67  ? 2433 VAL B N   1 
ATOM   7263  C CA  . VAL B  1 414 ? 39.528  -58.394 17.989  1.00 13.07  ? 2433 VAL B CA  1 
ATOM   7264  C C   . VAL B  1 414 ? 40.706  -59.317 18.301  1.00 13.37  ? 2433 VAL B C   1 
ATOM   7265  O O   . VAL B  1 414 ? 41.850  -58.863 18.453  1.00 13.67  ? 2433 VAL B O   1 
ATOM   7266  C CB  . VAL B  1 414 ? 38.694  -58.180 19.295  1.00 13.11  ? 2433 VAL B CB  1 
ATOM   7267  C CG1 . VAL B  1 414 ? 39.613  -57.976 20.489  1.00 13.09  ? 2433 VAL B CG1 1 
ATOM   7268  C CG2 . VAL B  1 414 ? 37.788  -56.966 19.134  1.00 12.62  ? 2433 VAL B CG2 1 
ATOM   7269  N N   . ALA B  1 415 ? 40.432  -60.612 18.406  1.00 11.93  ? 2434 ALA B N   1 
ATOM   7270  C CA  . ALA B  1 415 ? 41.492  -61.573 18.706  1.00 13.74  ? 2434 ALA B CA  1 
ATOM   7271  C C   . ALA B  1 415 ? 42.555  -61.598 17.598  1.00 12.65  ? 2434 ALA B C   1 
ATOM   7272  O O   . ALA B  1 415 ? 43.751  -61.598 17.882  1.00 15.02  ? 2434 ALA B O   1 
ATOM   7273  C CB  . ALA B  1 415 ? 40.900  -62.961 18.906  1.00 13.50  ? 2434 ALA B CB  1 
ATOM   7274  N N   . ARG B  1 416 ? 42.119  -61.608 16.342  1.00 13.86  ? 2435 ARG B N   1 
ATOM   7275  C CA  . ARG B  1 416 ? 43.057  -61.622 15.219  1.00 16.29  ? 2435 ARG B CA  1 
ATOM   7276  C C   . ARG B  1 416 ? 43.984  -60.412 15.227  1.00 19.31  ? 2435 ARG B C   1 
ATOM   7277  O O   . ARG B  1 416 ? 45.190  -60.540 15.002  1.00 19.14  ? 2435 ARG B O   1 
ATOM   7278  C CB  . ARG B  1 416 ? 42.301  -61.677 13.896  1.00 14.35  ? 2435 ARG B CB  1 
ATOM   7279  C CG  . ARG B  1 416 ? 41.743  -63.051 13.569  1.00 16.47  ? 2435 ARG B CG  1 
ATOM   7280  C CD  . ARG B  1 416 ? 40.939  -63.005 12.286  1.00 16.78  ? 2435 ARG B CD  1 
ATOM   7281  N NE  . ARG B  1 416 ? 40.431  -64.323 11.927  1.00 18.42  ? 2435 ARG B NE  1 
ATOM   7282  C CZ  . ARG B  1 416 ? 39.674  -64.570 10.863  1.00 20.29  ? 2435 ARG B CZ  1 
ATOM   7283  N NH1 . ARG B  1 416 ? 39.332  -63.584 10.047  1.00 21.59  ? 2435 ARG B NH1 1 
ATOM   7284  N NH2 . ARG B  1 416 ? 39.254  -65.806 10.618  1.00 19.31  ? 2435 ARG B NH2 1 
ATOM   7285  N N   . ASN B  1 417 ? 43.420  -59.236 15.484  1.00 19.49  ? 2436 ASN B N   1 
ATOM   7286  C CA  . ASN B  1 417 ? 44.216  -58.019 15.524  1.00 20.97  ? 2436 ASN B CA  1 
ATOM   7287  C C   . ASN B  1 417 ? 45.176  -58.015 16.704  1.00 20.69  ? 2436 ASN B C   1 
ATOM   7288  O O   . ASN B  1 417 ? 46.280  -57.484 16.606  1.00 20.39  ? 2436 ASN B O   1 
ATOM   7289  C CB  . ASN B  1 417 ? 43.303  -56.794 15.577  1.00 23.57  ? 2436 ASN B CB  1 
ATOM   7290  C CG  . ASN B  1 417 ? 42.865  -56.341 14.198  1.00 27.26  ? 2436 ASN B CG  1 
ATOM   7291  O OD1 . ASN B  1 417 ? 43.556  -55.559 13.545  1.00 29.75  ? 2436 ASN B OD1 1 
ATOM   7292  N ND2 . ASN B  1 417 ? 41.725  -56.840 13.741  1.00 26.49  ? 2436 ASN B ND2 1 
ATOM   7293  N N   . HIS B  1 418 ? 44.764  -58.609 17.820  1.00 18.73  ? 2437 HIS B N   1 
ATOM   7294  C CA  . HIS B  1 418 ? 45.624  -58.663 19.000  1.00 17.40  ? 2437 HIS B CA  1 
ATOM   7295  C C   . HIS B  1 418 ? 46.785  -59.608 18.693  1.00 18.79  ? 2437 HIS B C   1 
ATOM   7296  O O   . HIS B  1 418 ? 47.945  -59.325 19.007  1.00 17.97  ? 2437 HIS B O   1 
ATOM   7297  C CB  . HIS B  1 418 ? 44.844  -59.184 20.206  1.00 17.14  ? 2437 HIS B CB  1 
ATOM   7298  C CG  . HIS B  1 418 ? 45.496  -58.876 21.514  1.00 16.68  ? 2437 HIS B CG  1 
ATOM   7299  N ND1 . HIS B  1 418 ? 45.443  -57.626 22.091  1.00 19.27  ? 2437 HIS B ND1 1 
ATOM   7300  C CD2 . HIS B  1 418 ? 46.260  -59.636 22.331  1.00 18.14  ? 2437 HIS B CD2 1 
ATOM   7301  C CE1 . HIS B  1 418 ? 46.147  -57.629 23.208  1.00 19.89  ? 2437 HIS B CE1 1 
ATOM   7302  N NE2 . HIS B  1 418 ? 46.655  -58.838 23.377  1.00 17.15  ? 2437 HIS B NE2 1 
ATOM   7303  N N   . ARG B  1 419 ? 46.450  -60.741 18.086  1.00 19.52  ? 2438 ARG B N   1 
ATOM   7304  C CA  . ARG B  1 419 ? 47.438  -61.736 17.692  1.00 23.10  ? 2438 ARG B CA  1 
ATOM   7305  C C   . ARG B  1 419 ? 48.433  -61.081 16.725  1.00 24.80  ? 2438 ARG B C   1 
ATOM   7306  O O   . ARG B  1 419 ? 49.646  -61.212 16.879  1.00 26.38  ? 2438 ARG B O   1 
ATOM   7307  C CB  . ARG B  1 419 ? 46.735  -62.907 16.997  1.00 22.05  ? 2438 ARG B CB  1 
ATOM   7308  C CG  . ARG B  1 419 ? 47.659  -63.881 16.263  1.00 22.88  ? 2438 ARG B CG  1 
ATOM   7309  C CD  . ARG B  1 419 ? 46.884  -64.684 15.220  1.00 19.55  ? 2438 ARG B CD  1 
ATOM   7310  N NE  . ARG B  1 419 ? 46.367  -63.827 14.155  1.00 18.48  ? 2438 ARG B NE  1 
ATOM   7311  C CZ  . ARG B  1 419 ? 45.530  -64.224 13.200  1.00 18.06  ? 2438 ARG B CZ  1 
ATOM   7312  N NH1 . ARG B  1 419 ? 45.095  -65.476 13.165  1.00 19.02  ? 2438 ARG B NH1 1 
ATOM   7313  N NH2 . ARG B  1 419 ? 45.129  -63.369 12.270  1.00 17.49  ? 2438 ARG B NH2 1 
ATOM   7314  N N   . ASP B  1 420 ? 47.909  -60.360 15.737  1.00 25.53  ? 2439 ASP B N   1 
ATOM   7315  C CA  . ASP B  1 420 ? 48.760  -59.712 14.748  1.00 25.69  ? 2439 ASP B CA  1 
ATOM   7316  C C   . ASP B  1 420 ? 49.678  -58.631 15.314  1.00 26.41  ? 2439 ASP B C   1 
ATOM   7317  O O   . ASP B  1 420 ? 50.639  -58.224 14.655  1.00 25.67  ? 2439 ASP B O   1 
ATOM   7318  C CB  . ASP B  1 420 ? 47.907  -59.152 13.606  1.00 27.02  ? 2439 ASP B CB  1 
ATOM   7319  C CG  . ASP B  1 420 ? 47.217  -60.246 12.811  1.00 29.84  ? 2439 ASP B CG  1 
ATOM   7320  O OD1 . ASP B  1 420 ? 47.622  -61.424 12.943  1.00 30.22  ? 2439 ASP B OD1 1 
ATOM   7321  O OD2 . ASP B  1 420 ? 46.280  -59.935 12.048  1.00 32.22  ? 2439 ASP B OD2 1 
ATOM   7322  N N   . ALA B  1 421 ? 49.403  -58.174 16.534  1.00 23.82  ? 2440 ALA B N   1 
ATOM   7323  C CA  . ALA B  1 421 ? 50.249  -57.163 17.152  1.00 23.20  ? 2440 ALA B CA  1 
ATOM   7324  C C   . ALA B  1 421 ? 51.410  -57.847 17.877  1.00 23.55  ? 2440 ALA B C   1 
ATOM   7325  O O   . ALA B  1 421 ? 52.259  -57.189 18.475  1.00 23.64  ? 2440 ALA B O   1 
ATOM   7326  C CB  . ALA B  1 421 ? 49.438  -56.311 18.130  1.00 23.71  ? 2440 ALA B CB  1 
ATOM   7327  N N   . GLY B  1 422 ? 51.432  -59.174 17.823  1.00 23.93  ? 2441 GLY B N   1 
ATOM   7328  C CA  . GLY B  1 422 ? 52.498  -59.925 18.461  1.00 24.07  ? 2441 GLY B CA  1 
ATOM   7329  C C   . GLY B  1 422 ? 52.244  -60.308 19.908  1.00 25.98  ? 2441 GLY B C   1 
ATOM   7330  O O   . GLY B  1 422 ? 53.134  -60.830 20.574  1.00 27.06  ? 2441 GLY B O   1 
ATOM   7331  N N   . ALA B  1 423 ? 51.035  -60.063 20.401  1.00 23.60  ? 2442 ALA B N   1 
ATOM   7332  C CA  . ALA B  1 423 ? 50.705  -60.390 21.788  1.00 23.31  ? 2442 ALA B CA  1 
ATOM   7333  C C   . ALA B  1 423 ? 50.065  -61.776 21.915  1.00 22.11  ? 2442 ALA B C   1 
ATOM   7334  O O   . ALA B  1 423 ? 49.285  -62.184 21.060  1.00 21.61  ? 2442 ALA B O   1 
ATOM   7335  C CB  . ALA B  1 423 ? 49.762  -59.328 22.354  1.00 23.53  ? 2442 ALA B CB  1 
ATOM   7336  N N   . PRO B  1 424 ? 50.394  -62.519 22.989  1.00 22.37  ? 2443 PRO B N   1 
ATOM   7337  C CA  . PRO B  1 424 ? 49.818  -63.855 23.187  1.00 21.20  ? 2443 PRO B CA  1 
ATOM   7338  C C   . PRO B  1 424 ? 48.295  -63.736 23.200  1.00 20.61  ? 2443 PRO B C   1 
ATOM   7339  O O   . PRO B  1 424 ? 47.745  -62.892 23.905  1.00 20.11  ? 2443 PRO B O   1 
ATOM   7340  C CB  . PRO B  1 424 ? 50.381  -64.277 24.546  1.00 21.35  ? 2443 PRO B CB  1 
ATOM   7341  C CG  . PRO B  1 424 ? 51.705  -63.553 24.600  1.00 22.21  ? 2443 PRO B CG  1 
ATOM   7342  C CD  . PRO B  1 424 ? 51.340  -62.189 24.072  1.00 22.47  ? 2443 PRO B CD  1 
ATOM   7343  N N   . THR B  1 425 ? 47.623  -64.575 22.419  1.00 19.90  ? 2444 THR B N   1 
ATOM   7344  C CA  . THR B  1 425 ? 46.167  -64.534 22.320  1.00 19.80  ? 2444 THR B CA  1 
ATOM   7345  C C   . THR B  1 425 ? 45.560  -65.929 22.462  1.00 19.78  ? 2444 THR B C   1 
ATOM   7346  O O   . THR B  1 425 ? 46.172  -66.923 22.065  1.00 21.90  ? 2444 THR B O   1 
ATOM   7347  C CB  . THR B  1 425 ? 45.739  -63.923 20.957  1.00 20.11  ? 2444 THR B CB  1 
ATOM   7348  O OG1 . THR B  1 425 ? 46.372  -62.649 20.789  1.00 20.35  ? 2444 THR B OG1 1 
ATOM   7349  C CG2 . THR B  1 425 ? 44.235  -63.731 20.896  1.00 19.71  ? 2444 THR B CG2 1 
ATOM   7350  N N   . TYR B  1 426 ? 44.361  -65.997 23.040  1.00 18.82  ? 2445 TYR B N   1 
ATOM   7351  C CA  . TYR B  1 426 ? 43.648  -67.266 23.243  1.00 15.93  ? 2445 TYR B CA  1 
ATOM   7352  C C   . TYR B  1 426 ? 42.152  -67.050 23.026  1.00 15.39  ? 2445 TYR B C   1 
ATOM   7353  O O   . TYR B  1 426 ? 41.626  -65.972 23.316  1.00 14.23  ? 2445 TYR B O   1 
ATOM   7354  C CB  . TYR B  1 426 ? 43.876  -67.795 24.668  1.00 13.09  ? 2445 TYR B CB  1 
ATOM   7355  C CG  . TYR B  1 426 ? 45.278  -68.286 24.940  1.00 16.91  ? 2445 TYR B CG  1 
ATOM   7356  C CD1 . TYR B  1 426 ? 45.635  -69.614 24.698  1.00 17.51  ? 2445 TYR B CD1 1 
ATOM   7357  C CD2 . TYR B  1 426 ? 46.261  -67.416 25.414  1.00 16.68  ? 2445 TYR B CD2 1 
ATOM   7358  C CE1 . TYR B  1 426 ? 46.941  -70.058 24.921  1.00 19.40  ? 2445 TYR B CE1 1 
ATOM   7359  C CE2 . TYR B  1 426 ? 47.561  -67.847 25.635  1.00 17.81  ? 2445 TYR B CE2 1 
ATOM   7360  C CZ  . TYR B  1 426 ? 47.895  -69.166 25.388  1.00 18.07  ? 2445 TYR B CZ  1 
ATOM   7361  O OH  . TYR B  1 426 ? 49.181  -69.589 25.608  1.00 18.11  ? 2445 TYR B OH  1 
ATOM   7362  N N   . MET B  1 427 ? 41.470  -68.060 22.494  1.00 14.21  ? 2446 MET B N   1 
ATOM   7363  C CA  . MET B  1 427 ? 40.029  -67.966 22.280  1.00 15.00  ? 2446 MET B CA  1 
ATOM   7364  C C   . MET B  1 427 ? 39.336  -69.244 22.742  1.00 15.00  ? 2446 MET B C   1 
ATOM   7365  O O   . MET B  1 427 ? 39.960  -70.302 22.837  1.00 14.76  ? 2446 MET B O   1 
ATOM   7366  C CB  . MET B  1 427 ? 39.692  -67.738 20.799  1.00 16.63  ? 2446 MET B CB  1 
ATOM   7367  C CG  . MET B  1 427 ? 40.017  -66.358 20.257  1.00 19.81  ? 2446 MET B CG  1 
ATOM   7368  S SD  . MET B  1 427 ? 39.020  -65.975 18.789  1.00 21.95  ? 2446 MET B SD  1 
ATOM   7369  C CE  . MET B  1 427 ? 37.510  -65.314 19.611  1.00 19.33  ? 2446 MET B CE  1 
ATOM   7370  N N   . TYR B  1 428 ? 38.047  -69.134 23.045  1.00 14.81  ? 2447 TYR B N   1 
ATOM   7371  C CA  . TYR B  1 428 ? 37.259  -70.289 23.449  1.00 14.21  ? 2447 TYR B CA  1 
ATOM   7372  C C   . TYR B  1 428 ? 35.814  -70.084 23.034  1.00 15.74  ? 2447 TYR B C   1 
ATOM   7373  O O   . TYR B  1 428 ? 35.385  -68.957 22.760  1.00 14.32  ? 2447 TYR B O   1 
ATOM   7374  C CB  . TYR B  1 428 ? 37.311  -70.503 24.973  1.00 16.52  ? 2447 TYR B CB  1 
ATOM   7375  C CG  . TYR B  1 428 ? 36.542  -69.468 25.778  1.00 19.56  ? 2447 TYR B CG  1 
ATOM   7376  C CD1 . TYR B  1 428 ? 37.209  -68.472 26.492  1.00 18.40  ? 2447 TYR B CD1 1 
ATOM   7377  C CD2 . TYR B  1 428 ? 35.143  -69.475 25.808  1.00 19.43  ? 2447 TYR B CD2 1 
ATOM   7378  C CE1 . TYR B  1 428 ? 36.503  -67.508 27.214  1.00 19.73  ? 2447 TYR B CE1 1 
ATOM   7379  C CE2 . TYR B  1 428 ? 34.429  -68.515 26.521  1.00 19.91  ? 2447 TYR B CE2 1 
ATOM   7380  C CZ  . TYR B  1 428 ? 35.113  -67.535 27.220  1.00 20.75  ? 2447 TYR B CZ  1 
ATOM   7381  O OH  . TYR B  1 428 ? 34.403  -66.571 27.901  1.00 20.03  ? 2447 TYR B OH  1 
ATOM   7382  N N   . GLU B  1 429 ? 35.072  -71.186 22.966  1.00 16.16  ? 2448 GLU B N   1 
ATOM   7383  C CA  . GLU B  1 429 ? 33.647  -71.143 22.668  1.00 19.24  ? 2448 GLU B CA  1 
ATOM   7384  C C   . GLU B  1 429 ? 33.025  -72.034 23.743  1.00 20.25  ? 2448 GLU B C   1 
ATOM   7385  O O   . GLU B  1 429 ? 33.328  -73.227 23.831  1.00 19.00  ? 2448 GLU B O   1 
ATOM   7386  C CB  . GLU B  1 429 ? 33.325  -71.697 21.281  1.00 21.86  ? 2448 GLU B CB  1 
ATOM   7387  C CG  . GLU B  1 429 ? 31.877  -71.435 20.894  1.00 25.80  ? 2448 GLU B CG  1 
ATOM   7388  C CD  . GLU B  1 429 ? 31.507  -71.987 19.531  1.00 30.42  ? 2448 GLU B CD  1 
ATOM   7389  O OE1 . GLU B  1 429 ? 30.471  -71.550 18.984  1.00 31.78  ? 2448 GLU B OE1 1 
ATOM   7390  O OE2 . GLU B  1 429 ? 32.239  -72.859 19.011  1.00 31.50  ? 2448 GLU B OE2 1 
ATOM   7391  N N   . PHE B  1 430 ? 32.174  -71.448 24.577  1.00 19.99  ? 2449 PHE B N   1 
ATOM   7392  C CA  . PHE B  1 430 ? 31.549  -72.188 25.673  1.00 20.19  ? 2449 PHE B CA  1 
ATOM   7393  C C   . PHE B  1 430 ? 30.183  -72.731 25.275  1.00 18.90  ? 2449 PHE B C   1 
ATOM   7394  O O   . PHE B  1 430 ? 29.344  -72.004 24.758  1.00 18.80  ? 2449 PHE B O   1 
ATOM   7395  C CB  . PHE B  1 430 ? 31.419  -71.278 26.891  1.00 19.54  ? 2449 PHE B CB  1 
ATOM   7396  C CG  . PHE B  1 430 ? 30.925  -71.977 28.128  1.00 19.13  ? 2449 PHE B CG  1 
ATOM   7397  C CD1 . PHE B  1 430 ? 31.818  -72.600 28.994  1.00 16.17  ? 2449 PHE B CD1 1 
ATOM   7398  C CD2 . PHE B  1 430 ? 29.568  -71.985 28.440  1.00 18.65  ? 2449 PHE B CD2 1 
ATOM   7399  C CE1 . PHE B  1 430 ? 31.368  -73.222 30.168  1.00 18.40  ? 2449 PHE B CE1 1 
ATOM   7400  C CE2 . PHE B  1 430 ? 29.102  -72.604 29.609  1.00 18.38  ? 2449 PHE B CE2 1 
ATOM   7401  C CZ  . PHE B  1 430 ? 30.005  -73.222 30.474  1.00 17.48  ? 2449 PHE B CZ  1 
ATOM   7402  N N   . GLN B  1 431 ? 29.970  -74.016 25.538  1.00 20.30  ? 2450 GLN B N   1 
ATOM   7403  C CA  . GLN B  1 431 ? 28.725  -74.675 25.199  1.00 23.16  ? 2450 GLN B CA  1 
ATOM   7404  C C   . GLN B  1 431 ? 28.316  -75.649 26.300  1.00 25.04  ? 2450 GLN B C   1 
ATOM   7405  O O   . GLN B  1 431 ? 28.776  -76.793 26.339  1.00 25.76  ? 2450 GLN B O   1 
ATOM   7406  C CB  . GLN B  1 431 ? 28.882  -75.419 23.883  1.00 26.95  ? 2450 GLN B CB  1 
ATOM   7407  C CG  . GLN B  1 431 ? 27.722  -76.348 23.528  1.00 30.87  ? 2450 GLN B CG  1 
ATOM   7408  C CD  . GLN B  1 431 ? 27.928  -76.939 22.138  1.00 34.22  ? 2450 GLN B CD  1 
ATOM   7409  O OE1 . GLN B  1 431 ? 28.966  -77.545 21.860  1.00 35.88  ? 2450 GLN B OE1 1 
ATOM   7410  N NE2 . GLN B  1 431 ? 26.937  -76.772 21.267  1.00 36.68  ? 2450 GLN B NE2 1 
ATOM   7411  N N   . TYR B  1 432 ? 27.457  -75.182 27.200  1.00 24.81  ? 2451 TYR B N   1 
ATOM   7412  C CA  . TYR B  1 432 ? 26.978  -76.003 28.299  1.00 25.48  ? 2451 TYR B CA  1 
ATOM   7413  C C   . TYR B  1 432 ? 25.749  -75.327 28.888  1.00 25.85  ? 2451 TYR B C   1 
ATOM   7414  O O   . TYR B  1 432 ? 25.621  -74.100 28.834  1.00 26.00  ? 2451 TYR B O   1 
ATOM   7415  C CB  . TYR B  1 432 ? 28.052  -76.129 29.378  1.00 25.75  ? 2451 TYR B CB  1 
ATOM   7416  C CG  . TYR B  1 432 ? 27.759  -77.196 30.413  1.00 25.55  ? 2451 TYR B CG  1 
ATOM   7417  C CD1 . TYR B  1 432 ? 27.931  -78.548 30.111  1.00 25.44  ? 2451 TYR B CD1 1 
ATOM   7418  C CD2 . TYR B  1 432 ? 27.293  -76.858 31.686  1.00 24.22  ? 2451 TYR B CD2 1 
ATOM   7419  C CE1 . TYR B  1 432 ? 27.647  -79.543 31.044  1.00 25.63  ? 2451 TYR B CE1 1 
ATOM   7420  C CE2 . TYR B  1 432 ? 27.004  -77.845 32.633  1.00 24.56  ? 2451 TYR B CE2 1 
ATOM   7421  C CZ  . TYR B  1 432 ? 27.187  -79.186 32.298  1.00 28.13  ? 2451 TYR B CZ  1 
ATOM   7422  O OH  . TYR B  1 432 ? 26.924  -80.173 33.215  1.00 30.54  ? 2451 TYR B OH  1 
ATOM   7423  N N   . ARG B  1 433 ? 24.831  -76.121 29.428  1.00 24.53  ? 2452 ARG B N   1 
ATOM   7424  C CA  . ARG B  1 433 ? 23.638  -75.556 30.045  1.00 25.32  ? 2452 ARG B CA  1 
ATOM   7425  C C   . ARG B  1 433 ? 23.722  -75.811 31.537  1.00 24.67  ? 2452 ARG B C   1 
ATOM   7426  O O   . ARG B  1 433 ? 23.532  -76.936 32.001  1.00 23.17  ? 2452 ARG B O   1 
ATOM   7427  C CB  . ARG B  1 433 ? 22.361  -76.188 29.486  1.00 28.42  ? 2452 ARG B CB  1 
ATOM   7428  C CG  . ARG B  1 433 ? 21.093  -75.490 29.979  1.00 29.89  ? 2452 ARG B CG  1 
ATOM   7429  C CD  . ARG B  1 433 ? 19.853  -75.976 29.237  1.00 36.47  ? 2452 ARG B CD  1 
ATOM   7430  N NE  . ARG B  1 433 ? 18.658  -75.189 29.555  1.00 36.90  ? 2452 ARG B NE  1 
ATOM   7431  C CZ  . ARG B  1 433 ? 18.108  -75.120 30.764  1.00 37.81  ? 2452 ARG B CZ  1 
ATOM   7432  N NH1 . ARG B  1 433 ? 18.646  -75.788 31.775  1.00 38.32  ? 2452 ARG B NH1 1 
ATOM   7433  N NH2 . ARG B  1 433 ? 17.015  -74.390 30.961  1.00 38.09  ? 2452 ARG B NH2 1 
ATOM   7434  N N   . PRO B  1 434 ? 24.031  -74.765 32.311  1.00 23.97  ? 2453 PRO B N   1 
ATOM   7435  C CA  . PRO B  1 434 ? 24.130  -74.933 33.759  1.00 22.80  ? 2453 PRO B CA  1 
ATOM   7436  C C   . PRO B  1 434 ? 22.782  -75.255 34.398  1.00 23.06  ? 2453 PRO B C   1 
ATOM   7437  O O   . PRO B  1 434 ? 21.734  -74.813 33.924  1.00 23.07  ? 2453 PRO B O   1 
ATOM   7438  C CB  . PRO B  1 434 ? 24.701  -73.595 34.223  1.00 23.43  ? 2453 PRO B CB  1 
ATOM   7439  C CG  . PRO B  1 434 ? 24.206  -72.630 33.196  1.00 24.38  ? 2453 PRO B CG  1 
ATOM   7440  C CD  . PRO B  1 434 ? 24.370  -73.389 31.906  1.00 24.18  ? 2453 PRO B CD  1 
ATOM   7441  N N   . SER B  1 435 ? 22.819  -76.046 35.463  1.00 23.50  ? 2454 SER B N   1 
ATOM   7442  C CA  . SER B  1 435 ? 21.607  -76.421 36.178  1.00 25.00  ? 2454 SER B CA  1 
ATOM   7443  C C   . SER B  1 435 ? 21.052  -75.204 36.923  1.00 25.46  ? 2454 SER B C   1 
ATOM   7444  O O   . SER B  1 435 ? 19.915  -75.215 37.393  1.00 26.53  ? 2454 SER B O   1 
ATOM   7445  C CB  . SER B  1 435 ? 21.910  -77.542 37.175  1.00 23.13  ? 2454 SER B CB  1 
ATOM   7446  O OG  . SER B  1 435 ? 22.896  -77.144 38.117  1.00 22.35  ? 2454 SER B OG  1 
ATOM   7447  N N   . PHE B  1 436 ? 21.865  -74.157 37.022  1.00 25.66  ? 2455 PHE B N   1 
ATOM   7448  C CA  . PHE B  1 436 ? 21.470  -72.936 37.715  1.00 25.33  ? 2455 PHE B CA  1 
ATOM   7449  C C   . PHE B  1 436 ? 20.691  -72.002 36.796  1.00 25.36  ? 2455 PHE B C   1 
ATOM   7450  O O   . PHE B  1 436 ? 20.346  -70.884 37.182  1.00 25.37  ? 2455 PHE B O   1 
ATOM   7451  C CB  . PHE B  1 436 ? 22.710  -72.222 38.257  1.00 25.34  ? 2455 PHE B CB  1 
ATOM   7452  C CG  . PHE B  1 436 ? 23.650  -73.132 38.995  1.00 26.79  ? 2455 PHE B CG  1 
ATOM   7453  C CD1 . PHE B  1 436 ? 24.869  -73.498 38.432  1.00 25.77  ? 2455 PHE B CD1 1 
ATOM   7454  C CD2 . PHE B  1 436 ? 23.306  -73.645 40.242  1.00 27.63  ? 2455 PHE B CD2 1 
ATOM   7455  C CE1 . PHE B  1 436 ? 25.732  -74.363 39.103  1.00 25.98  ? 2455 PHE B CE1 1 
ATOM   7456  C CE2 . PHE B  1 436 ? 24.162  -74.511 40.921  1.00 26.76  ? 2455 PHE B CE2 1 
ATOM   7457  C CZ  . PHE B  1 436 ? 25.376  -74.869 40.349  1.00 26.21  ? 2455 PHE B CZ  1 
ATOM   7458  N N   . SER B  1 437 ? 20.428  -72.464 35.578  1.00 24.96  ? 2456 SER B N   1 
ATOM   7459  C CA  . SER B  1 437 ? 19.679  -71.683 34.600  1.00 25.80  ? 2456 SER B CA  1 
ATOM   7460  C C   . SER B  1 437 ? 18.311  -71.341 35.171  1.00 25.06  ? 2456 SER B C   1 
ATOM   7461  O O   . SER B  1 437 ? 17.818  -72.017 36.071  1.00 24.19  ? 2456 SER B O   1 
ATOM   7462  C CB  . SER B  1 437 ? 19.479  -72.486 33.305  1.00 28.56  ? 2456 SER B CB  1 
ATOM   7463  O OG  . SER B  1 437 ? 20.704  -72.781 32.656  1.00 29.59  ? 2456 SER B OG  1 
ATOM   7464  N N   . SER B  1 438 ? 17.697  -70.289 34.643  1.00 24.91  ? 2457 SER B N   1 
ATOM   7465  C CA  . SER B  1 438 ? 16.376  -69.887 35.098  1.00 24.59  ? 2457 SER B CA  1 
ATOM   7466  C C   . SER B  1 438 ? 15.340  -70.930 34.676  1.00 25.38  ? 2457 SER B C   1 
ATOM   7467  O O   . SER B  1 438 ? 15.436  -71.506 33.591  1.00 21.85  ? 2457 SER B O   1 
ATOM   7468  C CB  . SER B  1 438 ? 16.000  -68.532 34.499  1.00 23.45  ? 2457 SER B CB  1 
ATOM   7469  O OG  . SER B  1 438 ? 14.630  -68.250 34.728  1.00 25.53  ? 2457 SER B OG  1 
ATOM   7470  N N   . ASP B  1 439 ? 14.350  -71.164 35.534  1.00 26.06  ? 2458 ASP B N   1 
ATOM   7471  C CA  . ASP B  1 439 ? 13.292  -72.123 35.229  1.00 27.01  ? 2458 ASP B CA  1 
ATOM   7472  C C   . ASP B  1 439 ? 12.467  -71.665 34.034  1.00 26.26  ? 2458 ASP B C   1 
ATOM   7473  O O   . ASP B  1 439 ? 11.793  -72.472 33.404  1.00 26.31  ? 2458 ASP B O   1 
ATOM   7474  C CB  . ASP B  1 439 ? 12.360  -72.308 36.431  1.00 31.39  ? 2458 ASP B CB  1 
ATOM   7475  C CG  . ASP B  1 439 ? 13.061  -72.914 37.622  1.00 34.73  ? 2458 ASP B CG  1 
ATOM   7476  O OD1 . ASP B  1 439 ? 13.734  -73.947 37.444  1.00 39.31  ? 2458 ASP B OD1 1 
ATOM   7477  O OD2 . ASP B  1 439 ? 12.935  -72.365 38.737  1.00 40.28  ? 2458 ASP B OD2 1 
ATOM   7478  N N   . MET B  1 440 ? 12.519  -70.372 33.725  1.00 24.51  ? 2459 MET B N   1 
ATOM   7479  C CA  . MET B  1 440 ? 11.765  -69.829 32.600  1.00 25.62  ? 2459 MET B CA  1 
ATOM   7480  C C   . MET B  1 440 ? 12.484  -70.013 31.270  1.00 25.00  ? 2459 MET B C   1 
ATOM   7481  O O   . MET B  1 440 ? 11.940  -69.692 30.214  1.00 25.46  ? 2459 MET B O   1 
ATOM   7482  C CB  . MET B  1 440 ? 11.481  -68.340 32.815  1.00 29.21  ? 2459 MET B CB  1 
ATOM   7483  C CG  . MET B  1 440 ? 10.633  -68.033 34.041  1.00 33.50  ? 2459 MET B CG  1 
ATOM   7484  S SD  . MET B  1 440 ? 10.436  -66.251 34.265  1.00 39.74  ? 2459 MET B SD  1 
ATOM   7485  C CE  . MET B  1 440 ? 11.955  -65.840 35.113  1.00 37.42  ? 2459 MET B CE  1 
ATOM   7486  N N   . LYS B  1 441 ? 13.711  -70.519 31.322  1.00 24.47  ? 2460 LYS B N   1 
ATOM   7487  C CA  . LYS B  1 441 ? 14.484  -70.746 30.107  1.00 24.51  ? 2460 LYS B CA  1 
ATOM   7488  C C   . LYS B  1 441 ? 14.319  -72.194 29.638  1.00 24.80  ? 2460 LYS B C   1 
ATOM   7489  O O   . LYS B  1 441 ? 14.561  -73.128 30.397  1.00 23.46  ? 2460 LYS B O   1 
ATOM   7490  C CB  . LYS B  1 441 ? 15.967  -70.448 30.360  1.00 23.02  ? 2460 LYS B CB  1 
ATOM   7491  C CG  . LYS B  1 441 ? 16.861  -70.744 29.164  1.00 24.55  ? 2460 LYS B CG  1 
ATOM   7492  C CD  . LYS B  1 441 ? 18.290  -70.259 29.358  1.00 23.73  ? 2460 LYS B CD  1 
ATOM   7493  C CE  . LYS B  1 441 ? 19.044  -71.097 30.373  1.00 25.11  ? 2460 LYS B CE  1 
ATOM   7494  N NZ  . LYS B  1 441 ? 20.491  -70.713 30.456  1.00 23.74  ? 2460 LYS B NZ  1 
ATOM   7495  N N   . PRO B  1 442 ? 13.904  -72.397 28.377  1.00 26.31  ? 2461 PRO B N   1 
ATOM   7496  C CA  . PRO B  1 442 ? 13.726  -73.759 27.859  1.00 27.83  ? 2461 PRO B CA  1 
ATOM   7497  C C   . PRO B  1 442 ? 15.017  -74.575 27.908  1.00 29.00  ? 2461 PRO B C   1 
ATOM   7498  O O   . PRO B  1 442 ? 16.114  -74.028 27.782  1.00 29.05  ? 2461 PRO B O   1 
ATOM   7499  C CB  . PRO B  1 442 ? 13.224  -73.528 26.431  1.00 27.89  ? 2461 PRO B CB  1 
ATOM   7500  C CG  . PRO B  1 442 ? 13.814  -72.198 26.067  1.00 29.26  ? 2461 PRO B CG  1 
ATOM   7501  C CD  . PRO B  1 442 ? 13.623  -71.398 27.334  1.00 27.17  ? 2461 PRO B CD  1 
ATOM   7502  N N   . LYS B  1 443 ? 14.873  -75.885 28.085  1.00 29.72  ? 2462 LYS B N   1 
ATOM   7503  C CA  . LYS B  1 443 ? 16.010  -76.794 28.181  1.00 31.58  ? 2462 LYS B CA  1 
ATOM   7504  C C   . LYS B  1 443 ? 16.884  -76.889 26.936  1.00 30.17  ? 2462 LYS B C   1 
ATOM   7505  O O   . LYS B  1 443 ? 18.046  -77.284 27.024  1.00 30.33  ? 2462 LYS B O   1 
ATOM   7506  C CB  . LYS B  1 443 ? 15.517  -78.195 28.559  1.00 35.23  ? 2462 LYS B CB  1 
ATOM   7507  C CG  . LYS B  1 443 ? 14.852  -78.244 29.921  1.00 43.80  ? 2462 LYS B CG  1 
ATOM   7508  C CD  . LYS B  1 443 ? 14.373  -79.642 30.271  1.00 49.97  ? 2462 LYS B CD  1 
ATOM   7509  C CE  . LYS B  1 443 ? 13.697  -79.662 31.636  1.00 52.77  ? 2462 LYS B CE  1 
ATOM   7510  N NZ  . LYS B  1 443 ? 13.222  -81.026 32.002  1.00 55.91  ? 2462 LYS B NZ  1 
ATOM   7511  N N   . THR B  1 444 ? 16.333  -76.527 25.784  1.00 29.02  ? 2463 THR B N   1 
ATOM   7512  C CA  . THR B  1 444 ? 17.078  -76.602 24.529  1.00 29.96  ? 2463 THR B CA  1 
ATOM   7513  C C   . THR B  1 444 ? 18.178  -75.553 24.353  1.00 29.06  ? 2463 THR B C   1 
ATOM   7514  O O   . THR B  1 444 ? 19.029  -75.688 23.475  1.00 29.40  ? 2463 THR B O   1 
ATOM   7515  C CB  . THR B  1 444 ? 16.128  -76.503 23.327  1.00 30.03  ? 2463 THR B CB  1 
ATOM   7516  O OG1 . THR B  1 444 ? 15.290  -75.350 23.480  1.00 34.43  ? 2463 THR B OG1 1 
ATOM   7517  C CG2 . THR B  1 444 ? 15.256  -77.755 23.231  1.00 34.59  ? 2463 THR B CG2 1 
ATOM   7518  N N   . VAL B  1 445 ? 18.164  -74.510 25.176  1.00 26.22  ? 2464 VAL B N   1 
ATOM   7519  C CA  . VAL B  1 445 ? 19.172  -73.463 25.072  1.00 23.75  ? 2464 VAL B CA  1 
ATOM   7520  C C   . VAL B  1 445 ? 20.469  -73.871 25.764  1.00 24.00  ? 2464 VAL B C   1 
ATOM   7521  O O   . VAL B  1 445 ? 20.508  -74.052 26.981  1.00 25.00  ? 2464 VAL B O   1 
ATOM   7522  C CB  . VAL B  1 445 ? 18.659  -72.142 25.683  1.00 23.45  ? 2464 VAL B CB  1 
ATOM   7523  C CG1 . VAL B  1 445 ? 19.745  -71.073 25.616  1.00 21.57  ? 2464 VAL B CG1 1 
ATOM   7524  C CG2 . VAL B  1 445 ? 17.420  -71.686 24.933  1.00 22.64  ? 2464 VAL B CG2 1 
ATOM   7525  N N   . ILE B  1 446 ? 21.531  -74.026 24.980  1.00 23.44  ? 2465 ILE B N   1 
ATOM   7526  C CA  . ILE B  1 446 ? 22.823  -74.421 25.527  1.00 23.49  ? 2465 ILE B CA  1 
ATOM   7527  C C   . ILE B  1 446 ? 23.876  -73.361 25.212  1.00 21.64  ? 2465 ILE B C   1 
ATOM   7528  O O   . ILE B  1 446 ? 24.050  -72.962 24.057  1.00 21.56  ? 2465 ILE B O   1 
ATOM   7529  C CB  . ILE B  1 446 ? 23.280  -75.778 24.952  1.00 24.09  ? 2465 ILE B CB  1 
ATOM   7530  C CG1 . ILE B  1 446 ? 22.161  -76.808 25.102  1.00 26.92  ? 2465 ILE B CG1 1 
ATOM   7531  C CG2 . ILE B  1 446 ? 24.519  -76.268 25.693  1.00 23.09  ? 2465 ILE B CG2 1 
ATOM   7532  C CD1 . ILE B  1 446 ? 22.476  -78.149 24.454  1.00 32.48  ? 2465 ILE B CD1 1 
ATOM   7533  N N   . GLY B  1 447 ? 24.577  -72.910 26.244  1.00 19.58  ? 2466 GLY B N   1 
ATOM   7534  C CA  . GLY B  1 447 ? 25.589  -71.887 26.046  1.00 18.59  ? 2466 GLY B CA  1 
ATOM   7535  C C   . GLY B  1 447 ? 24.949  -70.541 25.765  1.00 19.10  ? 2466 GLY B C   1 
ATOM   7536  O O   . GLY B  1 447 ? 25.351  -69.829 24.843  1.00 16.74  ? 2466 GLY B O   1 
ATOM   7537  N N   . ASP B  1 448 ? 23.930  -70.199 26.550  1.00 17.28  ? 2467 ASP B N   1 
ATOM   7538  C CA  . ASP B  1 448 ? 23.246  -68.914 26.402  1.00 18.96  ? 2467 ASP B CA  1 
ATOM   7539  C C   . ASP B  1 448 ? 24.181  -67.849 26.970  1.00 17.53  ? 2467 ASP B C   1 
ATOM   7540  O O   . ASP B  1 448 ? 25.182  -68.167 27.615  1.00 18.64  ? 2467 ASP B O   1 
ATOM   7541  C CB  . ASP B  1 448 ? 21.918  -68.937 27.175  1.00 18.23  ? 2467 ASP B CB  1 
ATOM   7542  C CG  . ASP B  1 448 ? 21.098  -67.653 27.007  1.00 21.36  ? 2467 ASP B CG  1 
ATOM   7543  O OD1 . ASP B  1 448 ? 21.260  -66.942 25.991  1.00 21.33  ? 2467 ASP B OD1 1 
ATOM   7544  O OD2 . ASP B  1 448 ? 20.268  -67.368 27.897  1.00 19.40  ? 2467 ASP B OD2 1 
ATOM   7545  N N   . HIS B  1 449 ? 23.862  -66.589 26.712  1.00 19.53  ? 2468 HIS B N   1 
ATOM   7546  C CA  . HIS B  1 449 ? 24.660  -65.480 27.209  1.00 19.25  ? 2468 HIS B CA  1 
ATOM   7547  C C   . HIS B  1 449 ? 24.780  -65.598 28.727  1.00 20.09  ? 2468 HIS B C   1 
ATOM   7548  O O   . HIS B  1 449 ? 23.775  -65.776 29.414  1.00 20.73  ? 2468 HIS B O   1 
ATOM   7549  C CB  . HIS B  1 449 ? 23.974  -64.160 26.841  1.00 21.40  ? 2468 HIS B CB  1 
ATOM   7550  C CG  . HIS B  1 449 ? 24.821  -62.947 27.067  1.00 23.17  ? 2468 HIS B CG  1 
ATOM   7551  N ND1 . HIS B  1 449 ? 26.050  -62.774 26.467  1.00 25.14  ? 2468 HIS B ND1 1 
ATOM   7552  C CD2 . HIS B  1 449 ? 24.589  -61.822 27.785  1.00 24.17  ? 2468 HIS B CD2 1 
ATOM   7553  C CE1 . HIS B  1 449 ? 26.539  -61.592 26.804  1.00 24.87  ? 2468 HIS B CE1 1 
ATOM   7554  N NE2 . HIS B  1 449 ? 25.671  -60.996 27.601  1.00 25.39  ? 2468 HIS B NE2 1 
ATOM   7555  N N   . GLY B  1 450 ? 26.010  -65.520 29.236  1.00 19.04  ? 2469 GLY B N   1 
ATOM   7556  C CA  . GLY B  1 450 ? 26.246  -65.599 30.672  1.00 18.99  ? 2469 GLY B CA  1 
ATOM   7557  C C   . GLY B  1 450 ? 26.373  -66.984 31.296  1.00 19.01  ? 2469 GLY B C   1 
ATOM   7558  O O   . GLY B  1 450 ? 26.668  -67.100 32.488  1.00 17.81  ? 2469 GLY B O   1 
ATOM   7559  N N   . ASP B  1 451 ? 26.162  -68.041 30.519  1.00 17.21  ? 2470 ASP B N   1 
ATOM   7560  C CA  . ASP B  1 451 ? 26.241  -69.385 31.087  1.00 18.18  ? 2470 ASP B CA  1 
ATOM   7561  C C   . ASP B  1 451 ? 27.606  -69.790 31.635  1.00 17.87  ? 2470 ASP B C   1 
ATOM   7562  O O   . ASP B  1 451 ? 27.690  -70.614 32.551  1.00 18.30  ? 2470 ASP B O   1 
ATOM   7563  C CB  . ASP B  1 451 ? 25.774  -70.431 30.067  1.00 20.97  ? 2470 ASP B CB  1 
ATOM   7564  C CG  . ASP B  1 451 ? 24.262  -70.470 29.917  1.00 22.71  ? 2470 ASP B CG  1 
ATOM   7565  O OD1 . ASP B  1 451 ? 23.555  -69.946 30.806  1.00 24.36  ? 2470 ASP B OD1 1 
ATOM   7566  O OD2 . ASP B  1 451 ? 23.778  -71.044 28.918  1.00 25.05  ? 2470 ASP B OD2 1 
ATOM   7567  N N   . GLU B  1 452 ? 28.675  -69.218 31.093  1.00 16.58  ? 2471 GLU B N   1 
ATOM   7568  C CA  . GLU B  1 452 ? 30.009  -69.572 31.559  1.00 17.42  ? 2471 GLU B CA  1 
ATOM   7569  C C   . GLU B  1 452 ? 30.312  -69.018 32.952  1.00 17.96  ? 2471 GLU B C   1 
ATOM   7570  O O   . GLU B  1 452 ? 31.217  -69.498 33.631  1.00 15.86  ? 2471 GLU B O   1 
ATOM   7571  C CB  . GLU B  1 452 ? 31.074  -69.088 30.566  1.00 18.88  ? 2471 GLU B CB  1 
ATOM   7572  C CG  . GLU B  1 452 ? 31.617  -67.684 30.811  1.00 22.11  ? 2471 GLU B CG  1 
ATOM   7573  C CD  . GLU B  1 452 ? 30.653  -66.582 30.404  1.00 26.15  ? 2471 GLU B CD  1 
ATOM   7574  O OE1 . GLU B  1 452 ? 31.061  -65.401 30.453  1.00 29.06  ? 2471 GLU B OE1 1 
ATOM   7575  O OE2 . GLU B  1 452 ? 29.496  -66.888 30.036  1.00 25.81  ? 2471 GLU B OE2 1 
ATOM   7576  N N   . LEU B  1 453 ? 29.547  -68.012 33.367  1.00 17.00  ? 2472 LEU B N   1 
ATOM   7577  C CA  . LEU B  1 453 ? 29.733  -67.374 34.666  1.00 18.28  ? 2472 LEU B CA  1 
ATOM   7578  C C   . LEU B  1 453 ? 29.645  -68.335 35.847  1.00 16.93  ? 2472 LEU B C   1 
ATOM   7579  O O   . LEU B  1 453 ? 30.398  -68.206 36.810  1.00 18.43  ? 2472 LEU B O   1 
ATOM   7580  C CB  . LEU B  1 453 ? 28.701  -66.251 34.851  1.00 16.73  ? 2472 LEU B CB  1 
ATOM   7581  C CG  . LEU B  1 453 ? 28.787  -65.054 33.898  1.00 19.07  ? 2472 LEU B CG  1 
ATOM   7582  C CD1 . LEU B  1 453 ? 27.635  -64.098 34.154  1.00 18.56  ? 2472 LEU B CD1 1 
ATOM   7583  C CD2 . LEU B  1 453 ? 30.117  -64.351 34.092  1.00 20.42  ? 2472 LEU B CD2 1 
ATOM   7584  N N   . PHE B  1 454 ? 28.725  -69.292 35.784  1.00 18.86  ? 2473 PHE B N   1 
ATOM   7585  C CA  . PHE B  1 454 ? 28.569  -70.252 36.875  1.00 17.41  ? 2473 PHE B CA  1 
ATOM   7586  C C   . PHE B  1 454 ? 29.788  -71.147 37.030  1.00 17.55  ? 2473 PHE B C   1 
ATOM   7587  O O   . PHE B  1 454 ? 30.095  -71.600 38.135  1.00 17.32  ? 2473 PHE B O   1 
ATOM   7588  C CB  . PHE B  1 454 ? 27.303  -71.088 36.673  1.00 17.88  ? 2473 PHE B CB  1 
ATOM   7589  C CG  . PHE B  1 454 ? 26.042  -70.275 36.734  1.00 19.91  ? 2473 PHE B CG  1 
ATOM   7590  C CD1 . PHE B  1 454 ? 25.412  -69.852 35.573  1.00 21.06  ? 2473 PHE B CD1 1 
ATOM   7591  C CD2 . PHE B  1 454 ? 25.522  -69.874 37.962  1.00 20.57  ? 2473 PHE B CD2 1 
ATOM   7592  C CE1 . PHE B  1 454 ? 24.287  -69.040 35.630  1.00 21.06  ? 2473 PHE B CE1 1 
ATOM   7593  C CE2 . PHE B  1 454 ? 24.396  -69.061 38.028  1.00 20.38  ? 2473 PHE B CE2 1 
ATOM   7594  C CZ  . PHE B  1 454 ? 23.779  -68.643 36.864  1.00 21.04  ? 2473 PHE B CZ  1 
ATOM   7595  N N   . SER B  1 455 ? 30.487  -71.396 35.926  1.00 16.06  ? 2474 SER B N   1 
ATOM   7596  C CA  . SER B  1 455 ? 31.697  -72.215 35.972  1.00 16.28  ? 2474 SER B CA  1 
ATOM   7597  C C   . SER B  1 455 ? 32.868  -71.369 36.482  1.00 15.88  ? 2474 SER B C   1 
ATOM   7598  O O   . SER B  1 455 ? 33.575  -71.755 37.414  1.00 17.33  ? 2474 SER B O   1 
ATOM   7599  C CB  . SER B  1 455 ? 32.027  -72.759 34.575  1.00 14.76  ? 2474 SER B CB  1 
ATOM   7600  O OG  . SER B  1 455 ? 31.041  -73.675 34.135  1.00 15.68  ? 2474 SER B OG  1 
ATOM   7601  N N   . VAL B  1 456 ? 33.056  -70.206 35.867  1.00 16.95  ? 2475 VAL B N   1 
ATOM   7602  C CA  . VAL B  1 456 ? 34.135  -69.291 36.235  1.00 15.91  ? 2475 VAL B CA  1 
ATOM   7603  C C   . VAL B  1 456 ? 34.115  -68.929 37.723  1.00 16.02  ? 2475 VAL B C   1 
ATOM   7604  O O   . VAL B  1 456 ? 35.159  -68.915 38.375  1.00 15.43  ? 2475 VAL B O   1 
ATOM   7605  C CB  . VAL B  1 456 ? 34.053  -67.990 35.401  1.00 16.69  ? 2475 VAL B CB  1 
ATOM   7606  C CG1 . VAL B  1 456 ? 35.097  -66.982 35.884  1.00 17.51  ? 2475 VAL B CG1 1 
ATOM   7607  C CG2 . VAL B  1 456 ? 34.275  -68.306 33.919  1.00 16.59  ? 2475 VAL B CG2 1 
ATOM   7608  N N   . PHE B  1 457 ? 32.934  -68.631 38.258  1.00 15.34  ? 2476 PHE B N   1 
ATOM   7609  C CA  . PHE B  1 457 ? 32.833  -68.266 39.670  1.00 16.13  ? 2476 PHE B CA  1 
ATOM   7610  C C   . PHE B  1 457 ? 32.504  -69.417 40.613  1.00 17.55  ? 2476 PHE B C   1 
ATOM   7611  O O   . PHE B  1 457 ? 32.088  -69.194 41.747  1.00 18.85  ? 2476 PHE B O   1 
ATOM   7612  C CB  . PHE B  1 457 ? 31.830  -67.123 39.857  1.00 15.59  ? 2476 PHE B CB  1 
ATOM   7613  C CG  . PHE B  1 457 ? 32.388  -65.782 39.481  1.00 15.14  ? 2476 PHE B CG  1 
ATOM   7614  C CD1 . PHE B  1 457 ? 32.192  -65.258 38.209  1.00 14.98  ? 2476 PHE B CD1 1 
ATOM   7615  C CD2 . PHE B  1 457 ? 33.191  -65.085 40.374  1.00 18.11  ? 2476 PHE B CD2 1 
ATOM   7616  C CE1 . PHE B  1 457 ? 32.796  -64.058 37.831  1.00 16.85  ? 2476 PHE B CE1 1 
ATOM   7617  C CE2 . PHE B  1 457 ? 33.800  -63.885 40.004  1.00 17.44  ? 2476 PHE B CE2 1 
ATOM   7618  C CZ  . PHE B  1 457 ? 33.600  -63.376 38.729  1.00 15.66  ? 2476 PHE B CZ  1 
ATOM   7619  N N   . GLY B  1 458 ? 32.701  -70.644 40.135  1.00 16.68  ? 2477 GLY B N   1 
ATOM   7620  C CA  . GLY B  1 458 ? 32.468  -71.821 40.954  1.00 15.64  ? 2477 GLY B CA  1 
ATOM   7621  C C   . GLY B  1 458 ? 31.121  -71.946 41.643  1.00 16.26  ? 2477 GLY B C   1 
ATOM   7622  O O   . GLY B  1 458 ? 31.052  -72.326 42.814  1.00 15.42  ? 2477 GLY B O   1 
ATOM   7623  N N   . ALA B  1 459 ? 30.051  -71.639 40.920  1.00 15.12  ? 2478 ALA B N   1 
ATOM   7624  C CA  . ALA B  1 459 ? 28.712  -71.740 41.469  1.00 17.01  ? 2478 ALA B CA  1 
ATOM   7625  C C   . ALA B  1 459 ? 28.433  -73.139 42.036  1.00 19.25  ? 2478 ALA B C   1 
ATOM   7626  O O   . ALA B  1 459 ? 27.757  -73.272 43.055  1.00 21.35  ? 2478 ALA B O   1 
ATOM   7627  C CB  . ALA B  1 459 ? 27.687  -71.394 40.399  1.00 16.71  ? 2478 ALA B CB  1 
ATOM   7628  N N   . PRO B  1 460 ? 28.946  -74.203 41.385  1.00 19.28  ? 2479 PRO B N   1 
ATOM   7629  C CA  . PRO B  1 460 ? 28.691  -75.549 41.914  1.00 20.69  ? 2479 PRO B CA  1 
ATOM   7630  C C   . PRO B  1 460 ? 29.141  -75.760 43.359  1.00 21.76  ? 2479 PRO B C   1 
ATOM   7631  O O   . PRO B  1 460 ? 28.666  -76.672 44.033  1.00 23.40  ? 2479 PRO B O   1 
ATOM   7632  C CB  . PRO B  1 460 ? 29.443  -76.449 40.940  1.00 19.48  ? 2479 PRO B CB  1 
ATOM   7633  C CG  . PRO B  1 460 ? 29.277  -75.733 39.648  1.00 19.36  ? 2479 PRO B CG  1 
ATOM   7634  C CD  . PRO B  1 460 ? 29.555  -74.284 40.045  1.00 18.66  ? 2479 PRO B CD  1 
ATOM   7635  N N   . PHE B  1 461 ? 30.047  -74.916 43.840  1.00 21.07  ? 2480 PHE B N   1 
ATOM   7636  C CA  . PHE B  1 461 ? 30.540  -75.053 45.205  1.00 22.79  ? 2480 PHE B CA  1 
ATOM   7637  C C   . PHE B  1 461 ? 29.847  -74.137 46.215  1.00 24.53  ? 2480 PHE B C   1 
ATOM   7638  O O   . PHE B  1 461 ? 30.136  -74.192 47.414  1.00 24.22  ? 2480 PHE B O   1 
ATOM   7639  C CB  . PHE B  1 461 ? 32.048  -74.816 45.233  1.00 23.29  ? 2480 PHE B CB  1 
ATOM   7640  C CG  . PHE B  1 461 ? 32.796  -75.663 44.256  1.00 25.87  ? 2480 PHE B CG  1 
ATOM   7641  C CD1 . PHE B  1 461 ? 33.052  -75.200 42.969  1.00 26.15  ? 2480 PHE B CD1 1 
ATOM   7642  C CD2 . PHE B  1 461 ? 33.182  -76.956 44.593  1.00 26.91  ? 2480 PHE B CD2 1 
ATOM   7643  C CE1 . PHE B  1 461 ? 33.674  -76.012 42.031  1.00 25.20  ? 2480 PHE B CE1 1 
ATOM   7644  C CE2 . PHE B  1 461 ? 33.805  -77.777 43.659  1.00 28.31  ? 2480 PHE B CE2 1 
ATOM   7645  C CZ  . PHE B  1 461 ? 34.050  -77.301 42.374  1.00 27.93  ? 2480 PHE B CZ  1 
ATOM   7646  N N   . LEU B  1 462 ? 28.931  -73.302 45.730  1.00 25.85  ? 2481 LEU B N   1 
ATOM   7647  C CA  . LEU B  1 462 ? 28.201  -72.382 46.596  1.00 27.51  ? 2481 LEU B CA  1 
ATOM   7648  C C   . LEU B  1 462 ? 26.699  -72.668 46.546  1.00 29.56  ? 2481 LEU B C   1 
ATOM   7649  O O   . LEU B  1 462 ? 26.003  -72.538 47.552  1.00 29.37  ? 2481 LEU B O   1 
ATOM   7650  C CB  . LEU B  1 462 ? 28.479  -70.935 46.179  1.00 25.51  ? 2481 LEU B CB  1 
ATOM   7651  C CG  . LEU B  1 462 ? 29.956  -70.528 46.134  1.00 26.15  ? 2481 LEU B CG  1 
ATOM   7652  C CD1 . LEU B  1 462 ? 30.085  -69.141 45.514  1.00 28.34  ? 2481 LEU B CD1 1 
ATOM   7653  C CD2 . LEU B  1 462 ? 30.553  -70.559 47.536  1.00 24.56  ? 2481 LEU B CD2 1 
ATOM   7654  N N   . LYS B  1 463 ? 26.205  -73.047 45.371  1.00 30.35  ? 2482 LYS B N   1 
ATOM   7655  C CA  . LYS B  1 463 ? 24.789  -73.373 45.197  1.00 33.33  ? 2482 LYS B CA  1 
ATOM   7656  C C   . LYS B  1 463 ? 24.643  -74.892 45.244  1.00 33.27  ? 2482 LYS B C   1 
ATOM   7657  O O   . LYS B  1 463 ? 25.636  -75.615 45.193  1.00 33.89  ? 2482 LYS B O   1 
ATOM   7658  C CB  . LYS B  1 463 ? 24.270  -72.860 43.851  1.00 34.48  ? 2482 LYS B CB  1 
ATOM   7659  C CG  . LYS B  1 463 ? 23.956  -71.371 43.785  1.00 37.27  ? 2482 LYS B CG  1 
ATOM   7660  C CD  . LYS B  1 463 ? 23.543  -70.995 42.362  1.00 40.20  ? 2482 LYS B CD  1 
ATOM   7661  C CE  . LYS B  1 463 ? 23.059  -69.561 42.253  1.00 42.95  ? 2482 LYS B CE  1 
ATOM   7662  N NZ  . LYS B  1 463 ? 21.781  -69.349 42.992  1.00 46.47  ? 2482 LYS B NZ  1 
ATOM   7663  N N   . GLU B  1 464 ? 23.410  -75.378 45.325  1.00 33.60  ? 2483 GLU B N   1 
ATOM   7664  C CA  . GLU B  1 464 ? 23.183  -76.817 45.388  1.00 35.81  ? 2483 GLU B CA  1 
ATOM   7665  C C   . GLU B  1 464 ? 22.627  -77.405 44.098  1.00 33.89  ? 2483 GLU B C   1 
ATOM   7666  O O   . GLU B  1 464 ? 22.145  -76.682 43.230  1.00 33.22  ? 2483 GLU B O   1 
ATOM   7667  C CB  . GLU B  1 464 ? 22.227  -77.144 46.535  1.00 39.03  ? 2483 GLU B CB  1 
ATOM   7668  C CG  . GLU B  1 464 ? 22.715  -76.680 47.896  1.00 45.11  ? 2483 GLU B CG  1 
ATOM   7669  C CD  . GLU B  1 464 ? 21.793  -77.109 49.022  1.00 48.18  ? 2483 GLU B CD  1 
ATOM   7670  O OE1 . GLU B  1 464 ? 20.610  -76.700 49.016  1.00 50.01  ? 2483 GLU B OE1 1 
ATOM   7671  O OE2 . GLU B  1 464 ? 22.254  -77.858 49.911  1.00 50.49  ? 2483 GLU B OE2 1 
ATOM   7672  N N   . GLY B  1 465 ? 22.723  -78.727 43.981  1.00 33.74  ? 2484 GLY B N   1 
ATOM   7673  C CA  . GLY B  1 465 ? 22.181  -79.421 42.825  1.00 33.31  ? 2484 GLY B CA  1 
ATOM   7674  C C   . GLY B  1 465 ? 23.037  -79.633 41.590  1.00 32.63  ? 2484 GLY B C   1 
ATOM   7675  O O   . GLY B  1 465 ? 22.510  -80.033 40.550  1.00 33.48  ? 2484 GLY B O   1 
ATOM   7676  N N   . ALA B  1 466 ? 24.339  -79.384 41.682  1.00 29.18  ? 2485 ALA B N   1 
ATOM   7677  C CA  . ALA B  1 466 ? 25.206  -79.565 40.522  1.00 28.33  ? 2485 ALA B CA  1 
ATOM   7678  C C   . ALA B  1 466 ? 25.641  -81.023 40.352  1.00 27.26  ? 2485 ALA B C   1 
ATOM   7679  O O   . ALA B  1 466 ? 25.990  -81.695 41.321  1.00 25.69  ? 2485 ALA B O   1 
ATOM   7680  C CB  . ALA B  1 466 ? 26.431  -78.668 40.641  1.00 27.05  ? 2485 ALA B CB  1 
ATOM   7681  N N   . SER B  1 467 ? 25.615  -81.505 39.114  1.00 26.92  ? 2486 SER B N   1 
ATOM   7682  C CA  . SER B  1 467 ? 26.030  -82.875 38.823  1.00 26.12  ? 2486 SER B CA  1 
ATOM   7683  C C   . SER B  1 467 ? 27.551  -82.960 38.905  1.00 26.33  ? 2486 SER B C   1 
ATOM   7684  O O   . SER B  1 467 ? 28.244  -81.937 38.931  1.00 25.50  ? 2486 SER B O   1 
ATOM   7685  C CB  . SER B  1 467 ? 25.571  -83.284 37.419  1.00 26.44  ? 2486 SER B CB  1 
ATOM   7686  O OG  . SER B  1 467 ? 26.157  -82.463 36.422  1.00 23.88  ? 2486 SER B OG  1 
ATOM   7687  N N   . GLU B  1 468 ? 28.072  -84.181 38.947  1.00 25.26  ? 2487 GLU B N   1 
ATOM   7688  C CA  . GLU B  1 468 ? 29.507  -84.382 39.014  1.00 23.99  ? 2487 GLU B CA  1 
ATOM   7689  C C   . GLU B  1 468 ? 30.142  -83.726 37.791  1.00 21.64  ? 2487 GLU B C   1 
ATOM   7690  O O   . GLU B  1 468 ? 31.203  -83.107 37.880  1.00 20.43  ? 2487 GLU B O   1 
ATOM   7691  C CB  . GLU B  1 468 ? 29.826  -85.878 39.031  1.00 29.44  ? 2487 GLU B CB  1 
ATOM   7692  C CG  . GLU B  1 468 ? 31.291  -86.189 39.255  1.00 36.55  ? 2487 GLU B CG  1 
ATOM   7693  C CD  . GLU B  1 468 ? 31.810  -85.596 40.550  1.00 41.14  ? 2487 GLU B CD  1 
ATOM   7694  O OE1 . GLU B  1 468 ? 31.181  -85.835 41.605  1.00 42.72  ? 2487 GLU B OE1 1 
ATOM   7695  O OE2 . GLU B  1 468 ? 32.847  -84.895 40.511  1.00 43.08  ? 2487 GLU B OE2 1 
ATOM   7696  N N   . GLU B  1 469 ? 29.477  -83.862 36.651  1.00 19.37  ? 2488 GLU B N   1 
ATOM   7697  C CA  . GLU B  1 469 ? 29.956  -83.280 35.404  1.00 21.39  ? 2488 GLU B CA  1 
ATOM   7698  C C   . GLU B  1 469 ? 30.091  -81.753 35.511  1.00 20.11  ? 2488 GLU B C   1 
ATOM   7699  O O   . GLU B  1 469 ? 31.127  -81.191 35.166  1.00 20.31  ? 2488 GLU B O   1 
ATOM   7700  C CB  . GLU B  1 469 ? 28.992  -83.656 34.271  1.00 21.79  ? 2488 GLU B CB  1 
ATOM   7701  C CG  . GLU B  1 469 ? 29.233  -82.956 32.943  1.00 27.08  ? 2488 GLU B CG  1 
ATOM   7702  C CD  . GLU B  1 469 ? 28.262  -83.422 31.868  1.00 29.24  ? 2488 GLU B CD  1 
ATOM   7703  O OE1 . GLU B  1 469 ? 28.594  -84.380 31.134  1.00 31.68  ? 2488 GLU B OE1 1 
ATOM   7704  O OE2 . GLU B  1 469 ? 27.158  -82.844 31.769  1.00 28.05  ? 2488 GLU B OE2 1 
ATOM   7705  N N   . GLU B  1 470 ? 29.052  -81.089 36.002  1.00 20.18  ? 2489 GLU B N   1 
ATOM   7706  C CA  . GLU B  1 470 ? 29.071  -79.631 36.135  1.00 19.90  ? 2489 GLU B CA  1 
ATOM   7707  C C   . GLU B  1 470 ? 30.139  -79.193 37.137  1.00 19.61  ? 2489 GLU B C   1 
ATOM   7708  O O   . GLU B  1 470 ? 30.806  -78.172 36.949  1.00 18.00  ? 2489 GLU B O   1 
ATOM   7709  C CB  . GLU B  1 470 ? 27.691  -79.132 36.570  1.00 22.28  ? 2489 GLU B CB  1 
ATOM   7710  C CG  . GLU B  1 470 ? 27.418  -77.673 36.254  1.00 23.25  ? 2489 GLU B CG  1 
ATOM   7711  C CD  . GLU B  1 470 ? 25.999  -77.271 36.603  1.00 26.51  ? 2489 GLU B CD  1 
ATOM   7712  O OE1 . GLU B  1 470 ? 25.525  -76.239 36.085  1.00 28.94  ? 2489 GLU B OE1 1 
ATOM   7713  O OE2 . GLU B  1 470 ? 25.356  -77.984 37.402  1.00 27.66  ? 2489 GLU B OE2 1 
ATOM   7714  N N   . ILE B  1 471 ? 30.304  -79.973 38.198  1.00 19.65  ? 2490 ILE B N   1 
ATOM   7715  C CA  . ILE B  1 471 ? 31.305  -79.677 39.211  1.00 20.24  ? 2490 ILE B CA  1 
ATOM   7716  C C   . ILE B  1 471 ? 32.705  -79.727 38.601  1.00 19.93  ? 2490 ILE B C   1 
ATOM   7717  O O   . ILE B  1 471 ? 33.518  -78.830 38.814  1.00 18.16  ? 2490 ILE B O   1 
ATOM   7718  C CB  . ILE B  1 471 ? 31.241  -80.698 40.364  1.00 22.27  ? 2490 ILE B CB  1 
ATOM   7719  C CG1 . ILE B  1 471 ? 29.930  -80.519 41.143  1.00 23.90  ? 2490 ILE B CG1 1 
ATOM   7720  C CG2 . ILE B  1 471 ? 32.471  -80.560 41.249  1.00 19.91  ? 2490 ILE B CG2 1 
ATOM   7721  C CD1 . ILE B  1 471 ? 29.671  -81.603 42.197  1.00 25.17  ? 2490 ILE B CD1 1 
ATOM   7722  N N   . ARG B  1 472 ? 32.982  -80.781 37.843  1.00 19.42  ? 2491 ARG B N   1 
ATOM   7723  C CA  . ARG B  1 472 ? 34.286  -80.927 37.219  1.00 19.73  ? 2491 ARG B CA  1 
ATOM   7724  C C   . ARG B  1 472 ? 34.540  -79.832 36.190  1.00 17.38  ? 2491 ARG B C   1 
ATOM   7725  O O   . ARG B  1 472 ? 35.666  -79.363 36.057  1.00 17.24  ? 2491 ARG B O   1 
ATOM   7726  C CB  . ARG B  1 472 ? 34.414  -82.312 36.576  1.00 22.43  ? 2491 ARG B CB  1 
ATOM   7727  C CG  . ARG B  1 472 ? 34.619  -83.421 37.594  1.00 26.93  ? 2491 ARG B CG  1 
ATOM   7728  C CD  . ARG B  1 472 ? 34.399  -84.797 36.990  1.00 31.69  ? 2491 ARG B CD  1 
ATOM   7729  N NE  . ARG B  1 472 ? 34.641  -85.853 37.971  1.00 35.84  ? 2491 ARG B NE  1 
ATOM   7730  C CZ  . ARG B  1 472 ? 35.848  -86.295 38.313  1.00 39.10  ? 2491 ARG B CZ  1 
ATOM   7731  N NH1 . ARG B  1 472 ? 36.935  -85.778 37.750  1.00 37.76  ? 2491 ARG B NH1 1 
ATOM   7732  N NH2 . ARG B  1 472 ? 35.969  -87.253 39.223  1.00 40.82  ? 2491 ARG B NH2 1 
ATOM   7733  N N   . LEU B  1 473 ? 33.493  -79.422 35.479  1.00 16.95  ? 2492 LEU B N   1 
ATOM   7734  C CA  . LEU B  1 473 ? 33.613  -78.374 34.472  1.00 18.14  ? 2492 LEU B CA  1 
ATOM   7735  C C   . LEU B  1 473 ? 34.047  -77.066 35.134  1.00 19.11  ? 2492 LEU B C   1 
ATOM   7736  O O   . LEU B  1 473 ? 34.911  -76.352 34.618  1.00 17.40  ? 2492 LEU B O   1 
ATOM   7737  C CB  . LEU B  1 473 ? 32.281  -78.173 33.744  1.00 19.71  ? 2492 LEU B CB  1 
ATOM   7738  C CG  . LEU B  1 473 ? 32.219  -77.033 32.722  1.00 19.42  ? 2492 LEU B CG  1 
ATOM   7739  C CD1 . LEU B  1 473 ? 33.143  -77.327 31.544  1.00 22.16  ? 2492 LEU B CD1 1 
ATOM   7740  C CD2 . LEU B  1 473 ? 30.792  -76.865 32.242  1.00 21.19  ? 2492 LEU B CD2 1 
ATOM   7741  N N   . SER B  1 474 ? 33.452  -76.756 36.282  1.00 17.79  ? 2493 SER B N   1 
ATOM   7742  C CA  . SER B  1 474 ? 33.805  -75.542 37.004  1.00 17.52  ? 2493 SER B CA  1 
ATOM   7743  C C   . SER B  1 474 ? 35.261  -75.606 37.456  1.00 18.16  ? 2493 SER B C   1 
ATOM   7744  O O   . SER B  1 474 ? 36.017  -74.650 37.265  1.00 18.63  ? 2493 SER B O   1 
ATOM   7745  C CB  . SER B  1 474 ? 32.890  -75.349 38.219  1.00 18.62  ? 2493 SER B CB  1 
ATOM   7746  O OG  . SER B  1 474 ? 33.248  -74.176 38.928  1.00 17.54  ? 2493 SER B OG  1 
ATOM   7747  N N   . LYS B  1 475 ? 35.662  -76.728 38.053  1.00 17.95  ? 2494 LYS B N   1 
ATOM   7748  C CA  . LYS B  1 475 ? 37.043  -76.873 38.505  1.00 18.23  ? 2494 LYS B CA  1 
ATOM   7749  C C   . LYS B  1 475 ? 38.028  -76.633 37.363  1.00 17.57  ? 2494 LYS B C   1 
ATOM   7750  O O   . LYS B  1 475 ? 39.050  -75.965 37.541  1.00 15.98  ? 2494 LYS B O   1 
ATOM   7751  C CB  . LYS B  1 475 ? 37.286  -78.265 39.090  1.00 18.62  ? 2494 LYS B CB  1 
ATOM   7752  C CG  . LYS B  1 475 ? 36.585  -78.532 40.414  1.00 24.07  ? 2494 LYS B CG  1 
ATOM   7753  C CD  . LYS B  1 475 ? 36.954  -79.916 40.954  1.00 28.58  ? 2494 LYS B CD  1 
ATOM   7754  C CE  . LYS B  1 475 ? 36.248  -80.208 42.273  1.00 31.60  ? 2494 LYS B CE  1 
ATOM   7755  N NZ  . LYS B  1 475 ? 36.576  -81.565 42.804  1.00 33.86  ? 2494 LYS B NZ  1 
ATOM   7756  N N   . MET B  1 476 ? 37.719  -77.193 36.196  1.00 17.81  ? 2495 MET B N   1 
ATOM   7757  C CA  . MET B  1 476 ? 38.577  -77.043 35.026  1.00 17.22  ? 2495 MET B CA  1 
ATOM   7758  C C   . MET B  1 476 ? 38.616  -75.592 34.545  1.00 16.53  ? 2495 MET B C   1 
ATOM   7759  O O   . MET B  1 476 ? 39.688  -75.058 34.260  1.00 16.97  ? 2495 MET B O   1 
ATOM   7760  C CB  . MET B  1 476 ? 38.086  -77.937 33.887  1.00 17.61  ? 2495 MET B CB  1 
ATOM   7761  C CG  . MET B  1 476 ? 38.981  -77.906 32.659  1.00 20.95  ? 2495 MET B CG  1 
ATOM   7762  S SD  . MET B  1 476 ? 38.162  -78.574 31.202  1.00 22.63  ? 2495 MET B SD  1 
ATOM   7763  C CE  . MET B  1 476 ? 37.126  -77.171 30.729  1.00 25.18  ? 2495 MET B CE  1 
ATOM   7764  N N   . VAL B  1 477 ? 37.450  -74.956 34.457  1.00 15.49  ? 2496 VAL B N   1 
ATOM   7765  C CA  . VAL B  1 477 ? 37.385  -73.572 34.002  1.00 15.97  ? 2496 VAL B CA  1 
ATOM   7766  C C   . VAL B  1 477 ? 38.143  -72.643 34.948  1.00 14.93  ? 2496 VAL B C   1 
ATOM   7767  O O   . VAL B  1 477 ? 38.924  -71.805 34.508  1.00 15.77  ? 2496 VAL B O   1 
ATOM   7768  C CB  . VAL B  1 477 ? 35.916  -73.091 33.855  1.00 15.89  ? 2496 VAL B CB  1 
ATOM   7769  C CG1 . VAL B  1 477 ? 35.880  -71.580 33.582  1.00 15.06  ? 2496 VAL B CG1 1 
ATOM   7770  C CG2 . VAL B  1 477 ? 35.243  -73.828 32.702  1.00 15.80  ? 2496 VAL B CG2 1 
ATOM   7771  N N   . MET B  1 478 ? 37.937  -72.800 36.250  1.00 14.15  ? 2497 MET B N   1 
ATOM   7772  C CA  . MET B  1 478 ? 38.632  -71.944 37.200  1.00 14.28  ? 2497 MET B CA  1 
ATOM   7773  C C   . MET B  1 478 ? 40.143  -72.144 37.111  1.00 14.92  ? 2497 MET B C   1 
ATOM   7774  O O   . MET B  1 478 ? 40.913  -71.182 37.181  1.00 14.46  ? 2497 MET B O   1 
ATOM   7775  C CB  . MET B  1 478 ? 38.151  -72.219 38.634  1.00 14.26  ? 2497 MET B CB  1 
ATOM   7776  C CG  . MET B  1 478 ? 36.684  -71.877 38.880  1.00 14.55  ? 2497 MET B CG  1 
ATOM   7777  S SD  . MET B  1 478 ? 36.287  -71.850 40.655  1.00 18.95  ? 2497 MET B SD  1 
ATOM   7778  C CE  . MET B  1 478 ? 36.324  -73.626 41.034  1.00 13.81  ? 2497 MET B CE  1 
ATOM   7779  N N   . LYS B  1 479 ? 40.574  -73.393 36.958  1.00 15.11  ? 2498 LYS B N   1 
ATOM   7780  C CA  . LYS B  1 479 ? 42.000  -73.666 36.862  1.00 16.83  ? 2498 LYS B CA  1 
ATOM   7781  C C   . LYS B  1 479 ? 42.573  -73.007 35.593  1.00 15.21  ? 2498 LYS B C   1 
ATOM   7782  O O   . LYS B  1 479 ? 43.650  -72.417 35.638  1.00 17.71  ? 2498 LYS B O   1 
ATOM   7783  C CB  . LYS B  1 479 ? 42.262  -75.182 36.868  1.00 16.80  ? 2498 LYS B CB  1 
ATOM   7784  C CG  . LYS B  1 479 ? 43.727  -75.552 37.112  1.00 21.74  ? 2498 LYS B CG  1 
ATOM   7785  C CD  . LYS B  1 479 ? 43.918  -77.056 37.296  1.00 24.67  ? 2498 LYS B CD  1 
ATOM   7786  C CE  . LYS B  1 479 ? 43.192  -77.564 38.535  1.00 27.67  ? 2498 LYS B CE  1 
ATOM   7787  N NZ  . LYS B  1 479 ? 43.642  -76.859 39.774  1.00 30.36  ? 2498 LYS B NZ  1 
ATOM   7788  N N   . PHE B  1 480 ? 41.852  -73.094 34.475  1.00 15.36  ? 2499 PHE B N   1 
ATOM   7789  C CA  . PHE B  1 480 ? 42.304  -72.472 33.223  1.00 15.64  ? 2499 PHE B CA  1 
ATOM   7790  C C   . PHE B  1 480 ? 42.449  -70.955 33.401  1.00 18.58  ? 2499 PHE B C   1 
ATOM   7791  O O   . PHE B  1 480 ? 43.480  -70.368 33.056  1.00 19.08  ? 2499 PHE B O   1 
ATOM   7792  C CB  . PHE B  1 480 ? 41.297  -72.725 32.095  1.00 14.94  ? 2499 PHE B CB  1 
ATOM   7793  C CG  . PHE B  1 480 ? 41.566  -73.962 31.281  1.00 15.03  ? 2499 PHE B CG  1 
ATOM   7794  C CD1 . PHE B  1 480 ? 40.506  -74.707 30.772  1.00 15.95  ? 2499 PHE B CD1 1 
ATOM   7795  C CD2 . PHE B  1 480 ? 42.864  -74.346 30.963  1.00 16.24  ? 2499 PHE B CD2 1 
ATOM   7796  C CE1 . PHE B  1 480 ? 40.732  -75.816 29.948  1.00 16.93  ? 2499 PHE B CE1 1 
ATOM   7797  C CE2 . PHE B  1 480 ? 43.103  -75.455 30.139  1.00 16.51  ? 2499 PHE B CE2 1 
ATOM   7798  C CZ  . PHE B  1 480 ? 42.034  -76.188 29.632  1.00 15.23  ? 2499 PHE B CZ  1 
ATOM   7799  N N   . TRP B  1 481 ? 41.404  -70.324 33.931  1.00 17.10  ? 2500 TRP B N   1 
ATOM   7800  C CA  . TRP B  1 481 ? 41.407  -68.875 34.140  1.00 16.81  ? 2500 TRP B CA  1 
ATOM   7801  C C   . TRP B  1 481 ? 42.526  -68.429 35.078  1.00 15.48  ? 2500 TRP B C   1 
ATOM   7802  O O   . TRP B  1 481 ? 43.199  -67.429 34.825  1.00 16.74  ? 2500 TRP B O   1 
ATOM   7803  C CB  . TRP B  1 481 ? 40.062  -68.414 34.721  1.00 16.29  ? 2500 TRP B CB  1 
ATOM   7804  C CG  . TRP B  1 481 ? 39.045  -67.904 33.733  1.00 15.78  ? 2500 TRP B CG  1 
ATOM   7805  C CD1 . TRP B  1 481 ? 38.319  -66.749 33.843  1.00 15.05  ? 2500 TRP B CD1 1 
ATOM   7806  C CD2 . TRP B  1 481 ? 38.583  -68.552 32.537  1.00 16.22  ? 2500 TRP B CD2 1 
ATOM   7807  N NE1 . TRP B  1 481 ? 37.438  -66.637 32.797  1.00 16.32  ? 2500 TRP B NE1 1 
ATOM   7808  C CE2 . TRP B  1 481 ? 37.575  -67.728 31.980  1.00 16.19  ? 2500 TRP B CE2 1 
ATOM   7809  C CE3 . TRP B  1 481 ? 38.918  -69.745 31.884  1.00 15.74  ? 2500 TRP B CE3 1 
ATOM   7810  C CZ2 . TRP B  1 481 ? 36.899  -68.061 30.800  1.00 16.54  ? 2500 TRP B CZ2 1 
ATOM   7811  C CZ3 . TRP B  1 481 ? 38.244  -70.077 30.702  1.00 14.25  ? 2500 TRP B CZ3 1 
ATOM   7812  C CH2 . TRP B  1 481 ? 37.248  -69.237 30.177  1.00 18.47  ? 2500 TRP B CH2 1 
ATOM   7813  N N   . ALA B  1 482 ? 42.711  -69.162 36.171  1.00 15.19  ? 2501 ALA B N   1 
ATOM   7814  C CA  . ALA B  1 482 ? 43.744  -68.823 37.141  1.00 15.61  ? 2501 ALA B CA  1 
ATOM   7815  C C   . ALA B  1 482 ? 45.144  -69.131 36.615  1.00 15.75  ? 2501 ALA B C   1 
ATOM   7816  O O   . ALA B  1 482 ? 46.103  -68.456 36.990  1.00 15.50  ? 2501 ALA B O   1 
ATOM   7817  C CB  . ALA B  1 482 ? 43.501  -69.559 38.460  1.00 14.35  ? 2501 ALA B CB  1 
ATOM   7818  N N   . ASN B  1 483 ? 45.277  -70.156 35.773  1.00 16.48  ? 2502 ASN B N   1 
ATOM   7819  C CA  . ASN B  1 483 ? 46.591  -70.461 35.200  1.00 17.43  ? 2502 ASN B CA  1 
ATOM   7820  C C   . ASN B  1 483 ? 46.937  -69.281 34.312  1.00 16.07  ? 2502 ASN B C   1 
ATOM   7821  O O   . ASN B  1 483 ? 48.082  -68.837 34.260  1.00 14.99  ? 2502 ASN B O   1 
ATOM   7822  C CB  . ASN B  1 483 ? 46.566  -71.735 34.344  1.00 17.84  ? 2502 ASN B CB  1 
ATOM   7823  C CG  . ASN B  1 483 ? 46.646  -72.999 35.174  1.00 20.20  ? 2502 ASN B CG  1 
ATOM   7824  O OD1 . ASN B  1 483 ? 46.941  -72.956 36.372  1.00 19.08  ? 2502 ASN B OD1 1 
ATOM   7825  N ND2 . ASN B  1 483 ? 46.395  -74.139 34.538  1.00 19.93  ? 2502 ASN B ND2 1 
ATOM   7826  N N   . PHE B  1 484 ? 45.926  -68.776 33.615  1.00 16.11  ? 2503 PHE B N   1 
ATOM   7827  C CA  . PHE B  1 484 ? 46.109  -67.636 32.732  1.00 16.23  ? 2503 PHE B CA  1 
ATOM   7828  C C   . PHE B  1 484 ? 46.516  -66.419 33.550  1.00 17.84  ? 2503 PHE B C   1 
ATOM   7829  O O   . PHE B  1 484 ? 47.407  -65.663 33.153  1.00 17.19  ? 2503 PHE B O   1 
ATOM   7830  C CB  . PHE B  1 484 ? 44.816  -67.334 31.978  1.00 14.82  ? 2503 PHE B CB  1 
ATOM   7831  C CG  . PHE B  1 484 ? 44.970  -66.279 30.911  1.00 18.56  ? 2503 PHE B CG  1 
ATOM   7832  C CD1 . PHE B  1 484 ? 45.670  -66.554 29.735  1.00 16.78  ? 2503 PHE B CD1 1 
ATOM   7833  C CD2 . PHE B  1 484 ? 44.415  -65.010 31.080  1.00 15.71  ? 2503 PHE B CD2 1 
ATOM   7834  C CE1 . PHE B  1 484 ? 45.812  -65.582 28.742  1.00 18.37  ? 2503 PHE B CE1 1 
ATOM   7835  C CE2 . PHE B  1 484 ? 44.551  -64.029 30.095  1.00 17.76  ? 2503 PHE B CE2 1 
ATOM   7836  C CZ  . PHE B  1 484 ? 45.250  -64.314 28.921  1.00 16.65  ? 2503 PHE B CZ  1 
ATOM   7837  N N   . ALA B  1 485 ? 45.866  -66.236 34.698  1.00 17.29  ? 2504 ALA B N   1 
ATOM   7838  C CA  . ALA B  1 485 ? 46.174  -65.102 35.565  1.00 17.56  ? 2504 ALA B CA  1 
ATOM   7839  C C   . ALA B  1 485 ? 47.616  -65.133 36.044  1.00 17.89  ? 2504 ALA B C   1 
ATOM   7840  O O   . ALA B  1 485 ? 48.262  -64.096 36.137  1.00 18.60  ? 2504 ALA B O   1 
ATOM   7841  C CB  . ALA B  1 485 ? 45.225  -65.067 36.767  1.00 13.70  ? 2504 ALA B CB  1 
ATOM   7842  N N   . ARG B  1 486 ? 48.153  -66.304 36.357  1.00 18.92  ? 2505 ARG B N   1 
ATOM   7843  C CA  . ARG B  1 486 ? 49.531  -66.281 36.815  1.00 19.79  ? 2505 ARG B CA  1 
ATOM   7844  C C   . ARG B  1 486 ? 50.591  -66.434 35.736  1.00 18.79  ? 2505 ARG B C   1 
ATOM   7845  O O   . ARG B  1 486 ? 51.703  -65.951 35.917  1.00 18.45  ? 2505 ARG B O   1 
ATOM   7846  C CB  . ARG B  1 486 ? 49.758  -67.298 37.945  1.00 23.15  ? 2505 ARG B CB  1 
ATOM   7847  C CG  . ARG B  1 486 ? 49.184  -68.656 37.709  1.00 23.30  ? 2505 ARG B CG  1 
ATOM   7848  C CD  . ARG B  1 486 ? 49.016  -69.432 39.022  1.00 22.49  ? 2505 ARG B CD  1 
ATOM   7849  N NE  . ARG B  1 486 ? 48.132  -70.569 38.787  1.00 23.53  ? 2505 ARG B NE  1 
ATOM   7850  C CZ  . ARG B  1 486 ? 47.051  -70.856 39.502  1.00 23.08  ? 2505 ARG B CZ  1 
ATOM   7851  N NH1 . ARG B  1 486 ? 46.704  -70.098 40.538  1.00 24.17  ? 2505 ARG B NH1 1 
ATOM   7852  N NH2 . ARG B  1 486 ? 46.286  -71.874 39.141  1.00 22.98  ? 2505 ARG B NH2 1 
ATOM   7853  N N   . ASN B  1 487 ? 50.247  -67.039 34.600  1.00 17.65  ? 2506 ASN B N   1 
ATOM   7854  C CA  . ASN B  1 487 ? 51.242  -67.255 33.545  1.00 20.24  ? 2506 ASN B CA  1 
ATOM   7855  C C   . ASN B  1 487 ? 50.993  -66.626 32.179  1.00 18.43  ? 2506 ASN B C   1 
ATOM   7856  O O   . ASN B  1 487 ? 51.888  -66.618 31.342  1.00 19.25  ? 2506 ASN B O   1 
ATOM   7857  C CB  . ASN B  1 487 ? 51.464  -68.758 33.332  1.00 20.75  ? 2506 ASN B CB  1 
ATOM   7858  C CG  . ASN B  1 487 ? 51.910  -69.459 34.589  1.00 23.48  ? 2506 ASN B CG  1 
ATOM   7859  O OD1 . ASN B  1 487 ? 52.731  -68.934 35.343  1.00 27.19  ? 2506 ASN B OD1 1 
ATOM   7860  N ND2 . ASN B  1 487 ? 51.382  -70.659 34.820  1.00 22.89  ? 2506 ASN B ND2 1 
ATOM   7861  N N   . GLY B  1 488 ? 49.791  -66.114 31.947  1.00 16.46  ? 2507 GLY B N   1 
ATOM   7862  C CA  . GLY B  1 488 ? 49.490  -65.523 30.658  1.00 16.01  ? 2507 GLY B CA  1 
ATOM   7863  C C   . GLY B  1 488 ? 49.308  -66.632 29.641  1.00 16.99  ? 2507 GLY B C   1 
ATOM   7864  O O   . GLY B  1 488 ? 49.318  -66.398 28.438  1.00 15.94  ? 2507 GLY B O   1 
ATOM   7865  N N   . ASN B  1 489 ? 49.136  -67.846 30.159  1.00 17.66  ? 2508 ASN B N   1 
ATOM   7866  C CA  . ASN B  1 489 ? 48.942  -69.063 29.373  1.00 17.42  ? 2508 ASN B CA  1 
ATOM   7867  C C   . ASN B  1 489 ? 48.032  -69.908 30.275  1.00 16.20  ? 2508 ASN B C   1 
ATOM   7868  O O   . ASN B  1 489 ? 48.360  -70.145 31.433  1.00 15.85  ? 2508 ASN B O   1 
ATOM   7869  C CB  . ASN B  1 489 ? 50.292  -69.777 29.175  1.00 17.88  ? 2508 ASN B CB  1 
ATOM   7870  C CG  . ASN B  1 489 ? 50.191  -71.003 28.275  1.00 19.79  ? 2508 ASN B CG  1 
ATOM   7871  O OD1 . ASN B  1 489 ? 49.259  -71.799 28.382  1.00 20.14  ? 2508 ASN B OD1 1 
ATOM   7872  N ND2 . ASN B  1 489 ? 51.167  -71.163 27.387  1.00 22.30  ? 2508 ASN B ND2 1 
ATOM   7873  N N   . PRO B  1 490 ? 46.882  -70.367 29.760  1.00 15.77  ? 2509 PRO B N   1 
ATOM   7874  C CA  . PRO B  1 490 ? 45.973  -71.172 30.583  1.00 16.68  ? 2509 PRO B CA  1 
ATOM   7875  C C   . PRO B  1 490 ? 46.400  -72.619 30.838  1.00 19.54  ? 2509 PRO B C   1 
ATOM   7876  O O   . PRO B  1 490 ? 45.980  -73.235 31.816  1.00 21.50  ? 2509 PRO B O   1 
ATOM   7877  C CB  . PRO B  1 490 ? 44.667  -71.098 29.806  1.00 15.28  ? 2509 PRO B CB  1 
ATOM   7878  C CG  . PRO B  1 490 ? 45.149  -71.101 28.381  1.00 17.87  ? 2509 PRO B CG  1 
ATOM   7879  C CD  . PRO B  1 490 ? 46.308  -70.122 28.423  1.00 15.83  ? 2509 PRO B CD  1 
ATOM   7880  N N   . ASN B  1 491 ? 47.233  -73.159 29.961  1.00 18.54  ? 2510 ASN B N   1 
ATOM   7881  C CA  . ASN B  1 491 ? 47.661  -74.546 30.085  1.00 19.28  ? 2510 ASN B CA  1 
ATOM   7882  C C   . ASN B  1 491 ? 48.282  -74.966 31.409  1.00 19.49  ? 2510 ASN B C   1 
ATOM   7883  O O   . ASN B  1 491 ? 48.977  -74.197 32.068  1.00 19.94  ? 2510 ASN B O   1 
ATOM   7884  C CB  . ASN B  1 491 ? 48.594  -74.890 28.931  1.00 17.38  ? 2510 ASN B CB  1 
ATOM   7885  C CG  . ASN B  1 491 ? 47.868  -74.919 27.613  1.00 16.13  ? 2510 ASN B CG  1 
ATOM   7886  O OD1 . ASN B  1 491 ? 47.019  -75.782 27.381  1.00 20.19  ? 2510 ASN B OD1 1 
ATOM   7887  N ND2 . ASN B  1 491 ? 48.174  -73.964 26.746  1.00 19.38  ? 2510 ASN B ND2 1 
ATOM   7888  N N   . GLY B  1 492 ? 48.012  -76.209 31.791  1.00 21.49  ? 2511 GLY B N   1 
ATOM   7889  C CA  . GLY B  1 492 ? 48.545  -76.733 33.032  1.00 22.95  ? 2511 GLY B CA  1 
ATOM   7890  C C   . GLY B  1 492 ? 48.401  -78.239 33.090  1.00 26.58  ? 2511 GLY B C   1 
ATOM   7891  O O   . GLY B  1 492 ? 47.662  -78.831 32.309  1.00 25.04  ? 2511 GLY B O   1 
ATOM   7892  N N   . GLU B  1 493 ? 49.106  -78.863 34.023  1.00 30.19  ? 2512 GLU B N   1 
ATOM   7893  C CA  . GLU B  1 493 ? 49.047  -80.310 34.175  1.00 33.84  ? 2512 GLU B CA  1 
ATOM   7894  C C   . GLU B  1 493 ? 47.620  -80.736 34.514  1.00 33.51  ? 2512 GLU B C   1 
ATOM   7895  O O   . GLU B  1 493 ? 46.934  -80.074 35.297  1.00 34.46  ? 2512 GLU B O   1 
ATOM   7896  C CB  . GLU B  1 493 ? 50.004  -80.752 35.285  1.00 37.61  ? 2512 GLU B CB  1 
ATOM   7897  C CG  . GLU B  1 493 ? 50.279  -82.249 35.326  1.00 43.82  ? 2512 GLU B CG  1 
ATOM   7898  C CD  . GLU B  1 493 ? 51.272  -82.619 36.413  1.00 47.49  ? 2512 GLU B CD  1 
ATOM   7899  O OE1 . GLU B  1 493 ? 52.373  -82.020 36.443  1.00 49.65  ? 2512 GLU B OE1 1 
ATOM   7900  O OE2 . GLU B  1 493 ? 50.955  -83.506 37.236  1.00 48.55  ? 2512 GLU B OE2 1 
ATOM   7901  N N   . GLY B  1 494 ? 47.172  -81.828 33.902  1.00 32.74  ? 2513 GLY B N   1 
ATOM   7902  C CA  . GLY B  1 494 ? 45.836  -82.334 34.167  1.00 31.82  ? 2513 GLY B CA  1 
ATOM   7903  C C   . GLY B  1 494 ? 44.699  -81.621 33.458  1.00 31.02  ? 2513 GLY B C   1 
ATOM   7904  O O   . GLY B  1 494 ? 43.532  -81.889 33.744  1.00 33.78  ? 2513 GLY B O   1 
ATOM   7905  N N   . LEU B  1 495 ? 45.027  -80.717 32.540  1.00 27.49  ? 2514 LEU B N   1 
ATOM   7906  C CA  . LEU B  1 495 ? 44.012  -79.976 31.794  1.00 24.46  ? 2514 LEU B CA  1 
ATOM   7907  C C   . LEU B  1 495 ? 44.153  -80.224 30.301  1.00 24.04  ? 2514 LEU B C   1 
ATOM   7908  O O   . LEU B  1 495 ? 45.258  -80.452 29.806  1.00 23.32  ? 2514 LEU B O   1 
ATOM   7909  C CB  . LEU B  1 495 ? 44.153  -78.468 32.040  1.00 23.30  ? 2514 LEU B CB  1 
ATOM   7910  C CG  . LEU B  1 495 ? 43.894  -77.907 33.440  1.00 23.16  ? 2514 LEU B CG  1 
ATOM   7911  C CD1 . LEU B  1 495 ? 44.257  -76.427 33.475  1.00 22.59  ? 2514 LEU B CD1 1 
ATOM   7912  C CD2 . LEU B  1 495 ? 42.434  -78.115 33.805  1.00 21.28  ? 2514 LEU B CD2 1 
ATOM   7913  N N   . PRO B  1 496 ? 43.033  -80.184 29.563  1.00 22.19  ? 2515 PRO B N   1 
ATOM   7914  C CA  . PRO B  1 496 ? 43.045  -80.393 28.113  1.00 22.35  ? 2515 PRO B CA  1 
ATOM   7915  C C   . PRO B  1 496 ? 43.953  -79.334 27.503  1.00 22.60  ? 2515 PRO B C   1 
ATOM   7916  O O   . PRO B  1 496 ? 44.026  -78.212 28.009  1.00 19.56  ? 2515 PRO B O   1 
ATOM   7917  C CB  . PRO B  1 496 ? 41.590  -80.170 27.724  1.00 21.55  ? 2515 PRO B CB  1 
ATOM   7918  C CG  . PRO B  1 496 ? 40.850  -80.644 28.929  1.00 22.80  ? 2515 PRO B CG  1 
ATOM   7919  C CD  . PRO B  1 496 ? 41.652  -80.054 30.059  1.00 22.67  ? 2515 PRO B CD  1 
ATOM   7920  N N   . HIS B  1 497 ? 44.639  -79.670 26.417  1.00 23.20  ? 2516 HIS B N   1 
ATOM   7921  C CA  . HIS B  1 497 ? 45.520  -78.693 25.813  1.00 22.16  ? 2516 HIS B CA  1 
ATOM   7922  C C   . HIS B  1 497 ? 44.729  -77.587 25.138  1.00 21.55  ? 2516 HIS B C   1 
ATOM   7923  O O   . HIS B  1 497 ? 43.789  -77.844 24.384  1.00 21.93  ? 2516 HIS B O   1 
ATOM   7924  C CB  . HIS B  1 497 ? 46.464  -79.337 24.797  1.00 24.39  ? 2516 HIS B CB  1 
ATOM   7925  C CG  . HIS B  1 497 ? 47.509  -78.393 24.294  1.00 24.77  ? 2516 HIS B CG  1 
ATOM   7926  N ND1 . HIS B  1 497 ? 47.525  -77.918 23.000  1.00 24.91  ? 2516 HIS B ND1 1 
ATOM   7927  C CD2 . HIS B  1 497 ? 48.523  -77.768 24.938  1.00 24.83  ? 2516 HIS B CD2 1 
ATOM   7928  C CE1 . HIS B  1 497 ? 48.501  -77.037 22.870  1.00 25.93  ? 2516 HIS B CE1 1 
ATOM   7929  N NE2 . HIS B  1 497 ? 49.121  -76.927 24.032  1.00 27.32  ? 2516 HIS B NE2 1 
ATOM   7930  N N   . TRP B  1 498 ? 45.124  -76.353 25.425  1.00 20.45  ? 2517 TRP B N   1 
ATOM   7931  C CA  . TRP B  1 498 ? 44.482  -75.179 24.861  1.00 19.72  ? 2517 TRP B CA  1 
ATOM   7932  C C   . TRP B  1 498 ? 45.522  -74.496 23.964  1.00 18.84  ? 2517 TRP B C   1 
ATOM   7933  O O   . TRP B  1 498 ? 46.448  -73.845 24.445  1.00 17.94  ? 2517 TRP B O   1 
ATOM   7934  C CB  . TRP B  1 498 ? 44.047  -74.233 25.988  1.00 18.60  ? 2517 TRP B CB  1 
ATOM   7935  C CG  . TRP B  1 498 ? 43.173  -73.101 25.535  1.00 18.70  ? 2517 TRP B CG  1 
ATOM   7936  C CD1 . TRP B  1 498 ? 43.121  -72.547 24.283  1.00 17.69  ? 2517 TRP B CD1 1 
ATOM   7937  C CD2 . TRP B  1 498 ? 42.255  -72.353 26.342  1.00 17.84  ? 2517 TRP B CD2 1 
ATOM   7938  N NE1 . TRP B  1 498 ? 42.229  -71.500 24.264  1.00 18.13  ? 2517 TRP B NE1 1 
ATOM   7939  C CE2 . TRP B  1 498 ? 41.684  -71.359 25.515  1.00 18.59  ? 2517 TRP B CE2 1 
ATOM   7940  C CE3 . TRP B  1 498 ? 41.860  -72.426 27.686  1.00 17.96  ? 2517 TRP B CE3 1 
ATOM   7941  C CZ2 . TRP B  1 498 ? 40.736  -70.439 25.989  1.00 16.16  ? 2517 TRP B CZ2 1 
ATOM   7942  C CZ3 . TRP B  1 498 ? 40.916  -71.509 28.158  1.00 15.61  ? 2517 TRP B CZ3 1 
ATOM   7943  C CH2 . TRP B  1 498 ? 40.368  -70.531 27.310  1.00 17.36  ? 2517 TRP B CH2 1 
ATOM   7944  N N   . PRO B  1 499 ? 45.384  -74.648 22.643  1.00 19.81  ? 2518 PRO B N   1 
ATOM   7945  C CA  . PRO B  1 499 ? 46.343  -74.030 21.729  1.00 21.05  ? 2518 PRO B CA  1 
ATOM   7946  C C   . PRO B  1 499 ? 46.233  -72.510 21.699  1.00 22.58  ? 2518 PRO B C   1 
ATOM   7947  O O   . PRO B  1 499 ? 45.157  -71.945 21.906  1.00 23.01  ? 2518 PRO B O   1 
ATOM   7948  C CB  . PRO B  1 499 ? 45.985  -74.660 20.387  1.00 19.64  ? 2518 PRO B CB  1 
ATOM   7949  C CG  . PRO B  1 499 ? 44.501  -74.790 20.485  1.00 21.69  ? 2518 PRO B CG  1 
ATOM   7950  C CD  . PRO B  1 499 ? 44.311  -75.330 21.898  1.00 19.79  ? 2518 PRO B CD  1 
ATOM   7951  N N   . GLU B  1 500 ? 47.354  -71.848 21.448  1.00 22.89  ? 2519 GLU B N   1 
ATOM   7952  C CA  . GLU B  1 500 ? 47.356  -70.398 21.365  1.00 25.87  ? 2519 GLU B CA  1 
ATOM   7953  C C   . GLU B  1 500 ? 46.652  -70.024 20.062  1.00 23.74  ? 2519 GLU B C   1 
ATOM   7954  O O   . GLU B  1 500 ? 46.684  -70.781 19.091  1.00 25.86  ? 2519 GLU B O   1 
ATOM   7955  C CB  . GLU B  1 500 ? 48.795  -69.870 21.368  1.00 29.82  ? 2519 GLU B CB  1 
ATOM   7956  C CG  . GLU B  1 500 ? 48.905  -68.353 21.339  1.00 36.06  ? 2519 GLU B CG  1 
ATOM   7957  C CD  . GLU B  1 500 ? 50.344  -67.864 21.364  1.00 40.18  ? 2519 GLU B CD  1 
ATOM   7958  O OE1 . GLU B  1 500 ? 50.551  -66.633 21.340  1.00 43.57  ? 2519 GLU B OE1 1 
ATOM   7959  O OE2 . GLU B  1 500 ? 51.267  -68.705 21.406  1.00 41.15  ? 2519 GLU B OE2 1 
ATOM   7960  N N   . TYR B  1 501 ? 46.000  -68.870 20.044  1.00 21.02  ? 2520 TYR B N   1 
ATOM   7961  C CA  . TYR B  1 501 ? 45.302  -68.416 18.850  1.00 21.39  ? 2520 TYR B CA  1 
ATOM   7962  C C   . TYR B  1 501 ? 46.322  -67.746 17.931  1.00 22.61  ? 2520 TYR B C   1 
ATOM   7963  O O   . TYR B  1 501 ? 46.544  -66.538 18.009  1.00 21.47  ? 2520 TYR B O   1 
ATOM   7964  C CB  . TYR B  1 501 ? 44.202  -67.417 19.227  1.00 20.42  ? 2520 TYR B CB  1 
ATOM   7965  C CG  . TYR B  1 501 ? 43.292  -67.044 18.083  1.00 19.88  ? 2520 TYR B CG  1 
ATOM   7966  C CD1 . TYR B  1 501 ? 42.321  -67.928 17.621  1.00 19.02  ? 2520 TYR B CD1 1 
ATOM   7967  C CD2 . TYR B  1 501 ? 43.424  -65.817 17.440  1.00 18.50  ? 2520 TYR B CD2 1 
ATOM   7968  C CE1 . TYR B  1 501 ? 41.505  -67.599 16.543  1.00 19.12  ? 2520 TYR B CE1 1 
ATOM   7969  C CE2 . TYR B  1 501 ? 42.616  -65.478 16.366  1.00 20.66  ? 2520 TYR B CE2 1 
ATOM   7970  C CZ  . TYR B  1 501 ? 41.660  -66.372 15.921  1.00 19.63  ? 2520 TYR B CZ  1 
ATOM   7971  O OH  . TYR B  1 501 ? 40.870  -66.034 14.851  1.00 25.01  ? 2520 TYR B OH  1 
ATOM   7972  N N   . ASN B  1 502 ? 46.960  -68.539 17.076  1.00 22.72  ? 2521 ASN B N   1 
ATOM   7973  C CA  . ASN B  1 502 ? 47.952  -68.001 16.154  1.00 22.47  ? 2521 ASN B CA  1 
ATOM   7974  C C   . ASN B  1 502 ? 47.410  -68.064 14.736  1.00 22.86  ? 2521 ASN B C   1 
ATOM   7975  O O   . ASN B  1 502 ? 46.198  -68.053 14.536  1.00 23.02  ? 2521 ASN B O   1 
ATOM   7976  C CB  . ASN B  1 502 ? 49.262  -68.786 16.258  1.00 22.69  ? 2521 ASN B CB  1 
ATOM   7977  C CG  . ASN B  1 502 ? 49.057  -70.277 16.132  1.00 21.41  ? 2521 ASN B CG  1 
ATOM   7978  O OD1 . ASN B  1 502 ? 48.154  -70.733 15.428  1.00 24.32  ? 2521 ASN B OD1 1 
ATOM   7979  N ND2 . ASN B  1 502 ? 49.902  -71.049 16.803  1.00 23.47  ? 2521 ASN B ND2 1 
ATOM   7980  N N   . GLN B  1 503 ? 48.299  -68.138 13.749  1.00 24.64  ? 2522 GLN B N   1 
ATOM   7981  C CA  . GLN B  1 503 ? 47.855  -68.190 12.360  1.00 25.95  ? 2522 GLN B CA  1 
ATOM   7982  C C   . GLN B  1 503 ? 46.979  -69.405 12.063  1.00 26.39  ? 2522 GLN B C   1 
ATOM   7983  O O   . GLN B  1 503 ? 46.205  -69.387 11.113  1.00 29.01  ? 2522 GLN B O   1 
ATOM   7984  C CB  . GLN B  1 503 ? 49.056  -68.161 11.408  1.00 29.60  ? 2522 GLN B CB  1 
ATOM   7985  C CG  . GLN B  1 503 ? 49.834  -66.847 11.440  1.00 31.68  ? 2522 GLN B CG  1 
ATOM   7986  C CD  . GLN B  1 503 ? 48.927  -65.625 11.386  1.00 32.66  ? 2522 GLN B CD  1 
ATOM   7987  O OE1 . GLN B  1 503 ? 48.086  -65.492 10.492  1.00 32.30  ? 2522 GLN B OE1 1 
ATOM   7988  N NE2 . GLN B  1 503 ? 49.098  -64.724 12.346  1.00 33.94  ? 2522 GLN B NE2 1 
ATOM   7989  N N   . LYS B  1 504 ? 47.095  -70.456 12.869  1.00 26.11  ? 2523 LYS B N   1 
ATOM   7990  C CA  . LYS B  1 504 ? 46.273  -71.652 12.670  1.00 27.33  ? 2523 LYS B CA  1 
ATOM   7991  C C   . LYS B  1 504 ? 44.893  -71.439 13.301  1.00 26.35  ? 2523 LYS B C   1 
ATOM   7992  O O   . LYS B  1 504 ? 43.967  -72.231 13.101  1.00 24.32  ? 2523 LYS B O   1 
ATOM   7993  C CB  . LYS B  1 504 ? 46.951  -72.869 13.298  1.00 30.42  ? 2523 LYS B CB  1 
ATOM   7994  C CG  . LYS B  1 504 ? 48.335  -73.146 12.730  1.00 35.28  ? 2523 LYS B CG  1 
ATOM   7995  C CD  . LYS B  1 504 ? 49.056  -74.228 13.515  1.00 38.97  ? 2523 LYS B CD  1 
ATOM   7996  C CE  . LYS B  1 504 ? 50.493  -74.379 13.035  1.00 42.68  ? 2523 LYS B CE  1 
ATOM   7997  N NZ  . LYS B  1 504 ? 51.220  -75.455 13.768  1.00 45.42  ? 2523 LYS B NZ  1 
ATOM   7998  N N   . GLU B  1 505 ? 44.775  -70.359 14.068  1.00 23.28  ? 2524 GLU B N   1 
ATOM   7999  C CA  . GLU B  1 505 ? 43.528  -69.999 14.726  1.00 24.30  ? 2524 GLU B CA  1 
ATOM   8000  C C   . GLU B  1 505 ? 42.913  -71.085 15.600  1.00 22.07  ? 2524 GLU B C   1 
ATOM   8001  O O   . GLU B  1 505 ? 41.715  -71.358 15.529  1.00 22.06  ? 2524 GLU B O   1 
ATOM   8002  C CB  . GLU B  1 505 ? 42.519  -69.528 13.681  1.00 24.70  ? 2524 GLU B CB  1 
ATOM   8003  C CG  . GLU B  1 505 ? 42.889  -68.182 13.084  1.00 30.32  ? 2524 GLU B CG  1 
ATOM   8004  C CD  . GLU B  1 505 ? 41.892  -67.694 12.059  1.00 33.23  ? 2524 GLU B CD  1 
ATOM   8005  O OE1 . GLU B  1 505 ? 42.044  -66.547 11.591  1.00 36.19  ? 2524 GLU B OE1 1 
ATOM   8006  O OE2 . GLU B  1 505 ? 40.960  -68.453 11.720  1.00 36.46  ? 2524 GLU B OE2 1 
ATOM   8007  N N   . GLY B  1 506 ? 43.741  -71.699 16.431  1.00 20.36  ? 2525 GLY B N   1 
ATOM   8008  C CA  . GLY B  1 506 ? 43.234  -72.726 17.315  1.00 22.22  ? 2525 GLY B CA  1 
ATOM   8009  C C   . GLY B  1 506 ? 42.511  -72.087 18.488  1.00 20.76  ? 2525 GLY B C   1 
ATOM   8010  O O   . GLY B  1 506 ? 42.854  -70.985 18.910  1.00 20.28  ? 2525 GLY B O   1 
ATOM   8011  N N   . TYR B  1 507 ? 41.499  -72.773 19.002  1.00 20.56  ? 2526 TYR B N   1 
ATOM   8012  C CA  . TYR B  1 507 ? 40.738  -72.279 20.140  1.00 20.64  ? 2526 TYR B CA  1 
ATOM   8013  C C   . TYR B  1 507 ? 40.201  -73.476 20.906  1.00 20.82  ? 2526 TYR B C   1 
ATOM   8014  O O   . TYR B  1 507 ? 40.226  -74.606 20.408  1.00 19.79  ? 2526 TYR B O   1 
ATOM   8015  C CB  . TYR B  1 507 ? 39.582  -71.381 19.670  1.00 19.05  ? 2526 TYR B CB  1 
ATOM   8016  C CG  . TYR B  1 507 ? 38.480  -72.105 18.927  1.00 18.41  ? 2526 TYR B CG  1 
ATOM   8017  C CD1 . TYR B  1 507 ? 37.286  -72.433 19.566  1.00 19.32  ? 2526 TYR B CD1 1 
ATOM   8018  C CD2 . TYR B  1 507 ? 38.626  -72.454 17.582  1.00 19.54  ? 2526 TYR B CD2 1 
ATOM   8019  C CE1 . TYR B  1 507 ? 36.261  -73.086 18.890  1.00 19.47  ? 2526 TYR B CE1 1 
ATOM   8020  C CE2 . TYR B  1 507 ? 37.606  -73.108 16.892  1.00 17.99  ? 2526 TYR B CE2 1 
ATOM   8021  C CZ  . TYR B  1 507 ? 36.427  -73.419 17.552  1.00 21.62  ? 2526 TYR B CZ  1 
ATOM   8022  O OH  . TYR B  1 507 ? 35.406  -74.047 16.882  1.00 18.98  ? 2526 TYR B OH  1 
ATOM   8023  N N   . LEU B  1 508 ? 39.717  -73.235 22.117  1.00 19.08  ? 2527 LEU B N   1 
ATOM   8024  C CA  . LEU B  1 508 ? 39.185  -74.319 22.925  1.00 18.92  ? 2527 LEU B CA  1 
ATOM   8025  C C   . LEU B  1 508 ? 37.656  -74.345 22.938  1.00 19.13  ? 2527 LEU B C   1 
ATOM   8026  O O   . LEU B  1 508 ? 37.007  -73.310 23.107  1.00 15.99  ? 2527 LEU B O   1 
ATOM   8027  C CB  . LEU B  1 508 ? 39.709  -74.204 24.361  1.00 17.12  ? 2527 LEU B CB  1 
ATOM   8028  C CG  . LEU B  1 508 ? 39.504  -75.444 25.236  1.00 17.80  ? 2527 LEU B CG  1 
ATOM   8029  C CD1 . LEU B  1 508 ? 40.212  -76.634 24.584  1.00 18.36  ? 2527 LEU B CD1 1 
ATOM   8030  C CD2 . LEU B  1 508 ? 40.057  -75.200 26.633  1.00 14.96  ? 2527 LEU B CD2 1 
ATOM   8031  N N   . GLN B  1 509 ? 37.087  -75.530 22.726  1.00 17.77  ? 2528 GLN B N   1 
ATOM   8032  C CA  . GLN B  1 509 ? 35.639  -75.705 22.772  1.00 18.27  ? 2528 GLN B CA  1 
ATOM   8033  C C   . GLN B  1 509 ? 35.430  -76.221 24.190  1.00 19.16  ? 2528 GLN B C   1 
ATOM   8034  O O   . GLN B  1 509 ? 35.810  -77.349 24.509  1.00 19.55  ? 2528 GLN B O   1 
ATOM   8035  C CB  . GLN B  1 509 ? 35.166  -76.751 21.755  1.00 18.54  ? 2528 GLN B CB  1 
ATOM   8036  C CG  . GLN B  1 509 ? 35.446  -76.386 20.302  1.00 22.33  ? 2528 GLN B CG  1 
ATOM   8037  C CD  . GLN B  1 509 ? 34.926  -77.433 19.325  1.00 25.89  ? 2528 GLN B CD  1 
ATOM   8038  O OE1 . GLN B  1 509 ? 35.019  -78.637 19.579  1.00 27.35  ? 2528 GLN B OE1 1 
ATOM   8039  N NE2 . GLN B  1 509 ? 34.391  -76.979 18.198  1.00 24.57  ? 2528 GLN B NE2 1 
ATOM   8040  N N   . ILE B  1 510 ? 34.860  -75.378 25.046  1.00 18.43  ? 2529 ILE B N   1 
ATOM   8041  C CA  . ILE B  1 510 ? 34.637  -75.738 26.444  1.00 16.21  ? 2529 ILE B CA  1 
ATOM   8042  C C   . ILE B  1 510 ? 33.210  -76.208 26.702  1.00 18.52  ? 2529 ILE B C   1 
ATOM   8043  O O   . ILE B  1 510 ? 32.243  -75.544 26.321  1.00 18.60  ? 2529 ILE B O   1 
ATOM   8044  C CB  . ILE B  1 510 ? 34.954  -74.543 27.367  1.00 13.82  ? 2529 ILE B CB  1 
ATOM   8045  C CG1 . ILE B  1 510 ? 36.399  -74.088 27.147  1.00 13.49  ? 2529 ILE B CG1 1 
ATOM   8046  C CG2 . ILE B  1 510 ? 34.741  -74.928 28.825  1.00 11.91  ? 2529 ILE B CG2 1 
ATOM   8047  C CD1 . ILE B  1 510 ? 36.792  -72.815 27.926  1.00 11.02  ? 2529 ILE B CD1 1 
ATOM   8048  N N   . GLY B  1 511 ? 33.093  -77.360 27.356  1.00 19.08  ? 2530 GLY B N   1 
ATOM   8049  C CA  . GLY B  1 511 ? 31.792  -77.923 27.670  1.00 20.12  ? 2530 GLY B CA  1 
ATOM   8050  C C   . GLY B  1 511 ? 31.965  -79.278 28.329  1.00 21.76  ? 2530 GLY B C   1 
ATOM   8051  O O   . GLY B  1 511 ? 33.001  -79.540 28.945  1.00 22.38  ? 2530 GLY B O   1 
ATOM   8052  N N   . ALA B  1 512 ? 30.960  -80.140 28.209  1.00 23.05  ? 2531 ALA B N   1 
ATOM   8053  C CA  . ALA B  1 512 ? 31.044  -81.477 28.799  1.00 24.56  ? 2531 ALA B CA  1 
ATOM   8054  C C   . ALA B  1 512 ? 32.256  -82.156 28.180  1.00 25.82  ? 2531 ALA B C   1 
ATOM   8055  O O   . ALA B  1 512 ? 33.056  -82.791 28.866  1.00 27.30  ? 2531 ALA B O   1 
ATOM   8056  C CB  . ALA B  1 512 ? 29.775  -82.276 28.485  1.00 24.87  ? 2531 ALA B CB  1 
ATOM   8057  N N   . ASN B  1 513 ? 32.379  -82.004 26.868  1.00 26.88  ? 2532 ASN B N   1 
ATOM   8058  C CA  . ASN B  1 513 ? 33.489  -82.571 26.121  1.00 28.38  ? 2532 ASN B CA  1 
ATOM   8059  C C   . ASN B  1 513 ? 34.359  -81.416 25.626  1.00 28.01  ? 2532 ASN B C   1 
ATOM   8060  O O   . ASN B  1 513 ? 34.076  -80.806 24.593  1.00 29.65  ? 2532 ASN B O   1 
ATOM   8061  C CB  . ASN B  1 513 ? 32.954  -83.388 24.941  1.00 29.46  ? 2532 ASN B CB  1 
ATOM   8062  C CG  . ASN B  1 513 ? 34.052  -84.102 24.182  1.00 32.92  ? 2532 ASN B CG  1 
ATOM   8063  O OD1 . ASN B  1 513 ? 34.965  -84.672 24.781  1.00 33.23  ? 2532 ASN B OD1 1 
ATOM   8064  N ND2 . ASN B  1 513 ? 33.963  -84.090 22.855  1.00 35.69  ? 2532 ASN B ND2 1 
ATOM   8065  N N   . THR B  1 514 ? 35.412  -81.120 26.379  1.00 25.50  ? 2533 THR B N   1 
ATOM   8066  C CA  . THR B  1 514 ? 36.329  -80.033 26.056  1.00 24.98  ? 2533 THR B CA  1 
ATOM   8067  C C   . THR B  1 514 ? 37.462  -80.484 25.131  1.00 26.02  ? 2533 THR B C   1 
ATOM   8068  O O   . THR B  1 514 ? 38.175  -81.441 25.424  1.00 25.22  ? 2533 THR B O   1 
ATOM   8069  C CB  . THR B  1 514 ? 36.917  -79.441 27.356  1.00 24.08  ? 2533 THR B CB  1 
ATOM   8070  O OG1 . THR B  1 514 ? 35.856  -78.861 28.128  1.00 19.49  ? 2533 THR B OG1 1 
ATOM   8071  C CG2 . THR B  1 514 ? 37.966  -78.375 27.047  1.00 21.86  ? 2533 THR B CG2 1 
ATOM   8072  N N   . GLN B  1 515 ? 37.628  -79.783 24.014  1.00 26.88  ? 2534 GLN B N   1 
ATOM   8073  C CA  . GLN B  1 515 ? 38.662  -80.131 23.046  1.00 28.58  ? 2534 GLN B CA  1 
ATOM   8074  C C   . GLN B  1 515 ? 39.030  -78.959 22.147  1.00 28.19  ? 2534 GLN B C   1 
ATOM   8075  O O   . GLN B  1 515 ? 38.214  -78.070 21.895  1.00 26.46  ? 2534 GLN B O   1 
ATOM   8076  C CB  . GLN B  1 515 ? 38.185  -81.295 22.177  1.00 32.03  ? 2534 GLN B CB  1 
ATOM   8077  C CG  . GLN B  1 515 ? 36.820  -81.053 21.559  1.00 38.43  ? 2534 GLN B CG  1 
ATOM   8078  C CD  . GLN B  1 515 ? 36.419  -82.124 20.570  1.00 42.87  ? 2534 GLN B CD  1 
ATOM   8079  O OE1 . GLN B  1 515 ? 36.516  -83.319 20.855  1.00 46.15  ? 2534 GLN B OE1 1 
ATOM   8080  N NE2 . GLN B  1 515 ? 35.954  -81.701 19.398  1.00 44.22  ? 2534 GLN B NE2 1 
ATOM   8081  N N   . ALA B  1 516 ? 40.263  -78.973 21.651  1.00 25.91  ? 2535 ALA B N   1 
ATOM   8082  C CA  . ALA B  1 516 ? 40.738  -77.916 20.776  1.00 23.90  ? 2535 ALA B CA  1 
ATOM   8083  C C   . ALA B  1 516 ? 40.141  -78.058 19.382  1.00 24.24  ? 2535 ALA B C   1 
ATOM   8084  O O   . ALA B  1 516 ? 39.720  -79.140 18.979  1.00 23.45  ? 2535 ALA B O   1 
ATOM   8085  C CB  . ALA B  1 516 ? 42.258  -77.952 20.699  1.00 25.57  ? 2535 ALA B CB  1 
ATOM   8086  N N   . ALA B  1 517 ? 40.096  -76.944 18.663  1.00 23.85  ? 2536 ALA B N   1 
ATOM   8087  C CA  . ALA B  1 517 ? 39.583  -76.893 17.301  1.00 24.04  ? 2536 ALA B CA  1 
ATOM   8088  C C   . ALA B  1 517 ? 40.271  -75.702 16.646  1.00 23.81  ? 2536 ALA B C   1 
ATOM   8089  O O   . ALA B  1 517 ? 41.138  -75.077 17.260  1.00 23.42  ? 2536 ALA B O   1 
ATOM   8090  C CB  . ALA B  1 517 ? 38.074  -76.706 17.300  1.00 23.45  ? 2536 ALA B CB  1 
ATOM   8091  N N   . GLN B  1 518 ? 39.893  -75.383 15.413  1.00 24.60  ? 2537 GLN B N   1 
ATOM   8092  C CA  . GLN B  1 518 ? 40.515  -74.268 14.712  1.00 26.14  ? 2537 GLN B CA  1 
ATOM   8093  C C   . GLN B  1 518 ? 39.526  -73.501 13.834  1.00 25.99  ? 2537 GLN B C   1 
ATOM   8094  O O   . GLN B  1 518 ? 38.504  -74.043 13.422  1.00 27.00  ? 2537 GLN B O   1 
ATOM   8095  C CB  . GLN B  1 518 ? 41.663  -74.779 13.830  1.00 27.30  ? 2537 GLN B CB  1 
ATOM   8096  C CG  . GLN B  1 518 ? 42.685  -75.681 14.515  1.00 28.45  ? 2537 GLN B CG  1 
ATOM   8097  C CD  . GLN B  1 518 ? 43.751  -76.166 13.541  1.00 31.79  ? 2537 GLN B CD  1 
ATOM   8098  O OE1 . GLN B  1 518 ? 43.446  -76.502 12.398  1.00 32.31  ? 2537 GLN B OE1 1 
ATOM   8099  N NE2 . GLN B  1 518 ? 45.006  -76.196 13.987  1.00 29.73  ? 2537 GLN B NE2 1 
ATOM   8100  N N   . LYS B  1 519 ? 39.844  -72.237 13.564  1.00 25.39  ? 2538 LYS B N   1 
ATOM   8101  C CA  . LYS B  1 519 ? 39.043  -71.360 12.702  1.00 26.59  ? 2538 LYS B CA  1 
ATOM   8102  C C   . LYS B  1 519 ? 37.639  -70.966 13.170  1.00 25.10  ? 2538 LYS B C   1 
ATOM   8103  O O   . LYS B  1 519 ? 36.682  -70.995 12.396  1.00 24.61  ? 2538 LYS B O   1 
ATOM   8104  C CB  . LYS B  1 519 ? 38.959  -71.965 11.295  1.00 29.79  ? 2538 LYS B CB  1 
ATOM   8105  C CG  . LYS B  1 519 ? 40.309  -72.102 10.609  1.00 33.40  ? 2538 LYS B CG  1 
ATOM   8106  C CD  . LYS B  1 519 ? 40.145  -72.625 9.190   1.00 39.16  ? 2538 LYS B CD  1 
ATOM   8107  C CE  . LYS B  1 519 ? 41.475  -72.642 8.448   1.00 42.02  ? 2538 LYS B CE  1 
ATOM   8108  N NZ  . LYS B  1 519 ? 41.314  -73.139 7.051   1.00 44.10  ? 2538 LYS B NZ  1 
ATOM   8109  N N   . LEU B  1 520 ? 37.525  -70.571 14.430  1.00 23.90  ? 2539 LEU B N   1 
ATOM   8110  C CA  . LEU B  1 520 ? 36.247  -70.155 14.983  1.00 22.21  ? 2539 LEU B CA  1 
ATOM   8111  C C   . LEU B  1 520 ? 35.615  -69.035 14.147  1.00 22.10  ? 2539 LEU B C   1 
ATOM   8112  O O   . LEU B  1 520 ? 36.249  -68.010 13.899  1.00 21.68  ? 2539 LEU B O   1 
ATOM   8113  C CB  . LEU B  1 520 ? 36.457  -69.672 16.423  1.00 22.16  ? 2539 LEU B CB  1 
ATOM   8114  C CG  . LEU B  1 520 ? 35.263  -69.133 17.217  1.00 21.56  ? 2539 LEU B CG  1 
ATOM   8115  C CD1 . LEU B  1 520 ? 34.217  -70.228 17.425  1.00 18.19  ? 2539 LEU B CD1 1 
ATOM   8116  C CD2 . LEU B  1 520 ? 35.770  -68.617 18.559  1.00 20.93  ? 2539 LEU B CD2 1 
ATOM   8117  N N   . LYS B  1 521 ? 34.374  -69.251 13.705  1.00 22.26  ? 2540 LYS B N   1 
ATOM   8118  C CA  . LYS B  1 521 ? 33.613  -68.266 12.924  1.00 24.45  ? 2540 LYS B CA  1 
ATOM   8119  C C   . LYS B  1 521 ? 34.294  -67.729 11.661  1.00 24.96  ? 2540 LYS B C   1 
ATOM   8120  O O   . LYS B  1 521 ? 33.972  -66.630 11.207  1.00 22.84  ? 2540 LYS B O   1 
ATOM   8121  C CB  . LYS B  1 521 ? 33.246  -67.071 13.814  1.00 23.77  ? 2540 LYS B CB  1 
ATOM   8122  C CG  . LYS B  1 521 ? 32.442  -67.425 15.061  1.00 24.16  ? 2540 LYS B CG  1 
ATOM   8123  C CD  . LYS B  1 521 ? 31.034  -67.877 14.716  1.00 23.58  ? 2540 LYS B CD  1 
ATOM   8124  C CE  . LYS B  1 521 ? 30.244  -68.230 15.974  1.00 23.36  ? 2540 LYS B CE  1 
ATOM   8125  N NZ  . LYS B  1 521 ? 28.857  -68.656 15.654  1.00 20.55  ? 2540 LYS B NZ  1 
ATOM   8126  N N   . ASP B  1 522 ? 35.218  -68.490 11.086  1.00 25.82  ? 2541 ASP B N   1 
ATOM   8127  C CA  . ASP B  1 522 ? 35.927  -68.020 9.897   1.00 28.23  ? 2541 ASP B CA  1 
ATOM   8128  C C   . ASP B  1 522 ? 35.036  -67.575 8.749   1.00 26.79  ? 2541 ASP B C   1 
ATOM   8129  O O   . ASP B  1 522 ? 35.181  -66.468 8.232   1.00 26.42  ? 2541 ASP B O   1 
ATOM   8130  C CB  . ASP B  1 522 ? 36.885  -69.088 9.383   1.00 32.83  ? 2541 ASP B CB  1 
ATOM   8131  C CG  . ASP B  1 522 ? 38.306  -68.589 9.305   1.00 37.42  ? 2541 ASP B CG  1 
ATOM   8132  O OD1 . ASP B  1 522 ? 38.931  -68.435 10.377  1.00 40.84  ? 2541 ASP B OD1 1 
ATOM   8133  O OD2 . ASP B  1 522 ? 38.794  -68.336 8.182   1.00 40.50  ? 2541 ASP B OD2 1 
ATOM   8134  N N   . LYS B  1 523 ? 34.120  -68.441 8.341   1.00 26.79  ? 2542 LYS B N   1 
ATOM   8135  C CA  . LYS B  1 523 ? 33.230  -68.116 7.238   1.00 26.93  ? 2542 LYS B CA  1 
ATOM   8136  C C   . LYS B  1 523 ? 32.310  -66.951 7.575   1.00 25.49  ? 2542 LYS B C   1 
ATOM   8137  O O   . LYS B  1 523 ? 31.967  -66.160 6.703   1.00 23.79  ? 2542 LYS B O   1 
ATOM   8138  C CB  . LYS B  1 523 ? 32.417  -69.350 6.841   1.00 28.72  ? 2542 LYS B CB  1 
ATOM   8139  C CG  . LYS B  1 523 ? 33.287  -70.462 6.264   1.00 33.27  ? 2542 LYS B CG  1 
ATOM   8140  C CD  . LYS B  1 523 ? 32.469  -71.626 5.735   1.00 37.98  ? 2542 LYS B CD  1 
ATOM   8141  C CE  . LYS B  1 523 ? 33.374  -72.673 5.092   1.00 40.28  ? 2542 LYS B CE  1 
ATOM   8142  N NZ  . LYS B  1 523 ? 32.611  -73.821 4.523   1.00 43.25  ? 2542 LYS B NZ  1 
ATOM   8143  N N   . GLU B  1 524 ? 31.923  -66.841 8.843   1.00 24.94  ? 2543 GLU B N   1 
ATOM   8144  C CA  . GLU B  1 524 ? 31.043  -65.763 9.276   1.00 22.51  ? 2543 GLU B CA  1 
ATOM   8145  C C   . GLU B  1 524 ? 31.757  -64.418 9.213   1.00 21.65  ? 2543 GLU B C   1 
ATOM   8146  O O   . GLU B  1 524 ? 31.184  -63.427 8.760   1.00 21.66  ? 2543 GLU B O   1 
ATOM   8147  C CB  . GLU B  1 524 ? 30.540  -66.016 10.704  1.00 24.68  ? 2543 GLU B CB  1 
ATOM   8148  C CG  . GLU B  1 524 ? 29.528  -67.155 10.845  1.00 25.70  ? 2543 GLU B CG  1 
ATOM   8149  C CD  . GLU B  1 524 ? 30.156  -68.548 10.866  1.00 28.72  ? 2543 GLU B CD  1 
ATOM   8150  O OE1 . GLU B  1 524 ? 29.409  -69.519 11.115  1.00 29.68  ? 2543 GLU B OE1 1 
ATOM   8151  O OE2 . GLU B  1 524 ? 31.380  -68.682 10.638  1.00 29.07  ? 2543 GLU B OE2 1 
ATOM   8152  N N   . VAL B  1 525 ? 33.006  -64.377 9.668   1.00 20.62  ? 2544 VAL B N   1 
ATOM   8153  C CA  . VAL B  1 525 ? 33.759  -63.134 9.627   1.00 21.37  ? 2544 VAL B CA  1 
ATOM   8154  C C   . VAL B  1 525 ? 33.899  -62.683 8.176   1.00 22.24  ? 2544 VAL B C   1 
ATOM   8155  O O   . VAL B  1 525 ? 33.727  -61.503 7.862   1.00 23.49  ? 2544 VAL B O   1 
ATOM   8156  C CB  . VAL B  1 525 ? 35.161  -63.297 10.253  1.00 20.77  ? 2544 VAL B CB  1 
ATOM   8157  C CG1 . VAL B  1 525 ? 35.998  -62.046 10.004  1.00 21.82  ? 2544 VAL B CG1 1 
ATOM   8158  C CG2 . VAL B  1 525 ? 35.033  -63.529 11.751  1.00 22.01  ? 2544 VAL B CG2 1 
ATOM   8159  N N   . ALA B  1 526 ? 34.194  -63.630 7.290   1.00 22.88  ? 2545 ALA B N   1 
ATOM   8160  C CA  . ALA B  1 526 ? 34.349  -63.321 5.873   1.00 23.54  ? 2545 ALA B CA  1 
ATOM   8161  C C   . ALA B  1 526 ? 33.055  -62.726 5.329   1.00 22.96  ? 2545 ALA B C   1 
ATOM   8162  O O   . ALA B  1 526 ? 33.057  -61.641 4.753   1.00 23.89  ? 2545 ALA B O   1 
ATOM   8163  C CB  . ALA B  1 526 ? 34.718  -64.588 5.095   1.00 24.37  ? 2545 ALA B CB  1 
ATOM   8164  N N   . PHE B  1 527 ? 31.948  -63.437 5.520   1.00 23.49  ? 2546 PHE B N   1 
ATOM   8165  C CA  . PHE B  1 527 ? 30.652  -62.960 5.046   1.00 24.12  ? 2546 PHE B CA  1 
ATOM   8166  C C   . PHE B  1 527 ? 30.293  -61.561 5.539   1.00 24.36  ? 2546 PHE B C   1 
ATOM   8167  O O   . PHE B  1 527 ? 29.981  -60.678 4.739   1.00 24.25  ? 2546 PHE B O   1 
ATOM   8168  C CB  . PHE B  1 527 ? 29.537  -63.915 5.469   1.00 24.71  ? 2546 PHE B CB  1 
ATOM   8169  C CG  . PHE B  1 527 ? 28.161  -63.408 5.137   1.00 25.42  ? 2546 PHE B CG  1 
ATOM   8170  C CD1 . PHE B  1 527 ? 27.740  -63.315 3.810   1.00 24.86  ? 2546 PHE B CD1 1 
ATOM   8171  C CD2 . PHE B  1 527 ? 27.299  -62.984 6.148   1.00 24.62  ? 2546 PHE B CD2 1 
ATOM   8172  C CE1 . PHE B  1 527 ? 26.477  -62.803 3.493   1.00 25.56  ? 2546 PHE B CE1 1 
ATOM   8173  C CE2 . PHE B  1 527 ? 26.037  -62.471 5.846   1.00 24.95  ? 2546 PHE B CE2 1 
ATOM   8174  C CZ  . PHE B  1 527 ? 25.623  -62.380 4.514   1.00 25.54  ? 2546 PHE B CZ  1 
ATOM   8175  N N   . TRP B  1 528 ? 30.325  -61.367 6.857   1.00 23.37  ? 2547 TRP B N   1 
ATOM   8176  C CA  . TRP B  1 528 ? 29.975  -60.081 7.454   1.00 23.68  ? 2547 TRP B CA  1 
ATOM   8177  C C   . TRP B  1 528 ? 30.909  -58.925 7.115   1.00 24.87  ? 2547 TRP B C   1 
ATOM   8178  O O   . TRP B  1 528 ? 30.460  -57.802 6.878   1.00 24.65  ? 2547 TRP B O   1 
ATOM   8179  C CB  . TRP B  1 528 ? 29.857  -60.228 8.978   1.00 20.36  ? 2547 TRP B CB  1 
ATOM   8180  C CG  . TRP B  1 528 ? 28.623  -60.977 9.361   1.00 18.90  ? 2547 TRP B CG  1 
ATOM   8181  C CD1 . TRP B  1 528 ? 28.546  -62.252 9.855   1.00 17.93  ? 2547 TRP B CD1 1 
ATOM   8182  C CD2 . TRP B  1 528 ? 27.277  -60.530 9.193   1.00 15.93  ? 2547 TRP B CD2 1 
ATOM   8183  N NE1 . TRP B  1 528 ? 27.229  -62.626 9.999   1.00 17.21  ? 2547 TRP B NE1 1 
ATOM   8184  C CE2 . TRP B  1 528 ? 26.430  -61.587 9.599   1.00 16.14  ? 2547 TRP B CE2 1 
ATOM   8185  C CE3 . TRP B  1 528 ? 26.701  -59.338 8.734   1.00 18.25  ? 2547 TRP B CE3 1 
ATOM   8186  C CZ2 . TRP B  1 528 ? 25.038  -61.486 9.562   1.00 16.38  ? 2547 TRP B CZ2 1 
ATOM   8187  C CZ3 . TRP B  1 528 ? 25.312  -59.240 8.696   1.00 18.55  ? 2547 TRP B CZ3 1 
ATOM   8188  C CH2 . TRP B  1 528 ? 24.500  -60.311 9.108   1.00 17.48  ? 2547 TRP B CH2 1 
ATOM   8189  N N   . THR B  1 529 ? 32.209  -59.191 7.101   1.00 25.69  ? 2548 THR B N   1 
ATOM   8190  C CA  . THR B  1 529 ? 33.168  -58.149 6.781   1.00 27.75  ? 2548 THR B CA  1 
ATOM   8191  C C   . THR B  1 529 ? 32.881  -57.659 5.366   1.00 28.72  ? 2548 THR B C   1 
ATOM   8192  O O   . THR B  1 529 ? 32.936  -56.462 5.085   1.00 27.98  ? 2548 THR B O   1 
ATOM   8193  C CB  . THR B  1 529 ? 34.607  -58.683 6.874   1.00 28.16  ? 2548 THR B CB  1 
ATOM   8194  O OG1 . THR B  1 529 ? 34.854  -59.140 8.210   1.00 30.85  ? 2548 THR B OG1 1 
ATOM   8195  C CG2 . THR B  1 529 ? 35.606  -57.589 6.530   1.00 30.81  ? 2548 THR B CG2 1 
ATOM   8196  N N   . ASN B  1 530 ? 32.555  -58.595 4.484   1.00 30.55  ? 2549 ASN B N   1 
ATOM   8197  C CA  . ASN B  1 530 ? 32.247  -58.257 3.103   1.00 34.65  ? 2549 ASN B CA  1 
ATOM   8198  C C   . ASN B  1 530 ? 30.910  -57.520 2.987   1.00 35.93  ? 2549 ASN B C   1 
ATOM   8199  O O   . ASN B  1 530 ? 30.791  -56.555 2.233   1.00 37.04  ? 2549 ASN B O   1 
ATOM   8200  C CB  . ASN B  1 530 ? 32.205  -59.522 2.246   1.00 36.10  ? 2549 ASN B CB  1 
ATOM   8201  C CG  . ASN B  1 530 ? 31.939  -59.221 0.786   1.00 40.65  ? 2549 ASN B CG  1 
ATOM   8202  O OD1 . ASN B  1 530 ? 32.741  -58.564 0.123   1.00 42.84  ? 2549 ASN B OD1 1 
ATOM   8203  N ND2 . ASN B  1 530 ? 30.806  -59.694 0.277   1.00 39.75  ? 2549 ASN B ND2 1 
ATOM   8204  N N   . LEU B  1 531 ? 29.909  -57.970 3.740   1.00 35.68  ? 2550 LEU B N   1 
ATOM   8205  C CA  . LEU B  1 531 ? 28.590  -57.342 3.695   1.00 35.37  ? 2550 LEU B CA  1 
ATOM   8206  C C   . LEU B  1 531 ? 28.622  -55.908 4.218   1.00 34.68  ? 2550 LEU B C   1 
ATOM   8207  O O   . LEU B  1 531 ? 28.068  -55.005 3.594   1.00 35.26  ? 2550 LEU B O   1 
ATOM   8208  C CB  . LEU B  1 531 ? 27.577  -58.165 4.502   1.00 35.70  ? 2550 LEU B CB  1 
ATOM   8209  C CG  . LEU B  1 531 ? 26.109  -57.741 4.364   1.00 36.03  ? 2550 LEU B CG  1 
ATOM   8210  C CD1 . LEU B  1 531 ? 25.690  -57.842 2.907   1.00 37.08  ? 2550 LEU B CD1 1 
ATOM   8211  C CD2 . LEU B  1 531 ? 25.221  -58.626 5.221   1.00 36.23  ? 2550 LEU B CD2 1 
ATOM   8212  N N   . PHE B  1 532 ? 29.276  -55.706 5.357   1.00 34.74  ? 2551 PHE B N   1 
ATOM   8213  C CA  . PHE B  1 532 ? 29.387  -54.383 5.969   1.00 35.48  ? 2551 PHE B CA  1 
ATOM   8214  C C   . PHE B  1 532 ? 30.281  -53.443 5.171   1.00 38.20  ? 2551 PHE B C   1 
ATOM   8215  O O   . PHE B  1 532 ? 30.321  -52.243 5.440   1.00 38.48  ? 2551 PHE B O   1 
ATOM   8216  C CB  . PHE B  1 532 ? 29.951  -54.496 7.391   1.00 34.23  ? 2551 PHE B CB  1 
ATOM   8217  C CG  . PHE B  1 532 ? 28.962  -54.996 8.407   1.00 31.22  ? 2551 PHE B CG  1 
ATOM   8218  C CD1 . PHE B  1 532 ? 29.335  -55.959 9.340   1.00 28.89  ? 2551 PHE B CD1 1 
ATOM   8219  C CD2 . PHE B  1 532 ? 27.665  -54.489 8.448   1.00 30.98  ? 2551 PHE B CD2 1 
ATOM   8220  C CE1 . PHE B  1 532 ? 28.430  -56.412 10.301  1.00 28.93  ? 2551 PHE B CE1 1 
ATOM   8221  C CE2 . PHE B  1 532 ? 26.752  -54.934 9.404   1.00 27.43  ? 2551 PHE B CE2 1 
ATOM   8222  C CZ  . PHE B  1 532 ? 27.134  -55.897 10.331  1.00 26.97  ? 2551 PHE B CZ  1 
ATOM   8223  N N   . ALA B  1 533 ? 31.012  -53.988 4.205   1.00 40.75  ? 2552 ALA B N   1 
ATOM   8224  C CA  . ALA B  1 533 ? 31.904  -53.171 3.390   1.00 43.09  ? 2552 ALA B CA  1 
ATOM   8225  C C   . ALA B  1 533 ? 31.136  -52.499 2.256   1.00 44.35  ? 2552 ALA B C   1 
ATOM   8226  O O   . ALA B  1 533 ? 31.551  -51.461 1.745   1.00 44.80  ? 2552 ALA B O   1 
ATOM   8227  C CB  . ALA B  1 533 ? 33.026  -54.027 2.827   1.00 42.76  ? 2552 ALA B CB  1 
ATOM   8228  N N   . LYS B  1 534 ? 30.013  -53.098 1.873   1.00 46.16  ? 2553 LYS B N   1 
ATOM   8229  C CA  . LYS B  1 534 ? 29.180  -52.567 0.801   1.00 47.06  ? 2553 LYS B CA  1 
ATOM   8230  C C   . LYS B  1 534 ? 28.623  -51.190 1.153   1.00 48.11  ? 2553 LYS B C   1 
ATOM   8231  O O   . LYS B  1 534 ? 28.019  -51.003 2.209   1.00 48.77  ? 2553 LYS B O   1 
ATOM   8232  C CB  . LYS B  1 534 ? 28.027  -53.528 0.509   1.00 46.45  ? 2553 LYS B CB  1 
ATOM   8233  C CG  . LYS B  1 534 ? 28.473  -54.927 0.124   1.00 46.22  ? 2553 LYS B CG  1 
ATOM   8234  C CD  . LYS B  1 534 ? 27.290  -55.802 -0.261  1.00 45.70  ? 2553 LYS B CD  1 
ATOM   8235  C CE  . LYS B  1 534 ? 27.754  -57.175 -0.723  1.00 47.42  ? 2553 LYS B CE  1 
ATOM   8236  N NZ  . LYS B  1 534 ? 26.631  -58.021 -1.215  1.00 47.03  ? 2553 LYS B NZ  1 
ATOM   8237  N N   . SER C  1 4   ? 39.635  10.914  65.270  1.00 49.70  ? 3022 SER C N   1 
ATOM   8238  C CA  . SER C  1 4   ? 38.945  10.134  64.246  1.00 49.07  ? 3022 SER C CA  1 
ATOM   8239  C C   . SER C  1 4   ? 38.905  8.650   64.617  1.00 47.60  ? 3022 SER C C   1 
ATOM   8240  O O   . SER C  1 4   ? 39.690  8.181   65.442  1.00 46.32  ? 3022 SER C O   1 
ATOM   8241  C CB  . SER C  1 4   ? 39.634  10.313  62.889  1.00 49.93  ? 3022 SER C CB  1 
ATOM   8242  O OG  . SER C  1 4   ? 40.963  9.820   62.917  1.00 52.73  ? 3022 SER C OG  1 
ATOM   8243  N N   . PRO C  1 5   ? 37.983  7.891   64.002  1.00 46.69  ? 3023 PRO C N   1 
ATOM   8244  C CA  . PRO C  1 5   ? 37.818  6.456   64.255  1.00 44.42  ? 3023 PRO C CA  1 
ATOM   8245  C C   . PRO C  1 5   ? 39.108  5.657   64.091  1.00 42.36  ? 3023 PRO C C   1 
ATOM   8246  O O   . PRO C  1 5   ? 39.936  5.968   63.238  1.00 42.03  ? 3023 PRO C O   1 
ATOM   8247  C CB  . PRO C  1 5   ? 36.760  6.049   63.233  1.00 45.32  ? 3023 PRO C CB  1 
ATOM   8248  C CG  . PRO C  1 5   ? 35.946  7.290   63.077  1.00 46.41  ? 3023 PRO C CG  1 
ATOM   8249  C CD  . PRO C  1 5   ? 37.008  8.355   62.999  1.00 46.38  ? 3023 PRO C CD  1 
ATOM   8250  N N   . PRO C  1 6   ? 39.287  4.608   64.911  1.00 40.38  ? 3024 PRO C N   1 
ATOM   8251  C CA  . PRO C  1 6   ? 40.473  3.747   64.872  1.00 39.16  ? 3024 PRO C CA  1 
ATOM   8252  C C   . PRO C  1 6   ? 40.532  2.911   63.594  1.00 37.34  ? 3024 PRO C C   1 
ATOM   8253  O O   . PRO C  1 6   ? 39.564  2.238   63.245  1.00 34.97  ? 3024 PRO C O   1 
ATOM   8254  C CB  . PRO C  1 6   ? 40.301  2.853   66.103  1.00 38.51  ? 3024 PRO C CB  1 
ATOM   8255  C CG  . PRO C  1 6   ? 39.387  3.627   66.988  1.00 40.92  ? 3024 PRO C CG  1 
ATOM   8256  C CD  . PRO C  1 6   ? 38.407  4.219   66.022  1.00 40.45  ? 3024 PRO C CD  1 
ATOM   8257  N N   . VAL C  1 7   ? 41.668  2.957   62.905  1.00 36.65  ? 3025 VAL C N   1 
ATOM   8258  C CA  . VAL C  1 7   ? 41.857  2.180   61.685  1.00 35.83  ? 3025 VAL C CA  1 
ATOM   8259  C C   . VAL C  1 7   ? 43.100  1.318   61.843  1.00 35.48  ? 3025 VAL C C   1 
ATOM   8260  O O   . VAL C  1 7   ? 44.197  1.830   62.067  1.00 36.78  ? 3025 VAL C O   1 
ATOM   8261  C CB  . VAL C  1 7   ? 42.031  3.080   60.446  1.00 35.55  ? 3025 VAL C CB  1 
ATOM   8262  C CG1 . VAL C  1 7   ? 42.300  2.217   59.219  1.00 36.08  ? 3025 VAL C CG1 1 
ATOM   8263  C CG2 . VAL C  1 7   ? 40.782  3.920   60.230  1.00 34.04  ? 3025 VAL C CG2 1 
ATOM   8264  N N   . VAL C  1 8   ? 42.922  0.008   61.720  1.00 34.84  ? 3026 VAL C N   1 
ATOM   8265  C CA  . VAL C  1 8   ? 44.019  -0.935  61.868  1.00 34.39  ? 3026 VAL C CA  1 
ATOM   8266  C C   . VAL C  1 8   ? 44.209  -1.813  60.634  1.00 35.11  ? 3026 VAL C C   1 
ATOM   8267  O O   . VAL C  1 8   ? 43.244  -2.179  59.956  1.00 32.43  ? 3026 VAL C O   1 
ATOM   8268  C CB  . VAL C  1 8   ? 43.787  -1.849  63.103  1.00 34.70  ? 3026 VAL C CB  1 
ATOM   8269  C CG1 . VAL C  1 8   ? 44.856  -2.928  63.174  1.00 35.00  ? 3026 VAL C CG1 1 
ATOM   8270  C CG2 . VAL C  1 8   ? 43.800  -1.011  64.377  1.00 33.88  ? 3026 VAL C CG2 1 
ATOM   8271  N N   . ASP C  1 9   ? 45.465  -2.143  60.352  1.00 35.70  ? 3027 ASP C N   1 
ATOM   8272  C CA  . ASP C  1 9   ? 45.810  -2.991  59.222  1.00 36.84  ? 3027 ASP C CA  1 
ATOM   8273  C C   . ASP C  1 9   ? 45.938  -4.433  59.682  1.00 35.72  ? 3027 ASP C C   1 
ATOM   8274  O O   . ASP C  1 9   ? 46.659  -4.723  60.636  1.00 36.96  ? 3027 ASP C O   1 
ATOM   8275  C CB  . ASP C  1 9   ? 47.148  -2.562  58.612  1.00 41.88  ? 3027 ASP C CB  1 
ATOM   8276  C CG  . ASP C  1 9   ? 47.079  -1.213  57.936  1.00 44.81  ? 3027 ASP C CG  1 
ATOM   8277  O OD1 . ASP C  1 9   ? 46.283  -1.067  56.984  1.00 48.46  ? 3027 ASP C OD1 1 
ATOM   8278  O OD2 . ASP C  1 9   ? 47.826  -0.301  58.353  1.00 47.76  ? 3027 ASP C OD2 1 
ATOM   8279  N N   . THR C  1 10  ? 45.230  -5.333  59.011  1.00 33.35  ? 3028 THR C N   1 
ATOM   8280  C CA  . THR C  1 10  ? 45.304  -6.753  59.334  1.00 30.82  ? 3028 THR C CA  1 
ATOM   8281  C C   . THR C  1 10  ? 45.894  -7.426  58.102  1.00 30.30  ? 3028 THR C C   1 
ATOM   8282  O O   . THR C  1 10  ? 46.024  -6.798  57.052  1.00 28.10  ? 3028 THR C O   1 
ATOM   8283  C CB  . THR C  1 10  ? 43.913  -7.364  59.603  1.00 30.03  ? 3028 THR C CB  1 
ATOM   8284  O OG1 . THR C  1 10  ? 43.177  -7.442  58.376  1.00 27.27  ? 3028 THR C OG1 1 
ATOM   8285  C CG2 . THR C  1 10  ? 43.139  -6.509  60.600  1.00 31.58  ? 3028 THR C CG2 1 
ATOM   8286  N N   . VAL C  1 11  ? 46.251  -8.697  58.224  1.00 29.99  ? 3029 VAL C N   1 
ATOM   8287  C CA  . VAL C  1 11  ? 46.819  -9.417  57.096  1.00 29.74  ? 3029 VAL C CA  1 
ATOM   8288  C C   . VAL C  1 11  ? 45.902  -9.362  55.873  1.00 29.43  ? 3029 VAL C C   1 
ATOM   8289  O O   . VAL C  1 11  ? 46.373  -9.250  54.741  1.00 25.96  ? 3029 VAL C O   1 
ATOM   8290  C CB  . VAL C  1 11  ? 47.087  -10.894 57.463  1.00 31.34  ? 3029 VAL C CB  1 
ATOM   8291  C CG1 . VAL C  1 11  ? 47.523  -11.669 56.230  1.00 32.48  ? 3029 VAL C CG1 1 
ATOM   8292  C CG2 . VAL C  1 11  ? 48.166  -10.972 58.540  1.00 30.68  ? 3029 VAL C CG2 1 
ATOM   8293  N N   . HIS C  1 12  ? 44.593  -9.414  56.102  1.00 28.56  ? 3030 HIS C N   1 
ATOM   8294  C CA  . HIS C  1 12  ? 43.636  -9.398  55.001  1.00 27.87  ? 3030 HIS C CA  1 
ATOM   8295  C C   . HIS C  1 12  ? 43.093  -8.024  54.611  1.00 28.21  ? 3030 HIS C C   1 
ATOM   8296  O O   . HIS C  1 12  ? 42.297  -7.917  53.676  1.00 28.14  ? 3030 HIS C O   1 
ATOM   8297  C CB  . HIS C  1 12  ? 42.469  -10.335 55.318  1.00 30.61  ? 3030 HIS C CB  1 
ATOM   8298  C CG  . HIS C  1 12  ? 42.878  -11.762 55.514  1.00 30.44  ? 3030 HIS C CG  1 
ATOM   8299  N ND1 . HIS C  1 12  ? 43.639  -12.448 54.594  1.00 34.53  ? 3030 HIS C ND1 1 
ATOM   8300  C CD2 . HIS C  1 12  ? 42.623  -12.633 56.518  1.00 33.66  ? 3030 HIS C CD2 1 
ATOM   8301  C CE1 . HIS C  1 12  ? 43.836  -13.684 55.022  1.00 33.19  ? 3030 HIS C CE1 1 
ATOM   8302  N NE2 . HIS C  1 12  ? 43.230  -13.821 56.186  1.00 33.75  ? 3030 HIS C NE2 1 
ATOM   8303  N N   . GLY C  1 13  ? 43.511  -6.976  55.314  1.00 26.45  ? 3031 GLY C N   1 
ATOM   8304  C CA  . GLY C  1 13  ? 43.028  -5.647  54.981  1.00 27.04  ? 3031 GLY C CA  1 
ATOM   8305  C C   . GLY C  1 13  ? 42.801  -4.719  56.161  1.00 27.11  ? 3031 GLY C C   1 
ATOM   8306  O O   . GLY C  1 13  ? 42.944  -5.115  57.318  1.00 26.90  ? 3031 GLY C O   1 
ATOM   8307  N N   . LYS C  1 14  ? 42.438  -3.475  55.862  1.00 27.66  ? 3032 LYS C N   1 
ATOM   8308  C CA  . LYS C  1 14  ? 42.197  -2.467  56.889  1.00 29.51  ? 3032 LYS C CA  1 
ATOM   8309  C C   . LYS C  1 14  ? 40.807  -2.596  57.501  1.00 28.95  ? 3032 LYS C C   1 
ATOM   8310  O O   . LYS C  1 14  ? 39.841  -2.946  56.816  1.00 28.28  ? 3032 LYS C O   1 
ATOM   8311  C CB  . LYS C  1 14  ? 42.337  -1.061  56.300  1.00 31.05  ? 3032 LYS C CB  1 
ATOM   8312  C CG  . LYS C  1 14  ? 43.678  -0.760  55.656  1.00 35.35  ? 3032 LYS C CG  1 
ATOM   8313  C CD  . LYS C  1 14  ? 43.677  0.641   55.049  1.00 40.12  ? 3032 LYS C CD  1 
ATOM   8314  C CE  . LYS C  1 14  ? 44.985  0.952   54.333  1.00 42.76  ? 3032 LYS C CE  1 
ATOM   8315  N NZ  . LYS C  1 14  ? 46.154  0.942   55.260  1.00 44.83  ? 3032 LYS C NZ  1 
ATOM   8316  N N   . VAL C  1 15  ? 40.714  -2.304  58.793  1.00 28.19  ? 3033 VAL C N   1 
ATOM   8317  C CA  . VAL C  1 15  ? 39.442  -2.359  59.498  1.00 28.43  ? 3033 VAL C CA  1 
ATOM   8318  C C   . VAL C  1 15  ? 39.235  -1.073  60.286  1.00 28.46  ? 3033 VAL C C   1 
ATOM   8319  O O   . VAL C  1 15  ? 40.163  -0.560  60.912  1.00 28.07  ? 3033 VAL C O   1 
ATOM   8320  C CB  . VAL C  1 15  ? 39.379  -3.556  60.464  1.00 30.51  ? 3033 VAL C CB  1 
ATOM   8321  C CG1 . VAL C  1 15  ? 39.382  -4.855  59.677  1.00 30.79  ? 3033 VAL C CG1 1 
ATOM   8322  C CG2 . VAL C  1 15  ? 40.559  -3.519  61.414  1.00 29.98  ? 3033 VAL C CG2 1 
ATOM   8323  N N   . LEU C  1 16  ? 38.011  -0.558  60.237  1.00 27.36  ? 3034 LEU C N   1 
ATOM   8324  C CA  . LEU C  1 16  ? 37.642  0.668   60.933  1.00 28.38  ? 3034 LEU C CA  1 
ATOM   8325  C C   . LEU C  1 16  ? 36.822  0.325   62.177  1.00 27.71  ? 3034 LEU C C   1 
ATOM   8326  O O   . LEU C  1 16  ? 35.815  -0.380  62.088  1.00 25.58  ? 3034 LEU C O   1 
ATOM   8327  C CB  . LEU C  1 16  ? 36.821  1.563   59.993  1.00 28.87  ? 3034 LEU C CB  1 
ATOM   8328  C CG  . LEU C  1 16  ? 36.270  2.915   60.472  1.00 31.63  ? 3034 LEU C CG  1 
ATOM   8329  C CD1 . LEU C  1 16  ? 35.082  2.719   61.400  1.00 32.78  ? 3034 LEU C CD1 1 
ATOM   8330  C CD2 . LEU C  1 16  ? 37.368  3.688   61.162  1.00 30.83  ? 3034 LEU C CD2 1 
ATOM   8331  N N   . GLY C  1 17  ? 37.256  0.823   63.332  1.00 26.67  ? 3035 GLY C N   1 
ATOM   8332  C CA  . GLY C  1 17  ? 36.537  0.556   64.566  1.00 26.94  ? 3035 GLY C CA  1 
ATOM   8333  C C   . GLY C  1 17  ? 35.888  1.809   65.128  1.00 27.52  ? 3035 GLY C C   1 
ATOM   8334  O O   . GLY C  1 17  ? 35.567  2.734   64.386  1.00 27.42  ? 3035 GLY C O   1 
ATOM   8335  N N   . LYS C  1 18  ? 35.690  1.840   66.441  1.00 27.48  ? 3036 LYS C N   1 
ATOM   8336  C CA  . LYS C  1 18  ? 35.085  2.996   67.092  1.00 30.08  ? 3036 LYS C CA  1 
ATOM   8337  C C   . LYS C  1 18  ? 35.660  3.158   68.490  1.00 29.87  ? 3036 LYS C C   1 
ATOM   8338  O O   . LYS C  1 18  ? 36.025  2.175   69.140  1.00 28.67  ? 3036 LYS C O   1 
ATOM   8339  C CB  . LYS C  1 18  ? 33.566  2.828   67.190  1.00 33.00  ? 3036 LYS C CB  1 
ATOM   8340  C CG  . LYS C  1 18  ? 33.138  1.663   68.067  1.00 36.39  ? 3036 LYS C CG  1 
ATOM   8341  C CD  . LYS C  1 18  ? 31.627  1.524   68.122  1.00 41.37  ? 3036 LYS C CD  1 
ATOM   8342  C CE  . LYS C  1 18  ? 31.221  0.304   68.939  1.00 42.91  ? 3036 LYS C CE  1 
ATOM   8343  N NZ  . LYS C  1 18  ? 29.740  0.168   69.033  1.00 45.74  ? 3036 LYS C NZ  1 
ATOM   8344  N N   . PHE C  1 19  ? 35.740  4.404   68.944  1.00 29.48  ? 3037 PHE C N   1 
ATOM   8345  C CA  . PHE C  1 19  ? 36.264  4.709   70.268  1.00 30.93  ? 3037 PHE C CA  1 
ATOM   8346  C C   . PHE C  1 19  ? 35.145  4.783   71.292  1.00 31.24  ? 3037 PHE C C   1 
ATOM   8347  O O   . PHE C  1 19  ? 34.106  5.396   71.053  1.00 30.76  ? 3037 PHE C O   1 
ATOM   8348  C CB  . PHE C  1 19  ? 37.025  6.039   70.249  1.00 30.41  ? 3037 PHE C CB  1 
ATOM   8349  C CG  . PHE C  1 19  ? 38.445  5.917   69.788  1.00 31.58  ? 3037 PHE C CG  1 
ATOM   8350  C CD1 . PHE C  1 19  ? 38.971  6.820   68.871  1.00 32.36  ? 3037 PHE C CD1 1 
ATOM   8351  C CD2 . PHE C  1 19  ? 39.268  4.906   70.285  1.00 32.17  ? 3037 PHE C CD2 1 
ATOM   8352  C CE1 . PHE C  1 19  ? 40.299  6.720   68.452  1.00 33.04  ? 3037 PHE C CE1 1 
ATOM   8353  C CE2 . PHE C  1 19  ? 40.594  4.795   69.875  1.00 32.24  ? 3037 PHE C CE2 1 
ATOM   8354  C CZ  . PHE C  1 19  ? 41.113  5.705   68.955  1.00 33.66  ? 3037 PHE C CZ  1 
ATOM   8355  N N   . VAL C  1 20  ? 35.364  4.142   72.430  1.00 31.72  ? 3038 VAL C N   1 
ATOM   8356  C CA  . VAL C  1 20  ? 34.389  4.136   73.505  1.00 32.83  ? 3038 VAL C CA  1 
ATOM   8357  C C   . VAL C  1 20  ? 35.152  4.317   74.803  1.00 33.31  ? 3038 VAL C C   1 
ATOM   8358  O O   . VAL C  1 20  ? 36.055  3.543   75.115  1.00 32.73  ? 3038 VAL C O   1 
ATOM   8359  C CB  . VAL C  1 20  ? 33.618  2.804   73.565  1.00 33.07  ? 3038 VAL C CB  1 
ATOM   8360  C CG1 . VAL C  1 20  ? 32.626  2.831   74.716  1.00 33.49  ? 3038 VAL C CG1 1 
ATOM   8361  C CG2 . VAL C  1 20  ? 32.899  2.563   72.248  1.00 33.81  ? 3038 VAL C CG2 1 
ATOM   8362  N N   . SER C  1 21  ? 34.798  5.352   75.552  1.00 34.62  ? 3039 SER C N   1 
ATOM   8363  C CA  . SER C  1 21  ? 35.469  5.618   76.812  1.00 35.51  ? 3039 SER C CA  1 
ATOM   8364  C C   . SER C  1 21  ? 34.647  5.147   78.002  1.00 35.31  ? 3039 SER C C   1 
ATOM   8365  O O   . SER C  1 21  ? 33.418  5.179   77.979  1.00 35.60  ? 3039 SER C O   1 
ATOM   8366  C CB  . SER C  1 21  ? 35.760  7.114   76.945  1.00 37.47  ? 3039 SER C CB  1 
ATOM   8367  O OG  . SER C  1 21  ? 36.686  7.535   75.961  1.00 38.62  ? 3039 SER C OG  1 
ATOM   8368  N N   . LEU C  1 22  ? 35.346  4.698   79.037  1.00 35.70  ? 3040 LEU C N   1 
ATOM   8369  C CA  . LEU C  1 22  ? 34.717  4.234   80.264  1.00 37.39  ? 3040 LEU C CA  1 
ATOM   8370  C C   . LEU C  1 22  ? 35.249  5.144   81.365  1.00 38.40  ? 3040 LEU C C   1 
ATOM   8371  O O   . LEU C  1 22  ? 36.457  5.206   81.591  1.00 37.29  ? 3040 LEU C O   1 
ATOM   8372  C CB  . LEU C  1 22  ? 35.111  2.778   80.541  1.00 35.29  ? 3040 LEU C CB  1 
ATOM   8373  C CG  . LEU C  1 22  ? 34.461  2.075   81.737  1.00 36.19  ? 3040 LEU C CG  1 
ATOM   8374  C CD1 . LEU C  1 22  ? 32.947  2.068   81.565  1.00 34.60  ? 3040 LEU C CD1 1 
ATOM   8375  C CD2 . LEU C  1 22  ? 34.989  0.651   81.849  1.00 34.32  ? 3040 LEU C CD2 1 
ATOM   8376  N N   . GLU C  1 23  ? 34.360  5.864   82.040  1.00 41.91  ? 3041 GLU C N   1 
ATOM   8377  C CA  . GLU C  1 23  ? 34.800  6.771   83.094  1.00 44.67  ? 3041 GLU C CA  1 
ATOM   8378  C C   . GLU C  1 23  ? 35.735  6.098   84.087  1.00 43.91  ? 3041 GLU C C   1 
ATOM   8379  O O   . GLU C  1 23  ? 35.513  4.961   84.506  1.00 43.95  ? 3041 GLU C O   1 
ATOM   8380  C CB  . GLU C  1 23  ? 33.598  7.391   83.812  1.00 47.93  ? 3041 GLU C CB  1 
ATOM   8381  C CG  . GLU C  1 23  ? 33.008  8.568   83.043  1.00 52.69  ? 3041 GLU C CG  1 
ATOM   8382  C CD  . GLU C  1 23  ? 31.995  9.360   83.847  1.00 55.61  ? 3041 GLU C CD  1 
ATOM   8383  O OE1 . GLU C  1 23  ? 32.293  9.697   85.014  1.00 57.77  ? 3041 GLU C OE1 1 
ATOM   8384  O OE2 . GLU C  1 23  ? 30.907  9.659   83.308  1.00 56.85  ? 3041 GLU C OE2 1 
ATOM   8385  N N   . GLY C  1 24  ? 36.794  6.816   84.448  1.00 43.43  ? 3042 GLY C N   1 
ATOM   8386  C CA  . GLY C  1 24  ? 37.781  6.286   85.368  1.00 42.49  ? 3042 GLY C CA  1 
ATOM   8387  C C   . GLY C  1 24  ? 39.041  5.973   84.589  1.00 42.19  ? 3042 GLY C C   1 
ATOM   8388  O O   . GLY C  1 24  ? 40.076  5.633   85.161  1.00 42.64  ? 3042 GLY C O   1 
ATOM   8389  N N   . PHE C  1 25  ? 38.942  6.086   83.267  1.00 41.94  ? 3043 PHE C N   1 
ATOM   8390  C CA  . PHE C  1 25  ? 40.064  5.818   82.375  1.00 41.85  ? 3043 PHE C CA  1 
ATOM   8391  C C   . PHE C  1 25  ? 40.081  6.850   81.249  1.00 42.16  ? 3043 PHE C C   1 
ATOM   8392  O O   . PHE C  1 25  ? 39.083  7.036   80.552  1.00 41.75  ? 3043 PHE C O   1 
ATOM   8393  C CB  . PHE C  1 25  ? 39.949  4.403   81.797  1.00 41.04  ? 3043 PHE C CB  1 
ATOM   8394  C CG  . PHE C  1 25  ? 39.770  3.340   82.842  1.00 39.64  ? 3043 PHE C CG  1 
ATOM   8395  C CD1 . PHE C  1 25  ? 38.524  3.118   83.420  1.00 39.12  ? 3043 PHE C CD1 1 
ATOM   8396  C CD2 . PHE C  1 25  ? 40.855  2.595   83.287  1.00 39.28  ? 3043 PHE C CD2 1 
ATOM   8397  C CE1 . PHE C  1 25  ? 38.361  2.173   84.427  1.00 38.28  ? 3043 PHE C CE1 1 
ATOM   8398  C CE2 . PHE C  1 25  ? 40.703  1.646   84.296  1.00 40.16  ? 3043 PHE C CE2 1 
ATOM   8399  C CZ  . PHE C  1 25  ? 39.452  1.436   84.867  1.00 39.43  ? 3043 PHE C CZ  1 
ATOM   8400  N N   . ALA C  1 26  ? 41.219  7.518   81.079  1.00 42.30  ? 3044 ALA C N   1 
ATOM   8401  C CA  . ALA C  1 26  ? 41.365  8.544   80.050  1.00 43.33  ? 3044 ALA C CA  1 
ATOM   8402  C C   . ALA C  1 26  ? 41.524  7.973   78.641  1.00 42.74  ? 3044 ALA C C   1 
ATOM   8403  O O   . ALA C  1 26  ? 40.963  8.505   77.686  1.00 42.89  ? 3044 ALA C O   1 
ATOM   8404  C CB  . ALA C  1 26  ? 42.552  9.450   80.383  1.00 43.98  ? 3044 ALA C CB  1 
ATOM   8405  N N   . GLN C  1 27  ? 42.292  6.896   78.515  1.00 42.54  ? 3045 GLN C N   1 
ATOM   8406  C CA  . GLN C  1 27  ? 42.516  6.264   77.218  1.00 41.93  ? 3045 GLN C CA  1 
ATOM   8407  C C   . GLN C  1 27  ? 41.271  5.525   76.738  1.00 40.23  ? 3045 GLN C C   1 
ATOM   8408  O O   . GLN C  1 27  ? 40.867  4.524   77.325  1.00 40.56  ? 3045 GLN C O   1 
ATOM   8409  C CB  . GLN C  1 27  ? 43.691  5.286   77.305  1.00 43.12  ? 3045 GLN C CB  1 
ATOM   8410  C CG  . GLN C  1 27  ? 43.966  4.506   76.022  1.00 44.89  ? 3045 GLN C CG  1 
ATOM   8411  C CD  . GLN C  1 27  ? 44.211  5.406   74.821  1.00 46.15  ? 3045 GLN C CD  1 
ATOM   8412  O OE1 . GLN C  1 27  ? 45.097  6.261   74.840  1.00 45.65  ? 3045 GLN C OE1 1 
ATOM   8413  N NE2 . GLN C  1 27  ? 43.424  5.213   73.767  1.00 45.95  ? 3045 GLN C NE2 1 
ATOM   8414  N N   . PRO C  1 28  ? 40.638  6.021   75.665  1.00 38.94  ? 3046 PRO C N   1 
ATOM   8415  C CA  . PRO C  1 28  ? 39.436  5.374   75.130  1.00 36.06  ? 3046 PRO C CA  1 
ATOM   8416  C C   . PRO C  1 28  ? 39.761  3.970   74.617  1.00 32.82  ? 3046 PRO C C   1 
ATOM   8417  O O   . PRO C  1 28  ? 40.883  3.702   74.189  1.00 31.38  ? 3046 PRO C O   1 
ATOM   8418  C CB  . PRO C  1 28  ? 39.009  6.315   74.006  1.00 37.22  ? 3046 PRO C CB  1 
ATOM   8419  C CG  . PRO C  1 28  ? 39.524  7.654   74.472  1.00 39.07  ? 3046 PRO C CG  1 
ATOM   8420  C CD  . PRO C  1 28  ? 40.893  7.300   74.980  1.00 39.30  ? 3046 PRO C CD  1 
ATOM   8421  N N   . VAL C  1 29  ? 38.782  3.077   74.667  1.00 29.94  ? 3047 VAL C N   1 
ATOM   8422  C CA  . VAL C  1 29  ? 38.982  1.711   74.199  1.00 27.64  ? 3047 VAL C CA  1 
ATOM   8423  C C   . VAL C  1 29  ? 38.557  1.589   72.737  1.00 26.14  ? 3047 VAL C C   1 
ATOM   8424  O O   . VAL C  1 29  ? 37.467  2.020   72.360  1.00 24.47  ? 3047 VAL C O   1 
ATOM   8425  C CB  . VAL C  1 29  ? 38.166  0.711   75.049  1.00 27.52  ? 3047 VAL C CB  1 
ATOM   8426  C CG1 . VAL C  1 29  ? 38.209  -0.680  74.420  1.00 25.00  ? 3047 VAL C CG1 1 
ATOM   8427  C CG2 . VAL C  1 29  ? 38.720  0.666   76.461  1.00 25.98  ? 3047 VAL C CG2 1 
ATOM   8428  N N   . ALA C  1 30  ? 39.428  1.010   71.917  1.00 25.89  ? 3048 ALA C N   1 
ATOM   8429  C CA  . ALA C  1 30  ? 39.131  0.821   70.500  1.00 24.00  ? 3048 ALA C CA  1 
ATOM   8430  C C   . ALA C  1 30  ? 38.330  -0.465  70.359  1.00 21.71  ? 3048 ALA C C   1 
ATOM   8431  O O   . ALA C  1 30  ? 38.786  -1.531  70.760  1.00 23.26  ? 3048 ALA C O   1 
ATOM   8432  C CB  . ALA C  1 30  ? 40.420  0.726   69.700  1.00 23.90  ? 3048 ALA C CB  1 
ATOM   8433  N N   . ILE C  1 31  ? 37.138  -0.358  69.788  1.00 21.70  ? 3049 ILE C N   1 
ATOM   8434  C CA  . ILE C  1 31  ? 36.269  -1.513  69.616  1.00 22.25  ? 3049 ILE C CA  1 
ATOM   8435  C C   . ILE C  1 31  ? 36.041  -1.861  68.147  1.00 21.70  ? 3049 ILE C C   1 
ATOM   8436  O O   . ILE C  1 31  ? 35.725  -0.996  67.333  1.00 22.28  ? 3049 ILE C O   1 
ATOM   8437  C CB  . ILE C  1 31  ? 34.908  -1.274  70.299  1.00 22.81  ? 3049 ILE C CB  1 
ATOM   8438  C CG1 . ILE C  1 31  ? 35.109  -1.147  71.814  1.00 25.06  ? 3049 ILE C CG1 1 
ATOM   8439  C CG2 . ILE C  1 31  ? 33.959  -2.418  69.994  1.00 25.10  ? 3049 ILE C CG2 1 
ATOM   8440  C CD1 . ILE C  1 31  ? 33.831  -0.891  72.591  1.00 26.94  ? 3049 ILE C CD1 1 
ATOM   8441  N N   . PHE C  1 32  ? 36.203  -3.139  67.825  1.00 20.19  ? 3050 PHE C N   1 
ATOM   8442  C CA  . PHE C  1 32  ? 36.021  -3.626  66.462  1.00 21.06  ? 3050 PHE C CA  1 
ATOM   8443  C C   . PHE C  1 32  ? 35.006  -4.760  66.497  1.00 19.35  ? 3050 PHE C C   1 
ATOM   8444  O O   . PHE C  1 32  ? 35.219  -5.776  67.155  1.00 19.69  ? 3050 PHE C O   1 
ATOM   8445  C CB  . PHE C  1 32  ? 37.358  -4.121  65.889  1.00 20.74  ? 3050 PHE C CB  1 
ATOM   8446  C CG  . PHE C  1 32  ? 38.431  -3.064  65.852  1.00 22.28  ? 3050 PHE C CG  1 
ATOM   8447  C CD1 . PHE C  1 32  ? 39.151  -2.744  66.999  1.00 23.34  ? 3050 PHE C CD1 1 
ATOM   8448  C CD2 . PHE C  1 32  ? 38.689  -2.356  64.682  1.00 22.96  ? 3050 PHE C CD2 1 
ATOM   8449  C CE1 . PHE C  1 32  ? 40.113  -1.732  66.984  1.00 23.36  ? 3050 PHE C CE1 1 
ATOM   8450  C CE2 . PHE C  1 32  ? 39.649  -1.340  64.656  1.00 24.18  ? 3050 PHE C CE2 1 
ATOM   8451  C CZ  . PHE C  1 32  ? 40.360  -1.029  65.812  1.00 24.93  ? 3050 PHE C CZ  1 
ATOM   8452  N N   . LEU C  1 33  ? 33.901  -4.574  65.788  1.00 19.43  ? 3051 LEU C N   1 
ATOM   8453  C CA  . LEU C  1 33  ? 32.839  -5.565  65.760  1.00 18.95  ? 3051 LEU C CA  1 
ATOM   8454  C C   . LEU C  1 33  ? 32.698  -6.284  64.424  1.00 19.64  ? 3051 LEU C C   1 
ATOM   8455  O O   . LEU C  1 33  ? 32.683  -5.658  63.364  1.00 20.33  ? 3051 LEU C O   1 
ATOM   8456  C CB  . LEU C  1 33  ? 31.504  -4.891  66.096  1.00 18.08  ? 3051 LEU C CB  1 
ATOM   8457  C CG  . LEU C  1 33  ? 31.457  -4.054  67.375  1.00 18.74  ? 3051 LEU C CG  1 
ATOM   8458  C CD1 . LEU C  1 33  ? 30.082  -3.415  67.509  1.00 20.81  ? 3051 LEU C CD1 1 
ATOM   8459  C CD2 . LEU C  1 33  ? 31.768  -4.927  68.581  1.00 17.70  ? 3051 LEU C CD2 1 
ATOM   8460  N N   . GLY C  1 34  ? 32.577  -7.606  64.485  1.00 19.83  ? 3052 GLY C N   1 
ATOM   8461  C CA  . GLY C  1 34  ? 32.389  -8.388  63.280  1.00 18.70  ? 3052 GLY C CA  1 
ATOM   8462  C C   . GLY C  1 34  ? 33.547  -8.517  62.307  1.00 18.91  ? 3052 GLY C C   1 
ATOM   8463  O O   . GLY C  1 34  ? 33.377  -8.279  61.112  1.00 19.22  ? 3052 GLY C O   1 
ATOM   8464  N N   . ILE C  1 35  ? 34.720  -8.891  62.804  1.00 18.89  ? 3053 ILE C N   1 
ATOM   8465  C CA  . ILE C  1 35  ? 35.872  -9.092  61.933  1.00 19.63  ? 3053 ILE C CA  1 
ATOM   8466  C C   . ILE C  1 35  ? 35.821  -10.563 61.510  1.00 18.51  ? 3053 ILE C C   1 
ATOM   8467  O O   . ILE C  1 35  ? 35.765  -11.454 62.356  1.00 17.08  ? 3053 ILE C O   1 
ATOM   8468  C CB  . ILE C  1 35  ? 37.199  -8.837  62.672  1.00 18.94  ? 3053 ILE C CB  1 
ATOM   8469  C CG1 . ILE C  1 35  ? 37.268  -7.384  63.149  1.00 18.84  ? 3053 ILE C CG1 1 
ATOM   8470  C CG2 . ILE C  1 35  ? 38.367  -9.149  61.754  1.00 19.99  ? 3053 ILE C CG2 1 
ATOM   8471  C CD1 . ILE C  1 35  ? 38.544  -7.053  63.916  1.00 17.61  ? 3053 ILE C CD1 1 
ATOM   8472  N N   . PRO C  1 36  ? 35.820  -10.836 60.194  1.00 18.11  ? 3054 PRO C N   1 
ATOM   8473  C CA  . PRO C  1 36  ? 35.772  -12.231 59.745  1.00 18.17  ? 3054 PRO C CA  1 
ATOM   8474  C C   . PRO C  1 36  ? 37.107  -12.933 59.946  1.00 18.17  ? 3054 PRO C C   1 
ATOM   8475  O O   . PRO C  1 36  ? 38.145  -12.377 59.611  1.00 21.33  ? 3054 PRO C O   1 
ATOM   8476  C CB  . PRO C  1 36  ? 35.396  -12.105 58.270  1.00 20.48  ? 3054 PRO C CB  1 
ATOM   8477  C CG  . PRO C  1 36  ? 36.043  -10.794 57.868  1.00 20.24  ? 3054 PRO C CG  1 
ATOM   8478  C CD  . PRO C  1 36  ? 35.724  -9.901  59.054  1.00 19.87  ? 3054 PRO C CD  1 
ATOM   8479  N N   . PHE C  1 37  ? 37.092  -14.134 60.518  1.00 17.26  ? 3055 PHE C N   1 
ATOM   8480  C CA  . PHE C  1 37  ? 38.345  -14.870 60.714  1.00 18.04  ? 3055 PHE C CA  1 
ATOM   8481  C C   . PHE C  1 37  ? 38.386  -16.125 59.852  1.00 17.81  ? 3055 PHE C C   1 
ATOM   8482  O O   . PHE C  1 37  ? 39.340  -16.899 59.904  1.00 18.33  ? 3055 PHE C O   1 
ATOM   8483  C CB  . PHE C  1 37  ? 38.567  -15.235 62.196  1.00 15.88  ? 3055 PHE C CB  1 
ATOM   8484  C CG  . PHE C  1 37  ? 37.574  -16.227 62.756  1.00 15.31  ? 3055 PHE C CG  1 
ATOM   8485  C CD1 . PHE C  1 37  ? 37.704  -17.590 62.507  1.00 14.36  ? 3055 PHE C CD1 1 
ATOM   8486  C CD2 . PHE C  1 37  ? 36.532  -15.793 63.576  1.00 15.67  ? 3055 PHE C CD2 1 
ATOM   8487  C CE1 . PHE C  1 37  ? 36.814  -18.510 63.066  1.00 14.72  ? 3055 PHE C CE1 1 
ATOM   8488  C CE2 . PHE C  1 37  ? 35.639  -16.700 64.138  1.00 11.81  ? 3055 PHE C CE2 1 
ATOM   8489  C CZ  . PHE C  1 37  ? 35.779  -18.059 63.885  1.00 13.14  ? 3055 PHE C CZ  1 
ATOM   8490  N N   . ALA C  1 38  ? 37.343  -16.312 59.054  1.00 20.17  ? 3056 ALA C N   1 
ATOM   8491  C CA  . ALA C  1 38  ? 37.251  -17.461 58.165  1.00 19.89  ? 3056 ALA C CA  1 
ATOM   8492  C C   . ALA C  1 38  ? 36.295  -17.144 57.030  1.00 21.82  ? 3056 ALA C C   1 
ATOM   8493  O O   . ALA C  1 38  ? 35.582  -16.146 57.066  1.00 22.07  ? 3056 ALA C O   1 
ATOM   8494  C CB  . ALA C  1 38  ? 36.755  -18.675 58.928  1.00 20.26  ? 3056 ALA C CB  1 
ATOM   8495  N N   . LYS C  1 39  ? 36.287  -17.998 56.015  1.00 22.24  ? 3057 LYS C N   1 
ATOM   8496  C CA  . LYS C  1 39  ? 35.394  -17.808 54.888  1.00 23.03  ? 3057 LYS C CA  1 
ATOM   8497  C C   . LYS C  1 39  ? 34.014  -18.319 55.316  1.00 21.68  ? 3057 LYS C C   1 
ATOM   8498  O O   . LYS C  1 39  ? 33.907  -19.358 55.964  1.00 21.83  ? 3057 LYS C O   1 
ATOM   8499  C CB  . LYS C  1 39  ? 35.906  -18.600 53.683  1.00 23.90  ? 3057 LYS C CB  1 
ATOM   8500  C CG  . LYS C  1 39  ? 35.119  -18.359 52.413  1.00 27.93  ? 3057 LYS C CG  1 
ATOM   8501  C CD  . LYS C  1 39  ? 35.769  -19.033 51.218  1.00 29.44  ? 3057 LYS C CD  1 
ATOM   8502  C CE  . LYS C  1 39  ? 35.000  -18.721 49.940  1.00 33.09  ? 3057 LYS C CE  1 
ATOM   8503  N NZ  . LYS C  1 39  ? 35.633  -19.343 48.743  1.00 37.40  ? 3057 LYS C NZ  1 
ATOM   8504  N N   . PRO C  1 40  ? 32.946  -17.577 54.990  1.00 21.03  ? 3058 PRO C N   1 
ATOM   8505  C CA  . PRO C  1 40  ? 31.589  -17.997 55.359  1.00 21.81  ? 3058 PRO C CA  1 
ATOM   8506  C C   . PRO C  1 40  ? 31.341  -19.460 54.978  1.00 22.63  ? 3058 PRO C C   1 
ATOM   8507  O O   . PRO C  1 40  ? 31.419  -19.828 53.805  1.00 21.75  ? 3058 PRO C O   1 
ATOM   8508  C CB  . PRO C  1 40  ? 30.713  -17.024 54.581  1.00 20.89  ? 3058 PRO C CB  1 
ATOM   8509  C CG  . PRO C  1 40  ? 31.518  -15.757 54.658  1.00 22.01  ? 3058 PRO C CG  1 
ATOM   8510  C CD  . PRO C  1 40  ? 32.932  -16.244 54.359  1.00 19.98  ? 3058 PRO C CD  1 
ATOM   8511  N N   . PRO C  1 41  ? 31.039  -20.311 55.974  1.00 22.07  ? 3059 PRO C N   1 
ATOM   8512  C CA  . PRO C  1 41  ? 30.781  -21.746 55.794  1.00 21.82  ? 3059 PRO C CA  1 
ATOM   8513  C C   . PRO C  1 41  ? 29.459  -22.071 55.100  1.00 22.02  ? 3059 PRO C C   1 
ATOM   8514  O O   . PRO C  1 41  ? 28.654  -22.851 55.608  1.00 21.37  ? 3059 PRO C O   1 
ATOM   8515  C CB  . PRO C  1 41  ? 30.840  -22.278 57.223  1.00 21.95  ? 3059 PRO C CB  1 
ATOM   8516  C CG  . PRO C  1 41  ? 30.223  -21.154 58.002  1.00 21.66  ? 3059 PRO C CG  1 
ATOM   8517  C CD  . PRO C  1 41  ? 30.883  -19.925 57.390  1.00 22.81  ? 3059 PRO C CD  1 
ATOM   8518  N N   . LEU C  1 42  ? 29.258  -21.483 53.926  1.00 22.55  ? 3060 LEU C N   1 
ATOM   8519  C CA  . LEU C  1 42  ? 28.035  -21.681 53.161  1.00 23.91  ? 3060 LEU C CA  1 
ATOM   8520  C C   . LEU C  1 42  ? 28.180  -22.721 52.048  1.00 24.39  ? 3060 LEU C C   1 
ATOM   8521  O O   . LEU C  1 42  ? 29.292  -23.051 51.623  1.00 24.18  ? 3060 LEU C O   1 
ATOM   8522  C CB  . LEU C  1 42  ? 27.591  -20.347 52.551  1.00 24.64  ? 3060 LEU C CB  1 
ATOM   8523  C CG  . LEU C  1 42  ? 27.631  -19.145 53.502  1.00 26.56  ? 3060 LEU C CG  1 
ATOM   8524  C CD1 . LEU C  1 42  ? 27.051  -17.915 52.806  1.00 24.81  ? 3060 LEU C CD1 1 
ATOM   8525  C CD2 . LEU C  1 42  ? 26.846  -19.459 54.764  1.00 26.10  ? 3060 LEU C CD2 1 
ATOM   8526  N N   . GLY C  1 43  ? 27.039  -23.228 51.589  1.00 24.43  ? 3061 GLY C N   1 
ATOM   8527  C CA  . GLY C  1 43  ? 27.014  -24.211 50.519  1.00 24.61  ? 3061 GLY C CA  1 
ATOM   8528  C C   . GLY C  1 43  ? 27.844  -25.456 50.765  1.00 25.83  ? 3061 GLY C C   1 
ATOM   8529  O O   . GLY C  1 43  ? 27.628  -26.176 51.747  1.00 23.65  ? 3061 GLY C O   1 
ATOM   8530  N N   . PRO C  1 44  ? 28.813  -25.737 49.878  1.00 26.77  ? 3062 PRO C N   1 
ATOM   8531  C CA  . PRO C  1 44  ? 29.685  -26.908 49.996  1.00 26.18  ? 3062 PRO C CA  1 
ATOM   8532  C C   . PRO C  1 44  ? 30.567  -26.857 51.235  1.00 23.82  ? 3062 PRO C C   1 
ATOM   8533  O O   . PRO C  1 44  ? 31.116  -27.874 51.652  1.00 23.67  ? 3062 PRO C O   1 
ATOM   8534  C CB  . PRO C  1 44  ? 30.500  -26.857 48.707  1.00 27.28  ? 3062 PRO C CB  1 
ATOM   8535  C CG  . PRO C  1 44  ? 30.630  -25.375 48.471  1.00 27.77  ? 3062 PRO C CG  1 
ATOM   8536  C CD  . PRO C  1 44  ? 29.215  -24.904 48.728  1.00 28.20  ? 3062 PRO C CD  1 
ATOM   8537  N N   . LEU C  1 45  ? 30.701  -25.675 51.823  1.00 22.46  ? 3063 LEU C N   1 
ATOM   8538  C CA  . LEU C  1 45  ? 31.537  -25.527 53.010  1.00 20.99  ? 3063 LEU C CA  1 
ATOM   8539  C C   . LEU C  1 45  ? 30.824  -25.939 54.298  1.00 19.61  ? 3063 LEU C C   1 
ATOM   8540  O O   . LEU C  1 45  ? 31.421  -25.955 55.375  1.00 22.47  ? 3063 LEU C O   1 
ATOM   8541  C CB  . LEU C  1 45  ? 32.054  -24.089 53.113  1.00 21.18  ? 3063 LEU C CB  1 
ATOM   8542  C CG  . LEU C  1 45  ? 32.942  -23.653 51.940  1.00 24.56  ? 3063 LEU C CG  1 
ATOM   8543  C CD1 . LEU C  1 45  ? 33.516  -22.275 52.221  1.00 24.17  ? 3063 LEU C CD1 1 
ATOM   8544  C CD2 . LEU C  1 45  ? 34.070  -24.657 51.735  1.00 23.07  ? 3063 LEU C CD2 1 
ATOM   8545  N N   . ARG C  1 46  ? 29.544  -26.270 54.196  1.00 19.07  ? 3064 ARG C N   1 
ATOM   8546  C CA  . ARG C  1 46  ? 28.815  -26.711 55.377  1.00 19.23  ? 3064 ARG C CA  1 
ATOM   8547  C C   . ARG C  1 46  ? 29.376  -28.094 55.703  1.00 18.98  ? 3064 ARG C C   1 
ATOM   8548  O O   . ARG C  1 46  ? 29.575  -28.911 54.808  1.00 15.68  ? 3064 ARG C O   1 
ATOM   8549  C CB  . ARG C  1 46  ? 27.314  -26.805 55.088  1.00 19.92  ? 3064 ARG C CB  1 
ATOM   8550  C CG  . ARG C  1 46  ? 26.475  -27.119 56.314  1.00 18.77  ? 3064 ARG C CG  1 
ATOM   8551  C CD  . ARG C  1 46  ? 25.003  -27.301 55.966  1.00 17.44  ? 3064 ARG C CD  1 
ATOM   8552  N NE  . ARG C  1 46  ? 24.340  -26.057 55.579  1.00 15.48  ? 3064 ARG C NE  1 
ATOM   8553  C CZ  . ARG C  1 46  ? 23.192  -26.015 54.909  1.00 16.81  ? 3064 ARG C CZ  1 
ATOM   8554  N NH1 . ARG C  1 46  ? 22.600  -27.152 54.556  1.00 17.13  ? 3064 ARG C NH1 1 
ATOM   8555  N NH2 . ARG C  1 46  ? 22.632  -24.853 54.594  1.00 11.46  ? 3064 ARG C NH2 1 
ATOM   8556  N N   . PHE C  1 47  ? 29.651  -28.337 56.979  1.00 16.35  ? 3065 PHE C N   1 
ATOM   8557  C CA  . PHE C  1 47  ? 30.198  -29.605 57.448  1.00 18.39  ? 3065 PHE C CA  1 
ATOM   8558  C C   . PHE C  1 47  ? 31.623  -29.854 56.978  1.00 17.63  ? 3065 PHE C C   1 
ATOM   8559  O O   . PHE C  1 47  ? 32.003  -30.991 56.721  1.00 18.49  ? 3065 PHE C O   1 
ATOM   8560  C CB  . PHE C  1 47  ? 29.314  -30.787 57.021  1.00 18.43  ? 3065 PHE C CB  1 
ATOM   8561  C CG  . PHE C  1 47  ? 27.867  -30.618 57.372  1.00 19.03  ? 3065 PHE C CG  1 
ATOM   8562  C CD1 . PHE C  1 47  ? 27.487  -30.257 58.661  1.00 18.78  ? 3065 PHE C CD1 1 
ATOM   8563  C CD2 . PHE C  1 47  ? 26.883  -30.807 56.412  1.00 16.79  ? 3065 PHE C CD2 1 
ATOM   8564  C CE1 . PHE C  1 47  ? 26.144  -30.084 58.984  1.00 18.64  ? 3065 PHE C CE1 1 
ATOM   8565  C CE2 . PHE C  1 47  ? 25.541  -30.639 56.725  1.00 19.09  ? 3065 PHE C CE2 1 
ATOM   8566  C CZ  . PHE C  1 47  ? 25.171  -30.275 58.014  1.00 19.22  ? 3065 PHE C CZ  1 
ATOM   8567  N N   . THR C  1 48  ? 32.407  -28.792 56.847  1.00 18.86  ? 3066 THR C N   1 
ATOM   8568  C CA  . THR C  1 48  ? 33.803  -28.934 56.448  1.00 20.04  ? 3066 THR C CA  1 
ATOM   8569  C C   . THR C  1 48  ? 34.609  -27.957 57.289  1.00 19.95  ? 3066 THR C C   1 
ATOM   8570  O O   . THR C  1 48  ? 34.070  -26.974 57.797  1.00 19.26  ? 3066 THR C O   1 
ATOM   8571  C CB  . THR C  1 48  ? 34.042  -28.595 54.954  1.00 19.52  ? 3066 THR C CB  1 
ATOM   8572  O OG1 . THR C  1 48  ? 34.048  -27.173 54.777  1.00 19.93  ? 3066 THR C OG1 1 
ATOM   8573  C CG2 . THR C  1 48  ? 32.953  -29.210 54.084  1.00 19.63  ? 3066 THR C CG2 1 
ATOM   8574  N N   . PRO C  1 49  ? 35.912  -28.216 57.454  1.00 21.42  ? 3067 PRO C N   1 
ATOM   8575  C CA  . PRO C  1 49  ? 36.725  -27.297 58.256  1.00 19.93  ? 3067 PRO C CA  1 
ATOM   8576  C C   . PRO C  1 49  ? 36.728  -25.868 57.713  1.00 19.63  ? 3067 PRO C C   1 
ATOM   8577  O O   . PRO C  1 49  ? 36.506  -25.638 56.519  1.00 19.66  ? 3067 PRO C O   1 
ATOM   8578  C CB  . PRO C  1 49  ? 38.111  -27.954 58.256  1.00 21.21  ? 3067 PRO C CB  1 
ATOM   8579  C CG  . PRO C  1 49  ? 38.104  -28.838 57.033  1.00 25.09  ? 3067 PRO C CG  1 
ATOM   8580  C CD  . PRO C  1 49  ? 36.698  -29.376 56.994  1.00 21.21  ? 3067 PRO C CD  1 
ATOM   8581  N N   . PRO C  1 50  ? 36.950  -24.883 58.596  1.00 16.78  ? 3068 PRO C N   1 
ATOM   8582  C CA  . PRO C  1 50  ? 36.980  -23.470 58.218  1.00 18.20  ? 3068 PRO C CA  1 
ATOM   8583  C C   . PRO C  1 50  ? 38.160  -23.132 57.316  1.00 20.74  ? 3068 PRO C C   1 
ATOM   8584  O O   . PRO C  1 50  ? 39.288  -23.557 57.568  1.00 21.62  ? 3068 PRO C O   1 
ATOM   8585  C CB  . PRO C  1 50  ? 37.068  -22.756 59.568  1.00 17.72  ? 3068 PRO C CB  1 
ATOM   8586  C CG  . PRO C  1 50  ? 37.876  -23.711 60.388  1.00 14.31  ? 3068 PRO C CG  1 
ATOM   8587  C CD  . PRO C  1 50  ? 37.209  -25.037 60.039  1.00 16.34  ? 3068 PRO C CD  1 
ATOM   8588  N N   . GLN C  1 51  ? 37.890  -22.366 56.264  1.00 21.01  ? 3069 GLN C N   1 
ATOM   8589  C CA  . GLN C  1 51  ? 38.928  -21.952 55.338  1.00 24.02  ? 3069 GLN C CA  1 
ATOM   8590  C C   . GLN C  1 51  ? 39.260  -20.490 55.614  1.00 23.95  ? 3069 GLN C C   1 
ATOM   8591  O O   . GLN C  1 51  ? 38.420  -19.737 56.098  1.00 22.90  ? 3069 GLN C O   1 
ATOM   8592  C CB  . GLN C  1 51  ? 38.448  -22.121 53.892  1.00 24.91  ? 3069 GLN C CB  1 
ATOM   8593  C CG  . GLN C  1 51  ? 37.921  -23.515 53.582  1.00 30.01  ? 3069 GLN C CG  1 
ATOM   8594  C CD  . GLN C  1 51  ? 37.908  -23.822 52.094  1.00 32.92  ? 3069 GLN C CD  1 
ATOM   8595  O OE1 . GLN C  1 51  ? 37.424  -23.030 51.285  1.00 33.53  ? 3069 GLN C OE1 1 
ATOM   8596  N NE2 . GLN C  1 51  ? 38.437  -24.983 51.728  1.00 35.25  ? 3069 GLN C NE2 1 
ATOM   8597  N N   . PRO C  1 52  ? 40.493  -20.065 55.311  1.00 25.46  ? 3070 PRO C N   1 
ATOM   8598  C CA  . PRO C  1 52  ? 40.857  -18.666 55.559  1.00 25.58  ? 3070 PRO C CA  1 
ATOM   8599  C C   . PRO C  1 52  ? 39.947  -17.650 54.866  1.00 25.12  ? 3070 PRO C C   1 
ATOM   8600  O O   . PRO C  1 52  ? 39.416  -17.898 53.780  1.00 23.07  ? 3070 PRO C O   1 
ATOM   8601  C CB  . PRO C  1 52  ? 42.307  -18.590 55.068  1.00 27.71  ? 3070 PRO C CB  1 
ATOM   8602  C CG  . PRO C  1 52  ? 42.387  -19.688 54.041  1.00 29.28  ? 3070 PRO C CG  1 
ATOM   8603  C CD  . PRO C  1 52  ? 41.612  -20.802 54.699  1.00 27.19  ? 3070 PRO C CD  1 
ATOM   8604  N N   . ALA C  1 53  ? 39.768  -16.503 55.511  1.00 23.89  ? 3071 ALA C N   1 
ATOM   8605  C CA  . ALA C  1 53  ? 38.935  -15.440 54.966  1.00 23.89  ? 3071 ALA C CA  1 
ATOM   8606  C C   . ALA C  1 53  ? 39.641  -14.797 53.777  1.00 24.43  ? 3071 ALA C C   1 
ATOM   8607  O O   . ALA C  1 53  ? 40.869  -14.692 53.757  1.00 23.17  ? 3071 ALA C O   1 
ATOM   8608  C CB  . ALA C  1 53  ? 38.669  -14.395 56.037  1.00 21.08  ? 3071 ALA C CB  1 
ATOM   8609  N N   . GLU C  1 54  ? 38.862  -14.378 52.784  1.00 26.09  ? 3072 GLU C N   1 
ATOM   8610  C CA  . GLU C  1 54  ? 39.420  -13.729 51.603  1.00 27.29  ? 3072 GLU C CA  1 
ATOM   8611  C C   . GLU C  1 54  ? 39.763  -12.270 51.915  1.00 25.84  ? 3072 GLU C C   1 
ATOM   8612  O O   . GLU C  1 54  ? 39.022  -11.590 52.618  1.00 24.37  ? 3072 GLU C O   1 
ATOM   8613  C CB  . GLU C  1 54  ? 38.423  -13.788 50.441  1.00 30.11  ? 3072 GLU C CB  1 
ATOM   8614  C CG  . GLU C  1 54  ? 38.249  -15.180 49.850  1.00 38.17  ? 3072 GLU C CG  1 
ATOM   8615  C CD  . GLU C  1 54  ? 39.569  -15.788 49.406  1.00 41.32  ? 3072 GLU C CD  1 
ATOM   8616  O OE1 . GLU C  1 54  ? 40.275  -15.157 48.589  1.00 44.38  ? 3072 GLU C OE1 1 
ATOM   8617  O OE2 . GLU C  1 54  ? 39.903  -16.898 49.874  1.00 44.27  ? 3072 GLU C OE2 1 
ATOM   8618  N N   . PRO C  1 55  ? 40.898  -11.774 51.392  1.00 25.43  ? 3073 PRO C N   1 
ATOM   8619  C CA  . PRO C  1 55  ? 41.314  -10.386 51.633  1.00 24.47  ? 3073 PRO C CA  1 
ATOM   8620  C C   . PRO C  1 55  ? 40.386  -9.367  50.981  1.00 23.81  ? 3073 PRO C C   1 
ATOM   8621  O O   . PRO C  1 55  ? 39.732  -9.654  49.978  1.00 24.60  ? 3073 PRO C O   1 
ATOM   8622  C CB  . PRO C  1 55  ? 42.726  -10.346 51.055  1.00 24.75  ? 3073 PRO C CB  1 
ATOM   8623  C CG  . PRO C  1 55  ? 42.644  -11.329 49.920  1.00 26.56  ? 3073 PRO C CG  1 
ATOM   8624  C CD  . PRO C  1 55  ? 41.880  -12.478 50.548  1.00 24.80  ? 3073 PRO C CD  1 
ATOM   8625  N N   . TRP C  1 56  ? 40.330  -8.171  51.555  1.00 23.92  ? 3074 TRP C N   1 
ATOM   8626  C CA  . TRP C  1 56  ? 39.473  -7.124  51.018  1.00 24.19  ? 3074 TRP C CA  1 
ATOM   8627  C C   . TRP C  1 56  ? 40.257  -5.855  50.729  1.00 25.64  ? 3074 TRP C C   1 
ATOM   8628  O O   . TRP C  1 56  ? 41.325  -5.622  51.298  1.00 26.37  ? 3074 TRP C O   1 
ATOM   8629  C CB  . TRP C  1 56  ? 38.331  -6.822  51.993  1.00 24.58  ? 3074 TRP C CB  1 
ATOM   8630  C CG  . TRP C  1 56  ? 38.795  -6.466  53.374  1.00 23.81  ? 3074 TRP C CG  1 
ATOM   8631  C CD1 . TRP C  1 56  ? 39.181  -5.236  53.823  1.00 22.45  ? 3074 TRP C CD1 1 
ATOM   8632  C CD2 . TRP C  1 56  ? 38.958  -7.366  54.475  1.00 22.54  ? 3074 TRP C CD2 1 
ATOM   8633  N NE1 . TRP C  1 56  ? 39.575  -5.314  55.139  1.00 22.44  ? 3074 TRP C NE1 1 
ATOM   8634  C CE2 . TRP C  1 56  ? 39.449  -6.610  55.564  1.00 22.22  ? 3074 TRP C CE2 1 
ATOM   8635  C CE3 . TRP C  1 56  ? 38.738  -8.738  54.648  1.00 21.65  ? 3074 TRP C CE3 1 
ATOM   8636  C CZ2 . TRP C  1 56  ? 39.724  -7.182  56.811  1.00 22.61  ? 3074 TRP C CZ2 1 
ATOM   8637  C CZ3 . TRP C  1 56  ? 39.012  -9.308  55.889  1.00 22.76  ? 3074 TRP C CZ3 1 
ATOM   8638  C CH2 . TRP C  1 56  ? 39.500  -8.528  56.952  1.00 22.76  ? 3074 TRP C CH2 1 
ATOM   8639  N N   . SER C  1 57  ? 39.715  -5.041  49.833  1.00 25.52  ? 3075 SER C N   1 
ATOM   8640  C CA  . SER C  1 57  ? 40.348  -3.791  49.451  1.00 28.43  ? 3075 SER C CA  1 
ATOM   8641  C C   . SER C  1 57  ? 39.770  -2.674  50.303  1.00 28.56  ? 3075 SER C C   1 
ATOM   8642  O O   . SER C  1 57  ? 38.712  -2.832  50.911  1.00 30.69  ? 3075 SER C O   1 
ATOM   8643  C CB  . SER C  1 57  ? 40.076  -3.499  47.971  1.00 28.29  ? 3075 SER C CB  1 
ATOM   8644  O OG  . SER C  1 57  ? 40.376  -4.625  47.161  1.00 28.65  ? 3075 SER C OG  1 
ATOM   8645  N N   . PHE C  1 58  ? 40.470  -1.552  50.357  1.00 28.16  ? 3076 PHE C N   1 
ATOM   8646  C CA  . PHE C  1 58  ? 39.992  -0.406  51.113  1.00 28.36  ? 3076 PHE C CA  1 
ATOM   8647  C C   . PHE C  1 58  ? 39.820  -0.715  52.606  1.00 27.90  ? 3076 PHE C C   1 
ATOM   8648  O O   . PHE C  1 58  ? 40.525  -1.561  53.153  1.00 27.48  ? 3076 PHE C O   1 
ATOM   8649  C CB  . PHE C  1 58  ? 38.678  0.075   50.496  1.00 27.82  ? 3076 PHE C CB  1 
ATOM   8650  C CG  . PHE C  1 58  ? 38.709  0.133   48.989  1.00 30.56  ? 3076 PHE C CG  1 
ATOM   8651  C CD1 . PHE C  1 58  ? 37.848  -0.652  48.231  1.00 30.16  ? 3076 PHE C CD1 1 
ATOM   8652  C CD2 . PHE C  1 58  ? 39.615  0.959   48.329  1.00 31.18  ? 3076 PHE C CD2 1 
ATOM   8653  C CE1 . PHE C  1 58  ? 37.890  -0.614  46.833  1.00 32.96  ? 3076 PHE C CE1 1 
ATOM   8654  C CE2 . PHE C  1 58  ? 39.664  1.004   46.931  1.00 31.19  ? 3076 PHE C CE2 1 
ATOM   8655  C CZ  . PHE C  1 58  ? 38.802  0.217   46.185  1.00 30.10  ? 3076 PHE C CZ  1 
ATOM   8656  N N   . VAL C  1 59  ? 38.886  -0.031  53.259  1.00 27.52  ? 3077 VAL C N   1 
ATOM   8657  C CA  . VAL C  1 59  ? 38.669  -0.226  54.688  1.00 27.58  ? 3077 VAL C CA  1 
ATOM   8658  C C   . VAL C  1 59  ? 37.337  -0.897  55.009  1.00 27.04  ? 3077 VAL C C   1 
ATOM   8659  O O   . VAL C  1 59  ? 36.275  -0.411  54.613  1.00 26.89  ? 3077 VAL C O   1 
ATOM   8660  C CB  . VAL C  1 59  ? 38.721  1.123   55.448  1.00 28.08  ? 3077 VAL C CB  1 
ATOM   8661  C CG1 . VAL C  1 59  ? 38.788  0.870   56.954  1.00 27.37  ? 3077 VAL C CG1 1 
ATOM   8662  C CG2 . VAL C  1 59  ? 39.923  1.935   54.996  1.00 28.63  ? 3077 VAL C CG2 1 
ATOM   8663  N N   . LYS C  1 60  ? 37.400  -2.012  55.730  1.00 26.60  ? 3078 LYS C N   1 
ATOM   8664  C CA  . LYS C  1 60  ? 36.193  -2.731  56.121  1.00 28.16  ? 3078 LYS C CA  1 
ATOM   8665  C C   . LYS C  1 60  ? 35.643  -2.094  57.397  1.00 28.84  ? 3078 LYS C C   1 
ATOM   8666  O O   . LYS C  1 60  ? 36.372  -1.910  58.370  1.00 29.68  ? 3078 LYS C O   1 
ATOM   8667  C CB  . LYS C  1 60  ? 36.501  -4.210  56.374  1.00 26.42  ? 3078 LYS C CB  1 
ATOM   8668  C CG  . LYS C  1 60  ? 35.299  -5.008  56.862  1.00 27.47  ? 3078 LYS C CG  1 
ATOM   8669  C CD  . LYS C  1 60  ? 35.651  -6.460  57.165  1.00 27.65  ? 3078 LYS C CD  1 
ATOM   8670  C CE  . LYS C  1 60  ? 35.916  -7.256  55.898  1.00 28.93  ? 3078 LYS C CE  1 
ATOM   8671  N NZ  . LYS C  1 60  ? 34.759  -7.206  54.953  1.00 30.04  ? 3078 LYS C NZ  1 
ATOM   8672  N N   . ASN C  1 61  ? 34.357  -1.759  57.385  1.00 30.87  ? 3079 ASN C N   1 
ATOM   8673  C CA  . ASN C  1 61  ? 33.701  -1.136  58.531  1.00 32.32  ? 3079 ASN C CA  1 
ATOM   8674  C C   . ASN C  1 61  ? 33.332  -2.175  59.579  1.00 29.82  ? 3079 ASN C C   1 
ATOM   8675  O O   . ASN C  1 61  ? 32.405  -2.952  59.386  1.00 30.45  ? 3079 ASN C O   1 
ATOM   8676  C CB  . ASN C  1 61  ? 32.434  -0.412  58.072  1.00 38.67  ? 3079 ASN C CB  1 
ATOM   8677  C CG  . ASN C  1 61  ? 32.381  1.028   58.541  1.00 47.65  ? 3079 ASN C CG  1 
ATOM   8678  O OD1 . ASN C  1 61  ? 33.323  1.790   58.323  1.00 49.32  ? 3079 ASN C OD1 1 
ATOM   8679  N ND2 . ASN C  1 61  ? 31.273  1.410   59.168  1.00 54.52  ? 3079 ASN C ND2 1 
ATOM   8680  N N   . ALA C  1 62  ? 34.055  -2.186  60.692  1.00 28.02  ? 3080 ALA C N   1 
ATOM   8681  C CA  . ALA C  1 62  ? 33.778  -3.139  61.760  1.00 27.31  ? 3080 ALA C CA  1 
ATOM   8682  C C   . ALA C  1 62  ? 33.077  -2.413  62.898  1.00 27.53  ? 3080 ALA C C   1 
ATOM   8683  O O   . ALA C  1 62  ? 33.606  -2.323  64.008  1.00 26.71  ? 3080 ALA C O   1 
ATOM   8684  C CB  . ALA C  1 62  ? 35.075  -3.760  62.256  1.00 26.98  ? 3080 ALA C CB  1 
ATOM   8685  N N   . THR C  1 63  ? 31.882  -1.900  62.625  1.00 27.63  ? 3081 THR C N   1 
ATOM   8686  C CA  . THR C  1 63  ? 31.145  -1.163  63.642  1.00 30.02  ? 3081 THR C CA  1 
ATOM   8687  C C   . THR C  1 63  ? 29.746  -1.692  63.936  1.00 28.97  ? 3081 THR C C   1 
ATOM   8688  O O   . THR C  1 63  ? 28.983  -1.061  64.664  1.00 29.71  ? 3081 THR C O   1 
ATOM   8689  C CB  . THR C  1 63  ? 31.048  0.331   63.266  1.00 30.65  ? 3081 THR C CB  1 
ATOM   8690  O OG1 . THR C  1 63  ? 30.370  0.468   62.012  1.00 33.57  ? 3081 THR C OG1 1 
ATOM   8691  C CG2 . THR C  1 63  ? 32.440  0.936   63.149  1.00 32.22  ? 3081 THR C CG2 1 
ATOM   8692  N N   . SER C  1 64  ? 29.403  -2.845  63.375  1.00 28.49  ? 3082 SER C N   1 
ATOM   8693  C CA  . SER C  1 64  ? 28.092  -3.423  63.631  1.00 27.24  ? 3082 SER C CA  1 
ATOM   8694  C C   . SER C  1 64  ? 28.234  -4.866  64.106  1.00 25.80  ? 3082 SER C C   1 
ATOM   8695  O O   . SER C  1 64  ? 29.121  -5.598  63.663  1.00 22.58  ? 3082 SER C O   1 
ATOM   8696  C CB  . SER C  1 64  ? 27.219  -3.356  62.374  1.00 29.22  ? 3082 SER C CB  1 
ATOM   8697  O OG  . SER C  1 64  ? 27.757  -4.144  61.330  1.00 36.66  ? 3082 SER C OG  1 
ATOM   8698  N N   . TYR C  1 65  ? 27.364  -5.260  65.030  1.00 24.28  ? 3083 TYR C N   1 
ATOM   8699  C CA  . TYR C  1 65  ? 27.383  -6.609  65.576  1.00 23.09  ? 3083 TYR C CA  1 
ATOM   8700  C C   . TYR C  1 65  ? 27.101  -7.638  64.496  1.00 21.14  ? 3083 TYR C C   1 
ATOM   8701  O O   . TYR C  1 65  ? 26.175  -7.484  63.698  1.00 19.48  ? 3083 TYR C O   1 
ATOM   8702  C CB  . TYR C  1 65  ? 26.351  -6.734  66.699  1.00 24.76  ? 3083 TYR C CB  1 
ATOM   8703  C CG  . TYR C  1 65  ? 26.721  -5.909  67.906  1.00 26.63  ? 3083 TYR C CG  1 
ATOM   8704  C CD1 . TYR C  1 65  ? 27.765  -6.301  68.741  1.00 27.84  ? 3083 TYR C CD1 1 
ATOM   8705  C CD2 . TYR C  1 65  ? 26.077  -4.702  68.175  1.00 28.57  ? 3083 TYR C CD2 1 
ATOM   8706  C CE1 . TYR C  1 65  ? 28.165  -5.512  69.814  1.00 28.86  ? 3083 TYR C CE1 1 
ATOM   8707  C CE2 . TYR C  1 65  ? 26.471  -3.901  69.249  1.00 28.87  ? 3083 TYR C CE2 1 
ATOM   8708  C CZ  . TYR C  1 65  ? 27.516  -4.314  70.060  1.00 29.97  ? 3083 TYR C CZ  1 
ATOM   8709  O OH  . TYR C  1 65  ? 27.931  -3.525  71.106  1.00 32.43  ? 3083 TYR C OH  1 
ATOM   8710  N N   . PRO C  1 66  ? 27.914  -8.702  64.447  1.00 19.28  ? 3084 PRO C N   1 
ATOM   8711  C CA  . PRO C  1 66  ? 27.700  -9.735  63.436  1.00 19.19  ? 3084 PRO C CA  1 
ATOM   8712  C C   . PRO C  1 66  ? 26.524  -10.624 63.832  1.00 20.12  ? 3084 PRO C C   1 
ATOM   8713  O O   . PRO C  1 66  ? 26.087  -10.626 64.988  1.00 19.62  ? 3084 PRO C O   1 
ATOM   8714  C CB  . PRO C  1 66  ? 29.019  -10.497 63.450  1.00 18.19  ? 3084 PRO C CB  1 
ATOM   8715  C CG  . PRO C  1 66  ? 29.396  -10.447 64.910  1.00 19.94  ? 3084 PRO C CG  1 
ATOM   8716  C CD  . PRO C  1 66  ? 29.107  -8.998  65.263  1.00 18.35  ? 3084 PRO C CD  1 
ATOM   8717  N N   . PRO C  1 67  ? 25.970  -11.367 62.871  1.00 19.09  ? 3085 PRO C N   1 
ATOM   8718  C CA  . PRO C  1 67  ? 24.855  -12.230 63.262  1.00 18.29  ? 3085 PRO C CA  1 
ATOM   8719  C C   . PRO C  1 67  ? 25.398  -13.355 64.143  1.00 18.99  ? 3085 PRO C C   1 
ATOM   8720  O O   . PRO C  1 67  ? 26.612  -13.568 64.203  1.00 18.55  ? 3085 PRO C O   1 
ATOM   8721  C CB  . PRO C  1 67  ? 24.333  -12.747 61.922  1.00 19.79  ? 3085 PRO C CB  1 
ATOM   8722  C CG  . PRO C  1 67  ? 25.556  -12.724 61.041  1.00 20.52  ? 3085 PRO C CG  1 
ATOM   8723  C CD  . PRO C  1 67  ? 26.216  -11.424 61.418  1.00 18.56  ? 3085 PRO C CD  1 
ATOM   8724  N N   . MET C  1 68  ? 24.513  -14.057 64.847  1.00 18.31  ? 3086 MET C N   1 
ATOM   8725  C CA  . MET C  1 68  ? 24.949  -15.180 65.670  1.00 17.31  ? 3086 MET C CA  1 
ATOM   8726  C C   . MET C  1 68  ? 24.667  -16.425 64.838  1.00 16.89  ? 3086 MET C C   1 
ATOM   8727  O O   . MET C  1 68  ? 23.741  -16.429 64.030  1.00 19.45  ? 3086 MET C O   1 
ATOM   8728  C CB  . MET C  1 68  ? 24.188  -15.232 67.005  1.00 15.91  ? 3086 MET C CB  1 
ATOM   8729  C CG  . MET C  1 68  ? 22.675  -15.423 66.915  1.00 19.81  ? 3086 MET C CG  1 
ATOM   8730  S SD  . MET C  1 68  ? 21.932  -15.260 68.585  1.00 24.72  ? 3086 MET C SD  1 
ATOM   8731  C CE  . MET C  1 68  ? 20.334  -16.033 68.385  1.00 21.82  ? 3086 MET C CE  1 
ATOM   8732  N N   . CYS C  1 69  ? 25.465  -17.471 65.017  1.00 14.86  ? 3087 CYS C N   1 
ATOM   8733  C CA  . CYS C  1 69  ? 25.269  -18.688 64.240  1.00 16.72  ? 3087 CYS C CA  1 
ATOM   8734  C C   . CYS C  1 69  ? 23.854  -19.240 64.411  1.00 17.10  ? 3087 CYS C C   1 
ATOM   8735  O O   . CYS C  1 69  ? 23.277  -19.174 65.498  1.00 15.90  ? 3087 CYS C O   1 
ATOM   8736  C CB  . CYS C  1 69  ? 26.303  -19.746 64.639  1.00 16.05  ? 3087 CYS C CB  1 
ATOM   8737  S SG  . CYS C  1 69  ? 28.043  -19.228 64.427  1.00 24.69  ? 3087 CYS C SG  1 
ATOM   8738  N N   . THR C  1 70  ? 23.302  -19.780 63.329  1.00 14.34  ? 3088 THR C N   1 
ATOM   8739  C CA  . THR C  1 70  ? 21.956  -20.335 63.348  1.00 16.31  ? 3088 THR C CA  1 
ATOM   8740  C C   . THR C  1 70  ? 21.732  -21.194 64.589  1.00 16.53  ? 3088 THR C C   1 
ATOM   8741  O O   . THR C  1 70  ? 22.578  -22.016 64.957  1.00 15.99  ? 3088 THR C O   1 
ATOM   8742  C CB  . THR C  1 70  ? 21.687  -21.165 62.082  1.00 17.05  ? 3088 THR C CB  1 
ATOM   8743  O OG1 . THR C  1 70  ? 22.201  -20.460 60.942  1.00 15.32  ? 3088 THR C OG1 1 
ATOM   8744  C CG2 . THR C  1 70  ? 20.187  -21.355 61.886  1.00 15.65  ? 3088 THR C CG2 1 
ATOM   8745  N N   . GLN C  1 71  ? 20.580  -20.989 65.224  1.00 14.73  ? 3089 GLN C N   1 
ATOM   8746  C CA  . GLN C  1 71  ? 20.212  -21.693 66.449  1.00 14.68  ? 3089 GLN C CA  1 
ATOM   8747  C C   . GLN C  1 71  ? 18.752  -21.351 66.763  1.00 16.29  ? 3089 GLN C C   1 
ATOM   8748  O O   . GLN C  1 71  ? 18.173  -20.475 66.123  1.00 16.05  ? 3089 GLN C O   1 
ATOM   8749  C CB  . GLN C  1 71  ? 21.088  -21.181 67.586  1.00 10.86  ? 3089 GLN C CB  1 
ATOM   8750  C CG  . GLN C  1 71  ? 20.979  -19.658 67.731  1.00 14.18  ? 3089 GLN C CG  1 
ATOM   8751  C CD  . GLN C  1 71  ? 21.952  -19.091 68.733  1.00 16.06  ? 3089 GLN C CD  1 
ATOM   8752  O OE1 . GLN C  1 71  ? 21.649  -18.979 69.928  1.00 16.14  ? 3089 GLN C OE1 1 
ATOM   8753  N NE2 . GLN C  1 71  ? 23.147  -18.746 68.259  1.00 14.71  ? 3089 GLN C NE2 1 
ATOM   8754  N N   . ASP C  1 72  ? 18.165  -22.044 67.738  1.00 17.11  ? 3090 ASP C N   1 
ATOM   8755  C CA  . ASP C  1 72  ? 16.791  -21.765 68.165  1.00 19.30  ? 3090 ASP C CA  1 
ATOM   8756  C C   . ASP C  1 72  ? 16.803  -20.283 68.553  1.00 17.78  ? 3090 ASP C C   1 
ATOM   8757  O O   . ASP C  1 72  ? 17.458  -19.896 69.520  1.00 19.35  ? 3090 ASP C O   1 
ATOM   8758  C CB  . ASP C  1 72  ? 16.446  -22.603 69.397  1.00 20.71  ? 3090 ASP C CB  1 
ATOM   8759  C CG  . ASP C  1 72  ? 15.008  -22.407 69.856  1.00 24.04  ? 3090 ASP C CG  1 
ATOM   8760  O OD1 . ASP C  1 72  ? 14.476  -21.281 69.750  1.00 24.80  ? 3090 ASP C OD1 1 
ATOM   8761  O OD2 . ASP C  1 72  ? 14.412  -23.390 70.337  1.00 26.56  ? 3090 ASP C OD2 1 
ATOM   8762  N N   . PRO C  1 73  ? 16.080  -19.435 67.811  1.00 18.11  ? 3091 PRO C N   1 
ATOM   8763  C CA  . PRO C  1 73  ? 16.092  -18.009 68.157  1.00 18.78  ? 3091 PRO C CA  1 
ATOM   8764  C C   . PRO C  1 73  ? 15.529  -17.619 69.524  1.00 19.55  ? 3091 PRO C C   1 
ATOM   8765  O O   . PRO C  1 73  ? 16.051  -16.719 70.166  1.00 17.65  ? 3091 PRO C O   1 
ATOM   8766  C CB  . PRO C  1 73  ? 15.343  -17.365 66.993  1.00 17.66  ? 3091 PRO C CB  1 
ATOM   8767  C CG  . PRO C  1 73  ? 14.384  -18.440 66.573  1.00 17.39  ? 3091 PRO C CG  1 
ATOM   8768  C CD  . PRO C  1 73  ? 15.238  -19.688 66.629  1.00 18.66  ? 3091 PRO C CD  1 
ATOM   8769  N N   . LYS C  1 74  ? 14.477  -18.288 69.974  1.00 21.22  ? 3092 LYS C N   1 
ATOM   8770  C CA  . LYS C  1 74  ? 13.910  -17.953 71.275  1.00 24.03  ? 3092 LYS C CA  1 
ATOM   8771  C C   . LYS C  1 74  ? 14.866  -18.341 72.395  1.00 23.16  ? 3092 LYS C C   1 
ATOM   8772  O O   . LYS C  1 74  ? 15.076  -17.583 73.344  1.00 24.96  ? 3092 LYS C O   1 
ATOM   8773  C CB  . LYS C  1 74  ? 12.557  -18.643 71.459  1.00 25.48  ? 3092 LYS C CB  1 
ATOM   8774  C CG  . LYS C  1 74  ? 11.470  -18.088 70.553  1.00 30.25  ? 3092 LYS C CG  1 
ATOM   8775  C CD  . LYS C  1 74  ? 10.145  -18.785 70.795  1.00 32.93  ? 3092 LYS C CD  1 
ATOM   8776  C CE  . LYS C  1 74  ? 8.988   -18.034 70.142  1.00 35.19  ? 3092 LYS C CE  1 
ATOM   8777  N NZ  . LYS C  1 74  ? 9.122   -17.948 68.666  1.00 40.81  ? 3092 LYS C NZ  1 
ATOM   8778  N N   . ALA C  1 75  ? 15.460  -19.520 72.276  1.00 23.18  ? 3093 ALA C N   1 
ATOM   8779  C CA  . ALA C  1 75  ? 16.398  -19.997 73.282  1.00 20.83  ? 3093 ALA C CA  1 
ATOM   8780  C C   . ALA C  1 75  ? 17.655  -19.137 73.288  1.00 21.43  ? 3093 ALA C C   1 
ATOM   8781  O O   . ALA C  1 75  ? 18.195  -18.811 74.345  1.00 18.82  ? 3093 ALA C O   1 
ATOM   8782  C CB  . ALA C  1 75  ? 16.764  -21.421 72.993  1.00 22.61  ? 3093 ALA C CB  1 
ATOM   8783  N N   . GLY C  1 76  ? 18.121  -18.776 72.096  1.00 19.90  ? 3094 GLY C N   1 
ATOM   8784  C CA  . GLY C  1 76  ? 19.311  -17.956 71.997  1.00 19.24  ? 3094 GLY C CA  1 
ATOM   8785  C C   . GLY C  1 76  ? 19.121  -16.573 72.591  1.00 20.45  ? 3094 GLY C C   1 
ATOM   8786  O O   . GLY C  1 76  ? 19.999  -16.068 73.296  1.00 20.63  ? 3094 GLY C O   1 
ATOM   8787  N N   . GLN C  1 77  ? 17.982  -15.947 72.318  1.00 21.27  ? 3095 GLN C N   1 
ATOM   8788  C CA  . GLN C  1 77  ? 17.753  -14.614 72.855  1.00 23.02  ? 3095 GLN C CA  1 
ATOM   8789  C C   . GLN C  1 77  ? 17.604  -14.661 74.370  1.00 22.04  ? 3095 GLN C C   1 
ATOM   8790  O O   . GLN C  1 77  ? 18.085  -13.774 75.071  1.00 24.15  ? 3095 GLN C O   1 
ATOM   8791  C CB  . GLN C  1 77  ? 16.512  -13.960 72.238  1.00 25.55  ? 3095 GLN C CB  1 
ATOM   8792  C CG  . GLN C  1 77  ? 16.311  -12.533 72.753  1.00 31.77  ? 3095 GLN C CG  1 
ATOM   8793  C CD  . GLN C  1 77  ? 15.300  -11.731 71.961  1.00 37.74  ? 3095 GLN C CD  1 
ATOM   8794  O OE1 . GLN C  1 77  ? 14.124  -12.100 71.866  1.00 41.50  ? 3095 GLN C OE1 1 
ATOM   8795  N NE2 . GLN C  1 77  ? 15.753  -10.617 71.388  1.00 38.73  ? 3095 GLN C NE2 1 
ATOM   8796  N N   . LEU C  1 78  ? 16.939  -15.694 74.875  1.00 22.09  ? 3096 LEU C N   1 
ATOM   8797  C CA  . LEU C  1 78  ? 16.752  -15.831 76.316  1.00 22.60  ? 3096 LEU C CA  1 
ATOM   8798  C C   . LEU C  1 78  ? 18.088  -15.984 77.033  1.00 22.14  ? 3096 LEU C C   1 
ATOM   8799  O O   . LEU C  1 78  ? 18.333  -15.326 78.041  1.00 22.91  ? 3096 LEU C O   1 
ATOM   8800  C CB  . LEU C  1 78  ? 15.862  -17.032 76.641  1.00 21.24  ? 3096 LEU C CB  1 
ATOM   8801  C CG  . LEU C  1 78  ? 15.634  -17.254 78.143  1.00 20.76  ? 3096 LEU C CG  1 
ATOM   8802  C CD1 . LEU C  1 78  ? 15.050  -15.984 78.764  1.00 21.45  ? 3096 LEU C CD1 1 
ATOM   8803  C CD2 . LEU C  1 78  ? 14.707  -18.437 78.356  1.00 19.72  ? 3096 LEU C CD2 1 
ATOM   8804  N N   . LEU C  1 79  ? 18.954  -16.854 76.519  1.00 21.29  ? 3097 LEU C N   1 
ATOM   8805  C CA  . LEU C  1 79  ? 20.252  -17.052 77.149  1.00 21.33  ? 3097 LEU C CA  1 
ATOM   8806  C C   . LEU C  1 79  ? 21.081  -15.777 77.097  1.00 20.52  ? 3097 LEU C C   1 
ATOM   8807  O O   . LEU C  1 79  ? 21.764  -15.431 78.063  1.00 22.54  ? 3097 LEU C O   1 
ATOM   8808  C CB  . LEU C  1 79  ? 21.031  -18.184 76.474  1.00 21.57  ? 3097 LEU C CB  1 
ATOM   8809  C CG  . LEU C  1 79  ? 22.424  -18.405 77.079  1.00 21.74  ? 3097 LEU C CG  1 
ATOM   8810  C CD1 . LEU C  1 79  ? 22.296  -18.876 78.520  1.00 22.61  ? 3097 LEU C CD1 1 
ATOM   8811  C CD2 . LEU C  1 79  ? 23.192  -19.415 76.256  1.00 23.57  ? 3097 LEU C CD2 1 
ATOM   8812  N N   . SER C  1 80  ? 21.016  -15.077 75.970  1.00 19.44  ? 3098 SER C N   1 
ATOM   8813  C CA  . SER C  1 80  ? 21.772  -13.842 75.809  1.00 20.01  ? 3098 SER C CA  1 
ATOM   8814  C C   . SER C  1 80  ? 21.355  -12.800 76.846  1.00 20.34  ? 3098 SER C C   1 
ATOM   8815  O O   . SER C  1 80  ? 22.204  -12.130 77.430  1.00 21.29  ? 3098 SER C O   1 
ATOM   8816  C CB  . SER C  1 80  ? 21.576  -13.279 74.400  1.00 18.60  ? 3098 SER C CB  1 
ATOM   8817  O OG  . SER C  1 80  ? 22.355  -12.113 74.216  1.00 20.73  ? 3098 SER C OG  1 
ATOM   8818  N N   . GLU C  1 81  ? 20.051  -12.667 77.074  1.00 21.23  ? 3099 GLU C N   1 
ATOM   8819  C CA  . GLU C  1 81  ? 19.545  -11.704 78.053  1.00 23.01  ? 3099 GLU C CA  1 
ATOM   8820  C C   . GLU C  1 81  ? 19.936  -12.094 79.480  1.00 21.17  ? 3099 GLU C C   1 
ATOM   8821  O O   . GLU C  1 81  ? 20.181  -11.232 80.318  1.00 20.30  ? 3099 GLU C O   1 
ATOM   8822  C CB  . GLU C  1 81  ? 18.019  -11.593 77.966  1.00 25.93  ? 3099 GLU C CB  1 
ATOM   8823  C CG  . GLU C  1 81  ? 17.498  -11.154 76.610  1.00 33.25  ? 3099 GLU C CG  1 
ATOM   8824  C CD  . GLU C  1 81  ? 16.010  -10.845 76.627  1.00 38.43  ? 3099 GLU C CD  1 
ATOM   8825  O OE1 . GLU C  1 81  ? 15.249  -11.601 77.272  1.00 41.11  ? 3099 GLU C OE1 1 
ATOM   8826  O OE2 . GLU C  1 81  ? 15.599  -9.851  75.988  1.00 39.90  ? 3099 GLU C OE2 1 
ATOM   8827  N N   . LEU C  1 82  ? 19.998  -13.395 79.745  1.00 19.88  ? 3100 LEU C N   1 
ATOM   8828  C CA  . LEU C  1 82  ? 20.349  -13.900 81.072  1.00 20.68  ? 3100 LEU C CA  1 
ATOM   8829  C C   . LEU C  1 82  ? 21.837  -13.794 81.409  1.00 22.26  ? 3100 LEU C C   1 
ATOM   8830  O O   . LEU C  1 82  ? 22.204  -13.680 82.581  1.00 20.00  ? 3100 LEU C O   1 
ATOM   8831  C CB  . LEU C  1 82  ? 19.908  -15.362 81.206  1.00 20.21  ? 3100 LEU C CB  1 
ATOM   8832  C CG  . LEU C  1 82  ? 18.396  -15.607 81.240  1.00 21.33  ? 3100 LEU C CG  1 
ATOM   8833  C CD1 . LEU C  1 82  ? 18.093  -17.099 81.161  1.00 21.91  ? 3100 LEU C CD1 1 
ATOM   8834  C CD2 . LEU C  1 82  ? 17.833  -15.016 82.518  1.00 25.59  ? 3100 LEU C CD2 1 
ATOM   8835  N N   . PHE C  1 83  ? 22.687  -13.827 80.384  1.00 20.89  ? 3101 PHE C N   1 
ATOM   8836  C CA  . PHE C  1 83  ? 24.135  -13.768 80.581  1.00 21.62  ? 3101 PHE C CA  1 
ATOM   8837  C C   . PHE C  1 83  ? 24.832  -12.473 80.178  1.00 21.34  ? 3101 PHE C C   1 
ATOM   8838  O O   . PHE C  1 83  ? 26.007  -12.288 80.489  1.00 21.23  ? 3101 PHE C O   1 
ATOM   8839  C CB  . PHE C  1 83  ? 24.811  -14.921 79.827  1.00 24.79  ? 3101 PHE C CB  1 
ATOM   8840  C CG  . PHE C  1 83  ? 24.697  -16.251 80.509  1.00 27.79  ? 3101 PHE C CG  1 
ATOM   8841  C CD1 . PHE C  1 83  ? 24.039  -16.378 81.728  1.00 30.34  ? 3101 PHE C CD1 1 
ATOM   8842  C CD2 . PHE C  1 83  ? 25.276  -17.378 79.941  1.00 30.97  ? 3101 PHE C CD2 1 
ATOM   8843  C CE1 . PHE C  1 83  ? 23.961  -17.608 82.371  1.00 31.68  ? 3101 PHE C CE1 1 
ATOM   8844  C CE2 . PHE C  1 83  ? 25.205  -18.616 80.576  1.00 32.41  ? 3101 PHE C CE2 1 
ATOM   8845  C CZ  . PHE C  1 83  ? 24.547  -18.729 81.793  1.00 32.57  ? 3101 PHE C CZ  1 
ATOM   8846  N N   . THR C  1 84  ? 24.139  -11.578 79.484  1.00 20.66  ? 3102 THR C N   1 
ATOM   8847  C CA  . THR C  1 84  ? 24.793  -10.353 79.061  1.00 21.98  ? 3102 THR C CA  1 
ATOM   8848  C C   . THR C  1 84  ? 25.223  -9.468  80.224  1.00 24.06  ? 3102 THR C C   1 
ATOM   8849  O O   . THR C  1 84  ? 24.523  -9.369  81.237  1.00 23.26  ? 3102 THR C O   1 
ATOM   8850  C CB  . THR C  1 84  ? 23.911  -9.542  78.102  1.00 20.68  ? 3102 THR C CB  1 
ATOM   8851  O OG1 . THR C  1 84  ? 24.679  -8.456  77.578  1.00 20.31  ? 3102 THR C OG1 1 
ATOM   8852  C CG2 . THR C  1 84  ? 22.680  -8.997  78.814  1.00 23.18  ? 3102 THR C CG2 1 
ATOM   8853  N N   . ASN C  1 85  ? 26.390  -8.843  80.071  1.00 24.42  ? 3103 ASN C N   1 
ATOM   8854  C CA  . ASN C  1 85  ? 26.947  -7.957  81.088  1.00 24.16  ? 3103 ASN C CA  1 
ATOM   8855  C C   . ASN C  1 85  ? 26.713  -6.488  80.742  1.00 25.35  ? 3103 ASN C C   1 
ATOM   8856  O O   . ASN C  1 85  ? 27.172  -5.607  81.460  1.00 27.35  ? 3103 ASN C O   1 
ATOM   8857  C CB  . ASN C  1 85  ? 28.454  -8.207  81.237  1.00 23.90  ? 3103 ASN C CB  1 
ATOM   8858  C CG  . ASN C  1 85  ? 29.238  -7.810  79.994  1.00 25.49  ? 3103 ASN C CG  1 
ATOM   8859  O OD1 . ASN C  1 85  ? 28.791  -8.035  78.870  1.00 25.50  ? 3103 ASN C OD1 1 
ATOM   8860  N ND2 . ASN C  1 85  ? 30.416  -7.227  80.193  1.00 23.84  ? 3103 ASN C ND2 1 
ATOM   8861  N N   . ARG C  1 86  ? 26.011  -6.220  79.643  1.00 25.36  ? 3104 ARG C N   1 
ATOM   8862  C CA  . ARG C  1 86  ? 25.746  -4.840  79.253  1.00 28.62  ? 3104 ARG C CA  1 
ATOM   8863  C C   . ARG C  1 86  ? 24.357  -4.364  79.727  1.00 29.39  ? 3104 ARG C C   1 
ATOM   8864  O O   . ARG C  1 86  ? 23.501  -5.169  80.094  1.00 27.16  ? 3104 ARG C O   1 
ATOM   8865  C CB  . ARG C  1 86  ? 25.895  -4.680  77.729  1.00 32.32  ? 3104 ARG C CB  1 
ATOM   8866  C CG  . ARG C  1 86  ? 25.031  -5.598  76.878  1.00 33.71  ? 3104 ARG C CG  1 
ATOM   8867  C CD  . ARG C  1 86  ? 25.296  -5.396  75.380  1.00 36.22  ? 3104 ARG C CD  1 
ATOM   8868  N NE  . ARG C  1 86  ? 26.384  -6.233  74.859  1.00 34.90  ? 3104 ARG C NE  1 
ATOM   8869  C CZ  . ARG C  1 86  ? 27.447  -5.760  74.214  1.00 32.88  ? 3104 ARG C CZ  1 
ATOM   8870  N NH1 . ARG C  1 86  ? 27.579  -4.457  74.009  1.00 33.61  ? 3104 ARG C NH1 1 
ATOM   8871  N NH2 . ARG C  1 86  ? 28.380  -6.586  73.770  1.00 32.16  ? 3104 ARG C NH2 1 
ATOM   8872  N N   . LYS C  1 87  ? 24.154  -3.049  79.742  1.00 31.20  ? 3105 LYS C N   1 
ATOM   8873  C CA  . LYS C  1 87  ? 22.891  -2.447  80.180  1.00 34.69  ? 3105 LYS C CA  1 
ATOM   8874  C C   . LYS C  1 87  ? 21.646  -2.978  79.428  1.00 34.75  ? 3105 LYS C C   1 
ATOM   8875  O O   . LYS C  1 87  ? 20.612  -3.268  80.043  1.00 34.11  ? 3105 LYS C O   1 
ATOM   8876  C CB  . LYS C  1 87  ? 22.967  -0.928  80.013  1.00 37.01  ? 3105 LYS C CB  1 
ATOM   8877  C CG  . LYS C  1 87  ? 23.217  -0.488  78.583  1.00 43.02  ? 3105 LYS C CG  1 
ATOM   8878  C CD  . LYS C  1 87  ? 23.051  1.006   78.377  1.00 46.97  ? 3105 LYS C CD  1 
ATOM   8879  C CE  . LYS C  1 87  ? 23.236  1.352   76.905  1.00 48.53  ? 3105 LYS C CE  1 
ATOM   8880  N NZ  . LYS C  1 87  ? 22.905  2.776   76.613  1.00 51.33  ? 3105 LYS C NZ  1 
ATOM   8881  N N   . GLU C  1 88  ? 21.766  -3.101  78.106  1.00 34.78  ? 3106 GLU C N   1 
ATOM   8882  C CA  . GLU C  1 88  ? 20.702  -3.561  77.209  1.00 36.13  ? 3106 GLU C CA  1 
ATOM   8883  C C   . GLU C  1 88  ? 21.132  -4.801  76.458  1.00 34.51  ? 3106 GLU C C   1 
ATOM   8884  O O   . GLU C  1 88  ? 22.240  -4.848  75.936  1.00 31.82  ? 3106 GLU C O   1 
ATOM   8885  C CB  . GLU C  1 88  ? 20.432  -2.496  76.154  1.00 41.30  ? 3106 GLU C CB  1 
ATOM   8886  C CG  . GLU C  1 88  ? 21.743  -1.961  75.470  1.00 47.11  ? 3106 GLU C CG  1 
ATOM   8887  C CD  . GLU C  1 88  ? 21.423  -1.050  74.273  1.00 51.08  ? 3106 GLU C CD  1 
ATOM   8888  O OE1 . GLU C  1 88  ? 20.359  -0.398  74.324  1.00 53.90  ? 3106 GLU C OE1 1 
ATOM   8889  O OE2 . GLU C  1 88  ? 22.216  -0.966  73.298  1.00 53.68  ? 3106 GLU C OE2 1 
ATOM   8890  N N   . ASN C  1 89  ? 20.260  -5.795  76.375  1.00 33.01  ? 3107 ASN C N   1 
ATOM   8891  C CA  . ASN C  1 89  ? 20.621  -6.969  75.617  1.00 32.27  ? 3107 ASN C CA  1 
ATOM   8892  C C   . ASN C  1 89  ? 20.478  -6.545  74.159  1.00 30.49  ? 3107 ASN C C   1 
ATOM   8893  O O   . ASN C  1 89  ? 19.544  -5.831  73.810  1.00 28.82  ? 3107 ASN C O   1 
ATOM   8894  C CB  . ASN C  1 89  ? 19.681  -8.121  75.932  1.00 32.03  ? 3107 ASN C CB  1 
ATOM   8895  C CG  . ASN C  1 89  ? 20.015  -9.349  75.137  1.00 32.93  ? 3107 ASN C CG  1 
ATOM   8896  O OD1 . ASN C  1 89  ? 19.175  -9.884  74.415  1.00 35.02  ? 3107 ASN C OD1 1 
ATOM   8897  N ND2 . ASN C  1 89  ? 21.257  -9.809  75.261  1.00 28.28  ? 3107 ASN C ND2 1 
ATOM   8898  N N   . ILE C  1 90  ? 21.409  -6.966  73.315  1.00 31.40  ? 3108 ILE C N   1 
ATOM   8899  C CA  . ILE C  1 90  ? 21.360  -6.597  71.907  1.00 32.21  ? 3108 ILE C CA  1 
ATOM   8900  C C   . ILE C  1 90  ? 20.770  -7.722  71.080  1.00 32.66  ? 3108 ILE C C   1 
ATOM   8901  O O   . ILE C  1 90  ? 21.318  -8.820  71.032  1.00 33.70  ? 3108 ILE C O   1 
ATOM   8902  C CB  . ILE C  1 90  ? 22.767  -6.265  71.389  1.00 32.18  ? 3108 ILE C CB  1 
ATOM   8903  C CG1 . ILE C  1 90  ? 23.278  -5.006  72.102  1.00 33.33  ? 3108 ILE C CG1 1 
ATOM   8904  C CG2 . ILE C  1 90  ? 22.747  -6.067  69.880  1.00 33.22  ? 3108 ILE C CG2 1 
ATOM   8905  C CD1 . ILE C  1 90  ? 24.761  -4.738  71.932  1.00 34.44  ? 3108 ILE C CD1 1 
ATOM   8906  N N   . PRO C  1 91  ? 19.627  -7.465  70.431  1.00 32.61  ? 3109 PRO C N   1 
ATOM   8907  C CA  . PRO C  1 91  ? 18.985  -8.489  69.604  1.00 32.74  ? 3109 PRO C CA  1 
ATOM   8908  C C   . PRO C  1 91  ? 19.908  -8.773  68.426  1.00 32.10  ? 3109 PRO C C   1 
ATOM   8909  O O   . PRO C  1 91  ? 20.415  -7.846  67.800  1.00 31.55  ? 3109 PRO C O   1 
ATOM   8910  C CB  . PRO C  1 91  ? 17.686  -7.819  69.159  1.00 33.75  ? 3109 PRO C CB  1 
ATOM   8911  C CG  . PRO C  1 91  ? 17.447  -6.761  70.210  1.00 34.35  ? 3109 PRO C CG  1 
ATOM   8912  C CD  . PRO C  1 91  ? 18.825  -6.231  70.461  1.00 33.73  ? 3109 PRO C CD  1 
ATOM   8913  N N   . LEU C  1 92  ? 20.129  -10.049 68.129  1.00 31.10  ? 3110 LEU C N   1 
ATOM   8914  C CA  . LEU C  1 92  ? 21.004  -10.414 67.025  1.00 27.51  ? 3110 LEU C CA  1 
ATOM   8915  C C   . LEU C  1 92  ? 20.260  -11.165 65.930  1.00 26.30  ? 3110 LEU C C   1 
ATOM   8916  O O   . LEU C  1 92  ? 19.221  -11.776 66.175  1.00 25.18  ? 3110 LEU C O   1 
ATOM   8917  C CB  . LEU C  1 92  ? 22.162  -11.274 67.543  1.00 25.81  ? 3110 LEU C CB  1 
ATOM   8918  C CG  . LEU C  1 92  ? 23.008  -10.664 68.668  1.00 25.05  ? 3110 LEU C CG  1 
ATOM   8919  C CD1 . LEU C  1 92  ? 23.953  -11.707 69.244  1.00 22.60  ? 3110 LEU C CD1 1 
ATOM   8920  C CD2 . LEU C  1 92  ? 23.774  -9.470  68.130  1.00 22.12  ? 3110 LEU C CD2 1 
ATOM   8921  N N   . LYS C  1 93  ? 20.793  -11.102 64.715  1.00 25.17  ? 3111 LYS C N   1 
ATOM   8922  C CA  . LYS C  1 93  ? 20.199  -11.801 63.587  1.00 23.41  ? 3111 LYS C CA  1 
ATOM   8923  C C   . LYS C  1 93  ? 20.868  -13.172 63.531  1.00 22.28  ? 3111 LYS C C   1 
ATOM   8924  O O   . LYS C  1 93  ? 21.978  -13.340 64.030  1.00 22.40  ? 3111 LYS C O   1 
ATOM   8925  C CB  . LYS C  1 93  ? 20.481  -11.044 62.287  1.00 28.62  ? 3111 LYS C CB  1 
ATOM   8926  C CG  . LYS C  1 93  ? 19.871  -9.652  62.208  1.00 32.32  ? 3111 LYS C CG  1 
ATOM   8927  C CD  . LYS C  1 93  ? 18.356  -9.720  62.104  1.00 36.45  ? 3111 LYS C CD  1 
ATOM   8928  C CE  . LYS C  1 93  ? 17.750  -8.331  61.967  1.00 40.33  ? 3111 LYS C CE  1 
ATOM   8929  N NZ  . LYS C  1 93  ? 16.262  -8.388  61.854  1.00 44.02  ? 3111 LYS C NZ  1 
ATOM   8930  N N   . LEU C  1 94  ? 20.186  -14.148 62.945  1.00 20.01  ? 3112 LEU C N   1 
ATOM   8931  C CA  . LEU C  1 94  ? 20.736  -15.492 62.804  1.00 20.68  ? 3112 LEU C CA  1 
ATOM   8932  C C   . LEU C  1 94  ? 21.336  -15.603 61.412  1.00 19.13  ? 3112 LEU C C   1 
ATOM   8933  O O   . LEU C  1 94  ? 20.853  -14.966 60.476  1.00 17.41  ? 3112 LEU C O   1 
ATOM   8934  C CB  . LEU C  1 94  ? 19.641  -16.559 62.912  1.00 19.75  ? 3112 LEU C CB  1 
ATOM   8935  C CG  . LEU C  1 94  ? 18.820  -16.761 64.183  1.00 24.34  ? 3112 LEU C CG  1 
ATOM   8936  C CD1 . LEU C  1 94  ? 17.907  -17.981 63.982  1.00 24.72  ? 3112 LEU C CD1 1 
ATOM   8937  C CD2 . LEU C  1 94  ? 19.734  -16.968 65.373  1.00 21.26  ? 3112 LEU C CD2 1 
ATOM   8938  N N   . SER C  1 95  ? 22.374  -16.420 61.272  1.00 18.18  ? 3113 SER C N   1 
ATOM   8939  C CA  . SER C  1 95  ? 22.992  -16.624 59.969  1.00 18.74  ? 3113 SER C CA  1 
ATOM   8940  C C   . SER C  1 95  ? 24.035  -17.725 60.005  1.00 18.43  ? 3113 SER C C   1 
ATOM   8941  O O   . SER C  1 95  ? 24.654  -17.976 61.043  1.00 15.94  ? 3113 SER C O   1 
ATOM   8942  C CB  . SER C  1 95  ? 23.651  -15.335 59.468  1.00 18.75  ? 3113 SER C CB  1 
ATOM   8943  O OG  . SER C  1 95  ? 24.138  -15.510 58.144  1.00 21.43  ? 3113 SER C OG  1 
ATOM   8944  N N   . GLU C  1 96  ? 24.213  -18.393 58.869  1.00 15.76  ? 3114 GLU C N   1 
ATOM   8945  C CA  . GLU C  1 96  ? 25.216  -19.436 58.769  1.00 16.67  ? 3114 GLU C CA  1 
ATOM   8946  C C   . GLU C  1 96  ? 26.544  -18.714 58.577  1.00 16.66  ? 3114 GLU C C   1 
ATOM   8947  O O   . GLU C  1 96  ? 27.613  -19.289 58.784  1.00 17.18  ? 3114 GLU C O   1 
ATOM   8948  C CB  . GLU C  1 96  ? 24.911  -20.356 57.588  1.00 17.01  ? 3114 GLU C CB  1 
ATOM   8949  C CG  . GLU C  1 96  ? 23.607  -21.125 57.772  1.00 21.45  ? 3114 GLU C CG  1 
ATOM   8950  C CD  . GLU C  1 96  ? 23.152  -21.836 56.511  1.00 24.26  ? 3114 GLU C CD  1 
ATOM   8951  O OE1 . GLU C  1 96  ? 23.049  -21.171 55.454  1.00 27.44  ? 3114 GLU C OE1 1 
ATOM   8952  O OE2 . GLU C  1 96  ? 22.889  -23.055 56.584  1.00 23.65  ? 3114 GLU C OE2 1 
ATOM   8953  N N   . ASP C  1 97  ? 26.458  -17.445 58.173  1.00 15.26  ? 3115 ASP C N   1 
ATOM   8954  C CA  . ASP C  1 97  ? 27.638  -16.596 57.985  1.00 16.04  ? 3115 ASP C CA  1 
ATOM   8955  C C   . ASP C  1 97  ? 27.845  -15.959 59.353  1.00 16.03  ? 3115 ASP C C   1 
ATOM   8956  O O   . ASP C  1 97  ? 27.382  -14.849 59.615  1.00 19.15  ? 3115 ASP C O   1 
ATOM   8957  C CB  . ASP C  1 97  ? 27.356  -15.518 56.932  1.00 16.80  ? 3115 ASP C CB  1 
ATOM   8958  C CG  . ASP C  1 97  ? 28.465  -14.485 56.843  1.00 19.09  ? 3115 ASP C CG  1 
ATOM   8959  O OD1 . ASP C  1 97  ? 29.556  -14.728 57.402  1.00 19.89  ? 3115 ASP C OD1 1 
ATOM   8960  O OD2 . ASP C  1 97  ? 28.249  -13.433 56.208  1.00 23.37  ? 3115 ASP C OD2 1 
ATOM   8961  N N   . CYS C  1 98  ? 28.551  -16.669 60.221  1.00 16.88  ? 3116 CYS C N   1 
ATOM   8962  C CA  . CYS C  1 98  ? 28.745  -16.210 61.586  1.00 17.39  ? 3116 CYS C CA  1 
ATOM   8963  C C   . CYS C  1 98  ? 30.156  -16.353 62.143  1.00 17.77  ? 3116 CYS C C   1 
ATOM   8964  O O   . CYS C  1 98  ? 30.368  -16.177 63.346  1.00 17.30  ? 3116 CYS C O   1 
ATOM   8965  C CB  . CYS C  1 98  ? 27.788  -16.990 62.470  1.00 19.23  ? 3116 CYS C CB  1 
ATOM   8966  S SG  . CYS C  1 98  ? 28.172  -18.774 62.456  1.00 20.16  ? 3116 CYS C SG  1 
ATOM   8967  N N   . LEU C  1 99  ? 31.127  -16.671 61.297  1.00 15.93  ? 3117 LEU C N   1 
ATOM   8968  C CA  . LEU C  1 99  ? 32.484  -16.825 61.803  1.00 15.88  ? 3117 LEU C CA  1 
ATOM   8969  C C   . LEU C  1 99  ? 33.179  -15.473 61.943  1.00 16.88  ? 3117 LEU C C   1 
ATOM   8970  O O   . LEU C  1 99  ? 34.023  -15.098 61.132  1.00 16.59  ? 3117 LEU C O   1 
ATOM   8971  C CB  . LEU C  1 99  ? 33.280  -17.780 60.904  1.00 15.04  ? 3117 LEU C CB  1 
ATOM   8972  C CG  . LEU C  1 99  ? 32.693  -19.200 60.895  1.00 16.41  ? 3117 LEU C CG  1 
ATOM   8973  C CD1 . LEU C  1 99  ? 33.570  -20.133 60.071  1.00 13.34  ? 3117 LEU C CD1 1 
ATOM   8974  C CD2 . LEU C  1 99  ? 32.589  -19.725 62.336  1.00 13.33  ? 3117 LEU C CD2 1 
ATOM   8975  N N   . TYR C  1 100 ? 32.791  -14.741 62.986  1.00 15.59  ? 3118 TYR C N   1 
ATOM   8976  C CA  . TYR C  1 100 ? 33.343  -13.423 63.277  1.00 15.82  ? 3118 TYR C CA  1 
ATOM   8977  C C   . TYR C  1 100 ? 33.811  -13.358 64.716  1.00 16.66  ? 3118 TYR C C   1 
ATOM   8978  O O   . TYR C  1 100 ? 33.475  -14.216 65.532  1.00 16.58  ? 3118 TYR C O   1 
ATOM   8979  C CB  . TYR C  1 100 ? 32.288  -12.325 63.086  1.00 14.88  ? 3118 TYR C CB  1 
ATOM   8980  C CG  . TYR C  1 100 ? 31.705  -12.237 61.695  1.00 17.23  ? 3118 TYR C CG  1 
ATOM   8981  C CD1 . TYR C  1 100 ? 30.527  -12.907 61.368  1.00 14.94  ? 3118 TYR C CD1 1 
ATOM   8982  C CD2 . TYR C  1 100 ? 32.348  -11.505 60.697  1.00 16.87  ? 3118 TYR C CD2 1 
ATOM   8983  C CE1 . TYR C  1 100 ? 30.002  -12.854 60.082  1.00 19.69  ? 3118 TYR C CE1 1 
ATOM   8984  C CE2 . TYR C  1 100 ? 31.830  -11.448 59.397  1.00 19.79  ? 3118 TYR C CE2 1 
ATOM   8985  C CZ  . TYR C  1 100 ? 30.657  -12.127 59.101  1.00 20.10  ? 3118 TYR C CZ  1 
ATOM   8986  O OH  . TYR C  1 100 ? 30.137  -12.087 57.826  1.00 23.03  ? 3118 TYR C OH  1 
ATOM   8987  N N   . LEU C  1 101 ? 34.594  -12.330 65.015  1.00 15.90  ? 3119 LEU C N   1 
ATOM   8988  C CA  . LEU C  1 101 ? 35.075  -12.103 66.367  1.00 17.60  ? 3119 LEU C CA  1 
ATOM   8989  C C   . LEU C  1 101 ? 35.075  -10.591 66.597  1.00 18.00  ? 3119 LEU C C   1 
ATOM   8990  O O   . LEU C  1 101 ? 35.138  -9.812  65.638  1.00 17.52  ? 3119 LEU C O   1 
ATOM   8991  C CB  . LEU C  1 101 ? 36.474  -12.708 66.552  1.00 18.79  ? 3119 LEU C CB  1 
ATOM   8992  C CG  . LEU C  1 101 ? 37.585  -12.370 65.556  1.00 20.29  ? 3119 LEU C CG  1 
ATOM   8993  C CD1 . LEU C  1 101 ? 38.104  -10.959 65.821  1.00 20.27  ? 3119 LEU C CD1 1 
ATOM   8994  C CD2 . LEU C  1 101 ? 38.710  -13.383 65.706  1.00 18.38  ? 3119 LEU C CD2 1 
ATOM   8995  N N   . ASN C  1 102 ? 34.956  -10.185 67.860  1.00 18.13  ? 3120 ASN C N   1 
ATOM   8996  C CA  . ASN C  1 102 ? 34.944  -8.773  68.223  1.00 17.87  ? 3120 ASN C CA  1 
ATOM   8997  C C   . ASN C  1 102 ? 36.186  -8.511  69.061  1.00 18.27  ? 3120 ASN C C   1 
ATOM   8998  O O   . ASN C  1 102 ? 36.640  -9.382  69.796  1.00 18.51  ? 3120 ASN C O   1 
ATOM   8999  C CB  . ASN C  1 102 ? 33.692  -8.417  69.039  1.00 19.48  ? 3120 ASN C CB  1 
ATOM   9000  C CG  . ASN C  1 102 ? 32.399  -8.749  68.315  1.00 18.99  ? 3120 ASN C CG  1 
ATOM   9001  O OD1 . ASN C  1 102 ? 32.266  -8.537  67.105  1.00 16.12  ? 3120 ASN C OD1 1 
ATOM   9002  N ND2 . ASN C  1 102 ? 31.423  -9.251  69.065  1.00 17.36  ? 3120 ASN C ND2 1 
ATOM   9003  N N   . ILE C  1 103 ? 36.733  -7.308  68.952  1.00 18.36  ? 3121 ILE C N   1 
ATOM   9004  C CA  . ILE C  1 103 ? 37.941  -6.973  69.685  1.00 19.80  ? 3121 ILE C CA  1 
ATOM   9005  C C   . ILE C  1 103 ? 37.793  -5.714  70.518  1.00 19.27  ? 3121 ILE C C   1 
ATOM   9006  O O   . ILE C  1 103 ? 37.274  -4.706  70.051  1.00 22.95  ? 3121 ILE C O   1 
ATOM   9007  C CB  . ILE C  1 103 ? 39.144  -6.778  68.714  1.00 21.59  ? 3121 ILE C CB  1 
ATOM   9008  C CG1 . ILE C  1 103 ? 39.422  -8.082  67.955  1.00 21.92  ? 3121 ILE C CG1 1 
ATOM   9009  C CG2 . ILE C  1 103 ? 40.395  -6.364  69.494  1.00 20.36  ? 3121 ILE C CG2 1 
ATOM   9010  C CD1 . ILE C  1 103 ? 40.529  -7.971  66.924  1.00 22.12  ? 3121 ILE C CD1 1 
ATOM   9011  N N   . TYR C  1 104 ? 38.238  -5.792  71.766  1.00 20.35  ? 3122 TYR C N   1 
ATOM   9012  C CA  . TYR C  1 104 ? 38.206  -4.648  72.668  1.00 19.98  ? 3122 TYR C CA  1 
ATOM   9013  C C   . TYR C  1 104 ? 39.650  -4.439  73.112  1.00 20.12  ? 3122 TYR C C   1 
ATOM   9014  O O   . TYR C  1 104 ? 40.192  -5.239  73.878  1.00 22.52  ? 3122 TYR C O   1 
ATOM   9015  C CB  . TYR C  1 104 ? 37.315  -4.929  73.887  1.00 20.61  ? 3122 TYR C CB  1 
ATOM   9016  C CG  . TYR C  1 104 ? 35.894  -5.309  73.528  1.00 20.21  ? 3122 TYR C CG  1 
ATOM   9017  C CD1 . TYR C  1 104 ? 35.580  -6.610  73.136  1.00 18.50  ? 3122 TYR C CD1 1 
ATOM   9018  C CD2 . TYR C  1 104 ? 34.876  -4.357  73.524  1.00 20.76  ? 3122 TYR C CD2 1 
ATOM   9019  C CE1 . TYR C  1 104 ? 34.289  -6.954  72.741  1.00 20.63  ? 3122 TYR C CE1 1 
ATOM   9020  C CE2 . TYR C  1 104 ? 33.579  -4.691  73.128  1.00 21.49  ? 3122 TYR C CE2 1 
ATOM   9021  C CZ  . TYR C  1 104 ? 33.296  -5.991  72.735  1.00 21.52  ? 3122 TYR C CZ  1 
ATOM   9022  O OH  . TYR C  1 104 ? 32.030  -6.321  72.302  1.00 22.89  ? 3122 TYR C OH  1 
ATOM   9023  N N   . THR C  1 105 ? 40.276  -3.376  72.620  1.00 20.32  ? 3123 THR C N   1 
ATOM   9024  C CA  . THR C  1 105 ? 41.663  -3.092  72.972  1.00 23.03  ? 3123 THR C CA  1 
ATOM   9025  C C   . THR C  1 105 ? 41.812  -1.723  73.631  1.00 22.86  ? 3123 THR C C   1 
ATOM   9026  O O   . THR C  1 105 ? 41.432  -0.703  73.066  1.00 23.62  ? 3123 THR C O   1 
ATOM   9027  C CB  . THR C  1 105 ? 42.590  -3.158  71.730  1.00 21.25  ? 3123 THR C CB  1 
ATOM   9028  O OG1 . THR C  1 105 ? 43.918  -2.777  72.108  1.00 23.65  ? 3123 THR C OG1 1 
ATOM   9029  C CG2 . THR C  1 105 ? 42.097  -2.227  70.635  1.00 22.13  ? 3123 THR C CG2 1 
ATOM   9030  N N   . PRO C  1 106 ? 42.366  -1.696  74.848  1.00 24.47  ? 3124 PRO C N   1 
ATOM   9031  C CA  . PRO C  1 106 ? 42.571  -0.460  75.605  1.00 27.73  ? 3124 PRO C CA  1 
ATOM   9032  C C   . PRO C  1 106 ? 43.875  0.227   75.212  1.00 30.79  ? 3124 PRO C C   1 
ATOM   9033  O O   . PRO C  1 106 ? 44.124  1.372   75.589  1.00 32.14  ? 3124 PRO C O   1 
ATOM   9034  C CB  . PRO C  1 106 ? 42.607  -0.956  77.040  1.00 25.36  ? 3124 PRO C CB  1 
ATOM   9035  C CG  . PRO C  1 106 ? 43.368  -2.235  76.891  1.00 25.09  ? 3124 PRO C CG  1 
ATOM   9036  C CD  . PRO C  1 106 ? 42.749  -2.870  75.655  1.00 23.76  ? 3124 PRO C CD  1 
ATOM   9037  N N   . ALA C  1 107 ? 44.703  -0.489  74.458  1.00 32.75  ? 3125 ALA C N   1 
ATOM   9038  C CA  . ALA C  1 107 ? 45.990  0.028   74.020  1.00 35.70  ? 3125 ALA C CA  1 
ATOM   9039  C C   . ALA C  1 107 ? 45.864  1.260   73.140  1.00 37.45  ? 3125 ALA C C   1 
ATOM   9040  O O   . ALA C  1 107 ? 44.872  1.436   72.431  1.00 38.31  ? 3125 ALA C O   1 
ATOM   9041  C CB  . ALA C  1 107 ? 46.755  -1.057  73.274  1.00 35.65  ? 3125 ALA C CB  1 
ATOM   9042  N N   . ASP C  1 108 ? 46.872  2.121   73.204  1.00 40.07  ? 3126 ASP C N   1 
ATOM   9043  C CA  . ASP C  1 108 ? 46.899  3.318   72.377  1.00 42.06  ? 3126 ASP C CA  1 
ATOM   9044  C C   . ASP C  1 108 ? 47.576  2.864   71.093  1.00 42.22  ? 3126 ASP C C   1 
ATOM   9045  O O   . ASP C  1 108 ? 48.784  2.642   71.061  1.00 42.45  ? 3126 ASP C O   1 
ATOM   9046  C CB  . ASP C  1 108 ? 47.706  4.424   73.056  1.00 43.70  ? 3126 ASP C CB  1 
ATOM   9047  C CG  . ASP C  1 108 ? 47.923  5.621   72.156  1.00 45.69  ? 3126 ASP C CG  1 
ATOM   9048  O OD1 . ASP C  1 108 ? 46.971  6.020   71.449  1.00 45.75  ? 3126 ASP C OD1 1 
ATOM   9049  O OD2 . ASP C  1 108 ? 49.045  6.168   72.162  1.00 47.24  ? 3126 ASP C OD2 1 
ATOM   9050  N N   . LEU C  1 109 ? 46.782  2.710   70.041  1.00 42.98  ? 3127 LEU C N   1 
ATOM   9051  C CA  . LEU C  1 109 ? 47.279  2.232   68.758  1.00 44.70  ? 3127 LEU C CA  1 
ATOM   9052  C C   . LEU C  1 109 ? 48.277  3.133   68.031  1.00 46.09  ? 3127 LEU C C   1 
ATOM   9053  O O   . LEU C  1 109 ? 48.810  2.747   66.988  1.00 45.62  ? 3127 LEU C O   1 
ATOM   9054  C CB  . LEU C  1 109 ? 46.091  1.911   67.848  1.00 43.87  ? 3127 LEU C CB  1 
ATOM   9055  C CG  . LEU C  1 109 ? 45.156  0.850   68.445  1.00 44.62  ? 3127 LEU C CG  1 
ATOM   9056  C CD1 . LEU C  1 109 ? 43.920  0.685   67.575  1.00 44.12  ? 3127 LEU C CD1 1 
ATOM   9057  C CD2 . LEU C  1 109 ? 45.908  -0.470  68.583  1.00 43.15  ? 3127 LEU C CD2 1 
ATOM   9058  N N   . THR C  1 110 ? 48.537  4.322   68.571  1.00 46.65  ? 3128 THR C N   1 
ATOM   9059  C CA  . THR C  1 110 ? 49.497  5.232   67.949  1.00 48.38  ? 3128 THR C CA  1 
ATOM   9060  C C   . THR C  1 110 ? 50.900  4.865   68.420  1.00 49.59  ? 3128 THR C C   1 
ATOM   9061  O O   . THR C  1 110 ? 51.893  5.372   67.902  1.00 50.55  ? 3128 THR C O   1 
ATOM   9062  C CB  . THR C  1 110 ? 49.234  6.705   68.323  1.00 48.21  ? 3128 THR C CB  1 
ATOM   9063  O OG1 . THR C  1 110 ? 49.549  6.913   69.704  1.00 48.67  ? 3128 THR C OG1 1 
ATOM   9064  C CG2 . THR C  1 110 ? 47.780  7.069   68.076  1.00 48.79  ? 3128 THR C CG2 1 
ATOM   9065  N N   . LYS C  1 111 ? 50.970  3.982   69.412  1.00 50.52  ? 3129 LYS C N   1 
ATOM   9066  C CA  . LYS C  1 111 ? 52.242  3.529   69.962  1.00 51.57  ? 3129 LYS C CA  1 
ATOM   9067  C C   . LYS C  1 111 ? 52.300  2.011   69.855  1.00 52.08  ? 3129 LYS C C   1 
ATOM   9068  O O   . LYS C  1 111 ? 51.322  1.375   69.464  1.00 52.37  ? 3129 LYS C O   1 
ATOM   9069  C CB  . LYS C  1 111 ? 52.361  3.946   71.429  1.00 52.45  ? 3129 LYS C CB  1 
ATOM   9070  C CG  . LYS C  1 111 ? 52.175  5.437   71.660  1.00 54.70  ? 3129 LYS C CG  1 
ATOM   9071  C CD  . LYS C  1 111 ? 52.237  5.782   73.136  1.00 56.64  ? 3129 LYS C CD  1 
ATOM   9072  C CE  . LYS C  1 111 ? 52.070  7.276   73.353  1.00 58.16  ? 3129 LYS C CE  1 
ATOM   9073  N NZ  . LYS C  1 111 ? 52.150  7.634   74.797  1.00 61.01  ? 3129 LYS C NZ  1 
ATOM   9074  N N   . LYS C  1 112 ? 53.442  1.427   70.200  1.00 52.35  ? 3130 LYS C N   1 
ATOM   9075  C CA  . LYS C  1 112 ? 53.586  -0.021  70.131  1.00 52.30  ? 3130 LYS C CA  1 
ATOM   9076  C C   . LYS C  1 112 ? 53.263  -0.666  71.473  1.00 50.72  ? 3130 LYS C C   1 
ATOM   9077  O O   . LYS C  1 112 ? 53.871  -0.344  72.495  1.00 50.79  ? 3130 LYS C O   1 
ATOM   9078  C CB  . LYS C  1 112 ? 55.007  -0.405  69.712  1.00 54.19  ? 3130 LYS C CB  1 
ATOM   9079  C CG  . LYS C  1 112 ? 55.209  -1.909  69.573  1.00 56.61  ? 3130 LYS C CG  1 
ATOM   9080  C CD  . LYS C  1 112 ? 56.632  -2.257  69.167  1.00 57.88  ? 3130 LYS C CD  1 
ATOM   9081  C CE  . LYS C  1 112 ? 56.803  -3.763  69.042  1.00 59.33  ? 3130 LYS C CE  1 
ATOM   9082  N NZ  . LYS C  1 112 ? 58.183  -4.142  68.633  1.00 60.63  ? 3130 LYS C NZ  1 
ATOM   9083  N N   . ASN C  1 113 ? 52.299  -1.579  71.462  1.00 48.27  ? 3131 ASN C N   1 
ATOM   9084  C CA  . ASN C  1 113 ? 51.899  -2.269  72.678  1.00 45.66  ? 3131 ASN C CA  1 
ATOM   9085  C C   . ASN C  1 113 ? 51.870  -3.774  72.458  1.00 43.54  ? 3131 ASN C C   1 
ATOM   9086  O O   . ASN C  1 113 ? 51.650  -4.246  71.344  1.00 43.42  ? 3131 ASN C O   1 
ATOM   9087  C CB  . ASN C  1 113 ? 50.512  -1.804  73.127  1.00 46.11  ? 3131 ASN C CB  1 
ATOM   9088  C CG  . ASN C  1 113 ? 50.453  -0.318  73.408  1.00 47.09  ? 3131 ASN C CG  1 
ATOM   9089  O OD1 . ASN C  1 113 ? 50.474  0.504   72.491  1.00 49.31  ? 3131 ASN C OD1 1 
ATOM   9090  N ND2 . ASN C  1 113 ? 50.382  0.036   74.684  1.00 47.30  ? 3131 ASN C ND2 1 
ATOM   9091  N N   . ARG C  1 114 ? 52.100  -4.517  73.532  1.00 41.15  ? 3132 ARG C N   1 
ATOM   9092  C CA  . ARG C  1 114 ? 52.078  -5.974  73.496  1.00 39.61  ? 3132 ARG C CA  1 
ATOM   9093  C C   . ARG C  1 114 ? 51.379  -6.448  74.760  1.00 36.14  ? 3132 ARG C C   1 
ATOM   9094  O O   . ARG C  1 114 ? 51.945  -7.173  75.576  1.00 34.82  ? 3132 ARG C O   1 
ATOM   9095  C CB  . ARG C  1 114 ? 53.496  -6.538  73.440  1.00 42.88  ? 3132 ARG C CB  1 
ATOM   9096  C CG  . ARG C  1 114 ? 54.138  -6.488  72.063  1.00 47.78  ? 3132 ARG C CG  1 
ATOM   9097  C CD  . ARG C  1 114 ? 55.585  -6.947  72.136  1.00 51.65  ? 3132 ARG C CD  1 
ATOM   9098  N NE  . ARG C  1 114 ? 55.722  -8.187  72.895  1.00 55.40  ? 3132 ARG C NE  1 
ATOM   9099  C CZ  . ARG C  1 114 ? 56.874  -8.823  73.091  1.00 57.95  ? 3132 ARG C CZ  1 
ATOM   9100  N NH1 . ARG C  1 114 ? 57.999  -8.338  72.581  1.00 59.38  ? 3132 ARG C NH1 1 
ATOM   9101  N NH2 . ARG C  1 114 ? 56.902  -9.942  73.800  1.00 59.04  ? 3132 ARG C NH2 1 
ATOM   9102  N N   . LEU C  1 115 ? 50.139  -6.011  74.918  1.00 32.99  ? 3133 LEU C N   1 
ATOM   9103  C CA  . LEU C  1 115 ? 49.343  -6.371  76.077  1.00 29.00  ? 3133 LEU C CA  1 
ATOM   9104  C C   . LEU C  1 115 ? 48.891  -7.820  75.976  1.00 26.86  ? 3133 LEU C C   1 
ATOM   9105  O O   . LEU C  1 115 ? 48.734  -8.355  74.874  1.00 26.91  ? 3133 LEU C O   1 
ATOM   9106  C CB  . LEU C  1 115 ? 48.114  -5.466  76.155  1.00 26.92  ? 3133 LEU C CB  1 
ATOM   9107  C CG  . LEU C  1 115 ? 48.326  -3.953  76.170  1.00 27.84  ? 3133 LEU C CG  1 
ATOM   9108  C CD1 . LEU C  1 115 ? 46.970  -3.255  76.164  1.00 25.83  ? 3133 LEU C CD1 1 
ATOM   9109  C CD2 . LEU C  1 115 ? 49.141  -3.558  77.394  1.00 25.27  ? 3133 LEU C CD2 1 
ATOM   9110  N N   . PRO C  1 116 ? 48.699  -8.487  77.126  1.00 25.12  ? 3134 PRO C N   1 
ATOM   9111  C CA  . PRO C  1 116 ? 48.250  -9.881  77.088  1.00 22.76  ? 3134 PRO C CA  1 
ATOM   9112  C C   . PRO C  1 116 ? 46.872  -9.953  76.431  1.00 22.18  ? 3134 PRO C C   1 
ATOM   9113  O O   . PRO C  1 116 ? 46.104  -8.986  76.465  1.00 22.11  ? 3134 PRO C O   1 
ATOM   9114  C CB  . PRO C  1 116 ? 48.245  -10.294 78.566  1.00 25.01  ? 3134 PRO C CB  1 
ATOM   9115  C CG  . PRO C  1 116 ? 48.177  -8.989  79.315  1.00 25.18  ? 3134 PRO C CG  1 
ATOM   9116  C CD  . PRO C  1 116 ? 49.045  -8.078  78.498  1.00 25.19  ? 3134 PRO C CD  1 
ATOM   9117  N N   . VAL C  1 117 ? 46.565  -11.090 75.816  1.00 20.92  ? 3135 VAL C N   1 
ATOM   9118  C CA  . VAL C  1 117 ? 45.293  -11.254 75.123  1.00 20.52  ? 3135 VAL C CA  1 
ATOM   9119  C C   . VAL C  1 117 ? 44.405  -12.307 75.766  1.00 19.02  ? 3135 VAL C C   1 
ATOM   9120  O O   . VAL C  1 117 ? 44.861  -13.395 76.106  1.00 20.55  ? 3135 VAL C O   1 
ATOM   9121  C CB  . VAL C  1 117 ? 45.522  -11.644 73.637  1.00 21.01  ? 3135 VAL C CB  1 
ATOM   9122  C CG1 . VAL C  1 117 ? 44.180  -11.752 72.910  1.00 19.79  ? 3135 VAL C CG1 1 
ATOM   9123  C CG2 . VAL C  1 117 ? 46.408  -10.614 72.961  1.00 20.88  ? 3135 VAL C CG2 1 
ATOM   9124  N N   . MET C  1 118 ? 43.131  -11.975 75.930  1.00 19.97  ? 3136 MET C N   1 
ATOM   9125  C CA  . MET C  1 118 ? 42.176  -12.902 76.516  1.00 19.63  ? 3136 MET C CA  1 
ATOM   9126  C C   . MET C  1 118 ? 41.088  -13.187 75.502  1.00 17.48  ? 3136 MET C C   1 
ATOM   9127  O O   . MET C  1 118 ? 40.342  -12.295 75.113  1.00 18.01  ? 3136 MET C O   1 
ATOM   9128  C CB  . MET C  1 118 ? 41.583  -12.316 77.802  1.00 20.39  ? 3136 MET C CB  1 
ATOM   9129  C CG  . MET C  1 118 ? 42.622  -12.147 78.894  1.00 22.55  ? 3136 MET C CG  1 
ATOM   9130  S SD  . MET C  1 118 ? 41.949  -11.697 80.510  1.00 22.99  ? 3136 MET C SD  1 
ATOM   9131  C CE  . MET C  1 118 ? 41.410  -13.282 81.108  1.00 20.59  ? 3136 MET C CE  1 
ATOM   9132  N N   . VAL C  1 119 ? 41.015  -14.441 75.066  1.00 18.32  ? 3137 VAL C N   1 
ATOM   9133  C CA  . VAL C  1 119 ? 40.028  -14.848 74.075  1.00 17.73  ? 3137 VAL C CA  1 
ATOM   9134  C C   . VAL C  1 119 ? 38.904  -15.616 74.751  1.00 16.80  ? 3137 VAL C C   1 
ATOM   9135  O O   . VAL C  1 119 ? 39.123  -16.670 75.341  1.00 16.48  ? 3137 VAL C O   1 
ATOM   9136  C CB  . VAL C  1 119 ? 40.668  -15.735 72.981  1.00 18.23  ? 3137 VAL C CB  1 
ATOM   9137  C CG1 . VAL C  1 119 ? 39.631  -16.074 71.907  1.00 19.45  ? 3137 VAL C CG1 1 
ATOM   9138  C CG2 . VAL C  1 119 ? 41.868  -15.009 72.361  1.00 19.81  ? 3137 VAL C CG2 1 
ATOM   9139  N N   . TRP C  1 120 ? 37.698  -15.073 74.641  1.00 15.55  ? 3138 TRP C N   1 
ATOM   9140  C CA  . TRP C  1 120 ? 36.514  -15.659 75.252  1.00 15.58  ? 3138 TRP C CA  1 
ATOM   9141  C C   . TRP C  1 120 ? 35.738  -16.586 74.332  1.00 14.79  ? 3138 TRP C C   1 
ATOM   9142  O O   . TRP C  1 120 ? 35.452  -16.238 73.193  1.00 14.45  ? 3138 TRP C O   1 
ATOM   9143  C CB  . TRP C  1 120 ? 35.580  -14.536 75.734  1.00 15.20  ? 3138 TRP C CB  1 
ATOM   9144  C CG  . TRP C  1 120 ? 34.288  -15.028 76.317  1.00 18.44  ? 3138 TRP C CG  1 
ATOM   9145  C CD1 . TRP C  1 120 ? 33.053  -14.997 75.732  1.00 17.19  ? 3138 TRP C CD1 1 
ATOM   9146  C CD2 . TRP C  1 120 ? 34.109  -15.636 77.599  1.00 17.14  ? 3138 TRP C CD2 1 
ATOM   9147  N NE1 . TRP C  1 120 ? 32.115  -15.548 76.573  1.00 17.18  ? 3138 TRP C NE1 1 
ATOM   9148  C CE2 . TRP C  1 120 ? 32.738  -15.950 77.726  1.00 18.08  ? 3138 TRP C CE2 1 
ATOM   9149  C CE3 . TRP C  1 120 ? 34.975  -15.947 78.655  1.00 19.39  ? 3138 TRP C CE3 1 
ATOM   9150  C CZ2 . TRP C  1 120 ? 32.211  -16.561 78.871  1.00 18.23  ? 3138 TRP C CZ2 1 
ATOM   9151  C CZ3 . TRP C  1 120 ? 34.452  -16.552 79.792  1.00 19.42  ? 3138 TRP C CZ3 1 
ATOM   9152  C CH2 . TRP C  1 120 ? 33.081  -16.852 79.889  1.00 17.55  ? 3138 TRP C CH2 1 
ATOM   9153  N N   . ILE C  1 121 ? 35.402  -17.766 74.844  1.00 13.33  ? 3139 ILE C N   1 
ATOM   9154  C CA  . ILE C  1 121 ? 34.613  -18.747 74.109  1.00 14.36  ? 3139 ILE C CA  1 
ATOM   9155  C C   . ILE C  1 121 ? 33.299  -18.888 74.884  1.00 15.94  ? 3139 ILE C C   1 
ATOM   9156  O O   . ILE C  1 121 ? 33.275  -19.456 75.981  1.00 16.51  ? 3139 ILE C O   1 
ATOM   9157  C CB  . ILE C  1 121 ? 35.303  -20.125 74.051  1.00 13.12  ? 3139 ILE C CB  1 
ATOM   9158  C CG1 . ILE C  1 121 ? 36.717  -19.993 73.473  1.00 14.51  ? 3139 ILE C CG1 1 
ATOM   9159  C CG2 . ILE C  1 121 ? 34.484  -21.068 73.170  1.00 14.90  ? 3139 ILE C CG2 1 
ATOM   9160  C CD1 . ILE C  1 121 ? 37.504  -21.315 73.451  1.00 16.74  ? 3139 ILE C CD1 1 
ATOM   9161  N N   . HIS C  1 122 ? 32.219  -18.359 74.314  1.00 15.40  ? 3140 HIS C N   1 
ATOM   9162  C CA  . HIS C  1 122 ? 30.909  -18.394 74.959  1.00 15.23  ? 3140 HIS C CA  1 
ATOM   9163  C C   . HIS C  1 122 ? 30.319  -19.788 75.120  1.00 16.25  ? 3140 HIS C C   1 
ATOM   9164  O O   . HIS C  1 122 ? 30.649  -20.716 74.371  1.00 13.83  ? 3140 HIS C O   1 
ATOM   9165  C CB  . HIS C  1 122 ? 29.913  -17.507 74.196  1.00 15.23  ? 3140 HIS C CB  1 
ATOM   9166  C CG  . HIS C  1 122 ? 29.447  -18.086 72.890  1.00 17.97  ? 3140 HIS C CG  1 
ATOM   9167  N ND1 . HIS C  1 122 ? 28.552  -19.132 72.814  1.00 17.11  ? 3140 HIS C ND1 1 
ATOM   9168  C CD2 . HIS C  1 122 ? 29.732  -17.744 71.609  1.00 19.04  ? 3140 HIS C CD2 1 
ATOM   9169  C CE1 . HIS C  1 122 ? 28.302  -19.407 71.545  1.00 19.52  ? 3140 HIS C CE1 1 
ATOM   9170  N NE2 . HIS C  1 122 ? 29.005  -18.579 70.793  1.00 15.71  ? 3140 HIS C NE2 1 
ATOM   9171  N N   . GLY C  1 123 ? 29.438  -19.918 76.111  1.00 15.12  ? 3141 GLY C N   1 
ATOM   9172  C CA  . GLY C  1 123 ? 28.783  -21.184 76.363  1.00 15.04  ? 3141 GLY C CA  1 
ATOM   9173  C C   . GLY C  1 123 ? 27.419  -21.253 75.709  1.00 16.50  ? 3141 GLY C C   1 
ATOM   9174  O O   . GLY C  1 123 ? 27.028  -20.347 74.966  1.00 16.23  ? 3141 GLY C O   1 
ATOM   9175  N N   . GLY C  1 124 ? 26.689  -22.332 75.980  1.00 15.88  ? 3142 GLY C N   1 
ATOM   9176  C CA  . GLY C  1 124 ? 25.375  -22.501 75.390  1.00 15.38  ? 3142 GLY C CA  1 
ATOM   9177  C C   . GLY C  1 124 ? 25.130  -23.933 74.933  1.00 15.42  ? 3142 GLY C C   1 
ATOM   9178  O O   . GLY C  1 124 ? 24.348  -24.173 74.007  1.00 16.15  ? 3142 GLY C O   1 
ATOM   9179  N N   . GLY C  1 125 ? 25.811  -24.878 75.578  1.00 15.94  ? 3143 GLY C N   1 
ATOM   9180  C CA  . GLY C  1 125 ? 25.651  -26.289 75.257  1.00 15.64  ? 3143 GLY C CA  1 
ATOM   9181  C C   . GLY C  1 125 ? 26.043  -26.671 73.843  1.00 15.65  ? 3143 GLY C C   1 
ATOM   9182  O O   . GLY C  1 125 ? 25.686  -27.749 73.376  1.00 16.43  ? 3143 GLY C O   1 
ATOM   9183  N N   . LEU C  1 126 ? 26.789  -25.790 73.181  1.00 16.07  ? 3144 LEU C N   1 
ATOM   9184  C CA  . LEU C  1 126 ? 27.243  -25.980 71.799  1.00 15.97  ? 3144 LEU C CA  1 
ATOM   9185  C C   . LEU C  1 126 ? 26.051  -25.933 70.850  1.00 15.34  ? 3144 LEU C C   1 
ATOM   9186  O O   . LEU C  1 126 ? 26.141  -26.323 69.681  1.00 16.18  ? 3144 LEU C O   1 
ATOM   9187  C CB  . LEU C  1 126 ? 28.010  -27.308 71.652  1.00 12.64  ? 3144 LEU C CB  1 
ATOM   9188  C CG  . LEU C  1 126 ? 29.237  -27.465 72.564  1.00 15.17  ? 3144 LEU C CG  1 
ATOM   9189  C CD1 . LEU C  1 126 ? 29.884  -28.824 72.337  1.00 17.26  ? 3144 LEU C CD1 1 
ATOM   9190  C CD2 . LEU C  1 126 ? 30.250  -26.334 72.302  1.00 13.88  ? 3144 LEU C CD2 1 
ATOM   9191  N N   . MET C  1 127 ? 24.935  -25.414 71.356  1.00 16.54  ? 3145 MET C N   1 
ATOM   9192  C CA  . MET C  1 127 ? 23.704  -25.319 70.577  1.00 15.44  ? 3145 MET C CA  1 
ATOM   9193  C C   . MET C  1 127 ? 23.217  -23.890 70.367  1.00 13.75  ? 3145 MET C C   1 
ATOM   9194  O O   . MET C  1 127 ? 22.594  -23.583 69.349  1.00 14.08  ? 3145 MET C O   1 
ATOM   9195  C CB  . MET C  1 127 ? 22.604  -26.129 71.254  1.00 17.41  ? 3145 MET C CB  1 
ATOM   9196  C CG  . MET C  1 127 ? 22.902  -27.624 71.390  1.00 21.58  ? 3145 MET C CG  1 
ATOM   9197  S SD  . MET C  1 127 ? 22.962  -28.473 69.795  1.00 24.96  ? 3145 MET C SD  1 
ATOM   9198  C CE  . MET C  1 127 ? 21.362  -27.961 69.084  1.00 20.86  ? 3145 MET C CE  1 
ATOM   9199  N N   . VAL C  1 128 ? 23.491  -23.020 71.330  1.00 14.30  ? 3146 VAL C N   1 
ATOM   9200  C CA  . VAL C  1 128 ? 23.080  -21.622 71.246  1.00 13.85  ? 3146 VAL C CA  1 
ATOM   9201  C C   . VAL C  1 128 ? 24.212  -20.748 71.759  1.00 13.57  ? 3146 VAL C C   1 
ATOM   9202  O O   . VAL C  1 128 ? 25.254  -21.257 72.171  1.00 14.97  ? 3146 VAL C O   1 
ATOM   9203  C CB  . VAL C  1 128 ? 21.813  -21.342 72.095  1.00 14.40  ? 3146 VAL C CB  1 
ATOM   9204  C CG1 . VAL C  1 128 ? 20.646  -22.164 71.588  1.00 15.34  ? 3146 VAL C CG1 1 
ATOM   9205  C CG2 . VAL C  1 128 ? 22.084  -21.649 73.549  1.00 13.33  ? 3146 VAL C CG2 1 
ATOM   9206  N N   . GLY C  1 129 ? 24.012  -19.434 71.725  1.00 14.29  ? 3147 GLY C N   1 
ATOM   9207  C CA  . GLY C  1 129 ? 25.036  -18.520 72.202  1.00 14.12  ? 3147 GLY C CA  1 
ATOM   9208  C C   . GLY C  1 129 ? 25.561  -17.576 71.135  1.00 17.13  ? 3147 GLY C C   1 
ATOM   9209  O O   . GLY C  1 129 ? 25.303  -17.759 69.940  1.00 16.58  ? 3147 GLY C O   1 
ATOM   9210  N N   . ALA C  1 130 ? 26.314  -16.568 71.572  1.00 15.94  ? 3148 ALA C N   1 
ATOM   9211  C CA  . ALA C  1 130 ? 26.885  -15.575 70.671  1.00 16.67  ? 3148 ALA C CA  1 
ATOM   9212  C C   . ALA C  1 130 ? 27.985  -14.799 71.380  1.00 18.06  ? 3148 ALA C C   1 
ATOM   9213  O O   . ALA C  1 130 ? 28.013  -14.714 72.612  1.00 15.67  ? 3148 ALA C O   1 
ATOM   9214  C CB  . ALA C  1 130 ? 25.797  -14.621 70.187  1.00 16.72  ? 3148 ALA C CB  1 
ATOM   9215  N N   . ALA C  1 131 ? 28.896  -14.235 70.598  1.00 17.32  ? 3149 ALA C N   1 
ATOM   9216  C CA  . ALA C  1 131 ? 29.996  -13.468 71.160  1.00 17.54  ? 3149 ALA C CA  1 
ATOM   9217  C C   . ALA C  1 131 ? 29.553  -12.076 71.598  1.00 17.27  ? 3149 ALA C C   1 
ATOM   9218  O O   . ALA C  1 131 ? 29.996  -11.573 72.636  1.00 17.81  ? 3149 ALA C O   1 
ATOM   9219  C CB  . ALA C  1 131 ? 31.117  -13.349 70.139  1.00 17.42  ? 3149 ALA C CB  1 
ATOM   9220  N N   . SER C  1 132 ? 28.674  -11.465 70.810  1.00 16.92  ? 3150 SER C N   1 
ATOM   9221  C CA  . SER C  1 132 ? 28.191  -10.113 71.082  1.00 17.52  ? 3150 SER C CA  1 
ATOM   9222  C C   . SER C  1 132 ? 27.486  -9.949  72.424  1.00 19.93  ? 3150 SER C C   1 
ATOM   9223  O O   . SER C  1 132 ? 27.316  -8.833  72.908  1.00 16.40  ? 3150 SER C O   1 
ATOM   9224  C CB  . SER C  1 132 ? 27.273  -9.650  69.952  1.00 18.71  ? 3150 SER C CB  1 
ATOM   9225  O OG  . SER C  1 132 ? 27.985  -9.612  68.723  1.00 18.44  ? 3150 SER C OG  1 
ATOM   9226  N N   . THR C  1 133 ? 27.079  -11.068 73.014  1.00 19.80  ? 3151 THR C N   1 
ATOM   9227  C CA  . THR C  1 133 ? 26.420  -11.073 74.308  1.00 18.79  ? 3151 THR C CA  1 
ATOM   9228  C C   . THR C  1 133 ? 27.377  -10.525 75.363  1.00 20.51  ? 3151 THR C C   1 
ATOM   9229  O O   . THR C  1 133 ? 26.963  -9.888  76.330  1.00 21.62  ? 3151 THR C O   1 
ATOM   9230  C CB  . THR C  1 133 ? 26.046  -12.501 74.708  1.00 17.66  ? 3151 THR C CB  1 
ATOM   9231  O OG1 . THR C  1 133 ? 25.062  -13.000 73.802  1.00 16.18  ? 3151 THR C OG1 1 
ATOM   9232  C CG2 . THR C  1 133 ? 25.510  -12.548 76.140  1.00 19.50  ? 3151 THR C CG2 1 
ATOM   9233  N N   . TYR C  1 134 ? 28.664  -10.769 75.152  1.00 19.85  ? 3152 TYR C N   1 
ATOM   9234  C CA  . TYR C  1 134 ? 29.691  -10.350 76.083  1.00 19.86  ? 3152 TYR C CA  1 
ATOM   9235  C C   . TYR C  1 134 ? 30.472  -9.127  75.624  1.00 22.06  ? 3152 TYR C C   1 
ATOM   9236  O O   . TYR C  1 134 ? 31.153  -9.150  74.597  1.00 22.51  ? 3152 TYR C O   1 
ATOM   9237  C CB  . TYR C  1 134 ? 30.635  -11.524 76.338  1.00 20.23  ? 3152 TYR C CB  1 
ATOM   9238  C CG  . TYR C  1 134 ? 29.883  -12.797 76.645  1.00 20.52  ? 3152 TYR C CG  1 
ATOM   9239  C CD1 . TYR C  1 134 ? 29.320  -13.565 75.620  1.00 18.23  ? 3152 TYR C CD1 1 
ATOM   9240  C CD2 . TYR C  1 134 ? 29.671  -13.201 77.964  1.00 19.32  ? 3152 TYR C CD2 1 
ATOM   9241  C CE1 . TYR C  1 134 ? 28.561  -14.700 75.901  1.00 18.82  ? 3152 TYR C CE1 1 
ATOM   9242  C CE2 . TYR C  1 134 ? 28.915  -14.331 78.255  1.00 20.72  ? 3152 TYR C CE2 1 
ATOM   9243  C CZ  . TYR C  1 134 ? 28.361  -15.075 77.220  1.00 20.09  ? 3152 TYR C CZ  1 
ATOM   9244  O OH  . TYR C  1 134 ? 27.597  -16.185 77.508  1.00 23.54  ? 3152 TYR C OH  1 
ATOM   9245  N N   . ASP C  1 135 ? 30.363  -8.056  76.402  1.00 20.72  ? 3153 ASP C N   1 
ATOM   9246  C CA  . ASP C  1 135 ? 31.043  -6.807  76.107  1.00 21.14  ? 3153 ASP C CA  1 
ATOM   9247  C C   . ASP C  1 135 ? 32.381  -6.789  76.841  1.00 21.77  ? 3153 ASP C C   1 
ATOM   9248  O O   . ASP C  1 135 ? 32.428  -6.895  78.068  1.00 21.39  ? 3153 ASP C O   1 
ATOM   9249  C CB  . ASP C  1 135 ? 30.155  -5.645  76.555  1.00 23.05  ? 3153 ASP C CB  1 
ATOM   9250  C CG  . ASP C  1 135 ? 30.735  -4.291  76.219  1.00 24.81  ? 3153 ASP C CG  1 
ATOM   9251  O OD1 . ASP C  1 135 ? 30.004  -3.298  76.396  1.00 27.09  ? 3153 ASP C OD1 1 
ATOM   9252  O OD2 . ASP C  1 135 ? 31.907  -4.209  75.787  1.00 27.31  ? 3153 ASP C OD2 1 
ATOM   9253  N N   . GLY C  1 136 ? 33.469  -6.662  76.087  1.00 19.67  ? 3154 GLY C N   1 
ATOM   9254  C CA  . GLY C  1 136 ? 34.785  -6.659  76.702  1.00 20.93  ? 3154 GLY C CA  1 
ATOM   9255  C C   . GLY C  1 136 ? 35.313  -5.319  77.187  1.00 20.07  ? 3154 GLY C C   1 
ATOM   9256  O O   . GLY C  1 136 ? 36.421  -5.257  77.709  1.00 22.82  ? 3154 GLY C O   1 
ATOM   9257  N N   . LEU C  1 137 ? 34.520  -4.262  77.033  1.00 20.80  ? 3155 LEU C N   1 
ATOM   9258  C CA  . LEU C  1 137 ? 34.910  -2.903  77.420  1.00 21.69  ? 3155 LEU C CA  1 
ATOM   9259  C C   . LEU C  1 137 ? 35.474  -2.747  78.837  1.00 22.40  ? 3155 LEU C C   1 
ATOM   9260  O O   . LEU C  1 137 ? 36.561  -2.196  79.022  1.00 23.14  ? 3155 LEU C O   1 
ATOM   9261  C CB  . LEU C  1 137 ? 33.712  -1.957  77.269  1.00 24.60  ? 3155 LEU C CB  1 
ATOM   9262  C CG  . LEU C  1 137 ? 33.948  -0.492  76.875  1.00 27.03  ? 3155 LEU C CG  1 
ATOM   9263  C CD1 . LEU C  1 137 ? 32.778  0.337   77.373  1.00 27.38  ? 3155 LEU C CD1 1 
ATOM   9264  C CD2 . LEU C  1 137 ? 35.240  0.040   77.453  1.00 28.17  ? 3155 LEU C CD2 1 
ATOM   9265  N N   . ALA C  1 138 ? 34.730  -3.217  79.833  1.00 20.88  ? 3156 ALA C N   1 
ATOM   9266  C CA  . ALA C  1 138 ? 35.158  -3.092  81.223  1.00 20.81  ? 3156 ALA C CA  1 
ATOM   9267  C C   . ALA C  1 138 ? 36.444  -3.851  81.547  1.00 21.47  ? 3156 ALA C C   1 
ATOM   9268  O O   . ALA C  1 138 ? 37.379  -3.287  82.120  1.00 21.04  ? 3156 ALA C O   1 
ATOM   9269  C CB  . ALA C  1 138 ? 34.038  -3.548  82.151  1.00 19.73  ? 3156 ALA C CB  1 
ATOM   9270  N N   . LEU C  1 139 ? 36.490  -5.128  81.184  1.00 21.42  ? 3157 LEU C N   1 
ATOM   9271  C CA  . LEU C  1 139 ? 37.664  -5.945  81.457  1.00 22.32  ? 3157 LEU C CA  1 
ATOM   9272  C C   . LEU C  1 139 ? 38.910  -5.371  80.787  1.00 22.81  ? 3157 LEU C C   1 
ATOM   9273  O O   . LEU C  1 139 ? 39.975  -5.287  81.401  1.00 22.88  ? 3157 LEU C O   1 
ATOM   9274  C CB  . LEU C  1 139 ? 37.427  -7.383  80.981  1.00 23.32  ? 3157 LEU C CB  1 
ATOM   9275  C CG  . LEU C  1 139 ? 38.519  -8.414  81.280  1.00 23.38  ? 3157 LEU C CG  1 
ATOM   9276  C CD1 . LEU C  1 139 ? 38.780  -8.486  82.786  1.00 25.86  ? 3157 LEU C CD1 1 
ATOM   9277  C CD2 . LEU C  1 139 ? 38.074  -9.776  80.757  1.00 25.06  ? 3157 LEU C CD2 1 
ATOM   9278  N N   . ALA C  1 140 ? 38.769  -4.979  79.526  1.00 22.16  ? 3158 ALA C N   1 
ATOM   9279  C CA  . ALA C  1 140 ? 39.875  -4.417  78.764  1.00 22.28  ? 3158 ALA C CA  1 
ATOM   9280  C C   . ALA C  1 140 ? 40.437  -3.167  79.445  1.00 23.64  ? 3158 ALA C C   1 
ATOM   9281  O O   . ALA C  1 140 ? 41.622  -3.108  79.781  1.00 25.05  ? 3158 ALA C O   1 
ATOM   9282  C CB  . ALA C  1 140 ? 39.406  -4.079  77.351  1.00 20.69  ? 3158 ALA C CB  1 
ATOM   9283  N N   . ALA C  1 141 ? 39.574  -2.178  79.648  1.00 23.16  ? 3159 ALA C N   1 
ATOM   9284  C CA  . ALA C  1 141 ? 39.955  -0.918  80.273  1.00 24.78  ? 3159 ALA C CA  1 
ATOM   9285  C C   . ALA C  1 141 ? 40.427  -1.064  81.717  1.00 25.72  ? 3159 ALA C C   1 
ATOM   9286  O O   . ALA C  1 141 ? 41.410  -0.445  82.114  1.00 26.24  ? 3159 ALA C O   1 
ATOM   9287  C CB  . ALA C  1 141 ? 38.781  0.063   80.214  1.00 25.25  ? 3159 ALA C CB  1 
ATOM   9288  N N   . HIS C  1 142 ? 39.729  -1.877  82.501  1.00 25.46  ? 3160 HIS C N   1 
ATOM   9289  C CA  . HIS C  1 142 ? 40.091  -2.060  83.901  1.00 26.18  ? 3160 HIS C CA  1 
ATOM   9290  C C   . HIS C  1 142 ? 41.403  -2.791  84.137  1.00 26.69  ? 3160 HIS C C   1 
ATOM   9291  O O   . HIS C  1 142 ? 42.178  -2.409  85.012  1.00 26.82  ? 3160 HIS C O   1 
ATOM   9292  C CB  . HIS C  1 142 ? 38.970  -2.789  84.646  1.00 28.15  ? 3160 HIS C CB  1 
ATOM   9293  C CG  . HIS C  1 142 ? 37.909  -1.880  85.181  1.00 29.24  ? 3160 HIS C CG  1 
ATOM   9294  N ND1 . HIS C  1 142 ? 37.988  -1.302  86.430  1.00 30.11  ? 3160 HIS C ND1 1 
ATOM   9295  C CD2 . HIS C  1 142 ? 36.760  -1.426  84.629  1.00 29.80  ? 3160 HIS C CD2 1 
ATOM   9296  C CE1 . HIS C  1 142 ? 36.933  -0.532  86.624  1.00 29.89  ? 3160 HIS C CE1 1 
ATOM   9297  N NE2 . HIS C  1 142 ? 36.172  -0.589  85.546  1.00 32.41  ? 3160 HIS C NE2 1 
ATOM   9298  N N   . GLU C  1 143 ? 41.660  -3.840  83.366  1.00 26.43  ? 3161 GLU C N   1 
ATOM   9299  C CA  . GLU C  1 143 ? 42.883  -4.607  83.560  1.00 26.93  ? 3161 GLU C CA  1 
ATOM   9300  C C   . GLU C  1 143 ? 43.926  -4.473  82.461  1.00 26.36  ? 3161 GLU C C   1 
ATOM   9301  O O   . GLU C  1 143 ? 44.937  -5.171  82.469  1.00 26.34  ? 3161 GLU C O   1 
ATOM   9302  C CB  . GLU C  1 143 ? 42.535  -6.077  83.766  1.00 26.97  ? 3161 GLU C CB  1 
ATOM   9303  C CG  . GLU C  1 143 ? 41.943  -6.365  85.128  1.00 29.28  ? 3161 GLU C CG  1 
ATOM   9304  C CD  . GLU C  1 143 ? 42.850  -5.909  86.256  1.00 30.93  ? 3161 GLU C CD  1 
ATOM   9305  O OE1 . GLU C  1 143 ? 44.061  -6.217  86.216  1.00 32.04  ? 3161 GLU C OE1 1 
ATOM   9306  O OE2 . GLU C  1 143 ? 42.349  -5.249  87.188  1.00 31.72  ? 3161 GLU C OE2 1 
ATOM   9307  N N   . ASN C  1 144 ? 43.680  -3.568  81.524  1.00 27.20  ? 3162 ASN C N   1 
ATOM   9308  C CA  . ASN C  1 144 ? 44.607  -3.336  80.430  1.00 27.69  ? 3162 ASN C CA  1 
ATOM   9309  C C   . ASN C  1 144 ? 44.991  -4.605  79.674  1.00 25.36  ? 3162 ASN C C   1 
ATOM   9310  O O   . ASN C  1 144 ? 46.169  -4.921  79.524  1.00 23.90  ? 3162 ASN C O   1 
ATOM   9311  C CB  . ASN C  1 144 ? 45.861  -2.639  80.957  1.00 32.14  ? 3162 ASN C CB  1 
ATOM   9312  C CG  . ASN C  1 144 ? 46.120  -1.324  80.265  1.00 35.08  ? 3162 ASN C CG  1 
ATOM   9313  O OD1 . ASN C  1 144 ? 46.550  -1.289  79.112  1.00 39.80  ? 3162 ASN C OD1 1 
ATOM   9314  N ND2 . ASN C  1 144 ? 45.843  -0.228  80.960  1.00 39.47  ? 3162 ASN C ND2 1 
ATOM   9315  N N   . VAL C  1 145 ? 43.981  -5.336  79.216  1.00 23.98  ? 3163 VAL C N   1 
ATOM   9316  C CA  . VAL C  1 145 ? 44.198  -6.548  78.436  1.00 22.09  ? 3163 VAL C CA  1 
ATOM   9317  C C   . VAL C  1 145 ? 43.357  -6.418  77.176  1.00 21.30  ? 3163 VAL C C   1 
ATOM   9318  O O   . VAL C  1 145 ? 42.350  -5.708  77.174  1.00 21.24  ? 3163 VAL C O   1 
ATOM   9319  C CB  . VAL C  1 145 ? 43.760  -7.825  79.188  1.00 22.15  ? 3163 VAL C CB  1 
ATOM   9320  C CG1 . VAL C  1 145 ? 44.579  -7.996  80.458  1.00 21.62  ? 3163 VAL C CG1 1 
ATOM   9321  C CG2 . VAL C  1 145 ? 42.269  -7.759  79.502  1.00 24.13  ? 3163 VAL C CG2 1 
ATOM   9322  N N   . VAL C  1 146 ? 43.780  -7.070  76.098  1.00 18.87  ? 3164 VAL C N   1 
ATOM   9323  C CA  . VAL C  1 146 ? 43.014  -7.023  74.863  1.00 18.86  ? 3164 VAL C CA  1 
ATOM   9324  C C   . VAL C  1 146 ? 42.024  -8.167  74.963  1.00 16.00  ? 3164 VAL C C   1 
ATOM   9325  O O   . VAL C  1 146 ? 42.416  -9.317  75.151  1.00 17.59  ? 3164 VAL C O   1 
ATOM   9326  C CB  . VAL C  1 146 ? 43.901  -7.236  73.613  1.00 19.57  ? 3164 VAL C CB  1 
ATOM   9327  C CG1 . VAL C  1 146 ? 43.024  -7.297  72.365  1.00 17.73  ? 3164 VAL C CG1 1 
ATOM   9328  C CG2 . VAL C  1 146 ? 44.922  -6.101  73.491  1.00 20.16  ? 3164 VAL C CG2 1 
ATOM   9329  N N   . VAL C  1 147 ? 40.741  -7.855  74.851  1.00 15.82  ? 3165 VAL C N   1 
ATOM   9330  C CA  . VAL C  1 147 ? 39.719  -8.889  74.949  1.00 16.53  ? 3165 VAL C CA  1 
ATOM   9331  C C   . VAL C  1 147 ? 39.135  -9.212  73.589  1.00 16.05  ? 3165 VAL C C   1 
ATOM   9332  O O   . VAL C  1 147 ? 38.716  -8.323  72.857  1.00 18.21  ? 3165 VAL C O   1 
ATOM   9333  C CB  . VAL C  1 147 ? 38.570  -8.469  75.892  1.00 15.94  ? 3165 VAL C CB  1 
ATOM   9334  C CG1 . VAL C  1 147 ? 37.552  -9.612  76.004  1.00 15.15  ? 3165 VAL C CG1 1 
ATOM   9335  C CG2 . VAL C  1 147 ? 39.134  -8.118  77.271  1.00 15.75  ? 3165 VAL C CG2 1 
ATOM   9336  N N   . VAL C  1 148 ? 39.109  -10.499 73.265  1.00 18.14  ? 3166 VAL C N   1 
ATOM   9337  C CA  . VAL C  1 148 ? 38.578  -10.962 71.990  1.00 18.39  ? 3166 VAL C CA  1 
ATOM   9338  C C   . VAL C  1 148 ? 37.451  -11.970 72.208  1.00 15.91  ? 3166 VAL C C   1 
ATOM   9339  O O   . VAL C  1 148 ? 37.650  -12.986 72.866  1.00 17.24  ? 3166 VAL C O   1 
ATOM   9340  C CB  . VAL C  1 148 ? 39.681  -11.660 71.155  1.00 18.79  ? 3166 VAL C CB  1 
ATOM   9341  C CG1 . VAL C  1 148 ? 39.097  -12.150 69.836  1.00 18.13  ? 3166 VAL C CG1 1 
ATOM   9342  C CG2 . VAL C  1 148 ? 40.850  -10.698 70.910  1.00 18.05  ? 3166 VAL C CG2 1 
ATOM   9343  N N   . THR C  1 149 ? 36.269  -11.691 71.663  1.00 16.45  ? 3167 THR C N   1 
ATOM   9344  C CA  . THR C  1 149 ? 35.152  -12.620 71.797  1.00 15.22  ? 3167 THR C CA  1 
ATOM   9345  C C   . THR C  1 149 ? 34.913  -13.265 70.439  1.00 16.16  ? 3167 THR C C   1 
ATOM   9346  O O   . THR C  1 149 ? 34.713  -12.574 69.437  1.00 16.32  ? 3167 THR C O   1 
ATOM   9347  C CB  . THR C  1 149 ? 33.865  -11.916 72.297  1.00 15.89  ? 3167 THR C CB  1 
ATOM   9348  O OG1 . THR C  1 149 ? 33.474  -10.893 71.380  1.00 14.97  ? 3167 THR C OG1 1 
ATOM   9349  C CG2 . THR C  1 149 ? 34.109  -11.287 73.672  1.00 12.99  ? 3167 THR C CG2 1 
ATOM   9350  N N   . ILE C  1 150 ? 34.942  -14.592 70.407  1.00 16.63  ? 3168 ILE C N   1 
ATOM   9351  C CA  . ILE C  1 150 ? 34.777  -15.318 69.150  1.00 17.03  ? 3168 ILE C CA  1 
ATOM   9352  C C   . ILE C  1 150 ? 33.478  -16.102 69.040  1.00 16.74  ? 3168 ILE C C   1 
ATOM   9353  O O   . ILE C  1 150 ? 32.836  -16.420 70.043  1.00 17.81  ? 3168 ILE C O   1 
ATOM   9354  C CB  . ILE C  1 150 ? 35.946  -16.321 68.937  1.00 17.28  ? 3168 ILE C CB  1 
ATOM   9355  C CG1 . ILE C  1 150 ? 35.798  -17.508 69.891  1.00 19.91  ? 3168 ILE C CG1 1 
ATOM   9356  C CG2 . ILE C  1 150 ? 37.283  -15.636 69.205  1.00 18.06  ? 3168 ILE C CG2 1 
ATOM   9357  C CD1 . ILE C  1 150 ? 36.904  -18.555 69.772  1.00 19.17  ? 3168 ILE C CD1 1 
ATOM   9358  N N   . GLN C  1 151 ? 33.090  -16.394 67.804  1.00 15.03  ? 3169 GLN C N   1 
ATOM   9359  C CA  . GLN C  1 151 ? 31.909  -17.195 67.545  1.00 16.45  ? 3169 GLN C CA  1 
ATOM   9360  C C   . GLN C  1 151 ? 32.381  -18.440 66.811  1.00 17.09  ? 3169 GLN C C   1 
ATOM   9361  O O   . GLN C  1 151 ? 33.493  -18.473 66.279  1.00 17.67  ? 3169 GLN C O   1 
ATOM   9362  C CB  . GLN C  1 151 ? 30.873  -16.411 66.731  1.00 15.49  ? 3169 GLN C CB  1 
ATOM   9363  C CG  . GLN C  1 151 ? 30.145  -15.400 67.613  1.00 18.27  ? 3169 GLN C CG  1 
ATOM   9364  C CD  . GLN C  1 151 ? 29.026  -14.644 66.925  1.00 19.97  ? 3169 GLN C CD  1 
ATOM   9365  O OE1 . GLN C  1 151 ? 28.303  -13.895 67.574  1.00 19.90  ? 3169 GLN C OE1 1 
ATOM   9366  N NE2 . GLN C  1 151 ? 28.879  -14.827 65.613  1.00 19.40  ? 3169 GLN C NE2 1 
ATOM   9367  N N   . TYR C  1 152 ? 31.547  -19.469 66.809  1.00 15.18  ? 3170 TYR C N   1 
ATOM   9368  C CA  . TYR C  1 152 ? 31.880  -20.729 66.170  1.00 15.52  ? 3170 TYR C CA  1 
ATOM   9369  C C   . TYR C  1 152 ? 30.577  -21.440 65.828  1.00 17.48  ? 3170 TYR C C   1 
ATOM   9370  O O   . TYR C  1 152 ? 29.559  -21.224 66.492  1.00 17.25  ? 3170 TYR C O   1 
ATOM   9371  C CB  . TYR C  1 152 ? 32.732  -21.582 67.120  1.00 14.30  ? 3170 TYR C CB  1 
ATOM   9372  C CG  . TYR C  1 152 ? 32.103  -21.809 68.486  1.00 15.90  ? 3170 TYR C CG  1 
ATOM   9373  C CD1 . TYR C  1 152 ? 32.252  -20.879 69.513  1.00 15.15  ? 3170 TYR C CD1 1 
ATOM   9374  C CD2 . TYR C  1 152 ? 31.333  -22.948 68.737  1.00 16.12  ? 3170 TYR C CD2 1 
ATOM   9375  C CE1 . TYR C  1 152 ? 31.643  -21.077 70.765  1.00 17.79  ? 3170 TYR C CE1 1 
ATOM   9376  C CE2 . TYR C  1 152 ? 30.723  -23.153 69.975  1.00 16.43  ? 3170 TYR C CE2 1 
ATOM   9377  C CZ  . TYR C  1 152 ? 30.881  -22.217 70.984  1.00 16.71  ? 3170 TYR C CZ  1 
ATOM   9378  O OH  . TYR C  1 152 ? 30.274  -22.430 72.206  1.00 19.02  ? 3170 TYR C OH  1 
ATOM   9379  N N   . ARG C  1 153 ? 30.593  -22.273 64.791  1.00 16.88  ? 3171 ARG C N   1 
ATOM   9380  C CA  . ARG C  1 153 ? 29.384  -22.990 64.393  1.00 15.66  ? 3171 ARG C CA  1 
ATOM   9381  C C   . ARG C  1 153 ? 28.770  -23.792 65.536  1.00 15.20  ? 3171 ARG C C   1 
ATOM   9382  O O   . ARG C  1 153 ? 29.469  -24.440 66.318  1.00 14.08  ? 3171 ARG C O   1 
ATOM   9383  C CB  . ARG C  1 153 ? 29.670  -23.894 63.192  1.00 14.74  ? 3171 ARG C CB  1 
ATOM   9384  C CG  . ARG C  1 153 ? 29.670  -23.124 61.872  1.00 15.77  ? 3171 ARG C CG  1 
ATOM   9385  C CD  . ARG C  1 153 ? 30.175  -23.973 60.719  1.00 14.33  ? 3171 ARG C CD  1 
ATOM   9386  N NE  . ARG C  1 153 ? 31.615  -24.200 60.798  1.00 16.47  ? 3171 ARG C NE  1 
ATOM   9387  C CZ  . ARG C  1 153 ? 32.309  -24.917 59.917  1.00 17.57  ? 3171 ARG C CZ  1 
ATOM   9388  N NH1 . ARG C  1 153 ? 31.694  -25.488 58.887  1.00 16.00  ? 3171 ARG C NH1 1 
ATOM   9389  N NH2 . ARG C  1 153 ? 33.624  -25.044 60.050  1.00 17.07  ? 3171 ARG C NH2 1 
ATOM   9390  N N   . LEU C  1 154 ? 27.445  -23.750 65.603  1.00 14.36  ? 3172 LEU C N   1 
ATOM   9391  C CA  . LEU C  1 154 ? 26.692  -24.413 66.658  1.00 15.86  ? 3172 LEU C CA  1 
ATOM   9392  C C   . LEU C  1 154 ? 25.723  -25.465 66.128  1.00 15.97  ? 3172 LEU C C   1 
ATOM   9393  O O   . LEU C  1 154 ? 25.382  -25.479 64.940  1.00 14.12  ? 3172 LEU C O   1 
ATOM   9394  C CB  . LEU C  1 154 ? 25.884  -23.364 67.433  1.00 15.97  ? 3172 LEU C CB  1 
ATOM   9395  C CG  . LEU C  1 154 ? 26.646  -22.156 67.985  1.00 16.48  ? 3172 LEU C CG  1 
ATOM   9396  C CD1 . LEU C  1 154 ? 25.663  -21.031 68.298  1.00 17.30  ? 3172 LEU C CD1 1 
ATOM   9397  C CD2 . LEU C  1 154 ? 27.418  -22.561 69.232  1.00 16.86  ? 3172 LEU C CD2 1 
ATOM   9398  N N   . GLY C  1 155 ? 25.277  -26.330 67.035  1.00 15.99  ? 3173 GLY C N   1 
ATOM   9399  C CA  . GLY C  1 155 ? 24.318  -27.367 66.694  1.00 14.24  ? 3173 GLY C CA  1 
ATOM   9400  C C   . GLY C  1 155 ? 24.665  -28.230 65.493  1.00 16.72  ? 3173 GLY C C   1 
ATOM   9401  O O   . GLY C  1 155 ? 25.792  -28.706 65.356  1.00 16.97  ? 3173 GLY C O   1 
ATOM   9402  N N   . ILE C  1 156 ? 23.683  -28.449 64.628  1.00 16.40  ? 3174 ILE C N   1 
ATOM   9403  C CA  . ILE C  1 156 ? 23.889  -29.276 63.446  1.00 17.40  ? 3174 ILE C CA  1 
ATOM   9404  C C   . ILE C  1 156 ? 25.063  -28.758 62.618  1.00 16.43  ? 3174 ILE C C   1 
ATOM   9405  O O   . ILE C  1 156 ? 25.959  -29.520 62.242  1.00 15.96  ? 3174 ILE C O   1 
ATOM   9406  C CB  . ILE C  1 156 ? 22.616  -29.310 62.574  1.00 18.97  ? 3174 ILE C CB  1 
ATOM   9407  C CG1 . ILE C  1 156 ? 21.490  -30.003 63.350  1.00 19.38  ? 3174 ILE C CG1 1 
ATOM   9408  C CG2 . ILE C  1 156 ? 22.904  -30.026 61.244  1.00 18.66  ? 3174 ILE C CG2 1 
ATOM   9409  C CD1 . ILE C  1 156 ? 20.148  -30.007 62.635  1.00 19.32  ? 3174 ILE C CD1 1 
ATOM   9410  N N   . TRP C  1 157 ? 25.057  -27.456 62.361  1.00 15.38  ? 3175 TRP C N   1 
ATOM   9411  C CA  . TRP C  1 157 ? 26.101  -26.808 61.572  1.00 15.91  ? 3175 TRP C CA  1 
ATOM   9412  C C   . TRP C  1 157 ? 27.487  -26.981 62.158  1.00 15.11  ? 3175 TRP C C   1 
ATOM   9413  O O   . TRP C  1 157 ? 28.464  -27.116 61.423  1.00 13.64  ? 3175 TRP C O   1 
ATOM   9414  C CB  . TRP C  1 157 ? 25.821  -25.309 61.452  1.00 13.80  ? 3175 TRP C CB  1 
ATOM   9415  C CG  . TRP C  1 157 ? 24.566  -24.993 60.729  1.00 14.64  ? 3175 TRP C CG  1 
ATOM   9416  C CD1 . TRP C  1 157 ? 24.420  -24.784 59.384  1.00 14.41  ? 3175 TRP C CD1 1 
ATOM   9417  C CD2 . TRP C  1 157 ? 23.261  -24.891 61.296  1.00 13.22  ? 3175 TRP C CD2 1 
ATOM   9418  N NE1 . TRP C  1 157 ? 23.101  -24.560 59.084  1.00 15.04  ? 3175 TRP C NE1 1 
ATOM   9419  C CE2 . TRP C  1 157 ? 22.366  -24.620 60.239  1.00 13.55  ? 3175 TRP C CE2 1 
ATOM   9420  C CE3 . TRP C  1 157 ? 22.757  -25.005 62.600  1.00 14.41  ? 3175 TRP C CE3 1 
ATOM   9421  C CZ2 . TRP C  1 157 ? 20.991  -24.460 60.442  1.00 14.82  ? 3175 TRP C CZ2 1 
ATOM   9422  C CZ3 . TRP C  1 157 ? 21.389  -24.847 62.803  1.00 16.57  ? 3175 TRP C CZ3 1 
ATOM   9423  C CH2 . TRP C  1 157 ? 20.523  -24.578 61.728  1.00 16.49  ? 3175 TRP C CH2 1 
ATOM   9424  N N   . GLY C  1 158 ? 27.580  -26.961 63.483  1.00 15.31  ? 3176 GLY C N   1 
ATOM   9425  C CA  . GLY C  1 158 ? 28.882  -27.078 64.107  1.00 15.13  ? 3176 GLY C CA  1 
ATOM   9426  C C   . GLY C  1 158 ? 29.310  -28.448 64.585  1.00 14.79  ? 3176 GLY C C   1 
ATOM   9427  O O   . GLY C  1 158 ? 30.500  -28.680 64.791  1.00 15.71  ? 3176 GLY C O   1 
ATOM   9428  N N   . PHE C  1 159 ? 28.372  -29.372 64.744  1.00 15.37  ? 3177 PHE C N   1 
ATOM   9429  C CA  . PHE C  1 159 ? 28.751  -30.669 65.266  1.00 15.94  ? 3177 PHE C CA  1 
ATOM   9430  C C   . PHE C  1 159 ? 28.170  -31.922 64.619  1.00 17.02  ? 3177 PHE C C   1 
ATOM   9431  O O   . PHE C  1 159 ? 28.355  -33.021 65.140  1.00 18.52  ? 3177 PHE C O   1 
ATOM   9432  C CB  . PHE C  1 159 ? 28.503  -30.655 66.786  1.00 14.56  ? 3177 PHE C CB  1 
ATOM   9433  C CG  . PHE C  1 159 ? 29.331  -29.621 67.505  1.00 14.11  ? 3177 PHE C CG  1 
ATOM   9434  C CD1 . PHE C  1 159 ? 30.633  -29.908 67.908  1.00 13.40  ? 3177 PHE C CD1 1 
ATOM   9435  C CD2 . PHE C  1 159 ? 28.854  -28.325 67.671  1.00 15.55  ? 3177 PHE C CD2 1 
ATOM   9436  C CE1 . PHE C  1 159 ? 31.452  -28.915 68.457  1.00 16.29  ? 3177 PHE C CE1 1 
ATOM   9437  C CE2 . PHE C  1 159 ? 29.665  -27.322 68.218  1.00 16.54  ? 3177 PHE C CE2 1 
ATOM   9438  C CZ  . PHE C  1 159 ? 30.967  -27.617 68.609  1.00 15.30  ? 3177 PHE C CZ  1 
ATOM   9439  N N   . PHE C  1 160 ? 27.491  -31.781 63.485  1.00 16.45  ? 3178 PHE C N   1 
ATOM   9440  C CA  . PHE C  1 160 ? 26.952  -32.965 62.824  1.00 17.68  ? 3178 PHE C CA  1 
ATOM   9441  C C   . PHE C  1 160 ? 28.111  -33.912 62.504  1.00 17.81  ? 3178 PHE C C   1 
ATOM   9442  O O   . PHE C  1 160 ? 29.116  -33.500 61.926  1.00 15.39  ? 3178 PHE C O   1 
ATOM   9443  C CB  . PHE C  1 160 ? 26.217  -32.604 61.525  1.00 18.06  ? 3178 PHE C CB  1 
ATOM   9444  C CG  . PHE C  1 160 ? 25.662  -33.804 60.802  1.00 17.46  ? 3178 PHE C CG  1 
ATOM   9445  C CD1 . PHE C  1 160 ? 26.279  -34.295 59.653  1.00 18.03  ? 3178 PHE C CD1 1 
ATOM   9446  C CD2 . PHE C  1 160 ? 24.563  -34.489 61.315  1.00 18.36  ? 3178 PHE C CD2 1 
ATOM   9447  C CE1 . PHE C  1 160 ? 25.812  -35.453 59.029  1.00 18.76  ? 3178 PHE C CE1 1 
ATOM   9448  C CE2 . PHE C  1 160 ? 24.088  -35.645 60.704  1.00 18.37  ? 3178 PHE C CE2 1 
ATOM   9449  C CZ  . PHE C  1 160 ? 24.717  -36.131 59.554  1.00 18.19  ? 3178 PHE C CZ  1 
ATOM   9450  N N   . SER C  1 161 ? 27.963  -35.178 62.888  1.00 16.59  ? 3179 SER C N   1 
ATOM   9451  C CA  . SER C  1 161 ? 28.994  -36.181 62.657  1.00 17.96  ? 3179 SER C CA  1 
ATOM   9452  C C   . SER C  1 161 ? 28.379  -37.517 62.251  1.00 19.17  ? 3179 SER C C   1 
ATOM   9453  O O   . SER C  1 161 ? 27.399  -37.960 62.844  1.00 19.29  ? 3179 SER C O   1 
ATOM   9454  C CB  . SER C  1 161 ? 29.833  -36.366 63.930  1.00 18.56  ? 3179 SER C CB  1 
ATOM   9455  O OG  . SER C  1 161 ? 30.800  -37.395 63.783  1.00 16.95  ? 3179 SER C OG  1 
ATOM   9456  N N   . THR C  1 162 ? 28.949  -38.144 61.223  1.00 18.82  ? 3180 THR C N   1 
ATOM   9457  C CA  . THR C  1 162 ? 28.479  -39.444 60.749  1.00 18.91  ? 3180 THR C CA  1 
ATOM   9458  C C   . THR C  1 162 ? 29.370  -40.515 61.359  1.00 21.66  ? 3180 THR C C   1 
ATOM   9459  O O   . THR C  1 162 ? 29.162  -41.712 61.146  1.00 22.51  ? 3180 THR C O   1 
ATOM   9460  C CB  . THR C  1 162 ? 28.579  -39.573 59.209  1.00 17.49  ? 3180 THR C CB  1 
ATOM   9461  O OG1 . THR C  1 162 ? 29.863  -39.110 58.783  1.00 16.44  ? 3180 THR C OG1 1 
ATOM   9462  C CG2 . THR C  1 162 ? 27.495  -38.770 58.523  1.00 18.35  ? 3180 THR C CG2 1 
ATOM   9463  N N   . GLY C  1 163 ? 30.369  -40.074 62.112  1.00 22.04  ? 3181 GLY C N   1 
ATOM   9464  C CA  . GLY C  1 163 ? 31.286  -41.005 62.734  1.00 25.30  ? 3181 GLY C CA  1 
ATOM   9465  C C   . GLY C  1 163 ? 32.417  -41.421 61.810  1.00 26.39  ? 3181 GLY C C   1 
ATOM   9466  O O   . GLY C  1 163 ? 33.278  -42.202 62.208  1.00 26.70  ? 3181 GLY C O   1 
ATOM   9467  N N   . ASP C  1 164 ? 32.428  -40.908 60.582  1.00 24.31  ? 3182 ASP C N   1 
ATOM   9468  C CA  . ASP C  1 164 ? 33.481  -41.266 59.640  1.00 25.08  ? 3182 ASP C CA  1 
ATOM   9469  C C   . ASP C  1 164 ? 34.021  -40.082 58.838  1.00 24.70  ? 3182 ASP C C   1 
ATOM   9470  O O   . ASP C  1 164 ? 33.699  -38.921 59.115  1.00 23.41  ? 3182 ASP C O   1 
ATOM   9471  C CB  . ASP C  1 164 ? 32.995  -42.383 58.703  1.00 25.76  ? 3182 ASP C CB  1 
ATOM   9472  C CG  . ASP C  1 164 ? 31.825  -41.963 57.836  1.00 26.15  ? 3182 ASP C CG  1 
ATOM   9473  O OD1 . ASP C  1 164 ? 31.035  -42.851 57.446  1.00 29.63  ? 3182 ASP C OD1 1 
ATOM   9474  O OD2 . ASP C  1 164 ? 31.697  -40.758 57.530  1.00 24.30  ? 3182 ASP C OD2 1 
ATOM   9475  N N   . GLU C  1 165 ? 34.829  -40.382 57.827  1.00 23.22  ? 3183 GLU C N   1 
ATOM   9476  C CA  . GLU C  1 165 ? 35.463  -39.345 57.025  1.00 22.38  ? 3183 GLU C CA  1 
ATOM   9477  C C   . GLU C  1 165 ? 34.566  -38.401 56.211  1.00 21.47  ? 3183 GLU C C   1 
ATOM   9478  O O   . GLU C  1 165 ? 35.013  -37.337 55.782  1.00 20.67  ? 3183 GLU C O   1 
ATOM   9479  C CB  . GLU C  1 165 ? 36.528  -39.979 56.111  1.00 25.08  ? 3183 GLU C CB  1 
ATOM   9480  C CG  . GLU C  1 165 ? 36.020  -40.747 54.891  1.00 22.82  ? 3183 GLU C CG  1 
ATOM   9481  C CD  . GLU C  1 165 ? 35.512  -42.146 55.203  1.00 24.35  ? 3183 GLU C CD  1 
ATOM   9482  O OE1 . GLU C  1 165 ? 35.262  -42.894 54.235  1.00 26.04  ? 3183 GLU C OE1 1 
ATOM   9483  O OE2 . GLU C  1 165 ? 35.352  -42.506 56.391  1.00 23.00  ? 3183 GLU C OE2 1 
ATOM   9484  N N   . HIS C  1 166 ? 33.311  -38.770 55.998  1.00 21.25  ? 3184 HIS C N   1 
ATOM   9485  C CA  . HIS C  1 166 ? 32.417  -37.911 55.231  1.00 22.79  ? 3184 HIS C CA  1 
ATOM   9486  C C   . HIS C  1 166 ? 31.899  -36.709 56.029  1.00 23.31  ? 3184 HIS C C   1 
ATOM   9487  O O   . HIS C  1 166 ? 31.413  -35.729 55.458  1.00 22.44  ? 3184 HIS C O   1 
ATOM   9488  C CB  . HIS C  1 166 ? 31.270  -38.747 54.676  1.00 23.31  ? 3184 HIS C CB  1 
ATOM   9489  C CG  . HIS C  1 166 ? 31.723  -39.790 53.705  1.00 24.96  ? 3184 HIS C CG  1 
ATOM   9490  N ND1 . HIS C  1 166 ? 31.674  -41.142 53.973  1.00 28.12  ? 3184 HIS C ND1 1 
ATOM   9491  C CD2 . HIS C  1 166 ? 32.290  -39.670 52.481  1.00 24.11  ? 3184 HIS C CD2 1 
ATOM   9492  C CE1 . HIS C  1 166 ? 32.193  -41.810 52.956  1.00 26.96  ? 3184 HIS C CE1 1 
ATOM   9493  N NE2 . HIS C  1 166 ? 32.575  -40.940 52.039  1.00 28.41  ? 3184 HIS C NE2 1 
ATOM   9494  N N   . SER C  1 167 ? 32.018  -36.795 57.350  1.00 22.49  ? 3185 SER C N   1 
ATOM   9495  C CA  . SER C  1 167 ? 31.623  -35.718 58.256  1.00 21.05  ? 3185 SER C CA  1 
ATOM   9496  C C   . SER C  1 167 ? 32.147  -36.084 59.636  1.00 19.51  ? 3185 SER C C   1 
ATOM   9497  O O   . SER C  1 167 ? 31.404  -36.565 60.489  1.00 20.35  ? 3185 SER C O   1 
ATOM   9498  C CB  . SER C  1 167 ? 30.103  -35.556 58.301  1.00 22.36  ? 3185 SER C CB  1 
ATOM   9499  O OG  . SER C  1 167 ? 29.739  -34.340 58.941  1.00 24.60  ? 3185 SER C OG  1 
ATOM   9500  N N   . ARG C  1 168 ? 33.441  -35.863 59.836  1.00 18.89  ? 3186 ARG C N   1 
ATOM   9501  C CA  . ARG C  1 168 ? 34.091  -36.182 61.096  1.00 20.85  ? 3186 ARG C CA  1 
ATOM   9502  C C   . ARG C  1 168 ? 33.415  -35.543 62.299  1.00 20.20  ? 3186 ARG C C   1 
ATOM   9503  O O   . ARG C  1 168 ? 33.209  -36.198 63.322  1.00 19.98  ? 3186 ARG C O   1 
ATOM   9504  C CB  . ARG C  1 168 ? 35.560  -35.753 61.056  1.00 22.16  ? 3186 ARG C CB  1 
ATOM   9505  C CG  . ARG C  1 168 ? 36.464  -36.662 60.232  1.00 22.71  ? 3186 ARG C CG  1 
ATOM   9506  C CD  . ARG C  1 168 ? 37.919  -36.397 60.576  1.00 24.37  ? 3186 ARG C CD  1 
ATOM   9507  N NE  . ARG C  1 168 ? 38.818  -37.451 60.110  1.00 27.27  ? 3186 ARG C NE  1 
ATOM   9508  C CZ  . ARG C  1 168 ? 39.158  -37.631 58.840  1.00 28.08  ? 3186 ARG C CZ  1 
ATOM   9509  N NH1 . ARG C  1 168 ? 38.673  -36.824 57.907  1.00 28.02  ? 3186 ARG C NH1 1 
ATOM   9510  N NH2 . ARG C  1 168 ? 39.988  -38.612 58.505  1.00 28.95  ? 3186 ARG C NH2 1 
ATOM   9511  N N   . GLY C  1 169 ? 33.077  -34.262 62.165  1.00 19.75  ? 3187 GLY C N   1 
ATOM   9512  C CA  . GLY C  1 169 ? 32.444  -33.535 63.248  1.00 18.62  ? 3187 GLY C CA  1 
ATOM   9513  C C   . GLY C  1 169 ? 33.372  -32.477 63.818  1.00 18.32  ? 3187 GLY C C   1 
ATOM   9514  O O   . GLY C  1 169 ? 34.407  -32.157 63.229  1.00 16.98  ? 3187 GLY C O   1 
ATOM   9515  N N   . ASN C  1 170 ? 32.988  -31.925 64.965  1.00 17.56  ? 3188 ASN C N   1 
ATOM   9516  C CA  . ASN C  1 170 ? 33.770  -30.901 65.653  1.00 15.63  ? 3188 ASN C CA  1 
ATOM   9517  C C   . ASN C  1 170 ? 34.069  -29.647 64.840  1.00 15.44  ? 3188 ASN C C   1 
ATOM   9518  O O   . ASN C  1 170 ? 35.054  -28.958 65.105  1.00 16.03  ? 3188 ASN C O   1 
ATOM   9519  C CB  . ASN C  1 170 ? 35.087  -31.491 66.162  1.00 17.26  ? 3188 ASN C CB  1 
ATOM   9520  C CG  . ASN C  1 170 ? 34.877  -32.577 67.196  1.00 19.20  ? 3188 ASN C CG  1 
ATOM   9521  O OD1 . ASN C  1 170 ? 33.898  -32.557 67.942  1.00 20.63  ? 3188 ASN C OD1 1 
ATOM   9522  N ND2 . ASN C  1 170 ? 35.806  -33.526 67.257  1.00 20.07  ? 3188 ASN C ND2 1 
ATOM   9523  N N   . TRP C  1 171 ? 33.222  -29.348 63.861  1.00 13.19  ? 3189 TRP C N   1 
ATOM   9524  C CA  . TRP C  1 171 ? 33.405  -28.162 63.029  1.00 14.75  ? 3189 TRP C CA  1 
ATOM   9525  C C   . TRP C  1 171 ? 33.507  -26.910 63.904  1.00 15.08  ? 3189 TRP C C   1 
ATOM   9526  O O   . TRP C  1 171 ? 34.295  -26.008 63.624  1.00 13.47  ? 3189 TRP C O   1 
ATOM   9527  C CB  . TRP C  1 171 ? 32.228  -28.018 62.061  1.00 14.46  ? 3189 TRP C CB  1 
ATOM   9528  C CG  . TRP C  1 171 ? 31.910  -29.298 61.363  1.00 16.56  ? 3189 TRP C CG  1 
ATOM   9529  C CD1 . TRP C  1 171 ? 30.719  -29.963 61.373  1.00 19.04  ? 3189 TRP C CD1 1 
ATOM   9530  C CD2 . TRP C  1 171 ? 32.826  -30.127 60.633  1.00 15.58  ? 3189 TRP C CD2 1 
ATOM   9531  N NE1 . TRP C  1 171 ? 30.837  -31.162 60.706  1.00 17.57  ? 3189 TRP C NE1 1 
ATOM   9532  C CE2 . TRP C  1 171 ? 32.120  -31.287 60.242  1.00 17.24  ? 3189 TRP C CE2 1 
ATOM   9533  C CE3 . TRP C  1 171 ? 34.175  -30.003 60.277  1.00 16.14  ? 3189 TRP C CE3 1 
ATOM   9534  C CZ2 . TRP C  1 171 ? 32.722  -32.325 59.510  1.00 16.03  ? 3189 TRP C CZ2 1 
ATOM   9535  C CZ3 . TRP C  1 171 ? 34.776  -31.035 59.549  1.00 14.50  ? 3189 TRP C CZ3 1 
ATOM   9536  C CH2 . TRP C  1 171 ? 34.044  -32.182 59.176  1.00 15.47  ? 3189 TRP C CH2 1 
ATOM   9537  N N   . GLY C  1 172 ? 32.702  -26.862 64.963  1.00 15.93  ? 3190 GLY C N   1 
ATOM   9538  C CA  . GLY C  1 172 ? 32.724  -25.712 65.855  1.00 15.71  ? 3190 GLY C CA  1 
ATOM   9539  C C   . GLY C  1 172 ? 34.054  -25.548 66.565  1.00 13.45  ? 3190 GLY C C   1 
ATOM   9540  O O   . GLY C  1 172 ? 34.513  -24.432 66.785  1.00 16.82  ? 3190 GLY C O   1 
ATOM   9541  N N   . HIS C  1 173 ? 34.681  -26.657 66.934  1.00 16.73  ? 3191 HIS C N   1 
ATOM   9542  C CA  . HIS C  1 173 ? 35.976  -26.589 67.604  1.00 15.46  ? 3191 HIS C CA  1 
ATOM   9543  C C   . HIS C  1 173 ? 37.046  -26.188 66.595  1.00 17.23  ? 3191 HIS C C   1 
ATOM   9544  O O   . HIS C  1 173 ? 37.988  -25.468 66.924  1.00 16.62  ? 3191 HIS C O   1 
ATOM   9545  C CB  . HIS C  1 173 ? 36.323  -27.934 68.240  1.00 19.55  ? 3191 HIS C CB  1 
ATOM   9546  C CG  . HIS C  1 173 ? 35.464  -28.286 69.415  1.00 19.71  ? 3191 HIS C CG  1 
ATOM   9547  N ND1 . HIS C  1 173 ? 35.242  -27.416 70.462  1.00 21.33  ? 3191 HIS C ND1 1 
ATOM   9548  C CD2 . HIS C  1 173 ? 34.794  -29.422 69.723  1.00 21.17  ? 3191 HIS C CD2 1 
ATOM   9549  C CE1 . HIS C  1 173 ? 34.473  -28.001 71.362  1.00 20.13  ? 3191 HIS C CE1 1 
ATOM   9550  N NE2 . HIS C  1 173 ? 34.188  -29.219 70.938  1.00 20.62  ? 3191 HIS C NE2 1 
ATOM   9551  N N   . LEU C  1 174 ? 36.908  -26.655 65.357  1.00 16.15  ? 3192 LEU C N   1 
ATOM   9552  C CA  . LEU C  1 174 ? 37.875  -26.281 64.332  1.00 15.72  ? 3192 LEU C CA  1 
ATOM   9553  C C   . LEU C  1 174 ? 37.804  -24.761 64.134  1.00 14.54  ? 3192 LEU C C   1 
ATOM   9554  O O   . LEU C  1 174 ? 38.823  -24.111 63.890  1.00 15.61  ? 3192 LEU C O   1 
ATOM   9555  C CB  . LEU C  1 174 ? 37.580  -27.031 63.023  1.00 15.38  ? 3192 LEU C CB  1 
ATOM   9556  C CG  . LEU C  1 174 ? 37.791  -28.552 63.132  1.00 17.20  ? 3192 LEU C CG  1 
ATOM   9557  C CD1 . LEU C  1 174 ? 37.415  -29.255 61.826  1.00 18.89  ? 3192 LEU C CD1 1 
ATOM   9558  C CD2 . LEU C  1 174 ? 39.243  -28.827 63.469  1.00 19.04  ? 3192 LEU C CD2 1 
ATOM   9559  N N   . ASP C  1 175 ? 36.606  -24.193 64.263  1.00 13.60  ? 3193 ASP C N   1 
ATOM   9560  C CA  . ASP C  1 175 ? 36.431  -22.745 64.119  1.00 14.14  ? 3193 ASP C CA  1 
ATOM   9561  C C   . ASP C  1 175 ? 37.149  -22.021 65.255  1.00 15.60  ? 3193 ASP C C   1 
ATOM   9562  O O   . ASP C  1 175 ? 37.752  -20.967 65.053  1.00 15.51  ? 3193 ASP C O   1 
ATOM   9563  C CB  . ASP C  1 175 ? 34.947  -22.354 64.159  1.00 16.71  ? 3193 ASP C CB  1 
ATOM   9564  C CG  . ASP C  1 175 ? 34.157  -22.911 62.989  1.00 18.44  ? 3193 ASP C CG  1 
ATOM   9565  O OD1 . ASP C  1 175 ? 34.764  -23.139 61.922  1.00 18.90  ? 3193 ASP C OD1 1 
ATOM   9566  O OD2 . ASP C  1 175 ? 32.927  -23.106 63.135  1.00 16.47  ? 3193 ASP C OD2 1 
ATOM   9567  N N   . GLN C  1 176 ? 37.065  -22.582 66.458  1.00 15.26  ? 3194 GLN C N   1 
ATOM   9568  C CA  . GLN C  1 176 ? 37.724  -21.984 67.613  1.00 17.28  ? 3194 GLN C CA  1 
ATOM   9569  C C   . GLN C  1 176 ? 39.233  -21.979 67.360  1.00 18.12  ? 3194 GLN C C   1 
ATOM   9570  O O   . GLN C  1 176 ? 39.923  -21.004 67.665  1.00 16.72  ? 3194 GLN C O   1 
ATOM   9571  C CB  . GLN C  1 176 ? 37.368  -22.778 68.874  1.00 19.04  ? 3194 GLN C CB  1 
ATOM   9572  C CG  . GLN C  1 176 ? 35.852  -22.884 69.069  1.00 19.51  ? 3194 GLN C CG  1 
ATOM   9573  C CD  . GLN C  1 176 ? 35.442  -23.785 70.218  1.00 19.71  ? 3194 GLN C CD  1 
ATOM   9574  O OE1 . GLN C  1 176 ? 36.136  -24.744 70.552  1.00 20.44  ? 3194 GLN C OE1 1 
ATOM   9575  N NE2 . GLN C  1 176 ? 34.290  -23.496 70.811  1.00 16.84  ? 3194 GLN C NE2 1 
ATOM   9576  N N   . VAL C  1 177 ? 39.741  -23.068 66.786  1.00 19.55  ? 3195 VAL C N   1 
ATOM   9577  C CA  . VAL C  1 177 ? 41.163  -23.154 66.462  1.00 18.04  ? 3195 VAL C CA  1 
ATOM   9578  C C   . VAL C  1 177 ? 41.500  -22.089 65.409  1.00 17.37  ? 3195 VAL C C   1 
ATOM   9579  O O   . VAL C  1 177 ? 42.502  -21.383 65.525  1.00 18.60  ? 3195 VAL C O   1 
ATOM   9580  C CB  . VAL C  1 177 ? 41.521  -24.554 65.921  1.00 17.37  ? 3195 VAL C CB  1 
ATOM   9581  C CG1 . VAL C  1 177 ? 42.921  -24.551 65.313  1.00 19.45  ? 3195 VAL C CG1 1 
ATOM   9582  C CG2 . VAL C  1 177 ? 41.448  -25.568 67.046  1.00 18.26  ? 3195 VAL C CG2 1 
ATOM   9583  N N   . ALA C  1 178 ? 40.651  -21.972 64.391  1.00 17.00  ? 3196 ALA C N   1 
ATOM   9584  C CA  . ALA C  1 178 ? 40.860  -20.990 63.329  1.00 17.16  ? 3196 ALA C CA  1 
ATOM   9585  C C   . ALA C  1 178 ? 40.879  -19.558 63.873  1.00 18.16  ? 3196 ALA C C   1 
ATOM   9586  O O   . ALA C  1 178 ? 41.646  -18.715 63.405  1.00 17.27  ? 3196 ALA C O   1 
ATOM   9587  C CB  . ALA C  1 178 ? 39.774  -21.130 62.260  1.00 15.28  ? 3196 ALA C CB  1 
ATOM   9588  N N   . ALA C  1 179 ? 40.034  -19.279 64.861  1.00 17.84  ? 3197 ALA C N   1 
ATOM   9589  C CA  . ALA C  1 179 ? 39.995  -17.943 65.441  1.00 17.39  ? 3197 ALA C CA  1 
ATOM   9590  C C   . ALA C  1 179 ? 41.297  -17.676 66.191  1.00 16.94  ? 3197 ALA C C   1 
ATOM   9591  O O   . ALA C  1 179 ? 41.803  -16.555 66.182  1.00 18.23  ? 3197 ALA C O   1 
ATOM   9592  C CB  . ALA C  1 179 ? 38.801  -17.808 66.386  1.00 18.14  ? 3197 ALA C CB  1 
ATOM   9593  N N   . LEU C  1 180 ? 41.842  -18.706 66.832  1.00 16.53  ? 3198 LEU C N   1 
ATOM   9594  C CA  . LEU C  1 180 ? 43.089  -18.551 67.573  1.00 19.76  ? 3198 LEU C CA  1 
ATOM   9595  C C   . LEU C  1 180 ? 44.263  -18.351 66.623  1.00 20.90  ? 3198 LEU C C   1 
ATOM   9596  O O   . LEU C  1 180 ? 45.208  -17.625 66.940  1.00 22.78  ? 3198 LEU C O   1 
ATOM   9597  C CB  . LEU C  1 180 ? 43.341  -19.762 68.475  1.00 19.61  ? 3198 LEU C CB  1 
ATOM   9598  C CG  . LEU C  1 180 ? 42.378  -19.888 69.663  1.00 21.81  ? 3198 LEU C CG  1 
ATOM   9599  C CD1 . LEU C  1 180 ? 42.730  -21.123 70.479  1.00 20.72  ? 3198 LEU C CD1 1 
ATOM   9600  C CD2 . LEU C  1 180 ? 42.452  -18.639 70.527  1.00 17.75  ? 3198 LEU C CD2 1 
ATOM   9601  N N   . ARG C  1 181 ? 44.211  -18.997 65.461  1.00 20.15  ? 3199 ARG C N   1 
ATOM   9602  C CA  . ARG C  1 181 ? 45.276  -18.829 64.476  1.00 21.16  ? 3199 ARG C CA  1 
ATOM   9603  C C   . ARG C  1 181 ? 45.226  -17.390 63.986  1.00 19.04  ? 3199 ARG C C   1 
ATOM   9604  O O   . ARG C  1 181 ? 46.261  -16.749 63.809  1.00 20.31  ? 3199 ARG C O   1 
ATOM   9605  C CB  . ARG C  1 181 ? 45.103  -19.793 63.288  1.00 23.26  ? 3199 ARG C CB  1 
ATOM   9606  C CG  . ARG C  1 181 ? 45.397  -21.250 63.622  1.00 28.47  ? 3199 ARG C CG  1 
ATOM   9607  C CD  . ARG C  1 181 ? 45.659  -22.117 62.376  1.00 34.26  ? 3199 ARG C CD  1 
ATOM   9608  N NE  . ARG C  1 181 ? 44.542  -23.004 62.041  1.00 38.86  ? 3199 ARG C NE  1 
ATOM   9609  C CZ  . ARG C  1 181 ? 43.486  -22.652 61.310  1.00 40.44  ? 3199 ARG C CZ  1 
ATOM   9610  N NH1 . ARG C  1 181 ? 43.385  -21.422 60.819  1.00 43.36  ? 3199 ARG C NH1 1 
ATOM   9611  N NH2 . ARG C  1 181 ? 42.523  -23.531 61.070  1.00 41.72  ? 3199 ARG C NH2 1 
ATOM   9612  N N   . TRP C  1 182 ? 44.014  -16.883 63.765  1.00 18.29  ? 3200 TRP C N   1 
ATOM   9613  C CA  . TRP C  1 182 ? 43.844  -15.512 63.305  1.00 18.06  ? 3200 TRP C CA  1 
ATOM   9614  C C   . TRP C  1 182 ? 44.434  -14.549 64.337  1.00 19.75  ? 3200 TRP C C   1 
ATOM   9615  O O   . TRP C  1 182 ? 45.112  -13.580 63.988  1.00 19.55  ? 3200 TRP C O   1 
ATOM   9616  C CB  . TRP C  1 182 ? 42.362  -15.196 63.098  1.00 18.57  ? 3200 TRP C CB  1 
ATOM   9617  C CG  . TRP C  1 182 ? 42.121  -13.844 62.500  1.00 17.83  ? 3200 TRP C CG  1 
ATOM   9618  C CD1 . TRP C  1 182 ? 41.955  -13.546 61.173  1.00 18.71  ? 3200 TRP C CD1 1 
ATOM   9619  C CD2 . TRP C  1 182 ? 42.054  -12.597 63.202  1.00 18.81  ? 3200 TRP C CD2 1 
ATOM   9620  N NE1 . TRP C  1 182 ? 41.789  -12.191 61.009  1.00 19.29  ? 3200 TRP C NE1 1 
ATOM   9621  C CE2 . TRP C  1 182 ? 41.847  -11.584 62.238  1.00 18.87  ? 3200 TRP C CE2 1 
ATOM   9622  C CE3 . TRP C  1 182 ? 42.151  -12.237 64.554  1.00 19.45  ? 3200 TRP C CE3 1 
ATOM   9623  C CZ2 . TRP C  1 182 ? 41.733  -10.232 62.582  1.00 20.37  ? 3200 TRP C CZ2 1 
ATOM   9624  C CZ3 . TRP C  1 182 ? 42.040  -10.889 64.896  1.00 19.47  ? 3200 TRP C CZ3 1 
ATOM   9625  C CH2 . TRP C  1 182 ? 41.832  -9.905  63.911  1.00 19.53  ? 3200 TRP C CH2 1 
ATOM   9626  N N   . VAL C  1 183 ? 44.176  -14.822 65.612  1.00 18.64  ? 3201 VAL C N   1 
ATOM   9627  C CA  . VAL C  1 183 ? 44.692  -13.980 66.684  1.00 19.53  ? 3201 VAL C CA  1 
ATOM   9628  C C   . VAL C  1 183 ? 46.216  -13.952 66.653  1.00 20.60  ? 3201 VAL C C   1 
ATOM   9629  O O   . VAL C  1 183 ? 46.833  -12.888 66.761  1.00 20.94  ? 3201 VAL C O   1 
ATOM   9630  C CB  . VAL C  1 183 ? 44.210  -14.486 68.068  1.00 17.81  ? 3201 VAL C CB  1 
ATOM   9631  C CG1 . VAL C  1 183 ? 44.990  -13.792 69.193  1.00 16.24  ? 3201 VAL C CG1 1 
ATOM   9632  C CG2 . VAL C  1 183 ? 42.727  -14.216 68.214  1.00 17.17  ? 3201 VAL C CG2 1 
ATOM   9633  N N   . GLN C  1 184 ? 46.827  -15.120 66.490  1.00 23.35  ? 3202 GLN C N   1 
ATOM   9634  C CA  . GLN C  1 184 ? 48.279  -15.180 66.444  1.00 26.12  ? 3202 GLN C CA  1 
ATOM   9635  C C   . GLN C  1 184 ? 48.836  -14.344 65.287  1.00 25.97  ? 3202 GLN C C   1 
ATOM   9636  O O   . GLN C  1 184 ? 49.837  -13.645 65.443  1.00 25.92  ? 3202 GLN C O   1 
ATOM   9637  C CB  . GLN C  1 184 ? 48.749  -16.627 66.312  1.00 28.59  ? 3202 GLN C CB  1 
ATOM   9638  C CG  . GLN C  1 184 ? 50.195  -16.816 66.726  1.00 37.12  ? 3202 GLN C CG  1 
ATOM   9639  C CD  . GLN C  1 184 ? 50.617  -18.269 66.732  1.00 41.09  ? 3202 GLN C CD  1 
ATOM   9640  O OE1 . GLN C  1 184 ? 50.766  -18.891 65.677  1.00 43.59  ? 3202 GLN C OE1 1 
ATOM   9641  N NE2 . GLN C  1 184 ? 50.806  -18.823 67.924  1.00 42.03  ? 3202 GLN C NE2 1 
ATOM   9642  N N   . ASP C  1 185 ? 48.173  -14.396 64.136  1.00 25.78  ? 3203 ASP C N   1 
ATOM   9643  C CA  . ASP C  1 185 ? 48.634  -13.652 62.966  1.00 26.63  ? 3203 ASP C CA  1 
ATOM   9644  C C   . ASP C  1 185 ? 48.256  -12.172 62.903  1.00 25.22  ? 3203 ASP C C   1 
ATOM   9645  O O   . ASP C  1 185 ? 48.888  -11.409 62.171  1.00 24.55  ? 3203 ASP C O   1 
ATOM   9646  C CB  . ASP C  1 185 ? 48.122  -14.308 61.675  1.00 29.32  ? 3203 ASP C CB  1 
ATOM   9647  C CG  . ASP C  1 185 ? 48.499  -15.772 61.564  1.00 33.85  ? 3203 ASP C CG  1 
ATOM   9648  O OD1 . ASP C  1 185 ? 49.589  -16.149 62.043  1.00 36.01  ? 3203 ASP C OD1 1 
ATOM   9649  O OD2 . ASP C  1 185 ? 47.708  -16.544 60.976  1.00 36.87  ? 3203 ASP C OD2 1 
ATOM   9650  N N   . ASN C  1 186 ? 47.251  -11.752 63.670  1.00 23.16  ? 3204 ASN C N   1 
ATOM   9651  C CA  . ASN C  1 186 ? 46.786  -10.365 63.588  1.00 21.24  ? 3204 ASN C CA  1 
ATOM   9652  C C   . ASN C  1 186 ? 46.705  -9.518  64.853  1.00 20.54  ? 3204 ASN C C   1 
ATOM   9653  O O   . ASN C  1 186 ? 46.748  -8.294  64.774  1.00 21.17  ? 3204 ASN C O   1 
ATOM   9654  C CB  . ASN C  1 186 ? 45.399  -10.346 62.946  1.00 20.91  ? 3204 ASN C CB  1 
ATOM   9655  C CG  . ASN C  1 186 ? 45.402  -10.873 61.531  1.00 20.47  ? 3204 ASN C CG  1 
ATOM   9656  O OD1 . ASN C  1 186 ? 45.654  -10.129 60.586  1.00 25.08  ? 3204 ASN C OD1 1 
ATOM   9657  N ND2 . ASN C  1 186 ? 45.126  -12.164 61.376  1.00 18.99  ? 3204 ASN C ND2 1 
ATOM   9658  N N   . ILE C  1 187 ? 46.584  -10.151 66.010  1.00 21.68  ? 3205 ILE C N   1 
ATOM   9659  C CA  . ILE C  1 187 ? 46.416  -9.398  67.247  1.00 22.52  ? 3205 ILE C CA  1 
ATOM   9660  C C   . ILE C  1 187 ? 47.463  -8.320  67.542  1.00 23.95  ? 3205 ILE C C   1 
ATOM   9661  O O   . ILE C  1 187 ? 47.156  -7.316  68.191  1.00 23.92  ? 3205 ILE C O   1 
ATOM   9662  C CB  . ILE C  1 187 ? 46.293  -10.356 68.457  1.00 22.11  ? 3205 ILE C CB  1 
ATOM   9663  C CG1 . ILE C  1 187 ? 45.496  -9.669  69.568  1.00 22.96  ? 3205 ILE C CG1 1 
ATOM   9664  C CG2 . ILE C  1 187 ? 47.670  -10.791 68.933  1.00 22.03  ? 3205 ILE C CG2 1 
ATOM   9665  C CD1 . ILE C  1 187 ? 44.073  -9.297  69.149  1.00 20.00  ? 3205 ILE C CD1 1 
ATOM   9666  N N   . ALA C  1 188 ? 48.689  -8.507  67.066  1.00 25.02  ? 3206 ALA C N   1 
ATOM   9667  C CA  . ALA C  1 188 ? 49.732  -7.514  67.311  1.00 25.68  ? 3206 ALA C CA  1 
ATOM   9668  C C   . ALA C  1 188 ? 49.317  -6.147  66.773  1.00 24.46  ? 3206 ALA C C   1 
ATOM   9669  O O   . ALA C  1 188 ? 49.656  -5.118  67.352  1.00 23.62  ? 3206 ALA C O   1 
ATOM   9670  C CB  . ALA C  1 188 ? 51.051  -7.957  66.672  1.00 26.93  ? 3206 ALA C CB  1 
ATOM   9671  N N   . SER C  1 189 ? 48.572  -6.135  65.672  1.00 24.72  ? 3207 SER C N   1 
ATOM   9672  C CA  . SER C  1 189 ? 48.123  -4.880  65.079  1.00 25.87  ? 3207 SER C CA  1 
ATOM   9673  C C   . SER C  1 189 ? 47.115  -4.156  65.967  1.00 25.94  ? 3207 SER C C   1 
ATOM   9674  O O   . SER C  1 189 ? 46.847  -2.971  65.771  1.00 27.08  ? 3207 SER C O   1 
ATOM   9675  C CB  . SER C  1 189 ? 47.500  -5.133  63.701  1.00 28.11  ? 3207 SER C CB  1 
ATOM   9676  O OG  . SER C  1 189 ? 48.447  -5.701  62.810  1.00 30.18  ? 3207 SER C OG  1 
ATOM   9677  N N   . PHE C  1 190 ? 46.556  -4.868  66.940  1.00 26.12  ? 3208 PHE C N   1 
ATOM   9678  C CA  . PHE C  1 190 ? 45.587  -4.274  67.852  1.00 25.17  ? 3208 PHE C CA  1 
ATOM   9679  C C   . PHE C  1 190 ? 46.210  -4.059  69.229  1.00 26.18  ? 3208 PHE C C   1 
ATOM   9680  O O   . PHE C  1 190 ? 45.505  -3.963  70.229  1.00 27.08  ? 3208 PHE C O   1 
ATOM   9681  C CB  . PHE C  1 190 ? 44.343  -5.167  67.976  1.00 26.15  ? 3208 PHE C CB  1 
ATOM   9682  C CG  . PHE C  1 190 ? 43.592  -5.345  66.684  1.00 23.34  ? 3208 PHE C CG  1 
ATOM   9683  C CD1 . PHE C  1 190 ? 43.967  -6.325  65.774  1.00 22.20  ? 3208 PHE C CD1 1 
ATOM   9684  C CD2 . PHE C  1 190 ? 42.531  -4.507  66.366  1.00 21.95  ? 3208 PHE C CD2 1 
ATOM   9685  C CE1 . PHE C  1 190 ? 43.295  -6.470  64.557  1.00 21.98  ? 3208 PHE C CE1 1 
ATOM   9686  C CE2 . PHE C  1 190 ? 41.852  -4.641  65.158  1.00 21.47  ? 3208 PHE C CE2 1 
ATOM   9687  C CZ  . PHE C  1 190 ? 42.238  -5.627  64.250  1.00 21.16  ? 3208 PHE C CZ  1 
ATOM   9688  N N   . GLY C  1 191 ? 47.536  -3.997  69.273  1.00 26.29  ? 3209 GLY C N   1 
ATOM   9689  C CA  . GLY C  1 191 ? 48.226  -3.779  70.532  1.00 25.43  ? 3209 GLY C CA  1 
ATOM   9690  C C   . GLY C  1 191 ? 48.342  -5.001  71.417  1.00 24.74  ? 3209 GLY C C   1 
ATOM   9691  O O   . GLY C  1 191 ? 48.717  -4.890  72.583  1.00 24.58  ? 3209 GLY C O   1 
ATOM   9692  N N   . GLY C  1 192 ? 48.024  -6.172  70.873  1.00 24.71  ? 3210 GLY C N   1 
ATOM   9693  C CA  . GLY C  1 192 ? 48.111  -7.389  71.658  1.00 23.02  ? 3210 GLY C CA  1 
ATOM   9694  C C   . GLY C  1 192 ? 49.398  -8.160  71.432  1.00 24.75  ? 3210 GLY C C   1 
ATOM   9695  O O   . GLY C  1 192 ? 50.074  -7.968  70.423  1.00 26.24  ? 3210 GLY C O   1 
ATOM   9696  N N   . ASN C  1 193 ? 49.735  -9.035  72.374  1.00 24.14  ? 3211 ASN C N   1 
ATOM   9697  C CA  . ASN C  1 193 ? 50.938  -9.854  72.288  1.00 25.35  ? 3211 ASN C CA  1 
ATOM   9698  C C   . ASN C  1 193 ? 50.588  -11.294 71.911  1.00 25.50  ? 3211 ASN C C   1 
ATOM   9699  O O   . ASN C  1 193 ? 50.121  -12.065 72.748  1.00 26.57  ? 3211 ASN C O   1 
ATOM   9700  C CB  . ASN C  1 193 ? 51.679  -9.838  73.630  1.00 26.29  ? 3211 ASN C CB  1 
ATOM   9701  C CG  . ASN C  1 193 ? 52.890  -10.762 73.645  1.00 27.40  ? 3211 ASN C CG  1 
ATOM   9702  O OD1 . ASN C  1 193 ? 53.366  -11.198 72.599  1.00 29.72  ? 3211 ASN C OD1 1 
ATOM   9703  N ND2 . ASN C  1 193 ? 53.400  -11.054 74.837  1.00 25.69  ? 3211 ASN C ND2 1 
ATOM   9704  N N   . PRO C  1 194 ? 50.816  -11.677 70.642  1.00 25.05  ? 3212 PRO C N   1 
ATOM   9705  C CA  . PRO C  1 194 ? 50.510  -13.040 70.194  1.00 24.85  ? 3212 PRO C CA  1 
ATOM   9706  C C   . PRO C  1 194 ? 51.281  -14.095 70.978  1.00 24.69  ? 3212 PRO C C   1 
ATOM   9707  O O   . PRO C  1 194 ? 50.998  -15.285 70.876  1.00 24.62  ? 3212 PRO C O   1 
ATOM   9708  C CB  . PRO C  1 194 ? 50.877  -13.011 68.706  1.00 26.62  ? 3212 PRO C CB  1 
ATOM   9709  C CG  . PRO C  1 194 ? 51.954  -11.971 68.638  1.00 27.59  ? 3212 PRO C CG  1 
ATOM   9710  C CD  . PRO C  1 194 ? 51.425  -10.891 69.554  1.00 26.53  ? 3212 PRO C CD  1 
ATOM   9711  N N   . GLY C  1 195 ? 52.250  -13.648 71.771  1.00 24.93  ? 3213 GLY C N   1 
ATOM   9712  C CA  . GLY C  1 195 ? 53.036  -14.565 72.576  1.00 25.69  ? 3213 GLY C CA  1 
ATOM   9713  C C   . GLY C  1 195 ? 52.444  -14.762 73.965  1.00 27.12  ? 3213 GLY C C   1 
ATOM   9714  O O   . GLY C  1 195 ? 53.016  -15.466 74.803  1.00 28.49  ? 3213 GLY C O   1 
ATOM   9715  N N   . SER C  1 196 ? 51.296  -14.139 74.218  1.00 26.95  ? 3214 SER C N   1 
ATOM   9716  C CA  . SER C  1 196 ? 50.637  -14.264 75.518  1.00 25.54  ? 3214 SER C CA  1 
ATOM   9717  C C   . SER C  1 196 ? 49.123  -14.277 75.343  1.00 24.57  ? 3214 SER C C   1 
ATOM   9718  O O   . SER C  1 196 ? 48.448  -13.270 75.570  1.00 23.31  ? 3214 SER C O   1 
ATOM   9719  C CB  . SER C  1 196 ? 51.039  -13.105 76.428  1.00 26.14  ? 3214 SER C CB  1 
ATOM   9720  O OG  . SER C  1 196 ? 50.539  -13.310 77.736  1.00 28.46  ? 3214 SER C OG  1 
ATOM   9721  N N   . VAL C  1 197 ? 48.596  -15.429 74.943  1.00 22.50  ? 3215 VAL C N   1 
ATOM   9722  C CA  . VAL C  1 197 ? 47.165  -15.573 74.712  1.00 21.18  ? 3215 VAL C CA  1 
ATOM   9723  C C   . VAL C  1 197 ? 46.509  -16.504 75.726  1.00 20.48  ? 3215 VAL C C   1 
ATOM   9724  O O   . VAL C  1 197 ? 46.924  -17.650 75.895  1.00 19.69  ? 3215 VAL C O   1 
ATOM   9725  C CB  . VAL C  1 197 ? 46.891  -16.120 73.293  1.00 21.34  ? 3215 VAL C CB  1 
ATOM   9726  C CG1 . VAL C  1 197 ? 45.395  -16.367 73.104  1.00 20.33  ? 3215 VAL C CG1 1 
ATOM   9727  C CG2 . VAL C  1 197 ? 47.414  -15.143 72.253  1.00 19.20  ? 3215 VAL C CG2 1 
ATOM   9728  N N   . THR C  1 198 ? 45.484  -15.997 76.404  1.00 19.84  ? 3216 THR C N   1 
ATOM   9729  C CA  . THR C  1 198 ? 44.754  -16.788 77.388  1.00 18.53  ? 3216 THR C CA  1 
ATOM   9730  C C   . THR C  1 198 ? 43.381  -17.123 76.837  1.00 16.06  ? 3216 THR C C   1 
ATOM   9731  O O   . THR C  1 198 ? 42.644  -16.230 76.422  1.00 18.36  ? 3216 THR C O   1 
ATOM   9732  C CB  . THR C  1 198 ? 44.539  -16.012 78.712  1.00 19.40  ? 3216 THR C CB  1 
ATOM   9733  O OG1 . THR C  1 198 ? 45.804  -15.753 79.332  1.00 20.52  ? 3216 THR C OG1 1 
ATOM   9734  C CG2 . THR C  1 198 ? 43.659  -16.822 79.666  1.00 20.07  ? 3216 THR C CG2 1 
ATOM   9735  N N   . ILE C  1 199 ? 43.034  -18.402 76.799  1.00 15.59  ? 3217 ILE C N   1 
ATOM   9736  C CA  . ILE C  1 199 ? 41.704  -18.749 76.335  1.00 15.85  ? 3217 ILE C CA  1 
ATOM   9737  C C   . ILE C  1 199 ? 40.858  -19.021 77.571  1.00 17.26  ? 3217 ILE C C   1 
ATOM   9738  O O   . ILE C  1 199 ? 41.310  -19.672 78.515  1.00 17.00  ? 3217 ILE C O   1 
ATOM   9739  C CB  . ILE C  1 199 ? 41.680  -20.006 75.424  1.00 18.20  ? 3217 ILE C CB  1 
ATOM   9740  C CG1 . ILE C  1 199 ? 42.390  -21.177 76.098  1.00 17.59  ? 3217 ILE C CG1 1 
ATOM   9741  C CG2 . ILE C  1 199 ? 42.299  -19.678 74.066  1.00 19.80  ? 3217 ILE C CG2 1 
ATOM   9742  C CD1 . ILE C  1 199 ? 42.254  -22.487 75.326  1.00 18.18  ? 3217 ILE C CD1 1 
ATOM   9743  N N   . PHE C  1 200 ? 39.641  -18.492 77.581  1.00 18.40  ? 3218 PHE C N   1 
ATOM   9744  C CA  . PHE C  1 200 ? 38.750  -18.728 78.704  1.00 18.61  ? 3218 PHE C CA  1 
ATOM   9745  C C   . PHE C  1 200 ? 37.310  -18.778 78.230  1.00 17.64  ? 3218 PHE C C   1 
ATOM   9746  O O   . PHE C  1 200 ? 36.958  -18.206 77.198  1.00 17.68  ? 3218 PHE C O   1 
ATOM   9747  C CB  . PHE C  1 200 ? 38.966  -17.679 79.824  1.00 17.15  ? 3218 PHE C CB  1 
ATOM   9748  C CG  . PHE C  1 200 ? 38.505  -16.275 79.491  1.00 18.60  ? 3218 PHE C CG  1 
ATOM   9749  C CD1 . PHE C  1 200 ? 38.873  -15.653 78.301  1.00 17.93  ? 3218 PHE C CD1 1 
ATOM   9750  C CD2 . PHE C  1 200 ? 37.762  -15.545 80.425  1.00 17.91  ? 3218 PHE C CD2 1 
ATOM   9751  C CE1 . PHE C  1 200 ? 38.517  -14.328 78.046  1.00 18.15  ? 3218 PHE C CE1 1 
ATOM   9752  C CE2 . PHE C  1 200 ? 37.399  -14.218 80.184  1.00 17.09  ? 3218 PHE C CE2 1 
ATOM   9753  C CZ  . PHE C  1 200 ? 37.779  -13.605 78.990  1.00 18.75  ? 3218 PHE C CZ  1 
ATOM   9754  N N   . GLY C  1 201 ? 36.493  -19.525 78.961  1.00 17.50  ? 3219 GLY C N   1 
ATOM   9755  C CA  . GLY C  1 201 ? 35.096  -19.650 78.604  1.00 17.56  ? 3219 GLY C CA  1 
ATOM   9756  C C   . GLY C  1 201 ? 34.352  -20.383 79.695  1.00 18.54  ? 3219 GLY C C   1 
ATOM   9757  O O   . GLY C  1 201 ? 34.971  -20.970 80.592  1.00 16.75  ? 3219 GLY C O   1 
ATOM   9758  N N   . GLU C  1 202 ? 33.026  -20.352 79.641  1.00 19.35  ? 3220 GLU C N   1 
ATOM   9759  C CA  . GLU C  1 202 ? 32.260  -21.049 80.660  1.00 19.95  ? 3220 GLU C CA  1 
ATOM   9760  C C   . GLU C  1 202 ? 31.228  -21.987 80.056  1.00 19.82  ? 3220 GLU C C   1 
ATOM   9761  O O   . GLU C  1 202 ? 30.746  -21.771 78.936  1.00 20.74  ? 3220 GLU C O   1 
ATOM   9762  C CB  . GLU C  1 202 ? 31.615  -20.044 81.637  1.00 22.45  ? 3220 GLU C CB  1 
ATOM   9763  C CG  . GLU C  1 202 ? 30.380  -19.330 81.160  1.00 26.25  ? 3220 GLU C CG  1 
ATOM   9764  C CD  . GLU C  1 202 ? 29.112  -20.158 81.317  1.00 27.43  ? 3220 GLU C CD  1 
ATOM   9765  O OE1 . GLU C  1 202 ? 28.796  -20.596 82.449  1.00 26.63  ? 3220 GLU C OE1 1 
ATOM   9766  O OE2 . GLU C  1 202 ? 28.423  -20.362 80.301  1.00 28.23  ? 3220 GLU C OE2 1 
ATOM   9767  N N   . SER C  1 203 ? 30.925  -23.047 80.801  1.00 19.68  ? 3221 SER C N   1 
ATOM   9768  C CA  . SER C  1 203 ? 29.970  -24.072 80.394  1.00 18.17  ? 3221 SER C CA  1 
ATOM   9769  C C   . SER C  1 203 ? 30.510  -24.738 79.116  1.00 18.31  ? 3221 SER C C   1 
ATOM   9770  O O   . SER C  1 203 ? 31.613  -25.277 79.136  1.00 18.99  ? 3221 SER C O   1 
ATOM   9771  C CB  . SER C  1 203 ? 28.590  -23.435 80.180  1.00 16.92  ? 3221 SER C CB  1 
ATOM   9772  O OG  . SER C  1 203 ? 27.553  -24.393 80.347  1.00 18.79  ? 3221 SER C OG  1 
ATOM   9773  N N   . ALA C  1 204 ? 29.762  -24.714 78.014  1.00 17.74  ? 3222 ALA C N   1 
ATOM   9774  C CA  . ALA C  1 204 ? 30.260  -25.329 76.780  1.00 18.42  ? 3222 ALA C CA  1 
ATOM   9775  C C   . ALA C  1 204 ? 31.552  -24.636 76.348  1.00 17.90  ? 3222 ALA C C   1 
ATOM   9776  O O   . ALA C  1 204 ? 32.403  -25.236 75.691  1.00 20.37  ? 3222 ALA C O   1 
ATOM   9777  C CB  . ALA C  1 204 ? 29.214  -25.236 75.670  1.00 16.71  ? 3222 ALA C CB  1 
ATOM   9778  N N   . GLY C  1 205 ? 31.692  -23.368 76.718  1.00 17.24  ? 3223 GLY C N   1 
ATOM   9779  C CA  . GLY C  1 205 ? 32.897  -22.634 76.375  1.00 16.46  ? 3223 GLY C CA  1 
ATOM   9780  C C   . GLY C  1 205 ? 34.049  -23.123 77.228  1.00 16.23  ? 3223 GLY C C   1 
ATOM   9781  O O   . GLY C  1 205 ? 35.207  -23.115 76.806  1.00 16.39  ? 3223 GLY C O   1 
ATOM   9782  N N   . GLY C  1 206 ? 33.727  -23.545 78.445  1.00 17.63  ? 3224 GLY C N   1 
ATOM   9783  C CA  . GLY C  1 206 ? 34.748  -24.055 79.346  1.00 16.76  ? 3224 GLY C CA  1 
ATOM   9784  C C   . GLY C  1 206 ? 35.179  -25.424 78.863  1.00 17.23  ? 3224 GLY C C   1 
ATOM   9785  O O   . GLY C  1 206 ? 36.359  -25.782 78.934  1.00 17.57  ? 3224 GLY C O   1 
ATOM   9786  N N   . GLU C  1 207 ? 34.210  -26.194 78.375  1.00 16.10  ? 3225 GLU C N   1 
ATOM   9787  C CA  . GLU C  1 207 ? 34.470  -27.527 77.846  1.00 16.65  ? 3225 GLU C CA  1 
ATOM   9788  C C   . GLU C  1 207 ? 35.350  -27.388 76.603  1.00 16.74  ? 3225 GLU C C   1 
ATOM   9789  O O   . GLU C  1 207 ? 36.249  -28.196 76.376  1.00 18.28  ? 3225 GLU C O   1 
ATOM   9790  C CB  . GLU C  1 207 ? 33.155  -28.220 77.475  1.00 16.15  ? 3225 GLU C CB  1 
ATOM   9791  C CG  . GLU C  1 207 ? 33.327  -29.643 76.960  1.00 20.64  ? 3225 GLU C CG  1 
ATOM   9792  C CD  . GLU C  1 207 ? 33.249  -29.756 75.436  1.00 22.94  ? 3225 GLU C CD  1 
ATOM   9793  O OE1 . GLU C  1 207 ? 33.256  -28.715 74.740  1.00 23.00  ? 3225 GLU C OE1 1 
ATOM   9794  O OE2 . GLU C  1 207 ? 33.184  -30.900 74.934  1.00 23.44  ? 3225 GLU C OE2 1 
ATOM   9795  N N   . SER C  1 208 ? 35.094  -26.352 75.810  1.00 17.08  ? 3226 SER C N   1 
ATOM   9796  C CA  . SER C  1 208 ? 35.879  -26.113 74.604  1.00 18.99  ? 3226 SER C CA  1 
ATOM   9797  C C   . SER C  1 208 ? 37.334  -25.815 74.959  1.00 19.04  ? 3226 SER C C   1 
ATOM   9798  O O   . SER C  1 208 ? 38.255  -26.340 74.328  1.00 19.40  ? 3226 SER C O   1 
ATOM   9799  C CB  . SER C  1 208 ? 35.284  -24.956 73.795  1.00 16.23  ? 3226 SER C CB  1 
ATOM   9800  O OG  . SER C  1 208 ? 34.059  -25.350 73.198  1.00 18.06  ? 3226 SER C OG  1 
ATOM   9801  N N   . VAL C  1 209 ? 37.543  -24.973 75.967  1.00 18.41  ? 3227 VAL C N   1 
ATOM   9802  C CA  . VAL C  1 209 ? 38.898  -24.651 76.400  1.00 17.24  ? 3227 VAL C CA  1 
ATOM   9803  C C   . VAL C  1 209 ? 39.606  -25.941 76.812  1.00 18.73  ? 3227 VAL C C   1 
ATOM   9804  O O   . VAL C  1 209 ? 40.763  -26.172 76.451  1.00 19.09  ? 3227 VAL C O   1 
ATOM   9805  C CB  . VAL C  1 209 ? 38.893  -23.670 77.600  1.00 16.68  ? 3227 VAL C CB  1 
ATOM   9806  C CG1 . VAL C  1 209 ? 40.239  -23.696 78.305  1.00 14.42  ? 3227 VAL C CG1 1 
ATOM   9807  C CG2 . VAL C  1 209 ? 38.588  -22.259 77.116  1.00 14.79  ? 3227 VAL C CG2 1 
ATOM   9808  N N   . SER C  1 210 ? 38.899  -26.777 77.564  1.00 19.21  ? 3228 SER C N   1 
ATOM   9809  C CA  . SER C  1 210 ? 39.436  -28.049 78.041  1.00 20.40  ? 3228 SER C CA  1 
ATOM   9810  C C   . SER C  1 210 ? 39.822  -28.949 76.857  1.00 21.17  ? 3228 SER C C   1 
ATOM   9811  O O   . SER C  1 210 ? 40.861  -29.621 76.875  1.00 21.81  ? 3228 SER C O   1 
ATOM   9812  C CB  . SER C  1 210 ? 38.390  -28.743 78.922  1.00 21.33  ? 3228 SER C CB  1 
ATOM   9813  O OG  . SER C  1 210 ? 38.900  -29.924 79.513  1.00 24.63  ? 3228 SER C OG  1 
ATOM   9814  N N   . VAL C  1 211 ? 38.978  -28.955 75.831  1.00 20.80  ? 3229 VAL C N   1 
ATOM   9815  C CA  . VAL C  1 211 ? 39.225  -29.748 74.631  1.00 21.00  ? 3229 VAL C CA  1 
ATOM   9816  C C   . VAL C  1 211 ? 40.469  -29.254 73.884  1.00 20.57  ? 3229 VAL C C   1 
ATOM   9817  O O   . VAL C  1 211 ? 41.278  -30.059 73.423  1.00 21.42  ? 3229 VAL C O   1 
ATOM   9818  C CB  . VAL C  1 211 ? 38.009  -29.698 73.675  1.00 21.39  ? 3229 VAL C CB  1 
ATOM   9819  C CG1 . VAL C  1 211 ? 38.382  -30.256 72.311  1.00 19.73  ? 3229 VAL C CG1 1 
ATOM   9820  C CG2 . VAL C  1 211 ? 36.859  -30.496 74.269  1.00 19.74  ? 3229 VAL C CG2 1 
ATOM   9821  N N   . LEU C  1 212 ? 40.612  -27.936 73.772  1.00 18.71  ? 3230 LEU C N   1 
ATOM   9822  C CA  . LEU C  1 212 ? 41.754  -27.335 73.088  1.00 21.43  ? 3230 LEU C CA  1 
ATOM   9823  C C   . LEU C  1 212 ? 43.052  -27.654 73.822  1.00 22.64  ? 3230 LEU C C   1 
ATOM   9824  O O   . LEU C  1 212 ? 44.101  -27.816 73.201  1.00 22.62  ? 3230 LEU C O   1 
ATOM   9825  C CB  . LEU C  1 212 ? 41.568  -25.816 72.977  1.00 21.29  ? 3230 LEU C CB  1 
ATOM   9826  C CG  . LEU C  1 212 ? 40.394  -25.404 72.085  1.00 23.64  ? 3230 LEU C CG  1 
ATOM   9827  C CD1 . LEU C  1 212 ? 40.135  -23.908 72.190  1.00 24.88  ? 3230 LEU C CD1 1 
ATOM   9828  C CD2 . LEU C  1 212 ? 40.700  -25.803 70.649  1.00 25.99  ? 3230 LEU C CD2 1 
ATOM   9829  N N   . VAL C  1 213 ? 42.975  -27.734 75.146  1.00 21.96  ? 3231 VAL C N   1 
ATOM   9830  C CA  . VAL C  1 213 ? 44.132  -28.068 75.963  1.00 22.12  ? 3231 VAL C CA  1 
ATOM   9831  C C   . VAL C  1 213 ? 44.579  -29.493 75.632  1.00 23.82  ? 3231 VAL C C   1 
ATOM   9832  O O   . VAL C  1 213 ? 45.762  -29.826 75.744  1.00 23.88  ? 3231 VAL C O   1 
ATOM   9833  C CB  . VAL C  1 213 ? 43.786  -27.980 77.475  1.00 22.50  ? 3231 VAL C CB  1 
ATOM   9834  C CG1 . VAL C  1 213 ? 44.886  -28.623 78.313  1.00 20.73  ? 3231 VAL C CG1 1 
ATOM   9835  C CG2 . VAL C  1 213 ? 43.600  -26.524 77.876  1.00 20.33  ? 3231 VAL C CG2 1 
ATOM   9836  N N   . LEU C  1 214 ? 43.626  -30.322 75.212  1.00 24.28  ? 3232 LEU C N   1 
ATOM   9837  C CA  . LEU C  1 214 ? 43.894  -31.716 74.870  1.00 26.00  ? 3232 LEU C CA  1 
ATOM   9838  C C   . LEU C  1 214 ? 44.133  -31.953 73.377  1.00 27.54  ? 3232 LEU C C   1 
ATOM   9839  O O   . LEU C  1 214 ? 44.461  -33.066 72.973  1.00 29.21  ? 3232 LEU C O   1 
ATOM   9840  C CB  . LEU C  1 214 ? 42.717  -32.593 75.311  1.00 26.65  ? 3232 LEU C CB  1 
ATOM   9841  C CG  . LEU C  1 214 ? 42.352  -32.670 76.794  1.00 26.28  ? 3232 LEU C CG  1 
ATOM   9842  C CD1 . LEU C  1 214 ? 40.968  -33.288 76.936  1.00 27.21  ? 3232 LEU C CD1 1 
ATOM   9843  C CD2 . LEU C  1 214 ? 43.389  -33.488 77.544  1.00 29.01  ? 3232 LEU C CD2 1 
ATOM   9844  N N   . SER C  1 215 ? 43.972  -30.920 72.557  1.00 28.73  ? 3233 SER C N   1 
ATOM   9845  C CA  . SER C  1 215 ? 44.142  -31.082 71.116  1.00 30.11  ? 3233 SER C CA  1 
ATOM   9846  C C   . SER C  1 215 ? 45.480  -30.630 70.541  1.00 31.90  ? 3233 SER C C   1 
ATOM   9847  O O   . SER C  1 215 ? 45.954  -29.529 70.818  1.00 29.64  ? 3233 SER C O   1 
ATOM   9848  C CB  . SER C  1 215 ? 43.014  -30.360 70.375  1.00 31.00  ? 3233 SER C CB  1 
ATOM   9849  O OG  . SER C  1 215 ? 43.176  -30.461 68.968  1.00 33.08  ? 3233 SER C OG  1 
ATOM   9850  N N   . PRO C  1 216 ? 46.095  -31.480 69.703  1.00 33.19  ? 3234 PRO C N   1 
ATOM   9851  C CA  . PRO C  1 216 ? 47.381  -31.155 69.085  1.00 33.18  ? 3234 PRO C CA  1 
ATOM   9852  C C   . PRO C  1 216 ? 47.243  -29.978 68.128  1.00 33.19  ? 3234 PRO C C   1 
ATOM   9853  O O   . PRO C  1 216 ? 48.187  -29.212 67.931  1.00 33.60  ? 3234 PRO C O   1 
ATOM   9854  C CB  . PRO C  1 216 ? 47.747  -32.450 68.361  1.00 34.38  ? 3234 PRO C CB  1 
ATOM   9855  C CG  . PRO C  1 216 ? 46.402  -32.974 67.940  1.00 34.84  ? 3234 PRO C CG  1 
ATOM   9856  C CD  . PRO C  1 216 ? 45.581  -32.766 69.196  1.00 34.63  ? 3234 PRO C CD  1 
ATOM   9857  N N   . LEU C  1 217 ? 46.056  -29.832 67.545  1.00 32.24  ? 3235 LEU C N   1 
ATOM   9858  C CA  . LEU C  1 217 ? 45.801  -28.755 66.595  1.00 32.57  ? 3235 LEU C CA  1 
ATOM   9859  C C   . LEU C  1 217 ? 45.971  -27.350 67.160  1.00 33.10  ? 3235 LEU C C   1 
ATOM   9860  O O   . LEU C  1 217 ? 46.067  -26.389 66.403  1.00 32.64  ? 3235 LEU C O   1 
ATOM   9861  C CB  . LEU C  1 217 ? 44.395  -28.888 66.006  1.00 32.13  ? 3235 LEU C CB  1 
ATOM   9862  C CG  . LEU C  1 217 ? 44.112  -30.131 65.157  1.00 32.06  ? 3235 LEU C CG  1 
ATOM   9863  C CD1 . LEU C  1 217 ? 42.669  -30.105 64.678  1.00 29.21  ? 3235 LEU C CD1 1 
ATOM   9864  C CD2 . LEU C  1 217 ? 45.068  -30.170 63.973  1.00 31.87  ? 3235 LEU C CD2 1 
ATOM   9865  N N   . ALA C  1 218 ? 46.017  -27.221 68.481  1.00 35.00  ? 3236 ALA C N   1 
ATOM   9866  C CA  . ALA C  1 218 ? 46.163  -25.903 69.092  1.00 35.59  ? 3236 ALA C CA  1 
ATOM   9867  C C   . ALA C  1 218 ? 47.398  -25.772 69.979  1.00 36.20  ? 3236 ALA C C   1 
ATOM   9868  O O   . ALA C  1 218 ? 47.503  -24.826 70.760  1.00 35.46  ? 3236 ALA C O   1 
ATOM   9869  C CB  . ALA C  1 218 ? 44.909  -25.576 69.897  1.00 36.10  ? 3236 ALA C CB  1 
ATOM   9870  N N   . LYS C  1 219 ? 48.338  -26.705 69.835  1.00 37.21  ? 3237 LYS C N   1 
ATOM   9871  C CA  . LYS C  1 219 ? 49.563  -26.734 70.642  1.00 37.97  ? 3237 LYS C CA  1 
ATOM   9872  C C   . LYS C  1 219 ? 50.331  -25.425 70.861  1.00 37.55  ? 3237 LYS C C   1 
ATOM   9873  O O   . LYS C  1 219 ? 50.894  -25.210 71.941  1.00 37.99  ? 3237 LYS C O   1 
ATOM   9874  C CB  . LYS C  1 219 ? 50.530  -27.788 70.088  1.00 40.37  ? 3237 LYS C CB  1 
ATOM   9875  C CG  . LYS C  1 219 ? 50.934  -27.587 68.637  1.00 42.86  ? 3237 LYS C CG  1 
ATOM   9876  C CD  . LYS C  1 219 ? 51.968  -28.623 68.211  1.00 44.76  ? 3237 LYS C CD  1 
ATOM   9877  C CE  . LYS C  1 219 ? 52.399  -28.416 66.766  1.00 45.80  ? 3237 LYS C CE  1 
ATOM   9878  N NZ  . LYS C  1 219 ? 53.516  -29.327 66.383  1.00 47.37  ? 3237 LYS C NZ  1 
ATOM   9879  N N   . ASN C  1 220 ? 50.376  -24.557 69.858  1.00 35.46  ? 3238 ASN C N   1 
ATOM   9880  C CA  . ASN C  1 220 ? 51.096  -23.297 70.015  1.00 33.76  ? 3238 ASN C CA  1 
ATOM   9881  C C   . ASN C  1 220 ? 50.186  -22.101 69.774  1.00 30.88  ? 3238 ASN C C   1 
ATOM   9882  O O   . ASN C  1 220 ? 50.644  -21.059 69.306  1.00 31.24  ? 3238 ASN C O   1 
ATOM   9883  C CB  . ASN C  1 220 ? 52.280  -23.231 69.042  1.00 37.91  ? 3238 ASN C CB  1 
ATOM   9884  C CG  . ASN C  1 220 ? 53.176  -24.461 69.115  1.00 40.18  ? 3238 ASN C CG  1 
ATOM   9885  O OD1 . ASN C  1 220 ? 53.172  -25.294 68.205  1.00 41.77  ? 3238 ASN C OD1 1 
ATOM   9886  N ND2 . ASN C  1 220 ? 53.937  -24.586 70.198  1.00 40.17  ? 3238 ASN C ND2 1 
ATOM   9887  N N   . LEU C  1 221 ? 48.905  -22.243 70.107  1.00 26.80  ? 3239 LEU C N   1 
ATOM   9888  C CA  . LEU C  1 221 ? 47.947  -21.162 69.891  1.00 24.24  ? 3239 LEU C CA  1 
ATOM   9889  C C   . LEU C  1 221 ? 47.529  -20.393 71.143  1.00 21.79  ? 3239 LEU C C   1 
ATOM   9890  O O   . LEU C  1 221 ? 46.812  -19.401 71.045  1.00 22.79  ? 3239 LEU C O   1 
ATOM   9891  C CB  . LEU C  1 221 ? 46.704  -21.705 69.179  1.00 24.25  ? 3239 LEU C CB  1 
ATOM   9892  C CG  . LEU C  1 221 ? 46.977  -22.252 67.778  1.00 26.10  ? 3239 LEU C CG  1 
ATOM   9893  C CD1 . LEU C  1 221 ? 45.682  -22.712 67.146  1.00 27.45  ? 3239 LEU C CD1 1 
ATOM   9894  C CD2 . LEU C  1 221 ? 47.631  -21.175 66.935  1.00 25.53  ? 3239 LEU C CD2 1 
ATOM   9895  N N   . PHE C  1 222 ? 47.958  -20.854 72.311  1.00 20.69  ? 3240 PHE C N   1 
ATOM   9896  C CA  . PHE C  1 222 ? 47.633  -20.170 73.563  1.00 22.73  ? 3240 PHE C CA  1 
ATOM   9897  C C   . PHE C  1 222 ? 48.628  -20.548 74.664  1.00 23.59  ? 3240 PHE C C   1 
ATOM   9898  O O   . PHE C  1 222 ? 49.268  -21.596 74.595  1.00 22.93  ? 3240 PHE C O   1 
ATOM   9899  C CB  . PHE C  1 222 ? 46.195  -20.480 73.996  1.00 19.30  ? 3240 PHE C CB  1 
ATOM   9900  C CG  . PHE C  1 222 ? 45.930  -21.932 74.249  1.00 18.92  ? 3240 PHE C CG  1 
ATOM   9901  C CD1 . PHE C  1 222 ? 45.599  -22.787 73.205  1.00 18.47  ? 3240 PHE C CD1 1 
ATOM   9902  C CD2 . PHE C  1 222 ? 45.986  -22.439 75.540  1.00 17.01  ? 3240 PHE C CD2 1 
ATOM   9903  C CE1 . PHE C  1 222 ? 45.320  -24.132 73.449  1.00 20.14  ? 3240 PHE C CE1 1 
ATOM   9904  C CE2 . PHE C  1 222 ? 45.710  -23.781 75.795  1.00 18.42  ? 3240 PHE C CE2 1 
ATOM   9905  C CZ  . PHE C  1 222 ? 45.375  -24.626 74.750  1.00 18.41  ? 3240 PHE C CZ  1 
ATOM   9906  N N   . HIS C  1 223 ? 48.738  -19.707 75.689  1.00 24.28  ? 3241 HIS C N   1 
ATOM   9907  C CA  . HIS C  1 223 ? 49.709  -19.941 76.749  1.00 24.26  ? 3241 HIS C CA  1 
ATOM   9908  C C   . HIS C  1 223 ? 49.141  -20.042 78.170  1.00 24.21  ? 3241 HIS C C   1 
ATOM   9909  O O   . HIS C  1 223 ? 49.874  -20.310 79.120  1.00 26.18  ? 3241 HIS C O   1 
ATOM   9910  C CB  . HIS C  1 223 ? 50.759  -18.838 76.647  1.00 25.46  ? 3241 HIS C CB  1 
ATOM   9911  C CG  . HIS C  1 223 ? 51.187  -18.566 75.236  1.00 26.79  ? 3241 HIS C CG  1 
ATOM   9912  N ND1 . HIS C  1 223 ? 50.500  -17.713 74.395  1.00 26.22  ? 3241 HIS C ND1 1 
ATOM   9913  C CD2 . HIS C  1 223 ? 52.177  -19.109 74.491  1.00 26.53  ? 3241 HIS C CD2 1 
ATOM   9914  C CE1 . HIS C  1 223 ? 51.049  -17.745 73.194  1.00 25.91  ? 3241 HIS C CE1 1 
ATOM   9915  N NE2 . HIS C  1 223 ? 52.068  -18.586 73.225  1.00 27.68  ? 3241 HIS C NE2 1 
ATOM   9916  N N   . ARG C  1 224 ? 47.837  -19.818 78.303  1.00 23.56  ? 3242 ARG C N   1 
ATOM   9917  C CA  . ARG C  1 224 ? 47.132  -19.916 79.586  1.00 22.72  ? 3242 ARG C CA  1 
ATOM   9918  C C   . ARG C  1 224 ? 45.695  -20.318 79.272  1.00 22.11  ? 3242 ARG C C   1 
ATOM   9919  O O   . ARG C  1 224 ? 45.167  -19.966 78.213  1.00 22.49  ? 3242 ARG C O   1 
ATOM   9920  C CB  . ARG C  1 224 ? 47.113  -18.580 80.338  1.00 22.10  ? 3242 ARG C CB  1 
ATOM   9921  C CG  . ARG C  1 224 ? 48.456  -18.103 80.862  1.00 24.81  ? 3242 ARG C CG  1 
ATOM   9922  C CD  . ARG C  1 224 ? 49.055  -17.062 79.935  1.00 26.25  ? 3242 ARG C CD  1 
ATOM   9923  N NE  . ARG C  1 224 ? 50.156  -16.338 80.561  1.00 26.43  ? 3242 ARG C NE  1 
ATOM   9924  C CZ  . ARG C  1 224 ? 51.322  -16.881 80.896  1.00 25.88  ? 3242 ARG C CZ  1 
ATOM   9925  N NH1 . ARG C  1 224 ? 51.555  -18.167 80.664  1.00 24.21  ? 3242 ARG C NH1 1 
ATOM   9926  N NH2 . ARG C  1 224 ? 52.252  -16.135 81.474  1.00 25.92  ? 3242 ARG C NH2 1 
ATOM   9927  N N   . ALA C  1 225 ? 45.066  -21.051 80.185  1.00 19.44  ? 3243 ALA C N   1 
ATOM   9928  C CA  . ALA C  1 225 ? 43.690  -21.491 79.975  1.00 17.71  ? 3243 ALA C CA  1 
ATOM   9929  C C   . ALA C  1 225 ? 42.839  -21.405 81.237  1.00 17.06  ? 3243 ALA C C   1 
ATOM   9930  O O   . ALA C  1 225 ? 43.315  -21.667 82.340  1.00 16.55  ? 3243 ALA C O   1 
ATOM   9931  C CB  . ALA C  1 225 ? 43.677  -22.911 79.454  1.00 15.98  ? 3243 ALA C CB  1 
ATOM   9932  N N   . ILE C  1 226 ? 41.574  -21.037 81.054  1.00 16.73  ? 3244 ILE C N   1 
ATOM   9933  C CA  . ILE C  1 226 ? 40.624  -20.939 82.160  1.00 16.11  ? 3244 ILE C CA  1 
ATOM   9934  C C   . ILE C  1 226 ? 39.310  -21.609 81.752  1.00 15.74  ? 3244 ILE C C   1 
ATOM   9935  O O   . ILE C  1 226 ? 38.699  -21.236 80.752  1.00 15.22  ? 3244 ILE C O   1 
ATOM   9936  C CB  . ILE C  1 226 ? 40.308  -19.463 82.530  1.00 16.42  ? 3244 ILE C CB  1 
ATOM   9937  C CG1 . ILE C  1 226 ? 41.584  -18.728 82.947  1.00 16.70  ? 3244 ILE C CG1 1 
ATOM   9938  C CG2 . ILE C  1 226 ? 39.303  -19.420 83.676  1.00 18.47  ? 3244 ILE C CG2 1 
ATOM   9939  C CD1 . ILE C  1 226 ? 41.406  -17.216 83.049  1.00 19.43  ? 3244 ILE C CD1 1 
ATOM   9940  N N   . SER C  1 227 ? 38.894  -22.617 82.508  1.00 15.75  ? 3245 SER C N   1 
ATOM   9941  C CA  . SER C  1 227 ? 37.634  -23.294 82.236  1.00 17.18  ? 3245 SER C CA  1 
ATOM   9942  C C   . SER C  1 227 ? 36.681  -22.955 83.379  1.00 19.42  ? 3245 SER C C   1 
ATOM   9943  O O   . SER C  1 227 ? 36.926  -23.328 84.532  1.00 18.52  ? 3245 SER C O   1 
ATOM   9944  C CB  . SER C  1 227 ? 37.832  -24.812 82.149  1.00 17.84  ? 3245 SER C CB  1 
ATOM   9945  O OG  . SER C  1 227 ? 38.373  -25.181 80.886  1.00 21.21  ? 3245 SER C OG  1 
ATOM   9946  N N   . GLU C  1 228 ? 35.613  -22.230 83.055  1.00 19.15  ? 3246 GLU C N   1 
ATOM   9947  C CA  . GLU C  1 228 ? 34.621  -21.825 84.043  1.00 20.49  ? 3246 GLU C CA  1 
ATOM   9948  C C   . GLU C  1 228 ? 33.377  -22.708 83.955  1.00 20.69  ? 3246 GLU C C   1 
ATOM   9949  O O   . GLU C  1 228 ? 32.629  -22.643 82.980  1.00 21.39  ? 3246 GLU C O   1 
ATOM   9950  C CB  . GLU C  1 228 ? 34.230  -20.360 83.820  1.00 19.07  ? 3246 GLU C CB  1 
ATOM   9951  C CG  . GLU C  1 228 ? 35.339  -19.353 84.108  1.00 19.98  ? 3246 GLU C CG  1 
ATOM   9952  C CD  . GLU C  1 228 ? 34.978  -17.938 83.672  1.00 21.25  ? 3246 GLU C CD  1 
ATOM   9953  O OE1 . GLU C  1 228 ? 33.801  -17.533 83.830  1.00 23.00  ? 3246 GLU C OE1 1 
ATOM   9954  O OE2 . GLU C  1 228 ? 35.875  -17.224 83.179  1.00 20.74  ? 3246 GLU C OE2 1 
ATOM   9955  N N   . SER C  1 229 ? 33.171  -23.547 84.965  1.00 19.40  ? 3247 SER C N   1 
ATOM   9956  C CA  . SER C  1 229 ? 32.005  -24.428 85.006  1.00 21.59  ? 3247 SER C CA  1 
ATOM   9957  C C   . SER C  1 229 ? 31.812  -25.297 83.755  1.00 21.72  ? 3247 SER C C   1 
ATOM   9958  O O   . SER C  1 229 ? 30.769  -25.241 83.099  1.00 20.87  ? 3247 SER C O   1 
ATOM   9959  C CB  . SER C  1 229 ? 30.744  -23.592 85.238  1.00 21.16  ? 3247 SER C CB  1 
ATOM   9960  O OG  . SER C  1 229 ? 30.841  -22.860 86.448  1.00 25.62  ? 3247 SER C OG  1 
ATOM   9961  N N   . GLY C  1 230 ? 32.809  -26.114 83.440  1.00 22.23  ? 3248 GLY C N   1 
ATOM   9962  C CA  . GLY C  1 230 ? 32.707  -26.974 82.275  1.00 21.27  ? 3248 GLY C CA  1 
ATOM   9963  C C   . GLY C  1 230 ? 34.066  -27.441 81.783  1.00 20.18  ? 3248 GLY C C   1 
ATOM   9964  O O   . GLY C  1 230 ? 34.970  -26.631 81.574  1.00 17.19  ? 3248 GLY C O   1 
ATOM   9965  N N   . VAL C  1 231 ? 34.209  -28.752 81.611  1.00 19.85  ? 3249 VAL C N   1 
ATOM   9966  C CA  . VAL C  1 231 ? 35.456  -29.337 81.139  1.00 21.74  ? 3249 VAL C CA  1 
ATOM   9967  C C   . VAL C  1 231 ? 35.171  -30.494 80.184  1.00 22.17  ? 3249 VAL C C   1 
ATOM   9968  O O   . VAL C  1 231 ? 34.014  -30.861 79.971  1.00 22.14  ? 3249 VAL C O   1 
ATOM   9969  C CB  . VAL C  1 231 ? 36.324  -29.847 82.316  1.00 23.26  ? 3249 VAL C CB  1 
ATOM   9970  C CG1 . VAL C  1 231 ? 36.824  -28.670 83.138  1.00 23.09  ? 3249 VAL C CG1 1 
ATOM   9971  C CG2 . VAL C  1 231 ? 35.524  -30.803 83.181  1.00 21.28  ? 3249 VAL C CG2 1 
ATOM   9972  N N   . ALA C  1 232 ? 36.230  -31.065 79.617  1.00 24.25  ? 3250 ALA C N   1 
ATOM   9973  C CA  . ALA C  1 232 ? 36.095  -32.167 78.670  1.00 25.42  ? 3250 ALA C CA  1 
ATOM   9974  C C   . ALA C  1 232 ? 35.478  -33.406 79.300  1.00 26.98  ? 3250 ALA C C   1 
ATOM   9975  O O   . ALA C  1 232 ? 35.021  -34.300 78.587  1.00 25.98  ? 3250 ALA C O   1 
ATOM   9976  C CB  . ALA C  1 232 ? 37.453  -32.508 78.072  1.00 26.83  ? 3250 ALA C CB  1 
ATOM   9977  N N   . LEU C  1 233 ? 35.473  -33.464 80.632  1.00 27.15  ? 3251 LEU C N   1 
ATOM   9978  C CA  . LEU C  1 233 ? 34.891  -34.600 81.331  1.00 27.73  ? 3251 LEU C CA  1 
ATOM   9979  C C   . LEU C  1 233 ? 33.418  -34.380 81.660  1.00 27.49  ? 3251 LEU C C   1 
ATOM   9980  O O   . LEU C  1 233 ? 32.784  -35.225 82.294  1.00 26.81  ? 3251 LEU C O   1 
ATOM   9981  C CB  . LEU C  1 233 ? 35.678  -34.919 82.603  1.00 30.96  ? 3251 LEU C CB  1 
ATOM   9982  C CG  . LEU C  1 233 ? 37.054  -35.559 82.381  1.00 31.36  ? 3251 LEU C CG  1 
ATOM   9983  C CD1 . LEU C  1 233 ? 37.650  -35.953 83.723  1.00 32.30  ? 3251 LEU C CD1 1 
ATOM   9984  C CD2 . LEU C  1 233 ? 36.920  -36.782 81.494  1.00 33.32  ? 3251 LEU C CD2 1 
ATOM   9985  N N   . THR C  1 234 ? 32.880  -33.235 81.245  1.00 26.28  ? 3252 THR C N   1 
ATOM   9986  C CA  . THR C  1 234 ? 31.461  -32.946 81.447  1.00 26.06  ? 3252 THR C CA  1 
ATOM   9987  C C   . THR C  1 234 ? 30.810  -33.751 80.323  1.00 27.28  ? 3252 THR C C   1 
ATOM   9988  O O   . THR C  1 234 ? 30.548  -33.236 79.237  1.00 27.06  ? 3252 THR C O   1 
ATOM   9989  C CB  . THR C  1 234 ? 31.157  -31.439 81.279  1.00 25.71  ? 3252 THR C CB  1 
ATOM   9990  O OG1 . THR C  1 234 ? 31.834  -30.698 82.306  1.00 24.90  ? 3252 THR C OG1 1 
ATOM   9991  C CG2 . THR C  1 234 ? 29.652  -31.176 81.383  1.00 24.86  ? 3252 THR C CG2 1 
ATOM   9992  N N   . SER C  1 235 ? 30.579  -35.030 80.610  1.00 29.87  ? 3253 SER C N   1 
ATOM   9993  C CA  . SER C  1 235 ? 30.037  -36.007 79.669  1.00 30.04  ? 3253 SER C CA  1 
ATOM   9994  C C   . SER C  1 235 ? 28.915  -35.619 78.715  1.00 29.97  ? 3253 SER C C   1 
ATOM   9995  O O   . SER C  1 235 ? 28.940  -36.019 77.555  1.00 30.30  ? 3253 SER C O   1 
ATOM   9996  C CB  . SER C  1 235 ? 29.623  -37.274 80.425  1.00 32.87  ? 3253 SER C CB  1 
ATOM   9997  O OG  . SER C  1 235 ? 28.495  -37.040 81.251  1.00 37.66  ? 3253 SER C OG  1 
ATOM   9998  N N   . VAL C  1 236 ? 27.929  -34.861 79.179  1.00 28.65  ? 3254 VAL C N   1 
ATOM   9999  C CA  . VAL C  1 236 ? 26.823  -34.491 78.303  1.00 27.71  ? 3254 VAL C CA  1 
ATOM   10000 C C   . VAL C  1 236 ? 27.261  -33.753 77.032  1.00 27.25  ? 3254 VAL C C   1 
ATOM   10001 O O   . VAL C  1 236 ? 26.534  -33.744 76.041  1.00 26.54  ? 3254 VAL C O   1 
ATOM   10002 C CB  . VAL C  1 236 ? 25.776  -33.628 79.050  1.00 27.74  ? 3254 VAL C CB  1 
ATOM   10003 C CG1 . VAL C  1 236 ? 26.321  -32.230 79.307  1.00 27.38  ? 3254 VAL C CG1 1 
ATOM   10004 C CG2 . VAL C  1 236 ? 24.486  -33.573 78.248  1.00 28.53  ? 3254 VAL C CG2 1 
ATOM   10005 N N   . LEU C  1 237 ? 28.445  -33.143 77.066  1.00 25.49  ? 3255 LEU C N   1 
ATOM   10006 C CA  . LEU C  1 237 ? 28.967  -32.392 75.928  1.00 25.91  ? 3255 LEU C CA  1 
ATOM   10007 C C   . LEU C  1 237 ? 29.885  -33.218 75.035  1.00 26.93  ? 3255 LEU C C   1 
ATOM   10008 O O   . LEU C  1 237 ? 30.241  -32.785 73.937  1.00 24.12  ? 3255 LEU C O   1 
ATOM   10009 C CB  . LEU C  1 237 ? 29.732  -31.153 76.409  1.00 24.33  ? 3255 LEU C CB  1 
ATOM   10010 C CG  . LEU C  1 237 ? 28.946  -30.026 77.088  1.00 24.67  ? 3255 LEU C CG  1 
ATOM   10011 C CD1 . LEU C  1 237 ? 29.916  -29.012 77.658  1.00 23.92  ? 3255 LEU C CD1 1 
ATOM   10012 C CD2 . LEU C  1 237 ? 28.010  -29.367 76.092  1.00 24.65  ? 3255 LEU C CD2 1 
ATOM   10013 N N   . VAL C  1 238 ? 30.276  -34.399 75.499  1.00 27.26  ? 3256 VAL C N   1 
ATOM   10014 C CA  . VAL C  1 238 ? 31.160  -35.257 74.722  1.00 29.41  ? 3256 VAL C CA  1 
ATOM   10015 C C   . VAL C  1 238 ? 30.482  -36.586 74.411  1.00 32.07  ? 3256 VAL C C   1 
ATOM   10016 O O   . VAL C  1 238 ? 30.043  -37.300 75.315  1.00 31.39  ? 3256 VAL C O   1 
ATOM   10017 C CB  . VAL C  1 238 ? 32.462  -35.540 75.488  1.00 29.15  ? 3256 VAL C CB  1 
ATOM   10018 C CG1 . VAL C  1 238 ? 33.369  -36.422 74.646  1.00 29.38  ? 3256 VAL C CG1 1 
ATOM   10019 C CG2 . VAL C  1 238 ? 33.150  -34.236 75.840  1.00 27.79  ? 3256 VAL C CG2 1 
ATOM   10020 N N   . LYS C  1 239 ? 30.407  -36.918 73.128  1.00 33.07  ? 3257 LYS C N   1 
ATOM   10021 C CA  . LYS C  1 239 ? 29.776  -38.156 72.703  1.00 36.47  ? 3257 LYS C CA  1 
ATOM   10022 C C   . LYS C  1 239 ? 30.796  -39.289 72.623  1.00 38.52  ? 3257 LYS C C   1 
ATOM   10023 O O   . LYS C  1 239 ? 31.880  -39.127 72.062  1.00 39.05  ? 3257 LYS C O   1 
ATOM   10024 C CB  . LYS C  1 239 ? 29.081  -37.962 71.348  1.00 37.51  ? 3257 LYS C CB  1 
ATOM   10025 C CG  . LYS C  1 239 ? 28.079  -36.810 71.348  1.00 39.60  ? 3257 LYS C CG  1 
ATOM   10026 C CD  . LYS C  1 239 ? 27.184  -36.864 72.583  1.00 41.03  ? 3257 LYS C CD  1 
ATOM   10027 C CE  . LYS C  1 239 ? 26.179  -35.726 72.602  1.00 41.91  ? 3257 LYS C CE  1 
ATOM   10028 N NZ  . LYS C  1 239 ? 25.203  -35.846 71.488  1.00 39.06  ? 3257 LYS C NZ  1 
ATOM   10029 N N   . LYS C  1 240 ? 30.450  -40.428 73.217  1.00 40.46  ? 3258 LYS C N   1 
ATOM   10030 C CA  . LYS C  1 240 ? 31.330  -41.598 73.229  1.00 43.37  ? 3258 LYS C CA  1 
ATOM   10031 C C   . LYS C  1 240 ? 30.670  -42.718 72.442  1.00 43.21  ? 3258 LYS C C   1 
ATOM   10032 O O   . LYS C  1 240 ? 29.460  -42.739 72.314  1.00 44.73  ? 3258 LYS C O   1 
ATOM   10033 C CB  . LYS C  1 240 ? 31.582  -42.052 74.671  1.00 45.40  ? 3258 LYS C CB  1 
ATOM   10034 C CG  . LYS C  1 240 ? 30.309  -42.527 75.336  1.00 48.26  ? 3258 LYS C CG  1 
ATOM   10035 C CD  . LYS C  1 240 ? 29.249  -41.392 75.416  1.00 49.71  ? 3258 LYS C CD  1 
ATOM   10036 C CE  . LYS C  1 240 ? 27.865  -41.958 75.658  1.00 51.30  ? 3258 LYS C CE  1 
ATOM   10037 N NZ  . LYS C  1 240 ? 26.815  -40.937 75.295  1.00 51.39  ? 3258 LYS C NZ  1 
ATOM   10038 N N   . GLY C  1 241 ? 31.471  -43.631 71.906  1.00 43.68  ? 3259 GLY C N   1 
ATOM   10039 C CA  . GLY C  1 241 ? 30.927  -44.733 71.146  1.00 43.03  ? 3259 GLY C CA  1 
ATOM   10040 C C   . GLY C  1 241 ? 30.453  -44.377 69.751  1.00 42.01  ? 3259 GLY C C   1 
ATOM   10041 O O   . GLY C  1 241 ? 30.922  -43.415 69.134  1.00 42.31  ? 3259 GLY C O   1 
ATOM   10042 N N   . ASP C  1 242 ? 29.491  -45.157 69.268  1.00 40.32  ? 3260 ASP C N   1 
ATOM   10043 C CA  . ASP C  1 242 ? 28.919  -44.960 67.945  1.00 38.51  ? 3260 ASP C CA  1 
ATOM   10044 C C   . ASP C  1 242 ? 27.963  -43.769 67.880  1.00 35.61  ? 3260 ASP C C   1 
ATOM   10045 O O   . ASP C  1 242 ? 26.940  -43.731 68.562  1.00 35.18  ? 3260 ASP C O   1 
ATOM   10046 C CB  . ASP C  1 242 ? 28.215  -46.244 67.514  1.00 40.91  ? 3260 ASP C CB  1 
ATOM   10047 C CG  . ASP C  1 242 ? 27.653  -46.163 66.113  1.00 43.28  ? 3260 ASP C CG  1 
ATOM   10048 O OD1 . ASP C  1 242 ? 28.388  -45.770 65.181  1.00 43.88  ? 3260 ASP C OD1 1 
ATOM   10049 O OD2 . ASP C  1 242 ? 26.473  -46.522 65.944  1.00 46.22  ? 3260 ASP C OD2 1 
ATOM   10050 N N   . VAL C  1 243 ? 28.310  -42.793 67.049  1.00 33.32  ? 3261 VAL C N   1 
ATOM   10051 C CA  . VAL C  1 243 ? 27.486  -41.603 66.891  1.00 31.86  ? 3261 VAL C CA  1 
ATOM   10052 C C   . VAL C  1 243 ? 26.567  -41.714 65.676  1.00 31.91  ? 3261 VAL C C   1 
ATOM   10053 O O   . VAL C  1 243 ? 25.792  -40.804 65.391  1.00 29.17  ? 3261 VAL C O   1 
ATOM   10054 C CB  . VAL C  1 243 ? 28.361  -40.339 66.734  1.00 32.60  ? 3261 VAL C CB  1 
ATOM   10055 C CG1 . VAL C  1 243 ? 29.299  -40.206 67.920  1.00 31.92  ? 3261 VAL C CG1 1 
ATOM   10056 C CG2 . VAL C  1 243 ? 29.148  -40.402 65.429  1.00 29.95  ? 3261 VAL C CG2 1 
ATOM   10057 N N   . LYS C  1 244 ? 26.651  -42.840 64.975  1.00 31.61  ? 3262 LYS C N   1 
ATOM   10058 C CA  . LYS C  1 244 ? 25.850  -43.074 63.777  1.00 33.03  ? 3262 LYS C CA  1 
ATOM   10059 C C   . LYS C  1 244 ? 24.328  -42.964 63.971  1.00 32.14  ? 3262 LYS C C   1 
ATOM   10060 O O   . LYS C  1 244 ? 23.635  -42.362 63.146  1.00 30.90  ? 3262 LYS C O   1 
ATOM   10061 C CB  . LYS C  1 244 ? 26.198  -44.444 63.195  1.00 35.43  ? 3262 LYS C CB  1 
ATOM   10062 C CG  . LYS C  1 244 ? 25.631  -44.694 61.815  1.00 40.88  ? 3262 LYS C CG  1 
ATOM   10063 C CD  . LYS C  1 244 ? 26.244  -43.752 60.793  1.00 43.26  ? 3262 LYS C CD  1 
ATOM   10064 C CE  . LYS C  1 244 ? 25.774  -44.093 59.390  1.00 46.48  ? 3262 LYS C CE  1 
ATOM   10065 N NZ  . LYS C  1 244 ? 26.477  -43.270 58.372  1.00 47.74  ? 3262 LYS C NZ  1 
ATOM   10066 N N   . PRO C  1 245 ? 23.786  -43.553 65.053  1.00 31.78  ? 3263 PRO C N   1 
ATOM   10067 C CA  . PRO C  1 245 ? 22.338  -43.484 65.297  1.00 30.54  ? 3263 PRO C CA  1 
ATOM   10068 C C   . PRO C  1 245 ? 21.806  -42.048 65.359  1.00 27.59  ? 3263 PRO C C   1 
ATOM   10069 O O   . PRO C  1 245 ? 20.740  -41.744 64.827  1.00 26.58  ? 3263 PRO C O   1 
ATOM   10070 C CB  . PRO C  1 245 ? 22.180  -44.217 66.629  1.00 31.13  ? 3263 PRO C CB  1 
ATOM   10071 C CG  . PRO C  1 245 ? 23.279  -45.241 66.572  1.00 32.04  ? 3263 PRO C CG  1 
ATOM   10072 C CD  . PRO C  1 245 ? 24.442  -44.428 66.043  1.00 31.61  ? 3263 PRO C CD  1 
ATOM   10073 N N   . LEU C  1 246 ? 22.552  -41.169 66.016  1.00 26.68  ? 3264 LEU C N   1 
ATOM   10074 C CA  . LEU C  1 246 ? 22.149  -39.773 66.136  1.00 25.37  ? 3264 LEU C CA  1 
ATOM   10075 C C   . LEU C  1 246 ? 22.189  -39.106 64.759  1.00 24.34  ? 3264 LEU C C   1 
ATOM   10076 O O   . LEU C  1 246 ? 21.319  -38.298 64.422  1.00 24.02  ? 3264 LEU C O   1 
ATOM   10077 C CB  . LEU C  1 246 ? 23.090  -39.029 67.085  1.00 25.83  ? 3264 LEU C CB  1 
ATOM   10078 C CG  . LEU C  1 246 ? 22.526  -37.860 67.898  1.00 28.75  ? 3264 LEU C CG  1 
ATOM   10079 C CD1 . LEU C  1 246 ? 23.672  -36.909 68.223  1.00 27.70  ? 3264 LEU C CD1 1 
ATOM   10080 C CD2 . LEU C  1 246 ? 21.431  -37.128 67.137  1.00 27.76  ? 3264 LEU C CD2 1 
ATOM   10081 N N   . ALA C  1 247 ? 23.207  -39.437 63.969  1.00 21.87  ? 3265 ALA C N   1 
ATOM   10082 C CA  . ALA C  1 247 ? 23.329  -38.862 62.632  1.00 21.41  ? 3265 ALA C CA  1 
ATOM   10083 C C   . ALA C  1 247 ? 22.120  -39.257 61.795  1.00 19.99  ? 3265 ALA C C   1 
ATOM   10084 O O   . ALA C  1 247 ? 21.530  -38.429 61.107  1.00 18.48  ? 3265 ALA C O   1 
ATOM   10085 C CB  . ALA C  1 247 ? 24.610  -39.347 61.961  1.00 21.07  ? 3265 ALA C CB  1 
ATOM   10086 N N   . GLU C  1 248 ? 21.745  -40.528 61.866  1.00 21.01  ? 3266 GLU C N   1 
ATOM   10087 C CA  . GLU C  1 248 ? 20.610  -41.014 61.100  1.00 22.86  ? 3266 GLU C CA  1 
ATOM   10088 C C   . GLU C  1 248 ? 19.290  -40.382 61.525  1.00 22.83  ? 3266 GLU C C   1 
ATOM   10089 O O   . GLU C  1 248 ? 18.458  -40.066 60.681  1.00 21.22  ? 3266 GLU C O   1 
ATOM   10090 C CB  . GLU C  1 248 ? 20.540  -42.541 61.189  1.00 27.62  ? 3266 GLU C CB  1 
ATOM   10091 C CG  . GLU C  1 248 ? 21.701  -43.209 60.449  1.00 32.38  ? 3266 GLU C CG  1 
ATOM   10092 C CD  . GLU C  1 248 ? 21.602  -44.718 60.403  1.00 36.33  ? 3266 GLU C CD  1 
ATOM   10093 O OE1 . GLU C  1 248 ? 20.489  -45.233 60.170  1.00 39.47  ? 3266 GLU C OE1 1 
ATOM   10094 O OE2 . GLU C  1 248 ? 22.642  -45.388 60.579  1.00 39.43  ? 3266 GLU C OE2 1 
ATOM   10095 N N   . GLN C  1 249 ? 19.106  -40.187 62.828  1.00 22.94  ? 3267 GLN C N   1 
ATOM   10096 C CA  . GLN C  1 249 ? 17.885  -39.577 63.336  1.00 24.01  ? 3267 GLN C CA  1 
ATOM   10097 C C   . GLN C  1 249 ? 17.749  -38.150 62.814  1.00 21.75  ? 3267 GLN C C   1 
ATOM   10098 O O   . GLN C  1 249 ? 16.655  -37.706 62.477  1.00 21.46  ? 3267 GLN C O   1 
ATOM   10099 C CB  . GLN C  1 249 ? 17.894  -39.574 64.868  1.00 28.59  ? 3267 GLN C CB  1 
ATOM   10100 C CG  . GLN C  1 249 ? 16.687  -38.887 65.500  1.00 34.93  ? 3267 GLN C CG  1 
ATOM   10101 C CD  . GLN C  1 249 ? 16.671  -39.015 67.014  1.00 37.50  ? 3267 GLN C CD  1 
ATOM   10102 O OE1 . GLN C  1 249 ? 17.616  -38.612 67.691  1.00 41.18  ? 3267 GLN C OE1 1 
ATOM   10103 N NE2 . GLN C  1 249 ? 15.595  -39.581 67.551  1.00 39.03  ? 3267 GLN C NE2 1 
ATOM   10104 N N   . ILE C  1 250 ? 18.864  -37.430 62.752  1.00 20.26  ? 3268 ILE C N   1 
ATOM   10105 C CA  . ILE C  1 250 ? 18.840  -36.063 62.252  1.00 19.80  ? 3268 ILE C CA  1 
ATOM   10106 C C   . ILE C  1 250 ? 18.503  -36.051 60.761  1.00 19.70  ? 3268 ILE C C   1 
ATOM   10107 O O   . ILE C  1 250 ? 17.672  -35.258 60.310  1.00 18.99  ? 3268 ILE C O   1 
ATOM   10108 C CB  . ILE C  1 250 ? 20.197  -35.367 62.468  1.00 19.67  ? 3268 ILE C CB  1 
ATOM   10109 C CG1 . ILE C  1 250 ? 20.452  -35.195 63.971  1.00 19.10  ? 3268 ILE C CG1 1 
ATOM   10110 C CG2 . ILE C  1 250 ? 20.208  -34.012 61.764  1.00 19.66  ? 3268 ILE C CG2 1 
ATOM   10111 C CD1 . ILE C  1 250 ? 21.806  -34.620 64.291  1.00 20.04  ? 3268 ILE C CD1 1 
ATOM   10112 N N   . ALA C  1 251 ? 19.141  -36.939 60.005  1.00 18.81  ? 3269 ALA C N   1 
ATOM   10113 C CA  . ALA C  1 251 ? 18.913  -37.024 58.563  1.00 20.48  ? 3269 ALA C CA  1 
ATOM   10114 C C   . ALA C  1 251 ? 17.452  -37.348 58.258  1.00 22.23  ? 3269 ALA C C   1 
ATOM   10115 O O   . ALA C  1 251 ? 16.822  -36.704 57.411  1.00 20.19  ? 3269 ALA C O   1 
ATOM   10116 C CB  . ALA C  1 251 ? 19.827  -38.084 57.951  1.00 21.28  ? 3269 ALA C CB  1 
ATOM   10117 N N   . ILE C  1 252 ? 16.919  -38.347 58.954  1.00 21.91  ? 3270 ILE C N   1 
ATOM   10118 C CA  . ILE C  1 252 ? 15.533  -38.750 58.769  1.00 24.17  ? 3270 ILE C CA  1 
ATOM   10119 C C   . ILE C  1 252 ? 14.600  -37.578 59.074  1.00 23.68  ? 3270 ILE C C   1 
ATOM   10120 O O   . ILE C  1 252 ? 13.683  -37.288 58.307  1.00 23.00  ? 3270 ILE C O   1 
ATOM   10121 C CB  . ILE C  1 252 ? 15.184  -39.941 59.685  1.00 24.73  ? 3270 ILE C CB  1 
ATOM   10122 C CG1 . ILE C  1 252 ? 15.984  -41.171 59.248  1.00 26.72  ? 3270 ILE C CG1 1 
ATOM   10123 C CG2 . ILE C  1 252 ? 13.687  -40.224 59.638  1.00 25.68  ? 3270 ILE C CG2 1 
ATOM   10124 C CD1 . ILE C  1 252 ? 15.828  -42.373 60.164  1.00 28.63  ? 3270 ILE C CD1 1 
ATOM   10125 N N   . THR C  1 253 ? 14.842  -36.899 60.191  1.00 23.97  ? 3271 THR C N   1 
ATOM   10126 C CA  . THR C  1 253 ? 14.012  -35.760 60.565  1.00 22.99  ? 3271 THR C CA  1 
ATOM   10127 C C   . THR C  1 253 ? 14.060  -34.671 59.493  1.00 22.31  ? 3271 THR C C   1 
ATOM   10128 O O   . THR C  1 253 ? 13.070  -33.987 59.243  1.00 22.06  ? 3271 THR C O   1 
ATOM   10129 C CB  . THR C  1 253 ? 14.461  -35.156 61.910  1.00 23.13  ? 3271 THR C CB  1 
ATOM   10130 O OG1 . THR C  1 253 ? 14.437  -36.169 62.922  1.00 24.22  ? 3271 THR C OG1 1 
ATOM   10131 C CG2 . THR C  1 253 ? 13.529  -34.025 62.320  1.00 22.91  ? 3271 THR C CG2 1 
ATOM   10132 N N   . ALA C  1 254 ? 15.215  -34.509 58.859  1.00 22.47  ? 3272 ALA C N   1 
ATOM   10133 C CA  . ALA C  1 254 ? 15.363  -33.500 57.820  1.00 24.03  ? 3272 ALA C CA  1 
ATOM   10134 C C   . ALA C  1 254 ? 14.772  -33.993 56.500  1.00 25.56  ? 3272 ALA C C   1 
ATOM   10135 O O   . ALA C  1 254 ? 14.720  -33.252 55.520  1.00 28.50  ? 3272 ALA C O   1 
ATOM   10136 C CB  . ALA C  1 254 ? 16.837  -33.146 57.637  1.00 23.90  ? 3272 ALA C CB  1 
ATOM   10137 N N   . GLY C  1 255 ? 14.327  -35.245 56.480  1.00 25.48  ? 3273 GLY C N   1 
ATOM   10138 C CA  . GLY C  1 255 ? 13.748  -35.805 55.272  1.00 27.46  ? 3273 GLY C CA  1 
ATOM   10139 C C   . GLY C  1 255 ? 14.796  -36.356 54.322  1.00 28.78  ? 3273 GLY C C   1 
ATOM   10140 O O   . GLY C  1 255 ? 14.593  -36.390 53.110  1.00 28.68  ? 3273 GLY C O   1 
ATOM   10141 N N   . CYS C  1 256 ? 15.919  -36.790 54.882  1.00 27.51  ? 3274 CYS C N   1 
ATOM   10142 C CA  . CYS C  1 256 ? 17.018  -37.336 54.103  1.00 29.15  ? 3274 CYS C CA  1 
ATOM   10143 C C   . CYS C  1 256 ? 17.099  -38.852 54.185  1.00 28.62  ? 3274 CYS C C   1 
ATOM   10144 O O   . CYS C  1 256 ? 16.700  -39.449 55.183  1.00 28.39  ? 3274 CYS C O   1 
ATOM   10145 C CB  . CYS C  1 256 ? 18.343  -36.760 54.596  1.00 30.42  ? 3274 CYS C CB  1 
ATOM   10146 S SG  . CYS C  1 256 ? 18.641  -35.030 54.133  1.00 30.54  ? 3274 CYS C SG  1 
ATOM   10147 N N   . LYS C  1 257 ? 17.625  -39.469 53.132  1.00 28.27  ? 3275 LYS C N   1 
ATOM   10148 C CA  . LYS C  1 257 ? 17.797  -40.915 53.120  1.00 28.79  ? 3275 LYS C CA  1 
ATOM   10149 C C   . LYS C  1 257 ? 19.059  -41.222 53.915  1.00 26.48  ? 3275 LYS C C   1 
ATOM   10150 O O   . LYS C  1 257 ? 19.916  -40.354 54.078  1.00 27.42  ? 3275 LYS C O   1 
ATOM   10151 C CB  . LYS C  1 257 ? 17.930  -41.426 51.682  1.00 31.23  ? 3275 LYS C CB  1 
ATOM   10152 C CG  . LYS C  1 257 ? 16.632  -41.316 50.897  1.00 34.37  ? 3275 LYS C CG  1 
ATOM   10153 C CD  . LYS C  1 257 ? 16.712  -41.998 49.547  1.00 36.76  ? 3275 LYS C CD  1 
ATOM   10154 C CE  . LYS C  1 257 ? 15.369  -41.919 48.838  1.00 39.10  ? 3275 LYS C CE  1 
ATOM   10155 N NZ  . LYS C  1 257 ? 15.410  -42.517 47.472  1.00 42.68  ? 3275 LYS C NZ  1 
ATOM   10156 N N   . THR C  1 258 ? 19.177  -42.447 54.413  1.00 24.67  ? 3276 THR C N   1 
ATOM   10157 C CA  . THR C  1 258 ? 20.342  -42.830 55.206  1.00 24.58  ? 3276 THR C CA  1 
ATOM   10158 C C   . THR C  1 258 ? 21.110  -43.992 54.580  1.00 23.27  ? 3276 THR C C   1 
ATOM   10159 O O   . THR C  1 258 ? 21.769  -44.764 55.275  1.00 21.85  ? 3276 THR C O   1 
ATOM   10160 C CB  . THR C  1 258 ? 19.914  -43.224 56.634  1.00 26.10  ? 3276 THR C CB  1 
ATOM   10161 O OG1 . THR C  1 258 ? 19.035  -44.357 56.577  1.00 26.36  ? 3276 THR C OG1 1 
ATOM   10162 C CG2 . THR C  1 258 ? 19.182  -42.069 57.303  1.00 25.61  ? 3276 THR C CG2 1 
ATOM   10163 N N   . THR C  1 259 ? 21.030  -44.098 53.259  1.00 20.41  ? 3277 THR C N   1 
ATOM   10164 C CA  . THR C  1 259 ? 21.692  -45.167 52.524  1.00 19.32  ? 3277 THR C CA  1 
ATOM   10165 C C   . THR C  1 259 ? 23.161  -45.310 52.908  1.00 18.59  ? 3277 THR C C   1 
ATOM   10166 O O   . THR C  1 259 ? 23.632  -46.409 53.185  1.00 18.01  ? 3277 THR C O   1 
ATOM   10167 C CB  . THR C  1 259 ? 21.562  -44.916 51.017  1.00 19.54  ? 3277 THR C CB  1 
ATOM   10168 O OG1 . THR C  1 259 ? 20.216  -44.514 50.736  1.00 21.14  ? 3277 THR C OG1 1 
ATOM   10169 C CG2 . THR C  1 259 ? 21.872  -46.183 50.234  1.00 21.77  ? 3277 THR C CG2 1 
ATOM   10170 N N   . THR C  1 260 ? 23.882  -44.195 52.926  1.00 17.43  ? 3278 THR C N   1 
ATOM   10171 C CA  . THR C  1 260 ? 25.288  -44.196 53.304  1.00 19.40  ? 3278 THR C CA  1 
ATOM   10172 C C   . THR C  1 260 ? 25.585  -42.862 53.977  1.00 17.73  ? 3278 THR C C   1 
ATOM   10173 O O   . THR C  1 260 ? 24.756  -41.952 53.944  1.00 18.28  ? 3278 THR C O   1 
ATOM   10174 C CB  . THR C  1 260 ? 26.215  -44.313 52.072  1.00 20.94  ? 3278 THR C CB  1 
ATOM   10175 O OG1 . THR C  1 260 ? 26.036  -43.162 51.236  1.00 22.98  ? 3278 THR C OG1 1 
ATOM   10176 C CG2 . THR C  1 260 ? 25.896  -45.570 51.265  1.00 22.70  ? 3278 THR C CG2 1 
ATOM   10177 N N   . SER C  1 261 ? 26.771  -42.752 54.564  1.00 19.45  ? 3279 SER C N   1 
ATOM   10178 C CA  . SER C  1 261 ? 27.207  -41.524 55.219  1.00 20.61  ? 3279 SER C CA  1 
ATOM   10179 C C   . SER C  1 261 ? 27.328  -40.404 54.195  1.00 20.35  ? 3279 SER C C   1 
ATOM   10180 O O   . SER C  1 261 ? 26.852  -39.295 54.422  1.00 19.11  ? 3279 SER C O   1 
ATOM   10181 C CB  . SER C  1 261 ? 28.571  -41.721 55.886  1.00 21.15  ? 3279 SER C CB  1 
ATOM   10182 O OG  . SER C  1 261 ? 28.516  -42.699 56.903  1.00 25.70  ? 3279 SER C OG  1 
ATOM   10183 N N   . ALA C  1 262 ? 27.982  -40.694 53.069  1.00 19.63  ? 3280 ALA C N   1 
ATOM   10184 C CA  . ALA C  1 262 ? 28.154  -39.694 52.022  1.00 16.97  ? 3280 ALA C CA  1 
ATOM   10185 C C   . ALA C  1 262 ? 26.799  -39.200 51.545  1.00 15.68  ? 3280 ALA C C   1 
ATOM   10186 O O   . ALA C  1 262 ? 26.627  -38.017 51.281  1.00 17.96  ? 3280 ALA C O   1 
ATOM   10187 C CB  . ALA C  1 262 ? 28.939  -40.279 50.844  1.00 18.81  ? 3280 ALA C CB  1 
ATOM   10188 N N   . VAL C  1 263 ? 25.842  -40.111 51.415  1.00 15.91  ? 3281 VAL C N   1 
ATOM   10189 C CA  . VAL C  1 263 ? 24.504  -39.734 50.972  1.00 15.93  ? 3281 VAL C CA  1 
ATOM   10190 C C   . VAL C  1 263 ? 23.854  -38.776 51.984  1.00 16.41  ? 3281 VAL C C   1 
ATOM   10191 O O   . VAL C  1 263 ? 23.290  -37.747 51.610  1.00 18.65  ? 3281 VAL C O   1 
ATOM   10192 C CB  . VAL C  1 263 ? 23.608  -40.992 50.779  1.00 19.08  ? 3281 VAL C CB  1 
ATOM   10193 C CG1 . VAL C  1 263 ? 22.139  -40.589 50.659  1.00 18.86  ? 3281 VAL C CG1 1 
ATOM   10194 C CG2 . VAL C  1 263 ? 24.034  -41.749 49.512  1.00 19.94  ? 3281 VAL C CG2 1 
ATOM   10195 N N   . MET C  1 264 ? 23.948  -39.104 53.267  1.00 17.27  ? 3282 MET C N   1 
ATOM   10196 C CA  . MET C  1 264 ? 23.363  -38.254 54.299  1.00 18.89  ? 3282 MET C CA  1 
ATOM   10197 C C   . MET C  1 264 ? 23.929  -36.840 54.269  1.00 17.96  ? 3282 MET C C   1 
ATOM   10198 O O   . MET C  1 264 ? 23.182  -35.867 54.204  1.00 18.27  ? 3282 MET C O   1 
ATOM   10199 C CB  . MET C  1 264 ? 23.593  -38.856 55.687  1.00 19.00  ? 3282 MET C CB  1 
ATOM   10200 C CG  . MET C  1 264 ? 22.709  -40.043 55.996  1.00 25.76  ? 3282 MET C CG  1 
ATOM   10201 S SD  . MET C  1 264 ? 22.824  -40.501 57.736  1.00 31.79  ? 3282 MET C SD  1 
ATOM   10202 C CE  . MET C  1 264 ? 24.189  -41.625 57.676  1.00 28.73  ? 3282 MET C CE  1 
ATOM   10203 N N   . VAL C  1 265 ? 25.253  -36.730 54.321  1.00 18.85  ? 3283 VAL C N   1 
ATOM   10204 C CA  . VAL C  1 265 ? 25.902  -35.426 54.308  1.00 18.72  ? 3283 VAL C CA  1 
ATOM   10205 C C   . VAL C  1 265 ? 25.533  -34.631 53.057  1.00 18.88  ? 3283 VAL C C   1 
ATOM   10206 O O   . VAL C  1 265 ? 25.230  -33.437 53.137  1.00 17.92  ? 3283 VAL C O   1 
ATOM   10207 C CB  . VAL C  1 265 ? 27.444  -35.571 54.406  1.00 20.30  ? 3283 VAL C CB  1 
ATOM   10208 C CG1 . VAL C  1 265 ? 28.115  -34.196 54.382  1.00 22.95  ? 3283 VAL C CG1 1 
ATOM   10209 C CG2 . VAL C  1 265 ? 27.806  -36.292 55.693  1.00 23.29  ? 3283 VAL C CG2 1 
ATOM   10210 N N   . HIS C  1 266 ? 25.546  -35.286 51.899  1.00 17.72  ? 3284 HIS C N   1 
ATOM   10211 C CA  . HIS C  1 266 ? 25.204  -34.596 50.659  1.00 16.96  ? 3284 HIS C CA  1 
ATOM   10212 C C   . HIS C  1 266 ? 23.789  -34.028 50.706  1.00 17.10  ? 3284 HIS C C   1 
ATOM   10213 O O   . HIS C  1 266 ? 23.556  -32.897 50.284  1.00 17.89  ? 3284 HIS C O   1 
ATOM   10214 C CB  . HIS C  1 266 ? 25.329  -35.534 49.462  1.00 19.36  ? 3284 HIS C CB  1 
ATOM   10215 C CG  . HIS C  1 266 ? 24.920  -34.904 48.168  1.00 21.34  ? 3284 HIS C CG  1 
ATOM   10216 N ND1 . HIS C  1 266 ? 25.589  -33.829 47.621  1.00 21.42  ? 3284 HIS C ND1 1 
ATOM   10217 C CD2 . HIS C  1 266 ? 23.889  -35.170 47.333  1.00 21.93  ? 3284 HIS C CD2 1 
ATOM   10218 C CE1 . HIS C  1 266 ? 24.985  -33.460 46.505  1.00 21.67  ? 3284 HIS C CE1 1 
ATOM   10219 N NE2 . HIS C  1 266 ? 23.951  -34.258 46.308  1.00 23.46  ? 3284 HIS C NE2 1 
ATOM   10220 N N   . CYS C  1 267 ? 22.845  -34.823 51.199  1.00 16.44  ? 3285 CYS C N   1 
ATOM   10221 C CA  . CYS C  1 267 ? 21.455  -34.380 51.313  1.00 20.30  ? 3285 CYS C CA  1 
ATOM   10222 C C   . CYS C  1 267 ? 21.355  -33.208 52.294  1.00 18.51  ? 3285 CYS C C   1 
ATOM   10223 O O   . CYS C  1 267 ? 20.681  -32.215 52.023  1.00 18.14  ? 3285 CYS C O   1 
ATOM   10224 C CB  . CYS C  1 267 ? 20.569  -35.534 51.801  1.00 21.39  ? 3285 CYS C CB  1 
ATOM   10225 S SG  . CYS C  1 267 ? 18.808  -35.136 52.097  1.00 32.21  ? 3285 CYS C SG  1 
ATOM   10226 N N   . LEU C  1 268 ? 22.027  -33.325 53.433  1.00 18.54  ? 3286 LEU C N   1 
ATOM   10227 C CA  . LEU C  1 268 ? 21.985  -32.260 54.426  1.00 20.37  ? 3286 LEU C CA  1 
ATOM   10228 C C   . LEU C  1 268 ? 22.641  -30.974 53.921  1.00 20.74  ? 3286 LEU C C   1 
ATOM   10229 O O   . LEU C  1 268 ? 22.252  -29.882 54.322  1.00 20.88  ? 3286 LEU C O   1 
ATOM   10230 C CB  . LEU C  1 268 ? 22.638  -32.722 55.733  1.00 21.20  ? 3286 LEU C CB  1 
ATOM   10231 C CG  . LEU C  1 268 ? 21.827  -33.742 56.546  1.00 22.13  ? 3286 LEU C CG  1 
ATOM   10232 C CD1 . LEU C  1 268 ? 22.653  -34.254 57.713  1.00 21.89  ? 3286 LEU C CD1 1 
ATOM   10233 C CD2 . LEU C  1 268 ? 20.540  -33.092 57.046  1.00 22.67  ? 3286 LEU C CD2 1 
ATOM   10234 N N   . ARG C  1 269 ? 23.633  -31.090 53.043  1.00 20.37  ? 3287 ARG C N   1 
ATOM   10235 C CA  . ARG C  1 269 ? 24.273  -29.890 52.509  1.00 20.45  ? 3287 ARG C CA  1 
ATOM   10236 C C   . ARG C  1 269 ? 23.340  -29.167 51.546  1.00 20.70  ? 3287 ARG C C   1 
ATOM   10237 O O   . ARG C  1 269 ? 23.536  -27.995 51.250  1.00 20.30  ? 3287 ARG C O   1 
ATOM   10238 C CB  . ARG C  1 269 ? 25.569  -30.232 51.780  1.00 21.61  ? 3287 ARG C CB  1 
ATOM   10239 C CG  . ARG C  1 269 ? 26.750  -30.412 52.695  1.00 24.68  ? 3287 ARG C CG  1 
ATOM   10240 C CD  . ARG C  1 269 ? 28.031  -30.561 51.895  1.00 26.14  ? 3287 ARG C CD  1 
ATOM   10241 N NE  . ARG C  1 269 ? 29.184  -30.685 52.777  1.00 25.58  ? 3287 ARG C NE  1 
ATOM   10242 C CZ  . ARG C  1 269 ? 29.995  -31.734 52.801  1.00 24.73  ? 3287 ARG C CZ  1 
ATOM   10243 N NH1 . ARG C  1 269 ? 29.783  -32.762 51.989  1.00 26.64  ? 3287 ARG C NH1 1 
ATOM   10244 N NH2 . ARG C  1 269 ? 31.019  -31.753 53.636  1.00 25.90  ? 3287 ARG C NH2 1 
ATOM   10245 N N   . GLN C  1 270 ? 22.321  -29.874 51.067  1.00 20.43  ? 3288 GLN C N   1 
ATOM   10246 C CA  . GLN C  1 270 ? 21.352  -29.300 50.136  1.00 23.56  ? 3288 GLN C CA  1 
ATOM   10247 C C   . GLN C  1 270 ? 20.217  -28.565 50.851  1.00 22.39  ? 3288 GLN C C   1 
ATOM   10248 O O   . GLN C  1 270 ? 19.558  -27.705 50.265  1.00 21.84  ? 3288 GLN C O   1 
ATOM   10249 C CB  . GLN C  1 270 ? 20.751  -30.404 49.268  1.00 27.73  ? 3288 GLN C CB  1 
ATOM   10250 C CG  . GLN C  1 270 ? 21.782  -31.261 48.574  1.00 35.23  ? 3288 GLN C CG  1 
ATOM   10251 C CD  . GLN C  1 270 ? 22.496  -30.517 47.481  1.00 38.20  ? 3288 GLN C CD  1 
ATOM   10252 O OE1 . GLN C  1 270 ? 21.906  -30.193 46.451  1.00 44.45  ? 3288 GLN C OE1 1 
ATOM   10253 N NE2 . GLN C  1 270 ? 23.774  -30.231 47.697  1.00 41.21  ? 3288 GLN C NE2 1 
ATOM   10254 N N   . LYS C  1 271 ? 19.982  -28.911 52.113  1.00 20.55  ? 3289 LYS C N   1 
ATOM   10255 C CA  . LYS C  1 271 ? 18.912  -28.280 52.883  1.00 19.63  ? 3289 LYS C CA  1 
ATOM   10256 C C   . LYS C  1 271 ? 19.161  -26.792 53.091  1.00 18.52  ? 3289 LYS C C   1 
ATOM   10257 O O   . LYS C  1 271 ? 20.304  -26.361 53.220  1.00 18.81  ? 3289 LYS C O   1 
ATOM   10258 C CB  . LYS C  1 271 ? 18.773  -28.962 54.244  1.00 18.74  ? 3289 LYS C CB  1 
ATOM   10259 C CG  . LYS C  1 271 ? 18.418  -30.440 54.165  1.00 20.61  ? 3289 LYS C CG  1 
ATOM   10260 C CD  . LYS C  1 271 ? 17.066  -30.655 53.507  1.00 22.32  ? 3289 LYS C CD  1 
ATOM   10261 C CE  . LYS C  1 271 ? 16.764  -32.138 53.361  1.00 24.89  ? 3289 LYS C CE  1 
ATOM   10262 N NZ  . LYS C  1 271 ? 15.427  -32.385 52.753  1.00 26.97  ? 3289 LYS C NZ  1 
ATOM   10263 N N   . THR C  1 272 ? 18.088  -26.008 53.127  1.00 16.84  ? 3290 THR C N   1 
ATOM   10264 C CA  . THR C  1 272 ? 18.213  -24.571 53.350  1.00 18.26  ? 3290 THR C CA  1 
ATOM   10265 C C   . THR C  1 272 ? 18.489  -24.345 54.833  1.00 19.09  ? 3290 THR C C   1 
ATOM   10266 O O   . THR C  1 272 ? 18.273  -25.247 55.652  1.00 16.56  ? 3290 THR C O   1 
ATOM   10267 C CB  . THR C  1 272 ? 16.913  -23.817 52.994  1.00 17.60  ? 3290 THR C CB  1 
ATOM   10268 O OG1 . THR C  1 272 ? 15.844  -24.312 53.810  1.00 18.52  ? 3290 THR C OG1 1 
ATOM   10269 C CG2 . THR C  1 272 ? 16.558  -24.007 51.516  1.00 19.12  ? 3290 THR C CG2 1 
ATOM   10270 N N   . GLU C  1 273 ? 18.966  -23.151 55.176  1.00 18.81  ? 3291 GLU C N   1 
ATOM   10271 C CA  . GLU C  1 273 ? 19.243  -22.828 56.573  1.00 22.08  ? 3291 GLU C CA  1 
ATOM   10272 C C   . GLU C  1 273 ? 17.954  -23.006 57.372  1.00 20.53  ? 3291 GLU C C   1 
ATOM   10273 O O   . GLU C  1 273 ? 17.966  -23.543 58.479  1.00 18.27  ? 3291 GLU C O   1 
ATOM   10274 C CB  . GLU C  1 273 ? 19.742  -21.380 56.718  1.00 22.84  ? 3291 GLU C CB  1 
ATOM   10275 C CG  . GLU C  1 273 ? 19.745  -20.881 58.171  1.00 27.70  ? 3291 GLU C CG  1 
ATOM   10276 C CD  . GLU C  1 273 ? 20.093  -19.399 58.305  1.00 32.14  ? 3291 GLU C CD  1 
ATOM   10277 O OE1 . GLU C  1 273 ? 19.575  -18.584 57.514  1.00 33.89  ? 3291 GLU C OE1 1 
ATOM   10278 O OE2 . GLU C  1 273 ? 20.876  -19.047 59.213  1.00 34.81  ? 3291 GLU C OE2 1 
ATOM   10279 N N   . GLU C  1 274 ? 16.846  -22.554 56.795  1.00 21.86  ? 3292 GLU C N   1 
ATOM   10280 C CA  . GLU C  1 274 ? 15.542  -22.660 57.440  1.00 22.66  ? 3292 GLU C CA  1 
ATOM   10281 C C   . GLU C  1 274 ? 15.170  -24.126 57.666  1.00 21.69  ? 3292 GLU C C   1 
ATOM   10282 O O   . GLU C  1 274 ? 14.689  -24.492 58.740  1.00 20.72  ? 3292 GLU C O   1 
ATOM   10283 C CB  . GLU C  1 274 ? 14.480  -21.966 56.582  1.00 29.21  ? 3292 GLU C CB  1 
ATOM   10284 C CG  . GLU C  1 274 ? 13.063  -22.054 57.128  1.00 38.09  ? 3292 GLU C CG  1 
ATOM   10285 C CD  . GLU C  1 274 ? 12.096  -21.129 56.402  1.00 45.25  ? 3292 GLU C CD  1 
ATOM   10286 O OE1 . GLU C  1 274 ? 11.955  -21.256 55.163  1.00 49.45  ? 3292 GLU C OE1 1 
ATOM   10287 O OE2 . GLU C  1 274 ? 11.473  -20.272 57.070  1.00 49.69  ? 3292 GLU C OE2 1 
ATOM   10288 N N   . GLU C  1 275 ? 15.400  -24.964 56.659  1.00 18.74  ? 3293 GLU C N   1 
ATOM   10289 C CA  . GLU C  1 275 ? 15.093  -26.390 56.775  1.00 18.86  ? 3293 GLU C CA  1 
ATOM   10290 C C   . GLU C  1 275 ? 15.867  -27.047 57.916  1.00 18.22  ? 3293 GLU C C   1 
ATOM   10291 O O   . GLU C  1 275 ? 15.325  -27.885 58.638  1.00 19.45  ? 3293 GLU C O   1 
ATOM   10292 C CB  . GLU C  1 275 ? 15.382  -27.106 55.446  1.00 19.84  ? 3293 GLU C CB  1 
ATOM   10293 C CG  . GLU C  1 275 ? 14.304  -26.874 54.387  1.00 24.37  ? 3293 GLU C CG  1 
ATOM   10294 C CD  . GLU C  1 275 ? 14.700  -27.344 52.984  1.00 28.08  ? 3293 GLU C CD  1 
ATOM   10295 O OE1 . GLU C  1 275 ? 13.786  -27.556 52.161  1.00 32.55  ? 3293 GLU C OE1 1 
ATOM   10296 O OE2 . GLU C  1 275 ? 15.907  -27.487 52.692  1.00 24.65  ? 3293 GLU C OE2 1 
ATOM   10297 N N   . LEU C  1 276 ? 17.132  -26.672 58.090  1.00 17.96  ? 3294 LEU C N   1 
ATOM   10298 C CA  . LEU C  1 276 ? 17.929  -27.246 59.171  1.00 18.98  ? 3294 LEU C CA  1 
ATOM   10299 C C   . LEU C  1 276 ? 17.517  -26.663 60.526  1.00 18.40  ? 3294 LEU C C   1 
ATOM   10300 O O   . LEU C  1 276 ? 17.638  -27.324 61.563  1.00 18.92  ? 3294 LEU C O   1 
ATOM   10301 C CB  . LEU C  1 276 ? 19.426  -27.021 58.921  1.00 20.22  ? 3294 LEU C CB  1 
ATOM   10302 C CG  . LEU C  1 276 ? 20.014  -27.831 57.760  1.00 21.69  ? 3294 LEU C CG  1 
ATOM   10303 C CD1 . LEU C  1 276 ? 21.523  -27.620 57.704  1.00 22.27  ? 3294 LEU C CD1 1 
ATOM   10304 C CD2 . LEU C  1 276 ? 19.695  -29.314 57.947  1.00 20.98  ? 3294 LEU C CD2 1 
ATOM   10305 N N   . LEU C  1 277 ? 17.031  -25.427 60.522  1.00 17.30  ? 3295 LEU C N   1 
ATOM   10306 C CA  . LEU C  1 277 ? 16.576  -24.817 61.766  1.00 20.81  ? 3295 LEU C CA  1 
ATOM   10307 C C   . LEU C  1 277 ? 15.303  -25.546 62.223  1.00 19.61  ? 3295 LEU C C   1 
ATOM   10308 O O   . LEU C  1 277 ? 15.130  -25.833 63.403  1.00 20.03  ? 3295 LEU C O   1 
ATOM   10309 C CB  . LEU C  1 277 ? 16.291  -23.326 61.565  1.00 20.11  ? 3295 LEU C CB  1 
ATOM   10310 C CG  . LEU C  1 277 ? 15.781  -22.590 62.809  1.00 22.87  ? 3295 LEU C CG  1 
ATOM   10311 C CD1 . LEU C  1 277 ? 16.690  -22.884 63.997  1.00 21.68  ? 3295 LEU C CD1 1 
ATOM   10312 C CD2 . LEU C  1 277 ? 15.730  -21.092 62.525  1.00 23.29  ? 3295 LEU C CD2 1 
ATOM   10313 N N   . GLU C  1 278 ? 14.422  -25.855 61.280  1.00 21.04  ? 3296 GLU C N   1 
ATOM   10314 C CA  . GLU C  1 278 ? 13.190  -26.568 61.603  1.00 22.85  ? 3296 GLU C CA  1 
ATOM   10315 C C   . GLU C  1 278 ? 13.511  -27.977 62.106  1.00 23.26  ? 3296 GLU C C   1 
ATOM   10316 O O   . GLU C  1 278 ? 12.819  -28.509 62.973  1.00 24.00  ? 3296 GLU C O   1 
ATOM   10317 C CB  . GLU C  1 278 ? 12.284  -26.620 60.371  1.00 26.14  ? 3296 GLU C CB  1 
ATOM   10318 C CG  . GLU C  1 278 ? 11.688  -25.260 60.033  1.00 33.15  ? 3296 GLU C CG  1 
ATOM   10319 C CD  . GLU C  1 278 ? 11.139  -25.170 58.622  1.00 38.12  ? 3296 GLU C CD  1 
ATOM   10320 O OE1 . GLU C  1 278 ? 10.543  -24.120 58.293  1.00 39.57  ? 3296 GLU C OE1 1 
ATOM   10321 O OE2 . GLU C  1 278 ? 11.308  -26.136 57.843  1.00 42.49  ? 3296 GLU C OE2 1 
ATOM   10322 N N   . THR C  1 279 ? 14.568  -28.576 61.566  1.00 22.51  ? 3297 THR C N   1 
ATOM   10323 C CA  . THR C  1 279 ? 14.980  -29.908 61.994  1.00 20.49  ? 3297 THR C CA  1 
ATOM   10324 C C   . THR C  1 279 ? 15.449  -29.791 63.444  1.00 20.44  ? 3297 THR C C   1 
ATOM   10325 O O   . THR C  1 279 ? 15.136  -30.627 64.285  1.00 21.20  ? 3297 THR C O   1 
ATOM   10326 C CB  . THR C  1 279 ? 16.141  -30.443 61.122  1.00 20.30  ? 3297 THR C CB  1 
ATOM   10327 O OG1 . THR C  1 279 ? 15.696  -30.578 59.765  1.00 20.35  ? 3297 THR C OG1 1 
ATOM   10328 C CG2 . THR C  1 279 ? 16.624  -31.795 61.633  1.00 17.83  ? 3297 THR C CG2 1 
ATOM   10329 N N   . THR C  1 280 ? 16.202  -28.734 63.721  1.00 21.58  ? 3298 THR C N   1 
ATOM   10330 C CA  . THR C  1 280 ? 16.723  -28.473 65.056  1.00 21.30  ? 3298 THR C CA  1 
ATOM   10331 C C   . THR C  1 280 ? 15.577  -28.382 66.060  1.00 21.65  ? 3298 THR C C   1 
ATOM   10332 O O   . THR C  1 280 ? 15.623  -28.994 67.121  1.00 21.31  ? 3298 THR C O   1 
ATOM   10333 C CB  . THR C  1 280 ? 17.518  -27.155 65.073  1.00 20.81  ? 3298 THR C CB  1 
ATOM   10334 O OG1 . THR C  1 280 ? 18.591  -27.241 64.132  1.00 23.68  ? 3298 THR C OG1 1 
ATOM   10335 C CG2 . THR C  1 280 ? 18.084  -26.873 66.458  1.00 19.05  ? 3298 THR C CG2 1 
ATOM   10336 N N   . LEU C  1 281 ? 14.547  -27.616 65.714  1.00 23.45  ? 3299 LEU C N   1 
ATOM   10337 C CA  . LEU C  1 281 ? 13.392  -27.446 66.583  1.00 24.88  ? 3299 LEU C CA  1 
ATOM   10338 C C   . LEU C  1 281 ? 12.625  -28.753 66.803  1.00 25.70  ? 3299 LEU C C   1 
ATOM   10339 O O   . LEU C  1 281 ? 12.166  -29.023 67.914  1.00 23.92  ? 3299 LEU C O   1 
ATOM   10340 C CB  . LEU C  1 281 ? 12.464  -26.367 66.010  1.00 28.80  ? 3299 LEU C CB  1 
ATOM   10341 C CG  . LEU C  1 281 ? 12.841  -24.912 66.324  1.00 32.04  ? 3299 LEU C CG  1 
ATOM   10342 C CD1 . LEU C  1 281 ? 14.301  -24.666 66.022  1.00 34.31  ? 3299 LEU C CD1 1 
ATOM   10343 C CD2 . LEU C  1 281 ? 11.964  -23.967 65.516  1.00 33.79  ? 3299 LEU C CD2 1 
ATOM   10344 N N   . LYS C  1 282 ? 12.498  -29.566 65.755  1.00 24.09  ? 3300 LYS C N   1 
ATOM   10345 C CA  . LYS C  1 282 ? 11.793  -30.841 65.871  1.00 25.52  ? 3300 LYS C CA  1 
ATOM   10346 C C   . LYS C  1 282 ? 12.532  -31.812 66.785  1.00 25.22  ? 3300 LYS C C   1 
ATOM   10347 O O   . LYS C  1 282 ? 11.908  -32.652 67.424  1.00 26.97  ? 3300 LYS C O   1 
ATOM   10348 C CB  . LYS C  1 282 ? 11.611  -31.502 64.498  1.00 27.17  ? 3300 LYS C CB  1 
ATOM   10349 C CG  . LYS C  1 282 ? 10.744  -30.731 63.528  1.00 28.63  ? 3300 LYS C CG  1 
ATOM   10350 C CD  . LYS C  1 282 ? 10.526  -31.522 62.244  1.00 32.24  ? 3300 LYS C CD  1 
ATOM   10351 C CE  . LYS C  1 282 ? 9.826   -30.669 61.190  1.00 36.72  ? 3300 LYS C CE  1 
ATOM   10352 N NZ  . LYS C  1 282 ? 9.645   -31.382 59.893  1.00 38.36  ? 3300 LYS C NZ  1 
ATOM   10353 N N   . MET C  1 283 ? 13.857  -31.700 66.839  1.00 25.83  ? 3301 MET C N   1 
ATOM   10354 C CA  . MET C  1 283 ? 14.681  -32.577 67.675  1.00 26.61  ? 3301 MET C CA  1 
ATOM   10355 C C   . MET C  1 283 ? 14.557  -32.225 69.159  1.00 27.26  ? 3301 MET C C   1 
ATOM   10356 O O   . MET C  1 283 ? 14.911  -33.024 70.025  1.00 25.93  ? 3301 MET C O   1 
ATOM   10357 C CB  . MET C  1 283 ? 16.159  -32.464 67.279  1.00 27.28  ? 3301 MET C CB  1 
ATOM   10358 C CG  . MET C  1 283 ? 16.522  -32.930 65.868  1.00 30.52  ? 3301 MET C CG  1 
ATOM   10359 S SD  . MET C  1 283 ? 16.526  -34.720 65.663  1.00 34.52  ? 3301 MET C SD  1 
ATOM   10360 C CE  . MET C  1 283 ? 17.892  -35.220 66.729  1.00 32.12  ? 3301 MET C CE  1 
ATOM   10361 N N   . LYS C  1 284 ? 14.071  -31.021 69.437  1.00 28.66  ? 3302 LYS C N   1 
ATOM   10362 C CA  . LYS C  1 284 ? 13.905  -30.527 70.803  1.00 32.06  ? 3302 LYS C CA  1 
ATOM   10363 C C   . LYS C  1 284 ? 15.175  -30.736 71.631  1.00 30.78  ? 3302 LYS C C   1 
ATOM   10364 O O   . LYS C  1 284 ? 15.165  -31.439 72.639  1.00 30.29  ? 3302 LYS C O   1 
ATOM   10365 C CB  . LYS C  1 284 ? 12.714  -31.217 71.481  1.00 35.15  ? 3302 LYS C CB  1 
ATOM   10366 C CG  . LYS C  1 284 ? 12.931  -32.682 71.811  1.00 43.06  ? 3302 LYS C CG  1 
ATOM   10367 C CD  . LYS C  1 284 ? 11.814  -33.257 72.661  1.00 48.89  ? 3302 LYS C CD  1 
ATOM   10368 C CE  . LYS C  1 284 ? 12.069  -34.732 72.955  1.00 52.19  ? 3302 LYS C CE  1 
ATOM   10369 N NZ  . LYS C  1 284 ? 10.937  -35.369 73.691  1.00 55.24  ? 3302 LYS C NZ  1 
ATOM   10370 N N   . PHE C  1 285 ? 16.270  -30.117 71.204  1.00 29.76  ? 3303 PHE C N   1 
ATOM   10371 C CA  . PHE C  1 285 ? 17.536  -30.257 71.915  1.00 30.48  ? 3303 PHE C CA  1 
ATOM   10372 C C   . PHE C  1 285 ? 17.541  -29.460 73.210  1.00 32.02  ? 3303 PHE C C   1 
ATOM   10373 O O   . PHE C  1 285 ? 16.663  -28.651 73.446  1.00 29.86  ? 3303 PHE C O   1 
ATOM   10374 C CB  . PHE C  1 285 ? 18.693  -29.771 71.043  1.00 28.29  ? 3303 PHE C CB  1 
ATOM   10375 C CG  . PHE C  1 285 ? 18.991  -30.662 69.878  1.00 27.47  ? 3303 PHE C CG  1 
ATOM   10376 C CD1 . PHE C  1 285 ? 18.920  -30.171 68.578  1.00 27.29  ? 3303 PHE C CD1 1 
ATOM   10377 C CD2 . PHE C  1 285 ? 19.362  -31.989 70.078  1.00 26.55  ? 3303 PHE C CD2 1 
ATOM   10378 C CE1 . PHE C  1 285 ? 19.215  -30.982 67.491  1.00 24.42  ? 3303 PHE C CE1 1 
ATOM   10379 C CE2 . PHE C  1 285 ? 19.660  -32.816 68.995  1.00 27.24  ? 3303 PHE C CE2 1 
ATOM   10380 C CZ  . PHE C  1 285 ? 19.587  -32.310 67.698  1.00 25.81  ? 3303 PHE C CZ  1 
ATOM   10381 N N   . LEU C  1 286 ? 18.534  -29.696 74.055  1.00 33.97  ? 3304 LEU C N   1 
ATOM   10382 C CA  . LEU C  1 286 ? 18.642  -28.942 75.297  1.00 35.98  ? 3304 LEU C CA  1 
ATOM   10383 C C   . LEU C  1 286 ? 17.351  -28.958 76.109  1.00 36.18  ? 3304 LEU C C   1 
ATOM   10384 O O   . LEU C  1 286 ? 16.963  -27.948 76.700  1.00 36.02  ? 3304 LEU C O   1 
ATOM   10385 C CB  . LEU C  1 286 ? 19.012  -27.502 74.960  1.00 38.01  ? 3304 LEU C CB  1 
ATOM   10386 C CG  . LEU C  1 286 ? 20.439  -27.202 74.504  1.00 39.94  ? 3304 LEU C CG  1 
ATOM   10387 C CD1 . LEU C  1 286 ? 20.500  -25.828 73.854  1.00 42.27  ? 3304 LEU C CD1 1 
ATOM   10388 C CD2 . LEU C  1 286 ? 21.364  -27.267 75.704  1.00 42.90  ? 3304 LEU C CD2 1 
ATOM   10389 N N   . SER C  1 287 ? 16.699  -30.110 76.148  1.00 35.97  ? 3305 SER C N   1 
ATOM   10390 C CA  . SER C  1 287 ? 15.449  -30.241 76.870  1.00 36.13  ? 3305 SER C CA  1 
ATOM   10391 C C   . SER C  1 287 ? 15.302  -31.671 77.370  1.00 36.04  ? 3305 SER C C   1 
ATOM   10392 O O   . SER C  1 287 ? 15.391  -32.614 76.588  1.00 37.32  ? 3305 SER C O   1 
ATOM   10393 C CB  . SER C  1 287 ? 14.300  -29.898 75.934  1.00 35.98  ? 3305 SER C CB  1 
ATOM   10394 O OG  . SER C  1 287 ? 13.202  -29.412 76.667  1.00 38.31  ? 3305 SER C OG  1 
ATOM   10395 N N   . LEU C  1 288 ? 15.073  -31.833 78.668  1.00 35.25  ? 3306 LEU C N   1 
ATOM   10396 C CA  . LEU C  1 288 ? 14.937  -33.165 79.241  1.00 35.21  ? 3306 LEU C CA  1 
ATOM   10397 C C   . LEU C  1 288 ? 13.695  -33.877 78.716  1.00 34.93  ? 3306 LEU C C   1 
ATOM   10398 O O   . LEU C  1 288 ? 12.566  -33.436 78.944  1.00 34.36  ? 3306 LEU C O   1 
ATOM   10399 C CB  . LEU C  1 288 ? 14.876  -33.085 80.766  1.00 36.44  ? 3306 LEU C CB  1 
ATOM   10400 C CG  . LEU C  1 288 ? 15.061  -34.431 81.469  1.00 37.99  ? 3306 LEU C CG  1 
ATOM   10401 C CD1 . LEU C  1 288 ? 16.497  -34.899 81.279  1.00 39.51  ? 3306 LEU C CD1 1 
ATOM   10402 C CD2 . LEU C  1 288 ? 14.740  -34.298 82.946  1.00 38.89  ? 3306 LEU C CD2 1 
ATOM   10403 N N   . ASP C  1 289 ? 13.920  -34.977 78.007  1.00 34.59  ? 3307 ASP C N   1 
ATOM   10404 C CA  . ASP C  1 289 ? 12.849  -35.787 77.436  1.00 35.14  ? 3307 ASP C CA  1 
ATOM   10405 C C   . ASP C  1 289 ? 12.299  -36.728 78.512  1.00 35.25  ? 3307 ASP C C   1 
ATOM   10406 O O   . ASP C  1 289 ? 13.023  -37.573 79.042  1.00 34.30  ? 3307 ASP C O   1 
ATOM   10407 C CB  . ASP C  1 289 ? 13.404  -36.597 76.260  1.00 37.45  ? 3307 ASP C CB  1 
ATOM   10408 C CG  . ASP C  1 289 ? 12.347  -37.440 75.572  1.00 39.13  ? 3307 ASP C CG  1 
ATOM   10409 O OD1 . ASP C  1 289 ? 12.711  -38.185 74.637  1.00 40.42  ? 3307 ASP C OD1 1 
ATOM   10410 O OD2 . ASP C  1 289 ? 11.161  -37.358 75.957  1.00 39.48  ? 3307 ASP C OD2 1 
ATOM   10411 N N   . LEU C  1 290 ? 11.016  -36.584 78.826  1.00 35.87  ? 3308 LEU C N   1 
ATOM   10412 C CA  . LEU C  1 290 ? 10.388  -37.412 79.852  1.00 38.15  ? 3308 LEU C CA  1 
ATOM   10413 C C   . LEU C  1 290 ? 9.672   -38.645 79.304  1.00 39.37  ? 3308 LEU C C   1 
ATOM   10414 O O   . LEU C  1 290 ? 9.063   -39.400 80.062  1.00 39.75  ? 3308 LEU C O   1 
ATOM   10415 C CB  . LEU C  1 290 ? 9.392   -36.574 80.654  1.00 37.75  ? 3308 LEU C CB  1 
ATOM   10416 C CG  . LEU C  1 290 ? 9.931   -35.318 81.338  1.00 38.15  ? 3308 LEU C CG  1 
ATOM   10417 C CD1 . LEU C  1 290 ? 8.816   -34.677 82.133  1.00 36.69  ? 3308 LEU C CD1 1 
ATOM   10418 C CD2 . LEU C  1 290 ? 11.096  -35.671 82.247  1.00 36.58  ? 3308 LEU C CD2 1 
ATOM   10419 N N   . GLN C  1 291 ? 9.754   -38.853 77.994  1.00 40.51  ? 3309 GLN C N   1 
ATOM   10420 C CA  . GLN C  1 291 ? 9.089   -39.984 77.359  1.00 41.47  ? 3309 GLN C CA  1 
ATOM   10421 C C   . GLN C  1 291 ? 10.086  -41.012 76.822  1.00 41.53  ? 3309 GLN C C   1 
ATOM   10422 O O   . GLN C  1 291 ? 11.161  -40.658 76.334  1.00 41.52  ? 3309 GLN C O   1 
ATOM   10423 C CB  . GLN C  1 291 ? 8.200   -39.469 76.220  1.00 43.97  ? 3309 GLN C CB  1 
ATOM   10424 C CG  . GLN C  1 291 ? 7.147   -40.446 75.706  1.00 48.34  ? 3309 GLN C CG  1 
ATOM   10425 C CD  . GLN C  1 291 ? 7.741   -41.670 75.030  1.00 51.63  ? 3309 GLN C CD  1 
ATOM   10426 O OE1 . GLN C  1 291 ? 8.585   -41.555 74.137  1.00 52.95  ? 3309 GLN C OE1 1 
ATOM   10427 N NE2 . GLN C  1 291 ? 7.297   -42.851 75.450  1.00 51.64  ? 3309 GLN C NE2 1 
ATOM   10428 N N   . GLY C  1 292 ? 9.721   -42.286 76.930  1.00 41.09  ? 3310 GLY C N   1 
ATOM   10429 C CA  . GLY C  1 292 ? 10.569  -43.357 76.434  1.00 40.68  ? 3310 GLY C CA  1 
ATOM   10430 C C   . GLY C  1 292 ? 11.769  -43.713 77.290  1.00 41.10  ? 3310 GLY C C   1 
ATOM   10431 O O   . GLY C  1 292 ? 11.789  -43.470 78.499  1.00 41.25  ? 3310 GLY C O   1 
ATOM   10432 N N   . ASP C  1 293 ? 12.773  -44.301 76.644  1.00 40.83  ? 3311 ASP C N   1 
ATOM   10433 C CA  . ASP C  1 293 ? 14.004  -44.711 77.305  1.00 39.98  ? 3311 ASP C CA  1 
ATOM   10434 C C   . ASP C  1 293 ? 14.958  -43.522 77.419  1.00 38.81  ? 3311 ASP C C   1 
ATOM   10435 O O   . ASP C  1 293 ? 15.330  -42.919 76.414  1.00 37.96  ? 3311 ASP C O   1 
ATOM   10436 C CB  . ASP C  1 293 ? 14.666  -45.835 76.506  1.00 41.84  ? 3311 ASP C CB  1 
ATOM   10437 C CG  . ASP C  1 293 ? 15.827  -46.470 77.244  1.00 44.81  ? 3311 ASP C CG  1 
ATOM   10438 O OD1 . ASP C  1 293 ? 16.793  -45.752 77.575  1.00 45.99  ? 3311 ASP C OD1 1 
ATOM   10439 O OD2 . ASP C  1 293 ? 15.773  -47.693 77.492  1.00 47.27  ? 3311 ASP C OD2 1 
ATOM   10440 N N   . PRO C  1 294 ? 15.368  -43.173 78.651  1.00 38.50  ? 3312 PRO C N   1 
ATOM   10441 C CA  . PRO C  1 294 ? 16.279  -42.054 78.919  1.00 37.07  ? 3312 PRO C CA  1 
ATOM   10442 C C   . PRO C  1 294 ? 17.632  -42.206 78.231  1.00 37.41  ? 3312 PRO C C   1 
ATOM   10443 O O   . PRO C  1 294 ? 18.304  -41.218 77.936  1.00 36.71  ? 3312 PRO C O   1 
ATOM   10444 C CB  . PRO C  1 294 ? 16.421  -42.077 80.440  1.00 37.59  ? 3312 PRO C CB  1 
ATOM   10445 C CG  . PRO C  1 294 ? 15.143  -42.697 80.899  1.00 37.98  ? 3312 PRO C CG  1 
ATOM   10446 C CD  . PRO C  1 294 ? 14.951  -43.811 79.911  1.00 37.71  ? 3312 PRO C CD  1 
ATOM   10447 N N   . ARG C  1 295 ? 18.034  -43.449 77.988  1.00 37.95  ? 3313 ARG C N   1 
ATOM   10448 C CA  . ARG C  1 295 ? 19.316  -43.722 77.350  1.00 39.27  ? 3313 ARG C CA  1 
ATOM   10449 C C   . ARG C  1 295 ? 19.325  -43.370 75.869  1.00 39.60  ? 3313 ARG C C   1 
ATOM   10450 O O   . ARG C  1 295 ? 20.384  -43.338 75.243  1.00 39.68  ? 3313 ARG C O   1 
ATOM   10451 C CB  . ARG C  1 295 ? 19.688  -45.196 77.528  1.00 40.27  ? 3313 ARG C CB  1 
ATOM   10452 C CG  . ARG C  1 295 ? 19.984  -45.584 78.965  1.00 42.17  ? 3313 ARG C CG  1 
ATOM   10453 C CD  . ARG C  1 295 ? 20.158  -47.083 79.105  1.00 44.03  ? 3313 ARG C CD  1 
ATOM   10454 N NE  . ARG C  1 295 ? 18.929  -47.797 78.779  1.00 46.47  ? 3313 ARG C NE  1 
ATOM   10455 C CZ  . ARG C  1 295 ? 18.767  -49.110 78.907  1.00 48.61  ? 3313 ARG C CZ  1 
ATOM   10456 N NH1 . ARG C  1 295 ? 19.763  -49.864 79.355  1.00 49.29  ? 3313 ARG C NH1 1 
ATOM   10457 N NH2 . ARG C  1 295 ? 17.605  -49.669 78.597  1.00 48.59  ? 3313 ARG C NH2 1 
ATOM   10458 N N   . GLU C  1 296 ? 18.151  -43.095 75.309  1.00 39.71  ? 3314 GLU C N   1 
ATOM   10459 C CA  . GLU C  1 296 ? 18.062  -42.759 73.895  1.00 41.08  ? 3314 GLU C CA  1 
ATOM   10460 C C   . GLU C  1 296 ? 17.874  -41.272 73.611  1.00 40.28  ? 3314 GLU C C   1 
ATOM   10461 O O   . GLU C  1 296 ? 17.922  -40.850 72.456  1.00 39.32  ? 3314 GLU C O   1 
ATOM   10462 C CB  . GLU C  1 296 ? 16.927  -43.542 73.239  1.00 43.75  ? 3314 GLU C CB  1 
ATOM   10463 C CG  . GLU C  1 296 ? 17.024  -45.042 73.438  1.00 47.92  ? 3314 GLU C CG  1 
ATOM   10464 C CD  . GLU C  1 296 ? 16.073  -45.803 72.543  1.00 50.85  ? 3314 GLU C CD  1 
ATOM   10465 O OE1 . GLU C  1 296 ? 14.872  -45.451 72.514  1.00 51.46  ? 3314 GLU C OE1 1 
ATOM   10466 O OE2 . GLU C  1 296 ? 16.526  -46.755 71.872  1.00 52.75  ? 3314 GLU C OE2 1 
ATOM   10467 N N   . SER C  1 297 ? 17.658  -40.474 74.650  1.00 38.62  ? 3315 SER C N   1 
ATOM   10468 C CA  . SER C  1 297 ? 17.470  -39.046 74.443  1.00 39.79  ? 3315 SER C CA  1 
ATOM   10469 C C   . SER C  1 297 ? 18.807  -38.368 74.160  1.00 39.56  ? 3315 SER C C   1 
ATOM   10470 O O   . SER C  1 297 ? 19.845  -38.764 74.696  1.00 38.79  ? 3315 SER C O   1 
ATOM   10471 C CB  . SER C  1 297 ? 16.785  -38.412 75.660  1.00 40.98  ? 3315 SER C CB  1 
ATOM   10472 O OG  . SER C  1 297 ? 17.463  -38.722 76.860  1.00 42.58  ? 3315 SER C OG  1 
ATOM   10473 N N   . GLN C  1 298 ? 18.771  -37.352 73.304  1.00 39.14  ? 3316 GLN C N   1 
ATOM   10474 C CA  . GLN C  1 298 ? 19.966  -36.610 72.915  1.00 40.14  ? 3316 GLN C CA  1 
ATOM   10475 C C   . GLN C  1 298 ? 19.678  -35.114 73.048  1.00 38.89  ? 3316 GLN C C   1 
ATOM   10476 O O   . GLN C  1 298 ? 19.133  -34.494 72.135  1.00 38.44  ? 3316 GLN C O   1 
ATOM   10477 C CB  . GLN C  1 298 ? 20.315  -36.930 71.460  1.00 42.90  ? 3316 GLN C CB  1 
ATOM   10478 C CG  . GLN C  1 298 ? 21.801  -36.966 71.158  1.00 47.12  ? 3316 GLN C CG  1 
ATOM   10479 C CD  . GLN C  1 298 ? 22.396  -38.347 71.353  1.00 47.85  ? 3316 GLN C CD  1 
ATOM   10480 O OE1 . GLN C  1 298 ? 21.918  -39.327 70.777  1.00 49.28  ? 3316 GLN C OE1 1 
ATOM   10481 N NE2 . GLN C  1 298 ? 23.448  -38.433 72.159  1.00 49.58  ? 3316 GLN C NE2 1 
ATOM   10482 N N   . PRO C  1 299 ? 20.045  -34.513 74.187  1.00 38.00  ? 3317 PRO C N   1 
ATOM   10483 C CA  . PRO C  1 299 ? 19.800  -33.085 74.401  1.00 37.44  ? 3317 PRO C CA  1 
ATOM   10484 C C   . PRO C  1 299 ? 20.774  -32.154 73.685  1.00 36.06  ? 3317 PRO C C   1 
ATOM   10485 O O   . PRO C  1 299 ? 20.491  -30.972 73.510  1.00 34.46  ? 3317 PRO C O   1 
ATOM   10486 C CB  . PRO C  1 299 ? 19.899  -32.958 75.917  1.00 37.78  ? 3317 PRO C CB  1 
ATOM   10487 C CG  . PRO C  1 299 ? 21.005  -33.917 76.231  1.00 37.17  ? 3317 PRO C CG  1 
ATOM   10488 C CD  . PRO C  1 299 ? 20.634  -35.128 75.391  1.00 38.41  ? 3317 PRO C CD  1 
ATOM   10489 N N   . LEU C  1 300 ? 21.914  -32.690 73.266  1.00 37.20  ? 3318 LEU C N   1 
ATOM   10490 C CA  . LEU C  1 300 ? 22.933  -31.881 72.605  1.00 36.76  ? 3318 LEU C CA  1 
ATOM   10491 C C   . LEU C  1 300 ? 23.654  -32.596 71.471  1.00 36.23  ? 3318 LEU C C   1 
ATOM   10492 O O   . LEU C  1 300 ? 23.721  -33.822 71.431  1.00 36.53  ? 3318 LEU C O   1 
ATOM   10493 C CB  . LEU C  1 300 ? 23.995  -31.463 73.623  1.00 38.43  ? 3318 LEU C CB  1 
ATOM   10494 C CG  . LEU C  1 300 ? 23.591  -30.640 74.841  1.00 40.50  ? 3318 LEU C CG  1 
ATOM   10495 C CD1 . LEU C  1 300 ? 24.703  -30.663 75.872  1.00 41.86  ? 3318 LEU C CD1 1 
ATOM   10496 C CD2 . LEU C  1 300 ? 23.295  -29.228 74.405  1.00 42.90  ? 3318 LEU C CD2 1 
ATOM   10497 N N   . LEU C  1 301 ? 24.189  -31.804 70.548  1.00 34.08  ? 3319 LEU C N   1 
ATOM   10498 C CA  . LEU C  1 301 ? 24.995  -32.311 69.447  1.00 32.20  ? 3319 LEU C CA  1 
ATOM   10499 C C   . LEU C  1 301 ? 26.337  -31.707 69.826  1.00 31.05  ? 3319 LEU C C   1 
ATOM   10500 O O   . LEU C  1 301 ? 26.493  -30.487 69.789  1.00 33.46  ? 3319 LEU C O   1 
ATOM   10501 C CB  . LEU C  1 301 ? 24.537  -31.740 68.106  1.00 33.49  ? 3319 LEU C CB  1 
ATOM   10502 C CG  . LEU C  1 301 ? 23.186  -32.212 67.571  1.00 34.90  ? 3319 LEU C CG  1 
ATOM   10503 C CD1 . LEU C  1 301 ? 22.937  -31.596 66.202  1.00 33.46  ? 3319 LEU C CD1 1 
ATOM   10504 C CD2 . LEU C  1 301 ? 23.182  -33.731 67.479  1.00 34.42  ? 3319 LEU C CD2 1 
ATOM   10505 N N   . GLY C  1 302 ? 27.303  -32.532 70.208  1.00 28.82  ? 3320 GLY C N   1 
ATOM   10506 C CA  . GLY C  1 302 ? 28.573  -31.961 70.617  1.00 26.13  ? 3320 GLY C CA  1 
ATOM   10507 C C   . GLY C  1 302 ? 29.860  -32.586 70.129  1.00 24.55  ? 3320 GLY C C   1 
ATOM   10508 O O   . GLY C  1 302 ? 29.943  -33.131 69.031  1.00 22.42  ? 3320 GLY C O   1 
ATOM   10509 N N   . THR C  1 303 ? 30.873  -32.483 70.978  1.00 23.08  ? 3321 THR C N   1 
ATOM   10510 C CA  . THR C  1 303 ? 32.210  -32.989 70.704  1.00 23.78  ? 3321 THR C CA  1 
ATOM   10511 C C   . THR C  1 303 ? 32.232  -34.501 70.499  1.00 23.86  ? 3321 THR C C   1 
ATOM   10512 O O   . THR C  1 303 ? 31.536  -35.243 71.190  1.00 23.69  ? 3321 THR C O   1 
ATOM   10513 C CB  . THR C  1 303 ? 33.159  -32.637 71.879  1.00 22.83  ? 3321 THR C CB  1 
ATOM   10514 O OG1 . THR C  1 303 ? 33.005  -31.250 72.215  1.00 22.37  ? 3321 THR C OG1 1 
ATOM   10515 C CG2 . THR C  1 303 ? 34.610  -32.908 71.507  1.00 20.13  ? 3321 THR C CG2 1 
ATOM   10516 N N   . VAL C  1 304 ? 33.031  -34.950 69.537  1.00 24.91  ? 3322 VAL C N   1 
ATOM   10517 C CA  . VAL C  1 304 ? 33.181  -36.379 69.271  1.00 23.68  ? 3322 VAL C CA  1 
ATOM   10518 C C   . VAL C  1 304 ? 34.672  -36.650 69.100  1.00 23.23  ? 3322 VAL C C   1 
ATOM   10519 O O   . VAL C  1 304 ? 35.466  -35.715 68.991  1.00 22.63  ? 3322 VAL C O   1 
ATOM   10520 C CB  . VAL C  1 304 ? 32.436  -36.816 67.980  1.00 22.56  ? 3322 VAL C CB  1 
ATOM   10521 C CG1 . VAL C  1 304 ? 30.970  -36.435 68.074  1.00 20.19  ? 3322 VAL C CG1 1 
ATOM   10522 C CG2 . VAL C  1 304 ? 33.084  -36.184 66.749  1.00 22.18  ? 3322 VAL C CG2 1 
ATOM   10523 N N   . ILE C  1 305 ? 35.053  -37.923 69.105  1.00 23.67  ? 3323 ILE C N   1 
ATOM   10524 C CA  . ILE C  1 305 ? 36.451  -38.300 68.908  1.00 25.40  ? 3323 ILE C CA  1 
ATOM   10525 C C   . ILE C  1 305 ? 36.561  -38.468 67.391  1.00 25.46  ? 3323 ILE C C   1 
ATOM   10526 O O   . ILE C  1 305 ? 36.249  -39.531 66.857  1.00 25.87  ? 3323 ILE C O   1 
ATOM   10527 C CB  . ILE C  1 305 ? 36.774  -39.638 69.608  1.00 25.03  ? 3323 ILE C CB  1 
ATOM   10528 C CG1 . ILE C  1 305 ? 36.201  -39.639 71.028  1.00 27.35  ? 3323 ILE C CG1 1 
ATOM   10529 C CG2 . ILE C  1 305 ? 38.283  -39.843 69.661  1.00 25.72  ? 3323 ILE C CG2 1 
ATOM   10530 C CD1 . ILE C  1 305 ? 36.703  -38.511 71.900  1.00 26.38  ? 3323 ILE C CD1 1 
ATOM   10531 N N   . ASP C  1 306 ? 36.995  -37.405 66.716  1.00 26.74  ? 3324 ASP C N   1 
ATOM   10532 C CA  . ASP C  1 306 ? 37.091  -37.358 65.254  1.00 27.93  ? 3324 ASP C CA  1 
ATOM   10533 C C   . ASP C  1 306 ? 38.371  -37.847 64.582  1.00 29.67  ? 3324 ASP C C   1 
ATOM   10534 O O   . ASP C  1 306 ? 38.351  -38.217 63.404  1.00 31.34  ? 3324 ASP C O   1 
ATOM   10535 C CB  . ASP C  1 306 ? 36.829  -35.927 64.773  1.00 26.68  ? 3324 ASP C CB  1 
ATOM   10536 C CG  . ASP C  1 306 ? 37.896  -34.949 65.241  1.00 29.09  ? 3324 ASP C CG  1 
ATOM   10537 O OD1 . ASP C  1 306 ? 38.252  -34.036 64.469  1.00 30.63  ? 3324 ASP C OD1 1 
ATOM   10538 O OD2 . ASP C  1 306 ? 38.377  -35.081 66.387  1.00 32.01  ? 3324 ASP C OD2 1 
ATOM   10539 N N   . GLY C  1 307 ? 39.484  -37.826 65.301  1.00 28.31  ? 3325 GLY C N   1 
ATOM   10540 C CA  . GLY C  1 307 ? 40.734  -38.262 64.708  1.00 29.18  ? 3325 GLY C CA  1 
ATOM   10541 C C   . GLY C  1 307 ? 41.576  -37.087 64.246  1.00 29.74  ? 3325 GLY C C   1 
ATOM   10542 O O   . GLY C  1 307 ? 42.749  -37.250 63.908  1.00 30.25  ? 3325 GLY C O   1 
ATOM   10543 N N   . MET C  1 308 ? 40.974  -35.901 64.221  1.00 29.75  ? 3326 MET C N   1 
ATOM   10544 C CA  . MET C  1 308 ? 41.675  -34.685 63.818  1.00 30.60  ? 3326 MET C CA  1 
ATOM   10545 C C   . MET C  1 308 ? 41.877  -33.799 65.045  1.00 28.99  ? 3326 MET C C   1 
ATOM   10546 O O   . MET C  1 308 ? 43.007  -33.491 65.417  1.00 27.54  ? 3326 MET C O   1 
ATOM   10547 C CB  . MET C  1 308 ? 40.871  -33.926 62.760  1.00 32.82  ? 3326 MET C CB  1 
ATOM   10548 C CG  . MET C  1 308 ? 40.653  -34.713 61.482  1.00 39.03  ? 3326 MET C CG  1 
ATOM   10549 S SD  . MET C  1 308 ? 42.210  -35.217 60.727  1.00 44.71  ? 3326 MET C SD  1 
ATOM   10550 C CE  . MET C  1 308 ? 42.389  -33.960 59.457  1.00 45.46  ? 3326 MET C CE  1 
ATOM   10551 N N   . LEU C  1 309 ? 40.773  -33.394 65.668  1.00 28.59  ? 3327 LEU C N   1 
ATOM   10552 C CA  . LEU C  1 309 ? 40.825  -32.562 66.867  1.00 28.67  ? 3327 LEU C CA  1 
ATOM   10553 C C   . LEU C  1 309 ? 41.241  -33.409 68.064  1.00 28.40  ? 3327 LEU C C   1 
ATOM   10554 O O   . LEU C  1 309 ? 42.185  -33.076 68.780  1.00 29.06  ? 3327 LEU C O   1 
ATOM   10555 C CB  . LEU C  1 309 ? 39.455  -31.938 67.142  1.00 28.94  ? 3327 LEU C CB  1 
ATOM   10556 C CG  . LEU C  1 309 ? 39.369  -31.142 68.447  1.00 26.81  ? 3327 LEU C CG  1 
ATOM   10557 C CD1 . LEU C  1 309 ? 40.215  -29.889 68.329  1.00 26.33  ? 3327 LEU C CD1 1 
ATOM   10558 C CD2 . LEU C  1 309 ? 37.916  -30.785 68.742  1.00 26.61  ? 3327 LEU C CD2 1 
ATOM   10559 N N   . LEU C  1 310 ? 40.516  -34.501 68.284  1.00 29.95  ? 3328 LEU C N   1 
ATOM   10560 C CA  . LEU C  1 310 ? 40.812  -35.422 69.378  1.00 30.40  ? 3328 LEU C CA  1 
ATOM   10561 C C   . LEU C  1 310 ? 41.106  -36.787 68.771  1.00 31.60  ? 3328 LEU C C   1 
ATOM   10562 O O   . LEU C  1 310 ? 40.304  -37.312 68.002  1.00 30.65  ? 3328 LEU C O   1 
ATOM   10563 C CB  . LEU C  1 310 ? 39.618  -35.540 70.327  1.00 29.13  ? 3328 LEU C CB  1 
ATOM   10564 C CG  . LEU C  1 310 ? 39.238  -34.292 71.123  1.00 28.10  ? 3328 LEU C CG  1 
ATOM   10565 C CD1 . LEU C  1 310 ? 37.927  -34.534 71.841  1.00 29.35  ? 3328 LEU C CD1 1 
ATOM   10566 C CD2 . LEU C  1 310 ? 40.343  -33.954 72.111  1.00 29.52  ? 3328 LEU C CD2 1 
ATOM   10567 N N   . LEU C  1 311 ? 42.254  -37.356 69.114  1.00 32.89  ? 3329 LEU C N   1 
ATOM   10568 C CA  . LEU C  1 311 ? 42.630  -38.657 68.577  1.00 35.67  ? 3329 LEU C CA  1 
ATOM   10569 C C   . LEU C  1 311 ? 42.060  -39.782 69.429  1.00 35.67  ? 3329 LEU C C   1 
ATOM   10570 O O   . LEU C  1 311 ? 42.013  -40.934 69.003  1.00 35.73  ? 3329 LEU C O   1 
ATOM   10571 C CB  . LEU C  1 311 ? 44.152  -38.768 68.490  1.00 37.70  ? 3329 LEU C CB  1 
ATOM   10572 C CG  . LEU C  1 311 ? 44.847  -37.566 67.842  1.00 39.48  ? 3329 LEU C CG  1 
ATOM   10573 C CD1 . LEU C  1 311 ? 46.311  -37.907 67.587  1.00 40.58  ? 3329 LEU C CD1 1 
ATOM   10574 C CD2 . LEU C  1 311 ? 44.153  -37.199 66.539  1.00 40.33  ? 3329 LEU C CD2 1 
ATOM   10575 N N   . LYS C  1 312 ? 41.630  -39.436 70.637  1.00 36.13  ? 3330 LYS C N   1 
ATOM   10576 C CA  . LYS C  1 312 ? 41.030  -40.393 71.557  1.00 36.07  ? 3330 LYS C CA  1 
ATOM   10577 C C   . LYS C  1 312 ? 40.254  -39.653 72.646  1.00 34.72  ? 3330 LYS C C   1 
ATOM   10578 O O   . LYS C  1 312 ? 40.239  -38.421 72.680  1.00 32.91  ? 3330 LYS C O   1 
ATOM   10579 C CB  . LYS C  1 312 ? 42.104  -41.298 72.168  1.00 39.50  ? 3330 LYS C CB  1 
ATOM   10580 C CG  . LYS C  1 312 ? 43.365  -40.577 72.589  1.00 42.19  ? 3330 LYS C CG  1 
ATOM   10581 C CD  . LYS C  1 312 ? 44.461  -41.561 72.968  1.00 45.54  ? 3330 LYS C CD  1 
ATOM   10582 C CE  . LYS C  1 312 ? 44.833  -42.459 71.798  1.00 45.96  ? 3330 LYS C CE  1 
ATOM   10583 N NZ  . LYS C  1 312 ? 45.974  -43.355 72.135  1.00 47.83  ? 3330 LYS C NZ  1 
ATOM   10584 N N   . THR C  1 313 ? 39.599  -40.403 73.523  1.00 33.65  ? 3331 THR C N   1 
ATOM   10585 C CA  . THR C  1 313 ? 38.804  -39.806 74.591  1.00 33.30  ? 3331 THR C CA  1 
ATOM   10586 C C   . THR C  1 313 ? 39.643  -38.959 75.538  1.00 32.11  ? 3331 THR C C   1 
ATOM   10587 O O   . THR C  1 313 ? 40.835  -39.201 75.713  1.00 32.16  ? 3331 THR C O   1 
ATOM   10588 C CB  . THR C  1 313 ? 38.095  -40.883 75.416  1.00 32.85  ? 3331 THR C CB  1 
ATOM   10589 O OG1 . THR C  1 313 ? 39.061  -41.596 76.197  1.00 34.48  ? 3331 THR C OG1 1 
ATOM   10590 C CG2 . THR C  1 313 ? 37.373  -41.854 74.498  1.00 33.51  ? 3331 THR C CG2 1 
ATOM   10591 N N   . PRO C  1 314 ? 39.028  -37.941 76.157  1.00 32.38  ? 3332 PRO C N   1 
ATOM   10592 C CA  . PRO C  1 314 ? 39.756  -37.075 77.089  1.00 32.02  ? 3332 PRO C CA  1 
ATOM   10593 C C   . PRO C  1 314 ? 40.439  -37.888 78.188  1.00 33.12  ? 3332 PRO C C   1 
ATOM   10594 O O   . PRO C  1 314 ? 41.563  -37.587 78.596  1.00 32.38  ? 3332 PRO C O   1 
ATOM   10595 C CB  . PRO C  1 314 ? 38.658  -36.164 77.631  1.00 30.86  ? 3332 PRO C CB  1 
ATOM   10596 C CG  . PRO C  1 314 ? 37.737  -36.032 76.449  1.00 32.43  ? 3332 PRO C CG  1 
ATOM   10597 C CD  . PRO C  1 314 ? 37.651  -37.453 75.951  1.00 31.21  ? 3332 PRO C CD  1 
ATOM   10598 N N   . GLU C  1 315 ? 39.752  -38.927 78.652  1.00 34.72  ? 3333 GLU C N   1 
ATOM   10599 C CA  . GLU C  1 315 ? 40.276  -39.794 79.700  1.00 37.36  ? 3333 GLU C CA  1 
ATOM   10600 C C   . GLU C  1 315 ? 41.562  -40.490 79.271  1.00 38.13  ? 3333 GLU C C   1 
ATOM   10601 O O   . GLU C  1 315 ? 42.498  -40.616 80.059  1.00 36.82  ? 3333 GLU C O   1 
ATOM   10602 C CB  . GLU C  1 315 ? 39.222  -40.831 80.085  1.00 40.70  ? 3333 GLU C CB  1 
ATOM   10603 C CG  . GLU C  1 315 ? 38.015  -40.237 80.791  1.00 45.23  ? 3333 GLU C CG  1 
ATOM   10604 C CD  . GLU C  1 315 ? 36.825  -41.175 80.801  1.00 50.19  ? 3333 GLU C CD  1 
ATOM   10605 O OE1 . GLU C  1 315 ? 37.009  -42.369 81.127  1.00 52.68  ? 3333 GLU C OE1 1 
ATOM   10606 O OE2 . GLU C  1 315 ? 35.703  -40.715 80.486  1.00 51.54  ? 3333 GLU C OE2 1 
ATOM   10607 N N   . GLU C  1 316 ? 41.610  -40.941 78.021  1.00 39.10  ? 3334 GLU C N   1 
ATOM   10608 C CA  . GLU C  1 316 ? 42.801  -41.611 77.512  1.00 39.41  ? 3334 GLU C CA  1 
ATOM   10609 C C   . GLU C  1 316 ? 43.942  -40.611 77.406  1.00 38.17  ? 3334 GLU C C   1 
ATOM   10610 O O   . GLU C  1 316 ? 45.064  -40.883 77.832  1.00 37.11  ? 3334 GLU C O   1 
ATOM   10611 C CB  . GLU C  1 316 ? 42.531  -42.225 76.138  1.00 43.25  ? 3334 GLU C CB  1 
ATOM   10612 C CG  . GLU C  1 316 ? 41.477  -43.320 76.128  1.00 49.55  ? 3334 GLU C CG  1 
ATOM   10613 C CD  . GLU C  1 316 ? 41.718  -44.381 77.186  1.00 54.19  ? 3334 GLU C CD  1 
ATOM   10614 O OE1 . GLU C  1 316 ? 42.890  -44.783 77.377  1.00 57.46  ? 3334 GLU C OE1 1 
ATOM   10615 O OE2 . GLU C  1 316 ? 40.732  -44.823 77.821  1.00 57.06  ? 3334 GLU C OE2 1 
ATOM   10616 N N   . LEU C  1 317 ? 43.641  -39.448 76.838  1.00 37.01  ? 3335 LEU C N   1 
ATOM   10617 C CA  . LEU C  1 317 ? 44.629  -38.392 76.671  1.00 37.06  ? 3335 LEU C CA  1 
ATOM   10618 C C   . LEU C  1 317 ? 45.202  -37.950 78.011  1.00 38.40  ? 3335 LEU C C   1 
ATOM   10619 O O   . LEU C  1 317 ? 46.408  -37.727 78.136  1.00 37.01  ? 3335 LEU C O   1 
ATOM   10620 C CB  . LEU C  1 317 ? 44.001  -37.194 75.956  1.00 36.35  ? 3335 LEU C CB  1 
ATOM   10621 C CG  . LEU C  1 317 ? 43.559  -37.454 74.513  1.00 38.52  ? 3335 LEU C CG  1 
ATOM   10622 C CD1 . LEU C  1 317 ? 42.838  -36.237 73.965  1.00 37.89  ? 3335 LEU C CD1 1 
ATOM   10623 C CD2 . LEU C  1 317 ? 44.781  -37.787 73.658  1.00 37.77  ? 3335 LEU C CD2 1 
ATOM   10624 N N   . GLN C  1 318 ? 44.338  -37.823 79.013  1.00 39.64  ? 3336 GLN C N   1 
ATOM   10625 C CA  . GLN C  1 318 ? 44.784  -37.408 80.338  1.00 41.73  ? 3336 GLN C CA  1 
ATOM   10626 C C   . GLN C  1 318 ? 45.767  -38.406 80.938  1.00 42.37  ? 3336 GLN C C   1 
ATOM   10627 O O   . GLN C  1 318 ? 46.829  -38.023 81.423  1.00 42.16  ? 3336 GLN C O   1 
ATOM   10628 C CB  . GLN C  1 318 ? 43.589  -37.242 81.276  1.00 41.94  ? 3336 GLN C CB  1 
ATOM   10629 C CG  . GLN C  1 318 ? 42.761  -36.004 80.999  1.00 43.83  ? 3336 GLN C CG  1 
ATOM   10630 C CD  . GLN C  1 318 ? 41.617  -35.862 81.973  1.00 46.82  ? 3336 GLN C CD  1 
ATOM   10631 O OE1 . GLN C  1 318 ? 40.715  -36.701 82.014  1.00 48.10  ? 3336 GLN C OE1 1 
ATOM   10632 N NE2 . GLN C  1 318 ? 41.649  -34.804 82.776  1.00 47.70  ? 3336 GLN C NE2 1 
ATOM   10633 N N   . ALA C  1 319 ? 45.404  -39.683 80.910  1.00 44.75  ? 3337 ALA C N   1 
ATOM   10634 C CA  . ALA C  1 319 ? 46.262  -40.731 81.446  1.00 47.34  ? 3337 ALA C CA  1 
ATOM   10635 C C   . ALA C  1 319 ? 47.562  -40.774 80.651  1.00 50.19  ? 3337 ALA C C   1 
ATOM   10636 O O   . ALA C  1 319 ? 48.631  -41.070 81.185  1.00 50.18  ? 3337 ALA C O   1 
ATOM   10637 C CB  . ALA C  1 319 ? 45.554  -42.072 81.358  1.00 46.98  ? 3337 ALA C CB  1 
ATOM   10638 N N   . GLU C  1 320 ? 47.449  -40.463 79.365  1.00 52.65  ? 3338 GLU C N   1 
ATOM   10639 C CA  . GLU C  1 320 ? 48.574  -40.460 78.440  1.00 54.84  ? 3338 GLU C CA  1 
ATOM   10640 C C   . GLU C  1 320 ? 49.473  -39.240 78.662  1.00 55.20  ? 3338 GLU C C   1 
ATOM   10641 O O   . GLU C  1 320 ? 50.577  -39.165 78.122  1.00 55.72  ? 3338 GLU C O   1 
ATOM   10642 C CB  . GLU C  1 320 ? 48.020  -40.463 77.011  1.00 56.86  ? 3338 GLU C CB  1 
ATOM   10643 C CG  . GLU C  1 320 ? 49.012  -40.746 75.905  1.00 59.66  ? 3338 GLU C CG  1 
ATOM   10644 C CD  . GLU C  1 320 ? 48.348  -40.741 74.537  1.00 61.45  ? 3338 GLU C CD  1 
ATOM   10645 O OE1 . GLU C  1 320 ? 47.854  -39.674 74.115  1.00 61.33  ? 3338 GLU C OE1 1 
ATOM   10646 O OE2 . GLU C  1 320 ? 48.311  -41.806 73.886  1.00 63.80  ? 3338 GLU C OE2 1 
ATOM   10647 N N   . ARG C  1 321 ? 48.999  -38.293 79.467  1.00 55.58  ? 3339 ARG C N   1 
ATOM   10648 C CA  . ARG C  1 321 ? 49.752  -37.072 79.741  1.00 55.57  ? 3339 ARG C CA  1 
ATOM   10649 C C   . ARG C  1 321 ? 50.052  -36.359 78.430  1.00 55.83  ? 3339 ARG C C   1 
ATOM   10650 O O   . ARG C  1 321 ? 50.982  -35.556 78.342  1.00 56.34  ? 3339 ARG C O   1 
ATOM   10651 C CB  . ARG C  1 321 ? 51.063  -37.396 80.464  1.00 56.21  ? 3339 ARG C CB  1 
ATOM   10652 C CG  . ARG C  1 321 ? 51.049  -37.121 81.962  1.00 56.78  ? 3339 ARG C CG  1 
ATOM   10653 C CD  . ARG C  1 321 ? 49.874  -37.792 82.648  1.00 58.20  ? 3339 ARG C CD  1 
ATOM   10654 N NE  . ARG C  1 321 ? 49.989  -37.748 84.103  1.00 59.60  ? 3339 ARG C NE  1 
ATOM   10655 C CZ  . ARG C  1 321 ? 49.025  -38.123 84.939  1.00 60.27  ? 3339 ARG C CZ  1 
ATOM   10656 N NH1 . ARG C  1 321 ? 47.869  -38.567 84.464  1.00 60.10  ? 3339 ARG C NH1 1 
ATOM   10657 N NH2 . ARG C  1 321 ? 49.221  -38.066 86.250  1.00 60.33  ? 3339 ARG C NH2 1 
ATOM   10658 N N   . ASN C  1 322 ? 49.247  -36.655 77.414  1.00 54.79  ? 3340 ASN C N   1 
ATOM   10659 C CA  . ASN C  1 322 ? 49.420  -36.057 76.098  1.00 53.84  ? 3340 ASN C CA  1 
ATOM   10660 C C   . ASN C  1 322 ? 48.569  -34.796 75.915  1.00 52.62  ? 3340 ASN C C   1 
ATOM   10661 O O   . ASN C  1 322 ? 47.508  -34.822 75.281  1.00 52.03  ? 3340 ASN C O   1 
ATOM   10662 C CB  . ASN C  1 322 ? 49.076  -37.080 75.012  1.00 54.84  ? 3340 ASN C CB  1 
ATOM   10663 C CG  . ASN C  1 322 ? 49.560  -36.657 73.640  1.00 55.07  ? 3340 ASN C CG  1 
ATOM   10664 O OD1 . ASN C  1 322 ? 50.037  -35.536 73.459  1.00 55.48  ? 3340 ASN C OD1 1 
ATOM   10665 N ND2 . ASN C  1 322 ? 49.435  -37.551 72.664  1.00 55.04  ? 3340 ASN C ND2 1 
ATOM   10666 N N   . PHE C  1 323 ? 49.052  -33.696 76.484  1.00 49.95  ? 3341 PHE C N   1 
ATOM   10667 C CA  . PHE C  1 323 ? 48.396  -32.394 76.401  1.00 48.20  ? 3341 PHE C CA  1 
ATOM   10668 C C   . PHE C  1 323 ? 49.431  -31.378 76.864  1.00 48.58  ? 3341 PHE C C   1 
ATOM   10669 O O   . PHE C  1 323 ? 50.261  -31.696 77.715  1.00 48.93  ? 3341 PHE C O   1 
ATOM   10670 C CB  . PHE C  1 323 ? 47.149  -32.362 77.296  1.00 45.12  ? 3341 PHE C CB  1 
ATOM   10671 C CG  . PHE C  1 323 ? 47.410  -32.717 78.736  1.00 42.70  ? 3341 PHE C CG  1 
ATOM   10672 C CD1 . PHE C  1 323 ? 47.990  -31.798 79.605  1.00 42.14  ? 3341 PHE C CD1 1 
ATOM   10673 C CD2 . PHE C  1 323 ? 47.047  -33.967 79.232  1.00 41.63  ? 3341 PHE C CD2 1 
ATOM   10674 C CE1 . PHE C  1 323 ? 48.200  -32.118 80.946  1.00 40.20  ? 3341 PHE C CE1 1 
ATOM   10675 C CE2 . PHE C  1 323 ? 47.253  -34.297 80.572  1.00 40.28  ? 3341 PHE C CE2 1 
ATOM   10676 C CZ  . PHE C  1 323 ? 47.829  -33.371 81.428  1.00 39.86  ? 3341 PHE C CZ  1 
ATOM   10677 N N   . HIS C  1 324 ? 49.414  -30.168 76.312  1.00 48.73  ? 3342 HIS C N   1 
ATOM   10678 C CA  . HIS C  1 324 ? 50.421  -29.201 76.731  1.00 49.58  ? 3342 HIS C CA  1 
ATOM   10679 C C   . HIS C  1 324 ? 50.156  -28.580 78.090  1.00 47.04  ? 3342 HIS C C   1 
ATOM   10680 O O   . HIS C  1 324 ? 49.037  -28.192 78.431  1.00 47.61  ? 3342 HIS C O   1 
ATOM   10681 C CB  . HIS C  1 324 ? 50.647  -28.115 75.673  1.00 53.00  ? 3342 HIS C CB  1 
ATOM   10682 C CG  . HIS C  1 324 ? 49.406  -27.404 75.243  1.00 55.42  ? 3342 HIS C CG  1 
ATOM   10683 N ND1 . HIS C  1 324 ? 49.432  -26.360 74.345  1.00 57.43  ? 3342 HIS C ND1 1 
ATOM   10684 C CD2 . HIS C  1 324 ? 48.106  -27.597 75.564  1.00 56.92  ? 3342 HIS C CD2 1 
ATOM   10685 C CE1 . HIS C  1 324 ? 48.199  -2