data_2H8W
# 
_entry.id   2H8W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2H8W         
RCSB  RCSB038076   
WWPDB D_1000038076 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2H8W 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lee, D.'                1 
'Walsh, J.D.'            2 
'Yu, P.'                 3 
'Choli-Papadopoulou, T.' 4 
'Krueger, S.'            5 
'Draper, D.'             6 
'Wang, Y.-X.'            7 
# 
_citation.id                        primary 
_citation.title                     
;The Structure of Free L11 and Functional Dynamics of L11 in Free, L11-rRNA(58 nt) Binary and L11-rRNA(58 nt)-thiostrepton Ternary Complexes.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            367 
_citation.page_first                1007 
_citation.page_last                 1022 
_citation.year                      2007 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17292917 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2007.01.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, D.'                1 
primary 'Walsh, J.D.'            2 
primary 'Yu, P.'                 3 
primary 'Markus, M.A.'           4 
primary 'Choli-Papadopoulou, T.' 5 
primary 'Schwieters, C.D.'       6 
primary 'Krueger, S.'            7 
primary 'Draper, D.E.'           8 
primary 'Wang, Y.-X.'            9 
# 
_cell.entry_id           2H8W 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2H8W 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           '50S ribosomal protein L11' 
_entity.formula_weight             15526.111 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRK
AAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRK
AAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   LYS n 
1 4   VAL n 
1 5   VAL n 
1 6   ALA n 
1 7   VAL n 
1 8   VAL n 
1 9   LYS n 
1 10  LEU n 
1 11  GLN n 
1 12  LEU n 
1 13  PRO n 
1 14  ALA n 
1 15  GLY n 
1 16  LYS n 
1 17  ALA n 
1 18  THR n 
1 19  PRO n 
1 20  ALA n 
1 21  PRO n 
1 22  PRO n 
1 23  VAL n 
1 24  GLY n 
1 25  PRO n 
1 26  ALA n 
1 27  LEU n 
1 28  GLY n 
1 29  GLN n 
1 30  HIS n 
1 31  GLY n 
1 32  ALA n 
1 33  ASN n 
1 34  ILE n 
1 35  MET n 
1 36  GLU n 
1 37  PHE n 
1 38  VAL n 
1 39  LYS n 
1 40  ALA n 
1 41  PHE n 
1 42  ASN n 
1 43  ALA n 
1 44  ALA n 
1 45  THR n 
1 46  ALA n 
1 47  ASN n 
1 48  MET n 
1 49  GLY n 
1 50  ASP n 
1 51  ALA n 
1 52  ILE n 
1 53  VAL n 
1 54  PRO n 
1 55  VAL n 
1 56  GLU n 
1 57  ILE n 
1 58  THR n 
1 59  ILE n 
1 60  TYR n 
1 61  ALA n 
1 62  ASP n 
1 63  ARG n 
1 64  SER n 
1 65  PHE n 
1 66  THR n 
1 67  PHE n 
1 68  VAL n 
1 69  THR n 
1 70  LYS n 
1 71  THR n 
1 72  PRO n 
1 73  PRO n 
1 74  ALA n 
1 75  SER n 
1 76  TYR n 
1 77  LEU n 
1 78  ILE n 
1 79  ARG n 
1 80  LYS n 
1 81  ALA n 
1 82  ALA n 
1 83  GLY n 
1 84  LEU n 
1 85  GLU n 
1 86  LYS n 
1 87  GLY n 
1 88  ALA n 
1 89  HIS n 
1 90  LYS n 
1 91  PRO n 
1 92  GLY n 
1 93  ARG n 
1 94  GLU n 
1 95  LYS n 
1 96  VAL n 
1 97  GLY n 
1 98  ARG n 
1 99  ILE n 
1 100 THR n 
1 101 TRP n 
1 102 GLU n 
1 103 GLN n 
1 104 VAL n 
1 105 LEU n 
1 106 GLU n 
1 107 ILE n 
1 108 ALA n 
1 109 LYS n 
1 110 GLN n 
1 111 LYS n 
1 112 MET n 
1 113 PRO n 
1 114 ASP n 
1 115 LEU n 
1 116 ASN n 
1 117 THR n 
1 118 THR n 
1 119 ASP n 
1 120 LEU n 
1 121 GLU n 
1 122 ALA n 
1 123 ALA n 
1 124 ALA n 
1 125 ARG n 
1 126 MET n 
1 127 ILE n 
1 128 ALA n 
1 129 GLY n 
1 130 SER n 
1 131 ALA n 
1 132 ARG n 
1 133 SER n 
1 134 MET n 
1 135 GLY n 
1 136 VAL n 
1 137 GLU n 
1 138 VAL n 
1 139 VAL n 
1 140 GLY n 
1 141 ALA n 
1 142 PRO n 
1 143 GLU n 
1 144 VAL n 
1 145 LYS n 
1 146 ASP n 
1 147 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermus 
_entity_src_gen.pdbx_gene_src_gene                 'rplK, rpl11' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     274 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RL11_THETH 
_struct_ref.pdbx_db_accession          P36238 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRK
AAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2H8W 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 147 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P36238 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  147 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       147 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY                  1 
2 1 3D_15N-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '10 mM KPi, 70 mM KCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '10 mM KPi, 70 mM KCl' 
_pdbx_nmr_sample_details.solvent_system   H2O 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2H8W 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2H8W 
_pdbx_nmr_details.text       'superimposed in N-terminal domain' 
# 
_pdbx_nmr_ensemble.entry_id                                      2H8W 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2H8W 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CYANA 2.1.4 'P.GUNTERT ET AL.' 1 
'structure solution' CYANA 2.1.4 ?                  2 
# 
_exptl.entry_id          2H8W 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2H8W 
_struct.title                     'Solution structure of ribosomal protein L11' 
_struct.pdbx_descriptor           '50S ribosomal protein L11' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2H8W 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.text            'L11, antibiotics, ribosome, RNA BINDING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 23  ? GLY A 28  ? VAL A 23  GLY A 28  1 ? 6  
HELX_P HELX_P2 2 ILE A 34  ? ALA A 43  ? ILE A 34  ALA A 43  1 ? 10 
HELX_P HELX_P3 3 ALA A 74  ? GLY A 83  ? ALA A 74  GLY A 83  1 ? 10 
HELX_P HELX_P4 4 THR A 100 ? LYS A 109 ? THR A 100 LYS A 109 1 ? 10 
HELX_P HELX_P5 5 ASP A 119 ? ARG A 125 ? ASP A 119 ARG A 125 1 ? 7  
HELX_P HELX_P6 6 SER A 130 ? MET A 134 ? SER A 130 MET A 134 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 6  ? VAL A 7  ? ALA A 6  VAL A 7  
A 2 THR A 58 ? ILE A 59 ? THR A 58 ILE A 59 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ALA 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    6 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ALA 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     6 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    59 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     59 
# 
_database_PDB_matrix.entry_id          2H8W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2H8W 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 11.791  -34.209 -18.292 1.00 0.00 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 13.215  -34.232 -17.980 1.00 0.00 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 13.521  -33.359 -16.767 1.00 0.00 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 14.046  -33.837 -15.762 1.00 0.00 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 14.030  -33.756 -19.184 1.00 0.00 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 14.321  -34.854 -20.194 1.00 0.00 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? 16.023  -35.445 -20.107 1.00 0.00 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? 15.951  -36.849 -21.217 1.00 0.00 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 11.508  -34.128 -19.227 1.00 0.00 ? 1   MET A H1   1  
ATOM 10    H HA   . MET A 1 1   ? 13.488  -35.252 -17.753 1.00 0.00 ? 1   MET A HA   1  
ATOM 11    H HB2  . MET A 1 1   ? 13.484  -32.971 -19.686 1.00 0.00 ? 1   MET A HB2  1  
ATOM 12    H HB3  . MET A 1 1   ? 14.972  -33.361 -18.834 1.00 0.00 ? 1   MET A HB3  1  
ATOM 13    H HG2  . MET A 1 1   ? 13.657  -35.685 -20.005 1.00 0.00 ? 1   MET A HG2  1  
ATOM 14    H HG3  . MET A 1 1   ? 14.138  -34.469 -21.186 1.00 0.00 ? 1   MET A HG3  1  
ATOM 15    H HE1  . MET A 1 1   ? 16.635  -36.695 -22.038 1.00 0.00 ? 1   MET A HE1  1  
ATOM 16    H HE2  . MET A 1 1   ? 16.227  -37.745 -20.681 1.00 0.00 ? 1   MET A HE2  1  
ATOM 17    H HE3  . MET A 1 1   ? 14.946  -36.954 -21.600 1.00 0.00 ? 1   MET A HE3  1  
ATOM 18    N N    . LYS A 1 2   ? 13.189  -32.076 -16.869 1.00 0.00 ? 2   LYS A N    1  
ATOM 19    C CA   . LYS A 1 2   ? 13.426  -31.136 -15.781 1.00 0.00 ? 2   LYS A CA   1  
ATOM 20    C C    . LYS A 1 2   ? 14.903  -31.104 -15.402 1.00 0.00 ? 2   LYS A C    1  
ATOM 21    O O    . LYS A 1 2   ? 15.337  -31.810 -14.491 1.00 0.00 ? 2   LYS A O    1  
ATOM 22    C CB   . LYS A 1 2   ? 12.584  -31.513 -14.560 1.00 0.00 ? 2   LYS A CB   1  
ATOM 23    C CG   . LYS A 1 2   ? 11.097  -31.261 -14.745 1.00 0.00 ? 2   LYS A CG   1  
ATOM 24    C CD   . LYS A 1 2   ? 10.261  -32.237 -13.935 1.00 0.00 ? 2   LYS A CD   1  
ATOM 25    C CE   . LYS A 1 2   ? 9.213   -32.923 -14.799 1.00 0.00 ? 2   LYS A CE   1  
ATOM 26    N NZ   . LYS A 1 2   ? 9.615   -34.311 -15.159 1.00 0.00 ? 2   LYS A NZ   1  
ATOM 27    H H    . LYS A 1 2   ? 12.773  -31.755 -17.697 1.00 0.00 ? 2   LYS A H    1  
ATOM 28    H HA   . LYS A 1 2   ? 13.133  -30.154 -16.120 1.00 0.00 ? 2   LYS A HA   1  
ATOM 29    H HB2  . LYS A 1 2   ? 12.726  -32.563 -14.350 1.00 0.00 ? 2   LYS A HB2  1  
ATOM 30    H HB3  . LYS A 1 2   ? 12.922  -30.936 -13.712 1.00 0.00 ? 2   LYS A HB3  1  
ATOM 31    H HG2  . LYS A 1 2   ? 10.869  -30.255 -14.424 1.00 0.00 ? 2   LYS A HG2  1  
ATOM 32    H HG3  . LYS A 1 2   ? 10.851  -31.371 -15.792 1.00 0.00 ? 2   LYS A HG3  1  
ATOM 33    H HD2  . LYS A 1 2   ? 10.910  -32.988 -13.511 1.00 0.00 ? 2   LYS A HD2  1  
ATOM 34    H HD3  . LYS A 1 2   ? 9.764   -31.698 -13.141 1.00 0.00 ? 2   LYS A HD3  1  
ATOM 35    H HE2  . LYS A 1 2   ? 8.283   -32.957 -14.254 1.00 0.00 ? 2   LYS A HE2  1  
ATOM 36    H HE3  . LYS A 1 2   ? 9.080   -32.349 -15.704 1.00 0.00 ? 2   LYS A HE3  1  
ATOM 37    H HZ1  . LYS A 1 2   ? 9.172   -34.991 -14.508 1.00 0.00 ? 2   LYS A HZ1  1  
ATOM 38    H HZ2  . LYS A 1 2   ? 10.648  -34.412 -15.097 1.00 0.00 ? 2   LYS A HZ2  1  
ATOM 39    H HZ3  . LYS A 1 2   ? 9.313   -34.530 -16.130 1.00 0.00 ? 2   LYS A HZ3  1  
ATOM 40    N N    . LYS A 1 3   ? 15.672  -30.279 -16.105 1.00 0.00 ? 3   LYS A N    1  
ATOM 41    C CA   . LYS A 1 3   ? 17.101  -30.152 -15.841 1.00 0.00 ? 3   LYS A CA   1  
ATOM 42    C C    . LYS A 1 3   ? 17.463  -28.713 -15.489 1.00 0.00 ? 3   LYS A C    1  
ATOM 43    O O    . LYS A 1 3   ? 16.835  -27.769 -15.969 1.00 0.00 ? 3   LYS A O    1  
ATOM 44    C CB   . LYS A 1 3   ? 17.907  -30.610 -17.058 1.00 0.00 ? 3   LYS A CB   1  
ATOM 45    C CG   . LYS A 1 3   ? 19.242  -31.241 -16.701 1.00 0.00 ? 3   LYS A CG   1  
ATOM 46    C CD   . LYS A 1 3   ? 19.307  -32.694 -17.139 1.00 0.00 ? 3   LYS A CD   1  
ATOM 47    C CE   . LYS A 1 3   ? 20.369  -33.462 -16.368 1.00 0.00 ? 3   LYS A CE   1  
ATOM 48    N NZ   . LYS A 1 3   ? 21.675  -33.474 -17.084 1.00 0.00 ? 3   LYS A NZ   1  
ATOM 49    H H    . LYS A 1 3   ? 15.268  -29.742 -16.819 1.00 0.00 ? 3   LYS A H    1  
ATOM 50    H HA   . LYS A 1 3   ? 17.340  -30.787 -15.002 1.00 0.00 ? 3   LYS A HA   1  
ATOM 51    H HB2  . LYS A 1 3   ? 17.326  -31.334 -17.609 1.00 0.00 ? 3   LYS A HB2  1  
ATOM 52    H HB3  . LYS A 1 3   ? 18.096  -29.755 -17.692 1.00 0.00 ? 3   LYS A HB3  1  
ATOM 53    H HG2  . LYS A 1 3   ? 20.032  -30.693 -17.192 1.00 0.00 ? 3   LYS A HG2  1  
ATOM 54    H HG3  . LYS A 1 3   ? 19.378  -31.191 -15.630 1.00 0.00 ? 3   LYS A HG3  1  
ATOM 55    H HD2  . LYS A 1 3   ? 18.347  -33.157 -16.965 1.00 0.00 ? 3   LYS A HD2  1  
ATOM 56    H HD3  . LYS A 1 3   ? 19.541  -32.733 -18.194 1.00 0.00 ? 3   LYS A HD3  1  
ATOM 57    H HE2  . LYS A 1 3   ? 20.502  -32.997 -15.403 1.00 0.00 ? 3   LYS A HE2  1  
ATOM 58    H HE3  . LYS A 1 3   ? 20.033  -34.480 -16.233 1.00 0.00 ? 3   LYS A HE3  1  
ATOM 59    H HZ1  . LYS A 1 3   ? 22.457  -33.496 -16.399 1.00 0.00 ? 3   LYS A HZ1  1  
ATOM 60    H HZ2  . LYS A 1 3   ? 21.767  -32.621 -17.672 1.00 0.00 ? 3   LYS A HZ2  1  
ATOM 61    H HZ3  . LYS A 1 3   ? 21.739  -34.312 -17.696 1.00 0.00 ? 3   LYS A HZ3  1  
ATOM 62    N N    . VAL A 1 4   ? 18.481  -28.552 -14.650 1.00 0.00 ? 4   VAL A N    1  
ATOM 63    C CA   . VAL A 1 4   ? 18.929  -27.227 -14.236 1.00 0.00 ? 4   VAL A CA   1  
ATOM 64    C C    . VAL A 1 4   ? 19.732  -26.549 -15.340 1.00 0.00 ? 4   VAL A C    1  
ATOM 65    O O    . VAL A 1 4   ? 20.913  -26.247 -15.167 1.00 0.00 ? 4   VAL A O    1  
ATOM 66    C CB   . VAL A 1 4   ? 19.789  -27.299 -12.960 1.00 0.00 ? 4   VAL A CB   1  
ATOM 67    C CG1  . VAL A 1 4   ? 20.020  -25.906 -12.393 1.00 0.00 ? 4   VAL A CG1  1  
ATOM 68    C CG2  . VAL A 1 4   ? 19.134  -28.202 -11.926 1.00 0.00 ? 4   VAL A CG2  1  
ATOM 69    H H    . VAL A 1 4   ? 18.942  -29.343 -14.301 1.00 0.00 ? 4   VAL A H    1  
ATOM 70    H HA   . VAL A 1 4   ? 18.054  -26.631 -14.022 1.00 0.00 ? 4   VAL A HA   1  
ATOM 71    H HB   . VAL A 1 4   ? 20.748  -27.721 -13.220 1.00 0.00 ? 4   VAL A HB   1  
ATOM 72    H HG11 . VAL A 1 4   ? 20.067  -25.960 -11.316 1.00 0.00 ? 4   VAL A HG11 1  
ATOM 73    H HG12 . VAL A 1 4   ? 20.949  -25.511 -12.776 1.00 0.00 ? 4   VAL A HG12 1  
ATOM 74    H HG13 . VAL A 1 4   ? 19.206  -25.259 -12.685 1.00 0.00 ? 4   VAL A HG13 1  
ATOM 75    H HG21 . VAL A 1 4   ? 18.103  -27.908 -11.793 1.00 0.00 ? 4   VAL A HG21 1  
ATOM 76    H HG22 . VAL A 1 4   ? 19.174  -29.227 -12.266 1.00 0.00 ? 4   VAL A HG22 1  
ATOM 77    H HG23 . VAL A 1 4   ? 19.658  -28.114 -10.987 1.00 0.00 ? 4   VAL A HG23 1  
ATOM 78    N N    . VAL A 1 5   ? 19.083  -26.312 -16.476 1.00 0.00 ? 5   VAL A N    1  
ATOM 79    C CA   . VAL A 1 5   ? 19.737  -25.667 -17.609 1.00 0.00 ? 5   VAL A CA   1  
ATOM 80    C C    . VAL A 1 5   ? 20.520  -24.437 -17.165 1.00 0.00 ? 5   VAL A C    1  
ATOM 81    O O    . VAL A 1 5   ? 21.641  -24.206 -17.616 1.00 0.00 ? 5   VAL A O    1  
ATOM 82    C CB   . VAL A 1 5   ? 18.715  -25.251 -18.683 1.00 0.00 ? 5   VAL A CB   1  
ATOM 83    C CG1  . VAL A 1 5   ? 18.158  -26.475 -19.393 1.00 0.00 ? 5   VAL A CG1  1  
ATOM 84    C CG2  . VAL A 1 5   ? 17.595  -24.428 -18.063 1.00 0.00 ? 5   VAL A CG2  1  
ATOM 85    H H    . VAL A 1 5   ? 18.143  -26.575 -16.553 1.00 0.00 ? 5   VAL A H    1  
ATOM 86    H HA   . VAL A 1 5   ? 20.421  -26.378 -18.049 1.00 0.00 ? 5   VAL A HA   1  
ATOM 87    H HB   . VAL A 1 5   ? 19.221  -24.638 -19.414 1.00 0.00 ? 5   VAL A HB   1  
ATOM 88    H HG11 . VAL A 1 5   ? 17.428  -26.165 -20.127 1.00 0.00 ? 5   VAL A HG11 1  
ATOM 89    H HG12 . VAL A 1 5   ? 18.961  -27.004 -19.884 1.00 0.00 ? 5   VAL A HG12 1  
ATOM 90    H HG13 . VAL A 1 5   ? 17.686  -27.126 -18.672 1.00 0.00 ? 5   VAL A HG13 1  
ATOM 91    H HG21 . VAL A 1 5   ? 17.194  -24.954 -17.209 1.00 0.00 ? 5   VAL A HG21 1  
ATOM 92    H HG22 . VAL A 1 5   ? 17.984  -23.471 -17.747 1.00 0.00 ? 5   VAL A HG22 1  
ATOM 93    H HG23 . VAL A 1 5   ? 16.814  -24.276 -18.793 1.00 0.00 ? 5   VAL A HG23 1  
ATOM 94    N N    . ALA A 1 6   ? 19.922  -23.650 -16.276 1.00 0.00 ? 6   ALA A N    1  
ATOM 95    C CA   . ALA A 1 6   ? 20.564  -22.445 -15.768 1.00 0.00 ? 6   ALA A CA   1  
ATOM 96    C C    . ALA A 1 6   ? 19.862  -21.935 -14.514 1.00 0.00 ? 6   ALA A C    1  
ATOM 97    O O    . ALA A 1 6   ? 18.803  -22.436 -14.136 1.00 0.00 ? 6   ALA A O    1  
ATOM 98    C CB   . ALA A 1 6   ? 20.584  -21.365 -16.840 1.00 0.00 ? 6   ALA A CB   1  
ATOM 99    H H    . ALA A 1 6   ? 19.028  -23.887 -15.953 1.00 0.00 ? 6   ALA A H    1  
ATOM 100   H HA   . ALA A 1 6   ? 21.587  -22.690 -15.521 1.00 0.00 ? 6   ALA A HA   1  
ATOM 101   H HB1  . ALA A 1 6   ? 21.322  -20.619 -16.585 1.00 0.00 ? 6   ALA A HB1  1  
ATOM 102   H HB2  . ALA A 1 6   ? 20.835  -21.809 -17.793 1.00 0.00 ? 6   ALA A HB2  1  
ATOM 103   H HB3  . ALA A 1 6   ? 19.610  -20.903 -16.903 1.00 0.00 ? 6   ALA A HB3  1  
ATOM 104   N N    . VAL A 1 7   ? 20.459  -20.935 -13.872 1.00 0.00 ? 7   VAL A N    1  
ATOM 105   C CA   . VAL A 1 7   ? 19.890  -20.357 -12.661 1.00 0.00 ? 7   VAL A CA   1  
ATOM 106   C C    . VAL A 1 7   ? 20.197  -18.867 -12.567 1.00 0.00 ? 7   VAL A C    1  
ATOM 107   O O    . VAL A 1 7   ? 21.253  -18.410 -13.005 1.00 0.00 ? 7   VAL A O    1  
ATOM 108   C CB   . VAL A 1 7   ? 20.424  -21.061 -11.399 1.00 0.00 ? 7   VAL A CB   1  
ATOM 109   C CG1  . VAL A 1 7   ? 19.781  -20.477 -10.150 1.00 0.00 ? 7   VAL A CG1  1  
ATOM 110   C CG2  . VAL A 1 7   ? 20.182  -22.560 -11.483 1.00 0.00 ? 7   VAL A CG2  1  
ATOM 111   H H    . VAL A 1 7   ? 21.302  -20.578 -14.222 1.00 0.00 ? 7   VAL A H    1  
ATOM 112   H HA   . VAL A 1 7   ? 18.819  -20.493 -12.697 1.00 0.00 ? 7   VAL A HA   1  
ATOM 113   H HB   . VAL A 1 7   ? 21.489  -20.892 -11.341 1.00 0.00 ? 7   VAL A HB   1  
ATOM 114   H HG11 . VAL A 1 7   ? 20.443  -19.743 -9.715  1.00 0.00 ? 7   VAL A HG11 1  
ATOM 115   H HG12 . VAL A 1 7   ? 18.844  -20.009 -10.412 1.00 0.00 ? 7   VAL A HG12 1  
ATOM 116   H HG13 . VAL A 1 7   ? 19.602  -21.267 -9.435  1.00 0.00 ? 7   VAL A HG13 1  
ATOM 117   H HG21 . VAL A 1 7   ? 20.925  -23.009 -12.124 1.00 0.00 ? 7   VAL A HG21 1  
ATOM 118   H HG22 . VAL A 1 7   ? 20.251  -22.992 -10.495 1.00 0.00 ? 7   VAL A HG22 1  
ATOM 119   H HG23 . VAL A 1 7   ? 19.198  -22.744 -11.887 1.00 0.00 ? 7   VAL A HG23 1  
ATOM 120   N N    . VAL A 1 8   ? 19.267  -18.112 -11.991 1.00 0.00 ? 8   VAL A N    1  
ATOM 121   C CA   . VAL A 1 8   ? 19.438  -16.672 -11.837 1.00 0.00 ? 8   VAL A CA   1  
ATOM 122   C C    . VAL A 1 8   ? 20.162  -16.340 -10.537 1.00 0.00 ? 8   VAL A C    1  
ATOM 123   O O    . VAL A 1 8   ? 19.902  -16.944 -9.496  1.00 0.00 ? 8   VAL A O    1  
ATOM 124   C CB   . VAL A 1 8   ? 18.083  -15.940 -11.858 1.00 0.00 ? 8   VAL A CB   1  
ATOM 125   C CG1  . VAL A 1 8   ? 17.365  -16.108 -10.527 1.00 0.00 ? 8   VAL A CG1  1  
ATOM 126   C CG2  . VAL A 1 8   ? 18.278  -14.468 -12.185 1.00 0.00 ? 8   VAL A CG2  1  
ATOM 127   H H    . VAL A 1 8   ? 18.446  -18.533 -11.661 1.00 0.00 ? 8   VAL A H    1  
ATOM 128   H HA   . VAL A 1 8   ? 20.029  -16.315 -12.668 1.00 0.00 ? 8   VAL A HA   1  
ATOM 129   H HB   . VAL A 1 8   ? 17.470  -16.381 -12.630 1.00 0.00 ? 8   VAL A HB   1  
ATOM 130   H HG11 . VAL A 1 8   ? 17.501  -17.119 -10.170 1.00 0.00 ? 8   VAL A HG11 1  
ATOM 131   H HG12 . VAL A 1 8   ? 17.771  -15.413 -9.808  1.00 0.00 ? 8   VAL A HG12 1  
ATOM 132   H HG13 . VAL A 1 8   ? 16.310  -15.914 -10.661 1.00 0.00 ? 8   VAL A HG13 1  
ATOM 133   H HG21 . VAL A 1 8   ? 18.667  -14.371 -13.187 1.00 0.00 ? 8   VAL A HG21 1  
ATOM 134   H HG22 . VAL A 1 8   ? 17.329  -13.954 -12.117 1.00 0.00 ? 8   VAL A HG22 1  
ATOM 135   H HG23 . VAL A 1 8   ? 18.974  -14.032 -11.484 1.00 0.00 ? 8   VAL A HG23 1  
ATOM 136   N N    . LYS A 1 9   ? 21.074  -15.376 -10.604 1.00 0.00 ? 9   LYS A N    1  
ATOM 137   C CA   . LYS A 1 9   ? 21.836  -14.961 -9.432  1.00 0.00 ? 9   LYS A CA   1  
ATOM 138   C C    . LYS A 1 9   ? 21.651  -13.471 -9.163  1.00 0.00 ? 9   LYS A C    1  
ATOM 139   O O    . LYS A 1 9   ? 22.044  -12.630 -9.972  1.00 0.00 ? 9   LYS A O    1  
ATOM 140   C CB   . LYS A 1 9   ? 23.321  -15.274 -9.628  1.00 0.00 ? 9   LYS A CB   1  
ATOM 141   C CG   . LYS A 1 9   ? 24.244  -14.369 -8.831  1.00 0.00 ? 9   LYS A CG   1  
ATOM 142   C CD   . LYS A 1 9   ? 25.704  -14.625 -9.167  1.00 0.00 ? 9   LYS A CD   1  
ATOM 143   C CE   . LYS A 1 9   ? 26.419  -15.343 -8.033  1.00 0.00 ? 9   LYS A CE   1  
ATOM 144   N NZ   . LYS A 1 9   ? 26.317  -16.823 -8.162  1.00 0.00 ? 9   LYS A NZ   1  
ATOM 145   H H    . LYS A 1 9   ? 21.237  -14.931 -11.463 1.00 0.00 ? 9   LYS A H    1  
ATOM 146   H HA   . LYS A 1 9   ? 21.468  -15.516 -8.583  1.00 0.00 ? 9   LYS A HA   1  
ATOM 147   H HB2  . LYS A 1 9   ? 23.504  -16.295 -9.327  1.00 0.00 ? 9   LYS A HB2  1  
ATOM 148   H HB3  . LYS A 1 9   ? 23.564  -15.168 -10.675 1.00 0.00 ? 9   LYS A HB3  1  
ATOM 149   H HG2  . LYS A 1 9   ? 24.009  -13.339 -9.058  1.00 0.00 ? 9   LYS A HG2  1  
ATOM 150   H HG3  . LYS A 1 9   ? 24.089  -14.551 -7.777  1.00 0.00 ? 9   LYS A HG3  1  
ATOM 151   H HD2  . LYS A 1 9   ? 25.758  -15.236 -10.055 1.00 0.00 ? 9   LYS A HD2  1  
ATOM 152   H HD3  . LYS A 1 9   ? 26.194  -13.678 -9.348  1.00 0.00 ? 9   LYS A HD3  1  
ATOM 153   H HE2  . LYS A 1 9   ? 27.460  -15.060 -8.044  1.00 0.00 ? 9   LYS A HE2  1  
ATOM 154   H HE3  . LYS A 1 9   ? 25.974  -15.041 -7.096  1.00 0.00 ? 9   LYS A HE3  1  
ATOM 155   H HZ1  . LYS A 1 9   ? 26.464  -17.105 -9.153  1.00 0.00 ? 9   LYS A HZ1  1  
ATOM 156   H HZ2  . LYS A 1 9   ? 25.377  -17.145 -7.858  1.00 0.00 ? 9   LYS A HZ2  1  
ATOM 157   H HZ3  . LYS A 1 9   ? 27.038  -17.284 -7.571  1.00 0.00 ? 9   LYS A HZ3  1  
ATOM 158   N N    . LEU A 1 10  ? 21.053  -13.151 -8.021  1.00 0.00 ? 10  LEU A N    1  
ATOM 159   C CA   . LEU A 1 10  ? 20.818  -11.761 -7.643  1.00 0.00 ? 10  LEU A CA   1  
ATOM 160   C C    . LEU A 1 10  ? 20.965  -11.574 -6.137  1.00 0.00 ? 10  LEU A C    1  
ATOM 161   O O    . LEU A 1 10  ? 20.947  -12.542 -5.377  1.00 0.00 ? 10  LEU A O    1  
ATOM 162   C CB   . LEU A 1 10  ? 19.423  -11.320 -8.090  1.00 0.00 ? 10  LEU A CB   1  
ATOM 163   C CG   . LEU A 1 10  ? 19.011  -11.729 -9.505  1.00 0.00 ? 10  LEU A CG   1  
ATOM 164   C CD1  . LEU A 1 10  ? 17.511  -11.561 -9.693  1.00 0.00 ? 10  LEU A CD1  1  
ATOM 165   C CD2  . LEU A 1 10  ? 19.775  -10.915 -10.539 1.00 0.00 ? 10  LEU A CD2  1  
ATOM 166   H H    . LEU A 1 10  ? 20.762  -13.865 -7.416  1.00 0.00 ? 10  LEU A H    1  
ATOM 167   H HA   . LEU A 1 10  ? 21.556  -11.153 -8.143  1.00 0.00 ? 10  LEU A HA   1  
ATOM 168   H HB2  . LEU A 1 10  ? 18.706  -11.742 -7.402  1.00 0.00 ? 10  LEU A HB2  1  
ATOM 169   H HB3  . LEU A 1 10  ? 19.383  -10.242 -8.031  1.00 0.00 ? 10  LEU A HB3  1  
ATOM 170   H HG   . LEU A 1 10  ? 19.251  -12.772 -9.656  1.00 0.00 ? 10  LEU A HG   1  
ATOM 171   H HD11 . LEU A 1 10  ? 17.072  -12.513 -9.952  1.00 0.00 ? 10  LEU A HD11 1  
ATOM 172   H HD12 . LEU A 1 10  ? 17.325  -10.851 -10.486 1.00 0.00 ? 10  LEU A HD12 1  
ATOM 173   H HD13 . LEU A 1 10  ? 17.071  -11.198 -8.776  1.00 0.00 ? 10  LEU A HD13 1  
ATOM 174   H HD21 . LEU A 1 10  ? 19.133  -10.140 -10.932 1.00 0.00 ? 10  LEU A HD21 1  
ATOM 175   H HD22 . LEU A 1 10  ? 20.092  -11.562 -11.344 1.00 0.00 ? 10  LEU A HD22 1  
ATOM 176   H HD23 . LEU A 1 10  ? 20.640  -10.464 -10.075 1.00 0.00 ? 10  LEU A HD23 1  
ATOM 177   N N    . GLN A 1 11  ? 21.107  -10.323 -5.712  1.00 0.00 ? 11  GLN A N    1  
ATOM 178   C CA   . GLN A 1 11  ? 21.255  -10.009 -4.296  1.00 0.00 ? 11  GLN A CA   1  
ATOM 179   C C    . GLN A 1 11  ? 20.430  -8.782  -3.921  1.00 0.00 ? 11  GLN A C    1  
ATOM 180   O O    . GLN A 1 11  ? 20.474  -7.759  -4.605  1.00 0.00 ? 11  GLN A O    1  
ATOM 181   C CB   . GLN A 1 11  ? 22.728  -9.772  -3.956  1.00 0.00 ? 11  GLN A CB   1  
ATOM 182   C CG   . GLN A 1 11  ? 23.250  -8.422  -4.421  1.00 0.00 ? 11  GLN A CG   1  
ATOM 183   C CD   . GLN A 1 11  ? 24.698  -8.193  -4.037  1.00 0.00 ? 11  GLN A CD   1  
ATOM 184   O OE1  . GLN A 1 11  ? 25.611  -8.728  -4.666  1.00 0.00 ? 11  GLN A OE1  1  
ATOM 185   N NE2  . GLN A 1 11  ? 24.916  -7.393  -3.000  1.00 0.00 ? 11  GLN A NE2  1  
ATOM 186   H H    . GLN A 1 11  ? 21.114  -9.594  -6.367  1.00 0.00 ? 11  GLN A H    1  
ATOM 187   H HA   . GLN A 1 11  ? 20.896  -10.855 -3.730  1.00 0.00 ? 11  GLN A HA   1  
ATOM 188   H HB2  . GLN A 1 11  ? 22.852  -9.832  -2.885  1.00 0.00 ? 11  GLN A HB2  1  
ATOM 189   H HB3  . GLN A 1 11  ? 23.322  -10.543 -4.423  1.00 0.00 ? 11  GLN A HB3  1  
ATOM 190   H HG2  . GLN A 1 11  ? 23.166  -8.369  -5.496  1.00 0.00 ? 11  GLN A HG2  1  
ATOM 191   H HG3  . GLN A 1 11  ? 22.647  -7.644  -3.975  1.00 0.00 ? 11  GLN A HG3  1  
ATOM 192   H HE21 . GLN A 1 11  ? 24.140  -7.002  -2.546  1.00 0.00 ? 11  GLN A HE21 1  
ATOM 193   H HE22 . GLN A 1 11  ? 25.843  -7.228  -2.729  1.00 0.00 ? 11  GLN A HE22 1  
ATOM 194   N N    . LEU A 1 12  ? 19.679  -8.892  -2.831  1.00 0.00 ? 12  LEU A N    1  
ATOM 195   C CA   . LEU A 1 12  ? 18.843  -7.791  -2.365  1.00 0.00 ? 12  LEU A CA   1  
ATOM 196   C C    . LEU A 1 12  ? 18.727  -7.801  -0.844  1.00 0.00 ? 12  LEU A C    1  
ATOM 197   O O    . LEU A 1 12  ? 18.834  -8.843  -0.196  1.00 0.00 ? 12  LEU A O    1  
ATOM 198   C CB   . LEU A 1 12  ? 17.451  -7.879  -2.994  1.00 0.00 ? 12  LEU A CB   1  
ATOM 199   C CG   . LEU A 1 12  ? 17.409  -8.213  -4.485  1.00 0.00 ? 12  LEU A CG   1  
ATOM 200   C CD1  . LEU A 1 12  ? 16.032  -8.726  -4.879  1.00 0.00 ? 12  LEU A CD1  1  
ATOM 201   C CD2  . LEU A 1 12  ? 17.782  -6.993  -5.315  1.00 0.00 ? 12  LEU A CD2  1  
ATOM 202   H H    . LEU A 1 12  ? 19.686  -9.732  -2.327  1.00 0.00 ? 12  LEU A H    1  
ATOM 203   H HA   . LEU A 1 12  ? 19.310  -6.867  -2.672  1.00 0.00 ? 12  LEU A HA   1  
ATOM 204   H HB2  . LEU A 1 12  ? 16.899  -8.643  -2.468  1.00 0.00 ? 12  LEU A HB2  1  
ATOM 205   H HB3  . LEU A 1 12  ? 16.964  -6.925  -2.853  1.00 0.00 ? 12  LEU A HB3  1  
ATOM 206   H HG   . LEU A 1 12  ? 18.128  -8.993  -4.694  1.00 0.00 ? 12  LEU A HG   1  
ATOM 207   H HD11 . LEU A 1 12  ? 15.382  -7.890  -5.087  1.00 0.00 ? 12  LEU A HD11 1  
ATOM 208   H HD12 . LEU A 1 12  ? 15.621  -9.309  -4.068  1.00 0.00 ? 12  LEU A HD12 1  
ATOM 209   H HD13 . LEU A 1 12  ? 16.117  -9.345  -5.760  1.00 0.00 ? 12  LEU A HD13 1  
ATOM 210   H HD21 . LEU A 1 12  ? 18.645  -7.222  -5.923  1.00 0.00 ? 12  LEU A HD21 1  
ATOM 211   H HD22 . LEU A 1 12  ? 18.014  -6.168  -4.658  1.00 0.00 ? 12  LEU A HD22 1  
ATOM 212   H HD23 . LEU A 1 12  ? 16.954  -6.725  -5.953  1.00 0.00 ? 12  LEU A HD23 1  
ATOM 213   N N    . PRO A 1 13  ? 18.503  -6.615  -0.259  1.00 0.00 ? 13  PRO A N    1  
ATOM 214   C CA   . PRO A 1 13  ? 18.365  -6.462  1.192   1.00 0.00 ? 13  PRO A CA   1  
ATOM 215   C C    . PRO A 1 13  ? 17.074  -7.077  1.720   1.00 0.00 ? 13  PRO A C    1  
ATOM 216   O O    . PRO A 1 13  ? 16.091  -7.203  0.991   1.00 0.00 ? 13  PRO A O    1  
ATOM 217   C CB   . PRO A 1 13  ? 18.353  -4.944  1.389   1.00 0.00 ? 13  PRO A CB   1  
ATOM 218   C CG   . PRO A 1 13  ? 17.859  -4.398  0.094   1.00 0.00 ? 13  PRO A CG   1  
ATOM 219   C CD   . PRO A 1 13  ? 18.365  -5.333  -0.970  1.00 0.00 ? 13  PRO A CD   1  
ATOM 220   H HA   . PRO A 1 13  ? 19.207  -6.888  1.718   1.00 0.00 ? 13  PRO A HA   1  
ATOM 221   H HB2  . PRO A 1 13  ? 17.691  -4.689  2.204   1.00 0.00 ? 13  PRO A HB2  1  
ATOM 222   H HB3  . PRO A 1 13  ? 19.352  -4.598  1.607   1.00 0.00 ? 13  PRO A HB3  1  
ATOM 223   H HG2  . PRO A 1 13  ? 16.780  -4.377  0.092   1.00 0.00 ? 13  PRO A HG2  1  
ATOM 224   H HG3  . PRO A 1 13  ? 18.256  -3.405  -0.061  1.00 0.00 ? 13  PRO A HG3  1  
ATOM 225   H HD2  . PRO A 1 13  ? 17.649  -5.413  -1.774  1.00 0.00 ? 13  PRO A HD2  1  
ATOM 226   H HD3  . PRO A 1 13  ? 19.320  -4.996  -1.345  1.00 0.00 ? 13  PRO A HD3  1  
ATOM 227   N N    . ALA A 1 14  ? 17.083  -7.459  2.994   1.00 0.00 ? 14  ALA A N    1  
ATOM 228   C CA   . ALA A 1 14  ? 15.912  -8.059  3.620   1.00 0.00 ? 14  ALA A CA   1  
ATOM 229   C C    . ALA A 1 14  ? 14.793  -7.036  3.786   1.00 0.00 ? 14  ALA A C    1  
ATOM 230   O O    . ALA A 1 14  ? 15.008  -5.949  4.321   1.00 0.00 ? 14  ALA A O    1  
ATOM 231   C CB   . ALA A 1 14  ? 16.283  -8.661  4.967   1.00 0.00 ? 14  ALA A CB   1  
ATOM 232   H H    . ALA A 1 14  ? 17.897  -7.332  3.525   1.00 0.00 ? 14  ALA A H    1  
ATOM 233   H HA   . ALA A 1 14  ? 15.563  -8.857  2.980   1.00 0.00 ? 14  ALA A HA   1  
ATOM 234   H HB1  . ALA A 1 14  ? 17.105  -8.105  5.394   1.00 0.00 ? 14  ALA A HB1  1  
ATOM 235   H HB2  . ALA A 1 14  ? 15.432  -8.613  5.629   1.00 0.00 ? 14  ALA A HB2  1  
ATOM 236   H HB3  . ALA A 1 14  ? 16.577  -9.691  4.831   1.00 0.00 ? 14  ALA A HB3  1  
ATOM 237   N N    . GLY A 1 15  ? 13.598  -7.391  3.323   1.00 0.00 ? 15  GLY A N    1  
ATOM 238   C CA   . GLY A 1 15  ? 12.464  -6.492  3.429   1.00 0.00 ? 15  GLY A CA   1  
ATOM 239   C C    . GLY A 1 15  ? 12.514  -5.372  2.408   1.00 0.00 ? 15  GLY A C    1  
ATOM 240   O O    . GLY A 1 15  ? 12.605  -4.198  2.767   1.00 0.00 ? 15  GLY A O    1  
ATOM 241   H H    . GLY A 1 15  ? 13.486  -8.271  2.906   1.00 0.00 ? 15  GLY A H    1  
ATOM 242   H HA2  . GLY A 1 15  ? 11.556  -7.057  3.285   1.00 0.00 ? 15  GLY A HA2  1  
ATOM 243   H HA3  . GLY A 1 15  ? 12.454  -6.059  4.419   1.00 0.00 ? 15  GLY A HA3  1  
ATOM 244   N N    . LYS A 1 16  ? 12.456  -5.736  1.132   1.00 0.00 ? 16  LYS A N    1  
ATOM 245   C CA   . LYS A 1 16  ? 12.495  -4.754  0.054   1.00 0.00 ? 16  LYS A CA   1  
ATOM 246   C C    . LYS A 1 16  ? 11.780  -5.280  -1.187  1.00 0.00 ? 16  LYS A C    1  
ATOM 247   O O    . LYS A 1 16  ? 12.011  -4.802  -2.297  1.00 0.00 ? 16  LYS A O    1  
ATOM 248   C CB   . LYS A 1 16  ? 13.944  -4.402  -0.290  1.00 0.00 ? 16  LYS A CB   1  
ATOM 249   C CG   . LYS A 1 16  ? 14.633  -5.442  -1.157  1.00 0.00 ? 16  LYS A CG   1  
ATOM 250   C CD   . LYS A 1 16  ? 14.923  -4.904  -2.549  1.00 0.00 ? 16  LYS A CD   1  
ATOM 251   C CE   . LYS A 1 16  ? 14.523  -5.901  -3.626  1.00 0.00 ? 16  LYS A CE   1  
ATOM 252   N NZ   . LYS A 1 16  ? 14.918  -5.437  -4.984  1.00 0.00 ? 16  LYS A NZ   1  
ATOM 253   H H    . LYS A 1 16  ? 12.384  -6.688  0.908   1.00 0.00 ? 16  LYS A H    1  
ATOM 254   H HA   . LYS A 1 16  ? 11.989  -3.865  0.397   1.00 0.00 ? 16  LYS A HA   1  
ATOM 255   H HB2  . LYS A 1 16  ? 13.957  -3.459  -0.817  1.00 0.00 ? 16  LYS A HB2  1  
ATOM 256   H HB3  . LYS A 1 16  ? 14.505  -4.300  0.628   1.00 0.00 ? 16  LYS A HB3  1  
ATOM 257   H HG2  . LYS A 1 16  ? 15.565  -5.725  -0.691  1.00 0.00 ? 16  LYS A HG2  1  
ATOM 258   H HG3  . LYS A 1 16  ? 13.993  -6.308  -1.242  1.00 0.00 ? 16  LYS A HG3  1  
ATOM 259   H HD2  . LYS A 1 16  ? 14.367  -3.990  -2.695  1.00 0.00 ? 16  LYS A HD2  1  
ATOM 260   H HD3  . LYS A 1 16  ? 15.982  -4.701  -2.633  1.00 0.00 ? 16  LYS A HD3  1  
ATOM 261   H HE2  . LYS A 1 16  ? 15.006  -6.844  -3.422  1.00 0.00 ? 16  LYS A HE2  1  
ATOM 262   H HE3  . LYS A 1 16  ? 13.451  -6.031  -3.597  1.00 0.00 ? 16  LYS A HE3  1  
ATOM 263   H HZ1  . LYS A 1 16  ? 14.403  -4.568  -5.229  1.00 0.00 ? 16  LYS A HZ1  1  
ATOM 264   H HZ2  . LYS A 1 16  ? 14.697  -6.168  -5.690  1.00 0.00 ? 16  LYS A HZ2  1  
ATOM 265   H HZ3  . LYS A 1 16  ? 15.939  -5.242  -5.013  1.00 0.00 ? 16  LYS A HZ3  1  
ATOM 266   N N    . ALA A 1 17  ? 10.910  -6.264  -0.990  1.00 0.00 ? 17  ALA A N    1  
ATOM 267   C CA   . ALA A 1 17  ? 10.158  -6.852  -2.092  1.00 0.00 ? 17  ALA A CA   1  
ATOM 268   C C    . ALA A 1 17  ? 9.357   -5.790  -2.838  1.00 0.00 ? 17  ALA A C    1  
ATOM 269   O O    . ALA A 1 17  ? 8.472   -5.151  -2.269  1.00 0.00 ? 17  ALA A O    1  
ATOM 270   C CB   . ALA A 1 17  ? 9.236   -7.947  -1.578  1.00 0.00 ? 17  ALA A CB   1  
ATOM 271   H H    . ALA A 1 17  ? 10.768  -6.603  -0.081  1.00 0.00 ? 17  ALA A H    1  
ATOM 272   H HA   . ALA A 1 17  ? 10.865  -7.301  -2.776  1.00 0.00 ? 17  ALA A HA   1  
ATOM 273   H HB1  . ALA A 1 17  ? 9.395   -8.849  -2.151  1.00 0.00 ? 17  ALA A HB1  1  
ATOM 274   H HB2  . ALA A 1 17  ? 9.450   -8.139  -0.537  1.00 0.00 ? 17  ALA A HB2  1  
ATOM 275   H HB3  . ALA A 1 17  ? 8.209   -7.630  -1.682  1.00 0.00 ? 17  ALA A HB3  1  
ATOM 276   N N    . THR A 1 18  ? 9.675   -5.604  -4.116  1.00 0.00 ? 18  THR A N    1  
ATOM 277   C CA   . THR A 1 18  ? 8.986   -4.619  -4.939  1.00 0.00 ? 18  THR A CA   1  
ATOM 278   C C    . THR A 1 18  ? 8.404   -5.260  -6.194  1.00 0.00 ? 18  THR A C    1  
ATOM 279   O O    . THR A 1 18  ? 8.826   -6.333  -6.624  1.00 0.00 ? 18  THR A O    1  
ATOM 280   C CB   . THR A 1 18  ? 9.930   -3.473  -5.352  1.00 0.00 ? 18  THR A CB   1  
ATOM 281   O OG1  . THR A 1 18  ? 11.268  -3.965  -5.484  1.00 0.00 ? 18  THR A OG1  1  
ATOM 282   C CG2  . THR A 1 18  ? 9.897   -2.349  -4.328  1.00 0.00 ? 18  THR A CG2  1  
ATOM 283   H H    . THR A 1 18  ? 10.390  -6.144  -4.513  1.00 0.00 ? 18  THR A H    1  
ATOM 284   H HA   . THR A 1 18  ? 8.180   -4.200  -4.354  1.00 0.00 ? 18  THR A HA   1  
ATOM 285   H HB   . THR A 1 18  ? 9.602   -3.083  -6.304  1.00 0.00 ? 18  THR A HB   1  
ATOM 286   H HG1  . THR A 1 18  ? 11.291  -4.654  -6.154  1.00 0.00 ? 18  THR A HG1  1  
ATOM 287   H HG21 . THR A 1 18  ? 10.878  -1.906  -4.247  1.00 0.00 ? 18  THR A HG21 1  
ATOM 288   H HG22 . THR A 1 18  ? 9.600   -2.745  -3.368  1.00 0.00 ? 18  THR A HG22 1  
ATOM 289   H HG23 . THR A 1 18  ? 9.188   -1.598  -4.642  1.00 0.00 ? 18  THR A HG23 1  
ATOM 290   N N    . PRO A 1 19  ? 7.412   -4.588  -6.797  1.00 0.00 ? 19  PRO A N    1  
ATOM 291   C CA   . PRO A 1 19  ? 6.753   -5.074  -8.013  1.00 0.00 ? 19  PRO A CA   1  
ATOM 292   C C    . PRO A 1 19  ? 7.667   -5.014  -9.232  1.00 0.00 ? 19  PRO A C    1  
ATOM 293   O O    . PRO A 1 19  ? 7.347   -5.562  -10.286 1.00 0.00 ? 19  PRO A O    1  
ATOM 294   C CB   . PRO A 1 19  ? 5.571   -4.115  -8.182  1.00 0.00 ? 19  PRO A CB   1  
ATOM 295   C CG   . PRO A 1 19  ? 5.995   -2.866  -7.490  1.00 0.00 ? 19  PRO A CG   1  
ATOM 296   C CD   . PRO A 1 19  ? 6.859   -3.303  -6.339  1.00 0.00 ? 19  PRO A CD   1  
ATOM 297   H HA   . PRO A 1 19  ? 6.385   -6.082  -7.889  1.00 0.00 ? 19  PRO A HA   1  
ATOM 298   H HB2  . PRO A 1 19  ? 5.392   -3.943  -9.234  1.00 0.00 ? 19  PRO A HB2  1  
ATOM 299   H HB3  . PRO A 1 19  ? 4.690   -4.539  -7.726  1.00 0.00 ? 19  PRO A HB3  1  
ATOM 300   H HG2  . PRO A 1 19  ? 6.560   -2.244  -8.168  1.00 0.00 ? 19  PRO A HG2  1  
ATOM 301   H HG3  . PRO A 1 19  ? 5.127   -2.336  -7.126  1.00 0.00 ? 19  PRO A HG3  1  
ATOM 302   H HD2  . PRO A 1 19  ? 7.646   -2.584  -6.165  1.00 0.00 ? 19  PRO A HD2  1  
ATOM 303   H HD3  . PRO A 1 19  ? 6.263   -3.436  -5.449  1.00 0.00 ? 19  PRO A HD3  1  
ATOM 304   N N    . ALA A 1 20  ? 8.805   -4.344  -9.080  1.00 0.00 ? 20  ALA A N    1  
ATOM 305   C CA   . ALA A 1 20  ? 9.766   -4.215  -10.168 1.00 0.00 ? 20  ALA A CA   1  
ATOM 306   C C    . ALA A 1 20  ? 11.120  -4.795  -9.776  1.00 0.00 ? 20  ALA A C    1  
ATOM 307   O O    . ALA A 1 20  ? 12.128  -4.090  -9.709  1.00 0.00 ? 20  ALA A O    1  
ATOM 308   C CB   . ALA A 1 20  ? 9.911   -2.756  -10.574 1.00 0.00 ? 20  ALA A CB   1  
ATOM 309   H H    . ALA A 1 20  ? 9.003   -3.928  -8.216  1.00 0.00 ? 20  ALA A H    1  
ATOM 310   H HA   . ALA A 1 20  ? 9.384   -4.763  -11.018 1.00 0.00 ? 20  ALA A HA   1  
ATOM 311   H HB1  . ALA A 1 20  ? 10.839  -2.623  -11.112 1.00 0.00 ? 20  ALA A HB1  1  
ATOM 312   H HB2  . ALA A 1 20  ? 9.083   -2.474  -11.207 1.00 0.00 ? 20  ALA A HB2  1  
ATOM 313   H HB3  . ALA A 1 20  ? 9.916   -2.136  -9.690  1.00 0.00 ? 20  ALA A HB3  1  
ATOM 314   N N    . PRO A 1 21  ? 11.148  -6.109  -9.508  1.00 0.00 ? 21  PRO A N    1  
ATOM 315   C CA   . PRO A 1 21  ? 12.373  -6.811  -9.117  1.00 0.00 ? 21  PRO A CA   1  
ATOM 316   C C    . PRO A 1 21  ? 13.368  -6.925  -10.267 1.00 0.00 ? 21  PRO A C    1  
ATOM 317   O O    . PRO A 1 21  ? 13.047  -6.662  -11.427 1.00 0.00 ? 21  PRO A O    1  
ATOM 318   C CB   . PRO A 1 21  ? 11.871  -8.198  -8.706  1.00 0.00 ? 21  PRO A CB   1  
ATOM 319   C CG   . PRO A 1 21  ? 10.598  -8.378  -9.458  1.00 0.00 ? 21  PRO A CG   1  
ATOM 320   C CD   . PRO A 1 21  ? 9.985   -7.010  -9.568  1.00 0.00 ? 21  PRO A CD   1  
ATOM 321   H HA   . PRO A 1 21  ? 12.852  -6.335  -8.274  1.00 0.00 ? 21  PRO A HA   1  
ATOM 322   H HB2  . PRO A 1 21  ? 12.603  -8.945  -8.981  1.00 0.00 ? 21  PRO A HB2  1  
ATOM 323   H HB3  . PRO A 1 21  ? 11.707  -8.223  -7.639  1.00 0.00 ? 21  PRO A HB3  1  
ATOM 324   H HG2  . PRO A 1 21  ? 10.804  -8.777  -10.439 1.00 0.00 ? 21  PRO A HG2  1  
ATOM 325   H HG3  . PRO A 1 21  ? 9.941   -9.040  -8.913  1.00 0.00 ? 21  PRO A HG3  1  
ATOM 326   H HD2  . PRO A 1 21  ? 9.463   -6.904  -10.507 1.00 0.00 ? 21  PRO A HD2  1  
ATOM 327   H HD3  . PRO A 1 21  ? 9.315   -6.829  -8.740  1.00 0.00 ? 21  PRO A HD3  1  
ATOM 328   N N    . PRO A 1 22  ? 14.606  -7.326  -9.942  1.00 0.00 ? 22  PRO A N    1  
ATOM 329   C CA   . PRO A 1 22  ? 15.673  -7.485  -10.935 1.00 0.00 ? 22  PRO A CA   1  
ATOM 330   C C    . PRO A 1 22  ? 15.428  -8.668  -11.865 1.00 0.00 ? 22  PRO A C    1  
ATOM 331   O O    . PRO A 1 22  ? 16.128  -8.841  -12.863 1.00 0.00 ? 22  PRO A O    1  
ATOM 332   C CB   . PRO A 1 22  ? 16.920  -7.726  -10.080 1.00 0.00 ? 22  PRO A CB   1  
ATOM 333   C CG   . PRO A 1 22  ? 16.401  -8.297  -8.806  1.00 0.00 ? 22  PRO A CG   1  
ATOM 334   C CD   . PRO A 1 22  ? 15.060  -7.657  -8.581  1.00 0.00 ? 22  PRO A CD   1  
ATOM 335   H HA   . PRO A 1 22  ? 15.805  -6.588  -11.522 1.00 0.00 ? 22  PRO A HA   1  
ATOM 336   H HB2  . PRO A 1 22  ? 17.578  -8.418  -10.586 1.00 0.00 ? 22  PRO A HB2  1  
ATOM 337   H HB3  . PRO A 1 22  ? 17.433  -6.790  -9.913  1.00 0.00 ? 22  PRO A HB3  1  
ATOM 338   H HG2  . PRO A 1 22  ? 16.295  -9.367  -8.900  1.00 0.00 ? 22  PRO A HG2  1  
ATOM 339   H HG3  . PRO A 1 22  ? 17.073  -8.055  -7.995  1.00 0.00 ? 22  PRO A HG3  1  
ATOM 340   H HD2  . PRO A 1 22  ? 14.383  -8.353  -8.107  1.00 0.00 ? 22  PRO A HD2  1  
ATOM 341   H HD3  . PRO A 1 22  ? 15.164  -6.763  -7.983  1.00 0.00 ? 22  PRO A HD3  1  
ATOM 342   N N    . VAL A 1 23  ? 14.431  -9.480  -11.532 1.00 0.00 ? 23  VAL A N    1  
ATOM 343   C CA   . VAL A 1 23  ? 14.092  -10.647 -12.339 1.00 0.00 ? 23  VAL A CA   1  
ATOM 344   C C    . VAL A 1 23  ? 12.658  -10.566 -12.848 1.00 0.00 ? 23  VAL A C    1  
ATOM 345   O O    . VAL A 1 23  ? 12.170  -11.480 -13.511 1.00 0.00 ? 23  VAL A O    1  
ATOM 346   C CB   . VAL A 1 23  ? 14.269  -11.952 -11.540 1.00 0.00 ? 23  VAL A CB   1  
ATOM 347   C CG1  . VAL A 1 23  ? 13.194  -12.073 -10.470 1.00 0.00 ? 23  VAL A CG1  1  
ATOM 348   C CG2  . VAL A 1 23  ? 14.243  -13.154 -12.472 1.00 0.00 ? 23  VAL A CG2  1  
ATOM 349   H H    . VAL A 1 23  ? 13.909  -9.290  -10.725 1.00 0.00 ? 23  VAL A H    1  
ATOM 350   H HA   . VAL A 1 23  ? 14.764  -10.674 -13.185 1.00 0.00 ? 23  VAL A HA   1  
ATOM 351   H HB   . VAL A 1 23  ? 15.231  -11.923 -11.050 1.00 0.00 ? 23  VAL A HB   1  
ATOM 352   H HG11 . VAL A 1 23  ? 12.803  -11.093 -10.241 1.00 0.00 ? 23  VAL A HG11 1  
ATOM 353   H HG12 . VAL A 1 23  ? 12.396  -12.705 -10.831 1.00 0.00 ? 23  VAL A HG12 1  
ATOM 354   H HG13 . VAL A 1 23  ? 13.622  -12.507 -9.578  1.00 0.00 ? 23  VAL A HG13 1  
ATOM 355   H HG21 . VAL A 1 23  ? 14.662  -14.011 -11.965 1.00 0.00 ? 23  VAL A HG21 1  
ATOM 356   H HG22 . VAL A 1 23  ? 13.223  -13.368 -12.757 1.00 0.00 ? 23  VAL A HG22 1  
ATOM 357   H HG23 . VAL A 1 23  ? 14.825  -12.938 -13.355 1.00 0.00 ? 23  VAL A HG23 1  
ATOM 358   N N    . GLY A 1 24  ? 11.986  -9.462  -12.534 1.00 0.00 ? 24  GLY A N    1  
ATOM 359   C CA   . GLY A 1 24  ? 10.613  -9.281  -12.968 1.00 0.00 ? 24  GLY A CA   1  
ATOM 360   C C    . GLY A 1 24  ? 10.406  -9.674  -14.418 1.00 0.00 ? 24  GLY A C    1  
ATOM 361   O O    . GLY A 1 24  ? 9.709   -10.640 -14.728 1.00 0.00 ? 24  GLY A O    1  
ATOM 362   H H    . GLY A 1 24  ? 12.425  -8.765  -12.003 1.00 0.00 ? 24  GLY A H    1  
ATOM 363   H HA2  . GLY A 1 24  ? 9.967   -9.884  -12.347 1.00 0.00 ? 24  GLY A HA2  1  
ATOM 364   H HA3  . GLY A 1 24  ? 10.343  -8.242  -12.847 1.00 0.00 ? 24  GLY A HA3  1  
ATOM 365   N N    . PRO A 1 25  ? 11.022  -8.912  -15.334 1.00 0.00 ? 25  PRO A N    1  
ATOM 366   C CA   . PRO A 1 25  ? 10.916  -9.166  -16.774 1.00 0.00 ? 25  PRO A CA   1  
ATOM 367   C C    . PRO A 1 25  ? 11.649  -10.436 -17.194 1.00 0.00 ? 25  PRO A C    1  
ATOM 368   O O    . PRO A 1 25  ? 11.563  -10.861 -18.346 1.00 0.00 ? 25  PRO A O    1  
ATOM 369   C CB   . PRO A 1 25  ? 11.577  -7.935  -17.401 1.00 0.00 ? 25  PRO A CB   1  
ATOM 370   C CG   . PRO A 1 25  ? 12.517  -7.438  -16.357 1.00 0.00 ? 25  PRO A CG   1  
ATOM 371   C CD   . PRO A 1 25  ? 11.869  -7.745  -15.036 1.00 0.00 ? 25  PRO A CD   1  
ATOM 372   H HA   . PRO A 1 25  ? 9.886   -9.224  -17.092 1.00 0.00 ? 25  PRO A HA   1  
ATOM 373   H HB2  . PRO A 1 25  ? 12.101  -8.224  -18.301 1.00 0.00 ? 25  PRO A HB2  1  
ATOM 374   H HB3  . PRO A 1 25  ? 10.823  -7.199  -17.637 1.00 0.00 ? 25  PRO A HB3  1  
ATOM 375   H HG2  . PRO A 1 25  ? 13.462  -7.951  -16.440 1.00 0.00 ? 25  PRO A HG2  1  
ATOM 376   H HG3  . PRO A 1 25  ? 12.655  -6.372  -16.467 1.00 0.00 ? 25  PRO A HG3  1  
ATOM 377   H HD2  . PRO A 1 25  ? 12.617  -7.990  -14.297 1.00 0.00 ? 25  PRO A HD2  1  
ATOM 378   H HD3  . PRO A 1 25  ? 11.270  -6.909  -14.706 1.00 0.00 ? 25  PRO A HD3  1  
ATOM 379   N N    . ALA A 1 26  ? 12.369  -11.037 -16.253 1.00 0.00 ? 26  ALA A N    1  
ATOM 380   C CA   . ALA A 1 26  ? 13.114  -12.259 -16.526 1.00 0.00 ? 26  ALA A CA   1  
ATOM 381   C C    . ALA A 1 26  ? 12.405  -13.476 -15.942 1.00 0.00 ? 26  ALA A C    1  
ATOM 382   O O    . ALA A 1 26  ? 12.882  -14.605 -16.066 1.00 0.00 ? 26  ALA A O    1  
ATOM 383   C CB   . ALA A 1 26  ? 14.526  -12.152 -15.969 1.00 0.00 ? 26  ALA A CB   1  
ATOM 384   H H    . ALA A 1 26  ? 12.398  -10.649 -15.354 1.00 0.00 ? 26  ALA A H    1  
ATOM 385   H HA   . ALA A 1 26  ? 13.184  -12.376 -17.598 1.00 0.00 ? 26  ALA A HA   1  
ATOM 386   H HB1  . ALA A 1 26  ? 14.991  -13.127 -15.979 1.00 0.00 ? 26  ALA A HB1  1  
ATOM 387   H HB2  . ALA A 1 26  ? 15.102  -11.472 -16.579 1.00 0.00 ? 26  ALA A HB2  1  
ATOM 388   H HB3  . ALA A 1 26  ? 14.486  -11.782 -14.956 1.00 0.00 ? 26  ALA A HB3  1  
ATOM 389   N N    . LEU A 1 27  ? 11.263  -13.241 -15.304 1.00 0.00 ? 27  LEU A N    1  
ATOM 390   C CA   . LEU A 1 27  ? 10.488  -14.319 -14.700 1.00 0.00 ? 27  LEU A CA   1  
ATOM 391   C C    . LEU A 1 27  ? 9.114   -14.434 -15.354 1.00 0.00 ? 27  LEU A C    1  
ATOM 392   O O    . LEU A 1 27  ? 8.477   -15.485 -15.302 1.00 0.00 ? 27  LEU A O    1  
ATOM 393   C CB   . LEU A 1 27  ? 10.332  -14.080 -13.197 1.00 0.00 ? 27  LEU A CB   1  
ATOM 394   C CG   . LEU A 1 27  ? 9.183   -13.162 -12.779 1.00 0.00 ? 27  LEU A CG   1  
ATOM 395   C CD1  . LEU A 1 27  ? 7.932   -13.975 -12.480 1.00 0.00 ? 27  LEU A CD1  1  
ATOM 396   C CD2  . LEU A 1 27  ? 9.580   -12.327 -11.570 1.00 0.00 ? 27  LEU A CD2  1  
ATOM 397   H H    . LEU A 1 27  ? 10.934  -12.321 -15.238 1.00 0.00 ? 27  LEU A H    1  
ATOM 398   H HA   . LEU A 1 27  ? 11.026  -15.242 -14.856 1.00 0.00 ? 27  LEU A HA   1  
ATOM 399   H HB2  . LEU A 1 27  ? 10.178  -15.039 -12.725 1.00 0.00 ? 27  LEU A HB2  1  
ATOM 400   H HB3  . LEU A 1 27  ? 11.252  -13.646 -12.835 1.00 0.00 ? 27  LEU A HB3  1  
ATOM 401   H HG   . LEU A 1 27  ? 8.955   -12.488 -13.592 1.00 0.00 ? 27  LEU A HG   1  
ATOM 402   H HD11 . LEU A 1 27  ? 8.144   -15.024 -12.616 1.00 0.00 ? 27  LEU A HD11 1  
ATOM 403   H HD12 . LEU A 1 27  ? 7.141   -13.677 -13.151 1.00 0.00 ? 27  LEU A HD12 1  
ATOM 404   H HD13 . LEU A 1 27  ? 7.624   -13.798 -11.460 1.00 0.00 ? 27  LEU A HD13 1  
ATOM 405   H HD21 . LEU A 1 27  ? 9.797   -12.980 -10.738 1.00 0.00 ? 27  LEU A HD21 1  
ATOM 406   H HD22 . LEU A 1 27  ? 8.767   -11.666 -11.306 1.00 0.00 ? 27  LEU A HD22 1  
ATOM 407   H HD23 . LEU A 1 27  ? 10.457  -11.744 -11.809 1.00 0.00 ? 27  LEU A HD23 1  
ATOM 408   N N    . GLY A 1 28  ? 8.665   -13.345 -15.970 1.00 0.00 ? 28  GLY A N    1  
ATOM 409   C CA   . GLY A 1 28  ? 7.371   -13.345 -16.627 1.00 0.00 ? 28  GLY A CA   1  
ATOM 410   C C    . GLY A 1 28  ? 7.262   -14.418 -17.693 1.00 0.00 ? 28  GLY A C    1  
ATOM 411   O O    . GLY A 1 28  ? 6.160   -14.804 -18.082 1.00 0.00 ? 28  GLY A O    1  
ATOM 412   H H    . GLY A 1 28  ? 9.216   -12.534 -15.979 1.00 0.00 ? 28  GLY A H    1  
ATOM 413   H HA2  . GLY A 1 28  ? 6.603   -13.509 -15.886 1.00 0.00 ? 28  GLY A HA2  1  
ATOM 414   H HA3  . GLY A 1 28  ? 7.213   -12.380 -17.087 1.00 0.00 ? 28  GLY A HA3  1  
ATOM 415   N N    . GLN A 1 29  ? 8.407   -14.898 -18.166 1.00 0.00 ? 29  GLN A N    1  
ATOM 416   C CA   . GLN A 1 29  ? 8.435   -15.930 -19.196 1.00 0.00 ? 29  GLN A CA   1  
ATOM 417   C C    . GLN A 1 29  ? 8.415   -17.322 -18.571 1.00 0.00 ? 29  GLN A C    1  
ATOM 418   O O    . GLN A 1 29  ? 8.604   -18.325 -19.260 1.00 0.00 ? 29  GLN A O    1  
ATOM 419   C CB   . GLN A 1 29  ? 9.677   -15.771 -20.075 1.00 0.00 ? 29  GLN A CB   1  
ATOM 420   C CG   . GLN A 1 29  ? 9.361   -15.363 -21.505 1.00 0.00 ? 29  GLN A CG   1  
ATOM 421   C CD   . GLN A 1 29  ? 10.606  -15.042 -22.308 1.00 0.00 ? 29  GLN A CD   1  
ATOM 422   O OE1  . GLN A 1 29  ? 11.418  -14.207 -21.910 1.00 0.00 ? 29  GLN A OE1  1  
ATOM 423   N NE2  . GLN A 1 29  ? 10.764  -15.706 -23.447 1.00 0.00 ? 29  GLN A NE2  1  
ATOM 424   H H    . GLN A 1 29  ? 9.253   -14.549 -17.816 1.00 0.00 ? 29  GLN A H    1  
ATOM 425   H HA   . GLN A 1 29  ? 7.554   -15.811 -19.808 1.00 0.00 ? 29  GLN A HA   1  
ATOM 426   H HB2  . GLN A 1 29  ? 10.316  -15.017 -19.641 1.00 0.00 ? 29  GLN A HB2  1  
ATOM 427   H HB3  . GLN A 1 29  ? 10.208  -16.711 -20.100 1.00 0.00 ? 29  GLN A HB3  1  
ATOM 428   H HG2  . GLN A 1 29  ? 8.838   -16.174 -21.990 1.00 0.00 ? 29  GLN A HG2  1  
ATOM 429   H HG3  . GLN A 1 29  ? 8.728   -14.489 -21.485 1.00 0.00 ? 29  GLN A HG3  1  
ATOM 430   H HE21 . GLN A 1 29  ? 10.075  -16.357 -23.702 1.00 0.00 ? 29  GLN A HE21 1  
ATOM 431   H HE22 . GLN A 1 29  ? 11.559  -15.518 -23.987 1.00 0.00 ? 29  GLN A HE22 1  
ATOM 432   N N    . HIS A 1 30  ? 8.184   -17.375 -17.263 1.00 0.00 ? 30  HIS A N    1  
ATOM 433   C CA   . HIS A 1 30  ? 8.139   -18.644 -16.546 1.00 0.00 ? 30  HIS A CA   1  
ATOM 434   C C    . HIS A 1 30  ? 6.866   -18.752 -15.712 1.00 0.00 ? 30  HIS A C    1  
ATOM 435   O O    . HIS A 1 30  ? 6.009   -19.594 -15.975 1.00 0.00 ? 30  HIS A O    1  
ATOM 436   C CB   . HIS A 1 30  ? 9.366   -18.789 -15.645 1.00 0.00 ? 30  HIS A CB   1  
ATOM 437   C CG   . HIS A 1 30  ? 10.069  -20.102 -15.797 1.00 0.00 ? 30  HIS A CG   1  
ATOM 438   N ND1  . HIS A 1 30  ? 10.650  -20.772 -14.741 1.00 0.00 ? 30  HIS A ND1  1  
ATOM 439   C CD2  . HIS A 1 30  ? 10.281  -20.872 -16.890 1.00 0.00 ? 30  HIS A CD2  1  
ATOM 440   C CE1  . HIS A 1 30  ? 11.191  -21.895 -15.178 1.00 0.00 ? 30  HIS A CE1  1  
ATOM 441   N NE2  . HIS A 1 30  ? 10.980  -21.980 -16.480 1.00 0.00 ? 30  HIS A NE2  1  
ATOM 442   H H    . HIS A 1 30  ? 8.041   -16.541 -16.769 1.00 0.00 ? 30  HIS A H    1  
ATOM 443   H HA   . HIS A 1 30  ? 8.144   -19.438 -17.276 1.00 0.00 ? 30  HIS A HA   1  
ATOM 444   H HB2  . HIS A 1 30  ? 10.072  -18.006 -15.881 1.00 0.00 ? 30  HIS A HB2  1  
ATOM 445   H HB3  . HIS A 1 30  ? 9.061   -18.692 -14.613 1.00 0.00 ? 30  HIS A HB3  1  
ATOM 446   H HD1  . HIS A 1 30  ? 10.666  -20.467 -13.810 1.00 0.00 ? 30  HIS A HD1  1  
ATOM 447   H HD2  . HIS A 1 30  ? 9.960   -20.655 -17.900 1.00 0.00 ? 30  HIS A HD2  1  
ATOM 448   H HE1  . HIS A 1 30  ? 11.715  -22.621 -14.575 1.00 0.00 ? 30  HIS A HE1  1  
ATOM 449   N N    . GLY A 1 31  ? 6.749   -17.892 -14.704 1.00 0.00 ? 31  GLY A N    1  
ATOM 450   C CA   . GLY A 1 31  ? 5.579   -17.908 -13.847 1.00 0.00 ? 31  GLY A CA   1  
ATOM 451   C C    . GLY A 1 31  ? 4.530   -16.901 -14.278 1.00 0.00 ? 31  GLY A C    1  
ATOM 452   O O    . GLY A 1 31  ? 3.334   -17.125 -14.096 1.00 0.00 ? 31  GLY A O    1  
ATOM 453   H H    . GLY A 1 31  ? 7.464   -17.241 -14.542 1.00 0.00 ? 31  GLY A H    1  
ATOM 454   H HA2  . GLY A 1 31  ? 5.144   -18.896 -13.868 1.00 0.00 ? 31  GLY A HA2  1  
ATOM 455   H HA3  . GLY A 1 31  ? 5.884   -17.681 -12.836 1.00 0.00 ? 31  GLY A HA3  1  
ATOM 456   N N    . ALA A 1 32  ? 4.980   -15.789 -14.850 1.00 0.00 ? 32  ALA A N    1  
ATOM 457   C CA   . ALA A 1 32  ? 4.072   -14.745 -15.309 1.00 0.00 ? 32  ALA A CA   1  
ATOM 458   C C    . ALA A 1 32  ? 3.310   -14.129 -14.141 1.00 0.00 ? 32  ALA A C    1  
ATOM 459   O O    . ALA A 1 32  ? 2.203   -13.620 -14.310 1.00 0.00 ? 32  ALA A O    1  
ATOM 460   C CB   . ALA A 1 32  ? 3.102   -15.304 -16.339 1.00 0.00 ? 32  ALA A CB   1  
ATOM 461   H H    . ALA A 1 32  ? 5.945   -15.669 -14.968 1.00 0.00 ? 32  ALA A H    1  
ATOM 462   H HA   . ALA A 1 32  ? 4.662   -13.976 -15.786 1.00 0.00 ? 32  ALA A HA   1  
ATOM 463   H HB1  . ALA A 1 32  ? 3.344   -16.338 -16.536 1.00 0.00 ? 32  ALA A HB1  1  
ATOM 464   H HB2  . ALA A 1 32  ? 2.094   -15.236 -15.958 1.00 0.00 ? 32  ALA A HB2  1  
ATOM 465   H HB3  . ALA A 1 32  ? 3.181   -14.735 -17.253 1.00 0.00 ? 32  ALA A HB3  1  
ATOM 466   N N    . ASN A 1 33  ? 3.909   -14.180 -12.956 1.00 0.00 ? 33  ASN A N    1  
ATOM 467   C CA   . ASN A 1 33  ? 3.285   -13.628 -11.759 1.00 0.00 ? 33  ASN A CA   1  
ATOM 468   C C    . ASN A 1 33  ? 4.277   -12.776 -10.972 1.00 0.00 ? 33  ASN A C    1  
ATOM 469   O O    . ASN A 1 33  ? 5.169   -13.300 -10.305 1.00 0.00 ? 33  ASN A O    1  
ATOM 470   C CB   . ASN A 1 33  ? 2.748   -14.753 -10.873 1.00 0.00 ? 33  ASN A CB   1  
ATOM 471   C CG   . ASN A 1 33  ? 1.237   -14.717 -10.745 1.00 0.00 ? 33  ASN A CG   1  
ATOM 472   O OD1  . ASN A 1 33  ? 0.565   -15.735 -10.909 1.00 0.00 ? 33  ASN A OD1  1  
ATOM 473   N ND2  . ASN A 1 33  ? 0.697   -13.540 -10.451 1.00 0.00 ? 33  ASN A ND2  1  
ATOM 474   H H    . ASN A 1 33  ? 4.792   -14.599 -12.884 1.00 0.00 ? 33  ASN A H    1  
ATOM 475   H HA   . ASN A 1 33  ? 2.462   -13.004 -12.072 1.00 0.00 ? 33  ASN A HA   1  
ATOM 476   H HB2  . ASN A 1 33  ? 3.031   -15.705 -11.299 1.00 0.00 ? 33  ASN A HB2  1  
ATOM 477   H HB3  . ASN A 1 33  ? 3.177   -14.664 -9.886  1.00 0.00 ? 33  ASN A HB3  1  
ATOM 478   H HD21 . ASN A 1 33  ? 1.294   -12.772 -10.334 1.00 0.00 ? 33  ASN A HD21 1  
ATOM 479   H HD22 . ASN A 1 33  ? -0.278  -13.488 -10.362 1.00 0.00 ? 33  ASN A HD22 1  
ATOM 480   N N    . ILE A 1 34  ? 4.114   -11.460 -11.056 1.00 0.00 ? 34  ILE A N    1  
ATOM 481   C CA   . ILE A 1 34  ? 4.993   -10.535 -10.350 1.00 0.00 ? 34  ILE A CA   1  
ATOM 482   C C    . ILE A 1 34  ? 4.641   -10.463 -8.869  1.00 0.00 ? 34  ILE A C    1  
ATOM 483   O O    . ILE A 1 34  ? 5.459   -10.787 -8.009  1.00 0.00 ? 34  ILE A O    1  
ATOM 484   C CB   . ILE A 1 34  ? 4.922   -9.120  -10.953 1.00 0.00 ? 34  ILE A CB   1  
ATOM 485   C CG1  . ILE A 1 34  ? 5.097   -9.179  -12.472 1.00 0.00 ? 34  ILE A CG1  1  
ATOM 486   C CG2  . ILE A 1 34  ? 5.980   -8.224  -10.327 1.00 0.00 ? 34  ILE A CG2  1  
ATOM 487   C CD1  . ILE A 1 34  ? 6.380   -9.852  -12.906 1.00 0.00 ? 34  ILE A CD1  1  
ATOM 488   H H    . ILE A 1 34  ? 3.385   -11.102 -11.604 1.00 0.00 ? 34  ILE A H    1  
ATOM 489   H HA   . ILE A 1 34  ? 6.006   -10.897 -10.451 1.00 0.00 ? 34  ILE A HA   1  
ATOM 490   H HB   . ILE A 1 34  ? 3.952   -8.704  -10.725 1.00 0.00 ? 34  ILE A HB   1  
ATOM 491   H HG12 . ILE A 1 34  ? 4.274   -9.727  -12.902 1.00 0.00 ? 34  ILE A HG12 1  
ATOM 492   H HG13 . ILE A 1 34  ? 5.099   -8.173  -12.866 1.00 0.00 ? 34  ILE A HG13 1  
ATOM 493   H HG21 . ILE A 1 34  ? 5.614   -7.209  -10.286 1.00 0.00 ? 34  ILE A HG21 1  
ATOM 494   H HG22 . ILE A 1 34  ? 6.196   -8.568  -9.327  1.00 0.00 ? 34  ILE A HG22 1  
ATOM 495   H HG23 . ILE A 1 34  ? 6.880   -8.258  -10.922 1.00 0.00 ? 34  ILE A HG23 1  
ATOM 496   H HD11 . ILE A 1 34  ? 6.955   -10.129 -12.035 1.00 0.00 ? 34  ILE A HD11 1  
ATOM 497   H HD12 . ILE A 1 34  ? 6.148   -10.735 -13.482 1.00 0.00 ? 34  ILE A HD12 1  
ATOM 498   H HD13 . ILE A 1 34  ? 6.957   -9.168  -13.513 1.00 0.00 ? 34  ILE A HD13 1  
ATOM 499   N N    . MET A 1 35  ? 3.416   -10.038 -8.578  1.00 0.00 ? 35  MET A N    1  
ATOM 500   C CA   . MET A 1 35  ? 2.953   -9.927  -7.199  1.00 0.00 ? 35  MET A CA   1  
ATOM 501   C C    . MET A 1 35  ? 3.099   -11.257 -6.468  1.00 0.00 ? 35  MET A C    1  
ATOM 502   O O    . MET A 1 35  ? 3.471   -11.293 -5.295  1.00 0.00 ? 35  MET A O    1  
ATOM 503   C CB   . MET A 1 35  ? 1.493   -9.469  -7.164  1.00 0.00 ? 35  MET A CB   1  
ATOM 504   C CG   . MET A 1 35  ? 1.297   -8.115  -6.502  1.00 0.00 ? 35  MET A CG   1  
ATOM 505   S SD   . MET A 1 35  ? 0.780   -8.252  -4.780  1.00 0.00 ? 35  MET A SD   1  
ATOM 506   C CE   . MET A 1 35  ? 2.268   -7.721  -3.937  1.00 0.00 ? 35  MET A CE   1  
ATOM 507   H H    . MET A 1 35  ? 2.807   -9.794  -9.307  1.00 0.00 ? 35  MET A H    1  
ATOM 508   H HA   . MET A 1 35  ? 3.564   -9.188  -6.704  1.00 0.00 ? 35  MET A HA   1  
ATOM 509   H HB2  . MET A 1 35  ? 1.123   -9.408  -8.176  1.00 0.00 ? 35  MET A HB2  1  
ATOM 510   H HB3  . MET A 1 35  ? 0.913   -10.199 -6.620  1.00 0.00 ? 35  MET A HB3  1  
ATOM 511   H HG2  . MET A 1 35  ? 2.229   -7.572  -6.540  1.00 0.00 ? 35  MET A HG2  1  
ATOM 512   H HG3  . MET A 1 35  ? 0.541   -7.570  -7.048  1.00 0.00 ? 35  MET A HG3  1  
ATOM 513   H HE1  . MET A 1 35  ? 2.624   -6.803  -4.379  1.00 0.00 ? 35  MET A HE1  1  
ATOM 514   H HE2  . MET A 1 35  ? 2.050   -7.557  -2.892  1.00 0.00 ? 35  MET A HE2  1  
ATOM 515   H HE3  . MET A 1 35  ? 3.027   -8.484  -4.031  1.00 0.00 ? 35  MET A HE3  1  
ATOM 516   N N    . GLU A 1 36  ? 2.804   -12.348 -7.168  1.00 0.00 ? 36  GLU A N    1  
ATOM 517   C CA   . GLU A 1 36  ? 2.901   -13.680 -6.582  1.00 0.00 ? 36  GLU A CA   1  
ATOM 518   C C    . GLU A 1 36  ? 4.360   -14.079 -6.378  1.00 0.00 ? 36  GLU A C    1  
ATOM 519   O O    . GLU A 1 36  ? 4.656   -15.083 -5.730  1.00 0.00 ? 36  GLU A O    1  
ATOM 520   C CB   . GLU A 1 36  ? 2.201   -14.707 -7.476  1.00 0.00 ? 36  GLU A CB   1  
ATOM 521   C CG   . GLU A 1 36  ? 0.991   -15.355 -6.825  1.00 0.00 ? 36  GLU A CG   1  
ATOM 522   C CD   . GLU A 1 36  ? 1.160   -16.850 -6.637  1.00 0.00 ? 36  GLU A CD   1  
ATOM 523   O OE1  . GLU A 1 36  ? 2.239   -17.271 -6.170  1.00 0.00 ? 36  GLU A OE1  1  
ATOM 524   O OE2  . GLU A 1 36  ? 0.213   -17.598 -6.956  1.00 0.00 ? 36  GLU A OE2  1  
ATOM 525   H H    . GLU A 1 36  ? 2.513   -12.255 -8.099  1.00 0.00 ? 36  GLU A H    1  
ATOM 526   H HA   . GLU A 1 36  ? 2.409   -13.658 -5.622  1.00 0.00 ? 36  GLU A HA   1  
ATOM 527   H HB2  . GLU A 1 36  ? 1.878   -14.216 -8.382  1.00 0.00 ? 36  GLU A HB2  1  
ATOM 528   H HB3  . GLU A 1 36  ? 2.906   -15.484 -7.730  1.00 0.00 ? 36  GLU A HB3  1  
ATOM 529   H HG2  . GLU A 1 36  ? 0.832   -14.902 -5.858  1.00 0.00 ? 36  GLU A HG2  1  
ATOM 530   H HG3  . GLU A 1 36  ? 0.126   -15.181 -7.449  1.00 0.00 ? 36  GLU A HG3  1  
ATOM 531   N N    . PHE A 1 37  ? 5.268   -13.285 -6.936  1.00 0.00 ? 37  PHE A N    1  
ATOM 532   C CA   . PHE A 1 37  ? 6.696   -13.555 -6.817  1.00 0.00 ? 37  PHE A CA   1  
ATOM 533   C C    . PHE A 1 37  ? 7.354   -12.584 -5.840  1.00 0.00 ? 37  PHE A C    1  
ATOM 534   O O    . PHE A 1 37  ? 8.453   -12.832 -5.346  1.00 0.00 ? 37  PHE A O    1  
ATOM 535   C CB   . PHE A 1 37  ? 7.372   -13.454 -8.186  1.00 0.00 ? 37  PHE A CB   1  
ATOM 536   C CG   . PHE A 1 37  ? 8.870   -13.532 -8.122  1.00 0.00 ? 37  PHE A CG   1  
ATOM 537   C CD1  . PHE A 1 37  ? 9.508   -14.752 -7.969  1.00 0.00 ? 37  PHE A CD1  1  
ATOM 538   C CD2  . PHE A 1 37  ? 9.641   -12.384 -8.216  1.00 0.00 ? 37  PHE A CD2  1  
ATOM 539   C CE1  . PHE A 1 37  ? 10.887  -14.826 -7.909  1.00 0.00 ? 37  PHE A CE1  1  
ATOM 540   C CE2  . PHE A 1 37  ? 11.021  -12.452 -8.157  1.00 0.00 ? 37  PHE A CE2  1  
ATOM 541   C CZ   . PHE A 1 37  ? 11.644  -13.675 -8.005  1.00 0.00 ? 37  PHE A CZ   1  
ATOM 542   H H    . PHE A 1 37  ? 4.970   -12.499 -7.441  1.00 0.00 ? 37  PHE A H    1  
ATOM 543   H HA   . PHE A 1 37  ? 6.813   -14.559 -6.440  1.00 0.00 ? 37  PHE A HA   1  
ATOM 544   H HB2  . PHE A 1 37  ? 7.025   -14.263 -8.811  1.00 0.00 ? 37  PHE A HB2  1  
ATOM 545   H HB3  . PHE A 1 37  ? 7.106   -12.512 -8.642  1.00 0.00 ? 37  PHE A HB3  1  
ATOM 546   H HD1  . PHE A 1 37  ? 8.918   -15.653 -7.895  1.00 0.00 ? 37  PHE A HD1  1  
ATOM 547   H HD2  . PHE A 1 37  ? 9.154   -11.427 -8.336  1.00 0.00 ? 37  PHE A HD2  1  
ATOM 548   H HE1  . PHE A 1 37  ? 11.372  -15.783 -7.790  1.00 0.00 ? 37  PHE A HE1  1  
ATOM 549   H HE2  . PHE A 1 37  ? 11.609  -11.550 -8.232  1.00 0.00 ? 37  PHE A HE2  1  
ATOM 550   H HZ   . PHE A 1 37  ? 12.722  -13.730 -7.958  1.00 0.00 ? 37  PHE A HZ   1  
ATOM 551   N N    . VAL A 1 38  ? 6.672   -11.476 -5.567  1.00 0.00 ? 38  VAL A N    1  
ATOM 552   C CA   . VAL A 1 38  ? 7.188   -10.467 -4.650  1.00 0.00 ? 38  VAL A CA   1  
ATOM 553   C C    . VAL A 1 38  ? 6.713   -10.726 -3.225  1.00 0.00 ? 38  VAL A C    1  
ATOM 554   O O    . VAL A 1 38  ? 7.490   -10.634 -2.273  1.00 0.00 ? 38  VAL A O    1  
ATOM 555   C CB   . VAL A 1 38  ? 6.756   -9.050  -5.073  1.00 0.00 ? 38  VAL A CB   1  
ATOM 556   C CG1  . VAL A 1 38  ? 7.203   -8.025  -4.042  1.00 0.00 ? 38  VAL A CG1  1  
ATOM 557   C CG2  . VAL A 1 38  ? 7.312   -8.713  -6.448  1.00 0.00 ? 38  VAL A CG2  1  
ATOM 558   H H    . VAL A 1 38  ? 5.800   -11.334 -5.993  1.00 0.00 ? 38  VAL A H    1  
ATOM 559   H HA   . VAL A 1 38  ? 8.267   -10.514 -4.675  1.00 0.00 ? 38  VAL A HA   1  
ATOM 560   H HB   . VAL A 1 38  ? 5.678   -9.026  -5.128  1.00 0.00 ? 38  VAL A HB   1  
ATOM 561   H HG11 . VAL A 1 38  ? 8.280   -8.043  -3.961  1.00 0.00 ? 38  VAL A HG11 1  
ATOM 562   H HG12 . VAL A 1 38  ? 6.880   -7.041  -4.348  1.00 0.00 ? 38  VAL A HG12 1  
ATOM 563   H HG13 . VAL A 1 38  ? 6.767   -8.266  -3.083  1.00 0.00 ? 38  VAL A HG13 1  
ATOM 564   H HG21 . VAL A 1 38  ? 8.377   -8.548  -6.375  1.00 0.00 ? 38  VAL A HG21 1  
ATOM 565   H HG22 . VAL A 1 38  ? 7.121   -9.533  -7.126  1.00 0.00 ? 38  VAL A HG22 1  
ATOM 566   H HG23 . VAL A 1 38  ? 6.834   -7.820  -6.821  1.00 0.00 ? 38  VAL A HG23 1  
ATOM 567   N N    . LYS A 1 39  ? 5.433   -11.052 -3.083  1.00 0.00 ? 39  LYS A N    1  
ATOM 568   C CA   . LYS A 1 39  ? 4.853   -11.327 -1.774  1.00 0.00 ? 39  LYS A CA   1  
ATOM 569   C C    . LYS A 1 39  ? 5.571   -12.489 -1.095  1.00 0.00 ? 39  LYS A C    1  
ATOM 570   O O    . LYS A 1 39  ? 5.514   -12.638 0.126   1.00 0.00 ? 39  LYS A O    1  
ATOM 571   C CB   . LYS A 1 39  ? 3.362   -11.643 -1.910  1.00 0.00 ? 39  LYS A CB   1  
ATOM 572   C CG   . LYS A 1 39  ? 2.470   -10.417 -1.826  1.00 0.00 ? 39  LYS A CG   1  
ATOM 573   C CD   . LYS A 1 39  ? 2.095   -10.098 -0.388  1.00 0.00 ? 39  LYS A CD   1  
ATOM 574   C CE   . LYS A 1 39  ? 2.819   -8.858  0.115   1.00 0.00 ? 39  LYS A CE   1  
ATOM 575   N NZ   . LYS A 1 39  ? 2.804   -8.772  1.601   1.00 0.00 ? 39  LYS A NZ   1  
ATOM 576   H H    . LYS A 1 39  ? 4.864   -11.109 -3.879  1.00 0.00 ? 39  LYS A H    1  
ATOM 577   H HA   . LYS A 1 39  ? 4.971   -10.443 -1.166  1.00 0.00 ? 39  LYS A HA   1  
ATOM 578   H HB2  . LYS A 1 39  ? 3.193   -12.121 -2.864  1.00 0.00 ? 39  LYS A HB2  1  
ATOM 579   H HB3  . LYS A 1 39  ? 3.078   -12.324 -1.120  1.00 0.00 ? 39  LYS A HB3  1  
ATOM 580   H HG2  . LYS A 1 39  ? 2.995   -9.572  -2.245  1.00 0.00 ? 39  LYS A HG2  1  
ATOM 581   H HG3  . LYS A 1 39  ? 1.568   -10.600 -2.392  1.00 0.00 ? 39  LYS A HG3  1  
ATOM 582   H HD2  . LYS A 1 39  ? 1.030   -9.926  -0.333  1.00 0.00 ? 39  LYS A HD2  1  
ATOM 583   H HD3  . LYS A 1 39  ? 2.359   -10.938 0.239   1.00 0.00 ? 39  LYS A HD3  1  
ATOM 584   H HE2  . LYS A 1 39  ? 3.843   -8.892  -0.225  1.00 0.00 ? 39  LYS A HE2  1  
ATOM 585   H HE3  . LYS A 1 39  ? 2.333   -7.984  -0.293  1.00 0.00 ? 39  LYS A HE3  1  
ATOM 586   H HZ1  . LYS A 1 39  ? 3.694   -8.357  1.944   1.00 0.00 ? 39  LYS A HZ1  1  
ATOM 587   H HZ2  . LYS A 1 39  ? 2.695   -9.720  2.013   1.00 0.00 ? 39  LYS A HZ2  1  
ATOM 588   H HZ3  . LYS A 1 39  ? 2.012   -8.176  1.917   1.00 0.00 ? 39  LYS A HZ3  1  
ATOM 589   N N    . ALA A 1 40  ? 6.246   -13.310 -1.893  1.00 0.00 ? 40  ALA A N    1  
ATOM 590   C CA   . ALA A 1 40  ? 6.977   -14.457 -1.368  1.00 0.00 ? 40  ALA A CA   1  
ATOM 591   C C    . ALA A 1 40  ? 8.379   -14.056 -0.923  1.00 0.00 ? 40  ALA A C    1  
ATOM 592   O O    . ALA A 1 40  ? 9.153   -14.890 -0.452  1.00 0.00 ? 40  ALA A O    1  
ATOM 593   C CB   . ALA A 1 40  ? 7.048   -15.560 -2.413  1.00 0.00 ? 40  ALA A CB   1  
ATOM 594   H H    . ALA A 1 40  ? 6.253   -13.139 -2.858  1.00 0.00 ? 40  ALA A H    1  
ATOM 595   H HA   . ALA A 1 40  ? 6.434   -14.836 -0.515  1.00 0.00 ? 40  ALA A HA   1  
ATOM 596   H HB1  . ALA A 1 40  ? 6.277   -15.404 -3.153  1.00 0.00 ? 40  ALA A HB1  1  
ATOM 597   H HB2  . ALA A 1 40  ? 8.015   -15.542 -2.891  1.00 0.00 ? 40  ALA A HB2  1  
ATOM 598   H HB3  . ALA A 1 40  ? 6.899   -16.517 -1.935  1.00 0.00 ? 40  ALA A HB3  1  
ATOM 599   N N    . PHE A 1 41  ? 8.700   -12.776 -1.075  1.00 0.00 ? 41  PHE A N    1  
ATOM 600   C CA   . PHE A 1 41  ? 10.011  -12.265 -0.690  1.00 0.00 ? 41  PHE A CA   1  
ATOM 601   C C    . PHE A 1 41  ? 9.900   -11.336 0.516   1.00 0.00 ? 41  PHE A C    1  
ATOM 602   O O    . PHE A 1 41  ? 10.701  -11.411 1.446   1.00 0.00 ? 41  PHE A O    1  
ATOM 603   C CB   . PHE A 1 41  ? 10.658  -11.524 -1.861  1.00 0.00 ? 41  PHE A CB   1  
ATOM 604   C CG   . PHE A 1 41  ? 12.042  -12.008 -2.186  1.00 0.00 ? 41  PHE A CG   1  
ATOM 605   C CD1  . PHE A 1 41  ? 12.272  -13.341 -2.486  1.00 0.00 ? 41  PHE A CD1  1  
ATOM 606   C CD2  . PHE A 1 41  ? 13.114  -11.130 -2.191  1.00 0.00 ? 41  PHE A CD2  1  
ATOM 607   C CE1  . PHE A 1 41  ? 13.545  -13.789 -2.786  1.00 0.00 ? 41  PHE A CE1  1  
ATOM 608   C CE2  . PHE A 1 41  ? 14.389  -11.572 -2.490  1.00 0.00 ? 41  PHE A CE2  1  
ATOM 609   C CZ   . PHE A 1 41  ? 14.604  -12.904 -2.787  1.00 0.00 ? 41  PHE A CZ   1  
ATOM 610   H H    . PHE A 1 41  ? 8.040   -12.159 -1.456  1.00 0.00 ? 41  PHE A H    1  
ATOM 611   H HA   . PHE A 1 41  ? 10.629  -13.109 -0.423  1.00 0.00 ? 41  PHE A HA   1  
ATOM 612   H HB2  . PHE A 1 41  ? 10.047  -11.654 -2.742  1.00 0.00 ? 41  PHE A HB2  1  
ATOM 613   H HB3  . PHE A 1 41  ? 10.719  -10.473 -1.623  1.00 0.00 ? 41  PHE A HB3  1  
ATOM 614   H HD1  . PHE A 1 41  ? 11.443  -14.035 -2.486  1.00 0.00 ? 41  PHE A HD1  1  
ATOM 615   H HD2  . PHE A 1 41  ? 12.947  -10.088 -1.958  1.00 0.00 ? 41  PHE A HD2  1  
ATOM 616   H HE1  . PHE A 1 41  ? 13.710  -14.831 -3.017  1.00 0.00 ? 41  PHE A HE1  1  
ATOM 617   H HE2  . PHE A 1 41  ? 15.216  -10.878 -2.489  1.00 0.00 ? 41  PHE A HE2  1  
ATOM 618   H HZ   . PHE A 1 41  ? 15.599  -13.252 -3.021  1.00 0.00 ? 41  PHE A HZ   1  
ATOM 619   N N    . ASN A 1 42  ? 8.901   -10.460 0.490   1.00 0.00 ? 42  ASN A N    1  
ATOM 620   C CA   . ASN A 1 42  ? 8.685   -9.515  1.579   1.00 0.00 ? 42  ASN A CA   1  
ATOM 621   C C    . ASN A 1 42  ? 8.434   -10.248 2.894   1.00 0.00 ? 42  ASN A C    1  
ATOM 622   O O    . ASN A 1 42  ? 8.598   -9.681  3.974   1.00 0.00 ? 42  ASN A O    1  
ATOM 623   C CB   . ASN A 1 42  ? 7.503   -8.598  1.260   1.00 0.00 ? 42  ASN A CB   1  
ATOM 624   C CG   . ASN A 1 42  ? 7.903   -7.137  1.203   1.00 0.00 ? 42  ASN A CG   1  
ATOM 625   O OD1  . ASN A 1 42  ? 8.708   -6.670  2.010   1.00 0.00 ? 42  ASN A OD1  1  
ATOM 626   N ND2  . ASN A 1 42  ? 7.341   -6.406  0.247   1.00 0.00 ? 42  ASN A ND2  1  
ATOM 627   H H    . ASN A 1 42  ? 8.295   -10.449 -0.280  1.00 0.00 ? 42  ASN A H    1  
ATOM 628   H HA   . ASN A 1 42  ? 9.577   -8.915  1.680   1.00 0.00 ? 42  ASN A HA   1  
ATOM 629   H HB2  . ASN A 1 42  ? 7.088   -8.876  0.301   1.00 0.00 ? 42  ASN A HB2  1  
ATOM 630   H HB3  . ASN A 1 42  ? 6.747   -8.716  2.022   1.00 0.00 ? 42  ASN A HB3  1  
ATOM 631   H HD21 . ASN A 1 42  ? 6.708   -6.845  -0.360  1.00 0.00 ? 42  ASN A HD21 1  
ATOM 632   H HD22 . ASN A 1 42  ? 7.583   -5.459  0.187   1.00 0.00 ? 42  ASN A HD22 1  
ATOM 633   N N    . ALA A 1 43  ? 8.037   -11.512 2.794   1.00 0.00 ? 43  ALA A N    1  
ATOM 634   C CA   . ALA A 1 43  ? 7.766   -12.324 3.974   1.00 0.00 ? 43  ALA A CA   1  
ATOM 635   C C    . ALA A 1 43  ? 8.861   -13.364 4.188   1.00 0.00 ? 43  ALA A C    1  
ATOM 636   O O    . ALA A 1 43  ? 8.806   -14.151 5.132   1.00 0.00 ? 43  ALA A O    1  
ATOM 637   C CB   . ALA A 1 43  ? 6.409   -13.001 3.849   1.00 0.00 ? 43  ALA A CB   1  
ATOM 638   H H    . ALA A 1 43  ? 7.925   -11.909 1.905   1.00 0.00 ? 43  ALA A H    1  
ATOM 639   H HA   . ALA A 1 43  ? 7.736   -11.667 4.831   1.00 0.00 ? 43  ALA A HA   1  
ATOM 640   H HB1  . ALA A 1 43  ? 6.517   -13.921 3.293   1.00 0.00 ? 43  ALA A HB1  1  
ATOM 641   H HB2  . ALA A 1 43  ? 6.024   -13.218 4.834   1.00 0.00 ? 43  ALA A HB2  1  
ATOM 642   H HB3  . ALA A 1 43  ? 5.726   -12.344 3.331   1.00 0.00 ? 43  ALA A HB3  1  
ATOM 643   N N    . ALA A 1 44  ? 9.853   -13.362 3.304   1.00 0.00 ? 44  ALA A N    1  
ATOM 644   C CA   . ALA A 1 44  ? 10.961  -14.305 3.397   1.00 0.00 ? 44  ALA A CA   1  
ATOM 645   C C    . ALA A 1 44  ? 12.255  -13.595 3.782   1.00 0.00 ? 44  ALA A C    1  
ATOM 646   O O    . ALA A 1 44  ? 12.895  -13.943 4.775   1.00 0.00 ? 44  ALA A O    1  
ATOM 647   C CB   . ALA A 1 44  ? 11.135  -15.046 2.080   1.00 0.00 ? 44  ALA A CB   1  
ATOM 648   H H    . ALA A 1 44  ? 9.841   -12.710 2.573   1.00 0.00 ? 44  ALA A H    1  
ATOM 649   H HA   . ALA A 1 44  ? 10.719  -15.030 4.161   1.00 0.00 ? 44  ALA A HA   1  
ATOM 650   H HB1  . ALA A 1 44  ? 11.821  -14.500 1.448   1.00 0.00 ? 44  ALA A HB1  1  
ATOM 651   H HB2  . ALA A 1 44  ? 11.530  -16.033 2.272   1.00 0.00 ? 44  ALA A HB2  1  
ATOM 652   H HB3  . ALA A 1 44  ? 10.179  -15.131 1.586   1.00 0.00 ? 44  ALA A HB3  1  
ATOM 653   N N    . THR A 1 45  ? 12.636  -12.598 2.989   1.00 0.00 ? 45  THR A N    1  
ATOM 654   C CA   . THR A 1 45  ? 13.855  -11.841 3.245   1.00 0.00 ? 45  THR A CA   1  
ATOM 655   C C    . THR A 1 45  ? 13.691  -10.928 4.455   1.00 0.00 ? 45  THR A C    1  
ATOM 656   O O    . THR A 1 45  ? 14.523  -10.927 5.361   1.00 0.00 ? 45  THR A O    1  
ATOM 657   C CB   . THR A 1 45  ? 14.255  -10.991 2.025   1.00 0.00 ? 45  THR A CB   1  
ATOM 658   O OG1  . THR A 1 45  ? 13.363  -9.878  1.890   1.00 0.00 ? 45  THR A OG1  1  
ATOM 659   C CG2  . THR A 1 45  ? 14.231  -11.824 0.753   1.00 0.00 ? 45  THR A CG2  1  
ATOM 660   H H    . THR A 1 45  ? 12.084  -12.368 2.213   1.00 0.00 ? 45  THR A H    1  
ATOM 661   H HA   . THR A 1 45  ? 14.650  -12.546 3.443   1.00 0.00 ? 45  THR A HA   1  
ATOM 662   H HB   . THR A 1 45  ? 15.259  -10.621 2.177   1.00 0.00 ? 45  THR A HB   1  
ATOM 663   H HG1  . THR A 1 45  ? 12.569  -10.159 1.429   1.00 0.00 ? 45  THR A HG1  1  
ATOM 664   H HG21 . THR A 1 45  ? 14.944  -11.425 0.047   1.00 0.00 ? 45  THR A HG21 1  
ATOM 665   H HG22 . THR A 1 45  ? 13.241  -11.794 0.321   1.00 0.00 ? 45  THR A HG22 1  
ATOM 666   H HG23 . THR A 1 45  ? 14.490  -12.845 0.988   1.00 0.00 ? 45  THR A HG23 1  
ATOM 667   N N    . ALA A 1 46  ? 12.611  -10.153 4.463   1.00 0.00 ? 46  ALA A N    1  
ATOM 668   C CA   . ALA A 1 46  ? 12.337  -9.237  5.563   1.00 0.00 ? 46  ALA A CA   1  
ATOM 669   C C    . ALA A 1 46  ? 12.390  -9.960  6.905   1.00 0.00 ? 46  ALA A C    1  
ATOM 670   O O    . ALA A 1 46  ? 12.735  -9.367  7.926   1.00 0.00 ? 46  ALA A O    1  
ATOM 671   C CB   . ALA A 1 46  ? 10.981  -8.573  5.372   1.00 0.00 ? 46  ALA A CB   1  
ATOM 672   H H    . ALA A 1 46  ? 11.984  -10.199 3.712   1.00 0.00 ? 46  ALA A H    1  
ATOM 673   H HA   . ALA A 1 46  ? 13.093  -8.465  5.552   1.00 0.00 ? 46  ALA A HA   1  
ATOM 674   H HB1  . ALA A 1 46  ? 10.691  -8.642  4.333   1.00 0.00 ? 46  ALA A HB1  1  
ATOM 675   H HB2  . ALA A 1 46  ? 10.246  -9.073  5.985   1.00 0.00 ? 46  ALA A HB2  1  
ATOM 676   H HB3  . ALA A 1 46  ? 11.045  -7.535  5.661   1.00 0.00 ? 46  ALA A HB3  1  
ATOM 677   N N    . ASN A 1 47  ? 12.044  -11.243 6.895   1.00 0.00 ? 47  ASN A N    1  
ATOM 678   C CA   . ASN A 1 47  ? 12.051  -12.046 8.112   1.00 0.00 ? 47  ASN A CA   1  
ATOM 679   C C    . ASN A 1 47  ? 13.475  -12.439 8.496   1.00 0.00 ? 47  ASN A C    1  
ATOM 680   O O    . ASN A 1 47  ? 13.832  -13.617 8.474   1.00 0.00 ? 47  ASN A O    1  
ATOM 681   C CB   . ASN A 1 47  ? 11.197  -13.301 7.925   1.00 0.00 ? 47  ASN A CB   1  
ATOM 682   C CG   . ASN A 1 47  ? 10.765  -13.909 9.245   1.00 0.00 ? 47  ASN A CG   1  
ATOM 683   O OD1  . ASN A 1 47  ? 11.390  -14.845 9.745   1.00 0.00 ? 47  ASN A OD1  1  
ATOM 684   N ND2  . ASN A 1 47  ? 9.690   -13.379 9.818   1.00 0.00 ? 47  ASN A ND2  1  
ATOM 685   H H    . ASN A 1 47  ? 11.778  -11.660 6.049   1.00 0.00 ? 47  ASN A H    1  
ATOM 686   H HA   . ASN A 1 47  ? 11.629  -11.449 8.906   1.00 0.00 ? 47  ASN A HA   1  
ATOM 687   H HB2  . ASN A 1 47  ? 10.311  -13.045 7.362   1.00 0.00 ? 47  ASN A HB2  1  
ATOM 688   H HB3  . ASN A 1 47  ? 11.765  -14.039 7.378   1.00 0.00 ? 47  ASN A HB3  1  
ATOM 689   H HD21 . ASN A 1 47  ? 9.242   -12.636 9.362   1.00 0.00 ? 47  ASN A HD21 1  
ATOM 690   H HD22 . ASN A 1 47  ? 9.390   -13.752 10.672  1.00 0.00 ? 47  ASN A HD22 1  
ATOM 691   N N    . MET A 1 48  ? 14.283  -11.444 8.849   1.00 0.00 ? 48  MET A N    1  
ATOM 692   C CA   . MET A 1 48  ? 15.666  -11.687 9.240   1.00 0.00 ? 48  MET A CA   1  
ATOM 693   C C    . MET A 1 48  ? 16.137  -10.642 10.247  1.00 0.00 ? 48  MET A C    1  
ATOM 694   O O    . MET A 1 48  ? 16.262  -10.925 11.438  1.00 0.00 ? 48  MET A O    1  
ATOM 695   C CB   . MET A 1 48  ? 16.576  -11.673 8.010   1.00 0.00 ? 48  MET A CB   1  
ATOM 696   C CG   . MET A 1 48  ? 16.748  -13.040 7.367   1.00 0.00 ? 48  MET A CG   1  
ATOM 697   S SD   . MET A 1 48  ? 17.551  -12.952 5.755   1.00 0.00 ? 48  MET A SD   1  
ATOM 698   C CE   . MET A 1 48  ? 17.080  -14.533 5.056   1.00 0.00 ? 48  MET A CE   1  
ATOM 699   H H    . MET A 1 48  ? 13.940  -10.526 8.847   1.00 0.00 ? 48  MET A H    1  
ATOM 700   H HA   . MET A 1 48  ? 15.714  -12.661 9.702   1.00 0.00 ? 48  MET A HA   1  
ATOM 701   H HB2  . MET A 1 48  ? 16.157  -11.003 7.274   1.00 0.00 ? 48  MET A HB2  1  
ATOM 702   H HB3  . MET A 1 48  ? 17.551  -11.312 8.302   1.00 0.00 ? 48  MET A HB3  1  
ATOM 703   H HG2  . MET A 1 48  ? 17.349  -13.657 8.018   1.00 0.00 ? 48  MET A HG2  1  
ATOM 704   H HG3  . MET A 1 48  ? 15.774  -13.490 7.245   1.00 0.00 ? 48  MET A HG3  1  
ATOM 705   H HE1  . MET A 1 48  ? 17.947  -15.175 5.002   1.00 0.00 ? 48  MET A HE1  1  
ATOM 706   H HE2  . MET A 1 48  ? 16.329  -14.993 5.681   1.00 0.00 ? 48  MET A HE2  1  
ATOM 707   H HE3  . MET A 1 48  ? 16.681  -14.383 4.063   1.00 0.00 ? 48  MET A HE3  1  
ATOM 708   N N    . GLY A 1 49  ? 16.398  -9.432  9.760   1.00 0.00 ? 49  GLY A N    1  
ATOM 709   C CA   . GLY A 1 49  ? 16.853  -8.364  10.631  1.00 0.00 ? 49  GLY A CA   1  
ATOM 710   C C    . GLY A 1 49  ? 17.939  -7.520  9.994   1.00 0.00 ? 49  GLY A C    1  
ATOM 711   O O    . GLY A 1 49  ? 19.076  -7.500  10.466  1.00 0.00 ? 49  GLY A O    1  
ATOM 712   H H    . GLY A 1 49  ? 16.281  -9.264  8.801   1.00 0.00 ? 49  GLY A H    1  
ATOM 713   H HA2  . GLY A 1 49  ? 16.014  -7.730  10.873  1.00 0.00 ? 49  GLY A HA2  1  
ATOM 714   H HA3  . GLY A 1 49  ? 17.239  -8.798  11.542  1.00 0.00 ? 49  GLY A HA3  1  
ATOM 715   N N    . ASP A 1 50  ? 17.589  -6.822  8.919   1.00 0.00 ? 50  ASP A N    1  
ATOM 716   C CA   . ASP A 1 50  ? 18.543  -5.972  8.216   1.00 0.00 ? 50  ASP A CA   1  
ATOM 717   C C    . ASP A 1 50  ? 19.758  -6.776  7.764   1.00 0.00 ? 50  ASP A C    1  
ATOM 718   O O    . ASP A 1 50  ? 20.712  -6.955  8.520   1.00 0.00 ? 50  ASP A O    1  
ATOM 719   C CB   . ASP A 1 50  ? 18.987  -4.815  9.114   1.00 0.00 ? 50  ASP A CB   1  
ATOM 720   C CG   . ASP A 1 50  ? 19.396  -3.590  8.320   1.00 0.00 ? 50  ASP A CG   1  
ATOM 721   O OD1  . ASP A 1 50  ? 18.810  -3.359  7.241   1.00 0.00 ? 50  ASP A OD1  1  
ATOM 722   O OD2  . ASP A 1 50  ? 20.301  -2.862  8.777   1.00 0.00 ? 50  ASP A OD2  1  
ATOM 723   H H    . ASP A 1 50  ? 16.667  -6.879  8.591   1.00 0.00 ? 50  ASP A H    1  
ATOM 724   H HA   . ASP A 1 50  ? 18.049  -5.569  7.345   1.00 0.00 ? 50  ASP A HA   1  
ATOM 725   H HB2  . ASP A 1 50  ? 18.171  -4.542  9.767   1.00 0.00 ? 50  ASP A HB2  1  
ATOM 726   H HB3  . ASP A 1 50  ? 19.829  -5.134  9.710   1.00 0.00 ? 50  ASP A HB3  1  
ATOM 727   N N    . ALA A 1 51  ? 19.714  -7.259  6.527   1.00 0.00 ? 51  ALA A N    1  
ATOM 728   C CA   . ALA A 1 51  ? 20.811  -8.044  5.974   1.00 0.00 ? 51  ALA A CA   1  
ATOM 729   C C    . ALA A 1 51  ? 20.529  -8.441  4.529   1.00 0.00 ? 51  ALA A C    1  
ATOM 730   O O    . ALA A 1 51  ? 19.374  -8.493  4.105   1.00 0.00 ? 51  ALA A O    1  
ATOM 731   C CB   . ALA A 1 51  ? 21.057  -9.281  6.825   1.00 0.00 ? 51  ALA A CB   1  
ATOM 732   H H    . ALA A 1 51  ? 18.926  -7.083  5.973   1.00 0.00 ? 51  ALA A H    1  
ATOM 733   H HA   . ALA A 1 51  ? 21.704  -7.435  6.002   1.00 0.00 ? 51  ALA A HA   1  
ATOM 734   H HB1  . ALA A 1 51  ? 22.006  -9.185  7.333   1.00 0.00 ? 51  ALA A HB1  1  
ATOM 735   H HB2  . ALA A 1 51  ? 20.267  -9.378  7.554   1.00 0.00 ? 51  ALA A HB2  1  
ATOM 736   H HB3  . ALA A 1 51  ? 21.073  -10.155 6.192   1.00 0.00 ? 51  ALA A HB3  1  
ATOM 737   N N    . ILE A 1 52  ? 21.590  -8.719  3.779   1.00 0.00 ? 52  ILE A N    1  
ATOM 738   C CA   . ILE A 1 52  ? 21.454  -9.111  2.382   1.00 0.00 ? 52  ILE A CA   1  
ATOM 739   C C    . ILE A 1 52  ? 21.222  -10.613 2.252   1.00 0.00 ? 52  ILE A C    1  
ATOM 740   O O    . ILE A 1 52  ? 21.933  -11.416 2.857   1.00 0.00 ? 52  ILE A O    1  
ATOM 741   C CB   . ILE A 1 52  ? 22.701  -8.724  1.565   1.00 0.00 ? 52  ILE A CB   1  
ATOM 742   C CG1  . ILE A 1 52  ? 22.937  -7.214  1.637   1.00 0.00 ? 52  ILE A CG1  1  
ATOM 743   C CG2  . ILE A 1 52  ? 22.548  -9.173  0.119   1.00 0.00 ? 52  ILE A CG2  1  
ATOM 744   C CD1  . ILE A 1 52  ? 21.823  -6.399  1.017   1.00 0.00 ? 52  ILE A CD1  1  
ATOM 745   H H    . ILE A 1 52  ? 22.484  -8.659  4.174   1.00 0.00 ? 52  ILE A H    1  
ATOM 746   H HA   . ILE A 1 52  ? 20.603  -8.589  1.970   1.00 0.00 ? 52  ILE A HA   1  
ATOM 747   H HB   . ILE A 1 52  ? 23.554  -9.235  1.987   1.00 0.00 ? 52  ILE A HB   1  
ATOM 748   H HG12 . ILE A 1 52  ? 23.027  -6.919  2.671   1.00 0.00 ? 52  ILE A HG12 1  
ATOM 749   H HG13 . ILE A 1 52  ? 23.853  -6.975  1.118   1.00 0.00 ? 52  ILE A HG13 1  
ATOM 750   H HG21 . ILE A 1 52  ? 23.275  -9.942  -0.097  1.00 0.00 ? 52  ILE A HG21 1  
ATOM 751   H HG22 . ILE A 1 52  ? 21.554  -9.566  -0.032  1.00 0.00 ? 52  ILE A HG22 1  
ATOM 752   H HG23 . ILE A 1 52  ? 22.707  -8.332  -0.538  1.00 0.00 ? 52  ILE A HG23 1  
ATOM 753   H HD11 . ILE A 1 52  ? 21.349  -5.798  1.779   1.00 0.00 ? 52  ILE A HD11 1  
ATOM 754   H HD12 . ILE A 1 52  ? 22.231  -5.756  0.252   1.00 0.00 ? 52  ILE A HD12 1  
ATOM 755   H HD13 . ILE A 1 52  ? 21.093  -7.063  0.578   1.00 0.00 ? 52  ILE A HD13 1  
ATOM 756   N N    . VAL A 1 53  ? 20.223  -10.986 1.458   1.00 0.00 ? 53  VAL A N    1  
ATOM 757   C CA   . VAL A 1 53  ? 19.899  -12.391 1.247   1.00 0.00 ? 53  VAL A CA   1  
ATOM 758   C C    . VAL A 1 53  ? 19.634  -12.678 -0.227  1.00 0.00 ? 53  VAL A C    1  
ATOM 759   O O    . VAL A 1 53  ? 18.499  -12.620 -0.702  1.00 0.00 ? 53  VAL A O    1  
ATOM 760   C CB   . VAL A 1 53  ? 18.667  -12.813 2.070   1.00 0.00 ? 53  VAL A CB   1  
ATOM 761   C CG1  . VAL A 1 53  ? 17.527  -11.827 1.869   1.00 0.00 ? 53  VAL A CG1  1  
ATOM 762   C CG2  . VAL A 1 53  ? 18.235  -14.223 1.698   1.00 0.00 ? 53  VAL A CG2  1  
ATOM 763   H H    . VAL A 1 53  ? 19.693  -10.299 1.004   1.00 0.00 ? 53  VAL A H    1  
ATOM 764   H HA   . VAL A 1 53  ? 20.743  -12.982 1.573   1.00 0.00 ? 53  VAL A HA   1  
ATOM 765   H HB   . VAL A 1 53  ? 18.939  -12.806 3.116   1.00 0.00 ? 53  VAL A HB   1  
ATOM 766   H HG11 . VAL A 1 53  ? 16.608  -12.369 1.700   1.00 0.00 ? 53  VAL A HG11 1  
ATOM 767   H HG12 . VAL A 1 53  ? 17.425  -11.209 2.748   1.00 0.00 ? 53  VAL A HG12 1  
ATOM 768   H HG13 . VAL A 1 53  ? 17.738  -11.203 1.012   1.00 0.00 ? 53  VAL A HG13 1  
ATOM 769   H HG21 . VAL A 1 53  ? 17.373  -14.175 1.050   1.00 0.00 ? 53  VAL A HG21 1  
ATOM 770   H HG22 . VAL A 1 53  ? 19.044  -14.724 1.185   1.00 0.00 ? 53  VAL A HG22 1  
ATOM 771   H HG23 . VAL A 1 53  ? 17.984  -14.771 2.594   1.00 0.00 ? 53  VAL A HG23 1  
ATOM 772   N N    . PRO A 1 54  ? 20.704  -12.996 -0.970  1.00 0.00 ? 54  PRO A N    1  
ATOM 773   C CA   . PRO A 1 54  ? 20.613  -13.300 -2.401  1.00 0.00 ? 54  PRO A CA   1  
ATOM 774   C C    . PRO A 1 54  ? 19.911  -14.627 -2.668  1.00 0.00 ? 54  PRO A C    1  
ATOM 775   O O    . PRO A 1 54  ? 20.205  -15.636 -2.027  1.00 0.00 ? 54  PRO A O    1  
ATOM 776   C CB   . PRO A 1 54  ? 22.077  -13.371 -2.842  1.00 0.00 ? 54  PRO A CB   1  
ATOM 777   C CG   . PRO A 1 54  ? 22.828  -13.729 -1.607  1.00 0.00 ? 54  PRO A CG   1  
ATOM 778   C CD   . PRO A 1 54  ? 22.086  -13.084 -0.469  1.00 0.00 ? 54  PRO A CD   1  
ATOM 779   H HA   . PRO A 1 54  ? 20.110  -12.512 -2.942  1.00 0.00 ? 54  PRO A HA   1  
ATOM 780   H HB2  . PRO A 1 54  ? 22.189  -14.127 -3.607  1.00 0.00 ? 54  PRO A HB2  1  
ATOM 781   H HB3  . PRO A 1 54  ? 22.387  -12.412 -3.228  1.00 0.00 ? 54  PRO A HB3  1  
ATOM 782   H HG2  . PRO A 1 54  ? 22.844  -14.802 -1.485  1.00 0.00 ? 54  PRO A HG2  1  
ATOM 783   H HG3  . PRO A 1 54  ? 23.835  -13.342 -1.665  1.00 0.00 ? 54  PRO A HG3  1  
ATOM 784   H HD2  . PRO A 1 54  ? 22.138  -13.704 0.414   1.00 0.00 ? 54  PRO A HD2  1  
ATOM 785   H HD3  . PRO A 1 54  ? 22.486  -12.101 -0.267  1.00 0.00 ? 54  PRO A HD3  1  
ATOM 786   N N    . VAL A 1 55  ? 18.982  -14.619 -3.619  1.00 0.00 ? 55  VAL A N    1  
ATOM 787   C CA   . VAL A 1 55  ? 18.239  -15.822 -3.972  1.00 0.00 ? 55  VAL A CA   1  
ATOM 788   C C    . VAL A 1 55  ? 18.711  -16.387 -5.307  1.00 0.00 ? 55  VAL A C    1  
ATOM 789   O O    . VAL A 1 55  ? 19.182  -15.650 -6.172  1.00 0.00 ? 55  VAL A O    1  
ATOM 790   C CB   . VAL A 1 55  ? 16.726  -15.545 -4.050  1.00 0.00 ? 55  VAL A CB   1  
ATOM 791   C CG1  . VAL A 1 55  ? 16.414  -14.604 -5.203  1.00 0.00 ? 55  VAL A CG1  1  
ATOM 792   C CG2  . VAL A 1 55  ? 15.953  -16.848 -4.190  1.00 0.00 ? 55  VAL A CG2  1  
ATOM 793   H H    . VAL A 1 55  ? 18.792  -13.783 -4.094  1.00 0.00 ? 55  VAL A H    1  
ATOM 794   H HA   . VAL A 1 55  ? 18.410  -16.559 -3.200  1.00 0.00 ? 55  VAL A HA   1  
ATOM 795   H HB   . VAL A 1 55  ? 16.420  -15.067 -3.131  1.00 0.00 ? 55  VAL A HB   1  
ATOM 796   H HG11 . VAL A 1 55  ? 15.562  -13.991 -4.947  1.00 0.00 ? 55  VAL A HG11 1  
ATOM 797   H HG12 . VAL A 1 55  ? 17.269  -13.972 -5.394  1.00 0.00 ? 55  VAL A HG12 1  
ATOM 798   H HG13 . VAL A 1 55  ? 16.188  -15.181 -6.088  1.00 0.00 ? 55  VAL A HG13 1  
ATOM 799   H HG21 . VAL A 1 55  ? 15.698  -17.005 -5.228  1.00 0.00 ? 55  VAL A HG21 1  
ATOM 800   H HG22 . VAL A 1 55  ? 16.563  -17.669 -3.841  1.00 0.00 ? 55  VAL A HG22 1  
ATOM 801   H HG23 . VAL A 1 55  ? 15.049  -16.796 -3.601  1.00 0.00 ? 55  VAL A HG23 1  
ATOM 802   N N    . GLU A 1 56  ? 18.579  -17.700 -5.468  1.00 0.00 ? 56  GLU A N    1  
ATOM 803   C CA   . GLU A 1 56  ? 18.992  -18.364 -6.699  1.00 0.00 ? 56  GLU A CA   1  
ATOM 804   C C    . GLU A 1 56  ? 17.831  -19.137 -7.316  1.00 0.00 ? 56  GLU A C    1  
ATOM 805   O O    . GLU A 1 56  ? 17.758  -20.361 -7.205  1.00 0.00 ? 56  GLU A O    1  
ATOM 806   C CB   . GLU A 1 56  ? 20.162  -19.311 -6.425  1.00 0.00 ? 56  GLU A CB   1  
ATOM 807   C CG   . GLU A 1 56  ? 21.524  -18.652 -6.562  1.00 0.00 ? 56  GLU A CG   1  
ATOM 808   C CD   . GLU A 1 56  ? 22.415  -19.355 -7.568  1.00 0.00 ? 56  GLU A CD   1  
ATOM 809   O OE1  . GLU A 1 56  ? 22.784  -20.522 -7.319  1.00 0.00 ? 56  GLU A OE1  1  
ATOM 810   O OE2  . GLU A 1 56  ? 22.742  -18.740 -8.604  1.00 0.00 ? 56  GLU A OE2  1  
ATOM 811   H H    . GLU A 1 56  ? 18.195  -18.235 -4.742  1.00 0.00 ? 56  GLU A H    1  
ATOM 812   H HA   . GLU A 1 56  ? 19.313  -17.603 -7.394  1.00 0.00 ? 56  GLU A HA   1  
ATOM 813   H HB2  . GLU A 1 56  ? 20.071  -19.697 -5.420  1.00 0.00 ? 56  GLU A HB2  1  
ATOM 814   H HB3  . GLU A 1 56  ? 20.113  -20.135 -7.122  1.00 0.00 ? 56  GLU A HB3  1  
ATOM 815   H HG2  . GLU A 1 56  ? 21.385  -17.630 -6.881  1.00 0.00 ? 56  GLU A HG2  1  
ATOM 816   H HG3  . GLU A 1 56  ? 22.014  -18.664 -5.599  1.00 0.00 ? 56  GLU A HG3  1  
ATOM 817   N N    . ILE A 1 57  ? 16.925  -18.414 -7.966  1.00 0.00 ? 57  ILE A N    1  
ATOM 818   C CA   . ILE A 1 57  ? 15.768  -19.032 -8.602  1.00 0.00 ? 57  ILE A CA   1  
ATOM 819   C C    . ILE A 1 57  ? 16.193  -19.963 -9.732  1.00 0.00 ? 57  ILE A C    1  
ATOM 820   O O    . ILE A 1 57  ? 16.351  -19.537 -10.877 1.00 0.00 ? 57  ILE A O    1  
ATOM 821   C CB   . ILE A 1 57  ? 14.801  -17.972 -9.162  1.00 0.00 ? 57  ILE A CB   1  
ATOM 822   C CG1  . ILE A 1 57  ? 14.495  -16.916 -8.097  1.00 0.00 ? 57  ILE A CG1  1  
ATOM 823   C CG2  . ILE A 1 57  ? 13.518  -18.630 -9.648  1.00 0.00 ? 57  ILE A CG2  1  
ATOM 824   C CD1  . ILE A 1 57  ? 14.998  -15.535 -8.453  1.00 0.00 ? 57  ILE A CD1  1  
ATOM 825   H H    . ILE A 1 57  ? 17.039  -17.442 -8.020  1.00 0.00 ? 57  ILE A H    1  
ATOM 826   H HA   . ILE A 1 57  ? 15.245  -19.608 -7.852  1.00 0.00 ? 57  ILE A HA   1  
ATOM 827   H HB   . ILE A 1 57  ? 15.275  -17.494 -10.006 1.00 0.00 ? 57  ILE A HB   1  
ATOM 828   H HG12 . ILE A 1 57  ? 13.427  -16.854 -7.958  1.00 0.00 ? 57  ILE A HG12 1  
ATOM 829   H HG13 . ILE A 1 57  ? 14.958  -17.210 -7.166  1.00 0.00 ? 57  ILE A HG13 1  
ATOM 830   H HG21 . ILE A 1 57  ? 12.730  -18.456 -8.930  1.00 0.00 ? 57  ILE A HG21 1  
ATOM 831   H HG22 . ILE A 1 57  ? 13.236  -18.206 -10.600 1.00 0.00 ? 57  ILE A HG22 1  
ATOM 832   H HG23 . ILE A 1 57  ? 13.678  -19.692 -9.759  1.00 0.00 ? 57  ILE A HG23 1  
ATOM 833   H HD11 . ILE A 1 57  ? 14.772  -15.324 -9.487  1.00 0.00 ? 57  ILE A HD11 1  
ATOM 834   H HD12 . ILE A 1 57  ? 14.518  -14.803 -7.821  1.00 0.00 ? 57  ILE A HD12 1  
ATOM 835   H HD13 . ILE A 1 57  ? 16.068  -15.493 -8.303  1.00 0.00 ? 57  ILE A HD13 1  
ATOM 836   N N    . THR A 1 58  ? 16.376  -21.238 -9.403  1.00 0.00 ? 58  THR A N    1  
ATOM 837   C CA   . THR A 1 58  ? 16.782  -22.231 -10.390 1.00 0.00 ? 58  THR A CA   1  
ATOM 838   C C    . THR A 1 58  ? 15.756  -22.343 -11.512 1.00 0.00 ? 58  THR A C    1  
ATOM 839   O O    . THR A 1 58  ? 14.577  -22.599 -11.264 1.00 0.00 ? 58  THR A O    1  
ATOM 840   C CB   . THR A 1 58  ? 16.975  -23.617 -9.746  1.00 0.00 ? 58  THR A CB   1  
ATOM 841   O OG1  . THR A 1 58  ? 17.763  -23.499 -8.556  1.00 0.00 ? 58  THR A OG1  1  
ATOM 842   C CG2  . THR A 1 58  ? 17.652  -24.574 -10.715 1.00 0.00 ? 58  THR A CG2  1  
ATOM 843   H H    . THR A 1 58  ? 16.235  -21.516 -8.475  1.00 0.00 ? 58  THR A H    1  
ATOM 844   H HA   . THR A 1 58  ? 17.727  -21.917 -10.810 1.00 0.00 ? 58  THR A HA   1  
ATOM 845   H HB   . THR A 1 58  ? 16.004  -24.015 -9.488  1.00 0.00 ? 58  THR A HB   1  
ATOM 846   H HG1  . THR A 1 58  ? 17.188  -23.322 -7.808  1.00 0.00 ? 58  THR A HG1  1  
ATOM 847   H HG21 . THR A 1 58  ? 17.202  -25.552 -10.628 1.00 0.00 ? 58  THR A HG21 1  
ATOM 848   H HG22 . THR A 1 58  ? 18.704  -24.639 -10.481 1.00 0.00 ? 58  THR A HG22 1  
ATOM 849   H HG23 . THR A 1 58  ? 17.529  -24.211 -11.724 1.00 0.00 ? 58  THR A HG23 1  
ATOM 850   N N    . ILE A 1 59  ? 16.211  -22.150 -12.745 1.00 0.00 ? 59  ILE A N    1  
ATOM 851   C CA   . ILE A 1 59  ? 15.332  -22.232 -13.905 1.00 0.00 ? 59  ILE A CA   1  
ATOM 852   C C    . ILE A 1 59  ? 15.518  -23.552 -14.644 1.00 0.00 ? 59  ILE A C    1  
ATOM 853   O O    . ILE A 1 59  ? 16.449  -23.709 -15.434 1.00 0.00 ? 59  ILE A O    1  
ATOM 854   C CB   . ILE A 1 59  ? 15.582  -21.069 -14.884 1.00 0.00 ? 59  ILE A CB   1  
ATOM 855   C CG1  . ILE A 1 59  ? 15.614  -19.738 -14.131 1.00 0.00 ? 59  ILE A CG1  1  
ATOM 856   C CG2  . ILE A 1 59  ? 14.512  -21.047 -15.965 1.00 0.00 ? 59  ILE A CG2  1  
ATOM 857   C CD1  . ILE A 1 59  ? 14.329  -19.429 -13.395 1.00 0.00 ? 59  ILE A CD1  1  
ATOM 858   H H    . ILE A 1 59  ? 17.161  -21.949 -12.878 1.00 0.00 ? 59  ILE A H    1  
ATOM 859   H HA   . ILE A 1 59  ? 14.312  -22.168 -13.555 1.00 0.00 ? 59  ILE A HA   1  
ATOM 860   H HB   . ILE A 1 59  ? 16.538  -21.228 -15.360 1.00 0.00 ? 59  ILE A HB   1  
ATOM 861   H HG12 . ILE A 1 59  ? 16.413  -19.759 -13.407 1.00 0.00 ? 59  ILE A HG12 1  
ATOM 862   H HG13 . ILE A 1 59  ? 15.794  -18.939 -14.836 1.00 0.00 ? 59  ILE A HG13 1  
ATOM 863   H HG21 . ILE A 1 59  ? 13.890  -21.926 -15.873 1.00 0.00 ? 59  ILE A HG21 1  
ATOM 864   H HG22 . ILE A 1 59  ? 13.903  -20.163 -15.850 1.00 0.00 ? 59  ILE A HG22 1  
ATOM 865   H HG23 . ILE A 1 59  ? 14.982  -21.039 -16.937 1.00 0.00 ? 59  ILE A HG23 1  
ATOM 866   H HD11 . ILE A 1 59  ? 14.468  -18.551 -12.781 1.00 0.00 ? 59  ILE A HD11 1  
ATOM 867   H HD12 . ILE A 1 59  ? 13.539  -19.250 -14.108 1.00 0.00 ? 59  ILE A HD12 1  
ATOM 868   H HD13 . ILE A 1 59  ? 14.064  -20.267 -12.767 1.00 0.00 ? 59  ILE A HD13 1  
ATOM 869   N N    . TYR A 1 60  ? 14.624  -24.500 -14.383 1.00 0.00 ? 60  TYR A N    1  
ATOM 870   C CA   . TYR A 1 60  ? 14.689  -25.809 -15.023 1.00 0.00 ? 60  TYR A CA   1  
ATOM 871   C C    . TYR A 1 60  ? 14.636  -25.676 -16.542 1.00 0.00 ? 60  TYR A C    1  
ATOM 872   O O    . TYR A 1 60  ? 14.635  -24.569 -17.080 1.00 0.00 ? 60  TYR A O    1  
ATOM 873   C CB   . TYR A 1 60  ? 13.541  -26.695 -14.537 1.00 0.00 ? 60  TYR A CB   1  
ATOM 874   C CG   . TYR A 1 60  ? 13.627  -27.046 -13.068 1.00 0.00 ? 60  TYR A CG   1  
ATOM 875   C CD1  . TYR A 1 60  ? 14.848  -27.346 -12.476 1.00 0.00 ? 60  TYR A CD1  1  
ATOM 876   C CD2  . TYR A 1 60  ? 12.488  -27.077 -12.274 1.00 0.00 ? 60  TYR A CD2  1  
ATOM 877   C CE1  . TYR A 1 60  ? 14.931  -27.668 -11.135 1.00 0.00 ? 60  TYR A CE1  1  
ATOM 878   C CE2  . TYR A 1 60  ? 12.562  -27.396 -10.931 1.00 0.00 ? 60  TYR A CE2  1  
ATOM 879   C CZ   . TYR A 1 60  ? 13.786  -27.691 -10.367 1.00 0.00 ? 60  TYR A CZ   1  
ATOM 880   O OH   . TYR A 1 60  ? 13.863  -28.011 -9.031  1.00 0.00 ? 60  TYR A OH   1  
ATOM 881   H H    . TYR A 1 60  ? 13.904  -24.316 -13.744 1.00 0.00 ? 60  TYR A H    1  
ATOM 882   H HA   . TYR A 1 60  ? 15.627  -26.267 -14.746 1.00 0.00 ? 60  TYR A HA   1  
ATOM 883   H HB2  . TYR A 1 60  ? 12.606  -26.183 -14.700 1.00 0.00 ? 60  TYR A HB2  1  
ATOM 884   H HB3  . TYR A 1 60  ? 13.545  -27.617 -15.099 1.00 0.00 ? 60  TYR A HB3  1  
ATOM 885   H HD1  . TYR A 1 60  ? 15.743  -27.328 -13.080 1.00 0.00 ? 60  TYR A HD1  1  
ATOM 886   H HD2  . TYR A 1 60  ? 11.531  -26.846 -12.719 1.00 0.00 ? 60  TYR A HD2  1  
ATOM 887   H HE1  . TYR A 1 60  ? 15.889  -27.899 -10.693 1.00 0.00 ? 60  TYR A HE1  1  
ATOM 888   H HE2  . TYR A 1 60  ? 11.665  -27.415 -10.330 1.00 0.00 ? 60  TYR A HE2  1  
ATOM 889   H HH   . TYR A 1 60  ? 14.624  -28.578 -8.881  1.00 0.00 ? 60  TYR A HH   1  
ATOM 890   N N    . ALA A 1 61  ? 14.591  -26.814 -17.227 1.00 0.00 ? 61  ALA A N    1  
ATOM 891   C CA   . ALA A 1 61  ? 14.535  -26.826 -18.684 1.00 0.00 ? 61  ALA A CA   1  
ATOM 892   C C    . ALA A 1 61  ? 13.408  -25.936 -19.197 1.00 0.00 ? 61  ALA A C    1  
ATOM 893   O O    . ALA A 1 61  ? 13.644  -24.995 -19.956 1.00 0.00 ? 61  ALA A O    1  
ATOM 894   C CB   . ALA A 1 61  ? 14.359  -28.249 -19.193 1.00 0.00 ? 61  ALA A CB   1  
ATOM 895   H H    . ALA A 1 61  ? 14.595  -27.665 -16.742 1.00 0.00 ? 61  ALA A H    1  
ATOM 896   H HA   . ALA A 1 61  ? 15.476  -26.450 -19.058 1.00 0.00 ? 61  ALA A HA   1  
ATOM 897   H HB1  . ALA A 1 61  ? 15.267  -28.808 -19.017 1.00 0.00 ? 61  ALA A HB1  1  
ATOM 898   H HB2  . ALA A 1 61  ? 13.539  -28.719 -18.672 1.00 0.00 ? 61  ALA A HB2  1  
ATOM 899   H HB3  . ALA A 1 61  ? 14.149  -28.229 -20.252 1.00 0.00 ? 61  ALA A HB3  1  
ATOM 900   N N    . ASP A 1 62  ? 12.184  -26.239 -18.780 1.00 0.00 ? 62  ASP A N    1  
ATOM 901   C CA   . ASP A 1 62  ? 11.020  -25.465 -19.198 1.00 0.00 ? 62  ASP A CA   1  
ATOM 902   C C    . ASP A 1 62  ? 9.747   -26.013 -18.562 1.00 0.00 ? 62  ASP A C    1  
ATOM 903   O O    . ASP A 1 62  ? 8.704   -26.098 -19.210 1.00 0.00 ? 62  ASP A O    1  
ATOM 904   C CB   . ASP A 1 62  ? 10.891  -25.480 -20.722 1.00 0.00 ? 62  ASP A CB   1  
ATOM 905   C CG   . ASP A 1 62  ? 10.503  -24.127 -21.283 1.00 0.00 ? 62  ASP A CG   1  
ATOM 906   O OD1  . ASP A 1 62  ? 9.293   -23.817 -21.302 1.00 0.00 ? 62  ASP A OD1  1  
ATOM 907   O OD2  . ASP A 1 62  ? 11.409  -23.377 -21.703 1.00 0.00 ? 62  ASP A OD2  1  
ATOM 908   H H    . ASP A 1 62  ? 12.060  -27.001 -18.176 1.00 0.00 ? 62  ASP A H    1  
ATOM 909   H HA   . ASP A 1 62  ? 11.163  -24.447 -18.868 1.00 0.00 ? 62  ASP A HA   1  
ATOM 910   H HB2  . ASP A 1 62  ? 11.838  -25.770 -21.154 1.00 0.00 ? 62  ASP A HB2  1  
ATOM 911   H HB3  . ASP A 1 62  ? 10.136  -26.198 -21.005 1.00 0.00 ? 62  ASP A HB3  1  
ATOM 912   N N    . ARG A 1 63  ? 9.839   -26.385 -17.289 1.00 0.00 ? 63  ARG A N    1  
ATOM 913   C CA   . ARG A 1 63  ? 8.695   -26.927 -16.566 1.00 0.00 ? 63  ARG A CA   1  
ATOM 914   C C    . ARG A 1 63  ? 8.355   -26.059 -15.358 1.00 0.00 ? 63  ARG A C    1  
ATOM 915   O O    . ARG A 1 63  ? 7.243   -25.541 -15.246 1.00 0.00 ? 63  ARG A O    1  
ATOM 916   C CB   . ARG A 1 63  ? 8.983   -28.359 -16.113 1.00 0.00 ? 63  ARG A CB   1  
ATOM 917   C CG   . ARG A 1 63  ? 8.327   -29.417 -16.985 1.00 0.00 ? 63  ARG A CG   1  
ATOM 918   C CD   . ARG A 1 63  ? 9.229   -29.827 -18.138 1.00 0.00 ? 63  ARG A CD   1  
ATOM 919   N NE   . ARG A 1 63  ? 8.480   -30.462 -19.220 1.00 0.00 ? 63  ARG A NE   1  
ATOM 920   C CZ   . ARG A 1 63  ? 9.047   -31.175 -20.186 1.00 0.00 ? 63  ARG A CZ   1  
ATOM 921   N NH1  . ARG A 1 63  ? 10.363  -31.343 -20.206 1.00 0.00 ? 63  ARG A NH1  1  
ATOM 922   N NH2  . ARG A 1 63  ? 8.299   -31.722 -21.136 1.00 0.00 ? 63  ARG A NH2  1  
ATOM 923   H H    . ARG A 1 63  ? 10.698  -26.293 -16.825 1.00 0.00 ? 63  ARG A H    1  
ATOM 924   H HA   . ARG A 1 63  ? 7.851   -26.934 -17.238 1.00 0.00 ? 63  ARG A HA   1  
ATOM 925   H HB2  . ARG A 1 63  ? 10.051  -28.522 -16.130 1.00 0.00 ? 63  ARG A HB2  1  
ATOM 926   H HB3  . ARG A 1 63  ? 8.625   -28.483 -15.102 1.00 0.00 ? 63  ARG A HB3  1  
ATOM 927   H HG2  . ARG A 1 63  ? 8.115   -30.288 -16.381 1.00 0.00 ? 63  ARG A HG2  1  
ATOM 928   H HG3  . ARG A 1 63  ? 7.405   -29.020 -17.383 1.00 0.00 ? 63  ARG A HG3  1  
ATOM 929   H HD2  . ARG A 1 63  ? 9.721   -28.947 -18.523 1.00 0.00 ? 63  ARG A HD2  1  
ATOM 930   H HD3  . ARG A 1 63  ? 9.969   -30.521 -17.769 1.00 0.00 ? 63  ARG A HD3  1  
ATOM 931   H HE   . ARG A 1 63  ? 7.507   -30.351 -19.224 1.00 0.00 ? 63  ARG A HE   1  
ATOM 932   H HH11 . ARG A 1 63  ? 10.929  -30.933 -19.491 1.00 0.00 ? 63  ARG A HH11 1  
ATOM 933   H HH12 . ARG A 1 63  ? 10.787  -31.882 -20.934 1.00 0.00 ? 63  ARG A HH12 1  
ATOM 934   H HH21 . ARG A 1 63  ? 7.307   -31.597 -21.124 1.00 0.00 ? 63  ARG A HH21 1  
ATOM 935   H HH22 . ARG A 1 63  ? 8.727   -32.258 -21.863 1.00 0.00 ? 63  ARG A HH22 1  
ATOM 936   N N    . SER A 1 64  ? 9.319   -25.904 -14.456 1.00 0.00 ? 64  SER A N    1  
ATOM 937   C CA   . SER A 1 64  ? 9.120   -25.103 -13.254 1.00 0.00 ? 64  SER A CA   1  
ATOM 938   C C    . SER A 1 64  ? 10.435  -24.487 -12.788 1.00 0.00 ? 64  SER A C    1  
ATOM 939   O O    . SER A 1 64  ? 11.468  -24.631 -13.442 1.00 0.00 ? 64  SER A O    1  
ATOM 940   C CB   . SER A 1 64  ? 8.521   -25.960 -12.137 1.00 0.00 ? 64  SER A CB   1  
ATOM 941   O OG   . SER A 1 64  ? 7.139   -26.189 -12.354 1.00 0.00 ? 64  SER A OG   1  
ATOM 942   H H    . SER A 1 64  ? 10.184  -26.343 -14.601 1.00 0.00 ? 64  SER A H    1  
ATOM 943   H HA   . SER A 1 64  ? 8.429   -24.309 -13.496 1.00 0.00 ? 64  SER A HA   1  
ATOM 944   H HB2  . SER A 1 64  ? 9.030   -26.912 -12.105 1.00 0.00 ? 64  SER A HB2  1  
ATOM 945   H HB3  . SER A 1 64  ? 8.646   -25.453 -11.191 1.00 0.00 ? 64  SER A HB3  1  
ATOM 946   H HG   . SER A 1 64  ? 6.626   -25.639 -11.758 1.00 0.00 ? 64  SER A HG   1  
ATOM 947   N N    . PHE A 1 65  ? 10.389  -23.799 -11.652 1.00 0.00 ? 65  PHE A N    1  
ATOM 948   C CA   . PHE A 1 65  ? 11.576  -23.159 -11.097 1.00 0.00 ? 65  PHE A CA   1  
ATOM 949   C C    . PHE A 1 65  ? 11.607  -23.294 -9.578  1.00 0.00 ? 65  PHE A C    1  
ATOM 950   O O    . PHE A 1 65  ? 10.615  -23.675 -8.956  1.00 0.00 ? 65  PHE A O    1  
ATOM 951   C CB   . PHE A 1 65  ? 11.615  -21.680 -11.490 1.00 0.00 ? 65  PHE A CB   1  
ATOM 952   C CG   . PHE A 1 65  ? 10.414  -20.906 -11.029 1.00 0.00 ? 65  PHE A CG   1  
ATOM 953   C CD1  . PHE A 1 65  ? 9.228   -20.951 -11.744 1.00 0.00 ? 65  PHE A CD1  1  
ATOM 954   C CD2  . PHE A 1 65  ? 10.469  -20.134 -9.879  1.00 0.00 ? 65  PHE A CD2  1  
ATOM 955   C CE1  . PHE A 1 65  ? 8.121   -20.238 -11.323 1.00 0.00 ? 65  PHE A CE1  1  
ATOM 956   C CE2  . PHE A 1 65  ? 9.365   -19.420 -9.453  1.00 0.00 ? 65  PHE A CE2  1  
ATOM 957   C CZ   . PHE A 1 65  ? 8.190   -19.473 -10.175 1.00 0.00 ? 65  PHE A CZ   1  
ATOM 958   H H    . PHE A 1 65  ? 9.536   -23.719 -11.176 1.00 0.00 ? 65  PHE A H    1  
ATOM 959   H HA   . PHE A 1 65  ? 12.442  -23.654 -11.509 1.00 0.00 ? 65  PHE A HA   1  
ATOM 960   H HB2  . PHE A 1 65  ? 12.491  -21.223 -11.055 1.00 0.00 ? 65  PHE A HB2  1  
ATOM 961   H HB3  . PHE A 1 65  ? 11.669  -21.602 -12.565 1.00 0.00 ? 65  PHE A HB3  1  
ATOM 962   H HD1  . PHE A 1 65  ? 9.172   -21.549 -12.642 1.00 0.00 ? 65  PHE A HD1  1  
ATOM 963   H HD2  . PHE A 1 65  ? 11.389  -20.092 -9.313  1.00 0.00 ? 65  PHE A HD2  1  
ATOM 964   H HE1  . PHE A 1 65  ? 7.203   -20.282 -11.889 1.00 0.00 ? 65  PHE A HE1  1  
ATOM 965   H HE2  . PHE A 1 65  ? 9.423   -18.823 -8.555  1.00 0.00 ? 65  PHE A HE2  1  
ATOM 966   H HZ   . PHE A 1 65  ? 7.326   -18.916 -9.843  1.00 0.00 ? 65  PHE A HZ   1  
ATOM 967   N N    . THR A 1 66  ? 12.755  -22.980 -8.985  1.00 0.00 ? 66  THR A N    1  
ATOM 968   C CA   . THR A 1 66  ? 12.918  -23.068 -7.539  1.00 0.00 ? 66  THR A CA   1  
ATOM 969   C C    . THR A 1 66  ? 13.223  -21.701 -6.936  1.00 0.00 ? 66  THR A C    1  
ATOM 970   O O    . THR A 1 66  ? 13.232  -20.690 -7.638  1.00 0.00 ? 66  THR A O    1  
ATOM 971   C CB   . THR A 1 66  ? 14.044  -24.047 -7.159  1.00 0.00 ? 66  THR A CB   1  
ATOM 972   O OG1  . THR A 1 66  ? 15.320  -23.435 -7.376  1.00 0.00 ? 66  THR A OG1  1  
ATOM 973   C CG2  . THR A 1 66  ? 13.946  -25.328 -7.975  1.00 0.00 ? 66  THR A CG2  1  
ATOM 974   H H    . THR A 1 66  ? 13.510  -22.683 -9.535  1.00 0.00 ? 66  THR A H    1  
ATOM 975   H HA   . THR A 1 66  ? 11.992  -23.436 -7.121  1.00 0.00 ? 66  THR A HA   1  
ATOM 976   H HB   . THR A 1 66  ? 13.946  -24.297 -6.112  1.00 0.00 ? 66  THR A HB   1  
ATOM 977   H HG1  . THR A 1 66  ? 15.516  -22.837 -6.650  1.00 0.00 ? 66  THR A HG1  1  
ATOM 978   H HG21 . THR A 1 66  ? 14.042  -26.181 -7.319  1.00 0.00 ? 66  THR A HG21 1  
ATOM 979   H HG22 . THR A 1 66  ? 14.736  -25.348 -8.710  1.00 0.00 ? 66  THR A HG22 1  
ATOM 980   H HG23 . THR A 1 66  ? 12.989  -25.364 -8.473  1.00 0.00 ? 66  THR A HG23 1  
ATOM 981   N N    . PHE A 1 67  ? 13.475  -21.678 -5.632  1.00 0.00 ? 67  PHE A N    1  
ATOM 982   C CA   . PHE A 1 67  ? 13.781  -20.435 -4.934  1.00 0.00 ? 67  PHE A CA   1  
ATOM 983   C C    . PHE A 1 67  ? 14.035  -20.692 -3.451  1.00 0.00 ? 67  PHE A C    1  
ATOM 984   O O    . PHE A 1 67  ? 13.296  -21.433 -2.803  1.00 0.00 ? 67  PHE A O    1  
ATOM 985   C CB   . PHE A 1 67  ? 12.635  -19.436 -5.101  1.00 0.00 ? 67  PHE A CB   1  
ATOM 986   C CG   . PHE A 1 67  ? 11.281  -20.025 -4.824  1.00 0.00 ? 67  PHE A CG   1  
ATOM 987   C CD1  . PHE A 1 67  ? 10.773  -20.049 -3.535  1.00 0.00 ? 67  PHE A CD1  1  
ATOM 988   C CD2  . PHE A 1 67  ? 10.517  -20.554 -5.851  1.00 0.00 ? 67  PHE A CD2  1  
ATOM 989   C CE1  . PHE A 1 67  ? 9.527   -20.590 -3.276  1.00 0.00 ? 67  PHE A CE1  1  
ATOM 990   C CE2  . PHE A 1 67  ? 9.271   -21.096 -5.599  1.00 0.00 ? 67  PHE A CE2  1  
ATOM 991   C CZ   . PHE A 1 67  ? 8.776   -21.115 -4.309  1.00 0.00 ? 67  PHE A CZ   1  
ATOM 992   H H    . PHE A 1 67  ? 13.454  -22.518 -5.126  1.00 0.00 ? 67  PHE A H    1  
ATOM 993   H HA   . PHE A 1 67  ? 14.675  -20.021 -5.373  1.00 0.00 ? 67  PHE A HA   1  
ATOM 994   H HB2  . PHE A 1 67  ? 12.783  -18.611 -4.421  1.00 0.00 ? 67  PHE A HB2  1  
ATOM 995   H HB3  . PHE A 1 67  ? 12.635  -19.065 -6.115  1.00 0.00 ? 67  PHE A HB3  1  
ATOM 996   H HD1  . PHE A 1 67  ? 11.360  -19.639 -2.726  1.00 0.00 ? 67  PHE A HD1  1  
ATOM 997   H HD2  . PHE A 1 67  ? 10.903  -20.541 -6.860  1.00 0.00 ? 67  PHE A HD2  1  
ATOM 998   H HE1  . PHE A 1 67  ? 9.143   -20.604 -2.267  1.00 0.00 ? 67  PHE A HE1  1  
ATOM 999   H HE2  . PHE A 1 67  ? 8.686   -21.506 -6.408  1.00 0.00 ? 67  PHE A HE2  1  
ATOM 1000  H HZ   . PHE A 1 67  ? 7.803   -21.537 -4.109  1.00 0.00 ? 67  PHE A HZ   1  
ATOM 1001  N N    . VAL A 1 68  ? 15.085  -20.073 -2.921  1.00 0.00 ? 68  VAL A N    1  
ATOM 1002  C CA   . VAL A 1 68  ? 15.437  -20.233 -1.515  1.00 0.00 ? 68  VAL A CA   1  
ATOM 1003  C C    . VAL A 1 68  ? 16.152  -18.997 -0.984  1.00 0.00 ? 68  VAL A C    1  
ATOM 1004  O O    . VAL A 1 68  ? 16.947  -18.373 -1.688  1.00 0.00 ? 68  VAL A O    1  
ATOM 1005  C CB   . VAL A 1 68  ? 16.336  -21.465 -1.298  1.00 0.00 ? 68  VAL A CB   1  
ATOM 1006  C CG1  . VAL A 1 68  ? 15.555  -22.747 -1.551  1.00 0.00 ? 68  VAL A CG1  1  
ATOM 1007  C CG2  . VAL A 1 68  ? 17.563  -21.394 -2.194  1.00 0.00 ? 68  VAL A CG2  1  
ATOM 1008  H H    . VAL A 1 68  ? 15.636  -19.495 -3.489  1.00 0.00 ? 68  VAL A H    1  
ATOM 1009  H HA   . VAL A 1 68  ? 14.524  -20.377 -0.957  1.00 0.00 ? 68  VAL A HA   1  
ATOM 1010  H HB   . VAL A 1 68  ? 16.666  -21.468 -0.270  1.00 0.00 ? 68  VAL A HB   1  
ATOM 1011  H HG11 . VAL A 1 68  ? 15.239  -22.777 -2.583  1.00 0.00 ? 68  VAL A HG11 1  
ATOM 1012  H HG12 . VAL A 1 68  ? 16.184  -23.599 -1.340  1.00 0.00 ? 68  VAL A HG12 1  
ATOM 1013  H HG13 . VAL A 1 68  ? 14.687  -22.771 -0.908  1.00 0.00 ? 68  VAL A HG13 1  
ATOM 1014  H HG21 . VAL A 1 68  ? 18.323  -22.060 -1.816  1.00 0.00 ? 68  VAL A HG21 1  
ATOM 1015  H HG22 . VAL A 1 68  ? 17.294  -21.689 -3.199  1.00 0.00 ? 68  VAL A HG22 1  
ATOM 1016  H HG23 . VAL A 1 68  ? 17.942  -20.383 -2.206  1.00 0.00 ? 68  VAL A HG23 1  
ATOM 1017  N N    . THR A 1 69  ? 15.866  -18.645 0.266   1.00 0.00 ? 69  THR A N    1  
ATOM 1018  C CA   . THR A 1 69  ? 16.481  -17.482 0.893   1.00 0.00 ? 69  THR A CA   1  
ATOM 1019  C C    . THR A 1 69  ? 17.617  -17.895 1.822   1.00 0.00 ? 69  THR A C    1  
ATOM 1020  O O    . THR A 1 69  ? 17.433  -18.723 2.715   1.00 0.00 ? 69  THR A O    1  
ATOM 1021  C CB   . THR A 1 69  ? 15.450  -16.664 1.694   1.00 0.00 ? 69  THR A CB   1  
ATOM 1022  O OG1  . THR A 1 69  ? 14.383  -17.514 2.131   1.00 0.00 ? 69  THR A OG1  1  
ATOM 1023  C CG2  . THR A 1 69  ? 14.887  -15.529 0.851   1.00 0.00 ? 69  THR A CG2  1  
ATOM 1024  H H    . THR A 1 69  ? 15.225  -19.181 0.777   1.00 0.00 ? 69  THR A H    1  
ATOM 1025  H HA   . THR A 1 69  ? 16.879  -16.853 0.111   1.00 0.00 ? 69  THR A HA   1  
ATOM 1026  H HB   . THR A 1 69  ? 15.941  -16.242 2.559   1.00 0.00 ? 69  THR A HB   1  
ATOM 1027  H HG1  . THR A 1 69  ? 14.174  -17.319 3.048   1.00 0.00 ? 69  THR A HG1  1  
ATOM 1028  H HG21 . THR A 1 69  ? 15.418  -14.616 1.077   1.00 0.00 ? 69  THR A HG21 1  
ATOM 1029  H HG22 . THR A 1 69  ? 13.839  -15.401 1.074   1.00 0.00 ? 69  THR A HG22 1  
ATOM 1030  H HG23 . THR A 1 69  ? 15.007  -15.765 -0.195  1.00 0.00 ? 69  THR A HG23 1  
ATOM 1031  N N    . LYS A 1 70  ? 18.792  -17.312 1.607   1.00 0.00 ? 70  LYS A N    1  
ATOM 1032  C CA   . LYS A 1 70  ? 19.959  -17.617 2.427   1.00 0.00 ? 70  LYS A CA   1  
ATOM 1033  C C    . LYS A 1 70  ? 19.937  -16.817 3.725   1.00 0.00 ? 70  LYS A C    1  
ATOM 1034  O O    . LYS A 1 70  ? 19.820  -15.591 3.709   1.00 0.00 ? 70  LYS A O    1  
ATOM 1035  C CB   . LYS A 1 70  ? 21.244  -17.318 1.652   1.00 0.00 ? 70  LYS A CB   1  
ATOM 1036  C CG   . LYS A 1 70  ? 21.347  -18.064 0.333   1.00 0.00 ? 70  LYS A CG   1  
ATOM 1037  C CD   . LYS A 1 70  ? 21.477  -19.563 0.550   1.00 0.00 ? 70  LYS A CD   1  
ATOM 1038  C CE   . LYS A 1 70  ? 22.681  -20.130 -0.187  1.00 0.00 ? 70  LYS A CE   1  
ATOM 1039  N NZ   . LYS A 1 70  ? 23.911  -20.097 0.652   1.00 0.00 ? 70  LYS A NZ   1  
ATOM 1040  H H    . LYS A 1 70  ? 18.876  -16.660 0.880   1.00 0.00 ? 70  LYS A H    1  
ATOM 1041  H HA   . LYS A 1 70  ? 19.930  -18.670 2.666   1.00 0.00 ? 70  LYS A HA   1  
ATOM 1042  H HB2  . LYS A 1 70  ? 21.287  -16.258 1.446   1.00 0.00 ? 70  LYS A HB2  1  
ATOM 1043  H HB3  . LYS A 1 70  ? 22.091  -17.592 2.264   1.00 0.00 ? 70  LYS A HB3  1  
ATOM 1044  H HG2  . LYS A 1 70  ? 20.459  -17.872 -0.250  1.00 0.00 ? 70  LYS A HG2  1  
ATOM 1045  H HG3  . LYS A 1 70  ? 22.217  -17.711 -0.203  1.00 0.00 ? 70  LYS A HG3  1  
ATOM 1046  H HD2  . LYS A 1 70  ? 21.592  -19.757 1.606   1.00 0.00 ? 70  LYS A HD2  1  
ATOM 1047  H HD3  . LYS A 1 70  ? 20.582  -20.049 0.188   1.00 0.00 ? 70  LYS A HD3  1  
ATOM 1048  H HE2  . LYS A 1 70  ? 22.470  -21.152 -0.461  1.00 0.00 ? 70  LYS A HE2  1  
ATOM 1049  H HE3  . LYS A 1 70  ? 22.848  -19.546 -1.079  1.00 0.00 ? 70  LYS A HE3  1  
ATOM 1050  H HZ1  . LYS A 1 70  ? 24.283  -19.127 0.702   1.00 0.00 ? 70  LYS A HZ1  1  
ATOM 1051  H HZ2  . LYS A 1 70  ? 24.640  -20.715 0.242   1.00 0.00 ? 70  LYS A HZ2  1  
ATOM 1052  H HZ3  . LYS A 1 70  ? 23.696  -20.425 1.615   1.00 0.00 ? 70  LYS A HZ3  1  
ATOM 1053  N N    . THR A 1 71  ? 20.051  -17.517 4.849   1.00 0.00 ? 71  THR A N    1  
ATOM 1054  C CA   . THR A 1 71  ? 20.045  -16.872 6.156   1.00 0.00 ? 71  THR A CA   1  
ATOM 1055  C C    . THR A 1 71  ? 21.255  -15.961 6.325   1.00 0.00 ? 71  THR A C    1  
ATOM 1056  O O    . THR A 1 71  ? 22.265  -16.095 5.633   1.00 0.00 ? 71  THR A O    1  
ATOM 1057  C CB   . THR A 1 71  ? 20.034  -17.909 7.295   1.00 0.00 ? 71  THR A CB   1  
ATOM 1058  O OG1  . THR A 1 71  ? 20.763  -19.077 6.901   1.00 0.00 ? 71  THR A OG1  1  
ATOM 1059  C CG2  . THR A 1 71  ? 18.609  -18.294 7.662   1.00 0.00 ? 71  THR A CG2  1  
ATOM 1060  H H    . THR A 1 71  ? 20.141  -18.492 4.797   1.00 0.00 ? 71  THR A H    1  
ATOM 1061  H HA   . THR A 1 71  ? 19.146  -16.277 6.230   1.00 0.00 ? 71  THR A HA   1  
ATOM 1062  H HB   . THR A 1 71  ? 20.508  -17.473 8.162   1.00 0.00 ? 71  THR A HB   1  
ATOM 1063  H HG1  . THR A 1 71  ? 20.701  -19.741 7.592   1.00 0.00 ? 71  THR A HG1  1  
ATOM 1064  H HG21 . THR A 1 71  ? 18.551  -19.362 7.809   1.00 0.00 ? 71  THR A HG21 1  
ATOM 1065  H HG22 . THR A 1 71  ? 17.941  -18.004 6.865   1.00 0.00 ? 71  THR A HG22 1  
ATOM 1066  H HG23 . THR A 1 71  ? 18.323  -17.790 8.572   1.00 0.00 ? 71  THR A HG23 1  
ATOM 1067  N N    . PRO A 1 72  ? 21.155  -15.011 7.267   1.00 0.00 ? 72  PRO A N    1  
ATOM 1068  C CA   . PRO A 1 72  ? 22.234  -14.060 7.550   1.00 0.00 ? 72  PRO A CA   1  
ATOM 1069  C C    . PRO A 1 72  ? 23.436  -14.726 8.210   1.00 0.00 ? 72  PRO A C    1  
ATOM 1070  O O    . PRO A 1 72  ? 23.373  -15.871 8.658   1.00 0.00 ? 72  PRO A O    1  
ATOM 1071  C CB   . PRO A 1 72  ? 21.583  -13.060 8.509   1.00 0.00 ? 72  PRO A CB   1  
ATOM 1072  C CG   . PRO A 1 72  ? 20.483  -13.823 9.162   1.00 0.00 ? 72  PRO A CG   1  
ATOM 1073  C CD   . PRO A 1 72  ? 19.981  -14.793 8.129   1.00 0.00 ? 72  PRO A CD   1  
ATOM 1074  H HA   . PRO A 1 72  ? 22.555  -13.546 6.655   1.00 0.00 ? 72  PRO A HA   1  
ATOM 1075  H HB2  . PRO A 1 72  ? 22.313  -12.722 9.230   1.00 0.00 ? 72  PRO A HB2  1  
ATOM 1076  H HB3  . PRO A 1 72  ? 21.202  -12.217 7.952   1.00 0.00 ? 72  PRO A HB3  1  
ATOM 1077  H HG2  . PRO A 1 72  ? 20.864  -14.354 10.021  1.00 0.00 ? 72  PRO A HG2  1  
ATOM 1078  H HG3  . PRO A 1 72  ? 19.693  -13.148 9.457   1.00 0.00 ? 72  PRO A HG3  1  
ATOM 1079  H HD2  . PRO A 1 72  ? 19.670  -15.716 8.597   1.00 0.00 ? 72  PRO A HD2  1  
ATOM 1080  H HD3  . PRO A 1 72  ? 19.167  -14.359 7.567   1.00 0.00 ? 72  PRO A HD3  1  
ATOM 1081  N N    . PRO A 1 73  ? 24.558  -13.994 8.274   1.00 0.00 ? 73  PRO A N    1  
ATOM 1082  C CA   . PRO A 1 73  ? 25.796  -14.494 8.879   1.00 0.00 ? 73  PRO A CA   1  
ATOM 1083  C C    . PRO A 1 73  ? 25.685  -14.635 10.393  1.00 0.00 ? 73  PRO A C    1  
ATOM 1084  O O    . PRO A 1 73  ? 24.779  -14.079 11.013  1.00 0.00 ? 73  PRO A O    1  
ATOM 1085  C CB   . PRO A 1 73  ? 26.827  -13.423 8.516   1.00 0.00 ? 73  PRO A CB   1  
ATOM 1086  C CG   . PRO A 1 73  ? 26.029  -12.180 8.320   1.00 0.00 ? 73  PRO A CG   1  
ATOM 1087  C CD   . PRO A 1 73  ? 24.705  -12.622 7.760   1.00 0.00 ? 73  PRO A CD   1  
ATOM 1088  H HA   . PRO A 1 73  ? 26.093  -15.441 8.451   1.00 0.00 ? 73  PRO A HA   1  
ATOM 1089  H HB2  . PRO A 1 73  ? 27.537  -13.314 9.323   1.00 0.00 ? 73  PRO A HB2  1  
ATOM 1090  H HB3  . PRO A 1 73  ? 27.343  -13.706 7.611   1.00 0.00 ? 73  PRO A HB3  1  
ATOM 1091  H HG2  . PRO A 1 73  ? 25.888  -11.682 9.267   1.00 0.00 ? 73  PRO A HG2  1  
ATOM 1092  H HG3  . PRO A 1 73  ? 26.531  -11.527 7.622   1.00 0.00 ? 73  PRO A HG3  1  
ATOM 1093  H HD2  . PRO A 1 73  ? 23.910  -11.987 8.124   1.00 0.00 ? 73  PRO A HD2  1  
ATOM 1094  H HD3  . PRO A 1 73  ? 24.731  -12.616 6.681   1.00 0.00 ? 73  PRO A HD3  1  
ATOM 1095  N N    . ALA A 1 74  ? 26.613  -15.382 10.983  1.00 0.00 ? 74  ALA A N    1  
ATOM 1096  C CA   . ALA A 1 74  ? 26.620  -15.593 12.425  1.00 0.00 ? 74  ALA A CA   1  
ATOM 1097  C C    . ALA A 1 74  ? 26.852  -14.283 13.171  1.00 0.00 ? 74  ALA A C    1  
ATOM 1098  O O    . ALA A 1 74  ? 26.424  -14.125 14.314  1.00 0.00 ? 74  ALA A O    1  
ATOM 1099  C CB   . ALA A 1 74  ? 27.684  -16.613 12.804  1.00 0.00 ? 74  ALA A CB   1  
ATOM 1100  H H    . ALA A 1 74  ? 27.310  -15.799 10.435  1.00 0.00 ? 74  ALA A H    1  
ATOM 1101  H HA   . ALA A 1 74  ? 25.657  -15.992 12.709  1.00 0.00 ? 74  ALA A HA   1  
ATOM 1102  H HB1  . ALA A 1 74  ? 27.528  -16.933 13.824  1.00 0.00 ? 74  ALA A HB1  1  
ATOM 1103  H HB2  . ALA A 1 74  ? 27.616  -17.466 12.145  1.00 0.00 ? 74  ALA A HB2  1  
ATOM 1104  H HB3  . ALA A 1 74  ? 28.662  -16.164 12.712  1.00 0.00 ? 74  ALA A HB3  1  
ATOM 1105  N N    . SER A 1 75  ? 27.532  -13.347 12.517  1.00 0.00 ? 75  SER A N    1  
ATOM 1106  C CA   . SER A 1 75  ? 27.824  -12.052 13.120  1.00 0.00 ? 75  SER A CA   1  
ATOM 1107  C C    . SER A 1 75  ? 26.542  -11.364 13.577  1.00 0.00 ? 75  SER A C    1  
ATOM 1108  O O    . SER A 1 75  ? 26.529  -10.656 14.584  1.00 0.00 ? 75  SER A O    1  
ATOM 1109  C CB   . SER A 1 75  ? 28.569  -11.160 12.126  1.00 0.00 ? 75  SER A CB   1  
ATOM 1110  O OG   . SER A 1 75  ? 27.665  -10.383 11.359  1.00 0.00 ? 75  SER A OG   1  
ATOM 1111  H H    . SER A 1 75  ? 27.847  -13.534 11.607  1.00 0.00 ? 75  SER A H    1  
ATOM 1112  H HA   . SER A 1 75  ? 28.454  -12.222 13.980  1.00 0.00 ? 75  SER A HA   1  
ATOM 1113  H HB2  . SER A 1 75  ? 29.227  -10.495 12.665  1.00 0.00 ? 75  SER A HB2  1  
ATOM 1114  H HB3  . SER A 1 75  ? 29.151  -11.778 11.457  1.00 0.00 ? 75  SER A HB3  1  
ATOM 1115  H HG   . SER A 1 75  ? 28.109  -10.056 10.574  1.00 0.00 ? 75  SER A HG   1  
ATOM 1116  N N    . TYR A 1 76  ? 25.465  -11.577 12.829  1.00 0.00 ? 76  TYR A N    1  
ATOM 1117  C CA   . TYR A 1 76  ? 24.177  -10.976 13.154  1.00 0.00 ? 76  TYR A CA   1  
ATOM 1118  C C    . TYR A 1 76  ? 23.722  -11.386 14.551  1.00 0.00 ? 76  TYR A C    1  
ATOM 1119  O O    . TYR A 1 76  ? 22.904  -10.707 15.175  1.00 0.00 ? 76  TYR A O    1  
ATOM 1120  C CB   . TYR A 1 76  ? 23.124  -11.384 12.122  1.00 0.00 ? 76  TYR A CB   1  
ATOM 1121  C CG   . TYR A 1 76  ? 21.718  -10.978 12.499  1.00 0.00 ? 76  TYR A CG   1  
ATOM 1122  C CD1  . TYR A 1 76  ? 21.305  -9.655  12.396  1.00 0.00 ? 76  TYR A CD1  1  
ATOM 1123  C CD2  . TYR A 1 76  ? 20.801  -11.917 12.956  1.00 0.00 ? 76  TYR A CD2  1  
ATOM 1124  C CE1  . TYR A 1 76  ? 20.021  -9.279  12.740  1.00 0.00 ? 76  TYR A CE1  1  
ATOM 1125  C CE2  . TYR A 1 76  ? 19.514  -11.550 13.300  1.00 0.00 ? 76  TYR A CE2  1  
ATOM 1126  C CZ   . TYR A 1 76  ? 19.129  -10.230 13.191  1.00 0.00 ? 76  TYR A CZ   1  
ATOM 1127  O OH   . TYR A 1 76  ? 17.849  -9.860  13.533  1.00 0.00 ? 76  TYR A OH   1  
ATOM 1128  H H    . TYR A 1 76  ? 25.538  -12.151 12.037  1.00 0.00 ? 76  TYR A H    1  
ATOM 1129  H HA   . TYR A 1 76  ? 24.296  -9.902  13.127  1.00 0.00 ? 76  TYR A HA   1  
ATOM 1130  H HB2  . TYR A 1 76  ? 23.360  -10.924 11.175  1.00 0.00 ? 76  TYR A HB2  1  
ATOM 1131  H HB3  . TYR A 1 76  ? 23.140  -12.459 12.008  1.00 0.00 ? 76  TYR A HB3  1  
ATOM 1132  H HD1  . TYR A 1 76  ? 22.006  -8.913  12.043  1.00 0.00 ? 76  TYR A HD1  1  
ATOM 1133  H HD2  . TYR A 1 76  ? 21.105  -12.950 13.040  1.00 0.00 ? 76  TYR A HD2  1  
ATOM 1134  H HE1  . TYR A 1 76  ? 19.719  -8.246  12.654  1.00 0.00 ? 76  TYR A HE1  1  
ATOM 1135  H HE2  . TYR A 1 76  ? 18.816  -12.294 13.653  1.00 0.00 ? 76  TYR A HE2  1  
ATOM 1136  H HH   . TYR A 1 76  ? 17.881  -9.217  14.245  1.00 0.00 ? 76  TYR A HH   1  
ATOM 1137  N N    . LEU A 1 77  ? 24.258  -12.500 15.037  1.00 0.00 ? 77  LEU A N    1  
ATOM 1138  C CA   . LEU A 1 77  ? 23.909  -13.002 16.362  1.00 0.00 ? 77  LEU A CA   1  
ATOM 1139  C C    . LEU A 1 77  ? 24.934  -12.559 17.400  1.00 0.00 ? 77  LEU A C    1  
ATOM 1140  O O    . LEU A 1 77  ? 24.610  -12.395 18.576  1.00 0.00 ? 77  LEU A O    1  
ATOM 1141  C CB   . LEU A 1 77  ? 23.813  -14.528 16.341  1.00 0.00 ? 77  LEU A CB   1  
ATOM 1142  C CG   . LEU A 1 77  ? 22.581  -15.115 15.651  1.00 0.00 ? 77  LEU A CG   1  
ATOM 1143  C CD1  . LEU A 1 77  ? 22.812  -16.576 15.298  1.00 0.00 ? 77  LEU A CD1  1  
ATOM 1144  C CD2  . LEU A 1 77  ? 21.353  -14.966 16.537  1.00 0.00 ? 77  LEU A CD2  1  
ATOM 1145  H H    . LEU A 1 77  ? 24.903  -12.997 14.494  1.00 0.00 ? 77  LEU A H    1  
ATOM 1146  H HA   . LEU A 1 77  ? 22.945  -12.593 16.628  1.00 0.00 ? 77  LEU A HA   1  
ATOM 1147  H HB2  . LEU A 1 77  ? 24.688  -14.907 15.835  1.00 0.00 ? 77  LEU A HB2  1  
ATOM 1148  H HB3  . LEU A 1 77  ? 23.816  -14.873 17.366  1.00 0.00 ? 77  LEU A HB3  1  
ATOM 1149  H HG   . LEU A 1 77  ? 22.400  -14.575 14.732  1.00 0.00 ? 77  LEU A HG   1  
ATOM 1150  H HD11 . LEU A 1 77  ? 22.610  -17.191 16.162  1.00 0.00 ? 77  LEU A HD11 1  
ATOM 1151  H HD12 . LEU A 1 77  ? 23.838  -16.714 14.989  1.00 0.00 ? 77  LEU A HD12 1  
ATOM 1152  H HD13 . LEU A 1 77  ? 22.152  -16.860 14.492  1.00 0.00 ? 77  LEU A HD13 1  
ATOM 1153  H HD21 . LEU A 1 77  ? 21.242  -13.931 16.826  1.00 0.00 ? 77  LEU A HD21 1  
ATOM 1154  H HD22 . LEU A 1 77  ? 21.469  -15.576 17.420  1.00 0.00 ? 77  LEU A HD22 1  
ATOM 1155  H HD23 . LEU A 1 77  ? 20.476  -15.283 15.992  1.00 0.00 ? 77  LEU A HD23 1  
ATOM 1156  N N    . ILE A 1 78  ? 26.172  -12.365 16.956  1.00 0.00 ? 78  ILE A N    1  
ATOM 1157  C CA   . ILE A 1 78  ? 27.244  -11.938 17.846  1.00 0.00 ? 78  ILE A CA   1  
ATOM 1158  C C    . ILE A 1 78  ? 26.915  -10.599 18.500  1.00 0.00 ? 78  ILE A C    1  
ATOM 1159  O O    . ILE A 1 78  ? 27.211  -10.382 19.675  1.00 0.00 ? 78  ILE A O    1  
ATOM 1160  C CB   . ILE A 1 78  ? 28.583  -11.815 17.096  1.00 0.00 ? 78  ILE A CB   1  
ATOM 1161  C CG1  . ILE A 1 78  ? 28.902  -13.118 16.360  1.00 0.00 ? 78  ILE A CG1  1  
ATOM 1162  C CG2  . ILE A 1 78  ? 29.702  -11.460 18.064  1.00 0.00 ? 78  ILE A CG2  1  
ATOM 1163  C CD1  . ILE A 1 78  ? 30.232  -13.095 15.640  1.00 0.00 ? 78  ILE A CD1  1  
ATOM 1164  H H    . ILE A 1 78  ? 26.368  -12.512 16.008  1.00 0.00 ? 78  ILE A H    1  
ATOM 1165  H HA   . ILE A 1 78  ? 27.354  -12.686 18.619  1.00 0.00 ? 78  ILE A HA   1  
ATOM 1166  H HB   . ILE A 1 78  ? 28.495  -11.016 16.377  1.00 0.00 ? 78  ILE A HB   1  
ATOM 1167  H HG12 . ILE A 1 78  ? 28.924  -13.929 17.071  1.00 0.00 ? 78  ILE A HG12 1  
ATOM 1168  H HG13 . ILE A 1 78  ? 28.130  -13.307 15.629  1.00 0.00 ? 78  ILE A HG13 1  
ATOM 1169  H HG21 . ILE A 1 78  ? 29.277  -11.080 18.982  1.00 0.00 ? 78  ILE A HG21 1  
ATOM 1170  H HG22 . ILE A 1 78  ? 30.287  -12.342 18.277  1.00 0.00 ? 78  ILE A HG22 1  
ATOM 1171  H HG23 . ILE A 1 78  ? 30.335  -10.706 17.622  1.00 0.00 ? 78  ILE A HG23 1  
ATOM 1172  H HD11 . ILE A 1 78  ? 30.884  -13.845 16.062  1.00 0.00 ? 78  ILE A HD11 1  
ATOM 1173  H HD12 . ILE A 1 78  ? 30.077  -13.301 14.591  1.00 0.00 ? 78  ILE A HD12 1  
ATOM 1174  H HD13 . ILE A 1 78  ? 30.685  -12.121 15.752  1.00 0.00 ? 78  ILE A HD13 1  
ATOM 1175  N N    . ARG A 1 79  ? 26.301  -9.707  17.730  1.00 0.00 ? 79  ARG A N    1  
ATOM 1176  C CA   . ARG A 1 79  ? 25.931  -8.390  18.234  1.00 0.00 ? 79  ARG A CA   1  
ATOM 1177  C C    . ARG A 1 79  ? 25.028  -8.510  19.458  1.00 0.00 ? 79  ARG A C    1  
ATOM 1178  O O    . ARG A 1 79  ? 24.926  -7.582  20.261  1.00 0.00 ? 79  ARG A O    1  
ATOM 1179  C CB   . ARG A 1 79  ? 25.225  -7.582  17.143  1.00 0.00 ? 79  ARG A CB   1  
ATOM 1180  C CG   . ARG A 1 79  ? 26.168  -6.732  16.308  1.00 0.00 ? 79  ARG A CG   1  
ATOM 1181  C CD   . ARG A 1 79  ? 26.471  -7.386  14.969  1.00 0.00 ? 79  ARG A CD   1  
ATOM 1182  N NE   . ARG A 1 79  ? 26.577  -6.405  13.892  1.00 0.00 ? 79  ARG A NE   1  
ATOM 1183  C CZ   . ARG A 1 79  ? 26.549  -6.723  12.603  1.00 0.00 ? 79  ARG A CZ   1  
ATOM 1184  N NH1  . ARG A 1 79  ? 26.418  -7.989  12.232  1.00 0.00 ? 79  ARG A NH1  1  
ATOM 1185  N NH2  . ARG A 1 79  ? 26.651  -5.773  11.682  1.00 0.00 ? 79  ARG A NH2  1  
ATOM 1186  H H    . ARG A 1 79  ? 26.091  -9.939  16.801  1.00 0.00 ? 79  ARG A H    1  
ATOM 1187  H HA   . ARG A 1 79  ? 26.837  -7.877  18.519  1.00 0.00 ? 79  ARG A HA   1  
ATOM 1188  H HB2  . ARG A 1 79  ? 24.711  -8.265  16.482  1.00 0.00 ? 79  ARG A HB2  1  
ATOM 1189  H HB3  . ARG A 1 79  ? 24.502  -6.929  17.607  1.00 0.00 ? 79  ARG A HB3  1  
ATOM 1190  H HG2  . ARG A 1 79  ? 25.710  -5.770  16.131  1.00 0.00 ? 79  ARG A HG2  1  
ATOM 1191  H HG3  . ARG A 1 79  ? 27.092  -6.598  16.851  1.00 0.00 ? 79  ARG A HG3  1  
ATOM 1192  H HD2  . ARG A 1 79  ? 27.405  -7.922  15.048  1.00 0.00 ? 79  ARG A HD2  1  
ATOM 1193  H HD3  . ARG A 1 79  ? 25.677  -8.079  14.735  1.00 0.00 ? 79  ARG A HD3  1  
ATOM 1194  H HE   . ARG A 1 79  ? 26.674  -5.463  14.144  1.00 0.00 ? 79  ARG A HE   1  
ATOM 1195  H HH11 . ARG A 1 79  ? 26.339  -8.706  12.924  1.00 0.00 ? 79  ARG A HH11 1  
ATOM 1196  H HH12 . ARG A 1 79  ? 26.395  -8.226  11.260  1.00 0.00 ? 79  ARG A HH12 1  
ATOM 1197  H HH21 . ARG A 1 79  ? 26.750  -4.818  11.958  1.00 0.00 ? 79  ARG A HH21 1  
ATOM 1198  H HH22 . ARG A 1 79  ? 26.630  -6.014  10.712  1.00 0.00 ? 79  ARG A HH22 1  
ATOM 1199  N N    . LYS A 1 80  ? 24.373  -9.658  19.593  1.00 0.00 ? 80  LYS A N    1  
ATOM 1200  C CA   . LYS A 1 80  ? 23.478  -9.901  20.719  1.00 0.00 ? 80  LYS A CA   1  
ATOM 1201  C C    . LYS A 1 80  ? 24.242  -9.866  22.038  1.00 0.00 ? 80  LYS A C    1  
ATOM 1202  O O    . LYS A 1 80  ? 23.862  -9.155  22.968  1.00 0.00 ? 80  LYS A O    1  
ATOM 1203  C CB   . LYS A 1 80  ? 22.778  -11.252 20.558  1.00 0.00 ? 80  LYS A CB   1  
ATOM 1204  C CG   . LYS A 1 80  ? 21.766  -11.547 21.651  1.00 0.00 ? 80  LYS A CG   1  
ATOM 1205  C CD   . LYS A 1 80  ? 22.414  -12.235 22.841  1.00 0.00 ? 80  LYS A CD   1  
ATOM 1206  C CE   . LYS A 1 80  ? 21.914  -13.663 22.999  1.00 0.00 ? 80  LYS A CE   1  
ATOM 1207  N NZ   . LYS A 1 80  ? 22.537  -14.581 22.005  1.00 0.00 ? 80  LYS A NZ   1  
ATOM 1208  H H    . LYS A 1 80  ? 24.495  -10.360 18.920  1.00 0.00 ? 80  LYS A H    1  
ATOM 1209  H HA   . LYS A 1 80  ? 22.735  -9.119  20.726  1.00 0.00 ? 80  LYS A HA   1  
ATOM 1210  H HB2  . LYS A 1 80  ? 22.266  -11.268 19.607  1.00 0.00 ? 80  LYS A HB2  1  
ATOM 1211  H HB3  . LYS A 1 80  ? 23.525  -12.034 20.567  1.00 0.00 ? 80  LYS A HB3  1  
ATOM 1212  H HG2  . LYS A 1 80  ? 21.326  -10.618 21.982  1.00 0.00 ? 80  LYS A HG2  1  
ATOM 1213  H HG3  . LYS A 1 80  ? 20.995  -12.190 21.251  1.00 0.00 ? 80  LYS A HG3  1  
ATOM 1214  H HD2  . LYS A 1 80  ? 23.484  -12.254 22.696  1.00 0.00 ? 80  LYS A HD2  1  
ATOM 1215  H HD3  . LYS A 1 80  ? 22.180  -11.679 23.738  1.00 0.00 ? 80  LYS A HD3  1  
ATOM 1216  H HE2  . LYS A 1 80  ? 22.154  -14.006 23.993  1.00 0.00 ? 80  LYS A HE2  1  
ATOM 1217  H HE3  . LYS A 1 80  ? 20.843  -13.672 22.863  1.00 0.00 ? 80  LYS A HE3  1  
ATOM 1218  H HZ1  . LYS A 1 80  ? 21.805  -14.989 21.389  1.00 0.00 ? 80  LYS A HZ1  1  
ATOM 1219  H HZ2  . LYS A 1 80  ? 23.032  -15.354 22.494  1.00 0.00 ? 80  LYS A HZ2  1  
ATOM 1220  H HZ3  . LYS A 1 80  ? 23.220  -14.062 21.418  1.00 0.00 ? 80  LYS A HZ3  1  
ATOM 1221  N N    . ALA A 1 81  ? 25.322  -10.637 22.113  1.00 0.00 ? 81  ALA A N    1  
ATOM 1222  C CA   . ALA A 1 81  ? 26.141  -10.692 23.317  1.00 0.00 ? 81  ALA A CA   1  
ATOM 1223  C C    . ALA A 1 81  ? 26.496  -9.290  23.803  1.00 0.00 ? 81  ALA A C    1  
ATOM 1224  O O    . ALA A 1 81  ? 25.996  -8.835  24.832  1.00 0.00 ? 81  ALA A O    1  
ATOM 1225  C CB   . ALA A 1 81  ? 27.405  -11.499 23.060  1.00 0.00 ? 81  ALA A CB   1  
ATOM 1226  H H    . ALA A 1 81  ? 25.575  -11.182 21.338  1.00 0.00 ? 81  ALA A H    1  
ATOM 1227  H HA   . ALA A 1 81  ? 25.572  -11.195 24.085  1.00 0.00 ? 81  ALA A HA   1  
ATOM 1228  H HB1  . ALA A 1 81  ? 27.888  -11.719 24.001  1.00 0.00 ? 81  ALA A HB1  1  
ATOM 1229  H HB2  . ALA A 1 81  ? 27.147  -12.422 22.563  1.00 0.00 ? 81  ALA A HB2  1  
ATOM 1230  H HB3  . ALA A 1 81  ? 28.076  -10.928 22.436  1.00 0.00 ? 81  ALA A HB3  1  
ATOM 1231  N N    . ALA A 1 82  ? 27.361  -8.612  23.057  1.00 0.00 ? 82  ALA A N    1  
ATOM 1232  C CA   . ALA A 1 82  ? 27.782  -7.262  23.412  1.00 0.00 ? 82  ALA A CA   1  
ATOM 1233  C C    . ALA A 1 82  ? 26.585  -6.322  23.508  1.00 0.00 ? 82  ALA A C    1  
ATOM 1234  O O    . ALA A 1 82  ? 26.319  -5.747  24.562  1.00 0.00 ? 82  ALA A O    1  
ATOM 1235  C CB   . ALA A 1 82  ? 28.787  -6.738  22.397  1.00 0.00 ? 82  ALA A CB   1  
ATOM 1236  H H    . ALA A 1 82  ? 27.725  -9.029  22.248  1.00 0.00 ? 82  ALA A H    1  
ATOM 1237  H HA   . ALA A 1 82  ? 28.270  -7.307  24.375  1.00 0.00 ? 82  ALA A HA   1  
ATOM 1238  H HB1  . ALA A 1 82  ? 29.520  -7.504  22.189  1.00 0.00 ? 82  ALA A HB1  1  
ATOM 1239  H HB2  . ALA A 1 82  ? 28.273  -6.475  21.485  1.00 0.00 ? 82  ALA A HB2  1  
ATOM 1240  H HB3  . ALA A 1 82  ? 29.281  -5.865  22.797  1.00 0.00 ? 82  ALA A HB3  1  
ATOM 1241  N N    . GLY A 1 83  ? 25.867  -6.170  22.400  1.00 0.00 ? 83  GLY A N    1  
ATOM 1242  C CA   . GLY A 1 83  ? 24.707  -5.298  22.381  1.00 0.00 ? 83  GLY A CA   1  
ATOM 1243  C C    . GLY A 1 83  ? 24.864  -4.146  21.407  1.00 0.00 ? 83  GLY A C    1  
ATOM 1244  O O    . GLY A 1 83  ? 24.439  -3.024  21.687  1.00 0.00 ? 83  GLY A O    1  
ATOM 1245  H H    . GLY A 1 83  ? 26.127  -6.654  21.588  1.00 0.00 ? 83  GLY A H    1  
ATOM 1246  H HA2  . GLY A 1 83  ? 23.839  -5.876  22.102  1.00 0.00 ? 83  GLY A HA2  1  
ATOM 1247  H HA3  . GLY A 1 83  ? 24.556  -4.897  23.372  1.00 0.00 ? 83  GLY A HA3  1  
ATOM 1248  N N    . LEU A 1 84  ? 25.476  -4.422  20.261  1.00 0.00 ? 84  LEU A N    1  
ATOM 1249  C CA   . LEU A 1 84  ? 25.689  -3.400  19.242  1.00 0.00 ? 84  LEU A CA   1  
ATOM 1250  C C    . LEU A 1 84  ? 24.402  -3.121  18.473  1.00 0.00 ? 84  LEU A C    1  
ATOM 1251  O O    . LEU A 1 84  ? 23.866  -2.014  18.523  1.00 0.00 ? 84  LEU A O    1  
ATOM 1252  C CB   . LEU A 1 84  ? 26.790  -3.839  18.274  1.00 0.00 ? 84  LEU A CB   1  
ATOM 1253  C CG   . LEU A 1 84  ? 27.914  -4.684  18.875  1.00 0.00 ? 84  LEU A CG   1  
ATOM 1254  C CD1  . LEU A 1 84  ? 29.012  -4.918  17.849  1.00 0.00 ? 84  LEU A CD1  1  
ATOM 1255  C CD2  . LEU A 1 84  ? 28.477  -4.016  20.120  1.00 0.00 ? 84  LEU A CD2  1  
ATOM 1256  H H    . LEU A 1 84  ? 25.792  -5.334  20.095  1.00 0.00 ? 84  LEU A H    1  
ATOM 1257  H HA   . LEU A 1 84  ? 26.000  -2.495  19.741  1.00 0.00 ? 84  LEU A HA   1  
ATOM 1258  H HB2  . LEU A 1 84  ? 26.328  -4.414  17.487  1.00 0.00 ? 84  LEU A HB2  1  
ATOM 1259  H HB3  . LEU A 1 84  ? 27.233  -2.947  17.854  1.00 0.00 ? 84  LEU A HB3  1  
ATOM 1260  H HG   . LEU A 1 84  ? 27.516  -5.648  19.162  1.00 0.00 ? 84  LEU A HG   1  
ATOM 1261  H HD11 . LEU A 1 84  ? 29.355  -5.939  17.915  1.00 0.00 ? 84  LEU A HD11 1  
ATOM 1262  H HD12 . LEU A 1 84  ? 29.836  -4.248  18.046  1.00 0.00 ? 84  LEU A HD12 1  
ATOM 1263  H HD13 . LEU A 1 84  ? 28.625  -4.730  16.858  1.00 0.00 ? 84  LEU A HD13 1  
ATOM 1264  H HD21 . LEU A 1 84  ? 28.149  -2.987  20.155  1.00 0.00 ? 84  LEU A HD21 1  
ATOM 1265  H HD22 . LEU A 1 84  ? 29.557  -4.048  20.088  1.00 0.00 ? 84  LEU A HD22 1  
ATOM 1266  H HD23 . LEU A 1 84  ? 28.126  -4.536  20.998  1.00 0.00 ? 84  LEU A HD23 1  
ATOM 1267  N N    . GLU A 1 85  ? 23.911  -4.132  17.764  1.00 0.00 ? 85  GLU A N    1  
ATOM 1268  C CA   . GLU A 1 85  ? 22.685  -3.995  16.985  1.00 0.00 ? 85  GLU A CA   1  
ATOM 1269  C C    . GLU A 1 85  ? 21.456  -4.098  17.884  1.00 0.00 ? 85  GLU A C    1  
ATOM 1270  O O    . GLU A 1 85  ? 21.572  -4.273  19.097  1.00 0.00 ? 85  GLU A O    1  
ATOM 1271  C CB   . GLU A 1 85  ? 22.625  -5.066  15.894  1.00 0.00 ? 85  GLU A CB   1  
ATOM 1272  C CG   . GLU A 1 85  ? 23.395  -4.698  14.637  1.00 0.00 ? 85  GLU A CG   1  
ATOM 1273  C CD   . GLU A 1 85  ? 22.501  -4.140  13.547  1.00 0.00 ? 85  GLU A CD   1  
ATOM 1274  O OE1  . GLU A 1 85  ? 21.744  -4.927  12.941  1.00 0.00 ? 85  GLU A OE1  1  
ATOM 1275  O OE2  . GLU A 1 85  ? 22.558  -2.917  13.300  1.00 0.00 ? 85  GLU A OE2  1  
ATOM 1276  H H    . GLU A 1 85  ? 24.384  -4.990  17.763  1.00 0.00 ? 85  GLU A H    1  
ATOM 1277  H HA   . GLU A 1 85  ? 22.695  -3.021  16.520  1.00 0.00 ? 85  GLU A HA   1  
ATOM 1278  H HB2  . GLU A 1 85  ? 23.033  -5.986  16.286  1.00 0.00 ? 85  GLU A HB2  1  
ATOM 1279  H HB3  . GLU A 1 85  ? 21.592  -5.228  15.623  1.00 0.00 ? 85  GLU A HB3  1  
ATOM 1280  H HG2  . GLU A 1 85  ? 24.136  -3.954  14.889  1.00 0.00 ? 85  GLU A HG2  1  
ATOM 1281  H HG3  . GLU A 1 85  ? 23.888  -5.582  14.261  1.00 0.00 ? 85  GLU A HG3  1  
ATOM 1282  N N    . LYS A 1 86  ? 20.278  -3.988  17.279  1.00 0.00 ? 86  LYS A N    1  
ATOM 1283  C CA   . LYS A 1 86  ? 19.026  -4.070  18.021  1.00 0.00 ? 86  LYS A CA   1  
ATOM 1284  C C    . LYS A 1 86  ? 18.979  -5.335  18.872  1.00 0.00 ? 86  LYS A C    1  
ATOM 1285  O O    . LYS A 1 86  ? 19.122  -6.444  18.360  1.00 0.00 ? 86  LYS A O    1  
ATOM 1286  C CB   . LYS A 1 86  ? 17.836  -4.045  17.059  1.00 0.00 ? 86  LYS A CB   1  
ATOM 1287  C CG   . LYS A 1 86  ? 16.491  -3.951  17.758  1.00 0.00 ? 86  LYS A CG   1  
ATOM 1288  C CD   . LYS A 1 86  ? 16.168  -2.521  18.159  1.00 0.00 ? 86  LYS A CD   1  
ATOM 1289  C CE   . LYS A 1 86  ? 15.322  -1.825  17.105  1.00 0.00 ? 86  LYS A CE   1  
ATOM 1290  N NZ   . LYS A 1 86  ? 15.986  -0.599  16.581  1.00 0.00 ? 86  LYS A NZ   1  
ATOM 1291  H H    . LYS A 1 86  ? 20.250  -3.849  16.309  1.00 0.00 ? 86  LYS A H    1  
ATOM 1292  H HA   . LYS A 1 86  ? 18.970  -3.210  18.672  1.00 0.00 ? 86  LYS A HA   1  
ATOM 1293  H HB2  . LYS A 1 86  ? 17.937  -3.193  16.403  1.00 0.00 ? 86  LYS A HB2  1  
ATOM 1294  H HB3  . LYS A 1 86  ? 17.848  -4.949  16.467  1.00 0.00 ? 86  LYS A HB3  1  
ATOM 1295  H HG2  . LYS A 1 86  ? 15.722  -4.308  17.089  1.00 0.00 ? 86  LYS A HG2  1  
ATOM 1296  H HG3  . LYS A 1 86  ? 16.513  -4.568  18.645  1.00 0.00 ? 86  LYS A HG3  1  
ATOM 1297  H HD2  . LYS A 1 86  ? 15.625  -2.532  19.091  1.00 0.00 ? 86  LYS A HD2  1  
ATOM 1298  H HD3  . LYS A 1 86  ? 17.093  -1.975  18.285  1.00 0.00 ? 86  LYS A HD3  1  
ATOM 1299  H HE2  . LYS A 1 86  ? 15.153  -2.509  16.287  1.00 0.00 ? 86  LYS A HE2  1  
ATOM 1300  H HE3  . LYS A 1 86  ? 14.375  -1.551  17.546  1.00 0.00 ? 86  LYS A HE3  1  
ATOM 1301  H HZ1  . LYS A 1 86  ? 16.492  -0.816  15.699  1.00 0.00 ? 86  LYS A HZ1  1  
ATOM 1302  H HZ2  . LYS A 1 86  ? 16.667  -0.236  17.279  1.00 0.00 ? 86  LYS A HZ2  1  
ATOM 1303  H HZ3  . LYS A 1 86  ? 15.277  0.138   16.390  1.00 0.00 ? 86  LYS A HZ3  1  
ATOM 1304  N N    . GLY A 1 87  ? 18.776  -5.160  20.175  1.00 0.00 ? 87  GLY A N    1  
ATOM 1305  C CA   . GLY A 1 87  ? 18.713  -6.297  21.075  1.00 0.00 ? 87  GLY A CA   1  
ATOM 1306  C C    . GLY A 1 87  ? 18.079  -5.947  22.406  1.00 0.00 ? 87  GLY A C    1  
ATOM 1307  O O    . GLY A 1 87  ? 18.091  -4.789  22.822  1.00 0.00 ? 87  GLY A O    1  
ATOM 1308  H H    . GLY A 1 87  ? 18.669  -4.252  20.527  1.00 0.00 ? 87  GLY A H    1  
ATOM 1309  H HA2  . GLY A 1 87  ? 18.135  -7.080  20.607  1.00 0.00 ? 87  GLY A HA2  1  
ATOM 1310  H HA3  . GLY A 1 87  ? 19.715  -6.658  21.250  1.00 0.00 ? 87  GLY A HA3  1  
ATOM 1311  N N    . ALA A 1 88  ? 17.522  -6.950  23.076  1.00 0.00 ? 88  ALA A N    1  
ATOM 1312  C CA   . ALA A 1 88  ? 16.880  -6.743  24.369  1.00 0.00 ? 88  ALA A CA   1  
ATOM 1313  C C    . ALA A 1 88  ? 16.940  -8.007  25.220  1.00 0.00 ? 88  ALA A C    1  
ATOM 1314  O O    . ALA A 1 88  ? 17.412  -9.050  24.768  1.00 0.00 ? 88  ALA A O    1  
ATOM 1315  C CB   . ALA A 1 88  ? 15.437  -6.301  24.177  1.00 0.00 ? 88  ALA A CB   1  
ATOM 1316  H H    . ALA A 1 88  ? 17.544  -7.852  22.693  1.00 0.00 ? 88  ALA A H    1  
ATOM 1317  H HA   . ALA A 1 88  ? 17.409  -5.951  24.880  1.00 0.00 ? 88  ALA A HA   1  
ATOM 1318  H HB1  . ALA A 1 88  ? 14.777  -7.133  24.374  1.00 0.00 ? 88  ALA A HB1  1  
ATOM 1319  H HB2  . ALA A 1 88  ? 15.214  -5.495  24.860  1.00 0.00 ? 88  ALA A HB2  1  
ATOM 1320  H HB3  . ALA A 1 88  ? 15.297  -5.963  23.161  1.00 0.00 ? 88  ALA A HB3  1  
ATOM 1321  N N    . HIS A 1 89  ? 16.458  -7.906  26.455  1.00 0.00 ? 89  HIS A N    1  
ATOM 1322  C CA   . HIS A 1 89  ? 16.457  -9.042  27.370  1.00 0.00 ? 89  HIS A CA   1  
ATOM 1323  C C    . HIS A 1 89  ? 17.873  -9.569  27.584  1.00 0.00 ? 89  HIS A C    1  
ATOM 1324  O O    . HIS A 1 89  ? 18.213  -10.665 27.139  1.00 0.00 ? 89  HIS A O    1  
ATOM 1325  C CB   . HIS A 1 89  ? 15.561  -10.157 26.831  1.00 0.00 ? 89  HIS A CB   1  
ATOM 1326  C CG   . HIS A 1 89  ? 14.999  -11.043 27.899  1.00 0.00 ? 89  HIS A CG   1  
ATOM 1327  N ND1  . HIS A 1 89  ? 15.701  -11.394 29.033  1.00 0.00 ? 89  HIS A ND1  1  
ATOM 1328  C CD2  . HIS A 1 89  ? 13.793  -11.649 28.003  1.00 0.00 ? 89  HIS A CD2  1  
ATOM 1329  C CE1  . HIS A 1 89  ? 14.952  -12.178 29.787  1.00 0.00 ? 89  HIS A CE1  1  
ATOM 1330  N NE2  . HIS A 1 89  ? 13.789  -12.349 29.184  1.00 0.00 ? 89  HIS A NE2  1  
ATOM 1331  H H    . HIS A 1 89  ? 16.095  -7.048  26.758  1.00 0.00 ? 89  HIS A H    1  
ATOM 1332  H HA   . HIS A 1 89  ? 16.065  -8.704  28.318  1.00 0.00 ? 89  HIS A HA   1  
ATOM 1333  H HB2  . HIS A 1 89  ? 14.733  -9.717  26.295  1.00 0.00 ? 89  HIS A HB2  1  
ATOM 1334  H HB3  . HIS A 1 89  ? 16.134  -10.775 26.154  1.00 0.00 ? 89  HIS A HB3  1  
ATOM 1335  H HD1  . HIS A 1 89  ? 16.613  -11.111 29.252  1.00 0.00 ? 89  HIS A HD1  1  
ATOM 1336  H HD2  . HIS A 1 89  ? 12.983  -11.594 27.288  1.00 0.00 ? 89  HIS A HD2  1  
ATOM 1337  H HE1  . HIS A 1 89  ? 15.240  -12.608 30.735  1.00 0.00 ? 89  HIS A HE1  1  
ATOM 1338  N N    . LYS A 1 90  ? 18.695  -8.780  28.268  1.00 0.00 ? 90  LYS A N    1  
ATOM 1339  C CA   . LYS A 1 90  ? 20.074  -9.166  28.542  1.00 0.00 ? 90  LYS A CA   1  
ATOM 1340  C C    . LYS A 1 90  ? 20.305  -9.334  30.040  1.00 0.00 ? 90  LYS A C    1  
ATOM 1341  O O    . LYS A 1 90  ? 19.547  -8.831  30.870  1.00 0.00 ? 90  LYS A O    1  
ATOM 1342  C CB   . LYS A 1 90  ? 21.040  -8.120  27.981  1.00 0.00 ? 90  LYS A CB   1  
ATOM 1343  C CG   . LYS A 1 90  ? 21.461  -8.388  26.546  1.00 0.00 ? 90  LYS A CG   1  
ATOM 1344  C CD   . LYS A 1 90  ? 21.599  -7.098  25.755  1.00 0.00 ? 90  LYS A CD   1  
ATOM 1345  C CE   . LYS A 1 90  ? 22.825  -6.308  26.186  1.00 0.00 ? 90  LYS A CE   1  
ATOM 1346  N NZ   . LYS A 1 90  ? 22.484  -5.255  27.182  1.00 0.00 ? 90  LYS A NZ   1  
ATOM 1347  H H    . LYS A 1 90  ? 18.366  -7.917  28.597  1.00 0.00 ? 90  LYS A H    1  
ATOM 1348  H HA   . LYS A 1 90  ? 20.258  -10.111 28.053  1.00 0.00 ? 90  LYS A HA   1  
ATOM 1349  H HB2  . LYS A 1 90  ? 20.563  -7.151  28.019  1.00 0.00 ? 90  LYS A HB2  1  
ATOM 1350  H HB3  . LYS A 1 90  ? 21.927  -8.099  28.597  1.00 0.00 ? 90  LYS A HB3  1  
ATOM 1351  H HG2  . LYS A 1 90  ? 22.412  -8.899  26.550  1.00 0.00 ? 90  LYS A HG2  1  
ATOM 1352  H HG3  . LYS A 1 90  ? 20.716  -9.012  26.073  1.00 0.00 ? 90  LYS A HG3  1  
ATOM 1353  H HD2  . LYS A 1 90  ? 21.689  -7.337  24.706  1.00 0.00 ? 90  LYS A HD2  1  
ATOM 1354  H HD3  . LYS A 1 90  ? 20.717  -6.493  25.914  1.00 0.00 ? 90  LYS A HD3  1  
ATOM 1355  H HE2  . LYS A 1 90  ? 23.539  -6.988  26.625  1.00 0.00 ? 90  LYS A HE2  1  
ATOM 1356  H HE3  . LYS A 1 90  ? 23.261  -5.841  25.315  1.00 0.00 ? 90  LYS A HE3  1  
ATOM 1357  H HZ1  . LYS A 1 90  ? 21.971  -5.674  27.984  1.00 0.00 ? 90  LYS A HZ1  1  
ATOM 1358  H HZ2  . LYS A 1 90  ? 21.884  -4.529  26.743  1.00 0.00 ? 90  LYS A HZ2  1  
ATOM 1359  H HZ3  . LYS A 1 90  ? 23.352  -4.804  27.537  1.00 0.00 ? 90  LYS A HZ3  1  
ATOM 1360  N N    . PRO A 1 91  ? 21.377  -10.057 30.398  1.00 0.00 ? 91  PRO A N    1  
ATOM 1361  C CA   . PRO A 1 91  ? 21.733  -10.306 31.798  1.00 0.00 ? 91  PRO A CA   1  
ATOM 1362  C C    . PRO A 1 91  ? 22.224  -9.047  32.504  1.00 0.00 ? 91  PRO A C    1  
ATOM 1363  O O    . PRO A 1 91  ? 21.989  -8.860  33.697  1.00 0.00 ? 91  PRO A O    1  
ATOM 1364  C CB   . PRO A 1 91  ? 22.859  -11.338 31.700  1.00 0.00 ? 91  PRO A CB   1  
ATOM 1365  C CG   . PRO A 1 91  ? 23.456  -11.119 30.352  1.00 0.00 ? 91  PRO A CG   1  
ATOM 1366  C CD   . PRO A 1 91  ? 22.324  -10.686 29.463  1.00 0.00 ? 91  PRO A CD   1  
ATOM 1367  H HA   . PRO A 1 91  ? 20.904  -10.726 32.349  1.00 0.00 ? 91  PRO A HA   1  
ATOM 1368  H HB2  . PRO A 1 91  ? 23.580  -11.163 32.486  1.00 0.00 ? 91  PRO A HB2  1  
ATOM 1369  H HB3  . PRO A 1 91  ? 22.450  -12.332 31.793  1.00 0.00 ? 91  PRO A HB3  1  
ATOM 1370  H HG2  . PRO A 1 91  ? 24.208  -10.347 30.405  1.00 0.00 ? 91  PRO A HG2  1  
ATOM 1371  H HG3  . PRO A 1 91  ? 23.887  -12.041 29.989  1.00 0.00 ? 91  PRO A HG3  1  
ATOM 1372  H HD2  . PRO A 1 91  ? 22.672  -9.975  28.729  1.00 0.00 ? 91  PRO A HD2  1  
ATOM 1373  H HD3  . PRO A 1 91  ? 21.876  -11.542 28.979  1.00 0.00 ? 91  PRO A HD3  1  
ATOM 1374  N N    . GLY A 1 92  ? 22.908  -8.184  31.758  1.00 0.00 ? 92  GLY A N    1  
ATOM 1375  C CA   . GLY A 1 92  ? 23.422  -6.953  32.330  1.00 0.00 ? 92  GLY A CA   1  
ATOM 1376  C C    . GLY A 1 92  ? 22.342  -5.907  32.518  1.00 0.00 ? 92  GLY A C    1  
ATOM 1377  O O    . GLY A 1 92  ? 21.154  -6.197  32.372  1.00 0.00 ? 92  GLY A O    1  
ATOM 1378  H H    . GLY A 1 92  ? 23.066  -8.386  30.811  1.00 0.00 ? 92  GLY A H    1  
ATOM 1379  H HA2  . GLY A 1 92  ? 23.867  -7.173  33.288  1.00 0.00 ? 92  GLY A HA2  1  
ATOM 1380  H HA3  . GLY A 1 92  ? 24.182  -6.555  31.674  1.00 0.00 ? 92  GLY A HA3  1  
ATOM 1381  N N    . ARG A 1 93  ? 22.753  -4.686  32.845  1.00 0.00 ? 93  ARG A N    1  
ATOM 1382  C CA   . ARG A 1 93  ? 21.812  -3.594  33.057  1.00 0.00 ? 93  ARG A CA   1  
ATOM 1383  C C    . ARG A 1 93  ? 21.636  -2.772  31.783  1.00 0.00 ? 93  ARG A C    1  
ATOM 1384  O O    . ARG A 1 93  ? 20.562  -2.765  31.182  1.00 0.00 ? 93  ARG A O    1  
ATOM 1385  C CB   . ARG A 1 93  ? 22.292  -2.692  34.196  1.00 0.00 ? 93  ARG A CB   1  
ATOM 1386  C CG   . ARG A 1 93  ? 22.246  -3.358  35.561  1.00 0.00 ? 93  ARG A CG   1  
ATOM 1387  C CD   . ARG A 1 93  ? 23.638  -3.507  36.155  1.00 0.00 ? 93  ARG A CD   1  
ATOM 1388  N NE   . ARG A 1 93  ? 23.602  -3.626  37.610  1.00 0.00 ? 93  ARG A NE   1  
ATOM 1389  C CZ   . ARG A 1 93  ? 23.213  -4.723  38.249  1.00 0.00 ? 93  ARG A CZ   1  
ATOM 1390  N NH1  . ARG A 1 93  ? 22.830  -5.792  37.564  1.00 0.00 ? 93  ARG A NH1  1  
ATOM 1391  N NH2  . ARG A 1 93  ? 23.209  -4.754  39.575  1.00 0.00 ? 93  ARG A NH2  1  
ATOM 1392  H H    . ARG A 1 93  ? 23.713  -4.516  32.947  1.00 0.00 ? 93  ARG A H    1  
ATOM 1393  H HA   . ARG A 1 93  ? 20.859  -4.024  33.328  1.00 0.00 ? 93  ARG A HA   1  
ATOM 1394  H HB2  . ARG A 1 93  ? 23.311  -2.395  33.999  1.00 0.00 ? 93  ARG A HB2  1  
ATOM 1395  H HB3  . ARG A 1 93  ? 21.669  -1.811  34.228  1.00 0.00 ? 93  ARG A HB3  1  
ATOM 1396  H HG2  . ARG A 1 93  ? 21.646  -2.754  36.226  1.00 0.00 ? 93  ARG A HG2  1  
ATOM 1397  H HG3  . ARG A 1 93  ? 21.800  -4.336  35.459  1.00 0.00 ? 93  ARG A HG3  1  
ATOM 1398  H HD2  . ARG A 1 93  ? 24.097  -4.393  35.743  1.00 0.00 ? 93  ARG A HD2  1  
ATOM 1399  H HD3  . ARG A 1 93  ? 24.224  -2.641  35.887  1.00 0.00 ? 93  ARG A HD3  1  
ATOM 1400  H HE   . ARG A 1 93  ? 23.882  -2.848  38.136  1.00 0.00 ? 93  ARG A HE   1  
ATOM 1401  H HH11 . ARG A 1 93  ? 22.833  -5.772  36.565  1.00 0.00 ? 93  ARG A HH11 1  
ATOM 1402  H HH12 . ARG A 1 93  ? 22.539  -6.618  38.048  1.00 0.00 ? 93  ARG A HH12 1  
ATOM 1403  H HH21 . ARG A 1 93  ? 23.498  -3.950  40.095  1.00 0.00 ? 93  ARG A HH21 1  
ATOM 1404  H HH22 . ARG A 1 93  ? 22.916  -5.580  40.055  1.00 0.00 ? 93  ARG A HH22 1  
ATOM 1405  N N    . GLU A 1 94  ? 22.697  -2.082  31.379  1.00 0.00 ? 94  GLU A N    1  
ATOM 1406  C CA   . GLU A 1 94  ? 22.659  -1.257  30.177  1.00 0.00 ? 94  GLU A CA   1  
ATOM 1407  C C    . GLU A 1 94  ? 24.070  -0.938  29.691  1.00 0.00 ? 94  GLU A C    1  
ATOM 1408  O O    . GLU A 1 94  ? 24.510  0.211   29.737  1.00 0.00 ? 94  GLU A O    1  
ATOM 1409  C CB   . GLU A 1 94  ? 21.895  0.041   30.447  1.00 0.00 ? 94  GLU A CB   1  
ATOM 1410  C CG   . GLU A 1 94  ? 21.551  0.818   29.188  1.00 0.00 ? 94  GLU A CG   1  
ATOM 1411  C CD   . GLU A 1 94  ? 20.602  1.971   29.454  1.00 0.00 ? 94  GLU A CD   1  
ATOM 1412  O OE1  . GLU A 1 94  ? 19.397  1.715   29.652  1.00 0.00 ? 94  GLU A OE1  1  
ATOM 1413  O OE2  . GLU A 1 94  ? 21.067  3.130   29.464  1.00 0.00 ? 94  GLU A OE2  1  
ATOM 1414  H H    . GLU A 1 94  ? 23.525  -2.128  31.901  1.00 0.00 ? 94  GLU A H    1  
ATOM 1415  H HA   . GLU A 1 94  ? 22.144  -1.814  29.409  1.00 0.00 ? 94  GLU A HA   1  
ATOM 1416  H HB2  . GLU A 1 94  ? 20.975  -0.197  30.961  1.00 0.00 ? 94  GLU A HB2  1  
ATOM 1417  H HB3  . GLU A 1 94  ? 22.498  0.674   31.081  1.00 0.00 ? 94  GLU A HB3  1  
ATOM 1418  H HG2  . GLU A 1 94  ? 22.462  1.212   28.763  1.00 0.00 ? 94  GLU A HG2  1  
ATOM 1419  H HG3  . GLU A 1 94  ? 21.087  0.146   28.480  1.00 0.00 ? 94  GLU A HG3  1  
ATOM 1420  N N    . LYS A 1 95  ? 24.774  -1.963  29.225  1.00 0.00 ? 95  LYS A N    1  
ATOM 1421  C CA   . LYS A 1 95  ? 26.135  -1.794  28.729  1.00 0.00 ? 95  LYS A CA   1  
ATOM 1422  C C    . LYS A 1 95  ? 26.361  -2.623  27.468  1.00 0.00 ? 95  LYS A C    1  
ATOM 1423  O O    . LYS A 1 95  ? 25.751  -3.676  27.288  1.00 0.00 ? 95  LYS A O    1  
ATOM 1424  C CB   . LYS A 1 95  ? 27.146  -2.198  29.805  1.00 0.00 ? 95  LYS A CB   1  
ATOM 1425  C CG   . LYS A 1 95  ? 27.112  -3.677  30.148  1.00 0.00 ? 95  LYS A CG   1  
ATOM 1426  C CD   . LYS A 1 95  ? 28.236  -4.434  29.462  1.00 0.00 ? 95  LYS A CD   1  
ATOM 1427  C CE   . LYS A 1 95  ? 29.343  -4.796  30.441  1.00 0.00 ? 95  LYS A CE   1  
ATOM 1428  N NZ   . LYS A 1 95  ? 30.442  -3.792  30.431  1.00 0.00 ? 95  LYS A NZ   1  
ATOM 1429  H H    . LYS A 1 95  ? 24.369  -2.856  29.214  1.00 0.00 ? 95  LYS A H    1  
ATOM 1430  H HA   . LYS A 1 95  ? 26.274  -0.751  28.490  1.00 0.00 ? 95  LYS A HA   1  
ATOM 1431  H HB2  . LYS A 1 95  ? 28.139  -1.952  29.459  1.00 0.00 ? 95  LYS A HB2  1  
ATOM 1432  H HB3  . LYS A 1 95  ? 26.939  -1.636  30.705  1.00 0.00 ? 95  LYS A HB3  1  
ATOM 1433  H HG2  . LYS A 1 95  ? 27.214  -3.792  31.216  1.00 0.00 ? 95  LYS A HG2  1  
ATOM 1434  H HG3  . LYS A 1 95  ? 26.165  -4.089  29.828  1.00 0.00 ? 95  LYS A HG3  1  
ATOM 1435  H HD2  . LYS A 1 95  ? 27.839  -5.343  29.035  1.00 0.00 ? 95  LYS A HD2  1  
ATOM 1436  H HD3  . LYS A 1 95  ? 28.649  -3.816  28.678  1.00 0.00 ? 95  LYS A HD3  1  
ATOM 1437  H HE2  . LYS A 1 95  ? 28.924  -4.848  31.434  1.00 0.00 ? 95  LYS A HE2  1  
ATOM 1438  H HE3  . LYS A 1 95  ? 29.745  -5.761  30.169  1.00 0.00 ? 95  LYS A HE3  1  
ATOM 1439  H HZ1  . LYS A 1 95  ? 31.363  -4.269  30.516  1.00 0.00 ? 95  LYS A HZ1  1  
ATOM 1440  H HZ2  . LYS A 1 95  ? 30.332  -3.133  31.228  1.00 0.00 ? 95  LYS A HZ2  1  
ATOM 1441  H HZ3  . LYS A 1 95  ? 30.424  -3.251  29.543  1.00 0.00 ? 95  LYS A HZ3  1  
ATOM 1442  N N    . VAL A 1 96  ? 27.243  -2.140  26.599  1.00 0.00 ? 96  VAL A N    1  
ATOM 1443  C CA   . VAL A 1 96  ? 27.552  -2.837  25.356  1.00 0.00 ? 96  VAL A CA   1  
ATOM 1444  C C    . VAL A 1 96  ? 29.055  -2.872  25.104  1.00 0.00 ? 96  VAL A C    1  
ATOM 1445  O O    . VAL A 1 96  ? 29.771  -1.923  25.422  1.00 0.00 ? 96  VAL A O    1  
ATOM 1446  C CB   . VAL A 1 96  ? 26.856  -2.174  24.152  1.00 0.00 ? 96  VAL A CB   1  
ATOM 1447  C CG1  . VAL A 1 96  ? 27.247  -2.871  22.858  1.00 0.00 ? 96  VAL A CG1  1  
ATOM 1448  C CG2  . VAL A 1 96  ? 25.347  -2.183  24.338  1.00 0.00 ? 96  VAL A CG2  1  
ATOM 1449  H H    . VAL A 1 96  ? 27.698  -1.295  26.798  1.00 0.00 ? 96  VAL A H    1  
ATOM 1450  H HA   . VAL A 1 96  ? 27.187  -3.850  25.442  1.00 0.00 ? 96  VAL A HA   1  
ATOM 1451  H HB   . VAL A 1 96  ? 27.184  -1.146  24.094  1.00 0.00 ? 96  VAL A HB   1  
ATOM 1452  H HG11 . VAL A 1 96  ? 28.313  -2.785  22.711  1.00 0.00 ? 96  VAL A HG11 1  
ATOM 1453  H HG12 . VAL A 1 96  ? 26.973  -3.915  22.915  1.00 0.00 ? 96  VAL A HG12 1  
ATOM 1454  H HG13 . VAL A 1 96  ? 26.731  -2.408  22.030  1.00 0.00 ? 96  VAL A HG13 1  
ATOM 1455  H HG21 . VAL A 1 96  ? 25.096  -1.696  25.269  1.00 0.00 ? 96  VAL A HG21 1  
ATOM 1456  H HG22 . VAL A 1 96  ? 24.879  -1.655  23.520  1.00 0.00 ? 96  VAL A HG22 1  
ATOM 1457  H HG23 . VAL A 1 96  ? 24.992  -3.203  24.358  1.00 0.00 ? 96  VAL A HG23 1  
ATOM 1458  N N    . GLY A 1 97  ? 29.528  -3.974  24.530  1.00 0.00 ? 97  GLY A N    1  
ATOM 1459  C CA   . GLY A 1 97  ? 30.944  -4.112  24.244  1.00 0.00 ? 97  GLY A CA   1  
ATOM 1460  C C    . GLY A 1 97  ? 31.634  -5.077  25.188  1.00 0.00 ? 97  GLY A C    1  
ATOM 1461  O O    . GLY A 1 97  ? 31.554  -4.928  26.407  1.00 0.00 ? 97  GLY A O    1  
ATOM 1462  H H    . GLY A 1 97  ? 28.910  -4.699  24.298  1.00 0.00 ? 97  GLY A H    1  
ATOM 1463  H HA2  . GLY A 1 97  ? 31.063  -4.468  23.232  1.00 0.00 ? 97  GLY A HA2  1  
ATOM 1464  H HA3  . GLY A 1 97  ? 31.414  -3.144  24.332  1.00 0.00 ? 97  GLY A HA3  1  
ATOM 1465  N N    . ARG A 1 98  ? 32.313  -6.071  24.624  1.00 0.00 ? 98  ARG A N    1  
ATOM 1466  C CA   . ARG A 1 98  ? 33.017  -7.066  25.423  1.00 0.00 ? 98  ARG A CA   1  
ATOM 1467  C C    . ARG A 1 98  ? 32.035  -8.043  26.063  1.00 0.00 ? 98  ARG A C    1  
ATOM 1468  O O    . ARG A 1 98  ? 31.062  -7.634  26.697  1.00 0.00 ? 98  ARG A O    1  
ATOM 1469  C CB   . ARG A 1 98  ? 33.852  -6.382  26.507  1.00 0.00 ? 98  ARG A CB   1  
ATOM 1470  C CG   . ARG A 1 98  ? 35.223  -7.008  26.706  1.00 0.00 ? 98  ARG A CG   1  
ATOM 1471  C CD   . ARG A 1 98  ? 35.140  -8.279  27.536  1.00 0.00 ? 98  ARG A CD   1  
ATOM 1472  N NE   . ARG A 1 98  ? 34.811  -8.001  28.931  1.00 0.00 ? 98  ARG A NE   1  
ATOM 1473  C CZ   . ARG A 1 98  ? 34.352  -8.919  29.775  1.00 0.00 ? 98  ARG A CZ   1  
ATOM 1474  N NH1  . ARG A 1 98  ? 34.169  -10.167 29.366  1.00 0.00 ? 98  ARG A NH1  1  
ATOM 1475  N NH2  . ARG A 1 98  ? 34.075  -8.589  31.030  1.00 0.00 ? 98  ARG A NH2  1  
ATOM 1476  H H    . ARG A 1 98  ? 32.340  -6.137  23.646  1.00 0.00 ? 98  ARG A H    1  
ATOM 1477  H HA   . ARG A 1 98  ? 33.676  -7.614  24.766  1.00 0.00 ? 98  ARG A HA   1  
ATOM 1478  H HB2  . ARG A 1 98  ? 33.990  -5.345  26.239  1.00 0.00 ? 98  ARG A HB2  1  
ATOM 1479  H HB3  . ARG A 1 98  ? 33.318  -6.435  27.444  1.00 0.00 ? 98  ARG A HB3  1  
ATOM 1480  H HG2  . ARG A 1 98  ? 35.642  -7.249  25.740  1.00 0.00 ? 98  ARG A HG2  1  
ATOM 1481  H HG3  . ARG A 1 98  ? 35.862  -6.299  27.211  1.00 0.00 ? 98  ARG A HG3  1  
ATOM 1482  H HD2  . ARG A 1 98  ? 34.377  -8.918  27.116  1.00 0.00 ? 98  ARG A HD2  1  
ATOM 1483  H HD3  . ARG A 1 98  ? 36.094  -8.783  27.494  1.00 0.00 ? 98  ARG A HD3  1  
ATOM 1484  H HE   . ARG A 1 98  ? 34.939  -7.085  29.254  1.00 0.00 ? 98  ARG A HE   1  
ATOM 1485  H HH11 . ARG A 1 98  ? 34.377  -10.419 28.422  1.00 0.00 ? 98  ARG A HH11 1  
ATOM 1486  H HH12 . ARG A 1 98  ? 33.824  -10.856 30.004  1.00 0.00 ? 98  ARG A HH12 1  
ATOM 1487  H HH21 . ARG A 1 98  ? 34.212  -7.649  31.341  1.00 0.00 ? 98  ARG A HH21 1  
ATOM 1488  H HH22 . ARG A 1 98  ? 33.730  -9.280  31.664  1.00 0.00 ? 98  ARG A HH22 1  
ATOM 1489  N N    . ILE A 1 99  ? 32.298  -9.334  25.892  1.00 0.00 ? 99  ILE A N    1  
ATOM 1490  C CA   . ILE A 1 99  ? 31.438  -10.369 26.453  1.00 0.00 ? 99  ILE A CA   1  
ATOM 1491  C C    . ILE A 1 99  ? 32.261  -11.521 27.018  1.00 0.00 ? 99  ILE A C    1  
ATOM 1492  O O    . ILE A 1 99  ? 33.492  -11.488 27.000  1.00 0.00 ? 99  ILE A O    1  
ATOM 1493  C CB   . ILE A 1 99  ? 30.459  -10.921 25.399  1.00 0.00 ? 99  ILE A CB   1  
ATOM 1494  C CG1  . ILE A 1 99  ? 31.211  -11.293 24.119  1.00 0.00 ? 99  ILE A CG1  1  
ATOM 1495  C CG2  . ILE A 1 99  ? 29.370  -9.901  25.103  1.00 0.00 ? 99  ILE A CG2  1  
ATOM 1496  C CD1  . ILE A 1 99  ? 30.793  -12.626 23.539  1.00 0.00 ? 99  ILE A CD1  1  
ATOM 1497  H H    . ILE A 1 99  ? 33.088  -9.598  25.377  1.00 0.00 ? 99  ILE A H    1  
ATOM 1498  H HA   . ILE A 1 99  ? 30.862  -9.926  27.253  1.00 0.00 ? 99  ILE A HA   1  
ATOM 1499  H HB   . ILE A 1 99  ? 29.991  -11.805 25.803  1.00 0.00 ? 99  ILE A HB   1  
ATOM 1500  H HG12 . ILE A 1 99  ? 31.033  -10.536 23.372  1.00 0.00 ? 99  ILE A HG12 1  
ATOM 1501  H HG13 . ILE A 1 99  ? 32.269  -11.340 24.333  1.00 0.00 ? 99  ILE A HG13 1  
ATOM 1502  H HG21 . ILE A 1 99  ? 29.399  -9.638  24.055  1.00 0.00 ? 99  ILE A HG21 1  
ATOM 1503  H HG22 . ILE A 1 99  ? 28.406  -10.325 25.340  1.00 0.00 ? 99  ILE A HG22 1  
ATOM 1504  H HG23 . ILE A 1 99  ? 29.532  -9.016  25.700  1.00 0.00 ? 99  ILE A HG23 1  
ATOM 1505  H HD11 . ILE A 1 99  ? 30.760  -13.367 24.325  1.00 0.00 ? 99  ILE A HD11 1  
ATOM 1506  H HD12 . ILE A 1 99  ? 29.816  -12.533 23.090  1.00 0.00 ? 99  ILE A HD12 1  
ATOM 1507  H HD13 . ILE A 1 99  ? 31.507  -12.931 22.788  1.00 0.00 ? 99  ILE A HD13 1  
ATOM 1508  N N    . THR A 1 100 ? 31.573  -12.543 27.520  1.00 0.00 ? 100 THR A N    1  
ATOM 1509  C CA   . THR A 1 100 ? 32.240  -13.707 28.090  1.00 0.00 ? 100 THR A CA   1  
ATOM 1510  C C    . THR A 1 100 ? 32.088  -14.925 27.187  1.00 0.00 ? 100 THR A C    1  
ATOM 1511  O O    . THR A 1 100 ? 31.420  -14.864 26.154  1.00 0.00 ? 100 THR A O    1  
ATOM 1512  C CB   . THR A 1 100 ? 31.685  -14.044 29.486  1.00 0.00 ? 100 THR A CB   1  
ATOM 1513  O OG1  . THR A 1 100 ? 30.257  -13.933 29.486  1.00 0.00 ? 100 THR A OG1  1  
ATOM 1514  C CG2  . THR A 1 100 ? 32.270  -13.117 30.540  1.00 0.00 ? 100 THR A CG2  1  
ATOM 1515  H H    . THR A 1 100 ? 30.594  -12.511 27.506  1.00 0.00 ? 100 THR A H    1  
ATOM 1516  H HA   . THR A 1 100 ? 33.290  -13.473 28.190  1.00 0.00 ? 100 THR A HA   1  
ATOM 1517  H HB   . THR A 1 100 ? 31.959  -15.061 29.730  1.00 0.00 ? 100 THR A HB   1  
ATOM 1518  H HG1  . THR A 1 100 ? 29.938  -13.906 30.391  1.00 0.00 ? 100 THR A HG1  1  
ATOM 1519  H HG21 . THR A 1 100 ? 32.459  -13.674 31.446  1.00 0.00 ? 100 THR A HG21 1  
ATOM 1520  H HG22 . THR A 1 100 ? 31.571  -12.320 30.747  1.00 0.00 ? 100 THR A HG22 1  
ATOM 1521  H HG23 . THR A 1 100 ? 33.196  -12.698 30.176  1.00 0.00 ? 100 THR A HG23 1  
ATOM 1522  N N    . TRP A 1 101 ? 32.710  -16.029 27.581  1.00 0.00 ? 101 TRP A N    1  
ATOM 1523  C CA   . TRP A 1 101 ? 32.643  -17.263 26.806  1.00 0.00 ? 101 TRP A CA   1  
ATOM 1524  C C    . TRP A 1 101 ? 31.250  -17.880 26.885  1.00 0.00 ? 101 TRP A C    1  
ATOM 1525  O O    . TRP A 1 101 ? 30.934  -18.814 26.149  1.00 0.00 ? 101 TRP A O    1  
ATOM 1526  C CB   . TRP A 1 101 ? 33.685  -18.263 27.309  1.00 0.00 ? 101 TRP A CB   1  
ATOM 1527  C CG   . TRP A 1 101 ? 33.614  -19.593 26.621  1.00 0.00 ? 101 TRP A CG   1  
ATOM 1528  C CD1  . TRP A 1 101 ? 33.019  -20.728 27.091  1.00 0.00 ? 101 TRP A CD1  1  
ATOM 1529  C CD2  . TRP A 1 101 ? 34.158  -19.924 25.338  1.00 0.00 ? 101 TRP A CD2  1  
ATOM 1530  N NE1  . TRP A 1 101 ? 33.160  -21.746 26.179  1.00 0.00 ? 101 TRP A NE1  1  
ATOM 1531  C CE2  . TRP A 1 101 ? 33.854  -21.278 25.095  1.00 0.00 ? 101 TRP A CE2  1  
ATOM 1532  C CE3  . TRP A 1 101 ? 34.869  -19.209 24.372  1.00 0.00 ? 101 TRP A CE3  1  
ATOM 1533  C CZ2  . TRP A 1 101 ? 34.240  -21.928 23.925  1.00 0.00 ? 101 TRP A CZ2  1  
ATOM 1534  C CZ3  . TRP A 1 101 ? 35.252  -19.855 23.212  1.00 0.00 ? 101 TRP A CZ3  1  
ATOM 1535  C CH2  . TRP A 1 101 ? 34.936  -21.203 22.996  1.00 0.00 ? 101 TRP A CH2  1  
ATOM 1536  H H    . TRP A 1 101 ? 33.228  -16.016 28.414  1.00 0.00 ? 101 TRP A H    1  
ATOM 1537  H HA   . TRP A 1 101 ? 32.858  -17.019 25.777  1.00 0.00 ? 101 TRP A HA   1  
ATOM 1538  H HB2  . TRP A 1 101 ? 34.672  -17.857 27.147  1.00 0.00 ? 101 TRP A HB2  1  
ATOM 1539  H HB3  . TRP A 1 101 ? 33.536  -18.426 28.367  1.00 0.00 ? 101 TRP A HB3  1  
ATOM 1540  H HD1  . TRP A 1 101 ? 32.517  -20.802 28.044  1.00 0.00 ? 101 TRP A HD1  1  
ATOM 1541  H HE1  . TRP A 1 101 ? 32.818  -22.658 26.287  1.00 0.00 ? 101 TRP A HE1  1  
ATOM 1542  H HE3  . TRP A 1 101 ? 35.122  -18.169 24.520  1.00 0.00 ? 101 TRP A HE3  1  
ATOM 1543  H HZ2  . TRP A 1 101 ? 34.004  -22.966 23.744  1.00 0.00 ? 101 TRP A HZ2  1  
ATOM 1544  H HZ3  . TRP A 1 101 ? 35.803  -19.319 22.453  1.00 0.00 ? 101 TRP A HZ3  1  
ATOM 1545  H HH2  . TRP A 1 101 ? 35.255  -21.668 22.076  1.00 0.00 ? 101 TRP A HH2  1  
ATOM 1546  N N    . GLU A 1 102 ? 30.423  -17.350 27.780  1.00 0.00 ? 102 GLU A N    1  
ATOM 1547  C CA   . GLU A 1 102 ? 29.064  -17.850 27.953  1.00 0.00 ? 102 GLU A CA   1  
ATOM 1548  C C    . GLU A 1 102 ? 28.149  -17.334 26.846  1.00 0.00 ? 102 GLU A C    1  
ATOM 1549  O O    . GLU A 1 102 ? 27.258  -18.045 26.382  1.00 0.00 ? 102 GLU A O    1  
ATOM 1550  C CB   . GLU A 1 102 ? 28.514  -17.434 29.319  1.00 0.00 ? 102 GLU A CB   1  
ATOM 1551  C CG   . GLU A 1 102 ? 27.004  -17.565 29.432  1.00 0.00 ? 102 GLU A CG   1  
ATOM 1552  C CD   . GLU A 1 102 ? 26.491  -18.888 28.899  1.00 0.00 ? 102 GLU A CD   1  
ATOM 1553  O OE1  . GLU A 1 102 ? 27.156  -19.919 29.134  1.00 0.00 ? 102 GLU A OE1  1  
ATOM 1554  O OE2  . GLU A 1 102 ? 25.425  -18.894 28.249  1.00 0.00 ? 102 GLU A OE2  1  
ATOM 1555  H H    . GLU A 1 102 ? 30.733  -16.606 28.337  1.00 0.00 ? 102 GLU A H    1  
ATOM 1556  H HA   . GLU A 1 102 ? 29.098  -18.928 27.902  1.00 0.00 ? 102 GLU A HA   1  
ATOM 1557  H HB2  . GLU A 1 102 ? 28.966  -18.053 30.080  1.00 0.00 ? 102 GLU A HB2  1  
ATOM 1558  H HB3  . GLU A 1 102 ? 28.779  -16.404 29.502  1.00 0.00 ? 102 GLU A HB3  1  
ATOM 1559  H HG2  . GLU A 1 102 ? 26.725  -17.481 30.472  1.00 0.00 ? 102 GLU A HG2  1  
ATOM 1560  H HG3  . GLU A 1 102 ? 26.543  -16.765 28.872  1.00 0.00 ? 102 GLU A HG3  1  
ATOM 1561  N N    . GLN A 1 103 ? 28.377  -16.093 26.428  1.00 0.00 ? 103 GLN A N    1  
ATOM 1562  C CA   . GLN A 1 103 ? 27.573  -15.482 25.377  1.00 0.00 ? 103 GLN A CA   1  
ATOM 1563  C C    . GLN A 1 103 ? 27.806  -16.177 24.039  1.00 0.00 ? 103 GLN A C    1  
ATOM 1564  O O    . GLN A 1 103 ? 26.860  -16.598 23.373  1.00 0.00 ? 103 GLN A O    1  
ATOM 1565  C CB   . GLN A 1 103 ? 27.901  -13.993 25.255  1.00 0.00 ? 103 GLN A CB   1  
ATOM 1566  C CG   . GLN A 1 103 ? 27.986  -13.277 26.593  1.00 0.00 ? 103 GLN A CG   1  
ATOM 1567  C CD   . GLN A 1 103 ? 26.794  -13.563 27.485  1.00 0.00 ? 103 GLN A CD   1  
ATOM 1568  O OE1  . GLN A 1 103 ? 26.945  -13.827 28.678  1.00 0.00 ? 103 GLN A OE1  1  
ATOM 1569  N NE2  . GLN A 1 103 ? 25.598  -13.513 26.909  1.00 0.00 ? 103 GLN A NE2  1  
ATOM 1570  H H    . GLN A 1 103 ? 29.102  -15.577 26.837  1.00 0.00 ? 103 GLN A H    1  
ATOM 1571  H HA   . GLN A 1 103 ? 26.534  -15.591 25.648  1.00 0.00 ? 103 GLN A HA   1  
ATOM 1572  H HB2  . GLN A 1 103 ? 28.851  -13.886 24.753  1.00 0.00 ? 103 GLN A HB2  1  
ATOM 1573  H HB3  . GLN A 1 103 ? 27.135  -13.515 24.663  1.00 0.00 ? 103 GLN A HB3  1  
ATOM 1574  H HG2  . GLN A 1 103 ? 28.882  -13.599 27.103  1.00 0.00 ? 103 GLN A HG2  1  
ATOM 1575  H HG3  . GLN A 1 103 ? 28.037  -12.213 26.415  1.00 0.00 ? 103 GLN A HG3  1  
ATOM 1576  H HE21 . GLN A 1 103 ? 25.554  -13.298 25.953  1.00 0.00 ? 103 GLN A HE21 1  
ATOM 1577  H HE22 . GLN A 1 103 ? 24.811  -13.694 27.461  1.00 0.00 ? 103 GLN A HE22 1  
ATOM 1578  N N    . VAL A 1 104 ? 29.072  -16.295 23.652  1.00 0.00 ? 104 VAL A N    1  
ATOM 1579  C CA   . VAL A 1 104 ? 29.429  -16.940 22.394  1.00 0.00 ? 104 VAL A CA   1  
ATOM 1580  C C    . VAL A 1 104 ? 28.746  -18.296 22.258  1.00 0.00 ? 104 VAL A C    1  
ATOM 1581  O O    . VAL A 1 104 ? 28.288  -18.667 21.177  1.00 0.00 ? 104 VAL A O    1  
ATOM 1582  C CB   . VAL A 1 104 ? 30.953  -17.131 22.274  1.00 0.00 ? 104 VAL A CB   1  
ATOM 1583  C CG1  . VAL A 1 104 ? 31.529  -17.664 23.577  1.00 0.00 ? 104 VAL A CG1  1  
ATOM 1584  C CG2  . VAL A 1 104 ? 31.284  -18.059 21.116  1.00 0.00 ? 104 VAL A CG2  1  
ATOM 1585  H H    . VAL A 1 104 ? 29.782  -15.940 24.226  1.00 0.00 ? 104 VAL A H    1  
ATOM 1586  H HA   . VAL A 1 104 ? 29.103  -16.301 21.586  1.00 0.00 ? 104 VAL A HA   1  
ATOM 1587  H HB   . VAL A 1 104 ? 31.402  -16.168 22.076  1.00 0.00 ? 104 VAL A HB   1  
ATOM 1588  H HG11 . VAL A 1 104 ? 31.428  -16.914 24.348  1.00 0.00 ? 104 VAL A HG11 1  
ATOM 1589  H HG12 . VAL A 1 104 ? 30.994  -18.556 23.869  1.00 0.00 ? 104 VAL A HG12 1  
ATOM 1590  H HG13 . VAL A 1 104 ? 32.574  -17.900 23.439  1.00 0.00 ? 104 VAL A HG13 1  
ATOM 1591  H HG21 . VAL A 1 104 ? 30.799  -17.703 20.220  1.00 0.00 ? 104 VAL A HG21 1  
ATOM 1592  H HG22 . VAL A 1 104 ? 32.354  -18.079 20.963  1.00 0.00 ? 104 VAL A HG22 1  
ATOM 1593  H HG23 . VAL A 1 104 ? 30.935  -19.056 21.342  1.00 0.00 ? 104 VAL A HG23 1  
ATOM 1594  N N    . LEU A 1 105 ? 28.681  -19.032 23.362  1.00 0.00 ? 105 LEU A N    1  
ATOM 1595  C CA   . LEU A 1 105 ? 28.052  -20.349 23.367  1.00 0.00 ? 105 LEU A CA   1  
ATOM 1596  C C    . LEU A 1 105 ? 26.537  -20.229 23.239  1.00 0.00 ? 105 LEU A C    1  
ATOM 1597  O O    . LEU A 1 105 ? 25.886  -21.086 22.643  1.00 0.00 ? 105 LEU A O    1  
ATOM 1598  C CB   . LEU A 1 105 ? 28.410  -21.101 24.650  1.00 0.00 ? 105 LEU A CB   1  
ATOM 1599  C CG   . LEU A 1 105 ? 29.886  -21.453 24.833  1.00 0.00 ? 105 LEU A CG   1  
ATOM 1600  C CD1  . LEU A 1 105 ? 30.125  -22.056 26.209  1.00 0.00 ? 105 LEU A CD1  1  
ATOM 1601  C CD2  . LEU A 1 105 ? 30.345  -22.410 23.742  1.00 0.00 ? 105 LEU A CD2  1  
ATOM 1602  H H    . LEU A 1 105 ? 29.064  -18.683 24.193  1.00 0.00 ? 105 LEU A H    1  
ATOM 1603  H HA   . LEU A 1 105 ? 28.431  -20.900 22.519  1.00 0.00 ? 105 LEU A HA   1  
ATOM 1604  H HB2  . LEU A 1 105 ? 28.110  -20.488 25.487  1.00 0.00 ? 105 LEU A HB2  1  
ATOM 1605  H HB3  . LEU A 1 105 ? 27.845  -22.022 24.661  1.00 0.00 ? 105 LEU A HB3  1  
ATOM 1606  H HG   . LEU A 1 105 ? 30.477  -20.550 24.758  1.00 0.00 ? 105 LEU A HG   1  
ATOM 1607  H HD11 . LEU A 1 105 ? 29.206  -22.483 26.579  1.00 0.00 ? 105 LEU A HD11 1  
ATOM 1608  H HD12 . LEU A 1 105 ? 30.462  -21.285 26.886  1.00 0.00 ? 105 LEU A HD12 1  
ATOM 1609  H HD13 . LEU A 1 105 ? 30.878  -22.827 26.138  1.00 0.00 ? 105 LEU A HD13 1  
ATOM 1610  H HD21 . LEU A 1 105 ? 29.850  -23.361 23.867  1.00 0.00 ? 105 LEU A HD21 1  
ATOM 1611  H HD22 . LEU A 1 105 ? 31.414  -22.549 23.813  1.00 0.00 ? 105 LEU A HD22 1  
ATOM 1612  H HD23 . LEU A 1 105 ? 30.098  -21.999 22.775  1.00 0.00 ? 105 LEU A HD23 1  
ATOM 1613  N N    . GLU A 1 106 ? 25.983  -19.160 23.801  1.00 0.00 ? 106 GLU A N    1  
ATOM 1614  C CA   . GLU A 1 106 ? 24.544  -18.928 23.748  1.00 0.00 ? 106 GLU A CA   1  
ATOM 1615  C C    . GLU A 1 106 ? 24.059  -18.849 22.304  1.00 0.00 ? 106 GLU A C    1  
ATOM 1616  O O    . GLU A 1 106 ? 22.880  -19.064 22.022  1.00 0.00 ? 106 GLU A O    1  
ATOM 1617  C CB   . GLU A 1 106 ? 24.185  -17.639 24.489  1.00 0.00 ? 106 GLU A CB   1  
ATOM 1618  C CG   . GLU A 1 106 ? 23.373  -17.869 25.753  1.00 0.00 ? 106 GLU A CG   1  
ATOM 1619  C CD   . GLU A 1 106 ? 22.131  -17.002 25.814  1.00 0.00 ? 106 GLU A CD   1  
ATOM 1620  O OE1  . GLU A 1 106 ? 22.273  -15.775 26.000  1.00 0.00 ? 106 GLU A OE1  1  
ATOM 1621  O OE2  . GLU A 1 106 ? 21.017  -17.550 25.677  1.00 0.00 ? 106 GLU A OE2  1  
ATOM 1622  H H    . GLU A 1 106 ? 26.555  -18.512 24.263  1.00 0.00 ? 106 GLU A H    1  
ATOM 1623  H HA   . GLU A 1 106 ? 24.057  -19.759 24.234  1.00 0.00 ? 106 GLU A HA   1  
ATOM 1624  H HB2  . GLU A 1 106 ? 25.097  -17.127 24.760  1.00 0.00 ? 106 GLU A HB2  1  
ATOM 1625  H HB3  . GLU A 1 106 ? 23.611  -17.006 23.828  1.00 0.00 ? 106 GLU A HB3  1  
ATOM 1626  H HG2  . GLU A 1 106 ? 23.073  -18.905 25.789  1.00 0.00 ? 106 GLU A HG2  1  
ATOM 1627  H HG3  . GLU A 1 106 ? 23.993  -17.646 26.609  1.00 0.00 ? 106 GLU A HG3  1  
ATOM 1628  N N    . ILE A 1 107 ? 24.977  -18.540 21.393  1.00 0.00 ? 107 ILE A N    1  
ATOM 1629  C CA   . ILE A 1 107 ? 24.643  -18.434 19.979  1.00 0.00 ? 107 ILE A CA   1  
ATOM 1630  C C    . ILE A 1 107 ? 25.067  -19.686 19.218  1.00 0.00 ? 107 ILE A C    1  
ATOM 1631  O O    . ILE A 1 107 ? 24.317  -20.206 18.392  1.00 0.00 ? 107 ILE A O    1  
ATOM 1632  C CB   . ILE A 1 107 ? 25.310  -17.204 19.334  1.00 0.00 ? 107 ILE A CB   1  
ATOM 1633  C CG1  . ILE A 1 107 ? 24.857  -15.924 20.038  1.00 0.00 ? 107 ILE A CG1  1  
ATOM 1634  C CG2  . ILE A 1 107 ? 24.984  -17.143 17.849  1.00 0.00 ? 107 ILE A CG2  1  
ATOM 1635  C CD1  . ILE A 1 107 ? 26.003  -15.058 20.513  1.00 0.00 ? 107 ILE A CD1  1  
ATOM 1636  H H    . ILE A 1 107 ? 25.900  -18.381 21.680  1.00 0.00 ? 107 ILE A H    1  
ATOM 1637  H HA   . ILE A 1 107 ? 23.571  -18.321 19.897  1.00 0.00 ? 107 ILE A HA   1  
ATOM 1638  H HB   . ILE A 1 107 ? 26.379  -17.306 19.439  1.00 0.00 ? 107 ILE A HB   1  
ATOM 1639  H HG12 . ILE A 1 107 ? 24.260  -15.338 19.357  1.00 0.00 ? 107 ILE A HG12 1  
ATOM 1640  H HG13 . ILE A 1 107 ? 24.259  -16.187 20.898  1.00 0.00 ? 107 ILE A HG13 1  
ATOM 1641  H HG21 . ILE A 1 107 ? 25.349  -18.036 17.363  1.00 0.00 ? 107 ILE A HG21 1  
ATOM 1642  H HG22 . ILE A 1 107 ? 23.914  -17.075 17.718  1.00 0.00 ? 107 ILE A HG22 1  
ATOM 1643  H HG23 . ILE A 1 107 ? 25.457  -16.276 17.412  1.00 0.00 ? 107 ILE A HG23 1  
ATOM 1644  H HD11 . ILE A 1 107 ? 26.326  -14.414 19.709  1.00 0.00 ? 107 ILE A HD11 1  
ATOM 1645  H HD12 . ILE A 1 107 ? 25.678  -14.457 21.349  1.00 0.00 ? 107 ILE A HD12 1  
ATOM 1646  H HD13 . ILE A 1 107 ? 26.826  -15.688 20.821  1.00 0.00 ? 107 ILE A HD13 1  
ATOM 1647  N N    . ALA A 1 108 ? 26.272  -20.166 19.505  1.00 0.00 ? 108 ALA A N    1  
ATOM 1648  C CA   . ALA A 1 108 ? 26.794  -21.359 18.851  1.00 0.00 ? 108 ALA A CA   1  
ATOM 1649  C C    . ALA A 1 108 ? 25.797  -22.510 18.931  1.00 0.00 ? 108 ALA A C    1  
ATOM 1650  O O    . ALA A 1 108 ? 25.670  -23.302 17.997  1.00 0.00 ? 108 ALA A O    1  
ATOM 1651  C CB   . ALA A 1 108 ? 28.122  -21.764 19.474  1.00 0.00 ? 108 ALA A CB   1  
ATOM 1652  H H    . ALA A 1 108 ? 26.823  -19.707 20.173  1.00 0.00 ? 108 ALA A H    1  
ATOM 1653  H HA   . ALA A 1 108 ? 26.970  -21.120 17.812  1.00 0.00 ? 108 ALA A HA   1  
ATOM 1654  H HB1  . ALA A 1 108 ? 28.131  -22.832 19.637  1.00 0.00 ? 108 ALA A HB1  1  
ATOM 1655  H HB2  . ALA A 1 108 ? 28.929  -21.494 18.809  1.00 0.00 ? 108 ALA A HB2  1  
ATOM 1656  H HB3  . ALA A 1 108 ? 28.247  -21.254 20.417  1.00 0.00 ? 108 ALA A HB3  1  
ATOM 1657  N N    . LYS A 1 109 ? 25.092  -22.598 20.054  1.00 0.00 ? 109 LYS A N    1  
ATOM 1658  C CA   . LYS A 1 109 ? 24.105  -23.652 20.257  1.00 0.00 ? 109 LYS A CA   1  
ATOM 1659  C C    . LYS A 1 109 ? 23.130  -23.718 19.086  1.00 0.00 ? 109 LYS A C    1  
ATOM 1660  O O    . LYS A 1 109 ? 23.091  -24.708 18.355  1.00 0.00 ? 109 LYS A O    1  
ATOM 1661  C CB   . LYS A 1 109 ? 23.338  -23.417 21.560  1.00 0.00 ? 109 LYS A CB   1  
ATOM 1662  C CG   . LYS A 1 109 ? 24.035  -23.982 22.786  1.00 0.00 ? 109 LYS A CG   1  
ATOM 1663  C CD   . LYS A 1 109 ? 23.058  -24.206 23.928  1.00 0.00 ? 109 LYS A CD   1  
ATOM 1664  C CE   . LYS A 1 109 ? 22.939  -25.681 24.279  1.00 0.00 ? 109 LYS A CE   1  
ATOM 1665  N NZ   . LYS A 1 109 ? 21.546  -26.051 24.655  1.00 0.00 ? 109 LYS A NZ   1  
ATOM 1666  H H    . LYS A 1 109 ? 25.239  -21.938 20.763  1.00 0.00 ? 109 LYS A H    1  
ATOM 1667  H HA   . LYS A 1 109 ? 24.633  -24.592 20.324  1.00 0.00 ? 109 LYS A HA   1  
ATOM 1668  H HB2  . LYS A 1 109 ? 23.211  -22.354 21.702  1.00 0.00 ? 109 LYS A HB2  1  
ATOM 1669  H HB3  . LYS A 1 109 ? 22.365  -23.880 21.480  1.00 0.00 ? 109 LYS A HB3  1  
ATOM 1670  H HG2  . LYS A 1 109 ? 24.491  -24.926 22.527  1.00 0.00 ? 109 LYS A HG2  1  
ATOM 1671  H HG3  . LYS A 1 109 ? 24.798  -23.288 23.108  1.00 0.00 ? 109 LYS A HG3  1  
ATOM 1672  H HD2  . LYS A 1 109 ? 23.405  -23.668 24.798  1.00 0.00 ? 109 LYS A HD2  1  
ATOM 1673  H HD3  . LYS A 1 109 ? 22.086  -23.834 23.637  1.00 0.00 ? 109 LYS A HD3  1  
ATOM 1674  H HE2  . LYS A 1 109 ? 23.239  -26.266 23.423  1.00 0.00 ? 109 LYS A HE2  1  
ATOM 1675  H HE3  . LYS A 1 109 ? 23.595  -25.894 25.109  1.00 0.00 ? 109 LYS A HE3  1  
ATOM 1676  H HZ1  . LYS A 1 109 ? 20.921  -25.976 23.827  1.00 0.00 ? 109 LYS A HZ1  1  
ATOM 1677  H HZ2  . LYS A 1 109 ? 21.195  -25.414 25.398  1.00 0.00 ? 109 LYS A HZ2  1  
ATOM 1678  H HZ3  . LYS A 1 109 ? 21.518  -27.028 25.009  1.00 0.00 ? 109 LYS A HZ3  1  
ATOM 1679  N N    . GLN A 1 110 ? 22.348  -22.658 18.913  1.00 0.00 ? 110 GLN A N    1  
ATOM 1680  C CA   . GLN A 1 110 ? 21.374  -22.596 17.830  1.00 0.00 ? 110 GLN A CA   1  
ATOM 1681  C C    . GLN A 1 110 ? 22.065  -22.660 16.472  1.00 0.00 ? 110 GLN A C    1  
ATOM 1682  O O    . GLN A 1 110 ? 21.435  -22.951 15.455  1.00 0.00 ? 110 GLN A O    1  
ATOM 1683  C CB   . GLN A 1 110 ? 20.544  -21.315 17.933  1.00 0.00 ? 110 GLN A CB   1  
ATOM 1684  C CG   . GLN A 1 110 ? 19.268  -21.480 18.743  1.00 0.00 ? 110 GLN A CG   1  
ATOM 1685  C CD   . GLN A 1 110 ? 18.192  -20.491 18.344  1.00 0.00 ? 110 GLN A CD   1  
ATOM 1686  O OE1  . GLN A 1 110 ? 17.038  -20.864 18.128  1.00 0.00 ? 110 GLN A OE1  1  
ATOM 1687  N NE2  . GLN A 1 110 ? 18.563  -19.220 18.245  1.00 0.00 ? 110 GLN A NE2  1  
ATOM 1688  H H    . GLN A 1 110 ? 22.426  -21.900 19.529  1.00 0.00 ? 110 GLN A H    1  
ATOM 1689  H HA   . GLN A 1 110 ? 20.717  -23.448 17.925  1.00 0.00 ? 110 GLN A HA   1  
ATOM 1690  H HB2  . GLN A 1 110 ? 21.145  -20.549 18.400  1.00 0.00 ? 110 GLN A HB2  1  
ATOM 1691  H HB3  . GLN A 1 110 ? 20.274  -20.994 16.938  1.00 0.00 ? 110 GLN A HB3  1  
ATOM 1692  H HG2  . GLN A 1 110 ? 18.889  -22.480 18.594  1.00 0.00 ? 110 GLN A HG2  1  
ATOM 1693  H HG3  . GLN A 1 110 ? 19.500  -21.337 19.788  1.00 0.00 ? 110 GLN A HG3  1  
ATOM 1694  H HE21 . GLN A 1 110 ? 19.500  -18.996 18.431  1.00 0.00 ? 110 GLN A HE21 1  
ATOM 1695  H HE22 . GLN A 1 110 ? 17.888  -18.559 17.988  1.00 0.00 ? 110 GLN A HE22 1  
ATOM 1696  N N    . LYS A 1 111 ? 23.365  -22.385 16.462  1.00 0.00 ? 111 LYS A N    1  
ATOM 1697  C CA   . LYS A 1 111 ? 24.144  -22.412 15.230  1.00 0.00 ? 111 LYS A CA   1  
ATOM 1698  C C    . LYS A 1 111 ? 24.772  -23.785 15.012  1.00 0.00 ? 111 LYS A C    1  
ATOM 1699  O O    . LYS A 1 111 ? 25.931  -23.892 14.614  1.00 0.00 ? 111 LYS A O    1  
ATOM 1700  C CB   . LYS A 1 111 ? 25.236  -21.341 15.270  1.00 0.00 ? 111 LYS A CB   1  
ATOM 1701  C CG   . LYS A 1 111 ? 25.427  -20.616 13.948  1.00 0.00 ? 111 LYS A CG   1  
ATOM 1702  C CD   . LYS A 1 111 ? 25.975  -21.544 12.877  1.00 0.00 ? 111 LYS A CD   1  
ATOM 1703  C CE   . LYS A 1 111 ? 26.309  -20.787 11.601  1.00 0.00 ? 111 LYS A CE   1  
ATOM 1704  N NZ   . LYS A 1 111 ? 25.864  -21.523 10.386  1.00 0.00 ? 111 LYS A NZ   1  
ATOM 1705  H H    . LYS A 1 111 ? 23.812  -22.160 17.305  1.00 0.00 ? 111 LYS A H    1  
ATOM 1706  H HA   . LYS A 1 111 ? 23.475  -22.201 14.410  1.00 0.00 ? 111 LYS A HA   1  
ATOM 1707  H HB2  . LYS A 1 111 ? 24.981  -20.610 16.023  1.00 0.00 ? 111 LYS A HB2  1  
ATOM 1708  H HB3  . LYS A 1 111 ? 26.173  -21.809 15.537  1.00 0.00 ? 111 LYS A HB3  1  
ATOM 1709  H HG2  . LYS A 1 111 ? 24.473  -20.229 13.620  1.00 0.00 ? 111 LYS A HG2  1  
ATOM 1710  H HG3  . LYS A 1 111 ? 26.119  -19.799 14.092  1.00 0.00 ? 111 LYS A HG3  1  
ATOM 1711  H HD2  . LYS A 1 111 ? 26.872  -22.017 13.248  1.00 0.00 ? 111 LYS A HD2  1  
ATOM 1712  H HD3  . LYS A 1 111 ? 25.234  -22.299 12.654  1.00 0.00 ? 111 LYS A HD3  1  
ATOM 1713  H HE2  . LYS A 1 111 ? 25.820  -19.826 11.630  1.00 0.00 ? 111 LYS A HE2  1  
ATOM 1714  H HE3  . LYS A 1 111 ? 27.379  -20.645 11.553  1.00 0.00 ? 111 LYS A HE3  1  
ATOM 1715  H HZ1  . LYS A 1 111 ? 24.825  -21.579 10.363  1.00 0.00 ? 111 LYS A HZ1  1  
ATOM 1716  H HZ2  . LYS A 1 111 ? 26.251  -22.488 10.391  1.00 0.00 ? 111 LYS A HZ2  1  
ATOM 1717  H HZ3  . LYS A 1 111 ? 26.193  -21.033 9.530   1.00 0.00 ? 111 LYS A HZ3  1  
ATOM 1718  N N    . MET A 1 112 ? 23.997  -24.833 15.275  1.00 0.00 ? 112 MET A N    1  
ATOM 1719  C CA   . MET A 1 112 ? 24.478  -26.199 15.105  1.00 0.00 ? 112 MET A CA   1  
ATOM 1720  C C    . MET A 1 112 ? 23.528  -27.003 14.223  1.00 0.00 ? 112 MET A C    1  
ATOM 1721  O O    . MET A 1 112 ? 23.293  -28.192 14.444  1.00 0.00 ? 112 MET A O    1  
ATOM 1722  C CB   . MET A 1 112 ? 24.630  -26.882 16.465  1.00 0.00 ? 112 MET A CB   1  
ATOM 1723  C CG   . MET A 1 112 ? 25.690  -26.245 17.350  1.00 0.00 ? 112 MET A CG   1  
ATOM 1724  S SD   . MET A 1 112 ? 26.965  -27.414 17.858  1.00 0.00 ? 112 MET A SD   1  
ATOM 1725  C CE   . MET A 1 112 ? 26.463  -27.751 19.544  1.00 0.00 ? 112 MET A CE   1  
ATOM 1726  H H    . MET A 1 112 ? 23.081  -24.684 15.590  1.00 0.00 ? 112 MET A H    1  
ATOM 1727  H HA   . MET A 1 112 ? 25.444  -26.153 14.625  1.00 0.00 ? 112 MET A HA   1  
ATOM 1728  H HB2  . MET A 1 112 ? 23.685  -26.838 16.985  1.00 0.00 ? 112 MET A HB2  1  
ATOM 1729  H HB3  . MET A 1 112 ? 24.898  -27.916 16.308  1.00 0.00 ? 112 MET A HB3  1  
ATOM 1730  H HG2  . MET A 1 112 ? 26.158  -25.439 16.805  1.00 0.00 ? 112 MET A HG2  1  
ATOM 1731  H HG3  . MET A 1 112 ? 25.210  -25.849 18.233  1.00 0.00 ? 112 MET A HG3  1  
ATOM 1732  H HE1  . MET A 1 112 ? 25.602  -28.402 19.540  1.00 0.00 ? 112 MET A HE1  1  
ATOM 1733  H HE2  . MET A 1 112 ? 27.274  -28.229 20.072  1.00 0.00 ? 112 MET A HE2  1  
ATOM 1734  H HE3  . MET A 1 112 ? 26.210  -26.823 20.036  1.00 0.00 ? 112 MET A HE3  1  
ATOM 1735  N N    . PRO A 1 113 ? 22.967  -26.342 13.199  1.00 0.00 ? 113 PRO A N    1  
ATOM 1736  C CA   . PRO A 1 113 ? 22.034  -26.977 12.264  1.00 0.00 ? 113 PRO A CA   1  
ATOM 1737  C C    . PRO A 1 113 ? 22.722  -27.993 11.358  1.00 0.00 ? 113 PRO A C    1  
ATOM 1738  O O    . PRO A 1 113 ? 22.254  -29.122 11.208  1.00 0.00 ? 113 PRO A O    1  
ATOM 1739  C CB   . PRO A 1 113 ? 21.502  -25.801 11.441  1.00 0.00 ? 113 PRO A CB   1  
ATOM 1740  C CG   . PRO A 1 113 ? 22.573  -24.769 11.519  1.00 0.00 ? 113 PRO A CG   1  
ATOM 1741  C CD   . PRO A 1 113 ? 23.201  -24.925 12.876  1.00 0.00 ? 113 PRO A CD   1  
ATOM 1742  H HA   . PRO A 1 113 ? 21.215  -27.455 12.782  1.00 0.00 ? 113 PRO A HA   1  
ATOM 1743  H HB2  . PRO A 1 113 ? 21.332  -26.119 10.422  1.00 0.00 ? 113 PRO A HB2  1  
ATOM 1744  H HB3  . PRO A 1 113 ? 20.578  -25.444 11.871  1.00 0.00 ? 113 PRO A HB3  1  
ATOM 1745  H HG2  . PRO A 1 113 ? 23.306  -24.941 10.745  1.00 0.00 ? 113 PRO A HG2  1  
ATOM 1746  H HG3  . PRO A 1 113 ? 22.142  -23.784 11.416  1.00 0.00 ? 113 PRO A HG3  1  
ATOM 1747  H HD2  . PRO A 1 113 ? 24.258  -24.709 12.831  1.00 0.00 ? 113 PRO A HD2  1  
ATOM 1748  H HD3  . PRO A 1 113 ? 22.713  -24.281 13.594  1.00 0.00 ? 113 PRO A HD3  1  
ATOM 1749  N N    . ASP A 1 114 ? 23.834  -27.585 10.758  1.00 0.00 ? 114 ASP A N    1  
ATOM 1750  C CA   . ASP A 1 114 ? 24.588  -28.461 9.868   1.00 0.00 ? 114 ASP A CA   1  
ATOM 1751  C C    . ASP A 1 114 ? 25.998  -28.694 10.401  1.00 0.00 ? 114 ASP A C    1  
ATOM 1752  O O    . ASP A 1 114 ? 26.673  -29.646 10.007  1.00 0.00 ? 114 ASP A O    1  
ATOM 1753  C CB   . ASP A 1 114 ? 24.653  -27.862 8.463   1.00 0.00 ? 114 ASP A CB   1  
ATOM 1754  C CG   . ASP A 1 114 ? 24.330  -28.878 7.385   1.00 0.00 ? 114 ASP A CG   1  
ATOM 1755  O OD1  . ASP A 1 114 ? 23.449  -29.731 7.619   1.00 0.00 ? 114 ASP A OD1  1  
ATOM 1756  O OD2  . ASP A 1 114 ? 24.959  -28.820 6.307   1.00 0.00 ? 114 ASP A OD2  1  
ATOM 1757  H H    . ASP A 1 114 ? 24.157  -26.674 10.917  1.00 0.00 ? 114 ASP A H    1  
ATOM 1758  H HA   . ASP A 1 114 ? 24.073  -29.409 9.822   1.00 0.00 ? 114 ASP A HA   1  
ATOM 1759  H HB2  . ASP A 1 114 ? 23.943  -27.051 8.391   1.00 0.00 ? 114 ASP A HB2  1  
ATOM 1760  H HB3  . ASP A 1 114 ? 25.648  -27.480 8.287   1.00 0.00 ? 114 ASP A HB3  1  
ATOM 1761  N N    . LEU A 1 115 ? 26.438  -27.818 11.298  1.00 0.00 ? 115 LEU A N    1  
ATOM 1762  C CA   . LEU A 1 115 ? 27.769  -27.927 11.885  1.00 0.00 ? 115 LEU A CA   1  
ATOM 1763  C C    . LEU A 1 115 ? 28.022  -29.340 12.403  1.00 0.00 ? 115 LEU A C    1  
ATOM 1764  O O    . LEU A 1 115 ? 27.267  -29.853 13.228  1.00 0.00 ? 115 LEU A O    1  
ATOM 1765  C CB   . LEU A 1 115 ? 27.930  -26.918 13.023  1.00 0.00 ? 115 LEU A CB   1  
ATOM 1766  C CG   . LEU A 1 115 ? 28.292  -25.491 12.608  1.00 0.00 ? 115 LEU A CG   1  
ATOM 1767  C CD1  . LEU A 1 115 ? 29.660  -25.458 11.946  1.00 0.00 ? 115 LEU A CD1  1  
ATOM 1768  C CD2  . LEU A 1 115 ? 27.232  -24.922 11.676  1.00 0.00 ? 115 LEU A CD2  1  
ATOM 1769  H H    . LEU A 1 115 ? 25.855  -27.081 11.573  1.00 0.00 ? 115 LEU A H    1  
ATOM 1770  H HA   . LEU A 1 115 ? 28.491  -27.706 11.113  1.00 0.00 ? 115 LEU A HA   1  
ATOM 1771  H HB2  . LEU A 1 115 ? 26.998  -26.878 13.565  1.00 0.00 ? 115 LEU A HB2  1  
ATOM 1772  H HB3  . LEU A 1 115 ? 28.710  -27.281 13.678  1.00 0.00 ? 115 LEU A HB3  1  
ATOM 1773  H HG   . LEU A 1 115 ? 28.333  -24.866 13.490  1.00 0.00 ? 115 LEU A HG   1  
ATOM 1774  H HD11 . LEU A 1 115 ? 29.864  -26.416 11.493  1.00 0.00 ? 115 LEU A HD11 1  
ATOM 1775  H HD12 . LEU A 1 115 ? 30.414  -25.244 12.689  1.00 0.00 ? 115 LEU A HD12 1  
ATOM 1776  H HD13 . LEU A 1 115 ? 29.675  -24.690 11.187  1.00 0.00 ? 115 LEU A HD13 1  
ATOM 1777  H HD21 . LEU A 1 115 ? 27.363  -23.854 11.593  1.00 0.00 ? 115 LEU A HD21 1  
ATOM 1778  H HD22 . LEU A 1 115 ? 26.251  -25.135 12.074  1.00 0.00 ? 115 LEU A HD22 1  
ATOM 1779  H HD23 . LEU A 1 115 ? 27.331  -25.374 10.700  1.00 0.00 ? 115 LEU A HD23 1  
ATOM 1780  N N    . ASN A 1 116 ? 29.090  -29.962 11.914  1.00 0.00 ? 116 ASN A N    1  
ATOM 1781  C CA   . ASN A 1 116 ? 29.443  -31.314 12.329  1.00 0.00 ? 116 ASN A CA   1  
ATOM 1782  C C    . ASN A 1 116 ? 30.101  -31.306 13.706  1.00 0.00 ? 116 ASN A C    1  
ATOM 1783  O O    . ASN A 1 116 ? 31.238  -31.752 13.866  1.00 0.00 ? 116 ASN A O    1  
ATOM 1784  C CB   . ASN A 1 116 ? 30.383  -31.955 11.306  1.00 0.00 ? 116 ASN A CB   1  
ATOM 1785  C CG   . ASN A 1 116 ? 31.619  -31.114 11.051  1.00 0.00 ? 116 ASN A CG   1  
ATOM 1786  O OD1  . ASN A 1 116 ? 31.528  -29.988 10.562  1.00 0.00 ? 116 ASN A OD1  1  
ATOM 1787  N ND2  . ASN A 1 116 ? 32.784  -31.660 11.382  1.00 0.00 ? 116 ASN A ND2  1  
ATOM 1788  H H    . ASN A 1 116 ? 29.653  -29.500 11.258  1.00 0.00 ? 116 ASN A H    1  
ATOM 1789  H HA   . ASN A 1 116 ? 28.533  -31.893 12.381  1.00 0.00 ? 116 ASN A HA   1  
ATOM 1790  H HB2  . ASN A 1 116 ? 30.698  -32.921 11.671  1.00 0.00 ? 116 ASN A HB2  1  
ATOM 1791  H HB3  . ASN A 1 116 ? 29.857  -32.081 10.372  1.00 0.00 ? 116 ASN A HB3  1  
ATOM 1792  H HD21 . ASN A 1 116 ? 32.781  -32.561 11.767  1.00 0.00 ? 116 ASN A HD21 1  
ATOM 1793  H HD22 . ASN A 1 116 ? 33.599  -31.138 11.229  1.00 0.00 ? 116 ASN A HD22 1  
ATOM 1794  N N    . THR A 1 117 ? 29.378  -30.797 14.698  1.00 0.00 ? 117 THR A N    1  
ATOM 1795  C CA   . THR A 1 117 ? 29.890  -30.731 16.061  1.00 0.00 ? 117 THR A CA   1  
ATOM 1796  C C    . THR A 1 117 ? 28.761  -30.847 17.079  1.00 0.00 ? 117 THR A C    1  
ATOM 1797  O O    . THR A 1 117 ? 27.676  -30.298 16.884  1.00 0.00 ? 117 THR A O    1  
ATOM 1798  C CB   . THR A 1 117 ? 30.657  -29.418 16.309  1.00 0.00 ? 117 THR A CB   1  
ATOM 1799  O OG1  . THR A 1 117 ? 29.800  -28.297 16.068  1.00 0.00 ? 117 THR A OG1  1  
ATOM 1800  C CG2  . THR A 1 117 ? 31.882  -29.330 15.412  1.00 0.00 ? 117 THR A CG2  1  
ATOM 1801  H H    . THR A 1 117 ? 28.478  -30.458 14.508  1.00 0.00 ? 117 THR A H    1  
ATOM 1802  H HA   . THR A 1 117 ? 30.574  -31.555 16.201  1.00 0.00 ? 117 THR A HA   1  
ATOM 1803  H HB   . THR A 1 117 ? 30.982  -29.398 17.340  1.00 0.00 ? 117 THR A HB   1  
ATOM 1804  H HG1  . THR A 1 117 ? 29.140  -28.534 15.412  1.00 0.00 ? 117 THR A HG1  1  
ATOM 1805  H HG21 . THR A 1 117 ? 32.484  -30.218 15.536  1.00 0.00 ? 117 THR A HG21 1  
ATOM 1806  H HG22 . THR A 1 117 ? 32.463  -28.460 15.681  1.00 0.00 ? 117 THR A HG22 1  
ATOM 1807  H HG23 . THR A 1 117 ? 31.569  -29.249 14.382  1.00 0.00 ? 117 THR A HG23 1  
ATOM 1808  N N    . THR A 1 118 ? 29.023  -31.564 18.167  1.00 0.00 ? 118 THR A N    1  
ATOM 1809  C CA   . THR A 1 118 ? 28.029  -31.753 19.216  1.00 0.00 ? 118 THR A CA   1  
ATOM 1810  C C    . THR A 1 118 ? 28.354  -30.905 20.441  1.00 0.00 ? 118 THR A C    1  
ATOM 1811  O O    . THR A 1 118 ? 27.468  -30.292 21.037  1.00 0.00 ? 118 THR A O    1  
ATOM 1812  C CB   . THR A 1 118 ? 27.933  -33.230 19.640  1.00 0.00 ? 118 THR A CB   1  
ATOM 1813  O OG1  . THR A 1 118 ? 29.224  -33.715 20.025  1.00 0.00 ? 118 THR A OG1  1  
ATOM 1814  C CG2  . THR A 1 118 ? 27.382  -34.083 18.507  1.00 0.00 ? 118 THR A CG2  1  
ATOM 1815  H H    . THR A 1 118 ? 29.907  -31.977 18.265  1.00 0.00 ? 118 THR A H    1  
ATOM 1816  H HA   . THR A 1 118 ? 27.069  -31.449 18.825  1.00 0.00 ? 118 THR A HA   1  
ATOM 1817  H HB   . THR A 1 118 ? 27.262  -33.304 20.485  1.00 0.00 ? 118 THR A HB   1  
ATOM 1818  H HG1  . THR A 1 118 ? 29.138  -34.599 20.390  1.00 0.00 ? 118 THR A HG1  1  
ATOM 1819  H HG21 . THR A 1 118 ? 28.025  -33.995 17.644  1.00 0.00 ? 118 THR A HG21 1  
ATOM 1820  H HG22 . THR A 1 118 ? 26.389  -33.745 18.252  1.00 0.00 ? 118 THR A HG22 1  
ATOM 1821  H HG23 . THR A 1 118 ? 27.342  -35.115 18.821  1.00 0.00 ? 118 THR A HG23 1  
ATOM 1822  N N    . ASP A 1 119 ? 29.630  -30.873 20.810  1.00 0.00 ? 119 ASP A N    1  
ATOM 1823  C CA   . ASP A 1 119 ? 30.073  -30.098 21.964  1.00 0.00 ? 119 ASP A CA   1  
ATOM 1824  C C    . ASP A 1 119 ? 29.985  -28.602 21.679  1.00 0.00 ? 119 ASP A C    1  
ATOM 1825  O O    . ASP A 1 119 ? 30.417  -28.133 20.625  1.00 0.00 ? 119 ASP A O    1  
ATOM 1826  C CB   . ASP A 1 119 ? 31.507  -30.475 22.338  1.00 0.00 ? 119 ASP A CB   1  
ATOM 1827  C CG   . ASP A 1 119 ? 31.797  -31.945 22.109  1.00 0.00 ? 119 ASP A CG   1  
ATOM 1828  O OD1  . ASP A 1 119 ? 31.467  -32.760 22.996  1.00 0.00 ? 119 ASP A OD1  1  
ATOM 1829  O OD2  . ASP A 1 119 ? 32.356  -32.281 21.044  1.00 0.00 ? 119 ASP A OD2  1  
ATOM 1830  H H    . ASP A 1 119 ? 30.290  -31.383 20.295  1.00 0.00 ? 119 ASP A H    1  
ATOM 1831  H HA   . ASP A 1 119 ? 29.421  -30.333 22.791  1.00 0.00 ? 119 ASP A HA   1  
ATOM 1832  H HB2  . ASP A 1 119 ? 32.193  -29.894 21.739  1.00 0.00 ? 119 ASP A HB2  1  
ATOM 1833  H HB3  . ASP A 1 119 ? 31.669  -30.252 23.383  1.00 0.00 ? 119 ASP A HB3  1  
ATOM 1834  N N    . LEU A 1 120 ? 29.421  -27.857 22.624  1.00 0.00 ? 120 LEU A N    1  
ATOM 1835  C CA   . LEU A 1 120 ? 29.275  -26.414 22.475  1.00 0.00 ? 120 LEU A CA   1  
ATOM 1836  C C    . LEU A 1 120 ? 30.637  -25.738 22.358  1.00 0.00 ? 120 LEU A C    1  
ATOM 1837  O O    . LEU A 1 120 ? 30.797  -24.768 21.618  1.00 0.00 ? 120 LEU A O    1  
ATOM 1838  C CB   . LEU A 1 120 ? 28.506  -25.834 23.663  1.00 0.00 ? 120 LEU A CB   1  
ATOM 1839  C CG   . LEU A 1 120 ? 27.293  -24.968 23.320  1.00 0.00 ? 120 LEU A CG   1  
ATOM 1840  C CD1  . LEU A 1 120 ? 26.677  -24.387 24.583  1.00 0.00 ? 120 LEU A CD1  1  
ATOM 1841  C CD2  . LEU A 1 120 ? 27.687  -23.857 22.357  1.00 0.00 ? 120 LEU A CD2  1  
ATOM 1842  H H    . LEU A 1 120 ? 29.096  -28.288 23.442  1.00 0.00 ? 120 LEU A H    1  
ATOM 1843  H HA   . LEU A 1 120 ? 28.716  -26.229 21.570  1.00 0.00 ? 120 LEU A HA   1  
ATOM 1844  H HB2  . LEU A 1 120 ? 28.162  -26.658 24.269  1.00 0.00 ? 120 LEU A HB2  1  
ATOM 1845  H HB3  . LEU A 1 120 ? 29.193  -25.230 24.238  1.00 0.00 ? 120 LEU A HB3  1  
ATOM 1846  H HG   . LEU A 1 120 ? 26.546  -25.581 22.836  1.00 0.00 ? 120 LEU A HG   1  
ATOM 1847  H HD11 . LEU A 1 120 ? 26.332  -23.383 24.387  1.00 0.00 ? 120 LEU A HD11 1  
ATOM 1848  H HD12 . LEU A 1 120 ? 27.418  -24.366 25.368  1.00 0.00 ? 120 LEU A HD12 1  
ATOM 1849  H HD13 . LEU A 1 120 ? 25.843  -25.000 24.892  1.00 0.00 ? 120 LEU A HD13 1  
ATOM 1850  H HD21 . LEU A 1 120 ? 27.170  -23.994 21.419  1.00 0.00 ? 120 LEU A HD21 1  
ATOM 1851  H HD22 . LEU A 1 120 ? 28.754  -23.889 22.188  1.00 0.00 ? 120 LEU A HD22 1  
ATOM 1852  H HD23 . LEU A 1 120 ? 27.417  -22.901 22.780  1.00 0.00 ? 120 LEU A HD23 1  
ATOM 1853  N N    . GLU A 1 121 ? 31.616  -26.258 23.092  1.00 0.00 ? 121 GLU A N    1  
ATOM 1854  C CA   . GLU A 1 121 ? 32.965  -25.705 23.069  1.00 0.00 ? 121 GLU A CA   1  
ATOM 1855  C C    . GLU A 1 121 ? 33.671  -26.048 21.760  1.00 0.00 ? 121 GLU A C    1  
ATOM 1856  O O    . GLU A 1 121 ? 34.554  -25.319 21.310  1.00 0.00 ? 121 GLU A O    1  
ATOM 1857  C CB   . GLU A 1 121 ? 33.777  -26.233 24.253  1.00 0.00 ? 121 GLU A CB   1  
ATOM 1858  C CG   . GLU A 1 121 ? 33.398  -25.602 25.582  1.00 0.00 ? 121 GLU A CG   1  
ATOM 1859  C CD   . GLU A 1 121 ? 34.600  -25.340 26.468  1.00 0.00 ? 121 GLU A CD   1  
ATOM 1860  O OE1  . GLU A 1 121 ? 35.227  -24.270 26.316  1.00 0.00 ? 121 GLU A OE1  1  
ATOM 1861  O OE2  . GLU A 1 121 ? 34.915  -26.204 27.312  1.00 0.00 ? 121 GLU A OE2  1  
ATOM 1862  H H    . GLU A 1 121 ? 31.426  -27.032 23.663  1.00 0.00 ? 121 GLU A H    1  
ATOM 1863  H HA   . GLU A 1 121 ? 32.884  -24.632 23.150  1.00 0.00 ? 121 GLU A HA   1  
ATOM 1864  H HB2  . GLU A 1 121 ? 33.628  -27.300 24.329  1.00 0.00 ? 121 GLU A HB2  1  
ATOM 1865  H HB3  . GLU A 1 121 ? 34.824  -26.038 24.071  1.00 0.00 ? 121 GLU A HB3  1  
ATOM 1866  H HG2  . GLU A 1 121 ? 32.900  -24.663 25.390  1.00 0.00 ? 121 GLU A HG2  1  
ATOM 1867  H HG3  . GLU A 1 121 ? 32.723  -26.266 26.102  1.00 0.00 ? 121 GLU A HG3  1  
ATOM 1868  N N    . ALA A 1 122 ? 33.274  -27.163 21.155  1.00 0.00 ? 122 ALA A N    1  
ATOM 1869  C CA   . ALA A 1 122 ? 33.867  -27.602 19.898  1.00 0.00 ? 122 ALA A CA   1  
ATOM 1870  C C    . ALA A 1 122 ? 33.291  -26.826 18.718  1.00 0.00 ? 122 ALA A C    1  
ATOM 1871  O O    . ALA A 1 122 ? 33.882  -26.788 17.640  1.00 0.00 ? 122 ALA A O    1  
ATOM 1872  C CB   . ALA A 1 122 ? 33.650  -29.095 19.706  1.00 0.00 ? 122 ALA A CB   1  
ATOM 1873  H H    . ALA A 1 122 ? 32.565  -27.701 21.563  1.00 0.00 ? 122 ALA A H    1  
ATOM 1874  H HA   . ALA A 1 122 ? 34.931  -27.421 19.950  1.00 0.00 ? 122 ALA A HA   1  
ATOM 1875  H HB1  . ALA A 1 122 ? 33.858  -29.611 20.632  1.00 0.00 ? 122 ALA A HB1  1  
ATOM 1876  H HB2  . ALA A 1 122 ? 32.626  -29.276 19.415  1.00 0.00 ? 122 ALA A HB2  1  
ATOM 1877  H HB3  . ALA A 1 122 ? 34.313  -29.459 18.935  1.00 0.00 ? 122 ALA A HB3  1  
ATOM 1878  N N    . ALA A 1 123 ? 32.134  -26.207 18.931  1.00 0.00 ? 123 ALA A N    1  
ATOM 1879  C CA   . ALA A 1 123 ? 31.479  -25.431 17.886  1.00 0.00 ? 123 ALA A CA   1  
ATOM 1880  C C    . ALA A 1 123 ? 31.689  -23.936 18.100  1.00 0.00 ? 123 ALA A C    1  
ATOM 1881  O O    . ALA A 1 123 ? 31.437  -23.130 17.204  1.00 0.00 ? 123 ALA A O    1  
ATOM 1882  C CB   . ALA A 1 123 ? 29.993  -25.756 17.840  1.00 0.00 ? 123 ALA A CB   1  
ATOM 1883  H H    . ALA A 1 123 ? 31.711  -26.274 19.813  1.00 0.00 ? 123 ALA A H    1  
ATOM 1884  H HA   . ALA A 1 123 ? 31.914  -25.713 16.938  1.00 0.00 ? 123 ALA A HA   1  
ATOM 1885  H HB1  . ALA A 1 123 ? 29.636  -25.661 16.824  1.00 0.00 ? 123 ALA A HB1  1  
ATOM 1886  H HB2  . ALA A 1 123 ? 29.835  -26.767 18.184  1.00 0.00 ? 123 ALA A HB2  1  
ATOM 1887  H HB3  . ALA A 1 123 ? 29.455  -25.070 18.476  1.00 0.00 ? 123 ALA A HB3  1  
ATOM 1888  N N    . ALA A 1 124 ? 32.151  -23.572 19.291  1.00 0.00 ? 124 ALA A N    1  
ATOM 1889  C CA   . ALA A 1 124 ? 32.396  -22.174 19.622  1.00 0.00 ? 124 ALA A CA   1  
ATOM 1890  C C    . ALA A 1 124 ? 33.842  -21.786 19.332  1.00 0.00 ? 124 ALA A C    1  
ATOM 1891  O O    . ALA A 1 124 ? 34.161  -20.606 19.184  1.00 0.00 ? 124 ALA A O    1  
ATOM 1892  C CB   . ALA A 1 124 ? 32.059  -21.909 21.082  1.00 0.00 ? 124 ALA A CB   1  
ATOM 1893  H H    . ALA A 1 124 ? 32.333  -24.261 19.964  1.00 0.00 ? 124 ALA A H    1  
ATOM 1894  H HA   . ALA A 1 124 ? 31.742  -21.567 19.011  1.00 0.00 ? 124 ALA A HA   1  
ATOM 1895  H HB1  . ALA A 1 124 ? 32.049  -22.844 21.623  1.00 0.00 ? 124 ALA A HB1  1  
ATOM 1896  H HB2  . ALA A 1 124 ? 32.801  -21.253 21.509  1.00 0.00 ? 124 ALA A HB2  1  
ATOM 1897  H HB3  . ALA A 1 124 ? 31.086  -21.445 21.148  1.00 0.00 ? 124 ALA A HB3  1  
ATOM 1898  N N    . ARG A 1 125 ? 34.713  -22.787 19.253  1.00 0.00 ? 125 ARG A N    1  
ATOM 1899  C CA   . ARG A 1 125 ? 36.126  -22.550 18.983  1.00 0.00 ? 125 ARG A CA   1  
ATOM 1900  C C    . ARG A 1 125 ? 36.304  -21.666 17.752  1.00 0.00 ? 125 ARG A C    1  
ATOM 1901  O O    . ARG A 1 125 ? 37.264  -20.902 17.658  1.00 0.00 ? 125 ARG A O    1  
ATOM 1902  C CB   . ARG A 1 125 ? 36.858  -23.878 18.781  1.00 0.00 ? 125 ARG A CB   1  
ATOM 1903  C CG   . ARG A 1 125 ? 38.339  -23.717 18.478  1.00 0.00 ? 125 ARG A CG   1  
ATOM 1904  C CD   . ARG A 1 125 ? 39.137  -23.423 19.739  1.00 0.00 ? 125 ARG A CD   1  
ATOM 1905  N NE   . ARG A 1 125 ? 39.745  -22.096 19.705  1.00 0.00 ? 125 ARG A NE   1  
ATOM 1906  C CZ   . ARG A 1 125 ? 40.765  -21.775 18.917  1.00 0.00 ? 125 ARG A CZ   1  
ATOM 1907  N NH1  . ARG A 1 125 ? 41.288  -22.680 18.102  1.00 0.00 ? 125 ARG A NH1  1  
ATOM 1908  N NH2  . ARG A 1 125 ? 41.264  -20.546 18.943  1.00 0.00 ? 125 ARG A NH2  1  
ATOM 1909  H H    . ARG A 1 125 ? 34.398  -23.706 19.380  1.00 0.00 ? 125 ARG A H    1  
ATOM 1910  H HA   . ARG A 1 125 ? 36.547  -22.044 19.839  1.00 0.00 ? 125 ARG A HA   1  
ATOM 1911  H HB2  . ARG A 1 125 ? 36.760  -24.470 19.679  1.00 0.00 ? 125 ARG A HB2  1  
ATOM 1912  H HB3  . ARG A 1 125 ? 36.400  -24.406 17.959  1.00 0.00 ? 125 ARG A HB3  1  
ATOM 1913  H HG2  . ARG A 1 125 ? 38.708  -24.631 18.037  1.00 0.00 ? 125 ARG A HG2  1  
ATOM 1914  H HG3  . ARG A 1 125 ? 38.468  -22.901 17.783  1.00 0.00 ? 125 ARG A HG3  1  
ATOM 1915  H HD2  . ARG A 1 125 ? 38.475  -23.484 20.590  1.00 0.00 ? 125 ARG A HD2  1  
ATOM 1916  H HD3  . ARG A 1 125 ? 39.916  -24.164 19.836  1.00 0.00 ? 125 ARG A HD3  1  
ATOM 1917  H HE   . ARG A 1 125 ? 39.375  -21.412 20.300  1.00 0.00 ? 125 ARG A HE   1  
ATOM 1918  H HH11 . ARG A 1 125 ? 40.913  -23.607 18.079  1.00 0.00 ? 125 ARG A HH11 1  
ATOM 1919  H HH12 . ARG A 1 125 ? 42.055  -22.436 17.508  1.00 0.00 ? 125 ARG A HH12 1  
ATOM 1920  H HH21 . ARG A 1 125 ? 40.873  -19.860 19.557  1.00 0.00 ? 125 ARG A HH21 1  
ATOM 1921  H HH22 . ARG A 1 125 ? 42.032  -20.305 18.350  1.00 0.00 ? 125 ARG A HH22 1  
ATOM 1922  N N    . MET A 1 126 ? 35.372  -21.777 16.811  1.00 0.00 ? 126 MET A N    1  
ATOM 1923  C CA   . MET A 1 126 ? 35.426  -20.987 15.586  1.00 0.00 ? 126 MET A CA   1  
ATOM 1924  C C    . MET A 1 126 ? 34.662  -19.677 15.750  1.00 0.00 ? 126 MET A C    1  
ATOM 1925  O O    . MET A 1 126 ? 34.960  -18.686 15.082  1.00 0.00 ? 126 MET A O    1  
ATOM 1926  C CB   . MET A 1 126 ? 34.849  -21.784 14.415  1.00 0.00 ? 126 MET A CB   1  
ATOM 1927  C CG   . MET A 1 126 ? 33.367  -22.090 14.560  1.00 0.00 ? 126 MET A CG   1  
ATOM 1928  S SD   . MET A 1 126 ? 32.883  -23.603 13.705  1.00 0.00 ? 126 MET A SD   1  
ATOM 1929  C CE   . MET A 1 126 ? 33.860  -24.817 14.587  1.00 0.00 ? 126 MET A CE   1  
ATOM 1930  H H    . MET A 1 126 ? 34.630  -22.403 16.944  1.00 0.00 ? 126 MET A H    1  
ATOM 1931  H HA   . MET A 1 126 ? 36.462  -20.763 15.382  1.00 0.00 ? 126 MET A HA   1  
ATOM 1932  H HB2  . MET A 1 126 ? 34.990  -21.219 13.506  1.00 0.00 ? 126 MET A HB2  1  
ATOM 1933  H HB3  . MET A 1 126 ? 35.381  -22.720 14.334  1.00 0.00 ? 126 MET A HB3  1  
ATOM 1934  H HG2  . MET A 1 126 ? 33.135  -22.198 15.609  1.00 0.00 ? 126 MET A HG2  1  
ATOM 1935  H HG3  . MET A 1 126 ? 32.802  -21.266 14.152  1.00 0.00 ? 126 MET A HG3  1  
ATOM 1936  H HE1  . MET A 1 126 ? 33.336  -25.762 14.598  1.00 0.00 ? 126 MET A HE1  1  
ATOM 1937  H HE2  . MET A 1 126 ? 34.813  -24.940 14.094  1.00 0.00 ? 126 MET A HE2  1  
ATOM 1938  H HE3  . MET A 1 126 ? 34.019  -24.483 15.602  1.00 0.00 ? 126 MET A HE3  1  
ATOM 1939  N N    . ILE A 1 127 ? 33.677  -19.679 16.642  1.00 0.00 ? 127 ILE A N    1  
ATOM 1940  C CA   . ILE A 1 127 ? 32.873  -18.490 16.893  1.00 0.00 ? 127 ILE A CA   1  
ATOM 1941  C C    . ILE A 1 127 ? 33.631  -17.483 17.752  1.00 0.00 ? 127 ILE A C    1  
ATOM 1942  O O    . ILE A 1 127 ? 33.266  -16.310 17.820  1.00 0.00 ? 127 ILE A O    1  
ATOM 1943  C CB   . ILE A 1 127 ? 31.546  -18.845 17.590  1.00 0.00 ? 127 ILE A CB   1  
ATOM 1944  C CG1  . ILE A 1 127 ? 30.866  -20.014 16.875  1.00 0.00 ? 127 ILE A CG1  1  
ATOM 1945  C CG2  . ILE A 1 127 ? 30.627  -17.633 17.628  1.00 0.00 ? 127 ILE A CG2  1  
ATOM 1946  C CD1  . ILE A 1 127 ? 30.448  -19.694 15.457  1.00 0.00 ? 127 ILE A CD1  1  
ATOM 1947  H H    . ILE A 1 127 ? 33.488  -20.499 17.143  1.00 0.00 ? 127 ILE A H    1  
ATOM 1948  H HA   . ILE A 1 127 ? 32.645  -18.034 15.940  1.00 0.00 ? 127 ILE A HA   1  
ATOM 1949  H HB   . ILE A 1 127 ? 31.765  -19.132 18.607  1.00 0.00 ? 127 ILE A HB   1  
ATOM 1950  H HG12 . ILE A 1 127 ? 31.545  -20.850 16.840  1.00 0.00 ? 127 ILE A HG12 1  
ATOM 1951  H HG13 . ILE A 1 127 ? 29.981  -20.297 17.427  1.00 0.00 ? 127 ILE A HG13 1  
ATOM 1952  H HG21 . ILE A 1 127 ? 29.622  -17.951 17.864  1.00 0.00 ? 127 ILE A HG21 1  
ATOM 1953  H HG22 . ILE A 1 127 ? 30.971  -16.944 18.384  1.00 0.00 ? 127 ILE A HG22 1  
ATOM 1954  H HG23 . ILE A 1 127 ? 30.634  -17.145 16.665  1.00 0.00 ? 127 ILE A HG23 1  
ATOM 1955  H HD11 . ILE A 1 127 ? 29.389  -19.873 15.344  1.00 0.00 ? 127 ILE A HD11 1  
ATOM 1956  H HD12 . ILE A 1 127 ? 30.665  -18.659 15.242  1.00 0.00 ? 127 ILE A HD12 1  
ATOM 1957  H HD13 . ILE A 1 127 ? 30.994  -20.326 14.770  1.00 0.00 ? 127 ILE A HD13 1  
ATOM 1958  N N    . ALA A 1 128 ? 34.691  -17.951 18.404  1.00 0.00 ? 128 ALA A N    1  
ATOM 1959  C CA   . ALA A 1 128 ? 35.504  -17.091 19.255  1.00 0.00 ? 128 ALA A CA   1  
ATOM 1960  C C    . ALA A 1 128 ? 36.470  -16.252 18.425  1.00 0.00 ? 128 ALA A C    1  
ATOM 1961  O O    . ALA A 1 128 ? 36.920  -15.193 18.860  1.00 0.00 ? 128 ALA A O    1  
ATOM 1962  C CB   . ALA A 1 128 ? 36.268  -17.926 20.272  1.00 0.00 ? 128 ALA A CB   1  
ATOM 1963  H H    . ALA A 1 128 ? 34.932  -18.895 18.309  1.00 0.00 ? 128 ALA A H    1  
ATOM 1964  H HA   . ALA A 1 128 ? 34.840  -16.430 19.794  1.00 0.00 ? 128 ALA A HA   1  
ATOM 1965  H HB1  . ALA A 1 128 ? 36.366  -17.369 21.193  1.00 0.00 ? 128 ALA A HB1  1  
ATOM 1966  H HB2  . ALA A 1 128 ? 35.730  -18.843 20.461  1.00 0.00 ? 128 ALA A HB2  1  
ATOM 1967  H HB3  . ALA A 1 128 ? 37.249  -18.156 19.885  1.00 0.00 ? 128 ALA A HB3  1  
ATOM 1968  N N    . GLY A 1 129 ? 36.785  -16.733 17.226  1.00 0.00 ? 129 GLY A N    1  
ATOM 1969  C CA   . GLY A 1 129 ? 37.696  -16.014 16.354  1.00 0.00 ? 129 GLY A CA   1  
ATOM 1970  C C    . GLY A 1 129 ? 36.980  -15.324 15.210  1.00 0.00 ? 129 GLY A C    1  
ATOM 1971  O O    . GLY A 1 129 ? 37.613  -14.876 14.254  1.00 0.00 ? 129 GLY A O    1  
ATOM 1972  H H    . GLY A 1 129 ? 36.395  -17.582 16.931  1.00 0.00 ? 129 GLY A H    1  
ATOM 1973  H HA2  . GLY A 1 129 ? 38.223  -15.273 16.935  1.00 0.00 ? 129 GLY A HA2  1  
ATOM 1974  H HA3  . GLY A 1 129 ? 38.412  -16.713 15.946  1.00 0.00 ? 129 GLY A HA3  1  
ATOM 1975  N N    . SER A 1 130 ? 35.657  -15.239 15.306  1.00 0.00 ? 130 SER A N    1  
ATOM 1976  C CA   . SER A 1 130 ? 34.855  -14.603 14.268  1.00 0.00 ? 130 SER A CA   1  
ATOM 1977  C C    . SER A 1 130 ? 34.619  -13.131 14.590  1.00 0.00 ? 130 SER A C    1  
ATOM 1978  O O    . SER A 1 130 ? 35.094  -12.245 13.879  1.00 0.00 ? 130 SER A O    1  
ATOM 1979  C CB   . SER A 1 130 ? 33.514  -15.325 14.117  1.00 0.00 ? 130 SER A CB   1  
ATOM 1980  O OG   . SER A 1 130 ? 32.901  -15.532 15.378  1.00 0.00 ? 130 SER A OG   1  
ATOM 1981  H H    . SER A 1 130 ? 35.211  -15.616 16.094  1.00 0.00 ? 130 SER A H    1  
ATOM 1982  H HA   . SER A 1 130 ? 35.399  -14.674 13.338  1.00 0.00 ? 130 SER A HA   1  
ATOM 1983  H HB2  . SER A 1 130 ? 32.855  -14.730 13.503  1.00 0.00 ? 130 SER A HB2  1  
ATOM 1984  H HB3  . SER A 1 130 ? 33.676  -16.284 13.647  1.00 0.00 ? 130 SER A HB3  1  
ATOM 1985  H HG   . SER A 1 130 ? 31.992  -15.812 15.250  1.00 0.00 ? 130 SER A HG   1  
ATOM 1986  N N    . ALA A 1 131 ? 33.880  -12.877 15.665  1.00 0.00 ? 131 ALA A N    1  
ATOM 1987  C CA   . ALA A 1 131 ? 33.582  -11.513 16.083  1.00 0.00 ? 131 ALA A CA   1  
ATOM 1988  C C    . ALA A 1 131 ? 34.859  -10.691 16.225  1.00 0.00 ? 131 ALA A C    1  
ATOM 1989  O O    . ALA A 1 131 ? 34.837  -9.466  16.102  1.00 0.00 ? 131 ALA A O    1  
ATOM 1990  C CB   . ALA A 1 131 ? 32.808  -11.519 17.393  1.00 0.00 ? 131 ALA A CB   1  
ATOM 1991  H H    . ALA A 1 131 ? 33.529  -13.626 16.191  1.00 0.00 ? 131 ALA A H    1  
ATOM 1992  H HA   . ALA A 1 131 ? 32.958  -11.061 15.326  1.00 0.00 ? 131 ALA A HA   1  
ATOM 1993  H HB1  . ALA A 1 131 ? 32.336  -10.558 17.535  1.00 0.00 ? 131 ALA A HB1  1  
ATOM 1994  H HB2  . ALA A 1 131 ? 32.053  -12.291 17.361  1.00 0.00 ? 131 ALA A HB2  1  
ATOM 1995  H HB3  . ALA A 1 131 ? 33.486  -11.712 18.210  1.00 0.00 ? 131 ALA A HB3  1  
ATOM 1996  N N    . ARG A 1 132 ? 35.970  -11.372 16.486  1.00 0.00 ? 132 ARG A N    1  
ATOM 1997  C CA   . ARG A 1 132 ? 37.256  -10.704 16.646  1.00 0.00 ? 132 ARG A CA   1  
ATOM 1998  C C    . ARG A 1 132 ? 37.585  -9.856  15.421  1.00 0.00 ? 132 ARG A C    1  
ATOM 1999  O O    . ARG A 1 132 ? 38.379  -8.919  15.497  1.00 0.00 ? 132 ARG A O    1  
ATOM 2000  C CB   . ARG A 1 132 ? 38.363  -11.733 16.881  1.00 0.00 ? 132 ARG A CB   1  
ATOM 2001  C CG   . ARG A 1 132 ? 38.661  -12.594 15.664  1.00 0.00 ? 132 ARG A CG   1  
ATOM 2002  C CD   . ARG A 1 132 ? 39.739  -11.971 14.791  1.00 0.00 ? 132 ARG A CD   1  
ATOM 2003  N NE   . ARG A 1 132 ? 40.900  -12.846 14.646  1.00 0.00 ? 132 ARG A NE   1  
ATOM 2004  C CZ   . ARG A 1 132 ? 41.979  -12.524 13.942  1.00 0.00 ? 132 ARG A CZ   1  
ATOM 2005  N NH1  . ARG A 1 132 ? 42.046  -11.353 13.323  1.00 0.00 ? 132 ARG A NH1  1  
ATOM 2006  N NH2  . ARG A 1 132 ? 42.995  -13.373 13.858  1.00 0.00 ? 132 ARG A NH2  1  
ATOM 2007  H H    . ARG A 1 132 ? 35.924  -12.347 16.573  1.00 0.00 ? 132 ARG A H    1  
ATOM 2008  H HA   . ARG A 1 132 ? 37.188  -10.058 17.509  1.00 0.00 ? 132 ARG A HA   1  
ATOM 2009  H HB2  . ARG A 1 132 ? 39.269  -11.213 17.157  1.00 0.00 ? 132 ARG A HB2  1  
ATOM 2010  H HB3  . ARG A 1 132 ? 38.069  -12.382 17.691  1.00 0.00 ? 132 ARG A HB3  1  
ATOM 2011  H HG2  . ARG A 1 132 ? 38.999  -13.565 15.996  1.00 0.00 ? 132 ARG A HG2  1  
ATOM 2012  H HG3  . ARG A 1 132 ? 37.758  -12.705 15.083  1.00 0.00 ? 132 ARG A HG3  1  
ATOM 2013  H HD2  . ARG A 1 132 ? 39.323  -11.776 13.814  1.00 0.00 ? 132 ARG A HD2  1  
ATOM 2014  H HD3  . ARG A 1 132 ? 40.054  -11.041 15.240  1.00 0.00 ? 132 ARG A HD3  1  
ATOM 2015  H HE   . ARG A 1 132 ? 40.871  -13.716 15.096  1.00 0.00 ? 132 ARG A HE   1  
ATOM 2016  H HH11 . ARG A 1 132 ? 41.282  -10.711 13.386  1.00 0.00 ? 132 ARG A HH11 1  
ATOM 2017  H HH12 . ARG A 1 132 ? 42.861  -11.113 12.795  1.00 0.00 ? 132 ARG A HH12 1  
ATOM 2018  H HH21 . ARG A 1 132 ? 42.949  -14.256 14.323  1.00 0.00 ? 132 ARG A HH21 1  
ATOM 2019  H HH22 . ARG A 1 132 ? 43.807  -13.130 13.328  1.00 0.00 ? 132 ARG A HH22 1  
ATOM 2020  N N    . SER A 1 133 ? 36.969  -10.193 14.292  1.00 0.00 ? 133 SER A N    1  
ATOM 2021  C CA   . SER A 1 133 ? 37.200  -9.466  13.049  1.00 0.00 ? 133 SER A CA   1  
ATOM 2022  C C    . SER A 1 133 ? 36.441  -8.142  13.046  1.00 0.00 ? 133 SER A C    1  
ATOM 2023  O O    . SER A 1 133 ? 36.873  -7.169  12.428  1.00 0.00 ? 133 SER A O    1  
ATOM 2024  C CB   . SER A 1 133 ? 36.773  -10.315 11.850  1.00 0.00 ? 133 SER A CB   1  
ATOM 2025  O OG   . SER A 1 133 ? 35.369  -10.271 11.668  1.00 0.00 ? 133 SER A OG   1  
ATOM 2026  H H    . SER A 1 133 ? 36.347  -10.950 14.295  1.00 0.00 ? 133 SER A H    1  
ATOM 2027  H HA   . SER A 1 133 ? 38.258  -9.261  12.976  1.00 0.00 ? 133 SER A HA   1  
ATOM 2028  H HB2  . SER A 1 133 ? 37.252  -9.940  10.958  1.00 0.00 ? 133 SER A HB2  1  
ATOM 2029  H HB3  . SER A 1 133 ? 37.071  -11.340 12.015  1.00 0.00 ? 133 SER A HB3  1  
ATOM 2030  H HG   . SER A 1 133 ? 35.166  -10.306 10.731  1.00 0.00 ? 133 SER A HG   1  
ATOM 2031  N N    . MET A 1 134 ? 35.308  -8.115  13.740  1.00 0.00 ? 134 MET A N    1  
ATOM 2032  C CA   . MET A 1 134 ? 34.489  -6.911  13.818  1.00 0.00 ? 134 MET A CA   1  
ATOM 2033  C C    . MET A 1 134 ? 35.148  -5.862  14.709  1.00 0.00 ? 134 MET A C    1  
ATOM 2034  O O    . MET A 1 134 ? 35.412  -4.742  14.274  1.00 0.00 ? 134 MET A O    1  
ATOM 2035  C CB   . MET A 1 134 ? 33.096  -7.250  14.352  1.00 0.00 ? 134 MET A CB   1  
ATOM 2036  C CG   . MET A 1 134 ? 32.421  -8.391  13.610  1.00 0.00 ? 134 MET A CG   1  
ATOM 2037  S SD   . MET A 1 134 ? 30.627  -8.368  13.784  1.00 0.00 ? 134 MET A SD   1  
ATOM 2038  C CE   . MET A 1 134 ? 30.389  -9.652  15.010  1.00 0.00 ? 134 MET A CE   1  
ATOM 2039  H H    . MET A 1 134 ? 35.016  -8.923  14.211  1.00 0.00 ? 134 MET A H    1  
ATOM 2040  H HA   . MET A 1 134 ? 34.394  -6.510  12.820  1.00 0.00 ? 134 MET A HA   1  
ATOM 2041  H HB2  . MET A 1 134 ? 33.181  -7.525  15.393  1.00 0.00 ? 134 MET A HB2  1  
ATOM 2042  H HB3  . MET A 1 134 ? 32.469  -6.375  14.270  1.00 0.00 ? 134 MET A HB3  1  
ATOM 2043  H HG2  . MET A 1 134 ? 32.667  -8.316  12.561  1.00 0.00 ? 134 MET A HG2  1  
ATOM 2044  H HG3  . MET A 1 134 ? 32.795  -9.326  13.999  1.00 0.00 ? 134 MET A HG3  1  
ATOM 2045  H HE1  . MET A 1 134 ? 29.695  -9.307  15.762  1.00 0.00 ? 134 MET A HE1  1  
ATOM 2046  H HE2  . MET A 1 134 ? 29.993  -10.536 14.533  1.00 0.00 ? 134 MET A HE2  1  
ATOM 2047  H HE3  . MET A 1 134 ? 31.336  -9.886  15.474  1.00 0.00 ? 134 MET A HE3  1  
ATOM 2048  N N    . GLY A 1 135 ? 35.410  -6.234  15.958  1.00 0.00 ? 135 GLY A N    1  
ATOM 2049  C CA   . GLY A 1 135 ? 36.035  -5.313  16.890  1.00 0.00 ? 135 GLY A CA   1  
ATOM 2050  C C    . GLY A 1 135 ? 35.645  -5.590  18.328  1.00 0.00 ? 135 GLY A C    1  
ATOM 2051  O O    . GLY A 1 135 ? 35.433  -4.664  19.111  1.00 0.00 ? 135 GLY A O    1  
ATOM 2052  H H    . GLY A 1 135 ? 35.177  -7.140  16.249  1.00 0.00 ? 135 GLY A H    1  
ATOM 2053  H HA2  . GLY A 1 135 ? 37.108  -5.396  16.796  1.00 0.00 ? 135 GLY A HA2  1  
ATOM 2054  H HA3  . GLY A 1 135 ? 35.739  -4.306  16.637  1.00 0.00 ? 135 GLY A HA3  1  
ATOM 2055  N N    . VAL A 1 136 ? 35.548  -6.869  18.678  1.00 0.00 ? 136 VAL A N    1  
ATOM 2056  C CA   . VAL A 1 136 ? 35.180  -7.266  20.032  1.00 0.00 ? 136 VAL A CA   1  
ATOM 2057  C C    . VAL A 1 136 ? 36.331  -7.985  20.726  1.00 0.00 ? 136 VAL A C    1  
ATOM 2058  O O    . VAL A 1 136 ? 37.188  -8.579  20.072  1.00 0.00 ? 136 VAL A O    1  
ATOM 2059  C CB   . VAL A 1 136 ? 33.942  -8.183  20.031  1.00 0.00 ? 136 VAL A CB   1  
ATOM 2060  C CG1  . VAL A 1 136 ? 34.279  -9.534  19.419  1.00 0.00 ? 136 VAL A CG1  1  
ATOM 2061  C CG2  . VAL A 1 136 ? 33.400  -8.347  21.442  1.00 0.00 ? 136 VAL A CG2  1  
ATOM 2062  H H    . VAL A 1 136 ? 35.729  -7.562  18.009  1.00 0.00 ? 136 VAL A H    1  
ATOM 2063  H HA   . VAL A 1 136 ? 34.939  -6.372  20.588  1.00 0.00 ? 136 VAL A HA   1  
ATOM 2064  H HB   . VAL A 1 136 ? 33.176  -7.720  19.425  1.00 0.00 ? 136 VAL A HB   1  
ATOM 2065  H HG11 . VAL A 1 136 ? 35.118  -9.967  19.944  1.00 0.00 ? 136 VAL A HG11 1  
ATOM 2066  H HG12 . VAL A 1 136 ? 33.424  -10.190 19.501  1.00 0.00 ? 136 VAL A HG12 1  
ATOM 2067  H HG13 . VAL A 1 136 ? 34.535  -9.404  18.378  1.00 0.00 ? 136 VAL A HG13 1  
ATOM 2068  H HG21 . VAL A 1 136 ? 34.030  -9.031  21.992  1.00 0.00 ? 136 VAL A HG21 1  
ATOM 2069  H HG22 . VAL A 1 136 ? 33.392  -7.387  21.939  1.00 0.00 ? 136 VAL A HG22 1  
ATOM 2070  H HG23 . VAL A 1 136 ? 32.395  -8.738  21.400  1.00 0.00 ? 136 VAL A HG23 1  
ATOM 2071  N N    . GLU A 1 137 ? 36.342  -7.928  22.054  1.00 0.00 ? 137 GLU A N    1  
ATOM 2072  C CA   . GLU A 1 137 ? 37.389  -8.575  22.836  1.00 0.00 ? 137 GLU A CA   1  
ATOM 2073  C C    . GLU A 1 137 ? 36.870  -9.854  23.487  1.00 0.00 ? 137 GLU A C    1  
ATOM 2074  O O    . GLU A 1 137 ? 36.087  -9.809  24.435  1.00 0.00 ? 137 GLU A O    1  
ATOM 2075  C CB   . GLU A 1 137 ? 37.916  -7.621  23.911  1.00 0.00 ? 137 GLU A CB   1  
ATOM 2076  C CG   . GLU A 1 137 ? 39.432  -7.568  23.986  1.00 0.00 ? 137 GLU A CG   1  
ATOM 2077  C CD   . GLU A 1 137 ? 39.937  -6.336  24.713  1.00 0.00 ? 137 GLU A CD   1  
ATOM 2078  O OE1  . GLU A 1 137 ? 39.251  -5.294  24.660  1.00 0.00 ? 137 GLU A OE1  1  
ATOM 2079  O OE2  . GLU A 1 137 ? 41.017  -6.415  25.335  1.00 0.00 ? 137 GLU A OE2  1  
ATOM 2080  H H    . GLU A 1 137 ? 35.630  -7.440  22.518  1.00 0.00 ? 137 GLU A H    1  
ATOM 2081  H HA   . GLU A 1 137 ? 38.196  -8.828  22.166  1.00 0.00 ? 137 GLU A HA   1  
ATOM 2082  H HB2  . GLU A 1 137 ? 37.551  -6.626  23.702  1.00 0.00 ? 137 GLU A HB2  1  
ATOM 2083  H HB3  . GLU A 1 137 ? 37.539  -7.939  24.872  1.00 0.00 ? 137 GLU A HB3  1  
ATOM 2084  H HG2  . GLU A 1 137 ? 39.785  -8.445  24.508  1.00 0.00 ? 137 GLU A HG2  1  
ATOM 2085  H HG3  . GLU A 1 137 ? 39.830  -7.564  22.982  1.00 0.00 ? 137 GLU A HG3  1  
ATOM 2086  N N    . VAL A 1 138 ? 37.313  -10.996 22.968  1.00 0.00 ? 138 VAL A N    1  
ATOM 2087  C CA   . VAL A 1 138 ? 36.895  -12.288 23.498  1.00 0.00 ? 138 VAL A CA   1  
ATOM 2088  C C    . VAL A 1 138 ? 37.479  -12.529 24.885  1.00 0.00 ? 138 VAL A C    1  
ATOM 2089  O O    . VAL A 1 138 ? 38.678  -12.356 25.104  1.00 0.00 ? 138 VAL A O    1  
ATOM 2090  C CB   . VAL A 1 138 ? 37.320  -13.440 22.567  1.00 0.00 ? 138 VAL A CB   1  
ATOM 2091  C CG1  . VAL A 1 138 ? 36.872  -14.778 23.134  1.00 0.00 ? 138 VAL A CG1  1  
ATOM 2092  C CG2  . VAL A 1 138 ? 36.759  -13.229 21.169  1.00 0.00 ? 138 VAL A CG2  1  
ATOM 2093  H H    . VAL A 1 138 ? 37.936  -10.967 22.213  1.00 0.00 ? 138 VAL A H    1  
ATOM 2094  H HA   . VAL A 1 138 ? 35.817  -12.288 23.567  1.00 0.00 ? 138 VAL A HA   1  
ATOM 2095  H HB   . VAL A 1 138 ? 38.398  -13.444 22.502  1.00 0.00 ? 138 VAL A HB   1  
ATOM 2096  H HG11 . VAL A 1 138 ? 35.797  -14.783 23.237  1.00 0.00 ? 138 VAL A HG11 1  
ATOM 2097  H HG12 . VAL A 1 138 ? 37.175  -15.572 22.467  1.00 0.00 ? 138 VAL A HG12 1  
ATOM 2098  H HG13 . VAL A 1 138 ? 37.326  -14.928 24.103  1.00 0.00 ? 138 VAL A HG13 1  
ATOM 2099  H HG21 . VAL A 1 138 ? 37.573  -13.135 20.466  1.00 0.00 ? 138 VAL A HG21 1  
ATOM 2100  H HG22 . VAL A 1 138 ? 36.144  -14.075 20.896  1.00 0.00 ? 138 VAL A HG22 1  
ATOM 2101  H HG23 . VAL A 1 138 ? 36.161  -12.330 21.152  1.00 0.00 ? 138 VAL A HG23 1  
ATOM 2102  N N    . VAL A 1 139 ? 36.623  -12.929 25.820  1.00 0.00 ? 139 VAL A N    1  
ATOM 2103  C CA   . VAL A 1 139 ? 37.054  -13.195 27.188  1.00 0.00 ? 139 VAL A CA   1  
ATOM 2104  C C    . VAL A 1 139 ? 36.311  -14.390 27.775  1.00 0.00 ? 139 VAL A C    1  
ATOM 2105  O O    . VAL A 1 139 ? 35.132  -14.600 27.494  1.00 0.00 ? 139 VAL A O    1  
ATOM 2106  C CB   . VAL A 1 139 ? 36.834  -11.970 28.094  1.00 0.00 ? 139 VAL A CB   1  
ATOM 2107  C CG1  . VAL A 1 139 ? 37.160  -12.310 29.541  1.00 0.00 ? 139 VAL A CG1  1  
ATOM 2108  C CG2  . VAL A 1 139 ? 37.670  -10.794 27.613  1.00 0.00 ? 139 VAL A CG2  1  
ATOM 2109  H H    . VAL A 1 139 ? 35.680  -13.049 25.585  1.00 0.00 ? 139 VAL A H    1  
ATOM 2110  H HA   . VAL A 1 139 ? 38.112  -13.416 27.167  1.00 0.00 ? 139 VAL A HA   1  
ATOM 2111  H HB   . VAL A 1 139 ? 35.792  -11.691 28.040  1.00 0.00 ? 139 VAL A HB   1  
ATOM 2112  H HG11 . VAL A 1 139 ? 37.131  -11.410 30.137  1.00 0.00 ? 139 VAL A HG11 1  
ATOM 2113  H HG12 . VAL A 1 139 ? 36.434  -13.017 29.917  1.00 0.00 ? 139 VAL A HG12 1  
ATOM 2114  H HG13 . VAL A 1 139 ? 38.147  -12.745 29.594  1.00 0.00 ? 139 VAL A HG13 1  
ATOM 2115  H HG21 . VAL A 1 139 ? 37.798  -10.090 28.422  1.00 0.00 ? 139 VAL A HG21 1  
ATOM 2116  H HG22 . VAL A 1 139 ? 38.637  -11.149 27.288  1.00 0.00 ? 139 VAL A HG22 1  
ATOM 2117  H HG23 . VAL A 1 139 ? 37.169  -10.309 26.789  1.00 0.00 ? 139 VAL A HG23 1  
ATOM 2118  N N    . GLY A 1 140 ? 37.010  -15.170 28.595  1.00 0.00 ? 140 GLY A N    1  
ATOM 2119  C CA   . GLY A 1 140 ? 36.400  -16.334 29.210  1.00 0.00 ? 140 GLY A CA   1  
ATOM 2120  C C    . GLY A 1 140 ? 36.789  -17.626 28.520  1.00 0.00 ? 140 GLY A C    1  
ATOM 2121  O O    . GLY A 1 140 ? 36.192  -18.673 28.766  1.00 0.00 ? 140 GLY A O    1  
ATOM 2122  H H    . GLY A 1 140 ? 37.947  -14.953 28.783  1.00 0.00 ? 140 GLY A H    1  
ATOM 2123  H HA2  . GLY A 1 140 ? 36.707  -16.384 30.244  1.00 0.00 ? 140 GLY A HA2  1  
ATOM 2124  H HA3  . GLY A 1 140 ? 35.325  -16.227 29.169  1.00 0.00 ? 140 GLY A HA3  1  
ATOM 2125  N N    . ALA A 1 141 ? 37.792  -17.552 27.651  1.00 0.00 ? 141 ALA A N    1  
ATOM 2126  C CA   . ALA A 1 141 ? 38.261  -18.724 26.923  1.00 0.00 ? 141 ALA A CA   1  
ATOM 2127  C C    . ALA A 1 141 ? 39.690  -19.081 27.318  1.00 0.00 ? 141 ALA A C    1  
ATOM 2128  O O    . ALA A 1 141 ? 40.639  -18.866 26.565  1.00 0.00 ? 141 ALA A O    1  
ATOM 2129  C CB   . ALA A 1 141 ? 38.169  -18.486 25.423  1.00 0.00 ? 141 ALA A CB   1  
ATOM 2130  H H    . ALA A 1 141 ? 38.229  -16.688 27.498  1.00 0.00 ? 141 ALA A H    1  
ATOM 2131  H HA   . ALA A 1 141 ? 37.612  -19.552 27.171  1.00 0.00 ? 141 ALA A HA   1  
ATOM 2132  H HB1  . ALA A 1 141 ? 39.070  -17.998 25.082  1.00 0.00 ? 141 ALA A HB1  1  
ATOM 2133  H HB2  . ALA A 1 141 ? 38.056  -19.432 24.915  1.00 0.00 ? 141 ALA A HB2  1  
ATOM 2134  H HB3  . ALA A 1 141 ? 37.317  -17.858 25.210  1.00 0.00 ? 141 ALA A HB3  1  
ATOM 2135  N N    . PRO A 1 142 ? 39.849  -19.639 28.527  1.00 0.00 ? 142 PRO A N    1  
ATOM 2136  C CA   . PRO A 1 142 ? 41.159  -20.037 29.049  1.00 0.00 ? 142 PRO A CA   1  
ATOM 2137  C C    . PRO A 1 142 ? 41.737  -21.239 28.310  1.00 0.00 ? 142 PRO A C    1  
ATOM 2138  O O    . PRO A 1 142 ? 41.181  -21.688 27.308  1.00 0.00 ? 142 PRO A O    1  
ATOM 2139  C CB   . PRO A 1 142 ? 40.866  -20.396 30.508  1.00 0.00 ? 142 PRO A CB   1  
ATOM 2140  C CG   . PRO A 1 142 ? 39.426  -20.779 30.522  1.00 0.00 ? 142 PRO A CG   1  
ATOM 2141  C CD   . PRO A 1 142 ? 38.761  -19.925 29.478  1.00 0.00 ? 142 PRO A CD   1  
ATOM 2142  H HA   . PRO A 1 142 ? 41.865  -19.221 29.013  1.00 0.00 ? 142 PRO A HA   1  
ATOM 2143  H HB2  . PRO A 1 142 ? 41.497  -21.219 30.813  1.00 0.00 ? 142 PRO A HB2  1  
ATOM 2144  H HB3  . PRO A 1 142 ? 41.053  -19.540 31.138  1.00 0.00 ? 142 PRO A HB3  1  
ATOM 2145  H HG2  . PRO A 1 142 ? 39.321  -21.824 30.274  1.00 0.00 ? 142 PRO A HG2  1  
ATOM 2146  H HG3  . PRO A 1 142 ? 39.003  -20.578 31.495  1.00 0.00 ? 142 PRO A HG3  1  
ATOM 2147  H HD2  . PRO A 1 142 ? 37.962  -20.470 28.998  1.00 0.00 ? 142 PRO A HD2  1  
ATOM 2148  H HD3  . PRO A 1 142 ? 38.386  -19.013 29.919  1.00 0.00 ? 142 PRO A HD3  1  
ATOM 2149  N N    . GLU A 1 143 ? 42.854  -21.756 28.812  1.00 0.00 ? 143 GLU A N    1  
ATOM 2150  C CA   . GLU A 1 143 ? 43.506  -22.907 28.198  1.00 0.00 ? 143 GLU A CA   1  
ATOM 2151  C C    . GLU A 1 143 ? 42.553  -24.097 28.125  1.00 0.00 ? 143 GLU A C    1  
ATOM 2152  O O    . GLU A 1 143 ? 42.357  -24.810 29.109  1.00 0.00 ? 143 GLU A O    1  
ATOM 2153  C CB   . GLU A 1 143 ? 44.760  -23.291 28.986  1.00 0.00 ? 143 GLU A CB   1  
ATOM 2154  C CG   . GLU A 1 143 ? 44.519  -23.443 30.478  1.00 0.00 ? 143 GLU A CG   1  
ATOM 2155  C CD   . GLU A 1 143 ? 44.938  -24.803 31.002  1.00 0.00 ? 143 GLU A CD   1  
ATOM 2156  O OE1  . GLU A 1 143 ? 44.599  -25.816 30.356  1.00 0.00 ? 143 GLU A OE1  1  
ATOM 2157  O OE2  . GLU A 1 143 ? 45.604  -24.854 32.057  1.00 0.00 ? 143 GLU A OE2  1  
ATOM 2158  H H    . GLU A 1 143 ? 43.249  -21.354 29.614  1.00 0.00 ? 143 GLU A H    1  
ATOM 2159  H HA   . GLU A 1 143 ? 43.793  -22.629 27.195  1.00 0.00 ? 143 GLU A HA   1  
ATOM 2160  H HB2  . GLU A 1 143 ? 45.136  -24.229 28.605  1.00 0.00 ? 143 GLU A HB2  1  
ATOM 2161  H HB3  . GLU A 1 143 ? 45.510  -22.527 28.839  1.00 0.00 ? 143 GLU A HB3  1  
ATOM 2162  H HG2  . GLU A 1 143 ? 45.084  -22.684 31.000  1.00 0.00 ? 143 GLU A HG2  1  
ATOM 2163  H HG3  . GLU A 1 143 ? 43.466  -23.306 30.676  1.00 0.00 ? 143 GLU A HG3  1  
ATOM 2164  N N    . VAL A 1 144 ? 41.964  -24.305 26.952  1.00 0.00 ? 144 VAL A N    1  
ATOM 2165  C CA   . VAL A 1 144 ? 41.033  -25.408 26.749  1.00 0.00 ? 144 VAL A CA   1  
ATOM 2166  C C    . VAL A 1 144 ? 41.695  -26.748 27.047  1.00 0.00 ? 144 VAL A C    1  
ATOM 2167  O O    . VAL A 1 144 ? 42.869  -26.806 27.414  1.00 0.00 ? 144 VAL A O    1  
ATOM 2168  C CB   . VAL A 1 144 ? 40.488  -25.425 25.308  1.00 0.00 ? 144 VAL A CB   1  
ATOM 2169  C CG1  . VAL A 1 144 ? 39.470  -24.314 25.109  1.00 0.00 ? 144 VAL A CG1  1  
ATOM 2170  C CG2  . VAL A 1 144 ? 41.627  -25.302 24.308  1.00 0.00 ? 144 VAL A CG2  1  
ATOM 2171  H H    . VAL A 1 144 ? 42.161  -23.702 26.205  1.00 0.00 ? 144 VAL A H    1  
ATOM 2172  H HA   . VAL A 1 144 ? 40.200  -25.271 27.424  1.00 0.00 ? 144 VAL A HA   1  
ATOM 2173  H HB   . VAL A 1 144 ? 39.993  -26.371 25.144  1.00 0.00 ? 144 VAL A HB   1  
ATOM 2174  H HG11 . VAL A 1 144 ? 38.645  -24.684 24.518  1.00 0.00 ? 144 VAL A HG11 1  
ATOM 2175  H HG12 . VAL A 1 144 ? 39.106  -23.982 26.070  1.00 0.00 ? 144 VAL A HG12 1  
ATOM 2176  H HG13 . VAL A 1 144 ? 39.937  -23.486 24.595  1.00 0.00 ? 144 VAL A HG13 1  
ATOM 2177  H HG21 . VAL A 1 144 ? 41.835  -24.258 24.126  1.00 0.00 ? 144 VAL A HG21 1  
ATOM 2178  H HG22 . VAL A 1 144 ? 42.511  -25.780 24.706  1.00 0.00 ? 144 VAL A HG22 1  
ATOM 2179  H HG23 . VAL A 1 144 ? 41.347  -25.781 23.381  1.00 0.00 ? 144 VAL A HG23 1  
ATOM 2180  N N    . LYS A 1 145 ? 40.935  -27.826 26.886  1.00 0.00 ? 145 LYS A N    1  
ATOM 2181  C CA   . LYS A 1 145 ? 41.448  -29.169 27.135  1.00 0.00 ? 145 LYS A CA   1  
ATOM 2182  C C    . LYS A 1 145 ? 41.056  -30.119 26.008  1.00 0.00 ? 145 LYS A C    1  
ATOM 2183  O O    . LYS A 1 145 ? 39.898  -30.159 25.591  1.00 0.00 ? 145 LYS A O    1  
ATOM 2184  C CB   . LYS A 1 145 ? 40.919  -29.699 28.470  1.00 0.00 ? 145 LYS A CB   1  
ATOM 2185  C CG   . LYS A 1 145 ? 41.783  -30.792 29.075  1.00 0.00 ? 145 LYS A CG   1  
ATOM 2186  C CD   . LYS A 1 145 ? 41.129  -31.405 30.302  1.00 0.00 ? 145 LYS A CD   1  
ATOM 2187  C CE   . LYS A 1 145 ? 42.161  -31.798 31.346  1.00 0.00 ? 145 LYS A CE   1  
ATOM 2188  N NZ   . LYS A 1 145 ? 42.468  -33.255 31.302  1.00 0.00 ? 145 LYS A NZ   1  
ATOM 2189  H H    . LYS A 1 145 ? 40.006  -27.717 26.591  1.00 0.00 ? 145 LYS A H    1  
ATOM 2190  H HA   . LYS A 1 145 ? 42.524  -29.109 27.182  1.00 0.00 ? 145 LYS A HA   1  
ATOM 2191  H HB2  . LYS A 1 145 ? 40.866  -28.881 29.173  1.00 0.00 ? 145 LYS A HB2  1  
ATOM 2192  H HB3  . LYS A 1 145 ? 39.926  -30.097 28.317  1.00 0.00 ? 145 LYS A HB3  1  
ATOM 2193  H HG2  . LYS A 1 145 ? 41.938  -31.566 28.338  1.00 0.00 ? 145 LYS A HG2  1  
ATOM 2194  H HG3  . LYS A 1 145 ? 42.736  -30.368 29.360  1.00 0.00 ? 145 LYS A HG3  1  
ATOM 2195  H HD2  . LYS A 1 145 ? 40.451  -30.685 30.735  1.00 0.00 ? 145 LYS A HD2  1  
ATOM 2196  H HD3  . LYS A 1 145 ? 40.578  -32.286 30.003  1.00 0.00 ? 145 LYS A HD3  1  
ATOM 2197  H HE2  . LYS A 1 145 ? 43.069  -31.243 31.164  1.00 0.00 ? 145 LYS A HE2  1  
ATOM 2198  H HE3  . LYS A 1 145 ? 41.777  -31.549 32.325  1.00 0.00 ? 145 LYS A HE3  1  
ATOM 2199  H HZ1  . LYS A 1 145 ? 42.661  -33.550 30.323  1.00 0.00 ? 145 LYS A HZ1  1  
ATOM 2200  H HZ2  . LYS A 1 145 ? 41.660  -33.801 31.664  1.00 0.00 ? 145 LYS A HZ2  1  
ATOM 2201  H HZ3  . LYS A 1 145 ? 43.303  -33.463 31.886  1.00 0.00 ? 145 LYS A HZ3  1  
ATOM 2202  N N    . ASP A 1 146 ? 42.027  -30.882 25.520  1.00 0.00 ? 146 ASP A N    1  
ATOM 2203  C CA   . ASP A 1 146 ? 41.783  -31.834 24.442  1.00 0.00 ? 146 ASP A CA   1  
ATOM 2204  C C    . ASP A 1 146 ? 42.416  -33.186 24.757  1.00 0.00 ? 146 ASP A C    1  
ATOM 2205  O O    . ASP A 1 146 ? 43.607  -33.393 24.526  1.00 0.00 ? 146 ASP A O    1  
ATOM 2206  C CB   . ASP A 1 146 ? 42.333  -31.294 23.121  1.00 0.00 ? 146 ASP A CB   1  
ATOM 2207  C CG   . ASP A 1 146 ? 41.509  -31.735 21.927  1.00 0.00 ? 146 ASP A CG   1  
ATOM 2208  O OD1  . ASP A 1 146 ? 40.877  -32.809 22.006  1.00 0.00 ? 146 ASP A OD1  1  
ATOM 2209  O OD2  . ASP A 1 146 ? 41.496  -31.005 20.915  1.00 0.00 ? 146 ASP A OD2  1  
ATOM 2210  H H    . ASP A 1 146 ? 42.930  -30.805 25.893  1.00 0.00 ? 146 ASP A H    1  
ATOM 2211  H HA   . ASP A 1 146 ? 40.715  -31.964 24.350  1.00 0.00 ? 146 ASP A HA   1  
ATOM 2212  H HB2  . ASP A 1 146 ? 42.336  -30.215 23.154  1.00 0.00 ? 146 ASP A HB2  1  
ATOM 2213  H HB3  . ASP A 1 146 ? 43.345  -31.649 22.989  1.00 0.00 ? 146 ASP A HB3  1  
ATOM 2214  N N    . ALA A 1 147 ? 41.611  -34.102 25.286  1.00 0.00 ? 147 ALA A N    1  
ATOM 2215  C CA   . ALA A 1 147 ? 42.093  -35.433 25.632  1.00 0.00 ? 147 ALA A CA   1  
ATOM 2216  C C    . ALA A 1 147 ? 43.264  -35.358 26.605  1.00 0.00 ? 147 ALA A C    1  
ATOM 2217  O O    . ALA A 1 147 ? 43.976  -36.342 26.812  1.00 0.00 ? 147 ALA A O    1  
ATOM 2218  C CB   . ALA A 1 147 ? 42.495  -36.192 24.376  1.00 0.00 ? 147 ALA A CB   1  
ATOM 2219  H H    . ALA A 1 147 ? 40.671  -33.877 25.447  1.00 0.00 ? 147 ALA A H    1  
ATOM 2220  H HA   . ALA A 1 147 ? 41.281  -35.970 26.102  1.00 0.00 ? 147 ALA A HA   1  
ATOM 2221  H HB1  . ALA A 1 147 ? 43.500  -36.571 24.492  1.00 0.00 ? 147 ALA A HB1  1  
ATOM 2222  H HB2  . ALA A 1 147 ? 41.815  -37.015 24.220  1.00 0.00 ? 147 ALA A HB2  1  
ATOM 2223  H HB3  . ALA A 1 147 ? 42.458  -35.526 23.527  1.00 0.00 ? 147 ALA A HB3  1  
ATOM 2224  N N    . MET A 1 1   ? 14.323  -35.729 -17.554 1.00 0.00 ? 1   MET A N    2  
ATOM 2225  C CA   . MET A 1 1   ? 13.957  -34.519 -18.282 1.00 0.00 ? 1   MET A CA   2  
ATOM 2226  C C    . MET A 1 1   ? 14.458  -33.275 -17.555 1.00 0.00 ? 1   MET A C    2  
ATOM 2227  O O    . MET A 1 1   ? 14.804  -32.274 -18.183 1.00 0.00 ? 1   MET A O    2  
ATOM 2228  C CB   . MET A 1 1   ? 12.439  -34.445 -18.458 1.00 0.00 ? 1   MET A CB   2  
ATOM 2229  C CG   . MET A 1 1   ? 11.965  -34.885 -19.834 1.00 0.00 ? 1   MET A CG   2  
ATOM 2230  S SD   . MET A 1 1   ? 12.437  -36.582 -20.221 1.00 0.00 ? 1   MET A SD   2  
ATOM 2231  C CE   . MET A 1 1   ? 13.550  -36.317 -21.600 1.00 0.00 ? 1   MET A CE   2  
ATOM 2232  H H1   . MET A 1 1   ? 13.827  -35.967 -16.743 1.00 0.00 ? 1   MET A H1   2  
ATOM 2233  H HA   . MET A 1 1   ? 14.421  -34.565 -19.255 1.00 0.00 ? 1   MET A HA   2  
ATOM 2234  H HB2  . MET A 1 1   ? 11.971  -35.078 -17.720 1.00 0.00 ? 1   MET A HB2  2  
ATOM 2235  H HB3  . MET A 1 1   ? 12.119  -33.425 -18.301 1.00 0.00 ? 1   MET A HB3  2  
ATOM 2236  H HG2  . MET A 1 1   ? 10.888  -34.810 -19.870 1.00 0.00 ? 1   MET A HG2  2  
ATOM 2237  H HG3  . MET A 1 1   ? 12.394  -34.228 -20.575 1.00 0.00 ? 1   MET A HG3  2  
ATOM 2238  H HE1  . MET A 1 1   ? 13.167  -36.822 -22.474 1.00 0.00 ? 1   MET A HE1  2  
ATOM 2239  H HE2  . MET A 1 1   ? 13.627  -35.259 -21.801 1.00 0.00 ? 1   MET A HE2  2  
ATOM 2240  H HE3  . MET A 1 1   ? 14.526  -36.710 -21.355 1.00 0.00 ? 1   MET A HE3  2  
ATOM 2241  N N    . LYS A 1 2   ? 14.493  -33.344 -16.229 1.00 0.00 ? 2   LYS A N    2  
ATOM 2242  C CA   . LYS A 1 2   ? 14.952  -32.224 -15.416 1.00 0.00 ? 2   LYS A CA   2  
ATOM 2243  C C    . LYS A 1 2   ? 16.367  -31.810 -15.809 1.00 0.00 ? 2   LYS A C    2  
ATOM 2244  O O    . LYS A 1 2   ? 17.342  -32.459 -15.430 1.00 0.00 ? 2   LYS A O    2  
ATOM 2245  C CB   . LYS A 1 2   ? 14.911  -32.593 -13.932 1.00 0.00 ? 2   LYS A CB   2  
ATOM 2246  C CG   . LYS A 1 2   ? 15.609  -33.904 -13.612 1.00 0.00 ? 2   LYS A CG   2  
ATOM 2247  C CD   . LYS A 1 2   ? 14.672  -34.879 -12.919 1.00 0.00 ? 2   LYS A CD   2  
ATOM 2248  C CE   . LYS A 1 2   ? 14.812  -34.807 -11.406 1.00 0.00 ? 2   LYS A CE   2  
ATOM 2249  N NZ   . LYS A 1 2   ? 15.566  -35.970 -10.862 1.00 0.00 ? 2   LYS A NZ   2  
ATOM 2250  H H    . LYS A 1 2   ? 14.203  -34.169 -15.785 1.00 0.00 ? 2   LYS A H    2  
ATOM 2251  H HA   . LYS A 1 2   ? 14.286  -31.392 -15.590 1.00 0.00 ? 2   LYS A HA   2  
ATOM 2252  H HB2  . LYS A 1 2   ? 15.388  -31.808 -13.364 1.00 0.00 ? 2   LYS A HB2  2  
ATOM 2253  H HB3  . LYS A 1 2   ? 13.879  -32.674 -13.622 1.00 0.00 ? 2   LYS A HB3  2  
ATOM 2254  H HG2  . LYS A 1 2   ? 15.959  -34.349 -14.531 1.00 0.00 ? 2   LYS A HG2  2  
ATOM 2255  H HG3  . LYS A 1 2   ? 16.450  -33.704 -12.963 1.00 0.00 ? 2   LYS A HG3  2  
ATOM 2256  H HD2  . LYS A 1 2   ? 13.654  -34.640 -13.187 1.00 0.00 ? 2   LYS A HD2  2  
ATOM 2257  H HD3  . LYS A 1 2   ? 14.906  -35.883 -13.246 1.00 0.00 ? 2   LYS A HD3  2  
ATOM 2258  H HE2  . LYS A 1 2   ? 15.333  -33.898 -11.149 1.00 0.00 ? 2   LYS A HE2  2  
ATOM 2259  H HE3  . LYS A 1 2   ? 13.825  -34.792 -10.967 1.00 0.00 ? 2   LYS A HE3  2  
ATOM 2260  H HZ1  . LYS A 1 2   ? 15.576  -35.934 -9.823  1.00 0.00 ? 2   LYS A HZ1  2  
ATOM 2261  H HZ2  . LYS A 1 2   ? 16.547  -35.952 -11.207 1.00 0.00 ? 2   LYS A HZ2  2  
ATOM 2262  H HZ3  . LYS A 1 2   ? 15.120  -36.859 -11.164 1.00 0.00 ? 2   LYS A HZ3  2  
ATOM 2263  N N    . LYS A 1 3   ? 16.472  -30.726 -16.570 1.00 0.00 ? 3   LYS A N    2  
ATOM 2264  C CA   . LYS A 1 3   ? 17.767  -30.224 -17.012 1.00 0.00 ? 3   LYS A CA   2  
ATOM 2265  C C    . LYS A 1 3   ? 17.926  -28.747 -16.664 1.00 0.00 ? 3   LYS A C    2  
ATOM 2266  O O    . LYS A 1 3   ? 17.018  -27.946 -16.884 1.00 0.00 ? 3   LYS A O    2  
ATOM 2267  C CB   . LYS A 1 3   ? 17.926  -30.423 -18.521 1.00 0.00 ? 3   LYS A CB   2  
ATOM 2268  C CG   . LYS A 1 3   ? 19.241  -31.075 -18.914 1.00 0.00 ? 3   LYS A CG   2  
ATOM 2269  C CD   . LYS A 1 3   ? 19.675  -30.658 -20.309 1.00 0.00 ? 3   LYS A CD   2  
ATOM 2270  C CE   . LYS A 1 3   ? 21.177  -30.428 -20.379 1.00 0.00 ? 3   LYS A CE   2  
ATOM 2271  N NZ   . LYS A 1 3   ? 21.689  -30.527 -21.774 1.00 0.00 ? 3   LYS A NZ   2  
ATOM 2272  H H    . LYS A 1 3   ? 15.658  -30.251 -16.840 1.00 0.00 ? 3   LYS A H    2  
ATOM 2273  H HA   . LYS A 1 3   ? 18.534  -30.787 -16.501 1.00 0.00 ? 3   LYS A HA   2  
ATOM 2274  H HB2  . LYS A 1 3   ? 17.119  -31.046 -18.877 1.00 0.00 ? 3   LYS A HB2  2  
ATOM 2275  H HB3  . LYS A 1 3   ? 17.867  -29.460 -19.007 1.00 0.00 ? 3   LYS A HB3  2  
ATOM 2276  H HG2  . LYS A 1 3   ? 20.003  -30.781 -18.208 1.00 0.00 ? 3   LYS A HG2  2  
ATOM 2277  H HG3  . LYS A 1 3   ? 19.120  -32.149 -18.890 1.00 0.00 ? 3   LYS A HG3  2  
ATOM 2278  H HD2  . LYS A 1 3   ? 19.409  -31.438 -21.007 1.00 0.00 ? 3   LYS A HD2  2  
ATOM 2279  H HD3  . LYS A 1 3   ? 19.166  -29.743 -20.577 1.00 0.00 ? 3   LYS A HD3  2  
ATOM 2280  H HE2  . LYS A 1 3   ? 21.396  -29.444 -19.994 1.00 0.00 ? 3   LYS A HE2  2  
ATOM 2281  H HE3  . LYS A 1 3   ? 21.671  -31.170 -19.770 1.00 0.00 ? 3   LYS A HE3  2  
ATOM 2282  H HZ1  . LYS A 1 3   ? 21.481  -31.469 -22.164 1.00 0.00 ? 3   LYS A HZ1  2  
ATOM 2283  H HZ2  . LYS A 1 3   ? 22.718  -30.378 -21.789 1.00 0.00 ? 3   LYS A HZ2  2  
ATOM 2284  H HZ3  . LYS A 1 3   ? 21.236  -29.808 -22.373 1.00 0.00 ? 3   LYS A HZ3  2  
ATOM 2285  N N    . VAL A 1 4   ? 19.087  -28.394 -16.120 1.00 0.00 ? 4   VAL A N    2  
ATOM 2286  C CA   . VAL A 1 4   ? 19.365  -27.013 -15.744 1.00 0.00 ? 4   VAL A CA   2  
ATOM 2287  C C    . VAL A 1 4   ? 19.668  -26.160 -16.971 1.00 0.00 ? 4   VAL A C    2  
ATOM 2288  O O    . VAL A 1 4   ? 20.772  -25.635 -17.119 1.00 0.00 ? 4   VAL A O    2  
ATOM 2289  C CB   . VAL A 1 4   ? 20.552  -26.926 -14.766 1.00 0.00 ? 4   VAL A CB   2  
ATOM 2290  C CG1  . VAL A 1 4   ? 20.620  -25.546 -14.130 1.00 0.00 ? 4   VAL A CG1  2  
ATOM 2291  C CG2  . VAL A 1 4   ? 20.446  -28.008 -13.703 1.00 0.00 ? 4   VAL A CG2  2  
ATOM 2292  H H    . VAL A 1 4   ? 19.772  -29.078 -15.970 1.00 0.00 ? 4   VAL A H    2  
ATOM 2293  H HA   . VAL A 1 4   ? 18.489  -26.618 -15.250 1.00 0.00 ? 4   VAL A HA   2  
ATOM 2294  H HB   . VAL A 1 4   ? 21.464  -27.086 -15.323 1.00 0.00 ? 4   VAL A HB   2  
ATOM 2295  H HG11 . VAL A 1 4   ? 19.626  -25.125 -14.077 1.00 0.00 ? 4   VAL A HG11 2  
ATOM 2296  H HG12 . VAL A 1 4   ? 21.031  -25.629 -13.134 1.00 0.00 ? 4   VAL A HG12 2  
ATOM 2297  H HG13 . VAL A 1 4   ? 21.250  -24.905 -14.728 1.00 0.00 ? 4   VAL A HG13 2  
ATOM 2298  H HG21 . VAL A 1 4   ? 20.664  -27.583 -12.735 1.00 0.00 ? 4   VAL A HG21 2  
ATOM 2299  H HG22 . VAL A 1 4   ? 19.444  -28.414 -13.700 1.00 0.00 ? 4   VAL A HG22 2  
ATOM 2300  H HG23 . VAL A 1 4   ? 21.152  -28.796 -13.918 1.00 0.00 ? 4   VAL A HG23 2  
ATOM 2301  N N    . VAL A 1 5   ? 18.680  -26.024 -17.849 1.00 0.00 ? 5   VAL A N    2  
ATOM 2302  C CA   . VAL A 1 5   ? 18.839  -25.232 -19.063 1.00 0.00 ? 5   VAL A CA   2  
ATOM 2303  C C    . VAL A 1 5   ? 19.530  -23.906 -18.768 1.00 0.00 ? 5   VAL A C    2  
ATOM 2304  O O    . VAL A 1 5   ? 20.406  -23.471 -19.514 1.00 0.00 ? 5   VAL A O    2  
ATOM 2305  C CB   . VAL A 1 5   ? 17.481  -24.953 -19.734 1.00 0.00 ? 5   VAL A CB   2  
ATOM 2306  C CG1  . VAL A 1 5   ? 16.923  -26.223 -20.359 1.00 0.00 ? 5   VAL A CG1  2  
ATOM 2307  C CG2  . VAL A 1 5   ? 16.501  -24.369 -18.728 1.00 0.00 ? 5   VAL A CG2  2  
ATOM 2308  H H    . VAL A 1 5   ? 17.822  -26.466 -17.676 1.00 0.00 ? 5   VAL A H    2  
ATOM 2309  H HA   . VAL A 1 5   ? 19.448  -25.798 -19.753 1.00 0.00 ? 5   VAL A HA   2  
ATOM 2310  H HB   . VAL A 1 5   ? 17.633  -24.228 -20.520 1.00 0.00 ? 5   VAL A HB   2  
ATOM 2311  H HG11 . VAL A 1 5   ? 15.966  -26.010 -20.812 1.00 0.00 ? 5   VAL A HG11 2  
ATOM 2312  H HG12 . VAL A 1 5   ? 17.607  -26.584 -21.113 1.00 0.00 ? 5   VAL A HG12 2  
ATOM 2313  H HG13 . VAL A 1 5   ? 16.800  -26.976 -19.595 1.00 0.00 ? 5   VAL A HG13 2  
ATOM 2314  H HG21 . VAL A 1 5   ? 16.817  -23.374 -18.454 1.00 0.00 ? 5   VAL A HG21 2  
ATOM 2315  H HG22 . VAL A 1 5   ? 15.515  -24.324 -19.169 1.00 0.00 ? 5   VAL A HG22 2  
ATOM 2316  H HG23 . VAL A 1 5   ? 16.472  -24.994 -17.848 1.00 0.00 ? 5   VAL A HG23 2  
ATOM 2317  N N    . ALA A 1 6   ? 19.129  -23.267 -17.673 1.00 0.00 ? 6   ALA A N    2  
ATOM 2318  C CA   . ALA A 1 6   ? 19.711  -21.991 -17.277 1.00 0.00 ? 6   ALA A CA   2  
ATOM 2319  C C    . ALA A 1 6   ? 19.323  -21.631 -15.847 1.00 0.00 ? 6   ALA A C    2  
ATOM 2320  O O    . ALA A 1 6   ? 18.396  -22.210 -15.280 1.00 0.00 ? 6   ALA A O    2  
ATOM 2321  C CB   . ALA A 1 6   ? 19.276  -20.892 -18.236 1.00 0.00 ? 6   ALA A CB   2  
ATOM 2322  H H    . ALA A 1 6   ? 18.426  -23.665 -17.119 1.00 0.00 ? 6   ALA A H    2  
ATOM 2323  H HA   . ALA A 1 6   ? 20.786  -22.082 -17.336 1.00 0.00 ? 6   ALA A HA   2  
ATOM 2324  H HB1  . ALA A 1 6   ? 19.836  -19.992 -18.028 1.00 0.00 ? 6   ALA A HB1  2  
ATOM 2325  H HB2  . ALA A 1 6   ? 19.463  -21.207 -19.252 1.00 0.00 ? 6   ALA A HB2  2  
ATOM 2326  H HB3  . ALA A 1 6   ? 18.222  -20.699 -18.107 1.00 0.00 ? 6   ALA A HB3  2  
ATOM 2327  N N    . VAL A 1 7   ? 20.039  -20.673 -15.268 1.00 0.00 ? 7   VAL A N    2  
ATOM 2328  C CA   . VAL A 1 7   ? 19.770  -20.236 -13.903 1.00 0.00 ? 7   VAL A CA   2  
ATOM 2329  C C    . VAL A 1 7   ? 20.081  -18.753 -13.730 1.00 0.00 ? 7   VAL A C    2  
ATOM 2330  O O    . VAL A 1 7   ? 20.988  -18.219 -14.367 1.00 0.00 ? 7   VAL A O    2  
ATOM 2331  C CB   . VAL A 1 7   ? 20.592  -21.044 -12.882 1.00 0.00 ? 7   VAL A CB   2  
ATOM 2332  C CG1  . VAL A 1 7   ? 20.231  -20.635 -11.462 1.00 0.00 ? 7   VAL A CG1  2  
ATOM 2333  C CG2  . VAL A 1 7   ? 20.376  -22.536 -13.087 1.00 0.00 ? 7   VAL A CG2  2  
ATOM 2334  H H    . VAL A 1 7   ? 20.766  -20.249 -15.771 1.00 0.00 ? 7   VAL A H    2  
ATOM 2335  H HA   . VAL A 1 7   ? 18.721  -20.400 -13.701 1.00 0.00 ? 7   VAL A HA   2  
ATOM 2336  H HB   . VAL A 1 7   ? 21.638  -20.828 -13.040 1.00 0.00 ? 7   VAL A HB   2  
ATOM 2337  H HG11 . VAL A 1 7   ? 20.294  -21.496 -10.813 1.00 0.00 ? 7   VAL A HG11 2  
ATOM 2338  H HG12 . VAL A 1 7   ? 20.918  -19.875 -11.121 1.00 0.00 ? 7   VAL A HG12 2  
ATOM 2339  H HG13 . VAL A 1 7   ? 19.224  -20.246 -11.445 1.00 0.00 ? 7   VAL A HG13 2  
ATOM 2340  H HG21 . VAL A 1 7   ? 20.911  -23.084 -12.326 1.00 0.00 ? 7   VAL A HG21 2  
ATOM 2341  H HG22 . VAL A 1 7   ? 19.322  -22.761 -13.018 1.00 0.00 ? 7   VAL A HG22 2  
ATOM 2342  H HG23 . VAL A 1 7   ? 20.742  -22.823 -14.062 1.00 0.00 ? 7   VAL A HG23 2  
ATOM 2343  N N    . VAL A 1 8   ? 19.321  -18.093 -12.861 1.00 0.00 ? 8   VAL A N    2  
ATOM 2344  C CA   . VAL A 1 8   ? 19.516  -16.671 -12.602 1.00 0.00 ? 8   VAL A CA   2  
ATOM 2345  C C    . VAL A 1 8   ? 20.227  -16.448 -11.272 1.00 0.00 ? 8   VAL A C    2  
ATOM 2346  O O    . VAL A 1 8   ? 20.261  -17.333 -10.417 1.00 0.00 ? 8   VAL A O    2  
ATOM 2347  C CB   . VAL A 1 8   ? 18.175  -15.914 -12.588 1.00 0.00 ? 8   VAL A CB   2  
ATOM 2348  C CG1  . VAL A 1 8   ? 17.445  -16.146 -11.274 1.00 0.00 ? 8   VAL A CG1  2  
ATOM 2349  C CG2  . VAL A 1 8   ? 18.400  -14.429 -12.827 1.00 0.00 ? 8   VAL A CG2  2  
ATOM 2350  H H    . VAL A 1 8   ? 18.614  -18.573 -12.383 1.00 0.00 ? 8   VAL A H    2  
ATOM 2351  H HA   . VAL A 1 8   ? 20.126  -16.267 -13.397 1.00 0.00 ? 8   VAL A HA   2  
ATOM 2352  H HB   . VAL A 1 8   ? 17.560  -16.298 -13.388 1.00 0.00 ? 8   VAL A HB   2  
ATOM 2353  H HG11 . VAL A 1 8   ? 17.991  -15.674 -10.470 1.00 0.00 ? 8   VAL A HG11 2  
ATOM 2354  H HG12 . VAL A 1 8   ? 16.453  -15.722 -11.333 1.00 0.00 ? 8   VAL A HG12 2  
ATOM 2355  H HG13 . VAL A 1 8   ? 17.373  -17.207 -11.084 1.00 0.00 ? 8   VAL A HG13 2  
ATOM 2356  H HG21 . VAL A 1 8   ? 18.691  -13.956 -11.902 1.00 0.00 ? 8   VAL A HG21 2  
ATOM 2357  H HG22 . VAL A 1 8   ? 19.182  -14.296 -13.561 1.00 0.00 ? 8   VAL A HG22 2  
ATOM 2358  H HG23 . VAL A 1 8   ? 17.487  -13.980 -13.190 1.00 0.00 ? 8   VAL A HG23 2  
ATOM 2359  N N    . LYS A 1 9   ? 20.795  -15.258 -11.103 1.00 0.00 ? 9   LYS A N    2  
ATOM 2360  C CA   . LYS A 1 9   ? 21.505  -14.916 -9.876  1.00 0.00 ? 9   LYS A CA   2  
ATOM 2361  C C    . LYS A 1 9   ? 21.281  -13.452 -9.509  1.00 0.00 ? 9   LYS A C    2  
ATOM 2362  O O    . LYS A 1 9   ? 21.806  -12.551 -10.164 1.00 0.00 ? 9   LYS A O    2  
ATOM 2363  C CB   . LYS A 1 9   ? 23.002  -15.190 -10.035 1.00 0.00 ? 9   LYS A CB   2  
ATOM 2364  C CG   . LYS A 1 9   ? 23.620  -14.510 -11.245 1.00 0.00 ? 9   LYS A CG   2  
ATOM 2365  C CD   . LYS A 1 9   ? 24.957  -15.131 -11.611 1.00 0.00 ? 9   LYS A CD   2  
ATOM 2366  C CE   . LYS A 1 9   ? 26.073  -14.622 -10.712 1.00 0.00 ? 9   LYS A CE   2  
ATOM 2367  N NZ   . LYS A 1 9   ? 27.411  -14.778 -11.346 1.00 0.00 ? 9   LYS A NZ   2  
ATOM 2368  H H    . LYS A 1 9   ? 20.734  -14.594 -11.821 1.00 0.00 ? 9   LYS A H    2  
ATOM 2369  H HA   . LYS A 1 9   ? 21.116  -15.537 -9.083  1.00 0.00 ? 9   LYS A HA   2  
ATOM 2370  H HB2  . LYS A 1 9   ? 23.515  -14.843 -9.151  1.00 0.00 ? 9   LYS A HB2  2  
ATOM 2371  H HB3  . LYS A 1 9   ? 23.152  -16.256 -10.132 1.00 0.00 ? 9   LYS A HB3  2  
ATOM 2372  H HG2  . LYS A 1 9   ? 22.947  -14.608 -12.084 1.00 0.00 ? 9   LYS A HG2  2  
ATOM 2373  H HG3  . LYS A 1 9   ? 23.768  -13.463 -11.020 1.00 0.00 ? 9   LYS A HG3  2  
ATOM 2374  H HD2  . LYS A 1 9   ? 24.887  -16.203 -11.506 1.00 0.00 ? 9   LYS A HD2  2  
ATOM 2375  H HD3  . LYS A 1 9   ? 25.191  -14.882 -12.637 1.00 0.00 ? 9   LYS A HD3  2  
ATOM 2376  H HE2  . LYS A 1 9   ? 25.902  -13.577 -10.505 1.00 0.00 ? 9   LYS A HE2  2  
ATOM 2377  H HE3  . LYS A 1 9   ? 26.055  -15.179 -9.787  1.00 0.00 ? 9   LYS A HE3  2  
ATOM 2378  H HZ1  . LYS A 1 9   ? 27.663  -13.913 -11.865 1.00 0.00 ? 9   LYS A HZ1  2  
ATOM 2379  H HZ2  . LYS A 1 9   ? 27.400  -15.577 -12.011 1.00 0.00 ? 9   LYS A HZ2  2  
ATOM 2380  H HZ3  . LYS A 1 9   ? 28.133  -14.956 -10.618 1.00 0.00 ? 9   LYS A HZ3  2  
ATOM 2381  N N    . LEU A 1 10  ? 20.501  -13.223 -8.458  1.00 0.00 ? 10  LEU A N    2  
ATOM 2382  C CA   . LEU A 1 10  ? 20.210  -11.868 -8.003  1.00 0.00 ? 10  LEU A CA   2  
ATOM 2383  C C    . LEU A 1 10  ? 20.233  -11.789 -6.480  1.00 0.00 ? 10  LEU A C    2  
ATOM 2384  O O    . LEU A 1 10  ? 19.954  -12.772 -5.794  1.00 0.00 ? 10  LEU A O    2  
ATOM 2385  C CB   . LEU A 1 10  ? 18.847  -11.414 -8.528  1.00 0.00 ? 10  LEU A CB   2  
ATOM 2386  C CG   . LEU A 1 10  ? 18.510  -9.936  -8.332  1.00 0.00 ? 10  LEU A CG   2  
ATOM 2387  C CD1  . LEU A 1 10  ? 18.526  -9.203  -9.665  1.00 0.00 ? 10  LEU A CD1  2  
ATOM 2388  C CD2  . LEU A 1 10  ? 17.157  -9.782  -7.653  1.00 0.00 ? 10  LEU A CD2  2  
ATOM 2389  H H    . LEU A 1 10  ? 20.112  -13.982 -7.977  1.00 0.00 ? 10  LEU A H    2  
ATOM 2390  H HA   . LEU A 1 10  ? 20.974  -11.215 -8.397  1.00 0.00 ? 10  LEU A HA   2  
ATOM 2391  H HB2  . LEU A 1 10  ? 18.814  -11.623 -9.586  1.00 0.00 ? 10  LEU A HB2  2  
ATOM 2392  H HB3  . LEU A 1 10  ? 18.089  -11.997 -8.024  1.00 0.00 ? 10  LEU A HB3  2  
ATOM 2393  H HG   . LEU A 1 10  ? 19.258  -9.484  -7.695  1.00 0.00 ? 10  LEU A HG   2  
ATOM 2394  H HD11 . LEU A 1 10  ? 17.821  -9.666  -10.338 1.00 0.00 ? 10  LEU A HD11 2  
ATOM 2395  H HD12 . LEU A 1 10  ? 19.517  -9.253  -10.091 1.00 0.00 ? 10  LEU A HD12 2  
ATOM 2396  H HD13 . LEU A 1 10  ? 18.253  -8.170  -9.510  1.00 0.00 ? 10  LEU A HD13 2  
ATOM 2397  H HD21 . LEU A 1 10  ? 16.373  -9.872  -8.390  1.00 0.00 ? 10  LEU A HD21 2  
ATOM 2398  H HD22 . LEU A 1 10  ? 17.099  -8.812  -7.182  1.00 0.00 ? 10  LEU A HD22 2  
ATOM 2399  H HD23 . LEU A 1 10  ? 17.040  -10.553 -6.906  1.00 0.00 ? 10  LEU A HD23 2  
ATOM 2400  N N    . GLN A 1 11  ? 20.566  -10.612 -5.959  1.00 0.00 ? 11  GLN A N    2  
ATOM 2401  C CA   . GLN A 1 11  ? 20.623  -10.405 -4.516  1.00 0.00 ? 11  GLN A CA   2  
ATOM 2402  C C    . GLN A 1 11  ? 19.943  -9.097  -4.127  1.00 0.00 ? 11  GLN A C    2  
ATOM 2403  O O    . GLN A 1 11  ? 20.104  -8.077  -4.798  1.00 0.00 ? 11  GLN A O    2  
ATOM 2404  C CB   . GLN A 1 11  ? 22.076  -10.400 -4.038  1.00 0.00 ? 11  GLN A CB   2  
ATOM 2405  C CG   . GLN A 1 11  ? 22.826  -9.123  -4.383  1.00 0.00 ? 11  GLN A CG   2  
ATOM 2406  C CD   . GLN A 1 11  ? 24.249  -9.123  -3.861  1.00 0.00 ? 11  GLN A CD   2  
ATOM 2407  O OE1  . GLN A 1 11  ? 25.095  -9.886  -4.329  1.00 0.00 ? 11  GLN A OE1  2  
ATOM 2408  N NE2  . GLN A 1 11  ? 24.522  -8.264  -2.886  1.00 0.00 ? 11  GLN A NE2  2  
ATOM 2409  H H    . GLN A 1 11  ? 20.777  -9.867  -6.558  1.00 0.00 ? 11  GLN A H    2  
ATOM 2410  H HA   . GLN A 1 11  ? 20.101  -11.223 -4.043  1.00 0.00 ? 11  GLN A HA   2  
ATOM 2411  H HB2  . GLN A 1 11  ? 22.090  -10.522 -2.966  1.00 0.00 ? 11  GLN A HB2  2  
ATOM 2412  H HB3  . GLN A 1 11  ? 22.595  -11.231 -4.494  1.00 0.00 ? 11  GLN A HB3  2  
ATOM 2413  H HG2  . GLN A 1 11  ? 22.854  -9.016  -5.458  1.00 0.00 ? 11  GLN A HG2  2  
ATOM 2414  H HG3  . GLN A 1 11  ? 22.299  -8.285  -3.953  1.00 0.00 ? 11  GLN A HG3  2  
ATOM 2415  H HE21 . GLN A 1 11  ? 23.798  -7.688  -2.561  1.00 0.00 ? 11  GLN A HE21 2  
ATOM 2416  H HE22 . GLN A 1 11  ? 25.433  -8.243  -2.529  1.00 0.00 ? 11  GLN A HE22 2  
ATOM 2417  N N    . LEU A 1 12  ? 19.181  -9.133  -3.039  1.00 0.00 ? 12  LEU A N    2  
ATOM 2418  C CA   . LEU A 1 12  ? 18.475  -7.950  -2.559  1.00 0.00 ? 12  LEU A CA   2  
ATOM 2419  C C    . LEU A 1 12  ? 18.376  -7.955  -1.037  1.00 0.00 ? 12  LEU A C    2  
ATOM 2420  O O    . LEU A 1 12  ? 18.384  -9.004  -0.394  1.00 0.00 ? 12  LEU A O    2  
ATOM 2421  C CB   . LEU A 1 12  ? 17.076  -7.883  -3.174  1.00 0.00 ? 12  LEU A CB   2  
ATOM 2422  C CG   . LEU A 1 12  ? 16.992  -8.126  -4.681  1.00 0.00 ? 12  LEU A CG   2  
ATOM 2423  C CD1  . LEU A 1 12  ? 15.559  -8.422  -5.095  1.00 0.00 ? 12  LEU A CD1  2  
ATOM 2424  C CD2  . LEU A 1 12  ? 17.534  -6.927  -5.446  1.00 0.00 ? 12  LEU A CD2  2  
ATOM 2425  H H    . LEU A 1 12  ? 19.091  -9.975  -2.546  1.00 0.00 ? 12  LEU A H    2  
ATOM 2426  H HA   . LEU A 1 12  ? 19.037  -7.081  -2.868  1.00 0.00 ? 12  LEU A HA   2  
ATOM 2427  H HB2  . LEU A 1 12  ? 16.465  -8.626  -2.684  1.00 0.00 ? 12  LEU A HB2  2  
ATOM 2428  H HB3  . LEU A 1 12  ? 16.675  -6.900  -2.973  1.00 0.00 ? 12  LEU A HB3  2  
ATOM 2429  H HG   . LEU A 1 12  ? 17.596  -8.987  -4.934  1.00 0.00 ? 12  LEU A HG   2  
ATOM 2430  H HD11 . LEU A 1 12  ? 14.887  -8.124  -4.304  1.00 0.00 ? 12  LEU A HD11 2  
ATOM 2431  H HD12 . LEU A 1 12  ? 15.449  -9.480  -5.281  1.00 0.00 ? 12  LEU A HD12 2  
ATOM 2432  H HD13 . LEU A 1 12  ? 15.324  -7.872  -5.994  1.00 0.00 ? 12  LEU A HD13 2  
ATOM 2433  H HD21 . LEU A 1 12  ? 18.109  -7.271  -6.292  1.00 0.00 ? 12  LEU A HD21 2  
ATOM 2434  H HD22 . LEU A 1 12  ? 18.166  -6.341  -4.795  1.00 0.00 ? 12  LEU A HD22 2  
ATOM 2435  H HD23 . LEU A 1 12  ? 16.711  -6.320  -5.792  1.00 0.00 ? 12  LEU A HD23 2  
ATOM 2436  N N    . PRO A 1 13  ? 18.277  -6.755  -0.447  1.00 0.00 ? 13  PRO A N    2  
ATOM 2437  C CA   . PRO A 1 13  ? 18.170  -6.594  1.007   1.00 0.00 ? 13  PRO A CA   2  
ATOM 2438  C C    . PRO A 1 13  ? 16.829  -7.080  1.547   1.00 0.00 ? 13  PRO A C    2  
ATOM 2439  O O    . PRO A 1 13  ? 15.772  -6.648  1.089   1.00 0.00 ? 13  PRO A O    2  
ATOM 2440  C CB   . PRO A 1 13  ? 18.313  -5.083  1.208   1.00 0.00 ? 13  PRO A CB   2  
ATOM 2441  C CG   . PRO A 1 13  ? 17.862  -4.486  -0.080  1.00 0.00 ? 13  PRO A CG   2  
ATOM 2442  C CD   . PRO A 1 13  ? 18.261  -5.462  -1.152  1.00 0.00 ? 13  PRO A CD   2  
ATOM 2443  H HA   . PRO A 1 13  ? 18.971  -7.105  1.522   1.00 0.00 ? 13  PRO A HA   2  
ATOM 2444  H HB2  . PRO A 1 13  ? 17.688  -4.767  2.031   1.00 0.00 ? 13  PRO A HB2  2  
ATOM 2445  H HB3  . PRO A 1 13  ? 19.343  -4.840  1.417   1.00 0.00 ? 13  PRO A HB3  2  
ATOM 2446  H HG2  . PRO A 1 13  ? 16.791  -4.356  -0.070  1.00 0.00 ? 13  PRO A HG2  2  
ATOM 2447  H HG3  . PRO A 1 13  ? 18.354  -3.537  -0.236  1.00 0.00 ? 13  PRO A HG3  2  
ATOM 2448  H HD2  . PRO A 1 13  ? 17.532  -5.467  -1.949  1.00 0.00 ? 13  PRO A HD2  2  
ATOM 2449  H HD3  . PRO A 1 13  ? 19.241  -5.221  -1.536  1.00 0.00 ? 13  PRO A HD3  2  
ATOM 2450  N N    . ALA A 1 14  ? 16.881  -7.979  2.523   1.00 0.00 ? 14  ALA A N    2  
ATOM 2451  C CA   . ALA A 1 14  ? 15.670  -8.521  3.127   1.00 0.00 ? 14  ALA A CA   2  
ATOM 2452  C C    . ALA A 1 14  ? 14.796  -7.409  3.697   1.00 0.00 ? 14  ALA A C    2  
ATOM 2453  O O    . ALA A 1 14  ? 15.255  -6.592  4.494   1.00 0.00 ? 14  ALA A O    2  
ATOM 2454  C CB   . ALA A 1 14  ? 16.026  -9.525  4.215   1.00 0.00 ? 14  ALA A CB   2  
ATOM 2455  H H    . ALA A 1 14  ? 17.754  -8.285  2.846   1.00 0.00 ? 14  ALA A H    2  
ATOM 2456  H HA   . ALA A 1 14  ? 15.118  -9.042  2.359   1.00 0.00 ? 14  ALA A HA   2  
ATOM 2457  H HB1  . ALA A 1 14  ? 15.294  -9.470  5.007   1.00 0.00 ? 14  ALA A HB1  2  
ATOM 2458  H HB2  . ALA A 1 14  ? 16.032  -10.520 3.797   1.00 0.00 ? 14  ALA A HB2  2  
ATOM 2459  H HB3  . ALA A 1 14  ? 17.004  -9.294  4.611   1.00 0.00 ? 14  ALA A HB3  2  
ATOM 2460  N N    . GLY A 1 15  ? 13.533  -7.384  3.282   1.00 0.00 ? 15  GLY A N    2  
ATOM 2461  C CA   . GLY A 1 15  ? 12.615  -6.368  3.761   1.00 0.00 ? 15  GLY A CA   2  
ATOM 2462  C C    . GLY A 1 15  ? 12.493  -5.199  2.803   1.00 0.00 ? 15  GLY A C    2  
ATOM 2463  O O    . GLY A 1 15  ? 13.485  -4.753  2.226   1.00 0.00 ? 15  GLY A O    2  
ATOM 2464  H H    . GLY A 1 15  ? 13.222  -8.062  2.645   1.00 0.00 ? 15  GLY A H    2  
ATOM 2465  H HA2  . GLY A 1 15  ? 11.640  -6.813  3.895   1.00 0.00 ? 15  GLY A HA2  2  
ATOM 2466  H HA3  . GLY A 1 15  ? 12.966  -6.001  4.714   1.00 0.00 ? 15  GLY A HA3  2  
ATOM 2467  N N    . LYS A 1 16  ? 11.272  -4.703  2.630   1.00 0.00 ? 16  LYS A N    2  
ATOM 2468  C CA   . LYS A 1 16  ? 11.023  -3.579  1.735   1.00 0.00 ? 16  LYS A CA   2  
ATOM 2469  C C    . LYS A 1 16  ? 11.213  -3.991  0.279   1.00 0.00 ? 16  LYS A C    2  
ATOM 2470  O O    . LYS A 1 16  ? 12.262  -3.743  -0.314  1.00 0.00 ? 16  LYS A O    2  
ATOM 2471  C CB   . LYS A 1 16  ? 11.956  -2.414  2.073   1.00 0.00 ? 16  LYS A CB   2  
ATOM 2472  C CG   . LYS A 1 16  ? 11.382  -1.053  1.718   1.00 0.00 ? 16  LYS A CG   2  
ATOM 2473  C CD   . LYS A 1 16  ? 12.375  -0.219  0.926   1.00 0.00 ? 16  LYS A CD   2  
ATOM 2474  C CE   . LYS A 1 16  ? 12.073  1.267   1.043   1.00 0.00 ? 16  LYS A CE   2  
ATOM 2475  N NZ   . LYS A 1 16  ? 11.911  1.907   -0.291  1.00 0.00 ? 16  LYS A NZ   2  
ATOM 2476  H H    . LYS A 1 16  ? 10.521  -5.101  3.118   1.00 0.00 ? 16  LYS A H    2  
ATOM 2477  H HA   . LYS A 1 16  ? 10.000  -3.263  1.877   1.00 0.00 ? 16  LYS A HA   2  
ATOM 2478  H HB2  . LYS A 1 16  ? 12.162  -2.430  3.133   1.00 0.00 ? 16  LYS A HB2  2  
ATOM 2479  H HB3  . LYS A 1 16  ? 12.883  -2.543  1.532   1.00 0.00 ? 16  LYS A HB3  2  
ATOM 2480  H HG2  . LYS A 1 16  ? 10.491  -1.191  1.125   1.00 0.00 ? 16  LYS A HG2  2  
ATOM 2481  H HG3  . LYS A 1 16  ? 11.133  -0.529  2.630   1.00 0.00 ? 16  LYS A HG3  2  
ATOM 2482  H HD2  . LYS A 1 16  ? 13.370  -0.404  1.303   1.00 0.00 ? 16  LYS A HD2  2  
ATOM 2483  H HD3  . LYS A 1 16  ? 12.324  -0.507  -0.115  1.00 0.00 ? 16  LYS A HD3  2  
ATOM 2484  H HE2  . LYS A 1 16  ? 11.161  1.393   1.607   1.00 0.00 ? 16  LYS A HE2  2  
ATOM 2485  H HE3  . LYS A 1 16  ? 12.888  1.746   1.566   1.00 0.00 ? 16  LYS A HE3  2  
ATOM 2486  H HZ1  . LYS A 1 16  ? 12.703  2.556   -0.475  1.00 0.00 ? 16  LYS A HZ1  2  
ATOM 2487  H HZ2  . LYS A 1 16  ? 11.022  2.446   -0.323  1.00 0.00 ? 16  LYS A HZ2  2  
ATOM 2488  H HZ3  . LYS A 1 16  ? 11.891  1.182   -1.036  1.00 0.00 ? 16  LYS A HZ3  2  
ATOM 2489  N N    . ALA A 1 17  ? 10.191  -4.620  -0.292  1.00 0.00 ? 17  ALA A N    2  
ATOM 2490  C CA   . ALA A 1 17  ? 10.245  -5.063  -1.680  1.00 0.00 ? 17  ALA A CA   2  
ATOM 2491  C C    . ALA A 1 17  ? 9.211   -4.332  -2.530  1.00 0.00 ? 17  ALA A C    2  
ATOM 2492  O O    . ALA A 1 17  ? 8.156   -3.932  -2.036  1.00 0.00 ? 17  ALA A O    2  
ATOM 2493  C CB   . ALA A 1 17  ? 10.030  -6.567  -1.762  1.00 0.00 ? 17  ALA A CB   2  
ATOM 2494  H H    . ALA A 1 17  ? 9.381   -4.789  0.233   1.00 0.00 ? 17  ALA A H    2  
ATOM 2495  H HA   . ALA A 1 17  ? 11.231  -4.843  -2.062  1.00 0.00 ? 17  ALA A HA   2  
ATOM 2496  H HB1  . ALA A 1 17  ? 10.929  -7.076  -1.444  1.00 0.00 ? 17  ALA A HB1  2  
ATOM 2497  H HB2  . ALA A 1 17  ? 9.209   -6.849  -1.120  1.00 0.00 ? 17  ALA A HB2  2  
ATOM 2498  H HB3  . ALA A 1 17  ? 9.802   -6.842  -2.781  1.00 0.00 ? 17  ALA A HB3  2  
ATOM 2499  N N    . THR A 1 18  ? 9.521   -4.158  -3.811  1.00 0.00 ? 18  THR A N    2  
ATOM 2500  C CA   . THR A 1 18  ? 8.620   -3.473  -4.729  1.00 0.00 ? 18  THR A CA   2  
ATOM 2501  C C    . THR A 1 18  ? 8.181   -4.397  -5.860  1.00 0.00 ? 18  THR A C    2  
ATOM 2502  O O    . THR A 1 18  ? 8.834   -5.394  -6.169  1.00 0.00 ? 18  THR A O    2  
ATOM 2503  C CB   . THR A 1 18  ? 9.280   -2.219  -5.333  1.00 0.00 ? 18  THR A CB   2  
ATOM 2504  O OG1  . THR A 1 18  ? 10.705  -2.323  -5.241  1.00 0.00 ? 18  THR A OG1  2  
ATOM 2505  C CG2  . THR A 1 18  ? 8.811   -0.962  -4.615  1.00 0.00 ? 18  THR A CG2  2  
ATOM 2506  H H    . THR A 1 18  ? 10.377  -4.499  -4.145  1.00 0.00 ? 18  THR A H    2  
ATOM 2507  H HA   . THR A 1 18  ? 7.748   -3.163  -4.172  1.00 0.00 ? 18  THR A HA   2  
ATOM 2508  H HB   . THR A 1 18  ? 8.998   -2.148  -6.373  1.00 0.00 ? 18  THR A HB   2  
ATOM 2509  H HG1  . THR A 1 18  ? 11.110  -1.803  -5.939  1.00 0.00 ? 18  THR A HG1  2  
ATOM 2510  H HG21 . THR A 1 18  ? 8.481   -1.219  -3.619  1.00 0.00 ? 18  THR A HG21 2  
ATOM 2511  H HG22 . THR A 1 18  ? 7.993   -0.519  -5.163  1.00 0.00 ? 18  THR A HG22 2  
ATOM 2512  H HG23 . THR A 1 18  ? 9.627   -0.258  -4.553  1.00 0.00 ? 18  THR A HG23 2  
ATOM 2513  N N    . PRO A 1 19  ? 7.049   -4.059  -6.494  1.00 0.00 ? 19  PRO A N    2  
ATOM 2514  C CA   . PRO A 1 19  ? 6.498   -4.845  -7.603  1.00 0.00 ? 19  PRO A CA   2  
ATOM 2515  C C    . PRO A 1 19  ? 7.350   -4.746  -8.863  1.00 0.00 ? 19  PRO A C    2  
ATOM 2516  O O    . PRO A 1 19  ? 7.110   -5.451  -9.843  1.00 0.00 ? 19  PRO A O    2  
ATOM 2517  C CB   . PRO A 1 19  ? 5.123   -4.215  -7.835  1.00 0.00 ? 19  PRO A CB   2  
ATOM 2518  C CG   . PRO A 1 19  ? 5.255   -2.819  -7.332  1.00 0.00 ? 19  PRO A CG   2  
ATOM 2519  C CD   . PRO A 1 19  ? 6.219   -2.884  -6.179  1.00 0.00 ? 19  PRO A CD   2  
ATOM 2520  H HA   . PRO A 1 19  ? 6.379   -5.884  -7.331  1.00 0.00 ? 19  PRO A HA   2  
ATOM 2521  H HB2  . PRO A 1 19  ? 4.888   -4.235  -8.890  1.00 0.00 ? 19  PRO A HB2  2  
ATOM 2522  H HB3  . PRO A 1 19  ? 4.373   -4.764  -7.284  1.00 0.00 ? 19  PRO A HB3  2  
ATOM 2523  H HG2  . PRO A 1 19  ? 5.646   -2.184  -8.112  1.00 0.00 ? 19  PRO A HG2  2  
ATOM 2524  H HG3  . PRO A 1 19  ? 4.295   -2.457  -6.997  1.00 0.00 ? 19  PRO A HG3  2  
ATOM 2525  H HD2  . PRO A 1 19  ? 6.819   -1.988  -6.138  1.00 0.00 ? 19  PRO A HD2  2  
ATOM 2526  H HD3  . PRO A 1 19  ? 5.687   -3.027  -5.250  1.00 0.00 ? 19  PRO A HD3  2  
ATOM 2527  N N    . ALA A 1 20  ? 8.346   -3.866  -8.831  1.00 0.00 ? 20  ALA A N    2  
ATOM 2528  C CA   . ALA A 1 20  ? 9.234   -3.677  -9.971  1.00 0.00 ? 20  ALA A CA   2  
ATOM 2529  C C    . ALA A 1 20  ? 10.684  -3.953  -9.588  1.00 0.00 ? 20  ALA A C    2  
ATOM 2530  O O    . ALA A 1 20  ? 11.546  -3.076  -9.650  1.00 0.00 ? 20  ALA A O    2  
ATOM 2531  C CB   . ALA A 1 20  ? 9.092   -2.266  -10.522 1.00 0.00 ? 20  ALA A CB   2  
ATOM 2532  H H    . ALA A 1 20  ? 8.487   -3.333  -8.021  1.00 0.00 ? 20  ALA A H    2  
ATOM 2533  H HA   . ALA A 1 20  ? 8.938   -4.371  -10.744 1.00 0.00 ? 20  ALA A HA   2  
ATOM 2534  H HB1  . ALA A 1 20  ? 8.065   -2.096  -10.812 1.00 0.00 ? 20  ALA A HB1  2  
ATOM 2535  H HB2  . ALA A 1 20  ? 9.375   -1.552  -9.763  1.00 0.00 ? 20  ALA A HB2  2  
ATOM 2536  H HB3  . ALA A 1 20  ? 9.733   -2.150  -11.383 1.00 0.00 ? 20  ALA A HB3  2  
ATOM 2537  N N    . PRO A 1 21  ? 10.963  -5.201  -9.182  1.00 0.00 ? 21  PRO A N    2  
ATOM 2538  C CA   . PRO A 1 21  ? 12.308  -5.621  -8.781  1.00 0.00 ? 21  PRO A CA   2  
ATOM 2539  C C    . PRO A 1 21  ? 13.272  -5.685  -9.961  1.00 0.00 ? 21  PRO A C    2  
ATOM 2540  O O    . PRO A 1 21  ? 12.871  -5.624  -11.124 1.00 0.00 ? 21  PRO A O    2  
ATOM 2541  C CB   . PRO A 1 21  ? 12.084  -7.018  -8.197  1.00 0.00 ? 21  PRO A CB   2  
ATOM 2542  C CG   . PRO A 1 21  ? 10.844  -7.511  -8.858  1.00 0.00 ? 21  PRO A CG   2  
ATOM 2543  C CD   . PRO A 1 21  ? 9.985   -6.297  -9.084  1.00 0.00 ? 21  PRO A CD   2  
ATOM 2544  H HA   . PRO A 1 21  ? 12.717  -4.972  -8.020  1.00 0.00 ? 21  PRO A HA   2  
ATOM 2545  H HB2  . PRO A 1 21  ? 12.933  -7.647  -8.427  1.00 0.00 ? 21  PRO A HB2  2  
ATOM 2546  H HB3  . PRO A 1 21  ? 11.960  -6.949  -7.127  1.00 0.00 ? 21  PRO A HB3  2  
ATOM 2547  H HG2  . PRO A 1 21  ? 11.090  -7.976  -9.801  1.00 0.00 ? 21  PRO A HG2  2  
ATOM 2548  H HG3  . PRO A 1 21  ? 10.338  -8.213  -8.212  1.00 0.00 ? 21  PRO A HG3  2  
ATOM 2549  H HD2  . PRO A 1 21  ? 9.424   -6.397  -10.001 1.00 0.00 ? 21  PRO A HD2  2  
ATOM 2550  H HD3  . PRO A 1 21  ? 9.319   -6.146  -8.247  1.00 0.00 ? 21  PRO A HD3  2  
ATOM 2551  N N    . PRO A 1 22  ? 14.572  -5.813  -9.659  1.00 0.00 ? 22  PRO A N    2  
ATOM 2552  C CA   . PRO A 1 22  ? 15.619  -5.889  -10.682 1.00 0.00 ? 22  PRO A CA   2  
ATOM 2553  C C    . PRO A 1 22  ? 15.572  -7.198  -11.463 1.00 0.00 ? 22  PRO A C    2  
ATOM 2554  O O    . PRO A 1 22  ? 16.278  -7.365  -12.457 1.00 0.00 ? 22  PRO A O    2  
ATOM 2555  C CB   . PRO A 1 22  ? 16.914  -5.797  -9.872  1.00 0.00 ? 22  PRO A CB   2  
ATOM 2556  C CG   . PRO A 1 22  ? 16.551  -6.300  -8.517  1.00 0.00 ? 22  PRO A CG   2  
ATOM 2557  C CD   . PRO A 1 22  ? 15.121  -5.892  -8.295  1.00 0.00 ? 22  PRO A CD   2  
ATOM 2558  H HA   . PRO A 1 22  ? 15.563  -5.059  -11.370 1.00 0.00 ? 22  PRO A HA   2  
ATOM 2559  H HB2  . PRO A 1 22  ? 17.675  -6.412  -10.332 1.00 0.00 ? 22  PRO A HB2  2  
ATOM 2560  H HB3  . PRO A 1 22  ? 17.248  -4.770  -9.835  1.00 0.00 ? 22  PRO A HB3  2  
ATOM 2561  H HG2  . PRO A 1 22  ? 16.644  -7.374  -8.488  1.00 0.00 ? 22  PRO A HG2  2  
ATOM 2562  H HG3  . PRO A 1 22  ? 17.189  -5.846  -7.774  1.00 0.00 ? 22  PRO A HG3  2  
ATOM 2563  H HD2  . PRO A 1 22  ? 14.602  -6.640  -7.713  1.00 0.00 ? 22  PRO A HD2  2  
ATOM 2564  H HD3  . PRO A 1 22  ? 15.074  -4.931  -7.804  1.00 0.00 ? 22  PRO A HD3  2  
ATOM 2565  N N    . VAL A 1 23  ? 14.735  -8.124  -11.007 1.00 0.00 ? 23  VAL A N    2  
ATOM 2566  C CA   . VAL A 1 23  ? 14.594  -9.418  -11.664 1.00 0.00 ? 23  VAL A CA   2  
ATOM 2567  C C    . VAL A 1 23  ? 13.167  -9.633  -12.156 1.00 0.00 ? 23  VAL A C    2  
ATOM 2568  O O    . VAL A 1 23  ? 12.842  -10.681 -12.713 1.00 0.00 ? 23  VAL A O    2  
ATOM 2569  C CB   . VAL A 1 23  ? 14.979  -10.572 -10.719 1.00 0.00 ? 23  VAL A CB   2  
ATOM 2570  C CG1  . VAL A 1 23  ? 13.970  -10.695 -9.587  1.00 0.00 ? 23  VAL A CG1  2  
ATOM 2571  C CG2  . VAL A 1 23  ? 15.087  -11.879 -11.490 1.00 0.00 ? 23  VAL A CG2  2  
ATOM 2572  H H    . VAL A 1 23  ? 14.198  -7.933  -10.209 1.00 0.00 ? 23  VAL A H    2  
ATOM 2573  H HA   . VAL A 1 23  ? 15.264  -9.437  -12.511 1.00 0.00 ? 23  VAL A HA   2  
ATOM 2574  H HB   . VAL A 1 23  ? 15.944  -10.352 -10.288 1.00 0.00 ? 23  VAL A HB   2  
ATOM 2575  H HG11 . VAL A 1 23  ? 13.543  -9.724  -9.379  1.00 0.00 ? 23  VAL A HG11 2  
ATOM 2576  H HG12 . VAL A 1 23  ? 13.186  -11.379 -9.875  1.00 0.00 ? 23  VAL A HG12 2  
ATOM 2577  H HG13 . VAL A 1 23  ? 14.465  -11.066 -8.702  1.00 0.00 ? 23  VAL A HG13 2  
ATOM 2578  H HG21 . VAL A 1 23  ? 14.362  -12.582 -11.110 1.00 0.00 ? 23  VAL A HG21 2  
ATOM 2579  H HG22 . VAL A 1 23  ? 14.895  -11.696 -12.538 1.00 0.00 ? 23  VAL A HG22 2  
ATOM 2580  H HG23 . VAL A 1 23  ? 16.080  -12.285 -11.373 1.00 0.00 ? 23  VAL A HG23 2  
ATOM 2581  N N    . GLY A 1 24  ? 12.318  -8.632  -11.946 1.00 0.00 ? 24  GLY A N    2  
ATOM 2582  C CA   . GLY A 1 24  ? 10.935  -8.730  -12.375 1.00 0.00 ? 24  GLY A CA   2  
ATOM 2583  C C    . GLY A 1 24  ? 10.801  -9.287  -13.778 1.00 0.00 ? 24  GLY A C    2  
ATOM 2584  O O    . GLY A 1 24  ? 10.321  -10.402 -13.983 1.00 0.00 ? 24  GLY A O    2  
ATOM 2585  H H    . GLY A 1 24  ? 12.633  -7.820  -11.497 1.00 0.00 ? 24  GLY A H    2  
ATOM 2586  H HA2  . GLY A 1 24  ? 10.402  -9.374  -11.691 1.00 0.00 ? 24  GLY A HA2  2  
ATOM 2587  H HA3  . GLY A 1 24  ? 10.490  -7.746  -12.347 1.00 0.00 ? 24  GLY A HA3  2  
ATOM 2588  N N    . PRO A 1 25  ? 11.231  -8.499  -14.775 1.00 0.00 ? 25  PRO A N    2  
ATOM 2589  C CA   . PRO A 1 25  ? 11.166  -8.898  -16.184 1.00 0.00 ? 25  PRO A CA   2  
ATOM 2590  C C    . PRO A 1 25  ? 12.147  -10.018 -16.515 1.00 0.00 ? 25  PRO A C    2  
ATOM 2591  O O    . PRO A 1 25  ? 12.132  -10.563 -17.618 1.00 0.00 ? 25  PRO A O    2  
ATOM 2592  C CB   . PRO A 1 25  ? 11.543  -7.618  -16.933 1.00 0.00 ? 25  PRO A CB   2  
ATOM 2593  C CG   . PRO A 1 25  ? 12.367  -6.842  -15.965 1.00 0.00 ? 25  PRO A CG   2  
ATOM 2594  C CD   . PRO A 1 25  ? 11.814  -7.158  -14.603 1.00 0.00 ? 25  PRO A CD   2  
ATOM 2595  H HA   . PRO A 1 25  ? 10.168  -9.201  -16.465 1.00 0.00 ? 25  PRO A HA   2  
ATOM 2596  H HB2  . PRO A 1 25  ? 12.107  -7.870  -17.820 1.00 0.00 ? 25  PRO A HB2  2  
ATOM 2597  H HB3  . PRO A 1 25  ? 10.648  -7.081  -17.209 1.00 0.00 ? 25  PRO A HB3  2  
ATOM 2598  H HG2  . PRO A 1 25  ? 13.400  -7.150  -16.031 1.00 0.00 ? 25  PRO A HG2  2  
ATOM 2599  H HG3  . PRO A 1 25  ? 12.276  -5.785  -16.170 1.00 0.00 ? 25  PRO A HG3  2  
ATOM 2600  H HD2  . PRO A 1 25  ? 12.605  -7.172  -13.868 1.00 0.00 ? 25  PRO A HD2  2  
ATOM 2601  H HD3  . PRO A 1 25  ? 11.054  -6.440  -14.329 1.00 0.00 ? 25  PRO A HD3  2  
ATOM 2602  N N    . ALA A 1 26  ? 12.998  -10.357 -15.552 1.00 0.00 ? 26  ALA A N    2  
ATOM 2603  C CA   . ALA A 1 26  ? 13.984  -11.414 -15.740 1.00 0.00 ? 26  ALA A CA   2  
ATOM 2604  C C    . ALA A 1 26  ? 13.548  -12.701 -15.049 1.00 0.00 ? 26  ALA A C    2  
ATOM 2605  O O    . ALA A 1 26  ? 14.254  -13.710 -15.090 1.00 0.00 ? 26  ALA A O    2  
ATOM 2606  C CB   . ALA A 1 26  ? 15.342  -10.967 -15.221 1.00 0.00 ? 26  ALA A CB   2  
ATOM 2607  H H    . ALA A 1 26  ? 12.961  -9.886  -14.694 1.00 0.00 ? 26  ALA A H    2  
ATOM 2608  H HA   . ALA A 1 26  ? 14.075  -11.599 -16.801 1.00 0.00 ? 26  ALA A HA   2  
ATOM 2609  H HB1  . ALA A 1 26  ? 16.032  -11.797 -15.260 1.00 0.00 ? 26  ALA A HB1  2  
ATOM 2610  H HB2  . ALA A 1 26  ? 15.714  -10.159 -15.833 1.00 0.00 ? 26  ALA A HB2  2  
ATOM 2611  H HB3  . ALA A 1 26  ? 15.243  -10.629 -14.200 1.00 0.00 ? 26  ALA A HB3  2  
ATOM 2612  N N    . LEU A 1 27  ? 12.382  -12.660 -14.414 1.00 0.00 ? 27  LEU A N    2  
ATOM 2613  C CA   . LEU A 1 27  ? 11.851  -13.824 -13.712 1.00 0.00 ? 27  LEU A CA   2  
ATOM 2614  C C    . LEU A 1 27  ? 10.521  -14.264 -14.315 1.00 0.00 ? 27  LEU A C    2  
ATOM 2615  O O    . LEU A 1 27  ? 10.155  -15.437 -14.249 1.00 0.00 ? 27  LEU A O    2  
ATOM 2616  C CB   . LEU A 1 27  ? 11.672  -13.510 -12.226 1.00 0.00 ? 27  LEU A CB   2  
ATOM 2617  C CG   . LEU A 1 27  ? 10.367  -12.812 -11.840 1.00 0.00 ? 27  LEU A CG   2  
ATOM 2618  C CD1  . LEU A 1 27  ? 9.321   -13.832 -11.417 1.00 0.00 ? 27  LEU A CD1  2  
ATOM 2619  C CD2  . LEU A 1 27  ? 10.611  -11.803 -10.728 1.00 0.00 ? 27  LEU A CD2  2  
ATOM 2620  H H    . LEU A 1 27  ? 11.864  -11.829 -14.416 1.00 0.00 ? 27  LEU A H    2  
ATOM 2621  H HA   . LEU A 1 27  ? 12.564  -14.628 -13.819 1.00 0.00 ? 27  LEU A HA   2  
ATOM 2622  H HB2  . LEU A 1 27  ? 11.721  -14.442 -11.683 1.00 0.00 ? 27  LEU A HB2  2  
ATOM 2623  H HB3  . LEU A 1 27  ? 12.491  -12.875 -11.922 1.00 0.00 ? 27  LEU A HB3  2  
ATOM 2624  H HG   . LEU A 1 27  ? 9.984   -12.279 -12.699 1.00 0.00 ? 27  LEU A HG   2  
ATOM 2625  H HD11 . LEU A 1 27  ? 9.102   -13.708 -10.368 1.00 0.00 ? 27  LEU A HD11 2  
ATOM 2626  H HD12 . LEU A 1 27  ? 9.699   -14.829 -11.591 1.00 0.00 ? 27  LEU A HD12 2  
ATOM 2627  H HD13 . LEU A 1 27  ? 8.420   -13.683 -11.995 1.00 0.00 ? 27  LEU A HD13 2  
ATOM 2628  H HD21 . LEU A 1 27  ? 11.048  -12.305 -9.877  1.00 0.00 ? 27  LEU A HD21 2  
ATOM 2629  H HD22 . LEU A 1 27  ? 9.673   -11.353 -10.438 1.00 0.00 ? 27  LEU A HD22 2  
ATOM 2630  H HD23 . LEU A 1 27  ? 11.285  -11.036 -11.079 1.00 0.00 ? 27  LEU A HD23 2  
ATOM 2631  N N    . GLY A 1 28  ? 9.802   -13.314 -14.906 1.00 0.00 ? 28  GLY A N    2  
ATOM 2632  C CA   . GLY A 1 28  ? 8.521   -13.624 -15.514 1.00 0.00 ? 28  GLY A CA   2  
ATOM 2633  C C    . GLY A 1 28  ? 8.667   -14.230 -16.896 1.00 0.00 ? 28  GLY A C    2  
ATOM 2634  O O    . GLY A 1 28  ? 8.190   -13.667 -17.881 1.00 0.00 ? 28  GLY A O    2  
ATOM 2635  H H    . GLY A 1 28  ? 10.144  -12.396 -14.929 1.00 0.00 ? 28  GLY A H    2  
ATOM 2636  H HA2  . GLY A 1 28  ? 7.993   -14.321 -14.881 1.00 0.00 ? 28  GLY A HA2  2  
ATOM 2637  H HA3  . GLY A 1 28  ? 7.944   -12.715 -15.592 1.00 0.00 ? 28  GLY A HA3  2  
ATOM 2638  N N    . GLN A 1 29  ? 9.329   -15.380 -16.970 1.00 0.00 ? 29  GLN A N    2  
ATOM 2639  C CA   . GLN A 1 29  ? 9.538   -16.061 -18.242 1.00 0.00 ? 29  GLN A CA   2  
ATOM 2640  C C    . GLN A 1 29  ? 8.795   -17.392 -18.276 1.00 0.00 ? 29  GLN A C    2  
ATOM 2641  O O    . GLN A 1 29  ? 8.456   -17.898 -19.346 1.00 0.00 ? 29  GLN A O    2  
ATOM 2642  C CB   . GLN A 1 29  ? 11.031  -16.291 -18.482 1.00 0.00 ? 29  GLN A CB   2  
ATOM 2643  C CG   . GLN A 1 29  ? 11.577  -15.541 -19.686 1.00 0.00 ? 29  GLN A CG   2  
ATOM 2644  C CD   . GLN A 1 29  ? 13.067  -15.280 -19.586 1.00 0.00 ? 29  GLN A CD   2  
ATOM 2645  O OE1  . GLN A 1 29  ? 13.590  -15.012 -18.504 1.00 0.00 ? 29  GLN A OE1  2  
ATOM 2646  N NE2  . GLN A 1 29  ? 13.759  -15.357 -20.716 1.00 0.00 ? 29  GLN A NE2  2  
ATOM 2647  H H    . GLN A 1 29  ? 9.686   -15.779 -16.149 1.00 0.00 ? 29  GLN A H    2  
ATOM 2648  H HA   . GLN A 1 29  ? 9.151   -15.426 -19.025 1.00 0.00 ? 29  GLN A HA   2  
ATOM 2649  H HB2  . GLN A 1 29  ? 11.578  -15.971 -17.607 1.00 0.00 ? 29  GLN A HB2  2  
ATOM 2650  H HB3  . GLN A 1 29  ? 11.200  -17.347 -18.636 1.00 0.00 ? 29  GLN A HB3  2  
ATOM 2651  H HG2  . GLN A 1 29  ? 11.389  -16.126 -20.574 1.00 0.00 ? 29  GLN A HG2  2  
ATOM 2652  H HG3  . GLN A 1 29  ? 11.065  -14.593 -19.766 1.00 0.00 ? 29  GLN A HG3  2  
ATOM 2653  H HE21 . GLN A 1 29  ? 13.275  -15.573 -21.541 1.00 0.00 ? 29  GLN A HE21 2  
ATOM 2654  H HE22 . GLN A 1 29  ? 14.724  -15.192 -20.680 1.00 0.00 ? 29  GLN A HE22 2  
ATOM 2655  N N    . HIS A 1 30  ? 8.544   -17.954 -17.098 1.00 0.00 ? 30  HIS A N    2  
ATOM 2656  C CA   . HIS A 1 30  ? 7.840   -19.227 -16.993 1.00 0.00 ? 30  HIS A CA   2  
ATOM 2657  C C    . HIS A 1 30  ? 6.414   -19.019 -16.491 1.00 0.00 ? 30  HIS A C    2  
ATOM 2658  O O    . HIS A 1 30  ? 5.449   -19.277 -17.210 1.00 0.00 ? 30  HIS A O    2  
ATOM 2659  C CB   . HIS A 1 30  ? 8.590   -20.173 -16.054 1.00 0.00 ? 30  HIS A CB   2  
ATOM 2660  C CG   . HIS A 1 30  ? 8.715   -21.568 -16.585 1.00 0.00 ? 30  HIS A CG   2  
ATOM 2661  N ND1  . HIS A 1 30  ? 7.981   -22.628 -16.097 1.00 0.00 ? 30  HIS A ND1  2  
ATOM 2662  C CD2  . HIS A 1 30  ? 9.495   -22.073 -17.569 1.00 0.00 ? 30  HIS A CD2  2  
ATOM 2663  C CE1  . HIS A 1 30  ? 8.305   -23.726 -16.757 1.00 0.00 ? 30  HIS A CE1  2  
ATOM 2664  N NE2  . HIS A 1 30  ? 9.222   -23.416 -17.656 1.00 0.00 ? 30  HIS A NE2  2  
ATOM 2665  H H    . HIS A 1 30  ? 8.839   -17.502 -16.280 1.00 0.00 ? 30  HIS A H    2  
ATOM 2666  H HA   . HIS A 1 30  ? 7.801   -19.667 -17.977 1.00 0.00 ? 30  HIS A HA   2  
ATOM 2667  H HB2  . HIS A 1 30  ? 9.586   -19.790 -15.889 1.00 0.00 ? 30  HIS A HB2  2  
ATOM 2668  H HB3  . HIS A 1 30  ? 8.067   -20.222 -15.110 1.00 0.00 ? 30  HIS A HB3  2  
ATOM 2669  H HD1  . HIS A 1 30  ? 7.322   -22.583 -15.374 1.00 0.00 ? 30  HIS A HD1  2  
ATOM 2670  H HD2  . HIS A 1 30  ? 10.203  -21.523 -18.174 1.00 0.00 ? 30  HIS A HD2  2  
ATOM 2671  H HE1  . HIS A 1 30  ? 7.891   -24.709 -16.590 1.00 0.00 ? 30  HIS A HE1  2  
ATOM 2672  N N    . GLY A 1 31  ? 6.289   -18.552 -15.252 1.00 0.00 ? 31  GLY A N    2  
ATOM 2673  C CA   . GLY A 1 31  ? 4.977   -18.319 -14.676 1.00 0.00 ? 31  GLY A CA   2  
ATOM 2674  C C    . GLY A 1 31  ? 4.474   -16.912 -14.932 1.00 0.00 ? 31  GLY A C    2  
ATOM 2675  O O    . GLY A 1 31  ? 3.267   -16.673 -14.960 1.00 0.00 ? 31  GLY A O    2  
ATOM 2676  H H    . GLY A 1 31  ? 7.094   -18.365 -14.726 1.00 0.00 ? 31  GLY A H    2  
ATOM 2677  H HA2  . GLY A 1 31  ? 4.279   -19.023 -15.102 1.00 0.00 ? 31  GLY A HA2  2  
ATOM 2678  H HA3  . GLY A 1 31  ? 5.032   -18.481 -13.610 1.00 0.00 ? 31  GLY A HA3  2  
ATOM 2679  N N    . ALA A 1 32  ? 5.401   -15.978 -15.116 1.00 0.00 ? 32  ALA A N    2  
ATOM 2680  C CA   . ALA A 1 32  ? 5.045   -14.587 -15.370 1.00 0.00 ? 32  ALA A CA   2  
ATOM 2681  C C    . ALA A 1 32  ? 4.309   -13.983 -14.179 1.00 0.00 ? 32  ALA A C    2  
ATOM 2682  O O    . ALA A 1 32  ? 3.335   -13.250 -14.347 1.00 0.00 ? 32  ALA A O    2  
ATOM 2683  C CB   . ALA A 1 32  ? 4.194   -14.482 -16.627 1.00 0.00 ? 32  ALA A CB   2  
ATOM 2684  H H    . ALA A 1 32  ? 6.347   -16.230 -15.081 1.00 0.00 ? 32  ALA A H    2  
ATOM 2685  H HA   . ALA A 1 32  ? 5.958   -14.033 -15.535 1.00 0.00 ? 32  ALA A HA   2  
ATOM 2686  H HB1  . ALA A 1 32  ? 4.494   -15.247 -17.329 1.00 0.00 ? 32  ALA A HB1  2  
ATOM 2687  H HB2  . ALA A 1 32  ? 3.154   -14.616 -16.371 1.00 0.00 ? 32  ALA A HB2  2  
ATOM 2688  H HB3  . ALA A 1 32  ? 4.333   -13.509 -17.075 1.00 0.00 ? 32  ALA A HB3  2  
ATOM 2689  N N    . ASN A 1 33  ? 4.781   -14.295 -12.977 1.00 0.00 ? 33  ASN A N    2  
ATOM 2690  C CA   . ASN A 1 33  ? 4.166   -13.783 -11.757 1.00 0.00 ? 33  ASN A CA   2  
ATOM 2691  C C    . ASN A 1 33  ? 5.063   -12.745 -11.091 1.00 0.00 ? 33  ASN A C    2  
ATOM 2692  O O    . ASN A 1 33  ? 6.147   -13.067 -10.603 1.00 0.00 ? 33  ASN A O    2  
ATOM 2693  C CB   . ASN A 1 33  ? 3.883   -14.930 -10.784 1.00 0.00 ? 33  ASN A CB   2  
ATOM 2694  C CG   . ASN A 1 33  ? 2.407   -15.270 -10.704 1.00 0.00 ? 33  ASN A CG   2  
ATOM 2695  O OD1  . ASN A 1 33  ? 1.554   -14.382 -10.691 1.00 0.00 ? 33  ASN A OD1  2  
ATOM 2696  N ND2  . ASN A 1 33  ? 2.100   -16.560 -10.651 1.00 0.00 ? 33  ASN A ND2  2  
ATOM 2697  H H    . ASN A 1 33  ? 5.561   -14.885 -12.908 1.00 0.00 ? 33  ASN A H    2  
ATOM 2698  H HA   . ASN A 1 33  ? 3.232   -13.315 -12.029 1.00 0.00 ? 33  ASN A HA   2  
ATOM 2699  H HB2  . ASN A 1 33  ? 4.419   -15.810 -11.109 1.00 0.00 ? 33  ASN A HB2  2  
ATOM 2700  H HB3  . ASN A 1 33  ? 4.223   -14.650 -9.798  1.00 0.00 ? 33  ASN A HB3  2  
ATOM 2701  H HD21 . ASN A 1 33  ? 2.832   -17.212 -10.666 1.00 0.00 ? 33  ASN A HD21 2  
ATOM 2702  H HD22 . ASN A 1 33  ? 1.153   -16.809 -10.600 1.00 0.00 ? 33  ASN A HD22 2  
ATOM 2703  N N    . ILE A 1 34  ? 4.603   -11.498 -11.073 1.00 0.00 ? 34  ILE A N    2  
ATOM 2704  C CA   . ILE A 1 34  ? 5.363   -10.413 -10.465 1.00 0.00 ? 34  ILE A CA   2  
ATOM 2705  C C    . ILE A 1 34  ? 4.951   -10.200 -9.012  1.00 0.00 ? 34  ILE A C    2  
ATOM 2706  O O    . ILE A 1 34  ? 5.770   -10.316 -8.101  1.00 0.00 ? 34  ILE A O    2  
ATOM 2707  C CB   . ILE A 1 34  ? 5.177   -9.094  -11.238 1.00 0.00 ? 34  ILE A CB   2  
ATOM 2708  C CG1  . ILE A 1 34  ? 5.407   -9.317  -12.734 1.00 0.00 ? 34  ILE A CG1  2  
ATOM 2709  C CG2  . ILE A 1 34  ? 6.124   -8.030  -10.704 1.00 0.00 ? 34  ILE A CG2  2  
ATOM 2710  C CD1  . ILE A 1 34  ? 6.784   -9.850  -13.061 1.00 0.00 ? 34  ILE A CD1  2  
ATOM 2711  H H    . ILE A 1 34  ? 3.732   -11.304 -11.478 1.00 0.00 ? 34  ILE A H    2  
ATOM 2712  H HA   . ILE A 1 34  ? 6.409   -10.681 -10.496 1.00 0.00 ? 34  ILE A HA   2  
ATOM 2713  H HB   . ILE A 1 34  ? 4.165   -8.751  -11.083 1.00 0.00 ? 34  ILE A HB   2  
ATOM 2714  H HG12 . ILE A 1 34  ? 4.682   -10.027 -13.101 1.00 0.00 ? 34  ILE A HG12 2  
ATOM 2715  H HG13 . ILE A 1 34  ? 5.281   -8.378  -13.254 1.00 0.00 ? 34  ILE A HG13 2  
ATOM 2716  H HG21 . ILE A 1 34  ? 6.592   -7.517  -11.532 1.00 0.00 ? 34  ILE A HG21 2  
ATOM 2717  H HG22 . ILE A 1 34  ? 5.569   -7.320  -10.110 1.00 0.00 ? 34  ILE A HG22 2  
ATOM 2718  H HG23 . ILE A 1 34  ? 6.883   -8.496  -10.094 1.00 0.00 ? 34  ILE A HG23 2  
ATOM 2719  H HD11 . ILE A 1 34  ? 7.174   -9.333  -13.925 1.00 0.00 ? 34  ILE A HD11 2  
ATOM 2720  H HD12 . ILE A 1 34  ? 7.441   -9.692  -12.219 1.00 0.00 ? 34  ILE A HD12 2  
ATOM 2721  H HD13 . ILE A 1 34  ? 6.720   -10.907 -13.274 1.00 0.00 ? 34  ILE A HD13 2  
ATOM 2722  N N    . MET A 1 35  ? 3.675   -9.891  -8.804  1.00 0.00 ? 35  MET A N    2  
ATOM 2723  C CA   . MET A 1 35  ? 3.153   -9.665  -7.461  1.00 0.00 ? 35  MET A CA   2  
ATOM 2724  C C    . MET A 1 35  ? 3.374   -10.890 -6.579  1.00 0.00 ? 35  MET A C    2  
ATOM 2725  O O    . MET A 1 35  ? 3.748   -10.766 -5.414  1.00 0.00 ? 35  MET A O    2  
ATOM 2726  C CB   . MET A 1 35  ? 1.662   -9.326  -7.520  1.00 0.00 ? 35  MET A CB   2  
ATOM 2727  C CG   . MET A 1 35  ? 1.362   -7.859  -7.260  1.00 0.00 ? 35  MET A CG   2  
ATOM 2728  S SD   . MET A 1 35  ? 1.073   -7.508  -5.515  1.00 0.00 ? 35  MET A SD   2  
ATOM 2729  C CE   . MET A 1 35  ? 2.560   -6.600  -5.102  1.00 0.00 ? 35  MET A CE   2  
ATOM 2730  H H    . MET A 1 35  ? 3.070   -9.812  -9.571  1.00 0.00 ? 35  MET A H    2  
ATOM 2731  H HA   . MET A 1 35  ? 3.687   -8.828  -7.035  1.00 0.00 ? 35  MET A HA   2  
ATOM 2732  H HB2  . MET A 1 35  ? 1.286   -9.580  -8.500  1.00 0.00 ? 35  MET A HB2  2  
ATOM 2733  H HB3  . MET A 1 35  ? 1.142   -9.915  -6.780  1.00 0.00 ? 35  MET A HB3  2  
ATOM 2734  H HG2  . MET A 1 35  ? 2.200   -7.268  -7.597  1.00 0.00 ? 35  MET A HG2  2  
ATOM 2735  H HG3  . MET A 1 35  ? 0.481   -7.582  -7.820  1.00 0.00 ? 35  MET A HG3  2  
ATOM 2736  H HE1  . MET A 1 35  ? 2.583   -5.674  -5.658  1.00 0.00 ? 35  MET A HE1  2  
ATOM 2737  H HE2  . MET A 1 35  ? 2.568   -6.385  -4.044  1.00 0.00 ? 35  MET A HE2  2  
ATOM 2738  H HE3  . MET A 1 35  ? 3.427   -7.193  -5.356  1.00 0.00 ? 35  MET A HE3  2  
ATOM 2739  N N    . GLU A 1 36  ? 3.139   -12.070 -7.144  1.00 0.00 ? 36  GLU A N    2  
ATOM 2740  C CA   . GLU A 1 36  ? 3.311   -13.317 -6.407  1.00 0.00 ? 36  GLU A CA   2  
ATOM 2741  C C    . GLU A 1 36  ? 4.764   -13.499 -5.979  1.00 0.00 ? 36  GLU A C    2  
ATOM 2742  O O    . GLU A 1 36  ? 5.063   -14.276 -5.072  1.00 0.00 ? 36  GLU A O    2  
ATOM 2743  C CB   . GLU A 1 36  ? 2.866   -14.506 -7.261  1.00 0.00 ? 36  GLU A CB   2  
ATOM 2744  C CG   . GLU A 1 36  ? 1.491   -15.039 -6.893  1.00 0.00 ? 36  GLU A CG   2  
ATOM 2745  C CD   . GLU A 1 36  ? 0.517   -13.936 -6.528  1.00 0.00 ? 36  GLU A CD   2  
ATOM 2746  O OE1  . GLU A 1 36  ? 0.005   -13.268 -7.450  1.00 0.00 ? 36  GLU A OE1  2  
ATOM 2747  O OE2  . GLU A 1 36  ? 0.266   -13.741 -5.320  1.00 0.00 ? 36  GLU A OE2  2  
ATOM 2748  H H    . GLU A 1 36  ? 2.842   -12.103 -8.077  1.00 0.00 ? 36  GLU A H    2  
ATOM 2749  H HA   . GLU A 1 36  ? 2.692   -13.268 -5.524  1.00 0.00 ? 36  GLU A HA   2  
ATOM 2750  H HB2  . GLU A 1 36  ? 2.847   -14.202 -8.297  1.00 0.00 ? 36  GLU A HB2  2  
ATOM 2751  H HB3  . GLU A 1 36  ? 3.582   -15.305 -7.143  1.00 0.00 ? 36  GLU A HB3  2  
ATOM 2752  H HG2  . GLU A 1 36  ? 1.094   -15.585 -7.736  1.00 0.00 ? 36  GLU A HG2  2  
ATOM 2753  H HG3  . GLU A 1 36  ? 1.592   -15.705 -6.049  1.00 0.00 ? 36  GLU A HG3  2  
ATOM 2754  N N    . PHE A 1 37  ? 5.664   -12.778 -6.640  1.00 0.00 ? 37  PHE A N    2  
ATOM 2755  C CA   . PHE A 1 37  ? 7.087   -12.861 -6.330  1.00 0.00 ? 37  PHE A CA   2  
ATOM 2756  C C    . PHE A 1 37  ? 7.429   -12.009 -5.111  1.00 0.00 ? 37  PHE A C    2  
ATOM 2757  O O    . PHE A 1 37  ? 8.071   -12.478 -4.171  1.00 0.00 ? 37  PHE A O    2  
ATOM 2758  C CB   . PHE A 1 37  ? 7.919   -12.409 -7.531  1.00 0.00 ? 37  PHE A CB   2  
ATOM 2759  C CG   . PHE A 1 37  ? 9.284   -13.034 -7.584  1.00 0.00 ? 37  PHE A CG   2  
ATOM 2760  C CD1  . PHE A 1 37  ? 9.432   -14.387 -7.844  1.00 0.00 ? 37  PHE A CD1  2  
ATOM 2761  C CD2  . PHE A 1 37  ? 10.420  -12.268 -7.374  1.00 0.00 ? 37  PHE A CD2  2  
ATOM 2762  C CE1  . PHE A 1 37  ? 10.687  -14.964 -7.892  1.00 0.00 ? 37  PHE A CE1  2  
ATOM 2763  C CE2  . PHE A 1 37  ? 11.677  -12.840 -7.421  1.00 0.00 ? 37  PHE A CE2  2  
ATOM 2764  C CZ   . PHE A 1 37  ? 11.811  -14.190 -7.681  1.00 0.00 ? 37  PHE A CZ   2  
ATOM 2765  H H    . PHE A 1 37  ? 5.364   -12.176 -7.353  1.00 0.00 ? 37  PHE A H    2  
ATOM 2766  H HA   . PHE A 1 37  ? 7.318   -13.892 -6.109  1.00 0.00 ? 37  PHE A HA   2  
ATOM 2767  H HB2  . PHE A 1 37  ? 7.399   -12.673 -8.440  1.00 0.00 ? 37  PHE A HB2  2  
ATOM 2768  H HB3  . PHE A 1 37  ? 8.045   -11.338 -7.491  1.00 0.00 ? 37  PHE A HB3  2  
ATOM 2769  H HD1  . PHE A 1 37  ? 8.554   -14.994 -8.009  1.00 0.00 ? 37  PHE A HD1  2  
ATOM 2770  H HD2  . PHE A 1 37  ? 10.316  -11.212 -7.170  1.00 0.00 ? 37  PHE A HD2  2  
ATOM 2771  H HE1  . PHE A 1 37  ? 10.789  -16.020 -8.095  1.00 0.00 ? 37  PHE A HE1  2  
ATOM 2772  H HE2  . PHE A 1 37  ? 12.554  -12.231 -7.256  1.00 0.00 ? 37  PHE A HE2  2  
ATOM 2773  H HZ   . PHE A 1 37  ? 12.792  -14.639 -7.718  1.00 0.00 ? 37  PHE A HZ   2  
ATOM 2774  N N    . VAL A 1 38  ? 6.995   -10.752 -5.134  1.00 0.00 ? 38  VAL A N    2  
ATOM 2775  C CA   . VAL A 1 38  ? 7.253   -9.834  -4.032  1.00 0.00 ? 38  VAL A CA   2  
ATOM 2776  C C    . VAL A 1 38  ? 6.394   -10.175 -2.819  1.00 0.00 ? 38  VAL A C    2  
ATOM 2777  O O    . VAL A 1 38  ? 6.875   -10.180 -1.686  1.00 0.00 ? 38  VAL A O    2  
ATOM 2778  C CB   . VAL A 1 38  ? 6.985   -8.374  -4.443  1.00 0.00 ? 38  VAL A CB   2  
ATOM 2779  C CG1  . VAL A 1 38  ? 7.235   -7.435  -3.273  1.00 0.00 ? 38  VAL A CG1  2  
ATOM 2780  C CG2  . VAL A 1 38  ? 7.845   -7.991  -5.638  1.00 0.00 ? 38  VAL A CG2  2  
ATOM 2781  H H    . VAL A 1 38  ? 6.488   -10.436 -5.911  1.00 0.00 ? 38  VAL A H    2  
ATOM 2782  H HA   . VAL A 1 38  ? 8.295   -9.923  -3.760  1.00 0.00 ? 38  VAL A HA   2  
ATOM 2783  H HB   . VAL A 1 38  ? 5.947   -8.287  -4.731  1.00 0.00 ? 38  VAL A HB   2  
ATOM 2784  H HG11 . VAL A 1 38  ? 7.611   -6.492  -3.643  1.00 0.00 ? 38  VAL A HG11 2  
ATOM 2785  H HG12 . VAL A 1 38  ? 6.310   -7.271  -2.739  1.00 0.00 ? 38  VAL A HG12 2  
ATOM 2786  H HG13 . VAL A 1 38  ? 7.963   -7.875  -2.608  1.00 0.00 ? 38  VAL A HG13 2  
ATOM 2787  H HG21 . VAL A 1 38  ? 7.295   -7.313  -6.274  1.00 0.00 ? 38  VAL A HG21 2  
ATOM 2788  H HG22 . VAL A 1 38  ? 8.747   -7.508  -5.293  1.00 0.00 ? 38  VAL A HG22 2  
ATOM 2789  H HG23 . VAL A 1 38  ? 8.103   -8.879  -6.196  1.00 0.00 ? 38  VAL A HG23 2  
ATOM 2790  N N    . LYS A 1 39  ? 5.120   -10.459 -3.065  1.00 0.00 ? 39  LYS A N    2  
ATOM 2791  C CA   . LYS A 1 39  ? 4.192   -10.804 -1.994  1.00 0.00 ? 39  LYS A CA   2  
ATOM 2792  C C    . LYS A 1 39  ? 4.673   -12.035 -1.233  1.00 0.00 ? 39  LYS A C    2  
ATOM 2793  O O    . LYS A 1 39  ? 4.271   -12.268 -0.094  1.00 0.00 ? 39  LYS A O    2  
ATOM 2794  C CB   . LYS A 1 39  ? 2.795   -11.056 -2.564  1.00 0.00 ? 39  LYS A CB   2  
ATOM 2795  C CG   . LYS A 1 39  ? 2.053   -9.785  -2.942  1.00 0.00 ? 39  LYS A CG   2  
ATOM 2796  C CD   . LYS A 1 39  ? 1.269   -9.227  -1.766  1.00 0.00 ? 39  LYS A CD   2  
ATOM 2797  C CE   . LYS A 1 39  ? -0.210  -9.567  -1.871  1.00 0.00 ? 39  LYS A CE   2  
ATOM 2798  N NZ   . LYS A 1 39  ? -0.505  -10.928 -1.343  1.00 0.00 ? 39  LYS A NZ   2  
ATOM 2799  H H    . LYS A 1 39  ? 4.796   -10.438 -3.990  1.00 0.00 ? 39  LYS A H    2  
ATOM 2800  H HA   . LYS A 1 39  ? 4.148   -9.968  -1.312  1.00 0.00 ? 39  LYS A HA   2  
ATOM 2801  H HB2  . LYS A 1 39  ? 2.885   -11.671 -3.447  1.00 0.00 ? 39  LYS A HB2  2  
ATOM 2802  H HB3  . LYS A 1 39  ? 2.208   -11.584 -1.826  1.00 0.00 ? 39  LYS A HB3  2  
ATOM 2803  H HG2  . LYS A 1 39  ? 2.768   -9.045  -3.267  1.00 0.00 ? 39  LYS A HG2  2  
ATOM 2804  H HG3  . LYS A 1 39  ? 1.368   -10.006 -3.748  1.00 0.00 ? 39  LYS A HG3  2  
ATOM 2805  H HD2  . LYS A 1 39  ? 1.659   -9.648  -0.851  1.00 0.00 ? 39  LYS A HD2  2  
ATOM 2806  H HD3  . LYS A 1 39  ? 1.382   -8.152  -1.746  1.00 0.00 ? 39  LYS A HD3  2  
ATOM 2807  H HE2  . LYS A 1 39  ? -0.774  -8.841  -1.305  1.00 0.00 ? 39  LYS A HE2  2  
ATOM 2808  H HE3  . LYS A 1 39  ? -0.504  -9.521  -2.909  1.00 0.00 ? 39  LYS A HE3  2  
ATOM 2809  H HZ1  . LYS A 1 39  ? -1.204  -10.869 -0.575  1.00 0.00 ? 39  LYS A HZ1  2  
ATOM 2810  H HZ2  . LYS A 1 39  ? 0.363   -11.364 -0.974  1.00 0.00 ? 39  LYS A HZ2  2  
ATOM 2811  H HZ3  . LYS A 1 39  ? -0.889  -11.529 -2.100  1.00 0.00 ? 39  LYS A HZ3  2  
ATOM 2812  N N    . ALA A 1 40  ? 5.535   -12.820 -1.871  1.00 0.00 ? 40  ALA A N    2  
ATOM 2813  C CA   . ALA A 1 40  ? 6.073   -14.026 -1.252  1.00 0.00 ? 40  ALA A CA   2  
ATOM 2814  C C    . ALA A 1 40  ? 7.484   -13.789 -0.724  1.00 0.00 ? 40  ALA A C    2  
ATOM 2815  O O    . ALA A 1 40  ? 8.094   -14.681 -0.135  1.00 0.00 ? 40  ALA A O    2  
ATOM 2816  C CB   . ALA A 1 40  ? 6.065   -15.177 -2.247  1.00 0.00 ? 40  ALA A CB   2  
ATOM 2817  H H    . ALA A 1 40  ? 5.818   -12.582 -2.778  1.00 0.00 ? 40  ALA A H    2  
ATOM 2818  H HA   . ALA A 1 40  ? 5.429   -14.292 -0.426  1.00 0.00 ? 40  ALA A HA   2  
ATOM 2819  H HB1  . ALA A 1 40  ? 5.060   -15.330 -2.611  1.00 0.00 ? 40  ALA A HB1  2  
ATOM 2820  H HB2  . ALA A 1 40  ? 6.717   -14.942 -3.075  1.00 0.00 ? 40  ALA A HB2  2  
ATOM 2821  H HB3  . ALA A 1 40  ? 6.413   -16.076 -1.759  1.00 0.00 ? 40  ALA A HB3  2  
ATOM 2822  N N    . PHE A 1 41  ? 7.996   -12.582 -0.939  1.00 0.00 ? 41  PHE A N    2  
ATOM 2823  C CA   . PHE A 1 41  ? 9.337   -12.229 -0.485  1.00 0.00 ? 41  PHE A CA   2  
ATOM 2824  C C    . PHE A 1 41  ? 9.291   -11.046 0.477   1.00 0.00 ? 41  PHE A C    2  
ATOM 2825  O O    . PHE A 1 41  ? 10.324  -10.593 0.970   1.00 0.00 ? 41  PHE A O    2  
ATOM 2826  C CB   . PHE A 1 41  ? 10.231  -11.895 -1.681  1.00 0.00 ? 41  PHE A CB   2  
ATOM 2827  C CG   . PHE A 1 41  ? 11.348  -12.878 -1.887  1.00 0.00 ? 41  PHE A CG   2  
ATOM 2828  C CD1  . PHE A 1 41  ? 11.104  -14.241 -1.857  1.00 0.00 ? 41  PHE A CD1  2  
ATOM 2829  C CD2  . PHE A 1 41  ? 12.643  -12.438 -2.110  1.00 0.00 ? 41  PHE A CD2  2  
ATOM 2830  C CE1  . PHE A 1 41  ? 12.130  -15.148 -2.046  1.00 0.00 ? 41  PHE A CE1  2  
ATOM 2831  C CE2  . PHE A 1 41  ? 13.673  -13.340 -2.301  1.00 0.00 ? 41  PHE A CE2  2  
ATOM 2832  C CZ   . PHE A 1 41  ? 13.416  -14.696 -2.268  1.00 0.00 ? 41  PHE A CZ   2  
ATOM 2833  H H    . PHE A 1 41  ? 7.461   -11.913 -1.414  1.00 0.00 ? 41  PHE A H    2  
ATOM 2834  H HA   . PHE A 1 41  ? 9.746   -13.083 0.032   1.00 0.00 ? 41  PHE A HA   2  
ATOM 2835  H HB2  . PHE A 1 41  ? 9.631   -11.883 -2.578  1.00 0.00 ? 41  PHE A HB2  2  
ATOM 2836  H HB3  . PHE A 1 41  ? 10.668  -10.920 -1.532  1.00 0.00 ? 41  PHE A HB3  2  
ATOM 2837  H HD1  . PHE A 1 41  ? 10.098  -14.596 -1.683  1.00 0.00 ? 41  PHE A HD1  2  
ATOM 2838  H HD2  . PHE A 1 41  ? 12.846  -11.377 -2.136  1.00 0.00 ? 41  PHE A HD2  2  
ATOM 2839  H HE1  . PHE A 1 41  ? 11.925  -16.208 -2.020  1.00 0.00 ? 41  PHE A HE1  2  
ATOM 2840  H HE2  . PHE A 1 41  ? 14.678  -12.984 -2.474  1.00 0.00 ? 41  PHE A HE2  2  
ATOM 2841  H HZ   . PHE A 1 41  ? 14.219  -15.403 -2.417  1.00 0.00 ? 41  PHE A HZ   2  
ATOM 2842  N N    . ASN A 1 42  ? 8.087   -10.549 0.738   1.00 0.00 ? 42  ASN A N    2  
ATOM 2843  C CA   . ASN A 1 42  ? 7.905   -9.417  1.640   1.00 0.00 ? 42  ASN A CA   2  
ATOM 2844  C C    . ASN A 1 42  ? 8.334   -9.779  3.059   1.00 0.00 ? 42  ASN A C    2  
ATOM 2845  O O    . ASN A 1 42  ? 9.332   -9.268  3.566   1.00 0.00 ? 42  ASN A O    2  
ATOM 2846  C CB   . ASN A 1 42  ? 6.444   -8.964  1.636   1.00 0.00 ? 42  ASN A CB   2  
ATOM 2847  C CG   . ASN A 1 42  ? 6.286   -7.519  2.067   1.00 0.00 ? 42  ASN A CG   2  
ATOM 2848  O OD1  . ASN A 1 42  ? 6.184   -7.222  3.257   1.00 0.00 ? 42  ASN A OD1  2  
ATOM 2849  N ND2  . ASN A 1 42  ? 6.264   -6.612  1.097   1.00 0.00 ? 42  ASN A ND2  2  
ATOM 2850  H H    . ASN A 1 42  ? 7.301   -10.953 0.314   1.00 0.00 ? 42  ASN A H    2  
ATOM 2851  H HA   . ASN A 1 42  ? 8.525   -8.608  1.284   1.00 0.00 ? 42  ASN A HA   2  
ATOM 2852  H HB2  . ASN A 1 42  ? 6.044   -9.068  0.638   1.00 0.00 ? 42  ASN A HB2  2  
ATOM 2853  H HB3  . ASN A 1 42  ? 5.878   -9.587  2.313   1.00 0.00 ? 42  ASN A HB3  2  
ATOM 2854  H HD21 . ASN A 1 42  ? 6.350   -6.921  0.171   1.00 0.00 ? 42  ASN A HD21 2  
ATOM 2855  H HD22 . ASN A 1 42  ? 6.164   -5.670  1.348   1.00 0.00 ? 42  ASN A HD22 2  
ATOM 2856  N N    . ALA A 1 43  ? 7.572   -10.663 3.694   1.00 0.00 ? 43  ALA A N    2  
ATOM 2857  C CA   . ALA A 1 43  ? 7.874   -11.095 5.053   1.00 0.00 ? 43  ALA A CA   2  
ATOM 2858  C C    . ALA A 1 43  ? 8.776   -12.324 5.051   1.00 0.00 ? 43  ALA A C    2  
ATOM 2859  O O    . ALA A 1 43  ? 9.141   -12.840 6.107   1.00 0.00 ? 43  ALA A O    2  
ATOM 2860  C CB   . ALA A 1 43  ? 6.588   -11.384 5.813   1.00 0.00 ? 43  ALA A CB   2  
ATOM 2861  H H    . ALA A 1 43  ? 6.789   -11.035 3.237   1.00 0.00 ? 43  ALA A H    2  
ATOM 2862  H HA   . ALA A 1 43  ? 8.385   -10.286 5.554   1.00 0.00 ? 43  ALA A HA   2  
ATOM 2863  H HB1  . ALA A 1 43  ? 5.784   -11.546 5.109   1.00 0.00 ? 43  ALA A HB1  2  
ATOM 2864  H HB2  . ALA A 1 43  ? 6.719   -12.267 6.420   1.00 0.00 ? 43  ALA A HB2  2  
ATOM 2865  H HB3  . ALA A 1 43  ? 6.348   -10.543 6.447   1.00 0.00 ? 43  ALA A HB3  2  
ATOM 2866  N N    . ALA A 1 44  ? 9.133   -12.789 3.858   1.00 0.00 ? 44  ALA A N    2  
ATOM 2867  C CA   . ALA A 1 44  ? 9.994   -13.957 3.718   1.00 0.00 ? 44  ALA A CA   2  
ATOM 2868  C C    . ALA A 1 44  ? 11.456  -13.593 3.956   1.00 0.00 ? 44  ALA A C    2  
ATOM 2869  O O    . ALA A 1 44  ? 12.161  -14.268 4.706   1.00 0.00 ? 44  ALA A O    2  
ATOM 2870  C CB   . ALA A 1 44  ? 9.820   -14.579 2.341   1.00 0.00 ? 44  ALA A CB   2  
ATOM 2871  H H    . ALA A 1 44  ? 8.810   -12.334 3.052   1.00 0.00 ? 44  ALA A H    2  
ATOM 2872  H HA   . ALA A 1 44  ? 9.690   -14.685 4.457   1.00 0.00 ? 44  ALA A HA   2  
ATOM 2873  H HB1  . ALA A 1 44  ? 10.786  -14.673 1.865   1.00 0.00 ? 44  ALA A HB1  2  
ATOM 2874  H HB2  . ALA A 1 44  ? 9.372   -15.557 2.442   1.00 0.00 ? 44  ALA A HB2  2  
ATOM 2875  H HB3  . ALA A 1 44  ? 9.182   -13.950 1.740   1.00 0.00 ? 44  ALA A HB3  2  
ATOM 2876  N N    . THR A 1 45  ? 11.906  -12.521 3.311   1.00 0.00 ? 45  THR A N    2  
ATOM 2877  C CA   . THR A 1 45  ? 13.284  -12.068 3.451   1.00 0.00 ? 45  THR A CA   2  
ATOM 2878  C C    . THR A 1 45  ? 13.466  -11.241 4.718   1.00 0.00 ? 45  THR A C    2  
ATOM 2879  O O    . THR A 1 45  ? 14.363  -11.503 5.519   1.00 0.00 ? 45  THR A O    2  
ATOM 2880  C CB   . THR A 1 45  ? 13.726  -11.229 2.236   1.00 0.00 ? 45  THR A CB   2  
ATOM 2881  O OG1  . THR A 1 45  ? 12.995  -9.998  2.200   1.00 0.00 ? 45  THR A OG1  2  
ATOM 2882  C CG2  . THR A 1 45  ? 13.505  -11.995 0.941   1.00 0.00 ? 45  THR A CG2  2  
ATOM 2883  H H    . THR A 1 45  ? 11.296  -12.024 2.727   1.00 0.00 ? 45  THR A H    2  
ATOM 2884  H HA   . THR A 1 45  ? 13.918  -12.941 3.508   1.00 0.00 ? 45  THR A HA   2  
ATOM 2885  H HB   . THR A 1 45  ? 14.780  -11.011 2.333   1.00 0.00 ? 45  THR A HB   2  
ATOM 2886  H HG1  . THR A 1 45  ? 12.988  -9.657  1.302   1.00 0.00 ? 45  THR A HG1  2  
ATOM 2887  H HG21 . THR A 1 45  ? 12.908  -11.398 0.267   1.00 0.00 ? 45  THR A HG21 2  
ATOM 2888  H HG22 . THR A 1 45  ? 12.992  -12.921 1.153   1.00 0.00 ? 45  THR A HG22 2  
ATOM 2889  H HG23 . THR A 1 45  ? 14.458  -12.208 0.482   1.00 0.00 ? 45  THR A HG23 2  
ATOM 2890  N N    . ALA A 1 46  ? 12.608  -10.241 4.895   1.00 0.00 ? 46  ALA A N    2  
ATOM 2891  C CA   . ALA A 1 46  ? 12.672  -9.377  6.067   1.00 0.00 ? 46  ALA A CA   2  
ATOM 2892  C C    . ALA A 1 46  ? 12.706  -10.198 7.352   1.00 0.00 ? 46  ALA A C    2  
ATOM 2893  O O    . ALA A 1 46  ? 13.283  -9.777  8.353   1.00 0.00 ? 46  ALA A O    2  
ATOM 2894  C CB   . ALA A 1 46  ? 11.492  -8.418  6.081   1.00 0.00 ? 46  ALA A CB   2  
ATOM 2895  H H    . ALA A 1 46  ? 11.915  -10.082 4.221   1.00 0.00 ? 46  ALA A H    2  
ATOM 2896  H HA   . ALA A 1 46  ? 13.579  -8.793  6.001   1.00 0.00 ? 46  ALA A HA   2  
ATOM 2897  H HB1  . ALA A 1 46  ? 10.809  -8.700  6.870   1.00 0.00 ? 46  ALA A HB1  2  
ATOM 2898  H HB2  . ALA A 1 46  ? 11.847  -7.413  6.254   1.00 0.00 ? 46  ALA A HB2  2  
ATOM 2899  H HB3  . ALA A 1 46  ? 10.981  -8.462  5.131   1.00 0.00 ? 46  ALA A HB3  2  
ATOM 2900  N N    . ASN A 1 47  ? 12.081  -11.370 7.316   1.00 0.00 ? 47  ASN A N    2  
ATOM 2901  C CA   . ASN A 1 47  ? 12.038  -12.249 8.480   1.00 0.00 ? 47  ASN A CA   2  
ATOM 2902  C C    . ASN A 1 47  ? 13.444  -12.530 9.001   1.00 0.00 ? 47  ASN A C    2  
ATOM 2903  O O    . ASN A 1 47  ? 13.635  -12.795 10.188  1.00 0.00 ? 47  ASN A O    2  
ATOM 2904  C CB   . ASN A 1 47  ? 11.342  -13.564 8.126   1.00 0.00 ? 47  ASN A CB   2  
ATOM 2905  C CG   . ASN A 1 47  ? 10.029  -13.740 8.864   1.00 0.00 ? 47  ASN A CG   2  
ATOM 2906  O OD1  . ASN A 1 47  ? 9.744   -14.812 9.400   1.00 0.00 ? 47  ASN A OD1  2  
ATOM 2907  N ND2  . ASN A 1 47  ? 9.222   -12.686 8.896   1.00 0.00 ? 47  ASN A ND2  2  
ATOM 2908  H H    . ASN A 1 47  ? 11.638  -11.652 6.489   1.00 0.00 ? 47  ASN A H    2  
ATOM 2909  H HA   . ASN A 1 47  ? 11.473  -11.749 9.252   1.00 0.00 ? 47  ASN A HA   2  
ATOM 2910  H HB2  . ASN A 1 47  ? 11.140  -13.584 7.064   1.00 0.00 ? 47  ASN A HB2  2  
ATOM 2911  H HB3  . ASN A 1 47  ? 11.990  -14.389 8.380   1.00 0.00 ? 47  ASN A HB3  2  
ATOM 2912  H HD21 . ASN A 1 47  ? 9.515   -11.865 8.447   1.00 0.00 ? 47  ASN A HD21 2  
ATOM 2913  H HD22 . ASN A 1 47  ? 8.367   -12.772 9.367   1.00 0.00 ? 47  ASN A HD22 2  
ATOM 2914  N N    . MET A 1 48  ? 14.425  -12.469 8.106   1.00 0.00 ? 48  MET A N    2  
ATOM 2915  C CA   . MET A 1 48  ? 15.814  -12.714 8.477   1.00 0.00 ? 48  MET A CA   2  
ATOM 2916  C C    . MET A 1 48  ? 16.350  -11.588 9.354   1.00 0.00 ? 48  MET A C    2  
ATOM 2917  O O    . MET A 1 48  ? 17.193  -11.811 10.222  1.00 0.00 ? 48  MET A O    2  
ATOM 2918  C CB   . MET A 1 48  ? 16.680  -12.858 7.224   1.00 0.00 ? 48  MET A CB   2  
ATOM 2919  C CG   . MET A 1 48  ? 16.619  -14.241 6.597   1.00 0.00 ? 48  MET A CG   2  
ATOM 2920  S SD   . MET A 1 48  ? 15.100  -14.514 5.665   1.00 0.00 ? 48  MET A SD   2  
ATOM 2921  C CE   . MET A 1 48  ? 15.762  -14.920 4.051   1.00 0.00 ? 48  MET A CE   2  
ATOM 2922  H H    . MET A 1 48  ? 14.210  -12.252 7.175   1.00 0.00 ? 48  MET A H    2  
ATOM 2923  H HA   . MET A 1 48  ? 15.849  -13.638 9.035   1.00 0.00 ? 48  MET A HA   2  
ATOM 2924  H HB2  . MET A 1 48  ? 16.352  -12.138 6.489   1.00 0.00 ? 48  MET A HB2  2  
ATOM 2925  H HB3  . MET A 1 48  ? 17.707  -12.651 7.485   1.00 0.00 ? 48  MET A HB3  2  
ATOM 2926  H HG2  . MET A 1 48  ? 17.459  -14.358 5.930   1.00 0.00 ? 48  MET A HG2  2  
ATOM 2927  H HG3  . MET A 1 48  ? 16.681  -14.980 7.383   1.00 0.00 ? 48  MET A HG3  2  
ATOM 2928  H HE1  . MET A 1 48  ? 16.738  -14.472 3.939   1.00 0.00 ? 48  MET A HE1  2  
ATOM 2929  H HE2  . MET A 1 48  ? 15.845  -15.992 3.955   1.00 0.00 ? 48  MET A HE2  2  
ATOM 2930  H HE3  . MET A 1 48  ? 15.101  -14.540 3.285   1.00 0.00 ? 48  MET A HE3  2  
ATOM 2931  N N    . GLY A 1 49  ? 15.855  -10.375 9.121   1.00 0.00 ? 49  GLY A N    2  
ATOM 2932  C CA   . GLY A 1 49  ? 16.297  -9.232  9.898   1.00 0.00 ? 49  GLY A CA   2  
ATOM 2933  C C    . GLY A 1 49  ? 16.568  -8.015  9.036   1.00 0.00 ? 49  GLY A C    2  
ATOM 2934  O O    . GLY A 1 49  ? 15.724  -7.127  8.921   1.00 0.00 ? 49  GLY A O    2  
ATOM 2935  H H    . GLY A 1 49  ? 15.185  -10.257 8.416   1.00 0.00 ? 49  GLY A H    2  
ATOM 2936  H HA2  . GLY A 1 49  ? 15.534  -8.986  10.621  1.00 0.00 ? 49  GLY A HA2  2  
ATOM 2937  H HA3  . GLY A 1 49  ? 17.204  -9.497  10.423  1.00 0.00 ? 49  GLY A HA3  2  
ATOM 2938  N N    . ASP A 1 50  ? 17.750  -7.973  8.431   1.00 0.00 ? 50  ASP A N    2  
ATOM 2939  C CA   . ASP A 1 50  ? 18.131  -6.855  7.575   1.00 0.00 ? 50  ASP A CA   2  
ATOM 2940  C C    . ASP A 1 50  ? 19.484  -7.109  6.919   1.00 0.00 ? 50  ASP A C    2  
ATOM 2941  O O    . ASP A 1 50  ? 20.460  -6.413  7.197   1.00 0.00 ? 50  ASP A O    2  
ATOM 2942  C CB   . ASP A 1 50  ? 18.178  -5.558  8.385   1.00 0.00 ? 50  ASP A CB   2  
ATOM 2943  C CG   . ASP A 1 50  ? 17.917  -4.333  7.531   1.00 0.00 ? 50  ASP A CG   2  
ATOM 2944  O OD1  . ASP A 1 50  ? 16.804  -4.221  6.977   1.00 0.00 ? 50  ASP A OD1  2  
ATOM 2945  O OD2  . ASP A 1 50  ? 18.827  -3.485  7.418   1.00 0.00 ? 50  ASP A OD2  2  
ATOM 2946  H H    . ASP A 1 50  ? 18.381  -8.711  8.562   1.00 0.00 ? 50  ASP A H    2  
ATOM 2947  H HA   . ASP A 1 50  ? 17.383  -6.759  6.802   1.00 0.00 ? 50  ASP A HA   2  
ATOM 2948  H HB2  . ASP A 1 50  ? 17.428  -5.599  9.161   1.00 0.00 ? 50  ASP A HB2  2  
ATOM 2949  H HB3  . ASP A 1 50  ? 19.154  -5.459  8.837   1.00 0.00 ? 50  ASP A HB3  2  
ATOM 2950  N N    . ALA A 1 51  ? 19.535  -8.112  6.048   1.00 0.00 ? 51  ALA A N    2  
ATOM 2951  C CA   . ALA A 1 51  ? 20.768  -8.458  5.352   1.00 0.00 ? 51  ALA A CA   2  
ATOM 2952  C C    . ALA A 1 51  ? 20.493  -8.824  3.897   1.00 0.00 ? 51  ALA A C    2  
ATOM 2953  O O    . ALA A 1 51  ? 19.341  -8.860  3.464   1.00 0.00 ? 51  ALA A O    2  
ATOM 2954  C CB   . ALA A 1 51  ? 21.472  -9.604  6.063   1.00 0.00 ? 51  ALA A CB   2  
ATOM 2955  H H    . ALA A 1 51  ? 18.723  -8.631  5.868   1.00 0.00 ? 51  ALA A H    2  
ATOM 2956  H HA   . ALA A 1 51  ? 21.419  -7.596  5.379   1.00 0.00 ? 51  ALA A HA   2  
ATOM 2957  H HB1  . ALA A 1 51  ? 20.762  -10.130 6.686   1.00 0.00 ? 51  ALA A HB1  2  
ATOM 2958  H HB2  . ALA A 1 51  ? 21.881  -10.284 5.331   1.00 0.00 ? 51  ALA A HB2  2  
ATOM 2959  H HB3  . ALA A 1 51  ? 22.269  -9.212  6.676   1.00 0.00 ? 51  ALA A HB3  2  
ATOM 2960  N N    . ILE A 1 52  ? 21.557  -9.093  3.149   1.00 0.00 ? 52  ILE A N    2  
ATOM 2961  C CA   . ILE A 1 52  ? 21.430  -9.457  1.743   1.00 0.00 ? 52  ILE A CA   2  
ATOM 2962  C C    . ILE A 1 52  ? 21.043  -10.924 1.587   1.00 0.00 ? 52  ILE A C    2  
ATOM 2963  O O    . ILE A 1 52  ? 21.672  -11.808 2.170   1.00 0.00 ? 52  ILE A O    2  
ATOM 2964  C CB   . ILE A 1 52  ? 22.738  -9.198  0.974   1.00 0.00 ? 52  ILE A CB   2  
ATOM 2965  C CG1  . ILE A 1 52  ? 23.159  -7.734  1.117   1.00 0.00 ? 52  ILE A CG1  2  
ATOM 2966  C CG2  . ILE A 1 52  ? 22.572  -9.565  -0.493  1.00 0.00 ? 52  ILE A CG2  2  
ATOM 2967  C CD1  . ILE A 1 52  ? 22.118  -6.755  0.620   1.00 0.00 ? 52  ILE A CD1  2  
ATOM 2968  H H    . ILE A 1 52  ? 22.449  -9.048  3.552   1.00 0.00 ? 52  ILE A H    2  
ATOM 2969  H HA   . ILE A 1 52  ? 20.653  -8.843  1.310   1.00 0.00 ? 52  ILE A HA   2  
ATOM 2970  H HB   . ILE A 1 52  ? 23.507  -9.828  1.393   1.00 0.00 ? 52  ILE A HB   2  
ATOM 2971  H HG12 . ILE A 1 52  ? 23.345  -7.519  2.158   1.00 0.00 ? 52  ILE A HG12 2  
ATOM 2972  H HG13 . ILE A 1 52  ? 24.065  -7.570  0.552   1.00 0.00 ? 52  ILE A HG13 2  
ATOM 2973  H HG21 . ILE A 1 52  ? 22.232  -10.587 -0.572  1.00 0.00 ? 52  ILE A HG21 2  
ATOM 2974  H HG22 . ILE A 1 52  ? 21.845  -8.909  -0.948  1.00 0.00 ? 52  ILE A HG22 2  
ATOM 2975  H HG23 . ILE A 1 52  ? 23.519  -9.461  -1.001  1.00 0.00 ? 52  ILE A HG23 2  
ATOM 2976  H HD11 . ILE A 1 52  ? 21.197  -6.899  1.167   1.00 0.00 ? 52  ILE A HD11 2  
ATOM 2977  H HD12 . ILE A 1 52  ? 22.472  -5.746  0.770   1.00 0.00 ? 52  ILE A HD12 2  
ATOM 2978  H HD13 . ILE A 1 52  ? 21.941  -6.921  -0.432  1.00 0.00 ? 52  ILE A HD13 2  
ATOM 2979  N N    . VAL A 1 53  ? 20.006  -11.176 0.795   1.00 0.00 ? 53  VAL A N    2  
ATOM 2980  C CA   . VAL A 1 53  ? 19.537  -12.536 0.560   1.00 0.00 ? 53  VAL A CA   2  
ATOM 2981  C C    . VAL A 1 53  ? 19.642  -12.906 -0.916  1.00 0.00 ? 53  VAL A C    2  
ATOM 2982  O O    . VAL A 1 53  ? 18.682  -12.800 -1.678  1.00 0.00 ? 53  VAL A O    2  
ATOM 2983  C CB   . VAL A 1 53  ? 18.078  -12.714 1.019   1.00 0.00 ? 53  VAL A CB   2  
ATOM 2984  C CG1  . VAL A 1 53  ? 17.677  -14.181 0.968   1.00 0.00 ? 53  VAL A CG1  2  
ATOM 2985  C CG2  . VAL A 1 53  ? 17.888  -12.149 2.419   1.00 0.00 ? 53  VAL A CG2  2  
ATOM 2986  H H    . VAL A 1 53  ? 19.546  -10.429 0.358   1.00 0.00 ? 53  VAL A H    2  
ATOM 2987  H HA   . VAL A 1 53  ? 20.158  -13.208 1.135   1.00 0.00 ? 53  VAL A HA   2  
ATOM 2988  H HB   . VAL A 1 53  ? 17.439  -12.166 0.343   1.00 0.00 ? 53  VAL A HB   2  
ATOM 2989  H HG11 . VAL A 1 53  ? 18.532  -14.778 0.689   1.00 0.00 ? 53  VAL A HG11 2  
ATOM 2990  H HG12 . VAL A 1 53  ? 17.320  -14.491 1.939   1.00 0.00 ? 53  VAL A HG12 2  
ATOM 2991  H HG13 . VAL A 1 53  ? 16.893  -14.314 0.237   1.00 0.00 ? 53  VAL A HG13 2  
ATOM 2992  H HG21 . VAL A 1 53  ? 17.926  -11.071 2.379   1.00 0.00 ? 53  VAL A HG21 2  
ATOM 2993  H HG22 . VAL A 1 53  ? 16.928  -12.461 2.806   1.00 0.00 ? 53  VAL A HG22 2  
ATOM 2994  H HG23 . VAL A 1 53  ? 18.672  -12.515 3.065   1.00 0.00 ? 53  VAL A HG23 2  
ATOM 2995  N N    . PRO A 1 54  ? 20.838  -13.352 -1.330  1.00 0.00 ? 54  PRO A N    2  
ATOM 2996  C CA   . PRO A 1 54  ? 21.097  -13.748 -2.717  1.00 0.00 ? 54  PRO A CA   2  
ATOM 2997  C C    . PRO A 1 54  ? 20.376  -15.036 -3.097  1.00 0.00 ? 54  PRO A C    2  
ATOM 2998  O O    . PRO A 1 54  ? 20.628  -16.094 -2.521  1.00 0.00 ? 54  PRO A O    2  
ATOM 2999  C CB   . PRO A 1 54  ? 22.614  -13.955 -2.749  1.00 0.00 ? 54  PRO A CB   2  
ATOM 3000  C CG   . PRO A 1 54  ? 22.981  -14.280 -1.342  1.00 0.00 ? 54  PRO A CG   2  
ATOM 3001  C CD   . PRO A 1 54  ? 22.027  -13.504 -0.476  1.00 0.00 ? 54  PRO A CD   2  
ATOM 3002  H HA   . PRO A 1 54  ? 20.825  -12.966 -3.411  1.00 0.00 ? 54  PRO A HA   2  
ATOM 3003  H HB2  . PRO A 1 54  ? 22.854  -14.769 -3.418  1.00 0.00 ? 54  PRO A HB2  2  
ATOM 3004  H HB3  . PRO A 1 54  ? 23.098  -13.050 -3.084  1.00 0.00 ? 54  PRO A HB3  2  
ATOM 3005  H HG2  . PRO A 1 54  ? 22.869  -15.339 -1.168  1.00 0.00 ? 54  PRO A HG2  2  
ATOM 3006  H HG3  . PRO A 1 54  ? 23.998  -13.971 -1.148  1.00 0.00 ? 54  PRO A HG3  2  
ATOM 3007  H HD2  . PRO A 1 54  ? 21.791  -14.062 0.419   1.00 0.00 ? 54  PRO A HD2  2  
ATOM 3008  H HD3  . PRO A 1 54  ? 22.445  -12.541 -0.222  1.00 0.00 ? 54  PRO A HD3  2  
ATOM 3009  N N    . VAL A 1 55  ? 19.476  -14.940 -4.071  1.00 0.00 ? 55  VAL A N    2  
ATOM 3010  C CA   . VAL A 1 55  ? 18.718  -16.099 -4.529  1.00 0.00 ? 55  VAL A CA   2  
ATOM 3011  C C    . VAL A 1 55  ? 18.963  -16.365 -6.010  1.00 0.00 ? 55  VAL A C    2  
ATOM 3012  O O    . VAL A 1 55  ? 19.108  -15.434 -6.802  1.00 0.00 ? 55  VAL A O    2  
ATOM 3013  C CB   . VAL A 1 55  ? 17.208  -15.909 -4.295  1.00 0.00 ? 55  VAL A CB   2  
ATOM 3014  C CG1  . VAL A 1 55  ? 16.694  -14.706 -5.070  1.00 0.00 ? 55  VAL A CG1  2  
ATOM 3015  C CG2  . VAL A 1 55  ? 16.447  -17.168 -4.684  1.00 0.00 ? 55  VAL A CG2  2  
ATOM 3016  H H    . VAL A 1 55  ? 19.319  -14.069 -4.492  1.00 0.00 ? 55  VAL A H    2  
ATOM 3017  H HA   . VAL A 1 55  ? 19.045  -16.957 -3.960  1.00 0.00 ? 55  VAL A HA   2  
ATOM 3018  H HB   . VAL A 1 55  ? 17.047  -15.728 -3.243  1.00 0.00 ? 55  VAL A HB   2  
ATOM 3019  H HG11 . VAL A 1 55  ? 16.294  -13.978 -4.380  1.00 0.00 ? 55  VAL A HG11 2  
ATOM 3020  H HG12 . VAL A 1 55  ? 17.505  -14.264 -5.630  1.00 0.00 ? 55  VAL A HG12 2  
ATOM 3021  H HG13 . VAL A 1 55  ? 15.916  -15.021 -5.750  1.00 0.00 ? 55  VAL A HG13 2  
ATOM 3022  H HG21 . VAL A 1 55  ? 15.624  -17.316 -4.000  1.00 0.00 ? 55  VAL A HG21 2  
ATOM 3023  H HG22 . VAL A 1 55  ? 16.065  -17.063 -5.689  1.00 0.00 ? 55  VAL A HG22 2  
ATOM 3024  H HG23 . VAL A 1 55  ? 17.111  -18.019 -4.639  1.00 0.00 ? 55  VAL A HG23 2  
ATOM 3025  N N    . GLU A 1 56  ? 19.007  -17.641 -6.377  1.00 0.00 ? 56  GLU A N    2  
ATOM 3026  C CA   . GLU A 1 56  ? 19.234  -18.029 -7.764  1.00 0.00 ? 56  GLU A CA   2  
ATOM 3027  C C    . GLU A 1 56  ? 18.113  -18.935 -8.267  1.00 0.00 ? 56  GLU A C    2  
ATOM 3028  O O    . GLU A 1 56  ? 18.142  -20.149 -8.060  1.00 0.00 ? 56  GLU A O    2  
ATOM 3029  C CB   . GLU A 1 56  ? 20.581  -18.742 -7.904  1.00 0.00 ? 56  GLU A CB   2  
ATOM 3030  C CG   . GLU A 1 56  ? 20.897  -19.678 -6.749  1.00 0.00 ? 56  GLU A CG   2  
ATOM 3031  C CD   . GLU A 1 56  ? 21.456  -21.009 -7.214  1.00 0.00 ? 56  GLU A CD   2  
ATOM 3032  O OE1  . GLU A 1 56  ? 20.688  -21.806 -7.793  1.00 0.00 ? 56  GLU A OE1  2  
ATOM 3033  O OE2  . GLU A 1 56  ? 22.661  -21.253 -6.999  1.00 0.00 ? 56  GLU A OE2  2  
ATOM 3034  H H    . GLU A 1 56  ? 18.884  -18.339 -5.699  1.00 0.00 ? 56  GLU A H    2  
ATOM 3035  H HA   . GLU A 1 56  ? 19.249  -17.131 -8.362  1.00 0.00 ? 56  GLU A HA   2  
ATOM 3036  H HB2  . GLU A 1 56  ? 20.578  -19.317 -8.817  1.00 0.00 ? 56  GLU A HB2  2  
ATOM 3037  H HB3  . GLU A 1 56  ? 21.363  -17.998 -7.960  1.00 0.00 ? 56  GLU A HB3  2  
ATOM 3038  H HG2  . GLU A 1 56  ? 21.624  -19.205 -6.107  1.00 0.00 ? 56  GLU A HG2  2  
ATOM 3039  H HG3  . GLU A 1 56  ? 19.990  -19.860 -6.192  1.00 0.00 ? 56  GLU A HG3  2  
ATOM 3040  N N    . ILE A 1 57  ? 17.128  -18.336 -8.926  1.00 0.00 ? 57  ILE A N    2  
ATOM 3041  C CA   . ILE A 1 57  ? 15.998  -19.088 -9.458  1.00 0.00 ? 57  ILE A CA   2  
ATOM 3042  C C    . ILE A 1 57  ? 16.451  -20.082 -10.522 1.00 0.00 ? 57  ILE A C    2  
ATOM 3043  O O    . ILE A 1 57  ? 16.550  -19.744 -11.703 1.00 0.00 ? 57  ILE A O    2  
ATOM 3044  C CB   . ILE A 1 57  ? 14.935  -18.153 -10.065 1.00 0.00 ? 57  ILE A CB   2  
ATOM 3045  C CG1  . ILE A 1 57  ? 14.464  -17.137 -9.023  1.00 0.00 ? 57  ILE A CG1  2  
ATOM 3046  C CG2  . ILE A 1 57  ? 13.759  -18.961 -10.594 1.00 0.00 ? 57  ILE A CG2  2  
ATOM 3047  C CD1  . ILE A 1 57  ? 14.297  -15.739 -9.575  1.00 0.00 ? 57  ILE A CD1  2  
ATOM 3048  H H    . ILE A 1 57  ? 17.161  -17.366 -9.059  1.00 0.00 ? 57  ILE A H    2  
ATOM 3049  H HA   . ILE A 1 57  ? 15.546  -19.633 -8.642  1.00 0.00 ? 57  ILE A HA   2  
ATOM 3050  H HB   . ILE A 1 57  ? 15.382  -17.627 -10.894 1.00 0.00 ? 57  ILE A HB   2  
ATOM 3051  H HG12 . ILE A 1 57  ? 13.512  -17.452 -8.626  1.00 0.00 ? 57  ILE A HG12 2  
ATOM 3052  H HG13 . ILE A 1 57  ? 15.187  -17.094 -8.221  1.00 0.00 ? 57  ILE A HG13 2  
ATOM 3053  H HG21 . ILE A 1 57  ? 12.857  -18.661 -10.083 1.00 0.00 ? 57  ILE A HG21 2  
ATOM 3054  H HG22 . ILE A 1 57  ? 13.648  -18.782 -11.653 1.00 0.00 ? 57  ILE A HG22 2  
ATOM 3055  H HG23 . ILE A 1 57  ? 13.938  -20.012 -10.423 1.00 0.00 ? 57  ILE A HG23 2  
ATOM 3056  H HD11 . ILE A 1 57  ? 13.263  -15.438 -9.488  1.00 0.00 ? 57  ILE A HD11 2  
ATOM 3057  H HD12 . ILE A 1 57  ? 14.919  -15.055 -9.018  1.00 0.00 ? 57  ILE A HD12 2  
ATOM 3058  H HD13 . ILE A 1 57  ? 14.588  -15.725 -10.615 1.00 0.00 ? 57  ILE A HD13 2  
ATOM 3059  N N    . THR A 1 58  ? 16.725  -21.312 -10.098 1.00 0.00 ? 58  THR A N    2  
ATOM 3060  C CA   . THR A 1 58  ? 17.167  -22.356 -11.013 1.00 0.00 ? 58  THR A CA   2  
ATOM 3061  C C    . THR A 1 58  ? 16.059  -22.739 -11.987 1.00 0.00 ? 58  THR A C    2  
ATOM 3062  O O    . THR A 1 58  ? 15.007  -23.234 -11.581 1.00 0.00 ? 58  THR A O    2  
ATOM 3063  C CB   . THR A 1 58  ? 17.623  -23.615 -10.252 1.00 0.00 ? 58  THR A CB   2  
ATOM 3064  O OG1  . THR A 1 58  ? 18.068  -23.258 -8.938  1.00 0.00 ? 58  THR A OG1  2  
ATOM 3065  C CG2  . THR A 1 58  ? 18.745  -24.322 -10.998 1.00 0.00 ? 58  THR A CG2  2  
ATOM 3066  H H    . THR A 1 58  ? 16.628  -21.520 -9.145  1.00 0.00 ? 58  THR A H    2  
ATOM 3067  H HA   . THR A 1 58  ? 18.009  -21.974 -11.573 1.00 0.00 ? 58  THR A HA   2  
ATOM 3068  H HB   . THR A 1 58  ? 16.784  -24.290 -10.169 1.00 0.00 ? 58  THR A HB   2  
ATOM 3069  H HG1  . THR A 1 58  ? 18.548  -23.995 -8.552  1.00 0.00 ? 58  THR A HG1  2  
ATOM 3070  H HG21 . THR A 1 58  ? 18.894  -25.305 -10.576 1.00 0.00 ? 58  THR A HG21 2  
ATOM 3071  H HG22 . THR A 1 58  ? 19.655  -23.749 -10.906 1.00 0.00 ? 58  THR A HG22 2  
ATOM 3072  H HG23 . THR A 1 58  ? 18.481  -24.414 -12.040 1.00 0.00 ? 58  THR A HG23 2  
ATOM 3073  N N    . ILE A 1 59  ? 16.301  -22.506 -13.273 1.00 0.00 ? 59  ILE A N    2  
ATOM 3074  C CA   . ILE A 1 59  ? 15.323  -22.829 -14.304 1.00 0.00 ? 59  ILE A CA   2  
ATOM 3075  C C    . ILE A 1 59  ? 15.614  -24.188 -14.932 1.00 0.00 ? 59  ILE A C    2  
ATOM 3076  O O    . ILE A 1 59  ? 16.647  -24.379 -15.573 1.00 0.00 ? 59  ILE A O    2  
ATOM 3077  C CB   . ILE A 1 59  ? 15.299  -21.760 -15.412 1.00 0.00 ? 59  ILE A CB   2  
ATOM 3078  C CG1  . ILE A 1 59  ? 15.387  -20.359 -14.801 1.00 0.00 ? 59  ILE A CG1  2  
ATOM 3079  C CG2  . ILE A 1 59  ? 14.040  -21.898 -16.255 1.00 0.00 ? 59  ILE A CG2  2  
ATOM 3080  C CD1  . ILE A 1 59  ? 14.267  -20.051 -13.833 1.00 0.00 ? 59  ILE A CD1  2  
ATOM 3081  H H    . ILE A 1 59  ? 17.158  -22.109 -13.534 1.00 0.00 ? 59  ILE A H    2  
ATOM 3082  H HA   . ILE A 1 59  ? 14.348  -22.860 -13.840 1.00 0.00 ? 59  ILE A HA   2  
ATOM 3083  H HB   . ILE A 1 59  ? 16.152  -21.919 -16.054 1.00 0.00 ? 59  ILE A HB   2  
ATOM 3084  H HG12 . ILE A 1 59  ? 16.321  -20.263 -14.270 1.00 0.00 ? 59  ILE A HG12 2  
ATOM 3085  H HG13 . ILE A 1 59  ? 15.352  -19.626 -15.594 1.00 0.00 ? 59  ILE A HG13 2  
ATOM 3086  H HG21 . ILE A 1 59  ? 14.267  -22.455 -17.152 1.00 0.00 ? 59  ILE A HG21 2  
ATOM 3087  H HG22 . ILE A 1 59  ? 13.285  -22.421 -15.689 1.00 0.00 ? 59  ILE A HG22 2  
ATOM 3088  H HG23 . ILE A 1 59  ? 13.676  -20.917 -16.522 1.00 0.00 ? 59  ILE A HG23 2  
ATOM 3089  H HD11 . ILE A 1 59  ? 14.347  -20.698 -12.971 1.00 0.00 ? 59  ILE A HD11 2  
ATOM 3090  H HD12 . ILE A 1 59  ? 14.335  -19.021 -13.518 1.00 0.00 ? 59  ILE A HD12 2  
ATOM 3091  H HD13 . ILE A 1 59  ? 13.316  -20.217 -14.318 1.00 0.00 ? 59  ILE A HD13 2  
ATOM 3092  N N    . TYR A 1 60  ? 14.695  -25.129 -14.744 1.00 0.00 ? 60  TYR A N    2  
ATOM 3093  C CA   . TYR A 1 60  ? 14.853  -26.471 -15.291 1.00 0.00 ? 60  TYR A CA   2  
ATOM 3094  C C    . TYR A 1 60  ? 14.229  -26.571 -16.679 1.00 0.00 ? 60  TYR A C    2  
ATOM 3095  O O    . TYR A 1 60  ? 13.799  -25.570 -17.252 1.00 0.00 ? 60  TYR A O    2  
ATOM 3096  C CB   . TYR A 1 60  ? 14.215  -27.503 -14.358 1.00 0.00 ? 60  TYR A CB   2  
ATOM 3097  C CG   . TYR A 1 60  ? 14.822  -27.525 -12.974 1.00 0.00 ? 60  TYR A CG   2  
ATOM 3098  C CD1  . TYR A 1 60  ? 16.107  -27.046 -12.750 1.00 0.00 ? 60  TYR A CD1  2  
ATOM 3099  C CD2  . TYR A 1 60  ? 14.112  -28.026 -11.890 1.00 0.00 ? 60  TYR A CD2  2  
ATOM 3100  C CE1  . TYR A 1 60  ? 16.667  -27.065 -11.487 1.00 0.00 ? 60  TYR A CE1  2  
ATOM 3101  C CE2  . TYR A 1 60  ? 14.663  -28.047 -10.623 1.00 0.00 ? 60  TYR A CE2  2  
ATOM 3102  C CZ   . TYR A 1 60  ? 15.940  -27.565 -10.427 1.00 0.00 ? 60  TYR A CZ   2  
ATOM 3103  O OH   . TYR A 1 60  ? 16.493  -27.586 -9.167  1.00 0.00 ? 60  TYR A OH   2  
ATOM 3104  H H    . TYR A 1 60  ? 13.892  -24.917 -14.224 1.00 0.00 ? 60  TYR A H    2  
ATOM 3105  H HA   . TYR A 1 60  ? 15.910  -26.676 -15.368 1.00 0.00 ? 60  TYR A HA   2  
ATOM 3106  H HB2  . TYR A 1 60  ? 13.163  -27.283 -14.255 1.00 0.00 ? 60  TYR A HB2  2  
ATOM 3107  H HB3  . TYR A 1 60  ? 14.331  -28.487 -14.788 1.00 0.00 ? 60  TYR A HB3  2  
ATOM 3108  H HD1  . TYR A 1 60  ? 16.674  -26.654 -13.582 1.00 0.00 ? 60  TYR A HD1  2  
ATOM 3109  H HD2  . TYR A 1 60  ? 13.111  -28.402 -12.047 1.00 0.00 ? 60  TYR A HD2  2  
ATOM 3110  H HE1  . TYR A 1 60  ? 17.667  -26.688 -11.333 1.00 0.00 ? 60  TYR A HE1  2  
ATOM 3111  H HE2  . TYR A 1 60  ? 14.094  -28.439 -9.793  1.00 0.00 ? 60  TYR A HE2  2  
ATOM 3112  H HH   . TYR A 1 60  ? 17.426  -27.368 -9.223  1.00 0.00 ? 60  TYR A HH   2  
ATOM 3113  N N    . ALA A 1 61  ? 14.184  -27.786 -17.215 1.00 0.00 ? 61  ALA A N    2  
ATOM 3114  C CA   . ALA A 1 61  ? 13.611  -28.018 -18.535 1.00 0.00 ? 61  ALA A CA   2  
ATOM 3115  C C    . ALA A 1 61  ? 12.089  -28.082 -18.470 1.00 0.00 ? 61  ALA A C    2  
ATOM 3116  O O    . ALA A 1 61  ? 11.401  -27.133 -18.848 1.00 0.00 ? 61  ALA A O    2  
ATOM 3117  C CB   . ALA A 1 61  ? 14.169  -29.300 -19.135 1.00 0.00 ? 61  ALA A CB   2  
ATOM 3118  H H    . ALA A 1 61  ? 14.543  -28.545 -16.710 1.00 0.00 ? 61  ALA A H    2  
ATOM 3119  H HA   . ALA A 1 61  ? 13.899  -27.195 -19.174 1.00 0.00 ? 61  ALA A HA   2  
ATOM 3120  H HB1  . ALA A 1 61  ? 15.195  -29.140 -19.433 1.00 0.00 ? 61  ALA A HB1  2  
ATOM 3121  H HB2  . ALA A 1 61  ? 14.127  -30.089 -18.399 1.00 0.00 ? 61  ALA A HB2  2  
ATOM 3122  H HB3  . ALA A 1 61  ? 13.583  -29.579 -19.997 1.00 0.00 ? 61  ALA A HB3  2  
ATOM 3123  N N    . ASP A 1 62  ? 11.569  -29.206 -17.989 1.00 0.00 ? 62  ASP A N    2  
ATOM 3124  C CA   . ASP A 1 62  ? 10.127  -29.393 -17.873 1.00 0.00 ? 62  ASP A CA   2  
ATOM 3125  C C    . ASP A 1 62  ? 9.714   -29.547 -16.413 1.00 0.00 ? 62  ASP A C    2  
ATOM 3126  O O    . ASP A 1 62  ? 8.619   -30.023 -16.114 1.00 0.00 ? 62  ASP A O    2  
ATOM 3127  C CB   . ASP A 1 62  ? 9.685   -30.619 -18.674 1.00 0.00 ? 62  ASP A CB   2  
ATOM 3128  C CG   . ASP A 1 62  ? 8.303   -30.450 -19.275 1.00 0.00 ? 62  ASP A CG   2  
ATOM 3129  O OD1  . ASP A 1 62  ? 7.446   -29.816 -18.624 1.00 0.00 ? 62  ASP A OD1  2  
ATOM 3130  O OD2  . ASP A 1 62  ? 8.079   -30.952 -20.396 1.00 0.00 ? 62  ASP A OD2  2  
ATOM 3131  H H    . ASP A 1 62  ? 12.169  -29.926 -17.703 1.00 0.00 ? 62  ASP A H    2  
ATOM 3132  H HA   . ASP A 1 62  ? 9.645   -28.516 -18.279 1.00 0.00 ? 62  ASP A HA   2  
ATOM 3133  H HB2  . ASP A 1 62  ? 10.387  -30.789 -19.476 1.00 0.00 ? 62  ASP A HB2  2  
ATOM 3134  H HB3  . ASP A 1 62  ? 9.672   -31.480 -18.022 1.00 0.00 ? 62  ASP A HB3  2  
ATOM 3135  N N    . ARG A 1 63  ? 10.599  -29.143 -15.507 1.00 0.00 ? 63  ARG A N    2  
ATOM 3136  C CA   . ARG A 1 63  ? 10.327  -29.239 -14.078 1.00 0.00 ? 63  ARG A CA   2  
ATOM 3137  C C    . ARG A 1 63  ? 10.066  -27.859 -13.480 1.00 0.00 ? 63  ARG A C    2  
ATOM 3138  O O    . ARG A 1 63  ? 9.906   -27.717 -12.268 1.00 0.00 ? 63  ARG A O    2  
ATOM 3139  C CB   . ARG A 1 63  ? 11.501  -29.905 -13.358 1.00 0.00 ? 63  ARG A CB   2  
ATOM 3140  C CG   . ARG A 1 63  ? 11.434  -31.423 -13.358 1.00 0.00 ? 63  ARG A CG   2  
ATOM 3141  C CD   . ARG A 1 63  ? 11.483  -31.982 -14.772 1.00 0.00 ? 63  ARG A CD   2  
ATOM 3142  N NE   . ARG A 1 63  ? 11.643  -33.434 -14.780 1.00 0.00 ? 63  ARG A NE   2  
ATOM 3143  C CZ   . ARG A 1 63  ? 10.640  -34.285 -14.594 1.00 0.00 ? 63  ARG A CZ   2  
ATOM 3144  N NH1  . ARG A 1 63  ? 9.411   -33.831 -14.385 1.00 0.00 ? 63  ARG A NH1  2  
ATOM 3145  N NH2  . ARG A 1 63  ? 10.865  -35.592 -14.616 1.00 0.00 ? 63  ARG A NH2  2  
ATOM 3146  H H    . ARG A 1 63  ? 11.455  -28.772 -15.807 1.00 0.00 ? 63  ARG A H    2  
ATOM 3147  H HA   . ARG A 1 63  ? 9.445   -29.847 -13.948 1.00 0.00 ? 63  ARG A HA   2  
ATOM 3148  H HB2  . ARG A 1 63  ? 12.420  -29.607 -13.840 1.00 0.00 ? 63  ARG A HB2  2  
ATOM 3149  H HB3  . ARG A 1 63  ? 11.516  -29.567 -12.332 1.00 0.00 ? 63  ARG A HB3  2  
ATOM 3150  H HG2  . ARG A 1 63  ? 12.273  -31.812 -12.800 1.00 0.00 ? 63  ARG A HG2  2  
ATOM 3151  H HG3  . ARG A 1 63  ? 10.512  -31.733 -12.889 1.00 0.00 ? 63  ARG A HG3  2  
ATOM 3152  H HD2  . ARG A 1 63  ? 10.564  -31.728 -15.277 1.00 0.00 ? 63  ARG A HD2  2  
ATOM 3153  H HD3  . ARG A 1 63  ? 12.316  -31.534 -15.292 1.00 0.00 ? 63  ARG A HD3  2  
ATOM 3154  H HE   . ARG A 1 63  ? 12.542  -33.791 -14.933 1.00 0.00 ? 63  ARG A HE   2  
ATOM 3155  H HH11 . ARG A 1 63  ? 9.239   -32.847 -14.369 1.00 0.00 ? 63  ARG A HH11 2  
ATOM 3156  H HH12 . ARG A 1 63  ? 8.658   -34.474 -14.246 1.00 0.00 ? 63  ARG A HH12 2  
ATOM 3157  H HH21 . ARG A 1 63  ? 11.789  -35.938 -14.773 1.00 0.00 ? 63  ARG A HH21 2  
ATOM 3158  H HH22 . ARG A 1 63  ? 10.109  -36.232 -14.476 1.00 0.00 ? 63  ARG A HH22 2  
ATOM 3159  N N    . SER A 1 64  ? 10.025  -26.846 -14.340 1.00 0.00 ? 64  SER A N    2  
ATOM 3160  C CA   . SER A 1 64  ? 9.789   -25.477 -13.897 1.00 0.00 ? 64  SER A CA   2  
ATOM 3161  C C    . SER A 1 64  ? 11.035  -24.897 -13.234 1.00 0.00 ? 64  SER A C    2  
ATOM 3162  O O    . SER A 1 64  ? 12.114  -25.486 -13.292 1.00 0.00 ? 64  SER A O    2  
ATOM 3163  C CB   . SER A 1 64  ? 8.610   -25.431 -12.922 1.00 0.00 ? 64  SER A CB   2  
ATOM 3164  O OG   . SER A 1 64  ? 9.061   -25.409 -11.578 1.00 0.00 ? 64  SER A OG   2  
ATOM 3165  H H    . SER A 1 64  ? 10.161  -27.023 -15.294 1.00 0.00 ? 64  SER A H    2  
ATOM 3166  H HA   . SER A 1 64  ? 9.549   -24.884 -14.767 1.00 0.00 ? 64  SER A HA   2  
ATOM 3167  H HB2  . SER A 1 64  ? 8.027   -24.541 -13.108 1.00 0.00 ? 64  SER A HB2  2  
ATOM 3168  H HB3  . SER A 1 64  ? 7.991   -26.304 -13.068 1.00 0.00 ? 64  SER A HB3  2  
ATOM 3169  H HG   . SER A 1 64  ? 8.418   -25.851 -11.018 1.00 0.00 ? 64  SER A HG   2  
ATOM 3170  N N    . PHE A 1 65  ? 10.877  -23.738 -12.604 1.00 0.00 ? 65  PHE A N    2  
ATOM 3171  C CA   . PHE A 1 65  ? 11.988  -23.076 -11.931 1.00 0.00 ? 65  PHE A CA   2  
ATOM 3172  C C    . PHE A 1 65  ? 12.001  -23.413 -10.443 1.00 0.00 ? 65  PHE A C    2  
ATOM 3173  O O    . PHE A 1 65  ? 11.112  -24.104 -9.942  1.00 0.00 ? 65  PHE A O    2  
ATOM 3174  C CB   . PHE A 1 65  ? 11.898  -21.560 -12.121 1.00 0.00 ? 65  PHE A CB   2  
ATOM 3175  C CG   . PHE A 1 65  ? 10.546  -20.995 -11.795 1.00 0.00 ? 65  PHE A CG   2  
ATOM 3176  C CD1  . PHE A 1 65  ? 10.059  -21.032 -10.498 1.00 0.00 ? 65  PHE A CD1  2  
ATOM 3177  C CD2  . PHE A 1 65  ? 9.761   -20.425 -12.785 1.00 0.00 ? 65  PHE A CD2  2  
ATOM 3178  C CE1  . PHE A 1 65  ? 8.815   -20.512 -10.195 1.00 0.00 ? 65  PHE A CE1  2  
ATOM 3179  C CE2  . PHE A 1 65  ? 8.516   -19.904 -12.488 1.00 0.00 ? 65  PHE A CE2  2  
ATOM 3180  C CZ   . PHE A 1 65  ? 8.042   -19.947 -11.191 1.00 0.00 ? 65  PHE A CZ   2  
ATOM 3181  H H    . PHE A 1 65  ? 9.991   -23.317 -12.592 1.00 0.00 ? 65  PHE A H    2  
ATOM 3182  H HA   . PHE A 1 65  ? 12.904  -23.432 -12.376 1.00 0.00 ? 65  PHE A HA   2  
ATOM 3183  H HB2  . PHE A 1 65  ? 12.621  -21.081 -11.479 1.00 0.00 ? 65  PHE A HB2  2  
ATOM 3184  H HB3  . PHE A 1 65  ? 12.121  -21.321 -13.150 1.00 0.00 ? 65  PHE A HB3  2  
ATOM 3185  H HD1  . PHE A 1 65  ? 10.662  -21.473 -9.718  1.00 0.00 ? 65  PHE A HD1  2  
ATOM 3186  H HD2  . PHE A 1 65  ? 10.131  -20.391 -13.800 1.00 0.00 ? 65  PHE A HD2  2  
ATOM 3187  H HE1  . PHE A 1 65  ? 8.447   -20.547 -9.181  1.00 0.00 ? 65  PHE A HE1  2  
ATOM 3188  H HE2  . PHE A 1 65  ? 7.915   -19.463 -13.269 1.00 0.00 ? 65  PHE A HE2  2  
ATOM 3189  H HZ   . PHE A 1 65  ? 7.070   -19.541 -10.957 1.00 0.00 ? 65  PHE A HZ   2  
ATOM 3190  N N    . THR A 1 66  ? 13.016  -22.921 -9.739  1.00 0.00 ? 66  THR A N    2  
ATOM 3191  C CA   . THR A 1 66  ? 13.147  -23.171 -8.309  1.00 0.00 ? 66  THR A CA   2  
ATOM 3192  C C    . THR A 1 66  ? 13.482  -21.889 -7.556  1.00 0.00 ? 66  THR A C    2  
ATOM 3193  O O    . THR A 1 66  ? 13.461  -20.798 -8.126  1.00 0.00 ? 66  THR A O    2  
ATOM 3194  C CB   . THR A 1 66  ? 14.235  -24.222 -8.020  1.00 0.00 ? 66  THR A CB   2  
ATOM 3195  O OG1  . THR A 1 66  ? 15.532  -23.620 -8.105  1.00 0.00 ? 66  THR A OG1  2  
ATOM 3196  C CG2  . THR A 1 66  ? 14.143  -25.381 -9.001  1.00 0.00 ? 66  THR A CG2  2  
ATOM 3197  H H    . THR A 1 66  ? 13.693  -22.378 -10.194 1.00 0.00 ? 66  THR A H    2  
ATOM 3198  H HA   . THR A 1 66  ? 12.203  -23.552 -7.949  1.00 0.00 ? 66  THR A HA   2  
ATOM 3199  H HB   . THR A 1 66  ? 14.089  -24.603 -7.019  1.00 0.00 ? 66  THR A HB   2  
ATOM 3200  H HG1  . THR A 1 66  ? 16.018  -23.790 -7.294  1.00 0.00 ? 66  THR A HG1  2  
ATOM 3201  H HG21 . THR A 1 66  ? 14.912  -25.279 -9.752  1.00 0.00 ? 66  THR A HG21 2  
ATOM 3202  H HG22 . THR A 1 66  ? 13.173  -25.374 -9.475  1.00 0.00 ? 66  THR A HG22 2  
ATOM 3203  H HG23 . THR A 1 66  ? 14.279  -26.312 -8.471  1.00 0.00 ? 66  THR A HG23 2  
ATOM 3204  N N    . PHE A 1 67  ? 13.791  -22.026 -6.271  1.00 0.00 ? 67  PHE A N    2  
ATOM 3205  C CA   . PHE A 1 67  ? 14.130  -20.878 -5.438  1.00 0.00 ? 67  PHE A CA   2  
ATOM 3206  C C    . PHE A 1 67  ? 14.575  -21.326 -4.049  1.00 0.00 ? 67  PHE A C    2  
ATOM 3207  O O    . PHE A 1 67  ? 14.172  -22.384 -3.567  1.00 0.00 ? 67  PHE A O    2  
ATOM 3208  C CB   . PHE A 1 67  ? 12.931  -19.934 -5.322  1.00 0.00 ? 67  PHE A CB   2  
ATOM 3209  C CG   . PHE A 1 67  ? 11.844  -20.453 -4.426  1.00 0.00 ? 67  PHE A CG   2  
ATOM 3210  C CD1  . PHE A 1 67  ? 10.834  -21.255 -4.933  1.00 0.00 ? 67  PHE A CD1  2  
ATOM 3211  C CD2  . PHE A 1 67  ? 11.830  -20.139 -3.077  1.00 0.00 ? 67  PHE A CD2  2  
ATOM 3212  C CE1  . PHE A 1 67  ? 9.831   -21.735 -4.111  1.00 0.00 ? 67  PHE A CE1  2  
ATOM 3213  C CE2  . PHE A 1 67  ? 10.831  -20.616 -2.250  1.00 0.00 ? 67  PHE A CE2  2  
ATOM 3214  C CZ   . PHE A 1 67  ? 9.830   -21.414 -2.768  1.00 0.00 ? 67  PHE A CZ   2  
ATOM 3215  H H    . PHE A 1 67  ? 13.790  -22.922 -5.872  1.00 0.00 ? 67  PHE A H    2  
ATOM 3216  H HA   . PHE A 1 67  ? 14.945  -20.355 -5.913  1.00 0.00 ? 67  PHE A HA   2  
ATOM 3217  H HB2  . PHE A 1 67  ? 13.265  -18.987 -4.924  1.00 0.00 ? 67  PHE A HB2  2  
ATOM 3218  H HB3  . PHE A 1 67  ? 12.509  -19.778 -6.303  1.00 0.00 ? 67  PHE A HB3  2  
ATOM 3219  H HD1  . PHE A 1 67  ? 10.834  -21.507 -5.985  1.00 0.00 ? 67  PHE A HD1  2  
ATOM 3220  H HD2  . PHE A 1 67  ? 12.612  -19.514 -2.670  1.00 0.00 ? 67  PHE A HD2  2  
ATOM 3221  H HE1  . PHE A 1 67  ? 9.050   -22.358 -4.520  1.00 0.00 ? 67  PHE A HE1  2  
ATOM 3222  H HE2  . PHE A 1 67  ? 10.832  -20.364 -1.200  1.00 0.00 ? 67  PHE A HE2  2  
ATOM 3223  H HZ   . PHE A 1 67  ? 9.048   -21.788 -2.124  1.00 0.00 ? 67  PHE A HZ   2  
ATOM 3224  N N    . VAL A 1 68  ? 15.410  -20.512 -3.411  1.00 0.00 ? 68  VAL A N    2  
ATOM 3225  C CA   . VAL A 1 68  ? 15.911  -20.822 -2.077  1.00 0.00 ? 68  VAL A CA   2  
ATOM 3226  C C    . VAL A 1 68  ? 16.265  -19.551 -1.314  1.00 0.00 ? 68  VAL A C    2  
ATOM 3227  O O    . VAL A 1 68  ? 16.539  -18.510 -1.911  1.00 0.00 ? 68  VAL A O    2  
ATOM 3228  C CB   . VAL A 1 68  ? 17.151  -21.733 -2.142  1.00 0.00 ? 68  VAL A CB   2  
ATOM 3229  C CG1  . VAL A 1 68  ? 16.752  -23.156 -2.501  1.00 0.00 ? 68  VAL A CG1  2  
ATOM 3230  C CG2  . VAL A 1 68  ? 18.162  -21.186 -3.138  1.00 0.00 ? 68  VAL A CG2  2  
ATOM 3231  H H    . VAL A 1 68  ? 15.695  -19.682 -3.847  1.00 0.00 ? 68  VAL A H    2  
ATOM 3232  H HA   . VAL A 1 68  ? 15.132  -21.347 -1.542  1.00 0.00 ? 68  VAL A HA   2  
ATOM 3233  H HB   . VAL A 1 68  ? 17.613  -21.748 -1.165  1.00 0.00 ? 68  VAL A HB   2  
ATOM 3234  H HG11 . VAL A 1 68  ? 17.600  -23.811 -2.371  1.00 0.00 ? 68  VAL A HG11 2  
ATOM 3235  H HG12 . VAL A 1 68  ? 15.945  -23.477 -1.859  1.00 0.00 ? 68  VAL A HG12 2  
ATOM 3236  H HG13 . VAL A 1 68  ? 16.427  -23.189 -3.531  1.00 0.00 ? 68  VAL A HG13 2  
ATOM 3237  H HG21 . VAL A 1 68  ? 19.133  -21.128 -2.670  1.00 0.00 ? 68  VAL A HG21 2  
ATOM 3238  H HG22 . VAL A 1 68  ? 18.214  -21.842 -3.995  1.00 0.00 ? 68  VAL A HG22 2  
ATOM 3239  H HG23 . VAL A 1 68  ? 17.856  -20.201 -3.458  1.00 0.00 ? 68  VAL A HG23 2  
ATOM 3240  N N    . THR A 1 69  ? 16.260  -19.643 0.012   1.00 0.00 ? 69  THR A N    2  
ATOM 3241  C CA   . THR A 1 69  ? 16.580  -18.501 0.859   1.00 0.00 ? 69  THR A CA   2  
ATOM 3242  C C    . THR A 1 69  ? 17.133  -18.953 2.206   1.00 0.00 ? 69  THR A C    2  
ATOM 3243  O O    . THR A 1 69  ? 16.643  -19.914 2.799   1.00 0.00 ? 69  THR A O    2  
ATOM 3244  C CB   . THR A 1 69  ? 15.344  -17.613 1.096   1.00 0.00 ? 69  THR A CB   2  
ATOM 3245  O OG1  . THR A 1 69  ? 14.214  -18.426 1.433   1.00 0.00 ? 69  THR A OG1  2  
ATOM 3246  C CG2  . THR A 1 69  ? 15.029  -16.784 -0.140  1.00 0.00 ? 69  THR A CG2  2  
ATOM 3247  H H    . THR A 1 69  ? 16.034  -20.500 0.430   1.00 0.00 ? 69  THR A H    2  
ATOM 3248  H HA   . THR A 1 69  ? 17.330  -17.910 0.353   1.00 0.00 ? 69  THR A HA   2  
ATOM 3249  H HB   . THR A 1 69  ? 15.553  -16.942 1.917   1.00 0.00 ? 69  THR A HB   2  
ATOM 3250  H HG1  . THR A 1 69  ? 13.831  -18.789 0.631   1.00 0.00 ? 69  THR A HG1  2  
ATOM 3251  H HG21 . THR A 1 69  ? 14.361  -17.337 -0.784  1.00 0.00 ? 69  THR A HG21 2  
ATOM 3252  H HG22 . THR A 1 69  ? 15.943  -16.567 -0.671  1.00 0.00 ? 69  THR A HG22 2  
ATOM 3253  H HG23 . THR A 1 69  ? 14.557  -15.860 0.158   1.00 0.00 ? 69  THR A HG23 2  
ATOM 3254  N N    . LYS A 1 70  ? 18.156  -18.253 2.685   1.00 0.00 ? 70  LYS A N    2  
ATOM 3255  C CA   . LYS A 1 70  ? 18.775  -18.580 3.964   1.00 0.00 ? 70  LYS A CA   2  
ATOM 3256  C C    . LYS A 1 70  ? 17.950  -18.031 5.124   1.00 0.00 ? 70  LYS A C    2  
ATOM 3257  O O    . LYS A 1 70  ? 17.624  -16.845 5.161   1.00 0.00 ? 70  LYS A O    2  
ATOM 3258  C CB   . LYS A 1 70  ? 20.197  -18.019 4.024   1.00 0.00 ? 70  LYS A CB   2  
ATOM 3259  C CG   . LYS A 1 70  ? 20.998  -18.255 2.756   1.00 0.00 ? 70  LYS A CG   2  
ATOM 3260  C CD   . LYS A 1 70  ? 21.069  -19.732 2.408   1.00 0.00 ? 70  LYS A CD   2  
ATOM 3261  C CE   . LYS A 1 70  ? 22.323  -20.057 1.610   1.00 0.00 ? 70  LYS A CE   2  
ATOM 3262  N NZ   . LYS A 1 70  ? 23.114  -21.150 2.241   1.00 0.00 ? 70  LYS A NZ   2  
ATOM 3263  H H    . LYS A 1 70  ? 18.502  -17.497 2.166   1.00 0.00 ? 70  LYS A H    2  
ATOM 3264  H HA   . LYS A 1 70  ? 18.818  -19.656 4.046   1.00 0.00 ? 70  LYS A HA   2  
ATOM 3265  H HB2  . LYS A 1 70  ? 20.144  -16.954 4.199   1.00 0.00 ? 70  LYS A HB2  2  
ATOM 3266  H HB3  . LYS A 1 70  ? 20.720  -18.484 4.847   1.00 0.00 ? 70  LYS A HB3  2  
ATOM 3267  H HG2  . LYS A 1 70  ? 20.528  -17.726 1.940   1.00 0.00 ? 70  LYS A HG2  2  
ATOM 3268  H HG3  . LYS A 1 70  ? 22.002  -17.879 2.900   1.00 0.00 ? 70  LYS A HG3  2  
ATOM 3269  H HD2  . LYS A 1 70  ? 21.078  -20.308 3.321   1.00 0.00 ? 70  LYS A HD2  2  
ATOM 3270  H HD3  . LYS A 1 70  ? 20.201  -19.997 1.821   1.00 0.00 ? 70  LYS A HD3  2  
ATOM 3271  H HE2  . LYS A 1 70  ? 22.033  -20.362 0.617   1.00 0.00 ? 70  LYS A HE2  2  
ATOM 3272  H HE3  . LYS A 1 70  ? 22.935  -19.169 1.550   1.00 0.00 ? 70  LYS A HE3  2  
ATOM 3273  H HZ1  . LYS A 1 70  ? 22.947  -21.164 3.268   1.00 0.00 ? 70  LYS A HZ1  2  
ATOM 3274  H HZ2  . LYS A 1 70  ? 24.129  -21.001 2.069   1.00 0.00 ? 70  LYS A HZ2  2  
ATOM 3275  H HZ3  . LYS A 1 70  ? 22.836  -22.069 1.842   1.00 0.00 ? 70  LYS A HZ3  2  
ATOM 3276  N N    . THR A 1 71  ? 17.618  -18.902 6.072   1.00 0.00 ? 71  THR A N    2  
ATOM 3277  C CA   . THR A 1 71  ? 16.832  -18.504 7.234   1.00 0.00 ? 71  THR A CA   2  
ATOM 3278  C C    . THR A 1 71  ? 17.275  -19.259 8.482   1.00 0.00 ? 71  THR A C    2  
ATOM 3279  O O    . THR A 1 71  ? 17.781  -20.379 8.412   1.00 0.00 ? 71  THR A O    2  
ATOM 3280  C CB   . THR A 1 71  ? 15.329  -18.749 7.005   1.00 0.00 ? 71  THR A CB   2  
ATOM 3281  O OG1  . THR A 1 71  ? 15.040  -20.148 7.103   1.00 0.00 ? 71  THR A OG1  2  
ATOM 3282  C CG2  . THR A 1 71  ? 14.897  -18.231 5.642   1.00 0.00 ? 71  THR A CG2  2  
ATOM 3283  H H    . THR A 1 71  ? 17.908  -19.834 5.987   1.00 0.00 ? 71  THR A H    2  
ATOM 3284  H HA   . THR A 1 71  ? 16.983  -17.446 7.392   1.00 0.00 ? 71  THR A HA   2  
ATOM 3285  H HB   . THR A 1 71  ? 14.774  -18.220 7.767   1.00 0.00 ? 71  THR A HB   2  
ATOM 3286  H HG1  . THR A 1 71  ? 14.321  -20.284 7.726   1.00 0.00 ? 71  THR A HG1  2  
ATOM 3287  H HG21 . THR A 1 71  ? 15.168  -18.948 4.881   1.00 0.00 ? 71  THR A HG21 2  
ATOM 3288  H HG22 . THR A 1 71  ? 15.389  -17.290 5.442   1.00 0.00 ? 71  THR A HG22 2  
ATOM 3289  H HG23 . THR A 1 71  ? 13.827  -18.086 5.634   1.00 0.00 ? 71  THR A HG23 2  
ATOM 3290  N N    . PRO A 1 72  ? 17.079  -18.635 9.653   1.00 0.00 ? 72  PRO A N    2  
ATOM 3291  C CA   . PRO A 1 72  ? 17.450  -19.231 10.939  1.00 0.00 ? 72  PRO A CA   2  
ATOM 3292  C C    . PRO A 1 72  ? 16.560  -20.412 11.309  1.00 0.00 ? 72  PRO A C    2  
ATOM 3293  O O    . PRO A 1 72  ? 15.518  -20.650 10.698  1.00 0.00 ? 72  PRO A O    2  
ATOM 3294  C CB   . PRO A 1 72  ? 17.254  -18.082 11.932  1.00 0.00 ? 72  PRO A CB   2  
ATOM 3295  C CG   . PRO A 1 72  ? 16.242  -17.197 11.292  1.00 0.00 ? 72  PRO A CG   2  
ATOM 3296  C CD   . PRO A 1 72  ? 16.480  -17.299 9.810   1.00 0.00 ? 72  PRO A CD   2  
ATOM 3297  H HA   . PRO A 1 72  ? 18.484  -19.544 10.948  1.00 0.00 ? 72  PRO A HA   2  
ATOM 3298  H HB2  . PRO A 1 72  ? 16.898  -18.474 12.874  1.00 0.00 ? 72  PRO A HB2  2  
ATOM 3299  H HB3  . PRO A 1 72  ? 18.191  -17.567 12.081  1.00 0.00 ? 72  PRO A HB3  2  
ATOM 3300  H HG2  . PRO A 1 72  ? 15.248  -17.538 11.536  1.00 0.00 ? 72  PRO A HG2  2  
ATOM 3301  H HG3  . PRO A 1 72  ? 16.383  -16.179 11.624  1.00 0.00 ? 72  PRO A HG3  2  
ATOM 3302  H HD2  . PRO A 1 72  ? 15.547  -17.228 9.272   1.00 0.00 ? 72  PRO A HD2  2  
ATOM 3303  H HD3  . PRO A 1 72  ? 17.165  -16.529 9.484   1.00 0.00 ? 72  PRO A HD3  2  
ATOM 3304  N N    . PRO A 1 73  ? 16.978  -21.171 12.333  1.00 0.00 ? 73  PRO A N    2  
ATOM 3305  C CA   . PRO A 1 73  ? 16.231  -22.340 12.808  1.00 0.00 ? 73  PRO A CA   2  
ATOM 3306  C C    . PRO A 1 73  ? 14.927  -21.955 13.498  1.00 0.00 ? 73  PRO A C    2  
ATOM 3307  O O    . PRO A 1 73  ? 14.830  -21.986 14.724  1.00 0.00 ? 73  PRO A O    2  
ATOM 3308  C CB   . PRO A 1 73  ? 17.192  -22.993 13.806  1.00 0.00 ? 73  PRO A CB   2  
ATOM 3309  C CG   . PRO A 1 73  ? 18.063  -21.879 14.277  1.00 0.00 ? 73  PRO A CG   2  
ATOM 3310  C CD   . PRO A 1 73  ? 18.210  -20.946 13.107  1.00 0.00 ? 73  PRO A CD   2  
ATOM 3311  H HA   . PRO A 1 73  ? 16.022  -23.030 12.004  1.00 0.00 ? 73  PRO A HA   2  
ATOM 3312  H HB2  . PRO A 1 73  ? 16.628  -23.426 14.620  1.00 0.00 ? 73  PRO A HB2  2  
ATOM 3313  H HB3  . PRO A 1 73  ? 17.766  -23.760 13.309  1.00 0.00 ? 73  PRO A HB3  2  
ATOM 3314  H HG2  . PRO A 1 73  ? 17.593  -21.371 15.105  1.00 0.00 ? 73  PRO A HG2  2  
ATOM 3315  H HG3  . PRO A 1 73  ? 19.027  -22.267 14.570  1.00 0.00 ? 73  PRO A HG3  2  
ATOM 3316  H HD2  . PRO A 1 73  ? 18.271  -19.923 13.446  1.00 0.00 ? 73  PRO A HD2  2  
ATOM 3317  H HD3  . PRO A 1 73  ? 19.082  -21.205 12.525  1.00 0.00 ? 73  PRO A HD3  2  
ATOM 3318  N N    . ALA A 1 74  ? 13.927  -21.591 12.701  1.00 0.00 ? 74  ALA A N    2  
ATOM 3319  C CA   . ALA A 1 74  ? 12.628  -21.202 13.236  1.00 0.00 ? 74  ALA A CA   2  
ATOM 3320  C C    . ALA A 1 74  ? 11.523  -22.110 12.709  1.00 0.00 ? 74  ALA A C    2  
ATOM 3321  O O    . ALA A 1 74  ? 10.882  -22.831 13.473  1.00 0.00 ? 74  ALA A O    2  
ATOM 3322  C CB   . ALA A 1 74  ? 12.329  -19.750 12.892  1.00 0.00 ? 74  ALA A CB   2  
ATOM 3323  H H    . ALA A 1 74  ? 14.066  -21.586 11.732  1.00 0.00 ? 74  ALA A H    2  
ATOM 3324  H HA   . ALA A 1 74  ? 12.670  -21.289 14.312  1.00 0.00 ? 74  ALA A HA   2  
ATOM 3325  H HB1  . ALA A 1 74  ? 12.684  -19.537 11.893  1.00 0.00 ? 74  ALA A HB1  2  
ATOM 3326  H HB2  . ALA A 1 74  ? 11.264  -19.581 12.940  1.00 0.00 ? 74  ALA A HB2  2  
ATOM 3327  H HB3  . ALA A 1 74  ? 12.829  -19.103 13.597  1.00 0.00 ? 74  ALA A HB3  2  
ATOM 3328  N N    . SER A 1 75  ? 11.306  -22.071 11.398  1.00 0.00 ? 75  SER A N    2  
ATOM 3329  C CA   . SER A 1 75  ? 10.274  -22.888 10.769  1.00 0.00 ? 75  SER A CA   2  
ATOM 3330  C C    . SER A 1 75  ? 10.681  -24.358 10.752  1.00 0.00 ? 75  SER A C    2  
ATOM 3331  O O    . SER A 1 75  ? 9.853   -25.241 10.527  1.00 0.00 ? 75  SER A O    2  
ATOM 3332  C CB   . SER A 1 75  ? 10.010  -22.404 9.343   1.00 0.00 ? 75  SER A CB   2  
ATOM 3333  O OG   . SER A 1 75  ? 9.406   -21.122 9.343   1.00 0.00 ? 75  SER A OG   2  
ATOM 3334  H H    . SER A 1 75  ? 11.850  -21.476 10.841  1.00 0.00 ? 75  SER A H    2  
ATOM 3335  H HA   . SER A 1 75  ? 9.369   -22.784 11.349  1.00 0.00 ? 75  SER A HA   2  
ATOM 3336  H HB2  . SER A 1 75  ? 10.944  -22.349 8.805   1.00 0.00 ? 75  SER A HB2  2  
ATOM 3337  H HB3  . SER A 1 75  ? 9.349   -23.100 8.846   1.00 0.00 ? 75  SER A HB3  2  
ATOM 3338  H HG   . SER A 1 75  ? 10.088  -20.447 9.309   1.00 0.00 ? 75  SER A HG   2  
ATOM 3339  N N    . TYR A 1 76  ? 11.963  -24.613 10.992  1.00 0.00 ? 76  TYR A N    2  
ATOM 3340  C CA   . TYR A 1 76  ? 12.482  -25.976 11.002  1.00 0.00 ? 76  TYR A CA   2  
ATOM 3341  C C    . TYR A 1 76  ? 11.750  -26.830 12.033  1.00 0.00 ? 76  TYR A C    2  
ATOM 3342  O O    . TYR A 1 76  ? 11.724  -28.058 11.933  1.00 0.00 ? 76  TYR A O    2  
ATOM 3343  C CB   . TYR A 1 76  ? 13.982  -25.970 11.301  1.00 0.00 ? 76  TYR A CB   2  
ATOM 3344  C CG   . TYR A 1 76  ? 14.592  -27.352 11.366  1.00 0.00 ? 76  TYR A CG   2  
ATOM 3345  C CD1  . TYR A 1 76  ? 14.955  -28.028 10.208  1.00 0.00 ? 76  TYR A CD1  2  
ATOM 3346  C CD2  . TYR A 1 76  ? 14.807  -27.982 12.586  1.00 0.00 ? 76  TYR A CD2  2  
ATOM 3347  C CE1  . TYR A 1 76  ? 15.511  -29.291 10.262  1.00 0.00 ? 76  TYR A CE1  2  
ATOM 3348  C CE2  . TYR A 1 76  ? 15.364  -29.244 12.650  1.00 0.00 ? 76  TYR A CE2  2  
ATOM 3349  C CZ   . TYR A 1 76  ? 15.714  -29.895 11.485  1.00 0.00 ? 76  TYR A CZ   2  
ATOM 3350  O OH   . TYR A 1 76  ? 16.270  -31.152 11.544  1.00 0.00 ? 76  TYR A OH   2  
ATOM 3351  H H    . TYR A 1 76  ? 12.575  -23.868 11.165  1.00 0.00 ? 76  TYR A H    2  
ATOM 3352  H HA   . TYR A 1 76  ? 12.322  -26.399 10.022  1.00 0.00 ? 76  TYR A HA   2  
ATOM 3353  H HB2  . TYR A 1 76  ? 14.494  -25.418 10.529  1.00 0.00 ? 76  TYR A HB2  2  
ATOM 3354  H HB3  . TYR A 1 76  ? 14.151  -25.488 12.253  1.00 0.00 ? 76  TYR A HB3  2  
ATOM 3355  H HD1  . TYR A 1 76  ? 14.794  -27.552 9.251   1.00 0.00 ? 76  TYR A HD1  2  
ATOM 3356  H HD2  . TYR A 1 76  ? 14.531  -27.469 13.497  1.00 0.00 ? 76  TYR A HD2  2  
ATOM 3357  H HE1  . TYR A 1 76  ? 15.786  -29.801 9.350   1.00 0.00 ? 76  TYR A HE1  2  
ATOM 3358  H HE2  . TYR A 1 76  ? 15.523  -29.717 13.608  1.00 0.00 ? 76  TYR A HE2  2  
ATOM 3359  H HH   . TYR A 1 76  ? 16.642  -31.297 12.417  1.00 0.00 ? 76  TYR A HH   2  
ATOM 3360  N N    . LEU A 1 77  ? 11.156  -26.172 13.022  1.00 0.00 ? 77  LEU A N    2  
ATOM 3361  C CA   . LEU A 1 77  ? 10.421  -26.870 14.072  1.00 0.00 ? 77  LEU A CA   2  
ATOM 3362  C C    . LEU A 1 77  ? 9.001   -27.195 13.620  1.00 0.00 ? 77  LEU A C    2  
ATOM 3363  O O    . LEU A 1 77  ? 8.346   -28.072 14.183  1.00 0.00 ? 77  LEU A O    2  
ATOM 3364  C CB   . LEU A 1 77  ? 10.382  -26.021 15.344  1.00 0.00 ? 77  LEU A CB   2  
ATOM 3365  C CG   . LEU A 1 77  ? 11.716  -25.834 16.067  1.00 0.00 ? 77  LEU A CG   2  
ATOM 3366  C CD1  . LEU A 1 77  ? 12.561  -24.781 15.365  1.00 0.00 ? 77  LEU A CD1  2  
ATOM 3367  C CD2  . LEU A 1 77  ? 11.486  -25.451 17.522  1.00 0.00 ? 77  LEU A CD2  2  
ATOM 3368  H H    . LEU A 1 77  ? 11.211  -25.195 13.048  1.00 0.00 ? 77  LEU A H    2  
ATOM 3369  H HA   . LEU A 1 77  ? 10.940  -27.794 14.281  1.00 0.00 ? 77  LEU A HA   2  
ATOM 3370  H HB2  . LEU A 1 77  ? 10.010  -25.044 15.078  1.00 0.00 ? 77  LEU A HB2  2  
ATOM 3371  H HB3  . LEU A 1 77  ? 9.695   -26.491 16.033  1.00 0.00 ? 77  LEU A HB3  2  
ATOM 3372  H HG   . LEU A 1 77  ? 12.263  -26.766 16.048  1.00 0.00 ? 77  LEU A HG   2  
ATOM 3373  H HD11 . LEU A 1 77  ? 11.968  -23.894 15.202  1.00 0.00 ? 77  LEU A HD11 2  
ATOM 3374  H HD12 . LEU A 1 77  ? 12.900  -25.167 14.415  1.00 0.00 ? 77  LEU A HD12 2  
ATOM 3375  H HD13 . LEU A 1 77  ? 13.415  -24.536 15.980  1.00 0.00 ? 77  LEU A HD13 2  
ATOM 3376  H HD21 . LEU A 1 77  ? 10.984  -26.261 18.031  1.00 0.00 ? 77  LEU A HD21 2  
ATOM 3377  H HD22 . LEU A 1 77  ? 10.872  -24.563 17.568  1.00 0.00 ? 77  LEU A HD22 2  
ATOM 3378  H HD23 . LEU A 1 77  ? 12.435  -25.259 17.999  1.00 0.00 ? 77  LEU A HD23 2  
ATOM 3379  N N    . ILE A 1 78  ? 8.534   -26.483 12.600  1.00 0.00 ? 78  ILE A N    2  
ATOM 3380  C CA   . ILE A 1 78  ? 7.193   -26.698 12.070  1.00 0.00 ? 78  ILE A CA   2  
ATOM 3381  C C    . ILE A 1 78  ? 7.095   -28.039 11.350  1.00 0.00 ? 78  ILE A C    2  
ATOM 3382  O O    . ILE A 1 78  ? 6.112   -28.764 11.498  1.00 0.00 ? 78  ILE A O    2  
ATOM 3383  C CB   . ILE A 1 78  ? 6.784   -25.575 11.099  1.00 0.00 ? 78  ILE A CB   2  
ATOM 3384  C CG1  . ILE A 1 78  ? 7.050   -24.206 11.728  1.00 0.00 ? 78  ILE A CG1  2  
ATOM 3385  C CG2  . ILE A 1 78  ? 5.318   -25.713 10.716  1.00 0.00 ? 78  ILE A CG2  2  
ATOM 3386  C CD1  . ILE A 1 78  ? 6.779   -23.048 10.792  1.00 0.00 ? 78  ILE A CD1  2  
ATOM 3387  H H    . ILE A 1 78  ? 9.104   -25.798 12.193  1.00 0.00 ? 78  ILE A H    2  
ATOM 3388  H HA   . ILE A 1 78  ? 6.502   -26.697 12.901  1.00 0.00 ? 78  ILE A HA   2  
ATOM 3389  H HB   . ILE A 1 78  ? 7.376   -25.672 10.202  1.00 0.00 ? 78  ILE A HB   2  
ATOM 3390  H HG12 . ILE A 1 78  ? 6.419   -24.086 12.594  1.00 0.00 ? 78  ILE A HG12 2  
ATOM 3391  H HG13 . ILE A 1 78  ? 8.085   -24.152 12.032  1.00 0.00 ? 78  ILE A HG13 2  
ATOM 3392  H HG21 . ILE A 1 78  ? 5.118   -25.119 9.837   1.00 0.00 ? 78  ILE A HG21 2  
ATOM 3393  H HG22 . ILE A 1 78  ? 5.097   -26.749 10.507  1.00 0.00 ? 78  ILE A HG22 2  
ATOM 3394  H HG23 . ILE A 1 78  ? 4.699   -25.370 11.531  1.00 0.00 ? 78  ILE A HG23 2  
ATOM 3395  H HD11 . ILE A 1 78  ? 5.836   -23.205 10.288  1.00 0.00 ? 78  ILE A HD11 2  
ATOM 3396  H HD12 . ILE A 1 78  ? 6.738   -22.130 11.357  1.00 0.00 ? 78  ILE A HD12 2  
ATOM 3397  H HD13 . ILE A 1 78  ? 7.571   -22.985 10.060  1.00 0.00 ? 78  ILE A HD13 2  
ATOM 3398  N N    . ARG A 1 79  ? 8.122   -28.362 10.570  1.00 0.00 ? 79  ARG A N    2  
ATOM 3399  C CA   . ARG A 1 79  ? 8.152   -29.615 9.827   1.00 0.00 ? 79  ARG A CA   2  
ATOM 3400  C C    . ARG A 1 79  ? 8.238   -30.808 10.775  1.00 0.00 ? 79  ARG A C    2  
ATOM 3401  O O    . ARG A 1 79  ? 7.842   -31.921 10.428  1.00 0.00 ? 79  ARG A O    2  
ATOM 3402  C CB   . ARG A 1 79  ? 9.338   -29.632 8.861   1.00 0.00 ? 79  ARG A CB   2  
ATOM 3403  C CG   . ARG A 1 79  ? 9.243   -28.587 7.761   1.00 0.00 ? 79  ARG A CG   2  
ATOM 3404  C CD   . ARG A 1 79  ? 10.599  -27.969 7.461   1.00 0.00 ? 79  ARG A CD   2  
ATOM 3405  N NE   . ARG A 1 79  ? 10.726  -27.581 6.059   1.00 0.00 ? 79  ARG A NE   2  
ATOM 3406  C CZ   . ARG A 1 79  ? 10.846  -28.452 5.063   1.00 0.00 ? 79  ARG A CZ   2  
ATOM 3407  N NH1  . ARG A 1 79  ? 10.856  -29.754 5.315   1.00 0.00 ? 79  ARG A NH1  2  
ATOM 3408  N NH2  . ARG A 1 79  ? 10.957  -28.022 3.813   1.00 0.00 ? 79  ARG A NH2  2  
ATOM 3409  H H    . ARG A 1 79  ? 8.877   -27.742 10.492  1.00 0.00 ? 79  ARG A H    2  
ATOM 3410  H HA   . ARG A 1 79  ? 7.236   -29.687 9.259   1.00 0.00 ? 79  ARG A HA   2  
ATOM 3411  H HB2  . ARG A 1 79  ? 10.245  -29.452 9.420   1.00 0.00 ? 79  ARG A HB2  2  
ATOM 3412  H HB3  . ARG A 1 79  ? 9.397   -30.606 8.399   1.00 0.00 ? 79  ARG A HB3  2  
ATOM 3413  H HG2  . ARG A 1 79  ? 8.867   -29.056 6.864   1.00 0.00 ? 79  ARG A HG2  2  
ATOM 3414  H HG3  . ARG A 1 79  ? 8.563   -27.809 8.075   1.00 0.00 ? 79  ARG A HG3  2  
ATOM 3415  H HD2  . ARG A 1 79  ? 10.725  -27.092 8.079   1.00 0.00 ? 79  ARG A HD2  2  
ATOM 3416  H HD3  . ARG A 1 79  ? 11.368  -28.689 7.697   1.00 0.00 ? 79  ARG A HD3  2  
ATOM 3417  H HE   . ARG A 1 79  ? 10.721  -26.624 5.850   1.00 0.00 ? 79  ARG A HE   2  
ATOM 3418  H HH11 . ARG A 1 79  ? 10.772  -30.081 6.256   1.00 0.00 ? 79  ARG A HH11 2  
ATOM 3419  H HH12 . ARG A 1 79  ? 10.945  -30.408 4.564   1.00 0.00 ? 79  ARG A HH12 2  
ATOM 3420  H HH21 . ARG A 1 79  ? 10.949  -27.042 3.619   1.00 0.00 ? 79  ARG A HH21 2  
ATOM 3421  H HH22 . ARG A 1 79  ? 11.047  -28.679 3.065   1.00 0.00 ? 79  ARG A HH22 2  
ATOM 3422  N N    . LYS A 1 80  ? 8.758   -30.567 11.974  1.00 0.00 ? 80  LYS A N    2  
ATOM 3423  C CA   . LYS A 1 80  ? 8.895   -31.620 12.974  1.00 0.00 ? 80  LYS A CA   2  
ATOM 3424  C C    . LYS A 1 80  ? 7.528   -32.100 13.451  1.00 0.00 ? 80  LYS A C    2  
ATOM 3425  O O    . LYS A 1 80  ? 7.224   -33.291 13.394  1.00 0.00 ? 80  LYS A O    2  
ATOM 3426  C CB   . LYS A 1 80  ? 9.715   -31.116 14.165  1.00 0.00 ? 80  LYS A CB   2  
ATOM 3427  C CG   . LYS A 1 80  ? 10.041  -32.198 15.179  1.00 0.00 ? 80  LYS A CG   2  
ATOM 3428  C CD   . LYS A 1 80  ? 8.932   -32.353 16.206  1.00 0.00 ? 80  LYS A CD   2  
ATOM 3429  C CE   . LYS A 1 80  ? 8.504   -33.805 16.350  1.00 0.00 ? 80  LYS A CE   2  
ATOM 3430  N NZ   . LYS A 1 80  ? 9.593   -34.651 16.913  1.00 0.00 ? 80  LYS A NZ   2  
ATOM 3431  H H    . LYS A 1 80  ? 9.055   -29.659 12.192  1.00 0.00 ? 80  LYS A H    2  
ATOM 3432  H HA   . LYS A 1 80  ? 9.414   -32.447 12.515  1.00 0.00 ? 80  LYS A HA   2  
ATOM 3433  H HB2  . LYS A 1 80  ? 10.643  -30.703 13.798  1.00 0.00 ? 80  LYS A HB2  2  
ATOM 3434  H HB3  . LYS A 1 80  ? 9.157   -30.338 14.666  1.00 0.00 ? 80  LYS A HB3  2  
ATOM 3435  H HG2  . LYS A 1 80  ? 10.171  -33.137 14.662  1.00 0.00 ? 80  LYS A HG2  2  
ATOM 3436  H HG3  . LYS A 1 80  ? 10.957  -31.936 15.689  1.00 0.00 ? 80  LYS A HG3  2  
ATOM 3437  H HD2  . LYS A 1 80  ? 9.286   -31.997 17.162  1.00 0.00 ? 80  LYS A HD2  2  
ATOM 3438  H HD3  . LYS A 1 80  ? 8.080   -31.765 15.894  1.00 0.00 ? 80  LYS A HD3  2  
ATOM 3439  H HE2  . LYS A 1 80  ? 7.648   -33.851 17.006  1.00 0.00 ? 80  LYS A HE2  2  
ATOM 3440  H HE3  . LYS A 1 80  ? 8.232   -34.185 15.377  1.00 0.00 ? 80  LYS A HE3  2  
ATOM 3441  H HZ1  . LYS A 1 80  ? 10.041  -34.167 17.718  1.00 0.00 ? 80  LYS A HZ1  2  
ATOM 3442  H HZ2  . LYS A 1 80  ? 10.315  -34.833 16.187  1.00 0.00 ? 80  LYS A HZ2  2  
ATOM 3443  H HZ3  . LYS A 1 80  ? 9.207   -35.560 17.240  1.00 0.00 ? 80  LYS A HZ3  2  
ATOM 3444  N N    . ALA A 1 81  ? 6.708   -31.165 13.919  1.00 0.00 ? 81  ALA A N    2  
ATOM 3445  C CA   . ALA A 1 81  ? 5.372   -31.492 14.402  1.00 0.00 ? 81  ALA A CA   2  
ATOM 3446  C C    . ALA A 1 81  ? 4.604   -32.316 13.374  1.00 0.00 ? 81  ALA A C    2  
ATOM 3447  O O    . ALA A 1 81  ? 4.332   -33.497 13.588  1.00 0.00 ? 81  ALA A O    2  
ATOM 3448  C CB   . ALA A 1 81  ? 4.608   -30.222 14.742  1.00 0.00 ? 81  ALA A CB   2  
ATOM 3449  H H    . ALA A 1 81  ? 7.008   -30.232 13.938  1.00 0.00 ? 81  ALA A H    2  
ATOM 3450  H HA   . ALA A 1 81  ? 5.478   -32.073 15.307  1.00 0.00 ? 81  ALA A HA   2  
ATOM 3451  H HB1  . ALA A 1 81  ? 5.209   -29.605 15.394  1.00 0.00 ? 81  ALA A HB1  2  
ATOM 3452  H HB2  . ALA A 1 81  ? 4.388   -29.680 13.834  1.00 0.00 ? 81  ALA A HB2  2  
ATOM 3453  H HB3  . ALA A 1 81  ? 3.685   -30.480 15.239  1.00 0.00 ? 81  ALA A HB3  2  
ATOM 3454  N N    . ALA A 1 82  ? 4.255   -31.684 12.258  1.00 0.00 ? 82  ALA A N    2  
ATOM 3455  C CA   . ALA A 1 82  ? 3.518   -32.359 11.196  1.00 0.00 ? 82  ALA A CA   2  
ATOM 3456  C C    . ALA A 1 82  ? 4.292   -33.563 10.671  1.00 0.00 ? 82  ALA A C    2  
ATOM 3457  O O    . ALA A 1 82  ? 3.818   -34.696 10.738  1.00 0.00 ? 82  ALA A O    2  
ATOM 3458  C CB   . ALA A 1 82  ? 3.216   -31.388 10.064  1.00 0.00 ? 82  ALA A CB   2  
ATOM 3459  H H    . ALA A 1 82  ? 4.500   -30.742 12.145  1.00 0.00 ? 82  ALA A H    2  
ATOM 3460  H HA   . ALA A 1 82  ? 2.578   -32.699 11.606  1.00 0.00 ? 82  ALA A HA   2  
ATOM 3461  H HB1  . ALA A 1 82  ? 2.959   -30.423 10.477  1.00 0.00 ? 82  ALA A HB1  2  
ATOM 3462  H HB2  . ALA A 1 82  ? 4.086   -31.290 9.432   1.00 0.00 ? 82  ALA A HB2  2  
ATOM 3463  H HB3  . ALA A 1 82  ? 2.387   -31.762 9.481   1.00 0.00 ? 82  ALA A HB3  2  
ATOM 3464  N N    . GLY A 1 83  ? 5.487   -33.309 10.146  1.00 0.00 ? 83  GLY A N    2  
ATOM 3465  C CA   . GLY A 1 83  ? 6.308   -34.382 9.615   1.00 0.00 ? 83  GLY A CA   2  
ATOM 3466  C C    . GLY A 1 83  ? 6.100   -34.591 8.128   1.00 0.00 ? 83  GLY A C    2  
ATOM 3467  O O    . GLY A 1 83  ? 5.289   -35.422 7.718   1.00 0.00 ? 83  GLY A O    2  
ATOM 3468  H H    . GLY A 1 83  ? 5.815   -32.386 10.118  1.00 0.00 ? 83  GLY A H    2  
ATOM 3469  H HA2  . GLY A 1 83  ? 7.347   -34.149 9.794   1.00 0.00 ? 83  GLY A HA2  2  
ATOM 3470  H HA3  . GLY A 1 83  ? 6.061   -35.298 10.133  1.00 0.00 ? 83  GLY A HA3  2  
ATOM 3471  N N    . LEU A 1 84  ? 6.831   -33.833 7.319   1.00 0.00 ? 84  LEU A N    2  
ATOM 3472  C CA   . LEU A 1 84  ? 6.722   -33.937 5.868   1.00 0.00 ? 84  LEU A CA   2  
ATOM 3473  C C    . LEU A 1 84  ? 7.552   -35.104 5.341   1.00 0.00 ? 84  LEU A C    2  
ATOM 3474  O O    . LEU A 1 84  ? 7.010   -36.068 4.801   1.00 0.00 ? 84  LEU A O    2  
ATOM 3475  C CB   . LEU A 1 84  ? 7.178   -32.635 5.207   1.00 0.00 ? 84  LEU A CB   2  
ATOM 3476  C CG   . LEU A 1 84  ? 6.426   -31.371 5.628   1.00 0.00 ? 84  LEU A CG   2  
ATOM 3477  C CD1  . LEU A 1 84  ? 4.935   -31.647 5.734   1.00 0.00 ? 84  LEU A CD1  2  
ATOM 3478  C CD2  . LEU A 1 84  ? 6.968   -30.843 6.948   1.00 0.00 ? 84  LEU A CD2  2  
ATOM 3479  H H    . LEU A 1 84  ? 7.460   -33.189 7.704   1.00 0.00 ? 84  LEU A H    2  
ATOM 3480  H HA   . LEU A 1 84  ? 5.684   -34.111 5.625   1.00 0.00 ? 84  LEU A HA   2  
ATOM 3481  H HB2  . LEU A 1 84  ? 8.221   -32.492 5.442   1.00 0.00 ? 84  LEU A HB2  2  
ATOM 3482  H HB3  . LEU A 1 84  ? 7.064   -32.749 4.139   1.00 0.00 ? 84  LEU A HB3  2  
ATOM 3483  H HG   . LEU A 1 84  ? 6.571   -30.607 4.876   1.00 0.00 ? 84  LEU A HG   2  
ATOM 3484  H HD11 . LEU A 1 84  ? 4.687   -31.899 6.754   1.00 0.00 ? 84  LEU A HD11 2  
ATOM 3485  H HD12 . LEU A 1 84  ? 4.674   -32.472 5.086   1.00 0.00 ? 84  LEU A HD12 2  
ATOM 3486  H HD13 . LEU A 1 84  ? 4.384   -30.767 5.435   1.00 0.00 ? 84  LEU A HD13 2  
ATOM 3487  H HD21 . LEU A 1 84  ? 6.507   -31.377 7.765   1.00 0.00 ? 84  LEU A HD21 2  
ATOM 3488  H HD22 . LEU A 1 84  ? 6.743   -29.789 7.034   1.00 0.00 ? 84  LEU A HD22 2  
ATOM 3489  H HD23 . LEU A 1 84  ? 8.038   -30.986 6.981   1.00 0.00 ? 84  LEU A HD23 2  
ATOM 3490  N N    . GLU A 1 85  ? 8.867   -35.010 5.506   1.00 0.00 ? 85  GLU A N    2  
ATOM 3491  C CA   . GLU A 1 85  ? 9.771   -36.060 5.048   1.00 0.00 ? 85  GLU A CA   2  
ATOM 3492  C C    . GLU A 1 85  ? 9.708   -36.208 3.531   1.00 0.00 ? 85  GLU A C    2  
ATOM 3493  O O    . GLU A 1 85  ? 9.973   -37.281 2.989   1.00 0.00 ? 85  GLU A O    2  
ATOM 3494  C CB   . GLU A 1 85  ? 9.421   -37.391 5.717   1.00 0.00 ? 85  GLU A CB   2  
ATOM 3495  C CG   . GLU A 1 85  ? 10.586  -38.022 6.462   1.00 0.00 ? 85  GLU A CG   2  
ATOM 3496  C CD   . GLU A 1 85  ? 10.137  -39.051 7.481   1.00 0.00 ? 85  GLU A CD   2  
ATOM 3497  O OE1  . GLU A 1 85  ? 9.556   -38.652 8.512   1.00 0.00 ? 85  GLU A OE1  2  
ATOM 3498  O OE2  . GLU A 1 85  ? 10.367  -40.256 7.247   1.00 0.00 ? 85  GLU A OE2  2  
ATOM 3499  H H    . GLU A 1 85  ? 9.239   -34.217 5.944   1.00 0.00 ? 85  GLU A H    2  
ATOM 3500  H HA   . GLU A 1 85  ? 10.774  -35.779 5.329   1.00 0.00 ? 85  GLU A HA   2  
ATOM 3501  H HB2  . GLU A 1 85  ? 8.617   -37.228 6.419   1.00 0.00 ? 85  GLU A HB2  2  
ATOM 3502  H HB3  . GLU A 1 85  ? 9.089   -38.084 4.958   1.00 0.00 ? 85  GLU A HB3  2  
ATOM 3503  H HG2  . GLU A 1 85  ? 11.234  -38.506 5.747   1.00 0.00 ? 85  GLU A HG2  2  
ATOM 3504  H HG3  . GLU A 1 85  ? 11.133  -37.244 6.974   1.00 0.00 ? 85  GLU A HG3  2  
ATOM 3505  N N    . LYS A 1 86  ? 9.356   -35.122 2.850   1.00 0.00 ? 86  LYS A N    2  
ATOM 3506  C CA   . LYS A 1 86  ? 9.258   -35.129 1.396   1.00 0.00 ? 86  LYS A CA   2  
ATOM 3507  C C    . LYS A 1 86  ? 8.300   -36.216 0.919   1.00 0.00 ? 86  LYS A C    2  
ATOM 3508  O O    . LYS A 1 86  ? 8.696   -37.365 0.726   1.00 0.00 ? 86  LYS A O    2  
ATOM 3509  C CB   . LYS A 1 86  ? 10.639  -35.342 0.772   1.00 0.00 ? 86  LYS A CB   2  
ATOM 3510  C CG   . LYS A 1 86  ? 10.675  -35.097 -0.726  1.00 0.00 ? 86  LYS A CG   2  
ATOM 3511  C CD   . LYS A 1 86  ? 11.662  -34.000 -1.088  1.00 0.00 ? 86  LYS A CD   2  
ATOM 3512  C CE   . LYS A 1 86  ? 11.391  -33.441 -2.476  1.00 0.00 ? 86  LYS A CE   2  
ATOM 3513  N NZ   . LYS A 1 86  ? 12.236  -34.095 -3.513  1.00 0.00 ? 86  LYS A NZ   2  
ATOM 3514  H H    . LYS A 1 86  ? 9.157   -34.296 3.339   1.00 0.00 ? 86  LYS A H    2  
ATOM 3515  H HA   . LYS A 1 86  ? 8.877   -34.168 1.084   1.00 0.00 ? 86  LYS A HA   2  
ATOM 3516  H HB2  . LYS A 1 86  ? 11.341  -34.670 1.243   1.00 0.00 ? 86  LYS A HB2  2  
ATOM 3517  H HB3  . LYS A 1 86  ? 10.950  -36.361 0.956   1.00 0.00 ? 86  LYS A HB3  2  
ATOM 3518  H HG2  . LYS A 1 86  ? 10.968  -36.009 -1.225  1.00 0.00 ? 86  LYS A HG2  2  
ATOM 3519  H HG3  . LYS A 1 86  ? 9.689   -34.804 -1.057  1.00 0.00 ? 86  LYS A HG3  2  
ATOM 3520  H HD2  . LYS A 1 86  ? 11.578  -33.200 -0.368  1.00 0.00 ? 86  LYS A HD2  2  
ATOM 3521  H HD3  . LYS A 1 86  ? 12.664  -34.406 -1.062  1.00 0.00 ? 86  LYS A HD3  2  
ATOM 3522  H HE2  . LYS A 1 86  ? 10.351  -33.602 -2.718  1.00 0.00 ? 86  LYS A HE2  2  
ATOM 3523  H HE3  . LYS A 1 86  ? 11.599  -32.381 -2.470  1.00 0.00 ? 86  LYS A HE3  2  
ATOM 3524  H HZ1  . LYS A 1 86  ? 12.384  -33.448 -4.313  1.00 0.00 ? 86  LYS A HZ1  2  
ATOM 3525  H HZ2  . LYS A 1 86  ? 11.771  -34.958 -3.861  1.00 0.00 ? 86  LYS A HZ2  2  
ATOM 3526  H HZ3  . LYS A 1 86  ? 13.161  -34.351 -3.111  1.00 0.00 ? 86  LYS A HZ3  2  
ATOM 3527  N N    . GLY A 1 87  ? 7.037   -35.845 0.730   1.00 0.00 ? 87  GLY A N    2  
ATOM 3528  C CA   . GLY A 1 87  ? 6.043   -36.800 0.277   1.00 0.00 ? 87  GLY A CA   2  
ATOM 3529  C C    . GLY A 1 87  ? 5.961   -38.021 1.172   1.00 0.00 ? 87  GLY A C    2  
ATOM 3530  O O    . GLY A 1 87  ? 5.391   -37.963 2.261   1.00 0.00 ? 87  GLY A O    2  
ATOM 3531  H H    . GLY A 1 87  ? 6.779   -34.915 0.901   1.00 0.00 ? 87  GLY A H    2  
ATOM 3532  H HA2  . GLY A 1 87  ? 5.078   -36.316 0.256   1.00 0.00 ? 87  GLY A HA2  2  
ATOM 3533  H HA3  . GLY A 1 87  ? 6.297   -37.119 -0.724  1.00 0.00 ? 87  GLY A HA3  2  
ATOM 3534  N N    . ALA A 1 88  ? 6.531   -39.130 0.712   1.00 0.00 ? 88  ALA A N    2  
ATOM 3535  C CA   . ALA A 1 88  ? 6.520   -40.369 1.478   1.00 0.00 ? 88  ALA A CA   2  
ATOM 3536  C C    . ALA A 1 88  ? 5.095   -40.858 1.711   1.00 0.00 ? 88  ALA A C    2  
ATOM 3537  O O    . ALA A 1 88  ? 4.137   -40.272 1.206   1.00 0.00 ? 88  ALA A O    2  
ATOM 3538  C CB   . ALA A 1 88  ? 7.237   -40.175 2.806   1.00 0.00 ? 88  ALA A CB   2  
ATOM 3539  H H    . ALA A 1 88  ? 6.971   -39.113 -0.164  1.00 0.00 ? 88  ALA A H    2  
ATOM 3540  H HA   . ALA A 1 88  ? 7.059   -41.116 0.913   1.00 0.00 ? 88  ALA A HA   2  
ATOM 3541  H HB1  . ALA A 1 88  ? 7.870   -39.301 2.748   1.00 0.00 ? 88  ALA A HB1  2  
ATOM 3542  H HB2  . ALA A 1 88  ? 6.509   -40.040 3.592   1.00 0.00 ? 88  ALA A HB2  2  
ATOM 3543  H HB3  . ALA A 1 88  ? 7.841   -41.044 3.020   1.00 0.00 ? 88  ALA A HB3  2  
ATOM 3544  N N    . HIS A 1 89  ? 4.961   -41.936 2.478   1.00 0.00 ? 89  HIS A N    2  
ATOM 3545  C CA   . HIS A 1 89  ? 3.652   -42.504 2.777   1.00 0.00 ? 89  HIS A CA   2  
ATOM 3546  C C    . HIS A 1 89  ? 2.792   -42.581 1.519   1.00 0.00 ? 89  HIS A C    2  
ATOM 3547  O O    . HIS A 1 89  ? 3.295   -42.453 0.402   1.00 0.00 ? 89  HIS A O    2  
ATOM 3548  C CB   . HIS A 1 89  ? 2.942   -41.669 3.843   1.00 0.00 ? 89  HIS A CB   2  
ATOM 3549  C CG   . HIS A 1 89  ? 2.507   -40.321 3.357   1.00 0.00 ? 89  HIS A CG   2  
ATOM 3550  N ND1  . HIS A 1 89  ? 3.232   -39.170 3.582   1.00 0.00 ? 89  HIS A ND1  2  
ATOM 3551  C CD2  . HIS A 1 89  ? 1.415   -39.944 2.652   1.00 0.00 ? 89  HIS A CD2  2  
ATOM 3552  C CE1  . HIS A 1 89  ? 2.603   -38.143 3.038   1.00 0.00 ? 89  HIS A CE1  2  
ATOM 3553  N NE2  . HIS A 1 89  ? 1.498   -38.586 2.467   1.00 0.00 ? 89  HIS A NE2  2  
ATOM 3554  H H    . HIS A 1 89  ? 5.762   -42.359 2.851   1.00 0.00 ? 89  HIS A H    2  
ATOM 3555  H HA   . HIS A 1 89  ? 3.802   -43.503 3.156   1.00 0.00 ? 89  HIS A HA   2  
ATOM 3556  H HB2  . HIS A 1 89  ? 2.063   -42.199 4.180   1.00 0.00 ? 89  HIS A HB2  2  
ATOM 3557  H HB3  . HIS A 1 89  ? 3.610   -41.521 4.680   1.00 0.00 ? 89  HIS A HB3  2  
ATOM 3558  H HD1  . HIS A 1 89  ? 4.079   -39.114 4.070   1.00 0.00 ? 89  HIS A HD1  2  
ATOM 3559  H HD2  . HIS A 1 89  ? 0.623   -40.591 2.299   1.00 0.00 ? 89  HIS A HD2  2  
ATOM 3560  H HE1  . HIS A 1 89  ? 2.936   -37.116 3.056   1.00 0.00 ? 89  HIS A HE1  2  
ATOM 3561  N N    . LYS A 1 90  ? 1.494   -42.791 1.706   1.00 0.00 ? 90  LYS A N    2  
ATOM 3562  C CA   . LYS A 1 90  ? 0.564   -42.885 0.588   1.00 0.00 ? 90  LYS A CA   2  
ATOM 3563  C C    . LYS A 1 90  ? -0.854  -42.535 1.028   1.00 0.00 ? 90  LYS A C    2  
ATOM 3564  O O    . LYS A 1 90  ? -1.187  -42.567 2.213   1.00 0.00 ? 90  LYS A O    2  
ATOM 3565  C CB   . LYS A 1 90  ? 0.591   -44.294 -0.008  1.00 0.00 ? 90  LYS A CB   2  
ATOM 3566  C CG   . LYS A 1 90  ? 1.575   -44.451 -1.155  1.00 0.00 ? 90  LYS A CG   2  
ATOM 3567  C CD   . LYS A 1 90  ? 2.854   -45.136 -0.702  1.00 0.00 ? 90  LYS A CD   2  
ATOM 3568  C CE   . LYS A 1 90  ? 3.990   -44.902 -1.686  1.00 0.00 ? 90  LYS A CE   2  
ATOM 3569  N NZ   . LYS A 1 90  ? 5.273   -45.479 -1.199  1.00 0.00 ? 90  LYS A NZ   2  
ATOM 3570  H H    . LYS A 1 90  ? 1.153   -42.885 2.621   1.00 0.00 ? 90  LYS A H    2  
ATOM 3571  H HA   . LYS A 1 90  ? 0.878   -42.179 -0.165  1.00 0.00 ? 90  LYS A HA   2  
ATOM 3572  H HB2  . LYS A 1 90  ? 0.860   -44.995 0.768   1.00 0.00 ? 90  LYS A HB2  2  
ATOM 3573  H HB3  . LYS A 1 90  ? -0.397  -44.537 -0.374  1.00 0.00 ? 90  LYS A HB3  2  
ATOM 3574  H HG2  . LYS A 1 90  ? 1.117   -45.045 -1.932  1.00 0.00 ? 90  LYS A HG2  2  
ATOM 3575  H HG3  . LYS A 1 90  ? 1.820   -43.473 -1.543  1.00 0.00 ? 90  LYS A HG3  2  
ATOM 3576  H HD2  . LYS A 1 90  ? 3.141   -44.744 0.262   1.00 0.00 ? 90  LYS A HD2  2  
ATOM 3577  H HD3  . LYS A 1 90  ? 2.673   -46.199 -0.621  1.00 0.00 ? 90  LYS A HD3  2  
ATOM 3578  H HE2  . LYS A 1 90  ? 3.733   -45.362 -2.628  1.00 0.00 ? 90  LYS A HE2  2  
ATOM 3579  H HE3  . LYS A 1 90  ? 4.113   -43.839 -1.827  1.00 0.00 ? 90  LYS A HE3  2  
ATOM 3580  H HZ1  . LYS A 1 90  ? 5.408   -46.433 -1.590  1.00 0.00 ? 90  LYS A HZ1  2  
ATOM 3581  H HZ2  . LYS A 1 90  ? 5.266   -45.540 -0.161  1.00 0.00 ? 90  LYS A HZ2  2  
ATOM 3582  H HZ3  . LYS A 1 90  ? 6.070   -44.879 -1.494  1.00 0.00 ? 90  LYS A HZ3  2  
ATOM 3583  N N    . PRO A 1 91  ? -1.710  -42.194 0.054   1.00 0.00 ? 91  PRO A N    2  
ATOM 3584  C CA   . PRO A 1 91  ? -3.107  -41.834 0.317   1.00 0.00 ? 91  PRO A CA   2  
ATOM 3585  C C    . PRO A 1 91  ? -3.939  -43.031 0.765   1.00 0.00 ? 91  PRO A C    2  
ATOM 3586  O O    . PRO A 1 91  ? -4.392  -43.826 -0.057  1.00 0.00 ? 91  PRO A O    2  
ATOM 3587  C CB   . PRO A 1 91  ? -3.600  -41.315 -1.036  1.00 0.00 ? 91  PRO A CB   2  
ATOM 3588  C CG   . PRO A 1 91  ? -2.724  -41.981 -2.040  1.00 0.00 ? 91  PRO A CG   2  
ATOM 3589  C CD   . PRO A 1 91  ? -1.381  -42.135 -1.380  1.00 0.00 ? 91  PRO A CD   2  
ATOM 3590  H HA   . PRO A 1 91  ? -3.181  -41.049 1.055   1.00 0.00 ? 91  PRO A HA   2  
ATOM 3591  H HB2  . PRO A 1 91  ? -4.637  -41.588 -1.172  1.00 0.00 ? 91  PRO A HB2  2  
ATOM 3592  H HB3  . PRO A 1 91  ? -3.497  -40.241 -1.073  1.00 0.00 ? 91  PRO A HB3  2  
ATOM 3593  H HG2  . PRO A 1 91  ? -3.129  -42.948 -2.296  1.00 0.00 ? 91  PRO A HG2  2  
ATOM 3594  H HG3  . PRO A 1 91  ? -2.640  -41.363 -2.921  1.00 0.00 ? 91  PRO A HG3  2  
ATOM 3595  H HD2  . PRO A 1 91  ? -0.904  -43.048 -1.705  1.00 0.00 ? 91  PRO A HD2  2  
ATOM 3596  H HD3  . PRO A 1 91  ? -0.755  -41.282 -1.596  1.00 0.00 ? 91  PRO A HD3  2  
ATOM 3597  N N    . GLY A 1 92  ? -4.138  -43.151 2.074   1.00 0.00 ? 92  GLY A N    2  
ATOM 3598  C CA   . GLY A 1 92  ? -4.917  -44.254 2.608   1.00 0.00 ? 92  GLY A CA   2  
ATOM 3599  C C    . GLY A 1 92  ? -5.683  -43.870 3.858   1.00 0.00 ? 92  GLY A C    2  
ATOM 3600  O O    . GLY A 1 92  ? -6.908  -43.979 3.901   1.00 0.00 ? 92  GLY A O    2  
ATOM 3601  H H    . GLY A 1 92  ? -3.752  -42.487 2.682   1.00 0.00 ? 92  GLY A H    2  
ATOM 3602  H HA2  . GLY A 1 92  ? -5.617  -44.583 1.855   1.00 0.00 ? 92  GLY A HA2  2  
ATOM 3603  H HA3  . GLY A 1 92  ? -4.249  -45.069 2.845   1.00 0.00 ? 92  GLY A HA3  2  
ATOM 3604  N N    . ARG A 1 93  ? -4.960  -43.422 4.879   1.00 0.00 ? 93  ARG A N    2  
ATOM 3605  C CA   . ARG A 1 93  ? -5.580  -43.024 6.137   1.00 0.00 ? 93  ARG A CA   2  
ATOM 3606  C C    . ARG A 1 93  ? -4.564  -42.346 7.053   1.00 0.00 ? 93  ARG A C    2  
ATOM 3607  O O    . ARG A 1 93  ? -4.398  -42.738 8.207   1.00 0.00 ? 93  ARG A O    2  
ATOM 3608  C CB   . ARG A 1 93  ? -6.184  -44.241 6.840   1.00 0.00 ? 93  ARG A CB   2  
ATOM 3609  C CG   . ARG A 1 93  ? -5.170  -45.330 7.152   1.00 0.00 ? 93  ARG A CG   2  
ATOM 3610  C CD   . ARG A 1 93  ? -5.247  -46.468 6.146   1.00 0.00 ? 93  ARG A CD   2  
ATOM 3611  N NE   . ARG A 1 93  ? -3.994  -47.213 6.065   1.00 0.00 ? 93  ARG A NE   2  
ATOM 3612  C CZ   . ARG A 1 93  ? -3.899  -48.439 5.561   1.00 0.00 ? 93  ARG A CZ   2  
ATOM 3613  N NH1  . ARG A 1 93  ? -4.978  -49.053 5.094   1.00 0.00 ? 93  ARG A NH1  2  
ATOM 3614  N NH2  . ARG A 1 93  ? -2.724  -49.052 5.521   1.00 0.00 ? 93  ARG A NH2  2  
ATOM 3615  H H    . ARG A 1 93  ? -3.987  -43.358 4.785   1.00 0.00 ? 93  ARG A H    2  
ATOM 3616  H HA   . ARG A 1 93  ? -6.368  -42.322 5.912   1.00 0.00 ? 93  ARG A HA   2  
ATOM 3617  H HB2  . ARG A 1 93  ? -6.631  -43.921 7.770   1.00 0.00 ? 93  ARG A HB2  2  
ATOM 3618  H HB3  . ARG A 1 93  ? -6.950  -44.663 6.208   1.00 0.00 ? 93  ARG A HB3  2  
ATOM 3619  H HG2  . ARG A 1 93  ? -4.177  -44.905 7.121   1.00 0.00 ? 93  ARG A HG2  2  
ATOM 3620  H HG3  . ARG A 1 93  ? -5.366  -45.720 8.139   1.00 0.00 ? 93  ARG A HG3  2  
ATOM 3621  H HD2  . ARG A 1 93  ? -6.037  -47.141 6.444   1.00 0.00 ? 93  ARG A HD2  2  
ATOM 3622  H HD3  . ARG A 1 93  ? -5.474  -46.056 5.174   1.00 0.00 ? 93  ARG A HD3  2  
ATOM 3623  H HE   . ARG A 1 93  ? -3.185  -46.779 6.404   1.00 0.00 ? 93  ARG A HE   2  
ATOM 3624  H HH11 . ARG A 1 93  ? -5.865  -48.592 5.122   1.00 0.00 ? 93  ARG A HH11 2  
ATOM 3625  H HH12 . ARG A 1 93  ? -4.904  -49.975 4.714   1.00 0.00 ? 93  ARG A HH12 2  
ATOM 3626  H HH21 . ARG A 1 93  ? -1.908  -48.592 5.872   1.00 0.00 ? 93  ARG A HH21 2  
ATOM 3627  H HH22 . ARG A 1 93  ? -2.653  -49.974 5.142   1.00 0.00 ? 93  ARG A HH22 2  
ATOM 3628  N N    . GLU A 1 94  ? -3.889  -41.329 6.529   1.00 0.00 ? 94  GLU A N    2  
ATOM 3629  C CA   . GLU A 1 94  ? -2.889  -40.598 7.299   1.00 0.00 ? 94  GLU A CA   2  
ATOM 3630  C C    . GLU A 1 94  ? -2.625  -39.226 6.685   1.00 0.00 ? 94  GLU A C    2  
ATOM 3631  O O    . GLU A 1 94  ? -2.028  -39.117 5.613   1.00 0.00 ? 94  GLU A O    2  
ATOM 3632  C CB   . GLU A 1 94  ? -1.586  -41.396 7.372   1.00 0.00 ? 94  GLU A CB   2  
ATOM 3633  C CG   . GLU A 1 94  ? -0.855  -41.249 8.696   1.00 0.00 ? 94  GLU A CG   2  
ATOM 3634  C CD   . GLU A 1 94  ? 0.652   -41.292 8.538   1.00 0.00 ? 94  GLU A CD   2  
ATOM 3635  O OE1  . GLU A 1 94  ? 1.239   -40.257 8.158   1.00 0.00 ? 94  GLU A OE1  2  
ATOM 3636  O OE2  . GLU A 1 94  ? 1.245   -42.360 8.796   1.00 0.00 ? 94  GLU A OE2  2  
ATOM 3637  H H    . GLU A 1 94  ? -4.067  -41.063 5.602   1.00 0.00 ? 94  GLU A H    2  
ATOM 3638  H HA   . GLU A 1 94  ? -3.274  -40.463 8.298   1.00 0.00 ? 94  GLU A HA   2  
ATOM 3639  H HB2  . GLU A 1 94  ? -1.809  -42.442 7.221   1.00 0.00 ? 94  GLU A HB2  2  
ATOM 3640  H HB3  . GLU A 1 94  ? -0.929  -41.061 6.583   1.00 0.00 ? 94  GLU A HB3  2  
ATOM 3641  H HG2  . GLU A 1 94  ? -1.129  -40.304 9.140   1.00 0.00 ? 94  GLU A HG2  2  
ATOM 3642  H HG3  . GLU A 1 94  ? -1.157  -42.054 9.350   1.00 0.00 ? 94  GLU A HG3  2  
ATOM 3643  N N    . LYS A 1 95  ? -3.074  -38.181 7.371   1.00 0.00 ? 95  LYS A N    2  
ATOM 3644  C CA   . LYS A 1 95  ? -2.886  -36.815 6.896   1.00 0.00 ? 95  LYS A CA   2  
ATOM 3645  C C    . LYS A 1 95  ? -1.520  -36.278 7.310   1.00 0.00 ? 95  LYS A C    2  
ATOM 3646  O O    . LYS A 1 95  ? -0.929  -36.742 8.285   1.00 0.00 ? 95  LYS A O    2  
ATOM 3647  C CB   . LYS A 1 95  ? -3.990  -35.907 7.442   1.00 0.00 ? 95  LYS A CB   2  
ATOM 3648  C CG   . LYS A 1 95  ? -4.301  -34.721 6.546   1.00 0.00 ? 95  LYS A CG   2  
ATOM 3649  C CD   . LYS A 1 95  ? -5.207  -35.116 5.392   1.00 0.00 ? 95  LYS A CD   2  
ATOM 3650  C CE   . LYS A 1 95  ? -5.706  -33.896 4.632   1.00 0.00 ? 95  LYS A CE   2  
ATOM 3651  N NZ   . LYS A 1 95  ? -6.879  -34.219 3.774   1.00 0.00 ? 95  LYS A NZ   2  
ATOM 3652  H H    . LYS A 1 95  ? -3.542  -38.332 8.219   1.00 0.00 ? 95  LYS A H    2  
ATOM 3653  H HA   . LYS A 1 95  ? -2.943  -36.828 5.818   1.00 0.00 ? 95  LYS A HA   2  
ATOM 3654  H HB2  . LYS A 1 95  ? -4.893  -36.489 7.560   1.00 0.00 ? 95  LYS A HB2  2  
ATOM 3655  H HB3  . LYS A 1 95  ? -3.686  -35.532 8.408   1.00 0.00 ? 95  LYS A HB3  2  
ATOM 3656  H HG2  . LYS A 1 95  ? -4.793  -33.958 7.131   1.00 0.00 ? 95  LYS A HG2  2  
ATOM 3657  H HG3  . LYS A 1 95  ? -3.375  -34.330 6.147   1.00 0.00 ? 95  LYS A HG3  2  
ATOM 3658  H HD2  . LYS A 1 95  ? -4.655  -35.748 4.712   1.00 0.00 ? 95  LYS A HD2  2  
ATOM 3659  H HD3  . LYS A 1 95  ? -6.056  -35.659 5.782   1.00 0.00 ? 95  LYS A HD3  2  
ATOM 3660  H HE2  . LYS A 1 95  ? -5.989  -33.136 5.344   1.00 0.00 ? 95  LYS A HE2  2  
ATOM 3661  H HE3  . LYS A 1 95  ? -4.906  -33.525 4.009   1.00 0.00 ? 95  LYS A HE3  2  
ATOM 3662  H HZ1  . LYS A 1 95  ? -7.440  -34.981 4.208   1.00 0.00 ? 95  LYS A HZ1  2  
ATOM 3663  H HZ2  . LYS A 1 95  ? -6.561  -34.530 2.835   1.00 0.00 ? 95  LYS A HZ2  2  
ATOM 3664  H HZ3  . LYS A 1 95  ? -7.483  -33.379 3.663   1.00 0.00 ? 95  LYS A HZ3  2  
ATOM 3665  N N    . VAL A 1 96  ? -1.024  -35.296 6.563   1.00 0.00 ? 96  VAL A N    2  
ATOM 3666  C CA   . VAL A 1 96  ? 0.271   -34.694 6.855   1.00 0.00 ? 96  VAL A CA   2  
ATOM 3667  C C    . VAL A 1 96  ? 0.250   -33.192 6.595   1.00 0.00 ? 96  VAL A C    2  
ATOM 3668  O O    . VAL A 1 96  ? -0.473  -32.712 5.723   1.00 0.00 ? 96  VAL A O    2  
ATOM 3669  C CB   . VAL A 1 96  ? 1.390   -35.333 6.011   1.00 0.00 ? 96  VAL A CB   2  
ATOM 3670  C CG1  . VAL A 1 96  ? 2.752   -34.817 6.451   1.00 0.00 ? 96  VAL A CG1  2  
ATOM 3671  C CG2  . VAL A 1 96  ? 1.330   -36.850 6.109   1.00 0.00 ? 96  VAL A CG2  2  
ATOM 3672  H H    . VAL A 1 96  ? -1.542  -34.969 5.799   1.00 0.00 ? 96  VAL A H    2  
ATOM 3673  H HA   . VAL A 1 96  ? 0.493   -34.866 7.898   1.00 0.00 ? 96  VAL A HA   2  
ATOM 3674  H HB   . VAL A 1 96  ? 1.240   -35.054 4.979   1.00 0.00 ? 96  VAL A HB   2  
ATOM 3675  H HG11 . VAL A 1 96  ? 2.821   -34.856 7.528   1.00 0.00 ? 96  VAL A HG11 2  
ATOM 3676  H HG12 . VAL A 1 96  ? 3.527   -35.430 6.016   1.00 0.00 ? 96  VAL A HG12 2  
ATOM 3677  H HG13 . VAL A 1 96  ? 2.873   -33.795 6.121   1.00 0.00 ? 96  VAL A HG13 2  
ATOM 3678  H HG21 . VAL A 1 96  ? 0.473   -37.211 5.559   1.00 0.00 ? 96  VAL A HG21 2  
ATOM 3679  H HG22 . VAL A 1 96  ? 2.231   -37.275 5.691   1.00 0.00 ? 96  VAL A HG22 2  
ATOM 3680  H HG23 . VAL A 1 96  ? 1.242   -37.142 7.145   1.00 0.00 ? 96  VAL A HG23 2  
ATOM 3681  N N    . GLY A 1 97  ? 1.048   -32.453 7.359   1.00 0.00 ? 97  GLY A N    2  
ATOM 3682  C CA   . GLY A 1 97  ? 1.106   -31.012 7.196   1.00 0.00 ? 97  GLY A CA   2  
ATOM 3683  C C    . GLY A 1 97  ? 0.141   -30.285 8.112   1.00 0.00 ? 97  GLY A C    2  
ATOM 3684  O O    . GLY A 1 97  ? -0.272  -29.162 7.824   1.00 0.00 ? 97  GLY A O    2  
ATOM 3685  H H    . GLY A 1 97  ? 1.603   -32.890 8.039   1.00 0.00 ? 97  GLY A H    2  
ATOM 3686  H HA2  . GLY A 1 97  ? 2.110   -30.676 7.409   1.00 0.00 ? 97  GLY A HA2  2  
ATOM 3687  H HA3  . GLY A 1 97  ? 0.865   -30.767 6.172   1.00 0.00 ? 97  GLY A HA3  2  
ATOM 3688  N N    . ARG A 1 98  ? -0.220  -30.928 9.218   1.00 0.00 ? 98  ARG A N    2  
ATOM 3689  C CA   . ARG A 1 98  ? -1.144  -30.337 10.178  1.00 0.00 ? 98  ARG A CA   2  
ATOM 3690  C C    . ARG A 1 98  ? -0.470  -30.140 11.532  1.00 0.00 ? 98  ARG A C    2  
ATOM 3691  O O    . ARG A 1 98  ? -0.010  -31.098 12.153  1.00 0.00 ? 98  ARG A O    2  
ATOM 3692  C CB   . ARG A 1 98  ? -2.382  -31.222 10.337  1.00 0.00 ? 98  ARG A CB   2  
ATOM 3693  C CG   . ARG A 1 98  ? -3.608  -30.690 9.614   1.00 0.00 ? 98  ARG A CG   2  
ATOM 3694  C CD   . ARG A 1 98  ? -4.797  -31.626 9.768   1.00 0.00 ? 98  ARG A CD   2  
ATOM 3695  N NE   . ARG A 1 98  ? -5.718  -31.532 8.639   1.00 0.00 ? 98  ARG A NE   2  
ATOM 3696  C CZ   . ARG A 1 98  ? -6.776  -32.321 8.487   1.00 0.00 ? 98  ARG A CZ   2  
ATOM 3697  N NH1  . ARG A 1 98  ? -7.046  -33.256 9.387   1.00 0.00 ? 98  ARG A NH1  2  
ATOM 3698  N NH2  . ARG A 1 98  ? -7.568  -32.174 7.432   1.00 0.00 ? 98  ARG A NH2  2  
ATOM 3699  H H    . ARG A 1 98  ? 0.144   -31.821 9.393   1.00 0.00 ? 98  ARG A H    2  
ATOM 3700  H HA   . ARG A 1 98  ? -1.448  -29.374 9.796   1.00 0.00 ? 98  ARG A HA   2  
ATOM 3701  H HB2  . ARG A 1 98  ? -2.160  -32.205 9.948   1.00 0.00 ? 98  ARG A HB2  2  
ATOM 3702  H HB3  . ARG A 1 98  ? -2.618  -31.304 11.387  1.00 0.00 ? 98  ARG A HB3  2  
ATOM 3703  H HG2  . ARG A 1 98  ? -3.868  -29.726 10.026  1.00 0.00 ? 98  ARG A HG2  2  
ATOM 3704  H HG3  . ARG A 1 98  ? -3.378  -30.585 8.564   1.00 0.00 ? 98  ARG A HG3  2  
ATOM 3705  H HD2  . ARG A 1 98  ? -4.432  -32.640 9.840   1.00 0.00 ? 98  ARG A HD2  2  
ATOM 3706  H HD3  . ARG A 1 98  ? -5.325  -31.369 10.674  1.00 0.00 ? 98  ARG A HD3  2  
ATOM 3707  H HE   . ARG A 1 98  ? -5.537  -30.848 7.962   1.00 0.00 ? 98  ARG A HE   2  
ATOM 3708  H HH11 . ARG A 1 98  ? -6.452  -33.368 10.183  1.00 0.00 ? 98  ARG A HH11 2  
ATOM 3709  H HH12 . ARG A 1 98  ? -7.844  -33.847 9.271   1.00 0.00 ? 98  ARG A HH12 2  
ATOM 3710  H HH21 . ARG A 1 98  ? -7.368  -31.470 6.751   1.00 0.00 ? 98  ARG A HH21 2  
ATOM 3711  H HH22 . ARG A 1 98  ? -8.364  -32.767 7.318   1.00 0.00 ? 98  ARG A HH22 2  
ATOM 3712  N N    . ILE A 1 99  ? -0.414  -28.891 11.983  1.00 0.00 ? 99  ILE A N    2  
ATOM 3713  C CA   . ILE A 1 99  ? 0.203   -28.568 13.264  1.00 0.00 ? 99  ILE A CA   2  
ATOM 3714  C C    . ILE A 1 99  ? -0.764  -27.807 14.164  1.00 0.00 ? 99  ILE A C    2  
ATOM 3715  O O    . ILE A 1 99  ? -1.583  -27.019 13.689  1.00 0.00 ? 99  ILE A O    2  
ATOM 3716  C CB   . ILE A 1 99  ? 1.482   -27.730 13.077  1.00 0.00 ? 99  ILE A CB   2  
ATOM 3717  C CG1  . ILE A 1 99  ? 1.147   -26.390 12.419  1.00 0.00 ? 99  ILE A CG1  2  
ATOM 3718  C CG2  . ILE A 1 99  ? 2.500   -28.495 12.244  1.00 0.00 ? 99  ILE A CG2  2  
ATOM 3719  C CD1  . ILE A 1 99  ? 1.386   -25.198 13.319  1.00 0.00 ? 99  ILE A CD1  2  
ATOM 3720  H H    . ILE A 1 99  ? -0.799  -28.170 11.443  1.00 0.00 ? 99  ILE A H    2  
ATOM 3721  H HA   . ILE A 1 99  ? 0.473   -29.497 13.746  1.00 0.00 ? 99  ILE A HA   2  
ATOM 3722  H HB   . ILE A 1 99  ? 1.911   -27.548 14.050  1.00 0.00 ? 99  ILE A HB   2  
ATOM 3723  H HG12 . ILE A 1 99  ? 1.756   -26.266 11.537  1.00 0.00 ? 99  ILE A HG12 2  
ATOM 3724  H HG13 . ILE A 1 99  ? 0.105   -26.388 12.134  1.00 0.00 ? 99  ILE A HG13 2  
ATOM 3725  H HG21 . ILE A 1 99  ? 2.090   -28.691 11.264  1.00 0.00 ? 99  ILE A HG21 2  
ATOM 3726  H HG22 . ILE A 1 99  ? 3.399   -27.906 12.146  1.00 0.00 ? 99  ILE A HG22 2  
ATOM 3727  H HG23 . ILE A 1 99  ? 2.732   -29.431 12.730  1.00 0.00 ? 99  ILE A HG23 2  
ATOM 3728  H HD11 . ILE A 1 99  ? 0.445   -24.715 13.536  1.00 0.00 ? 99  ILE A HD11 2  
ATOM 3729  H HD12 . ILE A 1 99  ? 1.843   -25.528 14.240  1.00 0.00 ? 99  ILE A HD12 2  
ATOM 3730  H HD13 . ILE A 1 99  ? 2.043   -24.498 12.822  1.00 0.00 ? 99  ILE A HD13 2  
ATOM 3731  N N    . THR A 1 100 ? -0.662  -28.045 15.468  1.00 0.00 ? 100 THR A N    2  
ATOM 3732  C CA   . THR A 1 100 ? -1.526  -27.382 16.436  1.00 0.00 ? 100 THR A CA   2  
ATOM 3733  C C    . THR A 1 100 ? -1.012  -25.985 16.765  1.00 0.00 ? 100 THR A C    2  
ATOM 3734  O O    . THR A 1 100 ? 0.036   -25.567 16.273  1.00 0.00 ? 100 THR A O    2  
ATOM 3735  C CB   . THR A 1 100 ? -1.639  -28.195 17.739  1.00 0.00 ? 100 THR A CB   2  
ATOM 3736  O OG1  . THR A 1 100 ? -0.388  -28.827 18.032  1.00 0.00 ? 100 THR A OG1  2  
ATOM 3737  C CG2  . THR A 1 100 ? -2.731  -29.249 17.626  1.00 0.00 ? 100 THR A CG2  2  
ATOM 3738  H H    . THR A 1 100 ? 0.011   -28.683 15.785  1.00 0.00 ? 100 THR A H    2  
ATOM 3739  H HA   . THR A 1 100 ? -2.512  -27.299 16.001  1.00 0.00 ? 100 THR A HA   2  
ATOM 3740  H HB   . THR A 1 100 ? -1.892  -27.522 18.545  1.00 0.00 ? 100 THR A HB   2  
ATOM 3741  H HG1  . THR A 1 100 ? -0.439  -29.257 18.889  1.00 0.00 ? 100 THR A HG1  2  
ATOM 3742  H HG21 . THR A 1 100 ? -3.688  -28.801 17.847  1.00 0.00 ? 100 THR A HG21 2  
ATOM 3743  H HG22 . THR A 1 100 ? -2.535  -30.046 18.327  1.00 0.00 ? 100 THR A HG22 2  
ATOM 3744  H HG23 . THR A 1 100 ? -2.744  -29.647 16.622  1.00 0.00 ? 100 THR A HG23 2  
ATOM 3745  N N    . TRP A 1 101 ? -1.755  -25.268 17.601  1.00 0.00 ? 101 TRP A N    2  
ATOM 3746  C CA   . TRP A 1 101 ? -1.373  -23.918 17.997  1.00 0.00 ? 101 TRP A CA   2  
ATOM 3747  C C    . TRP A 1 101 ? -0.232  -23.949 19.008  1.00 0.00 ? 101 TRP A C    2  
ATOM 3748  O O    . TRP A 1 101 ? 0.309   -22.907 19.378  1.00 0.00 ? 101 TRP A O    2  
ATOM 3749  C CB   . TRP A 1 101 ? -2.574  -23.178 18.587  1.00 0.00 ? 101 TRP A CB   2  
ATOM 3750  C CG   . TRP A 1 101 ? -2.295  -21.737 18.889  1.00 0.00 ? 101 TRP A CG   2  
ATOM 3751  C CD1  . TRP A 1 101 ? -2.153  -21.170 20.123  1.00 0.00 ? 101 TRP A CD1  2  
ATOM 3752  C CD2  . TRP A 1 101 ? -2.126  -20.680 17.938  1.00 0.00 ? 101 TRP A CD2  2  
ATOM 3753  N NE1  . TRP A 1 101 ? -1.906  -19.824 19.997  1.00 0.00 ? 101 TRP A NE1  2  
ATOM 3754  C CE2  . TRP A 1 101 ? -1.884  -19.499 18.666  1.00 0.00 ? 101 TRP A CE2  2  
ATOM 3755  C CE3  . TRP A 1 101 ? -2.154  -20.616 16.542  1.00 0.00 ? 101 TRP A CE3  2  
ATOM 3756  C CZ2  . TRP A 1 101 ? -1.672  -18.271 18.044  1.00 0.00 ? 101 TRP A CZ2  2  
ATOM 3757  C CZ3  . TRP A 1 101 ? -1.944  -19.397 15.926  1.00 0.00 ? 101 TRP A CZ3  2  
ATOM 3758  C CH2  . TRP A 1 101 ? -1.705  -18.238 16.677  1.00 0.00 ? 101 TRP A CH2  2  
ATOM 3759  H H    . TRP A 1 101 ? -2.580  -25.656 17.961  1.00 0.00 ? 101 TRP A H    2  
ATOM 3760  H HA   . TRP A 1 101 ? -1.040  -23.396 17.112  1.00 0.00 ? 101 TRP A HA   2  
ATOM 3761  H HB2  . TRP A 1 101 ? -3.395  -23.219 17.887  1.00 0.00 ? 101 TRP A HB2  2  
ATOM 3762  H HB3  . TRP A 1 101 ? -2.867  -23.661 19.508  1.00 0.00 ? 101 TRP A HB3  2  
ATOM 3763  H HD1  . TRP A 1 101 ? -2.229  -21.712 21.053  1.00 0.00 ? 101 TRP A HD1  2  
ATOM 3764  H HE1  . TRP A 1 101 ? -1.767  -19.199 20.739  1.00 0.00 ? 101 TRP A HE1  2  
ATOM 3765  H HE3  . TRP A 1 101 ? -2.336  -21.498 15.946  1.00 0.00 ? 101 TRP A HE3  2  
ATOM 3766  H HZ2  . TRP A 1 101 ? -1.486  -17.369 18.609  1.00 0.00 ? 101 TRP A HZ2  2  
ATOM 3767  H HZ3  . TRP A 1 101 ? -1.962  -19.328 14.849  1.00 0.00 ? 101 TRP A HZ3  2  
ATOM 3768  H HH2  . TRP A 1 101 ? -1.546  -17.307 16.154  1.00 0.00 ? 101 TRP A HH2  2  
ATOM 3769  N N    . GLU A 1 102 ? 0.129   -25.150 19.450  1.00 0.00 ? 102 GLU A N    2  
ATOM 3770  C CA   . GLU A 1 102 ? 1.205   -25.314 20.419  1.00 0.00 ? 102 GLU A CA   2  
ATOM 3771  C C    . GLU A 1 102 ? 2.561   -25.373 19.722  1.00 0.00 ? 102 GLU A C    2  
ATOM 3772  O O    . GLU A 1 102 ? 3.582   -24.997 20.296  1.00 0.00 ? 102 GLU A O    2  
ATOM 3773  C CB   . GLU A 1 102 ? 0.989   -26.584 21.245  1.00 0.00 ? 102 GLU A CB   2  
ATOM 3774  C CG   . GLU A 1 102 ? 2.272   -27.169 21.811  1.00 0.00 ? 102 GLU A CG   2  
ATOM 3775  C CD   . GLU A 1 102 ? 2.021   -28.347 22.732  1.00 0.00 ? 102 GLU A CD   2  
ATOM 3776  O OE1  . GLU A 1 102 ? 0.875   -28.843 22.759  1.00 0.00 ? 102 GLU A OE1  2  
ATOM 3777  O OE2  . GLU A 1 102 ? 2.968   -28.772 23.425  1.00 0.00 ? 102 GLU A OE2  2  
ATOM 3778  H H    . GLU A 1 102 ? -0.341  -25.943 19.117  1.00 0.00 ? 102 GLU A H    2  
ATOM 3779  H HA   . GLU A 1 102 ? 1.191   -24.460 21.080  1.00 0.00 ? 102 GLU A HA   2  
ATOM 3780  H HB2  . GLU A 1 102 ? 0.327   -26.356 22.067  1.00 0.00 ? 102 GLU A HB2  2  
ATOM 3781  H HB3  . GLU A 1 102 ? 0.524   -27.331 20.618  1.00 0.00 ? 102 GLU A HB3  2  
ATOM 3782  H HG2  . GLU A 1 102 ? 2.895   -27.498 20.992  1.00 0.00 ? 102 GLU A HG2  2  
ATOM 3783  H HG3  . GLU A 1 102 ? 2.788   -26.400 22.367  1.00 0.00 ? 102 GLU A HG3  2  
ATOM 3784  N N    . GLN A 1 103 ? 2.561   -25.847 18.480  1.00 0.00 ? 103 GLN A N    2  
ATOM 3785  C CA   . GLN A 1 103 ? 3.791   -25.957 17.705  1.00 0.00 ? 103 GLN A CA   2  
ATOM 3786  C C    . GLN A 1 103 ? 4.224   -24.593 17.175  1.00 0.00 ? 103 GLN A C    2  
ATOM 3787  O O    . GLN A 1 103 ? 5.404   -24.365 16.909  1.00 0.00 ? 103 GLN A O    2  
ATOM 3788  C CB   . GLN A 1 103 ? 3.601   -26.932 16.541  1.00 0.00 ? 103 GLN A CB   2  
ATOM 3789  C CG   . GLN A 1 103 ? 2.874   -28.209 16.931  1.00 0.00 ? 103 GLN A CG   2  
ATOM 3790  C CD   . GLN A 1 103 ? 3.550   -28.940 18.074  1.00 0.00 ? 103 GLN A CD   2  
ATOM 3791  O OE1  . GLN A 1 103 ? 2.893   -29.390 19.013  1.00 0.00 ? 103 GLN A OE1  2  
ATOM 3792  N NE2  . GLN A 1 103 ? 4.870   -29.062 18.001  1.00 0.00 ? 103 GLN A NE2  2  
ATOM 3793  H H    . GLN A 1 103 ? 1.715   -26.131 18.077  1.00 0.00 ? 103 GLN A H    2  
ATOM 3794  H HA   . GLN A 1 103 ? 4.562   -26.336 18.358  1.00 0.00 ? 103 GLN A HA   2  
ATOM 3795  H HB2  . GLN A 1 103 ? 3.032   -26.441 15.766  1.00 0.00 ? 103 GLN A HB2  2  
ATOM 3796  H HB3  . GLN A 1 103 ? 4.571   -27.201 16.150  1.00 0.00 ? 103 GLN A HB3  2  
ATOM 3797  H HG2  . GLN A 1 103 ? 1.867   -27.958 17.230  1.00 0.00 ? 103 GLN A HG2  2  
ATOM 3798  H HG3  . GLN A 1 103 ? 2.840   -28.864 16.073  1.00 0.00 ? 103 GLN A HG3  2  
ATOM 3799  H HE21 . GLN A 1 103 ? 5.327   -28.677 17.223  1.00 0.00 ? 103 GLN A HE21 2  
ATOM 3800  H HE22 . GLN A 1 103 ? 5.333   -29.529 18.726  1.00 0.00 ? 103 GLN A HE22 2  
ATOM 3801  N N    . VAL A 1 104 ? 3.260   -23.690 17.024  1.00 0.00 ? 104 VAL A N    2  
ATOM 3802  C CA   . VAL A 1 104 ? 3.541   -22.348 16.527  1.00 0.00 ? 104 VAL A CA   2  
ATOM 3803  C C    . VAL A 1 104 ? 4.198   -21.490 17.602  1.00 0.00 ? 104 VAL A C    2  
ATOM 3804  O O    . VAL A 1 104 ? 5.285   -20.948 17.402  1.00 0.00 ? 104 VAL A O    2  
ATOM 3805  C CB   . VAL A 1 104 ? 2.258   -21.650 16.040  1.00 0.00 ? 104 VAL A CB   2  
ATOM 3806  C CG1  . VAL A 1 104 ? 2.554   -20.216 15.628  1.00 0.00 ? 104 VAL A CG1  2  
ATOM 3807  C CG2  . VAL A 1 104 ? 1.633   -22.425 14.890  1.00 0.00 ? 104 VAL A CG2  2  
ATOM 3808  H H    . VAL A 1 104 ? 2.338   -23.931 17.253  1.00 0.00 ? 104 VAL A H    2  
ATOM 3809  H HA   . VAL A 1 104 ? 4.217   -22.438 15.689  1.00 0.00 ? 104 VAL A HA   2  
ATOM 3810  H HB   . VAL A 1 104 ? 1.552   -21.628 16.858  1.00 0.00 ? 104 VAL A HB   2  
ATOM 3811  H HG11 . VAL A 1 104 ? 2.913   -19.663 16.484  1.00 0.00 ? 104 VAL A HG11 2  
ATOM 3812  H HG12 . VAL A 1 104 ? 3.306   -20.211 14.853  1.00 0.00 ? 104 VAL A HG12 2  
ATOM 3813  H HG13 . VAL A 1 104 ? 1.650   -19.755 15.256  1.00 0.00 ? 104 VAL A HG13 2  
ATOM 3814  H HG21 . VAL A 1 104 ? 1.059   -23.251 15.284  1.00 0.00 ? 104 VAL A HG21 2  
ATOM 3815  H HG22 . VAL A 1 104 ? 0.983   -21.772 14.326  1.00 0.00 ? 104 VAL A HG22 2  
ATOM 3816  H HG23 . VAL A 1 104 ? 2.412   -22.803 14.245  1.00 0.00 ? 104 VAL A HG23 2  
ATOM 3817  N N    . LEU A 1 105 ? 3.530   -21.370 18.745  1.00 0.00 ? 105 LEU A N    2  
ATOM 3818  C CA   . LEU A 1 105 ? 4.048   -20.578 19.854  1.00 0.00 ? 105 LEU A CA   2  
ATOM 3819  C C    . LEU A 1 105 ? 5.462   -21.016 20.223  1.00 0.00 ? 105 LEU A C    2  
ATOM 3820  O O    . LEU A 1 105 ? 6.303   -20.193 20.582  1.00 0.00 ? 105 LEU A O    2  
ATOM 3821  C CB   . LEU A 1 105 ? 3.129   -20.705 21.071  1.00 0.00 ? 105 LEU A CB   2  
ATOM 3822  C CG   . LEU A 1 105 ? 1.953   -19.730 21.127  1.00 0.00 ? 105 LEU A CG   2  
ATOM 3823  C CD1  . LEU A 1 105 ? 1.223   -19.695 19.793  1.00 0.00 ? 105 LEU A CD1  2  
ATOM 3824  C CD2  . LEU A 1 105 ? 0.998   -20.111 22.249  1.00 0.00 ? 105 LEU A CD2  2  
ATOM 3825  H H    . LEU A 1 105 ? 2.668   -21.825 18.845  1.00 0.00 ? 105 LEU A H    2  
ATOM 3826  H HA   . LEU A 1 105 ? 4.075   -19.545 19.540  1.00 0.00 ? 105 LEU A HA   2  
ATOM 3827  H HB2  . LEU A 1 105 ? 2.729   -21.707 21.079  1.00 0.00 ? 105 LEU A HB2  2  
ATOM 3828  H HB3  . LEU A 1 105 ? 3.731   -20.551 21.956  1.00 0.00 ? 105 LEU A HB3  2  
ATOM 3829  H HG   . LEU A 1 105 ? 2.327   -18.735 21.328  1.00 0.00 ? 105 LEU A HG   2  
ATOM 3830  H HD11 . LEU A 1 105 ? 0.851   -20.681 19.561  1.00 0.00 ? 105 LEU A HD11 2  
ATOM 3831  H HD12 . LEU A 1 105 ? 1.905   -19.376 19.019  1.00 0.00 ? 105 LEU A HD12 2  
ATOM 3832  H HD13 . LEU A 1 105 ? 0.397   -19.002 19.853  1.00 0.00 ? 105 LEU A HD13 2  
ATOM 3833  H HD21 . LEU A 1 105 ? 0.133   -19.465 22.220  1.00 0.00 ? 105 LEU A HD21 2  
ATOM 3834  H HD22 . LEU A 1 105 ? 1.498   -19.999 23.201  1.00 0.00 ? 105 LEU A HD22 2  
ATOM 3835  H HD23 . LEU A 1 105 ? 0.687   -21.137 22.124  1.00 0.00 ? 105 LEU A HD23 2  
ATOM 3836  N N    . GLU A 1 106 ? 5.716   -22.318 20.129  1.00 0.00 ? 106 GLU A N    2  
ATOM 3837  C CA   . GLU A 1 106 ? 7.029   -22.864 20.452  1.00 0.00 ? 106 GLU A CA   2  
ATOM 3838  C C    . GLU A 1 106 ? 8.113   -22.219 19.593  1.00 0.00 ? 106 GLU A C    2  
ATOM 3839  O O    . GLU A 1 106 ? 9.286   -22.201 19.966  1.00 0.00 ? 106 GLU A O    2  
ATOM 3840  C CB   . GLU A 1 106 ? 7.038   -24.381 20.249  1.00 0.00 ? 106 GLU A CB   2  
ATOM 3841  C CG   . GLU A 1 106 ? 6.571   -25.161 21.466  1.00 0.00 ? 106 GLU A CG   2  
ATOM 3842  C CD   . GLU A 1 106 ? 7.723   -25.704 22.289  1.00 0.00 ? 106 GLU A CD   2  
ATOM 3843  O OE1  . GLU A 1 106 ? 8.362   -24.912 23.012  1.00 0.00 ? 106 GLU A OE1  2  
ATOM 3844  O OE2  . GLU A 1 106 ? 7.985   -26.923 22.209  1.00 0.00 ? 106 GLU A OE2  2  
ATOM 3845  H H    . GLU A 1 106 ? 5.004   -22.924 19.837  1.00 0.00 ? 106 GLU A H    2  
ATOM 3846  H HA   . GLU A 1 106 ? 7.232   -22.648 21.489  1.00 0.00 ? 106 GLU A HA   2  
ATOM 3847  H HB2  . GLU A 1 106 ? 6.391   -24.625 19.420  1.00 0.00 ? 106 GLU A HB2  2  
ATOM 3848  H HB3  . GLU A 1 106 ? 8.045   -24.694 20.012  1.00 0.00 ? 106 GLU A HB3  2  
ATOM 3849  H HG2  . GLU A 1 106 ? 5.980   -24.508 22.091  1.00 0.00 ? 106 GLU A HG2  2  
ATOM 3850  H HG3  . GLU A 1 106 ? 5.962   -25.989 21.136  1.00 0.00 ? 106 GLU A HG3  2  
ATOM 3851  N N    . ILE A 1 107 ? 7.711   -21.690 18.442  1.00 0.00 ? 107 ILE A N    2  
ATOM 3852  C CA   . ILE A 1 107 ? 8.647   -21.044 17.531  1.00 0.00 ? 107 ILE A CA   2  
ATOM 3853  C C    . ILE A 1 107 ? 8.528   -19.525 17.607  1.00 0.00 ? 107 ILE A C    2  
ATOM 3854  O O    . ILE A 1 107 ? 9.531   -18.817 17.689  1.00 0.00 ? 107 ILE A O    2  
ATOM 3855  C CB   . ILE A 1 107 ? 8.419   -21.494 16.076  1.00 0.00 ? 107 ILE A CB   2  
ATOM 3856  C CG1  . ILE A 1 107 ? 8.581   -23.010 15.957  1.00 0.00 ? 107 ILE A CG1  2  
ATOM 3857  C CG2  . ILE A 1 107 ? 9.383   -20.777 15.142  1.00 0.00 ? 107 ILE A CG2  2  
ATOM 3858  C CD1  . ILE A 1 107 ? 7.872   -23.602 14.759  1.00 0.00 ? 107 ILE A CD1  2  
ATOM 3859  H H    . ILE A 1 107 ? 6.763   -21.736 18.200  1.00 0.00 ? 107 ILE A H    2  
ATOM 3860  H HA   . ILE A 1 107 ? 9.648   -21.331 17.822  1.00 0.00 ? 107 ILE A HA   2  
ATOM 3861  H HB   . ILE A 1 107 ? 7.413   -21.223 15.793  1.00 0.00 ? 107 ILE A HB   2  
ATOM 3862  H HG12 . ILE A 1 107 ? 9.630   -23.248 15.871  1.00 0.00 ? 107 ILE A HG12 2  
ATOM 3863  H HG13 . ILE A 1 107 ? 8.182   -23.479 16.845  1.00 0.00 ? 107 ILE A HG13 2  
ATOM 3864  H HG21 . ILE A 1 107 ? 9.195   -19.714 15.178  1.00 0.00 ? 107 ILE A HG21 2  
ATOM 3865  H HG22 . ILE A 1 107 ? 10.398  -20.972 15.454  1.00 0.00 ? 107 ILE A HG22 2  
ATOM 3866  H HG23 . ILE A 1 107 ? 9.240   -21.134 14.134  1.00 0.00 ? 107 ILE A HG23 2  
ATOM 3867  H HD11 . ILE A 1 107 ? 7.984   -24.676 14.767  1.00 0.00 ? 107 ILE A HD11 2  
ATOM 3868  H HD12 . ILE A 1 107 ? 6.823   -23.348 14.800  1.00 0.00 ? 107 ILE A HD12 2  
ATOM 3869  H HD13 . ILE A 1 107 ? 8.303   -23.203 13.852  1.00 0.00 ? 107 ILE A HD13 2  
ATOM 3870  N N    . ALA A 1 108 ? 7.294   -19.032 17.580  1.00 0.00 ? 108 ALA A N    2  
ATOM 3871  C CA   . ALA A 1 108 ? 7.043   -17.598 17.649  1.00 0.00 ? 108 ALA A CA   2  
ATOM 3872  C C    . ALA A 1 108 ? 7.760   -16.972 18.841  1.00 0.00 ? 108 ALA A C    2  
ATOM 3873  O O    . ALA A 1 108 ? 8.155   -15.807 18.799  1.00 0.00 ? 108 ALA A O    2  
ATOM 3874  C CB   . ALA A 1 108 ? 5.548   -17.328 17.729  1.00 0.00 ? 108 ALA A CB   2  
ATOM 3875  H H    . ALA A 1 108 ? 6.535   -19.648 17.513  1.00 0.00 ? 108 ALA A H    2  
ATOM 3876  H HA   . ALA A 1 108 ? 7.417   -17.149 16.740  1.00 0.00 ? 108 ALA A HA   2  
ATOM 3877  H HB1  . ALA A 1 108 ? 5.261   -17.199 18.762  1.00 0.00 ? 108 ALA A HB1  2  
ATOM 3878  H HB2  . ALA A 1 108 ? 5.315   -16.430 17.175  1.00 0.00 ? 108 ALA A HB2  2  
ATOM 3879  H HB3  . ALA A 1 108 ? 5.008   -18.162 17.306  1.00 0.00 ? 108 ALA A HB3  2  
ATOM 3880  N N    . LYS A 1 109 ? 7.924   -17.753 19.903  1.00 0.00 ? 109 LYS A N    2  
ATOM 3881  C CA   . LYS A 1 109 ? 8.594   -17.276 21.107  1.00 0.00 ? 109 LYS A CA   2  
ATOM 3882  C C    . LYS A 1 109 ? 9.939   -16.642 20.767  1.00 0.00 ? 109 LYS A C    2  
ATOM 3883  O O    . LYS A 1 109 ? 10.171  -15.468 21.054  1.00 0.00 ? 109 LYS A O    2  
ATOM 3884  C CB   . LYS A 1 109 ? 8.798   -18.429 22.093  1.00 0.00 ? 109 LYS A CB   2  
ATOM 3885  C CG   . LYS A 1 109 ? 7.782   -18.450 23.222  1.00 0.00 ? 109 LYS A CG   2  
ATOM 3886  C CD   . LYS A 1 109 ? 8.175   -19.438 24.308  1.00 0.00 ? 109 LYS A CD   2  
ATOM 3887  C CE   . LYS A 1 109 ? 7.943   -18.862 25.696  1.00 0.00 ? 109 LYS A CE   2  
ATOM 3888  N NZ   . LYS A 1 109 ? 8.930   -19.380 26.684  1.00 0.00 ? 109 LYS A NZ   2  
ATOM 3889  H H    . LYS A 1 109 ? 7.587   -18.674 19.876  1.00 0.00 ? 109 LYS A H    2  
ATOM 3890  H HA   . LYS A 1 109 ? 7.963   -16.530 21.565  1.00 0.00 ? 109 LYS A HA   2  
ATOM 3891  H HB2  . LYS A 1 109 ? 8.727   -19.363 21.556  1.00 0.00 ? 109 LYS A HB2  2  
ATOM 3892  H HB3  . LYS A 1 109 ? 9.784   -18.347 22.526  1.00 0.00 ? 109 LYS A HB3  2  
ATOM 3893  H HG2  . LYS A 1 109 ? 7.717   -17.463 23.655  1.00 0.00 ? 109 LYS A HG2  2  
ATOM 3894  H HG3  . LYS A 1 109 ? 6.819   -18.734 22.822  1.00 0.00 ? 109 LYS A HG3  2  
ATOM 3895  H HD2  . LYS A 1 109 ? 7.583   -20.334 24.199  1.00 0.00 ? 109 LYS A HD2  2  
ATOM 3896  H HD3  . LYS A 1 109 ? 9.223   -19.681 24.199  1.00 0.00 ? 109 LYS A HD3  2  
ATOM 3897  H HE2  . LYS A 1 109 ? 8.029   -17.787 25.645  1.00 0.00 ? 109 LYS A HE2  2  
ATOM 3898  H HE3  . LYS A 1 109 ? 6.948   -19.128 26.020  1.00 0.00 ? 109 LYS A HE3  2  
ATOM 3899  H HZ1  . LYS A 1 109 ? 8.450   -19.975 27.390  1.00 0.00 ? 109 LYS A HZ1  2  
ATOM 3900  H HZ2  . LYS A 1 109 ? 9.395   -18.589 27.173  1.00 0.00 ? 109 LYS A HZ2  2  
ATOM 3901  H HZ3  . LYS A 1 109 ? 9.654   -19.949 26.201  1.00 0.00 ? 109 LYS A HZ3  2  
ATOM 3902  N N    . GLN A 1 110 ? 10.820  -17.426 20.153  1.00 0.00 ? 110 GLN A N    2  
ATOM 3903  C CA   . GLN A 1 110 ? 12.140  -16.938 19.773  1.00 0.00 ? 110 GLN A CA   2  
ATOM 3904  C C    . GLN A 1 110 ? 12.033  -15.832 18.729  1.00 0.00 ? 110 GLN A C    2  
ATOM 3905  O O    . GLN A 1 110 ? 12.982  -15.081 18.505  1.00 0.00 ? 110 GLN A O    2  
ATOM 3906  C CB   . GLN A 1 110 ? 12.994  -18.086 19.232  1.00 0.00 ? 110 GLN A CB   2  
ATOM 3907  C CG   . GLN A 1 110 ? 13.814  -18.792 20.300  1.00 0.00 ? 110 GLN A CG   2  
ATOM 3908  C CD   . GLN A 1 110 ? 15.048  -19.468 19.737  1.00 0.00 ? 110 GLN A CD   2  
ATOM 3909  O OE1  . GLN A 1 110 ? 16.173  -19.159 20.129  1.00 0.00 ? 110 GLN A OE1  2  
ATOM 3910  N NE2  . GLN A 1 110 ? 14.843  -20.399 18.812  1.00 0.00 ? 110 GLN A NE2  2  
ATOM 3911  H H    . GLN A 1 110 ? 10.576  -18.352 19.952  1.00 0.00 ? 110 GLN A H    2  
ATOM 3912  H HA   . GLN A 1 110 ? 12.612  -16.537 20.657  1.00 0.00 ? 110 GLN A HA   2  
ATOM 3913  H HB2  . GLN A 1 110 ? 12.345  -18.814 18.767  1.00 0.00 ? 110 GLN A HB2  2  
ATOM 3914  H HB3  . GLN A 1 110 ? 13.673  -17.694 18.489  1.00 0.00 ? 110 GLN A HB3  2  
ATOM 3915  H HG2  . GLN A 1 110 ? 14.125  -18.065 21.035  1.00 0.00 ? 110 GLN A HG2  2  
ATOM 3916  H HG3  . GLN A 1 110 ? 13.195  -19.540 20.774  1.00 0.00 ? 110 GLN A HG3  2  
ATOM 3917  H HE21 . GLN A 1 110 ? 13.919  -20.592 18.547  1.00 0.00 ? 110 GLN A HE21 2  
ATOM 3918  H HE22 . GLN A 1 110 ? 15.623  -20.851 18.430  1.00 0.00 ? 110 GLN A HE22 2  
ATOM 3919  N N    . LYS A 1 111 ? 10.871  -15.737 18.092  1.00 0.00 ? 111 LYS A N    2  
ATOM 3920  C CA   . LYS A 1 111 ? 10.638  -14.722 17.071  1.00 0.00 ? 111 LYS A CA   2  
ATOM 3921  C C    . LYS A 1 111 ? 10.064  -13.451 17.689  1.00 0.00 ? 111 LYS A C    2  
ATOM 3922  O O    . LYS A 1 111 ? 9.127   -12.859 17.155  1.00 0.00 ? 111 LYS A O    2  
ATOM 3923  C CB   . LYS A 1 111 ? 9.684   -15.257 16.000  1.00 0.00 ? 111 LYS A CB   2  
ATOM 3924  C CG   . LYS A 1 111 ? 10.369  -16.114 14.950  1.00 0.00 ? 111 LYS A CG   2  
ATOM 3925  C CD   . LYS A 1 111 ? 10.738  -15.302 13.721  1.00 0.00 ? 111 LYS A CD   2  
ATOM 3926  C CE   . LYS A 1 111 ? 12.241  -15.083 13.628  1.00 0.00 ? 111 LYS A CE   2  
ATOM 3927  N NZ   . LYS A 1 111 ? 12.573  -13.706 13.169  1.00 0.00 ? 111 LYS A NZ   2  
ATOM 3928  H H    . LYS A 1 111 ? 10.152  -16.366 18.315  1.00 0.00 ? 111 LYS A H    2  
ATOM 3929  H HA   . LYS A 1 111 ? 11.587  -14.489 16.613  1.00 0.00 ? 111 LYS A HA   2  
ATOM 3930  H HB2  . LYS A 1 111 ? 8.921   -15.851 16.479  1.00 0.00 ? 111 LYS A HB2  2  
ATOM 3931  H HB3  . LYS A 1 111 ? 9.217   -14.419 15.502  1.00 0.00 ? 111 LYS A HB3  2  
ATOM 3932  H HG2  . LYS A 1 111 ? 11.268  -16.537 15.373  1.00 0.00 ? 111 LYS A HG2  2  
ATOM 3933  H HG3  . LYS A 1 111 ? 9.699   -16.910 14.656  1.00 0.00 ? 111 LYS A HG3  2  
ATOM 3934  H HD2  . LYS A 1 111 ? 10.408  -15.829 12.838  1.00 0.00 ? 111 LYS A HD2  2  
ATOM 3935  H HD3  . LYS A 1 111 ? 10.246  -14.341 13.773  1.00 0.00 ? 111 LYS A HD3  2  
ATOM 3936  H HE2  . LYS A 1 111 ? 12.675  -15.242 14.603  1.00 0.00 ? 111 LYS A HE2  2  
ATOM 3937  H HE3  . LYS A 1 111 ? 12.653  -15.796 12.930  1.00 0.00 ? 111 LYS A HE3  2  
ATOM 3938  H HZ1  . LYS A 1 111 ? 11.999  -13.459 12.337  1.00 0.00 ? 111 LYS A HZ1  2  
ATOM 3939  H HZ2  . LYS A 1 111 ? 13.579  -13.649 12.910  1.00 0.00 ? 111 LYS A HZ2  2  
ATOM 3940  H HZ3  . LYS A 1 111 ? 12.381  -13.020 13.926  1.00 0.00 ? 111 LYS A HZ3  2  
ATOM 3941  N N    . MET A 1 112 ? 10.634  -13.037 18.816  1.00 0.00 ? 112 MET A N    2  
ATOM 3942  C CA   . MET A 1 112 ? 10.181  -11.834 19.505  1.00 0.00 ? 112 MET A CA   2  
ATOM 3943  C C    . MET A 1 112 ? 11.347  -10.887 19.769  1.00 0.00 ? 112 MET A C    2  
ATOM 3944  O O    . MET A 1 112 ? 11.414  -10.221 20.802  1.00 0.00 ? 112 MET A O    2  
ATOM 3945  C CB   . MET A 1 112 ? 9.498   -12.202 20.823  1.00 0.00 ? 112 MET A CB   2  
ATOM 3946  C CG   . MET A 1 112 ? 8.250   -13.052 20.645  1.00 0.00 ? 112 MET A CG   2  
ATOM 3947  S SD   . MET A 1 112 ? 6.739   -12.167 21.075  1.00 0.00 ? 112 MET A SD   2  
ATOM 3948  C CE   . MET A 1 112 ? 6.355   -12.904 22.661  1.00 0.00 ? 112 MET A CE   2  
ATOM 3949  H H    . MET A 1 112 ? 11.378  -13.552 19.194  1.00 0.00 ? 112 MET A H    2  
ATOM 3950  H HA   . MET A 1 112 ? 9.466   -11.337 18.866  1.00 0.00 ? 112 MET A HA   2  
ATOM 3951  H HB2  . MET A 1 112 ? 10.197  -12.751 21.436  1.00 0.00 ? 112 MET A HB2  2  
ATOM 3952  H HB3  . MET A 1 112 ? 9.218   -11.294 21.336  1.00 0.00 ? 112 MET A HB3  2  
ATOM 3953  H HG2  . MET A 1 112 ? 8.187   -13.363 19.613  1.00 0.00 ? 112 MET A HG2  2  
ATOM 3954  H HG3  . MET A 1 112 ? 8.333   -13.924 21.277  1.00 0.00 ? 112 MET A HG3  2  
ATOM 3955  H HE1  . MET A 1 112 ? 5.349   -12.635 22.949  1.00 0.00 ? 112 MET A HE1  2  
ATOM 3956  H HE2  . MET A 1 112 ? 6.433   -13.978 22.587  1.00 0.00 ? 112 MET A HE2  2  
ATOM 3957  H HE3  . MET A 1 112 ? 7.051   -12.542 23.404  1.00 0.00 ? 112 MET A HE3  2  
ATOM 3958  N N    . PRO A 1 113 ? 12.287  -10.824 18.815  1.00 0.00 ? 113 PRO A N    2  
ATOM 3959  C CA   . PRO A 1 113 ? 13.468  -9.961  18.923  1.00 0.00 ? 113 PRO A CA   2  
ATOM 3960  C C    . PRO A 1 113 ? 13.116  -8.481  18.811  1.00 0.00 ? 113 PRO A C    2  
ATOM 3961  O O    . PRO A 1 113 ? 13.543  -7.668  19.631  1.00 0.00 ? 113 PRO A O    2  
ATOM 3962  C CB   . PRO A 1 113 ? 14.334  -10.396 17.739  1.00 0.00 ? 113 PRO A CB   2  
ATOM 3963  C CG   . PRO A 1 113 ? 13.371  -10.958 16.751  1.00 0.00 ? 113 PRO A CG   2  
ATOM 3964  C CD   . PRO A 1 113 ? 12.272  -11.590 17.558  1.00 0.00 ? 113 PRO A CD   2  
ATOM 3965  H HA   . PRO A 1 113 ? 14.003  -10.134 19.845  1.00 0.00 ? 113 PRO A HA   2  
ATOM 3966  H HB2  . PRO A 1 113 ? 14.858  -9.539  17.339  1.00 0.00 ? 113 PRO A HB2  2  
ATOM 3967  H HB3  . PRO A 1 113 ? 15.046  -11.140 18.063  1.00 0.00 ? 113 PRO A HB3  2  
ATOM 3968  H HG2  . PRO A 1 113 ? 12.976  -10.166 16.133  1.00 0.00 ? 113 PRO A HG2  2  
ATOM 3969  H HG3  . PRO A 1 113 ? 13.863  -11.701 16.141  1.00 0.00 ? 113 PRO A HG3  2  
ATOM 3970  H HD2  . PRO A 1 113 ? 11.323  -11.482 17.053  1.00 0.00 ? 113 PRO A HD2  2  
ATOM 3971  H HD3  . PRO A 1 113 ? 12.488  -12.632 17.739  1.00 0.00 ? 113 PRO A HD3  2  
ATOM 3972  N N    . ASP A 1 114 ? 12.335  -8.139  17.792  1.00 0.00 ? 114 ASP A N    2  
ATOM 3973  C CA   . ASP A 1 114 ? 11.925  -6.757  17.574  1.00 0.00 ? 114 ASP A CA   2  
ATOM 3974  C C    . ASP A 1 114 ? 10.458  -6.561  17.946  1.00 0.00 ? 114 ASP A C    2  
ATOM 3975  O O    . ASP A 1 114 ? 9.977   -5.431  18.043  1.00 0.00 ? 114 ASP A O    2  
ATOM 3976  C CB   . ASP A 1 114 ? 12.152  -6.359  16.115  1.00 0.00 ? 114 ASP A CB   2  
ATOM 3977  C CG   . ASP A 1 114 ? 11.978  -7.527  15.163  1.00 0.00 ? 114 ASP A CG   2  
ATOM 3978  O OD1  . ASP A 1 114 ? 10.904  -8.163  15.195  1.00 0.00 ? 114 ASP A OD1  2  
ATOM 3979  O OD2  . ASP A 1 114 ? 12.915  -7.803  14.386  1.00 0.00 ? 114 ASP A OD2  2  
ATOM 3980  H H    . ASP A 1 114 ? 12.026  -8.833  17.173  1.00 0.00 ? 114 ASP A H    2  
ATOM 3981  H HA   . ASP A 1 114 ? 12.531  -6.127  18.208  1.00 0.00 ? 114 ASP A HA   2  
ATOM 3982  H HB2  . ASP A 1 114 ? 11.444  -5.590  15.844  1.00 0.00 ? 114 ASP A HB2  2  
ATOM 3983  H HB3  . ASP A 1 114 ? 13.155  -5.975  16.006  1.00 0.00 ? 114 ASP A HB3  2  
ATOM 3984  N N    . LEU A 1 115 ? 9.752   -7.667  18.152  1.00 0.00 ? 115 LEU A N    2  
ATOM 3985  C CA   . LEU A 1 115 ? 8.339   -7.617  18.512  1.00 0.00 ? 115 LEU A CA   2  
ATOM 3986  C C    . LEU A 1 115 ? 8.122   -6.743  19.743  1.00 0.00 ? 115 LEU A C    2  
ATOM 3987  O O    . LEU A 1 115 ? 7.095   -6.077  19.869  1.00 0.00 ? 115 LEU A O    2  
ATOM 3988  C CB   . LEU A 1 115 ? 7.809   -9.028  18.774  1.00 0.00 ? 115 LEU A CB   2  
ATOM 3989  C CG   . LEU A 1 115 ? 7.379   -9.823  17.541  1.00 0.00 ? 115 LEU A CG   2  
ATOM 3990  C CD1  . LEU A 1 115 ? 6.272   -9.095  16.796  1.00 0.00 ? 115 LEU A CD1  2  
ATOM 3991  C CD2  . LEU A 1 115 ? 8.569   -10.070 16.624  1.00 0.00 ? 115 LEU A CD2  2  
ATOM 3992  H H    . LEU A 1 115 ? 10.190  -8.538  18.060  1.00 0.00 ? 115 LEU A H    2  
ATOM 3993  H HA   . LEU A 1 115 ? 7.801   -7.188  17.680  1.00 0.00 ? 115 LEU A HA   2  
ATOM 3994  H HB2  . LEU A 1 115 ? 8.587   -9.586  19.273  1.00 0.00 ? 115 LEU A HB2  2  
ATOM 3995  H HB3  . LEU A 1 115 ? 6.954   -8.942  19.429  1.00 0.00 ? 115 LEU A HB3  2  
ATOM 3996  H HG   . LEU A 1 115 ? 6.994   -10.783 17.856  1.00 0.00 ? 115 LEU A HG   2  
ATOM 3997  H HD11 . LEU A 1 115 ? 5.571   -8.683  17.506  1.00 0.00 ? 115 LEU A HD11 2  
ATOM 3998  H HD12 . LEU A 1 115 ? 5.759   -9.789  16.146  1.00 0.00 ? 115 LEU A HD12 2  
ATOM 3999  H HD13 . LEU A 1 115 ? 6.699   -8.298  16.205  1.00 0.00 ? 115 LEU A HD13 2  
ATOM 4000  H HD21 . LEU A 1 115 ? 8.398   -10.967 16.048  1.00 0.00 ? 115 LEU A HD21 2  
ATOM 4001  H HD22 . LEU A 1 115 ? 9.463   -10.189 17.219  1.00 0.00 ? 115 LEU A HD22 2  
ATOM 4002  H HD23 . LEU A 1 115 ? 8.689   -9.230  15.957  1.00 0.00 ? 115 LEU A HD23 2  
ATOM 4003  N N    . ASN A 1 116 ? 9.096   -6.748  20.646  1.00 0.00 ? 116 ASN A N    2  
ATOM 4004  C CA   . ASN A 1 116 ? 9.012   -5.954  21.867  1.00 0.00 ? 116 ASN A CA   2  
ATOM 4005  C C    . ASN A 1 116 ? 7.690   -6.204  22.587  1.00 0.00 ? 116 ASN A C    2  
ATOM 4006  O O    . ASN A 1 116 ? 7.156   -5.316  23.253  1.00 0.00 ? 116 ASN A O    2  
ATOM 4007  C CB   . ASN A 1 116 ? 9.156   -4.466  21.542  1.00 0.00 ? 116 ASN A CB   2  
ATOM 4008  C CG   . ASN A 1 116 ? 9.966   -3.723  22.587  1.00 0.00 ? 116 ASN A CG   2  
ATOM 4009  O OD1  . ASN A 1 116 ? 10.866  -4.288  23.209  1.00 0.00 ? 116 ASN A OD1  2  
ATOM 4010  N ND2  . ASN A 1 116 ? 9.650   -2.448  22.784  1.00 0.00 ? 116 ASN A ND2  2  
ATOM 4011  H H    . ASN A 1 116 ? 9.891   -7.300  20.489  1.00 0.00 ? 116 ASN A H    2  
ATOM 4012  H HA   . ASN A 1 116 ? 9.823   -6.253  22.513  1.00 0.00 ? 116 ASN A HA   2  
ATOM 4013  H HB2  . ASN A 1 116 ? 9.651   -4.358  20.588  1.00 0.00 ? 116 ASN A HB2  2  
ATOM 4014  H HB3  . ASN A 1 116 ? 8.175   -4.019  21.488  1.00 0.00 ? 116 ASN A HB3  2  
ATOM 4015  H HD21 . ASN A 1 116 ? 8.921   -2.064  22.253  1.00 0.00 ? 116 ASN A HD21 2  
ATOM 4016  H HD22 . ASN A 1 116 ? 10.158  -1.944  23.453  1.00 0.00 ? 116 ASN A HD22 2  
ATOM 4017  N N    . THR A 1 117 ? 7.168   -7.418  22.451  1.00 0.00 ? 117 THR A N    2  
ATOM 4018  C CA   . THR A 1 117 ? 5.909   -7.785  23.088  1.00 0.00 ? 117 THR A CA   2  
ATOM 4019  C C    . THR A 1 117 ? 5.994   -9.172  23.716  1.00 0.00 ? 117 THR A C    2  
ATOM 4020  O O    . THR A 1 117 ? 6.799   -10.006 23.298  1.00 0.00 ? 117 THR A O    2  
ATOM 4021  C CB   . THR A 1 117 ? 4.743   -7.760  22.083  1.00 0.00 ? 117 THR A CB   2  
ATOM 4022  O OG1  . THR A 1 117 ? 3.497   -7.904  22.774  1.00 0.00 ? 117 THR A OG1  2  
ATOM 4023  C CG2  . THR A 1 117 ? 4.890   -8.871  21.055  1.00 0.00 ? 117 THR A CG2  2  
ATOM 4024  H H    . THR A 1 117 ? 7.641   -8.083  21.908  1.00 0.00 ? 117 THR A H    2  
ATOM 4025  H HA   . THR A 1 117 ? 5.705   -7.061  23.863  1.00 0.00 ? 117 THR A HA   2  
ATOM 4026  H HB   . THR A 1 117 ? 4.752   -6.810  21.568  1.00 0.00 ? 117 THR A HB   2  
ATOM 4027  H HG1  . THR A 1 117 ? 2.947   -7.135  22.607  1.00 0.00 ? 117 THR A HG1  2  
ATOM 4028  H HG21 . THR A 1 117 ? 4.859   -8.449  20.061  1.00 0.00 ? 117 THR A HG21 2  
ATOM 4029  H HG22 . THR A 1 117 ? 4.082   -9.578  21.171  1.00 0.00 ? 117 THR A HG22 2  
ATOM 4030  H HG23 . THR A 1 117 ? 5.833   -9.375  21.202  1.00 0.00 ? 117 THR A HG23 2  
ATOM 4031  N N    . THR A 1 118 ? 5.159   -9.413  24.721  1.00 0.00 ? 118 THR A N    2  
ATOM 4032  C CA   . THR A 1 118 ? 5.140   -10.699 25.407  1.00 0.00 ? 118 THR A CA   2  
ATOM 4033  C C    . THR A 1 118 ? 3.886   -11.492 25.055  1.00 0.00 ? 118 THR A C    2  
ATOM 4034  O O    . THR A 1 118 ? 3.472   -12.380 25.800  1.00 0.00 ? 118 THR A O    2  
ATOM 4035  C CB   . THR A 1 118 ? 5.209   -10.522 26.935  1.00 0.00 ? 118 THR A CB   2  
ATOM 4036  O OG1  . THR A 1 118 ? 4.166   -9.645  27.375  1.00 0.00 ? 118 THR A OG1  2  
ATOM 4037  C CG2  . THR A 1 118 ? 6.560   -9.961  27.355  1.00 0.00 ? 118 THR A CG2  2  
ATOM 4038  H H    . THR A 1 118 ? 4.542   -8.708  25.008  1.00 0.00 ? 118 THR A H    2  
ATOM 4039  H HA   . THR A 1 118 ? 6.009   -11.259 25.091  1.00 0.00 ? 118 THR A HA   2  
ATOM 4040  H HB   . THR A 1 118 ? 5.077   -11.488 27.401  1.00 0.00 ? 118 THR A HB   2  
ATOM 4041  H HG1  . THR A 1 118 ? 3.350   -10.142 27.474  1.00 0.00 ? 118 THR A HG1  2  
ATOM 4042  H HG21 . THR A 1 118 ? 7.309   -10.736 27.282  1.00 0.00 ? 118 THR A HG21 2  
ATOM 4043  H HG22 . THR A 1 118 ? 6.503   -9.610  28.374  1.00 0.00 ? 118 THR A HG22 2  
ATOM 4044  H HG23 . THR A 1 118 ? 6.826   -9.142  26.705  1.00 0.00 ? 118 THR A HG23 2  
ATOM 4045  N N    . ASP A 1 119 ? 3.287   -11.166 23.915  1.00 0.00 ? 119 ASP A N    2  
ATOM 4046  C CA   . ASP A 1 119 ? 2.080   -11.849 23.463  1.00 0.00 ? 119 ASP A CA   2  
ATOM 4047  C C    . ASP A 1 119 ? 2.425   -12.978 22.497  1.00 0.00 ? 119 ASP A C    2  
ATOM 4048  O O    . ASP A 1 119 ? 2.723   -12.738 21.326  1.00 0.00 ? 119 ASP A O    2  
ATOM 4049  C CB   . ASP A 1 119 ? 1.129   -10.858 22.791  1.00 0.00 ? 119 ASP A CB   2  
ATOM 4050  C CG   . ASP A 1 119 ? -0.006  -10.435 23.704  1.00 0.00 ? 119 ASP A CG   2  
ATOM 4051  O OD1  . ASP A 1 119 ? -0.677  -11.325 24.266  1.00 0.00 ? 119 ASP A OD1  2  
ATOM 4052  O OD2  . ASP A 1 119 ? -0.224  -9.214  23.854  1.00 0.00 ? 119 ASP A OD2  2  
ATOM 4053  H H    . ASP A 1 119 ? 3.665   -10.448 23.364  1.00 0.00 ? 119 ASP A H    2  
ATOM 4054  H HA   . ASP A 1 119 ? 1.593   -12.270 24.330  1.00 0.00 ? 119 ASP A HA   2  
ATOM 4055  H HB2  . ASP A 1 119 ? 1.682   -9.976  22.504  1.00 0.00 ? 119 ASP A HB2  2  
ATOM 4056  H HB3  . ASP A 1 119 ? 0.706   -11.316 21.909  1.00 0.00 ? 119 ASP A HB3  2  
ATOM 4057  N N    . LEU A 1 120 ? 2.382   -14.209 22.994  1.00 0.00 ? 120 LEU A N    2  
ATOM 4058  C CA   . LEU A 1 120 ? 2.690   -15.376 22.175  1.00 0.00 ? 120 LEU A CA   2  
ATOM 4059  C C    . LEU A 1 120 ? 1.606   -15.609 21.128  1.00 0.00 ? 120 LEU A C    2  
ATOM 4060  O O    . LEU A 1 120 ? 1.858   -16.204 20.081  1.00 0.00 ? 120 LEU A O    2  
ATOM 4061  C CB   . LEU A 1 120 ? 2.839   -16.617 23.057  1.00 0.00 ? 120 LEU A CB   2  
ATOM 4062  C CG   . LEU A 1 120 ? 4.207   -17.299 23.030  1.00 0.00 ? 120 LEU A CG   2  
ATOM 4063  C CD1  . LEU A 1 120 ? 4.637   -17.578 21.598  1.00 0.00 ? 120 LEU A CD1  2  
ATOM 4064  C CD2  . LEU A 1 120 ? 5.244   -16.443 23.742  1.00 0.00 ? 120 LEU A CD2  2  
ATOM 4065  H H    . LEU A 1 120 ? 2.137   -14.337 23.934  1.00 0.00 ? 120 LEU A H    2  
ATOM 4066  H HA   . LEU A 1 120 ? 3.626   -15.188 21.670  1.00 0.00 ? 120 LEU A HA   2  
ATOM 4067  H HB2  . LEU A 1 120 ? 2.635   -16.325 24.075  1.00 0.00 ? 120 LEU A HB2  2  
ATOM 4068  H HB3  . LEU A 1 120 ? 2.102   -17.339 22.736  1.00 0.00 ? 120 LEU A HB3  2  
ATOM 4069  H HG   . LEU A 1 120 ? 4.141   -18.246 23.548  1.00 0.00 ? 120 LEU A HG   2  
ATOM 4070  H HD11 . LEU A 1 120 ? 3.823   -17.349 20.927  1.00 0.00 ? 120 LEU A HD11 2  
ATOM 4071  H HD12 . LEU A 1 120 ? 4.904   -18.620 21.498  1.00 0.00 ? 120 LEU A HD12 2  
ATOM 4072  H HD13 . LEU A 1 120 ? 5.490   -16.963 21.352  1.00 0.00 ? 120 LEU A HD13 2  
ATOM 4073  H HD21 . LEU A 1 120 ? 4.744   -15.727 24.377  1.00 0.00 ? 120 LEU A HD21 2  
ATOM 4074  H HD22 . LEU A 1 120 ? 5.842   -15.919 23.011  1.00 0.00 ? 120 LEU A HD22 2  
ATOM 4075  H HD23 . LEU A 1 120 ? 5.881   -17.075 24.343  1.00 0.00 ? 120 LEU A HD23 2  
ATOM 4076  N N    . GLU A 1 121 ? 0.398   -15.134 21.419  1.00 0.00 ? 121 GLU A N    2  
ATOM 4077  C CA   . GLU A 1 121 ? -0.724  -15.289 20.501  1.00 0.00 ? 121 GLU A CA   2  
ATOM 4078  C C    . GLU A 1 121 ? -0.672  -14.240 19.395  1.00 0.00 ? 121 GLU A C    2  
ATOM 4079  O O    . GLU A 1 121 ? -1.017  -14.516 18.246  1.00 0.00 ? 121 GLU A O    2  
ATOM 4080  C CB   . GLU A 1 121 ? -2.049  -15.183 21.259  1.00 0.00 ? 121 GLU A CB   2  
ATOM 4081  C CG   . GLU A 1 121 ? -2.109  -14.006 22.218  1.00 0.00 ? 121 GLU A CG   2  
ATOM 4082  C CD   . GLU A 1 121 ? -3.495  -13.397 22.308  1.00 0.00 ? 121 GLU A CD   2  
ATOM 4083  O OE1  . GLU A 1 121 ? -3.898  -12.694 21.358  1.00 0.00 ? 121 GLU A OE1  2  
ATOM 4084  O OE2  . GLU A 1 121 ? -4.177  -13.624 23.330  1.00 0.00 ? 121 GLU A OE2  2  
ATOM 4085  H H    . GLU A 1 121 ? 0.259   -14.668 22.270  1.00 0.00 ? 121 GLU A H    2  
ATOM 4086  H HA   . GLU A 1 121 ? -0.654  -16.269 20.054  1.00 0.00 ? 121 GLU A HA   2  
ATOM 4087  H HB2  . GLU A 1 121 ? -2.852  -15.079 20.543  1.00 0.00 ? 121 GLU A HB2  2  
ATOM 4088  H HB3  . GLU A 1 121 ? -2.200  -16.090 21.825  1.00 0.00 ? 121 GLU A HB3  2  
ATOM 4089  H HG2  . GLU A 1 121 ? -1.817  -14.344 23.201  1.00 0.00 ? 121 GLU A HG2  2  
ATOM 4090  H HG3  . GLU A 1 121 ? -1.420  -13.247 21.880  1.00 0.00 ? 121 GLU A HG3  2  
ATOM 4091  N N    . ALA A 1 122 ? -0.240  -13.034 19.751  1.00 0.00 ? 122 ALA A N    2  
ATOM 4092  C CA   . ALA A 1 122 ? -0.141  -11.943 18.789  1.00 0.00 ? 122 ALA A CA   2  
ATOM 4093  C C    . ALA A 1 122 ? 1.116   -12.075 17.936  1.00 0.00 ? 122 ALA A C    2  
ATOM 4094  O O    . ALA A 1 122 ? 1.194   -11.523 16.839  1.00 0.00 ? 122 ALA A O    2  
ATOM 4095  C CB   . ALA A 1 122 ? -0.155  -10.603 19.509  1.00 0.00 ? 122 ALA A CB   2  
ATOM 4096  H H    . ALA A 1 122 ? 0.020   -12.876 20.682  1.00 0.00 ? 122 ALA A H    2  
ATOM 4097  H HA   . ALA A 1 122 ? -1.008  -11.987 18.145  1.00 0.00 ? 122 ALA A HA   2  
ATOM 4098  H HB1  . ALA A 1 122 ? -0.764  -10.679 20.398  1.00 0.00 ? 122 ALA A HB1  2  
ATOM 4099  H HB2  . ALA A 1 122 ? 0.853   -10.332 19.784  1.00 0.00 ? 122 ALA A HB2  2  
ATOM 4100  H HB3  . ALA A 1 122 ? -0.566  -9.848  18.855  1.00 0.00 ? 122 ALA A HB3  2  
ATOM 4101  N N    . ALA A 1 123 ? 2.098   -12.810 18.448  1.00 0.00 ? 123 ALA A N    2  
ATOM 4102  C CA   . ALA A 1 123 ? 3.351   -13.015 17.732  1.00 0.00 ? 123 ALA A CA   2  
ATOM 4103  C C    . ALA A 1 123 ? 3.269   -14.234 16.820  1.00 0.00 ? 123 ALA A C    2  
ATOM 4104  O O    . ALA A 1 123 ? 4.005   -14.337 15.839  1.00 0.00 ? 123 ALA A O    2  
ATOM 4105  C CB   . ALA A 1 123 ? 4.502   -13.165 18.716  1.00 0.00 ? 123 ALA A CB   2  
ATOM 4106  H H    . ALA A 1 123 ? 1.976   -13.225 19.327  1.00 0.00 ? 123 ALA A H    2  
ATOM 4107  H HA   . ALA A 1 123 ? 3.538   -12.138 17.129  1.00 0.00 ? 123 ALA A HA   2  
ATOM 4108  H HB1  . ALA A 1 123 ? 4.134   -13.597 19.636  1.00 0.00 ? 123 ALA A HB1  2  
ATOM 4109  H HB2  . ALA A 1 123 ? 5.256   -13.811 18.291  1.00 0.00 ? 123 ALA A HB2  2  
ATOM 4110  H HB3  . ALA A 1 123 ? 4.931   -12.196 18.919  1.00 0.00 ? 123 ALA A HB3  2  
ATOM 4111  N N    . ALA A 1 124 ? 2.370   -15.155 17.151  1.00 0.00 ? 124 ALA A N    2  
ATOM 4112  C CA   . ALA A 1 124 ? 2.192   -16.367 16.360  1.00 0.00 ? 124 ALA A CA   2  
ATOM 4113  C C    . ALA A 1 124 ? 1.234   -16.128 15.198  1.00 0.00 ? 124 ALA A C    2  
ATOM 4114  O O    . ALA A 1 124 ? 1.262   -16.848 14.200  1.00 0.00 ? 124 ALA A O    2  
ATOM 4115  C CB   . ALA A 1 124 ? 1.685   -17.501 17.239  1.00 0.00 ? 124 ALA A CB   2  
ATOM 4116  H H    . ALA A 1 124 ? 1.813   -15.016 17.944  1.00 0.00 ? 124 ALA A H    2  
ATOM 4117  H HA   . ALA A 1 124 ? 3.156   -16.653 15.966  1.00 0.00 ? 124 ALA A HA   2  
ATOM 4118  H HB1  . ALA A 1 124 ? 1.121   -17.091 18.065  1.00 0.00 ? 124 ALA A HB1  2  
ATOM 4119  H HB2  . ALA A 1 124 ? 1.050   -18.151 16.657  1.00 0.00 ? 124 ALA A HB2  2  
ATOM 4120  H HB3  . ALA A 1 124 ? 2.525   -18.063 17.620  1.00 0.00 ? 124 ALA A HB3  2  
ATOM 4121  N N    . ARG A 1 125 ? 0.386   -15.113 15.335  1.00 0.00 ? 125 ARG A N    2  
ATOM 4122  C CA   . ARG A 1 125 ? -0.582  -14.781 14.296  1.00 0.00 ? 125 ARG A CA   2  
ATOM 4123  C C    . ARG A 1 125 ? 0.103   -14.638 12.940  1.00 0.00 ? 125 ARG A C    2  
ATOM 4124  O O    . ARG A 1 125 ? -0.498  -14.903 11.900  1.00 0.00 ? 125 ARG A O    2  
ATOM 4125  C CB   . ARG A 1 125 ? -1.315  -13.485 14.649  1.00 0.00 ? 125 ARG A CB   2  
ATOM 4126  C CG   . ARG A 1 125 ? -2.582  -13.704 15.460  1.00 0.00 ? 125 ARG A CG   2  
ATOM 4127  C CD   . ARG A 1 125 ? -3.628  -14.470 14.665  1.00 0.00 ? 125 ARG A CD   2  
ATOM 4128  N NE   . ARG A 1 125 ? -4.673  -13.591 14.146  1.00 0.00 ? 125 ARG A NE   2  
ATOM 4129  C CZ   . ARG A 1 125 ? -5.703  -13.168 14.870  1.00 0.00 ? 125 ARG A CZ   2  
ATOM 4130  N NH1  . ARG A 1 125 ? -5.826  -13.541 16.137  1.00 0.00 ? 125 ARG A NH1  2  
ATOM 4131  N NH2  . ARG A 1 125 ? -6.614  -12.370 14.328  1.00 0.00 ? 125 ARG A NH2  2  
ATOM 4132  H H    . ARG A 1 125 ? 0.412   -14.575 16.154  1.00 0.00 ? 125 ARG A H    2  
ATOM 4133  H HA   . ARG A 1 125 ? -1.299  -15.586 14.241  1.00 0.00 ? 125 ARG A HA   2  
ATOM 4134  H HB2  . ARG A 1 125 ? -0.652  -12.854 15.221  1.00 0.00 ? 125 ARG A HB2  2  
ATOM 4135  H HB3  . ARG A 1 125 ? -1.582  -12.977 13.734  1.00 0.00 ? 125 ARG A HB3  2  
ATOM 4136  H HG2  . ARG A 1 125 ? -2.337  -14.268 16.348  1.00 0.00 ? 125 ARG A HG2  2  
ATOM 4137  H HG3  . ARG A 1 125 ? -2.988  -12.744 15.741  1.00 0.00 ? 125 ARG A HG3  2  
ATOM 4138  H HD2  . ARG A 1 125 ? -3.141  -14.962 13.836  1.00 0.00 ? 125 ARG A HD2  2  
ATOM 4139  H HD3  . ARG A 1 125 ? -4.079  -15.210 15.308  1.00 0.00 ? 125 ARG A HD3  2  
ATOM 4140  H HE   . ARG A 1 125 ? -4.602  -13.303 13.213  1.00 0.00 ? 125 ARG A HE   2  
ATOM 4141  H HH11 . ARG A 1 125 ? -5.141  -14.142 16.548  1.00 0.00 ? 125 ARG A HH11 2  
ATOM 4142  H HH12 . ARG A 1 125 ? -6.602  -13.221 16.680  1.00 0.00 ? 125 ARG A HH12 2  
ATOM 4143  H HH21 . ARG A 1 125 ? -6.524  -12.086 13.373  1.00 0.00 ? 125 ARG A HH21 2  
ATOM 4144  H HH22 . ARG A 1 125 ? -7.389  -12.052 14.873  1.00 0.00 ? 125 ARG A HH22 2  
ATOM 4145  N N    . MET A 1 126 ? 1.363   -14.216 12.961  1.00 0.00 ? 126 MET A N    2  
ATOM 4146  C CA   . MET A 1 126 ? 2.130   -14.038 11.733  1.00 0.00 ? 126 MET A CA   2  
ATOM 4147  C C    . MET A 1 126 ? 2.965   -15.278 11.430  1.00 0.00 ? 126 MET A C    2  
ATOM 4148  O O    . MET A 1 126 ? 3.206   -15.605 10.267  1.00 0.00 ? 126 MET A O    2  
ATOM 4149  C CB   . MET A 1 126 ? 3.038   -12.812 11.847  1.00 0.00 ? 126 MET A CB   2  
ATOM 4150  C CG   . MET A 1 126 ? 3.881   -12.795 13.112  1.00 0.00 ? 126 MET A CG   2  
ATOM 4151  S SD   . MET A 1 126 ? 3.194   -11.723 14.389  1.00 0.00 ? 126 MET A SD   2  
ATOM 4152  C CE   . MET A 1 126 ? 4.095   -10.206 14.078  1.00 0.00 ? 126 MET A CE   2  
ATOM 4153  H H    . MET A 1 126 ? 1.789   -14.020 13.822  1.00 0.00 ? 126 MET A H    2  
ATOM 4154  H HA   . MET A 1 126 ? 1.430   -13.883 10.926  1.00 0.00 ? 126 MET A HA   2  
ATOM 4155  H HB2  . MET A 1 126 ? 3.703   -12.792 10.997  1.00 0.00 ? 126 MET A HB2  2  
ATOM 4156  H HB3  . MET A 1 126 ? 2.426   -11.923 11.836  1.00 0.00 ? 126 MET A HB3  2  
ATOM 4157  H HG2  . MET A 1 126 ? 3.942   -13.800 13.502  1.00 0.00 ? 126 MET A HG2  2  
ATOM 4158  H HG3  . MET A 1 126 ? 4.872   -12.447 12.863  1.00 0.00 ? 126 MET A HG3  2  
ATOM 4159  H HE1  . MET A 1 126 ? 4.132   -9.618  14.983  1.00 0.00 ? 126 MET A HE1  2  
ATOM 4160  H HE2  . MET A 1 126 ? 5.099   -10.443 13.760  1.00 0.00 ? 126 MET A HE2  2  
ATOM 4161  H HE3  . MET A 1 126 ? 3.594   -9.644  13.303  1.00 0.00 ? 126 MET A HE3  2  
ATOM 4162  N N    . ILE A 1 127 ? 3.403   -15.963 12.481  1.00 0.00 ? 127 ILE A N    2  
ATOM 4163  C CA   . ILE A 1 127 ? 4.210   -17.166 12.325  1.00 0.00 ? 127 ILE A CA   2  
ATOM 4164  C C    . ILE A 1 127 ? 3.380   -18.316 11.765  1.00 0.00 ? 127 ILE A C    2  
ATOM 4165  O O    . ILE A 1 127 ? 3.917   -19.250 11.169  1.00 0.00 ? 127 ILE A O    2  
ATOM 4166  C CB   . ILE A 1 127 ? 4.835   -17.602 13.663  1.00 0.00 ? 127 ILE A CB   2  
ATOM 4167  C CG1  . ILE A 1 127 ? 5.730   -16.493 14.219  1.00 0.00 ? 127 ILE A CG1  2  
ATOM 4168  C CG2  . ILE A 1 127 ? 5.626   -18.890 13.484  1.00 0.00 ? 127 ILE A CG2  2  
ATOM 4169  C CD1  . ILE A 1 127 ? 6.943   -16.209 13.361  1.00 0.00 ? 127 ILE A CD1  2  
ATOM 4170  H H    . ILE A 1 127 ? 3.178   -15.652 13.382  1.00 0.00 ? 127 ILE A H    2  
ATOM 4171  H HA   . ILE A 1 127 ? 5.010   -16.944 11.633  1.00 0.00 ? 127 ILE A HA   2  
ATOM 4172  H HB   . ILE A 1 127 ? 4.035   -17.794 14.363  1.00 0.00 ? 127 ILE A HB   2  
ATOM 4173  H HG12 . ILE A 1 127 ? 5.158   -15.582 14.296  1.00 0.00 ? 127 ILE A HG12 2  
ATOM 4174  H HG13 . ILE A 1 127 ? 6.078   -16.780 15.201  1.00 0.00 ? 127 ILE A HG13 2  
ATOM 4175  H HG21 . ILE A 1 127 ? 6.528   -18.843 14.077  1.00 0.00 ? 127 ILE A HG21 2  
ATOM 4176  H HG22 . ILE A 1 127 ? 5.027   -19.728 13.807  1.00 0.00 ? 127 ILE A HG22 2  
ATOM 4177  H HG23 . ILE A 1 127 ? 5.886   -19.011 12.444  1.00 0.00 ? 127 ILE A HG23 2  
ATOM 4178  H HD11 . ILE A 1 127 ? 7.552   -15.454 13.836  1.00 0.00 ? 127 ILE A HD11 2  
ATOM 4179  H HD12 . ILE A 1 127 ? 7.519   -17.114 13.239  1.00 0.00 ? 127 ILE A HD12 2  
ATOM 4180  H HD13 . ILE A 1 127 ? 6.623   -15.853 12.392  1.00 0.00 ? 127 ILE A HD13 2  
ATOM 4181  N N    . ALA A 1 128 ? 2.068   -18.241 11.960  1.00 0.00 ? 128 ALA A N    2  
ATOM 4182  C CA   . ALA A 1 128 ? 1.162   -19.274 11.472  1.00 0.00 ? 128 ALA A CA   2  
ATOM 4183  C C    . ALA A 1 128 ? 1.058   -19.238 9.951   1.00 0.00 ? 128 ALA A C    2  
ATOM 4184  O O    . ALA A 1 128 ? 0.718   -20.237 9.319   1.00 0.00 ? 128 ALA A O    2  
ATOM 4185  C CB   . ALA A 1 128 ? -0.213  -19.111 12.101  1.00 0.00 ? 128 ALA A CB   2  
ATOM 4186  H H    . ALA A 1 128 ? 1.700   -17.472 12.443  1.00 0.00 ? 128 ALA A H    2  
ATOM 4187  H HA   . ALA A 1 128 ? 1.557   -20.234 11.773  1.00 0.00 ? 128 ALA A HA   2  
ATOM 4188  H HB1  . ALA A 1 128 ? -0.951  -18.981 11.323  1.00 0.00 ? 128 ALA A HB1  2  
ATOM 4189  H HB2  . ALA A 1 128 ? -0.450  -19.990 12.681  1.00 0.00 ? 128 ALA A HB2  2  
ATOM 4190  H HB3  . ALA A 1 128 ? -0.213  -18.244 12.745  1.00 0.00 ? 128 ALA A HB3  2  
ATOM 4191  N N    . GLY A 1 129 ? 1.352   -18.079 9.369   1.00 0.00 ? 129 GLY A N    2  
ATOM 4192  C CA   . GLY A 1 129 ? 1.284   -17.934 7.927   1.00 0.00 ? 129 GLY A CA   2  
ATOM 4193  C C    . GLY A 1 129 ? 2.538   -18.430 7.235   1.00 0.00 ? 129 GLY A C    2  
ATOM 4194  O O    . GLY A 1 129 ? 2.526   -18.707 6.036   1.00 0.00 ? 129 GLY A O    2  
ATOM 4195  H H    . GLY A 1 129 ? 1.617   -17.316 9.924   1.00 0.00 ? 129 GLY A H    2  
ATOM 4196  H HA2  . GLY A 1 129 ? 0.437   -18.495 7.560   1.00 0.00 ? 129 GLY A HA2  2  
ATOM 4197  H HA3  . GLY A 1 129 ? 1.143   -16.891 7.688   1.00 0.00 ? 129 GLY A HA3  2  
ATOM 4198  N N    . SER A 1 130 ? 3.625   -18.540 7.992   1.00 0.00 ? 130 SER A N    2  
ATOM 4199  C CA   . SER A 1 130 ? 4.896   -19.000 7.443   1.00 0.00 ? 130 SER A CA   2  
ATOM 4200  C C    . SER A 1 130 ? 4.815   -20.470 7.045   1.00 0.00 ? 130 SER A C    2  
ATOM 4201  O O    . SER A 1 130 ? 5.556   -20.932 6.178   1.00 0.00 ? 130 SER A O    2  
ATOM 4202  C CB   . SER A 1 130 ? 6.019   -18.796 8.461   1.00 0.00 ? 130 SER A CB   2  
ATOM 4203  O OG   . SER A 1 130 ? 6.987   -17.881 7.976   1.00 0.00 ? 130 SER A OG   2  
ATOM 4204  H H    . SER A 1 130 ? 3.572   -18.303 8.942   1.00 0.00 ? 130 SER A H    2  
ATOM 4205  H HA   . SER A 1 130 ? 5.108   -18.412 6.562   1.00 0.00 ? 130 SER A HA   2  
ATOM 4206  H HB2  . SER A 1 130 ? 5.604   -18.409 9.379   1.00 0.00 ? 130 SER A HB2  2  
ATOM 4207  H HB3  . SER A 1 130 ? 6.502   -19.743 8.655   1.00 0.00 ? 130 SER A HB3  2  
ATOM 4208  H HG   . SER A 1 130 ? 6.790   -17.002 8.307   1.00 0.00 ? 130 SER A HG   2  
ATOM 4209  N N    . ALA A 1 131 ? 3.909   -21.201 7.686   1.00 0.00 ? 131 ALA A N    2  
ATOM 4210  C CA   . ALA A 1 131 ? 3.729   -22.619 7.399   1.00 0.00 ? 131 ALA A CA   2  
ATOM 4211  C C    . ALA A 1 131 ? 2.859   -22.822 6.163   1.00 0.00 ? 131 ALA A C    2  
ATOM 4212  O O    . ALA A 1 131 ? 2.912   -23.871 5.521   1.00 0.00 ? 131 ALA A O    2  
ATOM 4213  C CB   . ALA A 1 131 ? 3.118   -23.327 8.599   1.00 0.00 ? 131 ALA A CB   2  
ATOM 4214  H H    . ALA A 1 131 ? 3.347   -20.776 8.367   1.00 0.00 ? 131 ALA A H    2  
ATOM 4215  H HA   . ALA A 1 131 ? 4.703   -23.049 7.216   1.00 0.00 ? 131 ALA A HA   2  
ATOM 4216  H HB1  . ALA A 1 131 ? 2.084   -23.560 8.391   1.00 0.00 ? 131 ALA A HB1  2  
ATOM 4217  H HB2  . ALA A 1 131 ? 3.661   -24.240 8.793   1.00 0.00 ? 131 ALA A HB2  2  
ATOM 4218  H HB3  . ALA A 1 131 ? 3.175   -22.683 9.464   1.00 0.00 ? 131 ALA A HB3  2  
ATOM 4219  N N    . ARG A 1 132 ? 2.058   -21.814 5.837   1.00 0.00 ? 132 ARG A N    2  
ATOM 4220  C CA   . ARG A 1 132 ? 1.174   -21.883 4.678   1.00 0.00 ? 132 ARG A CA   2  
ATOM 4221  C C    . ARG A 1 132 ? 1.977   -22.057 3.392   1.00 0.00 ? 132 ARG A C    2  
ATOM 4222  O O    . ARG A 1 132 ? 1.440   -22.470 2.365   1.00 0.00 ? 132 ARG A O    2  
ATOM 4223  C CB   . ARG A 1 132 ? 0.315   -20.621 4.589   1.00 0.00 ? 132 ARG A CB   2  
ATOM 4224  C CG   . ARG A 1 132 ? -0.412  -20.472 3.263   1.00 0.00 ? 132 ARG A CG   2  
ATOM 4225  C CD   . ARG A 1 132 ? 0.397   -19.648 2.274   1.00 0.00 ? 132 ARG A CD   2  
ATOM 4226  N NE   . ARG A 1 132 ? 0.140   -20.044 0.892   1.00 0.00 ? 132 ARG A NE   2  
ATOM 4227  C CZ   . ARG A 1 132 ? 0.870   -19.633 -0.139  1.00 0.00 ? 132 ARG A CZ   2  
ATOM 4228  N NH1  . ARG A 1 132 ? 1.898   -18.818 0.056   1.00 0.00 ? 132 ARG A NH1  2  
ATOM 4229  N NH2  . ARG A 1 132 ? 0.573   -20.037 -1.367  1.00 0.00 ? 132 ARG A NH2  2  
ATOM 4230  H H    . ARG A 1 132 ? 2.060   -21.003 6.388   1.00 0.00 ? 132 ARG A H    2  
ATOM 4231  H HA   . ARG A 1 132 ? 0.529   -22.739 4.804   1.00 0.00 ? 132 ARG A HA   2  
ATOM 4232  H HB2  . ARG A 1 132 ? -0.423  -20.645 5.378   1.00 0.00 ? 132 ARG A HB2  2  
ATOM 4233  H HB3  . ARG A 1 132 ? 0.949   -19.758 4.726   1.00 0.00 ? 132 ARG A HB3  2  
ATOM 4234  H HG2  . ARG A 1 132 ? -0.582  -21.453 2.843   1.00 0.00 ? 132 ARG A HG2  2  
ATOM 4235  H HG3  . ARG A 1 132 ? -1.359  -19.983 3.435   1.00 0.00 ? 132 ARG A HG3  2  
ATOM 4236  H HD2  . ARG A 1 132 ? 0.136   -18.607 2.394   1.00 0.00 ? 132 ARG A HD2  2  
ATOM 4237  H HD3  . ARG A 1 132 ? 1.447   -19.782 2.488   1.00 0.00 ? 132 ARG A HD3  2  
ATOM 4238  H HE   . ARG A 1 132 ? -0.615  -20.645 0.725   1.00 0.00 ? 132 ARG A HE   2  
ATOM 4239  H HH11 . ARG A 1 132 ? 2.125   -18.513 0.981   1.00 0.00 ? 132 ARG A HH11 2  
ATOM 4240  H HH12 . ARG A 1 132 ? 2.447   -18.511 -0.722  1.00 0.00 ? 132 ARG A HH12 2  
ATOM 4241  H HH21 . ARG A 1 132 ? -0.201  -20.651 -1.518  1.00 0.00 ? 132 ARG A HH21 2  
ATOM 4242  H HH22 . ARG A 1 132 ? 1.124   -19.727 -2.142  1.00 0.00 ? 132 ARG A HH22 2  
ATOM 4243  N N    . SER A 1 133 ? 3.266   -21.739 3.458   1.00 0.00 ? 133 SER A N    2  
ATOM 4244  C CA   . SER A 1 133 ? 4.142   -21.855 2.298   1.00 0.00 ? 133 SER A CA   2  
ATOM 4245  C C    . SER A 1 133 ? 4.795   -23.233 2.247   1.00 0.00 ? 133 SER A C    2  
ATOM 4246  O O    . SER A 1 133 ? 4.678   -23.951 1.255   1.00 0.00 ? 133 SER A O    2  
ATOM 4247  C CB   . SER A 1 133 ? 5.218   -20.769 2.333   1.00 0.00 ? 133 SER A CB   2  
ATOM 4248  O OG   . SER A 1 133 ? 6.023   -20.810 1.168   1.00 0.00 ? 133 SER A OG   2  
ATOM 4249  H H    . SER A 1 133 ? 3.636   -21.415 4.306   1.00 0.00 ? 133 SER A H    2  
ATOM 4250  H HA   . SER A 1 133 ? 3.538   -21.723 1.412   1.00 0.00 ? 133 SER A HA   2  
ATOM 4251  H HB2  . SER A 1 133 ? 4.746   -19.800 2.396   1.00 0.00 ? 133 SER A HB2  2  
ATOM 4252  H HB3  . SER A 1 133 ? 5.849   -20.919 3.198   1.00 0.00 ? 133 SER A HB3  2  
ATOM 4253  H HG   . SER A 1 133 ? 5.478   -20.641 0.396   1.00 0.00 ? 133 SER A HG   2  
ATOM 4254  N N    . MET A 1 134 ? 5.485   -23.594 3.324   1.00 0.00 ? 134 MET A N    2  
ATOM 4255  C CA   . MET A 1 134 ? 6.156   -24.886 3.404   1.00 0.00 ? 134 MET A CA   2  
ATOM 4256  C C    . MET A 1 134 ? 5.196   -26.020 3.060   1.00 0.00 ? 134 MET A C    2  
ATOM 4257  O O    . MET A 1 134 ? 5.599   -27.039 2.500   1.00 0.00 ? 134 MET A O    2  
ATOM 4258  C CB   . MET A 1 134 ? 6.735   -25.099 4.804   1.00 0.00 ? 134 MET A CB   2  
ATOM 4259  C CG   . MET A 1 134 ? 5.684   -25.428 5.852   1.00 0.00 ? 134 MET A CG   2  
ATOM 4260  S SD   . MET A 1 134 ? 6.404   -25.831 7.455   1.00 0.00 ? 134 MET A SD   2  
ATOM 4261  C CE   . MET A 1 134 ? 7.248   -24.300 7.842   1.00 0.00 ? 134 MET A CE   2  
ATOM 4262  H H    . MET A 1 134 ? 5.542   -22.978 4.084   1.00 0.00 ? 134 MET A H    2  
ATOM 4263  H HA   . MET A 1 134 ? 6.964   -24.884 2.687   1.00 0.00 ? 134 MET A HA   2  
ATOM 4264  H HB2  . MET A 1 134 ? 7.444   -25.912 4.768   1.00 0.00 ? 134 MET A HB2  2  
ATOM 4265  H HB3  . MET A 1 134 ? 7.247   -24.199 5.110   1.00 0.00 ? 134 MET A HB3  2  
ATOM 4266  H HG2  . MET A 1 134 ? 5.033   -24.574 5.971   1.00 0.00 ? 134 MET A HG2  2  
ATOM 4267  H HG3  . MET A 1 134 ? 5.106   -26.273 5.509   1.00 0.00 ? 134 MET A HG3  2  
ATOM 4268  H HE1  . MET A 1 134 ? 6.519   -23.529 8.048   1.00 0.00 ? 134 MET A HE1  2  
ATOM 4269  H HE2  . MET A 1 134 ? 7.875   -24.444 8.710   1.00 0.00 ? 134 MET A HE2  2  
ATOM 4270  H HE3  . MET A 1 134 ? 7.858   -24.002 7.002   1.00 0.00 ? 134 MET A HE3  2  
ATOM 4271  N N    . GLY A 1 135 ? 3.924   -25.836 3.399   1.00 0.00 ? 135 GLY A N    2  
ATOM 4272  C CA   . GLY A 1 135 ? 2.927   -26.852 3.118   1.00 0.00 ? 135 GLY A CA   2  
ATOM 4273  C C    . GLY A 1 135 ? 2.244   -27.357 4.374   1.00 0.00 ? 135 GLY A C    2  
ATOM 4274  O O    . GLY A 1 135 ? 1.795   -28.503 4.428   1.00 0.00 ? 135 GLY A O    2  
ATOM 4275  H H    . GLY A 1 135 ? 3.660   -25.003 3.843   1.00 0.00 ? 135 GLY A H    2  
ATOM 4276  H HA2  . GLY A 1 135 ? 2.181   -26.437 2.458   1.00 0.00 ? 135 GLY A HA2  2  
ATOM 4277  H HA3  . GLY A 1 135 ? 3.407   -27.684 2.624   1.00 0.00 ? 135 GLY A HA3  2  
ATOM 4278  N N    . VAL A 1 136 ? 2.167   -26.502 5.388   1.00 0.00 ? 136 VAL A N    2  
ATOM 4279  C CA   . VAL A 1 136 ? 1.535   -26.868 6.650   1.00 0.00 ? 136 VAL A CA   2  
ATOM 4280  C C    . VAL A 1 136 ? 0.403   -25.907 6.997   1.00 0.00 ? 136 VAL A C    2  
ATOM 4281  O O    . VAL A 1 136 ? 0.483   -24.712 6.717   1.00 0.00 ? 136 VAL A O    2  
ATOM 4282  C CB   . VAL A 1 136 ? 2.554   -26.881 7.805   1.00 0.00 ? 136 VAL A CB   2  
ATOM 4283  C CG1  . VAL A 1 136 ? 1.869   -27.230 9.118   1.00 0.00 ? 136 VAL A CG1  2  
ATOM 4284  C CG2  . VAL A 1 136 ? 3.683   -27.856 7.508   1.00 0.00 ? 136 VAL A CG2  2  
ATOM 4285  H H    . VAL A 1 136 ? 2.543   -25.603 5.285   1.00 0.00 ? 136 VAL A H    2  
ATOM 4286  H HA   . VAL A 1 136 ? 1.130   -27.864 6.544   1.00 0.00 ? 136 VAL A HA   2  
ATOM 4287  H HB   . VAL A 1 136 ? 2.976   -25.891 7.897   1.00 0.00 ? 136 VAL A HB   2  
ATOM 4288  H HG11 . VAL A 1 136 ? 2.596   -27.218 9.917   1.00 0.00 ? 136 VAL A HG11 2  
ATOM 4289  H HG12 . VAL A 1 136 ? 1.094   -26.506 9.324   1.00 0.00 ? 136 VAL A HG12 2  
ATOM 4290  H HG13 . VAL A 1 136 ? 1.431   -28.215 9.045   1.00 0.00 ? 136 VAL A HG13 2  
ATOM 4291  H HG21 . VAL A 1 136 ? 4.479   -27.713 8.224   1.00 0.00 ? 136 VAL A HG21 2  
ATOM 4292  H HG22 . VAL A 1 136 ? 3.313   -28.869 7.579   1.00 0.00 ? 136 VAL A HG22 2  
ATOM 4293  H HG23 . VAL A 1 136 ? 4.058   -27.680 6.511   1.00 0.00 ? 136 VAL A HG23 2  
ATOM 4294  N N    . GLU A 1 137 ? -0.652  -26.440 7.607   1.00 0.00 ? 137 GLU A N    2  
ATOM 4295  C CA   . GLU A 1 137 ? -1.801  -25.628 7.992   1.00 0.00 ? 137 GLU A CA   2  
ATOM 4296  C C    . GLU A 1 137 ? -1.991  -25.638 9.506   1.00 0.00 ? 137 GLU A C    2  
ATOM 4297  O O    . GLU A 1 137 ? -1.187  -26.211 10.240  1.00 0.00 ? 137 GLU A O    2  
ATOM 4298  C CB   . GLU A 1 137 ? -3.068  -26.141 7.304   1.00 0.00 ? 137 GLU A CB   2  
ATOM 4299  C CG   . GLU A 1 137 ? -3.128  -25.820 5.820   1.00 0.00 ? 137 GLU A CG   2  
ATOM 4300  C CD   . GLU A 1 137 ? -2.837  -27.027 4.950   1.00 0.00 ? 137 GLU A CD   2  
ATOM 4301  O OE1  . GLU A 1 137 ? -3.593  -28.017 5.038   1.00 0.00 ? 137 GLU A OE1  2  
ATOM 4302  O OE2  . GLU A 1 137 ? -1.855  -26.982 4.180   1.00 0.00 ? 137 GLU A OE2  2  
ATOM 4303  H H    . GLU A 1 137 ? -0.657  -27.400 7.803   1.00 0.00 ? 137 GLU A H    2  
ATOM 4304  H HA   . GLU A 1 137 ? -1.614  -24.615 7.671   1.00 0.00 ? 137 GLU A HA   2  
ATOM 4305  H HB2  . GLU A 1 137 ? -3.118  -27.214 7.422   1.00 0.00 ? 137 GLU A HB2  2  
ATOM 4306  H HB3  . GLU A 1 137 ? -3.927  -25.696 7.782   1.00 0.00 ? 137 GLU A HB3  2  
ATOM 4307  H HG2  . GLU A 1 137 ? -4.116  -25.455 5.584   1.00 0.00 ? 137 GLU A HG2  2  
ATOM 4308  H HG3  . GLU A 1 137 ? -2.400  -25.053 5.601   1.00 0.00 ? 137 GLU A HG3  2  
ATOM 4309  N N    . VAL A 1 138 ? -3.061  -24.997 9.965   1.00 0.00 ? 138 VAL A N    2  
ATOM 4310  C CA   . VAL A 1 138 ? -3.359  -24.931 11.391  1.00 0.00 ? 138 VAL A CA   2  
ATOM 4311  C C    . VAL A 1 138 ? -4.342  -26.023 11.799  1.00 0.00 ? 138 VAL A C    2  
ATOM 4312  O O    . VAL A 1 138 ? -5.208  -26.417 11.017  1.00 0.00 ? 138 VAL A O    2  
ATOM 4313  C CB   . VAL A 1 138 ? -3.942  -23.560 11.780  1.00 0.00 ? 138 VAL A CB   2  
ATOM 4314  C CG1  . VAL A 1 138 ? -5.252  -23.309 11.048  1.00 0.00 ? 138 VAL A CG1  2  
ATOM 4315  C CG2  . VAL A 1 138 ? -4.138  -23.472 13.286  1.00 0.00 ? 138 VAL A CG2  2  
ATOM 4316  H H    . VAL A 1 138 ? -3.666  -24.559 9.330   1.00 0.00 ? 138 VAL A H    2  
ATOM 4317  H HA   . VAL A 1 138 ? -2.434  -25.072 11.932  1.00 0.00 ? 138 VAL A HA   2  
ATOM 4318  H HB   . VAL A 1 138 ? -3.238  -22.795 11.485  1.00 0.00 ? 138 VAL A HB   2  
ATOM 4319  H HG11 . VAL A 1 138 ? -5.092  -23.401 9.984   1.00 0.00 ? 138 VAL A HG11 2  
ATOM 4320  H HG12 . VAL A 1 138 ? -5.987  -24.033 11.367  1.00 0.00 ? 138 VAL A HG12 2  
ATOM 4321  H HG13 . VAL A 1 138 ? -5.605  -22.314 11.274  1.00 0.00 ? 138 VAL A HG13 2  
ATOM 4322  H HG21 . VAL A 1 138 ? -3.897  -22.475 13.622  1.00 0.00 ? 138 VAL A HG21 2  
ATOM 4323  H HG22 . VAL A 1 138 ? -5.168  -23.694 13.529  1.00 0.00 ? 138 VAL A HG22 2  
ATOM 4324  H HG23 . VAL A 1 138 ? -3.492  -24.185 13.776  1.00 0.00 ? 138 VAL A HG23 2  
ATOM 4325  N N    . VAL A 1 139 ? -4.202  -26.509 13.028  1.00 0.00 ? 139 VAL A N    2  
ATOM 4326  C CA   . VAL A 1 139 ? -5.079  -27.555 13.541  1.00 0.00 ? 139 VAL A CA   2  
ATOM 4327  C C    . VAL A 1 139 ? -5.928  -27.041 14.698  1.00 0.00 ? 139 VAL A C    2  
ATOM 4328  O O    . VAL A 1 139 ? -6.975  -27.607 15.013  1.00 0.00 ? 139 VAL A O    2  
ATOM 4329  C CB   . VAL A 1 139 ? -4.274  -28.780 14.014  1.00 0.00 ? 139 VAL A CB   2  
ATOM 4330  C CG1  . VAL A 1 139 ? -5.204  -29.848 14.570  1.00 0.00 ? 139 VAL A CG1  2  
ATOM 4331  C CG2  . VAL A 1 139 ? -3.431  -29.335 12.876  1.00 0.00 ? 139 VAL A CG2  2  
ATOM 4332  H H    . VAL A 1 139 ? -3.493  -26.155 13.604  1.00 0.00 ? 139 VAL A H    2  
ATOM 4333  H HA   . VAL A 1 139 ? -5.731  -27.867 12.739  1.00 0.00 ? 139 VAL A HA   2  
ATOM 4334  H HB   . VAL A 1 139 ? -3.609  -28.465 14.805  1.00 0.00 ? 139 VAL A HB   2  
ATOM 4335  H HG11 . VAL A 1 139 ? -4.900  -30.816 14.201  1.00 0.00 ? 139 VAL A HG11 2  
ATOM 4336  H HG12 . VAL A 1 139 ? -5.156  -29.841 15.649  1.00 0.00 ? 139 VAL A HG12 2  
ATOM 4337  H HG13 . VAL A 1 139 ? -6.216  -29.644 14.252  1.00 0.00 ? 139 VAL A HG13 2  
ATOM 4338  H HG21 . VAL A 1 139 ? -2.970  -28.519 12.339  1.00 0.00 ? 139 VAL A HG21 2  
ATOM 4339  H HG22 . VAL A 1 139 ? -2.664  -29.982 13.277  1.00 0.00 ? 139 VAL A HG22 2  
ATOM 4340  H HG23 . VAL A 1 139 ? -4.061  -29.898 12.203  1.00 0.00 ? 139 VAL A HG23 2  
ATOM 4341  N N    . GLY A 1 140 ? -5.471  -25.964 15.328  1.00 0.00 ? 140 GLY A N    2  
ATOM 4342  C CA   . GLY A 1 140 ? -6.202  -25.391 16.444  1.00 0.00 ? 140 GLY A CA   2  
ATOM 4343  C C    . GLY A 1 140 ? -6.433  -23.902 16.282  1.00 0.00 ? 140 GLY A C    2  
ATOM 4344  O O    . GLY A 1 140 ? -7.120  -23.470 15.356  1.00 0.00 ? 140 GLY A O    2  
ATOM 4345  H H    . GLY A 1 140 ? -4.631  -25.554 15.034  1.00 0.00 ? 140 GLY A H    2  
ATOM 4346  H HA2  . GLY A 1 140 ? -7.157  -25.886 16.527  1.00 0.00 ? 140 GLY A HA2  2  
ATOM 4347  H HA3  . GLY A 1 140 ? -5.640  -25.560 17.351  1.00 0.00 ? 140 GLY A HA3  2  
ATOM 4348  N N    . ALA A 1 141 ? -5.860  -23.114 17.186  1.00 0.00 ? 141 ALA A N    2  
ATOM 4349  C CA   . ALA A 1 141 ? -6.007  -21.664 17.139  1.00 0.00 ? 141 ALA A CA   2  
ATOM 4350  C C    . ALA A 1 141 ? -7.465  -21.254 17.317  1.00 0.00 ? 141 ALA A C    2  
ATOM 4351  O O    . ALA A 1 141 ? -8.386  -22.048 17.124  1.00 0.00 ? 141 ALA A O    2  
ATOM 4352  C CB   . ALA A 1 141 ? -5.460  -21.121 15.827  1.00 0.00 ? 141 ALA A CB   2  
ATOM 4353  H H    . ALA A 1 141 ? -5.324  -23.517 17.901  1.00 0.00 ? 141 ALA A H    2  
ATOM 4354  H HA   . ALA A 1 141 ? -5.424  -21.243 17.946  1.00 0.00 ? 141 ALA A HA   2  
ATOM 4355  H HB1  . ALA A 1 141 ? -4.872  -20.236 16.022  1.00 0.00 ? 141 ALA A HB1  2  
ATOM 4356  H HB2  . ALA A 1 141 ? -4.840  -21.870 15.358  1.00 0.00 ? 141 ALA A HB2  2  
ATOM 4357  H HB3  . ALA A 1 141 ? -6.281  -20.870 15.172  1.00 0.00 ? 141 ALA A HB3  2  
ATOM 4358  N N    . PRO A 1 142 ? -7.682  -19.986 17.696  1.00 0.00 ? 142 PRO A N    2  
ATOM 4359  C CA   . PRO A 1 142 ? -9.026  -19.442 17.909  1.00 0.00 ? 142 PRO A CA   2  
ATOM 4360  C C    . PRO A 1 142 ? -9.803  -19.289 16.605  1.00 0.00 ? 142 PRO A C    2  
ATOM 4361  O O    . PRO A 1 142 ? -9.329  -19.683 15.540  1.00 0.00 ? 142 PRO A O    2  
ATOM 4362  C CB   . PRO A 1 142 ? -8.760  -18.072 18.536  1.00 0.00 ? 142 PRO A CB   2  
ATOM 4363  C CG   . PRO A 1 142 ? -7.398  -17.697 18.062  1.00 0.00 ? 142 PRO A CG   2  
ATOM 4364  C CD   . PRO A 1 142 ? -6.631  -18.985 17.944  1.00 0.00 ? 142 PRO A CD   2  
ATOM 4365  H HA   . PRO A 1 142 ? -9.596  -20.050 18.596  1.00 0.00 ? 142 PRO A HA   2  
ATOM 4366  H HB2  . PRO A 1 142 ? -9.505  -17.366 18.197  1.00 0.00 ? 142 PRO A HB2  2  
ATOM 4367  H HB3  . PRO A 1 142 ? -8.795  -18.151 19.612  1.00 0.00 ? 142 PRO A HB3  2  
ATOM 4368  H HG2  . PRO A 1 142 ? -7.465  -17.211 17.100  1.00 0.00 ? 142 PRO A HG2  2  
ATOM 4369  H HG3  . PRO A 1 142 ? -6.926  -17.044 18.781  1.00 0.00 ? 142 PRO A HG3  2  
ATOM 4370  H HD2  . PRO A 1 142 ? -5.939  -18.938 17.116  1.00 0.00 ? 142 PRO A HD2  2  
ATOM 4371  H HD3  . PRO A 1 142 ? -6.107  -19.197 18.865  1.00 0.00 ? 142 PRO A HD3  2  
ATOM 4372  N N    . GLU A 1 143 ? -10.998 -18.715 16.698  1.00 0.00 ? 143 GLU A N    2  
ATOM 4373  C CA   . GLU A 1 143 ? -11.840 -18.511 15.524  1.00 0.00 ? 143 GLU A CA   2  
ATOM 4374  C C    . GLU A 1 143 ? -12.880 -17.424 15.783  1.00 0.00 ? 143 GLU A C    2  
ATOM 4375  O O    . GLU A 1 143 ? -14.036 -17.716 16.086  1.00 0.00 ? 143 GLU A O    2  
ATOM 4376  C CB   . GLU A 1 143 ? -12.536 -19.817 15.136  1.00 0.00 ? 143 GLU A CB   2  
ATOM 4377  C CG   . GLU A 1 143 ? -13.304 -19.730 13.827  1.00 0.00 ? 143 GLU A CG   2  
ATOM 4378  C CD   . GLU A 1 143 ? -12.519 -20.280 12.652  1.00 0.00 ? 143 GLU A CD   2  
ATOM 4379  O OE1  . GLU A 1 143 ? -11.951 -21.384 12.784  1.00 0.00 ? 143 GLU A OE1  2  
ATOM 4380  O OE2  . GLU A 1 143 ? -12.472 -19.606 11.602  1.00 0.00 ? 143 GLU A OE2  2  
ATOM 4381  H H    . GLU A 1 143 ? -11.322 -18.422 17.575  1.00 0.00 ? 143 GLU A H    2  
ATOM 4382  H HA   . GLU A 1 143 ? -11.204 -18.197 14.711  1.00 0.00 ? 143 GLU A HA   2  
ATOM 4383  H HB2  . GLU A 1 143 ? -11.792 -20.594 15.042  1.00 0.00 ? 143 GLU A HB2  2  
ATOM 4384  H HB3  . GLU A 1 143 ? -13.229 -20.087 15.918  1.00 0.00 ? 143 GLU A HB3  2  
ATOM 4385  H HG2  . GLU A 1 143 ? -14.219 -20.295 13.924  1.00 0.00 ? 143 GLU A HG2  2  
ATOM 4386  H HG3  . GLU A 1 143 ? -13.541 -18.695 13.631  1.00 0.00 ? 143 GLU A HG3  2  
ATOM 4387  N N    . VAL A 1 144 ? -12.458 -16.169 15.661  1.00 0.00 ? 144 VAL A N    2  
ATOM 4388  C CA   . VAL A 1 144 ? -13.352 -15.038 15.881  1.00 0.00 ? 144 VAL A CA   2  
ATOM 4389  C C    . VAL A 1 144 ? -14.085 -15.168 17.211  1.00 0.00 ? 144 VAL A C    2  
ATOM 4390  O O    . VAL A 1 144 ? -15.205 -15.677 17.269  1.00 0.00 ? 144 VAL A O    2  
ATOM 4391  C CB   . VAL A 1 144 ? -14.387 -14.912 14.747  1.00 0.00 ? 144 VAL A CB   2  
ATOM 4392  C CG1  . VAL A 1 144 ? -15.373 -13.793 15.046  1.00 0.00 ? 144 VAL A CG1  2  
ATOM 4393  C CG2  . VAL A 1 144 ? -13.691 -14.680 13.415  1.00 0.00 ? 144 VAL A CG2  2  
ATOM 4394  H H    . VAL A 1 144 ? -11.525 -16.000 15.417  1.00 0.00 ? 144 VAL A H    2  
ATOM 4395  H HA   . VAL A 1 144 ? -12.754 -14.139 15.896  1.00 0.00 ? 144 VAL A HA   2  
ATOM 4396  H HB   . VAL A 1 144 ? -14.937 -15.839 14.685  1.00 0.00 ? 144 VAL A HB   2  
ATOM 4397  H HG11 . VAL A 1 144 ? -15.720 -13.362 14.118  1.00 0.00 ? 144 VAL A HG11 2  
ATOM 4398  H HG12 . VAL A 1 144 ? -16.213 -14.190 15.596  1.00 0.00 ? 144 VAL A HG12 2  
ATOM 4399  H HG13 . VAL A 1 144 ? -14.884 -13.031 15.634  1.00 0.00 ? 144 VAL A HG13 2  
ATOM 4400  H HG21 . VAL A 1 144 ? -13.878 -13.669 13.083  1.00 0.00 ? 144 VAL A HG21 2  
ATOM 4401  H HG22 . VAL A 1 144 ? -12.627 -14.829 13.533  1.00 0.00 ? 144 VAL A HG22 2  
ATOM 4402  H HG23 . VAL A 1 144 ? -14.072 -15.376 12.682  1.00 0.00 ? 144 VAL A HG23 2  
ATOM 4403  N N    . LYS A 1 145 ? -13.447 -14.703 18.280  1.00 0.00 ? 145 LYS A N    2  
ATOM 4404  C CA   . LYS A 1 145 ? -14.038 -14.764 19.611  1.00 0.00 ? 145 LYS A CA   2  
ATOM 4405  C C    . LYS A 1 145 ? -14.978 -13.586 19.844  1.00 0.00 ? 145 LYS A C    2  
ATOM 4406  O O    . LYS A 1 145 ? -14.749 -12.487 19.338  1.00 0.00 ? 145 LYS A O    2  
ATOM 4407  C CB   . LYS A 1 145 ? -12.941 -14.773 20.679  1.00 0.00 ? 145 LYS A CB   2  
ATOM 4408  C CG   . LYS A 1 145 ? -12.577 -16.165 21.165  1.00 0.00 ? 145 LYS A CG   2  
ATOM 4409  C CD   . LYS A 1 145 ? -13.102 -16.421 22.568  1.00 0.00 ? 145 LYS A CD   2  
ATOM 4410  C CE   . LYS A 1 145 ? -13.843 -17.746 22.653  1.00 0.00 ? 145 LYS A CE   2  
ATOM 4411  N NZ   . LYS A 1 145 ? -12.906 -18.903 22.707  1.00 0.00 ? 145 LYS A NZ   2  
ATOM 4412  H H    . LYS A 1 145 ? -12.556 -14.308 18.170  1.00 0.00 ? 145 LYS A H    2  
ATOM 4413  H HA   . LYS A 1 145 ? -14.604 -15.680 19.681  1.00 0.00 ? 145 LYS A HA   2  
ATOM 4414  H HB2  . LYS A 1 145 ? -12.053 -14.314 20.269  1.00 0.00 ? 145 LYS A HB2  2  
ATOM 4415  H HB3  . LYS A 1 145 ? -13.277 -14.194 21.527  1.00 0.00 ? 145 LYS A HB3  2  
ATOM 4416  H HG2  . LYS A 1 145 ? -13.005 -16.895 20.494  1.00 0.00 ? 145 LYS A HG2  2  
ATOM 4417  H HG3  . LYS A 1 145 ? -11.501 -16.265 21.169  1.00 0.00 ? 145 LYS A HG3  2  
ATOM 4418  H HD2  . LYS A 1 145 ? -12.270 -16.441 23.256  1.00 0.00 ? 145 LYS A HD2  2  
ATOM 4419  H HD3  . LYS A 1 145 ? -13.778 -15.622 22.841  1.00 0.00 ? 145 LYS A HD3  2  
ATOM 4420  H HE2  . LYS A 1 145 ? -14.452 -17.746 23.544  1.00 0.00 ? 145 LYS A HE2  2  
ATOM 4421  H HE3  . LYS A 1 145 ? -14.475 -17.847 21.784  1.00 0.00 ? 145 LYS A HE3  2  
ATOM 4422  H HZ1  . LYS A 1 145 ? -12.068 -18.711 22.121  1.00 0.00 ? 145 LYS A HZ1  2  
ATOM 4423  H HZ2  . LYS A 1 145 ? -13.375 -19.760 22.352  1.00 0.00 ? 145 LYS A HZ2  2  
ATOM 4424  H HZ3  . LYS A 1 145 ? -12.599 -19.069 23.687  1.00 0.00 ? 145 LYS A HZ3  2  
ATOM 4425  N N    . ASP A 1 146 ? -16.036 -13.822 20.612  1.00 0.00 ? 146 ASP A N    2  
ATOM 4426  C CA   . ASP A 1 146 ? -17.010 -12.779 20.914  1.00 0.00 ? 146 ASP A CA   2  
ATOM 4427  C C    . ASP A 1 146 ? -17.625 -12.224 19.634  1.00 0.00 ? 146 ASP A C    2  
ATOM 4428  O O    . ASP A 1 146 ? -17.057 -11.340 18.993  1.00 0.00 ? 146 ASP A O    2  
ATOM 4429  C CB   . ASP A 1 146 ? -16.351 -11.651 21.709  1.00 0.00 ? 146 ASP A CB   2  
ATOM 4430  C CG   . ASP A 1 146 ? -17.242 -11.127 22.818  1.00 0.00 ? 146 ASP A CG   2  
ATOM 4431  O OD1  . ASP A 1 146 ? -18.398 -10.756 22.524  1.00 0.00 ? 146 ASP A OD1  2  
ATOM 4432  O OD2  . ASP A 1 146 ? -16.784 -11.086 23.979  1.00 0.00 ? 146 ASP A OD2  2  
ATOM 4433  H H    . ASP A 1 146 ? -16.164 -14.719 20.987  1.00 0.00 ? 146 ASP A H    2  
ATOM 4434  H HA   . ASP A 1 146 ? -17.792 -13.220 21.513  1.00 0.00 ? 146 ASP A HA   2  
ATOM 4435  H HB2  . ASP A 1 146 ? -15.436 -12.017 22.152  1.00 0.00 ? 146 ASP A HB2  2  
ATOM 4436  H HB3  . ASP A 1 146 ? -16.121 -10.835 21.040  1.00 0.00 ? 146 ASP A HB3  2  
ATOM 4437  N N    . ALA A 1 147 ? -18.789 -12.749 19.266  1.00 0.00 ? 147 ALA A N    2  
ATOM 4438  C CA   . ALA A 1 147 ? -19.482 -12.306 18.063  1.00 0.00 ? 147 ALA A CA   2  
ATOM 4439  C C    . ALA A 1 147 ? -18.619 -12.515 16.824  1.00 0.00 ? 147 ALA A C    2  
ATOM 4440  O O    . ALA A 1 147 ? -18.949 -13.323 15.955  1.00 0.00 ? 147 ALA A O    2  
ATOM 4441  C CB   . ALA A 1 147 ? -19.878 -10.842 18.192  1.00 0.00 ? 147 ALA A CB   2  
ATOM 4442  H H    . ALA A 1 147 ? -19.192 -13.451 19.818  1.00 0.00 ? 147 ALA A H    2  
ATOM 4443  H HA   . ALA A 1 147 ? -20.386 -12.890 17.963  1.00 0.00 ? 147 ALA A HA   2  
ATOM 4444  H HB1  . ALA A 1 147 ? -20.939 -10.773 18.387  1.00 0.00 ? 147 ALA A HB1  2  
ATOM 4445  H HB2  . ALA A 1 147 ? -19.332 -10.392 19.007  1.00 0.00 ? 147 ALA A HB2  2  
ATOM 4446  H HB3  . ALA A 1 147 ? -19.646 -10.325 17.273  1.00 0.00 ? 147 ALA A HB3  2  
ATOM 4447  N N    . MET A 1 1   ? 15.148  -35.675 -16.956 1.00 0.00 ? 1   MET A N    3  
ATOM 4448  C CA   . MET A 1 1   ? 14.431  -34.406 -16.938 1.00 0.00 ? 1   MET A CA   3  
ATOM 4449  C C    . MET A 1 1   ? 15.133  -33.397 -16.035 1.00 0.00 ? 1   MET A C    3  
ATOM 4450  O O    . MET A 1 1   ? 15.039  -32.187 -16.247 1.00 0.00 ? 1   MET A O    3  
ATOM 4451  C CB   . MET A 1 1   ? 12.991  -34.616 -16.466 1.00 0.00 ? 1   MET A CB   3  
ATOM 4452  C CG   . MET A 1 1   ? 12.890  -35.222 -15.076 1.00 0.00 ? 1   MET A CG   3  
ATOM 4453  S SD   . MET A 1 1   ? 12.327  -34.037 -13.840 1.00 0.00 ? 1   MET A SD   3  
ATOM 4454  C CE   . MET A 1 1   ? 11.329  -35.090 -12.790 1.00 0.00 ? 1   MET A CE   3  
ATOM 4455  H H1   . MET A 1 1   ? 14.812  -36.421 -16.417 1.00 0.00 ? 1   MET A H1   3  
ATOM 4456  H HA   . MET A 1 1   ? 14.416  -34.019 -17.947 1.00 0.00 ? 1   MET A HA   3  
ATOM 4457  H HB2  . MET A 1 1   ? 12.485  -33.662 -16.456 1.00 0.00 ? 1   MET A HB2  3  
ATOM 4458  H HB3  . MET A 1 1   ? 12.489  -35.274 -17.159 1.00 0.00 ? 1   MET A HB3  3  
ATOM 4459  H HG2  . MET A 1 1   ? 12.193  -36.046 -15.107 1.00 0.00 ? 1   MET A HG2  3  
ATOM 4460  H HG3  . MET A 1 1   ? 13.864  -35.589 -14.787 1.00 0.00 ? 1   MET A HG3  3  
ATOM 4461  H HE1  . MET A 1 1   ? 11.950  -35.526 -12.022 1.00 0.00 ? 1   MET A HE1  3  
ATOM 4462  H HE2  . MET A 1 1   ? 10.547  -34.503 -12.331 1.00 0.00 ? 1   MET A HE2  3  
ATOM 4463  H HE3  . MET A 1 1   ? 10.887  -35.876 -13.386 1.00 0.00 ? 1   MET A HE3  3  
ATOM 4464  N N    . LYS A 1 2   ? 15.836  -33.901 -15.027 1.00 0.00 ? 2   LYS A N    3  
ATOM 4465  C CA   . LYS A 1 2   ? 16.555  -33.045 -14.091 1.00 0.00 ? 2   LYS A CA   3  
ATOM 4466  C C    . LYS A 1 2   ? 17.696  -32.312 -14.791 1.00 0.00 ? 2   LYS A C    3  
ATOM 4467  O O    . LYS A 1 2   ? 18.791  -32.853 -14.949 1.00 0.00 ? 2   LYS A O    3  
ATOM 4468  C CB   . LYS A 1 2   ? 17.105  -33.874 -12.928 1.00 0.00 ? 2   LYS A CB   3  
ATOM 4469  C CG   . LYS A 1 2   ? 17.299  -33.076 -11.651 1.00 0.00 ? 2   LYS A CG   3  
ATOM 4470  C CD   . LYS A 1 2   ? 16.728  -33.805 -10.446 1.00 0.00 ? 2   LYS A CD   3  
ATOM 4471  C CE   . LYS A 1 2   ? 15.463  -33.133 -9.935  1.00 0.00 ? 2   LYS A CE   3  
ATOM 4472  N NZ   . LYS A 1 2   ? 14.422  -34.128 -9.555  1.00 0.00 ? 2   LYS A NZ   3  
ATOM 4473  H H    . LYS A 1 2   ? 15.874  -34.874 -14.910 1.00 0.00 ? 2   LYS A H    3  
ATOM 4474  H HA   . LYS A 1 2   ? 15.859  -32.316 -13.705 1.00 0.00 ? 2   LYS A HA   3  
ATOM 4475  H HB2  . LYS A 1 2   ? 16.419  -34.682 -12.723 1.00 0.00 ? 2   LYS A HB2  3  
ATOM 4476  H HB3  . LYS A 1 2   ? 18.060  -34.288 -13.217 1.00 0.00 ? 2   LYS A HB3  3  
ATOM 4477  H HG2  . LYS A 1 2   ? 18.355  -32.915 -11.494 1.00 0.00 ? 2   LYS A HG2  3  
ATOM 4478  H HG3  . LYS A 1 2   ? 16.799  -32.123 -11.753 1.00 0.00 ? 2   LYS A HG3  3  
ATOM 4479  H HD2  . LYS A 1 2   ? 16.494  -34.821 -10.728 1.00 0.00 ? 2   LYS A HD2  3  
ATOM 4480  H HD3  . LYS A 1 2   ? 17.467  -33.810 -9.656  1.00 0.00 ? 2   LYS A HD3  3  
ATOM 4481  H HE2  . LYS A 1 2   ? 15.711  -32.537 -9.071  1.00 0.00 ? 2   LYS A HE2  3  
ATOM 4482  H HE3  . LYS A 1 2   ? 15.071  -32.494 -10.713 1.00 0.00 ? 2   LYS A HE3  3  
ATOM 4483  H HZ1  . LYS A 1 2   ? 14.051  -33.911 -8.607  1.00 0.00 ? 2   LYS A HZ1  3  
ATOM 4484  H HZ2  . LYS A 1 2   ? 14.828  -35.085 -9.544  1.00 0.00 ? 2   LYS A HZ2  3  
ATOM 4485  H HZ3  . LYS A 1 2   ? 13.637  -34.103 -10.237 1.00 0.00 ? 2   LYS A HZ3  3  
ATOM 4486  N N    . LYS A 1 3   ? 17.433  -31.078 -15.207 1.00 0.00 ? 3   LYS A N    3  
ATOM 4487  C CA   . LYS A 1 3   ? 18.438  -30.269 -15.887 1.00 0.00 ? 3   LYS A CA   3  
ATOM 4488  C C    . LYS A 1 3   ? 18.436  -28.839 -15.355 1.00 0.00 ? 3   LYS A C    3  
ATOM 4489  O O    . LYS A 1 3   ? 17.409  -28.337 -14.898 1.00 0.00 ? 3   LYS A O    3  
ATOM 4490  C CB   . LYS A 1 3   ? 18.182  -30.263 -17.395 1.00 0.00 ? 3   LYS A CB   3  
ATOM 4491  C CG   . LYS A 1 3   ? 19.448  -30.377 -18.227 1.00 0.00 ? 3   LYS A CG   3  
ATOM 4492  C CD   . LYS A 1 3   ? 19.141  -30.360 -19.715 1.00 0.00 ? 3   LYS A CD   3  
ATOM 4493  C CE   . LYS A 1 3   ? 18.686  -31.726 -20.206 1.00 0.00 ? 3   LYS A CE   3  
ATOM 4494  N NZ   . LYS A 1 3   ? 19.832  -32.659 -20.392 1.00 0.00 ? 3   LYS A NZ   3  
ATOM 4495  H H    . LYS A 1 3   ? 16.541  -30.701 -15.051 1.00 0.00 ? 3   LYS A H    3  
ATOM 4496  H HA   . LYS A 1 3   ? 19.404  -30.710 -15.695 1.00 0.00 ? 3   LYS A HA   3  
ATOM 4497  H HB2  . LYS A 1 3   ? 17.538  -31.094 -17.642 1.00 0.00 ? 3   LYS A HB2  3  
ATOM 4498  H HB3  . LYS A 1 3   ? 17.684  -29.342 -17.660 1.00 0.00 ? 3   LYS A HB3  3  
ATOM 4499  H HG2  . LYS A 1 3   ? 20.096  -29.545 -17.995 1.00 0.00 ? 3   LYS A HG2  3  
ATOM 4500  H HG3  . LYS A 1 3   ? 19.947  -31.304 -17.982 1.00 0.00 ? 3   LYS A HG3  3  
ATOM 4501  H HD2  . LYS A 1 3   ? 18.356  -29.643 -19.904 1.00 0.00 ? 3   LYS A HD2  3  
ATOM 4502  H HD3  . LYS A 1 3   ? 20.032  -30.072 -20.255 1.00 0.00 ? 3   LYS A HD3  3  
ATOM 4503  H HE2  . LYS A 1 3   ? 18.006  -32.147 -19.481 1.00 0.00 ? 3   LYS A HE2  3  
ATOM 4504  H HE3  . LYS A 1 3   ? 18.176  -31.604 -21.149 1.00 0.00 ? 3   LYS A HE3  3  
ATOM 4505  H HZ1  . LYS A 1 3   ? 20.692  -32.124 -20.631 1.00 0.00 ? 3   LYS A HZ1  3  
ATOM 4506  H HZ2  . LYS A 1 3   ? 19.628  -33.326 -21.162 1.00 0.00 ? 3   LYS A HZ2  3  
ATOM 4507  H HZ3  . LYS A 1 3   ? 20.002  -33.195 -19.518 1.00 0.00 ? 3   LYS A HZ3  3  
ATOM 4508  N N    . VAL A 1 4   ? 19.593  -28.188 -15.418 1.00 0.00 ? 4   VAL A N    3  
ATOM 4509  C CA   . VAL A 1 4   ? 19.725  -26.815 -14.946 1.00 0.00 ? 4   VAL A CA   3  
ATOM 4510  C C    . VAL A 1 4   ? 20.174  -25.887 -16.069 1.00 0.00 ? 4   VAL A C    3  
ATOM 4511  O O    . VAL A 1 4   ? 21.254  -25.299 -16.009 1.00 0.00 ? 4   VAL A O    3  
ATOM 4512  C CB   . VAL A 1 4   ? 20.728  -26.716 -13.781 1.00 0.00 ? 4   VAL A CB   3  
ATOM 4513  C CG1  . VAL A 1 4   ? 20.683  -25.331 -13.154 1.00 0.00 ? 4   VAL A CG1  3  
ATOM 4514  C CG2  . VAL A 1 4   ? 20.445  -27.790 -12.742 1.00 0.00 ? 4   VAL A CG2  3  
ATOM 4515  H H    . VAL A 1 4   ? 20.377  -28.641 -15.793 1.00 0.00 ? 4   VAL A H    3  
ATOM 4516  H HA   . VAL A 1 4   ? 18.758  -26.491 -14.589 1.00 0.00 ? 4   VAL A HA   3  
ATOM 4517  H HB   . VAL A 1 4   ? 21.721  -26.877 -14.173 1.00 0.00 ? 4   VAL A HB   3  
ATOM 4518  H HG11 . VAL A 1 4   ? 19.692  -24.915 -13.269 1.00 0.00 ? 4   VAL A HG11 3  
ATOM 4519  H HG12 . VAL A 1 4   ? 20.924  -25.402 -12.103 1.00 0.00 ? 4   VAL A HG12 3  
ATOM 4520  H HG13 . VAL A 1 4   ? 21.400  -24.690 -13.645 1.00 0.00 ? 4   VAL A HG13 3  
ATOM 4521  H HG21 . VAL A 1 4   ? 19.389  -28.019 -12.741 1.00 0.00 ? 4   VAL A HG21 3  
ATOM 4522  H HG22 . VAL A 1 4   ? 21.006  -28.681 -12.982 1.00 0.00 ? 4   VAL A HG22 3  
ATOM 4523  H HG23 . VAL A 1 4   ? 20.737  -27.433 -11.765 1.00 0.00 ? 4   VAL A HG23 3  
ATOM 4524  N N    . VAL A 1 5   ? 19.337  -25.760 -17.094 1.00 0.00 ? 5   VAL A N    3  
ATOM 4525  C CA   . VAL A 1 5   ? 19.647  -24.902 -18.232 1.00 0.00 ? 5   VAL A CA   3  
ATOM 4526  C C    . VAL A 1 5   ? 20.206  -23.561 -17.772 1.00 0.00 ? 5   VAL A C    3  
ATOM 4527  O O    . VAL A 1 5   ? 21.170  -23.050 -18.342 1.00 0.00 ? 5   VAL A O    3  
ATOM 4528  C CB   . VAL A 1 5   ? 18.401  -24.655 -19.104 1.00 0.00 ? 5   VAL A CB   3  
ATOM 4529  C CG1  . VAL A 1 5   ? 18.015  -25.920 -19.854 1.00 0.00 ? 5   VAL A CG1  3  
ATOM 4530  C CG2  . VAL A 1 5   ? 17.244  -24.157 -18.250 1.00 0.00 ? 5   VAL A CG2  3  
ATOM 4531  H H    . VAL A 1 5   ? 18.491  -26.254 -17.085 1.00 0.00 ? 5   VAL A H    3  
ATOM 4532  H HA   . VAL A 1 5   ? 20.389  -25.403 -18.835 1.00 0.00 ? 5   VAL A HA   3  
ATOM 4533  H HB   . VAL A 1 5   ? 18.640  -23.891 -19.829 1.00 0.00 ? 5   VAL A HB   3  
ATOM 4534  H HG11 . VAL A 1 5   ? 17.781  -26.701 -19.146 1.00 0.00 ? 5   VAL A HG11 3  
ATOM 4535  H HG12 . VAL A 1 5   ? 17.152  -25.723 -20.473 1.00 0.00 ? 5   VAL A HG12 3  
ATOM 4536  H HG13 . VAL A 1 5   ? 18.840  -26.235 -20.476 1.00 0.00 ? 5   VAL A HG13 3  
ATOM 4537  H HG21 . VAL A 1 5   ? 16.340  -24.149 -18.840 1.00 0.00 ? 5   VAL A HG21 3  
ATOM 4538  H HG22 . VAL A 1 5   ? 17.114  -24.813 -17.401 1.00 0.00 ? 5   VAL A HG22 3  
ATOM 4539  H HG23 . VAL A 1 5   ? 17.457  -23.157 -17.903 1.00 0.00 ? 5   VAL A HG23 3  
ATOM 4540  N N    . ALA A 1 6   ? 19.595  -22.994 -16.737 1.00 0.00 ? 6   ALA A N    3  
ATOM 4541  C CA   . ALA A 1 6   ? 20.034  -21.713 -16.198 1.00 0.00 ? 6   ALA A CA   3  
ATOM 4542  C C    . ALA A 1 6   ? 19.410  -21.448 -14.832 1.00 0.00 ? 6   ALA A C    3  
ATOM 4543  O O    . ALA A 1 6   ? 18.502  -22.162 -14.405 1.00 0.00 ? 6   ALA A O    3  
ATOM 4544  C CB   . ALA A 1 6   ? 19.690  -20.589 -17.164 1.00 0.00 ? 6   ALA A CB   3  
ATOM 4545  H H    . ALA A 1 6   ? 18.832  -23.450 -16.324 1.00 0.00 ? 6   ALA A H    3  
ATOM 4546  H HA   . ALA A 1 6   ? 21.109  -21.746 -16.092 1.00 0.00 ? 6   ALA A HA   3  
ATOM 4547  H HB1  . ALA A 1 6   ? 20.057  -20.837 -18.150 1.00 0.00 ? 6   ALA A HB1  3  
ATOM 4548  H HB2  . ALA A 1 6   ? 18.618  -20.461 -17.201 1.00 0.00 ? 6   ALA A HB2  3  
ATOM 4549  H HB3  . ALA A 1 6   ? 20.151  -19.672 -16.829 1.00 0.00 ? 6   ALA A HB3  3  
ATOM 4550  N N    . VAL A 1 7   ? 19.902  -20.419 -14.151 1.00 0.00 ? 7   VAL A N    3  
ATOM 4551  C CA   . VAL A 1 7   ? 19.392  -20.060 -12.833 1.00 0.00 ? 7   VAL A CA   3  
ATOM 4552  C C    . VAL A 1 7   ? 19.522  -18.562 -12.583 1.00 0.00 ? 7   VAL A C    3  
ATOM 4553  O O    . VAL A 1 7   ? 20.482  -17.929 -13.022 1.00 0.00 ? 7   VAL A O    3  
ATOM 4554  C CB   . VAL A 1 7   ? 20.134  -20.822 -11.718 1.00 0.00 ? 7   VAL A CB   3  
ATOM 4555  C CG1  . VAL A 1 7   ? 19.608  -20.411 -10.351 1.00 0.00 ? 7   VAL A CG1  3  
ATOM 4556  C CG2  . VAL A 1 7   ? 20.001  -22.323 -11.921 1.00 0.00 ? 7   VAL A CG2  3  
ATOM 4557  H H    . VAL A 1 7   ? 20.625  -19.887 -14.545 1.00 0.00 ? 7   VAL A H    3  
ATOM 4558  H HA   . VAL A 1 7   ? 18.348  -20.333 -12.794 1.00 0.00 ? 7   VAL A HA   3  
ATOM 4559  H HB   . VAL A 1 7   ? 21.181  -20.564 -11.769 1.00 0.00 ? 7   VAL A HB   3  
ATOM 4560  H HG11 . VAL A 1 7   ? 20.085  -19.492 -10.043 1.00 0.00 ? 7   VAL A HG11 3  
ATOM 4561  H HG12 . VAL A 1 7   ? 18.540  -20.263 -10.405 1.00 0.00 ? 7   VAL A HG12 3  
ATOM 4562  H HG13 . VAL A 1 7   ? 19.829  -21.188 -9.633  1.00 0.00 ? 7   VAL A HG13 3  
ATOM 4563  H HG21 . VAL A 1 7   ? 20.258  -22.833 -11.004 1.00 0.00 ? 7   VAL A HG21 3  
ATOM 4564  H HG22 . VAL A 1 7   ? 18.983  -22.562 -12.192 1.00 0.00 ? 7   VAL A HG22 3  
ATOM 4565  H HG23 . VAL A 1 7   ? 20.667  -22.641 -12.709 1.00 0.00 ? 7   VAL A HG23 3  
ATOM 4566  N N    . VAL A 1 8   ? 18.549  -17.999 -11.873 1.00 0.00 ? 8   VAL A N    3  
ATOM 4567  C CA   . VAL A 1 8   ? 18.554  -16.575 -11.562 1.00 0.00 ? 8   VAL A CA   3  
ATOM 4568  C C    . VAL A 1 8   ? 19.553  -16.258 -10.456 1.00 0.00 ? 8   VAL A C    3  
ATOM 4569  O O    . VAL A 1 8   ? 19.843  -17.100 -9.605  1.00 0.00 ? 8   VAL A O    3  
ATOM 4570  C CB   . VAL A 1 8   ? 17.157  -16.089 -11.132 1.00 0.00 ? 8   VAL A CB   3  
ATOM 4571  C CG1  . VAL A 1 8   ? 16.789  -16.659 -9.771  1.00 0.00 ? 8   VAL A CG1  3  
ATOM 4572  C CG2  . VAL A 1 8   ? 17.104  -14.569 -11.115 1.00 0.00 ? 8   VAL A CG2  3  
ATOM 4573  H H    . VAL A 1 8   ? 17.810  -18.556 -11.550 1.00 0.00 ? 8   VAL A H    3  
ATOM 4574  H HA   . VAL A 1 8   ? 18.839  -16.039 -12.456 1.00 0.00 ? 8   VAL A HA   3  
ATOM 4575  H HB   . VAL A 1 8   ? 16.436  -16.446 -11.853 1.00 0.00 ? 8   VAL A HB   3  
ATOM 4576  H HG11 . VAL A 1 8   ? 16.804  -17.738 -9.816  1.00 0.00 ? 8   VAL A HG11 3  
ATOM 4577  H HG12 . VAL A 1 8   ? 17.502  -16.319 -9.033  1.00 0.00 ? 8   VAL A HG12 3  
ATOM 4578  H HG13 . VAL A 1 8   ? 15.799  -16.324 -9.496  1.00 0.00 ? 8   VAL A HG13 3  
ATOM 4579  H HG21 . VAL A 1 8   ? 16.085  -14.243 -11.258 1.00 0.00 ? 8   VAL A HG21 3  
ATOM 4580  H HG22 . VAL A 1 8   ? 17.468  -14.206 -10.165 1.00 0.00 ? 8   VAL A HG22 3  
ATOM 4581  H HG23 . VAL A 1 8   ? 17.722  -14.178 -11.910 1.00 0.00 ? 8   VAL A HG23 3  
ATOM 4582  N N    . LYS A 1 9   ? 20.078  -15.037 -10.471 1.00 0.00 ? 9   LYS A N    3  
ATOM 4583  C CA   . LYS A 1 9   ? 21.044  -14.606 -9.468  1.00 0.00 ? 9   LYS A CA   3  
ATOM 4584  C C    . LYS A 1 9   ? 20.773  -13.169 -9.034  1.00 0.00 ? 9   LYS A C    3  
ATOM 4585  O O    . LYS A 1 9   ? 21.274  -12.221 -9.640  1.00 0.00 ? 9   LYS A O    3  
ATOM 4586  C CB   . LYS A 1 9   ? 22.467  -14.724 -10.018 1.00 0.00 ? 9   LYS A CB   3  
ATOM 4587  C CG   . LYS A 1 9   ? 22.652  -14.067 -11.375 1.00 0.00 ? 9   LYS A CG   3  
ATOM 4588  C CD   . LYS A 1 9   ? 23.958  -13.293 -11.447 1.00 0.00 ? 9   LYS A CD   3  
ATOM 4589  C CE   . LYS A 1 9   ? 24.276  -12.869 -12.873 1.00 0.00 ? 9   LYS A CE   3  
ATOM 4590  N NZ   . LYS A 1 9   ? 25.059  -13.907 -13.598 1.00 0.00 ? 9   LYS A NZ   3  
ATOM 4591  H H    . LYS A 1 9   ? 19.807  -14.410 -11.175 1.00 0.00 ? 9   LYS A H    3  
ATOM 4592  H HA   . LYS A 1 9   ? 20.944  -15.254 -8.611  1.00 0.00 ? 9   LYS A HA   3  
ATOM 4593  H HB2  . LYS A 1 9   ? 23.149  -14.260 -9.321  1.00 0.00 ? 9   LYS A HB2  3  
ATOM 4594  H HB3  . LYS A 1 9   ? 22.719  -15.770 -10.111 1.00 0.00 ? 9   LYS A HB3  3  
ATOM 4595  H HG2  . LYS A 1 9   ? 22.657  -14.831 -12.138 1.00 0.00 ? 9   LYS A HG2  3  
ATOM 4596  H HG3  . LYS A 1 9   ? 21.831  -13.386 -11.550 1.00 0.00 ? 9   LYS A HG3  3  
ATOM 4597  H HD2  . LYS A 1 9   ? 23.878  -12.410 -10.830 1.00 0.00 ? 9   LYS A HD2  3  
ATOM 4598  H HD3  . LYS A 1 9   ? 24.758  -13.920 -11.080 1.00 0.00 ? 9   LYS A HD3  3  
ATOM 4599  H HE2  . LYS A 1 9   ? 23.350  -12.696 -13.398 1.00 0.00 ? 9   LYS A HE2  3  
ATOM 4600  H HE3  . LYS A 1 9   ? 24.849  -11.954 -12.842 1.00 0.00 ? 9   LYS A HE3  3  
ATOM 4601  H HZ1  . LYS A 1 9   ? 25.201  -13.620 -14.588 1.00 0.00 ? 9   LYS A HZ1  3  
ATOM 4602  H HZ2  . LYS A 1 9   ? 24.552  -14.814 -13.582 1.00 0.00 ? 9   LYS A HZ2  3  
ATOM 4603  H HZ3  . LYS A 1 9   ? 25.988  -14.033 -13.148 1.00 0.00 ? 9   LYS A HZ3  3  
ATOM 4604  N N    . LEU A 1 10  ? 19.978  -13.014 -7.981  1.00 0.00 ? 10  LEU A N    3  
ATOM 4605  C CA   . LEU A 1 10  ? 19.642  -11.692 -7.464  1.00 0.00 ? 10  LEU A CA   3  
ATOM 4606  C C    . LEU A 1 10  ? 19.896  -11.614 -5.962  1.00 0.00 ? 10  LEU A C    3  
ATOM 4607  O O    . LEU A 1 10  ? 20.035  -12.637 -5.293  1.00 0.00 ? 10  LEU A O    3  
ATOM 4608  C CB   . LEU A 1 10  ? 18.178  -11.363 -7.763  1.00 0.00 ? 10  LEU A CB   3  
ATOM 4609  C CG   . LEU A 1 10  ? 17.933  -10.367 -8.896  1.00 0.00 ? 10  LEU A CG   3  
ATOM 4610  C CD1  . LEU A 1 10  ? 16.445  -10.246 -9.188  1.00 0.00 ? 10  LEU A CD1  3  
ATOM 4611  C CD2  . LEU A 1 10  ? 18.522  -9.008  -8.549  1.00 0.00 ? 10  LEU A CD2  3  
ATOM 4612  H H    . LEU A 1 10  ? 19.609  -13.807 -7.539  1.00 0.00 ? 10  LEU A H    3  
ATOM 4613  H HA   . LEU A 1 10  ? 20.274  -10.971 -7.961  1.00 0.00 ? 10  LEU A HA   3  
ATOM 4614  H HB2  . LEU A 1 10  ? 17.678  -12.285 -8.019  1.00 0.00 ? 10  LEU A HB2  3  
ATOM 4615  H HB3  . LEU A 1 10  ? 17.741  -10.956 -6.862  1.00 0.00 ? 10  LEU A HB3  3  
ATOM 4616  H HG   . LEU A 1 10  ? 18.420  -10.724 -9.793  1.00 0.00 ? 10  LEU A HG   3  
ATOM 4617  H HD11 . LEU A 1 10  ? 15.971  -9.672  -8.407  1.00 0.00 ? 10  LEU A HD11 3  
ATOM 4618  H HD12 . LEU A 1 10  ? 16.005  -11.232 -9.228  1.00 0.00 ? 10  LEU A HD12 3  
ATOM 4619  H HD13 . LEU A 1 10  ? 16.303  -9.750  -10.137 1.00 0.00 ? 10  LEU A HD13 3  
ATOM 4620  H HD21 . LEU A 1 10  ? 17.839  -8.474  -7.905  1.00 0.00 ? 10  LEU A HD21 3  
ATOM 4621  H HD22 . LEU A 1 10  ? 18.680  -8.441  -9.456  1.00 0.00 ? 10  LEU A HD22 3  
ATOM 4622  H HD23 . LEU A 1 10  ? 19.465  -9.144  -8.040  1.00 0.00 ? 10  LEU A HD23 3  
ATOM 4623  N N    . GLN A 1 11  ? 19.953  -10.393 -5.439  1.00 0.00 ? 11  GLN A N    3  
ATOM 4624  C CA   . GLN A 1 11  ? 20.188  -10.182 -4.016  1.00 0.00 ? 11  GLN A CA   3  
ATOM 4625  C C    . GLN A 1 11  ? 19.541  -8.884  -3.543  1.00 0.00 ? 11  GLN A C    3  
ATOM 4626  O O    . GLN A 1 11  ? 19.655  -7.847  -4.198  1.00 0.00 ? 11  GLN A O    3  
ATOM 4627  C CB   . GLN A 1 11  ? 21.689  -10.154 -3.724  1.00 0.00 ? 11  GLN A CB   3  
ATOM 4628  C CG   . GLN A 1 11  ? 22.366  -8.859  -4.146  1.00 0.00 ? 11  GLN A CG   3  
ATOM 4629  C CD   . GLN A 1 11  ? 23.841  -8.833  -3.799  1.00 0.00 ? 11  GLN A CD   3  
ATOM 4630  O OE1  . GLN A 1 11  ? 24.662  -9.446  -4.481  1.00 0.00 ? 11  GLN A OE1  3  
ATOM 4631  N NE2  . GLN A 1 11  ? 24.187  -8.119  -2.733  1.00 0.00 ? 11  GLN A NE2  3  
ATOM 4632  H H    . GLN A 1 11  ? 19.834  -9.617  -6.024  1.00 0.00 ? 11  GLN A H    3  
ATOM 4633  H HA   . GLN A 1 11  ? 19.742  -11.007 -3.480  1.00 0.00 ? 11  GLN A HA   3  
ATOM 4634  H HB2  . GLN A 1 11  ? 21.840  -10.285 -2.663  1.00 0.00 ? 11  GLN A HB2  3  
ATOM 4635  H HB3  . GLN A 1 11  ? 22.162  -10.969 -4.251  1.00 0.00 ? 11  GLN A HB3  3  
ATOM 4636  H HG2  . GLN A 1 11  ? 22.261  -8.744  -5.214  1.00 0.00 ? 11  GLN A HG2  3  
ATOM 4637  H HG3  . GLN A 1 11  ? 21.879  -8.035  -3.647  1.00 0.00 ? 11  GLN A HG3  3  
ATOM 4638  H HE21 . GLN A 1 11  ? 23.479  -7.658  -2.237  1.00 0.00 ? 11  GLN A HE21 3  
ATOM 4639  H HE22 . GLN A 1 11  ? 25.134  -8.085  -2.486  1.00 0.00 ? 11  GLN A HE22 3  
ATOM 4640  N N    . LEU A 1 12  ? 18.862  -8.948  -2.404  1.00 0.00 ? 12  LEU A N    3  
ATOM 4641  C CA   . LEU A 1 12  ? 18.196  -7.778  -1.843  1.00 0.00 ? 12  LEU A CA   3  
ATOM 4642  C C    . LEU A 1 12  ? 18.215  -7.818  -0.319  1.00 0.00 ? 12  LEU A C    3  
ATOM 4643  O O    . LEU A 1 12  ? 18.276  -8.882  0.298   1.00 0.00 ? 12  LEU A O    3  
ATOM 4644  C CB   . LEU A 1 12  ? 16.753  -7.699  -2.344  1.00 0.00 ? 12  LEU A CB   3  
ATOM 4645  C CG   . LEU A 1 12  ? 16.544  -7.963  -3.836  1.00 0.00 ? 12  LEU A CG   3  
ATOM 4646  C CD1  . LEU A 1 12  ? 15.083  -8.271  -4.125  1.00 0.00 ? 12  LEU A CD1  3  
ATOM 4647  C CD2  . LEU A 1 12  ? 17.013  -6.771  -4.659  1.00 0.00 ? 12  LEU A CD2  3  
ATOM 4648  H H    . LEU A 1 12  ? 18.806  -9.802  -1.927  1.00 0.00 ? 12  LEU A H    3  
ATOM 4649  H HA   . LEU A 1 12  ? 18.732  -6.901  -2.175  1.00 0.00 ? 12  LEU A HA   3  
ATOM 4650  H HB2  . LEU A 1 12  ? 16.172  -8.425  -1.796  1.00 0.00 ? 12  LEU A HB2  3  
ATOM 4651  H HB3  . LEU A 1 12  ? 16.382  -6.707  -2.128  1.00 0.00 ? 12  LEU A HB3  3  
ATOM 4652  H HG   . LEU A 1 12  ? 17.130  -8.823  -4.128  1.00 0.00 ? 12  LEU A HG   3  
ATOM 4653  H HD11 . LEU A 1 12  ? 14.734  -9.031  -3.443  1.00 0.00 ? 12  LEU A HD11 3  
ATOM 4654  H HD12 . LEU A 1 12  ? 14.984  -8.624  -5.140  1.00 0.00 ? 12  LEU A HD12 3  
ATOM 4655  H HD13 . LEU A 1 12  ? 14.495  -7.374  -3.997  1.00 0.00 ? 12  LEU A HD13 3  
ATOM 4656  H HD21 . LEU A 1 12  ? 17.794  -6.251  -4.125  1.00 0.00 ? 12  LEU A HD21 3  
ATOM 4657  H HD22 . LEU A 1 12  ? 16.183  -6.101  -4.826  1.00 0.00 ? 12  LEU A HD22 3  
ATOM 4658  H HD23 . LEU A 1 12  ? 17.394  -7.117  -5.608  1.00 0.00 ? 12  LEU A HD23 3  
ATOM 4659  N N    . PRO A 1 13  ? 18.161  -6.632  0.306   1.00 0.00 ? 13  PRO A N    3  
ATOM 4660  C CA   . PRO A 1 13  ? 18.169  -6.505  1.766   1.00 0.00 ? 13  PRO A CA   3  
ATOM 4661  C C    . PRO A 1 13  ? 16.875  -7.007  2.398   1.00 0.00 ? 13  PRO A C    3  
ATOM 4662  O O    . PRO A 1 13  ? 15.799  -6.881  1.815   1.00 0.00 ? 13  PRO A O    3  
ATOM 4663  C CB   . PRO A 1 13  ? 18.324  -4.999  1.990   1.00 0.00 ? 13  PRO A CB   3  
ATOM 4664  C CG   . PRO A 1 13  ? 17.773  -4.373  0.756   1.00 0.00 ? 13  PRO A CG   3  
ATOM 4665  C CD   . PRO A 1 13  ? 18.088  -5.324  -0.366  1.00 0.00 ? 13  PRO A CD   3  
ATOM 4666  H HA   . PRO A 1 13  ? 19.008  -7.024  2.205   1.00 0.00 ? 13  PRO A HA   3  
ATOM 4667  H HB2  . PRO A 1 13  ? 17.765  -4.703  2.867   1.00 0.00 ? 13  PRO A HB2  3  
ATOM 4668  H HB3  . PRO A 1 13  ? 19.368  -4.756  2.123   1.00 0.00 ? 13  PRO A HB3  3  
ATOM 4669  H HG2  . PRO A 1 13  ? 16.705  -4.248  0.852   1.00 0.00 ? 13  PRO A HG2  3  
ATOM 4670  H HG3  . PRO A 1 13  ? 18.250  -3.420  0.583   1.00 0.00 ? 13  PRO A HG3  3  
ATOM 4671  H HD2  . PRO A 1 13  ? 17.299  -5.312  -1.103  1.00 0.00 ? 13  PRO A HD2  3  
ATOM 4672  H HD3  . PRO A 1 13  ? 19.035  -5.071  -0.820  1.00 0.00 ? 13  PRO A HD3  3  
ATOM 4673  N N    . ALA A 1 14  ? 16.989  -7.576  3.594   1.00 0.00 ? 14  ALA A N    3  
ATOM 4674  C CA   . ALA A 1 14  ? 15.827  -8.095  4.306   1.00 0.00 ? 14  ALA A CA   3  
ATOM 4675  C C    . ALA A 1 14  ? 14.720  -7.050  4.385   1.00 0.00 ? 14  ALA A C    3  
ATOM 4676  O O    . ALA A 1 14  ? 14.909  -5.972  4.948   1.00 0.00 ? 14  ALA A O    3  
ATOM 4677  C CB   . ALA A 1 14  ? 16.225  -8.552  5.702   1.00 0.00 ? 14  ALA A CB   3  
ATOM 4678  H H    . ALA A 1 14  ? 17.874  -7.647  4.007   1.00 0.00 ? 14  ALA A H    3  
ATOM 4679  H HA   . ALA A 1 14  ? 15.459  -8.954  3.763   1.00 0.00 ? 14  ALA A HA   3  
ATOM 4680  H HB1  . ALA A 1 14  ? 15.519  -8.164  6.421   1.00 0.00 ? 14  ALA A HB1  3  
ATOM 4681  H HB2  . ALA A 1 14  ? 16.222  -9.631  5.741   1.00 0.00 ? 14  ALA A HB2  3  
ATOM 4682  H HB3  . ALA A 1 14  ? 17.214  -8.186  5.932   1.00 0.00 ? 14  ALA A HB3  3  
ATOM 4683  N N    . GLY A 1 15  ? 13.563  -7.376  3.818   1.00 0.00 ? 15  GLY A N    3  
ATOM 4684  C CA   . GLY A 1 15  ? 12.442  -6.453  3.835   1.00 0.00 ? 15  GLY A CA   3  
ATOM 4685  C C    . GLY A 1 15  ? 12.669  -5.248  2.944   1.00 0.00 ? 15  GLY A C    3  
ATOM 4686  O O    . GLY A 1 15  ? 12.918  -4.145  3.430   1.00 0.00 ? 15  GLY A O    3  
ATOM 4687  H H    . GLY A 1 15  ? 13.469  -8.249  3.383   1.00 0.00 ? 15  GLY A H    3  
ATOM 4688  H HA2  . GLY A 1 15  ? 11.557  -6.973  3.501   1.00 0.00 ? 15  GLY A HA2  3  
ATOM 4689  H HA3  . GLY A 1 15  ? 12.287  -6.113  4.848   1.00 0.00 ? 15  GLY A HA3  3  
ATOM 4690  N N    . LYS A 1 16  ? 12.586  -5.459  1.634   1.00 0.00 ? 16  LYS A N    3  
ATOM 4691  C CA   . LYS A 1 16  ? 12.785  -4.382  0.672   1.00 0.00 ? 16  LYS A CA   3  
ATOM 4692  C C    . LYS A 1 16  ? 12.651  -4.898  -0.757  1.00 0.00 ? 16  LYS A C    3  
ATOM 4693  O O    . LYS A 1 16  ? 13.647  -5.203  -1.413  1.00 0.00 ? 16  LYS A O    3  
ATOM 4694  C CB   . LYS A 1 16  ? 14.162  -3.742  0.868   1.00 0.00 ? 16  LYS A CB   3  
ATOM 4695  C CG   . LYS A 1 16  ? 14.106  -2.355  1.483   1.00 0.00 ? 16  LYS A CG   3  
ATOM 4696  C CD   . LYS A 1 16  ? 14.614  -1.296  0.519   1.00 0.00 ? 16  LYS A CD   3  
ATOM 4697  C CE   . LYS A 1 16  ? 13.489  -0.738  -0.340  1.00 0.00 ? 16  LYS A CE   3  
ATOM 4698  N NZ   . LYS A 1 16  ? 13.207  0.690   -0.025  1.00 0.00 ? 16  LYS A NZ   3  
ATOM 4699  H H    . LYS A 1 16  ? 12.385  -6.361  1.307   1.00 0.00 ? 16  LYS A H    3  
ATOM 4700  H HA   . LYS A 1 16  ? 12.023  -3.637  0.846   1.00 0.00 ? 16  LYS A HA   3  
ATOM 4701  H HB2  . LYS A 1 16  ? 14.751  -4.377  1.513   1.00 0.00 ? 16  LYS A HB2  3  
ATOM 4702  H HB3  . LYS A 1 16  ? 14.650  -3.668  -0.093  1.00 0.00 ? 16  LYS A HB3  3  
ATOM 4703  H HG2  . LYS A 1 16  ? 13.083  -2.127  1.744   1.00 0.00 ? 16  LYS A HG2  3  
ATOM 4704  H HG3  . LYS A 1 16  ? 14.718  -2.341  2.374   1.00 0.00 ? 16  LYS A HG3  3  
ATOM 4705  H HD2  . LYS A 1 16  ? 15.055  -0.488  1.084   1.00 0.00 ? 16  LYS A HD2  3  
ATOM 4706  H HD3  . LYS A 1 16  ? 15.361  -1.737  -0.125  1.00 0.00 ? 16  LYS A HD3  3  
ATOM 4707  H HE2  . LYS A 1 16  ? 13.771  -0.820  -1.378  1.00 0.00 ? 16  LYS A HE2  3  
ATOM 4708  H HE3  . LYS A 1 16  ? 12.596  -1.320  -0.163  1.00 0.00 ? 16  LYS A HE3  3  
ATOM 4709  H HZ1  . LYS A 1 16  ? 13.867  1.306   -0.541  1.00 0.00 ? 16  LYS A HZ1  3  
ATOM 4710  H HZ2  . LYS A 1 16  ? 13.317  0.859   0.995   1.00 0.00 ? 16  LYS A HZ2  3  
ATOM 4711  H HZ3  . LYS A 1 16  ? 12.234  0.931   -0.302  1.00 0.00 ? 16  LYS A HZ3  3  
ATOM 4712  N N    . ALA A 1 17  ? 11.414  -4.990  -1.235  1.00 0.00 ? 17  ALA A N    3  
ATOM 4713  C CA   . ALA A 1 17  ? 11.151  -5.466  -2.587  1.00 0.00 ? 17  ALA A CA   3  
ATOM 4714  C C    . ALA A 1 17  ? 10.115  -4.590  -3.285  1.00 0.00 ? 17  ALA A C    3  
ATOM 4715  O O    . ALA A 1 17  ? 9.382   -3.841  -2.638  1.00 0.00 ? 17  ALA A O    3  
ATOM 4716  C CB   . ALA A 1 17  ? 10.686  -6.914  -2.556  1.00 0.00 ? 17  ALA A CB   3  
ATOM 4717  H H    . ALA A 1 17  ? 10.661  -4.732  -0.664  1.00 0.00 ? 17  ALA A H    3  
ATOM 4718  H HA   . ALA A 1 17  ? 12.077  -5.422  -3.142  1.00 0.00 ? 17  ALA A HA   3  
ATOM 4719  H HB1  . ALA A 1 17  ? 10.404  -7.222  -3.553  1.00 0.00 ? 17  ALA A HB1  3  
ATOM 4720  H HB2  . ALA A 1 17  ? 11.488  -7.542  -2.198  1.00 0.00 ? 17  ALA A HB2  3  
ATOM 4721  H HB3  . ALA A 1 17  ? 9.835   -7.005  -1.898  1.00 0.00 ? 17  ALA A HB3  3  
ATOM 4722  N N    . THR A 1 18  ? 10.060  -4.689  -4.610  1.00 0.00 ? 18  THR A N    3  
ATOM 4723  C CA   . THR A 1 18  ? 9.116   -3.904  -5.395  1.00 0.00 ? 18  THR A CA   3  
ATOM 4724  C C    . THR A 1 18  ? 8.511   -4.737  -6.520  1.00 0.00 ? 18  THR A C    3  
ATOM 4725  O O    . THR A 1 18  ? 9.056   -5.763  -6.927  1.00 0.00 ? 18  THR A O    3  
ATOM 4726  C CB   . THR A 1 18  ? 9.787   -2.657  -6.000  1.00 0.00 ? 18  THR A CB   3  
ATOM 4727  O OG1  . THR A 1 18  ? 11.172  -2.920  -6.252  1.00 0.00 ? 18  THR A OG1  3  
ATOM 4728  C CG2  . THR A 1 18  ? 9.654   -1.464  -5.066  1.00 0.00 ? 18  THR A CG2  3  
ATOM 4729  H H    . THR A 1 18  ? 10.670  -5.303  -5.068  1.00 0.00 ? 18  THR A H    3  
ATOM 4730  H HA   . THR A 1 18  ? 8.324   -3.578  -4.737  1.00 0.00 ? 18  THR A HA   3  
ATOM 4731  H HB   . THR A 1 18  ? 9.298   -2.420  -6.934  1.00 0.00 ? 18  THR A HB   3  
ATOM 4732  H HG1  . THR A 1 18  ? 11.433  -2.499  -7.075  1.00 0.00 ? 18  THR A HG1  3  
ATOM 4733  H HG21 . THR A 1 18  ? 10.301  -0.668  -5.404  1.00 0.00 ? 18  THR A HG21 3  
ATOM 4734  H HG22 . THR A 1 18  ? 9.937   -1.757  -4.065  1.00 0.00 ? 18  THR A HG22 3  
ATOM 4735  H HG23 . THR A 1 18  ? 8.631   -1.120  -5.065  1.00 0.00 ? 18  THR A HG23 3  
ATOM 4736  N N    . PRO A 1 19  ? 7.357   -4.288  -7.035  1.00 0.00 ? 19  PRO A N    3  
ATOM 4737  C CA   . PRO A 1 19  ? 6.653   -4.977  -8.121  1.00 0.00 ? 19  PRO A CA   3  
ATOM 4738  C C    . PRO A 1 19  ? 7.398   -4.879  -9.448  1.00 0.00 ? 19  PRO A C    3  
ATOM 4739  O O    . PRO A 1 19  ? 7.066   -5.572  -10.410 1.00 0.00 ? 19  PRO A O    3  
ATOM 4740  C CB   . PRO A 1 19  ? 5.315   -4.238  -8.203  1.00 0.00 ? 19  PRO A CB   3  
ATOM 4741  C CG   . PRO A 1 19  ? 5.598   -2.882  -7.655  1.00 0.00 ? 19  PRO A CG   3  
ATOM 4742  C CD   . PRO A 1 19  ? 6.650   -3.073  -6.598  1.00 0.00 ? 19  PRO A CD   3  
ATOM 4743  H HA   . PRO A 1 19  ? 6.479   -6.017  -7.884  1.00 0.00 ? 19  PRO A HA   3  
ATOM 4744  H HB2  . PRO A 1 19  ? 4.990   -4.190  -9.232  1.00 0.00 ? 19  PRO A HB2  3  
ATOM 4745  H HB3  . PRO A 1 19  ? 4.577   -4.757  -7.610  1.00 0.00 ? 19  PRO A HB3  3  
ATOM 4746  H HG2  . PRO A 1 19  ? 5.968   -2.239  -8.440  1.00 0.00 ? 19  PRO A HG2  3  
ATOM 4747  H HG3  . PRO A 1 19  ? 4.701   -2.467  -7.220  1.00 0.00 ? 19  PRO A HG3  3  
ATOM 4748  H HD2  . PRO A 1 19  ? 7.319   -2.225  -6.574  1.00 0.00 ? 19  PRO A HD2  3  
ATOM 4749  H HD3  . PRO A 1 19  ? 6.191   -3.221  -5.632  1.00 0.00 ? 19  PRO A HD3  3  
ATOM 4750  N N    . ALA A 1 20  ? 8.406   -4.015  -9.493  1.00 0.00 ? 20  ALA A N    3  
ATOM 4751  C CA   . ALA A 1 20  ? 9.199   -3.828  -10.702 1.00 0.00 ? 20  ALA A CA   3  
ATOM 4752  C C    . ALA A 1 20  ? 10.670  -4.142  -10.448 1.00 0.00 ? 20  ALA A C    3  
ATOM 4753  O O    . ALA A 1 20  ? 11.540  -3.277  -10.543 1.00 0.00 ? 20  ALA A O    3  
ATOM 4754  C CB   . ALA A 1 20  ? 9.044   -2.406  -11.221 1.00 0.00 ? 20  ALA A CB   3  
ATOM 4755  H H    . ALA A 1 20  ? 8.623   -3.491  -8.694  1.00 0.00 ? 20  ALA A H    3  
ATOM 4756  H HA   . ALA A 1 20  ? 8.822   -4.504  -11.456 1.00 0.00 ? 20  ALA A HA   3  
ATOM 4757  H HB1  . ALA A 1 20  ? 9.318   -2.373  -12.265 1.00 0.00 ? 20  ALA A HB1  3  
ATOM 4758  H HB2  . ALA A 1 20  ? 8.017   -2.092  -11.108 1.00 0.00 ? 20  ALA A HB2  3  
ATOM 4759  H HB3  . ALA A 1 20  ? 9.687   -1.746  -10.659 1.00 0.00 ? 20  ALA A HB3  3  
ATOM 4760  N N    . PRO A 1 21  ? 10.956  -5.410  -10.116 1.00 0.00 ? 21  PRO A N    3  
ATOM 4761  C CA   . PRO A 1 21  ? 12.321  -5.868  -9.841  1.00 0.00 ? 21  PRO A CA   3  
ATOM 4762  C C    . PRO A 1 21  ? 13.186  -5.898  -11.096 1.00 0.00 ? 21  PRO A C    3  
ATOM 4763  O O    . PRO A 1 21  ? 12.699  -5.757  -12.218 1.00 0.00 ? 21  PRO A O    3  
ATOM 4764  C CB   . PRO A 1 21  ? 12.118  -7.284  -9.298  1.00 0.00 ? 21  PRO A CB   3  
ATOM 4765  C CG   . PRO A 1 21  ? 10.820  -7.729  -9.877  1.00 0.00 ? 21  PRO A CG   3  
ATOM 4766  C CD   . PRO A 1 21  ? 9.969   -6.495  -9.984  1.00 0.00 ? 21  PRO A CD   3  
ATOM 4767  H HA   . PRO A 1 21  ? 12.800  -5.257  -9.089  1.00 0.00 ? 21  PRO A HA   3  
ATOM 4768  H HB2  . PRO A 1 21  ? 12.933  -7.916  -9.620  1.00 0.00 ? 21  PRO A HB2  3  
ATOM 4769  H HB3  . PRO A 1 21  ? 12.080  -7.258  -8.219  1.00 0.00 ? 21  PRO A HB3  3  
ATOM 4770  H HG2  . PRO A 1 21  ? 10.982  -8.159  -10.854 1.00 0.00 ? 21  PRO A HG2  3  
ATOM 4771  H HG3  . PRO A 1 21  ? 10.354  -8.450  -9.222  1.00 0.00 ? 21  PRO A HG3  3  
ATOM 4772  H HD2  . PRO A 1 21  ? 9.335   -6.548  -10.857 1.00 0.00 ? 21  PRO A HD2  3  
ATOM 4773  H HD3  . PRO A 1 21  ? 9.374   -6.368  -9.091  1.00 0.00 ? 21  PRO A HD3  3  
ATOM 4774  N N    . PRO A 1 22  ? 14.501  -6.085  -10.906 1.00 0.00 ? 22  PRO A N    3  
ATOM 4775  C CA   . PRO A 1 22  ? 15.461  -6.139  -12.012 1.00 0.00 ? 22  PRO A CA   3  
ATOM 4776  C C    . PRO A 1 22  ? 15.304  -7.399  -12.855 1.00 0.00 ? 22  PRO A C    3  
ATOM 4777  O O    . PRO A 1 22  ? 15.926  -7.535  -13.909 1.00 0.00 ? 22  PRO A O    3  
ATOM 4778  C CB   . PRO A 1 22  ? 16.818  -6.135  -11.304 1.00 0.00 ? 22  PRO A CB   3  
ATOM 4779  C CG   . PRO A 1 22  ? 16.542  -6.701  -9.954  1.00 0.00 ? 22  PRO A CG   3  
ATOM 4780  C CD   . PRO A 1 22  ? 15.150  -6.260  -9.596  1.00 0.00 ? 22  PRO A CD   3  
ATOM 4781  H HA   . PRO A 1 22  ? 15.383  -5.269  -12.648 1.00 0.00 ? 22  PRO A HA   3  
ATOM 4782  H HB2  . PRO A 1 22  ? 17.516  -6.749  -11.856 1.00 0.00 ? 22  PRO A HB2  3  
ATOM 4783  H HB3  . PRO A 1 22  ? 17.192  -5.124  -11.239 1.00 0.00 ? 22  PRO A HB3  3  
ATOM 4784  H HG2  . PRO A 1 22  ? 16.597  -7.779  -9.989  1.00 0.00 ? 22  PRO A HG2  3  
ATOM 4785  H HG3  . PRO A 1 22  ? 17.254  -6.312  -9.241  1.00 0.00 ? 22  PRO A HG3  3  
ATOM 4786  H HD2  . PRO A 1 22  ? 14.650  -7.021  -9.016  1.00 0.00 ? 22  PRO A HD2  3  
ATOM 4787  H HD3  . PRO A 1 22  ? 15.178  -5.327  -9.053  1.00 0.00 ? 22  PRO A HD3  3  
ATOM 4788  N N    . VAL A 1 23  ? 14.467  -8.320  -12.386 1.00 0.00 ? 23  VAL A N    3  
ATOM 4789  C CA   . VAL A 1 23  ? 14.227  -9.569  -13.098 1.00 0.00 ? 23  VAL A CA   3  
ATOM 4790  C C    . VAL A 1 23  ? 12.761  -9.702  -13.495 1.00 0.00 ? 23  VAL A C    3  
ATOM 4791  O O    . VAL A 1 23  ? 12.351  -10.710 -14.069 1.00 0.00 ? 23  VAL A O    3  
ATOM 4792  C CB   . VAL A 1 23  ? 14.629  -10.787 -12.246 1.00 0.00 ? 23  VAL A CB   3  
ATOM 4793  C CG1  . VAL A 1 23  ? 13.664  -10.968 -11.084 1.00 0.00 ? 23  VAL A CG1  3  
ATOM 4794  C CG2  . VAL A 1 23  ? 14.684  -12.042 -13.104 1.00 0.00 ? 23  VAL A CG2  3  
ATOM 4795  H H    . VAL A 1 23  ? 14.000  -8.154  -11.541 1.00 0.00 ? 23  VAL A H    3  
ATOM 4796  H HA   . VAL A 1 23  ? 14.833  -9.566  -13.992 1.00 0.00 ? 23  VAL A HA   3  
ATOM 4797  H HB   . VAL A 1 23  ? 15.615  -10.609 -11.842 1.00 0.00 ? 23  VAL A HB   3  
ATOM 4798  H HG11 . VAL A 1 23  ? 13.369  -10.000 -10.708 1.00 0.00 ? 23  VAL A HG11 3  
ATOM 4799  H HG12 . VAL A 1 23  ? 12.791  -11.507 -11.421 1.00 0.00 ? 23  VAL A HG12 3  
ATOM 4800  H HG13 . VAL A 1 23  ? 14.150  -11.526 -10.297 1.00 0.00 ? 23  VAL A HG13 3  
ATOM 4801  H HG21 . VAL A 1 23  ? 15.258  -12.801 -12.593 1.00 0.00 ? 23  VAL A HG21 3  
ATOM 4802  H HG22 . VAL A 1 23  ? 13.682  -12.405 -13.277 1.00 0.00 ? 23  VAL A HG22 3  
ATOM 4803  H HG23 . VAL A 1 23  ? 15.152  -11.812 -14.050 1.00 0.00 ? 23  VAL A HG23 3  
ATOM 4804  N N    . GLY A 1 24  ? 11.974  -8.676  -13.186 1.00 0.00 ? 24  GLY A N    3  
ATOM 4805  C CA   . GLY A 1 24  ? 10.562  -8.697  -13.518 1.00 0.00 ? 24  GLY A CA   3  
ATOM 4806  C C    . GLY A 1 24  ? 10.305  -9.194  -14.927 1.00 0.00 ? 24  GLY A C    3  
ATOM 4807  O O    . GLY A 1 24  ? 9.732   -10.264 -15.137 1.00 0.00 ? 24  GLY A O    3  
ATOM 4808  H H    . GLY A 1 24  ? 12.356  -7.898  -12.728 1.00 0.00 ? 24  GLY A H    3  
ATOM 4809  H HA2  . GLY A 1 24  ? 10.049  -9.343  -12.821 1.00 0.00 ? 24  GLY A HA2  3  
ATOM 4810  H HA3  . GLY A 1 24  ? 10.166  -7.696  -13.425 1.00 0.00 ? 24  GLY A HA3  3  
ATOM 4811  N N    . PRO A 1 25  ? 10.734  -8.406  -15.924 1.00 0.00 ? 25  PRO A N    3  
ATOM 4812  C CA   . PRO A 1 25  ? 10.558  -8.751  -17.338 1.00 0.00 ? 25  PRO A CA   3  
ATOM 4813  C C    . PRO A 1 25  ? 11.431  -9.928  -17.761 1.00 0.00 ? 25  PRO A C    3  
ATOM 4814  O O    . PRO A 1 25  ? 11.312  -10.432 -18.877 1.00 0.00 ? 25  PRO A O    3  
ATOM 4815  C CB   . PRO A 1 25  ? 10.986  -7.477  -18.070 1.00 0.00 ? 25  PRO A CB   3  
ATOM 4816  C CG   . PRO A 1 25  ? 11.921  -6.796  -17.131 1.00 0.00 ? 25  PRO A CG   3  
ATOM 4817  C CD   . PRO A 1 25  ? 11.426  -7.118  -15.748 1.00 0.00 ? 25  PRO A CD   3  
ATOM 4818  H HA   . PRO A 1 25  ? 9.525   -8.970  -17.567 1.00 0.00 ? 25  PRO A HA   3  
ATOM 4819  H HB2  . PRO A 1 25  ? 11.478  -7.739  -18.997 1.00 0.00 ? 25  PRO A HB2  3  
ATOM 4820  H HB3  . PRO A 1 25  ? 10.120  -6.867  -18.276 1.00 0.00 ? 25  PRO A HB3  3  
ATOM 4821  H HG2  . PRO A 1 25  ? 12.922  -7.177  -17.268 1.00 0.00 ? 25  PRO A HG2  3  
ATOM 4822  H HG3  . PRO A 1 25  ? 11.897  -5.730  -17.298 1.00 0.00 ? 25  PRO A HG3  3  
ATOM 4823  H HD2  . PRO A 1 25  ? 12.255  -7.215  -15.063 1.00 0.00 ? 25  PRO A HD2  3  
ATOM 4824  H HD3  . PRO A 1 25  ? 10.739  -6.357  -15.407 1.00 0.00 ? 25  PRO A HD3  3  
ATOM 4825  N N    . ALA A 1 26  ? 12.308  -10.361 -16.861 1.00 0.00 ? 26  ALA A N    3  
ATOM 4826  C CA   . ALA A 1 26  ? 13.200  -11.480 -17.141 1.00 0.00 ? 26  ALA A CA   3  
ATOM 4827  C C    . ALA A 1 26  ? 12.708  -12.755 -16.465 1.00 0.00 ? 26  ALA A C    3  
ATOM 4828  O O    . ALA A 1 26  ? 13.333  -13.811 -16.578 1.00 0.00 ? 26  ALA A O    3  
ATOM 4829  C CB   . ALA A 1 26  ? 14.615  -11.153 -16.689 1.00 0.00 ? 26  ALA A CB   3  
ATOM 4830  H H    . ALA A 1 26  ? 12.356  -9.918  -15.989 1.00 0.00 ? 26  ALA A H    3  
ATOM 4831  H HA   . ALA A 1 26  ? 13.216  -11.635 -18.210 1.00 0.00 ? 26  ALA A HA   3  
ATOM 4832  H HB1  . ALA A 1 26  ? 15.033  -10.396 -17.337 1.00 0.00 ? 26  ALA A HB1  3  
ATOM 4833  H HB2  . ALA A 1 26  ? 14.593  -10.786 -15.674 1.00 0.00 ? 26  ALA A HB2  3  
ATOM 4834  H HB3  . ALA A 1 26  ? 15.223  -12.044 -16.738 1.00 0.00 ? 26  ALA A HB3  3  
ATOM 4835  N N    . LEU A 1 27  ? 11.586  -12.652 -15.761 1.00 0.00 ? 27  LEU A N    3  
ATOM 4836  C CA   . LEU A 1 27  ? 11.011  -13.797 -15.065 1.00 0.00 ? 27  LEU A CA   3  
ATOM 4837  C C    . LEU A 1 27  ? 9.648   -14.160 -15.647 1.00 0.00 ? 27  LEU A C    3  
ATOM 4838  O O    . LEU A 1 27  ? 9.174   -15.284 -15.490 1.00 0.00 ? 27  LEU A O    3  
ATOM 4839  C CB   . LEU A 1 27  ? 10.877  -13.497 -13.571 1.00 0.00 ? 27  LEU A CB   3  
ATOM 4840  C CG   . LEU A 1 27  ? 9.553   -12.873 -13.128 1.00 0.00 ? 27  LEU A CG   3  
ATOM 4841  C CD1  . LEU A 1 27  ? 8.607   -13.943 -12.604 1.00 0.00 ? 27  LEU A CD1  3  
ATOM 4842  C CD2  . LEU A 1 27  ? 9.794   -11.806 -12.070 1.00 0.00 ? 27  LEU A CD2  3  
ATOM 4843  H H    . LEU A 1 27  ? 11.134  -11.785 -15.707 1.00 0.00 ? 27  LEU A H    3  
ATOM 4844  H HA   . LEU A 1 27  ? 11.680  -14.635 -15.197 1.00 0.00 ? 27  LEU A HA   3  
ATOM 4845  H HB2  . LEU A 1 27  ? 11.000  -14.425 -13.035 1.00 0.00 ? 27  LEU A HB2  3  
ATOM 4846  H HB3  . LEU A 1 27  ? 11.672  -12.818 -13.298 1.00 0.00 ? 27  LEU A HB3  3  
ATOM 4847  H HG   . LEU A 1 27  ? 9.082   -12.401 -13.979 1.00 0.00 ? 27  LEU A HG   3  
ATOM 4848  H HD11 . LEU A 1 27  ? 8.983   -14.918 -12.874 1.00 0.00 ? 27  LEU A HD11 3  
ATOM 4849  H HD12 . LEU A 1 27  ? 7.628   -13.801 -13.037 1.00 0.00 ? 27  LEU A HD12 3  
ATOM 4850  H HD13 . LEU A 1 27  ? 8.540   -13.867 -11.528 1.00 0.00 ? 27  LEU A HD13 3  
ATOM 4851  H HD21 . LEU A 1 27  ? 9.105   -10.989 -12.221 1.00 0.00 ? 27  LEU A HD21 3  
ATOM 4852  H HD22 . LEU A 1 27  ? 10.808  -11.442 -12.150 1.00 0.00 ? 27  LEU A HD22 3  
ATOM 4853  H HD23 . LEU A 1 27  ? 9.640   -12.231 -11.089 1.00 0.00 ? 27  LEU A HD23 3  
ATOM 4854  N N    . GLY A 1 28  ? 9.024   -13.199 -16.322 1.00 0.00 ? 28  GLY A N    3  
ATOM 4855  C CA   . GLY A 1 28  ? 7.723   -13.437 -16.919 1.00 0.00 ? 28  GLY A CA   3  
ATOM 4856  C C    . GLY A 1 28  ? 7.703   -14.678 -17.789 1.00 0.00 ? 28  GLY A C    3  
ATOM 4857  O O    . GLY A 1 28  ? 6.655   -15.295 -17.977 1.00 0.00 ? 28  GLY A O    3  
ATOM 4858  H H    . GLY A 1 28  ? 9.451   -12.321 -16.414 1.00 0.00 ? 28  GLY A H    3  
ATOM 4859  H HA2  . GLY A 1 28  ? 6.993   -13.550 -16.131 1.00 0.00 ? 28  GLY A HA2  3  
ATOM 4860  H HA3  . GLY A 1 28  ? 7.456   -12.583 -17.524 1.00 0.00 ? 28  GLY A HA3  3  
ATOM 4861  N N    . GLN A 1 29  ? 8.864   -15.044 -18.323 1.00 0.00 ? 29  GLN A N    3  
ATOM 4862  C CA   . GLN A 1 29  ? 8.974   -16.218 -19.180 1.00 0.00 ? 29  GLN A CA   3  
ATOM 4863  C C    . GLN A 1 29  ? 8.351   -17.439 -18.513 1.00 0.00 ? 29  GLN A C    3  
ATOM 4864  O O    . GLN A 1 29  ? 7.836   -18.333 -19.187 1.00 0.00 ? 29  GLN A O    3  
ATOM 4865  C CB   . GLN A 1 29  ? 10.441  -16.497 -19.513 1.00 0.00 ? 29  GLN A CB   3  
ATOM 4866  C CG   . GLN A 1 29  ? 10.707  -16.665 -21.000 1.00 0.00 ? 29  GLN A CG   3  
ATOM 4867  C CD   . GLN A 1 29  ? 11.014  -15.350 -21.690 1.00 0.00 ? 29  GLN A CD   3  
ATOM 4868  O OE1  . GLN A 1 29  ? 11.192  -14.321 -21.039 1.00 0.00 ? 29  GLN A OE1  3  
ATOM 4869  N NE2  . GLN A 1 29  ? 11.079  -15.379 -23.016 1.00 0.00 ? 29  GLN A NE2  3  
ATOM 4870  H H    . GLN A 1 29  ? 9.665   -14.511 -18.136 1.00 0.00 ? 29  GLN A H    3  
ATOM 4871  H HA   . GLN A 1 29  ? 8.441   -16.011 -20.095 1.00 0.00 ? 29  GLN A HA   3  
ATOM 4872  H HB2  . GLN A 1 29  ? 11.042  -15.675 -19.152 1.00 0.00 ? 29  GLN A HB2  3  
ATOM 4873  H HB3  . GLN A 1 29  ? 10.746  -17.403 -19.010 1.00 0.00 ? 29  GLN A HB3  3  
ATOM 4874  H HG2  . GLN A 1 29  ? 11.550  -17.327 -21.130 1.00 0.00 ? 29  GLN A HG2  3  
ATOM 4875  H HG3  . GLN A 1 29  ? 9.833   -17.101 -21.461 1.00 0.00 ? 29  GLN A HG3  3  
ATOM 4876  H HE21 . GLN A 1 29  ? 10.926  -16.235 -23.468 1.00 0.00 ? 29  GLN A HE21 3  
ATOM 4877  H HE22 . GLN A 1 29  ? 11.276  -14.544 -23.488 1.00 0.00 ? 29  GLN A HE22 3  
ATOM 4878  N N    . HIS A 1 30  ? 8.400   -17.472 -17.185 1.00 0.00 ? 30  HIS A N    3  
ATOM 4879  C CA   . HIS A 1 30  ? 7.840   -18.585 -16.427 1.00 0.00 ? 30  HIS A CA   3  
ATOM 4880  C C    . HIS A 1 30  ? 6.404   -18.286 -16.004 1.00 0.00 ? 30  HIS A C    3  
ATOM 4881  O O    . HIS A 1 30  ? 5.611   -19.198 -15.778 1.00 0.00 ? 30  HIS A O    3  
ATOM 4882  C CB   . HIS A 1 30  ? 8.697   -18.872 -15.194 1.00 0.00 ? 30  HIS A CB   3  
ATOM 4883  C CG   . HIS A 1 30  ? 8.988   -20.328 -14.993 1.00 0.00 ? 30  HIS A CG   3  
ATOM 4884  N ND1  . HIS A 1 30  ? 8.062   -21.218 -14.492 1.00 0.00 ? 30  HIS A ND1  3  
ATOM 4885  C CD2  . HIS A 1 30  ? 10.109  -21.047 -15.230 1.00 0.00 ? 30  HIS A CD2  3  
ATOM 4886  C CE1  . HIS A 1 30  ? 8.602   -22.422 -14.428 1.00 0.00 ? 30  HIS A CE1  3  
ATOM 4887  N NE2  . HIS A 1 30  ? 9.844   -22.346 -14.871 1.00 0.00 ? 30  HIS A NE2  3  
ATOM 4888  H H    . HIS A 1 30  ? 8.823   -16.731 -16.704 1.00 0.00 ? 30  HIS A H    3  
ATOM 4889  H HA   . HIS A 1 30  ? 7.840   -19.455 -17.065 1.00 0.00 ? 30  HIS A HA   3  
ATOM 4890  H HB2  . HIS A 1 30  ? 9.641   -18.356 -15.291 1.00 0.00 ? 30  HIS A HB2  3  
ATOM 4891  H HB3  . HIS A 1 30  ? 8.184   -18.511 -14.314 1.00 0.00 ? 30  HIS A HB3  3  
ATOM 4892  H HD1  . HIS A 1 30  ? 7.146   -21.000 -14.221 1.00 0.00 ? 30  HIS A HD1  3  
ATOM 4893  H HD2  . HIS A 1 30  ? 11.041  -20.671 -15.628 1.00 0.00 ? 30  HIS A HD2  3  
ATOM 4894  H HE1  . HIS A 1 30  ? 8.112   -23.317 -14.075 1.00 0.00 ? 30  HIS A HE1  3  
ATOM 4895  N N    . GLY A 1 31  ? 6.078   -17.001 -15.900 1.00 0.00 ? 31  GLY A N    3  
ATOM 4896  C CA   . GLY A 1 31  ? 4.739   -16.605 -15.504 1.00 0.00 ? 31  GLY A CA   3  
ATOM 4897  C C    . GLY A 1 31  ? 4.406   -17.024 -14.086 1.00 0.00 ? 31  GLY A C    3  
ATOM 4898  O O    . GLY A 1 31  ? 3.482   -17.804 -13.863 1.00 0.00 ? 31  GLY A O    3  
ATOM 4899  H H    . GLY A 1 31  ? 6.753   -16.317 -16.093 1.00 0.00 ? 31  GLY A H    3  
ATOM 4900  H HA2  . GLY A 1 31  ? 4.656   -15.531 -15.581 1.00 0.00 ? 31  GLY A HA2  3  
ATOM 4901  H HA3  . GLY A 1 31  ? 4.028   -17.061 -16.178 1.00 0.00 ? 31  GLY A HA3  3  
ATOM 4902  N N    . ALA A 1 32  ? 5.163   -16.505 -13.125 1.00 0.00 ? 32  ALA A N    3  
ATOM 4903  C CA   . ALA A 1 32  ? 4.943   -16.829 -11.721 1.00 0.00 ? 32  ALA A CA   3  
ATOM 4904  C C    . ALA A 1 32  ? 4.272   -15.671 -10.989 1.00 0.00 ? 32  ALA A C    3  
ATOM 4905  O O    . ALA A 1 32  ? 4.315   -15.593 -9.762  1.00 0.00 ? 32  ALA A O    3  
ATOM 4906  C CB   . ALA A 1 32  ? 6.261   -17.188 -11.049 1.00 0.00 ? 32  ALA A CB   3  
ATOM 4907  H H    . ALA A 1 32  ? 5.886   -15.888 -13.365 1.00 0.00 ? 32  ALA A H    3  
ATOM 4908  H HA   . ALA A 1 32  ? 4.297   -17.693 -11.675 1.00 0.00 ? 32  ALA A HA   3  
ATOM 4909  H HB1  . ALA A 1 32  ? 6.700   -16.298 -10.622 1.00 0.00 ? 32  ALA A HB1  3  
ATOM 4910  H HB2  . ALA A 1 32  ? 6.081   -17.911 -10.268 1.00 0.00 ? 32  ALA A HB2  3  
ATOM 4911  H HB3  . ALA A 1 32  ? 6.935   -17.607 -11.781 1.00 0.00 ? 32  ALA A HB3  3  
ATOM 4912  N N    . ASN A 1 33  ? 3.654   -14.774 -11.750 1.00 0.00 ? 33  ASN A N    3  
ATOM 4913  C CA   . ASN A 1 33  ? 2.975   -13.620 -11.173 1.00 0.00 ? 33  ASN A CA   3  
ATOM 4914  C C    . ASN A 1 33  ? 3.956   -12.741 -10.403 1.00 0.00 ? 33  ASN A C    3  
ATOM 4915  O O    . ASN A 1 33  ? 4.444   -13.123 -9.339  1.00 0.00 ? 33  ASN A O    3  
ATOM 4916  C CB   . ASN A 1 33  ? 1.846   -14.076 -10.247 1.00 0.00 ? 33  ASN A CB   3  
ATOM 4917  C CG   . ASN A 1 33  ? 1.291   -12.941 -9.409  1.00 0.00 ? 33  ASN A CG   3  
ATOM 4918  O OD1  . ASN A 1 33  ? 1.406   -11.771 -9.775  1.00 0.00 ? 33  ASN A OD1  3  
ATOM 4919  N ND2  . ASN A 1 33  ? 0.683   -13.281 -8.279  1.00 0.00 ? 33  ASN A ND2  3  
ATOM 4920  H H    . ASN A 1 33  ? 3.655   -14.891 -12.723 1.00 0.00 ? 33  ASN A H    3  
ATOM 4921  H HA   . ASN A 1 33  ? 2.554   -13.044 -11.983 1.00 0.00 ? 33  ASN A HA   3  
ATOM 4922  H HB2  . ASN A 1 33  ? 1.043   -14.485 -10.843 1.00 0.00 ? 33  ASN A HB2  3  
ATOM 4923  H HB3  . ASN A 1 33  ? 2.220   -14.840 -9.582  1.00 0.00 ? 33  ASN A HB3  3  
ATOM 4924  H HD21 . ASN A 1 33  ? 0.629   -14.233 -8.051  1.00 0.00 ? 33  ASN A HD21 3  
ATOM 4925  H HD22 . ASN A 1 33  ? 0.314   -12.567 -7.719  1.00 0.00 ? 33  ASN A HD22 3  
ATOM 4926  N N    . ILE A 1 34  ? 4.239   -11.562 -10.947 1.00 0.00 ? 34  ILE A N    3  
ATOM 4927  C CA   . ILE A 1 34  ? 5.160   -10.629 -10.310 1.00 0.00 ? 34  ILE A CA   3  
ATOM 4928  C C    . ILE A 1 34  ? 4.818   -10.439 -8.836  1.00 0.00 ? 34  ILE A C    3  
ATOM 4929  O O    . ILE A 1 34  ? 5.706   -10.380 -7.986  1.00 0.00 ? 34  ILE A O    3  
ATOM 4930  C CB   . ILE A 1 34  ? 5.144   -9.257  -11.010 1.00 0.00 ? 34  ILE A CB   3  
ATOM 4931  C CG1  . ILE A 1 34  ? 5.425   -9.419  -12.505 1.00 0.00 ? 34  ILE A CG1  3  
ATOM 4932  C CG2  . ILE A 1 34  ? 6.164   -8.325  -10.372 1.00 0.00 ? 34  ILE A CG2  3  
ATOM 4933  C CD1  . ILE A 1 34  ? 6.727   -10.130 -12.802 1.00 0.00 ? 34  ILE A CD1  3  
ATOM 4934  H H    . ILE A 1 34  ? 3.818   -11.314 -11.796 1.00 0.00 ? 34  ILE A H    3  
ATOM 4935  H HA   . ILE A 1 34  ? 6.157   -11.039 -10.388 1.00 0.00 ? 34  ILE A HA   3  
ATOM 4936  H HB   . ILE A 1 34  ? 4.165   -8.823  -10.880 1.00 0.00 ? 34  ILE A HB   3  
ATOM 4937  H HG12 . ILE A 1 34  ? 4.627   -9.989  -12.955 1.00 0.00 ? 34  ILE A HG12 3  
ATOM 4938  H HG13 . ILE A 1 34  ? 5.467   -8.442  -12.964 1.00 0.00 ? 34  ILE A HG13 3  
ATOM 4939  H HG21 . ILE A 1 34  ? 5.682   -7.399  -10.096 1.00 0.00 ? 34  ILE A HG21 3  
ATOM 4940  H HG22 . ILE A 1 34  ? 6.576   -8.793  -9.491  1.00 0.00 ? 34  ILE A HG22 3  
ATOM 4941  H HG23 . ILE A 1 34  ? 6.956   -8.122  -11.077 1.00 0.00 ? 34  ILE A HG23 3  
ATOM 4942  H HD11 . ILE A 1 34  ? 6.838   -10.248 -13.870 1.00 0.00 ? 34  ILE A HD11 3  
ATOM 4943  H HD12 . ILE A 1 34  ? 7.551   -9.548  -12.416 1.00 0.00 ? 34  ILE A HD12 3  
ATOM 4944  H HD13 . ILE A 1 34  ? 6.722   -11.102 -12.331 1.00 0.00 ? 34  ILE A HD13 3  
ATOM 4945  N N    . MET A 1 35  ? 3.526   -10.345 -8.541  1.00 0.00 ? 35  MET A N    3  
ATOM 4946  C CA   . MET A 1 35  ? 3.067   -10.166 -7.169  1.00 0.00 ? 35  MET A CA   3  
ATOM 4947  C C    . MET A 1 35  ? 3.492   -11.341 -6.295  1.00 0.00 ? 35  MET A C    3  
ATOM 4948  O O    . MET A 1 35  ? 3.902   -11.157 -5.149  1.00 0.00 ? 35  MET A O    3  
ATOM 4949  C CB   . MET A 1 35  ? 1.545   -10.013 -7.133  1.00 0.00 ? 35  MET A CB   3  
ATOM 4950  C CG   . MET A 1 35  ? 1.082   -8.648  -6.650  1.00 0.00 ? 35  MET A CG   3  
ATOM 4951  S SD   . MET A 1 35  ? 0.953   -8.553  -4.854  1.00 0.00 ? 35  MET A SD   3  
ATOM 4952  C CE   . MET A 1 35  ? 2.559   -7.880  -4.434  1.00 0.00 ? 35  MET A CE   3  
ATOM 4953  H H    . MET A 1 35  ? 2.865   -10.400 -9.263  1.00 0.00 ? 35  MET A H    3  
ATOM 4954  H HA   . MET A 1 35  ? 3.519   -9.264  -6.784  1.00 0.00 ? 35  MET A HA   3  
ATOM 4955  H HB2  . MET A 1 35  ? 1.156   -10.170 -8.128  1.00 0.00 ? 35  MET A HB2  3  
ATOM 4956  H HB3  . MET A 1 35  ? 1.135   -10.762 -6.473  1.00 0.00 ? 35  MET A HB3  3  
ATOM 4957  H HG2  . MET A 1 35  ? 1.789   -7.903  -6.985  1.00 0.00 ? 35  MET A HG2  3  
ATOM 4958  H HG3  . MET A 1 35  ? 0.113   -8.439  -7.079  1.00 0.00 ? 35  MET A HG3  3  
ATOM 4959  H HE1  . MET A 1 35  ? 3.211   -8.679  -4.113  1.00 0.00 ? 35  MET A HE1  3  
ATOM 4960  H HE2  . MET A 1 35  ? 2.984   -7.395  -5.301  1.00 0.00 ? 35  MET A HE2  3  
ATOM 4961  H HE3  . MET A 1 35  ? 2.450   -7.161  -3.636  1.00 0.00 ? 35  MET A HE3  3  
ATOM 4962  N N    . GLU A 1 36  ? 3.391   -12.548 -6.843  1.00 0.00 ? 36  GLU A N    3  
ATOM 4963  C CA   . GLU A 1 36  ? 3.764   -13.753 -6.112  1.00 0.00 ? 36  GLU A CA   3  
ATOM 4964  C C    . GLU A 1 36  ? 5.280   -13.853 -5.965  1.00 0.00 ? 36  GLU A C    3  
ATOM 4965  O O    . GLU A 1 36  ? 5.785   -14.473 -5.029  1.00 0.00 ? 36  GLU A O    3  
ATOM 4966  C CB   . GLU A 1 36  ? 3.226   -14.996 -6.823  1.00 0.00 ? 36  GLU A CB   3  
ATOM 4967  C CG   . GLU A 1 36  ? 2.430   -15.919 -5.917  1.00 0.00 ? 36  GLU A CG   3  
ATOM 4968  C CD   . GLU A 1 36  ? 3.082   -16.112 -4.562  1.00 0.00 ? 36  GLU A CD   3  
ATOM 4969  O OE1  . GLU A 1 36  ? 4.172   -16.718 -4.508  1.00 0.00 ? 36  GLU A OE1  3  
ATOM 4970  O OE2  . GLU A 1 36  ? 2.502   -15.655 -3.554  1.00 0.00 ? 36  GLU A OE2  3  
ATOM 4971  H H    . GLU A 1 36  ? 3.056   -12.630 -7.761  1.00 0.00 ? 36  GLU A H    3  
ATOM 4972  H HA   . GLU A 1 36  ? 3.323   -13.693 -5.128  1.00 0.00 ? 36  GLU A HA   3  
ATOM 4973  H HB2  . GLU A 1 36  ? 2.587   -14.683 -7.636  1.00 0.00 ? 36  GLU A HB2  3  
ATOM 4974  H HB3  . GLU A 1 36  ? 4.059   -15.553 -7.227  1.00 0.00 ? 36  GLU A HB3  3  
ATOM 4975  H HG2  . GLU A 1 36  ? 1.447   -15.498 -5.769  1.00 0.00 ? 36  GLU A HG2  3  
ATOM 4976  H HG3  . GLU A 1 36  ? 2.339   -16.883 -6.397  1.00 0.00 ? 36  GLU A HG3  3  
ATOM 4977  N N    . PHE A 1 37  ? 6.000   -13.238 -6.898  1.00 0.00 ? 37  PHE A N    3  
ATOM 4978  C CA   . PHE A 1 37  ? 7.458   -13.259 -6.875  1.00 0.00 ? 37  PHE A CA   3  
ATOM 4979  C C    . PHE A 1 37  ? 7.997   -12.346 -5.778  1.00 0.00 ? 37  PHE A C    3  
ATOM 4980  O O    . PHE A 1 37  ? 8.848   -12.746 -4.984  1.00 0.00 ? 37  PHE A O    3  
ATOM 4981  C CB   . PHE A 1 37  ? 8.017   -12.829 -8.233  1.00 0.00 ? 37  PHE A CB   3  
ATOM 4982  C CG   . PHE A 1 37  ? 9.419   -13.304 -8.482  1.00 0.00 ? 37  PHE A CG   3  
ATOM 4983  C CD1  . PHE A 1 37  ? 9.704   -14.658 -8.552  1.00 0.00 ? 37  PHE A CD1  3  
ATOM 4984  C CD2  . PHE A 1 37  ? 10.454  -12.397 -8.647  1.00 0.00 ? 37  PHE A CD2  3  
ATOM 4985  C CE1  . PHE A 1 37  ? 10.994  -15.098 -8.779  1.00 0.00 ? 37  PHE A CE1  3  
ATOM 4986  C CE2  . PHE A 1 37  ? 11.746  -12.831 -8.876  1.00 0.00 ? 37  PHE A CE2  3  
ATOM 4987  C CZ   . PHE A 1 37  ? 12.016  -14.183 -8.943  1.00 0.00 ? 37  PHE A CZ   3  
ATOM 4988  H H    . PHE A 1 37  ? 5.540   -12.760 -7.620  1.00 0.00 ? 37  PHE A H    3  
ATOM 4989  H HA   . PHE A 1 37  ? 7.771   -14.271 -6.671  1.00 0.00 ? 37  PHE A HA   3  
ATOM 4990  H HB2  . PHE A 1 37  ? 7.388   -13.227 -9.015  1.00 0.00 ? 37  PHE A HB2  3  
ATOM 4991  H HB3  . PHE A 1 37  ? 8.015   -11.751 -8.290  1.00 0.00 ? 37  PHE A HB3  3  
ATOM 4992  H HD1  . PHE A 1 37  ? 8.906   -15.375 -8.425  1.00 0.00 ? 37  PHE A HD1  3  
ATOM 4993  H HD2  . PHE A 1 37  ? 10.243  -11.338 -8.594  1.00 0.00 ? 37  PHE A HD2  3  
ATOM 4994  H HE1  . PHE A 1 37  ? 11.203  -16.157 -8.832  1.00 0.00 ? 37  PHE A HE1  3  
ATOM 4995  H HE2  . PHE A 1 37  ? 12.542  -12.113 -9.003  1.00 0.00 ? 37  PHE A HE2  3  
ATOM 4996  H HZ   . PHE A 1 37  ? 13.025  -14.525 -9.121  1.00 0.00 ? 37  PHE A HZ   3  
ATOM 4997  N N    . VAL A 1 38  ? 7.497   -11.115 -5.742  1.00 0.00 ? 38  VAL A N    3  
ATOM 4998  C CA   . VAL A 1 38  ? 7.927   -10.144 -4.743  1.00 0.00 ? 38  VAL A CA   3  
ATOM 4999  C C    . VAL A 1 38  ? 7.459   -10.546 -3.349  1.00 0.00 ? 38  VAL A C    3  
ATOM 5000  O O    . VAL A 1 38  ? 8.230   -10.510 -2.389  1.00 0.00 ? 38  VAL A O    3  
ATOM 5001  C CB   . VAL A 1 38  ? 7.395   -8.734  -5.064  1.00 0.00 ? 38  VAL A CB   3  
ATOM 5002  C CG1  . VAL A 1 38  ? 7.872   -7.733  -4.024  1.00 0.00 ? 38  VAL A CG1  3  
ATOM 5003  C CG2  . VAL A 1 38  ? 7.822   -8.310  -6.461  1.00 0.00 ? 38  VAL A CG2  3  
ATOM 5004  H H    . VAL A 1 38  ? 6.821   -10.854 -6.402  1.00 0.00 ? 38  VAL A H    3  
ATOM 5005  H HA   . VAL A 1 38  ? 9.007   -10.109 -4.754  1.00 0.00 ? 38  VAL A HA   3  
ATOM 5006  H HB   . VAL A 1 38  ? 6.315   -8.764  -5.035  1.00 0.00 ? 38  VAL A HB   3  
ATOM 5007  H HG11 . VAL A 1 38  ? 7.027   -7.376  -3.454  1.00 0.00 ? 38  VAL A HG11 3  
ATOM 5008  H HG12 . VAL A 1 38  ? 8.580   -8.211  -3.362  1.00 0.00 ? 38  VAL A HG12 3  
ATOM 5009  H HG13 . VAL A 1 38  ? 8.349   -6.899  -4.519  1.00 0.00 ? 38  VAL A HG13 3  
ATOM 5010  H HG21 . VAL A 1 38  ? 7.402   -7.341  -6.687  1.00 0.00 ? 38  VAL A HG21 3  
ATOM 5011  H HG22 . VAL A 1 38  ? 8.901   -8.254  -6.507  1.00 0.00 ? 38  VAL A HG22 3  
ATOM 5012  H HG23 . VAL A 1 38  ? 7.470   -9.033  -7.181  1.00 0.00 ? 38  VAL A HG23 3  
ATOM 5013  N N    . LYS A 1 39  ? 6.191   -10.928 -3.243  1.00 0.00 ? 39  LYS A N    3  
ATOM 5014  C CA   . LYS A 1 39  ? 5.619   -11.340 -1.967  1.00 0.00 ? 39  LYS A CA   3  
ATOM 5015  C C    . LYS A 1 39  ? 6.389   -12.519 -1.380  1.00 0.00 ? 39  LYS A C    3  
ATOM 5016  O O    . LYS A 1 39  ? 6.348   -12.760 -0.174  1.00 0.00 ? 39  LYS A O    3  
ATOM 5017  C CB   . LYS A 1 39  ? 4.146   -11.715 -2.142  1.00 0.00 ? 39  LYS A CB   3  
ATOM 5018  C CG   . LYS A 1 39  ? 3.216   -10.516 -2.204  1.00 0.00 ? 39  LYS A CG   3  
ATOM 5019  C CD   . LYS A 1 39  ? 2.378   -10.394 -0.943  1.00 0.00 ? 39  LYS A CD   3  
ATOM 5020  C CE   . LYS A 1 39  ? 3.012   -9.441  0.059   1.00 0.00 ? 39  LYS A CE   3  
ATOM 5021  N NZ   . LYS A 1 39  ? 4.161   -10.067 0.769   1.00 0.00 ? 39  LYS A NZ   3  
ATOM 5022  H H    . LYS A 1 39  ? 5.626   -10.936 -4.045  1.00 0.00 ? 39  LYS A H    3  
ATOM 5023  H HA   . LYS A 1 39  ? 5.691   -10.504 -1.287  1.00 0.00 ? 39  LYS A HA   3  
ATOM 5024  H HB2  . LYS A 1 39  ? 4.036   -12.277 -3.057  1.00 0.00 ? 39  LYS A HB2  3  
ATOM 5025  H HB3  . LYS A 1 39  ? 3.844   -12.335 -1.310  1.00 0.00 ? 39  LYS A HB3  3  
ATOM 5026  H HG2  . LYS A 1 39  ? 3.807   -9.619  -2.318  1.00 0.00 ? 39  LYS A HG2  3  
ATOM 5027  H HG3  . LYS A 1 39  ? 2.558   -10.626 -3.054  1.00 0.00 ? 39  LYS A HG3  3  
ATOM 5028  H HD2  . LYS A 1 39  ? 1.399   -10.022 -1.206  1.00 0.00 ? 39  LYS A HD2  3  
ATOM 5029  H HD3  . LYS A 1 39  ? 2.284   -11.370 -0.488  1.00 0.00 ? 39  LYS A HD3  3  
ATOM 5030  H HE2  . LYS A 1 39  ? 3.360   -8.565  -0.468  1.00 0.00 ? 39  LYS A HE2  3  
ATOM 5031  H HE3  . LYS A 1 39  ? 2.266   -9.152  0.784   1.00 0.00 ? 39  LYS A HE3  3  
ATOM 5032  H HZ1  . LYS A 1 39  ? 5.051   -9.612  0.480   1.00 0.00 ? 39  LYS A HZ1  3  
ATOM 5033  H HZ2  . LYS A 1 39  ? 4.213   -11.080 0.541   1.00 0.00 ? 39  LYS A HZ2  3  
ATOM 5034  H HZ3  . LYS A 1 39  ? 4.048   -9.960  1.797   1.00 0.00 ? 39  LYS A HZ3  3  
ATOM 5035  N N    . ALA A 1 40  ? 7.090   -13.249 -2.241  1.00 0.00 ? 40  ALA A N    3  
ATOM 5036  C CA   . ALA A 1 40  ? 7.872   -14.400 -1.807  1.00 0.00 ? 40  ALA A CA   3  
ATOM 5037  C C    . ALA A 1 40  ? 9.177   -13.962 -1.151  1.00 0.00 ? 40  ALA A C    3  
ATOM 5038  O O    . ALA A 1 40  ? 9.925   -14.785 -0.623  1.00 0.00 ? 40  ALA A O    3  
ATOM 5039  C CB   . ALA A 1 40  ? 8.154   -15.321 -2.985  1.00 0.00 ? 40  ALA A CB   3  
ATOM 5040  H H    . ALA A 1 40  ? 7.083   -13.006 -3.190  1.00 0.00 ? 40  ALA A H    3  
ATOM 5041  H HA   . ALA A 1 40  ? 7.284   -14.950 -1.085  1.00 0.00 ? 40  ALA A HA   3  
ATOM 5042  H HB1  . ALA A 1 40  ? 7.241   -15.486 -3.538  1.00 0.00 ? 40  ALA A HB1  3  
ATOM 5043  H HB2  . ALA A 1 40  ? 8.889   -14.863 -3.631  1.00 0.00 ? 40  ALA A HB2  3  
ATOM 5044  H HB3  . ALA A 1 40  ? 8.532   -16.265 -2.622  1.00 0.00 ? 40  ALA A HB3  3  
ATOM 5045  N N    . PHE A 1 41  ? 9.445   -12.661 -1.189  1.00 0.00 ? 41  PHE A N    3  
ATOM 5046  C CA   . PHE A 1 41  ? 10.661  -12.114 -0.599  1.00 0.00 ? 41  PHE A CA   3  
ATOM 5047  C C    . PHE A 1 41  ? 10.328  -11.101 0.493   1.00 0.00 ? 41  PHE A C    3  
ATOM 5048  O O    . PHE A 1 41  ? 10.943  -11.097 1.559   1.00 0.00 ? 41  PHE A O    3  
ATOM 5049  C CB   . PHE A 1 41  ? 11.524  -11.454 -1.677  1.00 0.00 ? 41  PHE A CB   3  
ATOM 5050  C CG   . PHE A 1 41  ? 12.880  -12.081 -1.827  1.00 0.00 ? 41  PHE A CG   3  
ATOM 5051  C CD1  . PHE A 1 41  ? 13.012  -13.454 -1.961  1.00 0.00 ? 41  PHE A CD1  3  
ATOM 5052  C CD2  . PHE A 1 41  ? 14.023  -11.298 -1.832  1.00 0.00 ? 41  PHE A CD2  3  
ATOM 5053  C CE1  . PHE A 1 41  ? 14.259  -14.034 -2.100  1.00 0.00 ? 41  PHE A CE1  3  
ATOM 5054  C CE2  . PHE A 1 41  ? 15.272  -11.873 -1.971  1.00 0.00 ? 41  PHE A CE2  3  
ATOM 5055  C CZ   . PHE A 1 41  ? 15.390  -13.243 -2.104  1.00 0.00 ? 41  PHE A CZ   3  
ATOM 5056  H H    . PHE A 1 41  ? 8.810   -12.055 -1.624  1.00 0.00 ? 41  PHE A H    3  
ATOM 5057  H HA   . PHE A 1 41  ? 11.212  -12.931 -0.159  1.00 0.00 ? 41  PHE A HA   3  
ATOM 5058  H HB2  . PHE A 1 41  ? 11.018  -11.527 -2.627  1.00 0.00 ? 41  PHE A HB2  3  
ATOM 5059  H HB3  . PHE A 1 41  ? 11.664  -10.413 -1.427  1.00 0.00 ? 41  PHE A HB3  3  
ATOM 5060  H HD1  . PHE A 1 41  ? 12.127  -14.074 -1.958  1.00 0.00 ? 41  PHE A HD1  3  
ATOM 5061  H HD2  . PHE A 1 41  ? 13.933  -10.227 -1.727  1.00 0.00 ? 41  PHE A HD2  3  
ATOM 5062  H HE1  . PHE A 1 41  ? 14.347  -15.106 -2.204  1.00 0.00 ? 41  PHE A HE1  3  
ATOM 5063  H HE2  . PHE A 1 41  ? 16.156  -11.252 -1.973  1.00 0.00 ? 41  PHE A HE2  3  
ATOM 5064  H HZ   . PHE A 1 41  ? 16.365  -13.694 -2.212  1.00 0.00 ? 41  PHE A HZ   3  
ATOM 5065  N N    . ASN A 1 42  ? 9.351   -10.244 0.218   1.00 0.00 ? 42  ASN A N    3  
ATOM 5066  C CA   . ASN A 1 42  ? 8.936   -9.225  1.176   1.00 0.00 ? 42  ASN A CA   3  
ATOM 5067  C C    . ASN A 1 42  ? 8.474   -9.863  2.483   1.00 0.00 ? 42  ASN A C    3  
ATOM 5068  O O    . ASN A 1 42  ? 8.514   -9.234  3.540   1.00 0.00 ? 42  ASN A O    3  
ATOM 5069  C CB   . ASN A 1 42  ? 7.812   -8.370  0.588   1.00 0.00 ? 42  ASN A CB   3  
ATOM 5070  C CG   . ASN A 1 42  ? 8.206   -6.911  0.453   1.00 0.00 ? 42  ASN A CG   3  
ATOM 5071  O OD1  . ASN A 1 42  ? 8.880   -6.356  1.321   1.00 0.00 ? 42  ASN A OD1  3  
ATOM 5072  N ND2  . ASN A 1 42  ? 7.784   -6.283  -0.639  1.00 0.00 ? 42  ASN A ND2  3  
ATOM 5073  H H    . ASN A 1 42  ? 8.898   -10.297 -0.649  1.00 0.00 ? 42  ASN A H    3  
ATOM 5074  H HA   . ASN A 1 42  ? 9.788   -8.594  1.378   1.00 0.00 ? 42  ASN A HA   3  
ATOM 5075  H HB2  . ASN A 1 42  ? 7.557   -8.746  -0.393  1.00 0.00 ? 42  ASN A HB2  3  
ATOM 5076  H HB3  . ASN A 1 42  ? 6.946   -8.433  1.229   1.00 0.00 ? 42  ASN A HB3  3  
ATOM 5077  H HD21 . ASN A 1 42  ? 7.251   -6.789  -1.287  1.00 0.00 ? 42  ASN A HD21 3  
ATOM 5078  H HD22 . ASN A 1 42  ? 8.025   -5.340  -0.751  1.00 0.00 ? 42  ASN A HD22 3  
ATOM 5079  N N    . ALA A 1 43  ? 8.037   -11.115 2.401   1.00 0.00 ? 43  ALA A N    3  
ATOM 5080  C CA   . ALA A 1 43  ? 7.570   -11.839 3.577   1.00 0.00 ? 43  ALA A CA   3  
ATOM 5081  C C    . ALA A 1 43  ? 8.556   -12.932 3.976   1.00 0.00 ? 43  ALA A C    3  
ATOM 5082  O O    . ALA A 1 43  ? 8.335   -13.656 4.947   1.00 0.00 ? 43  ALA A O    3  
ATOM 5083  C CB   . ALA A 1 43  ? 6.194   -12.436 3.318   1.00 0.00 ? 43  ALA A CB   3  
ATOM 5084  H H    . ALA A 1 43  ? 8.029   -11.563 1.530   1.00 0.00 ? 43  ALA A H    3  
ATOM 5085  H HA   . ALA A 1 43  ? 7.481   -11.133 4.390   1.00 0.00 ? 43  ALA A HA   3  
ATOM 5086  H HB1  . ALA A 1 43  ? 6.007   -12.457 2.254   1.00 0.00 ? 43  ALA A HB1  3  
ATOM 5087  H HB2  . ALA A 1 43  ? 6.159   -13.441 3.710   1.00 0.00 ? 43  ALA A HB2  3  
ATOM 5088  H HB3  . ALA A 1 43  ? 5.443   -11.832 3.804   1.00 0.00 ? 43  ALA A HB3  3  
ATOM 5089  N N    . ALA A 1 44  ? 9.643   -13.046 3.221   1.00 0.00 ? 44  ALA A N    3  
ATOM 5090  C CA   . ALA A 1 44  ? 10.664  -14.049 3.498   1.00 0.00 ? 44  ALA A CA   3  
ATOM 5091  C C    . ALA A 1 44  ? 11.919  -13.410 4.080   1.00 0.00 ? 44  ALA A C    3  
ATOM 5092  O O    . ALA A 1 44  ? 12.328  -13.723 5.199   1.00 0.00 ? 44  ALA A O    3  
ATOM 5093  C CB   . ALA A 1 44  ? 11.001  -14.822 2.231   1.00 0.00 ? 44  ALA A CB   3  
ATOM 5094  H H    . ALA A 1 44  ? 9.763   -12.439 2.461   1.00 0.00 ? 44  ALA A H    3  
ATOM 5095  H HA   . ALA A 1 44  ? 10.260  -14.746 4.218   1.00 0.00 ? 44  ALA A HA   3  
ATOM 5096  H HB1  . ALA A 1 44  ? 10.885  -14.174 1.374   1.00 0.00 ? 44  ALA A HB1  3  
ATOM 5097  H HB2  . ALA A 1 44  ? 12.021  -15.171 2.283   1.00 0.00 ? 44  ALA A HB2  3  
ATOM 5098  H HB3  . ALA A 1 44  ? 10.335  -15.667 2.137   1.00 0.00 ? 44  ALA A HB3  3  
ATOM 5099  N N    . THR A 1 45  ? 12.530  -12.511 3.313   1.00 0.00 ? 45  THR A N    3  
ATOM 5100  C CA   . THR A 1 45  ? 13.741  -11.829 3.752   1.00 0.00 ? 45  THR A CA   3  
ATOM 5101  C C    . THR A 1 45  ? 13.456  -10.909 4.934   1.00 0.00 ? 45  THR A C    3  
ATOM 5102  O O    . THR A 1 45  ? 14.199  -10.895 5.915   1.00 0.00 ? 45  THR A O    3  
ATOM 5103  C CB   . THR A 1 45  ? 14.365  -11.003 2.612   1.00 0.00 ? 45  THR A CB   3  
ATOM 5104  O OG1  . THR A 1 45  ? 13.611  -9.802  2.408   1.00 0.00 ? 45  THR A OG1  3  
ATOM 5105  C CG2  . THR A 1 45  ? 14.407  -11.807 1.321   1.00 0.00 ? 45  THR A CG2  3  
ATOM 5106  H H    . THR A 1 45  ? 12.157  -12.304 2.431   1.00 0.00 ? 45  THR A H    3  
ATOM 5107  H HA   . THR A 1 45  ? 14.455  -12.580 4.057   1.00 0.00 ? 45  THR A HA   3  
ATOM 5108  H HB   . THR A 1 45  ? 15.376  -10.741 2.889   1.00 0.00 ? 45  THR A HB   3  
ATOM 5109  H HG1  . THR A 1 45  ? 12.834  -9.998  1.879   1.00 0.00 ? 45  THR A HG1  3  
ATOM 5110  H HG21 . THR A 1 45  ? 15.111  -11.355 0.638   1.00 0.00 ? 45  THR A HG21 3  
ATOM 5111  H HG22 . THR A 1 45  ? 13.425  -11.817 0.871   1.00 0.00 ? 45  THR A HG22 3  
ATOM 5112  H HG23 . THR A 1 45  ? 14.714  -12.819 1.538   1.00 0.00 ? 45  THR A HG23 3  
ATOM 5113  N N    . ALA A 1 46  ? 12.375  -10.142 4.834   1.00 0.00 ? 46  ALA A N    3  
ATOM 5114  C CA   . ALA A 1 46  ? 11.991  -9.221  5.896   1.00 0.00 ? 46  ALA A CA   3  
ATOM 5115  C C    . ALA A 1 46  ? 11.938  -9.930  7.245   1.00 0.00 ? 46  ALA A C    3  
ATOM 5116  O O    . ALA A 1 46  ? 12.184  -9.323  8.286   1.00 0.00 ? 46  ALA A O    3  
ATOM 5117  C CB   . ALA A 1 46  ? 10.646  -8.583  5.581   1.00 0.00 ? 46  ALA A CB   3  
ATOM 5118  H H    . ALA A 1 46  ? 11.823  -10.198 4.027   1.00 0.00 ? 46  ALA A H    3  
ATOM 5119  H HA   . ALA A 1 46  ? 12.732  -8.437  5.942   1.00 0.00 ? 46  ALA A HA   3  
ATOM 5120  H HB1  . ALA A 1 46  ? 9.855   -9.185  6.003   1.00 0.00 ? 46  ALA A HB1  3  
ATOM 5121  H HB2  . ALA A 1 46  ? 10.610  -7.591  6.006   1.00 0.00 ? 46  ALA A HB2  3  
ATOM 5122  H HB3  . ALA A 1 46  ? 10.520  -8.521  4.510   1.00 0.00 ? 46  ALA A HB3  3  
ATOM 5123  N N    . ASN A 1 47  ? 11.616  -11.220 7.219   1.00 0.00 ? 47  ASN A N    3  
ATOM 5124  C CA   . ASN A 1 47  ? 11.530  -12.011 8.440   1.00 0.00 ? 47  ASN A CA   3  
ATOM 5125  C C    . ASN A 1 47  ? 12.880  -12.635 8.780   1.00 0.00 ? 47  ASN A C    3  
ATOM 5126  O O    . ASN A 1 47  ? 12.972  -13.833 9.050   1.00 0.00 ? 47  ASN A O    3  
ATOM 5127  C CB   . ASN A 1 47  ? 10.473  -13.107 8.290   1.00 0.00 ? 47  ASN A CB   3  
ATOM 5128  C CG   . ASN A 1 47  ? 9.984   -13.626 9.628   1.00 0.00 ? 47  ASN A CG   3  
ATOM 5129  O OD1  . ASN A 1 47  ? 10.702  -14.338 10.330  1.00 0.00 ? 47  ASN A OD1  3  
ATOM 5130  N ND2  . ASN A 1 47  ? 8.755   -13.272 9.987   1.00 0.00 ? 47  ASN A ND2  3  
ATOM 5131  H H    . ASN A 1 47  ? 11.432  -11.649 6.357   1.00 0.00 ? 47  ASN A H    3  
ATOM 5132  H HA   . ASN A 1 47  ? 11.240  -11.351 9.243   1.00 0.00 ? 47  ASN A HA   3  
ATOM 5133  H HB2  . ASN A 1 47  ? 9.626   -12.710 7.749   1.00 0.00 ? 47  ASN A HB2  3  
ATOM 5134  H HB3  . ASN A 1 47  ? 10.894  -13.932 7.736   1.00 0.00 ? 47  ASN A HB3  3  
ATOM 5135  H HD21 . ASN A 1 47  ? 8.240   -12.703 9.377   1.00 0.00 ? 47  ASN A HD21 3  
ATOM 5136  H HD22 . ASN A 1 47  ? 8.414   -13.593 10.847  1.00 0.00 ? 47  ASN A HD22 3  
ATOM 5137  N N    . MET A 1 48  ? 13.926  -11.815 8.765   1.00 0.00 ? 48  MET A N    3  
ATOM 5138  C CA   . MET A 1 48  ? 15.271  -12.286 9.074   1.00 0.00 ? 48  MET A CA   3  
ATOM 5139  C C    . MET A 1 48  ? 16.009  -11.285 9.956   1.00 0.00 ? 48  MET A C    3  
ATOM 5140  O O    . MET A 1 48  ? 16.355  -11.586 11.098  1.00 0.00 ? 48  MET A O    3  
ATOM 5141  C CB   . MET A 1 48  ? 16.059  -12.526 7.784   1.00 0.00 ? 48  MET A CB   3  
ATOM 5142  C CG   . MET A 1 48  ? 16.881  -13.804 7.803   1.00 0.00 ? 48  MET A CG   3  
ATOM 5143  S SD   . MET A 1 48  ? 15.989  -15.213 7.117   1.00 0.00 ? 48  MET A SD   3  
ATOM 5144  C CE   . MET A 1 48  ? 16.651  -15.256 5.453   1.00 0.00 ? 48  MET A CE   3  
ATOM 5145  H H    . MET A 1 48  ? 13.790  -10.870 8.542   1.00 0.00 ? 48  MET A H    3  
ATOM 5146  H HA   . MET A 1 48  ? 15.180  -13.220 9.608   1.00 0.00 ? 48  MET A HA   3  
ATOM 5147  H HB2  . MET A 1 48  ? 15.366  -12.580 6.958   1.00 0.00 ? 48  MET A HB2  3  
ATOM 5148  H HB3  . MET A 1 48  ? 16.730  -11.695 7.627   1.00 0.00 ? 48  MET A HB3  3  
ATOM 5149  H HG2  . MET A 1 48  ? 17.778  -13.648 7.223   1.00 0.00 ? 48  MET A HG2  3  
ATOM 5150  H HG3  . MET A 1 48  ? 17.150  -14.028 8.825   1.00 0.00 ? 48  MET A HG3  3  
ATOM 5151  H HE1  . MET A 1 48  ? 17.593  -15.784 5.454   1.00 0.00 ? 48  MET A HE1  3  
ATOM 5152  H HE2  . MET A 1 48  ? 15.955  -15.763 4.802   1.00 0.00 ? 48  MET A HE2  3  
ATOM 5153  H HE3  . MET A 1 48  ? 16.805  -14.246 5.102   1.00 0.00 ? 48  MET A HE3  3  
ATOM 5154  N N    . GLY A 1 49  ? 16.247  -10.092 9.419   1.00 0.00 ? 49  GLY A N    3  
ATOM 5155  C CA   . GLY A 1 49  ? 16.943  -9.065  10.172  1.00 0.00 ? 49  GLY A CA   3  
ATOM 5156  C C    . GLY A 1 49  ? 17.329  -7.877  9.312   1.00 0.00 ? 49  GLY A C    3  
ATOM 5157  O O    . GLY A 1 49  ? 16.465  -7.190  8.766   1.00 0.00 ? 49  GLY A O    3  
ATOM 5158  H H    . GLY A 1 49  ? 15.947  -9.908  8.504   1.00 0.00 ? 49  GLY A H    3  
ATOM 5159  H HA2  . GLY A 1 49  ? 16.302  -8.724  10.971  1.00 0.00 ? 49  GLY A HA2  3  
ATOM 5160  H HA3  . GLY A 1 49  ? 17.838  -9.492  10.598  1.00 0.00 ? 49  GLY A HA3  3  
ATOM 5161  N N    . ASP A 1 50  ? 18.629  -7.634  9.192   1.00 0.00 ? 50  ASP A N    3  
ATOM 5162  C CA   . ASP A 1 50  ? 19.128  -6.521  8.393   1.00 0.00 ? 50  ASP A CA   3  
ATOM 5163  C C    . ASP A 1 50  ? 20.300  -6.960  7.521   1.00 0.00 ? 50  ASP A C    3  
ATOM 5164  O O    . ASP A 1 50  ? 21.355  -6.326  7.517   1.00 0.00 ? 50  ASP A O    3  
ATOM 5165  C CB   . ASP A 1 50  ? 19.556  -5.366  9.300   1.00 0.00 ? 50  ASP A CB   3  
ATOM 5166  C CG   . ASP A 1 50  ? 19.306  -4.010  8.668   1.00 0.00 ? 50  ASP A CG   3  
ATOM 5167  O OD1  . ASP A 1 50  ? 18.266  -3.853  7.993   1.00 0.00 ? 50  ASP A OD1  3  
ATOM 5168  O OD2  . ASP A 1 50  ? 20.148  -3.107  8.850   1.00 0.00 ? 50  ASP A OD2  3  
ATOM 5169  H H    . ASP A 1 50  ? 19.269  -8.218  9.651   1.00 0.00 ? 50  ASP A H    3  
ATOM 5170  H HA   . ASP A 1 50  ? 18.326  -6.186  7.753   1.00 0.00 ? 50  ASP A HA   3  
ATOM 5171  H HB2  . ASP A 1 50  ? 19.001  -5.418  10.225  1.00 0.00 ? 50  ASP A HB2  3  
ATOM 5172  H HB3  . ASP A 1 50  ? 20.611  -5.455  9.512   1.00 0.00 ? 50  ASP A HB3  3  
ATOM 5173  N N    . ALA A 1 51  ? 20.108  -8.050  6.785   1.00 0.00 ? 51  ALA A N    3  
ATOM 5174  C CA   . ALA A 1 51  ? 21.149  -8.573  5.909   1.00 0.00 ? 51  ALA A CA   3  
ATOM 5175  C C    . ALA A 1 51  ? 20.602  -8.852  4.513   1.00 0.00 ? 51  ALA A C    3  
ATOM 5176  O O    . ALA A 1 51  ? 19.406  -8.701  4.263   1.00 0.00 ? 51  ALA A O    3  
ATOM 5177  C CB   . ALA A 1 51  ? 21.753  -9.837  6.504   1.00 0.00 ? 51  ALA A CB   3  
ATOM 5178  H H    . ALA A 1 51  ? 19.245  -8.511  6.831   1.00 0.00 ? 51  ALA A H    3  
ATOM 5179  H HA   . ALA A 1 51  ? 21.930  -7.830  5.837   1.00 0.00 ? 51  ALA A HA   3  
ATOM 5180  H HB1  . ALA A 1 51  ? 21.997  -9.664  7.542   1.00 0.00 ? 51  ALA A HB1  3  
ATOM 5181  H HB2  . ALA A 1 51  ? 21.041  -10.645 6.430   1.00 0.00 ? 51  ALA A HB2  3  
ATOM 5182  H HB3  . ALA A 1 51  ? 22.650  -10.096 5.961   1.00 0.00 ? 51  ALA A HB3  3  
ATOM 5183  N N    . ILE A 1 52  ? 21.485  -9.259  3.607   1.00 0.00 ? 52  ILE A N    3  
ATOM 5184  C CA   . ILE A 1 52  ? 21.090  -9.559  2.237   1.00 0.00 ? 52  ILE A CA   3  
ATOM 5185  C C    . ILE A 1 52  ? 20.788  -11.044 2.064   1.00 0.00 ? 52  ILE A C    3  
ATOM 5186  O O    . ILE A 1 52  ? 21.568  -11.900 2.482   1.00 0.00 ? 52  ILE A O    3  
ATOM 5187  C CB   . ILE A 1 52  ? 22.183  -9.149  1.233   1.00 0.00 ? 52  ILE A CB   3  
ATOM 5188  C CG1  . ILE A 1 52  ? 22.482  -7.653  1.354   1.00 0.00 ? 52  ILE A CG1  3  
ATOM 5189  C CG2  . ILE A 1 52  ? 21.757  -9.496  -0.186  1.00 0.00 ? 52  ILE A CG2  3  
ATOM 5190  C CD1  . ILE A 1 52  ? 21.308  -6.771  0.989   1.00 0.00 ? 52  ILE A CD1  3  
ATOM 5191  H H    . ILE A 1 52  ? 22.424  -9.360  3.867   1.00 0.00 ? 52  ILE A H    3  
ATOM 5192  H HA   . ILE A 1 52  ? 20.196  -8.993  2.017   1.00 0.00 ? 52  ILE A HA   3  
ATOM 5193  H HB   . ILE A 1 52  ? 23.078  -9.707  1.461   1.00 0.00 ? 52  ILE A HB   3  
ATOM 5194  H HG12 . ILE A 1 52  ? 22.761  -7.429  2.371   1.00 0.00 ? 52  ILE A HG12 3  
ATOM 5195  H HG13 . ILE A 1 52  ? 23.303  -7.403  0.697   1.00 0.00 ? 52  ILE A HG13 3  
ATOM 5196  H HG21 . ILE A 1 52  ? 21.570  -10.558 -0.256  1.00 0.00 ? 52  ILE A HG21 3  
ATOM 5197  H HG22 . ILE A 1 52  ? 20.855  -8.956  -0.433  1.00 0.00 ? 52  ILE A HG22 3  
ATOM 5198  H HG23 . ILE A 1 52  ? 22.541  -9.222  -0.875  1.00 0.00 ? 52  ILE A HG23 3  
ATOM 5199  H HD11 . ILE A 1 52  ? 20.438  -7.385  0.808   1.00 0.00 ? 52  ILE A HD11 3  
ATOM 5200  H HD12 . ILE A 1 52  ? 21.106  -6.087  1.799   1.00 0.00 ? 52  ILE A HD12 3  
ATOM 5201  H HD13 . ILE A 1 52  ? 21.544  -6.210  0.096   1.00 0.00 ? 52  ILE A HD13 3  
ATOM 5202  N N    . VAL A 1 53  ? 19.651  -11.343 1.444   1.00 0.00 ? 53  VAL A N    3  
ATOM 5203  C CA   . VAL A 1 53  ? 19.247  -12.725 1.213   1.00 0.00 ? 53  VAL A CA   3  
ATOM 5204  C C    . VAL A 1 53  ? 19.158  -13.029 -0.278  1.00 0.00 ? 53  VAL A C    3  
ATOM 5205  O O    . VAL A 1 53  ? 18.091  -12.964 -0.888  1.00 0.00 ? 53  VAL A O    3  
ATOM 5206  C CB   . VAL A 1 53  ? 17.888  -13.030 1.870   1.00 0.00 ? 53  VAL A CB   3  
ATOM 5207  C CG1  . VAL A 1 53  ? 17.588  -14.520 1.810   1.00 0.00 ? 53  VAL A CG1  3  
ATOM 5208  C CG2  . VAL A 1 53  ? 17.867  -12.530 3.306   1.00 0.00 ? 53  VAL A CG2  3  
ATOM 5209  H H    . VAL A 1 53  ? 19.071  -10.617 1.133   1.00 0.00 ? 53  VAL A H    3  
ATOM 5210  H HA   . VAL A 1 53  ? 19.991  -13.369 1.658   1.00 0.00 ? 53  VAL A HA   3  
ATOM 5211  H HB   . VAL A 1 53  ? 17.119  -12.508 1.318   1.00 0.00 ? 53  VAL A HB   3  
ATOM 5212  H HG11 . VAL A 1 53  ? 18.425  -15.038 1.366   1.00 0.00 ? 53  VAL A HG11 3  
ATOM 5213  H HG12 . VAL A 1 53  ? 17.420  -14.894 2.809   1.00 0.00 ? 53  VAL A HG12 3  
ATOM 5214  H HG13 . VAL A 1 53  ? 16.705  -14.685 1.210   1.00 0.00 ? 53  VAL A HG13 3  
ATOM 5215  H HG21 . VAL A 1 53  ? 16.903  -12.739 3.745   1.00 0.00 ? 53  VAL A HG21 3  
ATOM 5216  H HG22 . VAL A 1 53  ? 18.637  -13.032 3.874   1.00 0.00 ? 53  VAL A HG22 3  
ATOM 5217  H HG23 . VAL A 1 53  ? 18.046  -11.465 3.321   1.00 0.00 ? 53  VAL A HG23 3  
ATOM 5218  N N    . PRO A 1 54  ? 20.306  -13.371 -0.882  1.00 0.00 ? 54  PRO A N    3  
ATOM 5219  C CA   . PRO A 1 54  ? 20.385  -13.694 -2.310  1.00 0.00 ? 54  PRO A CA   3  
ATOM 5220  C C    . PRO A 1 54  ? 19.702  -15.016 -2.644  1.00 0.00 ? 54  PRO A C    3  
ATOM 5221  O O    . PRO A 1 54  ? 20.078  -16.068 -2.127  1.00 0.00 ? 54  PRO A O    3  
ATOM 5222  C CB   . PRO A 1 54  ? 21.890  -13.789 -2.570  1.00 0.00 ? 54  PRO A CB   3  
ATOM 5223  C CG   . PRO A 1 54  ? 22.482  -14.139 -1.248  1.00 0.00 ? 54  PRO A CG   3  
ATOM 5224  C CD   . PRO A 1 54  ? 21.617  -13.469 -0.217  1.00 0.00 ? 54  PRO A CD   3  
ATOM 5225  H HA   . PRO A 1 54  ? 19.961  -12.908 -2.918  1.00 0.00 ? 54  PRO A HA   3  
ATOM 5226  H HB2  . PRO A 1 54  ? 22.083  -14.557 -3.306  1.00 0.00 ? 54  PRO A HB2  3  
ATOM 5227  H HB3  . PRO A 1 54  ? 22.258  -12.839 -2.928  1.00 0.00 ? 54  PRO A HB3  3  
ATOM 5228  H HG2  . PRO A 1 54  ? 22.467  -15.209 -1.112  1.00 0.00 ? 54  PRO A HG2  3  
ATOM 5229  H HG3  . PRO A 1 54  ? 23.493  -13.765 -1.189  1.00 0.00 ? 54  PRO A HG3  3  
ATOM 5230  H HD2  . PRO A 1 54  ? 21.552  -14.076 0.674   1.00 0.00 ? 54  PRO A HD2  3  
ATOM 5231  H HD3  . PRO A 1 54  ? 22.002  -12.488 0.020   1.00 0.00 ? 54  PRO A HD3  3  
ATOM 5232  N N    . VAL A 1 55  ? 18.697  -14.955 -3.511  1.00 0.00 ? 55  VAL A N    3  
ATOM 5233  C CA   . VAL A 1 55  ? 17.962  -16.148 -3.915  1.00 0.00 ? 55  VAL A CA   3  
ATOM 5234  C C    . VAL A 1 55  ? 18.337  -16.571 -5.331  1.00 0.00 ? 55  VAL A C    3  
ATOM 5235  O O    . VAL A 1 55  ? 18.346  -15.754 -6.251  1.00 0.00 ? 55  VAL A O    3  
ATOM 5236  C CB   . VAL A 1 55  ? 16.440  -15.921 -3.845  1.00 0.00 ? 55  VAL A CB   3  
ATOM 5237  C CG1  . VAL A 1 55  ? 16.019  -14.823 -4.811  1.00 0.00 ? 55  VAL A CG1  3  
ATOM 5238  C CG2  . VAL A 1 55  ? 15.695  -17.214 -4.137  1.00 0.00 ? 55  VAL A CG2  3  
ATOM 5239  H H    . VAL A 1 55  ? 18.443  -14.087 -3.889  1.00 0.00 ? 55  VAL A H    3  
ATOM 5240  H HA   . VAL A 1 55  ? 18.218  -16.945 -3.232  1.00 0.00 ? 55  VAL A HA   3  
ATOM 5241  H HB   . VAL A 1 55  ? 16.190  -15.604 -2.844  1.00 0.00 ? 55  VAL A HB   3  
ATOM 5242  H HG11 . VAL A 1 55  ? 16.085  -15.192 -5.824  1.00 0.00 ? 55  VAL A HG11 3  
ATOM 5243  H HG12 . VAL A 1 55  ? 15.002  -14.528 -4.599  1.00 0.00 ? 55  VAL A HG12 3  
ATOM 5244  H HG13 . VAL A 1 55  ? 16.674  -13.972 -4.695  1.00 0.00 ? 55  VAL A HG13 3  
ATOM 5245  H HG21 . VAL A 1 55  ? 16.367  -17.918 -4.604  1.00 0.00 ? 55  VAL A HG21 3  
ATOM 5246  H HG22 . VAL A 1 55  ? 15.322  -17.632 -3.213  1.00 0.00 ? 55  VAL A HG22 3  
ATOM 5247  H HG23 . VAL A 1 55  ? 14.867  -17.011 -4.800  1.00 0.00 ? 55  VAL A HG23 3  
ATOM 5248  N N    . GLU A 1 56  ? 18.646  -17.853 -5.497  1.00 0.00 ? 56  GLU A N    3  
ATOM 5249  C CA   . GLU A 1 56  ? 19.023  -18.384 -6.802  1.00 0.00 ? 56  GLU A CA   3  
ATOM 5250  C C    . GLU A 1 56  ? 17.965  -19.355 -7.320  1.00 0.00 ? 56  GLU A C    3  
ATOM 5251  O O    . GLU A 1 56  ? 18.214  -20.555 -7.438  1.00 0.00 ? 56  GLU A O    3  
ATOM 5252  C CB   . GLU A 1 56  ? 20.379  -19.087 -6.719  1.00 0.00 ? 56  GLU A CB   3  
ATOM 5253  C CG   . GLU A 1 56  ? 21.561  -18.133 -6.732  1.00 0.00 ? 56  GLU A CG   3  
ATOM 5254  C CD   . GLU A 1 56  ? 22.524  -18.412 -7.870  1.00 0.00 ? 56  GLU A CD   3  
ATOM 5255  O OE1  . GLU A 1 56  ? 22.232  -17.992 -9.009  1.00 0.00 ? 56  GLU A OE1  3  
ATOM 5256  O OE2  . GLU A 1 56  ? 23.569  -19.049 -7.621  1.00 0.00 ? 56  GLU A OE2  3  
ATOM 5257  H H    . GLU A 1 56  ? 18.621  -18.455 -4.725  1.00 0.00 ? 56  GLU A H    3  
ATOM 5258  H HA   . GLU A 1 56  ? 19.099  -17.555 -7.488  1.00 0.00 ? 56  GLU A HA   3  
ATOM 5259  H HB2  . GLU A 1 56  ? 20.418  -19.664 -5.806  1.00 0.00 ? 56  GLU A HB2  3  
ATOM 5260  H HB3  . GLU A 1 56  ? 20.476  -19.757 -7.561  1.00 0.00 ? 56  GLU A HB3  3  
ATOM 5261  H HG2  . GLU A 1 56  ? 21.192  -17.124 -6.833  1.00 0.00 ? 56  GLU A HG2  3  
ATOM 5262  H HG3  . GLU A 1 56  ? 22.094  -18.228 -5.797  1.00 0.00 ? 56  GLU A HG3  3  
ATOM 5263  N N    . ILE A 1 57  ? 16.785  -18.827 -7.626  1.00 0.00 ? 57  ILE A N    3  
ATOM 5264  C CA   . ILE A 1 57  ? 15.690  -19.645 -8.132  1.00 0.00 ? 57  ILE A CA   3  
ATOM 5265  C C    . ILE A 1 57  ? 16.120  -20.441 -9.360  1.00 0.00 ? 57  ILE A C    3  
ATOM 5266  O O    . ILE A 1 57  ? 16.182  -19.909 -10.469 1.00 0.00 ? 57  ILE A O    3  
ATOM 5267  C CB   . ILE A 1 57  ? 14.465  -18.786 -8.494  1.00 0.00 ? 57  ILE A CB   3  
ATOM 5268  C CG1  . ILE A 1 57  ? 14.064  -17.905 -7.309  1.00 0.00 ? 57  ILE A CG1  3  
ATOM 5269  C CG2  . ILE A 1 57  ? 13.304  -19.671 -8.920  1.00 0.00 ? 57  ILE A CG2  3  
ATOM 5270  C CD1  . ILE A 1 57  ? 13.977  -16.434 -7.651  1.00 0.00 ? 57  ILE A CD1  3  
ATOM 5271  H H    . ILE A 1 57  ? 16.648  -17.864 -7.511  1.00 0.00 ? 57  ILE A H    3  
ATOM 5272  H HA   . ILE A 1 57  ? 15.403  -20.335 -7.352  1.00 0.00 ? 57  ILE A HA   3  
ATOM 5273  H HB   . ILE A 1 57  ? 14.730  -18.155 -9.329  1.00 0.00 ? 57  ILE A HB   3  
ATOM 5274  H HG12 . ILE A 1 57  ? 13.098  -18.218 -6.946  1.00 0.00 ? 57  ILE A HG12 3  
ATOM 5275  H HG13 . ILE A 1 57  ? 14.794  -18.021 -6.521  1.00 0.00 ? 57  ILE A HG13 3  
ATOM 5276  H HG21 . ILE A 1 57  ? 12.392  -19.313 -8.465  1.00 0.00 ? 57  ILE A HG21 3  
ATOM 5277  H HG22 . ILE A 1 57  ? 13.204  -19.641 -9.995  1.00 0.00 ? 57  ILE A HG22 3  
ATOM 5278  H HG23 . ILE A 1 57  ? 13.490  -20.686 -8.603  1.00 0.00 ? 57  ILE A HG23 3  
ATOM 5279  H HD11 . ILE A 1 57  ? 13.141  -15.992 -7.130  1.00 0.00 ? 57  ILE A HD11 3  
ATOM 5280  H HD12 . ILE A 1 57  ? 14.890  -15.940 -7.353  1.00 0.00 ? 57  ILE A HD12 3  
ATOM 5281  H HD13 . ILE A 1 57  ? 13.838  -16.320 -8.716  1.00 0.00 ? 57  ILE A HD13 3  
ATOM 5282  N N    . THR A 1 58  ? 16.416  -21.721 -9.155  1.00 0.00 ? 58  THR A N    3  
ATOM 5283  C CA   . THR A 1 58  ? 16.840  -22.591 -10.245 1.00 0.00 ? 58  THR A CA   3  
ATOM 5284  C C    . THR A 1 58  ? 15.748  -22.720 -11.301 1.00 0.00 ? 58  THR A C    3  
ATOM 5285  O O    . THR A 1 58  ? 14.581  -22.941 -10.977 1.00 0.00 ? 58  THR A O    3  
ATOM 5286  C CB   . THR A 1 58  ? 17.210  -23.995 -9.731  1.00 0.00 ? 58  THR A CB   3  
ATOM 5287  O OG1  . THR A 1 58  ? 17.939  -23.891 -8.503  1.00 0.00 ? 58  THR A OG1  3  
ATOM 5288  C CG2  . THR A 1 58  ? 18.044  -24.745 -10.759 1.00 0.00 ? 58  THR A CG2  3  
ATOM 5289  H H    . THR A 1 58  ? 16.348  -22.087 -8.249  1.00 0.00 ? 58  THR A H    3  
ATOM 5290  H HA   . THR A 1 58  ? 17.717  -22.154 -10.699 1.00 0.00 ? 58  THR A HA   3  
ATOM 5291  H HB   . THR A 1 58  ? 16.299  -24.549 -9.555  1.00 0.00 ? 58  THR A HB   3  
ATOM 5292  H HG1  . THR A 1 58  ? 18.021  -24.761 -8.104  1.00 0.00 ? 58  THR A HG1  3  
ATOM 5293  H HG21 . THR A 1 58  ? 19.091  -24.539 -10.594 1.00 0.00 ? 58  THR A HG21 3  
ATOM 5294  H HG22 . THR A 1 58  ? 17.766  -24.423 -11.752 1.00 0.00 ? 58  THR A HG22 3  
ATOM 5295  H HG23 . THR A 1 58  ? 17.866  -25.805 -10.662 1.00 0.00 ? 58  THR A HG23 3  
ATOM 5296  N N    . ILE A 1 59  ? 16.135  -22.583 -12.565 1.00 0.00 ? 59  ILE A N    3  
ATOM 5297  C CA   . ILE A 1 59  ? 15.188  -22.686 -13.668 1.00 0.00 ? 59  ILE A CA   3  
ATOM 5298  C C    . ILE A 1 59  ? 15.547  -23.844 -14.593 1.00 0.00 ? 59  ILE A C    3  
ATOM 5299  O O    . ILE A 1 59  ? 16.396  -23.709 -15.474 1.00 0.00 ? 59  ILE A O    3  
ATOM 5300  C CB   . ILE A 1 59  ? 15.137  -21.385 -14.490 1.00 0.00 ? 59  ILE A CB   3  
ATOM 5301  C CG1  . ILE A 1 59  ? 14.980  -20.177 -13.564 1.00 0.00 ? 59  ILE A CG1  3  
ATOM 5302  C CG2  . ILE A 1 59  ? 13.998  -21.438 -15.497 1.00 0.00 ? 59  ILE A CG2  3  
ATOM 5303  C CD1  . ILE A 1 59  ? 13.674  -20.165 -12.802 1.00 0.00 ? 59  ILE A CD1  3  
ATOM 5304  H H    . ILE A 1 59  ? 17.079  -22.408 -12.760 1.00 0.00 ? 59  ILE A H    3  
ATOM 5305  H HA   . ILE A 1 59  ? 14.208  -22.863 -13.251 1.00 0.00 ? 59  ILE A HA   3  
ATOM 5306  H HB   . ILE A 1 59  ? 16.064  -21.293 -15.036 1.00 0.00 ? 59  ILE A HB   3  
ATOM 5307  H HG12 . ILE A 1 59  ? 15.783  -20.176 -12.844 1.00 0.00 ? 59  ILE A HG12 3  
ATOM 5308  H HG13 . ILE A 1 59  ? 15.030  -19.272 -14.153 1.00 0.00 ? 59  ILE A HG13 3  
ATOM 5309  H HG21 . ILE A 1 59  ? 13.433  -20.519 -15.451 1.00 0.00 ? 59  ILE A HG21 3  
ATOM 5310  H HG22 . ILE A 1 59  ? 14.402  -21.563 -16.491 1.00 0.00 ? 59  ILE A HG22 3  
ATOM 5311  H HG23 . ILE A 1 59  ? 13.350  -22.270 -15.264 1.00 0.00 ? 59  ILE A HG23 3  
ATOM 5312  H HD11 . ILE A 1 59  ? 13.590  -19.245 -12.243 1.00 0.00 ? 59  ILE A HD11 3  
ATOM 5313  H HD12 . ILE A 1 59  ? 12.851  -20.242 -13.496 1.00 0.00 ? 59  ILE A HD12 3  
ATOM 5314  H HD13 . ILE A 1 59  ? 13.648  -21.003 -12.120 1.00 0.00 ? 59  ILE A HD13 3  
ATOM 5315  N N    . TYR A 1 60  ? 14.893  -24.982 -14.388 1.00 0.00 ? 60  TYR A N    3  
ATOM 5316  C CA   . TYR A 1 60  ? 15.143  -26.165 -15.203 1.00 0.00 ? 60  TYR A CA   3  
ATOM 5317  C C    . TYR A 1 60  ? 14.869  -25.879 -16.676 1.00 0.00 ? 60  TYR A C    3  
ATOM 5318  O O    . TYR A 1 60  ? 14.610  -24.739 -17.061 1.00 0.00 ? 60  TYR A O    3  
ATOM 5319  C CB   . TYR A 1 60  ? 14.273  -27.330 -14.728 1.00 0.00 ? 60  TYR A CB   3  
ATOM 5320  C CG   . TYR A 1 60  ? 14.520  -27.723 -13.289 1.00 0.00 ? 60  TYR A CG   3  
ATOM 5321  C CD1  . TYR A 1 60  ? 15.749  -27.485 -12.685 1.00 0.00 ? 60  TYR A CD1  3  
ATOM 5322  C CD2  . TYR A 1 60  ? 13.526  -28.333 -12.534 1.00 0.00 ? 60  TYR A CD2  3  
ATOM 5323  C CE1  . TYR A 1 60  ? 15.979  -27.843 -11.370 1.00 0.00 ? 60  TYR A CE1  3  
ATOM 5324  C CE2  . TYR A 1 60  ? 13.747  -28.693 -11.219 1.00 0.00 ? 60  TYR A CE2  3  
ATOM 5325  C CZ   . TYR A 1 60  ? 14.975  -28.446 -10.641 1.00 0.00 ? 60  TYR A CZ   3  
ATOM 5326  O OH   . TYR A 1 60  ? 15.200  -28.804 -9.332  1.00 0.00 ? 60  TYR A OH   3  
ATOM 5327  H H    . TYR A 1 60  ? 14.227  -25.029 -13.670 1.00 0.00 ? 60  TYR A H    3  
ATOM 5328  H HA   . TYR A 1 60  ? 16.182  -26.434 -15.087 1.00 0.00 ? 60  TYR A HA   3  
ATOM 5329  H HB2  . TYR A 1 60  ? 13.234  -27.057 -14.823 1.00 0.00 ? 60  TYR A HB2  3  
ATOM 5330  H HB3  . TYR A 1 60  ? 14.471  -28.194 -15.346 1.00 0.00 ? 60  TYR A HB3  3  
ATOM 5331  H HD1  . TYR A 1 60  ? 16.533  -27.013 -13.258 1.00 0.00 ? 60  TYR A HD1  3  
ATOM 5332  H HD2  . TYR A 1 60  ? 12.565  -28.525 -12.989 1.00 0.00 ? 60  TYR A HD2  3  
ATOM 5333  H HE1  . TYR A 1 60  ? 16.941  -27.650 -10.918 1.00 0.00 ? 60  TYR A HE1  3  
ATOM 5334  H HE2  . TYR A 1 60  ? 12.962  -29.165 -10.648 1.00 0.00 ? 60  TYR A HE2  3  
ATOM 5335  H HH   . TYR A 1 60  ? 15.978  -28.347 -9.004  1.00 0.00 ? 60  TYR A HH   3  
ATOM 5336  N N    . ALA A 1 61  ? 14.929  -26.924 -17.496 1.00 0.00 ? 61  ALA A N    3  
ATOM 5337  C CA   . ALA A 1 61  ? 14.685  -26.787 -18.926 1.00 0.00 ? 61  ALA A CA   3  
ATOM 5338  C C    . ALA A 1 61  ? 13.363  -26.075 -19.193 1.00 0.00 ? 61  ALA A C    3  
ATOM 5339  O O    . ALA A 1 61  ? 13.343  -24.896 -19.549 1.00 0.00 ? 61  ALA A O    3  
ATOM 5340  C CB   . ALA A 1 61  ? 14.694  -28.153 -19.596 1.00 0.00 ? 61  ALA A CB   3  
ATOM 5341  H H    . ALA A 1 61  ? 15.140  -27.808 -17.129 1.00 0.00 ? 61  ALA A H    3  
ATOM 5342  H HA   . ALA A 1 61  ? 15.489  -26.201 -19.347 1.00 0.00 ? 61  ALA A HA   3  
ATOM 5343  H HB1  . ALA A 1 61  ? 14.199  -28.087 -20.554 1.00 0.00 ? 61  ALA A HB1  3  
ATOM 5344  H HB2  . ALA A 1 61  ? 15.715  -28.476 -19.740 1.00 0.00 ? 61  ALA A HB2  3  
ATOM 5345  H HB3  . ALA A 1 61  ? 14.176  -28.864 -18.971 1.00 0.00 ? 61  ALA A HB3  3  
ATOM 5346  N N    . ASP A 1 62  ? 12.262  -26.796 -19.019 1.00 0.00 ? 62  ASP A N    3  
ATOM 5347  C CA   . ASP A 1 62  ? 10.935  -26.233 -19.240 1.00 0.00 ? 62  ASP A CA   3  
ATOM 5348  C C    . ASP A 1 62  ? 9.878   -27.010 -18.463 1.00 0.00 ? 62  ASP A C    3  
ATOM 5349  O O    . ASP A 1 62  ? 8.835   -27.374 -19.007 1.00 0.00 ? 62  ASP A O    3  
ATOM 5350  C CB   . ASP A 1 62  ? 10.598  -26.239 -20.732 1.00 0.00 ? 62  ASP A CB   3  
ATOM 5351  C CG   . ASP A 1 62  ? 11.154  -27.455 -21.446 1.00 0.00 ? 62  ASP A CG   3  
ATOM 5352  O OD1  . ASP A 1 62  ? 10.473  -28.501 -21.455 1.00 0.00 ? 62  ASP A OD1  3  
ATOM 5353  O OD2  . ASP A 1 62  ? 12.272  -27.360 -21.996 1.00 0.00 ? 62  ASP A OD2  3  
ATOM 5354  H H    . ASP A 1 62  ? 12.343  -27.731 -18.734 1.00 0.00 ? 62  ASP A H    3  
ATOM 5355  H HA   . ASP A 1 62  ? 10.945  -25.213 -18.887 1.00 0.00 ? 62  ASP A HA   3  
ATOM 5356  H HB2  . ASP A 1 62  ? 9.524   -26.235 -20.851 1.00 0.00 ? 62  ASP A HB2  3  
ATOM 5357  H HB3  . ASP A 1 62  ? 11.010  -25.353 -21.191 1.00 0.00 ? 62  ASP A HB3  3  
ATOM 5358  N N    . ARG A 1 63  ? 10.155  -27.263 -17.188 1.00 0.00 ? 63  ARG A N    3  
ATOM 5359  C CA   . ARG A 1 63  ? 9.228   -28.000 -16.337 1.00 0.00 ? 63  ARG A CA   3  
ATOM 5360  C C    . ARG A 1 63  ? 8.799   -27.155 -15.141 1.00 0.00 ? 63  ARG A C    3  
ATOM 5361  O O    . ARG A 1 63  ? 7.610   -26.917 -14.930 1.00 0.00 ? 63  ARG A O    3  
ATOM 5362  C CB   . ARG A 1 63  ? 9.872   -29.300 -15.851 1.00 0.00 ? 63  ARG A CB   3  
ATOM 5363  C CG   . ARG A 1 63  ? 9.106   -30.548 -16.258 1.00 0.00 ? 63  ARG A CG   3  
ATOM 5364  C CD   . ARG A 1 63  ? 9.427   -30.958 -17.687 1.00 0.00 ? 63  ARG A CD   3  
ATOM 5365  N NE   . ARG A 1 63  ? 8.235   -30.981 -18.531 1.00 0.00 ? 63  ARG A NE   3  
ATOM 5366  C CZ   . ARG A 1 63  ? 8.220   -31.464 -19.768 1.00 0.00 ? 63  ARG A CZ   3  
ATOM 5367  N NH1  . ARG A 1 63  ? 9.327   -31.962 -20.303 1.00 0.00 ? 63  ARG A NH1  3  
ATOM 5368  N NH2  . ARG A 1 63  ? 7.096   -31.450 -20.474 1.00 0.00 ? 63  ARG A NH2  3  
ATOM 5369  H H    . ARG A 1 63  ? 11.002  -26.948 -16.810 1.00 0.00 ? 63  ARG A H    3  
ATOM 5370  H HA   . ARG A 1 63  ? 8.355   -28.239 -16.925 1.00 0.00 ? 63  ARG A HA   3  
ATOM 5371  H HB2  . ARG A 1 63  ? 10.870  -29.369 -16.259 1.00 0.00 ? 63  ARG A HB2  3  
ATOM 5372  H HB3  . ARG A 1 63  ? 9.933   -29.277 -14.774 1.00 0.00 ? 63  ARG A HB3  3  
ATOM 5373  H HG2  . ARG A 1 63  ? 9.374   -31.357 -15.595 1.00 0.00 ? 63  ARG A HG2  3  
ATOM 5374  H HG3  . ARG A 1 63  ? 8.047   -30.351 -16.179 1.00 0.00 ? 63  ARG A HG3  3  
ATOM 5375  H HD2  . ARG A 1 63  ? 10.134  -30.254 -18.099 1.00 0.00 ? 63  ARG A HD2  3  
ATOM 5376  H HD3  . ARG A 1 63  ? 9.867   -31.944 -17.674 1.00 0.00 ? 63  ARG A HD3  3  
ATOM 5377  H HE   . ARG A 1 63  ? 7.406   -30.618 -18.156 1.00 0.00 ? 63  ARG A HE   3  
ATOM 5378  H HH11 . ARG A 1 63  ? 10.175  -31.975 -19.773 1.00 0.00 ? 63  ARG A HH11 3  
ATOM 5379  H HH12 . ARG A 1 63  ? 9.312   -32.326 -21.234 1.00 0.00 ? 63  ARG A HH12 3  
ATOM 5380  H HH21 . ARG A 1 63  ? 6.260   -31.076 -20.074 1.00 0.00 ? 63  ARG A HH21 3  
ATOM 5381  H HH22 . ARG A 1 63  ? 7.086   -31.814 -21.405 1.00 0.00 ? 63  ARG A HH22 3  
ATOM 5382  N N    . SER A 1 64  ? 9.776   -26.705 -14.360 1.00 0.00 ? 64  SER A N    3  
ATOM 5383  C CA   . SER A 1 64  ? 9.500   -25.890 -13.182 1.00 0.00 ? 64  SER A CA   3  
ATOM 5384  C C    . SER A 1 64  ? 10.787  -25.294 -12.621 1.00 0.00 ? 64  SER A C    3  
ATOM 5385  O O    . SER A 1 64  ? 11.864  -25.458 -13.195 1.00 0.00 ? 64  SER A O    3  
ATOM 5386  C CB   . SER A 1 64  ? 8.802   -26.728 -12.109 1.00 0.00 ? 64  SER A CB   3  
ATOM 5387  O OG   . SER A 1 64  ? 7.407   -26.804 -12.348 1.00 0.00 ? 64  SER A OG   3  
ATOM 5388  H H    . SER A 1 64  ? 10.705  -26.929 -14.580 1.00 0.00 ? 64  SER A H    3  
ATOM 5389  H HA   . SER A 1 64  ? 8.845   -25.086 -13.482 1.00 0.00 ? 64  SER A HA   3  
ATOM 5390  H HB2  . SER A 1 64  ? 9.210   -27.727 -12.113 1.00 0.00 ? 64  SER A HB2  3  
ATOM 5391  H HB3  . SER A 1 64  ? 8.965   -26.276 -11.141 1.00 0.00 ? 64  SER A HB3  3  
ATOM 5392  H HG   . SER A 1 64  ? 7.049   -25.917 -12.436 1.00 0.00 ? 64  SER A HG   3  
ATOM 5393  N N    . PHE A 1 65  ? 10.667  -24.600 -11.494 1.00 0.00 ? 65  PHE A N    3  
ATOM 5394  C CA   . PHE A 1 65  ? 11.820  -23.977 -10.853 1.00 0.00 ? 65  PHE A CA   3  
ATOM 5395  C C    . PHE A 1 65  ? 11.916  -24.389 -9.387  1.00 0.00 ? 65  PHE A C    3  
ATOM 5396  O O    . PHE A 1 65  ? 11.038  -25.076 -8.864  1.00 0.00 ? 65  PHE A O    3  
ATOM 5397  C CB   . PHE A 1 65  ? 11.728  -22.453 -10.961 1.00 0.00 ? 65  PHE A CB   3  
ATOM 5398  C CG   . PHE A 1 65  ? 10.349  -21.916 -10.707 1.00 0.00 ? 65  PHE A CG   3  
ATOM 5399  C CD1  . PHE A 1 65  ? 9.717   -22.138 -9.494  1.00 0.00 ? 65  PHE A CD1  3  
ATOM 5400  C CD2  . PHE A 1 65  ? 9.684   -21.189 -11.681 1.00 0.00 ? 65  PHE A CD2  3  
ATOM 5401  C CE1  . PHE A 1 65  ? 8.447   -21.646 -9.258  1.00 0.00 ? 65  PHE A CE1  3  
ATOM 5402  C CE2  . PHE A 1 65  ? 8.414   -20.693 -11.451 1.00 0.00 ? 65  PHE A CE2  3  
ATOM 5403  C CZ   . PHE A 1 65  ? 7.795   -20.921 -10.237 1.00 0.00 ? 65  PHE A CZ   3  
ATOM 5404  H H    . PHE A 1 65  ? 9.782   -24.504 -11.083 1.00 0.00 ? 65  PHE A H    3  
ATOM 5405  H HA   . PHE A 1 65  ? 12.706  -24.313 -11.369 1.00 0.00 ? 65  PHE A HA   3  
ATOM 5406  H HB2  . PHE A 1 65  ? 12.395  -22.007 -10.239 1.00 0.00 ? 65  PHE A HB2  3  
ATOM 5407  H HB3  . PHE A 1 65  ? 12.026  -22.151 -11.954 1.00 0.00 ? 65  PHE A HB3  3  
ATOM 5408  H HD1  . PHE A 1 65  ? 10.226  -22.704 -8.727  1.00 0.00 ? 65  PHE A HD1  3  
ATOM 5409  H HD2  . PHE A 1 65  ? 10.167  -21.009 -12.631 1.00 0.00 ? 65  PHE A HD2  3  
ATOM 5410  H HE1  . PHE A 1 65  ? 7.966   -21.825 -8.309  1.00 0.00 ? 65  PHE A HE1  3  
ATOM 5411  H HE2  . PHE A 1 65  ? 7.908   -20.127 -12.219 1.00 0.00 ? 65  PHE A HE2  3  
ATOM 5412  H HZ   . PHE A 1 65  ? 6.803   -20.536 -10.056 1.00 0.00 ? 65  PHE A HZ   3  
ATOM 5413  N N    . THR A 1 66  ? 12.991  -23.965 -8.729  1.00 0.00 ? 66  THR A N    3  
ATOM 5414  C CA   . THR A 1 66  ? 13.205  -24.291 -7.325  1.00 0.00 ? 66  THR A CA   3  
ATOM 5415  C C    . THR A 1 66  ? 13.770  -23.098 -6.563  1.00 0.00 ? 66  THR A C    3  
ATOM 5416  O O    . THR A 1 66  ? 14.740  -22.475 -6.996  1.00 0.00 ? 66  THR A O    3  
ATOM 5417  C CB   . THR A 1 66  ? 14.162  -25.488 -7.165  1.00 0.00 ? 66  THR A CB   3  
ATOM 5418  O OG1  . THR A 1 66  ? 15.510  -25.072 -7.410  1.00 0.00 ? 66  THR A OG1  3  
ATOM 5419  C CG2  . THR A 1 66  ? 13.790  -26.610 -8.122  1.00 0.00 ? 66  THR A CG2  3  
ATOM 5420  H H    . THR A 1 66  ? 13.656  -23.421 -9.201  1.00 0.00 ? 66  THR A H    3  
ATOM 5421  H HA   . THR A 1 66  ? 12.251  -24.561 -6.896  1.00 0.00 ? 66  THR A HA   3  
ATOM 5422  H HB   . THR A 1 66  ? 14.086  -25.857 -6.152  1.00 0.00 ? 66  THR A HB   3  
ATOM 5423  H HG1  . THR A 1 66  ? 16.105  -25.557 -6.832  1.00 0.00 ? 66  THR A HG1  3  
ATOM 5424  H HG21 . THR A 1 66  ? 14.383  -26.528 -9.021  1.00 0.00 ? 66  THR A HG21 3  
ATOM 5425  H HG22 . THR A 1 66  ? 12.742  -26.536 -8.374  1.00 0.00 ? 66  THR A HG22 3  
ATOM 5426  H HG23 . THR A 1 66  ? 13.981  -27.562 -7.651  1.00 0.00 ? 66  THR A HG23 3  
ATOM 5427  N N    . PHE A 1 67  ? 13.158  -22.784 -5.426  1.00 0.00 ? 67  PHE A N    3  
ATOM 5428  C CA   . PHE A 1 67  ? 13.600  -21.663 -4.604  1.00 0.00 ? 67  PHE A CA   3  
ATOM 5429  C C    . PHE A 1 67  ? 13.916  -22.123 -3.183  1.00 0.00 ? 67  PHE A C    3  
ATOM 5430  O O    . PHE A 1 67  ? 13.210  -22.958 -2.618  1.00 0.00 ? 67  PHE A O    3  
ATOM 5431  C CB   . PHE A 1 67  ? 12.529  -20.571 -4.573  1.00 0.00 ? 67  PHE A CB   3  
ATOM 5432  C CG   . PHE A 1 67  ? 11.163  -21.082 -4.215  1.00 0.00 ? 67  PHE A CG   3  
ATOM 5433  C CD1  . PHE A 1 67  ? 10.298  -21.534 -5.198  1.00 0.00 ? 67  PHE A CD1  3  
ATOM 5434  C CD2  . PHE A 1 67  ? 10.744  -21.109 -2.894  1.00 0.00 ? 67  PHE A CD2  3  
ATOM 5435  C CE1  . PHE A 1 67  ? 9.040   -22.005 -4.871  1.00 0.00 ? 67  PHE A CE1  3  
ATOM 5436  C CE2  . PHE A 1 67  ? 9.487   -21.579 -2.562  1.00 0.00 ? 67  PHE A CE2  3  
ATOM 5437  C CZ   . PHE A 1 67  ? 8.634   -22.027 -3.552  1.00 0.00 ? 67  PHE A CZ   3  
ATOM 5438  H H    . PHE A 1 67  ? 12.390  -23.318 -5.133  1.00 0.00 ? 67  PHE A H    3  
ATOM 5439  H HA   . PHE A 1 67  ? 14.499  -21.262 -5.048  1.00 0.00 ? 67  PHE A HA   3  
ATOM 5440  H HB2  . PHE A 1 67  ? 12.806  -19.826 -3.843  1.00 0.00 ? 67  PHE A HB2  3  
ATOM 5441  H HB3  . PHE A 1 67  ? 12.468  -20.110 -5.547  1.00 0.00 ? 67  PHE A HB3  3  
ATOM 5442  H HD1  . PHE A 1 67  ? 10.615  -21.518 -6.231  1.00 0.00 ? 67  PHE A HD1  3  
ATOM 5443  H HD2  . PHE A 1 67  ? 11.409  -20.759 -2.119  1.00 0.00 ? 67  PHE A HD2  3  
ATOM 5444  H HE1  . PHE A 1 67  ? 8.376   -22.354 -5.648  1.00 0.00 ? 67  PHE A HE1  3  
ATOM 5445  H HE2  . PHE A 1 67  ? 9.172   -21.595 -1.529  1.00 0.00 ? 67  PHE A HE2  3  
ATOM 5446  H HZ   . PHE A 1 67  ? 7.652   -22.395 -3.294  1.00 0.00 ? 67  PHE A HZ   3  
ATOM 5447  N N    . VAL A 1 68  ? 14.982  -21.571 -2.613  1.00 0.00 ? 68  VAL A N    3  
ATOM 5448  C CA   . VAL A 1 68  ? 15.392  -21.923 -1.258  1.00 0.00 ? 68  VAL A CA   3  
ATOM 5449  C C    . VAL A 1 68  ? 16.055  -20.741 -0.561  1.00 0.00 ? 68  VAL A C    3  
ATOM 5450  O O    . VAL A 1 68  ? 16.930  -20.083 -1.125  1.00 0.00 ? 68  VAL A O    3  
ATOM 5451  C CB   . VAL A 1 68  ? 16.365  -23.117 -1.258  1.00 0.00 ? 68  VAL A CB   3  
ATOM 5452  C CG1  . VAL A 1 68  ? 15.712  -24.338 -1.888  1.00 0.00 ? 68  VAL A CG1  3  
ATOM 5453  C CG2  . VAL A 1 68  ? 17.651  -22.755 -1.985  1.00 0.00 ? 68  VAL A CG2  3  
ATOM 5454  H H    . VAL A 1 68  ? 15.505  -20.912 -3.114  1.00 0.00 ? 68  VAL A H    3  
ATOM 5455  H HA   . VAL A 1 68  ? 14.508  -22.205 -0.705  1.00 0.00 ? 68  VAL A HA   3  
ATOM 5456  H HB   . VAL A 1 68  ? 16.609  -23.356 -0.234  1.00 0.00 ? 68  VAL A HB   3  
ATOM 5457  H HG11 . VAL A 1 68  ? 14.724  -24.472 -1.473  1.00 0.00 ? 68  VAL A HG11 3  
ATOM 5458  H HG12 . VAL A 1 68  ? 15.638  -24.196 -2.957  1.00 0.00 ? 68  VAL A HG12 3  
ATOM 5459  H HG13 . VAL A 1 68  ? 16.310  -25.213 -1.682  1.00 0.00 ? 68  VAL A HG13 3  
ATOM 5460  H HG21 . VAL A 1 68  ? 18.274  -23.633 -2.070  1.00 0.00 ? 68  VAL A HG21 3  
ATOM 5461  H HG22 . VAL A 1 68  ? 17.416  -22.384 -2.972  1.00 0.00 ? 68  VAL A HG22 3  
ATOM 5462  H HG23 . VAL A 1 68  ? 18.177  -21.993 -1.430  1.00 0.00 ? 68  VAL A HG23 3  
ATOM 5463  N N    . THR A 1 69  ? 15.635  -20.476 0.672   1.00 0.00 ? 69  THR A N    3  
ATOM 5464  C CA   . THR A 1 69  ? 16.187  -19.373 1.448   1.00 0.00 ? 69  THR A CA   3  
ATOM 5465  C C    . THR A 1 69  ? 16.986  -19.885 2.641   1.00 0.00 ? 69  THR A C    3  
ATOM 5466  O O    . THR A 1 69  ? 16.742  -20.985 3.139   1.00 0.00 ? 69  THR A O    3  
ATOM 5467  C CB   . THR A 1 69  ? 15.078  -18.431 1.954   1.00 0.00 ? 69  THR A CB   3  
ATOM 5468  O OG1  . THR A 1 69  ? 13.891  -19.179 2.236   1.00 0.00 ? 69  THR A OG1  3  
ATOM 5469  C CG2  . THR A 1 69  ? 14.772  -17.354 0.924   1.00 0.00 ? 69  THR A CG2  3  
ATOM 5470  H H    . THR A 1 69  ? 14.935  -21.036 1.068   1.00 0.00 ? 69  THR A H    3  
ATOM 5471  H HA   . THR A 1 69  ? 16.844  -18.808 0.803   1.00 0.00 ? 69  THR A HA   3  
ATOM 5472  H HB   . THR A 1 69  ? 15.419  -17.953 2.862   1.00 0.00 ? 69  THR A HB   3  
ATOM 5473  H HG1  . THR A 1 69  ? 14.110  -19.930 2.793   1.00 0.00 ? 69  THR A HG1  3  
ATOM 5474  H HG21 . THR A 1 69  ? 14.236  -16.544 1.397   1.00 0.00 ? 69  THR A HG21 3  
ATOM 5475  H HG22 . THR A 1 69  ? 14.167  -17.773 0.134   1.00 0.00 ? 69  THR A HG22 3  
ATOM 5476  H HG23 . THR A 1 69  ? 15.696  -16.979 0.510   1.00 0.00 ? 69  THR A HG23 3  
ATOM 5477  N N    . LYS A 1 70  ? 17.941  -19.082 3.097   1.00 0.00 ? 70  LYS A N    3  
ATOM 5478  C CA   . LYS A 1 70  ? 18.775  -19.453 4.234   1.00 0.00 ? 70  LYS A CA   3  
ATOM 5479  C C    . LYS A 1 70  ? 18.132  -19.016 5.546   1.00 0.00 ? 70  LYS A C    3  
ATOM 5480  O O    . LYS A 1 70  ? 17.347  -18.068 5.580   1.00 0.00 ? 70  LYS A O    3  
ATOM 5481  C CB   . LYS A 1 70  ? 20.164  -18.824 4.100   1.00 0.00 ? 70  LYS A CB   3  
ATOM 5482  C CG   . LYS A 1 70  ? 20.756  -18.947 2.707   1.00 0.00 ? 70  LYS A CG   3  
ATOM 5483  C CD   . LYS A 1 70  ? 20.822  -20.396 2.255   1.00 0.00 ? 70  LYS A CD   3  
ATOM 5484  C CE   . LYS A 1 70  ? 21.632  -20.545 0.976   1.00 0.00 ? 70  LYS A CE   3  
ATOM 5485  N NZ   . LYS A 1 70  ? 23.092  -20.648 1.254   1.00 0.00 ? 70  LYS A NZ   3  
ATOM 5486  H H    . LYS A 1 70  ? 18.088  -18.217 2.658   1.00 0.00 ? 70  LYS A H    3  
ATOM 5487  H HA   . LYS A 1 70  ? 18.875  -20.528 4.236   1.00 0.00 ? 70  LYS A HA   3  
ATOM 5488  H HB2  . LYS A 1 70  ? 20.096  -17.775 4.349   1.00 0.00 ? 70  LYS A HB2  3  
ATOM 5489  H HB3  . LYS A 1 70  ? 20.834  -19.307 4.797   1.00 0.00 ? 70  LYS A HB3  3  
ATOM 5490  H HG2  . LYS A 1 70  ? 20.141  -18.393 2.014   1.00 0.00 ? 70  LYS A HG2  3  
ATOM 5491  H HG3  . LYS A 1 70  ? 21.755  -18.535 2.712   1.00 0.00 ? 70  LYS A HG3  3  
ATOM 5492  H HD2  . LYS A 1 70  ? 21.285  -20.986 3.032   1.00 0.00 ? 70  LYS A HD2  3  
ATOM 5493  H HD3  . LYS A 1 70  ? 19.817  -20.755 2.078   1.00 0.00 ? 70  LYS A HD3  3  
ATOM 5494  H HE2  . LYS A 1 70  ? 21.308  -21.437 0.462   1.00 0.00 ? 70  LYS A HE2  3  
ATOM 5495  H HE3  . LYS A 1 70  ? 21.453  -19.684 0.350   1.00 0.00 ? 70  LYS A HE3  3  
ATOM 5496  H HZ1  . LYS A 1 70  ? 23.249  -20.896 2.251   1.00 0.00 ? 70  LYS A HZ1  3  
ATOM 5497  H HZ2  . LYS A 1 70  ? 23.558  -19.739 1.057   1.00 0.00 ? 70  LYS A HZ2  3  
ATOM 5498  H HZ3  . LYS A 1 70  ? 23.519  -21.382 0.653   1.00 0.00 ? 70  LYS A HZ3  3  
ATOM 5499  N N    . THR A 1 71  ? 18.471  -19.713 6.627   1.00 0.00 ? 71  THR A N    3  
ATOM 5500  C CA   . THR A 1 71  ? 17.926  -19.397 7.941   1.00 0.00 ? 71  THR A CA   3  
ATOM 5501  C C    . THR A 1 71  ? 18.456  -20.357 9.001   1.00 0.00 ? 71  THR A C    3  
ATOM 5502  O O    . THR A 1 71  ? 17.748  -21.244 9.478   1.00 0.00 ? 71  THR A O    3  
ATOM 5503  C CB   . THR A 1 71  ? 16.387  -19.450 7.940   1.00 0.00 ? 71  THR A CB   3  
ATOM 5504  O OG1  . THR A 1 71  ? 15.894  -19.413 9.284   1.00 0.00 ? 71  THR A OG1  3  
ATOM 5505  C CG2  . THR A 1 71  ? 15.890  -20.709 7.246   1.00 0.00 ? 71  THR A CG2  3  
ATOM 5506  H H    . THR A 1 71  ? 19.101  -20.457 6.536   1.00 0.00 ? 71  THR A H    3  
ATOM 5507  H HA   . THR A 1 71  ? 18.231  -18.392 8.195   1.00 0.00 ? 71  THR A HA   3  
ATOM 5508  H HB   . THR A 1 71  ? 16.013  -18.589 7.404   1.00 0.00 ? 71  THR A HB   3  
ATOM 5509  H HG1  . THR A 1 71  ? 16.497  -18.905 9.832   1.00 0.00 ? 71  THR A HG1  3  
ATOM 5510  H HG21 . THR A 1 71  ? 16.284  -20.746 6.241   1.00 0.00 ? 71  THR A HG21 3  
ATOM 5511  H HG22 . THR A 1 71  ? 14.811  -20.698 7.210   1.00 0.00 ? 71  THR A HG22 3  
ATOM 5512  H HG23 . THR A 1 71  ? 16.223  -21.577 7.794   1.00 0.00 ? 71  THR A HG23 3  
ATOM 5513  N N    . PRO A 1 72  ? 19.730  -20.178 9.379   1.00 0.00 ? 72  PRO A N    3  
ATOM 5514  C CA   . PRO A 1 72  ? 20.382  -21.018 10.387  1.00 0.00 ? 72  PRO A CA   3  
ATOM 5515  C C    . PRO A 1 72  ? 19.829  -20.777 11.788  1.00 0.00 ? 72  PRO A C    3  
ATOM 5516  O O    . PRO A 1 72  ? 19.105  -19.814 12.038  1.00 0.00 ? 72  PRO A O    3  
ATOM 5517  C CB   . PRO A 1 72  ? 21.850  -20.591 10.311  1.00 0.00 ? 72  PRO A CB   3  
ATOM 5518  C CG   . PRO A 1 72  ? 21.811  -19.198 9.783   1.00 0.00 ? 72  PRO A CG   3  
ATOM 5519  C CD   . PRO A 1 72  ? 20.632  -19.140 8.852   1.00 0.00 ? 72  PRO A CD   3  
ATOM 5520  H HA   . PRO A 1 72  ? 20.297  -22.067 10.144  1.00 0.00 ? 72  PRO A HA   3  
ATOM 5521  H HB2  . PRO A 1 72  ? 22.290  -20.629 11.297  1.00 0.00 ? 72  PRO A HB2  3  
ATOM 5522  H HB3  . PRO A 1 72  ? 22.386  -21.250 9.645   1.00 0.00 ? 72  PRO A HB3  3  
ATOM 5523  H HG2  . PRO A 1 72  ? 21.681  -18.501 10.597  1.00 0.00 ? 72  PRO A HG2  3  
ATOM 5524  H HG3  . PRO A 1 72  ? 22.724  -18.984 9.246   1.00 0.00 ? 72  PRO A HG3  3  
ATOM 5525  H HD2  . PRO A 1 72  ? 20.167  -18.167 8.892   1.00 0.00 ? 72  PRO A HD2  3  
ATOM 5526  H HD3  . PRO A 1 72  ? 20.937  -19.373 7.842   1.00 0.00 ? 72  PRO A HD3  3  
ATOM 5527  N N    . PRO A 1 73  ? 20.178  -21.672 12.725  1.00 0.00 ? 73  PRO A N    3  
ATOM 5528  C CA   . PRO A 1 73  ? 19.728  -21.576 14.117  1.00 0.00 ? 73  PRO A CA   3  
ATOM 5529  C C    . PRO A 1 73  ? 20.371  -20.407 14.855  1.00 0.00 ? 73  PRO A C    3  
ATOM 5530  O O    . PRO A 1 73  ? 19.828  -19.909 15.840  1.00 0.00 ? 73  PRO A O    3  
ATOM 5531  C CB   . PRO A 1 73  ? 20.179  -22.906 14.727  1.00 0.00 ? 73  PRO A CB   3  
ATOM 5532  C CG   . PRO A 1 73  ? 21.332  -23.337 13.888  1.00 0.00 ? 73  PRO A CG   3  
ATOM 5533  C CD   . PRO A 1 73  ? 21.038  -22.845 12.497  1.00 0.00 ? 73  PRO A CD   3  
ATOM 5534  H HA   . PRO A 1 73  ? 18.653  -21.494 14.182  1.00 0.00 ? 73  PRO A HA   3  
ATOM 5535  H HB2  . PRO A 1 73  ? 20.474  -22.751 15.755  1.00 0.00 ? 73  PRO A HB2  3  
ATOM 5536  H HB3  . PRO A 1 73  ? 19.370  -23.619 14.682  1.00 0.00 ? 73  PRO A HB3  3  
ATOM 5537  H HG2  . PRO A 1 73  ? 22.243  -22.892 14.258  1.00 0.00 ? 73  PRO A HG2  3  
ATOM 5538  H HG3  . PRO A 1 73  ? 21.409  -24.414 13.895  1.00 0.00 ? 73  PRO A HG3  3  
ATOM 5539  H HD2  . PRO A 1 73  ? 21.952  -22.561 11.996  1.00 0.00 ? 73  PRO A HD2  3  
ATOM 5540  H HD3  . PRO A 1 73  ? 20.515  -23.602 11.932  1.00 0.00 ? 73  PRO A HD3  3  
ATOM 5541  N N    . ALA A 1 74  ? 21.530  -19.973 14.371  1.00 0.00 ? 74  ALA A N    3  
ATOM 5542  C CA   . ALA A 1 74  ? 22.245  -18.860 14.983  1.00 0.00 ? 74  ALA A CA   3  
ATOM 5543  C C    . ALA A 1 74  ? 21.334  -17.650 15.155  1.00 0.00 ? 74  ALA A C    3  
ATOM 5544  O O    . ALA A 1 74  ? 20.881  -17.354 16.261  1.00 0.00 ? 74  ALA A O    3  
ATOM 5545  C CB   . ALA A 1 74  ? 23.463  -18.492 14.149  1.00 0.00 ? 74  ALA A CB   3  
ATOM 5546  H H    . ALA A 1 74  ? 21.913  -20.411 13.582  1.00 0.00 ? 74  ALA A H    3  
ATOM 5547  H HA   . ALA A 1 74  ? 22.590  -19.180 15.957  1.00 0.00 ? 74  ALA A HA   3  
ATOM 5548  H HB1  . ALA A 1 74  ? 23.364  -18.919 13.161  1.00 0.00 ? 74  ALA A HB1  3  
ATOM 5549  H HB2  . ALA A 1 74  ? 23.535  -17.417 14.072  1.00 0.00 ? 74  ALA A HB2  3  
ATOM 5550  H HB3  . ALA A 1 74  ? 24.353  -18.880 14.621  1.00 0.00 ? 74  ALA A HB3  3  
ATOM 5551  N N    . SER A 1 75  ? 21.069  -16.953 14.055  1.00 0.00 ? 75  SER A N    3  
ATOM 5552  C CA   . SER A 1 75  ? 20.215  -15.772 14.085  1.00 0.00 ? 75  SER A CA   3  
ATOM 5553  C C    . SER A 1 75  ? 18.871  -16.089 14.735  1.00 0.00 ? 75  SER A C    3  
ATOM 5554  O O    . SER A 1 75  ? 18.231  -15.216 15.321  1.00 0.00 ? 75  SER A O    3  
ATOM 5555  C CB   . SER A 1 75  ? 19.995  -15.239 12.667  1.00 0.00 ? 75  SER A CB   3  
ATOM 5556  O OG   . SER A 1 75  ? 18.684  -15.526 12.213  1.00 0.00 ? 75  SER A OG   3  
ATOM 5557  H H    . SER A 1 75  ? 21.460  -17.240 13.202  1.00 0.00 ? 75  SER A H    3  
ATOM 5558  H HA   . SER A 1 75  ? 20.715  -15.016 14.671  1.00 0.00 ? 75  SER A HA   3  
ATOM 5559  H HB2  . SER A 1 75  ? 20.139  -14.170 12.661  1.00 0.00 ? 75  SER A HB2  3  
ATOM 5560  H HB3  . SER A 1 75  ? 20.705  -15.703 11.998  1.00 0.00 ? 75  SER A HB3  3  
ATOM 5561  H HG   . SER A 1 75  ? 18.660  -16.410 11.839  1.00 0.00 ? 75  SER A HG   3  
ATOM 5562  N N    . TYR A 1 76  ? 18.451  -17.345 14.626  1.00 0.00 ? 76  TYR A N    3  
ATOM 5563  C CA   . TYR A 1 76  ? 17.183  -17.778 15.201  1.00 0.00 ? 76  TYR A CA   3  
ATOM 5564  C C    . TYR A 1 76  ? 17.168  -17.565 16.712  1.00 0.00 ? 76  TYR A C    3  
ATOM 5565  O O    . TYR A 1 76  ? 16.108  -17.408 17.318  1.00 0.00 ? 76  TYR A O    3  
ATOM 5566  C CB   . TYR A 1 76  ? 16.931  -19.253 14.881  1.00 0.00 ? 76  TYR A CB   3  
ATOM 5567  C CG   . TYR A 1 76  ? 15.493  -19.677 15.074  1.00 0.00 ? 76  TYR A CG   3  
ATOM 5568  C CD1  . TYR A 1 76  ? 14.573  -19.576 14.038  1.00 0.00 ? 76  TYR A CD1  3  
ATOM 5569  C CD2  . TYR A 1 76  ? 15.055  -20.181 16.293  1.00 0.00 ? 76  TYR A CD2  3  
ATOM 5570  C CE1  . TYR A 1 76  ? 13.258  -19.962 14.211  1.00 0.00 ? 76  TYR A CE1  3  
ATOM 5571  C CE2  . TYR A 1 76  ? 13.742  -20.572 16.474  1.00 0.00 ? 76  TYR A CE2  3  
ATOM 5572  C CZ   . TYR A 1 76  ? 12.848  -20.460 15.430  1.00 0.00 ? 76  TYR A CZ   3  
ATOM 5573  O OH   . TYR A 1 76  ? 11.539  -20.847 15.606  1.00 0.00 ? 76  TYR A OH   3  
ATOM 5574  H H    . TYR A 1 76  ? 19.005  -17.995 14.147  1.00 0.00 ? 76  TYR A H    3  
ATOM 5575  H HA   . TYR A 1 76  ? 16.397  -17.184 14.757  1.00 0.00 ? 76  TYR A HA   3  
ATOM 5576  H HB2  . TYR A 1 76  ? 17.197  -19.441 13.852  1.00 0.00 ? 76  TYR A HB2  3  
ATOM 5577  H HB3  . TYR A 1 76  ? 17.548  -19.864 15.524  1.00 0.00 ? 76  TYR A HB3  3  
ATOM 5578  H HD1  . TYR A 1 76  ? 14.898  -19.186 13.084  1.00 0.00 ? 76  TYR A HD1  3  
ATOM 5579  H HD2  . TYR A 1 76  ? 15.758  -20.268 17.108  1.00 0.00 ? 76  TYR A HD2  3  
ATOM 5580  H HE1  . TYR A 1 76  ? 12.557  -19.875 13.394  1.00 0.00 ? 76  TYR A HE1  3  
ATOM 5581  H HE2  . TYR A 1 76  ? 13.420  -20.961 17.428  1.00 0.00 ? 76  TYR A HE2  3  
ATOM 5582  H HH   . TYR A 1 76  ? 11.150  -20.343 16.325  1.00 0.00 ? 76  TYR A HH   3  
ATOM 5583  N N    . LEU A 1 77  ? 18.352  -17.559 17.313  1.00 0.00 ? 77  LEU A N    3  
ATOM 5584  C CA   . LEU A 1 77  ? 18.478  -17.364 18.753  1.00 0.00 ? 77  LEU A CA   3  
ATOM 5585  C C    . LEU A 1 77  ? 18.825  -15.914 19.078  1.00 0.00 ? 77  LEU A C    3  
ATOM 5586  O O    . LEU A 1 77  ? 18.508  -15.418 20.159  1.00 0.00 ? 77  LEU A O    3  
ATOM 5587  C CB   . LEU A 1 77  ? 19.549  -18.296 19.323  1.00 0.00 ? 77  LEU A CB   3  
ATOM 5588  C CG   . LEU A 1 77  ? 19.296  -19.794 19.147  1.00 0.00 ? 77  LEU A CG   3  
ATOM 5589  C CD1  . LEU A 1 77  ? 20.613  -20.549 19.046  1.00 0.00 ? 77  LEU A CD1  3  
ATOM 5590  C CD2  . LEU A 1 77  ? 18.458  -20.332 20.298  1.00 0.00 ? 77  LEU A CD2  3  
ATOM 5591  H H    . LEU A 1 77  ? 19.162  -17.689 16.777  1.00 0.00 ? 77  LEU A H    3  
ATOM 5592  H HA   . LEU A 1 77  ? 17.527  -17.603 19.204  1.00 0.00 ? 77  LEU A HA   3  
ATOM 5593  H HB2  . LEU A 1 77  ? 20.484  -18.060 18.840  1.00 0.00 ? 77  LEU A HB2  3  
ATOM 5594  H HB3  . LEU A 1 77  ? 19.632  -18.096 20.382  1.00 0.00 ? 77  LEU A HB3  3  
ATOM 5595  H HG   . LEU A 1 77  ? 18.748  -19.955 18.229  1.00 0.00 ? 77  LEU A HG   3  
ATOM 5596  H HD11 . LEU A 1 77  ? 20.415  -21.600 18.897  1.00 0.00 ? 77  LEU A HD11 3  
ATOM 5597  H HD12 . LEU A 1 77  ? 21.176  -20.414 19.957  1.00 0.00 ? 77  LEU A HD12 3  
ATOM 5598  H HD13 . LEU A 1 77  ? 21.182  -20.168 18.211  1.00 0.00 ? 77  LEU A HD13 3  
ATOM 5599  H HD21 . LEU A 1 77  ? 19.092  -20.503 21.155  1.00 0.00 ? 77  LEU A HD21 3  
ATOM 5600  H HD22 . LEU A 1 77  ? 17.996  -21.263 20.001  1.00 0.00 ? 77  LEU A HD22 3  
ATOM 5601  H HD23 . LEU A 1 77  ? 17.693  -19.614 20.552  1.00 0.00 ? 77  LEU A HD23 3  
ATOM 5602  N N    . ILE A 1 78  ? 19.476  -15.242 18.135  1.00 0.00 ? 78  ILE A N    3  
ATOM 5603  C CA   . ILE A 1 78  ? 19.862  -13.848 18.320  1.00 0.00 ? 78  ILE A CA   3  
ATOM 5604  C C    . ILE A 1 78  ? 18.642  -12.933 18.307  1.00 0.00 ? 78  ILE A C    3  
ATOM 5605  O O    . ILE A 1 78  ? 18.580  -11.954 19.051  1.00 0.00 ? 78  ILE A O    3  
ATOM 5606  C CB   . ILE A 1 78  ? 20.847  -13.388 17.230  1.00 0.00 ? 78  ILE A CB   3  
ATOM 5607  C CG1  . ILE A 1 78  ? 22.037  -14.346 17.149  1.00 0.00 ? 78  ILE A CG1  3  
ATOM 5608  C CG2  . ILE A 1 78  ? 21.321  -11.969 17.509  1.00 0.00 ? 78  ILE A CG2  3  
ATOM 5609  C CD1  . ILE A 1 78  ? 22.935  -14.096 15.958  1.00 0.00 ? 78  ILE A CD1  3  
ATOM 5610  H H    . ILE A 1 78  ? 19.700  -15.692 17.295  1.00 0.00 ? 78  ILE A H    3  
ATOM 5611  H HA   . ILE A 1 78  ? 20.352  -13.763 19.279  1.00 0.00 ? 78  ILE A HA   3  
ATOM 5612  H HB   . ILE A 1 78  ? 20.328  -13.389 16.283  1.00 0.00 ? 78  ILE A HB   3  
ATOM 5613  H HG12 . ILE A 1 78  ? 22.635  -14.245 18.041  1.00 0.00 ? 78  ILE A HG12 3  
ATOM 5614  H HG13 . ILE A 1 78  ? 21.669  -15.360 17.081  1.00 0.00 ? 78  ILE A HG13 3  
ATOM 5615  H HG21 . ILE A 1 78  ? 20.696  -11.524 18.269  1.00 0.00 ? 78  ILE A HG21 3  
ATOM 5616  H HG22 . ILE A 1 78  ? 22.344  -11.993 17.853  1.00 0.00 ? 78  ILE A HG22 3  
ATOM 5617  H HG23 . ILE A 1 78  ? 21.259  -11.384 16.604  1.00 0.00 ? 78  ILE A HG23 3  
ATOM 5618  H HD11 . ILE A 1 78  ? 22.635  -14.733 15.139  1.00 0.00 ? 78  ILE A HD11 3  
ATOM 5619  H HD12 . ILE A 1 78  ? 22.856  -13.062 15.658  1.00 0.00 ? 78  ILE A HD12 3  
ATOM 5620  H HD13 . ILE A 1 78  ? 23.959  -14.315 16.226  1.00 0.00 ? 78  ILE A HD13 3  
ATOM 5621  N N    . ARG A 1 79  ? 17.674  -13.259 17.458  1.00 0.00 ? 79  ARG A N    3  
ATOM 5622  C CA   . ARG A 1 79  ? 16.455  -12.467 17.348  1.00 0.00 ? 79  ARG A CA   3  
ATOM 5623  C C    . ARG A 1 79  ? 15.684  -12.470 18.665  1.00 0.00 ? 79  ARG A C    3  
ATOM 5624  O O    . ARG A 1 79  ? 14.800  -11.641 18.882  1.00 0.00 ? 79  ARG A O    3  
ATOM 5625  C CB   . ARG A 1 79  ? 15.569  -13.008 16.225  1.00 0.00 ? 79  ARG A CB   3  
ATOM 5626  C CG   . ARG A 1 79  ? 16.073  -12.666 14.832  1.00 0.00 ? 79  ARG A CG   3  
ATOM 5627  C CD   . ARG A 1 79  ? 14.948  -12.695 13.810  1.00 0.00 ? 79  ARG A CD   3  
ATOM 5628  N NE   . ARG A 1 79  ? 15.180  -13.692 12.769  1.00 0.00 ? 79  ARG A NE   3  
ATOM 5629  C CZ   . ARG A 1 79  ? 14.969  -14.993 12.937  1.00 0.00 ? 79  ARG A CZ   3  
ATOM 5630  N NH1  . ARG A 1 79  ? 14.524  -15.451 14.099  1.00 0.00 ? 79  ARG A NH1  3  
ATOM 5631  N NH2  . ARG A 1 79  ? 15.204  -15.838 11.942  1.00 0.00 ? 79  ARG A NH2  3  
ATOM 5632  H H    . ARG A 1 79  ? 17.782  -14.052 16.890  1.00 0.00 ? 79  ARG A H    3  
ATOM 5633  H HA   . ARG A 1 79  ? 16.739  -11.452 17.113  1.00 0.00 ? 79  ARG A HA   3  
ATOM 5634  H HB2  . ARG A 1 79  ? 15.516  -14.084 16.310  1.00 0.00 ? 79  ARG A HB2  3  
ATOM 5635  H HB3  . ARG A 1 79  ? 14.577  -12.598 16.336  1.00 0.00 ? 79  ARG A HB3  3  
ATOM 5636  H HG2  . ARG A 1 79  ? 16.504  -11.676 14.849  1.00 0.00 ? 79  ARG A HG2  3  
ATOM 5637  H HG3  . ARG A 1 79  ? 16.827  -13.384 14.546  1.00 0.00 ? 79  ARG A HG3  3  
ATOM 5638  H HD2  . ARG A 1 79  ? 14.024  -12.927 14.317  1.00 0.00 ? 79  ARG A HD2  3  
ATOM 5639  H HD3  . ARG A 1 79  ? 14.871  -11.720 13.351  1.00 0.00 ? 79  ARG A HD3  3  
ATOM 5640  H HE   . ARG A 1 79  ? 15.509  -13.376 11.902  1.00 0.00 ? 79  ARG A HE   3  
ATOM 5641  H HH11 . ARG A 1 79  ? 14.346  -14.816 14.850  1.00 0.00 ? 79  ARG A HH11 3  
ATOM 5642  H HH12 . ARG A 1 79  ? 14.365  -16.430 14.223  1.00 0.00 ? 79  ARG A HH12 3  
ATOM 5643  H HH21 . ARG A 1 79  ? 15.539  -15.497 11.064  1.00 0.00 ? 79  ARG A HH21 3  
ATOM 5644  H HH22 . ARG A 1 79  ? 15.045  -16.817 12.069  1.00 0.00 ? 79  ARG A HH22 3  
ATOM 5645  N N    . LYS A 1 80  ? 16.025  -13.409 19.542  1.00 0.00 ? 80  LYS A N    3  
ATOM 5646  C CA   . LYS A 1 80  ? 15.366  -13.521 20.838  1.00 0.00 ? 80  LYS A CA   3  
ATOM 5647  C C    . LYS A 1 80  ? 15.552  -12.246 21.654  1.00 0.00 ? 80  LYS A C    3  
ATOM 5648  O O    . LYS A 1 80  ? 14.615  -11.468 21.829  1.00 0.00 ? 80  LYS A O    3  
ATOM 5649  C CB   . LYS A 1 80  ? 15.919  -14.720 21.612  1.00 0.00 ? 80  LYS A CB   3  
ATOM 5650  C CG   . LYS A 1 80  ? 15.321  -14.877 22.999  1.00 0.00 ? 80  LYS A CG   3  
ATOM 5651  C CD   . LYS A 1 80  ? 16.269  -14.374 24.075  1.00 0.00 ? 80  LYS A CD   3  
ATOM 5652  C CE   . LYS A 1 80  ? 16.158  -15.202 25.346  1.00 0.00 ? 80  LYS A CE   3  
ATOM 5653  N NZ   . LYS A 1 80  ? 16.911  -16.482 25.241  1.00 0.00 ? 80  LYS A NZ   3  
ATOM 5654  H H    . LYS A 1 80  ? 16.737  -14.042 19.311  1.00 0.00 ? 80  LYS A H    3  
ATOM 5655  H HA   . LYS A 1 80  ? 14.312  -13.672 20.662  1.00 0.00 ? 80  LYS A HA   3  
ATOM 5656  H HB2  . LYS A 1 80  ? 15.716  -15.620 21.051  1.00 0.00 ? 80  LYS A HB2  3  
ATOM 5657  H HB3  . LYS A 1 80  ? 16.989  -14.604 21.715  1.00 0.00 ? 80  LYS A HB3  3  
ATOM 5658  H HG2  . LYS A 1 80  ? 14.402  -14.312 23.051  1.00 0.00 ? 80  LYS A HG2  3  
ATOM 5659  H HG3  . LYS A 1 80  ? 15.113  -15.922 23.175  1.00 0.00 ? 80  LYS A HG3  3  
ATOM 5660  H HD2  . LYS A 1 80  ? 17.282  -14.433 23.707  1.00 0.00 ? 80  LYS A HD2  3  
ATOM 5661  H HD3  . LYS A 1 80  ? 16.027  -13.345 24.303  1.00 0.00 ? 80  LYS A HD3  3  
ATOM 5662  H HE2  . LYS A 1 80  ? 16.555  -14.627 26.169  1.00 0.00 ? 80  LYS A HE2  3  
ATOM 5663  H HE3  . LYS A 1 80  ? 15.117  -15.420 25.528  1.00 0.00 ? 80  LYS A HE3  3  
ATOM 5664  H HZ1  . LYS A 1 80  ? 16.249  -17.283 25.193  1.00 0.00 ? 80  LYS A HZ1  3  
ATOM 5665  H HZ2  . LYS A 1 80  ? 17.525  -16.605 26.071  1.00 0.00 ? 80  LYS A HZ2  3  
ATOM 5666  H HZ3  . LYS A 1 80  ? 17.501  -16.481 24.384  1.00 0.00 ? 80  LYS A HZ3  3  
ATOM 5667  N N    . ALA A 1 81  ? 16.767  -12.038 22.150  1.00 0.00 ? 81  ALA A N    3  
ATOM 5668  C CA   . ALA A 1 81  ? 17.076  -10.856 22.945  1.00 0.00 ? 81  ALA A CA   3  
ATOM 5669  C C    . ALA A 1 81  ? 16.710  -9.579  22.195  1.00 0.00 ? 81  ALA A C    3  
ATOM 5670  O O    . ALA A 1 81  ? 16.203  -8.625  22.785  1.00 0.00 ? 81  ALA A O    3  
ATOM 5671  C CB   . ALA A 1 81  ? 18.549  -10.844 23.323  1.00 0.00 ? 81  ALA A CB   3  
ATOM 5672  H H    . ALA A 1 81  ? 17.473  -12.695 21.976  1.00 0.00 ? 81  ALA A H    3  
ATOM 5673  H HA   . ALA A 1 81  ? 16.496  -10.905 23.856  1.00 0.00 ? 81  ALA A HA   3  
ATOM 5674  H HB1  . ALA A 1 81  ? 19.031  -9.994  22.862  1.00 0.00 ? 81  ALA A HB1  3  
ATOM 5675  H HB2  . ALA A 1 81  ? 18.645  -10.774 24.396  1.00 0.00 ? 81  ALA A HB2  3  
ATOM 5676  H HB3  . ALA A 1 81  ? 19.017  -11.754 22.978  1.00 0.00 ? 81  ALA A HB3  3  
ATOM 5677  N N    . ALA A 1 82  ? 16.970  -9.569  20.892  1.00 0.00 ? 82  ALA A N    3  
ATOM 5678  C CA   . ALA A 1 82  ? 16.666  -8.410  20.061  1.00 0.00 ? 82  ALA A CA   3  
ATOM 5679  C C    . ALA A 1 82  ? 15.387  -8.628  19.261  1.00 0.00 ? 82  ALA A C    3  
ATOM 5680  O O    . ALA A 1 82  ? 15.406  -9.249  18.199  1.00 0.00 ? 82  ALA A O    3  
ATOM 5681  C CB   . ALA A 1 82  ? 17.830  -8.110  19.128  1.00 0.00 ? 82  ALA A CB   3  
ATOM 5682  H H    . ALA A 1 82  ? 17.374  -10.360 20.479  1.00 0.00 ? 82  ALA A H    3  
ATOM 5683  H HA   . ALA A 1 82  ? 16.531  -7.559  20.713  1.00 0.00 ? 82  ALA A HA   3  
ATOM 5684  H HB1  . ALA A 1 82  ? 17.911  -7.042  18.987  1.00 0.00 ? 82  ALA A HB1  3  
ATOM 5685  H HB2  . ALA A 1 82  ? 18.745  -8.487  19.562  1.00 0.00 ? 82  ALA A HB2  3  
ATOM 5686  H HB3  . ALA A 1 82  ? 17.659  -8.587  18.175  1.00 0.00 ? 82  ALA A HB3  3  
ATOM 5687  N N    . GLY A 1 83  ? 14.275  -8.113  19.778  1.00 0.00 ? 83  GLY A N    3  
ATOM 5688  C CA   . GLY A 1 83  ? 13.002  -8.264  19.099  1.00 0.00 ? 83  GLY A CA   3  
ATOM 5689  C C    . GLY A 1 83  ? 12.883  -7.364  17.884  1.00 0.00 ? 83  GLY A C    3  
ATOM 5690  O O    . GLY A 1 83  ? 11.988  -6.521  17.812  1.00 0.00 ? 83  GLY A O    3  
ATOM 5691  H H    . GLY A 1 83  ? 14.321  -7.628  20.628  1.00 0.00 ? 83  GLY A H    3  
ATOM 5692  H HA2  . GLY A 1 83  ? 12.893  -9.291  18.785  1.00 0.00 ? 83  GLY A HA2  3  
ATOM 5693  H HA3  . GLY A 1 83  ? 12.208  -8.022  19.790  1.00 0.00 ? 83  GLY A HA3  3  
ATOM 5694  N N    . LEU A 1 84  ? 13.788  -7.541  16.928  1.00 0.00 ? 84  LEU A N    3  
ATOM 5695  C CA   . LEU A 1 84  ? 13.783  -6.738  15.711  1.00 0.00 ? 84  LEU A CA   3  
ATOM 5696  C C    . LEU A 1 84  ? 12.383  -6.673  15.107  1.00 0.00 ? 84  LEU A C    3  
ATOM 5697  O O    . LEU A 1 84  ? 11.851  -5.590  14.866  1.00 0.00 ? 84  LEU A O    3  
ATOM 5698  C CB   . LEU A 1 84  ? 14.764  -7.316  14.690  1.00 0.00 ? 84  LEU A CB   3  
ATOM 5699  C CG   . LEU A 1 84  ? 16.223  -6.885  14.843  1.00 0.00 ? 84  LEU A CG   3  
ATOM 5700  C CD1  . LEU A 1 84  ? 16.655  -6.969  16.299  1.00 0.00 ? 84  LEU A CD1  3  
ATOM 5701  C CD2  . LEU A 1 84  ? 17.127  -7.740  13.966  1.00 0.00 ? 84  LEU A CD2  3  
ATOM 5702  H H    . LEU A 1 84  ? 14.477  -8.229  17.042  1.00 0.00 ? 84  LEU A H    3  
ATOM 5703  H HA   . LEU A 1 84  ? 14.095  -5.738  15.972  1.00 0.00 ? 84  LEU A HA   3  
ATOM 5704  H HB2  . LEU A 1 84  ? 14.728  -8.391  14.768  1.00 0.00 ? 84  LEU A HB2  3  
ATOM 5705  H HB3  . LEU A 1 84  ? 14.431  -7.017  13.706  1.00 0.00 ? 84  LEU A HB3  3  
ATOM 5706  H HG   . LEU A 1 84  ? 16.323  -5.856  14.525  1.00 0.00 ? 84  LEU A HG   3  
ATOM 5707  H HD11 . LEU A 1 84  ? 16.054  -6.297  16.892  1.00 0.00 ? 84  LEU A HD11 3  
ATOM 5708  H HD12 . LEU A 1 84  ? 17.695  -6.691  16.382  1.00 0.00 ? 84  LEU A HD12 3  
ATOM 5709  H HD13 . LEU A 1 84  ? 16.523  -7.980  16.655  1.00 0.00 ? 84  LEU A HD13 3  
ATOM 5710  H HD21 . LEU A 1 84  ? 17.254  -8.711  14.421  1.00 0.00 ? 84  LEU A HD21 3  
ATOM 5711  H HD22 . LEU A 1 84  ? 18.090  -7.260  13.867  1.00 0.00 ? 84  LEU A HD22 3  
ATOM 5712  H HD23 . LEU A 1 84  ? 16.678  -7.854  12.991  1.00 0.00 ? 84  LEU A HD23 3  
ATOM 5713  N N    . GLU A 1 85  ? 11.793  -7.840  14.868  1.00 0.00 ? 85  GLU A N    3  
ATOM 5714  C CA   . GLU A 1 85  ? 10.454  -7.915  14.295  1.00 0.00 ? 85  GLU A CA   3  
ATOM 5715  C C    . GLU A 1 85  ? 9.418   -7.335  15.253  1.00 0.00 ? 85  GLU A C    3  
ATOM 5716  O O    . GLU A 1 85  ? 9.133   -7.915  16.302  1.00 0.00 ? 85  GLU A O    3  
ATOM 5717  C CB   . GLU A 1 85  ? 10.100  -9.365  13.958  1.00 0.00 ? 85  GLU A CB   3  
ATOM 5718  C CG   . GLU A 1 85  ? 10.226  -9.695  12.481  1.00 0.00 ? 85  GLU A CG   3  
ATOM 5719  C CD   . GLU A 1 85  ? 9.069   -9.157  11.661  1.00 0.00 ? 85  GLU A CD   3  
ATOM 5720  O OE1  . GLU A 1 85  ? 7.996   -8.900  12.246  1.00 0.00 ? 85  GLU A OE1  3  
ATOM 5721  O OE2  . GLU A 1 85  ? 9.238   -8.992  10.435  1.00 0.00 ? 85  GLU A OE2  3  
ATOM 5722  H H    . GLU A 1 85  ? 12.269  -8.669  15.082  1.00 0.00 ? 85  GLU A H    3  
ATOM 5723  H HA   . GLU A 1 85  ? 10.450  -7.333  13.385  1.00 0.00 ? 85  GLU A HA   3  
ATOM 5724  H HB2  . GLU A 1 85  ? 10.756  -10.021 14.511  1.00 0.00 ? 85  GLU A HB2  3  
ATOM 5725  H HB3  . GLU A 1 85  ? 9.080   -9.552  14.261  1.00 0.00 ? 85  GLU A HB3  3  
ATOM 5726  H HG2  . GLU A 1 85  ? 11.143  -9.266  12.106  1.00 0.00 ? 85  GLU A HG2  3  
ATOM 5727  H HG3  . GLU A 1 85  ? 10.260  -10.769 12.367  1.00 0.00 ? 85  GLU A HG3  3  
ATOM 5728  N N    . LYS A 1 86  ? 8.858   -6.188  14.887  1.00 0.00 ? 86  LYS A N    3  
ATOM 5729  C CA   . LYS A 1 86  ? 7.853   -5.528  15.712  1.00 0.00 ? 86  LYS A CA   3  
ATOM 5730  C C    . LYS A 1 86  ? 8.420   -5.177  17.084  1.00 0.00 ? 86  LYS A C    3  
ATOM 5731  O O    . LYS A 1 86  ? 9.618   -5.319  17.326  1.00 0.00 ? 86  LYS A O    3  
ATOM 5732  C CB   . LYS A 1 86  ? 6.625   -6.427  15.872  1.00 0.00 ? 86  LYS A CB   3  
ATOM 5733  C CG   . LYS A 1 86  ? 5.333   -5.780  15.402  1.00 0.00 ? 86  LYS A CG   3  
ATOM 5734  C CD   . LYS A 1 86  ? 4.761   -6.494  14.189  1.00 0.00 ? 86  LYS A CD   3  
ATOM 5735  C CE   . LYS A 1 86  ? 3.907   -5.561  13.344  1.00 0.00 ? 86  LYS A CE   3  
ATOM 5736  N NZ   . LYS A 1 86  ? 2.455   -5.857  13.487  1.00 0.00 ? 86  LYS A NZ   3  
ATOM 5737  H H    . LYS A 1 86  ? 9.127   -5.774  14.039  1.00 0.00 ? 86  LYS A H    3  
ATOM 5738  H HA   . LYS A 1 86  ? 7.560   -4.617  15.214  1.00 0.00 ? 86  LYS A HA   3  
ATOM 5739  H HB2  . LYS A 1 86  ? 6.778   -7.331  15.301  1.00 0.00 ? 86  LYS A HB2  3  
ATOM 5740  H HB3  . LYS A 1 86  ? 6.515   -6.684  16.915  1.00 0.00 ? 86  LYS A HB3  3  
ATOM 5741  H HG2  . LYS A 1 86  ? 4.610   -5.819  16.203  1.00 0.00 ? 86  LYS A HG2  3  
ATOM 5742  H HG3  . LYS A 1 86  ? 5.531   -4.750  15.142  1.00 0.00 ? 86  LYS A HG3  3  
ATOM 5743  H HD2  . LYS A 1 86  ? 5.575   -6.865  13.583  1.00 0.00 ? 86  LYS A HD2  3  
ATOM 5744  H HD3  . LYS A 1 86  ? 4.152   -7.322  14.523  1.00 0.00 ? 86  LYS A HD3  3  
ATOM 5745  H HE2  . LYS A 1 86  ? 4.091   -4.544  13.657  1.00 0.00 ? 86  LYS A HE2  3  
ATOM 5746  H HE3  . LYS A 1 86  ? 4.189   -5.675  12.308  1.00 0.00 ? 86  LYS A HE3  3  
ATOM 5747  H HZ1  . LYS A 1 86  ? 2.120   -6.406  12.669  1.00 0.00 ? 86  LYS A HZ1  3  
ATOM 5748  H HZ2  . LYS A 1 86  ? 1.913   -4.970  13.539  1.00 0.00 ? 86  LYS A HZ2  3  
ATOM 5749  H HZ3  . LYS A 1 86  ? 2.285   -6.406  14.353  1.00 0.00 ? 86  LYS A HZ3  3  
ATOM 5750  N N    . GLY A 1 87  ? 7.551   -4.720  17.980  1.00 0.00 ? 87  GLY A N    3  
ATOM 5751  C CA   . GLY A 1 87  ? 7.984   -4.358  19.317  1.00 0.00 ? 87  GLY A CA   3  
ATOM 5752  C C    . GLY A 1 87  ? 7.830   -5.497  20.305  1.00 0.00 ? 87  GLY A C    3  
ATOM 5753  O O    . GLY A 1 87  ? 8.637   -6.425  20.323  1.00 0.00 ? 87  GLY A O    3  
ATOM 5754  H H    . GLY A 1 87  ? 6.607   -4.628  17.732  1.00 0.00 ? 87  GLY A H    3  
ATOM 5755  H HA2  . GLY A 1 87  ? 9.023   -4.065  19.280  1.00 0.00 ? 87  GLY A HA2  3  
ATOM 5756  H HA3  . GLY A 1 87  ? 7.396   -3.519  19.658  1.00 0.00 ? 87  GLY A HA3  3  
ATOM 5757  N N    . ALA A 1 88  ? 6.791   -5.425  21.131  1.00 0.00 ? 88  ALA A N    3  
ATOM 5758  C CA   . ALA A 1 88  ? 6.534   -6.459  22.126  1.00 0.00 ? 88  ALA A CA   3  
ATOM 5759  C C    . ALA A 1 88  ? 5.130   -6.325  22.706  1.00 0.00 ? 88  ALA A C    3  
ATOM 5760  O O    . ALA A 1 88  ? 4.252   -7.143  22.428  1.00 0.00 ? 88  ALA A O    3  
ATOM 5761  C CB   . ALA A 1 88  ? 7.573   -6.393  23.236  1.00 0.00 ? 88  ALA A CB   3  
ATOM 5762  H H    . ALA A 1 88  ? 6.183   -4.660  21.068  1.00 0.00 ? 88  ALA A H    3  
ATOM 5763  H HA   . ALA A 1 88  ? 6.622   -7.420  21.640  1.00 0.00 ? 88  ALA A HA   3  
ATOM 5764  H HB1  . ALA A 1 88  ? 7.078   -6.437  24.195  1.00 0.00 ? 88  ALA A HB1  3  
ATOM 5765  H HB2  . ALA A 1 88  ? 8.252   -7.227  23.142  1.00 0.00 ? 88  ALA A HB2  3  
ATOM 5766  H HB3  . ALA A 1 88  ? 8.125   -5.469  23.157  1.00 0.00 ? 88  ALA A HB3  3  
ATOM 5767  N N    . HIS A 1 89  ? 4.923   -5.289  23.513  1.00 0.00 ? 89  HIS A N    3  
ATOM 5768  C CA   . HIS A 1 89  ? 3.625   -5.049  24.132  1.00 0.00 ? 89  HIS A CA   3  
ATOM 5769  C C    . HIS A 1 89  ? 3.349   -3.553  24.254  1.00 0.00 ? 89  HIS A C    3  
ATOM 5770  O O    . HIS A 1 89  ? 2.987   -3.063  25.323  1.00 0.00 ? 89  HIS A O    3  
ATOM 5771  C CB   . HIS A 1 89  ? 3.565   -5.704  25.512  1.00 0.00 ? 89  HIS A CB   3  
ATOM 5772  C CG   . HIS A 1 89  ? 3.750   -7.190  25.478  1.00 0.00 ? 89  HIS A CG   3  
ATOM 5773  N ND1  . HIS A 1 89  ? 4.776   -7.836  26.135  1.00 0.00 ? 89  HIS A ND1  3  
ATOM 5774  C CD2  . HIS A 1 89  ? 3.031   -8.158  24.862  1.00 0.00 ? 89  HIS A CD2  3  
ATOM 5775  C CE1  . HIS A 1 89  ? 4.681   -9.137  25.923  1.00 0.00 ? 89  HIS A CE1  3  
ATOM 5776  N NE2  . HIS A 1 89  ? 3.630   -9.358  25.154  1.00 0.00 ? 89  HIS A NE2  3  
ATOM 5777  H H    . HIS A 1 89  ? 5.662   -4.672  23.696  1.00 0.00 ? 89  HIS A H    3  
ATOM 5778  H HA   . HIS A 1 89  ? 2.869   -5.491  23.500  1.00 0.00 ? 89  HIS A HA   3  
ATOM 5779  H HB2  . HIS A 1 89  ? 4.343   -5.288  26.135  1.00 0.00 ? 89  HIS A HB2  3  
ATOM 5780  H HB3  . HIS A 1 89  ? 2.603   -5.499  25.960  1.00 0.00 ? 89  HIS A HB3  3  
ATOM 5781  H HD1  . HIS A 1 89  ? 5.470   -7.405  26.674  1.00 0.00 ? 89  HIS A HD1  3  
ATOM 5782  H HD2  . HIS A 1 89  ? 2.149   -8.013  24.253  1.00 0.00 ? 89  HIS A HD2  3  
ATOM 5783  H HE1  . HIS A 1 89  ? 5.348   -9.891  26.312  1.00 0.00 ? 89  HIS A HE1  3  
ATOM 5784  N N    . LYS A 1 90  ? 3.524   -2.832  23.151  1.00 0.00 ? 90  LYS A N    3  
ATOM 5785  C CA   . LYS A 1 90  ? 3.295   -1.393  23.133  1.00 0.00 ? 90  LYS A CA   3  
ATOM 5786  C C    . LYS A 1 90  ? 2.163   -1.034  22.175  1.00 0.00 ? 90  LYS A C    3  
ATOM 5787  O O    . LYS A 1 90  ? 1.801   -1.806  21.287  1.00 0.00 ? 90  LYS A O    3  
ATOM 5788  C CB   . LYS A 1 90  ? 4.573   -0.657  22.726  1.00 0.00 ? 90  LYS A CB   3  
ATOM 5789  C CG   . LYS A 1 90  ? 5.329   -0.057  23.900  1.00 0.00 ? 90  LYS A CG   3  
ATOM 5790  C CD   . LYS A 1 90  ? 5.798   -1.130  24.868  1.00 0.00 ? 90  LYS A CD   3  
ATOM 5791  C CE   . LYS A 1 90  ? 7.149   -0.783  25.473  1.00 0.00 ? 90  LYS A CE   3  
ATOM 5792  N NZ   . LYS A 1 90  ? 7.811   -1.975  26.073  1.00 0.00 ? 90  LYS A NZ   3  
ATOM 5793  H H    . LYS A 1 90  ? 3.815   -3.281  22.328  1.00 0.00 ? 90  LYS A H    3  
ATOM 5794  H HA   . LYS A 1 90  ? 3.016   -1.089  24.130  1.00 0.00 ? 90  LYS A HA   3  
ATOM 5795  H HB2  . LYS A 1 90  ? 5.228   -1.350  22.220  1.00 0.00 ? 90  LYS A HB2  3  
ATOM 5796  H HB3  . LYS A 1 90  ? 4.314   0.142   22.047  1.00 0.00 ? 90  LYS A HB3  3  
ATOM 5797  H HG2  . LYS A 1 90  ? 6.191   0.477   23.527  1.00 0.00 ? 90  LYS A HG2  3  
ATOM 5798  H HG3  . LYS A 1 90  ? 4.678   0.628   24.423  1.00 0.00 ? 90  LYS A HG3  3  
ATOM 5799  H HD2  . LYS A 1 90  ? 5.074   -1.226  25.664  1.00 0.00 ? 90  LYS A HD2  3  
ATOM 5800  H HD3  . LYS A 1 90  ? 5.880   -2.069  24.339  1.00 0.00 ? 90  LYS A HD3  3  
ATOM 5801  H HE2  . LYS A 1 90  ? 7.784   -0.382  24.698  1.00 0.00 ? 90  LYS A HE2  3  
ATOM 5802  H HE3  . LYS A 1 90  ? 7.004   -0.038  26.241  1.00 0.00 ? 90  LYS A HE3  3  
ATOM 5803  H HZ1  . LYS A 1 90  ? 7.620   -2.013  27.094  1.00 0.00 ? 90  LYS A HZ1  3  
ATOM 5804  H HZ2  . LYS A 1 90  ? 8.839   -1.925  25.925  1.00 0.00 ? 90  LYS A HZ2  3  
ATOM 5805  H HZ3  . LYS A 1 90  ? 7.450   -2.844  25.631  1.00 0.00 ? 90  LYS A HZ3  3  
ATOM 5806  N N    . PRO A 1 91  ? 1.590   0.165   22.357  1.00 0.00 ? 91  PRO A N    3  
ATOM 5807  C CA   . PRO A 1 91  ? 0.493   0.653   21.517  1.00 0.00 ? 91  PRO A CA   3  
ATOM 5808  C C    . PRO A 1 91  ? 0.948   0.976   20.098  1.00 0.00 ? 91  PRO A C    3  
ATOM 5809  O O    . PRO A 1 91  ? 0.322   0.560   19.124  1.00 0.00 ? 91  PRO A O    3  
ATOM 5810  C CB   . PRO A 1 91  ? 0.036   1.926   22.234  1.00 0.00 ? 91  PRO A CB   3  
ATOM 5811  C CG   . PRO A 1 91  ? 1.234   2.384   22.992  1.00 0.00 ? 91  PRO A CG   3  
ATOM 5812  C CD   . PRO A 1 91  ? 1.971   1.137   23.396  1.00 0.00 ? 91  PRO A CD   3  
ATOM 5813  H HA   . PRO A 1 91  ? -0.323  -0.054  21.479  1.00 0.00 ? 91  PRO A HA   3  
ATOM 5814  H HB2  . PRO A 1 91  ? -0.277  2.661   21.506  1.00 0.00 ? 91  PRO A HB2  3  
ATOM 5815  H HB3  . PRO A 1 91  ? -0.785  1.695   22.896  1.00 0.00 ? 91  PRO A HB3  3  
ATOM 5816  H HG2  . PRO A 1 91  ? 1.855   2.999   22.360  1.00 0.00 ? 91  PRO A HG2  3  
ATOM 5817  H HG3  . PRO A 1 91  ? 0.924   2.936   23.868  1.00 0.00 ? 91  PRO A HG3  3  
ATOM 5818  H HD2  . PRO A 1 91  ? 3.036   1.310   23.390  1.00 0.00 ? 91  PRO A HD2  3  
ATOM 5819  H HD3  . PRO A 1 91  ? 1.645   0.805   24.371  1.00 0.00 ? 91  PRO A HD3  3  
ATOM 5820  N N    . GLY A 1 92  ? 2.044   1.721   19.988  1.00 0.00 ? 92  GLY A N    3  
ATOM 5821  C CA   . GLY A 1 92  ? 2.565   2.087   18.684  1.00 0.00 ? 92  GLY A CA   3  
ATOM 5822  C C    . GLY A 1 92  ? 3.846   1.352   18.344  1.00 0.00 ? 92  GLY A C    3  
ATOM 5823  O O    . GLY A 1 92  ? 3.835   0.140   18.127  1.00 0.00 ? 92  GLY A O    3  
ATOM 5824  H H    . GLY A 1 92  ? 2.503   2.025   20.799  1.00 0.00 ? 92  GLY A H    3  
ATOM 5825  H HA2  . GLY A 1 92  ? 1.821   1.860   17.934  1.00 0.00 ? 92  GLY A HA2  3  
ATOM 5826  H HA3  . GLY A 1 92  ? 2.760   3.150   18.672  1.00 0.00 ? 92  GLY A HA3  3  
ATOM 5827  N N    . ARG A 1 93  ? 4.953   2.086   18.294  1.00 0.00 ? 93  ARG A N    3  
ATOM 5828  C CA   . ARG A 1 93  ? 6.247   1.496   17.975  1.00 0.00 ? 93  ARG A CA   3  
ATOM 5829  C C    . ARG A 1 93  ? 7.306   1.928   18.985  1.00 0.00 ? 93  ARG A C    3  
ATOM 5830  O O    . ARG A 1 93  ? 7.018   2.678   19.917  1.00 0.00 ? 93  ARG A O    3  
ATOM 5831  C CB   . ARG A 1 93  ? 6.680   1.896   16.563  1.00 0.00 ? 93  ARG A CB   3  
ATOM 5832  C CG   . ARG A 1 93  ? 6.587   3.390   16.299  1.00 0.00 ? 93  ARG A CG   3  
ATOM 5833  C CD   . ARG A 1 93  ? 5.224   3.775   15.746  1.00 0.00 ? 93  ARG A CD   3  
ATOM 5834  N NE   . ARG A 1 93  ? 5.309   4.270   14.375  1.00 0.00 ? 93  ARG A NE   3  
ATOM 5835  C CZ   . ARG A 1 93  ? 4.295   4.843   13.736  1.00 0.00 ? 93  ARG A CZ   3  
ATOM 5836  N NH1  . ARG A 1 93  ? 3.125   4.992   14.342  1.00 0.00 ? 93  ARG A NH1  3  
ATOM 5837  N NH2  . ARG A 1 93  ? 4.450   5.269   12.489  1.00 0.00 ? 93  ARG A NH2  3  
ATOM 5838  H H    . ARG A 1 93  ? 4.897   3.047   18.476  1.00 0.00 ? 93  ARG A H    3  
ATOM 5839  H HA   . ARG A 1 93  ? 6.142   0.422   18.019  1.00 0.00 ? 93  ARG A HA   3  
ATOM 5840  H HB2  . ARG A 1 93  ? 7.704   1.589   16.413  1.00 0.00 ? 93  ARG A HB2  3  
ATOM 5841  H HB3  . ARG A 1 93  ? 6.051   1.387   15.849  1.00 0.00 ? 93  ARG A HB3  3  
ATOM 5842  H HG2  . ARG A 1 93  ? 6.750   3.921   17.225  1.00 0.00 ? 93  ARG A HG2  3  
ATOM 5843  H HG3  . ARG A 1 93  ? 7.347   3.667   15.584  1.00 0.00 ? 93  ARG A HG3  3  
ATOM 5844  H HD2  . ARG A 1 93  ? 4.584   2.905   15.765  1.00 0.00 ? 93  ARG A HD2  3  
ATOM 5845  H HD3  . ARG A 1 93  ? 4.801   4.546   16.372  1.00 0.00 ? 93  ARG A HD3  3  
ATOM 5846  H HE   . ARG A 1 93  ? 6.164   4.170   13.909  1.00 0.00 ? 93  ARG A HE   3  
ATOM 5847  H HH11 . ARG A 1 93  ? 3.005   4.673   15.282  1.00 0.00 ? 93  ARG A HH11 3  
ATOM 5848  H HH12 . ARG A 1 93  ? 2.363   5.425   13.859  1.00 0.00 ? 93  ARG A HH12 3  
ATOM 5849  H HH21 . ARG A 1 93  ? 5.331   5.158   12.029  1.00 0.00 ? 93  ARG A HH21 3  
ATOM 5850  H HH22 . ARG A 1 93  ? 3.686   5.700   12.009  1.00 0.00 ? 93  ARG A HH22 3  
ATOM 5851  N N    . GLU A 1 94  ? 8.531   1.449   18.793  1.00 0.00 ? 94  GLU A N    3  
ATOM 5852  C CA   . GLU A 1 94  ? 9.631   1.786   19.688  1.00 0.00 ? 94  GLU A CA   3  
ATOM 5853  C C    . GLU A 1 94  ? 10.959  1.277   19.134  1.00 0.00 ? 94  GLU A C    3  
ATOM 5854  O O    . GLU A 1 94  ? 10.991  0.523   18.161  1.00 0.00 ? 94  GLU A O    3  
ATOM 5855  C CB   . GLU A 1 94  ? 9.386   1.195   21.078  1.00 0.00 ? 94  GLU A CB   3  
ATOM 5856  C CG   . GLU A 1 94  ? 8.897   -0.243  21.050  1.00 0.00 ? 94  GLU A CG   3  
ATOM 5857  C CD   . GLU A 1 94  ? 9.574   -1.110  22.095  1.00 0.00 ? 94  GLU A CD   3  
ATOM 5858  O OE1  . GLU A 1 94  ? 10.796  -0.953  22.295  1.00 0.00 ? 94  GLU A OE1  3  
ATOM 5859  O OE2  . GLU A 1 94  ? 8.880   -1.944  22.712  1.00 0.00 ? 94  GLU A OE2  3  
ATOM 5860  H H    . GLU A 1 94  ? 8.698   0.855   18.031  1.00 0.00 ? 94  GLU A H    3  
ATOM 5861  H HA   . GLU A 1 94  ? 9.677   2.861   19.767  1.00 0.00 ? 94  GLU A HA   3  
ATOM 5862  H HB2  . GLU A 1 94  ? 10.309  1.230   21.639  1.00 0.00 ? 94  GLU A HB2  3  
ATOM 5863  H HB3  . GLU A 1 94  ? 8.645   1.795   21.585  1.00 0.00 ? 94  GLU A HB3  3  
ATOM 5864  H HG2  . GLU A 1 94  ? 7.833   -0.252  21.233  1.00 0.00 ? 94  GLU A HG2  3  
ATOM 5865  H HG3  . GLU A 1 94  ? 9.097   -0.659  20.074  1.00 0.00 ? 94  GLU A HG3  3  
ATOM 5866  N N    . LYS A 1 95  ? 12.054  1.695   19.760  1.00 0.00 ? 95  LYS A N    3  
ATOM 5867  C CA   . LYS A 1 95  ? 13.385  1.282   19.332  1.00 0.00 ? 95  LYS A CA   3  
ATOM 5868  C C    . LYS A 1 95  ? 13.683  -0.145  19.780  1.00 0.00 ? 95  LYS A C    3  
ATOM 5869  O O    . LYS A 1 95  ? 13.464  -0.500  20.939  1.00 0.00 ? 95  LYS A O    3  
ATOM 5870  C CB   . LYS A 1 95  ? 14.442  2.236   19.893  1.00 0.00 ? 95  LYS A CB   3  
ATOM 5871  C CG   . LYS A 1 95  ? 14.374  3.635   19.305  1.00 0.00 ? 95  LYS A CG   3  
ATOM 5872  C CD   . LYS A 1 95  ? 15.301  3.783   18.110  1.00 0.00 ? 95  LYS A CD   3  
ATOM 5873  C CE   . LYS A 1 95  ? 14.641  4.570   16.987  1.00 0.00 ? 95  LYS A CE   3  
ATOM 5874  N NZ   . LYS A 1 95  ? 15.082  5.992   16.974  1.00 0.00 ? 95  LYS A NZ   3  
ATOM 5875  H H    . LYS A 1 95  ? 11.964  2.296   20.530  1.00 0.00 ? 95  LYS A H    3  
ATOM 5876  H HA   . LYS A 1 95  ? 13.414  1.321   18.253  1.00 0.00 ? 95  LYS A HA   3  
ATOM 5877  H HB2  . LYS A 1 95  ? 14.310  2.311   20.963  1.00 0.00 ? 95  LYS A HB2  3  
ATOM 5878  H HB3  . LYS A 1 95  ? 15.422  1.829   19.688  1.00 0.00 ? 95  LYS A HB3  3  
ATOM 5879  H HG2  . LYS A 1 95  ? 13.361  3.833   18.988  1.00 0.00 ? 95  LYS A HG2  3  
ATOM 5880  H HG3  . LYS A 1 95  ? 14.661  4.349   20.063  1.00 0.00 ? 95  LYS A HG3  3  
ATOM 5881  H HD2  . LYS A 1 95  ? 16.195  4.302   18.421  1.00 0.00 ? 95  LYS A HD2  3  
ATOM 5882  H HD3  . LYS A 1 95  ? 15.562  2.800   17.744  1.00 0.00 ? 95  LYS A HD3  3  
ATOM 5883  H HE2  . LYS A 1 95  ? 14.901  4.113   16.045  1.00 0.00 ? 95  LYS A HE2  3  
ATOM 5884  H HE3  . LYS A 1 95  ? 13.570  4.534   17.122  1.00 0.00 ? 95  LYS A HE3  3  
ATOM 5885  H HZ1  . LYS A 1 95  ? 14.279  6.616   17.191  1.00 0.00 ? 95  LYS A HZ1  3  
ATOM 5886  H HZ2  . LYS A 1 95  ? 15.456  6.241   16.037  1.00 0.00 ? 95  LYS A HZ2  3  
ATOM 5887  H HZ3  . LYS A 1 95  ? 15.826  6.143   17.684  1.00 0.00 ? 95  LYS A HZ3  3  
ATOM 5888  N N    . VAL A 1 96  ? 14.184  -0.958  18.857  1.00 0.00 ? 96  VAL A N    3  
ATOM 5889  C CA   . VAL A 1 96  ? 14.515  -2.346  19.158  1.00 0.00 ? 96  VAL A CA   3  
ATOM 5890  C C    . VAL A 1 96  ? 15.762  -2.791  18.402  1.00 0.00 ? 96  VAL A C    3  
ATOM 5891  O O    . VAL A 1 96  ? 16.073  -2.266  17.334  1.00 0.00 ? 96  VAL A O    3  
ATOM 5892  C CB   . VAL A 1 96  ? 13.350  -3.290  18.805  1.00 0.00 ? 96  VAL A CB   3  
ATOM 5893  C CG1  . VAL A 1 96  ? 13.603  -4.682  19.362  1.00 0.00 ? 96  VAL A CG1  3  
ATOM 5894  C CG2  . VAL A 1 96  ? 12.035  -2.730  19.325  1.00 0.00 ? 96  VAL A CG2  3  
ATOM 5895  H H    . VAL A 1 96  ? 14.337  -0.617  17.951  1.00 0.00 ? 96  VAL A H    3  
ATOM 5896  H HA   . VAL A 1 96  ? 14.703  -2.422  20.219  1.00 0.00 ? 96  VAL A HA   3  
ATOM 5897  H HB   . VAL A 1 96  ? 13.286  -3.363  17.729  1.00 0.00 ? 96  VAL A HB   3  
ATOM 5898  H HG11 . VAL A 1 96  ? 14.167  -4.605  20.280  1.00 0.00 ? 96  VAL A HG11 3  
ATOM 5899  H HG12 . VAL A 1 96  ? 12.659  -5.169  19.558  1.00 0.00 ? 96  VAL A HG12 3  
ATOM 5900  H HG13 . VAL A 1 96  ? 14.165  -5.261  18.643  1.00 0.00 ? 96  VAL A HG13 3  
ATOM 5901  H HG21 . VAL A 1 96  ? 11.255  -3.466  19.196  1.00 0.00 ? 96  VAL A HG21 3  
ATOM 5902  H HG22 . VAL A 1 96  ? 12.134  -2.490  20.374  1.00 0.00 ? 96  VAL A HG22 3  
ATOM 5903  H HG23 . VAL A 1 96  ? 11.781  -1.836  18.775  1.00 0.00 ? 96  VAL A HG23 3  
ATOM 5904  N N    . GLY A 1 97  ? 16.473  -3.763  18.965  1.00 0.00 ? 97  GLY A N    3  
ATOM 5905  C CA   . GLY A 1 97  ? 17.679  -4.263  18.330  1.00 0.00 ? 97  GLY A CA   3  
ATOM 5906  C C    . GLY A 1 97  ? 18.899  -4.134  19.220  1.00 0.00 ? 97  GLY A C    3  
ATOM 5907  O O    . GLY A 1 97  ? 20.027  -4.061  18.732  1.00 0.00 ? 97  GLY A O    3  
ATOM 5908  H H    . GLY A 1 97  ? 16.177  -4.144  19.818  1.00 0.00 ? 97  GLY A H    3  
ATOM 5909  H HA2  . GLY A 1 97  ? 17.536  -5.304  18.080  1.00 0.00 ? 97  GLY A HA2  3  
ATOM 5910  H HA3  . GLY A 1 97  ? 17.851  -3.706  17.421  1.00 0.00 ? 97  GLY A HA3  3  
ATOM 5911  N N    . ARG A 1 98  ? 18.674  -4.105  20.529  1.00 0.00 ? 98  ARG A N    3  
ATOM 5912  C CA   . ARG A 1 98  ? 19.764  -3.981  21.489  1.00 0.00 ? 98  ARG A CA   3  
ATOM 5913  C C    . ARG A 1 98  ? 20.089  -5.332  22.120  1.00 0.00 ? 98  ARG A C    3  
ATOM 5914  O O    . ARG A 1 98  ? 19.195  -6.134  22.387  1.00 0.00 ? 98  ARG A O    3  
ATOM 5915  C CB   . ARG A 1 98  ? 19.399  -2.972  22.580  1.00 0.00 ? 98  ARG A CB   3  
ATOM 5916  C CG   . ARG A 1 98  ? 20.345  -2.992  23.769  1.00 0.00 ? 98  ARG A CG   3  
ATOM 5917  C CD   . ARG A 1 98  ? 21.682  -2.352  23.428  1.00 0.00 ? 98  ARG A CD   3  
ATOM 5918  N NE   . ARG A 1 98  ? 21.747  -0.957  23.855  1.00 0.00 ? 98  ARG A NE   3  
ATOM 5919  C CZ   . ARG A 1 98  ? 22.589  -0.069  23.340  1.00 0.00 ? 98  ARG A CZ   3  
ATOM 5920  N NH1  . ARG A 1 98  ? 23.433  -0.429  22.383  1.00 0.00 ? 98  ARG A NH1  3  
ATOM 5921  N NH2  . ARG A 1 98  ? 22.588  1.182   23.781  1.00 0.00 ? 98  ARG A NH2  3  
ATOM 5922  H H    . ARG A 1 98  ? 17.753  -4.167  20.858  1.00 0.00 ? 98  ARG A H    3  
ATOM 5923  H HA   . ARG A 1 98  ? 20.635  -3.625  20.959  1.00 0.00 ? 98  ARG A HA   3  
ATOM 5924  H HB2  . ARG A 1 98  ? 19.412  -1.979  22.154  1.00 0.00 ? 98  ARG A HB2  3  
ATOM 5925  H HB3  . ARG A 1 98  ? 18.404  -3.189  22.936  1.00 0.00 ? 98  ARG A HB3  3  
ATOM 5926  H HG2  . ARG A 1 98  ? 19.895  -2.445  24.585  1.00 0.00 ? 98  ARG A HG2  3  
ATOM 5927  H HG3  . ARG A 1 98  ? 20.511  -4.016  24.068  1.00 0.00 ? 98  ARG A HG3  3  
ATOM 5928  H HD2  . ARG A 1 98  ? 22.467  -2.906  23.921  1.00 0.00 ? 98  ARG A HD2  3  
ATOM 5929  H HD3  . ARG A 1 98  ? 21.826  -2.399  22.359  1.00 0.00 ? 98  ARG A HD3  3  
ATOM 5930  H HE   . ARG A 1 98  ? 21.132  -0.670  24.562  1.00 0.00 ? 98  ARG A HE   3  
ATOM 5931  H HH11 . ARG A 1 98  ? 23.436  -1.371  22.048  1.00 0.00 ? 98  ARG A HH11 3  
ATOM 5932  H HH12 . ARG A 1 98  ? 24.066  0.242   21.995  1.00 0.00 ? 98  ARG A HH12 3  
ATOM 5933  H HH21 . ARG A 1 98  ? 21.953  1.457   24.502  1.00 0.00 ? 98  ARG A HH21 3  
ATOM 5934  H HH22 . ARG A 1 98  ? 23.222  1.850   23.393  1.00 0.00 ? 98  ARG A HH22 3  
ATOM 5935  N N    . ILE A 1 99  ? 21.375  -5.575  22.354  1.00 0.00 ? 99  ILE A N    3  
ATOM 5936  C CA   . ILE A 1 99  ? 21.817  -6.828  22.953  1.00 0.00 ? 99  ILE A CA   3  
ATOM 5937  C C    . ILE A 1 99  ? 23.083  -6.625  23.779  1.00 0.00 ? 99  ILE A C    3  
ATOM 5938  O O    . ILE A 1 99  ? 23.852  -5.694  23.540  1.00 0.00 ? 99  ILE A O    3  
ATOM 5939  C CB   . ILE A 1 99  ? 22.084  -7.901  21.881  1.00 0.00 ? 99  ILE A CB   3  
ATOM 5940  C CG1  . ILE A 1 99  ? 23.292  -7.511  21.027  1.00 0.00 ? 99  ILE A CG1  3  
ATOM 5941  C CG2  . ILE A 1 99  ? 20.853  -8.097  21.010  1.00 0.00 ? 99  ILE A CG2  3  
ATOM 5942  C CD1  . ILE A 1 99  ? 24.574  -8.198  21.442  1.00 0.00 ? 99  ILE A CD1  3  
ATOM 5943  H H    . ILE A 1 99  ? 22.040  -4.896  22.119  1.00 0.00 ? 99  ILE A H    3  
ATOM 5944  H HA   . ILE A 1 99  ? 21.030  -7.183  23.602  1.00 0.00 ? 99  ILE A HA   3  
ATOM 5945  H HB   . ILE A 1 99  ? 22.293  -8.834  22.382  1.00 0.00 ? 99  ILE A HB   3  
ATOM 5946  H HG12 . ILE A 1 99  ? 23.096  -7.769  19.998  1.00 0.00 ? 99  ILE A HG12 3  
ATOM 5947  H HG13 . ILE A 1 99  ? 23.447  -6.444  21.103  1.00 0.00 ? 99  ILE A HG13 3  
ATOM 5948  H HG21 . ILE A 1 99  ? 20.003  -8.332  21.634  1.00 0.00 ? 99  ILE A HG21 3  
ATOM 5949  H HG22 . ILE A 1 99  ? 20.653  -7.189  20.460  1.00 0.00 ? 99  ILE A HG22 3  
ATOM 5950  H HG23 . ILE A 1 99  ? 21.026  -8.907  20.318  1.00 0.00 ? 99  ILE A HG23 3  
ATOM 5951  H HD11 . ILE A 1 99  ? 24.925  -7.775  22.371  1.00 0.00 ? 99  ILE A HD11 3  
ATOM 5952  H HD12 . ILE A 1 99  ? 24.390  -9.254  21.574  1.00 0.00 ? 99  ILE A HD12 3  
ATOM 5953  H HD13 . ILE A 1 99  ? 25.323  -8.056  20.676  1.00 0.00 ? 99  ILE A HD13 3  
ATOM 5954  N N    . THR A 1 100 ? 23.294  -7.505  24.754  1.00 0.00 ? 100 THR A N    3  
ATOM 5955  C CA   . THR A 1 100 ? 24.467  -7.423  25.616  1.00 0.00 ? 100 THR A CA   3  
ATOM 5956  C C    . THR A 1 100 ? 25.374  -8.633  25.426  1.00 0.00 ? 100 THR A C    3  
ATOM 5957  O O    . THR A 1 100 ? 25.082  -9.519  24.622  1.00 0.00 ? 100 THR A O    3  
ATOM 5958  C CB   . THR A 1 100 ? 24.067  -7.323  27.100  1.00 0.00 ? 100 THR A CB   3  
ATOM 5959  O OG1  . THR A 1 100 ? 22.952  -8.182  27.366  1.00 0.00 ? 100 THR A OG1  3  
ATOM 5960  C CG2  . THR A 1 100 ? 23.710  -5.891  27.469  1.00 0.00 ? 100 THR A CG2  3  
ATOM 5961  H H    . THR A 1 100 ? 22.645  -8.225  24.895  1.00 0.00 ? 100 THR A H    3  
ATOM 5962  H HA   . THR A 1 100 ? 25.014  -6.530  25.351  1.00 0.00 ? 100 THR A HA   3  
ATOM 5963  H HB   . THR A 1 100 ? 24.906  -7.637  27.705  1.00 0.00 ? 100 THR A HB   3  
ATOM 5964  H HG1  . THR A 1 100 ? 22.617  -8.006  28.248  1.00 0.00 ? 100 THR A HG1  3  
ATOM 5965  H HG21 . THR A 1 100 ? 23.315  -5.866  28.474  1.00 0.00 ? 100 THR A HG21 3  
ATOM 5966  H HG22 . THR A 1 100 ? 22.968  -5.516  26.780  1.00 0.00 ? 100 THR A HG22 3  
ATOM 5967  H HG23 . THR A 1 100 ? 24.595  -5.275  27.416  1.00 0.00 ? 100 THR A HG23 3  
ATOM 5968  N N    . TRP A 1 101 ? 26.474  -8.665  26.170  1.00 0.00 ? 101 TRP A N    3  
ATOM 5969  C CA   . TRP A 1 101 ? 27.424  -9.768  26.083  1.00 0.00 ? 101 TRP A CA   3  
ATOM 5970  C C    . TRP A 1 101 ? 26.845  -11.034 26.705  1.00 0.00 ? 101 TRP A C    3  
ATOM 5971  O O    . TRP A 1 101 ? 27.437  -12.109 26.609  1.00 0.00 ? 101 TRP A O    3  
ATOM 5972  C CB   . TRP A 1 101 ? 28.734  -9.396  26.778  1.00 0.00 ? 101 TRP A CB   3  
ATOM 5973  C CG   . TRP A 1 101 ? 29.789  -10.454 26.662  1.00 0.00 ? 101 TRP A CG   3  
ATOM 5974  C CD1  . TRP A 1 101 ? 30.343  -11.175 27.682  1.00 0.00 ? 101 TRP A CD1  3  
ATOM 5975  C CD2  . TRP A 1 101 ? 30.419  -10.908 25.459  1.00 0.00 ? 101 TRP A CD2  3  
ATOM 5976  N NE1  . TRP A 1 101 ? 31.279  -12.049 27.185  1.00 0.00 ? 101 TRP A NE1  3  
ATOM 5977  C CE2  . TRP A 1 101 ? 31.344  -11.906 25.824  1.00 0.00 ? 101 TRP A CE2  3  
ATOM 5978  C CE3  . TRP A 1 101 ? 30.290  -10.570 24.109  1.00 0.00 ? 101 TRP A CE3  3  
ATOM 5979  C CZ2  . TRP A 1 101 ? 32.134  -12.566 24.887  1.00 0.00 ? 101 TRP A CZ2  3  
ATOM 5980  C CZ3  . TRP A 1 101 ? 31.076  -11.226 23.181  1.00 0.00 ? 101 TRP A CZ3  3  
ATOM 5981  C CH2  . TRP A 1 101 ? 31.988  -12.215 23.572  1.00 0.00 ? 101 TRP A CH2  3  
ATOM 5982  H H    . TRP A 1 101 ? 26.651  -7.929  26.792  1.00 0.00 ? 101 TRP A H    3  
ATOM 5983  H HA   . TRP A 1 101 ? 27.621  -9.953  25.037  1.00 0.00 ? 101 TRP A HA   3  
ATOM 5984  H HB2  . TRP A 1 101 ? 29.122  -8.489  26.340  1.00 0.00 ? 101 TRP A HB2  3  
ATOM 5985  H HB3  . TRP A 1 101 ? 28.541  -9.230  27.828  1.00 0.00 ? 101 TRP A HB3  3  
ATOM 5986  H HD1  . TRP A 1 101 ? 30.076  -11.061 28.721  1.00 0.00 ? 101 TRP A HD1  3  
ATOM 5987  H HE1  . TRP A 1 101 ? 31.812  -12.676 27.718  1.00 0.00 ? 101 TRP A HE1  3  
ATOM 5988  H HE3  . TRP A 1 101 ? 29.593  -9.810  23.788  1.00 0.00 ? 101 TRP A HE3  3  
ATOM 5989  H HZ2  . TRP A 1 101 ? 32.841  -13.331 25.173  1.00 0.00 ? 101 TRP A HZ2  3  
ATOM 5990  H HZ3  . TRP A 1 101 ? 30.991  -10.977 22.133  1.00 0.00 ? 101 TRP A HZ3  3  
ATOM 5991  H HH2  . TRP A 1 101 ? 32.581  -12.701 22.813  1.00 0.00 ? 101 TRP A HH2  3  
ATOM 5992  N N    . GLU A 1 102 ? 25.687  -10.900 27.343  1.00 0.00 ? 102 GLU A N    3  
ATOM 5993  C CA   . GLU A 1 102 ? 25.030  -12.034 27.981  1.00 0.00 ? 102 GLU A CA   3  
ATOM 5994  C C    . GLU A 1 102 ? 24.126  -12.766 26.994  1.00 0.00 ? 102 GLU A C    3  
ATOM 5995  O O    . GLU A 1 102 ? 24.183  -13.990 26.874  1.00 0.00 ? 102 GLU A O    3  
ATOM 5996  C CB   . GLU A 1 102 ? 24.214  -11.567 29.188  1.00 0.00 ? 102 GLU A CB   3  
ATOM 5997  C CG   . GLU A 1 102 ? 23.187  -12.584 29.659  1.00 0.00 ? 102 GLU A CG   3  
ATOM 5998  C CD   . GLU A 1 102 ? 23.728  -14.000 29.662  1.00 0.00 ? 102 GLU A CD   3  
ATOM 5999  O OE1  . GLU A 1 102 ? 24.793  -14.228 30.272  1.00 0.00 ? 102 GLU A OE1  3  
ATOM 6000  O OE2  . GLU A 1 102 ? 23.085  -14.882 29.053  1.00 0.00 ? 102 GLU A OE2  3  
ATOM 6001  H H    . GLU A 1 102 ? 25.264  -10.017 27.386  1.00 0.00 ? 102 GLU A H    3  
ATOM 6002  H HA   . GLU A 1 102 ? 25.798  -12.714 28.320  1.00 0.00 ? 102 GLU A HA   3  
ATOM 6003  H HB2  . GLU A 1 102 ? 24.888  -11.361 30.006  1.00 0.00 ? 102 GLU A HB2  3  
ATOM 6004  H HB3  . GLU A 1 102 ? 23.693  -10.658 28.925  1.00 0.00 ? 102 GLU A HB3  3  
ATOM 6005  H HG2  . GLU A 1 102 ? 22.882  -12.330 30.663  1.00 0.00 ? 102 GLU A HG2  3  
ATOM 6006  H HG3  . GLU A 1 102 ? 22.331  -12.543 29.002  1.00 0.00 ? 102 GLU A HG3  3  
ATOM 6007  N N    . GLN A 1 103 ? 23.293  -12.007 26.289  1.00 0.00 ? 103 GLN A N    3  
ATOM 6008  C CA   . GLN A 1 103 ? 22.376  -12.583 25.313  1.00 0.00 ? 103 GLN A CA   3  
ATOM 6009  C C    . GLN A 1 103 ? 23.126  -13.449 24.306  1.00 0.00 ? 103 GLN A C    3  
ATOM 6010  O O    . GLN A 1 103 ? 22.720  -14.575 24.017  1.00 0.00 ? 103 GLN A O    3  
ATOM 6011  C CB   . GLN A 1 103 ? 21.613  -11.476 24.583  1.00 0.00 ? 103 GLN A CB   3  
ATOM 6012  C CG   . GLN A 1 103 ? 21.005  -10.440 25.515  1.00 0.00 ? 103 GLN A CG   3  
ATOM 6013  C CD   . GLN A 1 103 ? 20.218  -11.065 26.649  1.00 0.00 ? 103 GLN A CD   3  
ATOM 6014  O OE1  . GLN A 1 103 ? 20.332  -10.649 27.802  1.00 0.00 ? 103 GLN A OE1  3  
ATOM 6015  N NE2  . GLN A 1 103 ? 19.412  -12.071 26.327  1.00 0.00 ? 103 GLN A NE2  3  
ATOM 6016  H H    . GLN A 1 103 ? 23.295  -11.038 26.430  1.00 0.00 ? 103 GLN A H    3  
ATOM 6017  H HA   . GLN A 1 103 ? 21.670  -13.202 25.846  1.00 0.00 ? 103 GLN A HA   3  
ATOM 6018  H HB2  . GLN A 1 103 ? 22.291  -10.971 23.911  1.00 0.00 ? 103 GLN A HB2  3  
ATOM 6019  H HB3  . GLN A 1 103 ? 20.815  -11.924 24.009  1.00 0.00 ? 103 GLN A HB3  3  
ATOM 6020  H HG2  . GLN A 1 103 ? 21.800  -9.843  25.936  1.00 0.00 ? 103 GLN A HG2  3  
ATOM 6021  H HG3  . GLN A 1 103 ? 20.344  -9.805  24.943  1.00 0.00 ? 103 GLN A HG3  3  
ATOM 6022  H HE21 . GLN A 1 103 ? 19.373  -12.349 25.388  1.00 0.00 ? 103 GLN A HE21 3  
ATOM 6023  H HE22 . GLN A 1 103 ? 18.892  -12.494 27.040  1.00 0.00 ? 103 GLN A HE22 3  
ATOM 6024  N N    . VAL A 1 104 ? 24.222  -12.917 23.776  1.00 0.00 ? 104 VAL A N    3  
ATOM 6025  C CA   . VAL A 1 104 ? 25.029  -13.641 22.802  1.00 0.00 ? 104 VAL A CA   3  
ATOM 6026  C C    . VAL A 1 104 ? 25.369  -15.041 23.301  1.00 0.00 ? 104 VAL A C    3  
ATOM 6027  O O    . VAL A 1 104 ? 25.411  -15.996 22.525  1.00 0.00 ? 104 VAL A O    3  
ATOM 6028  C CB   . VAL A 1 104 ? 26.336  -12.890 22.486  1.00 0.00 ? 104 VAL A CB   3  
ATOM 6029  C CG1  . VAL A 1 104 ? 26.995  -12.403 23.767  1.00 0.00 ? 104 VAL A CG1  3  
ATOM 6030  C CG2  . VAL A 1 104 ? 27.283  -13.779 21.694  1.00 0.00 ? 104 VAL A CG2  3  
ATOM 6031  H H    . VAL A 1 104 ? 24.494  -12.015 24.046  1.00 0.00 ? 104 VAL A H    3  
ATOM 6032  H HA   . VAL A 1 104 ? 24.457  -13.724 21.889  1.00 0.00 ? 104 VAL A HA   3  
ATOM 6033  H HB   . VAL A 1 104 ? 26.095  -12.028 21.881  1.00 0.00 ? 104 VAL A HB   3  
ATOM 6034  H HG11 . VAL A 1 104 ? 27.974  -12.007 23.540  1.00 0.00 ? 104 VAL A HG11 3  
ATOM 6035  H HG12 . VAL A 1 104 ? 26.387  -11.629 24.214  1.00 0.00 ? 104 VAL A HG12 3  
ATOM 6036  H HG13 . VAL A 1 104 ? 27.092  -13.228 24.458  1.00 0.00 ? 104 VAL A HG13 3  
ATOM 6037  H HG21 . VAL A 1 104 ? 28.145  -13.204 21.390  1.00 0.00 ? 104 VAL A HG21 3  
ATOM 6038  H HG22 . VAL A 1 104 ? 27.603  -14.606 22.312  1.00 0.00 ? 104 VAL A HG22 3  
ATOM 6039  H HG23 . VAL A 1 104 ? 26.775  -14.158 20.820  1.00 0.00 ? 104 VAL A HG23 3  
ATOM 6040  N N    . LEU A 1 105 ? 25.609  -15.156 24.603  1.00 0.00 ? 105 LEU A N    3  
ATOM 6041  C CA   . LEU A 1 105 ? 25.944  -16.440 25.208  1.00 0.00 ? 105 LEU A CA   3  
ATOM 6042  C C    . LEU A 1 105 ? 24.818  -17.449 25.004  1.00 0.00 ? 105 LEU A C    3  
ATOM 6043  O O    . LEU A 1 105 ? 25.066  -18.616 24.701  1.00 0.00 ? 105 LEU A O    3  
ATOM 6044  C CB   . LEU A 1 105 ? 26.223  -16.265 26.702  1.00 0.00 ? 105 LEU A CB   3  
ATOM 6045  C CG   . LEU A 1 105 ? 27.046  -15.037 27.092  1.00 0.00 ? 105 LEU A CG   3  
ATOM 6046  C CD1  . LEU A 1 105 ? 27.351  -15.049 28.582  1.00 0.00 ? 105 LEU A CD1  3  
ATOM 6047  C CD2  . LEU A 1 105 ? 28.334  -14.980 26.283  1.00 0.00 ? 105 LEU A CD2  3  
ATOM 6048  H H    . LEU A 1 105 ? 25.560  -14.360 25.171  1.00 0.00 ? 105 LEU A H    3  
ATOM 6049  H HA   . LEU A 1 105 ? 26.836  -16.811 24.725  1.00 0.00 ? 105 LEU A HA   3  
ATOM 6050  H HB2  . LEU A 1 105 ? 25.273  -16.201 27.210  1.00 0.00 ? 105 LEU A HB2  3  
ATOM 6051  H HB3  . LEU A 1 105 ? 26.754  -17.142 27.044  1.00 0.00 ? 105 LEU A HB3  3  
ATOM 6052  H HG   . LEU A 1 105 ? 26.475  -14.145 26.875  1.00 0.00 ? 105 LEU A HG   3  
ATOM 6053  H HD11 . LEU A 1 105 ? 27.677  -14.067 28.890  1.00 0.00 ? 105 LEU A HD11 3  
ATOM 6054  H HD12 . LEU A 1 105 ? 28.131  -15.768 28.784  1.00 0.00 ? 105 LEU A HD12 3  
ATOM 6055  H HD13 . LEU A 1 105 ? 26.460  -15.322 29.128  1.00 0.00 ? 105 LEU A HD13 3  
ATOM 6056  H HD21 . LEU A 1 105 ? 28.845  -15.929 26.353  1.00 0.00 ? 105 LEU A HD21 3  
ATOM 6057  H HD22 . LEU A 1 105 ? 28.970  -14.199 26.674  1.00 0.00 ? 105 LEU A HD22 3  
ATOM 6058  H HD23 . LEU A 1 105 ? 28.101  -14.772 25.249  1.00 0.00 ? 105 LEU A HD23 3  
ATOM 6059  N N    . GLU A 1 106 ? 23.582  -16.990 25.171  1.00 0.00 ? 106 GLU A N    3  
ATOM 6060  C CA   . GLU A 1 106 ? 22.419  -17.853 25.004  1.00 0.00 ? 106 GLU A CA   3  
ATOM 6061  C C    . GLU A 1 106 ? 22.466  -18.576 23.661  1.00 0.00 ? 106 GLU A C    3  
ATOM 6062  O O    . GLU A 1 106 ? 21.946  -19.683 23.522  1.00 0.00 ? 106 GLU A O    3  
ATOM 6063  C CB   . GLU A 1 106 ? 21.130  -17.035 25.109  1.00 0.00 ? 106 GLU A CB   3  
ATOM 6064  C CG   . GLU A 1 106 ? 20.906  -16.426 26.483  1.00 0.00 ? 106 GLU A CG   3  
ATOM 6065  C CD   . GLU A 1 106 ? 20.465  -17.450 27.510  1.00 0.00 ? 106 GLU A CD   3  
ATOM 6066  O OE1  . GLU A 1 106 ? 19.309  -17.913 27.429  1.00 0.00 ? 106 GLU A OE1  3  
ATOM 6067  O OE2  . GLU A 1 106 ? 21.279  -17.789 28.396  1.00 0.00 ? 106 GLU A OE2  3  
ATOM 6068  H H    . GLU A 1 106 ? 23.449  -16.050 25.413  1.00 0.00 ? 106 GLU A H    3  
ATOM 6069  H HA   . GLU A 1 106 ? 22.433  -18.587 25.795  1.00 0.00 ? 106 GLU A HA   3  
ATOM 6070  H HB2  . GLU A 1 106 ? 21.165  -16.235 24.384  1.00 0.00 ? 106 GLU A HB2  3  
ATOM 6071  H HB3  . GLU A 1 106 ? 20.291  -17.677 24.882  1.00 0.00 ? 106 GLU A HB3  3  
ATOM 6072  H HG2  . GLU A 1 106 ? 21.829  -15.976 26.818  1.00 0.00 ? 106 GLU A HG2  3  
ATOM 6073  H HG3  . GLU A 1 106 ? 20.144  -15.665 26.405  1.00 0.00 ? 106 GLU A HG3  3  
ATOM 6074  N N    . ILE A 1 107 ? 23.094  -17.942 22.676  1.00 0.00 ? 107 ILE A N    3  
ATOM 6075  C CA   . ILE A 1 107 ? 23.210  -18.525 21.345  1.00 0.00 ? 107 ILE A CA   3  
ATOM 6076  C C    . ILE A 1 107 ? 24.481  -19.359 21.219  1.00 0.00 ? 107 ILE A C    3  
ATOM 6077  O O    . ILE A 1 107 ? 24.501  -20.379 20.531  1.00 0.00 ? 107 ILE A O    3  
ATOM 6078  C CB   . ILE A 1 107 ? 23.212  -17.439 20.253  1.00 0.00 ? 107 ILE A CB   3  
ATOM 6079  C CG1  . ILE A 1 107 ? 21.988  -16.533 20.402  1.00 0.00 ? 107 ILE A CG1  3  
ATOM 6080  C CG2  . ILE A 1 107 ? 23.241  -18.077 18.872  1.00 0.00 ? 107 ILE A CG2  3  
ATOM 6081  C CD1  . ILE A 1 107 ? 22.310  -15.173 20.981  1.00 0.00 ? 107 ILE A CD1  3  
ATOM 6082  H H    . ILE A 1 107 ? 23.489  -17.063 22.849  1.00 0.00 ? 107 ILE A H    3  
ATOM 6083  H HA   . ILE A 1 107 ? 22.355  -19.166 21.186  1.00 0.00 ? 107 ILE A HA   3  
ATOM 6084  H HB   . ILE A 1 107 ? 24.106  -16.846 20.368  1.00 0.00 ? 107 ILE A HB   3  
ATOM 6085  H HG12 . ILE A 1 107 ? 21.539  -16.383 19.433  1.00 0.00 ? 107 ILE A HG12 3  
ATOM 6086  H HG13 . ILE A 1 107 ? 21.273  -17.012 21.056  1.00 0.00 ? 107 ILE A HG13 3  
ATOM 6087  H HG21 . ILE A 1 107 ? 22.711  -17.446 18.174  1.00 0.00 ? 107 ILE A HG21 3  
ATOM 6088  H HG22 . ILE A 1 107 ? 24.265  -18.189 18.549  1.00 0.00 ? 107 ILE A HG22 3  
ATOM 6089  H HG23 . ILE A 1 107 ? 22.768  -19.046 18.913  1.00 0.00 ? 107 ILE A HG23 3  
ATOM 6090  H HD11 . ILE A 1 107 ? 23.106  -15.268 21.705  1.00 0.00 ? 107 ILE A HD11 3  
ATOM 6091  H HD12 . ILE A 1 107 ? 22.620  -14.509 20.189  1.00 0.00 ? 107 ILE A HD12 3  
ATOM 6092  H HD13 . ILE A 1 107 ? 21.431  -14.771 21.464  1.00 0.00 ? 107 ILE A HD13 3  
ATOM 6093  N N    . ALA A 1 108 ? 25.540  -18.919 21.891  1.00 0.00 ? 108 ALA A N    3  
ATOM 6094  C CA   . ALA A 1 108 ? 26.814  -19.626 21.858  1.00 0.00 ? 108 ALA A CA   3  
ATOM 6095  C C    . ALA A 1 108 ? 26.714  -20.971 22.570  1.00 0.00 ? 108 ALA A C    3  
ATOM 6096  O O    . ALA A 1 108 ? 27.321  -21.956 22.149  1.00 0.00 ? 108 ALA A O    3  
ATOM 6097  C CB   . ALA A 1 108 ? 27.907  -18.775 22.485  1.00 0.00 ? 108 ALA A CB   3  
ATOM 6098  H H    . ALA A 1 108 ? 25.462  -18.100 22.423  1.00 0.00 ? 108 ALA A H    3  
ATOM 6099  H HA   . ALA A 1 108 ? 27.074  -19.797 20.823  1.00 0.00 ? 108 ALA A HA   3  
ATOM 6100  H HB1  . ALA A 1 108 ? 28.497  -19.384 23.155  1.00 0.00 ? 108 ALA A HB1  3  
ATOM 6101  H HB2  . ALA A 1 108 ? 28.542  -18.375 21.709  1.00 0.00 ? 108 ALA A HB2  3  
ATOM 6102  H HB3  . ALA A 1 108 ? 27.458  -17.963 23.037  1.00 0.00 ? 108 ALA A HB3  3  
ATOM 6103  N N    . LYS A 1 109 ? 25.944  -21.006 23.653  1.00 0.00 ? 109 LYS A N    3  
ATOM 6104  C CA   . LYS A 1 109 ? 25.764  -22.230 24.425  1.00 0.00 ? 109 LYS A CA   3  
ATOM 6105  C C    . LYS A 1 109 ? 25.299  -23.374 23.529  1.00 0.00 ? 109 LYS A C    3  
ATOM 6106  O O    . LYS A 1 109 ? 25.809  -24.490 23.620  1.00 0.00 ? 109 LYS A O    3  
ATOM 6107  C CB   . LYS A 1 109 ? 24.749  -22.003 25.548  1.00 0.00 ? 109 LYS A CB   3  
ATOM 6108  C CG   . LYS A 1 109 ? 25.365  -21.444 26.819  1.00 0.00 ? 109 LYS A CG   3  
ATOM 6109  C CD   . LYS A 1 109 ? 24.467  -21.677 28.023  1.00 0.00 ? 109 LYS A CD   3  
ATOM 6110  C CE   . LYS A 1 109 ? 24.769  -23.008 28.694  1.00 0.00 ? 109 LYS A CE   3  
ATOM 6111  N NZ   . LYS A 1 109 ? 23.708  -23.393 29.665  1.00 0.00 ? 109 LYS A NZ   3  
ATOM 6112  H H    . LYS A 1 109 ? 25.485  -20.188 23.939  1.00 0.00 ? 109 LYS A H    3  
ATOM 6113  H HA   . LYS A 1 109 ? 26.716  -22.492 24.859  1.00 0.00 ? 109 LYS A HA   3  
ATOM 6114  H HB2  . LYS A 1 109 ? 23.996  -21.311 25.203  1.00 0.00 ? 109 LYS A HB2  3  
ATOM 6115  H HB3  . LYS A 1 109 ? 24.278  -22.946 25.787  1.00 0.00 ? 109 LYS A HB3  3  
ATOM 6116  H HG2  . LYS A 1 109 ? 26.314  -21.928 26.993  1.00 0.00 ? 109 LYS A HG2  3  
ATOM 6117  H HG3  . LYS A 1 109 ? 25.518  -20.381 26.696  1.00 0.00 ? 109 LYS A HG3  3  
ATOM 6118  H HD2  . LYS A 1 109 ? 24.624  -20.883 28.737  1.00 0.00 ? 109 LYS A HD2  3  
ATOM 6119  H HD3  . LYS A 1 109 ? 23.436  -21.673 27.698  1.00 0.00 ? 109 LYS A HD3  3  
ATOM 6120  H HE2  . LYS A 1 109 ? 24.844  -23.771 27.934  1.00 0.00 ? 109 LYS A HE2  3  
ATOM 6121  H HE3  . LYS A 1 109 ? 25.711  -22.927 29.216  1.00 0.00 ? 109 LYS A HE3  3  
ATOM 6122  H HZ1  . LYS A 1 109 ? 23.296  -22.542 30.099  1.00 0.00 ? 109 LYS A HZ1  3  
ATOM 6123  H HZ2  . LYS A 1 109 ? 24.110  -23.991 30.415  1.00 0.00 ? 109 LYS A HZ2  3  
ATOM 6124  H HZ3  . LYS A 1 109 ? 22.955  -23.922 29.181  1.00 0.00 ? 109 LYS A HZ3  3  
ATOM 6125  N N    . GLN A 1 110 ? 24.330  -23.088 22.665  1.00 0.00 ? 110 GLN A N    3  
ATOM 6126  C CA   . GLN A 1 110 ? 23.799  -24.094 21.754  1.00 0.00 ? 110 GLN A CA   3  
ATOM 6127  C C    . GLN A 1 110 ? 24.720  -24.281 20.552  1.00 0.00 ? 110 GLN A C    3  
ATOM 6128  O O    . GLN A 1 110 ? 24.691  -25.318 19.889  1.00 0.00 ? 110 GLN A O    3  
ATOM 6129  C CB   . GLN A 1 110 ? 22.400  -23.696 21.281  1.00 0.00 ? 110 GLN A CB   3  
ATOM 6130  C CG   . GLN A 1 110 ? 21.297  -24.076 22.257  1.00 0.00 ? 110 GLN A CG   3  
ATOM 6131  C CD   . GLN A 1 110 ? 19.948  -24.230 21.582  1.00 0.00 ? 110 GLN A CD   3  
ATOM 6132  O OE1  . GLN A 1 110 ? 19.258  -25.232 21.770  1.00 0.00 ? 110 GLN A OE1  3  
ATOM 6133  N NE2  . GLN A 1 110 ? 19.565  -23.235 20.790  1.00 0.00 ? 110 GLN A NE2  3  
ATOM 6134  H H    . GLN A 1 110 ? 23.965  -22.180 22.641  1.00 0.00 ? 110 GLN A H    3  
ATOM 6135  H HA   . GLN A 1 110 ? 23.735  -25.028 22.291  1.00 0.00 ? 110 GLN A HA   3  
ATOM 6136  H HB2  . GLN A 1 110 ? 22.371  -22.626 21.138  1.00 0.00 ? 110 GLN A HB2  3  
ATOM 6137  H HB3  . GLN A 1 110 ? 22.199  -24.183 20.338  1.00 0.00 ? 110 GLN A HB3  3  
ATOM 6138  H HG2  . GLN A 1 110 ? 21.557  -25.014 22.725  1.00 0.00 ? 110 GLN A HG2  3  
ATOM 6139  H HG3  . GLN A 1 110 ? 21.221  -23.307 23.011  1.00 0.00 ? 110 GLN A HG3  3  
ATOM 6140  H HE21 . GLN A 1 110 ? 20.168  -22.469 20.686  1.00 0.00 ? 110 GLN A HE21 3  
ATOM 6141  H HE22 . GLN A 1 110 ? 18.699  -23.309 20.341  1.00 0.00 ? 110 GLN A HE22 3  
ATOM 6142  N N    . LYS A 1 111 ? 25.537  -23.270 20.277  1.00 0.00 ? 111 LYS A N    3  
ATOM 6143  C CA   . LYS A 1 111 ? 26.468  -23.322 19.156  1.00 0.00 ? 111 LYS A CA   3  
ATOM 6144  C C    . LYS A 1 111 ? 27.797  -23.938 19.581  1.00 0.00 ? 111 LYS A C    3  
ATOM 6145  O O    . LYS A 1 111 ? 28.864  -23.400 19.285  1.00 0.00 ? 111 LYS A O    3  
ATOM 6146  C CB   . LYS A 1 111 ? 26.701  -21.917 18.594  1.00 0.00 ? 111 LYS A CB   3  
ATOM 6147  C CG   . LYS A 1 111 ? 26.859  -21.884 17.084  1.00 0.00 ? 111 LYS A CG   3  
ATOM 6148  C CD   . LYS A 1 111 ? 28.282  -22.216 16.665  1.00 0.00 ? 111 LYS A CD   3  
ATOM 6149  C CE   . LYS A 1 111 ? 28.500  -21.957 15.182  1.00 0.00 ? 111 LYS A CE   3  
ATOM 6150  N NZ   . LYS A 1 111 ? 28.907  -20.549 14.919  1.00 0.00 ? 111 LYS A NZ   3  
ATOM 6151  H H    . LYS A 1 111 ? 25.514  -22.469 20.842  1.00 0.00 ? 111 LYS A H    3  
ATOM 6152  H HA   . LYS A 1 111 ? 26.028  -23.939 18.387  1.00 0.00 ? 111 LYS A HA   3  
ATOM 6153  H HB2  . LYS A 1 111 ? 25.862  -21.292 18.862  1.00 0.00 ? 111 LYS A HB2  3  
ATOM 6154  H HB3  . LYS A 1 111 ? 27.599  -21.510 19.038  1.00 0.00 ? 111 LYS A HB3  3  
ATOM 6155  H HG2  . LYS A 1 111 ? 26.188  -22.608 16.645  1.00 0.00 ? 111 LYS A HG2  3  
ATOM 6156  H HG3  . LYS A 1 111 ? 26.609  -20.895 16.727  1.00 0.00 ? 111 LYS A HG3  3  
ATOM 6157  H HD2  . LYS A 1 111 ? 28.967  -21.602 17.230  1.00 0.00 ? 111 LYS A HD2  3  
ATOM 6158  H HD3  . LYS A 1 111 ? 28.475  -23.259 16.872  1.00 0.00 ? 111 LYS A HD3  3  
ATOM 6159  H HE2  . LYS A 1 111 ? 29.274  -22.619 14.825  1.00 0.00 ? 111 LYS A HE2  3  
ATOM 6160  H HE3  . LYS A 1 111 ? 27.580  -22.162 14.655  1.00 0.00 ? 111 LYS A HE3  3  
ATOM 6161  H HZ1  . LYS A 1 111 ? 28.441  -19.910 15.594  1.00 0.00 ? 111 LYS A HZ1  3  
ATOM 6162  H HZ2  . LYS A 1 111 ? 28.635  -20.273 13.954  1.00 0.00 ? 111 LYS A HZ2  3  
ATOM 6163  H HZ3  . LYS A 1 111 ? 29.937  -20.450 15.018  1.00 0.00 ? 111 LYS A HZ3  3  
ATOM 6164  N N    . MET A 1 112 ? 27.725  -25.069 20.274  1.00 0.00 ? 112 MET A N    3  
ATOM 6165  C CA   . MET A 1 112 ? 28.923  -25.759 20.737  1.00 0.00 ? 112 MET A CA   3  
ATOM 6166  C C    . MET A 1 112 ? 28.909  -27.222 20.305  1.00 0.00 ? 112 MET A C    3  
ATOM 6167  O O    . MET A 1 112 ? 29.352  -28.113 21.030  1.00 0.00 ? 112 MET A O    3  
ATOM 6168  C CB   . MET A 1 112 ? 29.036  -25.666 22.260  1.00 0.00 ? 112 MET A CB   3  
ATOM 6169  C CG   . MET A 1 112 ? 28.970  -24.243 22.788  1.00 0.00 ? 112 MET A CG   3  
ATOM 6170  S SD   . MET A 1 112 ? 30.370  -23.828 23.845  1.00 0.00 ? 112 MET A SD   3  
ATOM 6171  C CE   . MET A 1 112 ? 29.604  -23.893 25.463  1.00 0.00 ? 112 MET A CE   3  
ATOM 6172  H H    . MET A 1 112 ? 26.845  -25.450 20.480  1.00 0.00 ? 112 MET A H    3  
ATOM 6173  H HA   . MET A 1 112 ? 29.778  -25.273 20.292  1.00 0.00 ? 112 MET A HA   3  
ATOM 6174  H HB2  . MET A 1 112 ? 28.228  -26.230 22.704  1.00 0.00 ? 112 MET A HB2  3  
ATOM 6175  H HB3  . MET A 1 112 ? 29.977  -26.098 22.567  1.00 0.00 ? 112 MET A HB3  3  
ATOM 6176  H HG2  . MET A 1 112 ? 28.956  -23.562 21.950  1.00 0.00 ? 112 MET A HG2  3  
ATOM 6177  H HG3  . MET A 1 112 ? 28.059  -24.127 23.357  1.00 0.00 ? 112 MET A HG3  3  
ATOM 6178  H HE1  . MET A 1 112 ? 28.735  -23.252 25.476  1.00 0.00 ? 112 MET A HE1  3  
ATOM 6179  H HE2  . MET A 1 112 ? 29.306  -24.908 25.679  1.00 0.00 ? 112 MET A HE2  3  
ATOM 6180  H HE3  . MET A 1 112 ? 30.310  -23.558 26.209  1.00 0.00 ? 112 MET A HE3  3  
ATOM 6181  N N    . PRO A 1 113 ? 28.387  -27.478 19.096  1.00 0.00 ? 113 PRO A N    3  
ATOM 6182  C CA   . PRO A 1 113 ? 28.303  -28.832 18.541  1.00 0.00 ? 113 PRO A CA   3  
ATOM 6183  C C    . PRO A 1 113 ? 29.672  -29.396 18.178  1.00 0.00 ? 113 PRO A C    3  
ATOM 6184  O O    . PRO A 1 113 ? 30.011  -30.519 18.552  1.00 0.00 ? 113 PRO A O    3  
ATOM 6185  C CB   . PRO A 1 113 ? 27.450  -28.648 17.283  1.00 0.00 ? 113 PRO A CB   3  
ATOM 6186  C CG   . PRO A 1 113 ? 27.653  -27.224 16.893  1.00 0.00 ? 113 PRO A CG   3  
ATOM 6187  C CD   . PRO A 1 113 ? 27.840  -26.466 18.178  1.00 0.00 ? 113 PRO A CD   3  
ATOM 6188  H HA   . PRO A 1 113 ? 27.805  -29.509 19.220  1.00 0.00 ? 113 PRO A HA   3  
ATOM 6189  H HB2  . PRO A 1 113 ? 27.792  -29.323 16.511  1.00 0.00 ? 113 PRO A HB2  3  
ATOM 6190  H HB3  . PRO A 1 113 ? 26.415  -28.850 17.513  1.00 0.00 ? 113 PRO A HB3  3  
ATOM 6191  H HG2  . PRO A 1 113 ? 28.533  -27.136 16.274  1.00 0.00 ? 113 PRO A HG2  3  
ATOM 6192  H HG3  . PRO A 1 113 ? 26.784  -26.861 16.366  1.00 0.00 ? 113 PRO A HG3  3  
ATOM 6193  H HD2  . PRO A 1 113 ? 28.538  -25.654 18.039  1.00 0.00 ? 113 PRO A HD2  3  
ATOM 6194  H HD3  . PRO A 1 113 ? 26.892  -26.093 18.537  1.00 0.00 ? 113 PRO A HD3  3  
ATOM 6195  N N    . ASP A 1 114 ? 30.456  -28.610 17.447  1.00 0.00 ? 114 ASP A N    3  
ATOM 6196  C CA   . ASP A 1 114 ? 31.790  -29.031 17.035  1.00 0.00 ? 114 ASP A CA   3  
ATOM 6197  C C    . ASP A 1 114 ? 32.862  -28.293 17.830  1.00 0.00 ? 114 ASP A C    3  
ATOM 6198  O O    . ASP A 1 114 ? 34.041  -28.647 17.779  1.00 0.00 ? 114 ASP A O    3  
ATOM 6199  C CB   . ASP A 1 114 ? 31.986  -28.783 15.538  1.00 0.00 ? 114 ASP A CB   3  
ATOM 6200  C CG   . ASP A 1 114 ? 31.220  -27.571 15.047  1.00 0.00 ? 114 ASP A CG   3  
ATOM 6201  O OD1  . ASP A 1 114 ? 31.562  -26.444 15.464  1.00 0.00 ? 114 ASP A OD1  3  
ATOM 6202  O OD2  . ASP A 1 114 ? 30.278  -27.748 14.246  1.00 0.00 ? 114 ASP A OD2  3  
ATOM 6203  H H    . ASP A 1 114 ? 30.129  -27.726 17.180  1.00 0.00 ? 114 ASP A H    3  
ATOM 6204  H HA   . ASP A 1 114 ? 31.879  -30.089 17.230  1.00 0.00 ? 114 ASP A HA   3  
ATOM 6205  H HB2  . ASP A 1 114 ? 33.036  -28.626 15.341  1.00 0.00 ? 114 ASP A HB2  3  
ATOM 6206  H HB3  . ASP A 1 114 ? 31.646  -29.649 14.989  1.00 0.00 ? 114 ASP A HB3  3  
ATOM 6207  N N    . LEU A 1 115 ? 32.446  -27.267 18.564  1.00 0.00 ? 115 LEU A N    3  
ATOM 6208  C CA   . LEU A 1 115 ? 33.372  -26.478 19.369  1.00 0.00 ? 115 LEU A CA   3  
ATOM 6209  C C    . LEU A 1 115 ? 34.201  -27.376 20.282  1.00 0.00 ? 115 LEU A C    3  
ATOM 6210  O O    . LEU A 1 115 ? 35.336  -27.049 20.625  1.00 0.00 ? 115 LEU A O    3  
ATOM 6211  C CB   . LEU A 1 115 ? 32.604  -25.452 20.205  1.00 0.00 ? 115 LEU A CB   3  
ATOM 6212  C CG   . LEU A 1 115 ? 32.224  -24.154 19.491  1.00 0.00 ? 115 LEU A CG   3  
ATOM 6213  C CD1  . LEU A 1 115 ? 31.355  -24.448 18.278  1.00 0.00 ? 115 LEU A CD1  3  
ATOM 6214  C CD2  . LEU A 1 115 ? 31.508  -23.210 20.446  1.00 0.00 ? 115 LEU A CD2  3  
ATOM 6215  H H    . LEU A 1 115 ? 31.495  -27.033 18.564  1.00 0.00 ? 115 LEU A H    3  
ATOM 6216  H HA   . LEU A 1 115 ? 34.036  -25.957 18.696  1.00 0.00 ? 115 LEU A HA   3  
ATOM 6217  H HB2  . LEU A 1 115 ? 31.694  -25.919 20.548  1.00 0.00 ? 115 LEU A HB2  3  
ATOM 6218  H HB3  . LEU A 1 115 ? 33.218  -25.195 21.057  1.00 0.00 ? 115 LEU A HB3  3  
ATOM 6219  H HG   . LEU A 1 115 ? 33.123  -23.663 19.146  1.00 0.00 ? 115 LEU A HG   3  
ATOM 6220  H HD11 . LEU A 1 115 ? 30.682  -25.260 18.505  1.00 0.00 ? 115 LEU A HD11 3  
ATOM 6221  H HD12 . LEU A 1 115 ? 31.983  -24.723 17.443  1.00 0.00 ? 115 LEU A HD12 3  
ATOM 6222  H HD13 . LEU A 1 115 ? 30.784  -23.567 18.023  1.00 0.00 ? 115 LEU A HD13 3  
ATOM 6223  H HD21 . LEU A 1 115 ? 30.854  -23.779 21.091  1.00 0.00 ? 115 LEU A HD21 3  
ATOM 6224  H HD22 . LEU A 1 115 ? 30.924  -22.499 19.879  1.00 0.00 ? 115 LEU A HD22 3  
ATOM 6225  H HD23 . LEU A 1 115 ? 32.236  -22.683 21.045  1.00 0.00 ? 115 LEU A HD23 3  
ATOM 6226  N N    . ASN A 1 116 ? 33.626  -28.509 20.670  1.00 0.00 ? 116 ASN A N    3  
ATOM 6227  C CA   . ASN A 1 116 ? 34.313  -29.456 21.541  1.00 0.00 ? 116 ASN A CA   3  
ATOM 6228  C C    . ASN A 1 116 ? 34.815  -28.765 22.806  1.00 0.00 ? 116 ASN A C    3  
ATOM 6229  O O    . ASN A 1 116 ? 35.804  -29.187 23.407  1.00 0.00 ? 116 ASN A O    3  
ATOM 6230  C CB   . ASN A 1 116 ? 35.485  -30.104 20.801  1.00 0.00 ? 116 ASN A CB   3  
ATOM 6231  C CG   . ASN A 1 116 ? 35.766  -31.513 21.286  1.00 0.00 ? 116 ASN A CG   3  
ATOM 6232  O OD1  . ASN A 1 116 ? 35.253  -31.940 22.321  1.00 0.00 ? 116 ASN A OD1  3  
ATOM 6233  N ND2  . ASN A 1 116 ? 36.585  -32.244 20.539  1.00 0.00 ? 116 ASN A ND2  3  
ATOM 6234  H H    . ASN A 1 116 ? 32.718  -28.715 20.363  1.00 0.00 ? 116 ASN A H    3  
ATOM 6235  H HA   . ASN A 1 116 ? 33.606  -30.223 21.820  1.00 0.00 ? 116 ASN A HA   3  
ATOM 6236  H HB2  . ASN A 1 116 ? 35.257  -30.147 19.746  1.00 0.00 ? 116 ASN A HB2  3  
ATOM 6237  H HB3  . ASN A 1 116 ? 36.372  -29.508 20.950  1.00 0.00 ? 116 ASN A HB3  3  
ATOM 6238  H HD21 . ASN A 1 116 ? 36.957  -31.838 19.728  1.00 0.00 ? 116 ASN A HD21 3  
ATOM 6239  H HD22 . ASN A 1 116 ? 36.784  -33.158 20.829  1.00 0.00 ? 116 ASN A HD22 3  
ATOM 6240  N N    . THR A 1 117 ? 34.126  -27.701 23.206  1.00 0.00 ? 117 THR A N    3  
ATOM 6241  C CA   . THR A 1 117 ? 34.501  -26.951 24.398  1.00 0.00 ? 117 THR A CA   3  
ATOM 6242  C C    . THR A 1 117 ? 33.272  -26.552 25.206  1.00 0.00 ? 117 THR A C    3  
ATOM 6243  O O    . THR A 1 117 ? 32.191  -26.345 24.652  1.00 0.00 ? 117 THR A O    3  
ATOM 6244  C CB   . THR A 1 117 ? 35.298  -25.683 24.036  1.00 0.00 ? 117 THR A CB   3  
ATOM 6245  O OG1  . THR A 1 117 ? 35.834  -25.087 25.223  1.00 0.00 ? 117 THR A OG1  3  
ATOM 6246  C CG2  . THR A 1 117 ? 34.415  -24.678 23.312  1.00 0.00 ? 117 THR A CG2  3  
ATOM 6247  H H    . THR A 1 117 ? 33.347  -27.414 22.685  1.00 0.00 ? 117 THR A H    3  
ATOM 6248  H HA   . THR A 1 117 ? 35.130  -27.585 25.006  1.00 0.00 ? 117 THR A HA   3  
ATOM 6249  H HB   . THR A 1 117 ? 36.112  -25.962 23.382  1.00 0.00 ? 117 THR A HB   3  
ATOM 6250  H HG1  . THR A 1 117 ? 36.397  -25.722 25.673  1.00 0.00 ? 117 THR A HG1  3  
ATOM 6251  H HG21 . THR A 1 117 ? 34.242  -23.824 23.952  1.00 0.00 ? 117 THR A HG21 3  
ATOM 6252  H HG22 . THR A 1 117 ? 33.471  -25.140 23.065  1.00 0.00 ? 117 THR A HG22 3  
ATOM 6253  H HG23 . THR A 1 117 ? 34.906  -24.355 22.407  1.00 0.00 ? 117 THR A HG23 3  
ATOM 6254  N N    . THR A 1 118 ? 33.442  -26.445 26.520  1.00 0.00 ? 118 THR A N    3  
ATOM 6255  C CA   . THR A 1 118 ? 32.346  -26.071 27.405  1.00 0.00 ? 118 THR A CA   3  
ATOM 6256  C C    . THR A 1 118 ? 32.503  -24.637 27.898  1.00 0.00 ? 118 THR A C    3  
ATOM 6257  O O    . THR A 1 118 ? 31.946  -24.262 28.930  1.00 0.00 ? 118 THR A O    3  
ATOM 6258  C CB   . THR A 1 118 ? 32.259  -27.013 28.620  1.00 0.00 ? 118 THR A CB   3  
ATOM 6259  O OG1  . THR A 1 118 ? 33.504  -27.018 29.327  1.00 0.00 ? 118 THR A OG1  3  
ATOM 6260  C CG2  . THR A 1 118 ? 31.913  -28.429 28.184  1.00 0.00 ? 118 THR A CG2  3  
ATOM 6261  H H    . THR A 1 118 ? 34.327  -26.623 26.902  1.00 0.00 ? 118 THR A H    3  
ATOM 6262  H HA   . THR A 1 118 ? 31.425  -26.151 26.847  1.00 0.00 ? 118 THR A HA   3  
ATOM 6263  H HB   . THR A 1 118 ? 31.481  -26.655 29.279  1.00 0.00 ? 118 THR A HB   3  
ATOM 6264  H HG1  . THR A 1 118 ? 33.337  -26.942 30.270  1.00 0.00 ? 118 THR A HG1  3  
ATOM 6265  H HG21 . THR A 1 118 ? 32.766  -29.072 28.339  1.00 0.00 ? 118 THR A HG21 3  
ATOM 6266  H HG22 . THR A 1 118 ? 31.649  -28.428 27.137  1.00 0.00 ? 118 THR A HG22 3  
ATOM 6267  H HG23 . THR A 1 118 ? 31.079  -28.791 28.766  1.00 0.00 ? 118 THR A HG23 3  
ATOM 6268  N N    . ASP A 1 119 ? 33.262  -23.840 27.154  1.00 0.00 ? 119 ASP A N    3  
ATOM 6269  C CA   . ASP A 1 119 ? 33.490  -22.446 27.516  1.00 0.00 ? 119 ASP A CA   3  
ATOM 6270  C C    . ASP A 1 119 ? 32.544  -21.525 26.751  1.00 0.00 ? 119 ASP A C    3  
ATOM 6271  O O    . ASP A 1 119 ? 32.577  -21.466 25.521  1.00 0.00 ? 119 ASP A O    3  
ATOM 6272  C CB   . ASP A 1 119 ? 34.941  -22.055 27.234  1.00 0.00 ? 119 ASP A CB   3  
ATOM 6273  C CG   . ASP A 1 119 ? 35.797  -22.064 28.485  1.00 0.00 ? 119 ASP A CG   3  
ATOM 6274  O OD1  . ASP A 1 119 ? 35.485  -21.301 29.424  1.00 0.00 ? 119 ASP A OD1  3  
ATOM 6275  O OD2  . ASP A 1 119 ? 36.778  -22.835 28.527  1.00 0.00 ? 119 ASP A OD2  3  
ATOM 6276  H H    . ASP A 1 119 ? 33.679  -24.198 26.342  1.00 0.00 ? 119 ASP A H    3  
ATOM 6277  H HA   . ASP A 1 119 ? 33.297  -22.341 28.573  1.00 0.00 ? 119 ASP A HA   3  
ATOM 6278  H HB2  . ASP A 1 119 ? 35.365  -22.752 26.526  1.00 0.00 ? 119 ASP A HB2  3  
ATOM 6279  H HB3  . ASP A 1 119 ? 34.964  -21.061 26.811  1.00 0.00 ? 119 ASP A HB3  3  
ATOM 6280  N N    . LEU A 1 120 ? 31.701  -20.809 27.487  1.00 0.00 ? 120 LEU A N    3  
ATOM 6281  C CA   . LEU A 1 120 ? 30.744  -19.891 26.878  1.00 0.00 ? 120 LEU A CA   3  
ATOM 6282  C C    . LEU A 1 120 ? 31.434  -18.608 26.424  1.00 0.00 ? 120 LEU A C    3  
ATOM 6283  O O    . LEU A 1 120 ? 31.029  -17.990 25.440  1.00 0.00 ? 120 LEU A O    3  
ATOM 6284  C CB   . LEU A 1 120 ? 29.626  -19.559 27.867  1.00 0.00 ? 120 LEU A CB   3  
ATOM 6285  C CG   . LEU A 1 120 ? 28.202  -19.850 27.392  1.00 0.00 ? 120 LEU A CG   3  
ATOM 6286  C CD1  . LEU A 1 120 ? 27.187  -19.346 28.406  1.00 0.00 ? 120 LEU A CD1  3  
ATOM 6287  C CD2  . LEU A 1 120 ? 27.955  -19.219 26.029  1.00 0.00 ? 120 LEU A CD2  3  
ATOM 6288  H H    . LEU A 1 120 ? 31.722  -20.898 28.462  1.00 0.00 ? 120 LEU A H    3  
ATOM 6289  H HA   . LEU A 1 120 ? 30.318  -20.381 26.015  1.00 0.00 ? 120 LEU A HA   3  
ATOM 6290  H HB2  . LEU A 1 120 ? 29.798  -20.133 28.765  1.00 0.00 ? 120 LEU A HB2  3  
ATOM 6291  H HB3  . LEU A 1 120 ? 29.690  -18.505 28.097  1.00 0.00 ? 120 LEU A HB3  3  
ATOM 6292  H HG   . LEU A 1 120 ? 28.072  -20.919 27.294  1.00 0.00 ? 120 LEU A HG   3  
ATOM 6293  H HD11 . LEU A 1 120 ? 26.326  -18.952 27.889  1.00 0.00 ? 120 LEU A HD11 3  
ATOM 6294  H HD12 . LEU A 1 120 ? 27.634  -18.567 29.006  1.00 0.00 ? 120 LEU A HD12 3  
ATOM 6295  H HD13 . LEU A 1 120 ? 26.882  -20.162 29.045  1.00 0.00 ? 120 LEU A HD13 3  
ATOM 6296  H HD21 . LEU A 1 120 ? 26.949  -18.828 25.991  1.00 0.00 ? 120 LEU A HD21 3  
ATOM 6297  H HD22 . LEU A 1 120 ? 28.080  -19.966 25.259  1.00 0.00 ? 120 LEU A HD22 3  
ATOM 6298  H HD23 . LEU A 1 120 ? 28.660  -18.416 25.872  1.00 0.00 ? 120 LEU A HD23 3  
ATOM 6299  N N    . GLU A 1 121 ? 32.478  -18.215 27.147  1.00 0.00 ? 121 GLU A N    3  
ATOM 6300  C CA   . GLU A 1 121 ? 33.224  -17.007 26.817  1.00 0.00 ? 121 GLU A CA   3  
ATOM 6301  C C    . GLU A 1 121 ? 34.014  -17.191 25.525  1.00 0.00 ? 121 GLU A C    3  
ATOM 6302  O O    . GLU A 1 121 ? 34.142  -16.264 24.726  1.00 0.00 ? 121 GLU A O    3  
ATOM 6303  C CB   . GLU A 1 121 ? 34.172  -16.638 27.960  1.00 0.00 ? 121 GLU A CB   3  
ATOM 6304  C CG   . GLU A 1 121 ? 34.966  -17.817 28.497  1.00 0.00 ? 121 GLU A CG   3  
ATOM 6305  C CD   . GLU A 1 121 ? 36.347  -17.420 28.979  1.00 0.00 ? 121 GLU A CD   3  
ATOM 6306  O OE1  . GLU A 1 121 ? 36.436  -16.699 29.995  1.00 0.00 ? 121 GLU A OE1  3  
ATOM 6307  O OE2  . GLU A 1 121 ? 37.340  -17.829 28.341  1.00 0.00 ? 121 GLU A OE2  3  
ATOM 6308  H H    . GLU A 1 121 ? 32.752  -18.750 27.921  1.00 0.00 ? 121 GLU A H    3  
ATOM 6309  H HA   . GLU A 1 121 ? 32.513  -16.206 26.679  1.00 0.00 ? 121 GLU A HA   3  
ATOM 6310  H HB2  . GLU A 1 121 ? 34.869  -15.892 27.607  1.00 0.00 ? 121 GLU A HB2  3  
ATOM 6311  H HB3  . GLU A 1 121 ? 33.594  -16.221 28.771  1.00 0.00 ? 121 GLU A HB3  3  
ATOM 6312  H HG2  . GLU A 1 121 ? 34.424  -18.253 29.323  1.00 0.00 ? 121 GLU A HG2  3  
ATOM 6313  H HG3  . GLU A 1 121 ? 35.072  -18.551 27.711  1.00 0.00 ? 121 GLU A HG3  3  
ATOM 6314  N N    . ALA A 1 122 ? 34.542  -18.395 25.328  1.00 0.00 ? 122 ALA A N    3  
ATOM 6315  C CA   . ALA A 1 122 ? 35.319  -18.702 24.133  1.00 0.00 ? 122 ALA A CA   3  
ATOM 6316  C C    . ALA A 1 122 ? 34.407  -19.008 22.950  1.00 0.00 ? 122 ALA A C    3  
ATOM 6317  O O    . ALA A 1 122 ? 34.831  -18.945 21.796  1.00 0.00 ? 122 ALA A O    3  
ATOM 6318  C CB   . ALA A 1 122 ? 36.254  -19.873 24.398  1.00 0.00 ? 122 ALA A CB   3  
ATOM 6319  H H    . ALA A 1 122 ? 34.406  -19.093 26.002  1.00 0.00 ? 122 ALA A H    3  
ATOM 6320  H HA   . ALA A 1 122 ? 35.923  -17.838 23.896  1.00 0.00 ? 122 ALA A HA   3  
ATOM 6321  H HB1  . ALA A 1 122 ? 37.277  -19.555 24.257  1.00 0.00 ? 122 ALA A HB1  3  
ATOM 6322  H HB2  . ALA A 1 122 ? 36.120  -20.218 25.413  1.00 0.00 ? 122 ALA A HB2  3  
ATOM 6323  H HB3  . ALA A 1 122 ? 36.028  -20.676 23.712  1.00 0.00 ? 122 ALA A HB3  3  
ATOM 6324  N N    . ALA A 1 123 ? 33.154  -19.339 23.244  1.00 0.00 ? 123 ALA A N    3  
ATOM 6325  C CA   . ALA A 1 123 ? 32.183  -19.653 22.203  1.00 0.00 ? 123 ALA A CA   3  
ATOM 6326  C C    . ALA A 1 123 ? 31.368  -18.421 21.824  1.00 0.00 ? 123 ALA A C    3  
ATOM 6327  O O    . ALA A 1 123 ? 30.672  -18.415 20.809  1.00 0.00 ? 123 ALA A O    3  
ATOM 6328  C CB   . ALA A 1 123 ? 31.264  -20.776 22.661  1.00 0.00 ? 123 ALA A CB   3  
ATOM 6329  H H    . ALA A 1 123 ? 32.877  -19.372 24.183  1.00 0.00 ? 123 ALA A H    3  
ATOM 6330  H HA   . ALA A 1 123 ? 32.725  -19.996 21.334  1.00 0.00 ? 123 ALA A HA   3  
ATOM 6331  H HB1  . ALA A 1 123 ? 31.837  -21.685 22.773  1.00 0.00 ? 123 ALA A HB1  3  
ATOM 6332  H HB2  . ALA A 1 123 ? 30.817  -20.512 23.608  1.00 0.00 ? 123 ALA A HB2  3  
ATOM 6333  H HB3  . ALA A 1 123 ? 30.488  -20.927 21.926  1.00 0.00 ? 123 ALA A HB3  3  
ATOM 6334  N N    . ALA A 1 124 ? 31.458  -17.381 22.646  1.00 0.00 ? 124 ALA A N    3  
ATOM 6335  C CA   . ALA A 1 124 ? 30.730  -16.143 22.395  1.00 0.00 ? 124 ALA A CA   3  
ATOM 6336  C C    . ALA A 1 124 ? 31.502  -15.235 21.444  1.00 0.00 ? 124 ALA A C    3  
ATOM 6337  O O    . ALA A 1 124 ? 30.917  -14.391 20.765  1.00 0.00 ? 124 ALA A O    3  
ATOM 6338  C CB   . ALA A 1 124 ? 30.449  -15.422 23.705  1.00 0.00 ? 124 ALA A CB   3  
ATOM 6339  H H    . ALA A 1 124 ? 32.030  -17.447 23.439  1.00 0.00 ? 124 ALA A H    3  
ATOM 6340  H HA   . ALA A 1 124 ? 29.783  -16.400 21.943  1.00 0.00 ? 124 ALA A HA   3  
ATOM 6341  H HB1  . ALA A 1 124 ? 29.462  -15.687 24.056  1.00 0.00 ? 124 ALA A HB1  3  
ATOM 6342  H HB2  . ALA A 1 124 ? 31.184  -15.712 24.441  1.00 0.00 ? 124 ALA A HB2  3  
ATOM 6343  H HB3  . ALA A 1 124 ? 30.500  -14.355 23.546  1.00 0.00 ? 124 ALA A HB3  3  
ATOM 6344  N N    . ARG A 1 125 ? 32.818  -15.414 21.400  1.00 0.00 ? 125 ARG A N    3  
ATOM 6345  C CA   . ARG A 1 125 ? 33.670  -14.609 20.533  1.00 0.00 ? 125 ARG A CA   3  
ATOM 6346  C C    . ARG A 1 125 ? 33.328  -14.844 19.065  1.00 0.00 ? 125 ARG A C    3  
ATOM 6347  O O    . ARG A 1 125 ? 33.501  -13.958 18.228  1.00 0.00 ? 125 ARG A O    3  
ATOM 6348  C CB   . ARG A 1 125 ? 35.144  -14.937 20.783  1.00 0.00 ? 125 ARG A CB   3  
ATOM 6349  C CG   . ARG A 1 125 ? 36.097  -14.204 19.854  1.00 0.00 ? 125 ARG A CG   3  
ATOM 6350  C CD   . ARG A 1 125 ? 36.166  -12.721 20.183  1.00 0.00 ? 125 ARG A CD   3  
ATOM 6351  N NE   . ARG A 1 125 ? 35.605  -11.897 19.117  1.00 0.00 ? 125 ARG A NE   3  
ATOM 6352  C CZ   . ARG A 1 125 ? 36.229  -11.654 17.969  1.00 0.00 ? 125 ARG A CZ   3  
ATOM 6353  N NH1  . ARG A 1 125 ? 37.428  -12.171 17.741  1.00 0.00 ? 125 ARG A NH1  3  
ATOM 6354  N NH2  . ARG A 1 125 ? 35.653  -10.894 17.047  1.00 0.00 ? 125 ARG A NH2  3  
ATOM 6355  H H    . ARG A 1 125 ? 33.227  -16.104 21.965  1.00 0.00 ? 125 ARG A H    3  
ATOM 6356  H HA   . ARG A 1 125 ? 33.497  -13.570 20.769  1.00 0.00 ? 125 ARG A HA   3  
ATOM 6357  H HB2  . ARG A 1 125 ? 35.392  -14.671 21.800  1.00 0.00 ? 125 ARG A HB2  3  
ATOM 6358  H HB3  . ARG A 1 125 ? 35.291  -15.998 20.651  1.00 0.00 ? 125 ARG A HB3  3  
ATOM 6359  H HG2  . ARG A 1 125 ? 37.084  -14.631 19.956  1.00 0.00 ? 125 ARG A HG2  3  
ATOM 6360  H HG3  . ARG A 1 125 ? 35.755  -14.323 18.836  1.00 0.00 ? 125 ARG A HG3  3  
ATOM 6361  H HD2  . ARG A 1 125 ? 35.613  -12.542 21.093  1.00 0.00 ? 125 ARG A HD2  3  
ATOM 6362  H HD3  . ARG A 1 125 ? 37.200  -12.447 20.331  1.00 0.00 ? 125 ARG A HD3  3  
ATOM 6363  H HE   . ARG A 1 125 ? 34.720  -11.504 19.264  1.00 0.00 ? 125 ARG A HE   3  
ATOM 6364  H HH11 . ARG A 1 125 ? 37.864  -12.746 18.434  1.00 0.00 ? 125 ARG A HH11 3  
ATOM 6365  H HH12 . ARG A 1 125 ? 37.896  -11.989 16.876  1.00 0.00 ? 125 ARG A HH12 3  
ATOM 6366  H HH21 . ARG A 1 125 ? 34.749  -10.502 17.216  1.00 0.00 ? 125 ARG A HH21 3  
ATOM 6367  H HH22 . ARG A 1 125 ? 36.123  -10.712 16.184  1.00 0.00 ? 125 ARG A HH22 3  
ATOM 6368  N N    . MET A 1 126 ? 32.843  -16.043 18.760  1.00 0.00 ? 126 MET A N    3  
ATOM 6369  C CA   . MET A 1 126 ? 32.476  -16.393 17.393  1.00 0.00 ? 126 MET A CA   3  
ATOM 6370  C C    . MET A 1 126 ? 31.046  -15.960 17.085  1.00 0.00 ? 126 MET A C    3  
ATOM 6371  O O    . MET A 1 126 ? 30.712  -15.655 15.940  1.00 0.00 ? 126 MET A O    3  
ATOM 6372  C CB   . MET A 1 126 ? 32.624  -17.900 17.172  1.00 0.00 ? 126 MET A CB   3  
ATOM 6373  C CG   . MET A 1 126 ? 31.877  -18.740 18.196  1.00 0.00 ? 126 MET A CG   3  
ATOM 6374  S SD   . MET A 1 126 ? 31.462  -20.382 17.578  1.00 0.00 ? 126 MET A SD   3  
ATOM 6375  C CE   . MET A 1 126 ? 33.050  -21.201 17.702  1.00 0.00 ? 126 MET A CE   3  
ATOM 6376  H H    . MET A 1 126 ? 32.728  -16.708 19.470  1.00 0.00 ? 126 MET A H    3  
ATOM 6377  H HA   . MET A 1 126 ? 33.148  -15.874 16.726  1.00 0.00 ? 126 MET A HA   3  
ATOM 6378  H HB2  . MET A 1 126 ? 32.246  -18.147 16.191  1.00 0.00 ? 126 MET A HB2  3  
ATOM 6379  H HB3  . MET A 1 126 ? 33.671  -18.158 17.222  1.00 0.00 ? 126 MET A HB3  3  
ATOM 6380  H HG2  . MET A 1 126 ? 32.496  -18.848 19.074  1.00 0.00 ? 126 MET A HG2  3  
ATOM 6381  H HG3  . MET A 1 126 ? 30.964  -18.229 18.462  1.00 0.00 ? 126 MET A HG3  3  
ATOM 6382  H HE1  . MET A 1 126 ? 33.442  -21.078 18.701  1.00 0.00 ? 126 MET A HE1  3  
ATOM 6383  H HE2  . MET A 1 126 ? 32.930  -22.253 17.490  1.00 0.00 ? 126 MET A HE2  3  
ATOM 6384  H HE3  . MET A 1 126 ? 33.736  -20.766 16.990  1.00 0.00 ? 126 MET A HE3  3  
ATOM 6385  N N    . ILE A 1 127 ? 30.206  -15.936 18.115  1.00 0.00 ? 127 ILE A N    3  
ATOM 6386  C CA   . ILE A 1 127 ? 28.813  -15.540 17.954  1.00 0.00 ? 127 ILE A CA   3  
ATOM 6387  C C    . ILE A 1 127 ? 28.664  -14.023 17.996  1.00 0.00 ? 127 ILE A C    3  
ATOM 6388  O O    . ILE A 1 127 ? 27.662  -13.474 17.539  1.00 0.00 ? 127 ILE A O    3  
ATOM 6389  C CB   . ILE A 1 127 ? 27.921  -16.162 19.044  1.00 0.00 ? 127 ILE A CB   3  
ATOM 6390  C CG1  . ILE A 1 127 ? 28.083  -17.684 19.059  1.00 0.00 ? 127 ILE A CG1  3  
ATOM 6391  C CG2  . ILE A 1 127 ? 26.465  -15.781 18.819  1.00 0.00 ? 127 ILE A CG2  3  
ATOM 6392  C CD1  . ILE A 1 127 ? 27.598  -18.356 17.794  1.00 0.00 ? 127 ILE A CD1  3  
ATOM 6393  H H    . ILE A 1 127 ? 30.531  -16.190 19.003  1.00 0.00 ? 127 ILE A H    3  
ATOM 6394  H HA   . ILE A 1 127 ? 28.474  -15.897 16.992  1.00 0.00 ? 127 ILE A HA   3  
ATOM 6395  H HB   . ILE A 1 127 ? 28.228  -15.765 19.999  1.00 0.00 ? 127 ILE A HB   3  
ATOM 6396  H HG12 . ILE A 1 127 ? 29.126  -17.927 19.184  1.00 0.00 ? 127 ILE A HG12 3  
ATOM 6397  H HG13 . ILE A 1 127 ? 27.521  -18.090 19.888  1.00 0.00 ? 127 ILE A HG13 3  
ATOM 6398  H HG21 . ILE A 1 127 ? 26.173  -16.054 17.816  1.00 0.00 ? 127 ILE A HG21 3  
ATOM 6399  H HG22 . ILE A 1 127 ? 25.843  -16.305 19.529  1.00 0.00 ? 127 ILE A HG22 3  
ATOM 6400  H HG23 . ILE A 1 127 ? 26.346  -14.717 18.952  1.00 0.00 ? 127 ILE A HG23 3  
ATOM 6401  H HD11 . ILE A 1 127 ? 28.416  -18.886 17.331  1.00 0.00 ? 127 ILE A HD11 3  
ATOM 6402  H HD12 . ILE A 1 127 ? 26.807  -19.050 18.035  1.00 0.00 ? 127 ILE A HD12 3  
ATOM 6403  H HD13 . ILE A 1 127 ? 27.223  -17.607 17.110  1.00 0.00 ? 127 ILE A HD13 3  
ATOM 6404  N N    . ALA A 1 128 ? 29.670  -13.350 18.547  1.00 0.00 ? 128 ALA A N    3  
ATOM 6405  C CA   . ALA A 1 128 ? 29.653  -11.896 18.646  1.00 0.00 ? 128 ALA A CA   3  
ATOM 6406  C C    . ALA A 1 128 ? 29.788  -11.251 17.271  1.00 0.00 ? 128 ALA A C    3  
ATOM 6407  O O    . ALA A 1 128 ? 29.495  -10.069 17.097  1.00 0.00 ? 128 ALA A O    3  
ATOM 6408  C CB   . ALA A 1 128 ? 30.765  -11.417 19.567  1.00 0.00 ? 128 ALA A CB   3  
ATOM 6409  H H    . ALA A 1 128 ? 30.441  -13.844 18.894  1.00 0.00 ? 128 ALA A H    3  
ATOM 6410  H HA   . ALA A 1 128 ? 28.708  -11.602 19.079  1.00 0.00 ? 128 ALA A HA   3  
ATOM 6411  H HB1  . ALA A 1 128 ? 30.840  -12.082 20.416  1.00 0.00 ? 128 ALA A HB1  3  
ATOM 6412  H HB2  . ALA A 1 128 ? 31.701  -11.412 19.029  1.00 0.00 ? 128 ALA A HB2  3  
ATOM 6413  H HB3  . ALA A 1 128 ? 30.542  -10.418 19.911  1.00 0.00 ? 128 ALA A HB3  3  
ATOM 6414  N N    . GLY A 1 129 ? 30.235  -12.036 16.295  1.00 0.00 ? 129 GLY A N    3  
ATOM 6415  C CA   . GLY A 1 129 ? 30.402  -11.523 14.948  1.00 0.00 ? 129 GLY A CA   3  
ATOM 6416  C C    . GLY A 1 129 ? 29.176  -11.747 14.086  1.00 0.00 ? 129 GLY A C    3  
ATOM 6417  O O    . GLY A 1 129 ? 28.819  -10.899 13.268  1.00 0.00 ? 129 GLY A O    3  
ATOM 6418  H H    . GLY A 1 129 ? 30.454  -12.971 16.492  1.00 0.00 ? 129 GLY A H    3  
ATOM 6419  H HA2  . GLY A 1 129 ? 30.604  -10.463 15.000  1.00 0.00 ? 129 GLY A HA2  3  
ATOM 6420  H HA3  . GLY A 1 129 ? 31.246  -12.017 14.489  1.00 0.00 ? 129 GLY A HA3  3  
ATOM 6421  N N    . SER A 1 130 ? 28.529  -12.894 14.267  1.00 0.00 ? 130 SER A N    3  
ATOM 6422  C CA   . SER A 1 130 ? 27.338  -13.230 13.495  1.00 0.00 ? 130 SER A CA   3  
ATOM 6423  C C    . SER A 1 130 ? 26.312  -12.103 13.560  1.00 0.00 ? 130 SER A C    3  
ATOM 6424  O O    . SER A 1 130 ? 26.117  -11.371 12.590  1.00 0.00 ? 130 SER A O    3  
ATOM 6425  C CB   . SER A 1 130 ? 26.718  -14.529 14.014  1.00 0.00 ? 130 SER A CB   3  
ATOM 6426  O OG   . SER A 1 130 ? 27.064  -14.753 15.370  1.00 0.00 ? 130 SER A OG   3  
ATOM 6427  H H    . SER A 1 130 ? 28.862  -13.530 14.934  1.00 0.00 ? 130 SER A H    3  
ATOM 6428  H HA   . SER A 1 130 ? 27.638  -13.370 12.467  1.00 0.00 ? 130 SER A HA   3  
ATOM 6429  H HB2  . SER A 1 130 ? 25.643  -14.469 13.935  1.00 0.00 ? 130 SER A HB2  3  
ATOM 6430  H HB3  . SER A 1 130 ? 27.077  -15.358 13.422  1.00 0.00 ? 130 SER A HB3  3  
ATOM 6431  H HG   . SER A 1 130 ? 26.849  -15.658 15.610  1.00 0.00 ? 130 SER A HG   3  
ATOM 6432  N N    . ALA A 1 131 ? 25.660  -11.970 14.710  1.00 0.00 ? 131 ALA A N    3  
ATOM 6433  C CA   . ALA A 1 131 ? 24.656  -10.931 14.903  1.00 0.00 ? 131 ALA A CA   3  
ATOM 6434  C C    . ALA A 1 131 ? 25.207  -9.559  14.529  1.00 0.00 ? 131 ALA A C    3  
ATOM 6435  O O    . ALA A 1 131 ? 24.497  -8.729  13.961  1.00 0.00 ? 131 ALA A O    3  
ATOM 6436  C CB   . ALA A 1 131 ? 24.168  -10.930 16.344  1.00 0.00 ? 131 ALA A CB   3  
ATOM 6437  H H    . ALA A 1 131 ? 25.861  -12.584 15.447  1.00 0.00 ? 131 ALA A H    3  
ATOM 6438  H HA   . ALA A 1 131 ? 23.815  -11.157 14.264  1.00 0.00 ? 131 ALA A HA   3  
ATOM 6439  H HB1  . ALA A 1 131 ? 24.826  -10.321 16.947  1.00 0.00 ? 131 ALA A HB1  3  
ATOM 6440  H HB2  . ALA A 1 131 ? 23.167  -10.528 16.385  1.00 0.00 ? 131 ALA A HB2  3  
ATOM 6441  H HB3  . ALA A 1 131 ? 24.166  -11.941 16.724  1.00 0.00 ? 131 ALA A HB3  3  
ATOM 6442  N N    . ARG A 1 132 ? 26.475  -9.327  14.852  1.00 0.00 ? 132 ARG A N    3  
ATOM 6443  C CA   . ARG A 1 132 ? 27.120  -8.054  14.552  1.00 0.00 ? 132 ARG A CA   3  
ATOM 6444  C C    . ARG A 1 132 ? 26.982  -7.711  13.071  1.00 0.00 ? 132 ARG A C    3  
ATOM 6445  O O    . ARG A 1 132 ? 27.105  -6.551  12.678  1.00 0.00 ? 132 ARG A O    3  
ATOM 6446  C CB   . ARG A 1 132 ? 28.599  -8.104  14.939  1.00 0.00 ? 132 ARG A CB   3  
ATOM 6447  C CG   . ARG A 1 132 ? 29.419  -6.962  14.359  1.00 0.00 ? 132 ARG A CG   3  
ATOM 6448  C CD   . ARG A 1 132 ? 30.059  -7.353  13.036  1.00 0.00 ? 132 ARG A CD   3  
ATOM 6449  N NE   . ARG A 1 132 ? 31.515  -7.244  13.080  1.00 0.00 ? 132 ARG A NE   3  
ATOM 6450  C CZ   . ARG A 1 132 ? 32.301  -7.474  12.034  1.00 0.00 ? 132 ARG A CZ   3  
ATOM 6451  N NH1  . ARG A 1 132 ? 31.774  -7.824  10.869  1.00 0.00 ? 132 ARG A NH1  3  
ATOM 6452  N NH2  . ARG A 1 132 ? 33.617  -7.354  12.152  1.00 0.00 ? 132 ARG A NH2  3  
ATOM 6453  H H    . ARG A 1 132 ? 26.989  -10.028 15.305  1.00 0.00 ? 132 ARG A H    3  
ATOM 6454  H HA   . ARG A 1 132 ? 26.630  -7.288  15.134  1.00 0.00 ? 132 ARG A HA   3  
ATOM 6455  H HB2  . ARG A 1 132 ? 28.679  -8.064  16.015  1.00 0.00 ? 132 ARG A HB2  3  
ATOM 6456  H HB3  . ARG A 1 132 ? 29.019  -9.034  14.589  1.00 0.00 ? 132 ARG A HB3  3  
ATOM 6457  H HG2  . ARG A 1 132 ? 28.772  -6.113  14.195  1.00 0.00 ? 132 ARG A HG2  3  
ATOM 6458  H HG3  . ARG A 1 132 ? 30.195  -6.697  15.060  1.00 0.00 ? 132 ARG A HG3  3  
ATOM 6459  H HD2  . ARG A 1 132 ? 29.791  -8.374  12.809  1.00 0.00 ? 132 ARG A HD2  3  
ATOM 6460  H HD3  . ARG A 1 132 ? 29.682  -6.701  12.262  1.00 0.00 ? 132 ARG A HD3  3  
ATOM 6461  H HE   . ARG A 1 132 ? 31.926  -6.987  13.931  1.00 0.00 ? 132 ARG A HE   3  
ATOM 6462  H HH11 . ARG A 1 132 ? 30.782  -7.914  10.776  1.00 0.00 ? 132 ARG A HH11 3  
ATOM 6463  H HH12 . ARG A 1 132 ? 32.368  -7.996  10.082  1.00 0.00 ? 132 ARG A HH12 3  
ATOM 6464  H HH21 . ARG A 1 132 ? 34.018  -7.091  13.029  1.00 0.00 ? 132 ARG A HH21 3  
ATOM 6465  H HH22 . ARG A 1 132 ? 34.208  -7.528  11.365  1.00 0.00 ? 132 ARG A HH22 3  
ATOM 6466  N N    . SER A 1 133 ? 26.725  -8.728  12.255  1.00 0.00 ? 133 SER A N    3  
ATOM 6467  C CA   . SER A 1 133 ? 26.574  -8.536  10.817  1.00 0.00 ? 133 SER A CA   3  
ATOM 6468  C C    . SER A 1 133 ? 25.100  -8.513  10.424  1.00 0.00 ? 133 SER A C    3  
ATOM 6469  O O    . SER A 1 133 ? 24.731  -7.952  9.393   1.00 0.00 ? 133 SER A O    3  
ATOM 6470  C CB   . SER A 1 133 ? 27.301  -9.644  10.054  1.00 0.00 ? 133 SER A CB   3  
ATOM 6471  O OG   . SER A 1 133 ? 26.441  -10.744 9.811   1.00 0.00 ? 133 SER A OG   3  
ATOM 6472  H H    . SER A 1 133 ? 26.638  -9.631  12.628  1.00 0.00 ? 133 SER A H    3  
ATOM 6473  H HA   . SER A 1 133 ? 27.017  -7.585  10.562  1.00 0.00 ? 133 SER A HA   3  
ATOM 6474  H HB2  . SER A 1 133 ? 27.648  -9.258  9.107   1.00 0.00 ? 133 SER A HB2  3  
ATOM 6475  H HB3  . SER A 1 133 ? 28.146  -9.984  10.635  1.00 0.00 ? 133 SER A HB3  3  
ATOM 6476  H HG   . SER A 1 133 ? 26.490  -11.358 10.547  1.00 0.00 ? 133 SER A HG   3  
ATOM 6477  N N    . MET A 1 134 ? 24.264  -9.128  11.253  1.00 0.00 ? 134 MET A N    3  
ATOM 6478  C CA   . MET A 1 134 ? 22.830  -9.179  10.993  1.00 0.00 ? 134 MET A CA   3  
ATOM 6479  C C    . MET A 1 134 ? 22.214  -7.785  11.071  1.00 0.00 ? 134 MET A C    3  
ATOM 6480  O O    . MET A 1 134 ? 21.235  -7.489  10.386  1.00 0.00 ? 134 MET A O    3  
ATOM 6481  C CB   . MET A 1 134 ? 22.141  -10.109 11.993  1.00 0.00 ? 134 MET A CB   3  
ATOM 6482  C CG   . MET A 1 134 ? 21.550  -9.384  13.191  1.00 0.00 ? 134 MET A CG   3  
ATOM 6483  S SD   . MET A 1 134 ? 20.364  -10.395 14.099  1.00 0.00 ? 134 MET A SD   3  
ATOM 6484  C CE   . MET A 1 134 ? 21.035  -12.033 13.824  1.00 0.00 ? 134 MET A CE   3  
ATOM 6485  H H    . MET A 1 134 ? 24.618  -9.558  12.060  1.00 0.00 ? 134 MET A H    3  
ATOM 6486  H HA   . MET A 1 134 ? 22.688  -9.567  9.996   1.00 0.00 ? 134 MET A HA   3  
ATOM 6487  H HB2  . MET A 1 134 ? 21.343  -10.634 11.487  1.00 0.00 ? 134 MET A HB2  3  
ATOM 6488  H HB3  . MET A 1 134 ? 22.861  -10.828 12.354  1.00 0.00 ? 134 MET A HB3  3  
ATOM 6489  H HG2  . MET A 1 134 ? 22.352  -9.108  13.859  1.00 0.00 ? 134 MET A HG2  3  
ATOM 6490  H HG3  . MET A 1 134 ? 21.051  -8.492  12.843  1.00 0.00 ? 134 MET A HG3  3  
ATOM 6491  H HE1  . MET A 1 134 ? 22.070  -12.054 14.130  1.00 0.00 ? 134 MET A HE1  3  
ATOM 6492  H HE2  . MET A 1 134 ? 20.473  -12.753 14.401  1.00 0.00 ? 134 MET A HE2  3  
ATOM 6493  H HE3  . MET A 1 134 ? 20.965  -12.278 12.774  1.00 0.00 ? 134 MET A HE3  3  
ATOM 6494  N N    . GLY A 1 135 ? 22.794  -6.932  11.909  1.00 0.00 ? 135 GLY A N    3  
ATOM 6495  C CA   . GLY A 1 135 ? 22.288  -5.580  12.061  1.00 0.00 ? 135 GLY A CA   3  
ATOM 6496  C C    . GLY A 1 135 ? 21.908  -5.260  13.493  1.00 0.00 ? 135 GLY A C    3  
ATOM 6497  O O    . GLY A 1 135 ? 20.998  -4.469  13.739  1.00 0.00 ? 135 GLY A O    3  
ATOM 6498  H H    . GLY A 1 135 ? 23.572  -7.223  12.430  1.00 0.00 ? 135 GLY A H    3  
ATOM 6499  H HA2  . GLY A 1 135 ? 23.048  -4.885  11.737  1.00 0.00 ? 135 GLY A HA2  3  
ATOM 6500  H HA3  . GLY A 1 135 ? 21.416  -5.462  11.434  1.00 0.00 ? 135 GLY A HA3  3  
ATOM 6501  N N    . VAL A 1 136 ? 22.606  -5.878  14.441  1.00 0.00 ? 136 VAL A N    3  
ATOM 6502  C CA   . VAL A 1 136 ? 22.336  -5.656  15.856  1.00 0.00 ? 136 VAL A CA   3  
ATOM 6503  C C    . VAL A 1 136 ? 23.472  -4.883  16.517  1.00 0.00 ? 136 VAL A C    3  
ATOM 6504  O O    . VAL A 1 136 ? 24.629  -4.994  16.112  1.00 0.00 ? 136 VAL A O    3  
ATOM 6505  C CB   . VAL A 1 136 ? 22.131  -6.986  16.604  1.00 0.00 ? 136 VAL A CB   3  
ATOM 6506  C CG1  . VAL A 1 136 ? 23.388  -7.839  16.531  1.00 0.00 ? 136 VAL A CG1  3  
ATOM 6507  C CG2  . VAL A 1 136 ? 21.736  -6.728  18.050  1.00 0.00 ? 136 VAL A CG2  3  
ATOM 6508  H H    . VAL A 1 136 ? 23.319  -6.498  14.182  1.00 0.00 ? 136 VAL A H    3  
ATOM 6509  H HA   . VAL A 1 136 ? 21.427  -5.078  15.936  1.00 0.00 ? 136 VAL A HA   3  
ATOM 6510  H HB   . VAL A 1 136 ? 21.328  -7.526  16.124  1.00 0.00 ? 136 VAL A HB   3  
ATOM 6511  H HG11 . VAL A 1 136 ? 24.221  -7.226  16.219  1.00 0.00 ? 136 VAL A HG11 3  
ATOM 6512  H HG12 . VAL A 1 136 ? 23.594  -8.262  17.504  1.00 0.00 ? 136 VAL A HG12 3  
ATOM 6513  H HG13 . VAL A 1 136 ? 23.241  -8.636  15.816  1.00 0.00 ? 136 VAL A HG13 3  
ATOM 6514  H HG21 . VAL A 1 136 ? 21.511  -7.667  18.534  1.00 0.00 ? 136 VAL A HG21 3  
ATOM 6515  H HG22 . VAL A 1 136 ? 22.552  -6.244  18.567  1.00 0.00 ? 136 VAL A HG22 3  
ATOM 6516  H HG23 . VAL A 1 136 ? 20.864  -6.091  18.078  1.00 0.00 ? 136 VAL A HG23 3  
ATOM 6517  N N    . GLU A 1 137 ? 23.133  -4.101  17.537  1.00 0.00 ? 137 GLU A N    3  
ATOM 6518  C CA   . GLU A 1 137 ? 24.126  -3.310  18.255  1.00 0.00 ? 137 GLU A CA   3  
ATOM 6519  C C    . GLU A 1 137 ? 24.705  -4.096  19.428  1.00 0.00 ? 137 GLU A C    3  
ATOM 6520  O O    . GLU A 1 137 ? 24.059  -4.252  20.464  1.00 0.00 ? 137 GLU A O    3  
ATOM 6521  C CB   . GLU A 1 137 ? 23.504  -2.005  18.758  1.00 0.00 ? 137 GLU A CB   3  
ATOM 6522  C CG   . GLU A 1 137 ? 24.434  -0.808  18.654  1.00 0.00 ? 137 GLU A CG   3  
ATOM 6523  C CD   . GLU A 1 137 ? 23.706  0.512   18.815  1.00 0.00 ? 137 GLU A CD   3  
ATOM 6524  O OE1  . GLU A 1 137 ? 23.209  1.042   17.799  1.00 0.00 ? 137 GLU A OE1  3  
ATOM 6525  O OE2  . GLU A 1 137 ? 23.632  1.015   19.956  1.00 0.00 ? 137 GLU A OE2  3  
ATOM 6526  H H    . GLU A 1 137 ? 22.194  -4.055  17.814  1.00 0.00 ? 137 GLU A H    3  
ATOM 6527  H HA   . GLU A 1 137 ? 24.924  -3.075  17.566  1.00 0.00 ? 137 GLU A HA   3  
ATOM 6528  H HB2  . GLU A 1 137 ? 22.616  -1.797  18.179  1.00 0.00 ? 137 GLU A HB2  3  
ATOM 6529  H HB3  . GLU A 1 137 ? 23.227  -2.130  19.794  1.00 0.00 ? 137 GLU A HB3  3  
ATOM 6530  H HG2  . GLU A 1 137 ? 25.185  -0.883  19.427  1.00 0.00 ? 137 GLU A HG2  3  
ATOM 6531  H HG3  . GLU A 1 137 ? 24.913  -0.823  17.686  1.00 0.00 ? 137 GLU A HG3  3  
ATOM 6532  N N    . VAL A 1 138 ? 25.927  -4.589  19.256  1.00 0.00 ? 138 VAL A N    3  
ATOM 6533  C CA   . VAL A 1 138 ? 26.594  -5.359  20.299  1.00 0.00 ? 138 VAL A CA   3  
ATOM 6534  C C    . VAL A 1 138 ? 27.002  -4.466  21.465  1.00 0.00 ? 138 VAL A C    3  
ATOM 6535  O O    . VAL A 1 138 ? 27.527  -3.370  21.268  1.00 0.00 ? 138 VAL A O    3  
ATOM 6536  C CB   . VAL A 1 138 ? 27.843  -6.077  19.755  1.00 0.00 ? 138 VAL A CB   3  
ATOM 6537  C CG1  . VAL A 1 138 ? 28.915  -5.068  19.372  1.00 0.00 ? 138 VAL A CG1  3  
ATOM 6538  C CG2  . VAL A 1 138 ? 28.375  -7.069  20.779  1.00 0.00 ? 138 VAL A CG2  3  
ATOM 6539  H H    . VAL A 1 138 ? 26.392  -4.432  18.408  1.00 0.00 ? 138 VAL A H    3  
ATOM 6540  H HA   . VAL A 1 138 ? 25.902  -6.107  20.657  1.00 0.00 ? 138 VAL A HA   3  
ATOM 6541  H HB   . VAL A 1 138 ? 27.562  -6.624  18.868  1.00 0.00 ? 138 VAL A HB   3  
ATOM 6542  H HG11 . VAL A 1 138 ? 29.687  -5.058  20.127  1.00 0.00 ? 138 VAL A HG11 3  
ATOM 6543  H HG12 . VAL A 1 138 ? 29.344  -5.342  18.419  1.00 0.00 ? 138 VAL A HG12 3  
ATOM 6544  H HG13 . VAL A 1 138 ? 28.473  -4.085  19.298  1.00 0.00 ? 138 VAL A HG13 3  
ATOM 6545  H HG21 . VAL A 1 138 ? 27.549  -7.510  21.315  1.00 0.00 ? 138 VAL A HG21 3  
ATOM 6546  H HG22 . VAL A 1 138 ? 28.932  -7.845  20.273  1.00 0.00 ? 138 VAL A HG22 3  
ATOM 6547  H HG23 . VAL A 1 138 ? 29.024  -6.557  21.474  1.00 0.00 ? 138 VAL A HG23 3  
ATOM 6548  N N    . VAL A 1 139 ? 26.758  -4.942  22.682  1.00 0.00 ? 139 VAL A N    3  
ATOM 6549  C CA   . VAL A 1 139 ? 27.101  -4.187  23.882  1.00 0.00 ? 139 VAL A CA   3  
ATOM 6550  C C    . VAL A 1 139 ? 27.848  -5.060  24.885  1.00 0.00 ? 139 VAL A C    3  
ATOM 6551  O O    . VAL A 1 139 ? 27.247  -5.879  25.579  1.00 0.00 ? 139 VAL A O    3  
ATOM 6552  C CB   . VAL A 1 139 ? 25.845  -3.606  24.558  1.00 0.00 ? 139 VAL A CB   3  
ATOM 6553  C CG1  . VAL A 1 139 ? 26.231  -2.750  25.754  1.00 0.00 ? 139 VAL A CG1  3  
ATOM 6554  C CG2  . VAL A 1 139 ? 25.026  -2.803  23.559  1.00 0.00 ? 139 VAL A CG2  3  
ATOM 6555  H H    . VAL A 1 139 ? 26.338  -5.822  22.776  1.00 0.00 ? 139 VAL A H    3  
ATOM 6556  H HA   . VAL A 1 139 ? 27.739  -3.366  23.588  1.00 0.00 ? 139 VAL A HA   3  
ATOM 6557  H HB   . VAL A 1 139 ? 25.239  -4.427  24.911  1.00 0.00 ? 139 VAL A HB   3  
ATOM 6558  H HG11 . VAL A 1 139 ? 26.505  -3.389  26.581  1.00 0.00 ? 139 VAL A HG11 3  
ATOM 6559  H HG12 . VAL A 1 139 ? 27.068  -2.120  25.492  1.00 0.00 ? 139 VAL A HG12 3  
ATOM 6560  H HG13 . VAL A 1 139 ? 25.392  -2.133  26.041  1.00 0.00 ? 139 VAL A HG13 3  
ATOM 6561  H HG21 . VAL A 1 139 ? 24.360  -2.141  24.091  1.00 0.00 ? 139 VAL A HG21 3  
ATOM 6562  H HG22 . VAL A 1 139 ? 25.689  -2.222  22.934  1.00 0.00 ? 139 VAL A HG22 3  
ATOM 6563  H HG23 . VAL A 1 139 ? 24.449  -3.476  22.942  1.00 0.00 ? 139 VAL A HG23 3  
ATOM 6564  N N    . GLY A 1 140 ? 29.163  -4.877  24.957  1.00 0.00 ? 140 GLY A N    3  
ATOM 6565  C CA   . GLY A 1 140 ? 29.971  -5.654  25.878  1.00 0.00 ? 140 GLY A CA   3  
ATOM 6566  C C    . GLY A 1 140 ? 31.273  -6.119  25.258  1.00 0.00 ? 140 GLY A C    3  
ATOM 6567  O O    . GLY A 1 140 ? 32.190  -5.324  25.055  1.00 0.00 ? 140 GLY A O    3  
ATOM 6568  H H    . GLY A 1 140 ? 29.588  -4.209  24.379  1.00 0.00 ? 140 GLY A H    3  
ATOM 6569  H HA2  . GLY A 1 140 ? 30.192  -5.049  26.744  1.00 0.00 ? 140 GLY A HA2  3  
ATOM 6570  H HA3  . GLY A 1 140 ? 29.406  -6.520  26.192  1.00 0.00 ? 140 GLY A HA3  3  
ATOM 6571  N N    . ALA A 1 141 ? 31.356  -7.411  24.957  1.00 0.00 ? 141 ALA A N    3  
ATOM 6572  C CA   . ALA A 1 141 ? 32.555  -7.980  24.356  1.00 0.00 ? 141 ALA A CA   3  
ATOM 6573  C C    . ALA A 1 141 ? 33.755  -7.840  25.286  1.00 0.00 ? 141 ALA A C    3  
ATOM 6574  O O    . ALA A 1 141 ? 33.765  -7.022  26.206  1.00 0.00 ? 141 ALA A O    3  
ATOM 6575  C CB   . ALA A 1 141 ? 32.842  -7.315  23.018  1.00 0.00 ? 141 ALA A CB   3  
ATOM 6576  H H    . ALA A 1 141 ? 30.591  -7.995  25.142  1.00 0.00 ? 141 ALA A H    3  
ATOM 6577  H HA   . ALA A 1 141 ? 32.372  -9.030  24.176  1.00 0.00 ? 141 ALA A HA   3  
ATOM 6578  H HB1  . ALA A 1 141 ? 33.113  -8.068  22.293  1.00 0.00 ? 141 ALA A HB1  3  
ATOM 6579  H HB2  . ALA A 1 141 ? 31.960  -6.791  22.681  1.00 0.00 ? 141 ALA A HB2  3  
ATOM 6580  H HB3  . ALA A 1 141 ? 33.656  -6.615  23.132  1.00 0.00 ? 141 ALA A HB3  3  
ATOM 6581  N N    . PRO A 1 142 ? 34.791  -8.657  25.045  1.00 0.00 ? 142 PRO A N    3  
ATOM 6582  C CA   . PRO A 1 142 ? 36.015  -8.643  25.851  1.00 0.00 ? 142 PRO A CA   3  
ATOM 6583  C C    . PRO A 1 142 ? 36.837  -7.377  25.635  1.00 0.00 ? 142 PRO A C    3  
ATOM 6584  O O    . PRO A 1 142 ? 36.382  -6.434  24.989  1.00 0.00 ? 142 PRO A O    3  
ATOM 6585  C CB   . PRO A 1 142 ? 36.783  -9.870  25.352  1.00 0.00 ? 142 PRO A CB   3  
ATOM 6586  C CG   . PRO A 1 142 ? 36.288  -10.088 23.964  1.00 0.00 ? 142 PRO A CG   3  
ATOM 6587  C CD   . PRO A 1 142 ? 34.847  -9.657  23.965  1.00 0.00 ? 142 PRO A CD   3  
ATOM 6588  H HA   . PRO A 1 142 ? 35.798  -8.755  26.903  1.00 0.00 ? 142 PRO A HA   3  
ATOM 6589  H HB2  . PRO A 1 142 ? 37.844  -9.665  25.367  1.00 0.00 ? 142 PRO A HB2  3  
ATOM 6590  H HB3  . PRO A 1 142 ? 36.565  -10.717 25.986  1.00 0.00 ? 142 PRO A HB3  3  
ATOM 6591  H HG2  . PRO A 1 142 ? 36.858  -9.486  23.273  1.00 0.00 ? 142 PRO A HG2  3  
ATOM 6592  H HG3  . PRO A 1 142 ? 36.366  -11.134 23.707  1.00 0.00 ? 142 PRO A HG3  3  
ATOM 6593  H HD2  . PRO A 1 142 ? 34.585  -9.215  23.016  1.00 0.00 ? 142 PRO A HD2  3  
ATOM 6594  H HD3  . PRO A 1 142 ? 34.203  -10.496 24.184  1.00 0.00 ? 142 PRO A HD3  3  
ATOM 6595  N N    . GLU A 1 143 ? 38.050  -7.364  26.180  1.00 0.00 ? 143 GLU A N    3  
ATOM 6596  C CA   . GLU A 1 143 ? 38.934  -6.212  26.046  1.00 0.00 ? 143 GLU A CA   3  
ATOM 6597  C C    . GLU A 1 143 ? 38.237  -4.935  26.506  1.00 0.00 ? 143 GLU A C    3  
ATOM 6598  O O    . GLU A 1 143 ? 37.715  -4.171  25.694  1.00 0.00 ? 143 GLU A O    3  
ATOM 6599  C CB   . GLU A 1 143 ? 39.394  -6.060  24.594  1.00 0.00 ? 143 GLU A CB   3  
ATOM 6600  C CG   . GLU A 1 143 ? 40.475  -5.010  24.405  1.00 0.00 ? 143 GLU A CG   3  
ATOM 6601  C CD   . GLU A 1 143 ? 41.810  -5.611  24.011  1.00 0.00 ? 143 GLU A CD   3  
ATOM 6602  O OE1  . GLU A 1 143 ? 41.826  -6.500  23.134  1.00 0.00 ? 143 GLU A OE1  3  
ATOM 6603  O OE2  . GLU A 1 143 ? 42.840  -5.193  24.581  1.00 0.00 ? 143 GLU A OE2  3  
ATOM 6604  H H    . GLU A 1 143 ? 38.356  -8.146  26.683  1.00 0.00 ? 143 GLU A H    3  
ATOM 6605  H HA   . GLU A 1 143 ? 39.797  -6.382  26.671  1.00 0.00 ? 143 GLU A HA   3  
ATOM 6606  H HB2  . GLU A 1 143 ? 39.778  -7.009  24.250  1.00 0.00 ? 143 GLU A HB2  3  
ATOM 6607  H HB3  . GLU A 1 143 ? 38.544  -5.784  23.988  1.00 0.00 ? 143 GLU A HB3  3  
ATOM 6608  H HG2  . GLU A 1 143 ? 40.164  -4.326  23.630  1.00 0.00 ? 143 GLU A HG2  3  
ATOM 6609  H HG3  . GLU A 1 143 ? 40.600  -4.469  25.332  1.00 0.00 ? 143 GLU A HG3  3  
ATOM 6610  N N    . VAL A 1 144 ? 38.233  -4.709  27.817  1.00 0.00 ? 144 VAL A N    3  
ATOM 6611  C CA   . VAL A 1 144 ? 37.602  -3.525  28.387  1.00 0.00 ? 144 VAL A CA   3  
ATOM 6612  C C    . VAL A 1 144 ? 38.427  -2.963  29.539  1.00 0.00 ? 144 VAL A C    3  
ATOM 6613  O O    . VAL A 1 144 ? 37.904  -2.270  30.411  1.00 0.00 ? 144 VAL A O    3  
ATOM 6614  C CB   . VAL A 1 144 ? 36.180  -3.835  28.892  1.00 0.00 ? 144 VAL A CB   3  
ATOM 6615  C CG1  . VAL A 1 144 ? 36.235  -4.629  30.188  1.00 0.00 ? 144 VAL A CG1  3  
ATOM 6616  C CG2  . VAL A 1 144 ? 35.389  -2.550  29.077  1.00 0.00 ? 144 VAL A CG2  3  
ATOM 6617  H H    . VAL A 1 144 ? 38.666  -5.355  28.414  1.00 0.00 ? 144 VAL A H    3  
ATOM 6618  H HA   . VAL A 1 144 ? 37.530  -2.778  27.609  1.00 0.00 ? 144 VAL A HA   3  
ATOM 6619  H HB   . VAL A 1 144 ? 35.679  -4.438  28.148  1.00 0.00 ? 144 VAL A HB   3  
ATOM 6620  H HG11 . VAL A 1 144 ? 35.336  -5.219  30.287  1.00 0.00 ? 144 VAL A HG11 3  
ATOM 6621  H HG12 . VAL A 1 144 ? 37.096  -5.281  30.176  1.00 0.00 ? 144 VAL A HG12 3  
ATOM 6622  H HG13 . VAL A 1 144 ? 36.311  -3.948  31.023  1.00 0.00 ? 144 VAL A HG13 3  
ATOM 6623  H HG21 . VAL A 1 144 ? 35.291  -2.336  30.131  1.00 0.00 ? 144 VAL A HG21 3  
ATOM 6624  H HG22 . VAL A 1 144 ? 35.906  -1.735  28.591  1.00 0.00 ? 144 VAL A HG22 3  
ATOM 6625  H HG23 . VAL A 1 144 ? 34.408  -2.664  28.640  1.00 0.00 ? 144 VAL A HG23 3  
ATOM 6626  N N    . LYS A 1 145 ? 39.721  -3.266  29.535  1.00 0.00 ? 145 LYS A N    3  
ATOM 6627  C CA   . LYS A 1 145 ? 40.621  -2.790  30.579  1.00 0.00 ? 145 LYS A CA   3  
ATOM 6628  C C    . LYS A 1 145 ? 42.070  -2.819  30.102  1.00 0.00 ? 145 LYS A C    3  
ATOM 6629  O O    . LYS A 1 145 ? 42.442  -3.643  29.266  1.00 0.00 ? 145 LYS A O    3  
ATOM 6630  C CB   . LYS A 1 145 ? 40.471  -3.645  31.839  1.00 0.00 ? 145 LYS A CB   3  
ATOM 6631  C CG   . LYS A 1 145 ? 40.828  -5.106  31.630  1.00 0.00 ? 145 LYS A CG   3  
ATOM 6632  C CD   . LYS A 1 145 ? 40.644  -5.913  32.904  1.00 0.00 ? 145 LYS A CD   3  
ATOM 6633  C CE   . LYS A 1 145 ? 40.355  -7.375  32.601  1.00 0.00 ? 145 LYS A CE   3  
ATOM 6634  N NZ   . LYS A 1 145 ? 39.056  -7.816  33.181  1.00 0.00 ? 145 LYS A NZ   3  
ATOM 6635  H H    . LYS A 1 145 ? 40.079  -3.823  28.812  1.00 0.00 ? 145 LYS A H    3  
ATOM 6636  H HA   . LYS A 1 145 ? 40.351  -1.771  30.810  1.00 0.00 ? 145 LYS A HA   3  
ATOM 6637  H HB2  . LYS A 1 145 ? 41.114  -3.245  32.609  1.00 0.00 ? 145 LYS A HB2  3  
ATOM 6638  H HB3  . LYS A 1 145 ? 39.446  -3.591  32.176  1.00 0.00 ? 145 LYS A HB3  3  
ATOM 6639  H HG2  . LYS A 1 145 ? 40.190  -5.517  30.861  1.00 0.00 ? 145 LYS A HG2  3  
ATOM 6640  H HG3  . LYS A 1 145 ? 41.861  -5.174  31.317  1.00 0.00 ? 145 LYS A HG3  3  
ATOM 6641  H HD2  . LYS A 1 145 ? 41.547  -5.851  33.493  1.00 0.00 ? 145 LYS A HD2  3  
ATOM 6642  H HD3  . LYS A 1 145 ? 39.818  -5.500  33.465  1.00 0.00 ? 145 LYS A HD3  3  
ATOM 6643  H HE2  . LYS A 1 145 ? 40.324  -7.508  31.530  1.00 0.00 ? 145 LYS A HE2  3  
ATOM 6644  H HE3  . LYS A 1 145 ? 41.148  -7.979  33.016  1.00 0.00 ? 145 LYS A HE3  3  
ATOM 6645  H HZ1  . LYS A 1 145 ? 38.413  -8.125  32.424  1.00 0.00 ? 145 LYS A HZ1  3  
ATOM 6646  H HZ2  . LYS A 1 145 ? 38.611  -7.031  33.698  1.00 0.00 ? 145 LYS A HZ2  3  
ATOM 6647  H HZ3  . LYS A 1 145 ? 39.208  -8.608  33.838  1.00 0.00 ? 145 LYS A HZ3  3  
ATOM 6648  N N    . ASP A 1 146 ? 42.883  -1.917  30.639  1.00 0.00 ? 146 ASP A N    3  
ATOM 6649  C CA   . ASP A 1 146 ? 44.292  -1.841  30.271  1.00 0.00 ? 146 ASP A CA   3  
ATOM 6650  C C    . ASP A 1 146 ? 44.453  -1.761  28.756  1.00 0.00 ? 146 ASP A C    3  
ATOM 6651  O O    . ASP A 1 146 ? 45.250  -2.492  28.167  1.00 0.00 ? 146 ASP A O    3  
ATOM 6652  C CB   . ASP A 1 146 ? 45.049  -3.054  30.814  1.00 0.00 ? 146 ASP A CB   3  
ATOM 6653  C CG   . ASP A 1 146 ? 46.534  -2.788  30.967  1.00 0.00 ? 146 ASP A CG   3  
ATOM 6654  O OD1  . ASP A 1 146 ? 46.984  -1.692  30.573  1.00 0.00 ? 146 ASP A OD1  3  
ATOM 6655  O OD2  . ASP A 1 146 ? 47.246  -3.676  31.482  1.00 0.00 ? 146 ASP A OD2  3  
ATOM 6656  H H    . ASP A 1 146 ? 42.527  -1.287  31.301  1.00 0.00 ? 146 ASP A H    3  
ATOM 6657  H HA   . ASP A 1 146 ? 44.702  -0.945  30.712  1.00 0.00 ? 146 ASP A HA   3  
ATOM 6658  H HB2  . ASP A 1 146 ? 44.648  -3.317  31.781  1.00 0.00 ? 146 ASP A HB2  3  
ATOM 6659  H HB3  . ASP A 1 146 ? 44.919  -3.884  30.136  1.00 0.00 ? 146 ASP A HB3  3  
ATOM 6660  N N    . ALA A 1 147 ? 43.692  -0.869  28.131  1.00 0.00 ? 147 ALA A N    3  
ATOM 6661  C CA   . ALA A 1 147 ? 43.751  -0.693  26.685  1.00 0.00 ? 147 ALA A CA   3  
ATOM 6662  C C    . ALA A 1 147 ? 43.554  -2.021  25.962  1.00 0.00 ? 147 ALA A C    3  
ATOM 6663  O O    . ALA A 1 147 ? 44.060  -2.217  24.857  1.00 0.00 ? 147 ALA A O    3  
ATOM 6664  C CB   . ALA A 1 147 ? 45.077  -0.063  26.284  1.00 0.00 ? 147 ALA A CB   3  
ATOM 6665  H H    . ALA A 1 147 ? 43.076  -0.315  28.655  1.00 0.00 ? 147 ALA A H    3  
ATOM 6666  H HA   . ALA A 1 147 ? 42.958  -0.017  26.398  1.00 0.00 ? 147 ALA A HA   3  
ATOM 6667  H HB1  . ALA A 1 147 ? 45.492  0.469   27.129  1.00 0.00 ? 147 ALA A HB1  3  
ATOM 6668  H HB2  . ALA A 1 147 ? 45.763  -0.837  25.973  1.00 0.00 ? 147 ALA A HB2  3  
ATOM 6669  H HB3  . ALA A 1 147 ? 44.916  0.626   25.469  1.00 0.00 ? 147 ALA A HB3  3  
ATOM 6670  N N    . MET A 1 1   ? 11.793  -34.371 -16.252 1.00 0.00 ? 1   MET A N    4  
ATOM 6671  C CA   . MET A 1 1   ? 13.197  -34.295 -16.639 1.00 0.00 ? 1   MET A CA   4  
ATOM 6672  C C    . MET A 1 1   ? 14.011  -33.549 -15.586 1.00 0.00 ? 1   MET A C    4  
ATOM 6673  O O    . MET A 1 1   ? 15.049  -34.031 -15.133 1.00 0.00 ? 1   MET A O    4  
ATOM 6674  C CB   . MET A 1 1   ? 13.338  -33.601 -17.995 1.00 0.00 ? 1   MET A CB   4  
ATOM 6675  C CG   . MET A 1 1   ? 13.195  -34.545 -19.178 1.00 0.00 ? 1   MET A CG   4  
ATOM 6676  S SD   . MET A 1 1   ? 14.663  -34.573 -20.225 1.00 0.00 ? 1   MET A SD   4  
ATOM 6677  C CE   . MET A 1 1   ? 14.529  -36.203 -20.953 1.00 0.00 ? 1   MET A CE   4  
ATOM 6678  H H1   . MET A 1 1   ? 11.257  -33.551 -16.236 1.00 0.00 ? 1   MET A H1   4  
ATOM 6679  H HA   . MET A 1 1   ? 13.573  -35.304 -16.720 1.00 0.00 ? 1   MET A HA   4  
ATOM 6680  H HB2  . MET A 1 1   ? 12.577  -32.839 -18.077 1.00 0.00 ? 1   MET A HB2  4  
ATOM 6681  H HB3  . MET A 1 1   ? 14.310  -33.135 -18.049 1.00 0.00 ? 1   MET A HB3  4  
ATOM 6682  H HG2  . MET A 1 1   ? 13.018  -35.543 -18.807 1.00 0.00 ? 1   MET A HG2  4  
ATOM 6683  H HG3  . MET A 1 1   ? 12.351  -34.229 -19.773 1.00 0.00 ? 1   MET A HG3  4  
ATOM 6684  H HE1  . MET A 1 1   ? 14.872  -36.170 -21.977 1.00 0.00 ? 1   MET A HE1  4  
ATOM 6685  H HE2  . MET A 1 1   ? 15.136  -36.899 -20.392 1.00 0.00 ? 1   MET A HE2  4  
ATOM 6686  H HE3  . MET A 1 1   ? 13.498  -36.524 -20.929 1.00 0.00 ? 1   MET A HE3  4  
ATOM 6687  N N    . LYS A 1 2   ? 13.534  -32.370 -15.201 1.00 0.00 ? 2   LYS A N    4  
ATOM 6688  C CA   . LYS A 1 2   ? 14.216  -31.557 -14.201 1.00 0.00 ? 2   LYS A CA   4  
ATOM 6689  C C    . LYS A 1 2   ? 15.640  -31.234 -14.642 1.00 0.00 ? 2   LYS A C    4  
ATOM 6690  O O    . LYS A 1 2   ? 16.562  -32.021 -14.426 1.00 0.00 ? 2   LYS A O    4  
ATOM 6691  C CB   . LYS A 1 2   ? 14.240  -32.283 -12.854 1.00 0.00 ? 2   LYS A CB   4  
ATOM 6692  C CG   . LYS A 1 2   ? 15.138  -31.622 -11.823 1.00 0.00 ? 2   LYS A CG   4  
ATOM 6693  C CD   . LYS A 1 2   ? 16.354  -32.479 -11.511 1.00 0.00 ? 2   LYS A CD   4  
ATOM 6694  C CE   . LYS A 1 2   ? 16.225  -33.155 -10.155 1.00 0.00 ? 2   LYS A CE   4  
ATOM 6695  N NZ   . LYS A 1 2   ? 17.523  -33.185 -9.425  1.00 0.00 ? 2   LYS A NZ   4  
ATOM 6696  H H    . LYS A 1 2   ? 12.701  -32.039 -15.599 1.00 0.00 ? 2   LYS A H    4  
ATOM 6697  H HA   . LYS A 1 2   ? 13.667  -30.634 -14.094 1.00 0.00 ? 2   LYS A HA   4  
ATOM 6698  H HB2  . LYS A 1 2   ? 13.236  -32.316 -12.459 1.00 0.00 ? 2   LYS A HB2  4  
ATOM 6699  H HB3  . LYS A 1 2   ? 14.589  -33.294 -13.010 1.00 0.00 ? 2   LYS A HB3  4  
ATOM 6700  H HG2  . LYS A 1 2   ? 15.472  -30.670 -12.207 1.00 0.00 ? 2   LYS A HG2  4  
ATOM 6701  H HG3  . LYS A 1 2   ? 14.574  -31.468 -10.914 1.00 0.00 ? 2   LYS A HG3  4  
ATOM 6702  H HD2  . LYS A 1 2   ? 16.452  -33.239 -12.272 1.00 0.00 ? 2   LYS A HD2  4  
ATOM 6703  H HD3  . LYS A 1 2   ? 17.234  -31.852 -11.510 1.00 0.00 ? 2   LYS A HD3  4  
ATOM 6704  H HE2  . LYS A 1 2   ? 15.502  -32.614 -9.564  1.00 0.00 ? 2   LYS A HE2  4  
ATOM 6705  H HE3  . LYS A 1 2   ? 15.882  -34.169 -10.303 1.00 0.00 ? 2   LYS A HE3  4  
ATOM 6706  H HZ1  . LYS A 1 2   ? 17.811  -34.168 -9.248  1.00 0.00 ? 2   LYS A HZ1  4  
ATOM 6707  H HZ2  . LYS A 1 2   ? 17.431  -32.694 -8.513  1.00 0.00 ? 2   LYS A HZ2  4  
ATOM 6708  H HZ3  . LYS A 1 2   ? 18.260  -32.714 -9.987  1.00 0.00 ? 2   LYS A HZ3  4  
ATOM 6709  N N    . LYS A 1 3   ? 15.813  -30.071 -15.260 1.00 0.00 ? 3   LYS A N    4  
ATOM 6710  C CA   . LYS A 1 3   ? 17.125  -29.641 -15.729 1.00 0.00 ? 3   LYS A CA   4  
ATOM 6711  C C    . LYS A 1 3   ? 17.327  -28.149 -15.487 1.00 0.00 ? 3   LYS A C    4  
ATOM 6712  O O    . LYS A 1 3   ? 16.422  -27.345 -15.710 1.00 0.00 ? 3   LYS A O    4  
ATOM 6713  C CB   . LYS A 1 3   ? 17.284  -29.953 -17.219 1.00 0.00 ? 3   LYS A CB   4  
ATOM 6714  C CG   . LYS A 1 3   ? 18.643  -30.530 -17.578 1.00 0.00 ? 3   LYS A CG   4  
ATOM 6715  C CD   . LYS A 1 3   ? 19.280  -29.778 -18.734 1.00 0.00 ? 3   LYS A CD   4  
ATOM 6716  C CE   . LYS A 1 3   ? 20.727  -30.198 -18.943 1.00 0.00 ? 3   LYS A CE   4  
ATOM 6717  N NZ   . LYS A 1 3   ? 21.205  -29.879 -20.317 1.00 0.00 ? 3   LYS A NZ   4  
ATOM 6718  H H    . LYS A 1 3   ? 15.039  -29.486 -15.403 1.00 0.00 ? 3   LYS A H    4  
ATOM 6719  H HA   . LYS A 1 3   ? 17.872  -30.188 -15.174 1.00 0.00 ? 3   LYS A HA   4  
ATOM 6720  H HB2  . LYS A 1 3   ? 16.526  -30.666 -17.508 1.00 0.00 ? 3   LYS A HB2  4  
ATOM 6721  H HB3  . LYS A 1 3   ? 17.143  -29.042 -17.782 1.00 0.00 ? 3   LYS A HB3  4  
ATOM 6722  H HG2  . LYS A 1 3   ? 19.292  -30.461 -16.717 1.00 0.00 ? 3   LYS A HG2  4  
ATOM 6723  H HG3  . LYS A 1 3   ? 18.521  -31.566 -17.858 1.00 0.00 ? 3   LYS A HG3  4  
ATOM 6724  H HD2  . LYS A 1 3   ? 18.724  -29.983 -19.636 1.00 0.00 ? 3   LYS A HD2  4  
ATOM 6725  H HD3  . LYS A 1 3   ? 19.249  -28.718 -18.524 1.00 0.00 ? 3   LYS A HD3  4  
ATOM 6726  H HE2  . LYS A 1 3   ? 21.346  -29.679 -18.227 1.00 0.00 ? 3   LYS A HE2  4  
ATOM 6727  H HE3  . LYS A 1 3   ? 20.805  -31.263 -18.781 1.00 0.00 ? 3   LYS A HE3  4  
ATOM 6728  H HZ1  . LYS A 1 3   ? 21.387  -28.859 -20.404 1.00 0.00 ? 3   LYS A HZ1  4  
ATOM 6729  H HZ2  . LYS A 1 3   ? 20.486  -30.152 -21.017 1.00 0.00 ? 3   LYS A HZ2  4  
ATOM 6730  H HZ3  . LYS A 1 3   ? 22.084  -30.396 -20.518 1.00 0.00 ? 3   LYS A HZ3  4  
ATOM 6731  N N    . VAL A 1 4   ? 18.522  -27.784 -15.031 1.00 0.00 ? 4   VAL A N    4  
ATOM 6732  C CA   . VAL A 1 4   ? 18.844  -26.388 -14.762 1.00 0.00 ? 4   VAL A CA   4  
ATOM 6733  C C    . VAL A 1 4   ? 19.118  -25.628 -16.055 1.00 0.00 ? 4   VAL A C    4  
ATOM 6734  O O    . VAL A 1 4   ? 20.228  -25.145 -16.280 1.00 0.00 ? 4   VAL A O    4  
ATOM 6735  C CB   . VAL A 1 4   ? 20.068  -26.263 -13.836 1.00 0.00 ? 4   VAL A CB   4  
ATOM 6736  C CG1  . VAL A 1 4   ? 20.138  -24.870 -13.228 1.00 0.00 ? 4   VAL A CG1  4  
ATOM 6737  C CG2  . VAL A 1 4   ? 20.025  -27.326 -12.750 1.00 0.00 ? 4   VAL A CG2  4  
ATOM 6738  H H    . VAL A 1 4   ? 19.203  -28.471 -14.873 1.00 0.00 ? 4   VAL A H    4  
ATOM 6739  H HA   . VAL A 1 4   ? 17.996  -25.939 -14.265 1.00 0.00 ? 4   VAL A HA   4  
ATOM 6740  H HB   . VAL A 1 4   ? 20.959  -26.418 -14.428 1.00 0.00 ? 4   VAL A HB   4  
ATOM 6741  H HG11 . VAL A 1 4   ? 20.622  -24.198 -13.922 1.00 0.00 ? 4   VAL A HG11 4  
ATOM 6742  H HG12 . VAL A 1 4   ? 19.138  -24.517 -13.020 1.00 0.00 ? 4   VAL A HG12 4  
ATOM 6743  H HG13 . VAL A 1 4   ? 20.705  -24.907 -12.309 1.00 0.00 ? 4   VAL A HG13 4  
ATOM 6744  H HG21 . VAL A 1 4   ? 20.641  -28.164 -13.042 1.00 0.00 ? 4   VAL A HG21 4  
ATOM 6745  H HG22 . VAL A 1 4   ? 20.397  -26.912 -11.824 1.00 0.00 ? 4   VAL A HG22 4  
ATOM 6746  H HG23 . VAL A 1 4   ? 19.007  -27.659 -12.611 1.00 0.00 ? 4   VAL A HG23 4  
ATOM 6747  N N    . VAL A 1 5   ? 18.099  -25.525 -16.902 1.00 0.00 ? 5   VAL A N    4  
ATOM 6748  C CA   . VAL A 1 5   ? 18.229  -24.822 -18.172 1.00 0.00 ? 5   VAL A CA   4  
ATOM 6749  C C    . VAL A 1 5   ? 18.967  -23.500 -17.996 1.00 0.00 ? 5   VAL A C    4  
ATOM 6750  O O    . VAL A 1 5   ? 19.817  -23.139 -18.809 1.00 0.00 ? 5   VAL A O    4  
ATOM 6751  C CB   . VAL A 1 5   ? 16.852  -24.547 -18.806 1.00 0.00 ? 5   VAL A CB   4  
ATOM 6752  C CG1  . VAL A 1 5   ? 16.232  -25.839 -19.316 1.00 0.00 ? 5   VAL A CG1  4  
ATOM 6753  C CG2  . VAL A 1 5   ? 15.932  -23.864 -17.805 1.00 0.00 ? 5   VAL A CG2  4  
ATOM 6754  H H    . VAL A 1 5   ? 17.238  -25.930 -16.666 1.00 0.00 ? 5   VAL A H    4  
ATOM 6755  H HA   . VAL A 1 5   ? 18.792  -25.451 -18.846 1.00 0.00 ? 5   VAL A HA   4  
ATOM 6756  H HB   . VAL A 1 5   ? 16.990  -23.883 -19.646 1.00 0.00 ? 5   VAL A HB   4  
ATOM 6757  H HG11 . VAL A 1 5   ? 16.250  -26.581 -18.532 1.00 0.00 ? 5   VAL A HG11 4  
ATOM 6758  H HG12 . VAL A 1 5   ? 15.210  -25.655 -19.615 1.00 0.00 ? 5   VAL A HG12 4  
ATOM 6759  H HG13 . VAL A 1 5   ? 16.796  -26.198 -20.164 1.00 0.00 ? 5   VAL A HG13 4  
ATOM 6760  H HG21 . VAL A 1 5   ? 16.300  -22.869 -17.600 1.00 0.00 ? 5   VAL A HG21 4  
ATOM 6761  H HG22 . VAL A 1 5   ? 14.935  -23.802 -18.215 1.00 0.00 ? 5   VAL A HG22 4  
ATOM 6762  H HG23 . VAL A 1 5   ? 15.908  -24.435 -16.889 1.00 0.00 ? 5   VAL A HG23 4  
ATOM 6763  N N    . ALA A 1 6   ? 18.637  -22.782 -16.928 1.00 0.00 ? 6   ALA A N    4  
ATOM 6764  C CA   . ALA A 1 6   ? 19.271  -21.500 -16.642 1.00 0.00 ? 6   ALA A CA   4  
ATOM 6765  C C    . ALA A 1 6   ? 19.185  -21.164 -15.157 1.00 0.00 ? 6   ALA A C    4  
ATOM 6766  O O    . ALA A 1 6   ? 18.464  -21.817 -14.403 1.00 0.00 ? 6   ALA A O    4  
ATOM 6767  C CB   . ALA A 1 6   ? 18.630  -20.398 -17.473 1.00 0.00 ? 6   ALA A CB   4  
ATOM 6768  H H    . ALA A 1 6   ? 17.952  -23.122 -16.316 1.00 0.00 ? 6   ALA A H    4  
ATOM 6769  H HA   . ALA A 1 6   ? 20.311  -21.572 -16.926 1.00 0.00 ? 6   ALA A HA   4  
ATOM 6770  H HB1  . ALA A 1 6   ? 17.564  -20.564 -17.528 1.00 0.00 ? 6   ALA A HB1  4  
ATOM 6771  H HB2  . ALA A 1 6   ? 18.822  -19.441 -17.011 1.00 0.00 ? 6   ALA A HB2  4  
ATOM 6772  H HB3  . ALA A 1 6   ? 19.048  -20.408 -18.468 1.00 0.00 ? 6   ALA A HB3  4  
ATOM 6773  N N    . VAL A 1 7   ? 19.926  -20.141 -14.744 1.00 0.00 ? 7   VAL A N    4  
ATOM 6774  C CA   . VAL A 1 7   ? 19.934  -19.718 -13.348 1.00 0.00 ? 7   VAL A CA   4  
ATOM 6775  C C    . VAL A 1 7   ? 20.076  -18.204 -13.234 1.00 0.00 ? 7   VAL A C    4  
ATOM 6776  O O    . VAL A 1 7   ? 20.590  -17.548 -14.140 1.00 0.00 ? 7   VAL A O    4  
ATOM 6777  C CB   . VAL A 1 7   ? 21.076  -20.390 -12.564 1.00 0.00 ? 7   VAL A CB   4  
ATOM 6778  C CG1  . VAL A 1 7   ? 20.875  -20.209 -11.067 1.00 0.00 ? 7   VAL A CG1  4  
ATOM 6779  C CG2  . VAL A 1 7   ? 21.172  -21.865 -12.923 1.00 0.00 ? 7   VAL A CG2  4  
ATOM 6780  H H    . VAL A 1 7   ? 20.481  -19.659 -15.392 1.00 0.00 ? 7   VAL A H    4  
ATOM 6781  H HA   . VAL A 1 7   ? 18.996  -20.016 -12.904 1.00 0.00 ? 7   VAL A HA   4  
ATOM 6782  H HB   . VAL A 1 7   ? 22.005  -19.913 -12.840 1.00 0.00 ? 7   VAL A HB   4  
ATOM 6783  H HG11 . VAL A 1 7   ? 19.836  -19.991 -10.868 1.00 0.00 ? 7   VAL A HG11 4  
ATOM 6784  H HG12 . VAL A 1 7   ? 21.160  -21.115 -10.553 1.00 0.00 ? 7   VAL A HG12 4  
ATOM 6785  H HG13 . VAL A 1 7   ? 21.487  -19.390 -10.719 1.00 0.00 ? 7   VAL A HG13 4  
ATOM 6786  H HG21 . VAL A 1 7   ? 21.754  -22.380 -12.173 1.00 0.00 ? 7   VAL A HG21 4  
ATOM 6787  H HG22 . VAL A 1 7   ? 20.180  -22.291 -12.964 1.00 0.00 ? 7   VAL A HG22 4  
ATOM 6788  H HG23 . VAL A 1 7   ? 21.649  -21.972 -13.886 1.00 0.00 ? 7   VAL A HG23 4  
ATOM 6789  N N    . VAL A 1 8   ? 19.617  -17.655 -12.114 1.00 0.00 ? 8   VAL A N    4  
ATOM 6790  C CA   . VAL A 1 8   ? 19.694  -16.218 -11.880 1.00 0.00 ? 8   VAL A CA   4  
ATOM 6791  C C    . VAL A 1 8   ? 20.453  -15.911 -10.594 1.00 0.00 ? 8   VAL A C    4  
ATOM 6792  O O    . VAL A 1 8   ? 20.616  -16.777 -9.734  1.00 0.00 ? 8   VAL A O    4  
ATOM 6793  C CB   . VAL A 1 8   ? 18.291  -15.587 -11.798 1.00 0.00 ? 8   VAL A CB   4  
ATOM 6794  C CG1  . VAL A 1 8   ? 17.669  -15.843 -10.434 1.00 0.00 ? 8   VAL A CG1  4  
ATOM 6795  C CG2  . VAL A 1 8   ? 18.361  -14.095 -12.089 1.00 0.00 ? 8   VAL A CG2  4  
ATOM 6796  H H    . VAL A 1 8   ? 19.218  -18.230 -11.429 1.00 0.00 ? 8   VAL A H    4  
ATOM 6797  H HA   . VAL A 1 8   ? 20.219  -15.771 -12.712 1.00 0.00 ? 8   VAL A HA   4  
ATOM 6798  H HB   . VAL A 1 8   ? 17.666  -16.049 -12.547 1.00 0.00 ? 8   VAL A HB   4  
ATOM 6799  H HG11 . VAL A 1 8   ? 18.174  -15.245 -9.690  1.00 0.00 ? 8   VAL A HG11 4  
ATOM 6800  H HG12 . VAL A 1 8   ? 16.622  -15.579 -10.460 1.00 0.00 ? 8   VAL A HG12 4  
ATOM 6801  H HG13 . VAL A 1 8   ? 17.771  -16.889 -10.183 1.00 0.00 ? 8   VAL A HG13 4  
ATOM 6802  H HG21 . VAL A 1 8   ? 18.664  -13.569 -11.196 1.00 0.00 ? 8   VAL A HG21 4  
ATOM 6803  H HG22 . VAL A 1 8   ? 19.081  -13.914 -12.874 1.00 0.00 ? 8   VAL A HG22 4  
ATOM 6804  H HG23 . VAL A 1 8   ? 17.390  -13.743 -12.403 1.00 0.00 ? 8   VAL A HG23 4  
ATOM 6805  N N    . LYS A 1 9   ? 20.916  -14.672 -10.468 1.00 0.00 ? 9   LYS A N    4  
ATOM 6806  C CA   . LYS A 1 9   ? 21.658  -14.247 -9.287  1.00 0.00 ? 9   LYS A CA   4  
ATOM 6807  C C    . LYS A 1 9   ? 21.251  -12.839 -8.866  1.00 0.00 ? 9   LYS A C    4  
ATOM 6808  O O    . LYS A 1 9   ? 21.696  -11.852 -9.454  1.00 0.00 ? 9   LYS A O    4  
ATOM 6809  C CB   . LYS A 1 9   ? 23.163  -14.296 -9.559  1.00 0.00 ? 9   LYS A CB   4  
ATOM 6810  C CG   . LYS A 1 9   ? 23.577  -13.555 -10.818 1.00 0.00 ? 9   LYS A CG   4  
ATOM 6811  C CD   . LYS A 1 9   ? 24.972  -13.957 -11.268 1.00 0.00 ? 9   LYS A CD   4  
ATOM 6812  C CE   . LYS A 1 9   ? 25.333  -13.319 -12.601 1.00 0.00 ? 9   LYS A CE   4  
ATOM 6813  N NZ   . LYS A 1 9   ? 26.721  -13.658 -13.021 1.00 0.00 ? 9   LYS A NZ   4  
ATOM 6814  H H    . LYS A 1 9   ? 20.754  -14.026 -11.188 1.00 0.00 ? 9   LYS A H    4  
ATOM 6815  H HA   . LYS A 1 9   ? 21.423  -14.931 -8.485  1.00 0.00 ? 9   LYS A HA   4  
ATOM 6816  H HB2  . LYS A 1 9   ? 23.682  -13.856 -8.720  1.00 0.00 ? 9   LYS A HB2  4  
ATOM 6817  H HB3  . LYS A 1 9   ? 23.465  -15.329 -9.658  1.00 0.00 ? 9   LYS A HB3  4  
ATOM 6818  H HG2  . LYS A 1 9   ? 22.876  -13.785 -11.607 1.00 0.00 ? 9   LYS A HG2  4  
ATOM 6819  H HG3  . LYS A 1 9   ? 23.564  -12.493 -10.621 1.00 0.00 ? 9   LYS A HG3  4  
ATOM 6820  H HD2  . LYS A 1 9   ? 25.687  -13.638 -10.524 1.00 0.00 ? 9   LYS A HD2  4  
ATOM 6821  H HD3  . LYS A 1 9   ? 25.012  -15.032 -11.371 1.00 0.00 ? 9   LYS A HD3  4  
ATOM 6822  H HE2  . LYS A 1 9   ? 24.643  -13.671 -13.352 1.00 0.00 ? 9   LYS A HE2  4  
ATOM 6823  H HE3  . LYS A 1 9   ? 25.246  -12.246 -12.507 1.00 0.00 ? 9   LYS A HE3  4  
ATOM 6824  H HZ1  . LYS A 1 9   ? 26.703  -14.415 -13.734 1.00 0.00 ? 9   LYS A HZ1  4  
ATOM 6825  H HZ2  . LYS A 1 9   ? 27.272  -13.984 -12.201 1.00 0.00 ? 9   LYS A HZ2  4  
ATOM 6826  H HZ3  . LYS A 1 9   ? 27.186  -12.822 -13.428 1.00 0.00 ? 9   LYS A HZ3  4  
ATOM 6827  N N    . LEU A 1 10  ? 20.406  -12.751 -7.845  1.00 0.00 ? 10  LEU A N    4  
ATOM 6828  C CA   . LEU A 1 10  ? 19.941  -11.462 -7.345  1.00 0.00 ? 10  LEU A CA   4  
ATOM 6829  C C    . LEU A 1 10  ? 20.096  -11.379 -5.829  1.00 0.00 ? 10  LEU A C    4  
ATOM 6830  O O    . LEU A 1 10  ? 20.029  -12.391 -5.133  1.00 0.00 ? 10  LEU A O    4  
ATOM 6831  C CB   . LEU A 1 10  ? 18.479  -11.240 -7.733  1.00 0.00 ? 10  LEU A CB   4  
ATOM 6832  C CG   . LEU A 1 10  ? 17.781  -10.052 -7.069  1.00 0.00 ? 10  LEU A CG   4  
ATOM 6833  C CD1  . LEU A 1 10  ? 18.329  -8.741  -7.609  1.00 0.00 ? 10  LEU A CD1  4  
ATOM 6834  C CD2  . LEU A 1 10  ? 16.276  -10.131 -7.281  1.00 0.00 ? 10  LEU A CD2  4  
ATOM 6835  H H    . LEU A 1 10  ? 20.087  -13.572 -7.417  1.00 0.00 ? 10  LEU A H    4  
ATOM 6836  H HA   . LEU A 1 10  ? 20.547  -10.693 -7.799  1.00 0.00 ? 10  LEU A HA   4  
ATOM 6837  H HB2  . LEU A 1 10  ? 18.439  -11.092 -8.801  1.00 0.00 ? 10  LEU A HB2  4  
ATOM 6838  H HB3  . LEU A 1 10  ? 17.929  -12.134 -7.474  1.00 0.00 ? 10  LEU A HB3  4  
ATOM 6839  H HG   . LEU A 1 10  ? 17.972  -10.079 -6.005  1.00 0.00 ? 10  LEU A HG   4  
ATOM 6840  H HD11 . LEU A 1 10  ? 17.901  -7.917  -7.058  1.00 0.00 ? 10  LEU A HD11 4  
ATOM 6841  H HD12 . LEU A 1 10  ? 18.073  -8.647  -8.654  1.00 0.00 ? 10  LEU A HD12 4  
ATOM 6842  H HD13 . LEU A 1 10  ? 19.404  -8.728  -7.500  1.00 0.00 ? 10  LEU A HD13 4  
ATOM 6843  H HD21 . LEU A 1 10  ? 16.000  -11.146 -7.525  1.00 0.00 ? 10  LEU A HD21 4  
ATOM 6844  H HD22 . LEU A 1 10  ? 15.992  -9.476  -8.092  1.00 0.00 ? 10  LEU A HD22 4  
ATOM 6845  H HD23 . LEU A 1 10  ? 15.769  -9.827  -6.377  1.00 0.00 ? 10  LEU A HD23 4  
ATOM 6846  N N    . GLN A 1 11  ? 20.300  -10.165 -5.327  1.00 0.00 ? 11  GLN A N    4  
ATOM 6847  C CA   . GLN A 1 11  ? 20.462  -9.950  -3.894  1.00 0.00 ? 11  GLN A CA   4  
ATOM 6848  C C    . GLN A 1 11  ? 19.701  -8.709  -3.440  1.00 0.00 ? 11  GLN A C    4  
ATOM 6849  O O    . GLN A 1 11  ? 19.752  -7.664  -4.091  1.00 0.00 ? 11  GLN A O    4  
ATOM 6850  C CB   . GLN A 1 11  ? 21.944  -9.811  -3.542  1.00 0.00 ? 11  GLN A CB   4  
ATOM 6851  C CG   . GLN A 1 11  ? 22.537  -8.465  -3.927  1.00 0.00 ? 11  GLN A CG   4  
ATOM 6852  C CD   . GLN A 1 11  ? 23.994  -8.334  -3.528  1.00 0.00 ? 11  GLN A CD   4  
ATOM 6853  O OE1  . GLN A 1 11  ? 24.880  -8.887  -4.179  1.00 0.00 ? 11  GLN A OE1  4  
ATOM 6854  N NE2  . GLN A 1 11  ? 24.249  -7.598  -2.452  1.00 0.00 ? 11  GLN A NE2  4  
ATOM 6855  H H    . GLN A 1 11  ? 20.344  -9.398  -5.933  1.00 0.00 ? 11  GLN A H    4  
ATOM 6856  H HA   . GLN A 1 11  ? 20.060  -10.811 -3.382  1.00 0.00 ? 11  GLN A HA   4  
ATOM 6857  H HB2  . GLN A 1 11  ? 22.063  -9.941  -2.476  1.00 0.00 ? 11  GLN A HB2  4  
ATOM 6858  H HB3  . GLN A 1 11  ? 22.498  -10.584 -4.055  1.00 0.00 ? 11  GLN A HB3  4  
ATOM 6859  H HG2  . GLN A 1 11  ? 22.462  -8.346  -4.998  1.00 0.00 ? 11  GLN A HG2  4  
ATOM 6860  H HG3  . GLN A 1 11  ? 21.973  -7.685  -3.439  1.00 0.00 ? 11  GLN A HG3  4  
ATOM 6861  H HE21 . GLN A 1 11  ? 23.492  -7.188  -1.983  1.00 0.00 ? 11  GLN A HE21 4  
ATOM 6862  H HE22 . GLN A 1 11  ? 25.181  -7.496  -2.171  1.00 0.00 ? 11  GLN A HE22 4  
ATOM 6863  N N    . LEU A 1 12  ? 18.996  -8.830  -2.321  1.00 0.00 ? 12  LEU A N    4  
ATOM 6864  C CA   . LEU A 1 12  ? 18.223  -7.717  -1.780  1.00 0.00 ? 12  LEU A CA   4  
ATOM 6865  C C    . LEU A 1 12  ? 18.202  -7.759  -0.255  1.00 0.00 ? 12  LEU A C    4  
ATOM 6866  O O    . LEU A 1 12  ? 18.327  -8.817  0.363   1.00 0.00 ? 12  LEU A O    4  
ATOM 6867  C CB   . LEU A 1 12  ? 16.793  -7.752  -2.322  1.00 0.00 ? 12  LEU A CB   4  
ATOM 6868  C CG   . LEU A 1 12  ? 16.650  -8.019  -3.821  1.00 0.00 ? 12  LEU A CG   4  
ATOM 6869  C CD1  . LEU A 1 12  ? 15.227  -8.438  -4.155  1.00 0.00 ? 12  LEU A CD1  4  
ATOM 6870  C CD2  . LEU A 1 12  ? 17.048  -6.788  -4.622  1.00 0.00 ? 12  LEU A CD2  4  
ATOM 6871  H H    . LEU A 1 12  ? 18.994  -9.687  -1.847  1.00 0.00 ? 12  LEU A H    4  
ATOM 6872  H HA   . LEU A 1 12  ? 18.697  -6.800  -2.096  1.00 0.00 ? 12  LEU A HA   4  
ATOM 6873  H HB2  . LEU A 1 12  ? 16.259  -8.528  -1.796  1.00 0.00 ? 12  LEU A HB2  4  
ATOM 6874  H HB3  . LEU A 1 12  ? 16.336  -6.795  -2.110  1.00 0.00 ? 12  LEU A HB3  4  
ATOM 6875  H HG   . LEU A 1 12  ? 17.310  -8.829  -4.101  1.00 0.00 ? 12  LEU A HG   4  
ATOM 6876  H HD11 . LEU A 1 12  ? 14.556  -8.075  -3.392  1.00 0.00 ? 12  LEU A HD11 4  
ATOM 6877  H HD12 . LEU A 1 12  ? 15.171  -9.516  -4.202  1.00 0.00 ? 12  LEU A HD12 4  
ATOM 6878  H HD13 . LEU A 1 12  ? 14.944  -8.022  -5.111  1.00 0.00 ? 12  LEU A HD13 4  
ATOM 6879  H HD21 . LEU A 1 12  ? 17.879  -7.032  -5.267  1.00 0.00 ? 12  LEU A HD21 4  
ATOM 6880  H HD22 . LEU A 1 12  ? 17.337  -5.996  -3.946  1.00 0.00 ? 12  LEU A HD22 4  
ATOM 6881  H HD23 . LEU A 1 12  ? 16.210  -6.462  -5.221  1.00 0.00 ? 12  LEU A HD23 4  
ATOM 6882  N N    . PRO A 1 13  ? 18.037  -6.583  0.367   1.00 0.00 ? 13  PRO A N    4  
ATOM 6883  C CA   . PRO A 1 13  ? 17.993  -6.459  1.827   1.00 0.00 ? 13  PRO A CA   4  
ATOM 6884  C C    . PRO A 1 13  ? 16.724  -7.062  2.422   1.00 0.00 ? 13  PRO A C    4  
ATOM 6885  O O    . PRO A 1 13  ? 15.639  -6.928  1.858   1.00 0.00 ? 13  PRO A O    4  
ATOM 6886  C CB   . PRO A 1 13  ? 18.023  -4.946  2.056   1.00 0.00 ? 13  PRO A CB   4  
ATOM 6887  C CG   . PRO A 1 13  ? 17.461  -4.362  0.806   1.00 0.00 ? 13  PRO A CG   4  
ATOM 6888  C CD   . PRO A 1 13  ? 17.881  -5.282  -0.306  1.00 0.00 ? 13  PRO A CD   4  
ATOM 6889  H HA   . PRO A 1 13  ? 18.857  -6.913  2.291   1.00 0.00 ? 13  PRO A HA   4  
ATOM 6890  H HB2  . PRO A 1 13  ? 17.418  -4.697  2.917   1.00 0.00 ? 13  PRO A HB2  4  
ATOM 6891  H HB3  . PRO A 1 13  ? 19.041  -4.623  2.220   1.00 0.00 ? 13  PRO A HB3  4  
ATOM 6892  H HG2  . PRO A 1 13  ? 16.385  -4.321  0.872   1.00 0.00 ? 13  PRO A HG2  4  
ATOM 6893  H HG3  . PRO A 1 13  ? 17.867  -3.374  0.648   1.00 0.00 ? 13  PRO A HG3  4  
ATOM 6894  H HD2  . PRO A 1 13  ? 17.115  -5.331  -1.066  1.00 0.00 ? 13  PRO A HD2  4  
ATOM 6895  H HD3  . PRO A 1 13  ? 18.818  -4.955  -0.732  1.00 0.00 ? 13  PRO A HD3  4  
ATOM 6896  N N    . ALA A 1 14  ? 16.869  -7.726  3.564   1.00 0.00 ? 14  ALA A N    4  
ATOM 6897  C CA   . ALA A 1 14  ? 15.735  -8.347  4.236   1.00 0.00 ? 14  ALA A CA   4  
ATOM 6898  C C    . ALA A 1 14  ? 14.588  -7.357  4.406   1.00 0.00 ? 14  ALA A C    4  
ATOM 6899  O O    . ALA A 1 14  ? 14.745  -6.313  5.038   1.00 0.00 ? 14  ALA A O    4  
ATOM 6900  C CB   . ALA A 1 14  ? 16.161  -8.902  5.587   1.00 0.00 ? 14  ALA A CB   4  
ATOM 6901  H H    . ALA A 1 14  ? 17.760  -7.799  3.965   1.00 0.00 ? 14  ALA A H    4  
ATOM 6902  H HA   . ALA A 1 14  ? 15.397  -9.173  3.626   1.00 0.00 ? 14  ALA A HA   4  
ATOM 6903  H HB1  . ALA A 1 14  ? 16.233  -9.978  5.527   1.00 0.00 ? 14  ALA A HB1  4  
ATOM 6904  H HB2  . ALA A 1 14  ? 17.122  -8.491  5.858   1.00 0.00 ? 14  ALA A HB2  4  
ATOM 6905  H HB3  . ALA A 1 14  ? 15.429  -8.631  6.333   1.00 0.00 ? 14  ALA A HB3  4  
ATOM 6906  N N    . GLY A 1 15  ? 13.434  -7.691  3.836   1.00 0.00 ? 15  GLY A N    4  
ATOM 6907  C CA   . GLY A 1 15  ? 12.277  -6.820  3.936   1.00 0.00 ? 15  GLY A CA   4  
ATOM 6908  C C    . GLY A 1 15  ? 12.394  -5.598  3.046   1.00 0.00 ? 15  GLY A C    4  
ATOM 6909  O O    . GLY A 1 15  ? 12.587  -4.483  3.530   1.00 0.00 ? 15  GLY A O    4  
ATOM 6910  H H    . GLY A 1 15  ? 13.367  -8.536  3.344   1.00 0.00 ? 15  GLY A H    4  
ATOM 6911  H HA2  . GLY A 1 15  ? 11.396  -7.376  3.654   1.00 0.00 ? 15  GLY A HA2  4  
ATOM 6912  H HA3  . GLY A 1 15  ? 12.173  -6.495  4.961   1.00 0.00 ? 15  GLY A HA3  4  
ATOM 6913  N N    . LYS A 1 16  ? 12.277  -5.808  1.739   1.00 0.00 ? 16  LYS A N    4  
ATOM 6914  C CA   . LYS A 1 16  ? 12.370  -4.716  0.777   1.00 0.00 ? 16  LYS A CA   4  
ATOM 6915  C C    . LYS A 1 16  ? 12.201  -5.230  -0.649  1.00 0.00 ? 16  LYS A C    4  
ATOM 6916  O O    . LYS A 1 16  ? 13.182  -5.468  -1.352  1.00 0.00 ? 16  LYS A O    4  
ATOM 6917  C CB   . LYS A 1 16  ? 13.715  -3.999  0.917   1.00 0.00 ? 16  LYS A CB   4  
ATOM 6918  C CG   . LYS A 1 16  ? 13.609  -2.626  1.556   1.00 0.00 ? 16  LYS A CG   4  
ATOM 6919  C CD   . LYS A 1 16  ? 14.025  -1.528  0.591   1.00 0.00 ? 16  LYS A CD   4  
ATOM 6920  C CE   . LYS A 1 16  ? 13.061  -1.422  -0.581  1.00 0.00 ? 16  LYS A CE   4  
ATOM 6921  N NZ   . LYS A 1 16  ? 13.421  -0.304  -1.496  1.00 0.00 ? 16  LYS A NZ   4  
ATOM 6922  H H    . LYS A 1 16  ? 12.123  -6.720  1.413   1.00 0.00 ? 16  LYS A H    4  
ATOM 6923  H HA   . LYS A 1 16  ? 11.576  -4.017  0.991   1.00 0.00 ? 16  LYS A HA   4  
ATOM 6924  H HB2  . LYS A 1 16  ? 14.371  -4.606  1.523   1.00 0.00 ? 16  LYS A HB2  4  
ATOM 6925  H HB3  . LYS A 1 16  ? 14.151  -3.884  -0.065  1.00 0.00 ? 16  LYS A HB3  4  
ATOM 6926  H HG2  . LYS A 1 16  ? 12.586  -2.456  1.858   1.00 0.00 ? 16  LYS A HG2  4  
ATOM 6927  H HG3  . LYS A 1 16  ? 14.253  -2.592  2.424   1.00 0.00 ? 16  LYS A HG3  4  
ATOM 6928  H HD2  . LYS A 1 16  ? 14.039  -0.585  1.116   1.00 0.00 ? 16  LYS A HD2  4  
ATOM 6929  H HD3  . LYS A 1 16  ? 15.014  -1.747  0.214   1.00 0.00 ? 16  LYS A HD3  4  
ATOM 6930  H HE2  . LYS A 1 16  ? 13.084  -2.349  -1.134  1.00 0.00 ? 16  LYS A HE2  4  
ATOM 6931  H HE3  . LYS A 1 16  ? 12.065  -1.256  -0.198  1.00 0.00 ? 16  LYS A HE3  4  
ATOM 6932  H HZ1  . LYS A 1 16  ? 14.132  0.310   -1.048  1.00 0.00 ? 16  LYS A HZ1  4  
ATOM 6933  H HZ2  . LYS A 1 16  ? 12.578  0.264   -1.715  1.00 0.00 ? 16  LYS A HZ2  4  
ATOM 6934  H HZ3  . LYS A 1 16  ? 13.813  -0.679  -2.383  1.00 0.00 ? 16  LYS A HZ3  4  
ATOM 6935  N N    . ALA A 1 17  ? 10.952  -5.398  -1.069  1.00 0.00 ? 17  ALA A N    4  
ATOM 6936  C CA   . ALA A 1 17  ? 10.656  -5.881  -2.412  1.00 0.00 ? 17  ALA A CA   4  
ATOM 6937  C C    . ALA A 1 17  ? 9.599   -5.013  -3.086  1.00 0.00 ? 17  ALA A C    4  
ATOM 6938  O O    . ALA A 1 17  ? 8.762   -4.404  -2.420  1.00 0.00 ? 17  ALA A O    4  
ATOM 6939  C CB   . ALA A 1 17  ? 10.197  -7.331  -2.362  1.00 0.00 ? 17  ALA A CB   4  
ATOM 6940  H H    . ALA A 1 17  ? 10.212  -5.191  -0.461  1.00 0.00 ? 17  ALA A H    4  
ATOM 6941  H HA   . ALA A 1 17  ? 11.567  -5.837  -2.991  1.00 0.00 ? 17  ALA A HA   4  
ATOM 6942  H HB1  . ALA A 1 17  ? 9.149   -7.367  -2.102  1.00 0.00 ? 17  ALA A HB1  4  
ATOM 6943  H HB2  . ALA A 1 17  ? 10.344  -7.788  -3.329  1.00 0.00 ? 17  ALA A HB2  4  
ATOM 6944  H HB3  . ALA A 1 17  ? 10.771  -7.865  -1.620  1.00 0.00 ? 17  ALA A HB3  4  
ATOM 6945  N N    . THR A 1 18  ? 9.644   -4.959  -4.414  1.00 0.00 ? 18  THR A N    4  
ATOM 6946  C CA   . THR A 1 18  ? 8.692   -4.164  -5.179  1.00 0.00 ? 18  THR A CA   4  
ATOM 6947  C C    . THR A 1 18  ? 8.114   -4.965  -6.340  1.00 0.00 ? 18  THR A C    4  
ATOM 6948  O O    . THR A 1 18  ? 8.670   -5.978  -6.765  1.00 0.00 ? 18  THR A O    4  
ATOM 6949  C CB   . THR A 1 18  ? 9.345   -2.882  -5.730  1.00 0.00 ? 18  THR A CB   4  
ATOM 6950  O OG1  . THR A 1 18  ? 10.749  -3.090  -5.918  1.00 0.00 ? 18  THR A OG1  4  
ATOM 6951  C CG2  . THR A 1 18  ? 9.123   -1.712  -4.783  1.00 0.00 ? 18  THR A CG2  4  
ATOM 6952  H H    . THR A 1 18  ? 10.335  -5.466  -4.889  1.00 0.00 ? 18  THR A H    4  
ATOM 6953  H HA   . THR A 1 18  ? 7.888   -3.877  -4.517  1.00 0.00 ? 18  THR A HA   4  
ATOM 6954  H HB   . THR A 1 18  ? 8.893   -2.646  -6.682  1.00 0.00 ? 18  THR A HB   4  
ATOM 6955  H HG1  . THR A 1 18  ? 11.051  -2.573  -6.669  1.00 0.00 ? 18  THR A HG1  4  
ATOM 6956  H HG21 . THR A 1 18  ? 8.136   -1.302  -4.943  1.00 0.00 ? 18  THR A HG21 4  
ATOM 6957  H HG22 . THR A 1 18  ? 9.865   -0.950  -4.972  1.00 0.00 ? 18  THR A HG22 4  
ATOM 6958  H HG23 . THR A 1 18  ? 9.209   -2.054  -3.763  1.00 0.00 ? 18  THR A HG23 4  
ATOM 6959  N N    . PRO A 1 19  ? 6.971   -4.503  -6.868  1.00 0.00 ? 19  PRO A N    4  
ATOM 6960  C CA   . PRO A 1 19  ? 6.293   -5.161  -7.989  1.00 0.00 ? 19  PRO A CA   4  
ATOM 6961  C C    . PRO A 1 19  ? 7.067   -5.024  -9.296  1.00 0.00 ? 19  PRO A C    4  
ATOM 6962  O O    . PRO A 1 19  ? 6.710   -5.629  -10.306 1.00 0.00 ? 19  PRO A O    4  
ATOM 6963  C CB   . PRO A 1 19  ? 4.956   -4.422  -8.079  1.00 0.00 ? 19  PRO A CB   4  
ATOM 6964  C CG   . PRO A 1 19  ? 5.224   -3.081  -7.487  1.00 0.00 ? 19  PRO A CG   4  
ATOM 6965  C CD   . PRO A 1 19  ? 6.252   -3.301  -6.412  1.00 0.00 ? 19  PRO A CD   4  
ATOM 6966  H HA   . PRO A 1 19  ? 6.115   -6.207  -7.786  1.00 0.00 ? 19  PRO A HA   4  
ATOM 6967  H HB2  . PRO A 1 19  ? 4.654   -4.344  -9.114  1.00 0.00 ? 19  PRO A HB2  4  
ATOM 6968  H HB3  . PRO A 1 19  ? 4.206   -4.958  -7.518  1.00 0.00 ? 19  PRO A HB3  4  
ATOM 6969  H HG2  . PRO A 1 19  ? 5.609   -2.416  -8.245  1.00 0.00 ? 19  PRO A HG2  4  
ATOM 6970  H HG3  . PRO A 1 19  ? 4.316   -2.681  -7.061  1.00 0.00 ? 19  PRO A HG3  4  
ATOM 6971  H HD2  . PRO A 1 19  ? 6.919   -2.454  -6.349  1.00 0.00 ? 19  PRO A HD2  4  
ATOM 6972  H HD3  . PRO A 1 19  ? 5.772   -3.478  -5.461  1.00 0.00 ? 19  PRO A HD3  4  
ATOM 6973  N N    . ALA A 1 20  ? 8.128   -4.224  -9.268  1.00 0.00 ? 20  ALA A N    4  
ATOM 6974  C CA   . ALA A 1 20  ? 8.954   -4.010  -10.450 1.00 0.00 ? 20  ALA A CA   4  
ATOM 6975  C C    . ALA A 1 20  ? 10.401  -4.414  -10.190 1.00 0.00 ? 20  ALA A C    4  
ATOM 6976  O O    . ALA A 1 20  ? 11.320  -3.598  -10.256 1.00 0.00 ? 20  ALA A O    4  
ATOM 6977  C CB   . ALA A 1 20  ? 8.881   -2.555  -10.888 1.00 0.00 ? 20  ALA A CB   4  
ATOM 6978  H H    . ALA A 1 20  ? 8.362   -3.769  -8.433  1.00 0.00 ? 20  ALA A H    4  
ATOM 6979  H HA   . ALA A 1 20  ? 8.558   -4.621  -11.249 1.00 0.00 ? 20  ALA A HA   4  
ATOM 6980  H HB1  . ALA A 1 20  ? 9.053   -2.491  -11.953 1.00 0.00 ? 20  ALA A HB1  4  
ATOM 6981  H HB2  . ALA A 1 20  ? 7.904   -2.158  -10.657 1.00 0.00 ? 20  ALA A HB2  4  
ATOM 6982  H HB3  . ALA A 1 20  ? 9.635   -1.984  -10.367 1.00 0.00 ? 20  ALA A HB3  4  
ATOM 6983  N N    . PRO A 1 21  ? 10.611  -5.704  -9.887  1.00 0.00 ? 21  PRO A N    4  
ATOM 6984  C CA   . PRO A 1 21  ? 11.944  -6.245  -9.610  1.00 0.00 ? 21  PRO A CA   4  
ATOM 6985  C C    . PRO A 1 21  ? 12.820  -6.295  -10.858 1.00 0.00 ? 21  PRO A C    4  
ATOM 6986  O O    . PRO A 1 21  ? 12.353  -6.108  -11.981 1.00 0.00 ? 21  PRO A O    4  
ATOM 6987  C CB   . PRO A 1 21  ? 11.655  -7.660  -9.103  1.00 0.00 ? 21  PRO A CB   4  
ATOM 6988  C CG   . PRO A 1 21  ? 10.340  -8.017  -9.706  1.00 0.00 ? 21  PRO A CG   4  
ATOM 6989  C CD   . PRO A 1 21  ? 9.562   -6.733  -9.791  1.00 0.00 ? 21  PRO A CD   4  
ATOM 6990  H HA   . PRO A 1 21  ? 12.449  -5.681  -8.839  1.00 0.00 ? 21  PRO A HA   4  
ATOM 6991  H HB2  . PRO A 1 21  ? 12.436  -8.330  -9.433  1.00 0.00 ? 21  PRO A HB2  4  
ATOM 6992  H HB3  . PRO A 1 21  ? 11.607  -7.657  -8.025  1.00 0.00 ? 21  PRO A HB3  4  
ATOM 6993  H HG2  . PRO A 1 21  ? 10.488  -8.431  -10.692 1.00 0.00 ? 21  PRO A HG2  4  
ATOM 6994  H HG3  . PRO A 1 21  ? 9.826   -8.725  -9.073  1.00 0.00 ? 21  PRO A HG3  4  
ATOM 6995  H HD2  . PRO A 1 21  ? 8.936   -6.728  -10.671 1.00 0.00 ? 21  PRO A HD2  4  
ATOM 6996  H HD3  . PRO A 1 21  ? 8.966   -6.593  -8.901  1.00 0.00 ? 21  PRO A HD3  4  
ATOM 6997  N N    . PRO A 1 22  ? 14.121  -6.553  -10.658 1.00 0.00 ? 22  PRO A N    4  
ATOM 6998  C CA   . PRO A 1 22  ? 15.089  -6.634  -11.756 1.00 0.00 ? 22  PRO A CA   4  
ATOM 6999  C C    . PRO A 1 22  ? 14.877  -7.868  -12.626 1.00 0.00 ? 22  PRO A C    4  
ATOM 7000  O O    . PRO A 1 22  ? 15.503  -8.015  -13.676 1.00 0.00 ? 22  PRO A O    4  
ATOM 7001  C CB   . PRO A 1 22  ? 16.437  -6.714  -11.035 1.00 0.00 ? 22  PRO A CB   4  
ATOM 7002  C CG   . PRO A 1 22  ? 16.119  -7.291  -9.699  1.00 0.00 ? 22  PRO A CG   4  
ATOM 7003  C CD   . PRO A 1 22  ? 14.747  -6.786  -9.346  1.00 0.00 ? 22  PRO A CD   4  
ATOM 7004  H HA   . PRO A 1 22  ? 15.062  -5.749  -12.375 1.00 0.00 ? 22  PRO A HA   4  
ATOM 7005  H HB2  . PRO A 1 22  ? 17.109  -7.351  -11.592 1.00 0.00 ? 22  PRO A HB2  4  
ATOM 7006  H HB3  . PRO A 1 22  ? 16.861  -5.725  -10.947 1.00 0.00 ? 22  PRO A HB3  4  
ATOM 7007  H HG2  . PRO A 1 22  ? 16.119  -8.369  -9.756  1.00 0.00 ? 22  PRO A HG2  4  
ATOM 7008  H HG3  . PRO A 1 22  ? 16.841  -6.952  -8.972  1.00 0.00 ? 22  PRO A HG3  4  
ATOM 7009  H HD2  . PRO A 1 22  ? 14.203  -7.532  -8.786  1.00 0.00 ? 22  PRO A HD2  4  
ATOM 7010  H HD3  . PRO A 1 22  ? 14.817  -5.866  -8.784  1.00 0.00 ? 22  PRO A HD3  4  
ATOM 7011  N N    . VAL A 1 23  ? 13.989  -8.753  -12.183 1.00 0.00 ? 23  VAL A N    4  
ATOM 7012  C CA   . VAL A 1 23  ? 13.693  -9.975  -12.923 1.00 0.00 ? 23  VAL A CA   4  
ATOM 7013  C C    . VAL A 1 23  ? 12.264  -9.963  -13.452 1.00 0.00 ? 23  VAL A C    4  
ATOM 7014  O O    . VAL A 1 23  ? 11.822  -10.914 -14.097 1.00 0.00 ? 23  VAL A O    4  
ATOM 7015  C CB   . VAL A 1 23  ? 13.894  -11.225 -12.046 1.00 0.00 ? 23  VAL A CB   4  
ATOM 7016  C CG1  . VAL A 1 23  ? 12.796  -11.324 -10.998 1.00 0.00 ? 23  VAL A CG1  4  
ATOM 7017  C CG2  . VAL A 1 23  ? 13.937  -12.478 -12.907 1.00 0.00 ? 23  VAL A CG2  4  
ATOM 7018  H H    . VAL A 1 23  ? 13.522  -8.581  -11.339 1.00 0.00 ? 23  VAL A H    4  
ATOM 7019  H HA   . VAL A 1 23  ? 14.376  -10.033 -13.758 1.00 0.00 ? 23  VAL A HA   4  
ATOM 7020  H HB   . VAL A 1 23  ? 14.841  -11.132 -11.534 1.00 0.00 ? 23  VAL A HB   4  
ATOM 7021  H HG11 . VAL A 1 23  ? 12.199  -10.424 -11.016 1.00 0.00 ? 23  VAL A HG11 4  
ATOM 7022  H HG12 . VAL A 1 23  ? 12.169  -12.178 -11.213 1.00 0.00 ? 23  VAL A HG12 4  
ATOM 7023  H HG13 . VAL A 1 23  ? 13.240  -11.441 -10.021 1.00 0.00 ? 23  VAL A HG13 4  
ATOM 7024  H HG21 . VAL A 1 23  ? 14.236  -13.320 -12.301 1.00 0.00 ? 23  VAL A HG21 4  
ATOM 7025  H HG22 . VAL A 1 23  ? 12.956  -12.664 -13.321 1.00 0.00 ? 23  VAL A HG22 4  
ATOM 7026  H HG23 . VAL A 1 23  ? 14.646  -12.340 -13.709 1.00 0.00 ? 23  VAL A HG23 4  
ATOM 7027  N N    . GLY A 1 24  ? 11.545  -8.879  -13.176 1.00 0.00 ? 24  GLY A N    4  
ATOM 7028  C CA   . GLY A 1 24  ? 10.172  -8.764  -13.633 1.00 0.00 ? 24  GLY A CA   4  
ATOM 7029  C C    . GLY A 1 24  ? 9.999   -9.215  -15.069 1.00 0.00 ? 24  GLY A C    4  
ATOM 7030  O O    . GLY A 1 24  ? 9.337   -10.214 -15.353 1.00 0.00 ? 24  GLY A O    4  
ATOM 7031  H H    . GLY A 1 24  ? 11.949  -8.152  -12.659 1.00 0.00 ? 24  GLY A H    4  
ATOM 7032  H HA2  . GLY A 1 24  ? 9.541   -9.368  -12.998 1.00 0.00 ? 24  GLY A HA2  4  
ATOM 7033  H HA3  . GLY A 1 24  ? 9.864   -7.732  -13.553 1.00 0.00 ? 24  GLY A HA3  4  
ATOM 7034  N N    . PRO A 1 25  ? 10.602  -8.468  -16.006 1.00 0.00 ? 25  PRO A N    4  
ATOM 7035  C CA   . PRO A 1 25  ? 10.525  -8.777  -17.436 1.00 0.00 ? 25  PRO A CA   4  
ATOM 7036  C C    . PRO A 1 25  ? 11.303  -10.036 -17.800 1.00 0.00 ? 25  PRO A C    4  
ATOM 7037  O O    . PRO A 1 25  ? 11.273  -10.487 -18.945 1.00 0.00 ? 25  PRO A O    4  
ATOM 7038  C CB   . PRO A 1 25  ? 11.154  -7.549  -18.099 1.00 0.00 ? 25  PRO A CB   4  
ATOM 7039  C CG   . PRO A 1 25  ? 12.063  -6.983  -17.063 1.00 0.00 ? 25  PRO A CG   4  
ATOM 7040  C CD   . PRO A 1 25  ? 11.407  -7.264  -15.739 1.00 0.00 ? 25  PRO A CD   4  
ATOM 7041  H HA   . PRO A 1 25  ? 9.501   -8.881  -17.765 1.00 0.00 ? 25  PRO A HA   4  
ATOM 7042  H HB2  . PRO A 1 25  ? 11.700  -7.853  -18.981 1.00 0.00 ? 25  PRO A HB2  4  
ATOM 7043  H HB3  . PRO A 1 25  ? 10.381  -6.847  -18.372 1.00 0.00 ? 25  PRO A HB3  4  
ATOM 7044  H HG2  . PRO A 1 25  ? 13.026  -7.468  -17.114 1.00 0.00 ? 25  PRO A HG2  4  
ATOM 7045  H HG3  . PRO A 1 25  ? 12.169  -5.919  -17.210 1.00 0.00 ? 25  PRO A HG3  4  
ATOM 7046  H HD2  . PRO A 1 25  ? 12.152  -7.458  -14.982 1.00 0.00 ? 25  PRO A HD2  4  
ATOM 7047  H HD3  . PRO A 1 25  ? 10.776  -6.437  -15.448 1.00 0.00 ? 25  PRO A HD3  4  
ATOM 7048  N N    . ALA A 1 26  ? 12.000  -10.600 -16.819 1.00 0.00 ? 26  ALA A N    4  
ATOM 7049  C CA   . ALA A 1 26  ? 12.785  -11.809 -17.036 1.00 0.00 ? 26  ALA A CA   4  
ATOM 7050  C C    . ALA A 1 26  ? 11.956  -13.059 -16.759 1.00 0.00 ? 26  ALA A C    4  
ATOM 7051  O O    . ALA A 1 26  ? 11.719  -13.870 -17.655 1.00 0.00 ? 26  ALA A O    4  
ATOM 7052  C CB   . ALA A 1 26  ? 14.030  -11.795 -16.161 1.00 0.00 ? 26  ALA A CB   4  
ATOM 7053  H H    . ALA A 1 26  ? 11.985  -10.194 -15.928 1.00 0.00 ? 26  ALA A H    4  
ATOM 7054  H HA   . ALA A 1 26  ? 13.101  -11.821 -18.069 1.00 0.00 ? 26  ALA A HA   4  
ATOM 7055  H HB1  . ALA A 1 26  ? 14.345  -12.810 -15.969 1.00 0.00 ? 26  ALA A HB1  4  
ATOM 7056  H HB2  . ALA A 1 26  ? 14.820  -11.261 -16.668 1.00 0.00 ? 26  ALA A HB2  4  
ATOM 7057  H HB3  . ALA A 1 26  ? 13.806  -11.304 -15.225 1.00 0.00 ? 26  ALA A HB3  4  
ATOM 7058  N N    . LEU A 1 27  ? 11.517  -13.208 -15.514 1.00 0.00 ? 27  LEU A N    4  
ATOM 7059  C CA   . LEU A 1 27  ? 10.714  -14.360 -15.119 1.00 0.00 ? 27  LEU A CA   4  
ATOM 7060  C C    . LEU A 1 27  ? 9.318   -14.285 -15.728 1.00 0.00 ? 27  LEU A C    4  
ATOM 7061  O O    . LEU A 1 27  ? 8.622   -15.294 -15.836 1.00 0.00 ? 27  LEU A O    4  
ATOM 7062  C CB   . LEU A 1 27  ? 10.615  -14.439 -13.595 1.00 0.00 ? 27  LEU A CB   4  
ATOM 7063  C CG   . LEU A 1 27  ? 9.392   -13.770 -12.967 1.00 0.00 ? 27  LEU A CG   4  
ATOM 7064  C CD1  . LEU A 1 27  ? 9.295   -14.114 -11.488 1.00 0.00 ? 27  LEU A CD1  4  
ATOM 7065  C CD2  . LEU A 1 27  ? 9.449   -12.262 -13.162 1.00 0.00 ? 27  LEU A CD2  4  
ATOM 7066  H H    . LEU A 1 27  ? 11.738  -12.528 -14.844 1.00 0.00 ? 27  LEU A H    4  
ATOM 7067  H HA   . LEU A 1 27  ? 11.207  -15.248 -15.486 1.00 0.00 ? 27  LEU A HA   4  
ATOM 7068  H HB2  . LEU A 1 27  ? 10.600  -15.481 -13.318 1.00 0.00 ? 27  LEU A HB2  4  
ATOM 7069  H HB3  . LEU A 1 27  ? 11.498  -13.971 -13.182 1.00 0.00 ? 27  LEU A HB3  4  
ATOM 7070  H HG   . LEU A 1 27  ? 8.499   -14.138 -13.453 1.00 0.00 ? 27  LEU A HG   4  
ATOM 7071  H HD11 . LEU A 1 27  ? 8.340   -14.574 -11.288 1.00 0.00 ? 27  LEU A HD11 4  
ATOM 7072  H HD12 . LEU A 1 27  ? 9.391   -13.212 -10.902 1.00 0.00 ? 27  LEU A HD12 4  
ATOM 7073  H HD13 . LEU A 1 27  ? 10.088  -14.799 -11.226 1.00 0.00 ? 27  LEU A HD13 4  
ATOM 7074  H HD21 . LEU A 1 27  ? 10.068  -11.823 -12.393 1.00 0.00 ? 27  LEU A HD21 4  
ATOM 7075  H HD22 . LEU A 1 27  ? 8.451   -11.853 -13.098 1.00 0.00 ? 27  LEU A HD22 4  
ATOM 7076  H HD23 . LEU A 1 27  ? 9.868   -12.040 -14.132 1.00 0.00 ? 27  LEU A HD23 4  
ATOM 7077  N N    . GLY A 1 28  ? 8.915   -13.082 -16.126 1.00 0.00 ? 28  GLY A N    4  
ATOM 7078  C CA   . GLY A 1 28  ? 7.604   -12.898 -16.722 1.00 0.00 ? 28  GLY A CA   4  
ATOM 7079  C C    . GLY A 1 28  ? 7.372   -13.815 -17.907 1.00 0.00 ? 28  GLY A C    4  
ATOM 7080  O O    . GLY A 1 28  ? 6.230   -14.128 -18.241 1.00 0.00 ? 28  GLY A O    4  
ATOM 7081  H H    . GLY A 1 28  ? 9.513   -12.313 -16.015 1.00 0.00 ? 28  GLY A H    4  
ATOM 7082  H HA2  . GLY A 1 28  ? 6.851   -13.095 -15.974 1.00 0.00 ? 28  GLY A HA2  4  
ATOM 7083  H HA3  . GLY A 1 28  ? 7.512   -11.874 -17.050 1.00 0.00 ? 28  GLY A HA3  4  
ATOM 7084  N N    . GLN A 1 29  ? 8.457   -14.243 -18.543 1.00 0.00 ? 29  GLN A N    4  
ATOM 7085  C CA   . GLN A 1 29  ? 8.365   -15.127 -19.699 1.00 0.00 ? 29  GLN A CA   4  
ATOM 7086  C C    . GLN A 1 29  ? 8.530   -16.585 -19.284 1.00 0.00 ? 29  GLN A C    4  
ATOM 7087  O O    . GLN A 1 29  ? 8.922   -17.430 -20.090 1.00 0.00 ? 29  GLN A O    4  
ATOM 7088  C CB   . GLN A 1 29  ? 9.427   -14.757 -20.737 1.00 0.00 ? 29  GLN A CB   4  
ATOM 7089  C CG   . GLN A 1 29  ? 8.856   -14.474 -22.117 1.00 0.00 ? 29  GLN A CG   4  
ATOM 7090  C CD   . GLN A 1 29  ? 9.436   -15.380 -23.185 1.00 0.00 ? 29  GLN A CD   4  
ATOM 7091  O OE1  . GLN A 1 29  ? 8.984   -16.510 -23.370 1.00 0.00 ? 29  GLN A OE1  4  
ATOM 7092  N NE2  . GLN A 1 29  ? 10.444  -14.887 -23.896 1.00 0.00 ? 29  GLN A NE2  4  
ATOM 7093  H H    . GLN A 1 29  ? 9.340   -13.958 -18.229 1.00 0.00 ? 29  GLN A H    4  
ATOM 7094  H HA   . GLN A 1 29  ? 7.387   -14.998 -20.137 1.00 0.00 ? 29  GLN A HA   4  
ATOM 7095  H HB2  . GLN A 1 29  ? 9.950   -13.875 -20.400 1.00 0.00 ? 29  GLN A HB2  4  
ATOM 7096  H HB3  . GLN A 1 29  ? 10.129  -15.572 -20.822 1.00 0.00 ? 29  GLN A HB3  4  
ATOM 7097  H HG2  . GLN A 1 29  ? 7.786   -14.619 -22.087 1.00 0.00 ? 29  GLN A HG2  4  
ATOM 7098  H HG3  . GLN A 1 29  ? 9.072   -13.449 -22.378 1.00 0.00 ? 29  GLN A HG3  4  
ATOM 7099  H HE21 . GLN A 1 29  ? 10.752  -13.979 -23.693 1.00 0.00 ? 29  GLN A HE21 4  
ATOM 7100  H HE22 . GLN A 1 29  ? 10.838  -15.451 -24.592 1.00 0.00 ? 29  GLN A HE22 4  
ATOM 7101  N N    . HIS A 1 30  ? 8.228   -16.874 -18.022 1.00 0.00 ? 30  HIS A N    4  
ATOM 7102  C CA   . HIS A 1 30  ? 8.342   -18.231 -17.500 1.00 0.00 ? 30  HIS A CA   4  
ATOM 7103  C C    . HIS A 1 30  ? 7.180   -18.553 -16.566 1.00 0.00 ? 30  HIS A C    4  
ATOM 7104  O O    . HIS A 1 30  ? 6.393   -19.462 -16.828 1.00 0.00 ? 30  HIS A O    4  
ATOM 7105  C CB   . HIS A 1 30  ? 9.669   -18.405 -16.761 1.00 0.00 ? 30  HIS A CB   4  
ATOM 7106  C CG   . HIS A 1 30  ? 10.798  -18.830 -17.649 1.00 0.00 ? 30  HIS A CG   4  
ATOM 7107  N ND1  . HIS A 1 30  ? 10.761  -19.974 -18.419 1.00 0.00 ? 30  HIS A ND1  4  
ATOM 7108  C CD2  . HIS A 1 30  ? 12.000  -18.256 -17.889 1.00 0.00 ? 30  HIS A CD2  4  
ATOM 7109  C CE1  . HIS A 1 30  ? 11.891  -20.086 -19.093 1.00 0.00 ? 30  HIS A CE1  4  
ATOM 7110  N NE2  . HIS A 1 30  ? 12.661  -19.056 -18.789 1.00 0.00 ? 30  HIS A NE2  4  
ATOM 7111  H H    . HIS A 1 30  ? 7.921   -16.157 -17.429 1.00 0.00 ? 30  HIS A H    4  
ATOM 7112  H HA   . HIS A 1 30  ? 8.314   -18.912 -18.337 1.00 0.00 ? 30  HIS A HA   4  
ATOM 7113  H HB2  . HIS A 1 30  ? 9.944   -17.467 -16.302 1.00 0.00 ? 30  HIS A HB2  4  
ATOM 7114  H HB3  . HIS A 1 30  ? 9.550   -19.156 -15.993 1.00 0.00 ? 30  HIS A HB3  4  
ATOM 7115  H HD1  . HIS A 1 30  ? 10.016  -20.609 -18.464 1.00 0.00 ? 30  HIS A HD1  4  
ATOM 7116  H HD2  . HIS A 1 30  ? 12.372  -17.340 -17.453 1.00 0.00 ? 30  HIS A HD2  4  
ATOM 7117  H HE1  . HIS A 1 30  ? 12.144  -20.883 -19.775 1.00 0.00 ? 30  HIS A HE1  4  
ATOM 7118  N N    . GLY A 1 31  ? 7.079   -17.802 -15.473 1.00 0.00 ? 31  GLY A N    4  
ATOM 7119  C CA   . GLY A 1 31  ? 6.011   -18.024 -14.516 1.00 0.00 ? 31  GLY A CA   4  
ATOM 7120  C C    . GLY A 1 31  ? 4.825   -17.108 -14.748 1.00 0.00 ? 31  GLY A C    4  
ATOM 7121  O O    . GLY A 1 31  ? 3.721   -17.380 -14.278 1.00 0.00 ? 31  GLY A O    4  
ATOM 7122  H H    . GLY A 1 31  ? 7.735   -17.091 -15.316 1.00 0.00 ? 31  GLY A H    4  
ATOM 7123  H HA2  . GLY A 1 31  ? 5.681   -19.049 -14.593 1.00 0.00 ? 31  GLY A HA2  4  
ATOM 7124  H HA3  . GLY A 1 31  ? 6.394   -17.853 -13.521 1.00 0.00 ? 31  GLY A HA3  4  
ATOM 7125  N N    . ALA A 1 32  ? 5.054   -16.018 -15.473 1.00 0.00 ? 32  ALA A N    4  
ATOM 7126  C CA   . ALA A 1 32  ? 3.996   -15.060 -15.766 1.00 0.00 ? 32  ALA A CA   4  
ATOM 7127  C C    . ALA A 1 32  ? 3.488   -14.396 -14.491 1.00 0.00 ? 32  ALA A C    4  
ATOM 7128  O O    . ALA A 1 32  ? 2.399   -13.825 -14.469 1.00 0.00 ? 32  ALA A O    4  
ATOM 7129  C CB   . ALA A 1 32  ? 2.852   -15.744 -16.499 1.00 0.00 ? 32  ALA A CB   4  
ATOM 7130  H H    . ALA A 1 32  ? 5.956   -15.856 -15.821 1.00 0.00 ? 32  ALA A H    4  
ATOM 7131  H HA   . ALA A 1 32  ? 4.405   -14.300 -16.418 1.00 0.00 ? 32  ALA A HA   4  
ATOM 7132  H HB1  . ALA A 1 32  ? 2.701   -15.267 -17.456 1.00 0.00 ? 32  ALA A HB1  4  
ATOM 7133  H HB2  . ALA A 1 32  ? 3.093   -16.786 -16.650 1.00 0.00 ? 32  ALA A HB2  4  
ATOM 7134  H HB3  . ALA A 1 32  ? 1.950   -15.665 -15.911 1.00 0.00 ? 32  ALA A HB3  4  
ATOM 7135  N N    . ASN A 1 33  ? 4.286   -14.474 -13.431 1.00 0.00 ? 33  ASN A N    4  
ATOM 7136  C CA   . ASN A 1 33  ? 3.915   -13.882 -12.150 1.00 0.00 ? 33  ASN A CA   4  
ATOM 7137  C C    . ASN A 1 33  ? 4.855   -12.734 -11.791 1.00 0.00 ? 33  ASN A C    4  
ATOM 7138  O O    . ASN A 1 33  ? 6.074   -12.903 -11.761 1.00 0.00 ? 33  ASN A O    4  
ATOM 7139  C CB   . ASN A 1 33  ? 3.941   -14.942 -11.047 1.00 0.00 ? 33  ASN A CB   4  
ATOM 7140  C CG   . ASN A 1 33  ? 2.553   -15.434 -10.687 1.00 0.00 ? 33  ASN A CG   4  
ATOM 7141  O OD1  . ASN A 1 33  ? 1.591   -14.666 -10.684 1.00 0.00 ? 33  ASN A OD1  4  
ATOM 7142  N ND2  . ASN A 1 33  ? 2.443   -16.722 -10.380 1.00 0.00 ? 33  ASN A ND2  4  
ATOM 7143  H H    . ASN A 1 33  ? 5.143   -14.943 -13.510 1.00 0.00 ? 33  ASN A H    4  
ATOM 7144  H HA   . ASN A 1 33  ? 2.912   -13.495 -12.242 1.00 0.00 ? 33  ASN A HA   4  
ATOM 7145  H HB2  . ASN A 1 33  ? 4.526   -15.786 -11.382 1.00 0.00 ? 33  ASN A HB2  4  
ATOM 7146  H HB3  . ASN A 1 33  ? 4.396   -14.522 -10.163 1.00 0.00 ? 33  ASN A HB3  4  
ATOM 7147  H HD21 . ASN A 1 33  ? 3.253   -17.274 -10.403 1.00 0.00 ? 33  ASN A HD21 4  
ATOM 7148  H HD22 . ASN A 1 33  ? 1.557   -17.067 -10.143 1.00 0.00 ? 33  ASN A HD22 4  
ATOM 7149  N N    . ILE A 1 34  ? 4.278   -11.569 -11.517 1.00 0.00 ? 34  ILE A N    4  
ATOM 7150  C CA   . ILE A 1 34  ? 5.063   -10.395 -11.157 1.00 0.00 ? 34  ILE A CA   4  
ATOM 7151  C C    . ILE A 1 34  ? 5.094   -10.196 -9.646  1.00 0.00 ? 34  ILE A C    4  
ATOM 7152  O O    . ILE A 1 34  ? 6.120   -10.414 -9.002  1.00 0.00 ? 34  ILE A O    4  
ATOM 7153  C CB   . ILE A 1 34  ? 4.507   -9.121  -11.820 1.00 0.00 ? 34  ILE A CB   4  
ATOM 7154  C CG1  . ILE A 1 34  ? 4.445   -9.295  -13.339 1.00 0.00 ? 34  ILE A CG1  4  
ATOM 7155  C CG2  . ILE A 1 34  ? 5.361   -7.916  -11.454 1.00 0.00 ? 34  ILE A CG2  4  
ATOM 7156  C CD1  . ILE A 1 34  ? 5.779   -9.644  -13.962 1.00 0.00 ? 34  ILE A CD1  4  
ATOM 7157  H H    . ILE A 1 34  ? 3.302   -11.497 -11.557 1.00 0.00 ? 34  ILE A H    4  
ATOM 7158  H HA   . ILE A 1 34  ? 6.073   -10.548 -11.510 1.00 0.00 ? 34  ILE A HA   4  
ATOM 7159  H HB   . ILE A 1 34  ? 3.510   -8.952  -11.443 1.00 0.00 ? 34  ILE A HB   4  
ATOM 7160  H HG12 . ILE A 1 34  ? 3.751   -10.086 -13.576 1.00 0.00 ? 34  ILE A HG12 4  
ATOM 7161  H HG13 . ILE A 1 34  ? 4.101   -8.373  -13.786 1.00 0.00 ? 34  ILE A HG13 4  
ATOM 7162  H HG21 . ILE A 1 34  ? 6.396   -8.218  -11.380 1.00 0.00 ? 34  ILE A HG21 4  
ATOM 7163  H HG22 . ILE A 1 34  ? 5.262   -7.159  -12.217 1.00 0.00 ? 34  ILE A HG22 4  
ATOM 7164  H HG23 . ILE A 1 34  ? 5.035   -7.518  -10.505 1.00 0.00 ? 34  ILE A HG23 4  
ATOM 7165  H HD11 . ILE A 1 34  ? 6.574   -9.395  -13.275 1.00 0.00 ? 34  ILE A HD11 4  
ATOM 7166  H HD12 . ILE A 1 34  ? 5.809   -10.701 -14.180 1.00 0.00 ? 34  ILE A HD12 4  
ATOM 7167  H HD13 . ILE A 1 34  ? 5.906   -9.084  -14.877 1.00 0.00 ? 34  ILE A HD13 4  
ATOM 7168  N N    . MET A 1 35  ? 3.962   -9.783  -9.086  1.00 0.00 ? 35  MET A N    4  
ATOM 7169  C CA   . MET A 1 35  ? 3.859   -9.558  -7.648  1.00 0.00 ? 35  MET A CA   4  
ATOM 7170  C C    . MET A 1 35  ? 4.013   -10.867 -6.881  1.00 0.00 ? 35  MET A C    4  
ATOM 7171  O O    . MET A 1 35  ? 4.418   -10.871 -5.719  1.00 0.00 ? 35  MET A O    4  
ATOM 7172  C CB   . MET A 1 35  ? 2.517   -8.908  -7.307  1.00 0.00 ? 35  MET A CB   4  
ATOM 7173  C CG   . MET A 1 35  ? 1.344   -9.874  -7.359  1.00 0.00 ? 35  MET A CG   4  
ATOM 7174  S SD   . MET A 1 35  ? 0.480   -10.003 -5.781  1.00 0.00 ? 35  MET A SD   4  
ATOM 7175  C CE   . MET A 1 35  ? 1.839   -10.398 -4.683  1.00 0.00 ? 35  MET A CE   4  
ATOM 7176  H H    . MET A 1 35  ? 3.177   -9.626  -9.651  1.00 0.00 ? 35  MET A H    4  
ATOM 7177  H HA   . MET A 1 35  ? 4.656   -8.889  -7.360  1.00 0.00 ? 35  MET A HA   4  
ATOM 7178  H HB2  . MET A 1 35  ? 2.572   -8.496  -6.311  1.00 0.00 ? 35  MET A HB2  4  
ATOM 7179  H HB3  . MET A 1 35  ? 2.328   -8.109  -8.009  1.00 0.00 ? 35  MET A HB3  4  
ATOM 7180  H HG2  . MET A 1 35  ? 0.645   -9.532  -8.108  1.00 0.00 ? 35  MET A HG2  4  
ATOM 7181  H HG3  . MET A 1 35  ? 1.712   -10.851 -7.633  1.00 0.00 ? 35  MET A HG3  4  
ATOM 7182  H HE1  . MET A 1 35  ? 2.572   -9.605  -4.717  1.00 0.00 ? 35  MET A HE1  4  
ATOM 7183  H HE2  . MET A 1 35  ? 1.467   -10.502 -3.674  1.00 0.00 ? 35  MET A HE2  4  
ATOM 7184  H HE3  . MET A 1 35  ? 2.297   -11.325 -4.996  1.00 0.00 ? 35  MET A HE3  4  
ATOM 7185  N N    . GLU A 1 36  ? 3.688   -11.975 -7.538  1.00 0.00 ? 36  GLU A N    4  
ATOM 7186  C CA   . GLU A 1 36  ? 3.790   -13.290 -6.915  1.00 0.00 ? 36  GLU A CA   4  
ATOM 7187  C C    . GLU A 1 36  ? 5.238   -13.612 -6.559  1.00 0.00 ? 36  GLU A C    4  
ATOM 7188  O O    . GLU A 1 36  ? 5.518   -14.182 -5.504  1.00 0.00 ? 36  GLU A O    4  
ATOM 7189  C CB   . GLU A 1 36  ? 3.231   -14.366 -7.849  1.00 0.00 ? 36  GLU A CB   4  
ATOM 7190  C CG   . GLU A 1 36  ? 2.064   -15.138 -7.258  1.00 0.00 ? 36  GLU A CG   4  
ATOM 7191  C CD   . GLU A 1 36  ? 2.358   -16.618 -7.109  1.00 0.00 ? 36  GLU A CD   4  
ATOM 7192  O OE1  . GLU A 1 36  ? 3.407   -16.958 -6.524  1.00 0.00 ? 36  GLU A OE1  4  
ATOM 7193  O OE2  . GLU A 1 36  ? 1.539   -17.435 -7.578  1.00 0.00 ? 36  GLU A OE2  4  
ATOM 7194  H H    . GLU A 1 36  ? 3.371   -11.907 -8.463  1.00 0.00 ? 36  GLU A H    4  
ATOM 7195  H HA   . GLU A 1 36  ? 3.204   -13.274 -6.009  1.00 0.00 ? 36  GLU A HA   4  
ATOM 7196  H HB2  . GLU A 1 36  ? 2.901   -13.896 -8.763  1.00 0.00 ? 36  GLU A HB2  4  
ATOM 7197  H HB3  . GLU A 1 36  ? 4.019   -15.068 -8.081  1.00 0.00 ? 36  GLU A HB3  4  
ATOM 7198  H HG2  . GLU A 1 36  ? 1.836   -14.732 -6.284  1.00 0.00 ? 36  GLU A HG2  4  
ATOM 7199  H HG3  . GLU A 1 36  ? 1.207   -15.020 -7.905  1.00 0.00 ? 36  GLU A HG3  4  
ATOM 7200  N N    . PHE A 1 37  ? 6.156   -13.244 -7.447  1.00 0.00 ? 37  PHE A N    4  
ATOM 7201  C CA   . PHE A 1 37  ? 7.576   -13.495 -7.228  1.00 0.00 ? 37  PHE A CA   4  
ATOM 7202  C C    . PHE A 1 37  ? 8.143   -12.536 -6.186  1.00 0.00 ? 37  PHE A C    4  
ATOM 7203  O O    . PHE A 1 37  ? 9.244   -12.738 -5.674  1.00 0.00 ? 37  PHE A O    4  
ATOM 7204  C CB   . PHE A 1 37  ? 8.349   -13.354 -8.541  1.00 0.00 ? 37  PHE A CB   4  
ATOM 7205  C CG   . PHE A 1 37  ? 9.835   -13.496 -8.380  1.00 0.00 ? 37  PHE A CG   4  
ATOM 7206  C CD1  . PHE A 1 37  ? 10.434  -14.745 -8.422  1.00 0.00 ? 37  PHE A CD1  4  
ATOM 7207  C CD2  . PHE A 1 37  ? 10.634  -12.381 -8.187  1.00 0.00 ? 37  PHE A CD2  4  
ATOM 7208  C CE1  . PHE A 1 37  ? 11.801  -14.878 -8.273  1.00 0.00 ? 37  PHE A CE1  4  
ATOM 7209  C CE2  . PHE A 1 37  ? 12.002  -12.508 -8.038  1.00 0.00 ? 37  PHE A CE2  4  
ATOM 7210  C CZ   . PHE A 1 37  ? 12.587  -13.759 -8.082  1.00 0.00 ? 37  PHE A CZ   4  
ATOM 7211  H H    . PHE A 1 37  ? 5.871   -12.794 -8.270  1.00 0.00 ? 37  PHE A H    4  
ATOM 7212  H HA   . PHE A 1 37  ? 7.681   -14.506 -6.865  1.00 0.00 ? 37  PHE A HA   4  
ATOM 7213  H HB2  . PHE A 1 37  ? 8.016   -14.116 -9.230  1.00 0.00 ? 37  PHE A HB2  4  
ATOM 7214  H HB3  . PHE A 1 37  ? 8.151   -12.381 -8.964  1.00 0.00 ? 37  PHE A HB3  4  
ATOM 7215  H HD1  . PHE A 1 37  ? 9.821   -15.622 -8.573  1.00 0.00 ? 37  PHE A HD1  4  
ATOM 7216  H HD2  . PHE A 1 37  ? 10.178  -11.401 -8.152  1.00 0.00 ? 37  PHE A HD2  4  
ATOM 7217  H HE1  . PHE A 1 37  ? 12.256  -15.857 -8.309  1.00 0.00 ? 37  PHE A HE1  4  
ATOM 7218  H HE2  . PHE A 1 37  ? 12.613  -11.630 -7.888  1.00 0.00 ? 37  PHE A HE2  4  
ATOM 7219  H HZ   . PHE A 1 37  ? 13.655  -13.860 -7.965  1.00 0.00 ? 37  PHE A HZ   4  
ATOM 7220  N N    . VAL A 1 38  ? 7.382   -11.491 -5.876  1.00 0.00 ? 38  VAL A N    4  
ATOM 7221  C CA   . VAL A 1 38  ? 7.808   -10.500 -4.895  1.00 0.00 ? 38  VAL A CA   4  
ATOM 7222  C C    . VAL A 1 38  ? 7.559   -10.992 -3.473  1.00 0.00 ? 38  VAL A C    4  
ATOM 7223  O O    . VAL A 1 38  ? 8.424   -10.879 -2.605  1.00 0.00 ? 38  VAL A O    4  
ATOM 7224  C CB   . VAL A 1 38  ? 7.076   -9.159  -5.097  1.00 0.00 ? 38  VAL A CB   4  
ATOM 7225  C CG1  . VAL A 1 38  ? 7.358   -8.217  -3.937  1.00 0.00 ? 38  VAL A CG1  4  
ATOM 7226  C CG2  . VAL A 1 38  ? 7.482   -8.526  -6.420  1.00 0.00 ? 38  VAL A CG2  4  
ATOM 7227  H H    . VAL A 1 38  ? 6.514   -11.384 -6.318  1.00 0.00 ? 38  VAL A H    4  
ATOM 7228  H HA   . VAL A 1 38  ? 8.867   -10.332 -5.027  1.00 0.00 ? 38  VAL A HA   4  
ATOM 7229  H HB   . VAL A 1 38  ? 6.014   -9.353  -5.125  1.00 0.00 ? 38  VAL A HB   4  
ATOM 7230  H HG11 . VAL A 1 38  ? 8.186   -8.597  -3.358  1.00 0.00 ? 38  VAL A HG11 4  
ATOM 7231  H HG12 . VAL A 1 38  ? 7.604   -7.237  -4.320  1.00 0.00 ? 38  VAL A HG12 4  
ATOM 7232  H HG13 . VAL A 1 38  ? 6.482   -8.149  -3.309  1.00 0.00 ? 38  VAL A HG13 4  
ATOM 7233  H HG21 . VAL A 1 38  ? 6.872   -7.654  -6.602  1.00 0.00 ? 38  VAL A HG21 4  
ATOM 7234  H HG22 . VAL A 1 38  ? 8.521   -8.236  -6.376  1.00 0.00 ? 38  VAL A HG22 4  
ATOM 7235  H HG23 . VAL A 1 38  ? 7.340   -9.239  -7.219  1.00 0.00 ? 38  VAL A HG23 4  
ATOM 7236  N N    . LYS A 1 39  ? 6.371   -11.540 -3.242  1.00 0.00 ? 39  LYS A N    4  
ATOM 7237  C CA   . LYS A 1 39  ? 6.007   -12.053 -1.927  1.00 0.00 ? 39  LYS A CA   4  
ATOM 7238  C C    . LYS A 1 39  ? 6.987   -13.130 -1.472  1.00 0.00 ? 39  LYS A C    4  
ATOM 7239  O O    . LYS A 1 39  ? 7.115   -13.402 -0.279  1.00 0.00 ? 39  LYS A O    4  
ATOM 7240  C CB   . LYS A 1 39  ? 4.586   -12.619 -1.953  1.00 0.00 ? 39  LYS A CB   4  
ATOM 7241  C CG   . LYS A 1 39  ? 3.531   -11.640 -1.468  1.00 0.00 ? 39  LYS A CG   4  
ATOM 7242  C CD   . LYS A 1 39  ? 2.885   -12.110 -0.176  1.00 0.00 ? 39  LYS A CD   4  
ATOM 7243  C CE   . LYS A 1 39  ? 3.570   -11.509 1.041   1.00 0.00 ? 39  LYS A CE   4  
ATOM 7244  N NZ   . LYS A 1 39  ? 2.960   -10.209 1.436   1.00 0.00 ? 39  LYS A NZ   4  
ATOM 7245  H H    . LYS A 1 39  ? 5.723   -11.602 -3.976  1.00 0.00 ? 39  LYS A H    4  
ATOM 7246  H HA   . LYS A 1 39  ? 6.045   -11.231 -1.228  1.00 0.00 ? 39  LYS A HA   4  
ATOM 7247  H HB2  . LYS A 1 39  ? 4.343   -12.905 -2.966  1.00 0.00 ? 39  LYS A HB2  4  
ATOM 7248  H HB3  . LYS A 1 39  ? 4.549   -13.496 -1.322  1.00 0.00 ? 39  LYS A HB3  4  
ATOM 7249  H HG2  . LYS A 1 39  ? 3.996   -10.680 -1.297  1.00 0.00 ? 39  LYS A HG2  4  
ATOM 7250  H HG3  . LYS A 1 39  ? 2.768   -11.542 -2.227  1.00 0.00 ? 39  LYS A HG3  4  
ATOM 7251  H HD2  . LYS A 1 39  ? 1.846   -11.813 -0.174  1.00 0.00 ? 39  LYS A HD2  4  
ATOM 7252  H HD3  . LYS A 1 39  ? 2.953   -13.187 -0.121  1.00 0.00 ? 39  LYS A HD3  4  
ATOM 7253  H HE2  . LYS A 1 39  ? 3.485   -12.201 1.865   1.00 0.00 ? 39  LYS A HE2  4  
ATOM 7254  H HE3  . LYS A 1 39  ? 4.613   -11.352 0.810   1.00 0.00 ? 39  LYS A HE3  4  
ATOM 7255  H HZ1  . LYS A 1 39  ? 2.121   -10.016 0.851   1.00 0.00 ? 39  LYS A HZ1  4  
ATOM 7256  H HZ2  . LYS A 1 39  ? 3.645   -9.438  1.304   1.00 0.00 ? 39  LYS A HZ2  4  
ATOM 7257  H HZ3  . LYS A 1 39  ? 2.673   -10.237 2.435   1.00 0.00 ? 39  LYS A HZ3  4  
ATOM 7258  N N    . ALA A 1 40  ? 7.677   -13.738 -2.431  1.00 0.00 ? 40  ALA A N    4  
ATOM 7259  C CA   . ALA A 1 40  ? 8.647   -14.783 -2.129  1.00 0.00 ? 40  ALA A CA   4  
ATOM 7260  C C    . ALA A 1 40  ? 9.892   -14.201 -1.468  1.00 0.00 ? 40  ALA A C    4  
ATOM 7261  O O    . ALA A 1 40  ? 10.749  -14.937 -0.979  1.00 0.00 ? 40  ALA A O    4  
ATOM 7262  C CB   . ALA A 1 40  ? 9.023   -15.537 -3.396  1.00 0.00 ? 40  ALA A CB   4  
ATOM 7263  H H    . ALA A 1 40  ? 7.530   -13.478 -3.364  1.00 0.00 ? 40  ALA A H    4  
ATOM 7264  H HA   . ALA A 1 40  ? 8.184   -15.482 -1.447  1.00 0.00 ? 40  ALA A HA   4  
ATOM 7265  H HB1  . ALA A 1 40  ? 10.084  -15.745 -3.388  1.00 0.00 ? 40  ALA A HB1  4  
ATOM 7266  H HB2  . ALA A 1 40  ? 8.475   -16.466 -3.438  1.00 0.00 ? 40  ALA A HB2  4  
ATOM 7267  H HB3  . ALA A 1 40  ? 8.780   -14.935 -4.258  1.00 0.00 ? 40  ALA A HB3  4  
ATOM 7268  N N    . PHE A 1 41  ? 9.986   -12.875 -1.458  1.00 0.00 ? 41  PHE A N    4  
ATOM 7269  C CA   . PHE A 1 41  ? 11.128  -12.194 -0.858  1.00 0.00 ? 41  PHE A CA   4  
ATOM 7270  C C    . PHE A 1 41  ? 10.679  -11.272 0.272   1.00 0.00 ? 41  PHE A C    4  
ATOM 7271  O O    . PHE A 1 41  ? 11.386  -11.098 1.263   1.00 0.00 ? 41  PHE A O    4  
ATOM 7272  C CB   . PHE A 1 41  ? 11.883  -11.390 -1.918  1.00 0.00 ? 41  PHE A CB   4  
ATOM 7273  C CG   . PHE A 1 41  ? 13.319  -11.802 -2.073  1.00 0.00 ? 41  PHE A CG   4  
ATOM 7274  C CD1  . PHE A 1 41  ? 13.657  -13.135 -2.241  1.00 0.00 ? 41  PHE A CD1  4  
ATOM 7275  C CD2  . PHE A 1 41  ? 14.331  -10.856 -2.050  1.00 0.00 ? 41  PHE A CD2  4  
ATOM 7276  C CE1  . PHE A 1 41  ? 14.977  -13.518 -2.383  1.00 0.00 ? 41  PHE A CE1  4  
ATOM 7277  C CE2  . PHE A 1 41  ? 15.653  -11.233 -2.193  1.00 0.00 ? 41  PHE A CE2  4  
ATOM 7278  C CZ   . PHE A 1 41  ? 15.977  -12.565 -2.358  1.00 0.00 ? 41  PHE A CZ   4  
ATOM 7279  H H    . PHE A 1 41  ? 9.270   -12.342 -1.864  1.00 0.00 ? 41  PHE A H    4  
ATOM 7280  H HA   . PHE A 1 41  ? 11.786  -12.947 -0.453  1.00 0.00 ? 41  PHE A HA   4  
ATOM 7281  H HB2  . PHE A 1 41  ? 11.396  -11.520 -2.873  1.00 0.00 ? 41  PHE A HB2  4  
ATOM 7282  H HB3  . PHE A 1 41  ? 11.863  -10.345 -1.649  1.00 0.00 ? 41  PHE A HB3  4  
ATOM 7283  H HD1  . PHE A 1 41  ? 12.875  -13.882 -2.260  1.00 0.00 ? 41  PHE A HD1  4  
ATOM 7284  H HD2  . PHE A 1 41  ? 14.080  -9.814  -1.919  1.00 0.00 ? 41  PHE A HD2  4  
ATOM 7285  H HE1  . PHE A 1 41  ? 15.226  -14.561 -2.513  1.00 0.00 ? 41  PHE A HE1  4  
ATOM 7286  H HE2  . PHE A 1 41  ? 16.433  -10.486 -2.173  1.00 0.00 ? 41  PHE A HE2  4  
ATOM 7287  H HZ   . PHE A 1 41  ? 17.009  -12.862 -2.471  1.00 0.00 ? 41  PHE A HZ   4  
ATOM 7288  N N    . ASN A 1 42  ? 9.498   -10.683 0.113   1.00 0.00 ? 42  ASN A N    4  
ATOM 7289  C CA   . ASN A 1 42  ? 8.954   -9.778  1.119   1.00 0.00 ? 42  ASN A CA   4  
ATOM 7290  C C    . ASN A 1 42  ? 8.515   -10.546 2.362   1.00 0.00 ? 42  ASN A C    4  
ATOM 7291  O O    . ASN A 1 42  ? 8.446   -9.988  3.457   1.00 0.00 ? 42  ASN A O    4  
ATOM 7292  C CB   . ASN A 1 42  ? 7.771   -8.996  0.545   1.00 0.00 ? 42  ASN A CB   4  
ATOM 7293  C CG   . ASN A 1 42  ? 8.005   -7.498  0.562   1.00 0.00 ? 42  ASN A CG   4  
ATOM 7294  O OD1  . ASN A 1 42  ? 8.676   -6.973  1.451   1.00 0.00 ? 42  ASN A OD1  4  
ATOM 7295  N ND2  . ASN A 1 42  ? 7.452   -6.801  -0.424  1.00 0.00 ? 42  ASN A ND2  4  
ATOM 7296  H H    . ASN A 1 42  ? 8.979   -10.862 -0.699  1.00 0.00 ? 42  ASN A H    4  
ATOM 7297  H HA   . ASN A 1 42  ? 9.733   -9.083  1.395   1.00 0.00 ? 42  ASN A HA   4  
ATOM 7298  H HB2  . ASN A 1 42  ? 7.606   -9.303  -0.478  1.00 0.00 ? 42  ASN A HB2  4  
ATOM 7299  H HB3  . ASN A 1 42  ? 6.888   -9.211  1.128   1.00 0.00 ? 42  ASN A HB3  4  
ATOM 7300  H HD21 . ASN A 1 42  ? 6.930   -7.286  -1.098  1.00 0.00 ? 42  ASN A HD21 4  
ATOM 7301  H HD22 . ASN A 1 42  ? 7.588   -5.831  -0.437  1.00 0.00 ? 42  ASN A HD22 4  
ATOM 7302  N N    . ALA A 1 43  ? 8.221   -11.830 2.185   1.00 0.00 ? 43  ALA A N    4  
ATOM 7303  C CA   . ALA A 1 43  ? 7.792   -12.675 3.292   1.00 0.00 ? 43  ALA A CA   4  
ATOM 7304  C C    . ALA A 1 43  ? 8.851   -13.719 3.628   1.00 0.00 ? 43  ALA A C    4  
ATOM 7305  O O    . ALA A 1 43  ? 8.669   -14.532 4.533   1.00 0.00 ? 43  ALA A O    4  
ATOM 7306  C CB   . ALA A 1 43  ? 6.469   -13.350 2.959   1.00 0.00 ? 43  ALA A CB   4  
ATOM 7307  H H    . ALA A 1 43  ? 8.295   -12.217 1.288   1.00 0.00 ? 43  ALA A H    4  
ATOM 7308  H HA   . ALA A 1 43  ? 7.638   -12.043 4.155   1.00 0.00 ? 43  ALA A HA   4  
ATOM 7309  H HB1  . ALA A 1 43  ? 6.571   -13.905 2.038   1.00 0.00 ? 43  ALA A HB1  4  
ATOM 7310  H HB2  . ALA A 1 43  ? 6.197   -14.023 3.758   1.00 0.00 ? 43  ALA A HB2  4  
ATOM 7311  H HB3  . ALA A 1 43  ? 5.701   -12.599 2.843   1.00 0.00 ? 43  ALA A HB3  4  
ATOM 7312  N N    . ALA A 1 44  ? 9.957   -13.692 2.892   1.00 0.00 ? 44  ALA A N    4  
ATOM 7313  C CA   . ALA A 1 44  ? 11.045  -14.635 3.113   1.00 0.00 ? 44  ALA A CA   4  
ATOM 7314  C C    . ALA A 1 44  ? 12.273  -13.934 3.684   1.00 0.00 ? 44  ALA A C    4  
ATOM 7315  O O    . ALA A 1 44  ? 12.801  -14.331 4.723   1.00 0.00 ? 44  ALA A O    4  
ATOM 7316  C CB   . ALA A 1 44  ? 11.398  -15.347 1.815   1.00 0.00 ? 44  ALA A CB   4  
ATOM 7317  H H    . ALA A 1 44  ? 10.043  -13.020 2.184   1.00 0.00 ? 44  ALA A H    4  
ATOM 7318  H HA   . ALA A 1 44  ? 10.705  -15.377 3.821   1.00 0.00 ? 44  ALA A HA   4  
ATOM 7319  H HB1  . ALA A 1 44  ? 11.849  -16.303 2.041   1.00 0.00 ? 44  ALA A HB1  4  
ATOM 7320  H HB2  . ALA A 1 44  ? 10.502  -15.500 1.233   1.00 0.00 ? 44  ALA A HB2  4  
ATOM 7321  H HB3  . ALA A 1 44  ? 12.095  -14.745 1.252   1.00 0.00 ? 44  ALA A HB3  4  
ATOM 7322  N N    . THR A 1 45  ? 12.723  -12.887 2.999   1.00 0.00 ? 45  THR A N    4  
ATOM 7323  C CA   . THR A 1 45  ? 13.889  -12.131 3.437   1.00 0.00 ? 45  THR A CA   4  
ATOM 7324  C C    . THR A 1 45  ? 13.582  -11.325 4.693   1.00 0.00 ? 45  THR A C    4  
ATOM 7325  O O    . THR A 1 45  ? 14.363  -11.317 5.644   1.00 0.00 ? 45  THR A O    4  
ATOM 7326  C CB   . THR A 1 45  ? 14.386  -11.175 2.336   1.00 0.00 ? 45  THR A CB   4  
ATOM 7327  O OG1  . THR A 1 45  ? 13.535  -10.026 2.264   1.00 0.00 ? 45  THR A OG1  4  
ATOM 7328  C CG2  . THR A 1 45  ? 14.416  -11.875 0.985   1.00 0.00 ? 45  THR A CG2  4  
ATOM 7329  H H    . THR A 1 45  ? 12.259  -12.619 2.178   1.00 0.00 ? 45  THR A H    4  
ATOM 7330  H HA   . THR A 1 45  ? 14.679  -12.835 3.657   1.00 0.00 ? 45  THR A HA   4  
ATOM 7331  H HB   . THR A 1 45  ? 15.389  -10.857 2.582   1.00 0.00 ? 45  THR A HB   4  
ATOM 7332  H HG1  . THR A 1 45  ? 13.601  -9.632  1.391   1.00 0.00 ? 45  THR A HG1  4  
ATOM 7333  H HG21 . THR A 1 45  ? 14.669  -12.916 1.124   1.00 0.00 ? 45  THR A HG21 4  
ATOM 7334  H HG22 . THR A 1 45  ? 15.154  -11.406 0.353   1.00 0.00 ? 45  THR A HG22 4  
ATOM 7335  H HG23 . THR A 1 45  ? 13.444  -11.800 0.520   1.00 0.00 ? 45  THR A HG23 4  
ATOM 7336  N N    . ALA A 1 46  ? 12.439  -10.647 4.690   1.00 0.00 ? 46  ALA A N    4  
ATOM 7337  C CA   . ALA A 1 46  ? 12.027  -9.839  5.831   1.00 0.00 ? 46  ALA A CA   4  
ATOM 7338  C C    . ALA A 1 46  ? 12.069  -10.650 7.122   1.00 0.00 ? 46  ALA A C    4  
ATOM 7339  O O    . ALA A 1 46  ? 12.288  -10.104 8.202   1.00 0.00 ? 46  ALA A O    4  
ATOM 7340  C CB   . ALA A 1 46  ? 10.631  -9.277  5.604   1.00 0.00 ? 46  ALA A CB   4  
ATOM 7341  H H    . ALA A 1 46  ? 11.858  -10.692 3.902   1.00 0.00 ? 46  ALA A H    4  
ATOM 7342  H HA   . ALA A 1 46  ? 12.712  -9.008  5.917   1.00 0.00 ? 46  ALA A HA   4  
ATOM 7343  H HB1  . ALA A 1 46  ? 10.562  -8.295  6.050   1.00 0.00 ? 46  ALA A HB1  4  
ATOM 7344  H HB2  . ALA A 1 46  ? 10.440  -9.206  4.544   1.00 0.00 ? 46  ALA A HB2  4  
ATOM 7345  H HB3  . ALA A 1 46  ? 9.902   -9.931  6.058   1.00 0.00 ? 46  ALA A HB3  4  
ATOM 7346  N N    . ASN A 1 47  ? 11.856  -11.956 7.002   1.00 0.00 ? 47  ASN A N    4  
ATOM 7347  C CA   . ASN A 1 47  ? 11.869  -12.843 8.160   1.00 0.00 ? 47  ASN A CA   4  
ATOM 7348  C C    . ASN A 1 47  ? 13.298  -13.205 8.552   1.00 0.00 ? 47  ASN A C    4  
ATOM 7349  O O    . ASN A 1 47  ? 13.672  -14.377 8.557   1.00 0.00 ? 47  ASN A O    4  
ATOM 7350  C CB   . ASN A 1 47  ? 11.071  -14.114 7.864   1.00 0.00 ? 47  ASN A CB   4  
ATOM 7351  C CG   . ASN A 1 47  ? 10.609  -14.814 9.127   1.00 0.00 ? 47  ASN A CG   4  
ATOM 7352  O OD1  . ASN A 1 47  ? 10.576  -14.218 10.204  1.00 0.00 ? 47  ASN A OD1  4  
ATOM 7353  N ND2  . ASN A 1 47  ? 10.249  -16.086 9.001   1.00 0.00 ? 47  ASN A ND2  4  
ATOM 7354  H H    . ASN A 1 47  ? 11.686  -12.334 6.113   1.00 0.00 ? 47  ASN A H    4  
ATOM 7355  H HA   . ASN A 1 47  ? 11.404  -12.320 8.982   1.00 0.00 ? 47  ASN A HA   4  
ATOM 7356  H HB2  . ASN A 1 47  ? 10.200  -13.857 7.279   1.00 0.00 ? 47  ASN A HB2  4  
ATOM 7357  H HB3  . ASN A 1 47  ? 11.689  -14.797 7.301   1.00 0.00 ? 47  ASN A HB3  4  
ATOM 7358  H HD21 . ASN A 1 47  ? 10.301  -16.496 8.112   1.00 0.00 ? 47  ASN A HD21 4  
ATOM 7359  H HD22 . ASN A 1 47  ? 9.946   -16.563 9.801   1.00 0.00 ? 47  ASN A HD22 4  
ATOM 7360  N N    . MET A 1 48  ? 14.091  -12.190 8.880   1.00 0.00 ? 48  MET A N    4  
ATOM 7361  C CA   . MET A 1 48  ? 15.478  -12.402 9.276   1.00 0.00 ? 48  MET A CA   4  
ATOM 7362  C C    . MET A 1 48  ? 15.925  -11.346 10.282  1.00 0.00 ? 48  MET A C    4  
ATOM 7363  O O    . MET A 1 48  ? 16.432  -11.672 11.354  1.00 0.00 ? 48  MET A O    4  
ATOM 7364  C CB   . MET A 1 48  ? 16.391  -12.372 8.048   1.00 0.00 ? 48  MET A CB   4  
ATOM 7365  C CG   . MET A 1 48  ? 16.701  -13.750 7.487   1.00 0.00 ? 48  MET A CG   4  
ATOM 7366  S SD   . MET A 1 48  ? 17.624  -13.679 5.940   1.00 0.00 ? 48  MET A SD   4  
ATOM 7367  C CE   . MET A 1 48  ? 16.949  -15.095 5.077   1.00 0.00 ? 48  MET A CE   4  
ATOM 7368  H H    . MET A 1 48  ? 13.735  -11.277 8.857   1.00 0.00 ? 48  MET A H    4  
ATOM 7369  H HA   . MET A 1 48  ? 15.546  -13.375 9.739   1.00 0.00 ? 48  MET A HA   4  
ATOM 7370  H HB2  . MET A 1 48  ? 15.914  -11.790 7.274   1.00 0.00 ? 48  MET A HB2  4  
ATOM 7371  H HB3  . MET A 1 48  ? 17.324  -11.900 8.319   1.00 0.00 ? 48  MET A HB3  4  
ATOM 7372  H HG2  . MET A 1 48  ? 17.284  -14.298 8.212   1.00 0.00 ? 48  MET A HG2  4  
ATOM 7373  H HG3  . MET A 1 48  ? 15.770  -14.269 7.311   1.00 0.00 ? 48  MET A HG3  4  
ATOM 7374  H HE1  . MET A 1 48  ? 17.697  -15.502 4.412   1.00 0.00 ? 48  MET A HE1  4  
ATOM 7375  H HE2  . MET A 1 48  ? 16.657  -15.848 5.794   1.00 0.00 ? 48  MET A HE2  4  
ATOM 7376  H HE3  . MET A 1 48  ? 16.086  -14.789 4.503   1.00 0.00 ? 48  MET A HE3  4  
ATOM 7377  N N    . GLY A 1 49  ? 15.732  -10.079 9.928   1.00 0.00 ? 49  GLY A N    4  
ATOM 7378  C CA   . GLY A 1 49  ? 16.120  -8.995  10.811  1.00 0.00 ? 49  GLY A CA   4  
ATOM 7379  C C    . GLY A 1 49  ? 16.670  -7.801  10.056  1.00 0.00 ? 49  GLY A C    4  
ATOM 7380  O O    . GLY A 1 49  ? 16.024  -6.755  9.981   1.00 0.00 ? 49  GLY A O    4  
ATOM 7381  H H    . GLY A 1 49  ? 15.322  -9.879  9.060   1.00 0.00 ? 49  GLY A H    4  
ATOM 7382  H HA2  . GLY A 1 49  ? 15.258  -8.682  11.380  1.00 0.00 ? 49  GLY A HA2  4  
ATOM 7383  H HA3  . GLY A 1 49  ? 16.878  -9.355  11.492  1.00 0.00 ? 49  GLY A HA3  4  
ATOM 7384  N N    . ASP A 1 50  ? 17.865  -7.955  9.497   1.00 0.00 ? 50  ASP A N    4  
ATOM 7385  C CA   . ASP A 1 50  ? 18.501  -6.881  8.745   1.00 0.00 ? 50  ASP A CA   4  
ATOM 7386  C C    . ASP A 1 50  ? 19.798  -7.362  8.101   1.00 0.00 ? 50  ASP A C    4  
ATOM 7387  O O    . ASP A 1 50  ? 20.853  -7.367  8.735   1.00 0.00 ? 50  ASP A O    4  
ATOM 7388  C CB   . ASP A 1 50  ? 18.783  -5.687  9.658   1.00 0.00 ? 50  ASP A CB   4  
ATOM 7389  C CG   . ASP A 1 50  ? 18.393  -4.367  9.024   1.00 0.00 ? 50  ASP A CG   4  
ATOM 7390  O OD1  . ASP A 1 50  ? 17.216  -4.222  8.632   1.00 0.00 ? 50  ASP A OD1  4  
ATOM 7391  O OD2  . ASP A 1 50  ? 19.264  -3.478  8.920   1.00 0.00 ? 50  ASP A OD2  4  
ATOM 7392  H H    . ASP A 1 50  ? 18.330  -8.813  9.592   1.00 0.00 ? 50  ASP A H    4  
ATOM 7393  H HA   . ASP A 1 50  ? 17.821  -6.573  7.966   1.00 0.00 ? 50  ASP A HA   4  
ATOM 7394  H HB2  . ASP A 1 50  ? 18.224  -5.804  10.575  1.00 0.00 ? 50  ASP A HB2  4  
ATOM 7395  H HB3  . ASP A 1 50  ? 19.839  -5.658  9.887   1.00 0.00 ? 50  ASP A HB3  4  
ATOM 7396  N N    . ALA A 1 51  ? 19.711  -7.768  6.839   1.00 0.00 ? 51  ALA A N    4  
ATOM 7397  C CA   . ALA A 1 51  ? 20.877  -8.250  6.109   1.00 0.00 ? 51  ALA A CA   4  
ATOM 7398  C C    . ALA A 1 51  ? 20.517  -8.606  4.671   1.00 0.00 ? 51  ALA A C    4  
ATOM 7399  O O    . ALA A 1 51  ? 19.340  -8.674  4.315   1.00 0.00 ? 51  ALA A O    4  
ATOM 7400  C CB   . ALA A 1 51  ? 21.482  -9.454  6.817   1.00 0.00 ? 51  ALA A CB   4  
ATOM 7401  H H    . ALA A 1 51  ? 18.842  -7.740  6.387   1.00 0.00 ? 51  ALA A H    4  
ATOM 7402  H HA   . ALA A 1 51  ? 21.615  -7.461  6.100   1.00 0.00 ? 51  ALA A HA   4  
ATOM 7403  H HB1  . ALA A 1 51  ? 20.962  -9.620  7.749   1.00 0.00 ? 51  ALA A HB1  4  
ATOM 7404  H HB2  . ALA A 1 51  ? 21.385  -10.326 6.189   1.00 0.00 ? 51  ALA A HB2  4  
ATOM 7405  H HB3  . ALA A 1 51  ? 22.526  -9.267  7.016   1.00 0.00 ? 51  ALA A HB3  4  
ATOM 7406  N N    . ILE A 1 52  ? 21.536  -8.830  3.849   1.00 0.00 ? 52  ILE A N    4  
ATOM 7407  C CA   . ILE A 1 52  ? 21.325  -9.179  2.449   1.00 0.00 ? 52  ILE A CA   4  
ATOM 7408  C C    . ILE A 1 52  ? 21.227  -10.690 2.268   1.00 0.00 ? 52  ILE A C    4  
ATOM 7409  O O    . ILE A 1 52  ? 22.075  -11.441 2.751   1.00 0.00 ? 52  ILE A O    4  
ATOM 7410  C CB   . ILE A 1 52  ? 22.459  -8.640  1.558   1.00 0.00 ? 52  ILE A CB   4  
ATOM 7411  C CG1  . ILE A 1 52  ? 22.562  -7.119  1.690   1.00 0.00 ? 52  ILE A CG1  4  
ATOM 7412  C CG2  . ILE A 1 52  ? 22.226  -9.036  0.107   1.00 0.00 ? 52  ILE A CG2  4  
ATOM 7413  C CD1  . ILE A 1 52  ? 21.308  -6.389  1.261   1.00 0.00 ? 52  ILE A CD1  4  
ATOM 7414  H H    . ILE A 1 52  ? 22.451  -8.760  4.191   1.00 0.00 ? 52  ILE A H    4  
ATOM 7415  H HA   . ILE A 1 52  ? 20.397  -8.728  2.130   1.00 0.00 ? 52  ILE A HA   4  
ATOM 7416  H HB   . ILE A 1 52  ? 23.386  -9.086  1.883   1.00 0.00 ? 52  ILE A HB   4  
ATOM 7417  H HG12 . ILE A 1 52  ? 22.756  -6.866  2.720   1.00 0.00 ? 52  ILE A HG12 4  
ATOM 7418  H HG13 . ILE A 1 52  ? 23.379  -6.766  1.077   1.00 0.00 ? 52  ILE A HG13 4  
ATOM 7419  H HG21 . ILE A 1 52  ? 23.038  -8.665  -0.502  1.00 0.00 ? 52  ILE A HG21 4  
ATOM 7420  H HG22 . ILE A 1 52  ? 22.184  -10.112 0.031   1.00 0.00 ? 52  ILE A HG22 4  
ATOM 7421  H HG23 . ILE A 1 52  ? 21.295  -8.613  -0.237  1.00 0.00 ? 52  ILE A HG23 4  
ATOM 7422  H HD11 . ILE A 1 52  ? 20.569  -7.105  0.932   1.00 0.00 ? 52  ILE A HD11 4  
ATOM 7423  H HD12 . ILE A 1 52  ? 20.918  -5.823  2.093   1.00 0.00 ? 52  ILE A HD12 4  
ATOM 7424  H HD13 . ILE A 1 52  ? 21.544  -5.717  0.448   1.00 0.00 ? 52  ILE A HD13 4  
ATOM 7425  N N    . VAL A 1 53  ? 20.187  -11.131 1.567   1.00 0.00 ? 53  VAL A N    4  
ATOM 7426  C CA   . VAL A 1 53  ? 19.979  -12.552 1.319   1.00 0.00 ? 53  VAL A CA   4  
ATOM 7427  C C    . VAL A 1 53  ? 19.906  -12.844 -0.175  1.00 0.00 ? 53  VAL A C    4  
ATOM 7428  O O    . VAL A 1 53  ? 18.832  -12.871 -0.777  1.00 0.00 ? 53  VAL A O    4  
ATOM 7429  C CB   . VAL A 1 53  ? 18.688  -13.056 1.993   1.00 0.00 ? 53  VAL A CB   4  
ATOM 7430  C CG1  . VAL A 1 53  ? 17.525  -12.126 1.683   1.00 0.00 ? 53  VAL A CG1  4  
ATOM 7431  C CG2  . VAL A 1 53  ? 18.377  -14.478 1.550   1.00 0.00 ? 53  VAL A CG2  4  
ATOM 7432  H H    . VAL A 1 53  ? 19.545  -10.484 1.208   1.00 0.00 ? 53  VAL A H    4  
ATOM 7433  H HA   . VAL A 1 53  ? 20.814  -13.091 1.742   1.00 0.00 ? 53  VAL A HA   4  
ATOM 7434  H HB   . VAL A 1 53  ? 18.842  -13.060 3.062   1.00 0.00 ? 53  VAL A HB   4  
ATOM 7435  H HG11 . VAL A 1 53  ? 16.685  -12.379 2.312   1.00 0.00 ? 53  VAL A HG11 4  
ATOM 7436  H HG12 . VAL A 1 53  ? 17.822  -11.104 1.870   1.00 0.00 ? 53  VAL A HG12 4  
ATOM 7437  H HG13 . VAL A 1 53  ? 17.244  -12.236 0.646   1.00 0.00 ? 53  VAL A HG13 4  
ATOM 7438  H HG21 . VAL A 1 53  ? 17.552  -14.465 0.853   1.00 0.00 ? 53  VAL A HG21 4  
ATOM 7439  H HG22 . VAL A 1 53  ? 19.247  -14.905 1.071   1.00 0.00 ? 53  VAL A HG22 4  
ATOM 7440  H HG23 . VAL A 1 53  ? 18.113  -15.074 2.411   1.00 0.00 ? 53  VAL A HG23 4  
ATOM 7441  N N    . PRO A 1 54  ? 21.076  -13.069 -0.791  1.00 0.00 ? 54  PRO A N    4  
ATOM 7442  C CA   . PRO A 1 54  ? 21.172  -13.365 -2.224  1.00 0.00 ? 54  PRO A CA   4  
ATOM 7443  C C    . PRO A 1 54  ? 20.613  -14.741 -2.571  1.00 0.00 ? 54  PRO A C    4  
ATOM 7444  O O    . PRO A 1 54  ? 21.121  -15.763 -2.109  1.00 0.00 ? 54  PRO A O    4  
ATOM 7445  C CB   . PRO A 1 54  ? 22.678  -13.316 -2.496  1.00 0.00 ? 54  PRO A CB   4  
ATOM 7446  C CG   . PRO A 1 54  ? 23.310  -13.626 -1.183  1.00 0.00 ? 54  PRO A CG   4  
ATOM 7447  C CD   . PRO A 1 54  ? 22.395  -13.053 -0.137  1.00 0.00 ? 54  PRO A CD   4  
ATOM 7448  H HA   . PRO A 1 54  ? 20.673  -12.614 -2.818  1.00 0.00 ? 54  PRO A HA   4  
ATOM 7449  H HB2  . PRO A 1 54  ? 22.935  -14.053 -3.244  1.00 0.00 ? 54  PRO A HB2  4  
ATOM 7450  H HB3  . PRO A 1 54  ? 22.952  -12.331 -2.843  1.00 0.00 ? 54  PRO A HB3  4  
ATOM 7451  H HG2  . PRO A 1 54  ? 23.397  -14.695 -1.061  1.00 0.00 ? 54  PRO A HG2  4  
ATOM 7452  H HG3  . PRO A 1 54  ? 24.283  -13.160 -1.126  1.00 0.00 ? 54  PRO A HG3  4  
ATOM 7453  H HD2  . PRO A 1 54  ? 22.395  -13.675 0.746   1.00 0.00 ? 54  PRO A HD2  4  
ATOM 7454  H HD3  . PRO A 1 54  ? 22.690  -12.044 0.110   1.00 0.00 ? 54  PRO A HD3  4  
ATOM 7455  N N    . VAL A 1 55  ? 19.564  -14.759 -3.387  1.00 0.00 ? 55  VAL A N    4  
ATOM 7456  C CA   . VAL A 1 55  ? 18.937  -16.010 -3.797  1.00 0.00 ? 55  VAL A CA   4  
ATOM 7457  C C    . VAL A 1 55  ? 19.299  -16.361 -5.236  1.00 0.00 ? 55  VAL A C    4  
ATOM 7458  O O    . VAL A 1 55  ? 19.500  -15.477 -6.068  1.00 0.00 ? 55  VAL A O    4  
ATOM 7459  C CB   . VAL A 1 55  ? 17.404  -15.938 -3.668  1.00 0.00 ? 55  VAL A CB   4  
ATOM 7460  C CG1  . VAL A 1 55  ? 16.839  -14.875 -4.598  1.00 0.00 ? 55  VAL A CG1  4  
ATOM 7461  C CG2  . VAL A 1 55  ? 16.781  -17.295 -3.956  1.00 0.00 ? 55  VAL A CG2  4  
ATOM 7462  H H    . VAL A 1 55  ? 19.204  -13.912 -3.722  1.00 0.00 ? 55  VAL A H    4  
ATOM 7463  H HA   . VAL A 1 55  ? 19.295  -16.793 -3.145  1.00 0.00 ? 55  VAL A HA   4  
ATOM 7464  H HB   . VAL A 1 55  ? 17.161  -15.662 -2.653  1.00 0.00 ? 55  VAL A HB   4  
ATOM 7465  H HG11 . VAL A 1 55  ? 15.760  -14.931 -4.595  1.00 0.00 ? 55  VAL A HG11 4  
ATOM 7466  H HG12 . VAL A 1 55  ? 17.151  -13.897 -4.260  1.00 0.00 ? 55  VAL A HG12 4  
ATOM 7467  H HG13 . VAL A 1 55  ? 17.205  -15.043 -5.601  1.00 0.00 ? 55  VAL A HG13 4  
ATOM 7468  H HG21 . VAL A 1 55  ? 15.942  -17.453 -3.294  1.00 0.00 ? 55  VAL A HG21 4  
ATOM 7469  H HG22 . VAL A 1 55  ? 16.440  -17.326 -4.981  1.00 0.00 ? 55  VAL A HG22 4  
ATOM 7470  H HG23 . VAL A 1 55  ? 17.516  -18.070 -3.799  1.00 0.00 ? 55  VAL A HG23 4  
ATOM 7471  N N    . GLU A 1 56  ? 19.380  -17.657 -5.521  1.00 0.00 ? 56  GLU A N    4  
ATOM 7472  C CA   . GLU A 1 56  ? 19.718  -18.124 -6.861  1.00 0.00 ? 56  GLU A CA   4  
ATOM 7473  C C    . GLU A 1 56  ? 18.599  -18.989 -7.434  1.00 0.00 ? 56  GLU A C    4  
ATOM 7474  O O    . GLU A 1 56  ? 18.658  -20.218 -7.372  1.00 0.00 ? 56  GLU A O    4  
ATOM 7475  C CB   . GLU A 1 56  ? 21.027  -18.915 -6.833  1.00 0.00 ? 56  GLU A CB   4  
ATOM 7476  C CG   . GLU A 1 56  ? 22.268  -18.038 -6.821  1.00 0.00 ? 56  GLU A CG   4  
ATOM 7477  C CD   . GLU A 1 56  ? 23.315  -18.495 -7.818  1.00 0.00 ? 56  GLU A CD   4  
ATOM 7478  O OE1  . GLU A 1 56  ? 22.938  -18.840 -8.957  1.00 0.00 ? 56  GLU A OE1  4  
ATOM 7479  O OE2  . GLU A 1 56  ? 24.511  -18.507 -7.459  1.00 0.00 ? 56  GLU A OE2  4  
ATOM 7480  H H    . GLU A 1 56  ? 19.208  -18.313 -4.815  1.00 0.00 ? 56  GLU A H    4  
ATOM 7481  H HA   . GLU A 1 56  ? 19.845  -17.257 -7.492  1.00 0.00 ? 56  GLU A HA   4  
ATOM 7482  H HB2  . GLU A 1 56  ? 21.040  -19.535 -5.949  1.00 0.00 ? 56  GLU A HB2  4  
ATOM 7483  H HB3  . GLU A 1 56  ? 21.069  -19.548 -7.707  1.00 0.00 ? 56  GLU A HB3  4  
ATOM 7484  H HG2  . GLU A 1 56  ? 21.981  -17.026 -7.062  1.00 0.00 ? 56  GLU A HG2  4  
ATOM 7485  H HG3  . GLU A 1 56  ? 22.700  -18.062 -5.831  1.00 0.00 ? 56  GLU A HG3  4  
ATOM 7486  N N    . ILE A 1 57  ? 17.582  -18.340 -7.990  1.00 0.00 ? 57  ILE A N    4  
ATOM 7487  C CA   . ILE A 1 57  ? 16.451  -19.049 -8.574  1.00 0.00 ? 57  ILE A CA   4  
ATOM 7488  C C    . ILE A 1 57  ? 16.897  -19.935 -9.733  1.00 0.00 ? 57  ILE A C    4  
ATOM 7489  O O    . ILE A 1 57  ? 17.011  -19.477 -10.871 1.00 0.00 ? 57  ILE A O    4  
ATOM 7490  C CB   . ILE A 1 57  ? 15.371  -18.072 -9.075  1.00 0.00 ? 57  ILE A CB   4  
ATOM 7491  C CG1  . ILE A 1 57  ? 14.949  -17.124 -7.951  1.00 0.00 ? 57  ILE A CG1  4  
ATOM 7492  C CG2  . ILE A 1 57  ? 14.170  -18.838 -9.608  1.00 0.00 ? 57  ILE A CG2  4  
ATOM 7493  C CD1  . ILE A 1 57  ? 15.467  -15.713 -8.124  1.00 0.00 ? 57  ILE A CD1  4  
ATOM 7494  H H    . ILE A 1 57  ? 17.593  -17.360 -8.008  1.00 0.00 ? 57  ILE A H    4  
ATOM 7495  H HA   . ILE A 1 57  ? 16.016  -19.672 -7.806  1.00 0.00 ? 57  ILE A HA   4  
ATOM 7496  H HB   . ILE A 1 57  ? 15.788  -17.495 -9.886  1.00 0.00 ? 57  ILE A HB   4  
ATOM 7497  H HG12 . ILE A 1 57  ? 13.873  -17.079 -7.911  1.00 0.00 ? 57  ILE A HG12 4  
ATOM 7498  H HG13 . ILE A 1 57  ? 15.325  -17.503 -7.011  1.00 0.00 ? 57  ILE A HG13 4  
ATOM 7499  H HG21 . ILE A 1 57  ? 14.402  -19.237 -10.584 1.00 0.00 ? 57  ILE A HG21 4  
ATOM 7500  H HG22 . ILE A 1 57  ? 13.934  -19.649 -8.936  1.00 0.00 ? 57  ILE A HG22 4  
ATOM 7501  H HG23 . ILE A 1 57  ? 13.323  -18.173 -9.683  1.00 0.00 ? 57  ILE A HG23 4  
ATOM 7502  H HD11 . ILE A 1 57  ? 15.135  -15.322 -9.075  1.00 0.00 ? 57  ILE A HD11 4  
ATOM 7503  H HD12 . ILE A 1 57  ? 15.090  -15.090 -7.327  1.00 0.00 ? 57  ILE A HD12 4  
ATOM 7504  H HD13 . ILE A 1 57  ? 16.547  -15.720 -8.095  1.00 0.00 ? 57  ILE A HD13 4  
ATOM 7505  N N    . THR A 1 58  ? 17.146  -21.206 -9.437  1.00 0.00 ? 58  THR A N    4  
ATOM 7506  C CA   . THR A 1 58  ? 17.579  -22.157 -10.453 1.00 0.00 ? 58  THR A CA   4  
ATOM 7507  C C    . THR A 1 58  ? 16.428  -22.533 -11.380 1.00 0.00 ? 58  THR A C    4  
ATOM 7508  O O    . THR A 1 58  ? 15.586  -23.362 -11.033 1.00 0.00 ? 58  THR A O    4  
ATOM 7509  C CB   . THR A 1 58  ? 18.151  -23.438 -9.818  1.00 0.00 ? 58  THR A CB   4  
ATOM 7510  O OG1  . THR A 1 58  ? 18.152  -23.319 -8.391  1.00 0.00 ? 58  THR A OG1  4  
ATOM 7511  C CG2  . THR A 1 58  ? 19.565  -23.702 -10.311 1.00 0.00 ? 58  THR A CG2  4  
ATOM 7512  H H    . THR A 1 58  ? 17.038  -21.511 -8.512  1.00 0.00 ? 58  THR A H    4  
ATOM 7513  H HA   . THR A 1 58  ? 18.360  -21.690 -11.036 1.00 0.00 ? 58  THR A HA   4  
ATOM 7514  H HB   . THR A 1 58  ? 17.525  -24.273 -10.101 1.00 0.00 ? 58  THR A HB   4  
ATOM 7515  H HG1  . THR A 1 58  ? 18.906  -22.793 -8.114  1.00 0.00 ? 58  THR A HG1  4  
ATOM 7516  H HG21 . THR A 1 58  ? 20.275  -23.307 -9.598  1.00 0.00 ? 58  THR A HG21 4  
ATOM 7517  H HG22 . THR A 1 58  ? 19.709  -23.221 -11.266 1.00 0.00 ? 58  THR A HG22 4  
ATOM 7518  H HG23 . THR A 1 58  ? 19.717  -24.766 -10.417 1.00 0.00 ? 58  THR A HG23 4  
ATOM 7519  N N    . ILE A 1 59  ? 16.398  -21.920 -12.558 1.00 0.00 ? 59  ILE A N    4  
ATOM 7520  C CA   . ILE A 1 59  ? 15.351  -22.192 -13.534 1.00 0.00 ? 59  ILE A CA   4  
ATOM 7521  C C    . ILE A 1 59  ? 15.420  -23.634 -14.026 1.00 0.00 ? 59  ILE A C    4  
ATOM 7522  O O    . ILE A 1 59  ? 16.378  -24.029 -14.691 1.00 0.00 ? 59  ILE A O    4  
ATOM 7523  C CB   . ILE A 1 59  ? 15.448  -21.244 -14.744 1.00 0.00 ? 59  ILE A CB   4  
ATOM 7524  C CG1  . ILE A 1 59  ? 15.414  -19.786 -14.281 1.00 0.00 ? 59  ILE A CG1  4  
ATOM 7525  C CG2  . ILE A 1 59  ? 14.319  -21.520 -15.726 1.00 0.00 ? 59  ILE A CG2  4  
ATOM 7526  C CD1  . ILE A 1 59  ? 14.103  -19.386 -13.641 1.00 0.00 ? 59  ILE A CD1  4  
ATOM 7527  H H    . ILE A 1 59  ? 17.098  -21.269 -12.776 1.00 0.00 ? 59  ILE A H    4  
ATOM 7528  H HA   . ILE A 1 59  ? 14.397  -22.033 -13.053 1.00 0.00 ? 59  ILE A HA   4  
ATOM 7529  H HB   . ILE A 1 59  ? 16.385  -21.432 -15.247 1.00 0.00 ? 59  ILE A HB   4  
ATOM 7530  H HG12 . ILE A 1 59  ? 16.197  -19.626 -13.557 1.00 0.00 ? 59  ILE A HG12 4  
ATOM 7531  H HG13 . ILE A 1 59  ? 15.579  -19.142 -15.132 1.00 0.00 ? 59  ILE A HG13 4  
ATOM 7532  H HG21 . ILE A 1 59  ? 13.372  -21.300 -15.256 1.00 0.00 ? 59  ILE A HG21 4  
ATOM 7533  H HG22 . ILE A 1 59  ? 14.441  -20.896 -16.598 1.00 0.00 ? 59  ILE A HG22 4  
ATOM 7534  H HG23 . ILE A 1 59  ? 14.343  -22.559 -16.019 1.00 0.00 ? 59  ILE A HG23 4  
ATOM 7535  H HD11 . ILE A 1 59  ? 13.886  -20.050 -12.817 1.00 0.00 ? 59  ILE A HD11 4  
ATOM 7536  H HD12 . ILE A 1 59  ? 14.173  -18.372 -13.279 1.00 0.00 ? 59  ILE A HD12 4  
ATOM 7537  H HD13 . ILE A 1 59  ? 13.311  -19.452 -14.373 1.00 0.00 ? 59  ILE A HD13 4  
ATOM 7538  N N    . TYR A 1 60  ? 14.398  -24.415 -13.696 1.00 0.00 ? 60  TYR A N    4  
ATOM 7539  C CA   . TYR A 1 60  ? 14.342  -25.814 -14.104 1.00 0.00 ? 60  TYR A CA   4  
ATOM 7540  C C    . TYR A 1 60  ? 13.860  -25.943 -15.546 1.00 0.00 ? 60  TYR A C    4  
ATOM 7541  O O    . TYR A 1 60  ? 13.669  -24.944 -16.239 1.00 0.00 ? 60  TYR A O    4  
ATOM 7542  C CB   . TYR A 1 60  ? 13.418  -26.602 -13.174 1.00 0.00 ? 60  TYR A CB   4  
ATOM 7543  C CG   . TYR A 1 60  ? 14.139  -27.260 -12.019 1.00 0.00 ? 60  TYR A CG   4  
ATOM 7544  C CD1  . TYR A 1 60  ? 15.373  -26.789 -11.586 1.00 0.00 ? 60  TYR A CD1  4  
ATOM 7545  C CD2  . TYR A 1 60  ? 13.588  -28.353 -11.362 1.00 0.00 ? 60  TYR A CD2  4  
ATOM 7546  C CE1  . TYR A 1 60  ? 16.036  -27.388 -10.532 1.00 0.00 ? 60  TYR A CE1  4  
ATOM 7547  C CE2  . TYR A 1 60  ? 14.243  -28.957 -10.306 1.00 0.00 ? 60  TYR A CE2  4  
ATOM 7548  C CZ   . TYR A 1 60  ? 15.466  -28.471 -9.895  1.00 0.00 ? 60  TYR A CZ   4  
ATOM 7549  O OH   . TYR A 1 60  ? 16.123  -29.070 -8.845  1.00 0.00 ? 60  TYR A OH   4  
ATOM 7550  H H    . TYR A 1 60  ? 13.663  -24.043 -13.165 1.00 0.00 ? 60  TYR A H    4  
ATOM 7551  H HA   . TYR A 1 60  ? 15.340  -26.221 -14.032 1.00 0.00 ? 60  TYR A HA   4  
ATOM 7552  H HB2  . TYR A 1 60  ? 12.677  -25.933 -12.763 1.00 0.00 ? 60  TYR A HB2  4  
ATOM 7553  H HB3  . TYR A 1 60  ? 12.922  -27.376 -13.741 1.00 0.00 ? 60  TYR A HB3  4  
ATOM 7554  H HD1  . TYR A 1 60  ? 15.816  -25.941 -12.087 1.00 0.00 ? 60  TYR A HD1  4  
ATOM 7555  H HD2  . TYR A 1 60  ? 12.629  -28.731 -11.687 1.00 0.00 ? 60  TYR A HD2  4  
ATOM 7556  H HE1  . TYR A 1 60  ? 16.994  -27.008 -10.210 1.00 0.00 ? 60  TYR A HE1  4  
ATOM 7557  H HE2  . TYR A 1 60  ? 13.797  -29.805 -9.808  1.00 0.00 ? 60  TYR A HE2  4  
ATOM 7558  H HH   . TYR A 1 60  ? 16.310  -29.986 -9.066  1.00 0.00 ? 60  TYR A HH   4  
ATOM 7559  N N    . ALA A 1 61  ? 13.665  -27.180 -15.989 1.00 0.00 ? 61  ALA A N    4  
ATOM 7560  C CA   . ALA A 1 61  ? 13.203  -27.441 -17.347 1.00 0.00 ? 61  ALA A CA   4  
ATOM 7561  C C    . ALA A 1 61  ? 11.890  -28.217 -17.341 1.00 0.00 ? 61  ALA A C    4  
ATOM 7562  O O    . ALA A 1 61  ? 11.380  -28.602 -18.393 1.00 0.00 ? 61  ALA A O    4  
ATOM 7563  C CB   . ALA A 1 61  ? 14.264  -28.201 -18.129 1.00 0.00 ? 61  ALA A CB   4  
ATOM 7564  H H    . ALA A 1 61  ? 13.835  -27.935 -15.389 1.00 0.00 ? 61  ALA A H    4  
ATOM 7565  H HA   . ALA A 1 61  ? 13.045  -26.490 -17.834 1.00 0.00 ? 61  ALA A HA   4  
ATOM 7566  H HB1  . ALA A 1 61  ? 13.929  -29.215 -18.295 1.00 0.00 ? 61  ALA A HB1  4  
ATOM 7567  H HB2  . ALA A 1 61  ? 14.428  -27.716 -19.079 1.00 0.00 ? 61  ALA A HB2  4  
ATOM 7568  H HB3  . ALA A 1 61  ? 15.185  -28.214 -17.566 1.00 0.00 ? 61  ALA A HB3  4  
ATOM 7569  N N    . ASP A 1 62  ? 11.348  -28.444 -16.149 1.00 0.00 ? 62  ASP A N    4  
ATOM 7570  C CA   . ASP A 1 62  ? 10.094  -29.174 -16.006 1.00 0.00 ? 62  ASP A CA   4  
ATOM 7571  C C    . ASP A 1 62  ? 8.903   -28.222 -16.047 1.00 0.00 ? 62  ASP A C    4  
ATOM 7572  O O    . ASP A 1 62  ? 8.280   -28.036 -17.093 1.00 0.00 ? 62  ASP A O    4  
ATOM 7573  C CB   . ASP A 1 62  ? 10.086  -29.964 -14.696 1.00 0.00 ? 62  ASP A CB   4  
ATOM 7574  C CG   . ASP A 1 62  ? 10.443  -31.424 -14.898 1.00 0.00 ? 62  ASP A CG   4  
ATOM 7575  O OD1  . ASP A 1 62  ? 10.969  -31.762 -15.980 1.00 0.00 ? 62  ASP A OD1  4  
ATOM 7576  O OD2  . ASP A 1 62  ? 10.198  -32.227 -13.975 1.00 0.00 ? 62  ASP A OD2  4  
ATOM 7577  H H    . ASP A 1 62  ? 11.803  -28.112 -15.346 1.00 0.00 ? 62  ASP A H    4  
ATOM 7578  H HA   . ASP A 1 62  ? 10.016  -29.864 -16.832 1.00 0.00 ? 62  ASP A HA   4  
ATOM 7579  H HB2  . ASP A 1 62  ? 10.803  -29.528 -14.016 1.00 0.00 ? 62  ASP A HB2  4  
ATOM 7580  H HB3  . ASP A 1 62  ? 9.101   -29.910 -14.257 1.00 0.00 ? 62  ASP A HB3  4  
ATOM 7581  N N    . ARG A 1 63  ? 8.592   -27.622 -14.903 1.00 0.00 ? 63  ARG A N    4  
ATOM 7582  C CA   . ARG A 1 63  ? 7.474   -26.690 -14.808 1.00 0.00 ? 63  ARG A CA   4  
ATOM 7583  C C    . ARG A 1 63  ? 7.937   -25.339 -14.272 1.00 0.00 ? 63  ARG A C    4  
ATOM 7584  O O    . ARG A 1 63  ? 8.163   -24.401 -15.037 1.00 0.00 ? 63  ARG A O    4  
ATOM 7585  C CB   . ARG A 1 63  ? 6.381   -27.263 -13.904 1.00 0.00 ? 63  ARG A CB   4  
ATOM 7586  C CG   . ARG A 1 63  ? 6.892   -28.289 -12.906 1.00 0.00 ? 63  ARG A CG   4  
ATOM 7587  C CD   . ARG A 1 63  ? 5.922   -28.472 -11.749 1.00 0.00 ? 63  ARG A CD   4  
ATOM 7588  N NE   . ARG A 1 63  ? 5.813   -27.268 -10.930 1.00 0.00 ? 63  ARG A NE   4  
ATOM 7589  C CZ   . ARG A 1 63  ? 4.984   -27.153 -9.898  1.00 0.00 ? 63  ARG A CZ   4  
ATOM 7590  N NH1  . ARG A 1 63  ? 4.197   -28.165 -9.561  1.00 0.00 ? 63  ARG A NH1  4  
ATOM 7591  N NH2  . ARG A 1 63  ? 4.942   -26.025 -9.201  1.00 0.00 ? 63  ARG A NH2  4  
ATOM 7592  H H    . ARG A 1 63  ? 9.126   -27.810 -14.103 1.00 0.00 ? 63  ARG A H    4  
ATOM 7593  H HA   . ARG A 1 63  ? 7.072   -26.552 -15.801 1.00 0.00 ? 63  ARG A HA   4  
ATOM 7594  H HB2  . ARG A 1 63  ? 5.925   -26.453 -13.353 1.00 0.00 ? 63  ARG A HB2  4  
ATOM 7595  H HB3  . ARG A 1 63  ? 5.631   -27.735 -14.521 1.00 0.00 ? 63  ARG A HB3  4  
ATOM 7596  H HG2  . ARG A 1 63  ? 7.017   -29.236 -13.409 1.00 0.00 ? 63  ARG A HG2  4  
ATOM 7597  H HG3  . ARG A 1 63  ? 7.843   -27.957 -12.517 1.00 0.00 ? 63  ARG A HG3  4  
ATOM 7598  H HD2  . ARG A 1 63  ? 4.948   -28.713 -12.149 1.00 0.00 ? 63  ARG A HD2  4  
ATOM 7599  H HD3  . ARG A 1 63  ? 6.269   -29.286 -11.131 1.00 0.00 ? 63  ARG A HD3  4  
ATOM 7600  H HE   . ARG A 1 63  ? 6.385   -26.507 -11.162 1.00 0.00 ? 63  ARG A HE   4  
ATOM 7601  H HH11 . ARG A 1 63  ? 4.227   -29.017 -10.083 1.00 0.00 ? 63  ARG A HH11 4  
ATOM 7602  H HH12 . ARG A 1 63  ? 3.575   -28.077 -8.782  1.00 0.00 ? 63  ARG A HH12 4  
ATOM 7603  H HH21 . ARG A 1 63  ? 5.535   -25.260 -9.453  1.00 0.00 ? 63  ARG A HH21 4  
ATOM 7604  H HH22 . ARG A 1 63  ? 4.319   -25.940 -8.425  1.00 0.00 ? 63  ARG A HH22 4  
ATOM 7605  N N    . SER A 1 64  ? 8.075   -25.247 -12.953 1.00 0.00 ? 64  SER A N    4  
ATOM 7606  C CA   . SER A 1 64  ? 8.506   -24.009 -12.315 1.00 0.00 ? 64  SER A CA   4  
ATOM 7607  C C    . SER A 1 64  ? 9.984   -24.076 -11.942 1.00 0.00 ? 64  SER A C    4  
ATOM 7608  O O    . SER A 1 64  ? 10.670  -25.051 -12.250 1.00 0.00 ? 64  SER A O    4  
ATOM 7609  C CB   . SER A 1 64  ? 7.665   -23.735 -11.066 1.00 0.00 ? 64  SER A CB   4  
ATOM 7610  O OG   . SER A 1 64  ? 6.373   -23.269 -11.413 1.00 0.00 ? 64  SER A OG   4  
ATOM 7611  H H    . SER A 1 64  ? 7.879   -26.029 -12.397 1.00 0.00 ? 64  SER A H    4  
ATOM 7612  H HA   . SER A 1 64  ? 8.361   -23.204 -13.020 1.00 0.00 ? 64  SER A HA   4  
ATOM 7613  H HB2  . SER A 1 64  ? 7.565   -24.646 -10.495 1.00 0.00 ? 64  SER A HB2  4  
ATOM 7614  H HB3  . SER A 1 64  ? 8.155   -22.984 -10.463 1.00 0.00 ? 64  SER A HB3  4  
ATOM 7615  H HG   . SER A 1 64  ? 5.858   -23.129 -10.616 1.00 0.00 ? 64  SER A HG   4  
ATOM 7616  N N    . PHE A 1 65  ? 10.468  -23.032 -11.277 1.00 0.00 ? 65  PHE A N    4  
ATOM 7617  C CA   . PHE A 1 65  ? 11.864  -22.971 -10.862 1.00 0.00 ? 65  PHE A CA   4  
ATOM 7618  C C    . PHE A 1 65  ? 11.999  -23.228 -9.364  1.00 0.00 ? 65  PHE A C    4  
ATOM 7619  O O    . PHE A 1 65  ? 11.011  -23.487 -8.675  1.00 0.00 ? 65  PHE A O    4  
ATOM 7620  C CB   . PHE A 1 65  ? 12.463  -21.607 -11.212 1.00 0.00 ? 65  PHE A CB   4  
ATOM 7621  C CG   . PHE A 1 65  ? 11.584  -20.450 -10.830 1.00 0.00 ? 65  PHE A CG   4  
ATOM 7622  C CD1  . PHE A 1 65  ? 11.289  -20.198 -9.500  1.00 0.00 ? 65  PHE A CD1  4  
ATOM 7623  C CD2  . PHE A 1 65  ? 11.053  -19.616 -11.800 1.00 0.00 ? 65  PHE A CD2  4  
ATOM 7624  C CE1  . PHE A 1 65  ? 10.481  -19.134 -9.144  1.00 0.00 ? 65  PHE A CE1  4  
ATOM 7625  C CE2  . PHE A 1 65  ? 10.245  -18.551 -11.450 1.00 0.00 ? 65  PHE A CE2  4  
ATOM 7626  C CZ   . PHE A 1 65  ? 9.958   -18.310 -10.121 1.00 0.00 ? 65  PHE A CZ   4  
ATOM 7627  H H    . PHE A 1 65  ? 9.871   -22.285 -11.060 1.00 0.00 ? 65  PHE A H    4  
ATOM 7628  H HA   . PHE A 1 65  ? 12.402  -23.738 -11.397 1.00 0.00 ? 65  PHE A HA   4  
ATOM 7629  H HB2  . PHE A 1 65  ? 13.405  -21.492 -10.697 1.00 0.00 ? 65  PHE A HB2  4  
ATOM 7630  H HB3  . PHE A 1 65  ? 12.632  -21.559 -12.278 1.00 0.00 ? 65  PHE A HB3  4  
ATOM 7631  H HD1  . PHE A 1 65  ? 11.698  -20.843 -8.734  1.00 0.00 ? 65  PHE A HD1  4  
ATOM 7632  H HD2  . PHE A 1 65  ? 11.276  -19.803 -12.840 1.00 0.00 ? 65  PHE A HD2  4  
ATOM 7633  H HE1  . PHE A 1 65  ? 10.259  -18.950 -8.103  1.00 0.00 ? 65  PHE A HE1  4  
ATOM 7634  H HE2  . PHE A 1 65  ? 9.837   -17.908 -12.216 1.00 0.00 ? 65  PHE A HE2  4  
ATOM 7635  H HZ   . PHE A 1 65  ? 9.327   -17.479 -9.845  1.00 0.00 ? 65  PHE A HZ   4  
ATOM 7636  N N    . THR A 1 66  ? 13.229  -23.155 -8.865  1.00 0.00 ? 66  THR A N    4  
ATOM 7637  C CA   . THR A 1 66  ? 13.494  -23.382 -7.450  1.00 0.00 ? 66  THR A CA   4  
ATOM 7638  C C    . THR A 1 66  ? 14.348  -22.263 -6.865  1.00 0.00 ? 66  THR A C    4  
ATOM 7639  O O    . THR A 1 66  ? 15.335  -21.841 -7.469  1.00 0.00 ? 66  THR A O    4  
ATOM 7640  C CB   . THR A 1 66  ? 14.206  -24.729 -7.220  1.00 0.00 ? 66  THR A CB   4  
ATOM 7641  O OG1  . THR A 1 66  ? 15.570  -24.641 -7.646  1.00 0.00 ? 66  THR A OG1  4  
ATOM 7642  C CG2  . THR A 1 66  ? 13.505  -25.847 -7.977  1.00 0.00 ? 66  THR A CG2  4  
ATOM 7643  H H    . THR A 1 66  ? 13.975  -22.945 -9.465  1.00 0.00 ? 66  THR A H    4  
ATOM 7644  H HA   . THR A 1 66  ? 12.546  -23.407 -6.933  1.00 0.00 ? 66  THR A HA   4  
ATOM 7645  H HB   . THR A 1 66  ? 14.180  -24.957 -6.164  1.00 0.00 ? 66  THR A HB   4  
ATOM 7646  H HG1  . THR A 1 66  ? 15.627  -24.842 -8.583  1.00 0.00 ? 66  THR A HG1  4  
ATOM 7647  H HG21 . THR A 1 66  ? 12.584  -25.473 -8.400  1.00 0.00 ? 66  THR A HG21 4  
ATOM 7648  H HG22 . THR A 1 66  ? 13.286  -26.658 -7.298  1.00 0.00 ? 66  THR A HG22 4  
ATOM 7649  H HG23 . THR A 1 66  ? 14.146  -26.203 -8.769  1.00 0.00 ? 66  THR A HG23 4  
ATOM 7650  N N    . PHE A 1 67  ? 13.964  -21.786 -5.685  1.00 0.00 ? 67  PHE A N    4  
ATOM 7651  C CA   . PHE A 1 67  ? 14.695  -20.715 -5.018  1.00 0.00 ? 67  PHE A CA   4  
ATOM 7652  C C    . PHE A 1 67  ? 14.881  -21.025 -3.536  1.00 0.00 ? 67  PHE A C    4  
ATOM 7653  O O    . PHE A 1 67  ? 13.934  -21.404 -2.846  1.00 0.00 ? 67  PHE A O    4  
ATOM 7654  C CB   . PHE A 1 67  ? 13.957  -19.385 -5.185  1.00 0.00 ? 67  PHE A CB   4  
ATOM 7655  C CG   . PHE A 1 67  ? 12.481  -19.482 -4.924  1.00 0.00 ? 67  PHE A CG   4  
ATOM 7656  C CD1  . PHE A 1 67  ? 11.608  -19.854 -5.934  1.00 0.00 ? 67  PHE A CD1  4  
ATOM 7657  C CD2  . PHE A 1 67  ? 11.966  -19.201 -3.668  1.00 0.00 ? 67  PHE A CD2  4  
ATOM 7658  C CE1  . PHE A 1 67  ? 10.250  -19.942 -5.696  1.00 0.00 ? 67  PHE A CE1  4  
ATOM 7659  C CE2  . PHE A 1 67  ? 10.608  -19.289 -3.425  1.00 0.00 ? 67  PHE A CE2  4  
ATOM 7660  C CZ   . PHE A 1 67  ? 9.749   -19.661 -4.440  1.00 0.00 ? 67  PHE A CZ   4  
ATOM 7661  H H    . PHE A 1 67  ? 13.169  -22.164 -5.254  1.00 0.00 ? 67  PHE A H    4  
ATOM 7662  H HA   . PHE A 1 67  ? 15.666  -20.639 -5.482  1.00 0.00 ? 67  PHE A HA   4  
ATOM 7663  H HB2  . PHE A 1 67  ? 14.369  -18.665 -4.494  1.00 0.00 ? 67  PHE A HB2  4  
ATOM 7664  H HB3  . PHE A 1 67  ? 14.094  -19.030 -6.195  1.00 0.00 ? 67  PHE A HB3  4  
ATOM 7665  H HD1  . PHE A 1 67  ? 11.998  -20.075 -6.916  1.00 0.00 ? 67  PHE A HD1  4  
ATOM 7666  H HD2  . PHE A 1 67  ? 12.638  -18.911 -2.873  1.00 0.00 ? 67  PHE A HD2  4  
ATOM 7667  H HE1  . PHE A 1 67  ? 9.580   -20.234 -6.492  1.00 0.00 ? 67  PHE A HE1  4  
ATOM 7668  H HE2  . PHE A 1 67  ? 10.221  -19.068 -2.441  1.00 0.00 ? 67  PHE A HE2  4  
ATOM 7669  H HZ   . PHE A 1 67  ? 8.688   -19.729 -4.252  1.00 0.00 ? 67  PHE A HZ   4  
ATOM 7670  N N    . VAL A 1 68  ? 16.108  -20.861 -3.052  1.00 0.00 ? 68  VAL A N    4  
ATOM 7671  C CA   . VAL A 1 68  ? 16.419  -21.122 -1.652  1.00 0.00 ? 68  VAL A CA   4  
ATOM 7672  C C    . VAL A 1 68  ? 16.904  -19.857 -0.952  1.00 0.00 ? 68  VAL A C    4  
ATOM 7673  O O    . VAL A 1 68  ? 17.315  -18.894 -1.599  1.00 0.00 ? 68  VAL A O    4  
ATOM 7674  C CB   . VAL A 1 68  ? 17.493  -22.217 -1.511  1.00 0.00 ? 68  VAL A CB   4  
ATOM 7675  C CG1  . VAL A 1 68  ? 17.473  -22.806 -0.109  1.00 0.00 ? 68  VAL A CG1  4  
ATOM 7676  C CG2  . VAL A 1 68  ? 17.288  -23.302 -2.557  1.00 0.00 ? 68  VAL A CG2  4  
ATOM 7677  H H    . VAL A 1 68  ? 16.821  -20.556 -3.652  1.00 0.00 ? 68  VAL A H    4  
ATOM 7678  H HA   . VAL A 1 68  ? 15.517  -21.467 -1.168  1.00 0.00 ? 68  VAL A HA   4  
ATOM 7679  H HB   . VAL A 1 68  ? 18.461  -21.767 -1.675  1.00 0.00 ? 68  VAL A HB   4  
ATOM 7680  H HG11 . VAL A 1 68  ? 16.509  -22.627 0.343   1.00 0.00 ? 68  VAL A HG11 4  
ATOM 7681  H HG12 . VAL A 1 68  ? 17.655  -23.870 -0.162  1.00 0.00 ? 68  VAL A HG12 4  
ATOM 7682  H HG13 . VAL A 1 68  ? 18.243  -22.339 0.489   1.00 0.00 ? 68  VAL A HG13 4  
ATOM 7683  H HG21 . VAL A 1 68  ? 16.244  -23.577 -2.590  1.00 0.00 ? 68  VAL A HG21 4  
ATOM 7684  H HG22 . VAL A 1 68  ? 17.593  -22.932 -3.525  1.00 0.00 ? 68  VAL A HG22 4  
ATOM 7685  H HG23 . VAL A 1 68  ? 17.880  -24.167 -2.300  1.00 0.00 ? 68  VAL A HG23 4  
ATOM 7686  N N    . THR A 1 69  ? 16.853  -19.866 0.377   1.00 0.00 ? 69  THR A N    4  
ATOM 7687  C CA   . THR A 1 69  ? 17.286  -18.720 1.166   1.00 0.00 ? 69  THR A CA   4  
ATOM 7688  C C    . THR A 1 69  ? 18.262  -19.142 2.258   1.00 0.00 ? 69  THR A C    4  
ATOM 7689  O O    . THR A 1 69  ? 18.161  -20.239 2.806   1.00 0.00 ? 69  THR A O    4  
ATOM 7690  C CB   . THR A 1 69  ? 16.088  -18.000 1.814   1.00 0.00 ? 69  THR A CB   4  
ATOM 7691  O OG1  . THR A 1 69  ? 15.040  -18.938 2.084   1.00 0.00 ? 69  THR A OG1  4  
ATOM 7692  C CG2  . THR A 1 69  ? 15.566  -16.895 0.909   1.00 0.00 ? 69  THR A CG2  4  
ATOM 7693  H H    . THR A 1 69  ? 16.515  -20.664 0.835   1.00 0.00 ? 69  THR A H    4  
ATOM 7694  H HA   . THR A 1 69  ? 17.780  -18.026 0.502   1.00 0.00 ? 69  THR A HA   4  
ATOM 7695  H HB   . THR A 1 69  ? 16.414  -17.559 2.745   1.00 0.00 ? 69  THR A HB   4  
ATOM 7696  H HG1  . THR A 1 69  ? 14.860  -19.453 1.293   1.00 0.00 ? 69  THR A HG1  4  
ATOM 7697  H HG21 . THR A 1 69  ? 15.772  -17.146 -0.121  1.00 0.00 ? 69  THR A HG21 4  
ATOM 7698  H HG22 . THR A 1 69  ? 16.056  -15.965 1.157   1.00 0.00 ? 69  THR A HG22 4  
ATOM 7699  H HG23 . THR A 1 69  ? 14.501  -16.790 1.047   1.00 0.00 ? 69  THR A HG23 4  
ATOM 7700  N N    . LYS A 1 70  ? 19.209  -18.263 2.570   1.00 0.00 ? 70  LYS A N    4  
ATOM 7701  C CA   . LYS A 1 70  ? 20.204  -18.543 3.598   1.00 0.00 ? 70  LYS A CA   4  
ATOM 7702  C C    . LYS A 1 70  ? 19.885  -17.787 4.884   1.00 0.00 ? 70  LYS A C    4  
ATOM 7703  O O    . LYS A 1 70  ? 19.682  -16.572 4.869   1.00 0.00 ? 70  LYS A O    4  
ATOM 7704  C CB   . LYS A 1 70  ? 21.601  -18.160 3.103   1.00 0.00 ? 70  LYS A CB   4  
ATOM 7705  C CG   . LYS A 1 70  ? 21.883  -18.603 1.677   1.00 0.00 ? 70  LYS A CG   4  
ATOM 7706  C CD   . LYS A 1 70  ? 21.902  -20.118 1.558   1.00 0.00 ? 70  LYS A CD   4  
ATOM 7707  C CE   . LYS A 1 70  ? 23.041  -20.592 0.668   1.00 0.00 ? 70  LYS A CE   4  
ATOM 7708  N NZ   . LYS A 1 70  ? 24.107  -21.277 1.450   1.00 0.00 ? 70  LYS A NZ   4  
ATOM 7709  H H    . LYS A 1 70  ? 19.238  -17.405 2.097   1.00 0.00 ? 70  LYS A H    4  
ATOM 7710  H HA   . LYS A 1 70  ? 20.182  -19.602 3.802   1.00 0.00 ? 70  LYS A HA   4  
ATOM 7711  H HB2  . LYS A 1 70  ? 21.705  -17.086 3.151   1.00 0.00 ? 70  LYS A HB2  4  
ATOM 7712  H HB3  . LYS A 1 70  ? 22.336  -18.615 3.751   1.00 0.00 ? 70  LYS A HB3  4  
ATOM 7713  H HG2  . LYS A 1 70  ? 21.113  -18.211 1.029   1.00 0.00 ? 70  LYS A HG2  4  
ATOM 7714  H HG3  . LYS A 1 70  ? 22.845  -18.215 1.373   1.00 0.00 ? 70  LYS A HG3  4  
ATOM 7715  H HD2  . LYS A 1 70  ? 22.026  -20.547 2.541   1.00 0.00 ? 70  LYS A HD2  4  
ATOM 7716  H HD3  . LYS A 1 70  ? 20.964  -20.448 1.134   1.00 0.00 ? 70  LYS A HD3  4  
ATOM 7717  H HE2  . LYS A 1 70  ? 22.646  -21.280 -0.064  1.00 0.00 ? 70  LYS A HE2  4  
ATOM 7718  H HE3  . LYS A 1 70  ? 23.468  -19.737 0.165   1.00 0.00 ? 70  LYS A HE3  4  
ATOM 7719  H HZ1  . LYS A 1 70  ? 23.934  -22.302 1.469   1.00 0.00 ? 70  LYS A HZ1  4  
ATOM 7720  H HZ2  . LYS A 1 70  ? 24.118  -20.921 2.427   1.00 0.00 ? 70  LYS A HZ2  4  
ATOM 7721  H HZ3  . LYS A 1 70  ? 25.036  -21.101 1.018   1.00 0.00 ? 70  LYS A HZ3  4  
ATOM 7722  N N    . THR A 1 71  ? 19.843  -18.513 5.997   1.00 0.00 ? 71  THR A N    4  
ATOM 7723  C CA   . THR A 1 71  ? 19.549  -17.911 7.291   1.00 0.00 ? 71  THR A CA   4  
ATOM 7724  C C    . THR A 1 71  ? 20.770  -17.943 8.203   1.00 0.00 ? 71  THR A C    4  
ATOM 7725  O O    . THR A 1 71  ? 21.700  -18.726 8.008   1.00 0.00 ? 71  THR A O    4  
ATOM 7726  C CB   . THR A 1 71  ? 18.381  -18.630 7.993   1.00 0.00 ? 71  THR A CB   4  
ATOM 7727  O OG1  . THR A 1 71  ? 18.388  -20.021 7.655   1.00 0.00 ? 71  THR A OG1  4  
ATOM 7728  C CG2  . THR A 1 71  ? 17.048  -18.013 7.594   1.00 0.00 ? 71  THR A CG2  4  
ATOM 7729  H H    . THR A 1 71  ? 20.013  -19.477 5.944   1.00 0.00 ? 71  THR A H    4  
ATOM 7730  H HA   . THR A 1 71  ? 19.263  -16.883 7.124   1.00 0.00 ? 71  THR A HA   4  
ATOM 7731  H HB   . THR A 1 71  ? 18.503  -18.526 9.061   1.00 0.00 ? 71  THR A HB   4  
ATOM 7732  H HG1  . THR A 1 71  ? 17.590  -20.437 7.991   1.00 0.00 ? 71  THR A HG1  4  
ATOM 7733  H HG21 . THR A 1 71  ? 16.944  -18.046 6.519   1.00 0.00 ? 71  THR A HG21 4  
ATOM 7734  H HG22 . THR A 1 71  ? 17.012  -16.987 7.928   1.00 0.00 ? 71  THR A HG22 4  
ATOM 7735  H HG23 . THR A 1 71  ? 16.244  -18.570 8.050   1.00 0.00 ? 71  THR A HG23 4  
ATOM 7736  N N    . PRO A 1 72  ? 20.771  -17.072 9.223   1.00 0.00 ? 72  PRO A N    4  
ATOM 7737  C CA   . PRO A 1 72  ? 21.873  -16.982 10.186  1.00 0.00 ? 72  PRO A CA   4  
ATOM 7738  C C    . PRO A 1 72  ? 21.946  -18.201 11.098  1.00 0.00 ? 72  PRO A C    4  
ATOM 7739  O O    . PRO A 1 72  ? 21.028  -19.020 11.155  1.00 0.00 ? 72  PRO A O    4  
ATOM 7740  C CB   . PRO A 1 72  ? 21.535  -15.727 10.995  1.00 0.00 ? 72  PRO A CB   4  
ATOM 7741  C CG   . PRO A 1 72  ? 20.056  -15.589 10.880  1.00 0.00 ? 72  PRO A CG   4  
ATOM 7742  C CD   . PRO A 1 72  ? 19.697  -16.108 9.515   1.00 0.00 ? 72  PRO A CD   4  
ATOM 7743  H HA   . PRO A 1 72  ? 22.823  -16.847 9.690   1.00 0.00 ? 72  PRO A HA   4  
ATOM 7744  H HB2  . PRO A 1 72  ? 21.841  -15.866 12.023  1.00 0.00 ? 72  PRO A HB2  4  
ATOM 7745  H HB3  . PRO A 1 72  ? 22.045  -14.874 10.574  1.00 0.00 ? 72  PRO A HB3  4  
ATOM 7746  H HG2  . PRO A 1 72  ? 19.571  -16.177 11.644  1.00 0.00 ? 72  PRO A HG2  4  
ATOM 7747  H HG3  . PRO A 1 72  ? 19.776  -14.550 10.970  1.00 0.00 ? 72  PRO A HG3  4  
ATOM 7748  H HD2  . PRO A 1 72  ? 18.735  -16.599 9.539   1.00 0.00 ? 72  PRO A HD2  4  
ATOM 7749  H HD3  . PRO A 1 72  ? 19.695  -15.304 8.794   1.00 0.00 ? 72  PRO A HD3  4  
ATOM 7750  N N    . PRO A 1 73  ? 23.063  -18.327 11.831  1.00 0.00 ? 73  PRO A N    4  
ATOM 7751  C CA   . PRO A 1 73  ? 23.282  -19.443 12.755  1.00 0.00 ? 73  PRO A CA   4  
ATOM 7752  C C    . PRO A 1 73  ? 22.372  -19.371 13.976  1.00 0.00 ? 73  PRO A C    4  
ATOM 7753  O O    . PRO A 1 73  ? 21.456  -18.551 14.032  1.00 0.00 ? 73  PRO A O    4  
ATOM 7754  C CB   . PRO A 1 73  ? 24.746  -19.279 13.169  1.00 0.00 ? 73  PRO A CB   4  
ATOM 7755  C CG   . PRO A 1 73  ? 25.032  -17.829 12.984  1.00 0.00 ? 73  PRO A CG   4  
ATOM 7756  C CD   . PRO A 1 73  ? 24.198  -17.388 11.813  1.00 0.00 ? 73  PRO A CD   4  
ATOM 7757  H HA   . PRO A 1 73  ? 23.149  -20.396 12.264  1.00 0.00 ? 73  PRO A HA   4  
ATOM 7758  H HB2  . PRO A 1 73  ? 24.867  -19.578 14.201  1.00 0.00 ? 73  PRO A HB2  4  
ATOM 7759  H HB3  . PRO A 1 73  ? 25.374  -19.889 12.536  1.00 0.00 ? 73  PRO A HB3  4  
ATOM 7760  H HG2  . PRO A 1 73  ? 24.751  -17.283 13.871  1.00 0.00 ? 73  PRO A HG2  4  
ATOM 7761  H HG3  . PRO A 1 73  ? 26.081  -17.686 12.771  1.00 0.00 ? 73  PRO A HG3  4  
ATOM 7762  H HD2  . PRO A 1 73  ? 23.860  -16.372 11.951  1.00 0.00 ? 73  PRO A HD2  4  
ATOM 7763  H HD3  . PRO A 1 73  ? 24.759  -17.480 10.894  1.00 0.00 ? 73  PRO A HD3  4  
ATOM 7764  N N    . ALA A 1 74  ? 22.631  -20.234 14.953  1.00 0.00 ? 74  ALA A N    4  
ATOM 7765  C CA   . ALA A 1 74  ? 21.837  -20.266 16.175  1.00 0.00 ? 74  ALA A CA   4  
ATOM 7766  C C    . ALA A 1 74  ? 22.641  -19.757 17.366  1.00 0.00 ? 74  ALA A C    4  
ATOM 7767  O O    . ALA A 1 74  ? 22.075  -19.349 18.380  1.00 0.00 ? 74  ALA A O    4  
ATOM 7768  C CB   . ALA A 1 74  ? 21.333  -21.677 16.440  1.00 0.00 ? 74  ALA A CB   4  
ATOM 7769  H H    . ALA A 1 74  ? 23.375  -20.863 14.850  1.00 0.00 ? 74  ALA A H    4  
ATOM 7770  H HA   . ALA A 1 74  ? 20.978  -19.625 16.032  1.00 0.00 ? 74  ALA A HA   4  
ATOM 7771  H HB1  . ALA A 1 74  ? 22.121  -22.261 16.894  1.00 0.00 ? 74  ALA A HB1  4  
ATOM 7772  H HB2  . ALA A 1 74  ? 20.485  -21.637 17.107  1.00 0.00 ? 74  ALA A HB2  4  
ATOM 7773  H HB3  . ALA A 1 74  ? 21.038  -22.135 15.508  1.00 0.00 ? 74  ALA A HB3  4  
ATOM 7774  N N    . SER A 1 75  ? 23.963  -19.784 17.237  1.00 0.00 ? 75  SER A N    4  
ATOM 7775  C CA   . SER A 1 75  ? 24.845  -19.329 18.305  1.00 0.00 ? 75  SER A CA   4  
ATOM 7776  C C    . SER A 1 75  ? 24.641  -17.843 18.583  1.00 0.00 ? 75  SER A C    4  
ATOM 7777  O O    . SER A 1 75  ? 25.051  -17.333 19.625  1.00 0.00 ? 75  SER A O    4  
ATOM 7778  C CB   . SER A 1 75  ? 26.306  -19.595 17.937  1.00 0.00 ? 75  SER A CB   4  
ATOM 7779  O OG   . SER A 1 75  ? 26.508  -20.956 17.600  1.00 0.00 ? 75  SER A OG   4  
ATOM 7780  H H    . SER A 1 75  ? 24.355  -20.121 16.404  1.00 0.00 ? 75  SER A H    4  
ATOM 7781  H HA   . SER A 1 75  ? 24.601  -19.887 19.197  1.00 0.00 ? 75  SER A HA   4  
ATOM 7782  H HB2  . SER A 1 75  ? 26.578  -18.983 17.090  1.00 0.00 ? 75  SER A HB2  4  
ATOM 7783  H HB3  . SER A 1 75  ? 26.938  -19.346 18.778  1.00 0.00 ? 75  SER A HB3  4  
ATOM 7784  H HG   . SER A 1 75  ? 25.886  -21.213 16.916  1.00 0.00 ? 75  SER A HG   4  
ATOM 7785  N N    . TYR A 1 76  ? 24.004  -17.155 17.642  1.00 0.00 ? 76  TYR A N    4  
ATOM 7786  C CA   . TYR A 1 76  ? 23.747  -15.726 17.782  1.00 0.00 ? 76  TYR A CA   4  
ATOM 7787  C C    . TYR A 1 76  ? 22.926  -15.441 19.036  1.00 0.00 ? 76  TYR A C    4  
ATOM 7788  O O    . TYR A 1 76  ? 22.943  -14.329 19.565  1.00 0.00 ? 76  TYR A O    4  
ATOM 7789  C CB   . TYR A 1 76  ? 23.015  -15.195 16.549  1.00 0.00 ? 76  TYR A CB   4  
ATOM 7790  C CG   . TYR A 1 76  ? 22.594  -13.748 16.671  1.00 0.00 ? 76  TYR A CG   4  
ATOM 7791  C CD1  . TYR A 1 76  ? 23.539  -12.737 16.803  1.00 0.00 ? 76  TYR A CD1  4  
ATOM 7792  C CD2  . TYR A 1 76  ? 21.252  -13.391 16.653  1.00 0.00 ? 76  TYR A CD2  4  
ATOM 7793  C CE1  . TYR A 1 76  ? 23.159  -11.414 16.916  1.00 0.00 ? 76  TYR A CE1  4  
ATOM 7794  C CE2  . TYR A 1 76  ? 20.862  -12.070 16.764  1.00 0.00 ? 76  TYR A CE2  4  
ATOM 7795  C CZ   . TYR A 1 76  ? 21.819  -11.086 16.896  1.00 0.00 ? 76  TYR A CZ   4  
ATOM 7796  O OH   . TYR A 1 76  ? 21.436  -9.768  17.006  1.00 0.00 ? 76  TYR A OH   4  
ATOM 7797  H H    . TYR A 1 76  ? 23.702  -17.617 16.833  1.00 0.00 ? 76  TYR A H    4  
ATOM 7798  H HA   . TYR A 1 76  ? 24.700  -15.224 17.868  1.00 0.00 ? 76  TYR A HA   4  
ATOM 7799  H HB2  . TYR A 1 76  ? 23.663  -15.279 15.690  1.00 0.00 ? 76  TYR A HB2  4  
ATOM 7800  H HB3  . TYR A 1 76  ? 22.127  -15.786 16.383  1.00 0.00 ? 76  TYR A HB3  4  
ATOM 7801  H HD1  . TYR A 1 76  ? 24.587  -12.999 16.818  1.00 0.00 ? 76  TYR A HD1  4  
ATOM 7802  H HD2  . TYR A 1 76  ? 20.504  -14.164 16.550  1.00 0.00 ? 76  TYR A HD2  4  
ATOM 7803  H HE1  . TYR A 1 76  ? 23.908  -10.643 17.018  1.00 0.00 ? 76  TYR A HE1  4  
ATOM 7804  H HE2  . TYR A 1 76  ? 19.813  -11.812 16.749  1.00 0.00 ? 76  TYR A HE2  4  
ATOM 7805  H HH   . TYR A 1 76  ? 21.894  -9.246  16.343  1.00 0.00 ? 76  TYR A HH   4  
ATOM 7806  N N    . LEU A 1 77  ? 22.208  -16.455 19.508  1.00 0.00 ? 77  LEU A N    4  
ATOM 7807  C CA   . LEU A 1 77  ? 21.380  -16.316 20.701  1.00 0.00 ? 77  LEU A CA   4  
ATOM 7808  C C    . LEU A 1 77  ? 22.219  -16.466 21.967  1.00 0.00 ? 77  LEU A C    4  
ATOM 7809  O O    . LEU A 1 77  ? 21.788  -16.090 23.057  1.00 0.00 ? 77  LEU A O    4  
ATOM 7810  C CB   . LEU A 1 77  ? 20.259  -17.357 20.692  1.00 0.00 ? 77  LEU A CB   4  
ATOM 7811  C CG   . LEU A 1 77  ? 19.134  -17.121 19.684  1.00 0.00 ? 77  LEU A CG   4  
ATOM 7812  C CD1  . LEU A 1 77  ? 19.569  -17.542 18.289  1.00 0.00 ? 77  LEU A CD1  4  
ATOM 7813  C CD2  . LEU A 1 77  ? 17.878  -17.873 20.102  1.00 0.00 ? 77  LEU A CD2  4  
ATOM 7814  H H    . LEU A 1 77  ? 22.235  -17.317 19.044  1.00 0.00 ? 77  LEU A H    4  
ATOM 7815  H HA   . LEU A 1 77  ? 20.944  -15.328 20.688  1.00 0.00 ? 77  LEU A HA   4  
ATOM 7816  H HB2  . LEU A 1 77  ? 20.701  -18.317 20.475  1.00 0.00 ? 77  LEU A HB2  4  
ATOM 7817  H HB3  . LEU A 1 77  ? 19.821  -17.379 21.680  1.00 0.00 ? 77  LEU A HB3  4  
ATOM 7818  H HG   . LEU A 1 77  ? 18.899  -16.066 19.656  1.00 0.00 ? 77  LEU A HG   4  
ATOM 7819  H HD11 . LEU A 1 77  ? 18.735  -17.456 17.610  1.00 0.00 ? 77  LEU A HD11 4  
ATOM 7820  H HD12 . LEU A 1 77  ? 19.911  -18.566 18.312  1.00 0.00 ? 77  LEU A HD12 4  
ATOM 7821  H HD13 . LEU A 1 77  ? 20.373  -16.902 17.955  1.00 0.00 ? 77  LEU A HD13 4  
ATOM 7822  H HD21 . LEU A 1 77  ? 18.071  -18.935 20.080  1.00 0.00 ? 77  LEU A HD21 4  
ATOM 7823  H HD22 . LEU A 1 77  ? 17.074  -17.639 19.419  1.00 0.00 ? 77  LEU A HD22 4  
ATOM 7824  H HD23 . LEU A 1 77  ? 17.598  -17.578 21.102  1.00 0.00 ? 77  LEU A HD23 4  
ATOM 7825  N N    . ILE A 1 78  ? 23.418  -17.017 21.813  1.00 0.00 ? 78  ILE A N    4  
ATOM 7826  C CA   . ILE A 1 78  ? 24.318  -17.214 22.943  1.00 0.00 ? 78  ILE A CA   4  
ATOM 7827  C C    . ILE A 1 78  ? 24.833  -15.880 23.474  1.00 0.00 ? 78  ILE A C    4  
ATOM 7828  O O    . ILE A 1 78  ? 24.964  -15.691 24.683  1.00 0.00 ? 78  ILE A O    4  
ATOM 7829  C CB   . ILE A 1 78  ? 25.518  -18.099 22.559  1.00 0.00 ? 78  ILE A CB   4  
ATOM 7830  C CG1  . ILE A 1 78  ? 25.037  -19.375 21.865  1.00 0.00 ? 78  ILE A CG1  4  
ATOM 7831  C CG2  . ILE A 1 78  ? 26.342  -18.439 23.793  1.00 0.00 ? 78  ILE A CG2  4  
ATOM 7832  C CD1  . ILE A 1 78  ? 26.163  -20.246 21.354  1.00 0.00 ? 78  ILE A CD1  4  
ATOM 7833  H H    . ILE A 1 78  ? 23.705  -17.297 20.919  1.00 0.00 ? 78  ILE A H    4  
ATOM 7834  H HA   . ILE A 1 78  ? 23.765  -17.711 23.727  1.00 0.00 ? 78  ILE A HA   4  
ATOM 7835  H HB   . ILE A 1 78  ? 26.145  -17.542 21.880  1.00 0.00 ? 78  ILE A HB   4  
ATOM 7836  H HG12 . ILE A 1 78  ? 24.457  -19.960 22.562  1.00 0.00 ? 78  ILE A HG12 4  
ATOM 7837  H HG13 . ILE A 1 78  ? 24.416  -19.105 21.023  1.00 0.00 ? 78  ILE A HG13 4  
ATOM 7838  H HG21 . ILE A 1 78  ? 25.836  -19.204 24.363  1.00 0.00 ? 78  ILE A HG21 4  
ATOM 7839  H HG22 . ILE A 1 78  ? 27.312  -18.800 23.489  1.00 0.00 ? 78  ILE A HG22 4  
ATOM 7840  H HG23 . ILE A 1 78  ? 26.460  -17.555 24.402  1.00 0.00 ? 78  ILE A HG23 4  
ATOM 7841  H HD11 . ILE A 1 78  ? 26.967  -19.621 20.994  1.00 0.00 ? 78  ILE A HD11 4  
ATOM 7842  H HD12 . ILE A 1 78  ? 26.525  -20.874 22.153  1.00 0.00 ? 78  ILE A HD12 4  
ATOM 7843  H HD13 . ILE A 1 78  ? 25.801  -20.865 20.545  1.00 0.00 ? 78  ILE A HD13 4  
ATOM 7844  N N    . ARG A 1 79  ? 25.123  -14.958 22.561  1.00 0.00 ? 79  ARG A N    4  
ATOM 7845  C CA   . ARG A 1 79  ? 25.624  -13.642 22.937  1.00 0.00 ? 79  ARG A CA   4  
ATOM 7846  C C    . ARG A 1 79  ? 24.693  -12.973 23.945  1.00 0.00 ? 79  ARG A C    4  
ATOM 7847  O O    . ARG A 1 79  ? 25.122  -12.150 24.753  1.00 0.00 ? 79  ARG A O    4  
ATOM 7848  C CB   . ARG A 1 79  ? 25.773  -12.756 21.699  1.00 0.00 ? 79  ARG A CB   4  
ATOM 7849  C CG   . ARG A 1 79  ? 27.216  -12.547 21.269  1.00 0.00 ? 79  ARG A CG   4  
ATOM 7850  C CD   . ARG A 1 79  ? 27.399  -11.214 20.562  1.00 0.00 ? 79  ARG A CD   4  
ATOM 7851  N NE   . ARG A 1 79  ? 27.478  -11.370 19.112  1.00 0.00 ? 79  ARG A NE   4  
ATOM 7852  C CZ   . ARG A 1 79  ? 28.577  -11.754 18.473  1.00 0.00 ? 79  ARG A CZ   4  
ATOM 7853  N NH1  . ARG A 1 79  ? 29.684  -12.021 19.152  1.00 0.00 ? 79  ARG A NH1  4  
ATOM 7854  N NH2  . ARG A 1 79  ? 28.570  -11.873 17.151  1.00 0.00 ? 79  ARG A NH2  4  
ATOM 7855  H H    . ARG A 1 79  ? 24.998  -15.169 21.612  1.00 0.00 ? 79  ARG A H    4  
ATOM 7856  H HA   . ARG A 1 79  ? 26.594  -13.773 23.394  1.00 0.00 ? 79  ARG A HA   4  
ATOM 7857  H HB2  . ARG A 1 79  ? 25.239  -13.212 20.878  1.00 0.00 ? 79  ARG A HB2  4  
ATOM 7858  H HB3  . ARG A 1 79  ? 25.339  -11.790 21.908  1.00 0.00 ? 79  ARG A HB3  4  
ATOM 7859  H HG2  . ARG A 1 79  ? 27.849  -12.568 22.144  1.00 0.00 ? 79  ARG A HG2  4  
ATOM 7860  H HG3  . ARG A 1 79  ? 27.500  -13.344 20.598  1.00 0.00 ? 79  ARG A HG3  4  
ATOM 7861  H HD2  . ARG A 1 79  ? 26.560  -10.577 20.800  1.00 0.00 ? 79  ARG A HD2  4  
ATOM 7862  H HD3  . ARG A 1 79  ? 28.310  -10.756 20.916  1.00 0.00 ? 79  ARG A HD3  4  
ATOM 7863  H HE   . ARG A 1 79  ? 26.671  -11.178 18.590  1.00 0.00 ? 79  ARG A HE   4  
ATOM 7864  H HH11 . ARG A 1 79  ? 29.691  -11.934 20.148  1.00 0.00 ? 79  ARG A HH11 4  
ATOM 7865  H HH12 . ARG A 1 79  ? 30.510  -12.312 18.669  1.00 0.00 ? 79  ARG A HH12 4  
ATOM 7866  H HH21 . ARG A 1 79  ? 27.738  -11.673 16.636  1.00 0.00 ? 79  ARG A HH21 4  
ATOM 7867  H HH22 . ARG A 1 79  ? 29.398  -12.162 16.671  1.00 0.00 ? 79  ARG A HH22 4  
ATOM 7868  N N    . LYS A 1 80  ? 23.415  -13.333 23.890  1.00 0.00 ? 80  LYS A N    4  
ATOM 7869  C CA   . LYS A 1 80  ? 22.421  -12.770 24.797  1.00 0.00 ? 80  LYS A CA   4  
ATOM 7870  C C    . LYS A 1 80  ? 22.688  -13.205 26.234  1.00 0.00 ? 80  LYS A C    4  
ATOM 7871  O O    . LYS A 1 80  ? 22.873  -12.372 27.121  1.00 0.00 ? 80  LYS A O    4  
ATOM 7872  C CB   . LYS A 1 80  ? 21.014  -13.199 24.376  1.00 0.00 ? 80  LYS A CB   4  
ATOM 7873  C CG   . LYS A 1 80  ? 19.909  -12.515 25.161  1.00 0.00 ? 80  LYS A CG   4  
ATOM 7874  C CD   . LYS A 1 80  ? 19.538  -13.304 26.405  1.00 0.00 ? 80  LYS A CD   4  
ATOM 7875  C CE   . LYS A 1 80  ? 18.096  -13.785 26.351  1.00 0.00 ? 80  LYS A CE   4  
ATOM 7876  N NZ   . LYS A 1 80  ? 17.578  -14.136 27.702  1.00 0.00 ? 80  LYS A NZ   4  
ATOM 7877  H H    . LYS A 1 80  ? 23.132  -13.995 23.223  1.00 0.00 ? 80  LYS A H    4  
ATOM 7878  H HA   . LYS A 1 80  ? 22.493  -11.694 24.740  1.00 0.00 ? 80  LYS A HA   4  
ATOM 7879  H HB2  . LYS A 1 80  ? 20.879  -12.970 23.329  1.00 0.00 ? 80  LYS A HB2  4  
ATOM 7880  H HB3  . LYS A 1 80  ? 20.919  -14.266 24.516  1.00 0.00 ? 80  LYS A HB3  4  
ATOM 7881  H HG2  . LYS A 1 80  ? 20.245  -11.532 25.457  1.00 0.00 ? 80  LYS A HG2  4  
ATOM 7882  H HG3  . LYS A 1 80  ? 19.036  -12.423 24.530  1.00 0.00 ? 80  LYS A HG3  4  
ATOM 7883  H HD2  . LYS A 1 80  ? 20.189  -14.162 26.484  1.00 0.00 ? 80  LYS A HD2  4  
ATOM 7884  H HD3  . LYS A 1 80  ? 19.666  -12.671 27.273  1.00 0.00 ? 80  LYS A HD3  4  
ATOM 7885  H HE2  . LYS A 1 80  ? 17.484  -13.000 25.933  1.00 0.00 ? 80  LYS A HE2  4  
ATOM 7886  H HE3  . LYS A 1 80  ? 18.045  -14.657 25.717  1.00 0.00 ? 80  LYS A HE3  4  
ATOM 7887  H HZ1  . LYS A 1 80  ? 18.368  -14.249 28.369  1.00 0.00 ? 80  LYS A HZ1  4  
ATOM 7888  H HZ2  . LYS A 1 80  ? 17.045  -15.028 27.660  1.00 0.00 ? 80  LYS A HZ2  4  
ATOM 7889  H HZ3  . LYS A 1 80  ? 16.949  -13.385 28.051  1.00 0.00 ? 80  LYS A HZ3  4  
ATOM 7890  N N    . ALA A 1 81  ? 22.708  -14.515 26.457  1.00 0.00 ? 81  ALA A N    4  
ATOM 7891  C CA   . ALA A 1 81  ? 22.956  -15.061 27.785  1.00 0.00 ? 81  ALA A CA   4  
ATOM 7892  C C    . ALA A 1 81  ? 24.225  -14.473 28.392  1.00 0.00 ? 81  ALA A C    4  
ATOM 7893  O O    . ALA A 1 81  ? 24.167  -13.692 29.342  1.00 0.00 ? 81  ALA A O    4  
ATOM 7894  C CB   . ALA A 1 81  ? 23.053  -16.578 27.723  1.00 0.00 ? 81  ALA A CB   4  
ATOM 7895  H H    . ALA A 1 81  ? 22.554  -15.130 25.709  1.00 0.00 ? 81  ALA A H    4  
ATOM 7896  H HA   . ALA A 1 81  ? 22.116  -14.804 28.414  1.00 0.00 ? 81  ALA A HA   4  
ATOM 7897  H HB1  . ALA A 1 81  ? 22.251  -16.964 27.110  1.00 0.00 ? 81  ALA A HB1  4  
ATOM 7898  H HB2  . ALA A 1 81  ? 24.003  -16.861 27.295  1.00 0.00 ? 81  ALA A HB2  4  
ATOM 7899  H HB3  . ALA A 1 81  ? 22.971  -16.985 28.720  1.00 0.00 ? 81  ALA A HB3  4  
ATOM 7900  N N    . ALA A 1 82  ? 25.372  -14.853 27.839  1.00 0.00 ? 82  ALA A N    4  
ATOM 7901  C CA   . ALA A 1 82  ? 26.655  -14.362 28.325  1.00 0.00 ? 82  ALA A CA   4  
ATOM 7902  C C    . ALA A 1 82  ? 26.704  -12.838 28.304  1.00 0.00 ? 82  ALA A C    4  
ATOM 7903  O O    . ALA A 1 82  ? 27.377  -12.217 29.124  1.00 0.00 ? 82  ALA A O    4  
ATOM 7904  C CB   . ALA A 1 82  ? 27.791  -14.940 27.493  1.00 0.00 ? 82  ALA A CB   4  
ATOM 7905  H H    . ALA A 1 82  ? 25.354  -15.478 27.084  1.00 0.00 ? 82  ALA A H    4  
ATOM 7906  H HA   . ALA A 1 82  ? 26.779  -14.702 29.343  1.00 0.00 ? 82  ALA A HA   4  
ATOM 7907  H HB1  . ALA A 1 82  ? 28.552  -14.186 27.351  1.00 0.00 ? 82  ALA A HB1  4  
ATOM 7908  H HB2  . ALA A 1 82  ? 28.217  -15.789 28.007  1.00 0.00 ? 82  ALA A HB2  4  
ATOM 7909  H HB3  . ALA A 1 82  ? 27.410  -15.253 26.533  1.00 0.00 ? 82  ALA A HB3  4  
ATOM 7910  N N    . GLY A 1 83  ? 25.985  -12.241 27.358  1.00 0.00 ? 83  GLY A N    4  
ATOM 7911  C CA   . GLY A 1 83  ? 25.961  -10.794 27.247  1.00 0.00 ? 83  GLY A CA   4  
ATOM 7912  C C    . GLY A 1 83  ? 27.351  -10.193 27.194  1.00 0.00 ? 83  GLY A C    4  
ATOM 7913  O O    . GLY A 1 83  ? 27.893  -9.770  28.216  1.00 0.00 ? 83  GLY A O    4  
ATOM 7914  H H    . GLY A 1 83  ? 25.467  -12.787 26.730  1.00 0.00 ? 83  GLY A H    4  
ATOM 7915  H HA2  . GLY A 1 83  ? 25.427  -10.521 26.349  1.00 0.00 ? 83  GLY A HA2  4  
ATOM 7916  H HA3  . GLY A 1 83  ? 25.438  -10.388 28.101  1.00 0.00 ? 83  GLY A HA3  4  
ATOM 7917  N N    . LEU A 1 84  ? 27.932  -10.156 26.000  1.00 0.00 ? 84  LEU A N    4  
ATOM 7918  C CA   . LEU A 1 84  ? 29.270  -9.604  25.817  1.00 0.00 ? 84  LEU A CA   4  
ATOM 7919  C C    . LEU A 1 84  ? 29.204  -8.124  25.453  1.00 0.00 ? 84  LEU A C    4  
ATOM 7920  O O    . LEU A 1 84  ? 28.716  -7.760  24.384  1.00 0.00 ? 84  LEU A O    4  
ATOM 7921  C CB   . LEU A 1 84  ? 30.017  -10.375 24.727  1.00 0.00 ? 84  LEU A CB   4  
ATOM 7922  C CG   . LEU A 1 84  ? 29.793  -11.888 24.702  1.00 0.00 ? 84  LEU A CG   4  
ATOM 7923  C CD1  . LEU A 1 84  ? 30.684  -12.542 23.657  1.00 0.00 ? 84  LEU A CD1  4  
ATOM 7924  C CD2  . LEU A 1 84  ? 30.051  -12.488 26.076  1.00 0.00 ? 84  LEU A CD2  4  
ATOM 7925  H H    . LEU A 1 84  ? 27.451  -10.508 25.222  1.00 0.00 ? 84  LEU A H    4  
ATOM 7926  H HA   . LEU A 1 84  ? 29.803  -9.710  26.750  1.00 0.00 ? 84  LEU A HA   4  
ATOM 7927  H HB2  . LEU A 1 84  ? 29.708  -9.980  23.771  1.00 0.00 ? 84  LEU A HB2  4  
ATOM 7928  H HB3  . LEU A 1 84  ? 31.074  -10.198 24.863  1.00 0.00 ? 84  LEU A HB3  4  
ATOM 7929  H HG   . LEU A 1 84  ? 28.765  -12.089 24.436  1.00 0.00 ? 84  LEU A HG   4  
ATOM 7930  H HD11 . LEU A 1 84  ? 30.703  -11.932 22.767  1.00 0.00 ? 84  LEU A HD11 4  
ATOM 7931  H HD12 . LEU A 1 84  ? 30.296  -13.520 23.415  1.00 0.00 ? 84  LEU A HD12 4  
ATOM 7932  H HD13 . LEU A 1 84  ? 31.686  -12.639 24.049  1.00 0.00 ? 84  LEU A HD13 4  
ATOM 7933  H HD21 . LEU A 1 84  ? 30.250  -13.544 25.976  1.00 0.00 ? 84  LEU A HD21 4  
ATOM 7934  H HD22 . LEU A 1 84  ? 29.181  -12.343 26.701  1.00 0.00 ? 84  LEU A HD22 4  
ATOM 7935  H HD23 . LEU A 1 84  ? 30.904  -12.002 26.527  1.00 0.00 ? 84  LEU A HD23 4  
ATOM 7936  N N    . GLU A 1 85  ? 29.699  -7.277  26.350  1.00 0.00 ? 85  GLU A N    4  
ATOM 7937  C CA   . GLU A 1 85  ? 29.697  -5.837  26.122  1.00 0.00 ? 85  GLU A CA   4  
ATOM 7938  C C    . GLU A 1 85  ? 31.113  -5.274  26.185  1.00 0.00 ? 85  GLU A C    4  
ATOM 7939  O O    . GLU A 1 85  ? 31.458  -4.345  25.454  1.00 0.00 ? 85  GLU A O    4  
ATOM 7940  C CB   . GLU A 1 85  ? 28.811  -5.136  27.155  1.00 0.00 ? 85  GLU A CB   4  
ATOM 7941  C CG   . GLU A 1 85  ? 27.349  -5.543  27.079  1.00 0.00 ? 85  GLU A CG   4  
ATOM 7942  C CD   . GLU A 1 85  ? 26.686  -5.593  28.442  1.00 0.00 ? 85  GLU A CD   4  
ATOM 7943  O OE1  . GLU A 1 85  ? 26.933  -4.679  29.256  1.00 0.00 ? 85  GLU A OE1  4  
ATOM 7944  O OE2  . GLU A 1 85  ? 25.919  -6.546  28.693  1.00 0.00 ? 85  GLU A OE2  4  
ATOM 7945  H H    . GLU A 1 85  ? 30.075  -7.629  27.184  1.00 0.00 ? 85  GLU A H    4  
ATOM 7946  H HA   . GLU A 1 85  ? 29.295  -5.658  25.137  1.00 0.00 ? 85  GLU A HA   4  
ATOM 7947  H HB2  . GLU A 1 85  ? 29.178  -5.370  28.144  1.00 0.00 ? 85  GLU A HB2  4  
ATOM 7948  H HB3  . GLU A 1 85  ? 28.875  -4.069  27.000  1.00 0.00 ? 85  GLU A HB3  4  
ATOM 7949  H HG2  . GLU A 1 85  ? 26.821  -4.828  26.465  1.00 0.00 ? 85  GLU A HG2  4  
ATOM 7950  H HG3  . GLU A 1 85  ? 27.284  -6.522  26.627  1.00 0.00 ? 85  GLU A HG3  4  
ATOM 7951  N N    . LYS A 1 86  ? 31.931  -5.842  27.065  1.00 0.00 ? 86  LYS A N    4  
ATOM 7952  C CA   . LYS A 1 86  ? 33.311  -5.399  27.225  1.00 0.00 ? 86  LYS A CA   4  
ATOM 7953  C C    . LYS A 1 86  ? 33.393  -3.876  27.260  1.00 0.00 ? 86  LYS A C    4  
ATOM 7954  O O    . LYS A 1 86  ? 32.390  -3.196  27.468  1.00 0.00 ? 86  LYS A O    4  
ATOM 7955  C CB   . LYS A 1 86  ? 34.178  -5.940  26.085  1.00 0.00 ? 86  LYS A CB   4  
ATOM 7956  C CG   . LYS A 1 86  ? 33.917  -5.265  24.750  1.00 0.00 ? 86  LYS A CG   4  
ATOM 7957  C CD   . LYS A 1 86  ? 35.025  -5.558  23.752  1.00 0.00 ? 86  LYS A CD   4  
ATOM 7958  C CE   . LYS A 1 86  ? 35.794  -4.297  23.387  1.00 0.00 ? 86  LYS A CE   4  
ATOM 7959  N NZ   . LYS A 1 86  ? 37.039  -4.153  24.191  1.00 0.00 ? 86  LYS A NZ   4  
ATOM 7960  H H    . LYS A 1 86  ? 31.598  -6.579  27.620  1.00 0.00 ? 86  LYS A H    4  
ATOM 7961  H HA   . LYS A 1 86  ? 33.679  -5.790  28.162  1.00 0.00 ? 86  LYS A HA   4  
ATOM 7962  H HB2  . LYS A 1 86  ? 35.217  -5.798  26.340  1.00 0.00 ? 86  LYS A HB2  4  
ATOM 7963  H HB3  . LYS A 1 86  ? 33.985  -6.998  25.974  1.00 0.00 ? 86  LYS A HB3  4  
ATOM 7964  H HG2  . LYS A 1 86  ? 32.982  -5.628  24.349  1.00 0.00 ? 86  LYS A HG2  4  
ATOM 7965  H HG3  . LYS A 1 86  ? 33.856  -4.197  24.903  1.00 0.00 ? 86  LYS A HG3  4  
ATOM 7966  H HD2  . LYS A 1 86  ? 35.711  -6.270  24.186  1.00 0.00 ? 86  LYS A HD2  4  
ATOM 7967  H HD3  . LYS A 1 86  ? 34.589  -5.976  22.855  1.00 0.00 ? 86  LYS A HD3  4  
ATOM 7968  H HE2  . LYS A 1 86  ? 36.054  -4.340  22.340  1.00 0.00 ? 86  LYS A HE2  4  
ATOM 7969  H HE3  . LYS A 1 86  ? 35.160  -3.441  23.564  1.00 0.00 ? 86  LYS A HE3  4  
ATOM 7970  H HZ1  . LYS A 1 86  ? 37.026  -3.252  24.710  1.00 0.00 ? 86  LYS A HZ1  4  
ATOM 7971  H HZ2  . LYS A 1 86  ? 37.871  -4.170  23.567  1.00 0.00 ? 86  LYS A HZ2  4  
ATOM 7972  H HZ3  . LYS A 1 86  ? 37.115  -4.934  24.874  1.00 0.00 ? 86  LYS A HZ3  4  
ATOM 7973  N N    . GLY A 1 87  ? 34.596  -3.348  27.055  1.00 0.00 ? 87  GLY A N    4  
ATOM 7974  C CA   . GLY A 1 87  ? 34.785  -1.909  27.066  1.00 0.00 ? 87  GLY A CA   4  
ATOM 7975  C C    . GLY A 1 87  ? 35.594  -1.440  28.260  1.00 0.00 ? 87  GLY A C    4  
ATOM 7976  O O    . GLY A 1 87  ? 36.189  -0.364  28.231  1.00 0.00 ? 87  GLY A O    4  
ATOM 7977  H H    . GLY A 1 87  ? 35.360  -3.940  26.894  1.00 0.00 ? 87  GLY A H    4  
ATOM 7978  H HA2  . GLY A 1 87  ? 35.297  -1.617  26.161  1.00 0.00 ? 87  GLY A HA2  4  
ATOM 7979  H HA3  . GLY A 1 87  ? 33.818  -1.430  27.091  1.00 0.00 ? 87  GLY A HA3  4  
ATOM 7980  N N    . ALA A 1 88  ? 35.613  -2.250  29.314  1.00 0.00 ? 88  ALA A N    4  
ATOM 7981  C CA   . ALA A 1 88  ? 36.354  -1.912  30.523  1.00 0.00 ? 88  ALA A CA   4  
ATOM 7982  C C    . ALA A 1 88  ? 37.785  -2.433  30.453  1.00 0.00 ? 88  ALA A C    4  
ATOM 7983  O O    . ALA A 1 88  ? 38.081  -3.367  29.707  1.00 0.00 ? 88  ALA A O    4  
ATOM 7984  C CB   . ALA A 1 88  ? 35.646  -2.470  31.749  1.00 0.00 ? 88  ALA A CB   4  
ATOM 7985  H H    . ALA A 1 88  ? 35.118  -3.094  29.277  1.00 0.00 ? 88  ALA A H    4  
ATOM 7986  H HA   . ALA A 1 88  ? 36.377  -0.835  30.610  1.00 0.00 ? 88  ALA A HA   4  
ATOM 7987  H HB1  . ALA A 1 88  ? 36.365  -2.969  32.382  1.00 0.00 ? 88  ALA A HB1  4  
ATOM 7988  H HB2  . ALA A 1 88  ? 35.183  -1.662  32.296  1.00 0.00 ? 88  ALA A HB2  4  
ATOM 7989  H HB3  . ALA A 1 88  ? 34.890  -3.175  31.438  1.00 0.00 ? 88  ALA A HB3  4  
ATOM 7990  N N    . HIS A 1 89  ? 38.671  -1.824  31.235  1.00 0.00 ? 89  HIS A N    4  
ATOM 7991  C CA   . HIS A 1 89  ? 40.073  -2.227  31.261  1.00 0.00 ? 89  HIS A CA   4  
ATOM 7992  C C    . HIS A 1 89  ? 40.288  -3.378  32.239  1.00 0.00 ? 89  HIS A C    4  
ATOM 7993  O O    . HIS A 1 89  ? 40.254  -3.189  33.455  1.00 0.00 ? 89  HIS A O    4  
ATOM 7994  C CB   . HIS A 1 89  ? 40.959  -1.042  31.646  1.00 0.00 ? 89  HIS A CB   4  
ATOM 7995  C CG   . HIS A 1 89  ? 42.342  -1.118  31.077  1.00 0.00 ? 89  HIS A CG   4  
ATOM 7996  N ND1  . HIS A 1 89  ? 43.032  -0.012  30.626  1.00 0.00 ? 89  HIS A ND1  4  
ATOM 7997  C CD2  . HIS A 1 89  ? 43.164  -2.176  30.887  1.00 0.00 ? 89  HIS A CD2  4  
ATOM 7998  C CE1  . HIS A 1 89  ? 44.218  -0.388  30.182  1.00 0.00 ? 89  HIS A CE1  4  
ATOM 7999  N NE2  . HIS A 1 89  ? 44.324  -1.696  30.330  1.00 0.00 ? 89  HIS A NE2  4  
ATOM 8000  H H    . HIS A 1 89  ? 38.375  -1.086  31.807  1.00 0.00 ? 89  HIS A H    4  
ATOM 8001  H HA   . HIS A 1 89  ? 40.341  -2.558  30.269  1.00 0.00 ? 89  HIS A HA   4  
ATOM 8002  H HB2  . HIS A 1 89  ? 40.503  -0.129  31.290  1.00 0.00 ? 89  HIS A HB2  4  
ATOM 8003  H HB3  . HIS A 1 89  ? 41.044  -1.000  32.723  1.00 0.00 ? 89  HIS A HB3  4  
ATOM 8004  H HD1  . HIS A 1 89  ? 42.701  0.910   30.630  1.00 0.00 ? 89  HIS A HD1  4  
ATOM 8005  H HD2  . HIS A 1 89  ? 42.949  -3.208  31.128  1.00 0.00 ? 89  HIS A HD2  4  
ATOM 8006  H HE1  . HIS A 1 89  ? 44.974  0.264   29.770  1.00 0.00 ? 89  HIS A HE1  4  
ATOM 8007  N N    . LYS A 1 90  ? 40.510  -4.572  31.699  1.00 0.00 ? 90  LYS A N    4  
ATOM 8008  C CA   . LYS A 1 90  ? 40.732  -5.754  32.523  1.00 0.00 ? 90  LYS A CA   4  
ATOM 8009  C C    . LYS A 1 90  ? 41.820  -6.639  31.923  1.00 0.00 ? 90  LYS A C    4  
ATOM 8010  O O    . LYS A 1 90  ? 42.147  -6.546  30.739  1.00 0.00 ? 90  LYS A O    4  
ATOM 8011  C CB   . LYS A 1 90  ? 39.434  -6.552  32.667  1.00 0.00 ? 90  LYS A CB   4  
ATOM 8012  C CG   . LYS A 1 90  ? 38.792  -6.426  34.039  1.00 0.00 ? 90  LYS A CG   4  
ATOM 8013  C CD   . LYS A 1 90  ? 37.488  -5.649  33.975  1.00 0.00 ? 90  LYS A CD   4  
ATOM 8014  C CE   . LYS A 1 90  ? 37.085  -5.125  35.345  1.00 0.00 ? 90  LYS A CE   4  
ATOM 8015  N NZ   . LYS A 1 90  ? 35.607  -5.137  35.530  1.00 0.00 ? 90  LYS A NZ   4  
ATOM 8016  H H    . LYS A 1 90  ? 40.525  -4.660  30.723  1.00 0.00 ? 90  LYS A H    4  
ATOM 8017  H HA   . LYS A 1 90  ? 41.052  -5.424  33.499  1.00 0.00 ? 90  LYS A HA   4  
ATOM 8018  H HB2  . LYS A 1 90  ? 38.727  -6.203  31.929  1.00 0.00 ? 90  LYS A HB2  4  
ATOM 8019  H HB3  . LYS A 1 90  ? 39.644  -7.596  32.486  1.00 0.00 ? 90  LYS A HB3  4  
ATOM 8020  H HG2  . LYS A 1 90  ? 38.591  -7.415  34.424  1.00 0.00 ? 90  LYS A HG2  4  
ATOM 8021  H HG3  . LYS A 1 90  ? 39.475  -5.912  34.700  1.00 0.00 ? 90  LYS A HG3  4  
ATOM 8022  H HD2  . LYS A 1 90  ? 37.609  -4.813  33.303  1.00 0.00 ? 90  LYS A HD2  4  
ATOM 8023  H HD3  . LYS A 1 90  ? 36.709  -6.301  33.605  1.00 0.00 ? 90  LYS A HD3  4  
ATOM 8024  H HE2  . LYS A 1 90  ? 37.539  -5.746  36.102  1.00 0.00 ? 90  LYS A HE2  4  
ATOM 8025  H HE3  . LYS A 1 90  ? 37.444  -4.111  35.447  1.00 0.00 ? 90  LYS A HE3  4  
ATOM 8026  H HZ1  . LYS A 1 90  ? 35.172  -4.368  34.981  1.00 0.00 ? 90  LYS A HZ1  4  
ATOM 8027  H HZ2  . LYS A 1 90  ? 35.372  -5.005  36.535  1.00 0.00 ? 90  LYS A HZ2  4  
ATOM 8028  H HZ3  . LYS A 1 90  ? 35.214  -6.044  35.209  1.00 0.00 ? 90  LYS A HZ3  4  
ATOM 8029  N N    . PRO A 1 91  ? 42.394  -7.520  32.755  1.00 0.00 ? 91  PRO A N    4  
ATOM 8030  C CA   . PRO A 1 91  ? 43.452  -8.440  32.328  1.00 0.00 ? 91  PRO A CA   4  
ATOM 8031  C C    . PRO A 1 91  ? 42.935  -9.520  31.384  1.00 0.00 ? 91  PRO A C    4  
ATOM 8032  O O    . PRO A 1 91  ? 41.746  -9.837  31.379  1.00 0.00 ? 91  PRO A O    4  
ATOM 8033  C CB   . PRO A 1 91  ? 43.934  -9.062  33.641  1.00 0.00 ? 91  PRO A CB   4  
ATOM 8034  C CG   . PRO A 1 91  ? 42.767  -8.953  34.561  1.00 0.00 ? 91  PRO A CG   4  
ATOM 8035  C CD   . PRO A 1 91  ? 42.054  -7.686  34.178  1.00 0.00 ? 91  PRO A CD   4  
ATOM 8036  H HA   . PRO A 1 91  ? 44.269  -7.913  31.856  1.00 0.00 ? 91  PRO A HA   4  
ATOM 8037  H HB2  . PRO A 1 91  ? 44.211  -10.093 33.473  1.00 0.00 ? 91  PRO A HB2  4  
ATOM 8038  H HB3  . PRO A 1 91  ? 44.783  -8.511  34.014  1.00 0.00 ? 91  PRO A HB3  4  
ATOM 8039  H HG2  . PRO A 1 91  ? 42.116  -9.804  34.431  1.00 0.00 ? 91  PRO A HG2  4  
ATOM 8040  H HG3  . PRO A 1 91  ? 43.111  -8.896  35.583  1.00 0.00 ? 91  PRO A HG3  4  
ATOM 8041  H HD2  . PRO A 1 91  ? 40.988  -7.799  34.310  1.00 0.00 ? 91  PRO A HD2  4  
ATOM 8042  H HD3  . PRO A 1 91  ? 42.422  -6.855  34.762  1.00 0.00 ? 91  PRO A HD3  4  
ATOM 8043  N N    . GLY A 1 92  ? 43.837  -10.084 30.586  1.00 0.00 ? 92  GLY A N    4  
ATOM 8044  C CA   . GLY A 1 92  ? 43.451  -11.124 29.650  1.00 0.00 ? 92  GLY A CA   4  
ATOM 8045  C C    . GLY A 1 92  ? 43.226  -12.460 30.328  1.00 0.00 ? 92  GLY A C    4  
ATOM 8046  O O    . GLY A 1 92  ? 42.844  -12.514 31.497  1.00 0.00 ? 92  GLY A O    4  
ATOM 8047  H H    . GLY A 1 92  ? 44.771  -9.792  30.634  1.00 0.00 ? 92  GLY A H    4  
ATOM 8048  H HA2  . GLY A 1 92  ? 42.541  -10.826 29.152  1.00 0.00 ? 92  GLY A HA2  4  
ATOM 8049  H HA3  . GLY A 1 92  ? 44.233  -11.235 28.912  1.00 0.00 ? 92  GLY A HA3  4  
ATOM 8050  N N    . ARG A 1 93  ? 43.460  -13.542 29.593  1.00 0.00 ? 93  ARG A N    4  
ATOM 8051  C CA   . ARG A 1 93  ? 43.277  -14.885 30.130  1.00 0.00 ? 93  ARG A CA   4  
ATOM 8052  C C    . ARG A 1 93  ? 41.858  -15.070 30.661  1.00 0.00 ? 93  ARG A C    4  
ATOM 8053  O O    . ARG A 1 93  ? 41.019  -14.179 30.537  1.00 0.00 ? 93  ARG A O    4  
ATOM 8054  C CB   . ARG A 1 93  ? 44.289  -15.155 31.244  1.00 0.00 ? 93  ARG A CB   4  
ATOM 8055  C CG   . ARG A 1 93  ? 45.721  -15.281 30.750  1.00 0.00 ? 93  ARG A CG   4  
ATOM 8056  C CD   . ARG A 1 93  ? 46.469  -13.962 30.867  1.00 0.00 ? 93  ARG A CD   4  
ATOM 8057  N NE   . ARG A 1 93  ? 47.234  -13.876 32.109  1.00 0.00 ? 93  ARG A NE   4  
ATOM 8058  C CZ   . ARG A 1 93  ? 48.389  -14.500 32.306  1.00 0.00 ? 93  ARG A CZ   4  
ATOM 8059  N NH1  . ARG A 1 93  ? 48.911  -15.253 31.347  1.00 0.00 ? 93  ARG A NH1  4  
ATOM 8060  N NH2  . ARG A 1 93  ? 49.025  -14.373 33.463  1.00 0.00 ? 93  ARG A NH2  4  
ATOM 8061  H H    . ARG A 1 93  ? 43.763  -13.435 28.667  1.00 0.00 ? 93  ARG A H    4  
ATOM 8062  H HA   . ARG A 1 93  ? 43.443  -15.589 29.328  1.00 0.00 ? 93  ARG A HA   4  
ATOM 8063  H HB2  . ARG A 1 93  ? 44.248  -14.343 31.956  1.00 0.00 ? 93  ARG A HB2  4  
ATOM 8064  H HB3  . ARG A 1 93  ? 44.021  -16.074 31.743  1.00 0.00 ? 93  ARG A HB3  4  
ATOM 8065  H HG2  . ARG A 1 93  ? 46.232  -16.026 31.341  1.00 0.00 ? 93  ARG A HG2  4  
ATOM 8066  H HG3  . ARG A 1 93  ? 45.708  -15.587 29.714  1.00 0.00 ? 93  ARG A HG3  4  
ATOM 8067  H HD2  . ARG A 1 93  ? 47.148  -13.873 30.032  1.00 0.00 ? 93  ARG A HD2  4  
ATOM 8068  H HD3  . ARG A 1 93  ? 45.754  -13.154 30.838  1.00 0.00 ? 93  ARG A HD3  4  
ATOM 8069  H HE   . ARG A 1 93  ? 46.866  -13.325 32.831  1.00 0.00 ? 93  ARG A HE   4  
ATOM 8070  H HH11 . ARG A 1 93  ? 48.435  -15.350 30.474  1.00 0.00 ? 93  ARG A HH11 4  
ATOM 8071  H HH12 . ARG A 1 93  ? 49.782  -15.721 31.497  1.00 0.00 ? 93  ARG A HH12 4  
ATOM 8072  H HH21 . ARG A 1 93  ? 48.635  -13.806 34.188  1.00 0.00 ? 93  ARG A HH21 4  
ATOM 8073  H HH22 . ARG A 1 93  ? 49.895  -14.843 33.610  1.00 0.00 ? 93  ARG A HH22 4  
ATOM 8074  N N    . GLU A 1 94  ? 41.599  -16.232 31.252  1.00 0.00 ? 94  GLU A N    4  
ATOM 8075  C CA   . GLU A 1 94  ? 40.282  -16.533 31.800  1.00 0.00 ? 94  GLU A CA   4  
ATOM 8076  C C    . GLU A 1 94  ? 39.227  -16.559 30.698  1.00 0.00 ? 94  GLU A C    4  
ATOM 8077  O O    . GLU A 1 94  ? 39.551  -16.518 29.511  1.00 0.00 ? 94  GLU A O    4  
ATOM 8078  C CB   . GLU A 1 94  ? 39.900  -15.501 32.863  1.00 0.00 ? 94  GLU A CB   4  
ATOM 8079  C CG   . GLU A 1 94  ? 39.502  -16.117 34.194  1.00 0.00 ? 94  GLU A CG   4  
ATOM 8080  C CD   . GLU A 1 94  ? 40.695  -16.393 35.089  1.00 0.00 ? 94  GLU A CD   4  
ATOM 8081  O OE1  . GLU A 1 94  ? 41.498  -15.462 35.310  1.00 0.00 ? 94  GLU A OE1  4  
ATOM 8082  O OE2  . GLU A 1 94  ? 40.826  -17.539 35.567  1.00 0.00 ? 94  GLU A OE2  4  
ATOM 8083  H H    . GLU A 1 94  ? 42.310  -16.903 31.320  1.00 0.00 ? 94  GLU A H    4  
ATOM 8084  H HA   . GLU A 1 94  ? 40.329  -17.509 32.259  1.00 0.00 ? 94  GLU A HA   4  
ATOM 8085  H HB2  . GLU A 1 94  ? 40.742  -14.845 33.030  1.00 0.00 ? 94  GLU A HB2  4  
ATOM 8086  H HB3  . GLU A 1 94  ? 39.068  -14.917 32.498  1.00 0.00 ? 94  GLU A HB3  4  
ATOM 8087  H HG2  . GLU A 1 94  ? 38.837  -15.437 34.706  1.00 0.00 ? 94  GLU A HG2  4  
ATOM 8088  H HG3  . GLU A 1 94  ? 38.988  -17.048 34.006  1.00 0.00 ? 94  GLU A HG3  4  
ATOM 8089  N N    . LYS A 1 95  ? 37.962  -16.627 31.099  1.00 0.00 ? 95  LYS A N    4  
ATOM 8090  C CA   . LYS A 1 95  ? 36.858  -16.658 30.148  1.00 0.00 ? 95  LYS A CA   4  
ATOM 8091  C C    . LYS A 1 95  ? 35.723  -15.745 30.603  1.00 0.00 ? 95  LYS A C    4  
ATOM 8092  O O    . LYS A 1 95  ? 35.465  -15.607 31.798  1.00 0.00 ? 95  LYS A O    4  
ATOM 8093  C CB   . LYS A 1 95  ? 36.341  -18.088 29.982  1.00 0.00 ? 95  LYS A CB   4  
ATOM 8094  C CG   . LYS A 1 95  ? 37.197  -18.942 29.063  1.00 0.00 ? 95  LYS A CG   4  
ATOM 8095  C CD   . LYS A 1 95  ? 38.028  -19.944 29.846  1.00 0.00 ? 95  LYS A CD   4  
ATOM 8096  C CE   . LYS A 1 95  ? 39.470  -19.971 29.363  1.00 0.00 ? 95  LYS A CE   4  
ATOM 8097  N NZ   . LYS A 1 95  ? 40.358  -20.707 30.306  1.00 0.00 ? 95  LYS A NZ   4  
ATOM 8098  H H    . LYS A 1 95  ? 37.767  -16.657 32.060  1.00 0.00 ? 95  LYS A H    4  
ATOM 8099  H HA   . LYS A 1 95  ? 37.228  -16.305 29.198  1.00 0.00 ? 95  LYS A HA   4  
ATOM 8100  H HB2  . LYS A 1 95  ? 36.308  -18.562 30.952  1.00 0.00 ? 95  LYS A HB2  4  
ATOM 8101  H HB3  . LYS A 1 95  ? 35.340  -18.052 29.575  1.00 0.00 ? 95  LYS A HB3  4  
ATOM 8102  H HG2  . LYS A 1 95  ? 36.554  -19.479 28.381  1.00 0.00 ? 95  LYS A HG2  4  
ATOM 8103  H HG3  . LYS A 1 95  ? 37.860  -18.297 28.503  1.00 0.00 ? 95  LYS A HG3  4  
ATOM 8104  H HD2  . LYS A 1 95  ? 38.016  -19.670 30.891  1.00 0.00 ? 95  LYS A HD2  4  
ATOM 8105  H HD3  . LYS A 1 95  ? 37.598  -20.928 29.725  1.00 0.00 ? 95  LYS A HD3  4  
ATOM 8106  H HE2  . LYS A 1 95  ? 39.504  -20.456 28.399  1.00 0.00 ? 95  LYS A HE2  4  
ATOM 8107  H HE3  . LYS A 1 95  ? 39.823  -18.955 29.268  1.00 0.00 ? 95  LYS A HE3  4  
ATOM 8108  H HZ1  . LYS A 1 95  ? 40.552  -21.662 29.942  1.00 0.00 ? 95  LYS A HZ1  4  
ATOM 8109  H HZ2  . LYS A 1 95  ? 39.900  -20.789 31.236  1.00 0.00 ? 95  LYS A HZ2  4  
ATOM 8110  H HZ3  . LYS A 1 95  ? 41.259  -20.200 30.418  1.00 0.00 ? 95  LYS A HZ3  4  
ATOM 8111  N N    . VAL A 1 96  ? 35.046  -15.126 29.641  1.00 0.00 ? 96  VAL A N    4  
ATOM 8112  C CA   . VAL A 1 96  ? 33.937  -14.229 29.942  1.00 0.00 ? 96  VAL A CA   4  
ATOM 8113  C C    . VAL A 1 96  ? 32.662  -14.675 29.236  1.00 0.00 ? 96  VAL A C    4  
ATOM 8114  O O    . VAL A 1 96  ? 32.702  -15.154 28.103  1.00 0.00 ? 96  VAL A O    4  
ATOM 8115  C CB   . VAL A 1 96  ? 34.259  -12.780 29.529  1.00 0.00 ? 96  VAL A CB   4  
ATOM 8116  C CG1  . VAL A 1 96  ? 33.128  -11.846 29.934  1.00 0.00 ? 96  VAL A CG1  4  
ATOM 8117  C CG2  . VAL A 1 96  ? 35.577  -12.332 30.143  1.00 0.00 ? 96  VAL A CG2  4  
ATOM 8118  H H    . VAL A 1 96  ? 35.299  -15.276 28.706  1.00 0.00 ? 96  VAL A H    4  
ATOM 8119  H HA   . VAL A 1 96  ? 33.772  -14.248 31.010  1.00 0.00 ? 96  VAL A HA   4  
ATOM 8120  H HB   . VAL A 1 96  ? 34.357  -12.747 28.454  1.00 0.00 ? 96  VAL A HB   4  
ATOM 8121  H HG11 . VAL A 1 96  ? 33.525  -10.857 30.112  1.00 0.00 ? 96  VAL A HG11 4  
ATOM 8122  H HG12 . VAL A 1 96  ? 32.395  -11.803 29.141  1.00 0.00 ? 96  VAL A HG12 4  
ATOM 8123  H HG13 . VAL A 1 96  ? 32.663  -12.214 30.836  1.00 0.00 ? 96  VAL A HG13 4  
ATOM 8124  H HG21 . VAL A 1 96  ? 36.392  -12.849 29.659  1.00 0.00 ? 96  VAL A HG21 4  
ATOM 8125  H HG22 . VAL A 1 96  ? 35.695  -11.267 30.005  1.00 0.00 ? 96  VAL A HG22 4  
ATOM 8126  H HG23 . VAL A 1 96  ? 35.580  -12.561 31.198  1.00 0.00 ? 96  VAL A HG23 4  
ATOM 8127  N N    . GLY A 1 97  ? 31.529  -14.515 29.914  1.00 0.00 ? 97  GLY A N    4  
ATOM 8128  C CA   . GLY A 1 97  ? 30.257  -14.906 29.336  1.00 0.00 ? 97  GLY A CA   4  
ATOM 8129  C C    . GLY A 1 97  ? 29.313  -15.501 30.362  1.00 0.00 ? 97  GLY A C    4  
ATOM 8130  O O    . GLY A 1 97  ? 28.455  -14.803 30.904  1.00 0.00 ? 97  GLY A O    4  
ATOM 8131  H H    . GLY A 1 97  ? 31.558  -14.128 30.814  1.00 0.00 ? 97  GLY A H    4  
ATOM 8132  H HA2  . GLY A 1 97  ? 29.792  -14.037 28.895  1.00 0.00 ? 97  GLY A HA2  4  
ATOM 8133  H HA3  . GLY A 1 97  ? 30.436  -15.639 28.563  1.00 0.00 ? 97  GLY A HA3  4  
ATOM 8134  N N    . ARG A 1 98  ? 29.468  -16.793 30.629  1.00 0.00 ? 98  ARG A N    4  
ATOM 8135  C CA   . ARG A 1 98  ? 28.620  -17.482 31.595  1.00 0.00 ? 98  ARG A CA   4  
ATOM 8136  C C    . ARG A 1 98  ? 27.182  -17.565 31.093  1.00 0.00 ? 98  ARG A C    4  
ATOM 8137  O O    . ARG A 1 98  ? 26.621  -16.576 30.619  1.00 0.00 ? 98  ARG A O    4  
ATOM 8138  C CB   . ARG A 1 98  ? 28.660  -16.763 32.944  1.00 0.00 ? 98  ARG A CB   4  
ATOM 8139  C CG   . ARG A 1 98  ? 29.030  -17.669 34.107  1.00 0.00 ? 98  ARG A CG   4  
ATOM 8140  C CD   . ARG A 1 98  ? 27.864  -18.556 34.515  1.00 0.00 ? 98  ARG A CD   4  
ATOM 8141  N NE   . ARG A 1 98  ? 26.725  -17.776 34.993  1.00 0.00 ? 98  ARG A NE   4  
ATOM 8142  C CZ   . ARG A 1 98  ? 25.760  -18.277 35.756  1.00 0.00 ? 98  ARG A CZ   4  
ATOM 8143  N NH1  . ARG A 1 98  ? 25.797  -19.550 36.127  1.00 0.00 ? 98  ARG A NH1  4  
ATOM 8144  N NH2  . ARG A 1 98  ? 24.756  -17.505 36.151  1.00 0.00 ? 98  ARG A NH2  4  
ATOM 8145  H H    . ARG A 1 98  ? 30.170  -17.296 30.165  1.00 0.00 ? 98  ARG A H    4  
ATOM 8146  H HA   . ARG A 1 98  ? 29.004  -18.483 31.719  1.00 0.00 ? 98  ARG A HA   4  
ATOM 8147  H HB2  . ARG A 1 98  ? 29.387  -15.965 32.893  1.00 0.00 ? 98  ARG A HB2  4  
ATOM 8148  H HB3  . ARG A 1 98  ? 27.687  -16.340 33.142  1.00 0.00 ? 98  ARG A HB3  4  
ATOM 8149  H HG2  . ARG A 1 98  ? 29.859  -18.297 33.812  1.00 0.00 ? 98  ARG A HG2  4  
ATOM 8150  H HG3  . ARG A 1 98  ? 29.320  -17.059 34.949  1.00 0.00 ? 98  ARG A HG3  4  
ATOM 8151  H HD2  . ARG A 1 98  ? 27.556  -19.139 33.660  1.00 0.00 ? 98  ARG A HD2  4  
ATOM 8152  H HD3  . ARG A 1 98  ? 28.192  -19.218 35.303  1.00 0.00 ? 98  ARG A HD3  4  
ATOM 8153  H HE   . ARG A 1 98  ? 26.679  -16.834 34.731  1.00 0.00 ? 98  ARG A HE   4  
ATOM 8154  H HH11 . ARG A 1 98  ? 26.553  -20.134 35.831  1.00 0.00 ? 98  ARG A HH11 4  
ATOM 8155  H HH12 . ARG A 1 98  ? 25.069  -19.924 36.702  1.00 0.00 ? 98  ARG A HH12 4  
ATOM 8156  H HH21 . ARG A 1 98  ? 24.726  -16.545 35.874  1.00 0.00 ? 98  ARG A HH21 4  
ATOM 8157  H HH22 . ARG A 1 98  ? 24.031  -17.882 36.725  1.00 0.00 ? 98  ARG A HH22 4  
ATOM 8158  N N    . ILE A 1 99  ? 26.591  -18.750 31.200  1.00 0.00 ? 99  ILE A N    4  
ATOM 8159  C CA   . ILE A 1 99  ? 25.218  -18.962 30.757  1.00 0.00 ? 99  ILE A CA   4  
ATOM 8160  C C    . ILE A 1 99  ? 24.506  -19.978 31.643  1.00 0.00 ? 99  ILE A C    4  
ATOM 8161  O O    . ILE A 1 99  ? 25.130  -20.887 32.191  1.00 0.00 ? 99  ILE A O    4  
ATOM 8162  C CB   . ILE A 1 99  ? 25.166  -19.445 29.296  1.00 0.00 ? 99  ILE A CB   4  
ATOM 8163  C CG1  . ILE A 1 99  ? 25.878  -20.792 29.156  1.00 0.00 ? 99  ILE A CG1  4  
ATOM 8164  C CG2  . ILE A 1 99  ? 25.791  -18.410 28.373  1.00 0.00 ? 99  ILE A CG2  4  
ATOM 8165  C CD1  . ILE A 1 99  ? 24.932  -21.965 29.024  1.00 0.00 ? 99  ILE A CD1  4  
ATOM 8166  H H    . ILE A 1 99  ? 27.090  -19.500 31.586  1.00 0.00 ? 99  ILE A H    4  
ATOM 8167  H HA   . ILE A 1 99  ? 24.698  -18.017 30.822  1.00 0.00 ? 99  ILE A HA   4  
ATOM 8168  H HB   . ILE A 1 99  ? 24.130  -19.563 29.016  1.00 0.00 ? 99  ILE A HB   4  
ATOM 8169  H HG12 . ILE A 1 99  ? 26.504  -20.771 28.278  1.00 0.00 ? 99  ILE A HG12 4  
ATOM 8170  H HG13 . ILE A 1 99  ? 26.494  -20.957 30.028  1.00 0.00 ? 99  ILE A HG13 4  
ATOM 8171  H HG21 . ILE A 1 99  ? 26.863  -18.408 28.508  1.00 0.00 ? 99  ILE A HG21 4  
ATOM 8172  H HG22 . ILE A 1 99  ? 25.560  -18.656 27.347  1.00 0.00 ? 99  ILE A HG22 4  
ATOM 8173  H HG23 . ILE A 1 99  ? 25.396  -17.433 28.607  1.00 0.00 ? 99  ILE A HG23 4  
ATOM 8174  H HD11 . ILE A 1 99  ? 23.941  -21.604 28.795  1.00 0.00 ? 99  ILE A HD11 4  
ATOM 8175  H HD12 . ILE A 1 99  ? 25.272  -22.615 28.232  1.00 0.00 ? 99  ILE A HD12 4  
ATOM 8176  H HD13 . ILE A 1 99  ? 24.908  -22.514 29.954  1.00 0.00 ? 99  ILE A HD13 4  
ATOM 8177  N N    . THR A 1 100 ? 23.192  -19.819 31.778  1.00 0.00 ? 100 THR A N    4  
ATOM 8178  C CA   . THR A 1 100 ? 22.394  -20.723 32.597  1.00 0.00 ? 100 THR A CA   4  
ATOM 8179  C C    . THR A 1 100 ? 21.705  -21.777 31.739  1.00 0.00 ? 100 THR A C    4  
ATOM 8180  O O    . THR A 1 100 ? 21.896  -21.824 30.524  1.00 0.00 ? 100 THR A O    4  
ATOM 8181  C CB   . THR A 1 100 ? 21.328  -19.957 33.403  1.00 0.00 ? 100 THR A CB   4  
ATOM 8182  O OG1  . THR A 1 100 ? 20.576  -19.102 32.533  1.00 0.00 ? 100 THR A OG1  4  
ATOM 8183  C CG2  . THR A 1 100 ? 21.974  -19.127 34.503  1.00 0.00 ? 100 THR A CG2  4  
ATOM 8184  H H    . THR A 1 100 ? 22.752  -19.076 31.317  1.00 0.00 ? 100 THR A H    4  
ATOM 8185  H HA   . THR A 1 100 ? 23.056  -21.216 33.293  1.00 0.00 ? 100 THR A HA   4  
ATOM 8186  H HB   . THR A 1 100 ? 20.659  -20.673 33.858  1.00 0.00 ? 100 THR A HB   4  
ATOM 8187  H HG1  . THR A 1 100 ? 19.982  -18.558 33.055  1.00 0.00 ? 100 THR A HG1  4  
ATOM 8188  H HG21 . THR A 1 100 ? 21.205  -18.686 35.119  1.00 0.00 ? 100 THR A HG21 4  
ATOM 8189  H HG22 . THR A 1 100 ? 22.573  -18.346 34.059  1.00 0.00 ? 100 THR A HG22 4  
ATOM 8190  H HG23 . THR A 1 100 ? 22.601  -19.762 35.110  1.00 0.00 ? 100 THR A HG23 4  
ATOM 8191  N N    . TRP A 1 101 ? 20.902  -22.621 32.378  1.00 0.00 ? 101 TRP A N    4  
ATOM 8192  C CA   . TRP A 1 101 ? 20.184  -23.676 31.671  1.00 0.00 ? 101 TRP A CA   4  
ATOM 8193  C C    . TRP A 1 101 ? 18.784  -23.213 31.282  1.00 0.00 ? 101 TRP A C    4  
ATOM 8194  O O    . TRP A 1 101 ? 17.890  -24.030 31.062  1.00 0.00 ? 101 TRP A O    4  
ATOM 8195  C CB   . TRP A 1 101 ? 20.096  -24.931 32.540  1.00 0.00 ? 101 TRP A CB   4  
ATOM 8196  C CG   . TRP A 1 101 ? 19.707  -26.159 31.773  1.00 0.00 ? 101 TRP A CG   4  
ATOM 8197  C CD1  . TRP A 1 101 ? 18.494  -26.786 31.790  1.00 0.00 ? 101 TRP A CD1  4  
ATOM 8198  C CD2  . TRP A 1 101 ? 20.536  -26.907 30.877  1.00 0.00 ? 101 TRP A CD2  4  
ATOM 8199  N NE1  . TRP A 1 101 ? 18.519  -27.880 30.959  1.00 0.00 ? 101 TRP A NE1  4  
ATOM 8200  C CE2  . TRP A 1 101 ? 19.760  -27.976 30.386  1.00 0.00 ? 101 TRP A CE2  4  
ATOM 8201  C CE3  . TRP A 1 101 ? 21.857  -26.778 30.440  1.00 0.00 ? 101 TRP A CE3  4  
ATOM 8202  C CZ2  . TRP A 1 101 ? 20.263  -28.907 29.482  1.00 0.00 ? 101 TRP A CZ2  4  
ATOM 8203  C CZ3  . TRP A 1 101 ? 22.355  -27.704 29.544  1.00 0.00 ? 101 TRP A CZ3  4  
ATOM 8204  C CH2  . TRP A 1 101 ? 21.560  -28.757 29.072  1.00 0.00 ? 101 TRP A CH2  4  
ATOM 8205  H H    . TRP A 1 101 ? 20.790  -22.533 33.348  1.00 0.00 ? 101 TRP A H    4  
ATOM 8206  H HA   . TRP A 1 101 ? 20.737  -23.908 30.773  1.00 0.00 ? 101 TRP A HA   4  
ATOM 8207  H HB2  . TRP A 1 101 ? 21.057  -25.114 32.996  1.00 0.00 ? 101 TRP A HB2  4  
ATOM 8208  H HB3  . TRP A 1 101 ? 19.358  -24.774 33.314  1.00 0.00 ? 101 TRP A HB3  4  
ATOM 8209  H HD1  . TRP A 1 101 ? 17.649  -26.460 32.377  1.00 0.00 ? 101 TRP A HD1  4  
ATOM 8210  H HE1  . TRP A 1 101 ? 17.769  -28.491 30.800  1.00 0.00 ? 101 TRP A HE1  4  
ATOM 8211  H HE3  . TRP A 1 101 ? 22.486  -25.974 30.792  1.00 0.00 ? 101 TRP A HE3  4  
ATOM 8212  H HZ2  . TRP A 1 101 ? 19.663  -29.724 29.109  1.00 0.00 ? 101 TRP A HZ2  4  
ATOM 8213  H HZ3  . TRP A 1 101 ? 23.374  -27.621 29.195  1.00 0.00 ? 101 TRP A HZ3  4  
ATOM 8214  H HH2  . TRP A 1 101 ? 21.991  -29.457 28.373  1.00 0.00 ? 101 TRP A HH2  4  
ATOM 8215  N N    . GLU A 1 102 ? 18.601  -21.899 31.197  1.00 0.00 ? 102 GLU A N    4  
ATOM 8216  C CA   . GLU A 1 102 ? 17.309  -21.330 30.834  1.00 0.00 ? 102 GLU A CA   4  
ATOM 8217  C C    . GLU A 1 102 ? 17.336  -20.786 29.408  1.00 0.00 ? 102 GLU A C    4  
ATOM 8218  O O    . GLU A 1 102 ? 16.483  -21.124 28.588  1.00 0.00 ? 102 GLU A O    4  
ATOM 8219  C CB   . GLU A 1 102 ? 16.924  -20.216 31.810  1.00 0.00 ? 102 GLU A CB   4  
ATOM 8220  C CG   . GLU A 1 102 ? 15.827  -19.304 31.290  1.00 0.00 ? 102 GLU A CG   4  
ATOM 8221  C CD   . GLU A 1 102 ? 14.716  -20.065 30.592  1.00 0.00 ? 102 GLU A CD   4  
ATOM 8222  O OE1  . GLU A 1 102 ? 14.360  -21.163 31.068  1.00 0.00 ? 102 GLU A OE1  4  
ATOM 8223  O OE2  . GLU A 1 102 ? 14.204  -19.562 29.570  1.00 0.00 ? 102 GLU A OE2  4  
ATOM 8224  H H    . GLU A 1 102 ? 19.353  -21.299 31.384  1.00 0.00 ? 102 GLU A H    4  
ATOM 8225  H HA   . GLU A 1 102 ? 16.572  -22.117 30.891  1.00 0.00 ? 102 GLU A HA   4  
ATOM 8226  H HB2  . GLU A 1 102 ? 16.586  -20.664 32.733  1.00 0.00 ? 102 GLU A HB2  4  
ATOM 8227  H HB3  . GLU A 1 102 ? 17.798  -19.615 32.012  1.00 0.00 ? 102 GLU A HB3  4  
ATOM 8228  H HG2  . GLU A 1 102 ? 15.402  -18.762 32.122  1.00 0.00 ? 102 GLU A HG2  4  
ATOM 8229  H HG3  . GLU A 1 102 ? 16.259  -18.604 30.589  1.00 0.00 ? 102 GLU A HG3  4  
ATOM 8230  N N    . GLN A 1 103 ? 18.320  -19.940 29.123  1.00 0.00 ? 103 GLN A N    4  
ATOM 8231  C CA   . GLN A 1 103 ? 18.457  -19.347 27.798  1.00 0.00 ? 103 GLN A CA   4  
ATOM 8232  C C    . GLN A 1 103 ? 18.743  -20.417 26.750  1.00 0.00 ? 103 GLN A C    4  
ATOM 8233  O O    . GLN A 1 103 ? 18.138  -20.429 25.677  1.00 0.00 ? 103 GLN A O    4  
ATOM 8234  C CB   . GLN A 1 103 ? 19.575  -18.303 27.796  1.00 0.00 ? 103 GLN A CB   4  
ATOM 8235  C CG   . GLN A 1 103 ? 19.088  -16.889 28.072  1.00 0.00 ? 103 GLN A CG   4  
ATOM 8236  C CD   . GLN A 1 103 ? 18.842  -16.634 29.546  1.00 0.00 ? 103 GLN A CD   4  
ATOM 8237  O OE1  . GLN A 1 103 ? 17.769  -16.175 29.937  1.00 0.00 ? 103 GLN A OE1  4  
ATOM 8238  N NE2  . GLN A 1 103 ? 19.838  -16.931 30.372  1.00 0.00 ? 103 GLN A NE2  4  
ATOM 8239  H H    . GLN A 1 103 ? 18.969  -19.709 29.819  1.00 0.00 ? 103 GLN A H    4  
ATOM 8240  H HA   . GLN A 1 103 ? 17.524  -18.862 27.553  1.00 0.00 ? 103 GLN A HA   4  
ATOM 8241  H HB2  . GLN A 1 103 ? 20.298  -18.566 28.553  1.00 0.00 ? 103 GLN A HB2  4  
ATOM 8242  H HB3  . GLN A 1 103 ? 20.058  -18.312 26.830  1.00 0.00 ? 103 GLN A HB3  4  
ATOM 8243  H HG2  . GLN A 1 103 ? 19.832  -16.191 27.721  1.00 0.00 ? 103 GLN A HG2  4  
ATOM 8244  H HG3  . GLN A 1 103 ? 18.164  -16.730 27.534  1.00 0.00 ? 103 GLN A HG3  4  
ATOM 8245  H HE21 . GLN A 1 103 ? 20.665  -17.292 29.989  1.00 0.00 ? 103 GLN A HE21 4  
ATOM 8246  H HE22 . GLN A 1 103 ? 19.707  -16.775 31.330  1.00 0.00 ? 103 GLN A HE22 4  
ATOM 8247  N N    . VAL A 1 104 ? 19.670  -21.316 27.066  1.00 0.00 ? 104 VAL A N    4  
ATOM 8248  C CA   . VAL A 1 104 ? 20.036  -22.391 26.152  1.00 0.00 ? 104 VAL A CA   4  
ATOM 8249  C C    . VAL A 1 104 ? 18.800  -23.116 25.632  1.00 0.00 ? 104 VAL A C    4  
ATOM 8250  O O    . VAL A 1 104 ? 18.689  -23.400 24.439  1.00 0.00 ? 104 VAL A O    4  
ATOM 8251  C CB   . VAL A 1 104 ? 20.968  -23.412 26.832  1.00 0.00 ? 104 VAL A CB   4  
ATOM 8252  C CG1  . VAL A 1 104 ? 20.397  -23.847 28.173  1.00 0.00 ? 104 VAL A CG1  4  
ATOM 8253  C CG2  . VAL A 1 104 ? 21.194  -24.613 25.925  1.00 0.00 ? 104 VAL A CG2  4  
ATOM 8254  H H    . VAL A 1 104 ? 20.118  -21.255 27.936  1.00 0.00 ? 104 VAL A H    4  
ATOM 8255  H HA   . VAL A 1 104 ? 20.564  -21.954 25.317  1.00 0.00 ? 104 VAL A HA   4  
ATOM 8256  H HB   . VAL A 1 104 ? 21.922  -22.937 27.009  1.00 0.00 ? 104 VAL A HB   4  
ATOM 8257  H HG11 . VAL A 1 104 ? 21.126  -24.449 28.696  1.00 0.00 ? 104 VAL A HG11 4  
ATOM 8258  H HG12 . VAL A 1 104 ? 20.159  -22.974 28.763  1.00 0.00 ? 104 VAL A HG12 4  
ATOM 8259  H HG13 . VAL A 1 104 ? 19.501  -24.428 28.011  1.00 0.00 ? 104 VAL A HG13 4  
ATOM 8260  H HG21 . VAL A 1 104 ? 21.903  -25.284 26.387  1.00 0.00 ? 104 VAL A HG21 4  
ATOM 8261  H HG22 . VAL A 1 104 ? 20.257  -25.129 25.771  1.00 0.00 ? 104 VAL A HG22 4  
ATOM 8262  H HG23 . VAL A 1 104 ? 21.581  -24.278 24.974  1.00 0.00 ? 104 VAL A HG23 4  
ATOM 8263  N N    . LEU A 1 105 ? 17.871  -23.412 26.535  1.00 0.00 ? 105 LEU A N    4  
ATOM 8264  C CA   . LEU A 1 105 ? 16.640  -24.103 26.168  1.00 0.00 ? 105 LEU A CA   4  
ATOM 8265  C C    . LEU A 1 105 ? 15.926  -23.377 25.033  1.00 0.00 ? 105 LEU A C    4  
ATOM 8266  O O    . LEU A 1 105 ? 15.527  -23.993 24.045  1.00 0.00 ? 105 LEU A O    4  
ATOM 8267  C CB   . LEU A 1 105 ? 15.714  -24.215 27.380  1.00 0.00 ? 105 LEU A CB   4  
ATOM 8268  C CG   . LEU A 1 105 ? 15.864  -25.480 28.225  1.00 0.00 ? 105 LEU A CG   4  
ATOM 8269  C CD1  . LEU A 1 105 ? 17.332  -25.772 28.494  1.00 0.00 ? 105 LEU A CD1  4  
ATOM 8270  C CD2  . LEU A 1 105 ? 15.098  -25.342 29.533  1.00 0.00 ? 105 LEU A CD2  4  
ATOM 8271  H H    . LEU A 1 105 ? 18.016  -23.160 27.471  1.00 0.00 ? 105 LEU A H    4  
ATOM 8272  H HA   . LEU A 1 105 ? 16.904  -25.096 25.835  1.00 0.00 ? 105 LEU A HA   4  
ATOM 8273  H HB2  . LEU A 1 105 ? 15.902  -23.366 28.020  1.00 0.00 ? 105 LEU A HB2  4  
ATOM 8274  H HB3  . LEU A 1 105 ? 14.695  -24.174 27.022  1.00 0.00 ? 105 LEU A HB3  4  
ATOM 8275  H HG   . LEU A 1 105 ? 15.451  -26.319 27.682  1.00 0.00 ? 105 LEU A HG   4  
ATOM 8276  H HD11 . LEU A 1 105 ? 17.415  -26.611 29.168  1.00 0.00 ? 105 LEU A HD11 4  
ATOM 8277  H HD12 . LEU A 1 105 ? 17.795  -24.904 28.940  1.00 0.00 ? 105 LEU A HD12 4  
ATOM 8278  H HD13 . LEU A 1 105 ? 17.828  -26.006 27.563  1.00 0.00 ? 105 LEU A HD13 4  
ATOM 8279  H HD21 . LEU A 1 105 ? 15.408  -24.439 30.038  1.00 0.00 ? 105 LEU A HD21 4  
ATOM 8280  H HD22 . LEU A 1 105 ? 15.304  -26.195 30.163  1.00 0.00 ? 105 LEU A HD22 4  
ATOM 8281  H HD23 . LEU A 1 105 ? 14.039  -25.293 29.327  1.00 0.00 ? 105 LEU A HD23 4  
ATOM 8282  N N    . GLU A 1 106 ? 15.770  -22.065 25.181  1.00 0.00 ? 106 GLU A N    4  
ATOM 8283  C CA   . GLU A 1 106 ? 15.105  -21.256 24.167  1.00 0.00 ? 106 GLU A CA   4  
ATOM 8284  C C    . GLU A 1 106 ? 15.723  -21.492 22.791  1.00 0.00 ? 106 GLU A C    4  
ATOM 8285  O O    . GLU A 1 106 ? 15.021  -21.512 21.780  1.00 0.00 ? 106 GLU A O    4  
ATOM 8286  C CB   . GLU A 1 106 ? 15.191  -19.772 24.529  1.00 0.00 ? 106 GLU A CB   4  
ATOM 8287  C CG   . GLU A 1 106 ? 13.898  -19.207 25.092  1.00 0.00 ? 106 GLU A CG   4  
ATOM 8288  C CD   . GLU A 1 106 ? 13.268  -18.171 24.181  1.00 0.00 ? 106 GLU A CD   4  
ATOM 8289  O OE1  . GLU A 1 106 ? 13.729  -17.011 24.196  1.00 0.00 ? 106 GLU A OE1  4  
ATOM 8290  O OE2  . GLU A 1 106 ? 12.315  -18.521 23.454  1.00 0.00 ? 106 GLU A OE2  4  
ATOM 8291  H H    . GLU A 1 106 ? 16.110  -21.632 25.991  1.00 0.00 ? 106 GLU A H    4  
ATOM 8292  H HA   . GLU A 1 106 ? 14.067  -21.550 24.136  1.00 0.00 ? 106 GLU A HA   4  
ATOM 8293  H HB2  . GLU A 1 106 ? 15.970  -19.638 25.265  1.00 0.00 ? 106 GLU A HB2  4  
ATOM 8294  H HB3  . GLU A 1 106 ? 15.448  -19.212 23.642  1.00 0.00 ? 106 GLU A HB3  4  
ATOM 8295  H HG2  . GLU A 1 106 ? 13.197  -20.016 25.231  1.00 0.00 ? 106 GLU A HG2  4  
ATOM 8296  H HG3  . GLU A 1 106 ? 14.107  -18.746 26.046  1.00 0.00 ? 106 GLU A HG3  4  
ATOM 8297  N N    . ILE A 1 107 ? 17.039  -21.669 22.763  1.00 0.00 ? 107 ILE A N    4  
ATOM 8298  C CA   . ILE A 1 107 ? 17.751  -21.904 21.513  1.00 0.00 ? 107 ILE A CA   4  
ATOM 8299  C C    . ILE A 1 107 ? 17.507  -23.318 20.999  1.00 0.00 ? 107 ILE A C    4  
ATOM 8300  O O    . ILE A 1 107 ? 17.231  -23.521 19.817  1.00 0.00 ? 107 ILE A O    4  
ATOM 8301  C CB   . ILE A 1 107 ? 19.267  -21.684 21.679  1.00 0.00 ? 107 ILE A CB   4  
ATOM 8302  C CG1  . ILE A 1 107 ? 19.540  -20.322 22.320  1.00 0.00 ? 107 ILE A CG1  4  
ATOM 8303  C CG2  . ILE A 1 107 ? 19.968  -21.792 20.333  1.00 0.00 ? 107 ILE A CG2  4  
ATOM 8304  C CD1  . ILE A 1 107 ? 20.998  -20.091 22.651  1.00 0.00 ? 107 ILE A CD1  4  
ATOM 8305  H H    . ILE A 1 107 ? 17.543  -21.642 23.603  1.00 0.00 ? 107 ILE A H    4  
ATOM 8306  H HA   . ILE A 1 107 ? 17.383  -21.198 20.783  1.00 0.00 ? 107 ILE A HA   4  
ATOM 8307  H HB   . ILE A 1 107 ? 19.652  -22.461 22.322  1.00 0.00 ? 107 ILE A HB   4  
ATOM 8308  H HG12 . ILE A 1 107 ? 19.226  -19.543 21.643  1.00 0.00 ? 107 ILE A HG12 4  
ATOM 8309  H HG13 . ILE A 1 107 ? 18.974  -20.245 23.238  1.00 0.00 ? 107 ILE A HG13 4  
ATOM 8310  H HG21 . ILE A 1 107 ? 19.728  -22.742 19.877  1.00 0.00 ? 107 ILE A HG21 4  
ATOM 8311  H HG22 . ILE A 1 107 ? 19.636  -20.991 19.690  1.00 0.00 ? 107 ILE A HG22 4  
ATOM 8312  H HG23 . ILE A 1 107 ? 21.036  -21.721 20.476  1.00 0.00 ? 107 ILE A HG23 4  
ATOM 8313  H HD11 . ILE A 1 107 ? 21.598  -20.260 21.769  1.00 0.00 ? 107 ILE A HD11 4  
ATOM 8314  H HD12 . ILE A 1 107 ? 21.134  -19.076 22.991  1.00 0.00 ? 107 ILE A HD12 4  
ATOM 8315  H HD13 . ILE A 1 107 ? 21.303  -20.776 23.430  1.00 0.00 ? 107 ILE A HD13 4  
ATOM 8316  N N    . ALA A 1 108 ? 17.609  -24.294 21.895  1.00 0.00 ? 108 ALA A N    4  
ATOM 8317  C CA   . ALA A 1 108 ? 17.396  -25.690 21.533  1.00 0.00 ? 108 ALA A CA   4  
ATOM 8318  C C    . ALA A 1 108 ? 16.014  -25.893 20.921  1.00 0.00 ? 108 ALA A C    4  
ATOM 8319  O O    . ALA A 1 108 ? 15.843  -26.688 19.996  1.00 0.00 ? 108 ALA A O    4  
ATOM 8320  C CB   . ALA A 1 108 ? 17.572  -26.584 22.751  1.00 0.00 ? 108 ALA A CB   4  
ATOM 8321  H H    . ALA A 1 108 ? 17.832  -24.069 22.823  1.00 0.00 ? 108 ALA A H    4  
ATOM 8322  H HA   . ALA A 1 108 ? 18.145  -25.964 20.804  1.00 0.00 ? 108 ALA A HA   4  
ATOM 8323  H HB1  . ALA A 1 108 ? 17.989  -26.006 23.563  1.00 0.00 ? 108 ALA A HB1  4  
ATOM 8324  H HB2  . ALA A 1 108 ? 16.613  -26.982 23.048  1.00 0.00 ? 108 ALA A HB2  4  
ATOM 8325  H HB3  . ALA A 1 108 ? 18.239  -27.397 22.507  1.00 0.00 ? 108 ALA A HB3  4  
ATOM 8326  N N    . LYS A 1 109 ? 15.029  -25.170 21.443  1.00 0.00 ? 109 LYS A N    4  
ATOM 8327  C CA   . LYS A 1 109 ? 13.661  -25.269 20.948  1.00 0.00 ? 109 LYS A CA   4  
ATOM 8328  C C    . LYS A 1 109 ? 13.617  -25.098 19.433  1.00 0.00 ? 109 LYS A C    4  
ATOM 8329  O O    . LYS A 1 109 ? 13.117  -25.965 18.716  1.00 0.00 ? 109 LYS A O    4  
ATOM 8330  C CB   . LYS A 1 109 ? 12.777  -24.215 21.617  1.00 0.00 ? 109 LYS A CB   4  
ATOM 8331  C CG   . LYS A 1 109 ? 12.772  -24.298 23.133  1.00 0.00 ? 109 LYS A CG   4  
ATOM 8332  C CD   . LYS A 1 109 ? 11.357  -24.325 23.686  1.00 0.00 ? 109 LYS A CD   4  
ATOM 8333  C CE   . LYS A 1 109 ? 11.348  -24.183 25.201  1.00 0.00 ? 109 LYS A CE   4  
ATOM 8334  N NZ   . LYS A 1 109 ? 10.606  -22.968 25.640  1.00 0.00 ? 109 LYS A NZ   4  
ATOM 8335  H H    . LYS A 1 109 ? 15.227  -24.553 22.179  1.00 0.00 ? 109 LYS A H    4  
ATOM 8336  H HA   . LYS A 1 109 ? 13.288  -26.251 21.198  1.00 0.00 ? 109 LYS A HA   4  
ATOM 8337  H HB2  . LYS A 1 109 ? 13.128  -23.234 21.332  1.00 0.00 ? 109 LYS A HB2  4  
ATOM 8338  H HB3  . LYS A 1 109 ? 11.762  -24.339 21.268  1.00 0.00 ? 109 LYS A HB3  4  
ATOM 8339  H HG2  . LYS A 1 109 ? 13.283  -25.199 23.437  1.00 0.00 ? 109 LYS A HG2  4  
ATOM 8340  H HG3  . LYS A 1 109 ? 13.289  -23.437 23.533  1.00 0.00 ? 109 LYS A HG3  4  
ATOM 8341  H HD2  . LYS A 1 109 ? 10.796  -23.508 23.256  1.00 0.00 ? 109 LYS A HD2  4  
ATOM 8342  H HD3  . LYS A 1 109 ? 10.893  -25.263 23.419  1.00 0.00 ? 109 LYS A HD3  4  
ATOM 8343  H HE2  . LYS A 1 109 ? 10.878  -25.055 25.628  1.00 0.00 ? 109 LYS A HE2  4  
ATOM 8344  H HE3  . LYS A 1 109 ? 12.368  -24.117 25.549  1.00 0.00 ? 109 LYS A HE3  4  
ATOM 8345  H HZ1  . LYS A 1 109 ? 11.180  -22.118 25.467  1.00 0.00 ? 109 LYS A HZ1  4  
ATOM 8346  H HZ2  . LYS A 1 109 ? 10.393  -23.028 26.655  1.00 0.00 ? 109 LYS A HZ2  4  
ATOM 8347  H HZ3  . LYS A 1 109 ? 9.714   -22.885 25.113  1.00 0.00 ? 109 LYS A HZ3  4  
ATOM 8348  N N    . GLN A 1 110 ? 14.144  -23.977 18.953  1.00 0.00 ? 110 GLN A N    4  
ATOM 8349  C CA   . GLN A 1 110 ? 14.165  -23.694 17.522  1.00 0.00 ? 110 GLN A CA   4  
ATOM 8350  C C    . GLN A 1 110 ? 15.096  -24.655 16.791  1.00 0.00 ? 110 GLN A C    4  
ATOM 8351  O O    . GLN A 1 110 ? 14.981  -24.848 15.580  1.00 0.00 ? 110 GLN A O    4  
ATOM 8352  C CB   . GLN A 1 110 ? 14.604  -22.250 17.273  1.00 0.00 ? 110 GLN A CB   4  
ATOM 8353  C CG   . GLN A 1 110 ? 13.455  -21.255 17.274  1.00 0.00 ? 110 GLN A CG   4  
ATOM 8354  C CD   . GLN A 1 110 ? 13.755  -20.016 16.455  1.00 0.00 ? 110 GLN A CD   4  
ATOM 8355  O OE1  . GLN A 1 110 ? 12.940  -19.587 15.637  1.00 0.00 ? 110 GLN A OE1  4  
ATOM 8356  N NE2  . GLN A 1 110 ? 14.928  -19.433 16.670  1.00 0.00 ? 110 GLN A NE2  4  
ATOM 8357  H H    . GLN A 1 110 ? 14.528  -23.324 19.575  1.00 0.00 ? 110 GLN A H    4  
ATOM 8358  H HA   . GLN A 1 110 ? 13.163  -23.826 17.144  1.00 0.00 ? 110 GLN A HA   4  
ATOM 8359  H HB2  . GLN A 1 110 ? 15.304  -21.961 18.043  1.00 0.00 ? 110 GLN A HB2  4  
ATOM 8360  H HB3  . GLN A 1 110 ? 15.096  -22.197 16.313  1.00 0.00 ? 110 GLN A HB3  4  
ATOM 8361  H HG2  . GLN A 1 110 ? 12.579  -21.736 16.864  1.00 0.00 ? 110 GLN A HG2  4  
ATOM 8362  H HG3  . GLN A 1 110 ? 13.256  -20.956 18.293  1.00 0.00 ? 110 GLN A HG3  4  
ATOM 8363  H HE21 . GLN A 1 110 ? 15.527  -19.831 17.336  1.00 0.00 ? 110 GLN A HE21 4  
ATOM 8364  H HE22 . GLN A 1 110 ? 15.148  -18.631 16.154  1.00 0.00 ? 110 GLN A HE22 4  
ATOM 8365  N N    . LYS A 1 111 ? 16.020  -25.256 17.533  1.00 0.00 ? 111 LYS A N    4  
ATOM 8366  C CA   . LYS A 1 111 ? 16.972  -26.198 16.957  1.00 0.00 ? 111 LYS A CA   4  
ATOM 8367  C C    . LYS A 1 111 ? 16.460  -27.630 17.077  1.00 0.00 ? 111 LYS A C    4  
ATOM 8368  O O    . LYS A 1 111 ? 17.226  -28.550 17.364  1.00 0.00 ? 111 LYS A O    4  
ATOM 8369  C CB   . LYS A 1 111 ? 18.330  -26.070 17.649  1.00 0.00 ? 111 LYS A CB   4  
ATOM 8370  C CG   . LYS A 1 111 ? 19.508  -26.119 16.691  1.00 0.00 ? 111 LYS A CG   4  
ATOM 8371  C CD   . LYS A 1 111 ? 19.671  -24.808 15.940  1.00 0.00 ? 111 LYS A CD   4  
ATOM 8372  C CE   . LYS A 1 111 ? 20.416  -25.005 14.629  1.00 0.00 ? 111 LYS A CE   4  
ATOM 8373  N NZ   . LYS A 1 111 ? 21.862  -24.674 14.758  1.00 0.00 ? 111 LYS A NZ   4  
ATOM 8374  H H    . LYS A 1 111 ? 16.062  -25.061 18.493  1.00 0.00 ? 111 LYS A H    4  
ATOM 8375  H HA   . LYS A 1 111 ? 17.086  -25.956 15.911  1.00 0.00 ? 111 LYS A HA   4  
ATOM 8376  H HB2  . LYS A 1 111 ? 18.363  -25.130 18.180  1.00 0.00 ? 111 LYS A HB2  4  
ATOM 8377  H HB3  . LYS A 1 111 ? 18.437  -26.878 18.358  1.00 0.00 ? 111 LYS A HB3  4  
ATOM 8378  H HG2  . LYS A 1 111 ? 20.410  -26.314 17.252  1.00 0.00 ? 111 LYS A HG2  4  
ATOM 8379  H HG3  . LYS A 1 111 ? 19.347  -26.915 15.977  1.00 0.00 ? 111 LYS A HG3  4  
ATOM 8380  H HD2  . LYS A 1 111 ? 18.693  -24.401 15.727  1.00 0.00 ? 111 LYS A HD2  4  
ATOM 8381  H HD3  . LYS A 1 111 ? 20.224  -24.115 16.558  1.00 0.00 ? 111 LYS A HD3  4  
ATOM 8382  H HE2  . LYS A 1 111 ? 20.317  -26.036 14.326  1.00 0.00 ? 111 LYS A HE2  4  
ATOM 8383  H HE3  . LYS A 1 111 ? 19.974  -24.366 13.879  1.00 0.00 ? 111 LYS A HE3  4  
ATOM 8384  H HZ1  . LYS A 1 111 ? 22.441  -25.509 14.532  1.00 0.00 ? 111 LYS A HZ1  4  
ATOM 8385  H HZ2  . LYS A 1 111 ? 22.074  -24.373 15.730  1.00 0.00 ? 111 LYS A HZ2  4  
ATOM 8386  H HZ3  . LYS A 1 111 ? 22.113  -23.905 14.105  1.00 0.00 ? 111 LYS A HZ3  4  
ATOM 8387  N N    . MET A 1 112 ? 15.163  -27.811 16.855  1.00 0.00 ? 112 MET A N    4  
ATOM 8388  C CA   . MET A 1 112 ? 14.551  -29.132 16.937  1.00 0.00 ? 112 MET A CA   4  
ATOM 8389  C C    . MET A 1 112 ? 13.777  -29.453 15.662  1.00 0.00 ? 112 MET A C    4  
ATOM 8390  O O    . MET A 1 112 ? 12.718  -30.079 15.691  1.00 0.00 ? 112 MET A O    4  
ATOM 8391  C CB   . MET A 1 112 ? 13.618  -29.212 18.147  1.00 0.00 ? 112 MET A CB   4  
ATOM 8392  C CG   . MET A 1 112 ? 14.343  -29.116 19.480  1.00 0.00 ? 112 MET A CG   4  
ATOM 8393  S SD   . MET A 1 112 ? 14.202  -30.624 20.458  1.00 0.00 ? 112 MET A SD   4  
ATOM 8394  C CE   . MET A 1 112 ? 12.979  -30.129 21.669  1.00 0.00 ? 112 MET A CE   4  
ATOM 8395  H H    . MET A 1 112 ? 14.603  -27.039 16.630  1.00 0.00 ? 112 MET A H    4  
ATOM 8396  H HA   . MET A 1 112 ? 15.342  -29.857 17.055  1.00 0.00 ? 112 MET A HA   4  
ATOM 8397  H HB2  . MET A 1 112 ? 12.904  -28.404 18.090  1.00 0.00 ? 112 MET A HB2  4  
ATOM 8398  H HB3  . MET A 1 112 ? 13.089  -30.153 18.117  1.00 0.00 ? 112 MET A HB3  4  
ATOM 8399  H HG2  . MET A 1 112 ? 15.389  -28.922 19.293  1.00 0.00 ? 112 MET A HG2  4  
ATOM 8400  H HG3  . MET A 1 112 ? 13.922  -28.296 20.043  1.00 0.00 ? 112 MET A HG3  4  
ATOM 8401  H HE1  . MET A 1 112 ? 12.012  -30.057 21.196  1.00 0.00 ? 112 MET A HE1  4  
ATOM 8402  H HE2  . MET A 1 112 ? 12.940  -30.863 22.460  1.00 0.00 ? 112 MET A HE2  4  
ATOM 8403  H HE3  . MET A 1 112 ? 13.251  -29.168 22.082  1.00 0.00 ? 112 MET A HE3  4  
ATOM 8404  N N    . PRO A 1 113 ? 14.316  -29.013 14.515  1.00 0.00 ? 113 PRO A N    4  
ATOM 8405  C CA   . PRO A 1 113 ? 13.692  -29.242 13.208  1.00 0.00 ? 113 PRO A CA   4  
ATOM 8406  C C    . PRO A 1 113 ? 13.748  -30.706 12.787  1.00 0.00 ? 113 PRO A C    4  
ATOM 8407  O O    . PRO A 1 113 ? 12.742  -31.282 12.374  1.00 0.00 ? 113 PRO A O    4  
ATOM 8408  C CB   . PRO A 1 113 ? 14.529  -28.380 12.260  1.00 0.00 ? 113 PRO A CB   4  
ATOM 8409  C CG   . PRO A 1 113 ? 15.855  -28.260 12.928  1.00 0.00 ? 113 PRO A CG   4  
ATOM 8410  C CD   . PRO A 1 113 ? 15.576  -28.259 14.405  1.00 0.00 ? 113 PRO A CD   4  
ATOM 8411  H HA   . PRO A 1 113 ? 12.666  -28.903 13.194  1.00 0.00 ? 113 PRO A HA   4  
ATOM 8412  H HB2  . PRO A 1 113 ? 14.612  -28.872 11.301  1.00 0.00 ? 113 PRO A HB2  4  
ATOM 8413  H HB3  . PRO A 1 113 ? 14.061  -27.415 12.136  1.00 0.00 ? 113 PRO A HB3  4  
ATOM 8414  H HG2  . PRO A 1 113 ? 16.477  -29.103 12.664  1.00 0.00 ? 113 PRO A HG2  4  
ATOM 8415  H HG3  . PRO A 1 113 ? 16.331  -27.335 12.636  1.00 0.00 ? 113 PRO A HG3  4  
ATOM 8416  H HD2  . PRO A 1 113 ? 16.371  -28.757 14.940  1.00 0.00 ? 113 PRO A HD2  4  
ATOM 8417  H HD3  . PRO A 1 113 ? 15.452  -27.248 14.765  1.00 0.00 ? 113 PRO A HD3  4  
ATOM 8418  N N    . ASP A 1 114 ? 14.930  -31.303 12.895  1.00 0.00 ? 114 ASP A N    4  
ATOM 8419  C CA   . ASP A 1 114 ? 15.117  -32.701 12.527  1.00 0.00 ? 114 ASP A CA   4  
ATOM 8420  C C    . ASP A 1 114 ? 15.526  -33.532 13.739  1.00 0.00 ? 114 ASP A C    4  
ATOM 8421  O O    . ASP A 1 114 ? 15.414  -34.759 13.731  1.00 0.00 ? 114 ASP A O    4  
ATOM 8422  C CB   . ASP A 1 114 ? 16.174  -32.825 11.429  1.00 0.00 ? 114 ASP A CB   4  
ATOM 8423  C CG   . ASP A 1 114 ? 15.974  -34.058 10.569  1.00 0.00 ? 114 ASP A CG   4  
ATOM 8424  O OD1  . ASP A 1 114 ? 15.966  -35.175 11.127  1.00 0.00 ? 114 ASP A OD1  4  
ATOM 8425  O OD2  . ASP A 1 114 ? 15.827  -33.905 9.338   1.00 0.00 ? 114 ASP A OD2  4  
ATOM 8426  H H    . ASP A 1 114 ? 15.695  -30.790 13.231  1.00 0.00 ? 114 ASP A H    4  
ATOM 8427  H HA   . ASP A 1 114 ? 14.176  -33.074 12.152  1.00 0.00 ? 114 ASP A HA   4  
ATOM 8428  H HB2  . ASP A 1 114 ? 16.126  -31.953 10.792  1.00 0.00 ? 114 ASP A HB2  4  
ATOM 8429  H HB3  . ASP A 1 114 ? 17.152  -32.880 11.884  1.00 0.00 ? 114 ASP A HB3  4  
ATOM 8430  N N    . LEU A 1 115 ? 16.001  -32.857 14.780  1.00 0.00 ? 115 LEU A N    4  
ATOM 8431  C CA   . LEU A 1 115 ? 16.428  -33.533 16.000  1.00 0.00 ? 115 LEU A CA   4  
ATOM 8432  C C    . LEU A 1 115 ? 15.325  -34.442 16.533  1.00 0.00 ? 115 LEU A C    4  
ATOM 8433  O O    . LEU A 1 115 ? 14.322  -33.970 17.067  1.00 0.00 ? 115 LEU A O    4  
ATOM 8434  C CB   . LEU A 1 115 ? 16.818  -32.506 17.065  1.00 0.00 ? 115 LEU A CB   4  
ATOM 8435  C CG   . LEU A 1 115 ? 18.246  -31.966 16.985  1.00 0.00 ? 115 LEU A CG   4  
ATOM 8436  C CD1  . LEU A 1 115 ? 19.253  -33.099 17.101  1.00 0.00 ? 115 LEU A CD1  4  
ATOM 8437  C CD2  . LEU A 1 115 ? 18.452  -31.196 15.689  1.00 0.00 ? 115 LEU A CD2  4  
ATOM 8438  H H    . LEU A 1 115 ? 16.066  -31.881 14.728  1.00 0.00 ? 115 LEU A H    4  
ATOM 8439  H HA   . LEU A 1 115 ? 17.291  -34.136 15.760  1.00 0.00 ? 115 LEU A HA   4  
ATOM 8440  H HB2  . LEU A 1 115 ? 16.142  -31.669 16.981  1.00 0.00 ? 115 LEU A HB2  4  
ATOM 8441  H HB3  . LEU A 1 115 ? 16.693  -32.972 18.033  1.00 0.00 ? 115 LEU A HB3  4  
ATOM 8442  H HG   . LEU A 1 115 ? 18.413  -31.286 17.809  1.00 0.00 ? 115 LEU A HG   4  
ATOM 8443  H HD11 . LEU A 1 115 ? 19.321  -33.618 16.157  1.00 0.00 ? 115 LEU A HD11 4  
ATOM 8444  H HD12 . LEU A 1 115 ? 18.933  -33.788 17.868  1.00 0.00 ? 115 LEU A HD12 4  
ATOM 8445  H HD13 . LEU A 1 115 ? 20.221  -32.695 17.361  1.00 0.00 ? 115 LEU A HD13 4  
ATOM 8446  H HD21 . LEU A 1 115 ? 19.454  -30.792 15.667  1.00 0.00 ? 115 LEU A HD21 4  
ATOM 8447  H HD22 . LEU A 1 115 ? 17.737  -30.388 15.632  1.00 0.00 ? 115 LEU A HD22 4  
ATOM 8448  H HD23 . LEU A 1 115 ? 18.313  -31.860 14.850  1.00 0.00 ? 115 LEU A HD23 4  
ATOM 8449  N N    . ASN A 1 116 ? 15.520  -35.749 16.387  1.00 0.00 ? 116 ASN A N    4  
ATOM 8450  C CA   . ASN A 1 116 ? 14.543  -36.725 16.855  1.00 0.00 ? 116 ASN A CA   4  
ATOM 8451  C C    . ASN A 1 116 ? 14.527  -36.790 18.380  1.00 0.00 ? 116 ASN A C    4  
ATOM 8452  O O    . ASN A 1 116 ? 15.148  -37.666 18.982  1.00 0.00 ? 116 ASN A O    4  
ATOM 8453  C CB   . ASN A 1 116 ? 14.855  -38.107 16.278  1.00 0.00 ? 116 ASN A CB   4  
ATOM 8454  C CG   . ASN A 1 116 ? 14.973  -38.089 14.766  1.00 0.00 ? 116 ASN A CG   4  
ATOM 8455  O OD1  . ASN A 1 116 ? 13.972  -38.163 14.053  1.00 0.00 ? 116 ASN A OD1  4  
ATOM 8456  N ND2  . ASN A 1 116 ? 16.201  -37.990 14.270  1.00 0.00 ? 116 ASN A ND2  4  
ATOM 8457  H H    . ASN A 1 116 ? 16.341  -36.064 15.953  1.00 0.00 ? 116 ASN A H    4  
ATOM 8458  H HA   . ASN A 1 116 ? 13.570  -36.411 16.510  1.00 0.00 ? 116 ASN A HA   4  
ATOM 8459  H HB2  . ASN A 1 116 ? 15.790  -38.459 16.689  1.00 0.00 ? 116 ASN A HB2  4  
ATOM 8460  H HB3  . ASN A 1 116 ? 14.065  -38.791 16.551  1.00 0.00 ? 116 ASN A HB3  4  
ATOM 8461  H HD21 . ASN A 1 116 ? 16.951  -37.935 14.899  1.00 0.00 ? 116 ASN A HD21 4  
ATOM 8462  H HD22 . ASN A 1 116 ? 16.306  -37.975 13.296  1.00 0.00 ? 116 ASN A HD22 4  
ATOM 8463  N N    . THR A 1 117 ? 13.811  -35.856 18.999  1.00 0.00 ? 117 THR A N    4  
ATOM 8464  C CA   . THR A 1 117 ? 13.714  -35.806 20.452  1.00 0.00 ? 117 THR A CA   4  
ATOM 8465  C C    . THR A 1 117 ? 12.799  -34.673 20.903  1.00 0.00 ? 117 THR A C    4  
ATOM 8466  O O    . THR A 1 117 ? 13.056  -33.503 20.619  1.00 0.00 ? 117 THR A O    4  
ATOM 8467  C CB   . THR A 1 117 ? 15.098  -35.623 21.102  1.00 0.00 ? 117 THR A CB   4  
ATOM 8468  O OG1  . THR A 1 117 ? 14.958  -35.474 22.519  1.00 0.00 ? 117 THR A OG1  4  
ATOM 8469  C CG2  . THR A 1 117 ? 15.810  -34.408 20.527  1.00 0.00 ? 117 THR A CG2  4  
ATOM 8470  H H    . THR A 1 117 ? 13.338  -35.185 18.464  1.00 0.00 ? 117 THR A H    4  
ATOM 8471  H HA   . THR A 1 117 ? 13.301  -36.745 20.791  1.00 0.00 ? 117 THR A HA   4  
ATOM 8472  H HB   . THR A 1 117 ? 15.694  -36.501 20.897  1.00 0.00 ? 117 THR A HB   4  
ATOM 8473  H HG1  . THR A 1 117 ? 14.687  -36.311 22.904  1.00 0.00 ? 117 THR A HG1  4  
ATOM 8474  H HG21 . THR A 1 117 ? 15.748  -34.431 19.449  1.00 0.00 ? 117 THR A HG21 4  
ATOM 8475  H HG22 . THR A 1 117 ? 16.846  -34.421 20.829  1.00 0.00 ? 117 THR A HG22 4  
ATOM 8476  H HG23 . THR A 1 117 ? 15.339  -33.509 20.894  1.00 0.00 ? 117 THR A HG23 4  
ATOM 8477  N N    . THR A 1 118 ? 11.730  -35.027 21.610  1.00 0.00 ? 118 THR A N    4  
ATOM 8478  C CA   . THR A 1 118 ? 10.777  -34.040 22.100  1.00 0.00 ? 118 THR A CA   4  
ATOM 8479  C C    . THR A 1 118 ? 11.082  -33.650 23.542  1.00 0.00 ? 118 THR A C    4  
ATOM 8480  O O    . THR A 1 118 ? 10.172  -33.469 24.352  1.00 0.00 ? 118 THR A O    4  
ATOM 8481  C CB   . THR A 1 118 ? 9.331   -34.564 22.017  1.00 0.00 ? 118 THR A CB   4  
ATOM 8482  O OG1  . THR A 1 118 ? 9.205   -35.775 22.771  1.00 0.00 ? 118 THR A OG1  4  
ATOM 8483  C CG2  . THR A 1 118 ? 8.930   -34.817 20.571  1.00 0.00 ? 118 THR A CG2  4  
ATOM 8484  H H    . THR A 1 118 ? 11.580  -35.976 21.804  1.00 0.00 ? 118 THR A H    4  
ATOM 8485  H HA   . THR A 1 118 ? 10.856  -33.161 21.476  1.00 0.00 ? 118 THR A HA   4  
ATOM 8486  H HB   . THR A 1 118 ? 8.669   -33.819 22.434  1.00 0.00 ? 118 THR A HB   4  
ATOM 8487  H HG1  . THR A 1 118 ? 8.276   -35.993 22.873  1.00 0.00 ? 118 THR A HG1  4  
ATOM 8488  H HG21 . THR A 1 118 ? 9.194   -35.827 20.295  1.00 0.00 ? 118 THR A HG21 4  
ATOM 8489  H HG22 . THR A 1 118 ? 9.447   -34.121 19.928  1.00 0.00 ? 118 THR A HG22 4  
ATOM 8490  H HG23 . THR A 1 118 ? 7.864   -34.682 20.466  1.00 0.00 ? 118 THR A HG23 4  
ATOM 8491  N N    . ASP A 1 119 ? 12.366  -33.523 23.857  1.00 0.00 ? 119 ASP A N    4  
ATOM 8492  C CA   . ASP A 1 119 ? 12.791  -33.153 25.202  1.00 0.00 ? 119 ASP A CA   4  
ATOM 8493  C C    . ASP A 1 119 ? 13.714  -31.939 25.166  1.00 0.00 ? 119 ASP A C    4  
ATOM 8494  O O    . ASP A 1 119 ? 14.792  -31.983 24.572  1.00 0.00 ? 119 ASP A O    4  
ATOM 8495  C CB   . ASP A 1 119 ? 13.500  -34.328 25.878  1.00 0.00 ? 119 ASP A CB   4  
ATOM 8496  C CG   . ASP A 1 119 ? 13.180  -34.424 27.356  1.00 0.00 ? 119 ASP A CG   4  
ATOM 8497  O OD1  . ASP A 1 119 ? 12.673  -33.432 27.919  1.00 0.00 ? 119 ASP A OD1  4  
ATOM 8498  O OD2  . ASP A 1 119 ? 13.438  -35.492 27.951  1.00 0.00 ? 119 ASP A OD2  4  
ATOM 8499  H H    . ASP A 1 119 ? 13.045  -33.681 23.168  1.00 0.00 ? 119 ASP A H    4  
ATOM 8500  H HA   . ASP A 1 119 ? 11.909  -32.902 25.771  1.00 0.00 ? 119 ASP A HA   4  
ATOM 8501  H HB2  . ASP A 1 119 ? 13.191  -35.248 25.402  1.00 0.00 ? 119 ASP A HB2  4  
ATOM 8502  H HB3  . ASP A 1 119 ? 14.567  -34.209 25.765  1.00 0.00 ? 119 ASP A HB3  4  
ATOM 8503  N N    . LEU A 1 120 ? 13.284  -30.856 25.804  1.00 0.00 ? 120 LEU A N    4  
ATOM 8504  C CA   . LEU A 1 120 ? 14.071  -29.628 25.844  1.00 0.00 ? 120 LEU A CA   4  
ATOM 8505  C C    . LEU A 1 120 ? 15.313  -29.806 26.712  1.00 0.00 ? 120 LEU A C    4  
ATOM 8506  O O    . LEU A 1 120 ? 16.347  -29.188 26.464  1.00 0.00 ? 120 LEU A O    4  
ATOM 8507  C CB   . LEU A 1 120 ? 13.223  -28.473 26.379  1.00 0.00 ? 120 LEU A CB   4  
ATOM 8508  C CG   . LEU A 1 120 ? 13.142  -27.232 25.489  1.00 0.00 ? 120 LEU A CG   4  
ATOM 8509  C CD1  . LEU A 1 120 ? 14.534  -26.779 25.077  1.00 0.00 ? 120 LEU A CD1  4  
ATOM 8510  C CD2  . LEU A 1 120 ? 12.285  -27.510 24.262  1.00 0.00 ? 120 LEU A CD2  4  
ATOM 8511  H H    . LEU A 1 120 ? 12.416  -30.881 26.259  1.00 0.00 ? 120 LEU A H    4  
ATOM 8512  H HA   . LEU A 1 120 ? 14.380  -29.400 24.835  1.00 0.00 ? 120 LEU A HA   4  
ATOM 8513  H HB2  . LEU A 1 120 ? 12.219  -28.840 26.526  1.00 0.00 ? 120 LEU A HB2  4  
ATOM 8514  H HB3  . LEU A 1 120 ? 13.637  -28.172 27.331  1.00 0.00 ? 120 LEU A HB3  4  
ATOM 8515  H HG   . LEU A 1 120 ? 12.681  -26.427 26.045  1.00 0.00 ? 120 LEU A HG   4  
ATOM 8516  H HD11 . LEU A 1 120 ? 15.273  -27.330 25.639  1.00 0.00 ? 120 LEU A HD11 4  
ATOM 8517  H HD12 . LEU A 1 120 ? 14.643  -25.723 25.277  1.00 0.00 ? 120 LEU A HD12 4  
ATOM 8518  H HD13 . LEU A 1 120 ? 14.674  -26.961 24.022  1.00 0.00 ? 120 LEU A HD13 4  
ATOM 8519  H HD21 . LEU A 1 120 ? 12.125  -28.574 24.170  1.00 0.00 ? 120 LEU A HD21 4  
ATOM 8520  H HD22 . LEU A 1 120 ? 12.790  -27.144 23.380  1.00 0.00 ? 120 LEU A HD22 4  
ATOM 8521  H HD23 . LEU A 1 120 ? 11.334  -27.010 24.367  1.00 0.00 ? 120 LEU A HD23 4  
ATOM 8522  N N    . GLU A 1 121 ? 15.203  -30.657 27.727  1.00 0.00 ? 121 GLU A N    4  
ATOM 8523  C CA   . GLU A 1 121 ? 16.318  -30.917 28.629  1.00 0.00 ? 121 GLU A CA   4  
ATOM 8524  C C    . GLU A 1 121 ? 17.371  -31.792 27.955  1.00 0.00 ? 121 GLU A C    4  
ATOM 8525  O O    . GLU A 1 121 ? 18.563  -31.674 28.236  1.00 0.00 ? 121 GLU A O    4  
ATOM 8526  C CB   . GLU A 1 121 ? 15.821  -31.593 29.909  1.00 0.00 ? 121 GLU A CB   4  
ATOM 8527  C CG   . GLU A 1 121 ? 15.097  -30.649 30.854  1.00 0.00 ? 121 GLU A CG   4  
ATOM 8528  C CD   . GLU A 1 121 ? 15.472  -30.876 32.306  1.00 0.00 ? 121 GLU A CD   4  
ATOM 8529  O OE1  . GLU A 1 121 ? 16.683  -30.973 32.597  1.00 0.00 ? 121 GLU A OE1  4  
ATOM 8530  O OE2  . GLU A 1 121 ? 14.556  -30.956 33.150  1.00 0.00 ? 121 GLU A OE2  4  
ATOM 8531  H H    . GLU A 1 121 ? 14.351  -31.120 27.873  1.00 0.00 ? 121 GLU A H    4  
ATOM 8532  H HA   . GLU A 1 121 ? 16.766  -29.969 28.885  1.00 0.00 ? 121 GLU A HA   4  
ATOM 8533  H HB2  . GLU A 1 121 ? 15.144  -32.391 29.641  1.00 0.00 ? 121 GLU A HB2  4  
ATOM 8534  H HB3  . GLU A 1 121 ? 16.668  -32.013 30.432  1.00 0.00 ? 121 GLU A HB3  4  
ATOM 8535  H HG2  . GLU A 1 121 ? 15.346  -29.633 30.589  1.00 0.00 ? 121 GLU A HG2  4  
ATOM 8536  H HG3  . GLU A 1 121 ? 14.032  -30.798 30.745  1.00 0.00 ? 121 GLU A HG3  4  
ATOM 8537  N N    . ALA A 1 122 ? 16.921  -32.670 27.065  1.00 0.00 ? 122 ALA A N    4  
ATOM 8538  C CA   . ALA A 1 122 ? 17.823  -33.564 26.350  1.00 0.00 ? 122 ALA A CA   4  
ATOM 8539  C C    . ALA A 1 122 ? 18.372  -32.899 25.092  1.00 0.00 ? 122 ALA A C    4  
ATOM 8540  O O    . ALA A 1 122 ? 19.444  -33.257 24.607  1.00 0.00 ? 122 ALA A O    4  
ATOM 8541  C CB   . ALA A 1 122 ? 17.110  -34.860 25.995  1.00 0.00 ? 122 ALA A CB   4  
ATOM 8542  H H    . ALA A 1 122 ? 15.959  -32.717 26.885  1.00 0.00 ? 122 ALA A H    4  
ATOM 8543  H HA   . ALA A 1 122 ? 18.646  -33.803 27.007  1.00 0.00 ? 122 ALA A HA   4  
ATOM 8544  H HB1  . ALA A 1 122 ? 16.830  -34.842 24.951  1.00 0.00 ? 122 ALA A HB1  4  
ATOM 8545  H HB2  . ALA A 1 122 ? 17.769  -35.695 26.177  1.00 0.00 ? 122 ALA A HB2  4  
ATOM 8546  H HB3  . ALA A 1 122 ? 16.224  -34.962 26.603  1.00 0.00 ? 122 ALA A HB3  4  
ATOM 8547  N N    . ALA A 1 123 ? 17.629  -31.928 24.569  1.00 0.00 ? 123 ALA A N    4  
ATOM 8548  C CA   . ALA A 1 123 ? 18.043  -31.212 23.369  1.00 0.00 ? 123 ALA A CA   4  
ATOM 8549  C C    . ALA A 1 123 ? 19.093  -30.155 23.695  1.00 0.00 ? 123 ALA A C    4  
ATOM 8550  O O    . ALA A 1 123 ? 19.909  -29.796 22.847  1.00 0.00 ? 123 ALA A O    4  
ATOM 8551  C CB   . ALA A 1 123 ? 16.838  -30.572 22.695  1.00 0.00 ? 123 ALA A CB   4  
ATOM 8552  H H    . ALA A 1 123 ? 16.784  -31.688 25.002  1.00 0.00 ? 123 ALA A H    4  
ATOM 8553  H HA   . ALA A 1 123 ? 18.470  -31.930 22.683  1.00 0.00 ? 123 ALA A HA   4  
ATOM 8554  H HB1  . ALA A 1 123 ? 16.338  -29.921 23.397  1.00 0.00 ? 123 ALA A HB1  4  
ATOM 8555  H HB2  . ALA A 1 123 ? 17.167  -29.998 21.842  1.00 0.00 ? 123 ALA A HB2  4  
ATOM 8556  H HB3  . ALA A 1 123 ? 16.156  -31.344 22.370  1.00 0.00 ? 123 ALA A HB3  4  
ATOM 8557  N N    . ALA A 1 124 ? 19.065  -29.661 24.928  1.00 0.00 ? 124 ALA A N    4  
ATOM 8558  C CA   . ALA A 1 124 ? 20.015  -28.646 25.366  1.00 0.00 ? 124 ALA A CA   4  
ATOM 8559  C C    . ALA A 1 124 ? 21.363  -29.269 25.714  1.00 0.00 ? 124 ALA A C    4  
ATOM 8560  O O    . ALA A 1 124 ? 22.382  -28.580 25.764  1.00 0.00 ? 124 ALA A O    4  
ATOM 8561  C CB   . ALA A 1 124 ? 19.461  -27.884 26.560  1.00 0.00 ? 124 ALA A CB   4  
ATOM 8562  H H    . ALA A 1 124 ? 18.391  -29.988 25.559  1.00 0.00 ? 124 ALA A H    4  
ATOM 8563  H HA   . ALA A 1 124 ? 20.153  -27.945 24.555  1.00 0.00 ? 124 ALA A HA   4  
ATOM 8564  H HB1  . ALA A 1 124 ? 20.279  -27.521 27.166  1.00 0.00 ? 124 ALA A HB1  4  
ATOM 8565  H HB2  . ALA A 1 124 ? 18.872  -27.048 26.212  1.00 0.00 ? 124 ALA A HB2  4  
ATOM 8566  H HB3  . ALA A 1 124 ? 18.839  -28.541 27.150  1.00 0.00 ? 124 ALA A HB3  4  
ATOM 8567  N N    . ARG A 1 125 ? 21.361  -30.577 25.954  1.00 0.00 ? 125 ARG A N    4  
ATOM 8568  C CA   . ARG A 1 125 ? 22.584  -31.292 26.298  1.00 0.00 ? 125 ARG A CA   4  
ATOM 8569  C C    . ARG A 1 125 ? 23.646  -31.105 25.219  1.00 0.00 ? 125 ARG A C    4  
ATOM 8570  O O    . ARG A 1 125 ? 24.842  -31.222 25.485  1.00 0.00 ? 125 ARG A O    4  
ATOM 8571  C CB   . ARG A 1 125 ? 22.292  -32.782 26.489  1.00 0.00 ? 125 ARG A CB   4  
ATOM 8572  C CG   . ARG A 1 125 ? 21.612  -33.105 27.810  1.00 0.00 ? 125 ARG A CG   4  
ATOM 8573  C CD   . ARG A 1 125 ? 22.533  -32.838 28.990  1.00 0.00 ? 125 ARG A CD   4  
ATOM 8574  N NE   . ARG A 1 125 ? 23.081  -34.072 29.546  1.00 0.00 ? 125 ARG A NE   4  
ATOM 8575  C CZ   . ARG A 1 125 ? 22.420  -34.854 30.392  1.00 0.00 ? 125 ARG A CZ   4  
ATOM 8576  N NH1  . ARG A 1 125 ? 21.193  -34.532 30.778  1.00 0.00 ? 125 ARG A NH1  4  
ATOM 8577  N NH2  . ARG A 1 125 ? 22.987  -35.962 30.855  1.00 0.00 ? 125 ARG A NH2  4  
ATOM 8578  H H    . ARG A 1 125 ? 20.517  -31.072 25.898  1.00 0.00 ? 125 ARG A H    4  
ATOM 8579  H HA   . ARG A 1 125 ? 22.955  -30.885 27.227  1.00 0.00 ? 125 ARG A HA   4  
ATOM 8580  H HB2  . ARG A 1 125 ? 21.649  -33.116 25.688  1.00 0.00 ? 125 ARG A HB2  4  
ATOM 8581  H HB3  . ARG A 1 125 ? 23.222  -33.327 26.446  1.00 0.00 ? 125 ARG A HB3  4  
ATOM 8582  H HG2  . ARG A 1 125 ? 20.730  -32.490 27.910  1.00 0.00 ? 125 ARG A HG2  4  
ATOM 8583  H HG3  . ARG A 1 125 ? 21.329  -34.147 27.813  1.00 0.00 ? 125 ARG A HG3  4  
ATOM 8584  H HD2  . ARG A 1 125 ? 23.347  -32.211 28.660  1.00 0.00 ? 125 ARG A HD2  4  
ATOM 8585  H HD3  . ARG A 1 125 ? 21.973  -32.326 29.758  1.00 0.00 ? 125 ARG A HD3  4  
ATOM 8586  H HE   . ARG A 1 125 ? 23.986  -34.330 29.275  1.00 0.00 ? 125 ARG A HE   4  
ATOM 8587  H HH11 . ARG A 1 125 ? 20.764  -33.699 30.430  1.00 0.00 ? 125 ARG A HH11 4  
ATOM 8588  H HH12 . ARG A 1 125 ? 20.697  -35.123 31.414  1.00 0.00 ? 125 ARG A HH12 4  
ATOM 8589  H HH21 . ARG A 1 125 ? 23.911  -36.208 30.566  1.00 0.00 ? 125 ARG A HH21 4  
ATOM 8590  H HH22 . ARG A 1 125 ? 22.489  -36.549 31.492  1.00 0.00 ? 125 ARG A HH22 4  
ATOM 8591  N N    . MET A 1 126 ? 23.200  -30.815 24.001  1.00 0.00 ? 126 MET A N    4  
ATOM 8592  C CA   . MET A 1 126 ? 24.112  -30.611 22.882  1.00 0.00 ? 126 MET A CA   4  
ATOM 8593  C C    . MET A 1 126 ? 24.260  -29.127 22.564  1.00 0.00 ? 126 MET A C    4  
ATOM 8594  O O    . MET A 1 126 ? 25.323  -28.678 22.135  1.00 0.00 ? 126 MET A O    4  
ATOM 8595  C CB   . MET A 1 126 ? 23.613  -31.362 21.646  1.00 0.00 ? 126 MET A CB   4  
ATOM 8596  C CG   . MET A 1 126 ? 23.181  -32.791 21.936  1.00 0.00 ? 126 MET A CG   4  
ATOM 8597  S SD   . MET A 1 126 ? 22.754  -33.705 20.442  1.00 0.00 ? 126 MET A SD   4  
ATOM 8598  C CE   . MET A 1 126 ? 21.078  -34.210 20.821  1.00 0.00 ? 126 MET A CE   4  
ATOM 8599  H H    . MET A 1 126 ? 22.234  -30.735 23.851  1.00 0.00 ? 126 MET A H    4  
ATOM 8600  H HA   . MET A 1 126 ? 25.077  -31.005 23.166  1.00 0.00 ? 126 MET A HA   4  
ATOM 8601  H HB2  . MET A 1 126 ? 22.769  -30.831 21.233  1.00 0.00 ? 126 MET A HB2  4  
ATOM 8602  H HB3  . MET A 1 126 ? 24.405  -31.392 20.913  1.00 0.00 ? 126 MET A HB3  4  
ATOM 8603  H HG2  . MET A 1 126 ? 23.989  -33.303 22.436  1.00 0.00 ? 126 MET A HG2  4  
ATOM 8604  H HG3  . MET A 1 126 ? 22.318  -32.766 22.586  1.00 0.00 ? 126 MET A HG3  4  
ATOM 8605  H HE1  . MET A 1 126 ? 21.032  -34.571 21.838  1.00 0.00 ? 126 MET A HE1  4  
ATOM 8606  H HE2  . MET A 1 126 ? 20.414  -33.366 20.707  1.00 0.00 ? 126 MET A HE2  4  
ATOM 8607  H HE3  . MET A 1 126 ? 20.779  -34.998 20.145  1.00 0.00 ? 126 MET A HE3  4  
ATOM 8608  N N    . ILE A 1 127 ? 23.188  -28.371 22.777  1.00 0.00 ? 127 ILE A N    4  
ATOM 8609  C CA   . ILE A 1 127 ? 23.200  -26.938 22.513  1.00 0.00 ? 127 ILE A CA   4  
ATOM 8610  C C    . ILE A 1 127 ? 24.045  -26.197 23.543  1.00 0.00 ? 127 ILE A C    4  
ATOM 8611  O O    . ILE A 1 127 ? 24.559  -25.112 23.274  1.00 0.00 ? 127 ILE A O    4  
ATOM 8612  C CB   . ILE A 1 127 ? 21.775  -26.353 22.518  1.00 0.00 ? 127 ILE A CB   4  
ATOM 8613  C CG1  . ILE A 1 127 ? 20.910  -27.050 21.466  1.00 0.00 ? 127 ILE A CG1  4  
ATOM 8614  C CG2  . ILE A 1 127 ? 21.817  -24.853 22.267  1.00 0.00 ? 127 ILE A CG2  4  
ATOM 8615  C CD1  . ILE A 1 127 ? 21.380  -26.818 20.047  1.00 0.00 ? 127 ILE A CD1  4  
ATOM 8616  H H    . ILE A 1 127 ? 22.370  -28.788 23.120  1.00 0.00 ? 127 ILE A H    4  
ATOM 8617  H HA   . ILE A 1 127 ? 23.628  -26.783 21.533  1.00 0.00 ? 127 ILE A HA   4  
ATOM 8618  H HB   . ILE A 1 127 ? 21.345  -26.518 23.494  1.00 0.00 ? 127 ILE A HB   4  
ATOM 8619  H HG12 . ILE A 1 127 ? 20.920  -28.113 21.648  1.00 0.00 ? 127 ILE A HG12 4  
ATOM 8620  H HG13 . ILE A 1 127 ? 19.896  -26.685 21.545  1.00 0.00 ? 127 ILE A HG13 4  
ATOM 8621  H HG21 . ILE A 1 127 ? 20.810  -24.470 22.205  1.00 0.00 ? 127 ILE A HG21 4  
ATOM 8622  H HG22 . ILE A 1 127 ? 22.337  -24.367 23.079  1.00 0.00 ? 127 ILE A HG22 4  
ATOM 8623  H HG23 . ILE A 1 127 ? 22.335  -24.657 21.340  1.00 0.00 ? 127 ILE A HG23 4  
ATOM 8624  H HD11 . ILE A 1 127 ? 22.365  -27.243 19.919  1.00 0.00 ? 127 ILE A HD11 4  
ATOM 8625  H HD12 . ILE A 1 127 ? 20.693  -27.286 19.359  1.00 0.00 ? 127 ILE A HD12 4  
ATOM 8626  H HD13 . ILE A 1 127 ? 21.419  -25.756 19.850  1.00 0.00 ? 127 ILE A HD13 4  
ATOM 8627  N N    . ALA A 1 128 ? 24.185  -26.791 24.724  1.00 0.00 ? 128 ALA A N    4  
ATOM 8628  C CA   . ALA A 1 128 ? 24.972  -26.189 25.793  1.00 0.00 ? 128 ALA A CA   4  
ATOM 8629  C C    . ALA A 1 128 ? 26.455  -26.168 25.439  1.00 0.00 ? 128 ALA A C    4  
ATOM 8630  O O    . ALA A 1 128 ? 27.208  -25.327 25.928  1.00 0.00 ? 128 ALA A O    4  
ATOM 8631  C CB   . ALA A 1 128 ? 24.749  -26.939 27.098  1.00 0.00 ? 128 ALA A CB   4  
ATOM 8632  H H    . ALA A 1 128 ? 23.751  -27.655 24.878  1.00 0.00 ? 128 ALA A H    4  
ATOM 8633  H HA   . ALA A 1 128 ? 24.630  -25.173 25.928  1.00 0.00 ? 128 ALA A HA   4  
ATOM 8634  H HB1  . ALA A 1 128 ? 24.261  -27.881 26.892  1.00 0.00 ? 128 ALA A HB1  4  
ATOM 8635  H HB2  . ALA A 1 128 ? 25.700  -27.122 27.575  1.00 0.00 ? 128 ALA A HB2  4  
ATOM 8636  H HB3  . ALA A 1 128 ? 24.126  -26.346 27.752  1.00 0.00 ? 128 ALA A HB3  4  
ATOM 8637  N N    . GLY A 1 129 ? 26.868  -27.101 24.587  1.00 0.00 ? 129 GLY A N    4  
ATOM 8638  C CA   . GLY A 1 129 ? 28.260  -27.172 24.183  1.00 0.00 ? 129 GLY A CA   4  
ATOM 8639  C C    . GLY A 1 129 ? 28.539  -26.381 22.921  1.00 0.00 ? 129 GLY A C    4  
ATOM 8640  O O    . GLY A 1 129 ? 29.546  -26.605 22.248  1.00 0.00 ? 129 GLY A O    4  
ATOM 8641  H H    . GLY A 1 129 ? 26.223  -27.746 24.229  1.00 0.00 ? 129 GLY A H    4  
ATOM 8642  H HA2  . GLY A 1 129 ? 28.876  -26.786 24.981  1.00 0.00 ? 129 GLY A HA2  4  
ATOM 8643  H HA3  . GLY A 1 129 ? 28.520  -28.206 24.010  1.00 0.00 ? 129 GLY A HA3  4  
ATOM 8644  N N    . SER A 1 130 ? 27.645  -25.452 22.597  1.00 0.00 ? 130 SER A N    4  
ATOM 8645  C CA   . SER A 1 130 ? 27.797  -24.628 21.403  1.00 0.00 ? 130 SER A CA   4  
ATOM 8646  C C    . SER A 1 130 ? 28.531  -23.331 21.729  1.00 0.00 ? 130 SER A C    4  
ATOM 8647  O O    . SER A 1 130 ? 29.176  -22.736 20.866  1.00 0.00 ? 130 SER A O    4  
ATOM 8648  C CB   . SER A 1 130 ? 26.428  -24.315 20.796  1.00 0.00 ? 130 SER A CB   4  
ATOM 8649  O OG   . SER A 1 130 ? 26.415  -24.576 19.404  1.00 0.00 ? 130 SER A OG   4  
ATOM 8650  H H    . SER A 1 130 ? 26.863  -25.320 23.173  1.00 0.00 ? 130 SER A H    4  
ATOM 8651  H HA   . SER A 1 130 ? 28.379  -25.187 20.686  1.00 0.00 ? 130 SER A HA   4  
ATOM 8652  H HB2  . SER A 1 130 ? 25.677  -24.927 21.272  1.00 0.00 ? 130 SER A HB2  4  
ATOM 8653  H HB3  . SER A 1 130 ? 26.196  -23.272 20.957  1.00 0.00 ? 130 SER A HB3  4  
ATOM 8654  H HG   . SER A 1 130 ? 26.256  -23.759 18.926  1.00 0.00 ? 130 SER A HG   4  
ATOM 8655  N N    . ALA A 1 131 ? 28.427  -22.898 22.981  1.00 0.00 ? 131 ALA A N    4  
ATOM 8656  C CA   . ALA A 1 131 ? 29.081  -21.673 23.422  1.00 0.00 ? 131 ALA A CA   4  
ATOM 8657  C C    . ALA A 1 131 ? 30.495  -21.954 23.921  1.00 0.00 ? 131 ALA A C    4  
ATOM 8658  O O    . ALA A 1 131 ? 31.343  -21.062 23.947  1.00 0.00 ? 131 ALA A O    4  
ATOM 8659  C CB   . ALA A 1 131 ? 28.260  -20.998 24.511  1.00 0.00 ? 131 ALA A CB   4  
ATOM 8660  H H    . ALA A 1 131 ? 27.898  -23.416 23.623  1.00 0.00 ? 131 ALA A H    4  
ATOM 8661  H HA   . ALA A 1 131 ? 29.136  -21.000 22.578  1.00 0.00 ? 131 ALA A HA   4  
ATOM 8662  H HB1  . ALA A 1 131 ? 27.218  -20.998 24.226  1.00 0.00 ? 131 ALA A HB1  4  
ATOM 8663  H HB2  . ALA A 1 131 ? 28.380  -21.537 25.439  1.00 0.00 ? 131 ALA A HB2  4  
ATOM 8664  H HB3  . ALA A 1 131 ? 28.598  -19.981 24.639  1.00 0.00 ? 131 ALA A HB3  4  
ATOM 8665  N N    . ARG A 1 132 ? 30.740  -23.199 24.316  1.00 0.00 ? 132 ARG A N    4  
ATOM 8666  C CA   . ARG A 1 132 ? 32.051  -23.597 24.816  1.00 0.00 ? 132 ARG A CA   4  
ATOM 8667  C C    . ARG A 1 132 ? 33.118  -23.430 23.739  1.00 0.00 ? 132 ARG A C    4  
ATOM 8668  O O    . ARG A 1 132 ? 34.313  -23.400 24.033  1.00 0.00 ? 132 ARG A O    4  
ATOM 8669  C CB   . ARG A 1 132 ? 32.018  -25.050 25.295  1.00 0.00 ? 132 ARG A CB   4  
ATOM 8670  C CG   . ARG A 1 132 ? 31.834  -26.057 24.172  1.00 0.00 ? 132 ARG A CG   4  
ATOM 8671  C CD   . ARG A 1 132 ? 33.172  -26.536 23.629  1.00 0.00 ? 132 ARG A CD   4  
ATOM 8672  N NE   . ARG A 1 132 ? 33.234  -27.992 23.534  1.00 0.00 ? 132 ARG A NE   4  
ATOM 8673  C CZ   . ARG A 1 132 ? 34.261  -28.651 23.008  1.00 0.00 ? 132 ARG A CZ   4  
ATOM 8674  N NH1  . ARG A 1 132 ? 35.305  -27.987 22.533  1.00 0.00 ? 132 ARG A NH1  4  
ATOM 8675  N NH2  . ARG A 1 132 ? 34.244  -29.976 22.957  1.00 0.00 ? 132 ARG A NH2  4  
ATOM 8676  H H    . ARG A 1 132 ? 30.023  -23.866 24.272  1.00 0.00 ? 132 ARG A H    4  
ATOM 8677  H HA   . ARG A 1 132 ? 32.296  -22.958 25.651  1.00 0.00 ? 132 ARG A HA   4  
ATOM 8678  H HB2  . ARG A 1 132 ? 32.947  -25.272 25.800  1.00 0.00 ? 132 ARG A HB2  4  
ATOM 8679  H HB3  . ARG A 1 132 ? 31.202  -25.167 25.992  1.00 0.00 ? 132 ARG A HB3  4  
ATOM 8680  H HG2  . ARG A 1 132 ? 31.286  -26.908 24.550  1.00 0.00 ? 132 ARG A HG2  4  
ATOM 8681  H HG3  . ARG A 1 132 ? 31.276  -25.593 23.373  1.00 0.00 ? 132 ARG A HG3  4  
ATOM 8682  H HD2  . ARG A 1 132 ? 33.317  -26.114 22.646  1.00 0.00 ? 132 ARG A HD2  4  
ATOM 8683  H HD3  . ARG A 1 132 ? 33.955  -26.193 24.288  1.00 0.00 ? 132 ARG A HD3  4  
ATOM 8684  H HE   . ARG A 1 132 ? 32.473  -28.502 23.879  1.00 0.00 ? 132 ARG A HE   4  
ATOM 8685  H HH11 . ARG A 1 132 ? 35.321  -26.988 22.571  1.00 0.00 ? 132 ARG A HH11 4  
ATOM 8686  H HH12 . ARG A 1 132 ? 36.078  -28.485 22.138  1.00 0.00 ? 132 ARG A HH12 4  
ATOM 8687  H HH21 . ARG A 1 132 ? 33.458  -30.480 23.315  1.00 0.00 ? 132 ARG A HH21 4  
ATOM 8688  H HH22 . ARG A 1 132 ? 35.017  -30.471 22.561  1.00 0.00 ? 132 ARG A HH22 4  
ATOM 8689  N N    . SER A 1 133 ? 32.678  -23.321 22.489  1.00 0.00 ? 133 SER A N    4  
ATOM 8690  C CA   . SER A 1 133 ? 33.595  -23.161 21.367  1.00 0.00 ? 133 SER A CA   4  
ATOM 8691  C C    . SER A 1 133 ? 34.010  -21.702 21.208  1.00 0.00 ? 133 SER A C    4  
ATOM 8692  O O    . SER A 1 133 ? 35.083  -21.404 20.686  1.00 0.00 ? 133 SER A O    4  
ATOM 8693  C CB   . SER A 1 133 ? 32.945  -23.662 20.075  1.00 0.00 ? 133 SER A CB   4  
ATOM 8694  O OG   . SER A 1 133 ? 32.286  -22.609 19.394  1.00 0.00 ? 133 SER A OG   4  
ATOM 8695  H H    . SER A 1 133 ? 31.713  -23.352 22.318  1.00 0.00 ? 133 SER A H    4  
ATOM 8696  H HA   . SER A 1 133 ? 34.474  -23.753 21.571  1.00 0.00 ? 133 SER A HA   4  
ATOM 8697  H HB2  . SER A 1 133 ? 33.706  -24.072 19.428  1.00 0.00 ? 133 SER A HB2  4  
ATOM 8698  H HB3  . SER A 1 133 ? 32.223  -24.429 20.313  1.00 0.00 ? 133 SER A HB3  4  
ATOM 8699  H HG   . SER A 1 133 ? 32.082  -22.885 18.498  1.00 0.00 ? 133 SER A HG   4  
ATOM 8700  N N    . MET A 1 134 ? 33.150  -20.796 21.663  1.00 0.00 ? 134 MET A N    4  
ATOM 8701  C CA   . MET A 1 134 ? 33.427  -19.367 21.573  1.00 0.00 ? 134 MET A CA   4  
ATOM 8702  C C    . MET A 1 134 ? 34.171  -18.878 22.812  1.00 0.00 ? 134 MET A C    4  
ATOM 8703  O O    . MET A 1 134 ? 34.882  -17.875 22.766  1.00 0.00 ? 134 MET A O    4  
ATOM 8704  C CB   . MET A 1 134 ? 32.125  -18.583 21.403  1.00 0.00 ? 134 MET A CB   4  
ATOM 8705  C CG   . MET A 1 134 ? 31.171  -19.200 20.393  1.00 0.00 ? 134 MET A CG   4  
ATOM 8706  S SD   . MET A 1 134 ? 30.298  -17.962 19.416  1.00 0.00 ? 134 MET A SD   4  
ATOM 8707  C CE   . MET A 1 134 ? 28.815  -17.741 20.396  1.00 0.00 ? 134 MET A CE   4  
ATOM 8708  H H    . MET A 1 134 ? 32.310  -21.095 22.070  1.00 0.00 ? 134 MET A H    4  
ATOM 8709  H HA   . MET A 1 134 ? 34.050  -19.205 20.706  1.00 0.00 ? 134 MET A HA   4  
ATOM 8710  H HB2  . MET A 1 134 ? 31.622  -18.533 22.357  1.00 0.00 ? 134 MET A HB2  4  
ATOM 8711  H HB3  . MET A 1 134 ? 32.361  -17.581 21.077  1.00 0.00 ? 134 MET A HB3  4  
ATOM 8712  H HG2  . MET A 1 134 ? 31.735  -19.833 19.725  1.00 0.00 ? 134 MET A HG2  4  
ATOM 8713  H HG3  . MET A 1 134 ? 30.445  -19.798 20.924  1.00 0.00 ? 134 MET A HG3  4  
ATOM 8714  H HE1  . MET A 1 134 ? 27.947  -17.945 19.787  1.00 0.00 ? 134 MET A HE1  4  
ATOM 8715  H HE2  . MET A 1 134 ? 28.834  -18.420 21.235  1.00 0.00 ? 134 MET A HE2  4  
ATOM 8716  H HE3  . MET A 1 134 ? 28.770  -16.723 20.756  1.00 0.00 ? 134 MET A HE3  4  
ATOM 8717  N N    . GLY A 1 135 ? 34.002  -19.595 23.920  1.00 0.00 ? 135 GLY A N    4  
ATOM 8718  C CA   . GLY A 1 135 ? 34.663  -19.217 25.155  1.00 0.00 ? 135 GLY A CA   4  
ATOM 8719  C C    . GLY A 1 135 ? 33.682  -18.948 26.279  1.00 0.00 ? 135 GLY A C    4  
ATOM 8720  O O    . GLY A 1 135 ? 33.798  -17.948 26.988  1.00 0.00 ? 135 GLY A O    4  
ATOM 8721  H H    . GLY A 1 135 ? 33.423  -20.385 23.897  1.00 0.00 ? 135 GLY A H    4  
ATOM 8722  H HA2  . GLY A 1 135 ? 35.326  -20.015 25.454  1.00 0.00 ? 135 GLY A HA2  4  
ATOM 8723  H HA3  . GLY A 1 135 ? 35.246  -18.325 24.980  1.00 0.00 ? 135 GLY A HA3  4  
ATOM 8724  N N    . VAL A 1 136 ? 32.711  -19.841 26.442  1.00 0.00 ? 136 VAL A N    4  
ATOM 8725  C CA   . VAL A 1 136 ? 31.705  -19.694 27.487  1.00 0.00 ? 136 VAL A CA   4  
ATOM 8726  C C    . VAL A 1 136 ? 31.587  -20.966 28.319  1.00 0.00 ? 136 VAL A C    4  
ATOM 8727  O O    . VAL A 1 136 ? 31.817  -22.068 27.821  1.00 0.00 ? 136 VAL A O    4  
ATOM 8728  C CB   . VAL A 1 136 ? 30.325  -19.352 26.894  1.00 0.00 ? 136 VAL A CB   4  
ATOM 8729  C CG1  . VAL A 1 136 ? 29.334  -19.023 28.000  1.00 0.00 ? 136 VAL A CG1  4  
ATOM 8730  C CG2  . VAL A 1 136 ? 30.440  -18.198 25.909  1.00 0.00 ? 136 VAL A CG2  4  
ATOM 8731  H H    . VAL A 1 136 ? 32.671  -20.617 25.845  1.00 0.00 ? 136 VAL A H    4  
ATOM 8732  H HA   . VAL A 1 136 ? 32.008  -18.881 28.130  1.00 0.00 ? 136 VAL A HA   4  
ATOM 8733  H HB   . VAL A 1 136 ? 29.961  -20.218 26.360  1.00 0.00 ? 136 VAL A HB   4  
ATOM 8734  H HG11 . VAL A 1 136 ? 28.720  -19.889 28.202  1.00 0.00 ? 136 VAL A HG11 4  
ATOM 8735  H HG12 . VAL A 1 136 ? 29.872  -18.746 28.895  1.00 0.00 ? 136 VAL A HG12 4  
ATOM 8736  H HG13 . VAL A 1 136 ? 28.706  -18.202 27.688  1.00 0.00 ? 136 VAL A HG13 4  
ATOM 8737  H HG21 . VAL A 1 136 ? 30.959  -18.532 25.023  1.00 0.00 ? 136 VAL A HG21 4  
ATOM 8738  H HG22 . VAL A 1 136 ? 29.451  -17.855 25.639  1.00 0.00 ? 136 VAL A HG22 4  
ATOM 8739  H HG23 . VAL A 1 136 ? 30.990  -17.388 26.365  1.00 0.00 ? 136 VAL A HG23 4  
ATOM 8740  N N    . GLU A 1 137 ? 31.227  -20.805 29.588  1.00 0.00 ? 137 GLU A N    4  
ATOM 8741  C CA   . GLU A 1 137 ? 31.079  -21.942 30.490  1.00 0.00 ? 137 GLU A CA   4  
ATOM 8742  C C    . GLU A 1 137 ? 29.608  -22.208 30.793  1.00 0.00 ? 137 GLU A C    4  
ATOM 8743  O O    . GLU A 1 137 ? 28.952  -21.425 31.480  1.00 0.00 ? 137 GLU A O    4  
ATOM 8744  C CB   . GLU A 1 137 ? 31.842  -21.691 31.792  1.00 0.00 ? 137 GLU A CB   4  
ATOM 8745  C CG   . GLU A 1 137 ? 32.737  -22.847 32.206  1.00 0.00 ? 137 GLU A CG   4  
ATOM 8746  C CD   . GLU A 1 137 ? 33.818  -22.427 33.183  1.00 0.00 ? 137 GLU A CD   4  
ATOM 8747  O OE1  . GLU A 1 137 ? 34.732  -21.681 32.771  1.00 0.00 ? 137 GLU A OE1  4  
ATOM 8748  O OE2  . GLU A 1 137 ? 33.751  -22.844 34.358  1.00 0.00 ? 137 GLU A OE2  4  
ATOM 8749  H H    . GLU A 1 137 ? 31.058  -19.901 29.927  1.00 0.00 ? 137 GLU A H    4  
ATOM 8750  H HA   . GLU A 1 137 ? 31.496  -22.809 30.001  1.00 0.00 ? 137 GLU A HA   4  
ATOM 8751  H HB2  . GLU A 1 137 ? 32.457  -20.811 31.672  1.00 0.00 ? 137 GLU A HB2  4  
ATOM 8752  H HB3  . GLU A 1 137 ? 31.129  -21.514 32.584  1.00 0.00 ? 137 GLU A HB3  4  
ATOM 8753  H HG2  . GLU A 1 137 ? 32.129  -23.608 32.671  1.00 0.00 ? 137 GLU A HG2  4  
ATOM 8754  H HG3  . GLU A 1 137 ? 33.209  -23.254 31.323  1.00 0.00 ? 137 GLU A HG3  4  
ATOM 8755  N N    . VAL A 1 138 ? 29.094  -23.319 30.274  1.00 0.00 ? 138 VAL A N    4  
ATOM 8756  C CA   . VAL A 1 138 ? 27.701  -23.690 30.489  1.00 0.00 ? 138 VAL A CA   4  
ATOM 8757  C C    . VAL A 1 138 ? 27.431  -23.984 31.960  1.00 0.00 ? 138 VAL A C    4  
ATOM 8758  O O    . VAL A 1 138 ? 28.215  -24.663 32.623  1.00 0.00 ? 138 VAL A O    4  
ATOM 8759  C CB   . VAL A 1 138 ? 27.313  -24.923 29.651  1.00 0.00 ? 138 VAL A CB   4  
ATOM 8760  C CG1  . VAL A 1 138 ? 28.089  -26.148 30.112  1.00 0.00 ? 138 VAL A CG1  4  
ATOM 8761  C CG2  . VAL A 1 138 ? 25.814  -25.170 29.730  1.00 0.00 ? 138 VAL A CG2  4  
ATOM 8762  H H    . VAL A 1 138 ? 29.667  -23.904 29.735  1.00 0.00 ? 138 VAL A H    4  
ATOM 8763  H HA   . VAL A 1 138 ? 27.083  -22.861 30.178  1.00 0.00 ? 138 VAL A HA   4  
ATOM 8764  H HB   . VAL A 1 138 ? 27.571  -24.729 28.621  1.00 0.00 ? 138 VAL A HB   4  
ATOM 8765  H HG11 . VAL A 1 138 ? 28.945  -25.834 30.692  1.00 0.00 ? 138 VAL A HG11 4  
ATOM 8766  H HG12 . VAL A 1 138 ? 27.449  -26.771 30.721  1.00 0.00 ? 138 VAL A HG12 4  
ATOM 8767  H HG13 . VAL A 1 138 ? 28.423  -26.707 29.251  1.00 0.00 ? 138 VAL A HG13 4  
ATOM 8768  H HG21 . VAL A 1 138 ? 25.374  -24.488 30.442  1.00 0.00 ? 138 VAL A HG21 4  
ATOM 8769  H HG22 . VAL A 1 138 ? 25.371  -25.011 28.758  1.00 0.00 ? 138 VAL A HG22 4  
ATOM 8770  H HG23 . VAL A 1 138 ? 25.632  -26.187 30.046  1.00 0.00 ? 138 VAL A HG23 4  
ATOM 8771  N N    . VAL A 1 139 ? 26.315  -23.468 32.466  1.00 0.00 ? 139 VAL A N    4  
ATOM 8772  C CA   . VAL A 1 139 ? 25.939  -23.675 33.859  1.00 0.00 ? 139 VAL A CA   4  
ATOM 8773  C C    . VAL A 1 139 ? 24.461  -24.026 33.984  1.00 0.00 ? 139 VAL A C    4  
ATOM 8774  O O    . VAL A 1 139 ? 23.617  -23.455 33.295  1.00 0.00 ? 139 VAL A O    4  
ATOM 8775  C CB   . VAL A 1 139 ? 26.233  -22.427 34.712  1.00 0.00 ? 139 VAL A CB   4  
ATOM 8776  C CG1  . VAL A 1 139 ? 25.793  -22.647 36.151  1.00 0.00 ? 139 VAL A CG1  4  
ATOM 8777  C CG2  . VAL A 1 139 ? 27.711  -22.072 34.645  1.00 0.00 ? 139 VAL A CG2  4  
ATOM 8778  H H    . VAL A 1 139 ? 25.730  -22.935 31.888  1.00 0.00 ? 139 VAL A H    4  
ATOM 8779  H HA   . VAL A 1 139 ? 26.527  -24.495 34.245  1.00 0.00 ? 139 VAL A HA   4  
ATOM 8780  H HB   . VAL A 1 139 ? 25.668  -21.599 34.309  1.00 0.00 ? 139 VAL A HB   4  
ATOM 8781  H HG11 . VAL A 1 139 ? 25.975  -23.675 36.429  1.00 0.00 ? 139 VAL A HG11 4  
ATOM 8782  H HG12 . VAL A 1 139 ? 26.352  -21.992 36.803  1.00 0.00 ? 139 VAL A HG12 4  
ATOM 8783  H HG13 . VAL A 1 139 ? 24.739  -22.432 36.242  1.00 0.00 ? 139 VAL A HG13 4  
ATOM 8784  H HG21 . VAL A 1 139 ? 27.990  -21.528 35.535  1.00 0.00 ? 139 VAL A HG21 4  
ATOM 8785  H HG22 . VAL A 1 139 ? 28.296  -22.978 34.579  1.00 0.00 ? 139 VAL A HG22 4  
ATOM 8786  H HG23 . VAL A 1 139 ? 27.896  -21.461 33.776  1.00 0.00 ? 139 VAL A HG23 4  
ATOM 8787  N N    . GLY A 1 140 ? 24.154  -24.969 34.869  1.00 0.00 ? 140 GLY A N    4  
ATOM 8788  C CA   . GLY A 1 140 ? 22.776  -25.380 35.068  1.00 0.00 ? 140 GLY A CA   4  
ATOM 8789  C C    . GLY A 1 140 ? 22.468  -26.713 34.415  1.00 0.00 ? 140 GLY A C    4  
ATOM 8790  O O    . GLY A 1 140 ? 21.305  -27.054 34.205  1.00 0.00 ? 140 GLY A O    4  
ATOM 8791  H H    . GLY A 1 140 ? 24.869  -25.390 35.390  1.00 0.00 ? 140 GLY A H    4  
ATOM 8792  H HA2  . GLY A 1 140 ? 22.585  -25.457 36.128  1.00 0.00 ? 140 GLY A HA2  4  
ATOM 8793  H HA3  . GLY A 1 140 ? 22.124  -24.628 34.648  1.00 0.00 ? 140 GLY A HA3  4  
ATOM 8794  N N    . ALA A 1 141 ? 23.514  -27.467 34.092  1.00 0.00 ? 141 ALA A N    4  
ATOM 8795  C CA   . ALA A 1 141 ? 23.349  -28.770 33.459  1.00 0.00 ? 141 ALA A CA   4  
ATOM 8796  C C    . ALA A 1 141 ? 23.904  -29.883 34.341  1.00 0.00 ? 141 ALA A C    4  
ATOM 8797  O O    . ALA A 1 141 ? 24.962  -30.452 34.072  1.00 0.00 ? 141 ALA A O    4  
ATOM 8798  C CB   . ALA A 1 141 ? 24.028  -28.785 32.097  1.00 0.00 ? 141 ALA A CB   4  
ATOM 8799  H H    . ALA A 1 141 ? 24.417  -27.140 34.285  1.00 0.00 ? 141 ALA A H    4  
ATOM 8800  H HA   . ALA A 1 141 ? 22.292  -28.937 33.309  1.00 0.00 ? 141 ALA A HA   4  
ATOM 8801  H HB1  . ALA A 1 141 ? 23.924  -27.815 31.634  1.00 0.00 ? 141 ALA A HB1  4  
ATOM 8802  H HB2  . ALA A 1 141 ? 25.076  -29.015 32.220  1.00 0.00 ? 141 ALA A HB2  4  
ATOM 8803  H HB3  . ALA A 1 141 ? 23.565  -29.534 31.473  1.00 0.00 ? 141 ALA A HB3  4  
ATOM 8804  N N    . PRO A 1 142 ? 23.176  -30.201 35.422  1.00 0.00 ? 142 PRO A N    4  
ATOM 8805  C CA   . PRO A 1 142 ? 23.577  -31.249 36.366  1.00 0.00 ? 142 PRO A CA   4  
ATOM 8806  C C    . PRO A 1 142 ? 23.471  -32.645 35.762  1.00 0.00 ? 142 PRO A C    4  
ATOM 8807  O O    . PRO A 1 142 ? 22.705  -32.869 34.826  1.00 0.00 ? 142 PRO A O    4  
ATOM 8808  C CB   . PRO A 1 142 ? 22.581  -31.088 37.518  1.00 0.00 ? 142 PRO A CB   4  
ATOM 8809  C CG   . PRO A 1 142 ? 21.384  -30.455 36.898  1.00 0.00 ? 142 PRO A CG   4  
ATOM 8810  C CD   . PRO A 1 142 ? 21.905  -29.564 35.805  1.00 0.00 ? 142 PRO A CD   4  
ATOM 8811  H HA   . PRO A 1 142 ? 24.581  -31.091 36.731  1.00 0.00 ? 142 PRO A HA   4  
ATOM 8812  H HB2  . PRO A 1 142 ? 22.347  -32.058 37.933  1.00 0.00 ? 142 PRO A HB2  4  
ATOM 8813  H HB3  . PRO A 1 142 ? 23.009  -30.457 38.282  1.00 0.00 ? 142 PRO A HB3  4  
ATOM 8814  H HG2  . PRO A 1 142 ? 20.738  -31.216 36.486  1.00 0.00 ? 142 PRO A HG2  4  
ATOM 8815  H HG3  . PRO A 1 142 ? 20.854  -29.871 37.636  1.00 0.00 ? 142 PRO A HG3  4  
ATOM 8816  H HD2  . PRO A 1 142 ? 21.217  -29.545 34.973  1.00 0.00 ? 142 PRO A HD2  4  
ATOM 8817  H HD3  . PRO A 1 142 ? 22.073  -28.565 36.180  1.00 0.00 ? 142 PRO A HD3  4  
ATOM 8818  N N    . GLU A 1 143 ? 24.245  -33.580 36.305  1.00 0.00 ? 143 GLU A N    4  
ATOM 8819  C CA   . GLU A 1 143 ? 24.238  -34.954 35.818  1.00 0.00 ? 143 GLU A CA   4  
ATOM 8820  C C    . GLU A 1 143 ? 24.176  -35.942 36.979  1.00 0.00 ? 143 GLU A C    4  
ATOM 8821  O O    . GLU A 1 143 ? 24.521  -35.608 38.112  1.00 0.00 ? 143 GLU A O    4  
ATOM 8822  C CB   . GLU A 1 143 ? 25.481  -35.225 34.969  1.00 0.00 ? 143 GLU A CB   4  
ATOM 8823  C CG   . GLU A 1 143 ? 25.167  -35.744 33.576  1.00 0.00 ? 143 GLU A CG   4  
ATOM 8824  C CD   . GLU A 1 143 ? 26.413  -36.107 32.793  1.00 0.00 ? 143 GLU A CD   4  
ATOM 8825  O OE1  . GLU A 1 143 ? 27.089  -37.085 33.175  1.00 0.00 ? 143 GLU A OE1  4  
ATOM 8826  O OE2  . GLU A 1 143 ? 26.713  -35.413 31.799  1.00 0.00 ? 143 GLU A OE2  4  
ATOM 8827  H H    . GLU A 1 143 ? 24.835  -33.339 37.049  1.00 0.00 ? 143 GLU A H    4  
ATOM 8828  H HA   . GLU A 1 143 ? 23.359  -35.083 35.204  1.00 0.00 ? 143 GLU A HA   4  
ATOM 8829  H HB2  . GLU A 1 143 ? 26.042  -34.307 34.870  1.00 0.00 ? 143 GLU A HB2  4  
ATOM 8830  H HB3  . GLU A 1 143 ? 26.094  -35.957 35.473  1.00 0.00 ? 143 GLU A HB3  4  
ATOM 8831  H HG2  . GLU A 1 143 ? 24.548  -36.624 33.665  1.00 0.00 ? 143 GLU A HG2  4  
ATOM 8832  H HG3  . GLU A 1 143 ? 24.628  -34.980 33.034  1.00 0.00 ? 143 GLU A HG3  4  
ATOM 8833  N N    . VAL A 1 144 ? 23.734  -37.162 36.688  1.00 0.00 ? 144 VAL A N    4  
ATOM 8834  C CA   . VAL A 1 144 ? 23.627  -38.199 37.706  1.00 0.00 ? 144 VAL A CA   4  
ATOM 8835  C C    . VAL A 1 144 ? 24.978  -38.472 38.357  1.00 0.00 ? 144 VAL A C    4  
ATOM 8836  O O    . VAL A 1 144 ? 26.001  -37.929 37.940  1.00 0.00 ? 144 VAL A O    4  
ATOM 8837  C CB   . VAL A 1 144 ? 23.080  -39.512 37.114  1.00 0.00 ? 144 VAL A CB   4  
ATOM 8838  C CG1  . VAL A 1 144 ? 21.588  -39.395 36.842  1.00 0.00 ? 144 VAL A CG1  4  
ATOM 8839  C CG2  . VAL A 1 144 ? 23.835  -39.879 35.845  1.00 0.00 ? 144 VAL A CG2  4  
ATOM 8840  H H    . VAL A 1 144 ? 23.474  -37.368 35.766  1.00 0.00 ? 144 VAL A H    4  
ATOM 8841  H HA   . VAL A 1 144 ? 22.936  -37.855 38.463  1.00 0.00 ? 144 VAL A HA   4  
ATOM 8842  H HB   . VAL A 1 144 ? 23.231  -40.300 37.838  1.00 0.00 ? 144 VAL A HB   4  
ATOM 8843  H HG11 . VAL A 1 144 ? 21.185  -40.373 36.623  1.00 0.00 ? 144 VAL A HG11 4  
ATOM 8844  H HG12 . VAL A 1 144 ? 21.094  -38.987 37.712  1.00 0.00 ? 144 VAL A HG12 4  
ATOM 8845  H HG13 . VAL A 1 144 ? 21.427  -38.742 35.997  1.00 0.00 ? 144 VAL A HG13 4  
ATOM 8846  H HG21 . VAL A 1 144 ? 24.896  -39.781 36.017  1.00 0.00 ? 144 VAL A HG21 4  
ATOM 8847  H HG22 . VAL A 1 144 ? 23.607  -40.899 35.573  1.00 0.00 ? 144 VAL A HG22 4  
ATOM 8848  H HG23 . VAL A 1 144 ? 23.536  -39.218 35.045  1.00 0.00 ? 144 VAL A HG23 4  
ATOM 8849  N N    . LYS A 1 145 ? 24.975  -39.318 39.382  1.00 0.00 ? 145 LYS A N    4  
ATOM 8850  C CA   . LYS A 1 145 ? 26.201  -39.665 40.091  1.00 0.00 ? 145 LYS A CA   4  
ATOM 8851  C C    . LYS A 1 145 ? 26.128  -41.087 40.638  1.00 0.00 ? 145 LYS A C    4  
ATOM 8852  O O    . LYS A 1 145 ? 25.118  -41.773 40.479  1.00 0.00 ? 145 LYS A O    4  
ATOM 8853  C CB   . LYS A 1 145 ? 26.450  -38.680 41.234  1.00 0.00 ? 145 LYS A CB   4  
ATOM 8854  C CG   . LYS A 1 145 ? 25.444  -38.794 42.366  1.00 0.00 ? 145 LYS A CG   4  
ATOM 8855  C CD   . LYS A 1 145 ? 25.761  -37.827 43.495  1.00 0.00 ? 145 LYS A CD   4  
ATOM 8856  C CE   . LYS A 1 145 ? 26.090  -38.564 44.784  1.00 0.00 ? 145 LYS A CE   4  
ATOM 8857  N NZ   . LYS A 1 145 ? 26.361  -37.624 45.907  1.00 0.00 ? 145 LYS A NZ   4  
ATOM 8858  H H    . LYS A 1 145 ? 24.127  -39.719 39.668  1.00 0.00 ? 145 LYS A H    4  
ATOM 8859  H HA   . LYS A 1 145 ? 27.019  -39.604 39.389  1.00 0.00 ? 145 LYS A HA   4  
ATOM 8860  H HB2  . LYS A 1 145 ? 27.436  -38.856 41.638  1.00 0.00 ? 145 LYS A HB2  4  
ATOM 8861  H HB3  . LYS A 1 145 ? 26.406  -37.674 40.842  1.00 0.00 ? 145 LYS A HB3  4  
ATOM 8862  H HG2  . LYS A 1 145 ? 24.458  -38.572 41.984  1.00 0.00 ? 145 LYS A HG2  4  
ATOM 8863  H HG3  . LYS A 1 145 ? 25.464  -39.803 42.753  1.00 0.00 ? 145 LYS A HG3  4  
ATOM 8864  H HD2  . LYS A 1 145 ? 26.611  -37.224 43.212  1.00 0.00 ? 145 LYS A HD2  4  
ATOM 8865  H HD3  . LYS A 1 145 ? 24.905  -37.190 43.663  1.00 0.00 ? 145 LYS A HD3  4  
ATOM 8866  H HE2  . LYS A 1 145 ? 25.253  -39.193 45.047  1.00 0.00 ? 145 LYS A HE2  4  
ATOM 8867  H HE3  . LYS A 1 145 ? 26.964  -39.177 44.620  1.00 0.00 ? 145 LYS A HE3  4  
ATOM 8868  H HZ1  . LYS A 1 145 ? 27.255  -37.119 45.742  1.00 0.00 ? 145 LYS A HZ1  4  
ATOM 8869  H HZ2  . LYS A 1 145 ? 26.432  -38.148 46.802  1.00 0.00 ? 145 LYS A HZ2  4  
ATOM 8870  H HZ3  . LYS A 1 145 ? 25.591  -36.929 45.984  1.00 0.00 ? 145 LYS A HZ3  4  
ATOM 8871  N N    . ASP A 1 146 ? 27.203  -41.523 41.285  1.00 0.00 ? 146 ASP A N    4  
ATOM 8872  C CA   . ASP A 1 146 ? 27.260  -42.863 41.858  1.00 0.00 ? 146 ASP A CA   4  
ATOM 8873  C C    . ASP A 1 146 ? 28.480  -43.016 42.761  1.00 0.00 ? 146 ASP A C    4  
ATOM 8874  O O    . ASP A 1 146 ? 29.384  -43.800 42.472  1.00 0.00 ? 146 ASP A O    4  
ATOM 8875  C CB   . ASP A 1 146 ? 27.296  -43.915 40.749  1.00 0.00 ? 146 ASP A CB   4  
ATOM 8876  C CG   . ASP A 1 146 ? 28.144  -43.483 39.569  1.00 0.00 ? 146 ASP A CG   4  
ATOM 8877  O OD1  . ASP A 1 146 ? 29.368  -43.729 39.597  1.00 0.00 ? 146 ASP A OD1  4  
ATOM 8878  O OD2  . ASP A 1 146 ? 27.585  -42.899 38.617  1.00 0.00 ? 146 ASP A OD2  4  
ATOM 8879  H H    . ASP A 1 146 ? 27.978  -40.930 41.379  1.00 0.00 ? 146 ASP A H    4  
ATOM 8880  H HA   . ASP A 1 146 ? 26.369  -43.008 42.451  1.00 0.00 ? 146 ASP A HA   4  
ATOM 8881  H HB2  . ASP A 1 146 ? 27.704  -44.833 41.145  1.00 0.00 ? 146 ASP A HB2  4  
ATOM 8882  H HB3  . ASP A 1 146 ? 26.290  -44.094 40.399  1.00 0.00 ? 146 ASP A HB3  4  
ATOM 8883  N N    . ALA A 1 147 ? 28.499  -42.262 43.855  1.00 0.00 ? 147 ALA A N    4  
ATOM 8884  C CA   . ALA A 1 147 ? 29.607  -42.315 44.801  1.00 0.00 ? 147 ALA A CA   4  
ATOM 8885  C C    . ALA A 1 147 ? 30.936  -42.044 44.104  1.00 0.00 ? 147 ALA A C    4  
ATOM 8886  O O    . ALA A 1 147 ? 32.004  -42.299 44.663  1.00 0.00 ? 147 ALA A O    4  
ATOM 8887  C CB   . ALA A 1 147 ? 29.640  -43.666 45.500  1.00 0.00 ? 147 ALA A CB   4  
ATOM 8888  H H    . ALA A 1 147 ? 27.749  -41.657 44.031  1.00 0.00 ? 147 ALA A H    4  
ATOM 8889  H HA   . ALA A 1 147 ? 29.443  -41.553 45.550  1.00 0.00 ? 147 ALA A HA   4  
ATOM 8890  H HB1  . ALA A 1 147 ? 30.272  -43.602 46.374  1.00 0.00 ? 147 ALA A HB1  4  
ATOM 8891  H HB2  . ALA A 1 147 ? 28.640  -43.942 45.797  1.00 0.00 ? 147 ALA A HB2  4  
ATOM 8892  H HB3  . ALA A 1 147 ? 30.034  -44.410 44.824  1.00 0.00 ? 147 ALA A HB3  4  
ATOM 8893  N N    . MET A 1 1   ? 14.531  -31.693 -21.390 1.00 0.00 ? 1   MET A N    5  
ATOM 8894  C CA   . MET A 1 1   ? 13.223  -31.921 -20.786 1.00 0.00 ? 1   MET A CA   5  
ATOM 8895  C C    . MET A 1 1   ? 13.233  -31.542 -19.309 1.00 0.00 ? 1   MET A C    5  
ATOM 8896  O O    . MET A 1 1   ? 12.290  -30.929 -18.808 1.00 0.00 ? 1   MET A O    5  
ATOM 8897  C CB   . MET A 1 1   ? 12.812  -33.386 -20.946 1.00 0.00 ? 1   MET A CB   5  
ATOM 8898  C CG   . MET A 1 1   ? 11.546  -33.748 -20.188 1.00 0.00 ? 1   MET A CG   5  
ATOM 8899  S SD   . MET A 1 1   ? 10.975  -35.420 -20.547 1.00 0.00 ? 1   MET A SD   5  
ATOM 8900  C CE   . MET A 1 1   ? 11.001  -36.145 -18.909 1.00 0.00 ? 1   MET A CE   5  
ATOM 8901  H H1   . MET A 1 1   ? 14.987  -32.437 -21.837 1.00 0.00 ? 1   MET A H1   5  
ATOM 8902  H HA   . MET A 1 1   ? 12.508  -31.297 -21.301 1.00 0.00 ? 1   MET A HA   5  
ATOM 8903  H HB2  . MET A 1 1   ? 12.650  -33.589 -21.994 1.00 0.00 ? 1   MET A HB2  5  
ATOM 8904  H HB3  . MET A 1 1   ? 13.613  -34.014 -20.586 1.00 0.00 ? 1   MET A HB3  5  
ATOM 8905  H HG2  . MET A 1 1   ? 11.740  -33.669 -19.129 1.00 0.00 ? 1   MET A HG2  5  
ATOM 8906  H HG3  . MET A 1 1   ? 10.768  -33.050 -20.461 1.00 0.00 ? 1   MET A HG3  5  
ATOM 8907  H HE1  . MET A 1 1   ? 11.569  -35.512 -18.244 1.00 0.00 ? 1   MET A HE1  5  
ATOM 8908  H HE2  . MET A 1 1   ? 9.990   -36.238 -18.541 1.00 0.00 ? 1   MET A HE2  5  
ATOM 8909  H HE3  . MET A 1 1   ? 11.459  -37.123 -18.955 1.00 0.00 ? 1   MET A HE3  5  
ATOM 8910  N N    . LYS A 1 2   ? 14.304  -31.911 -18.615 1.00 0.00 ? 2   LYS A N    5  
ATOM 8911  C CA   . LYS A 1 2   ? 14.438  -31.609 -17.194 1.00 0.00 ? 2   LYS A CA   5  
ATOM 8912  C C    . LYS A 1 2   ? 15.906  -31.470 -16.803 1.00 0.00 ? 2   LYS A C    5  
ATOM 8913  O O    . LYS A 1 2   ? 16.503  -32.397 -16.255 1.00 0.00 ? 2   LYS A O    5  
ATOM 8914  C CB   . LYS A 1 2   ? 13.776  -32.704 -16.355 1.00 0.00 ? 2   LYS A CB   5  
ATOM 8915  C CG   . LYS A 1 2   ? 12.266  -32.574 -16.266 1.00 0.00 ? 2   LYS A CG   5  
ATOM 8916  C CD   . LYS A 1 2   ? 11.680  -33.552 -15.263 1.00 0.00 ? 2   LYS A CD   5  
ATOM 8917  C CE   . LYS A 1 2   ? 10.587  -32.905 -14.426 1.00 0.00 ? 2   LYS A CE   5  
ATOM 8918  N NZ   . LYS A 1 2   ? 9.340   -33.720 -14.415 1.00 0.00 ? 2   LYS A NZ   5  
ATOM 8919  H H    . LYS A 1 2   ? 15.024  -32.397 -19.070 1.00 0.00 ? 2   LYS A H    5  
ATOM 8920  H HA   . LYS A 1 2   ? 13.938  -30.671 -17.006 1.00 0.00 ? 2   LYS A HA   5  
ATOM 8921  H HB2  . LYS A 1 2   ? 14.009  -33.665 -16.790 1.00 0.00 ? 2   LYS A HB2  5  
ATOM 8922  H HB3  . LYS A 1 2   ? 14.179  -32.665 -15.353 1.00 0.00 ? 2   LYS A HB3  5  
ATOM 8923  H HG2  . LYS A 1 2   ? 12.017  -31.568 -15.960 1.00 0.00 ? 2   LYS A HG2  5  
ATOM 8924  H HG3  . LYS A 1 2   ? 11.839  -32.771 -17.240 1.00 0.00 ? 2   LYS A HG3  5  
ATOM 8925  H HD2  . LYS A 1 2   ? 11.259  -34.393 -15.795 1.00 0.00 ? 2   LYS A HD2  5  
ATOM 8926  H HD3  . LYS A 1 2   ? 12.467  -33.896 -14.607 1.00 0.00 ? 2   LYS A HD3  5  
ATOM 8927  H HE2  . LYS A 1 2   ? 10.944  -32.794 -13.414 1.00 0.00 ? 2   LYS A HE2  5  
ATOM 8928  H HE3  . LYS A 1 2   ? 10.366  -31.931 -14.838 1.00 0.00 ? 2   LYS A HE3  5  
ATOM 8929  H HZ1  . LYS A 1 2   ? 9.536   -34.665 -14.027 1.00 0.00 ? 2   LYS A HZ1  5  
ATOM 8930  H HZ2  . LYS A 1 2   ? 8.973   -33.824 -15.382 1.00 0.00 ? 2   LYS A HZ2  5  
ATOM 8931  H HZ3  . LYS A 1 2   ? 8.617   -33.258 -13.828 1.00 0.00 ? 2   LYS A HZ3  5  
ATOM 8932  N N    . LYS A 1 3   ? 16.482  -30.307 -17.087 1.00 0.00 ? 3   LYS A N    5  
ATOM 8933  C CA   . LYS A 1 3   ? 17.879  -30.045 -16.763 1.00 0.00 ? 3   LYS A CA   5  
ATOM 8934  C C    . LYS A 1 3   ? 18.082  -28.586 -16.370 1.00 0.00 ? 3   LYS A C    5  
ATOM 8935  O O    . LYS A 1 3   ? 17.357  -27.702 -16.828 1.00 0.00 ? 3   LYS A O    5  
ATOM 8936  C CB   . LYS A 1 3   ? 18.774  -30.393 -17.954 1.00 0.00 ? 3   LYS A CB   5  
ATOM 8937  C CG   . LYS A 1 3   ? 20.102  -31.014 -17.556 1.00 0.00 ? 3   LYS A CG   5  
ATOM 8938  C CD   . LYS A 1 3   ? 20.114  -32.513 -17.805 1.00 0.00 ? 3   LYS A CD   5  
ATOM 8939  C CE   . LYS A 1 3   ? 20.054  -32.832 -19.291 1.00 0.00 ? 3   LYS A CE   5  
ATOM 8940  N NZ   . LYS A 1 3   ? 20.436  -34.243 -19.571 1.00 0.00 ? 3   LYS A NZ   5  
ATOM 8941  H H    . LYS A 1 3   ? 15.953  -29.606 -17.525 1.00 0.00 ? 3   LYS A H    5  
ATOM 8942  H HA   . LYS A 1 3   ? 18.148  -30.672 -15.926 1.00 0.00 ? 3   LYS A HA   5  
ATOM 8943  H HB2  . LYS A 1 3   ? 18.251  -31.091 -18.591 1.00 0.00 ? 3   LYS A HB2  5  
ATOM 8944  H HB3  . LYS A 1 3   ? 18.976  -29.491 -18.513 1.00 0.00 ? 3   LYS A HB3  5  
ATOM 8945  H HG2  . LYS A 1 3   ? 20.891  -30.558 -18.136 1.00 0.00 ? 3   LYS A HG2  5  
ATOM 8946  H HG3  . LYS A 1 3   ? 20.274  -30.831 -16.505 1.00 0.00 ? 3   LYS A HG3  5  
ATOM 8947  H HD2  . LYS A 1 3   ? 21.022  -32.930 -17.395 1.00 0.00 ? 3   LYS A HD2  5  
ATOM 8948  H HD3  . LYS A 1 3   ? 19.259  -32.957 -17.316 1.00 0.00 ? 3   LYS A HD3  5  
ATOM 8949  H HE2  . LYS A 1 3   ? 19.048  -32.664 -19.642 1.00 0.00 ? 3   LYS A HE2  5  
ATOM 8950  H HE3  . LYS A 1 3   ? 20.732  -32.174 -19.814 1.00 0.00 ? 3   LYS A HE3  5  
ATOM 8951  H HZ1  . LYS A 1 3   ? 21.318  -34.272 -20.122 1.00 0.00 ? 3   LYS A HZ1  5  
ATOM 8952  H HZ2  . LYS A 1 3   ? 19.686  -34.716 -20.115 1.00 0.00 ? 3   LYS A HZ2  5  
ATOM 8953  H HZ3  . LYS A 1 3   ? 20.580  -34.759 -18.679 1.00 0.00 ? 3   LYS A HZ3  5  
ATOM 8954  N N    . VAL A 1 4   ? 19.074  -28.338 -15.520 1.00 0.00 ? 4   VAL A N    5  
ATOM 8955  C CA   . VAL A 1 4   ? 19.374  -26.985 -15.068 1.00 0.00 ? 4   VAL A CA   5  
ATOM 8956  C C    . VAL A 1 4   ? 20.119  -26.200 -16.141 1.00 0.00 ? 4   VAL A C    5  
ATOM 8957  O O    . VAL A 1 4   ? 21.257  -25.776 -15.938 1.00 0.00 ? 4   VAL A O    5  
ATOM 8958  C CB   . VAL A 1 4   ? 20.217  -26.998 -13.779 1.00 0.00 ? 4   VAL A CB   5  
ATOM 8959  C CG1  . VAL A 1 4   ? 20.204  -25.628 -13.119 1.00 0.00 ? 4   VAL A CG1  5  
ATOM 8960  C CG2  . VAL A 1 4   ? 19.708  -28.065 -12.821 1.00 0.00 ? 4   VAL A CG2  5  
ATOM 8961  H H    . VAL A 1 4   ? 19.617  -29.084 -15.190 1.00 0.00 ? 4   VAL A H    5  
ATOM 8962  H HA   . VAL A 1 4   ? 18.438  -26.488 -14.856 1.00 0.00 ? 4   VAL A HA   5  
ATOM 8963  H HB   . VAL A 1 4   ? 21.237  -27.237 -14.042 1.00 0.00 ? 4   VAL A HB   5  
ATOM 8964  H HG11 . VAL A 1 4   ? 21.065  -25.063 -13.446 1.00 0.00 ? 4   VAL A HG11 5  
ATOM 8965  H HG12 . VAL A 1 4   ? 19.301  -25.103 -13.394 1.00 0.00 ? 4   VAL A HG12 5  
ATOM 8966  H HG13 . VAL A 1 4   ? 20.239  -25.745 -12.045 1.00 0.00 ? 4   VAL A HG13 5  
ATOM 8967  H HG21 . VAL A 1 4   ? 18.670  -28.272 -13.033 1.00 0.00 ? 4   VAL A HG21 5  
ATOM 8968  H HG22 . VAL A 1 4   ? 20.288  -28.968 -12.946 1.00 0.00 ? 4   VAL A HG22 5  
ATOM 8969  H HG23 . VAL A 1 4   ? 19.806  -27.713 -11.805 1.00 0.00 ? 4   VAL A HG23 5  
ATOM 8970  N N    . VAL A 1 5   ? 19.470  -26.009 -17.285 1.00 0.00 ? 5   VAL A N    5  
ATOM 8971  C CA   . VAL A 1 5   ? 20.070  -25.273 -18.391 1.00 0.00 ? 5   VAL A CA   5  
ATOM 8972  C C    . VAL A 1 5   ? 20.688  -23.964 -17.910 1.00 0.00 ? 5   VAL A C    5  
ATOM 8973  O O    . VAL A 1 5   ? 21.787  -23.596 -18.323 1.00 0.00 ? 5   VAL A O    5  
ATOM 8974  C CB   . VAL A 1 5   ? 19.034  -24.965 -19.489 1.00 0.00 ? 5   VAL A CB   5  
ATOM 8975  C CG1  . VAL A 1 5   ? 18.567  -26.249 -20.157 1.00 0.00 ? 5   VAL A CG1  5  
ATOM 8976  C CG2  . VAL A 1 5   ? 17.856  -24.198 -18.909 1.00 0.00 ? 5   VAL A CG2  5  
ATOM 8977  H H    . VAL A 1 5   ? 18.565  -26.371 -17.387 1.00 0.00 ? 5   VAL A H    5  
ATOM 8978  H HA   . VAL A 1 5   ? 20.846  -25.889 -18.821 1.00 0.00 ? 5   VAL A HA   5  
ATOM 8979  H HB   . VAL A 1 5   ? 19.506  -24.347 -20.238 1.00 0.00 ? 5   VAL A HB   5  
ATOM 8980  H HG11 . VAL A 1 5   ? 17.912  -26.786 -19.487 1.00 0.00 ? 5   VAL A HG11 5  
ATOM 8981  H HG12 . VAL A 1 5   ? 18.037  -26.010 -21.067 1.00 0.00 ? 5   VAL A HG12 5  
ATOM 8982  H HG13 . VAL A 1 5   ? 19.424  -26.865 -20.391 1.00 0.00 ? 5   VAL A HG13 5  
ATOM 8983  H HG21 . VAL A 1 5   ? 17.552  -24.655 -17.979 1.00 0.00 ? 5   VAL A HG21 5  
ATOM 8984  H HG22 . VAL A 1 5   ? 18.147  -23.173 -18.727 1.00 0.00 ? 5   VAL A HG22 5  
ATOM 8985  H HG23 . VAL A 1 5   ? 17.033  -24.219 -19.607 1.00 0.00 ? 5   VAL A HG23 5  
ATOM 8986  N N    . ALA A 1 6   ? 19.973  -23.266 -17.033 1.00 0.00 ? 6   ALA A N    5  
ATOM 8987  C CA   . ALA A 1 6   ? 20.451  -22.000 -16.493 1.00 0.00 ? 6   ALA A CA   5  
ATOM 8988  C C    . ALA A 1 6   ? 19.853  -21.729 -15.118 1.00 0.00 ? 6   ALA A C    5  
ATOM 8989  O O    . ALA A 1 6   ? 18.966  -22.451 -14.662 1.00 0.00 ? 6   ALA A O    5  
ATOM 8990  C CB   . ALA A 1 6   ? 20.123  -20.861 -17.448 1.00 0.00 ? 6   ALA A CB   5  
ATOM 8991  H H    . ALA A 1 6   ? 19.104  -23.612 -16.742 1.00 0.00 ? 6   ALA A H    5  
ATOM 8992  H HA   . ALA A 1 6   ? 21.526  -22.061 -16.401 1.00 0.00 ? 6   ALA A HA   5  
ATOM 8993  H HB1  . ALA A 1 6   ? 20.385  -21.151 -18.455 1.00 0.00 ? 6   ALA A HB1  5  
ATOM 8994  H HB2  . ALA A 1 6   ? 19.067  -20.644 -17.399 1.00 0.00 ? 6   ALA A HB2  5  
ATOM 8995  H HB3  . ALA A 1 6   ? 20.686  -19.984 -17.167 1.00 0.00 ? 6   ALA A HB3  5  
ATOM 8996  N N    . VAL A 1 7   ? 20.343  -20.683 -14.460 1.00 0.00 ? 7   VAL A N    5  
ATOM 8997  C CA   . VAL A 1 7   ? 19.855  -20.316 -13.135 1.00 0.00 ? 7   VAL A CA   5  
ATOM 8998  C C    . VAL A 1 7   ? 19.971  -18.813 -12.904 1.00 0.00 ? 7   VAL A C    5  
ATOM 8999  O O    . VAL A 1 7   ? 20.913  -18.173 -13.373 1.00 0.00 ? 7   VAL A O    5  
ATOM 9000  C CB   . VAL A 1 7   ? 20.628  -21.056 -12.028 1.00 0.00 ? 7   VAL A CB   5  
ATOM 9001  C CG1  . VAL A 1 7   ? 20.123  -20.640 -10.655 1.00 0.00 ? 7   VAL A CG1  5  
ATOM 9002  C CG2  . VAL A 1 7   ? 20.514  -22.561 -12.214 1.00 0.00 ? 7   VAL A CG2  5  
ATOM 9003  H H    . VAL A 1 7   ? 21.048  -20.144 -14.875 1.00 0.00 ? 7   VAL A H    5  
ATOM 9004  H HA   . VAL A 1 7   ? 18.815  -20.601 -13.071 1.00 0.00 ? 7   VAL A HA   5  
ATOM 9005  H HB   . VAL A 1 7   ? 21.671  -20.783 -12.101 1.00 0.00 ? 7   VAL A HB   5  
ATOM 9006  H HG11 . VAL A 1 7   ? 19.124  -20.241 -10.745 1.00 0.00 ? 7   VAL A HG11 5  
ATOM 9007  H HG12 . VAL A 1 7   ? 20.112  -21.499 -10.000 1.00 0.00 ? 7   VAL A HG12 5  
ATOM 9008  H HG13 . VAL A 1 7   ? 20.776  -19.883 -10.245 1.00 0.00 ? 7   VAL A HG13 5  
ATOM 9009  H HG21 . VAL A 1 7   ? 21.161  -22.874 -13.020 1.00 0.00 ? 7   VAL A HG21 5  
ATOM 9010  H HG22 . VAL A 1 7   ? 20.809  -23.060 -11.302 1.00 0.00 ? 7   VAL A HG22 5  
ATOM 9011  H HG23 . VAL A 1 7   ? 19.493  -22.819 -12.450 1.00 0.00 ? 7   VAL A HG23 5  
ATOM 9012  N N    . VAL A 1 8   ? 19.008  -18.256 -12.177 1.00 0.00 ? 8   VAL A N    5  
ATOM 9013  C CA   . VAL A 1 8   ? 19.002  -16.828 -11.882 1.00 0.00 ? 8   VAL A CA   5  
ATOM 9014  C C    . VAL A 1 8   ? 20.035  -16.484 -10.814 1.00 0.00 ? 8   VAL A C    5  
ATOM 9015  O O    . VAL A 1 8   ? 20.331  -17.294 -9.936  1.00 0.00 ? 8   VAL A O    5  
ATOM 9016  C CB   . VAL A 1 8   ? 17.614  -16.358 -11.408 1.00 0.00 ? 8   VAL A CB   5  
ATOM 9017  C CG1  . VAL A 1 8   ? 17.611  -14.856 -11.168 1.00 0.00 ? 8   VAL A CG1  5  
ATOM 9018  C CG2  . VAL A 1 8   ? 16.546  -16.748 -12.419 1.00 0.00 ? 8   VAL A CG2  5  
ATOM 9019  H H    . VAL A 1 8   ? 18.284  -18.818 -11.831 1.00 0.00 ? 8   VAL A H    5  
ATOM 9020  H HA   . VAL A 1 8   ? 19.248  -16.298 -12.791 1.00 0.00 ? 8   VAL A HA   5  
ATOM 9021  H HB   . VAL A 1 8   ? 17.390  -16.850 -10.472 1.00 0.00 ? 8   VAL A HB   5  
ATOM 9022  H HG11 . VAL A 1 8   ? 16.595  -14.516 -11.032 1.00 0.00 ? 8   VAL A HG11 5  
ATOM 9023  H HG12 . VAL A 1 8   ? 18.190  -14.631 -10.285 1.00 0.00 ? 8   VAL A HG12 5  
ATOM 9024  H HG13 . VAL A 1 8   ? 18.046  -14.355 -12.021 1.00 0.00 ? 8   VAL A HG13 5  
ATOM 9025  H HG21 . VAL A 1 8   ? 16.658  -16.145 -13.308 1.00 0.00 ? 8   VAL A HG21 5  
ATOM 9026  H HG22 . VAL A 1 8   ? 16.656  -17.792 -12.675 1.00 0.00 ? 8   VAL A HG22 5  
ATOM 9027  H HG23 . VAL A 1 8   ? 15.568  -16.583 -11.992 1.00 0.00 ? 8   VAL A HG23 5  
ATOM 9028  N N    . LYS A 1 9   ? 20.581  -15.275 -10.895 1.00 0.00 ? 9   LYS A N    5  
ATOM 9029  C CA   . LYS A 1 9   ? 21.580  -14.820 -9.935  1.00 0.00 ? 9   LYS A CA   5  
ATOM 9030  C C    . LYS A 1 9   ? 21.271  -13.405 -9.458  1.00 0.00 ? 9   LYS A C    5  
ATOM 9031  O O    . LYS A 1 9   ? 21.541  -12.429 -10.160 1.00 0.00 ? 9   LYS A O    5  
ATOM 9032  C CB   . LYS A 1 9   ? 22.976  -14.866 -10.561 1.00 0.00 ? 9   LYS A CB   5  
ATOM 9033  C CG   . LYS A 1 9   ? 23.056  -14.190 -11.919 1.00 0.00 ? 9   LYS A CG   5  
ATOM 9034  C CD   . LYS A 1 9   ? 24.302  -13.329 -12.040 1.00 0.00 ? 9   LYS A CD   5  
ATOM 9035  C CE   . LYS A 1 9   ? 25.489  -14.134 -12.548 1.00 0.00 ? 9   LYS A CE   5  
ATOM 9036  N NZ   . LYS A 1 9   ? 25.683  -13.970 -14.015 1.00 0.00 ? 9   LYS A NZ   5  
ATOM 9037  H H    . LYS A 1 9   ? 20.304  -14.673 -11.618 1.00 0.00 ? 9   LYS A H    5  
ATOM 9038  H HA   . LYS A 1 9   ? 21.553  -15.488 -9.087  1.00 0.00 ? 9   LYS A HA   5  
ATOM 9039  H HB2  . LYS A 1 9   ? 23.671  -14.376 -9.896  1.00 0.00 ? 9   LYS A HB2  5  
ATOM 9040  H HB3  . LYS A 1 9   ? 23.271  -15.899 -10.679 1.00 0.00 ? 9   LYS A HB3  5  
ATOM 9041  H HG2  . LYS A 1 9   ? 23.079  -14.948 -12.688 1.00 0.00 ? 9   LYS A HG2  5  
ATOM 9042  H HG3  . LYS A 1 9   ? 22.184  -13.566 -12.052 1.00 0.00 ? 9   LYS A HG3  5  
ATOM 9043  H HD2  . LYS A 1 9   ? 24.106  -12.523 -12.732 1.00 0.00 ? 9   LYS A HD2  5  
ATOM 9044  H HD3  . LYS A 1 9   ? 24.543  -12.921 -11.069 1.00 0.00 ? 9   LYS A HD3  5  
ATOM 9045  H HE2  . LYS A 1 9   ? 26.378  -13.801 -12.036 1.00 0.00 ? 9   LYS A HE2  5  
ATOM 9046  H HE3  . LYS A 1 9   ? 25.318  -15.178 -12.330 1.00 0.00 ? 9   LYS A HE3  5  
ATOM 9047  H HZ1  . LYS A 1 9   ? 25.608  -12.965 -14.275 1.00 0.00 ? 9   LYS A HZ1  5  
ATOM 9048  H HZ2  . LYS A 1 9   ? 24.959  -14.506 -14.534 1.00 0.00 ? 9   LYS A HZ2  5  
ATOM 9049  H HZ3  . LYS A 1 9   ? 26.623  -14.319 -14.292 1.00 0.00 ? 9   LYS A HZ3  5  
ATOM 9050  N N    . LEU A 1 10  ? 20.706  -13.300 -8.260  1.00 0.00 ? 10  LEU A N    5  
ATOM 9051  C CA   . LEU A 1 10  ? 20.362  -12.003 -7.688  1.00 0.00 ? 10  LEU A CA   5  
ATOM 9052  C C    . LEU A 1 10  ? 20.403  -12.052 -6.164  1.00 0.00 ? 10  LEU A C    5  
ATOM 9053  O O    . LEU A 1 10  ? 20.022  -13.051 -5.556  1.00 0.00 ? 10  LEU A O    5  
ATOM 9054  C CB   . LEU A 1 10  ? 18.973  -11.568 -8.158  1.00 0.00 ? 10  LEU A CB   5  
ATOM 9055  C CG   . LEU A 1 10  ? 18.452  -10.250 -7.583  1.00 0.00 ? 10  LEU A CG   5  
ATOM 9056  C CD1  . LEU A 1 10  ? 18.795  -9.092  -8.507  1.00 0.00 ? 10  LEU A CD1  5  
ATOM 9057  C CD2  . LEU A 1 10  ? 16.949  -10.326 -7.355  1.00 0.00 ? 10  LEU A CD2  5  
ATOM 9058  H H    . LEU A 1 10  ? 20.515  -14.113 -7.748  1.00 0.00 ? 10  LEU A H    5  
ATOM 9059  H HA   . LEU A 1 10  ? 21.091  -11.285 -8.033  1.00 0.00 ? 10  LEU A HA   5  
ATOM 9060  H HB2  . LEU A 1 10  ? 19.003  -11.471 -9.233  1.00 0.00 ? 10  LEU A HB2  5  
ATOM 9061  H HB3  . LEU A 1 10  ? 18.274  -12.347 -7.888  1.00 0.00 ? 10  LEU A HB3  5  
ATOM 9062  H HG   . LEU A 1 10  ? 18.927  -10.068 -6.630  1.00 0.00 ? 10  LEU A HG   5  
ATOM 9063  H HD11 . LEU A 1 10  ? 18.479  -9.327  -9.512  1.00 0.00 ? 10  LEU A HD11 5  
ATOM 9064  H HD12 . LEU A 1 10  ? 19.862  -8.926  -8.495  1.00 0.00 ? 10  LEU A HD12 5  
ATOM 9065  H HD13 . LEU A 1 10  ? 18.288  -8.200  -8.169  1.00 0.00 ? 10  LEU A HD13 5  
ATOM 9066  H HD21 . LEU A 1 10  ? 16.722  -10.001 -6.350  1.00 0.00 ? 10  LEU A HD21 5  
ATOM 9067  H HD22 . LEU A 1 10  ? 16.615  -11.345 -7.488  1.00 0.00 ? 10  LEU A HD22 5  
ATOM 9068  H HD23 . LEU A 1 10  ? 16.445  -9.685  -8.063  1.00 0.00 ? 10  LEU A HD23 5  
ATOM 9069  N N    . GLN A 1 11  ? 20.867  -10.966 -5.555  1.00 0.00 ? 11  GLN A N    5  
ATOM 9070  C CA   . GLN A 1 11  ? 20.956  -10.885 -4.101  1.00 0.00 ? 11  GLN A CA   5  
ATOM 9071  C C    . GLN A 1 11  ? 20.530  -9.507  -3.605  1.00 0.00 ? 11  GLN A C    5  
ATOM 9072  O O    . GLN A 1 11  ? 20.977  -8.483  -4.125  1.00 0.00 ? 11  GLN A O    5  
ATOM 9073  C CB   . GLN A 1 11  ? 22.382  -11.188 -3.639  1.00 0.00 ? 11  GLN A CB   5  
ATOM 9074  C CG   . GLN A 1 11  ? 23.354  -10.043 -3.874  1.00 0.00 ? 11  GLN A CG   5  
ATOM 9075  C CD   . GLN A 1 11  ? 24.752  -10.353 -3.376  1.00 0.00 ? 11  GLN A CD   5  
ATOM 9076  O OE1  . GLN A 1 11  ? 25.472  -11.155 -3.971  1.00 0.00 ? 11  GLN A OE1  5  
ATOM 9077  N NE2  . GLN A 1 11  ? 25.145  -9.716  -2.278  1.00 0.00 ? 11  GLN A NE2  5  
ATOM 9078  H H    . GLN A 1 11  ? 21.156  -10.201 -6.094  1.00 0.00 ? 11  GLN A H    5  
ATOM 9079  H HA   . GLN A 1 11  ? 20.288  -11.625 -3.687  1.00 0.00 ? 11  GLN A HA   5  
ATOM 9080  H HB2  . GLN A 1 11  ? 22.367  -11.408 -2.582  1.00 0.00 ? 11  GLN A HB2  5  
ATOM 9081  H HB3  . GLN A 1 11  ? 22.745  -12.054 -4.174  1.00 0.00 ? 11  GLN A HB3  5  
ATOM 9082  H HG2  . GLN A 1 11  ? 23.403  -9.841  -4.933  1.00 0.00 ? 11  GLN A HG2  5  
ATOM 9083  H HG3  . GLN A 1 11  ? 22.989  -9.167  -3.357  1.00 0.00 ? 11  GLN A HG3  5  
ATOM 9084  H HE21 . GLN A 1 11  ? 24.517  -9.092  -1.857  1.00 0.00 ? 11  GLN A HE21 5  
ATOM 9085  H HE22 . GLN A 1 11  ? 26.043  -9.898  -1.934  1.00 0.00 ? 11  GLN A HE22 5  
ATOM 9086  N N    . LEU A 1 12  ? 19.665  -9.488  -2.598  1.00 0.00 ? 12  LEU A N    5  
ATOM 9087  C CA   . LEU A 1 12  ? 19.178  -8.235  -2.031  1.00 0.00 ? 12  LEU A CA   5  
ATOM 9088  C C    . LEU A 1 12  ? 18.884  -8.389  -0.542  1.00 0.00 ? 12  LEU A C    5  
ATOM 9089  O O    . LEU A 1 12  ? 18.554  -9.472  -0.058  1.00 0.00 ? 12  LEU A O    5  
ATOM 9090  C CB   . LEU A 1 12  ? 17.918  -7.776  -2.766  1.00 0.00 ? 12  LEU A CB   5  
ATOM 9091  C CG   . LEU A 1 12  ? 17.943  -7.910  -4.289  1.00 0.00 ? 12  LEU A CG   5  
ATOM 9092  C CD1  . LEU A 1 12  ? 16.529  -7.889  -4.850  1.00 0.00 ? 12  LEU A CD1  5  
ATOM 9093  C CD2  . LEU A 1 12  ? 18.781  -6.802  -4.909  1.00 0.00 ? 12  LEU A CD2  5  
ATOM 9094  H H    . LEU A 1 12  ? 19.345  -10.336 -2.225  1.00 0.00 ? 12  LEU A H    5  
ATOM 9095  H HA   . LEU A 1 12  ? 19.951  -7.492  -2.158  1.00 0.00 ? 12  LEU A HA   5  
ATOM 9096  H HB2  . LEU A 1 12  ? 17.088  -8.358  -2.397  1.00 0.00 ? 12  LEU A HB2  5  
ATOM 9097  H HB3  . LEU A 1 12  ? 17.758  -6.734  -2.528  1.00 0.00 ? 12  LEU A HB3  5  
ATOM 9098  H HG   . LEU A 1 12  ? 18.391  -8.858  -4.553  1.00 0.00 ? 12  LEU A HG   5  
ATOM 9099  H HD11 . LEU A 1 12  ? 15.923  -7.209  -4.272  1.00 0.00 ? 12  LEU A HD11 5  
ATOM 9100  H HD12 . LEU A 1 12  ? 16.106  -8.881  -4.799  1.00 0.00 ? 12  LEU A HD12 5  
ATOM 9101  H HD13 . LEU A 1 12  ? 16.556  -7.562  -5.880  1.00 0.00 ? 12  LEU A HD13 5  
ATOM 9102  H HD21 . LEU A 1 12  ? 19.597  -7.238  -5.468  1.00 0.00 ? 12  LEU A HD21 5  
ATOM 9103  H HD22 . LEU A 1 12  ? 19.178  -6.171  -4.127  1.00 0.00 ? 12  LEU A HD22 5  
ATOM 9104  H HD23 . LEU A 1 12  ? 18.166  -6.212  -5.572  1.00 0.00 ? 12  LEU A HD23 5  
ATOM 9105  N N    . PRO A 1 13  ? 19.004  -7.280  0.202   1.00 0.00 ? 13  PRO A N    5  
ATOM 9106  C CA   . PRO A 1 13  ? 18.753  -7.265  1.647   1.00 0.00 ? 13  PRO A CA   5  
ATOM 9107  C C    . PRO A 1 13  ? 17.276  -7.447  1.980   1.00 0.00 ? 13  PRO A C    5  
ATOM 9108  O O    . PRO A 1 13  ? 16.452  -6.582  1.684   1.00 0.00 ? 13  PRO A O    5  
ATOM 9109  C CB   . PRO A 1 13  ? 19.231  -5.875  2.075   1.00 0.00 ? 13  PRO A CB   5  
ATOM 9110  C CG   . PRO A 1 13  ? 19.109  -5.038  0.849   1.00 0.00 ? 13  PRO A CG   5  
ATOM 9111  C CD   . PRO A 1 13  ? 19.394  -5.955  -0.308  1.00 0.00 ? 13  PRO A CD   5  
ATOM 9112  H HA   . PRO A 1 13  ? 19.332  -8.020  2.158   1.00 0.00 ? 13  PRO A HA   5  
ATOM 9113  H HB2  . PRO A 1 13  ? 18.600  -5.505  2.872   1.00 0.00 ? 13  PRO A HB2  5  
ATOM 9114  H HB3  . PRO A 1 13  ? 20.254  -5.931  2.415   1.00 0.00 ? 13  PRO A HB3  5  
ATOM 9115  H HG2  . PRO A 1 13  ? 18.109  -4.639  0.775   1.00 0.00 ? 13  PRO A HG2  5  
ATOM 9116  H HG3  . PRO A 1 13  ? 19.833  -4.237  0.879   1.00 0.00 ? 13  PRO A HG3  5  
ATOM 9117  H HD2  . PRO A 1 13  ? 18.795  -5.680  -1.164  1.00 0.00 ? 13  PRO A HD2  5  
ATOM 9118  H HD3  . PRO A 1 13  ? 20.444  -5.932  -0.558  1.00 0.00 ? 13  PRO A HD3  5  
ATOM 9119  N N    . ALA A 1 14  ? 16.949  -8.577  2.599   1.00 0.00 ? 14  ALA A N    5  
ATOM 9120  C CA   . ALA A 1 14  ? 15.572  -8.870  2.975   1.00 0.00 ? 14  ALA A CA   5  
ATOM 9121  C C    . ALA A 1 14  ? 14.620  -8.623  1.809   1.00 0.00 ? 14  ALA A C    5  
ATOM 9122  O O    . ALA A 1 14  ? 15.051  -8.409  0.677   1.00 0.00 ? 14  ALA A O    5  
ATOM 9123  C CB   . ALA A 1 14  ? 15.164  -8.035  4.179   1.00 0.00 ? 14  ALA A CB   5  
ATOM 9124  H H    . ALA A 1 14  ? 17.651  -9.227  2.808   1.00 0.00 ? 14  ALA A H    5  
ATOM 9125  H HA   . ALA A 1 14  ? 15.517  -9.913  3.256   1.00 0.00 ? 14  ALA A HA   5  
ATOM 9126  H HB1  . ALA A 1 14  ? 14.915  -8.689  5.002   1.00 0.00 ? 14  ALA A HB1  5  
ATOM 9127  H HB2  . ALA A 1 14  ? 15.982  -7.391  4.464   1.00 0.00 ? 14  ALA A HB2  5  
ATOM 9128  H HB3  . ALA A 1 14  ? 14.304  -7.433  3.924   1.00 0.00 ? 14  ALA A HB3  5  
ATOM 9129  N N    . GLY A 1 15  ? 13.321  -8.655  2.095   1.00 0.00 ? 15  GLY A N    5  
ATOM 9130  C CA   . GLY A 1 15  ? 12.329  -8.433  1.059   1.00 0.00 ? 15  GLY A CA   5  
ATOM 9131  C C    . GLY A 1 15  ? 12.041  -6.961  0.838   1.00 0.00 ? 15  GLY A C    5  
ATOM 9132  O O    . GLY A 1 15  ? 12.935  -6.192  0.485   1.00 0.00 ? 15  GLY A O    5  
ATOM 9133  H H    . GLY A 1 15  ? 13.035  -8.830  3.015   1.00 0.00 ? 15  GLY A H    5  
ATOM 9134  H HA2  . GLY A 1 15  ? 12.686  -8.862  0.135   1.00 0.00 ? 15  GLY A HA2  5  
ATOM 9135  H HA3  . GLY A 1 15  ? 11.412  -8.928  1.344   1.00 0.00 ? 15  GLY A HA3  5  
ATOM 9136  N N    . LYS A 1 16  ? 10.789  -6.567  1.044   1.00 0.00 ? 16  LYS A N    5  
ATOM 9137  C CA   . LYS A 1 16  ? 10.384  -5.178  0.864   1.00 0.00 ? 16  LYS A CA   5  
ATOM 9138  C C    . LYS A 1 16  ? 10.835  -4.651  -0.495  1.00 0.00 ? 16  LYS A C    5  
ATOM 9139  O O    . LYS A 1 16  ? 11.097  -3.459  -0.653  1.00 0.00 ? 16  LYS A O    5  
ATOM 9140  C CB   . LYS A 1 16  ? 10.967  -4.307  1.980   1.00 0.00 ? 16  LYS A CB   5  
ATOM 9141  C CG   . LYS A 1 16  ? 9.967   -3.332  2.575   1.00 0.00 ? 16  LYS A CG   5  
ATOM 9142  C CD   . LYS A 1 16  ? 9.962   -2.011  1.824   1.00 0.00 ? 16  LYS A CD   5  
ATOM 9143  C CE   . LYS A 1 16  ? 9.176   -0.946  2.574   1.00 0.00 ? 16  LYS A CE   5  
ATOM 9144  N NZ   . LYS A 1 16  ? 8.204   -0.247  1.688   1.00 0.00 ? 16  LYS A NZ   5  
ATOM 9145  H H    . LYS A 1 16  ? 10.120  -7.228  1.325   1.00 0.00 ? 16  LYS A H    5  
ATOM 9146  H HA   . LYS A 1 16  ? 9.306   -5.138  0.913   1.00 0.00 ? 16  LYS A HA   5  
ATOM 9147  H HB2  . LYS A 1 16  ? 11.326  -4.949  2.770   1.00 0.00 ? 16  LYS A HB2  5  
ATOM 9148  H HB3  . LYS A 1 16  ? 11.797  -3.741  1.581   1.00 0.00 ? 16  LYS A HB3  5  
ATOM 9149  H HG2  . LYS A 1 16  ? 8.979   -3.766  2.524   1.00 0.00 ? 16  LYS A HG2  5  
ATOM 9150  H HG3  . LYS A 1 16  ? 10.228  -3.147  3.607   1.00 0.00 ? 16  LYS A HG3  5  
ATOM 9151  H HD2  . LYS A 1 16  ? 10.980  -1.672  1.702   1.00 0.00 ? 16  LYS A HD2  5  
ATOM 9152  H HD3  . LYS A 1 16  ? 9.512   -2.161  0.852   1.00 0.00 ? 16  LYS A HD3  5  
ATOM 9153  H HE2  . LYS A 1 16  ? 8.638   -1.417  3.383   1.00 0.00 ? 16  LYS A HE2  5  
ATOM 9154  H HE3  . LYS A 1 16  ? 9.869   -0.222  2.976   1.00 0.00 ? 16  LYS A HE3  5  
ATOM 9155  H HZ1  . LYS A 1 16  ? 8.088   0.741   1.995   1.00 0.00 ? 16  LYS A HZ1  5  
ATOM 9156  H HZ2  . LYS A 1 16  ? 7.280   -0.720  1.728   1.00 0.00 ? 16  LYS A HZ2  5  
ATOM 9157  H HZ3  . LYS A 1 16  ? 8.545   -0.256  0.706   1.00 0.00 ? 16  LYS A HZ3  5  
ATOM 9158  N N    . ALA A 1 17  ? 10.921  -5.547  -1.472  1.00 0.00 ? 17  ALA A N    5  
ATOM 9159  C CA   . ALA A 1 17  ? 11.336  -5.171  -2.818  1.00 0.00 ? 17  ALA A CA   5  
ATOM 9160  C C    . ALA A 1 17  ? 10.224  -4.426  -3.548  1.00 0.00 ? 17  ALA A C    5  
ATOM 9161  O O    . ALA A 1 17  ? 9.168   -4.149  -2.977  1.00 0.00 ? 17  ALA A O    5  
ATOM 9162  C CB   . ALA A 1 17  ? 11.752  -6.405  -3.606  1.00 0.00 ? 17  ALA A CB   5  
ATOM 9163  H H    . ALA A 1 17  ? 10.699  -6.483  -1.285  1.00 0.00 ? 17  ALA A H    5  
ATOM 9164  H HA   . ALA A 1 17  ? 12.196  -4.522  -2.733  1.00 0.00 ? 17  ALA A HA   5  
ATOM 9165  H HB1  . ALA A 1 17  ? 11.240  -6.413  -4.557  1.00 0.00 ? 17  ALA A HB1  5  
ATOM 9166  H HB2  . ALA A 1 17  ? 12.819  -6.383  -3.771  1.00 0.00 ? 17  ALA A HB2  5  
ATOM 9167  H HB3  . ALA A 1 17  ? 11.492  -7.292  -3.049  1.00 0.00 ? 17  ALA A HB3  5  
ATOM 9168  N N    . THR A 1 18  ? 10.467  -4.101  -4.814  1.00 0.00 ? 18  THR A N    5  
ATOM 9169  C CA   . THR A 1 18  ? 9.487   -3.386  -5.621  1.00 0.00 ? 18  THR A CA   5  
ATOM 9170  C C    . THR A 1 18  ? 8.845   -4.307  -6.652  1.00 0.00 ? 18  THR A C    5  
ATOM 9171  O O    . THR A 1 18  ? 9.363   -5.378  -6.970  1.00 0.00 ? 18  THR A O    5  
ATOM 9172  C CB   . THR A 1 18  ? 10.125  -2.187  -6.348  1.00 0.00 ? 18  THR A CB   5  
ATOM 9173  O OG1  . THR A 1 18  ? 11.539  -2.381  -6.464  1.00 0.00 ? 18  THR A OG1  5  
ATOM 9174  C CG2  . THR A 1 18  ? 9.845   -0.891  -5.603  1.00 0.00 ? 18  THR A CG2  5  
ATOM 9175  H H    . THR A 1 18  ? 11.327  -4.349  -5.213  1.00 0.00 ? 18  THR A H    5  
ATOM 9176  H HA   . THR A 1 18  ? 8.719   -3.011  -4.959  1.00 0.00 ? 18  THR A HA   5  
ATOM 9177  H HB   . THR A 1 18  ? 9.697   -2.116  -7.338  1.00 0.00 ? 18  THR A HB   5  
ATOM 9178  H HG1  . THR A 1 18  ? 11.936  -2.370  -5.590  1.00 0.00 ? 18  THR A HG1  5  
ATOM 9179  H HG21 . THR A 1 18  ? 10.479  -0.833  -4.730  1.00 0.00 ? 18  THR A HG21 5  
ATOM 9180  H HG22 . THR A 1 18  ? 8.809   -0.867  -5.299  1.00 0.00 ? 18  THR A HG22 5  
ATOM 9181  H HG23 . THR A 1 18  ? 10.049  -0.052  -6.251  1.00 0.00 ? 18  THR A HG23 5  
ATOM 9182  N N    . PRO A 1 19  ? 7.691   -3.885  -7.188  1.00 0.00 ? 19  PRO A N    5  
ATOM 9183  C CA   . PRO A 1 19  ? 6.954   -4.657  -8.192  1.00 0.00 ? 19  PRO A CA   5  
ATOM 9184  C C    . PRO A 1 19  ? 7.675   -4.700  -9.535  1.00 0.00 ? 19  PRO A C    5  
ATOM 9185  O O    . PRO A 1 19  ? 7.270   -5.422  -10.445 1.00 0.00 ? 19  PRO A O    5  
ATOM 9186  C CB   . PRO A 1 19  ? 5.629   -3.901  -8.320  1.00 0.00 ? 19  PRO A CB   5  
ATOM 9187  C CG   . PRO A 1 19  ? 5.948   -2.506  -7.908  1.00 0.00 ? 19  PRO A CG   5  
ATOM 9188  C CD   . PRO A 1 19  ? 7.016   -2.619  -6.855  1.00 0.00 ? 19  PRO A CD   5  
ATOM 9189  H HA   . PRO A 1 19  ? 6.764   -5.666  -7.855  1.00 0.00 ? 19  PRO A HA   5  
ATOM 9190  H HB2  . PRO A 1 19  ? 5.286   -3.943  -9.344  1.00 0.00 ? 19  PRO A HB2  5  
ATOM 9191  H HB3  . PRO A 1 19  ? 4.892   -4.346  -7.669  1.00 0.00 ? 19  PRO A HB3  5  
ATOM 9192  H HG2  . PRO A 1 19  ? 6.315   -1.947  -8.756  1.00 0.00 ? 19  PRO A HG2  5  
ATOM 9193  H HG3  . PRO A 1 19  ? 5.067   -2.034  -7.499  1.00 0.00 ? 19  PRO A HG3  5  
ATOM 9194  H HD2  . PRO A 1 19  ? 7.701   -1.787  -6.922  1.00 0.00 ? 19  PRO A HD2  5  
ATOM 9195  H HD3  . PRO A 1 19  ? 6.572   -2.666  -5.871  1.00 0.00 ? 19  PRO A HD3  5  
ATOM 9196  N N    . ALA A 1 20  ? 8.746   -3.921  -9.651  1.00 0.00 ? 20  ALA A N    5  
ATOM 9197  C CA   . ALA A 1 20  ? 9.525   -3.872  -10.882 1.00 0.00 ? 20  ALA A CA   5  
ATOM 9198  C C    . ALA A 1 20  ? 10.980  -4.251  -10.626 1.00 0.00 ? 20  ALA A C    5  
ATOM 9199  O O    . ALA A 1 20  ? 11.898  -3.455  -10.823 1.00 0.00 ? 20  ALA A O    5  
ATOM 9200  C CB   . ALA A 1 20  ? 9.440   -2.487  -11.505 1.00 0.00 ? 20  ALA A CB   5  
ATOM 9201  H H    . ALA A 1 20  ? 9.019   -3.368  -8.890  1.00 0.00 ? 20  ALA A H    5  
ATOM 9202  H HA   . ALA A 1 20  ? 9.096   -4.579  -11.577 1.00 0.00 ? 20  ALA A HA   5  
ATOM 9203  H HB1  . ALA A 1 20  ? 8.426   -2.121  -11.432 1.00 0.00 ? 20  ALA A HB1  5  
ATOM 9204  H HB2  . ALA A 1 20  ? 10.104  -1.815  -10.980 1.00 0.00 ? 20  ALA A HB2  5  
ATOM 9205  H HB3  . ALA A 1 20  ? 9.730   -2.541  -12.543 1.00 0.00 ? 20  ALA A HB3  5  
ATOM 9206  N N    . PRO A 1 21  ? 11.197  -5.496  -10.176 1.00 0.00 ? 21  PRO A N    5  
ATOM 9207  C CA   . PRO A 1 21  ? 12.539  -6.009  -9.884  1.00 0.00 ? 21  PRO A CA   5  
ATOM 9208  C C    . PRO A 1 21  ? 13.369  -6.215  -11.147 1.00 0.00 ? 21  PRO A C    5  
ATOM 9209  O O    . PRO A 1 21  ? 12.866  -6.141  -12.268 1.00 0.00 ? 21  PRO A O    5  
ATOM 9210  C CB   . PRO A 1 21  ? 12.265  -7.350  -9.199  1.00 0.00 ? 21  PRO A CB   5  
ATOM 9211  C CG   . PRO A 1 21  ? 10.928  -7.768  -9.707  1.00 0.00 ? 21  PRO A CG   5  
ATOM 9212  C CD   . PRO A 1 21  ? 10.150  -6.499  -9.919  1.00 0.00 ? 21  PRO A CD   5  
ATOM 9213  H HA   . PRO A 1 21  ? 13.073  -5.359  -9.206  1.00 0.00 ? 21  PRO A HA   5  
ATOM 9214  H HB2  . PRO A 1 21  ? 13.033  -8.060  -9.473  1.00 0.00 ? 21  PRO A HB2  5  
ATOM 9215  H HB3  . PRO A 1 21  ? 12.256  -7.216  -8.128  1.00 0.00 ? 21  PRO A HB3  5  
ATOM 9216  H HG2  . PRO A 1 21  ? 11.039  -8.300  -10.639 1.00 0.00 ? 21  PRO A HG2  5  
ATOM 9217  H HG3  . PRO A 1 21  ? 10.436  -8.391  -8.974  1.00 0.00 ? 21  PRO A HG3  5  
ATOM 9218  H HD2  . PRO A 1 21  ? 9.493   -6.597  -10.770 1.00 0.00 ? 21  PRO A HD2  5  
ATOM 9219  H HD3  . PRO A 1 21  ? 9.588   -6.248  -9.032  1.00 0.00 ? 21  PRO A HD3  5  
ATOM 9220  N N    . PRO A 1 22  ? 14.671  -6.480  -10.964 1.00 0.00 ? 22  PRO A N    5  
ATOM 9221  C CA   . PRO A 1 22  ? 15.597  -6.704  -12.078 1.00 0.00 ? 22  PRO A CA   5  
ATOM 9222  C C    . PRO A 1 22  ? 15.330  -8.020  -12.799 1.00 0.00 ? 22  PRO A C    5  
ATOM 9223  O O    . PRO A 1 22  ? 15.910  -8.293  -13.850 1.00 0.00 ? 22  PRO A O    5  
ATOM 9224  C CB   . PRO A 1 22  ? 16.968  -6.736  -11.397 1.00 0.00 ? 22  PRO A CB   5  
ATOM 9225  C CG   . PRO A 1 22  ? 16.686  -7.156  -9.996  1.00 0.00 ? 22  PRO A CG   5  
ATOM 9226  C CD   . PRO A 1 22  ? 15.339  -6.584  -9.655  1.00 0.00 ? 22  PRO A CD   5  
ATOM 9227  H HA   . PRO A 1 22  ? 15.566  -5.892  -12.789 1.00 0.00 ? 22  PRO A HA   5  
ATOM 9228  H HB2  . PRO A 1 22  ? 17.607  -7.446  -11.903 1.00 0.00 ? 22  PRO A HB2  5  
ATOM 9229  H HB3  . PRO A 1 22  ? 17.415  -5.754  -11.432 1.00 0.00 ? 22  PRO A HB3  5  
ATOM 9230  H HG2  . PRO A 1 22  ? 16.663  -8.234  -9.934  1.00 0.00 ? 22  PRO A HG2  5  
ATOM 9231  H HG3  . PRO A 1 22  ? 17.441  -6.757  -9.335  1.00 0.00 ? 22  PRO A HG3  5  
ATOM 9232  H HD2  . PRO A 1 22  ? 14.800  -7.251  -8.999  1.00 0.00 ? 22  PRO A HD2  5  
ATOM 9233  H HD3  . PRO A 1 22  ? 15.446  -5.610  -9.201  1.00 0.00 ? 22  PRO A HD3  5  
ATOM 9234  N N    . VAL A 1 23  ? 14.447  -8.834  -12.228 1.00 0.00 ? 23  VAL A N    5  
ATOM 9235  C CA   . VAL A 1 23  ? 14.101  -10.121 -12.818 1.00 0.00 ? 23  VAL A CA   5  
ATOM 9236  C C    . VAL A 1 23  ? 12.612  -10.197 -13.138 1.00 0.00 ? 23  VAL A C    5  
ATOM 9237  O O    . VAL A 1 23  ? 12.120  -11.220 -13.613 1.00 0.00 ? 23  VAL A O    5  
ATOM 9238  C CB   . VAL A 1 23  ? 14.474  -11.286 -11.882 1.00 0.00 ? 23  VAL A CB   5  
ATOM 9239  C CG1  . VAL A 1 23  ? 13.594  -11.276 -10.641 1.00 0.00 ? 23  VAL A CG1  5  
ATOM 9240  C CG2  . VAL A 1 23  ? 14.362  -12.615 -12.614 1.00 0.00 ? 23  VAL A CG2  5  
ATOM 9241  H H    . VAL A 1 23  ? 14.017  -8.561  -11.391 1.00 0.00 ? 23  VAL A H    5  
ATOM 9242  H HA   . VAL A 1 23  ? 14.662  -10.230 -13.735 1.00 0.00 ? 23  VAL A HA   5  
ATOM 9243  H HB   . VAL A 1 23  ? 15.500  -11.156 -11.570 1.00 0.00 ? 23  VAL A HB   5  
ATOM 9244  H HG11 . VAL A 1 23  ? 14.199  -11.480 -9.770  1.00 0.00 ? 23  VAL A HG11 5  
ATOM 9245  H HG12 . VAL A 1 23  ? 13.126  -10.308 -10.538 1.00 0.00 ? 23  VAL A HG12 5  
ATOM 9246  H HG13 . VAL A 1 23  ? 12.832  -12.036 -10.734 1.00 0.00 ? 23  VAL A HG13 5  
ATOM 9247  H HG21 . VAL A 1 23  ? 14.065  -12.437 -13.637 1.00 0.00 ? 23  VAL A HG21 5  
ATOM 9248  H HG22 . VAL A 1 23  ? 15.319  -13.116 -12.599 1.00 0.00 ? 23  VAL A HG22 5  
ATOM 9249  H HG23 . VAL A 1 23  ? 13.624  -13.234 -12.127 1.00 0.00 ? 23  VAL A HG23 5  
ATOM 9250  N N    . GLY A 1 24  ? 11.899  -9.106  -12.875 1.00 0.00 ? 24  GLY A N    5  
ATOM 9251  C CA   . GLY A 1 24  ? 10.473  -9.070  -13.141 1.00 0.00 ? 24  GLY A CA   5  
ATOM 9252  C C    . GLY A 1 24  ? 10.122  -9.647  -14.498 1.00 0.00 ? 24  GLY A C    5  
ATOM 9253  O O    . GLY A 1 24  ? 9.473   -10.688 -14.604 1.00 0.00 ? 24  GLY A O    5  
ATOM 9254  H H    . GLY A 1 24  ? 12.346  -8.320  -12.497 1.00 0.00 ? 24  GLY A H    5  
ATOM 9255  H HA2  . GLY A 1 24  ? 9.961   -9.635  -12.377 1.00 0.00 ? 24  GLY A HA2  5  
ATOM 9256  H HA3  . GLY A 1 24  ? 10.138  -8.044  -13.102 1.00 0.00 ? 24  GLY A HA3  5  
ATOM 9257  N N    . PRO A 1 25  ? 10.555  -8.962  -15.567 1.00 0.00 ? 25  PRO A N    5  
ATOM 9258  C CA   . PRO A 1 25  ? 10.293  -9.394  -16.943 1.00 0.00 ? 25  PRO A CA   5  
ATOM 9259  C C    . PRO A 1 25  ? 11.069  -10.653 -17.313 1.00 0.00 ? 25  PRO A C    5  
ATOM 9260  O O    . PRO A 1 25  ? 10.867  -11.226 -18.383 1.00 0.00 ? 25  PRO A O    5  
ATOM 9261  C CB   . PRO A 1 25  ? 10.767  -8.206  -17.784 1.00 0.00 ? 25  PRO A CB   5  
ATOM 9262  C CG   . PRO A 1 25  ? 11.785  -7.525  -16.936 1.00 0.00 ? 25  PRO A CG   5  
ATOM 9263  C CD   . PRO A 1 25  ? 11.333  -7.713  -15.515 1.00 0.00 ? 25  PRO A CD   5  
ATOM 9264  H HA   . PRO A 1 25  ? 9.239   -9.559  -17.113 1.00 0.00 ? 25  PRO A HA   5  
ATOM 9265  H HB2  . PRO A 1 25  ? 11.198  -8.566  -18.708 1.00 0.00 ? 25  PRO A HB2  5  
ATOM 9266  H HB3  . PRO A 1 25  ? 9.933   -7.556  -17.999 1.00 0.00 ? 25  PRO A HB3  5  
ATOM 9267  H HG2  . PRO A 1 25  ? 12.752  -7.980  -17.086 1.00 0.00 ? 25  PRO A HG2  5  
ATOM 9268  H HG3  . PRO A 1 25  ? 11.822  -6.473  -17.181 1.00 0.00 ? 25  PRO A HG3  5  
ATOM 9269  H HD2  . PRO A 1 25  ? 12.185  -7.817  -14.859 1.00 0.00 ? 25  PRO A HD2  5  
ATOM 9270  H HD3  . PRO A 1 25  ? 10.713  -6.886  -15.203 1.00 0.00 ? 25  PRO A HD3  5  
ATOM 9271  N N    . ALA A 1 26  ? 11.957  -11.079 -16.421 1.00 0.00 ? 26  ALA A N    5  
ATOM 9272  C CA   . ALA A 1 26  ? 12.762  -12.272 -16.654 1.00 0.00 ? 26  ALA A CA   5  
ATOM 9273  C C    . ALA A 1 26  ? 12.244  -13.451 -15.837 1.00 0.00 ? 26  ALA A C    5  
ATOM 9274  O O    . ALA A 1 26  ? 12.781  -14.557 -15.915 1.00 0.00 ? 26  ALA A O    5  
ATOM 9275  C CB   . ALA A 1 26  ? 14.221  -11.997 -16.321 1.00 0.00 ? 26  ALA A CB   5  
ATOM 9276  H H    . ALA A 1 26  ? 12.073  -10.579 -15.587 1.00 0.00 ? 26  ALA A H    5  
ATOM 9277  H HA   . ALA A 1 26  ? 12.698  -12.518 -17.704 1.00 0.00 ? 26  ALA A HA   5  
ATOM 9278  H HB1  . ALA A 1 26  ? 14.734  -11.655 -17.209 1.00 0.00 ? 26  ALA A HB1  5  
ATOM 9279  H HB2  . ALA A 1 26  ? 14.279  -11.237 -15.556 1.00 0.00 ? 26  ALA A HB2  5  
ATOM 9280  H HB3  . ALA A 1 26  ? 14.685  -12.904 -15.964 1.00 0.00 ? 26  ALA A HB3  5  
ATOM 9281  N N    . LEU A 1 27  ? 11.199  -13.208 -15.054 1.00 0.00 ? 27  LEU A N    5  
ATOM 9282  C CA   . LEU A 1 27  ? 10.609  -14.251 -14.222 1.00 0.00 ? 27  LEU A CA   5  
ATOM 9283  C C    . LEU A 1 27  ? 9.143   -14.472 -14.584 1.00 0.00 ? 27  LEU A C    5  
ATOM 9284  O O    . LEU A 1 27  ? 8.516   -15.423 -14.120 1.00 0.00 ? 27  LEU A O    5  
ATOM 9285  C CB   . LEU A 1 27  ? 10.730  -13.880 -12.743 1.00 0.00 ? 27  LEU A CB   5  
ATOM 9286  C CG   . LEU A 1 27  ? 9.663   -12.928 -12.200 1.00 0.00 ? 27  LEU A CG   5  
ATOM 9287  C CD1  . LEU A 1 27  ? 8.510   -13.711 -11.591 1.00 0.00 ? 27  LEU A CD1  5  
ATOM 9288  C CD2  . LEU A 1 27  ? 10.266  -11.980 -11.174 1.00 0.00 ? 27  LEU A CD2  5  
ATOM 9289  H H    . LEU A 1 27  ? 10.815  -12.308 -15.034 1.00 0.00 ? 27  LEU A H    5  
ATOM 9290  H HA   . LEU A 1 27  ? 11.153  -15.166 -14.401 1.00 0.00 ? 27  LEU A HA   5  
ATOM 9291  H HB2  . LEU A 1 27  ? 10.682  -14.792 -12.168 1.00 0.00 ? 27  LEU A HB2  5  
ATOM 9292  H HB3  . LEU A 1 27  ? 11.694  -13.414 -12.597 1.00 0.00 ? 27  LEU A HB3  5  
ATOM 9293  H HG   . LEU A 1 27  ? 9.270   -12.336 -13.014 1.00 0.00 ? 27  LEU A HG   5  
ATOM 9294  H HD11 . LEU A 1 27  ? 7.593   -13.459 -12.103 1.00 0.00 ? 27  LEU A HD11 5  
ATOM 9295  H HD12 . LEU A 1 27  ? 8.418   -13.461 -10.545 1.00 0.00 ? 27  LEU A HD12 5  
ATOM 9296  H HD13 . LEU A 1 27  ? 8.700   -14.770 -11.693 1.00 0.00 ? 27  LEU A HD13 5  
ATOM 9297  H HD21 . LEU A 1 27  ? 10.862  -12.542 -10.471 1.00 0.00 ? 27  LEU A HD21 5  
ATOM 9298  H HD22 . LEU A 1 27  ? 9.473   -11.469 -10.646 1.00 0.00 ? 27  LEU A HD22 5  
ATOM 9299  H HD23 . LEU A 1 27  ? 10.889  -11.255 -11.677 1.00 0.00 ? 27  LEU A HD23 5  
ATOM 9300  N N    . GLY A 1 28  ? 8.605   -13.587 -15.418 1.00 0.00 ? 28  GLY A N    5  
ATOM 9301  C CA   . GLY A 1 28  ? 7.219   -13.705 -15.830 1.00 0.00 ? 28  GLY A CA   5  
ATOM 9302  C C    . GLY A 1 28  ? 6.915   -15.045 -16.469 1.00 0.00 ? 28  GLY A C    5  
ATOM 9303  O O    . GLY A 1 28  ? 5.785   -15.529 -16.405 1.00 0.00 ? 28  GLY A O    5  
ATOM 9304  H H    . GLY A 1 28  ? 9.154   -12.849 -15.756 1.00 0.00 ? 28  GLY A H    5  
ATOM 9305  H HA2  . GLY A 1 28  ? 6.585   -13.579 -14.965 1.00 0.00 ? 28  GLY A HA2  5  
ATOM 9306  H HA3  . GLY A 1 28  ? 6.999   -12.922 -16.541 1.00 0.00 ? 28  GLY A HA3  5  
ATOM 9307  N N    . GLN A 1 29  ? 7.926   -15.646 -17.088 1.00 0.00 ? 29  GLN A N    5  
ATOM 9308  C CA   . GLN A 1 29  ? 7.761   -16.938 -17.744 1.00 0.00 ? 29  GLN A CA   5  
ATOM 9309  C C    . GLN A 1 29  ? 8.093   -18.080 -16.789 1.00 0.00 ? 29  GLN A C    5  
ATOM 9310  O O    . GLN A 1 29  ? 8.282   -19.221 -17.211 1.00 0.00 ? 29  GLN A O    5  
ATOM 9311  C CB   . GLN A 1 29  ? 8.650   -17.021 -18.986 1.00 0.00 ? 29  GLN A CB   5  
ATOM 9312  C CG   . GLN A 1 29  ? 7.871   -17.158 -20.284 1.00 0.00 ? 29  GLN A CG   5  
ATOM 9313  C CD   . GLN A 1 29  ? 8.773   -17.331 -21.490 1.00 0.00 ? 29  GLN A CD   5  
ATOM 9314  O OE1  . GLN A 1 29  ? 8.932   -16.414 -22.297 1.00 0.00 ? 29  GLN A OE1  5  
ATOM 9315  N NE2  . GLN A 1 29  ? 9.368   -18.511 -21.620 1.00 0.00 ? 29  GLN A NE2  5  
ATOM 9316  H H    . GLN A 1 29  ? 8.803   -15.211 -17.105 1.00 0.00 ? 29  GLN A H    5  
ATOM 9317  H HA   . GLN A 1 29  ? 6.728   -17.027 -18.045 1.00 0.00 ? 29  GLN A HA   5  
ATOM 9318  H HB2  . GLN A 1 29  ? 9.251   -16.126 -19.044 1.00 0.00 ? 29  GLN A HB2  5  
ATOM 9319  H HB3  . GLN A 1 29  ? 9.302   -17.877 -18.891 1.00 0.00 ? 29  GLN A HB3  5  
ATOM 9320  H HG2  . GLN A 1 29  ? 7.224   -18.020 -20.211 1.00 0.00 ? 29  GLN A HG2  5  
ATOM 9321  H HG3  . GLN A 1 29  ? 7.272   -16.270 -20.424 1.00 0.00 ? 29  GLN A HG3  5  
ATOM 9322  H HE21 . GLN A 1 29  ? 9.194   -19.194 -20.939 1.00 0.00 ? 29  GLN A HE21 5  
ATOM 9323  H HE22 . GLN A 1 29  ? 9.956   -18.650 -22.391 1.00 0.00 ? 29  GLN A HE22 5  
ATOM 9324  N N    . HIS A 1 30  ? 8.163   -17.765 -15.499 1.00 0.00 ? 30  HIS A N    5  
ATOM 9325  C CA   . HIS A 1 30  ? 8.473   -18.765 -14.484 1.00 0.00 ? 30  HIS A CA   5  
ATOM 9326  C C    . HIS A 1 30  ? 7.510   -18.659 -13.305 1.00 0.00 ? 30  HIS A C    5  
ATOM 9327  O O    . HIS A 1 30  ? 6.637   -19.507 -13.125 1.00 0.00 ? 30  HIS A O    5  
ATOM 9328  C CB   . HIS A 1 30  ? 9.913   -18.600 -13.997 1.00 0.00 ? 30  HIS A CB   5  
ATOM 9329  C CG   . HIS A 1 30  ? 10.927  -18.656 -15.097 1.00 0.00 ? 30  HIS A CG   5  
ATOM 9330  N ND1  . HIS A 1 30  ? 10.850  -19.547 -16.147 1.00 0.00 ? 30  HIS A ND1  5  
ATOM 9331  C CD2  . HIS A 1 30  ? 12.046  -17.925 -15.308 1.00 0.00 ? 30  HIS A CD2  5  
ATOM 9332  C CE1  . HIS A 1 30  ? 11.878  -19.362 -16.955 1.00 0.00 ? 30  HIS A CE1  5  
ATOM 9333  N NE2  . HIS A 1 30  ? 12.619  -18.383 -16.469 1.00 0.00 ? 30  HIS A NE2  5  
ATOM 9334  H H    . HIS A 1 30  ? 8.003   -16.838 -15.225 1.00 0.00 ? 30  HIS A H    5  
ATOM 9335  H HA   . HIS A 1 30  ? 8.364   -19.740 -14.934 1.00 0.00 ? 30  HIS A HA   5  
ATOM 9336  H HB2  . HIS A 1 30  ? 10.012  -17.643 -13.505 1.00 0.00 ? 30  HIS A HB2  5  
ATOM 9337  H HB3  . HIS A 1 30  ? 10.141  -19.387 -13.293 1.00 0.00 ? 30  HIS A HB3  5  
ATOM 9338  H HD1  . HIS A 1 30  ? 10.146  -20.216 -16.279 1.00 0.00 ? 30  HIS A HD1  5  
ATOM 9339  H HD2  . HIS A 1 30  ? 12.420  -17.129 -14.680 1.00 0.00 ? 30  HIS A HD2  5  
ATOM 9340  H HE1  . HIS A 1 30  ? 12.079  -19.917 -17.860 1.00 0.00 ? 30  HIS A HE1  5  
ATOM 9341  N N    . GLY A 1 31  ? 7.675   -17.610 -12.505 1.00 0.00 ? 31  GLY A N    5  
ATOM 9342  C CA   . GLY A 1 31  ? 6.813   -17.413 -11.353 1.00 0.00 ? 31  GLY A CA   5  
ATOM 9343  C C    . GLY A 1 31  ? 5.361   -17.219 -11.742 1.00 0.00 ? 31  GLY A C    5  
ATOM 9344  O O    . GLY A 1 31  ? 4.468   -17.320 -10.901 1.00 0.00 ? 31  GLY A O    5  
ATOM 9345  H H    . GLY A 1 31  ? 8.387   -16.965 -12.697 1.00 0.00 ? 31  GLY A H    5  
ATOM 9346  H HA2  . GLY A 1 31  ? 6.891   -18.274 -10.708 1.00 0.00 ? 31  GLY A HA2  5  
ATOM 9347  H HA3  . GLY A 1 31  ? 7.149   -16.539 -10.813 1.00 0.00 ? 31  GLY A HA3  5  
ATOM 9348  N N    . ALA A 1 32  ? 5.124   -16.939 -13.019 1.00 0.00 ? 32  ALA A N    5  
ATOM 9349  C CA   . ALA A 1 32  ? 3.770   -16.731 -13.518 1.00 0.00 ? 32  ALA A CA   5  
ATOM 9350  C C    . ALA A 1 32  ? 3.063   -15.625 -12.741 1.00 0.00 ? 32  ALA A C    5  
ATOM 9351  O O    . ALA A 1 32  ? 1.836   -15.589 -12.673 1.00 0.00 ? 32  ALA A O    5  
ATOM 9352  C CB   . ALA A 1 32  ? 2.974   -18.026 -13.439 1.00 0.00 ? 32  ALA A CB   5  
ATOM 9353  H H    . ALA A 1 32  ? 5.878   -16.872 -13.642 1.00 0.00 ? 32  ALA A H    5  
ATOM 9354  H HA   . ALA A 1 32  ? 3.838   -16.442 -14.556 1.00 0.00 ? 32  ALA A HA   5  
ATOM 9355  H HB1  . ALA A 1 32  ? 2.128   -17.887 -12.782 1.00 0.00 ? 32  ALA A HB1  5  
ATOM 9356  H HB2  . ALA A 1 32  ? 2.626   -18.295 -14.425 1.00 0.00 ? 32  ALA A HB2  5  
ATOM 9357  H HB3  . ALA A 1 32  ? 3.605   -18.813 -13.052 1.00 0.00 ? 32  ALA A HB3  5  
ATOM 9358  N N    . ASN A 1 33  ? 3.847   -14.725 -12.157 1.00 0.00 ? 33  ASN A N    5  
ATOM 9359  C CA   . ASN A 1 33  ? 3.295   -13.618 -11.383 1.00 0.00 ? 33  ASN A CA   5  
ATOM 9360  C C    . ASN A 1 33  ? 4.402   -12.684 -10.906 1.00 0.00 ? 33  ASN A C    5  
ATOM 9361  O O    . ASN A 1 33  ? 5.529   -13.114 -10.661 1.00 0.00 ? 33  ASN A O    5  
ATOM 9362  C CB   . ASN A 1 33  ? 2.508   -14.150 -10.184 1.00 0.00 ? 33  ASN A CB   5  
ATOM 9363  C CG   . ASN A 1 33  ? 1.399   -13.207 -9.757  1.00 0.00 ? 33  ASN A CG   5  
ATOM 9364  O OD1  . ASN A 1 33  ? 1.617   -12.006 -9.596  1.00 0.00 ? 33  ASN A OD1  5  
ATOM 9365  N ND2  . ASN A 1 33  ? 0.201   -13.749 -9.572  1.00 0.00 ? 33  ASN A ND2  5  
ATOM 9366  H H    . ASN A 1 33  ? 4.819   -14.807 -12.247 1.00 0.00 ? 33  ASN A H    5  
ATOM 9367  H HA   . ASN A 1 33  ? 2.626   -13.067 -12.026 1.00 0.00 ? 33  ASN A HA   5  
ATOM 9368  H HB2  . ASN A 1 33  ? 2.065   -15.100 -10.444 1.00 0.00 ? 33  ASN A HB2  5  
ATOM 9369  H HB3  . ASN A 1 33  ? 3.180   -14.286 -9.351  1.00 0.00 ? 33  ASN A HB3  5  
ATOM 9370  H HD21 . ASN A 1 33  ? 0.101   -14.713 -9.718  1.00 0.00 ? 33  ASN A HD21 5  
ATOM 9371  H HD22 . ASN A 1 33  ? -0.534  -13.163 -9.296  1.00 0.00 ? 33  ASN A HD22 5  
ATOM 9372  N N    . ILE A 1 34  ? 4.072   -11.403 -10.775 1.00 0.00 ? 34  ILE A N    5  
ATOM 9373  C CA   . ILE A 1 34  ? 5.037   -10.408 -10.325 1.00 0.00 ? 34  ILE A CA   5  
ATOM 9374  C C    . ILE A 1 34  ? 4.903   -10.149 -8.828  1.00 0.00 ? 34  ILE A C    5  
ATOM 9375  O O    . ILE A 1 34  ? 5.844   -10.361 -8.065  1.00 0.00 ? 34  ILE A O    5  
ATOM 9376  C CB   . ILE A 1 34  ? 4.869   -9.077  -11.082 1.00 0.00 ? 34  ILE A CB   5  
ATOM 9377  C CG1  . ILE A 1 34  ? 4.923   -9.314  -12.593 1.00 0.00 ? 34  ILE A CG1  5  
ATOM 9378  C CG2  . ILE A 1 34  ? 5.942   -8.086  -10.657 1.00 0.00 ? 34  ILE A CG2  5  
ATOM 9379  C CD1  . ILE A 1 34  ? 6.205   -9.970  -13.055 1.00 0.00 ? 34  ILE A CD1  5  
ATOM 9380  H H    . ILE A 1 34  ? 3.158   -11.121 -10.986 1.00 0.00 ? 34  ILE A H    5  
ATOM 9381  H HA   . ILE A 1 34  ? 6.028   -10.790 -10.526 1.00 0.00 ? 34  ILE A HA   5  
ATOM 9382  H HB   . ILE A 1 34  ? 3.906   -8.662  -10.825 1.00 0.00 ? 34  ILE A HB   5  
ATOM 9383  H HG12 . ILE A 1 34  ? 4.103   -9.952  -12.881 1.00 0.00 ? 34  ILE A HG12 5  
ATOM 9384  H HG13 . ILE A 1 34  ? 4.832   -8.366  -13.102 1.00 0.00 ? 34  ILE A HG13 5  
ATOM 9385  H HG21 . ILE A 1 34  ? 5.478   -7.151  -10.378 1.00 0.00 ? 34  ILE A HG21 5  
ATOM 9386  H HG22 . ILE A 1 34  ? 6.483   -8.484  -9.812  1.00 0.00 ? 34  ILE A HG22 5  
ATOM 9387  H HG23 . ILE A 1 34  ? 6.624   -7.920  -11.477 1.00 0.00 ? 34  ILE A HG23 5  
ATOM 9388  H HD11 . ILE A 1 34  ? 6.351   -10.896 -12.519 1.00 0.00 ? 34  ILE A HD11 5  
ATOM 9389  H HD12 . ILE A 1 34  ? 6.146   -10.172 -14.114 1.00 0.00 ? 34  ILE A HD12 5  
ATOM 9390  H HD13 . ILE A 1 34  ? 7.038   -9.309  -12.862 1.00 0.00 ? 34  ILE A HD13 5  
ATOM 9391  N N    . MET A 1 35  ? 3.725   -9.691  -8.416  1.00 0.00 ? 35  MET A N    5  
ATOM 9392  C CA   . MET A 1 35  ? 3.466   -9.406  -7.010  1.00 0.00 ? 35  MET A CA   5  
ATOM 9393  C C    . MET A 1 35  ? 3.723   -10.639 -6.149  1.00 0.00 ? 35  MET A C    5  
ATOM 9394  O O    . MET A 1 35  ? 4.157   -10.527 -5.003  1.00 0.00 ? 35  MET A O    5  
ATOM 9395  C CB   . MET A 1 35  ? 2.025   -8.929  -6.821  1.00 0.00 ? 35  MET A CB   5  
ATOM 9396  C CG   . MET A 1 35  ? 1.868   -7.419  -6.905  1.00 0.00 ? 35  MET A CG   5  
ATOM 9397  S SD   . MET A 1 35  ? 1.570   -6.661  -5.297  1.00 0.00 ? 35  MET A SD   5  
ATOM 9398  C CE   . MET A 1 35  ? 3.046   -5.662  -5.115  1.00 0.00 ? 35  MET A CE   5  
ATOM 9399  H H    . MET A 1 35  ? 3.013   -9.541  -9.073  1.00 0.00 ? 35  MET A H    5  
ATOM 9400  H HA   . MET A 1 35  ? 4.139   -8.620  -6.702  1.00 0.00 ? 35  MET A HA   5  
ATOM 9401  H HB2  . MET A 1 35  ? 1.407   -9.377  -7.585  1.00 0.00 ? 35  MET A HB2  5  
ATOM 9402  H HB3  . MET A 1 35  ? 1.675   -9.251  -5.851  1.00 0.00 ? 35  MET A HB3  5  
ATOM 9403  H HG2  . MET A 1 35  ? 2.771   -7.000  -7.323  1.00 0.00 ? 35  MET A HG2  5  
ATOM 9404  H HG3  . MET A 1 35  ? 1.036   -7.194  -7.555  1.00 0.00 ? 35  MET A HG3  5  
ATOM 9405  H HE1  . MET A 1 35  ? 3.903   -6.306  -4.985  1.00 0.00 ? 35  MET A HE1  5  
ATOM 9406  H HE2  . MET A 1 35  ? 3.181   -5.056  -5.998  1.00 0.00 ? 35  MET A HE2  5  
ATOM 9407  H HE3  . MET A 1 35  ? 2.942   -5.022  -4.251  1.00 0.00 ? 35  MET A HE3  5  
ATOM 9408  N N    . GLU A 1 36  ? 3.453   -11.813 -6.710  1.00 0.00 ? 36  GLU A N    5  
ATOM 9409  C CA   . GLU A 1 36  ? 3.654   -13.066 -5.992  1.00 0.00 ? 36  GLU A CA   5  
ATOM 9410  C C    . GLU A 1 36  ? 5.140   -13.329 -5.762  1.00 0.00 ? 36  GLU A C    5  
ATOM 9411  O O    . GLU A 1 36  ? 5.513   -14.209 -4.986  1.00 0.00 ? 36  GLU A O    5  
ATOM 9412  C CB   . GLU A 1 36  ? 3.033   -14.230 -6.767  1.00 0.00 ? 36  GLU A CB   5  
ATOM 9413  C CG   . GLU A 1 36  ? 2.113   -15.099 -5.926  1.00 0.00 ? 36  GLU A CG   5  
ATOM 9414  C CD   . GLU A 1 36  ? 2.654   -15.342 -4.531  1.00 0.00 ? 36  GLU A CD   5  
ATOM 9415  O OE1  . GLU A 1 36  ? 3.556   -16.193 -4.383  1.00 0.00 ? 36  GLU A OE1  5  
ATOM 9416  O OE2  . GLU A 1 36  ? 2.175   -14.681 -3.586  1.00 0.00 ? 36  GLU A OE2  5  
ATOM 9417  H H    . GLU A 1 36  ? 3.109   -11.838 -7.627  1.00 0.00 ? 36  GLU A H    5  
ATOM 9418  H HA   . GLU A 1 36  ? 3.164   -12.982 -5.033  1.00 0.00 ? 36  GLU A HA   5  
ATOM 9419  H HB2  . GLU A 1 36  ? 2.463   -13.832 -7.594  1.00 0.00 ? 36  GLU A HB2  5  
ATOM 9420  H HB3  . GLU A 1 36  ? 3.826   -14.852 -7.155  1.00 0.00 ? 36  GLU A HB3  5  
ATOM 9421  H HG2  . GLU A 1 36  ? 1.153   -14.611 -5.843  1.00 0.00 ? 36  GLU A HG2  5  
ATOM 9422  H HG3  . GLU A 1 36  ? 1.989   -16.052 -6.419  1.00 0.00 ? 36  GLU A HG3  5  
ATOM 9423  N N    . PHE A 1 37  ? 5.983   -12.561 -6.444  1.00 0.00 ? 37  PHE A N    5  
ATOM 9424  C CA   . PHE A 1 37  ? 7.428   -12.711 -6.317  1.00 0.00 ? 37  PHE A CA   5  
ATOM 9425  C C    . PHE A 1 37  ? 7.971   -11.818 -5.205  1.00 0.00 ? 37  PHE A C    5  
ATOM 9426  O O    . PHE A 1 37  ? 8.784   -12.251 -4.387  1.00 0.00 ? 37  PHE A O    5  
ATOM 9427  C CB   . PHE A 1 37  ? 8.115   -12.371 -7.641  1.00 0.00 ? 37  PHE A CB   5  
ATOM 9428  C CG   . PHE A 1 37  ? 9.527   -12.877 -7.730  1.00 0.00 ? 37  PHE A CG   5  
ATOM 9429  C CD1  . PHE A 1 37  ? 9.792   -14.237 -7.726  1.00 0.00 ? 37  PHE A CD1  5  
ATOM 9430  C CD2  . PHE A 1 37  ? 10.590  -11.992 -7.817  1.00 0.00 ? 37  PHE A CD2  5  
ATOM 9431  C CE1  . PHE A 1 37  ? 11.090  -14.704 -7.807  1.00 0.00 ? 37  PHE A CE1  5  
ATOM 9432  C CE2  . PHE A 1 37  ? 11.890  -12.453 -7.898  1.00 0.00 ? 37  PHE A CE2  5  
ATOM 9433  C CZ   . PHE A 1 37  ? 12.140  -13.811 -7.894  1.00 0.00 ? 37  PHE A CZ   5  
ATOM 9434  H H    . PHE A 1 37  ? 5.624   -11.877 -7.048  1.00 0.00 ? 37  PHE A H    5  
ATOM 9435  H HA   . PHE A 1 37  ? 7.632   -13.741 -6.068  1.00 0.00 ? 37  PHE A HA   5  
ATOM 9436  H HB2  . PHE A 1 37  ? 7.555   -12.810 -8.452  1.00 0.00 ? 37  PHE A HB2  5  
ATOM 9437  H HB3  . PHE A 1 37  ? 8.137   -11.299 -7.762  1.00 0.00 ? 37  PHE A HB3  5  
ATOM 9438  H HD1  . PHE A 1 37  ? 8.971   -14.936 -7.659  1.00 0.00 ? 37  PHE A HD1  5  
ATOM 9439  H HD2  . PHE A 1 37  ? 10.395  -10.928 -7.820  1.00 0.00 ? 37  PHE A HD2  5  
ATOM 9440  H HE1  . PHE A 1 37  ? 11.283  -15.767 -7.804  1.00 0.00 ? 37  PHE A HE1  5  
ATOM 9441  H HE2  . PHE A 1 37  ? 12.709  -11.752 -7.966  1.00 0.00 ? 37  PHE A HE2  5  
ATOM 9442  H HZ   . PHE A 1 37  ? 13.155  -14.174 -7.957  1.00 0.00 ? 37  PHE A HZ   5  
ATOM 9443  N N    . VAL A 1 38  ? 7.517   -10.569 -5.181  1.00 0.00 ? 38  VAL A N    5  
ATOM 9444  C CA   . VAL A 1 38  ? 7.956   -9.615  -4.170  1.00 0.00 ? 38  VAL A CA   5  
ATOM 9445  C C    . VAL A 1 38  ? 7.198   -9.812  -2.863  1.00 0.00 ? 38  VAL A C    5  
ATOM 9446  O O    . VAL A 1 38  ? 7.797   -9.889  -1.790  1.00 0.00 ? 38  VAL A O    5  
ATOM 9447  C CB   . VAL A 1 38  ? 7.765   -8.163  -4.648  1.00 0.00 ? 38  VAL A CB   5  
ATOM 9448  C CG1  . VAL A 1 38  ? 8.221   -7.184  -3.577  1.00 0.00 ? 38  VAL A CG1  5  
ATOM 9449  C CG2  . VAL A 1 38  ? 8.516   -7.929  -5.951  1.00 0.00 ? 38  VAL A CG2  5  
ATOM 9450  H H    . VAL A 1 38  ? 6.870   -10.283 -5.860  1.00 0.00 ? 38  VAL A H    5  
ATOM 9451  H HA   . VAL A 1 38  ? 9.010   -9.778  -3.993  1.00 0.00 ? 38  VAL A HA   5  
ATOM 9452  H HB   . VAL A 1 38  ? 6.713   -8.001  -4.829  1.00 0.00 ? 38  VAL A HB   5  
ATOM 9453  H HG11 . VAL A 1 38  ? 7.497   -7.166  -2.776  1.00 0.00 ? 38  VAL A HG11 5  
ATOM 9454  H HG12 . VAL A 1 38  ? 9.181   -7.494  -3.191  1.00 0.00 ? 38  VAL A HG12 5  
ATOM 9455  H HG13 . VAL A 1 38  ? 8.306   -6.196  -4.006  1.00 0.00 ? 38  VAL A HG13 5  
ATOM 9456  H HG21 . VAL A 1 38  ? 9.386   -7.319  -5.759  1.00 0.00 ? 38  VAL A HG21 5  
ATOM 9457  H HG22 . VAL A 1 38  ? 8.825   -8.877  -6.365  1.00 0.00 ? 38  VAL A HG22 5  
ATOM 9458  H HG23 . VAL A 1 38  ? 7.869   -7.424  -6.653  1.00 0.00 ? 38  VAL A HG23 5  
ATOM 9459  N N    . LYS A 1 39  ? 5.875   -9.893  -2.959  1.00 0.00 ? 39  LYS A N    5  
ATOM 9460  C CA   . LYS A 1 39  ? 5.033   -10.083 -1.784  1.00 0.00 ? 39  LYS A CA   5  
ATOM 9461  C C    . LYS A 1 39  ? 5.394   -11.375 -1.058  1.00 0.00 ? 39  LYS A C    5  
ATOM 9462  O O    . LYS A 1 39  ? 5.135   -11.521 0.136   1.00 0.00 ? 39  LYS A O    5  
ATOM 9463  C CB   . LYS A 1 39  ? 3.557   -10.107 -2.188  1.00 0.00 ? 39  LYS A CB   5  
ATOM 9464  C CG   . LYS A 1 39  ? 3.098   -8.841  -2.890  1.00 0.00 ? 39  LYS A CG   5  
ATOM 9465  C CD   . LYS A 1 39  ? 2.892   -7.701  -1.907  1.00 0.00 ? 39  LYS A CD   5  
ATOM 9466  C CE   . LYS A 1 39  ? 1.457   -7.650  -1.405  1.00 0.00 ? 39  LYS A CE   5  
ATOM 9467  N NZ   . LYS A 1 39  ? 0.758   -6.412  -1.850  1.00 0.00 ? 39  LYS A NZ   5  
ATOM 9468  H H    . LYS A 1 39  ? 5.455   -9.825  -3.842  1.00 0.00 ? 39  LYS A H    5  
ATOM 9469  H HA   . LYS A 1 39  ? 5.201   -9.251  -1.117  1.00 0.00 ? 39  LYS A HA   5  
ATOM 9470  H HB2  . LYS A 1 39  ? 3.392   -10.943 -2.852  1.00 0.00 ? 39  LYS A HB2  5  
ATOM 9471  H HB3  . LYS A 1 39  ? 2.955   -10.240 -1.300  1.00 0.00 ? 39  LYS A HB3  5  
ATOM 9472  H HG2  . LYS A 1 39  ? 3.846   -8.549  -3.612  1.00 0.00 ? 39  LYS A HG2  5  
ATOM 9473  H HG3  . LYS A 1 39  ? 2.164   -9.040  -3.397  1.00 0.00 ? 39  LYS A HG3  5  
ATOM 9474  H HD2  . LYS A 1 39  ? 3.552   -7.841  -1.063  1.00 0.00 ? 39  LYS A HD2  5  
ATOM 9475  H HD3  . LYS A 1 39  ? 3.127   -6.767  -2.398  1.00 0.00 ? 39  LYS A HD3  5  
ATOM 9476  H HE2  . LYS A 1 39  ? 0.926   -8.509  -1.784  1.00 0.00 ? 39  LYS A HE2  5  
ATOM 9477  H HE3  . LYS A 1 39  ? 1.466   -7.679  -0.325  1.00 0.00 ? 39  LYS A HE3  5  
ATOM 9478  H HZ1  . LYS A 1 39  ? 1.435   -5.762  -2.298  1.00 0.00 ? 39  LYS A HZ1  5  
ATOM 9479  H HZ2  . LYS A 1 39  ? 0.323   -5.935  -1.035  1.00 0.00 ? 39  LYS A HZ2  5  
ATOM 9480  H HZ3  . LYS A 1 39  ? 0.014   -6.650  -2.537  1.00 0.00 ? 39  LYS A HZ3  5  
ATOM 9481  N N    . ALA A 1 40  ? 5.993   -12.310 -1.788  1.00 0.00 ? 40  ALA A N    5  
ATOM 9482  C CA   . ALA A 1 40  ? 6.393   -13.589 -1.213  1.00 0.00 ? 40  ALA A CA   5  
ATOM 9483  C C    . ALA A 1 40  ? 7.713   -13.463 -0.460  1.00 0.00 ? 40  ALA A C    5  
ATOM 9484  O O    . ALA A 1 40  ? 8.164   -14.410 0.185   1.00 0.00 ? 40  ALA A O    5  
ATOM 9485  C CB   . ALA A 1 40  ? 6.502   -14.646 -2.301  1.00 0.00 ? 40  ALA A CB   5  
ATOM 9486  H H    . ALA A 1 40  ? 6.173   -12.135 -2.735  1.00 0.00 ? 40  ALA A H    5  
ATOM 9487  H HA   . ALA A 1 40  ? 5.623   -13.898 -0.520  1.00 0.00 ? 40  ALA A HA   5  
ATOM 9488  H HB1  . ALA A 1 40  ? 7.089   -14.258 -3.121  1.00 0.00 ? 40  ALA A HB1  5  
ATOM 9489  H HB2  . ALA A 1 40  ? 6.980   -15.527 -1.900  1.00 0.00 ? 40  ALA A HB2  5  
ATOM 9490  H HB3  . ALA A 1 40  ? 5.514   -14.902 -2.655  1.00 0.00 ? 40  ALA A HB3  5  
ATOM 9491  N N    . PHE A 1 41  ? 8.330   -12.289 -0.547  1.00 0.00 ? 41  PHE A N    5  
ATOM 9492  C CA   . PHE A 1 41  ? 9.600   -12.041 0.125   1.00 0.00 ? 41  PHE A CA   5  
ATOM 9493  C C    . PHE A 1 41  ? 9.429   -11.031 1.256   1.00 0.00 ? 41  PHE A C    5  
ATOM 9494  O O    . PHE A 1 41  ? 10.339  -10.819 2.056   1.00 0.00 ? 41  PHE A O    5  
ATOM 9495  C CB   . PHE A 1 41  ? 10.639  -11.532 -0.876  1.00 0.00 ? 41  PHE A CB   5  
ATOM 9496  C CG   . PHE A 1 41  ? 11.711  -12.535 -1.190  1.00 0.00 ? 41  PHE A CG   5  
ATOM 9497  C CD1  . PHE A 1 41  ? 11.391  -13.866 -1.406  1.00 0.00 ? 41  PHE A CD1  5  
ATOM 9498  C CD2  . PHE A 1 41  ? 13.039  -12.149 -1.270  1.00 0.00 ? 41  PHE A CD2  5  
ATOM 9499  C CE1  . PHE A 1 41  ? 12.375  -14.793 -1.695  1.00 0.00 ? 41  PHE A CE1  5  
ATOM 9500  C CE2  . PHE A 1 41  ? 14.027  -13.070 -1.560  1.00 0.00 ? 41  PHE A CE2  5  
ATOM 9501  C CZ   . PHE A 1 41  ? 13.695  -14.394 -1.771  1.00 0.00 ? 41  PHE A CZ   5  
ATOM 9502  H H    . PHE A 1 41  ? 7.920   -11.573 -1.077  1.00 0.00 ? 41  PHE A H    5  
ATOM 9503  H HA   . PHE A 1 41  ? 9.942   -12.976 0.541   1.00 0.00 ? 41  PHE A HA   5  
ATOM 9504  H HB2  . PHE A 1 41  ? 10.144  -11.276 -1.800  1.00 0.00 ? 41  PHE A HB2  5  
ATOM 9505  H HB3  . PHE A 1 41  ? 11.115  -10.651 -0.472  1.00 0.00 ? 41  PHE A HB3  5  
ATOM 9506  H HD1  . PHE A 1 41  ? 10.358  -14.179 -1.346  1.00 0.00 ? 41  PHE A HD1  5  
ATOM 9507  H HD2  . PHE A 1 41  ? 13.301  -11.114 -1.103  1.00 0.00 ? 41  PHE A HD2  5  
ATOM 9508  H HE1  . PHE A 1 41  ? 12.112  -15.827 -1.860  1.00 0.00 ? 41  PHE A HE1  5  
ATOM 9509  H HE2  . PHE A 1 41  ? 15.059  -12.756 -1.618  1.00 0.00 ? 41  PHE A HE2  5  
ATOM 9510  H HZ   . PHE A 1 41  ? 14.465  -15.116 -1.998  1.00 0.00 ? 41  PHE A HZ   5  
ATOM 9511  N N    . ASN A 1 42  ? 8.255   -10.411 1.314   1.00 0.00 ? 42  ASN A N    5  
ATOM 9512  C CA   . ASN A 1 42  ? 7.963   -9.422  2.346   1.00 0.00 ? 42  ASN A CA   5  
ATOM 9513  C C    . ASN A 1 42  ? 7.490   -10.098 3.629   1.00 0.00 ? 42  ASN A C    5  
ATOM 9514  O O    . ASN A 1 42  ? 7.336   -9.450  4.664   1.00 0.00 ? 42  ASN A O    5  
ATOM 9515  C CB   . ASN A 1 42  ? 6.900   -8.438  1.853   1.00 0.00 ? 42  ASN A CB   5  
ATOM 9516  C CG   . ASN A 1 42  ? 7.500   -7.129  1.377   1.00 0.00 ? 42  ASN A CG   5  
ATOM 9517  O OD1  . ASN A 1 42  ? 7.706   -6.205  2.164   1.00 0.00 ? 42  ASN A OD1  5  
ATOM 9518  N ND2  . ASN A 1 42  ? 7.784   -7.045  0.083   1.00 0.00 ? 42  ASN A ND2  5  
ATOM 9519  H H    . ASN A 1 42  ? 7.568   -10.622 0.648   1.00 0.00 ? 42  ASN A H    5  
ATOM 9520  H HA   . ASN A 1 42  ? 8.874   -8.881  2.553   1.00 0.00 ? 42  ASN A HA   5  
ATOM 9521  H HB2  . ASN A 1 42  ? 6.359   -8.884  1.031   1.00 0.00 ? 42  ASN A HB2  5  
ATOM 9522  H HB3  . ASN A 1 42  ? 6.213   -8.227  2.658   1.00 0.00 ? 42  ASN A HB3  5  
ATOM 9523  H HD21 . ASN A 1 42  ? 7.593   -7.821  -0.485  1.00 0.00 ? 42  ASN A HD21 5  
ATOM 9524  H HD22 . ASN A 1 42  ? 8.173   -6.210  -0.252  1.00 0.00 ? 42  ASN A HD22 5  
ATOM 9525  N N    . ALA A 1 43  ? 7.263   -11.406 3.554   1.00 0.00 ? 43  ALA A N    5  
ATOM 9526  C CA   . ALA A 1 43  ? 6.811   -12.170 4.709   1.00 0.00 ? 43  ALA A CA   5  
ATOM 9527  C C    . ALA A 1 43  ? 7.800   -13.278 5.056   1.00 0.00 ? 43  ALA A C    5  
ATOM 9528  O O    . ALA A 1 43  ? 7.591   -14.036 6.003   1.00 0.00 ? 43  ALA A O    5  
ATOM 9529  C CB   . ALA A 1 43  ? 5.431   -12.755 4.448   1.00 0.00 ? 43  ALA A CB   5  
ATOM 9530  H H    . ALA A 1 43  ? 7.405   -11.867 2.701   1.00 0.00 ? 43  ALA A H    5  
ATOM 9531  H HA   . ALA A 1 43  ? 6.735   -11.494 5.549   1.00 0.00 ? 43  ALA A HA   5  
ATOM 9532  H HB1  . ALA A 1 43  ? 5.428   -13.252 3.488   1.00 0.00 ? 43  ALA A HB1  5  
ATOM 9533  H HB2  . ALA A 1 43  ? 5.189   -13.467 5.223   1.00 0.00 ? 43  ALA A HB2  5  
ATOM 9534  H HB3  . ALA A 1 43  ? 4.699   -11.962 4.445   1.00 0.00 ? 43  ALA A HB3  5  
ATOM 9535  N N    . ALA A 1 44  ? 8.878   -13.366 4.283   1.00 0.00 ? 44  ALA A N    5  
ATOM 9536  C CA   . ALA A 1 44  ? 9.900   -14.380 4.510   1.00 0.00 ? 44  ALA A CA   5  
ATOM 9537  C C    . ALA A 1 44  ? 11.257  -13.741 4.780   1.00 0.00 ? 44  ALA A C    5  
ATOM 9538  O O    . ALA A 1 44  ? 11.857  -13.953 5.834   1.00 0.00 ? 44  ALA A O    5  
ATOM 9539  C CB   . ALA A 1 44  ? 9.985   -15.320 3.316   1.00 0.00 ? 44  ALA A CB   5  
ATOM 9540  H H    . ALA A 1 44  ? 8.988   -12.733 3.544   1.00 0.00 ? 44  ALA A H    5  
ATOM 9541  H HA   . ALA A 1 44  ? 9.608   -14.961 5.373   1.00 0.00 ? 44  ALA A HA   5  
ATOM 9542  H HB1  . ALA A 1 44  ? 10.936  -15.187 2.821   1.00 0.00 ? 44  ALA A HB1  5  
ATOM 9543  H HB2  . ALA A 1 44  ? 9.894   -16.341 3.655   1.00 0.00 ? 44  ALA A HB2  5  
ATOM 9544  H HB3  . ALA A 1 44  ? 9.185   -15.097 2.625   1.00 0.00 ? 44  ALA A HB3  5  
ATOM 9545  N N    . THR A 1 45  ? 11.739  -12.957 3.820   1.00 0.00 ? 45  THR A N    5  
ATOM 9546  C CA   . THR A 1 45  ? 13.027  -12.288 3.953   1.00 0.00 ? 45  THR A CA   5  
ATOM 9547  C C    . THR A 1 45  ? 12.910  -11.038 4.817   1.00 0.00 ? 45  THR A C    5  
ATOM 9548  O O    . THR A 1 45  ? 13.620  -10.890 5.811   1.00 0.00 ? 45  THR A O    5  
ATOM 9549  C CB   . THR A 1 45  ? 13.602  -11.897 2.579   1.00 0.00 ? 45  THR A CB   5  
ATOM 9550  O OG1  . THR A 1 45  ? 12.585  -11.999 1.575   1.00 0.00 ? 45  THR A OG1  5  
ATOM 9551  C CG2  . THR A 1 45  ? 14.777  -12.790 2.210   1.00 0.00 ? 45  THR A CG2  5  
ATOM 9552  H H    . THR A 1 45  ? 11.214  -12.827 3.002   1.00 0.00 ? 45  THR A H    5  
ATOM 9553  H HA   . THR A 1 45  ? 13.713  -12.977 4.424   1.00 0.00 ? 45  THR A HA   5  
ATOM 9554  H HB   . THR A 1 45  ? 13.947  -10.874 2.628   1.00 0.00 ? 45  THR A HB   5  
ATOM 9555  H HG1  . THR A 1 45  ? 12.315  -11.119 1.302   1.00 0.00 ? 45  THR A HG1  5  
ATOM 9556  H HG21 . THR A 1 45  ? 15.253  -13.149 3.110   1.00 0.00 ? 45  THR A HG21 5  
ATOM 9557  H HG22 . THR A 1 45  ? 15.489  -12.225 1.627   1.00 0.00 ? 45  THR A HG22 5  
ATOM 9558  H HG23 . THR A 1 45  ? 14.423  -13.629 1.631   1.00 0.00 ? 45  THR A HG23 5  
ATOM 9559  N N    . ALA A 1 46  ? 12.010  -10.140 4.431   1.00 0.00 ? 46  ALA A N    5  
ATOM 9560  C CA   . ALA A 1 46  ? 11.798  -8.903  5.172   1.00 0.00 ? 46  ALA A CA   5  
ATOM 9561  C C    . ALA A 1 46  ? 11.751  -9.164  6.674   1.00 0.00 ? 46  ALA A C    5  
ATOM 9562  O O    . ALA A 1 46  ? 12.211  -8.347  7.470   1.00 0.00 ? 46  ALA A O    5  
ATOM 9563  C CB   . ALA A 1 46  ? 10.517  -8.224  4.712   1.00 0.00 ? 46  ALA A CB   5  
ATOM 9564  H H    . ALA A 1 46  ? 11.474  -10.314 3.630   1.00 0.00 ? 46  ALA A H    5  
ATOM 9565  H HA   . ALA A 1 46  ? 12.624  -8.240  4.958   1.00 0.00 ? 46  ALA A HA   5  
ATOM 9566  H HB1  . ALA A 1 46  ? 9.672   -8.857  4.942   1.00 0.00 ? 46  ALA A HB1  5  
ATOM 9567  H HB2  . ALA A 1 46  ? 10.407  -7.278  5.222   1.00 0.00 ? 46  ALA A HB2  5  
ATOM 9568  H HB3  . ALA A 1 46  ? 10.562  -8.056  3.646   1.00 0.00 ? 46  ALA A HB3  5  
ATOM 9569  N N    . ASN A 1 47  ? 11.190  -10.307 7.054   1.00 0.00 ? 47  ASN A N    5  
ATOM 9570  C CA   . ASN A 1 47  ? 11.082  -10.675 8.461   1.00 0.00 ? 47  ASN A CA   5  
ATOM 9571  C C    . ASN A 1 47  ? 12.409  -11.215 8.986   1.00 0.00 ? 47  ASN A C    5  
ATOM 9572  O O    . ASN A 1 47  ? 12.476  -12.329 9.503   1.00 0.00 ? 47  ASN A O    5  
ATOM 9573  C CB   . ASN A 1 47  ? 9.982   -11.722 8.652   1.00 0.00 ? 47  ASN A CB   5  
ATOM 9574  C CG   . ASN A 1 47  ? 8.603   -11.175 8.335   1.00 0.00 ? 47  ASN A CG   5  
ATOM 9575  O OD1  . ASN A 1 47  ? 8.412   -10.485 7.334   1.00 0.00 ? 47  ASN A OD1  5  
ATOM 9576  N ND2  . ASN A 1 47  ? 7.634   -11.484 9.189   1.00 0.00 ? 47  ASN A ND2  5  
ATOM 9577  H H    . ASN A 1 47  ? 10.841  -10.919 6.372   1.00 0.00 ? 47  ASN A H    5  
ATOM 9578  H HA   . ASN A 1 47  ? 10.822  -9.787  9.016   1.00 0.00 ? 47  ASN A HA   5  
ATOM 9579  H HB2  . ASN A 1 47  ? 10.174  -12.561 8.000   1.00 0.00 ? 47  ASN A HB2  5  
ATOM 9580  H HB3  . ASN A 1 47  ? 9.988   -12.059 9.678   1.00 0.00 ? 47  ASN A HB3  5  
ATOM 9581  H HD21 . ASN A 1 47  ? 7.859   -12.038 9.965   1.00 0.00 ? 47  ASN A HD21 5  
ATOM 9582  H HD22 . ASN A 1 47  ? 6.732   -11.144 9.007   1.00 0.00 ? 47  ASN A HD22 5  
ATOM 9583  N N    . MET A 1 48  ? 13.461  -10.415 8.850   1.00 0.00 ? 48  MET A N    5  
ATOM 9584  C CA   . MET A 1 48  ? 14.786  -10.811 9.313   1.00 0.00 ? 48  MET A CA   5  
ATOM 9585  C C    . MET A 1 48  ? 15.383  -9.747  10.230  1.00 0.00 ? 48  MET A C    5  
ATOM 9586  O O    . MET A 1 48  ? 15.441  -9.924  11.446  1.00 0.00 ? 48  MET A O    5  
ATOM 9587  C CB   . MET A 1 48  ? 15.715  -11.053 8.122   1.00 0.00 ? 48  MET A CB   5  
ATOM 9588  C CG   . MET A 1 48  ? 15.647  -12.470 7.576   1.00 0.00 ? 48  MET A CG   5  
ATOM 9589  S SD   . MET A 1 48  ? 16.833  -12.761 6.250   1.00 0.00 ? 48  MET A SD   5  
ATOM 9590  C CE   . MET A 1 48  ? 16.313  -14.378 5.680   1.00 0.00 ? 48  MET A CE   5  
ATOM 9591  H H    . MET A 1 48  ? 13.345  -9.537  8.430   1.00 0.00 ? 48  MET A H    5  
ATOM 9592  H HA   . MET A 1 48  ? 14.682  -11.730 9.869   1.00 0.00 ? 48  MET A HA   5  
ATOM 9593  H HB2  . MET A 1 48  ? 15.447  -10.371 7.328   1.00 0.00 ? 48  MET A HB2  5  
ATOM 9594  H HB3  . MET A 1 48  ? 16.732  -10.856 8.427   1.00 0.00 ? 48  MET A HB3  5  
ATOM 9595  H HG2  . MET A 1 48  ? 15.852  -13.161 8.380   1.00 0.00 ? 48  MET A HG2  5  
ATOM 9596  H HG3  . MET A 1 48  ? 14.652  -12.647 7.197   1.00 0.00 ? 48  MET A HG3  5  
ATOM 9597  H HE1  . MET A 1 48  ? 15.271  -14.342 5.398   1.00 0.00 ? 48  MET A HE1  5  
ATOM 9598  H HE2  . MET A 1 48  ? 16.908  -14.666 4.826   1.00 0.00 ? 48  MET A HE2  5  
ATOM 9599  H HE3  . MET A 1 48  ? 16.447  -15.099 6.473   1.00 0.00 ? 48  MET A HE3  5  
ATOM 9600  N N    . GLY A 1 49  ? 15.824  -8.642  9.637   1.00 0.00 ? 49  GLY A N    5  
ATOM 9601  C CA   . GLY A 1 49  ? 16.411  -7.566  10.416  1.00 0.00 ? 49  GLY A CA   5  
ATOM 9602  C C    . GLY A 1 49  ? 17.299  -6.665  9.582   1.00 0.00 ? 49  GLY A C    5  
ATOM 9603  O O    . GLY A 1 49  ? 17.026  -5.473  9.440   1.00 0.00 ? 49  GLY A O    5  
ATOM 9604  H H    . GLY A 1 49  ? 15.751  -8.556  8.664   1.00 0.00 ? 49  GLY A H    5  
ATOM 9605  H HA2  . GLY A 1 49  ? 15.617  -6.974  10.847  1.00 0.00 ? 49  GLY A HA2  5  
ATOM 9606  H HA3  . GLY A 1 49  ? 17.000  -7.995  11.213  1.00 0.00 ? 49  GLY A HA3  5  
ATOM 9607  N N    . ASP A 1 50  ? 18.366  -7.233  9.032   1.00 0.00 ? 50  ASP A N    5  
ATOM 9608  C CA   . ASP A 1 50  ? 19.298  -6.472  8.208   1.00 0.00 ? 50  ASP A CA   5  
ATOM 9609  C C    . ASP A 1 50  ? 20.417  -7.368  7.685   1.00 0.00 ? 50  ASP A C    5  
ATOM 9610  O O    . ASP A 1 50  ? 21.500  -7.429  8.267   1.00 0.00 ? 50  ASP A O    5  
ATOM 9611  C CB   . ASP A 1 50  ? 19.890  -5.311  9.009   1.00 0.00 ? 50  ASP A CB   5  
ATOM 9612  C CG   . ASP A 1 50  ? 21.050  -4.646  8.295   1.00 0.00 ? 50  ASP A CG   5  
ATOM 9613  O OD1  . ASP A 1 50  ? 20.913  -4.354  7.088   1.00 0.00 ? 50  ASP A OD1  5  
ATOM 9614  O OD2  . ASP A 1 50  ? 22.094  -4.419  8.941   1.00 0.00 ? 50  ASP A OD2  5  
ATOM 9615  H H    . ASP A 1 50  ? 18.530  -8.188  9.182   1.00 0.00 ? 50  ASP A H    5  
ATOM 9616  H HA   . ASP A 1 50  ? 18.750  -6.075  7.367   1.00 0.00 ? 50  ASP A HA   5  
ATOM 9617  H HB2  . ASP A 1 50  ? 19.122  -4.570  9.177   1.00 0.00 ? 50  ASP A HB2  5  
ATOM 9618  H HB3  . ASP A 1 50  ? 20.241  -5.682  9.961   1.00 0.00 ? 50  ASP A HB3  5  
ATOM 9619  N N    . ALA A 1 51  ? 20.147  -8.062  6.585   1.00 0.00 ? 51  ALA A N    5  
ATOM 9620  C CA   . ALA A 1 51  ? 21.131  -8.953  5.983   1.00 0.00 ? 51  ALA A CA   5  
ATOM 9621  C C    . ALA A 1 51  ? 20.779  -9.260  4.531   1.00 0.00 ? 51  ALA A C    5  
ATOM 9622  O O    . ALA A 1 51  ? 19.622  -9.147  4.127   1.00 0.00 ? 51  ALA A O    5  
ATOM 9623  C CB   . ALA A 1 51  ? 21.237  -10.242 6.786   1.00 0.00 ? 51  ALA A CB   5  
ATOM 9624  H H    . ALA A 1 51  ? 19.266  -7.971  6.167   1.00 0.00 ? 51  ALA A H    5  
ATOM 9625  H HA   . ALA A 1 51  ? 22.092  -8.460  6.013   1.00 0.00 ? 51  ALA A HA   5  
ATOM 9626  H HB1  . ALA A 1 51  ? 21.959  -10.897 6.321   1.00 0.00 ? 51  ALA A HB1  5  
ATOM 9627  H HB2  . ALA A 1 51  ? 21.553  -10.013 7.793   1.00 0.00 ? 51  ALA A HB2  5  
ATOM 9628  H HB3  . ALA A 1 51  ? 20.274  -10.729 6.813   1.00 0.00 ? 51  ALA A HB3  5  
ATOM 9629  N N    . ILE A 1 52  ? 21.783  -9.649  3.753   1.00 0.00 ? 52  ILE A N    5  
ATOM 9630  C CA   . ILE A 1 52  ? 21.578  -9.972  2.347   1.00 0.00 ? 52  ILE A CA   5  
ATOM 9631  C C    . ILE A 1 52  ? 21.006  -11.375 2.183   1.00 0.00 ? 52  ILE A C    5  
ATOM 9632  O O    . ILE A 1 52  ? 21.347  -12.289 2.935   1.00 0.00 ? 52  ILE A O    5  
ATOM 9633  C CB   . ILE A 1 52  ? 22.892  -9.869  1.548   1.00 0.00 ? 52  ILE A CB   5  
ATOM 9634  C CG1  . ILE A 1 52  ? 23.473  -8.458  1.661   1.00 0.00 ? 52  ILE A CG1  5  
ATOM 9635  C CG2  . ILE A 1 52  ? 22.655  -10.236 0.091   1.00 0.00 ? 52  ILE A CG2  5  
ATOM 9636  C CD1  . ILE A 1 52  ? 22.521  -7.374  1.207   1.00 0.00 ? 52  ILE A CD1  5  
ATOM 9637  H H    . ILE A 1 52  ? 22.683  -9.720  4.134   1.00 0.00 ? 52  ILE A H    5  
ATOM 9638  H HA   . ILE A 1 52  ? 20.876  -9.258  1.940   1.00 0.00 ? 52  ILE A HA   5  
ATOM 9639  H HB   . ILE A 1 52  ? 23.595  -10.575 1.963   1.00 0.00 ? 52  ILE A HB   5  
ATOM 9640  H HG12 . ILE A 1 52  ? 23.731  -8.263  2.690   1.00 0.00 ? 52  ILE A HG12 5  
ATOM 9641  H HG13 . ILE A 1 52  ? 24.364  -8.395  1.052   1.00 0.00 ? 52  ILE A HG13 5  
ATOM 9642  H HG21 . ILE A 1 52  ? 22.266  -11.241 0.031   1.00 0.00 ? 52  ILE A HG21 5  
ATOM 9643  H HG22 . ILE A 1 52  ? 21.943  -9.549  -0.342  1.00 0.00 ? 52  ILE A HG22 5  
ATOM 9644  H HG23 . ILE A 1 52  ? 23.587  -10.178 -0.451  1.00 0.00 ? 52  ILE A HG23 5  
ATOM 9645  H HD11 . ILE A 1 52  ? 21.621  -7.412  1.803   1.00 0.00 ? 52  ILE A HD11 5  
ATOM 9646  H HD12 . ILE A 1 52  ? 22.991  -6.409  1.325   1.00 0.00 ? 52  ILE A HD12 5  
ATOM 9647  H HD13 . ILE A 1 52  ? 22.270  -7.528  0.167   1.00 0.00 ? 52  ILE A HD13 5  
ATOM 9648  N N    . VAL A 1 53  ? 20.133  -11.541 1.194   1.00 0.00 ? 53  VAL A N    5  
ATOM 9649  C CA   . VAL A 1 53  ? 19.515  -12.834 0.928   1.00 0.00 ? 53  VAL A CA   5  
ATOM 9650  C C    . VAL A 1 53  ? 19.617  -13.200 -0.548  1.00 0.00 ? 53  VAL A C    5  
ATOM 9651  O O    . VAL A 1 53  ? 18.704  -12.959 -1.338  1.00 0.00 ? 53  VAL A O    5  
ATOM 9652  C CB   . VAL A 1 53  ? 18.032  -12.844 1.346   1.00 0.00 ? 53  VAL A CB   5  
ATOM 9653  C CG1  . VAL A 1 53  ? 17.487  -14.264 1.350   1.00 0.00 ? 53  VAL A CG1  5  
ATOM 9654  C CG2  . VAL A 1 53  ? 17.860  -12.194 2.711   1.00 0.00 ? 53  VAL A CG2  5  
ATOM 9655  H H    . VAL A 1 53  ? 19.901  -10.775 0.628   1.00 0.00 ? 53  VAL A H    5  
ATOM 9656  H HA   . VAL A 1 53  ? 20.036  -13.580 1.511   1.00 0.00 ? 53  VAL A HA   5  
ATOM 9657  H HB   . VAL A 1 53  ? 17.472  -12.269 0.624   1.00 0.00 ? 53  VAL A HB   5  
ATOM 9658  H HG11 . VAL A 1 53  ? 18.237  -14.937 0.961   1.00 0.00 ? 53  VAL A HG11 5  
ATOM 9659  H HG12 . VAL A 1 53  ? 17.234  -14.550 2.360   1.00 0.00 ? 53  VAL A HG12 5  
ATOM 9660  H HG13 . VAL A 1 53  ? 16.604  -14.312 0.730   1.00 0.00 ? 53  VAL A HG13 5  
ATOM 9661  H HG21 . VAL A 1 53  ? 18.824  -12.098 3.188   1.00 0.00 ? 53  VAL A HG21 5  
ATOM 9662  H HG22 . VAL A 1 53  ? 17.419  -11.215 2.592   1.00 0.00 ? 53  VAL A HG22 5  
ATOM 9663  H HG23 . VAL A 1 53  ? 17.215  -12.807 3.323   1.00 0.00 ? 53  VAL A HG23 5  
ATOM 9664  N N    . PRO A 1 54  ? 20.755  -13.798 -0.932  1.00 0.00 ? 54  PRO A N    5  
ATOM 9665  C CA   . PRO A 1 54  ? 21.004  -14.211 -2.316  1.00 0.00 ? 54  PRO A CA   5  
ATOM 9666  C C    . PRO A 1 54  ? 20.130  -15.387 -2.736  1.00 0.00 ? 54  PRO A C    5  
ATOM 9667  O O    . PRO A 1 54  ? 20.230  -16.479 -2.176  1.00 0.00 ? 54  PRO A O    5  
ATOM 9668  C CB   . PRO A 1 54  ? 22.480  -14.619 -2.304  1.00 0.00 ? 54  PRO A CB   5  
ATOM 9669  C CG   . PRO A 1 54  ? 22.755  -15.003 -0.892  1.00 0.00 ? 54  PRO A CG   5  
ATOM 9670  C CD   . PRO A 1 54  ? 21.886  -14.116 -0.044  1.00 0.00 ? 54  PRO A CD   5  
ATOM 9671  H HA   . PRO A 1 54  ? 20.861  -13.393 -3.006  1.00 0.00 ? 54  PRO A HA   5  
ATOM 9672  H HB2  . PRO A 1 54  ? 22.631  -15.450 -2.978  1.00 0.00 ? 54  PRO A HB2  5  
ATOM 9673  H HB3  . PRO A 1 54  ? 23.090  -13.783 -2.612  1.00 0.00 ? 54  PRO A HB3  5  
ATOM 9674  H HG2  . PRO A 1 54  ? 22.498  -16.040 -0.736  1.00 0.00 ? 54  PRO A HG2  5  
ATOM 9675  H HG3  . PRO A 1 54  ? 23.797  -14.835 -0.663  1.00 0.00 ? 54  PRO A HG3  5  
ATOM 9676  H HD2  . PRO A 1 54  ? 21.549  -14.646 0.835   1.00 0.00 ? 54  PRO A HD2  5  
ATOM 9677  H HD3  . PRO A 1 54  ? 22.420  -13.220 0.235   1.00 0.00 ? 54  PRO A HD3  5  
ATOM 9678  N N    . VAL A 1 55  ? 19.272  -15.158 -3.725  1.00 0.00 ? 55  VAL A N    5  
ATOM 9679  C CA   . VAL A 1 55  ? 18.381  -16.200 -4.222  1.00 0.00 ? 55  VAL A CA   5  
ATOM 9680  C C    . VAL A 1 55  ? 18.633  -16.481 -5.699  1.00 0.00 ? 55  VAL A C    5  
ATOM 9681  O O    . VAL A 1 55  ? 18.681  -15.562 -6.516  1.00 0.00 ? 55  VAL A O    5  
ATOM 9682  C CB   . VAL A 1 55  ? 16.903  -15.813 -4.029  1.00 0.00 ? 55  VAL A CB   5  
ATOM 9683  C CG1  . VAL A 1 55  ? 16.610  -14.474 -4.690  1.00 0.00 ? 55  VAL A CG1  5  
ATOM 9684  C CG2  . VAL A 1 55  ? 15.992  -16.899 -4.579  1.00 0.00 ? 55  VAL A CG2  5  
ATOM 9685  H H    . VAL A 1 55  ? 19.239  -14.267 -4.132  1.00 0.00 ? 55  VAL A H    5  
ATOM 9686  H HA   . VAL A 1 55  ? 18.572  -17.100 -3.656  1.00 0.00 ? 55  VAL A HA   5  
ATOM 9687  H HB   . VAL A 1 55  ? 16.713  -15.715 -2.970  1.00 0.00 ? 55  VAL A HB   5  
ATOM 9688  H HG11 . VAL A 1 55  ? 15.587  -14.192 -4.493  1.00 0.00 ? 55  VAL A HG11 5  
ATOM 9689  H HG12 . VAL A 1 55  ? 17.276  -13.723 -4.292  1.00 0.00 ? 55  VAL A HG12 5  
ATOM 9690  H HG13 . VAL A 1 55  ? 16.760  -14.560 -5.757  1.00 0.00 ? 55  VAL A HG13 5  
ATOM 9691  H HG21 . VAL A 1 55  ? 16.211  -17.835 -4.087  1.00 0.00 ? 55  VAL A HG21 5  
ATOM 9692  H HG22 . VAL A 1 55  ? 14.961  -16.631 -4.398  1.00 0.00 ? 55  VAL A HG22 5  
ATOM 9693  H HG23 . VAL A 1 55  ? 16.155  -17.003 -5.641  1.00 0.00 ? 55  VAL A HG23 5  
ATOM 9694  N N    . GLU A 1 56  ? 18.792  -17.757 -6.034  1.00 0.00 ? 56  GLU A N    5  
ATOM 9695  C CA   . GLU A 1 56  ? 19.040  -18.158 -7.414  1.00 0.00 ? 56  GLU A CA   5  
ATOM 9696  C C    . GLU A 1 56  ? 17.913  -19.048 -7.932  1.00 0.00 ? 56  GLU A C    5  
ATOM 9697  O O    . GLU A 1 56  ? 17.951  -20.269 -7.779  1.00 0.00 ? 56  GLU A O    5  
ATOM 9698  C CB   . GLU A 1 56  ? 20.376  -18.895 -7.522  1.00 0.00 ? 56  GLU A CB   5  
ATOM 9699  C CG   . GLU A 1 56  ? 20.769  -19.634 -6.254  1.00 0.00 ? 56  GLU A CG   5  
ATOM 9700  C CD   . GLU A 1 56  ? 22.110  -20.331 -6.376  1.00 0.00 ? 56  GLU A CD   5  
ATOM 9701  O OE1  . GLU A 1 56  ? 22.453  -20.766 -7.495  1.00 0.00 ? 56  GLU A OE1  5  
ATOM 9702  O OE2  . GLU A 1 56  ? 22.816  -20.442 -5.352  1.00 0.00 ? 56  GLU A OE2  5  
ATOM 9703  H H    . GLU A 1 56  ? 18.743  -18.444 -5.337  1.00 0.00 ? 56  GLU A H    5  
ATOM 9704  H HA   . GLU A 1 56  ? 19.082  -17.264 -8.017  1.00 0.00 ? 56  GLU A HA   5  
ATOM 9705  H HB2  . GLU A 1 56  ? 20.314  -19.612 -8.328  1.00 0.00 ? 56  GLU A HB2  5  
ATOM 9706  H HB3  . GLU A 1 56  ? 21.151  -18.178 -7.750  1.00 0.00 ? 56  GLU A HB3  5  
ATOM 9707  H HG2  . GLU A 1 56  ? 20.822  -18.925 -5.442  1.00 0.00 ? 56  GLU A HG2  5  
ATOM 9708  H HG3  . GLU A 1 56  ? 20.013  -20.374 -6.035  1.00 0.00 ? 56  GLU A HG3  5  
ATOM 9709  N N    . ILE A 1 57  ? 16.911  -18.426 -8.545  1.00 0.00 ? 57  ILE A N    5  
ATOM 9710  C CA   . ILE A 1 57  ? 15.774  -19.160 -9.086  1.00 0.00 ? 57  ILE A CA   5  
ATOM 9711  C C    . ILE A 1 57  ? 16.198  -20.051 -10.250 1.00 0.00 ? 57  ILE A C    5  
ATOM 9712  O O    . ILE A 1 57  ? 16.168  -19.634 -11.408 1.00 0.00 ? 57  ILE A O    5  
ATOM 9713  C CB   . ILE A 1 57  ? 14.663  -18.206 -9.563  1.00 0.00 ? 57  ILE A CB   5  
ATOM 9714  C CG1  . ILE A 1 57  ? 14.409  -17.121 -8.515  1.00 0.00 ? 57  ILE A CG1  5  
ATOM 9715  C CG2  . ILE A 1 57  ? 13.387  -18.981 -9.852  1.00 0.00 ? 57  ILE A CG2  5  
ATOM 9716  C CD1  . ILE A 1 57  ? 14.952  -15.764 -8.905  1.00 0.00 ? 57  ILE A CD1  5  
ATOM 9717  H H    . ILE A 1 57  ? 16.938  -17.451 -8.637  1.00 0.00 ? 57  ILE A H    5  
ATOM 9718  H HA   . ILE A 1 57  ? 15.374  -19.782 -8.298  1.00 0.00 ? 57  ILE A HA   5  
ATOM 9719  H HB   . ILE A 1 57  ? 14.989  -17.741 -10.481 1.00 0.00 ? 57  ILE A HB   5  
ATOM 9720  H HG12 . ILE A 1 57  ? 13.346  -17.020 -8.361  1.00 0.00 ? 57  ILE A HG12 5  
ATOM 9721  H HG13 . ILE A 1 57  ? 14.876  -17.412 -7.586  1.00 0.00 ? 57  ILE A HG13 5  
ATOM 9722  H HG21 . ILE A 1 57  ? 13.638  -19.982 -10.171 1.00 0.00 ? 57  ILE A HG21 5  
ATOM 9723  H HG22 . ILE A 1 57  ? 12.786  -19.030 -8.956  1.00 0.00 ? 57  ILE A HG22 5  
ATOM 9724  H HG23 . ILE A 1 57  ? 12.831  -18.484 -10.632 1.00 0.00 ? 57  ILE A HG23 5  
ATOM 9725  H HD11 . ILE A 1 57  ? 14.343  -15.345 -9.693  1.00 0.00 ? 57  ILE A HD11 5  
ATOM 9726  H HD12 . ILE A 1 57  ? 14.935  -15.108 -8.048  1.00 0.00 ? 57  ILE A HD12 5  
ATOM 9727  H HD13 . ILE A 1 57  ? 15.969  -15.871 -9.256  1.00 0.00 ? 57  ILE A HD13 5  
ATOM 9728  N N    . THR A 1 58  ? 16.592  -21.280 -9.933  1.00 0.00 ? 58  THR A N    5  
ATOM 9729  C CA   . THR A 1 58  ? 17.021  -22.231 -10.952 1.00 0.00 ? 58  THR A CA   5  
ATOM 9730  C C    . THR A 1 58  ? 15.927  -22.458 -11.988 1.00 0.00 ? 58  THR A C    5  
ATOM 9731  O O    . THR A 1 58  ? 14.766  -22.677 -11.640 1.00 0.00 ? 58  THR A O    5  
ATOM 9732  C CB   . THR A 1 58  ? 17.411  -23.584 -10.328 1.00 0.00 ? 58  THR A CB   5  
ATOM 9733  O OG1  . THR A 1 58  ? 18.557  -23.423 -9.484  1.00 0.00 ? 58  THR A OG1  5  
ATOM 9734  C CG2  . THR A 1 58  ? 17.711  -24.612 -11.409 1.00 0.00 ? 58  THR A CG2  5  
ATOM 9735  H H    . THR A 1 58  ? 16.594  -21.553 -8.992  1.00 0.00 ? 58  THR A H    5  
ATOM 9736  H HA   . THR A 1 58  ? 17.891  -21.821 -11.445 1.00 0.00 ? 58  THR A HA   5  
ATOM 9737  H HB   . THR A 1 58  ? 16.582  -23.941 -9.733  1.00 0.00 ? 58  THR A HB   5  
ATOM 9738  H HG1  . THR A 1 58  ? 18.628  -24.177 -8.894  1.00 0.00 ? 58  THR A HG1  5  
ATOM 9739  H HG21 . THR A 1 58  ? 17.935  -24.104 -12.336 1.00 0.00 ? 58  THR A HG21 5  
ATOM 9740  H HG22 . THR A 1 58  ? 16.852  -25.251 -11.546 1.00 0.00 ? 58  THR A HG22 5  
ATOM 9741  H HG23 . THR A 1 58  ? 18.560  -25.208 -11.112 1.00 0.00 ? 58  THR A HG23 5  
ATOM 9742  N N    . ILE A 1 59  ? 16.303  -22.405 -13.261 1.00 0.00 ? 59  ILE A N    5  
ATOM 9743  C CA   . ILE A 1 59  ? 15.353  -22.608 -14.347 1.00 0.00 ? 59  ILE A CA   5  
ATOM 9744  C C    . ILE A 1 59  ? 15.669  -23.882 -15.124 1.00 0.00 ? 59  ILE A C    5  
ATOM 9745  O O    . ILE A 1 59  ? 16.731  -24.001 -15.735 1.00 0.00 ? 59  ILE A O    5  
ATOM 9746  C CB   . ILE A 1 59  ? 15.349  -21.414 -15.321 1.00 0.00 ? 59  ILE A CB   5  
ATOM 9747  C CG1  . ILE A 1 59  ? 15.339  -20.095 -14.545 1.00 0.00 ? 59  ILE A CG1  5  
ATOM 9748  C CG2  . ILE A 1 59  ? 14.149  -21.495 -16.253 1.00 0.00 ? 59  ILE A CG2  5  
ATOM 9749  C CD1  . ILE A 1 59  ? 14.167  -19.959 -13.599 1.00 0.00 ? 59  ILE A CD1  5  
ATOM 9750  H H    . ILE A 1 59  ? 17.243  -22.227 -13.474 1.00 0.00 ? 59  ILE A H    5  
ATOM 9751  H HA   . ILE A 1 59  ? 14.367  -22.697 -13.915 1.00 0.00 ? 59  ILE A HA   5  
ATOM 9752  H HB   . ILE A 1 59  ? 16.244  -21.465 -15.921 1.00 0.00 ? 59  ILE A HB   5  
ATOM 9753  H HG12 . ILE A 1 59  ? 16.245  -20.021 -13.964 1.00 0.00 ? 59  ILE A HG12 5  
ATOM 9754  H HG13 . ILE A 1 59  ? 15.298  -19.274 -15.247 1.00 0.00 ? 59  ILE A HG13 5  
ATOM 9755  H HG21 . ILE A 1 59  ? 14.308  -20.846 -17.102 1.00 0.00 ? 59  ILE A HG21 5  
ATOM 9756  H HG22 . ILE A 1 59  ? 14.029  -22.512 -16.596 1.00 0.00 ? 59  ILE A HG22 5  
ATOM 9757  H HG23 . ILE A 1 59  ? 13.260  -21.186 -15.724 1.00 0.00 ? 59  ILE A HG23 5  
ATOM 9758  H HD11 . ILE A 1 59  ? 14.150  -20.800 -12.922 1.00 0.00 ? 59  ILE A HD11 5  
ATOM 9759  H HD12 . ILE A 1 59  ? 14.263  -19.043 -13.036 1.00 0.00 ? 59  ILE A HD12 5  
ATOM 9760  H HD13 . ILE A 1 59  ? 13.247  -19.937 -14.167 1.00 0.00 ? 59  ILE A HD13 5  
ATOM 9761  N N    . TYR A 1 60  ? 14.739  -24.830 -15.097 1.00 0.00 ? 60  TYR A N    5  
ATOM 9762  C CA   . TYR A 1 60  ? 14.918  -26.096 -15.798 1.00 0.00 ? 60  TYR A CA   5  
ATOM 9763  C C    . TYR A 1 60  ? 15.092  -25.869 -17.296 1.00 0.00 ? 60  TYR A C    5  
ATOM 9764  O O    . TYR A 1 60  ? 15.268  -24.738 -17.748 1.00 0.00 ? 60  TYR A O    5  
ATOM 9765  C CB   . TYR A 1 60  ? 13.722  -27.016 -15.545 1.00 0.00 ? 60  TYR A CB   5  
ATOM 9766  C CG   . TYR A 1 60  ? 14.027  -28.160 -14.604 1.00 0.00 ? 60  TYR A CG   5  
ATOM 9767  C CD1  . TYR A 1 60  ? 14.925  -28.002 -13.555 1.00 0.00 ? 60  TYR A CD1  5  
ATOM 9768  C CD2  . TYR A 1 60  ? 13.417  -29.398 -14.764 1.00 0.00 ? 60  TYR A CD2  5  
ATOM 9769  C CE1  . TYR A 1 60  ? 15.206  -29.044 -12.693 1.00 0.00 ? 60  TYR A CE1  5  
ATOM 9770  C CE2  . TYR A 1 60  ? 13.692  -30.445 -13.906 1.00 0.00 ? 60  TYR A CE2  5  
ATOM 9771  C CZ   . TYR A 1 60  ? 14.587  -30.263 -12.872 1.00 0.00 ? 60  TYR A CZ   5  
ATOM 9772  O OH   . TYR A 1 60  ? 14.865  -31.304 -12.016 1.00 0.00 ? 60  TYR A OH   5  
ATOM 9773  H H    . TYR A 1 60  ? 13.913  -24.676 -14.592 1.00 0.00 ? 60  TYR A H    5  
ATOM 9774  H HA   . TYR A 1 60  ? 15.810  -26.566 -15.410 1.00 0.00 ? 60  TYR A HA   5  
ATOM 9775  H HB2  . TYR A 1 60  ? 12.917  -26.440 -15.116 1.00 0.00 ? 60  TYR A HB2  5  
ATOM 9776  H HB3  . TYR A 1 60  ? 13.396  -27.437 -16.485 1.00 0.00 ? 60  TYR A HB3  5  
ATOM 9777  H HD1  . TYR A 1 60  ? 15.408  -27.045 -13.418 1.00 0.00 ? 60  TYR A HD1  5  
ATOM 9778  H HD2  . TYR A 1 60  ? 12.717  -29.537 -15.574 1.00 0.00 ? 60  TYR A HD2  5  
ATOM 9779  H HE1  . TYR A 1 60  ? 15.907  -28.902 -11.884 1.00 0.00 ? 60  TYR A HE1  5  
ATOM 9780  H HE2  . TYR A 1 60  ? 13.208  -31.400 -14.046 1.00 0.00 ? 60  TYR A HE2  5  
ATOM 9781  H HH   . TYR A 1 60  ? 15.767  -31.600 -12.155 1.00 0.00 ? 60  TYR A HH   5  
ATOM 9782  N N    . ALA A 1 61  ? 15.040  -26.954 -18.062 1.00 0.00 ? 61  ALA A N    5  
ATOM 9783  C CA   . ALA A 1 61  ? 15.188  -26.875 -19.510 1.00 0.00 ? 61  ALA A CA   5  
ATOM 9784  C C    . ALA A 1 61  ? 13.852  -26.582 -20.184 1.00 0.00 ? 61  ALA A C    5  
ATOM 9785  O O    . ALA A 1 61  ? 13.770  -26.492 -21.409 1.00 0.00 ? 61  ALA A O    5  
ATOM 9786  C CB   . ALA A 1 61  ? 15.782  -28.167 -20.051 1.00 0.00 ? 61  ALA A CB   5  
ATOM 9787  H H    . ALA A 1 61  ? 14.896  -27.828 -17.644 1.00 0.00 ? 61  ALA A H    5  
ATOM 9788  H HA   . ALA A 1 61  ? 15.876  -26.071 -19.732 1.00 0.00 ? 61  ALA A HA   5  
ATOM 9789  H HB1  . ALA A 1 61  ? 16.675  -28.412 -19.494 1.00 0.00 ? 61  ALA A HB1  5  
ATOM 9790  H HB2  . ALA A 1 61  ? 15.063  -28.965 -19.948 1.00 0.00 ? 61  ALA A HB2  5  
ATOM 9791  H HB3  . ALA A 1 61  ? 16.032  -28.039 -21.094 1.00 0.00 ? 61  ALA A HB3  5  
ATOM 9792  N N    . ASP A 1 62  ? 12.807  -26.435 -19.377 1.00 0.00 ? 62  ASP A N    5  
ATOM 9793  C CA   . ASP A 1 62  ? 11.474  -26.152 -19.895 1.00 0.00 ? 62  ASP A CA   5  
ATOM 9794  C C    . ASP A 1 62  ? 10.815  -25.021 -19.112 1.00 0.00 ? 62  ASP A C    5  
ATOM 9795  O O    . ASP A 1 62  ? 10.975  -23.847 -19.445 1.00 0.00 ? 62  ASP A O    5  
ATOM 9796  C CB   . ASP A 1 62  ? 10.603  -27.407 -19.833 1.00 0.00 ? 62  ASP A CB   5  
ATOM 9797  C CG   . ASP A 1 62  ? 10.770  -28.289 -21.055 1.00 0.00 ? 62  ASP A CG   5  
ATOM 9798  O OD1  . ASP A 1 62  ? 11.920  -28.672 -21.356 1.00 0.00 ? 62  ASP A OD1  5  
ATOM 9799  O OD2  . ASP A 1 62  ? 9.752   -28.596 -21.710 1.00 0.00 ? 62  ASP A OD2  5  
ATOM 9800  H H    . ASP A 1 62  ? 12.936  -26.518 -18.408 1.00 0.00 ? 62  ASP A H    5  
ATOM 9801  H HA   . ASP A 1 62  ? 11.577  -25.847 -20.926 1.00 0.00 ? 62  ASP A HA   5  
ATOM 9802  H HB2  . ASP A 1 62  ? 10.871  -27.981 -18.958 1.00 0.00 ? 62  ASP A HB2  5  
ATOM 9803  H HB3  . ASP A 1 62  ? 9.565   -27.114 -19.763 1.00 0.00 ? 62  ASP A HB3  5  
ATOM 9804  N N    . ARG A 1 63  ? 10.074  -25.383 -18.070 1.00 0.00 ? 63  ARG A N    5  
ATOM 9805  C CA   . ARG A 1 63  ? 9.389   -24.399 -17.241 1.00 0.00 ? 63  ARG A CA   5  
ATOM 9806  C C    . ARG A 1 63  ? 9.733   -24.596 -15.767 1.00 0.00 ? 63  ARG A C    5  
ATOM 9807  O O    . ARG A 1 63  ? 9.813   -23.633 -15.005 1.00 0.00 ? 63  ARG A O    5  
ATOM 9808  C CB   . ARG A 1 63  ? 7.875   -24.498 -17.440 1.00 0.00 ? 63  ARG A CB   5  
ATOM 9809  C CG   . ARG A 1 63  ? 7.404   -23.994 -18.794 1.00 0.00 ? 63  ARG A CG   5  
ATOM 9810  C CD   . ARG A 1 63  ? 6.565   -25.036 -19.516 1.00 0.00 ? 63  ARG A CD   5  
ATOM 9811  N NE   . ARG A 1 63  ? 5.634   -24.429 -20.463 1.00 0.00 ? 63  ARG A NE   5  
ATOM 9812  C CZ   . ARG A 1 63  ? 6.008   -23.900 -21.623 1.00 0.00 ? 63  ARG A CZ   5  
ATOM 9813  N NH1  . ARG A 1 63  ? 7.285   -23.903 -21.977 1.00 0.00 ? 63  ARG A NH1  5  
ATOM 9814  N NH2  . ARG A 1 63  ? 5.101   -23.366 -22.432 1.00 0.00 ? 63  ARG A NH2  5  
ATOM 9815  H H    . ARG A 1 63  ? 9.985   -26.335 -17.854 1.00 0.00 ? 63  ARG A H    5  
ATOM 9816  H HA   . ARG A 1 63  ? 9.719   -23.418 -17.548 1.00 0.00 ? 63  ARG A HA   5  
ATOM 9817  H HB2  . ARG A 1 63  ? 7.578   -25.532 -17.342 1.00 0.00 ? 63  ARG A HB2  5  
ATOM 9818  H HB3  . ARG A 1 63  ? 7.385   -23.918 -16.673 1.00 0.00 ? 63  ARG A HB3  5  
ATOM 9819  H HG2  . ARG A 1 63  ? 6.807   -23.105 -18.649 1.00 0.00 ? 63  ARG A HG2  5  
ATOM 9820  H HG3  . ARG A 1 63  ? 8.266   -23.756 -19.398 1.00 0.00 ? 63  ARG A HG3  5  
ATOM 9821  H HD2  . ARG A 1 63  ? 7.225   -25.703 -20.051 1.00 0.00 ? 63  ARG A HD2  5  
ATOM 9822  H HD3  . ARG A 1 63  ? 6.004   -25.597 -18.783 1.00 0.00 ? 63  ARG A HD3  5  
ATOM 9823  H HE   . ARG A 1 63  ? 4.685   -24.416 -20.222 1.00 0.00 ? 63  ARG A HE   5  
ATOM 9824  H HH11 . ARG A 1 63  ? 7.970   -24.306 -21.369 1.00 0.00 ? 63  ARG A HH11 5  
ATOM 9825  H HH12 . ARG A 1 63  ? 7.564   -23.505 -22.851 1.00 0.00 ? 63  ARG A HH12 5  
ATOM 9826  H HH21 . ARG A 1 63  ? 4.137   -23.362 -22.169 1.00 0.00 ? 63  ARG A HH21 5  
ATOM 9827  H HH22 . ARG A 1 63  ? 5.383   -22.968 -23.305 1.00 0.00 ? 63  ARG A HH22 5  
ATOM 9828  N N    . SER A 1 64  ? 9.935   -25.849 -15.374 1.00 0.00 ? 64  SER A N    5  
ATOM 9829  C CA   . SER A 1 64  ? 10.267  -26.173 -13.992 1.00 0.00 ? 64  SER A CA   5  
ATOM 9830  C C    . SER A 1 64  ? 11.313  -25.207 -13.444 1.00 0.00 ? 64  SER A C    5  
ATOM 9831  O O    . SER A 1 64  ? 12.059  -24.586 -14.201 1.00 0.00 ? 64  SER A O    5  
ATOM 9832  C CB   . SER A 1 64  ? 10.781  -27.610 -13.891 1.00 0.00 ? 64  SER A CB   5  
ATOM 9833  O OG   . SER A 1 64  ? 10.816  -28.230 -15.165 1.00 0.00 ? 64  SER A OG   5  
ATOM 9834  H H    . SER A 1 64  ? 9.857   -26.574 -16.030 1.00 0.00 ? 64  SER A H    5  
ATOM 9835  H HA   . SER A 1 64  ? 9.366   -26.080 -13.404 1.00 0.00 ? 64  SER A HA   5  
ATOM 9836  H HB2  . SER A 1 64  ? 11.779  -27.605 -13.479 1.00 0.00 ? 64  SER A HB2  5  
ATOM 9837  H HB3  . SER A 1 64  ? 10.128  -28.179 -13.245 1.00 0.00 ? 64  SER A HB3  5  
ATOM 9838  H HG   . SER A 1 64  ? 10.161  -28.931 -15.198 1.00 0.00 ? 64  SER A HG   5  
ATOM 9839  N N    . PHE A 1 65  ? 11.361  -25.085 -12.121 1.00 0.00 ? 65  PHE A N    5  
ATOM 9840  C CA   . PHE A 1 65  ? 12.315  -24.194 -11.470 1.00 0.00 ? 65  PHE A CA   5  
ATOM 9841  C C    . PHE A 1 65  ? 12.452  -24.534 -9.988  1.00 0.00 ? 65  PHE A C    5  
ATOM 9842  O O    . PHE A 1 65  ? 11.568  -25.154 -9.397  1.00 0.00 ? 65  PHE A O    5  
ATOM 9843  C CB   . PHE A 1 65  ? 11.877  -22.737 -11.632 1.00 0.00 ? 65  PHE A CB   5  
ATOM 9844  C CG   . PHE A 1 65  ? 10.512  -22.456 -11.074 1.00 0.00 ? 65  PHE A CG   5  
ATOM 9845  C CD1  . PHE A 1 65  ? 9.373   -22.794 -11.788 1.00 0.00 ? 65  PHE A CD1  5  
ATOM 9846  C CD2  . PHE A 1 65  ? 10.366  -21.854 -9.834  1.00 0.00 ? 65  PHE A CD2  5  
ATOM 9847  C CE1  . PHE A 1 65  ? 8.116   -22.535 -11.277 1.00 0.00 ? 65  PHE A CE1  5  
ATOM 9848  C CE2  . PHE A 1 65  ? 9.111   -21.593 -9.318  1.00 0.00 ? 65  PHE A CE2  5  
ATOM 9849  C CZ   . PHE A 1 65  ? 7.984   -21.935 -10.040 1.00 0.00 ? 65  PHE A CZ   5  
ATOM 9850  H H    . PHE A 1 65  ? 10.740  -25.607 -11.570 1.00 0.00 ? 65  PHE A H    5  
ATOM 9851  H HA   . PHE A 1 65  ? 13.273  -24.329 -11.948 1.00 0.00 ? 65  PHE A HA   5  
ATOM 9852  H HB2  . PHE A 1 65  ? 12.582  -22.098 -11.122 1.00 0.00 ? 65  PHE A HB2  5  
ATOM 9853  H HB3  . PHE A 1 65  ? 11.866  -22.488 -12.683 1.00 0.00 ? 65  PHE A HB3  5  
ATOM 9854  H HD1  . PHE A 1 65  ? 9.474   -23.264 -12.755 1.00 0.00 ? 65  PHE A HD1  5  
ATOM 9855  H HD2  . PHE A 1 65  ? 11.247  -21.586 -9.268  1.00 0.00 ? 65  PHE A HD2  5  
ATOM 9856  H HE1  . PHE A 1 65  ? 7.236   -22.803 -11.843 1.00 0.00 ? 65  PHE A HE1  5  
ATOM 9857  H HE2  . PHE A 1 65  ? 9.012   -21.124 -8.350  1.00 0.00 ? 65  PHE A HE2  5  
ATOM 9858  H HZ   . PHE A 1 65  ? 7.003   -21.731 -9.638  1.00 0.00 ? 65  PHE A HZ   5  
ATOM 9859  N N    . THR A 1 66  ? 13.568  -24.123 -9.394  1.00 0.00 ? 66  THR A N    5  
ATOM 9860  C CA   . THR A 1 66  ? 13.823  -24.384 -7.983  1.00 0.00 ? 66  THR A CA   5  
ATOM 9861  C C    . THR A 1 66  ? 14.550  -23.214 -7.330  1.00 0.00 ? 66  THR A C    5  
ATOM 9862  O O    . THR A 1 66  ? 15.543  -22.714 -7.859  1.00 0.00 ? 66  THR A O    5  
ATOM 9863  C CB   . THR A 1 66  ? 14.657  -25.665 -7.790  1.00 0.00 ? 66  THR A CB   5  
ATOM 9864  O OG1  . THR A 1 66  ? 16.039  -25.392 -8.051  1.00 0.00 ? 66  THR A OG1  5  
ATOM 9865  C CG2  . THR A 1 66  ? 14.171  -26.772 -8.713  1.00 0.00 ? 66  THR A CG2  5  
ATOM 9866  H H    . THR A 1 66  ? 14.235  -23.633 -9.918  1.00 0.00 ? 66  THR A H    5  
ATOM 9867  H HA   . THR A 1 66  ? 12.870  -24.523 -7.492  1.00 0.00 ? 66  THR A HA   5  
ATOM 9868  H HB   . THR A 1 66  ? 14.550  -25.996 -6.767  1.00 0.00 ? 66  THR A HB   5  
ATOM 9869  H HG1  . THR A 1 66  ? 16.481  -25.167 -7.229  1.00 0.00 ? 66  THR A HG1  5  
ATOM 9870  H HG21 . THR A 1 66  ? 14.254  -26.447 -9.740  1.00 0.00 ? 66  THR A HG21 5  
ATOM 9871  H HG22 . THR A 1 66  ? 13.139  -26.999 -8.489  1.00 0.00 ? 66  THR A HG22 5  
ATOM 9872  H HG23 . THR A 1 66  ? 14.775  -27.654 -8.566  1.00 0.00 ? 66  THR A HG23 5  
ATOM 9873  N N    . PHE A 1 67  ? 14.050  -22.782 -6.177  1.00 0.00 ? 67  PHE A N    5  
ATOM 9874  C CA   . PHE A 1 67  ? 14.652  -21.670 -5.451  1.00 0.00 ? 67  PHE A CA   5  
ATOM 9875  C C    . PHE A 1 67  ? 14.552  -21.886 -3.944  1.00 0.00 ? 67  PHE A C    5  
ATOM 9876  O O    . PHE A 1 67  ? 13.735  -22.676 -3.471  1.00 0.00 ? 67  PHE A O    5  
ATOM 9877  C CB   . PHE A 1 67  ? 13.971  -20.355 -5.835  1.00 0.00 ? 67  PHE A CB   5  
ATOM 9878  C CG   . PHE A 1 67  ? 12.599  -20.195 -5.245  1.00 0.00 ? 67  PHE A CG   5  
ATOM 9879  C CD1  . PHE A 1 67  ? 11.522  -20.896 -5.761  1.00 0.00 ? 67  PHE A CD1  5  
ATOM 9880  C CD2  . PHE A 1 67  ? 12.387  -19.342 -4.173  1.00 0.00 ? 67  PHE A CD2  5  
ATOM 9881  C CE1  . PHE A 1 67  ? 10.259  -20.752 -5.220  1.00 0.00 ? 67  PHE A CE1  5  
ATOM 9882  C CE2  . PHE A 1 67  ? 11.126  -19.194 -3.627  1.00 0.00 ? 67  PHE A CE2  5  
ATOM 9883  C CZ   . PHE A 1 67  ? 10.060  -19.899 -4.152  1.00 0.00 ? 67  PHE A CZ   5  
ATOM 9884  H H    . PHE A 1 67  ? 13.256  -23.222 -5.806  1.00 0.00 ? 67  PHE A H    5  
ATOM 9885  H HA   . PHE A 1 67  ? 15.694  -21.621 -5.728  1.00 0.00 ? 67  PHE A HA   5  
ATOM 9886  H HB2  . PHE A 1 67  ? 14.578  -19.530 -5.492  1.00 0.00 ? 67  PHE A HB2  5  
ATOM 9887  H HB3  . PHE A 1 67  ? 13.879  -20.306 -6.910  1.00 0.00 ? 67  PHE A HB3  5  
ATOM 9888  H HD1  . PHE A 1 67  ? 11.677  -21.564 -6.598  1.00 0.00 ? 67  PHE A HD1  5  
ATOM 9889  H HD2  . PHE A 1 67  ? 13.219  -18.790 -3.762  1.00 0.00 ? 67  PHE A HD2  5  
ATOM 9890  H HE1  . PHE A 1 67  ? 9.428   -21.305 -5.633  1.00 0.00 ? 67  PHE A HE1  5  
ATOM 9891  H HE2  . PHE A 1 67  ? 10.973  -18.526 -2.793  1.00 0.00 ? 67  PHE A HE2  5  
ATOM 9892  H HZ   . PHE A 1 67  ? 9.074   -19.785 -3.728  1.00 0.00 ? 67  PHE A HZ   5  
ATOM 9893  N N    . VAL A 1 68  ? 15.391  -21.179 -3.194  1.00 0.00 ? 68  VAL A N    5  
ATOM 9894  C CA   . VAL A 1 68  ? 15.399  -21.292 -1.740  1.00 0.00 ? 68  VAL A CA   5  
ATOM 9895  C C    . VAL A 1 68  ? 15.865  -19.995 -1.090  1.00 0.00 ? 68  VAL A C    5  
ATOM 9896  O O    . VAL A 1 68  ? 16.451  -19.133 -1.747  1.00 0.00 ? 68  VAL A O    5  
ATOM 9897  C CB   . VAL A 1 68  ? 16.307  -22.444 -1.272  1.00 0.00 ? 68  VAL A CB   5  
ATOM 9898  C CG1  . VAL A 1 68  ? 15.716  -23.788 -1.672  1.00 0.00 ? 68  VAL A CG1  5  
ATOM 9899  C CG2  . VAL A 1 68  ? 17.710  -22.280 -1.837  1.00 0.00 ? 68  VAL A CG2  5  
ATOM 9900  H H    . VAL A 1 68  ? 16.020  -20.566 -3.629  1.00 0.00 ? 68  VAL A H    5  
ATOM 9901  H HA   . VAL A 1 68  ? 14.390  -21.503 -1.417  1.00 0.00 ? 68  VAL A HA   5  
ATOM 9902  H HB   . VAL A 1 68  ? 16.370  -22.411 -0.194  1.00 0.00 ? 68  VAL A HB   5  
ATOM 9903  H HG11 . VAL A 1 68  ? 16.296  -24.583 -1.226  1.00 0.00 ? 68  VAL A HG11 5  
ATOM 9904  H HG12 . VAL A 1 68  ? 14.694  -23.848 -1.329  1.00 0.00 ? 68  VAL A HG12 5  
ATOM 9905  H HG13 . VAL A 1 68  ? 15.742  -23.885 -2.748  1.00 0.00 ? 68  VAL A HG13 5  
ATOM 9906  H HG21 . VAL A 1 68  ? 18.192  -21.439 -1.361  1.00 0.00 ? 68  VAL A HG21 5  
ATOM 9907  H HG22 . VAL A 1 68  ? 18.282  -23.176 -1.648  1.00 0.00 ? 68  VAL A HG22 5  
ATOM 9908  H HG23 . VAL A 1 68  ? 17.652  -22.107 -2.901  1.00 0.00 ? 68  VAL A HG23 5  
ATOM 9909  N N    . THR A 1 69  ? 15.603  -19.861 0.206   1.00 0.00 ? 69  THR A N    5  
ATOM 9910  C CA   . THR A 1 69  ? 15.995  -18.668 0.946   1.00 0.00 ? 69  THR A CA   5  
ATOM 9911  C C    . THR A 1 69  ? 16.721  -19.035 2.236   1.00 0.00 ? 69  THR A C    5  
ATOM 9912  O O    . THR A 1 69  ? 16.701  -20.189 2.665   1.00 0.00 ? 69  THR A O    5  
ATOM 9913  C CB   . THR A 1 69  ? 14.775  -17.793 1.288   1.00 0.00 ? 69  THR A CB   5  
ATOM 9914  O OG1  . THR A 1 69  ? 13.634  -18.619 1.539   1.00 0.00 ? 69  THR A OG1  5  
ATOM 9915  C CG2  . THR A 1 69  ? 14.468  -16.826 0.154   1.00 0.00 ? 69  THR A CG2  5  
ATOM 9916  H H    . THR A 1 69  ? 15.134  -20.582 0.675   1.00 0.00 ? 69  THR A H    5  
ATOM 9917  H HA   . THR A 1 69  ? 16.662  -18.092 0.321   1.00 0.00 ? 69  THR A HA   5  
ATOM 9918  H HB   . THR A 1 69  ? 14.999  -17.221 2.178   1.00 0.00 ? 69  THR A HB   5  
ATOM 9919  H HG1  . THR A 1 69  ? 12.916  -18.080 1.881   1.00 0.00 ? 69  THR A HG1  5  
ATOM 9920  H HG21 . THR A 1 69  ? 13.423  -16.897 -0.107  1.00 0.00 ? 69  THR A HG21 5  
ATOM 9921  H HG22 . THR A 1 69  ? 15.072  -17.076 -0.705  1.00 0.00 ? 69  THR A HG22 5  
ATOM 9922  H HG23 . THR A 1 69  ? 14.692  -15.818 0.470   1.00 0.00 ? 69  THR A HG23 5  
ATOM 9923  N N    . LYS A 1 70  ? 17.360  -18.046 2.851   1.00 0.00 ? 70  LYS A N    5  
ATOM 9924  C CA   . LYS A 1 70  ? 18.091  -18.264 4.094   1.00 0.00 ? 70  LYS A CA   5  
ATOM 9925  C C    . LYS A 1 70  ? 17.142  -18.271 5.289   1.00 0.00 ? 70  LYS A C    5  
ATOM 9926  O O    . LYS A 1 70  ? 16.355  -17.343 5.476   1.00 0.00 ? 70  LYS A O    5  
ATOM 9927  C CB   . LYS A 1 70  ? 19.155  -17.179 4.281   1.00 0.00 ? 70  LYS A CB   5  
ATOM 9928  C CG   . LYS A 1 70  ? 20.004  -16.941 3.044   1.00 0.00 ? 70  LYS A CG   5  
ATOM 9929  C CD   . LYS A 1 70  ? 20.680  -18.219 2.577   1.00 0.00 ? 70  LYS A CD   5  
ATOM 9930  C CE   . LYS A 1 70  ? 21.545  -17.976 1.350   1.00 0.00 ? 70  LYS A CE   5  
ATOM 9931  N NZ   . LYS A 1 70  ? 22.994  -18.145 1.651   1.00 0.00 ? 70  LYS A NZ   5  
ATOM 9932  H H    . LYS A 1 70  ? 17.339  -17.147 2.460   1.00 0.00 ? 70  LYS A H    5  
ATOM 9933  H HA   . LYS A 1 70  ? 18.577  -19.225 4.030   1.00 0.00 ? 70  LYS A HA   5  
ATOM 9934  H HB2  . LYS A 1 70  ? 18.665  -16.252 4.540   1.00 0.00 ? 70  LYS A HB2  5  
ATOM 9935  H HB3  . LYS A 1 70  ? 19.809  -17.469 5.090   1.00 0.00 ? 70  LYS A HB3  5  
ATOM 9936  H HG2  . LYS A 1 70  ? 19.372  -16.571 2.250   1.00 0.00 ? 70  LYS A HG2  5  
ATOM 9937  H HG3  . LYS A 1 70  ? 20.762  -16.207 3.276   1.00 0.00 ? 70  LYS A HG3  5  
ATOM 9938  H HD2  . LYS A 1 70  ? 21.303  -18.598 3.374   1.00 0.00 ? 70  LYS A HD2  5  
ATOM 9939  H HD3  . LYS A 1 70  ? 19.921  -18.949 2.333   1.00 0.00 ? 70  LYS A HD3  5  
ATOM 9940  H HE2  . LYS A 1 70  ? 21.262  -18.678 0.581   1.00 0.00 ? 70  LYS A HE2  5  
ATOM 9941  H HE3  . LYS A 1 70  ? 21.374  -16.969 1.000   1.00 0.00 ? 70  LYS A HE3  5  
ATOM 9942  H HZ1  . LYS A 1 70  ? 23.123  -18.416 2.647   1.00 0.00 ? 70  LYS A HZ1  5  
ATOM 9943  H HZ2  . LYS A 1 70  ? 23.501  -17.254 1.478   1.00 0.00 ? 70  LYS A HZ2  5  
ATOM 9944  H HZ3  . LYS A 1 70  ? 23.401  -18.887 1.046   1.00 0.00 ? 70  LYS A HZ3  5  
ATOM 9945  N N    . THR A 1 71  ? 17.223  -19.324 6.097   1.00 0.00 ? 71  THR A N    5  
ATOM 9946  C CA   . THR A 1 71  ? 16.373  -19.451 7.273   1.00 0.00 ? 71  THR A CA   5  
ATOM 9947  C C    . THR A 1 71  ? 16.641  -20.761 8.006   1.00 0.00 ? 71  THR A C    5  
ATOM 9948  O O    . THR A 1 71  ? 15.864  -21.713 7.931   1.00 0.00 ? 71  THR A O    5  
ATOM 9949  C CB   . THR A 1 71  ? 14.881  -19.383 6.898   1.00 0.00 ? 71  THR A CB   5  
ATOM 9950  O OG1  . THR A 1 71  ? 14.076  -19.781 8.013   1.00 0.00 ? 71  THR A OG1  5  
ATOM 9951  C CG2  . THR A 1 71  ? 14.581  -20.278 5.705   1.00 0.00 ? 71  THR A CG2  5  
ATOM 9952  H H    . THR A 1 71  ? 17.871  -20.031 5.895   1.00 0.00 ? 71  THR A H    5  
ATOM 9953  H HA   . THR A 1 71  ? 16.594  -18.627 7.936   1.00 0.00 ? 71  THR A HA   5  
ATOM 9954  H HB   . THR A 1 71  ? 14.638  -18.363 6.634   1.00 0.00 ? 71  THR A HB   5  
ATOM 9955  H HG1  . THR A 1 71  ? 13.147  -19.693 7.786   1.00 0.00 ? 71  THR A HG1  5  
ATOM 9956  H HG21 . THR A 1 71  ? 15.433  -20.912 5.508   1.00 0.00 ? 71  THR A HG21 5  
ATOM 9957  H HG22 . THR A 1 71  ? 14.379  -19.666 4.838   1.00 0.00 ? 71  THR A HG22 5  
ATOM 9958  H HG23 . THR A 1 71  ? 13.719  -20.891 5.922   1.00 0.00 ? 71  THR A HG23 5  
ATOM 9959  N N    . PRO A 1 72  ? 17.767  -20.813 8.733   1.00 0.00 ? 72  PRO A N    5  
ATOM 9960  C CA   . PRO A 1 72  ? 18.163  -22.001 9.495   1.00 0.00 ? 72  PRO A CA   5  
ATOM 9961  C C    . PRO A 1 72  ? 17.259  -22.246 10.698  1.00 0.00 ? 72  PRO A C    5  
ATOM 9962  O O    . PRO A 1 72  ? 16.460  -21.395 11.088  1.00 0.00 ? 72  PRO A O    5  
ATOM 9963  C CB   . PRO A 1 72  ? 19.586  -21.671 9.954   1.00 0.00 ? 72  PRO A CB   5  
ATOM 9964  C CG   . PRO A 1 72  ? 19.639  -20.182 9.980   1.00 0.00 ? 72  PRO A CG   5  
ATOM 9965  C CD   . PRO A 1 72  ? 18.740  -19.716 8.868   1.00 0.00 ? 72  PRO A CD   5  
ATOM 9966  H HA   . PRO A 1 72  ? 18.180  -22.884 8.873   1.00 0.00 ? 72  PRO A HA   5  
ATOM 9967  H HB2  . PRO A 1 72  ? 19.756  -22.090 10.935  1.00 0.00 ? 72  PRO A HB2  5  
ATOM 9968  H HB3  . PRO A 1 72  ? 20.298  -22.079 9.253   1.00 0.00 ? 72  PRO A HB3  5  
ATOM 9969  H HG2  . PRO A 1 72  ? 19.279  -19.818 10.930  1.00 0.00 ? 72  PRO A HG2  5  
ATOM 9970  H HG3  . PRO A 1 72  ? 20.652  -19.849 9.807   1.00 0.00 ? 72  PRO A HG3  5  
ATOM 9971  H HD2  . PRO A 1 72  ? 18.248  -18.795 9.141   1.00 0.00 ? 72  PRO A HD2  5  
ATOM 9972  H HD3  . PRO A 1 72  ? 19.304  -19.588 7.955   1.00 0.00 ? 72  PRO A HD3  5  
ATOM 9973  N N    . PRO A 1 73  ? 17.385  -23.438 11.301  1.00 0.00 ? 73  PRO A N    5  
ATOM 9974  C CA   . PRO A 1 73  ? 16.588  -23.822 12.470  1.00 0.00 ? 73  PRO A CA   5  
ATOM 9975  C C    . PRO A 1 73  ? 16.975  -23.038 13.719  1.00 0.00 ? 73  PRO A C    5  
ATOM 9976  O O    . PRO A 1 73  ? 17.730  -22.068 13.646  1.00 0.00 ? 73  PRO A O    5  
ATOM 9977  C CB   . PRO A 1 73  ? 16.913  -25.307 12.648  1.00 0.00 ? 73  PRO A CB   5  
ATOM 9978  C CG   . PRO A 1 73  ? 18.258  -25.477 12.032  1.00 0.00 ? 73  PRO A CG   5  
ATOM 9979  C CD   . PRO A 1 73  ? 18.317  -24.501 10.890  1.00 0.00 ? 73  PRO A CD   5  
ATOM 9980  H HA   . PRO A 1 73  ? 15.530  -23.702 12.285  1.00 0.00 ? 73  PRO A HA   5  
ATOM 9981  H HB2  . PRO A 1 73  ? 16.925  -25.551 13.701  1.00 0.00 ? 73  PRO A HB2  5  
ATOM 9982  H HB3  . PRO A 1 73  ? 16.169  -25.905 12.144  1.00 0.00 ? 73  PRO A HB3  5  
ATOM 9983  H HG2  . PRO A 1 73  ? 19.025  -25.252 12.758  1.00 0.00 ? 73  PRO A HG2  5  
ATOM 9984  H HG3  . PRO A 1 73  ? 18.369  -26.487 11.667  1.00 0.00 ? 73  PRO A HG3  5  
ATOM 9985  H HD2  . PRO A 1 73  ? 19.318  -24.113 10.776  1.00 0.00 ? 73  PRO A HD2  5  
ATOM 9986  H HD3  . PRO A 1 73  ? 17.986  -24.970 9.975   1.00 0.00 ? 73  PRO A HD3  5  
ATOM 9987  N N    . ALA A 1 74  ? 16.454  -23.464 14.865  1.00 0.00 ? 74  ALA A N    5  
ATOM 9988  C CA   . ALA A 1 74  ? 16.747  -22.803 16.130  1.00 0.00 ? 74  ALA A CA   5  
ATOM 9989  C C    . ALA A 1 74  ? 18.234  -22.886 16.461  1.00 0.00 ? 74  ALA A C    5  
ATOM 9990  O O    . ALA A 1 74  ? 18.734  -22.144 17.306  1.00 0.00 ? 74  ALA A O    5  
ATOM 9991  C CB   . ALA A 1 74  ? 15.921  -23.417 17.251  1.00 0.00 ? 74  ALA A CB   5  
ATOM 9992  H H    . ALA A 1 74  ? 15.859  -24.242 14.859  1.00 0.00 ? 74  ALA A H    5  
ATOM 9993  H HA   . ALA A 1 74  ? 16.467  -21.764 16.037  1.00 0.00 ? 74  ALA A HA   5  
ATOM 9994  H HB1  . ALA A 1 74  ? 14.965  -23.735 16.859  1.00 0.00 ? 74  ALA A HB1  5  
ATOM 9995  H HB2  . ALA A 1 74  ? 16.444  -24.268 17.660  1.00 0.00 ? 74  ALA A HB2  5  
ATOM 9996  H HB3  . ALA A 1 74  ? 15.765  -22.682 18.027  1.00 0.00 ? 74  ALA A HB3  5  
ATOM 9997  N N    . SER A 1 75  ? 18.935  -23.794 15.790  1.00 0.00 ? 75  SER A N    5  
ATOM 9998  C CA   . SER A 1 75  ? 20.364  -23.976 16.016  1.00 0.00 ? 75  SER A CA   5  
ATOM 9999  C C    . SER A 1 75  ? 21.123  -22.677 15.769  1.00 0.00 ? 75  SER A C    5  
ATOM 10000 O O    . SER A 1 75  ? 22.232  -22.487 16.272  1.00 0.00 ? 75  SER A O    5  
ATOM 10001 C CB   . SER A 1 75  ? 20.909  -25.079 15.106  1.00 0.00 ? 75  SER A CB   5  
ATOM 10002 O OG   . SER A 1 75  ? 20.994  -24.637 13.763  1.00 0.00 ? 75  SER A OG   5  
ATOM 10003 H H    . SER A 1 75  ? 18.479  -24.356 15.128  1.00 0.00 ? 75  SER A H    5  
ATOM 10004 H HA   . SER A 1 75  ? 20.502  -24.270 17.046  1.00 0.00 ? 75  SER A HA   5  
ATOM 10005 H HB2  . SER A 1 75  ? 21.894  -25.365 15.442  1.00 0.00 ? 75  SER A HB2  5  
ATOM 10006 H HB3  . SER A 1 75  ? 20.251  -25.936 15.150  1.00 0.00 ? 75  SER A HB3  5  
ATOM 10007 H HG   . SER A 1 75  ? 21.858  -24.859 13.407  1.00 0.00 ? 75  SER A HG   5  
ATOM 10008 N N    . TYR A 1 76  ? 20.520  -21.784 14.992  1.00 0.00 ? 76  TYR A N    5  
ATOM 10009 C CA   . TYR A 1 76  ? 21.139  -20.503 14.676  1.00 0.00 ? 76  TYR A CA   5  
ATOM 10010 C C    . TYR A 1 76  ? 21.434  -19.712 15.947  1.00 0.00 ? 76  TYR A C    5  
ATOM 10011 O O    . TYR A 1 76  ? 22.276  -18.813 15.952  1.00 0.00 ? 76  TYR A O    5  
ATOM 10012 C CB   . TYR A 1 76  ? 20.231  -19.688 13.754  1.00 0.00 ? 76  TYR A CB   5  
ATOM 10013 C CG   . TYR A 1 76  ? 20.779  -18.319 13.419  1.00 0.00 ? 76  TYR A CG   5  
ATOM 10014 C CD1  . TYR A 1 76  ? 21.694  -18.149 12.387  1.00 0.00 ? 76  TYR A CD1  5  
ATOM 10015 C CD2  . TYR A 1 76  ? 20.382  -17.196 14.134  1.00 0.00 ? 76  TYR A CD2  5  
ATOM 10016 C CE1  . TYR A 1 76  ? 22.198  -16.900 12.078  1.00 0.00 ? 76  TYR A CE1  5  
ATOM 10017 C CE2  . TYR A 1 76  ? 20.880  -15.943 13.832  1.00 0.00 ? 76  TYR A CE2  5  
ATOM 10018 C CZ   . TYR A 1 76  ? 21.788  -15.801 12.803  1.00 0.00 ? 76  TYR A CZ   5  
ATOM 10019 O OH   . TYR A 1 76  ? 22.287  -14.555 12.498  1.00 0.00 ? 76  TYR A OH   5  
ATOM 10020 H H    . TYR A 1 76  ? 19.637  -21.993 14.621  1.00 0.00 ? 76  TYR A H    5  
ATOM 10021 H HA   . TYR A 1 76  ? 22.069  -20.701 14.165  1.00 0.00 ? 76  TYR A HA   5  
ATOM 10022 H HB2  . TYR A 1 76  ? 20.094  -20.225 12.828  1.00 0.00 ? 76  TYR A HB2  5  
ATOM 10023 H HB3  . TYR A 1 76  ? 19.271  -19.553 14.232  1.00 0.00 ? 76  TYR A HB3  5  
ATOM 10024 H HD1  . TYR A 1 76  ? 22.012  -19.012 11.821  1.00 0.00 ? 76  TYR A HD1  5  
ATOM 10025 H HD2  . TYR A 1 76  ? 19.671  -17.311 14.939  1.00 0.00 ? 76  TYR A HD2  5  
ATOM 10026 H HE1  . TYR A 1 76  ? 22.908  -16.788 11.273  1.00 0.00 ? 76  TYR A HE1  5  
ATOM 10027 H HE2  . TYR A 1 76  ? 20.559  -15.082 14.399  1.00 0.00 ? 76  TYR A HE2  5  
ATOM 10028 H HH   . TYR A 1 76  ? 22.305  -14.015 13.291  1.00 0.00 ? 76  TYR A HH   5  
ATOM 10029 N N    . LEU A 1 77  ? 20.735  -20.053 17.024  1.00 0.00 ? 77  LEU A N    5  
ATOM 10030 C CA   . LEU A 1 77  ? 20.921  -19.376 18.303  1.00 0.00 ? 77  LEU A CA   5  
ATOM 10031 C C    . LEU A 1 77  ? 22.095  -19.975 19.070  1.00 0.00 ? 77  LEU A C    5  
ATOM 10032 O O    . LEU A 1 77  ? 22.635  -19.351 19.984  1.00 0.00 ? 77  LEU A O    5  
ATOM 10033 C CB   . LEU A 1 77  ? 19.646  -19.472 19.143  1.00 0.00 ? 77  LEU A CB   5  
ATOM 10034 C CG   . LEU A 1 77  ? 18.483  -18.582 18.702  1.00 0.00 ? 77  LEU A CG   5  
ATOM 10035 C CD1  . LEU A 1 77  ? 17.839  -19.133 17.440  1.00 0.00 ? 77  LEU A CD1  5  
ATOM 10036 C CD2  . LEU A 1 77  ? 17.455  -18.458 19.817  1.00 0.00 ? 77  LEU A CD2  5  
ATOM 10037 H H    . LEU A 1 77  ? 20.078  -20.777 16.958  1.00 0.00 ? 77  LEU A H    5  
ATOM 10038 H HA   . LEU A 1 77  ? 21.131  -18.337 18.100  1.00 0.00 ? 77  LEU A HA   5  
ATOM 10039 H HB2  . LEU A 1 77  ? 19.307  -20.497 19.114  1.00 0.00 ? 77  LEU A HB2  5  
ATOM 10040 H HB3  . LEU A 1 77  ? 19.900  -19.207 20.159  1.00 0.00 ? 77  LEU A HB3  5  
ATOM 10041 H HG   . LEU A 1 77  ? 18.859  -17.593 18.481  1.00 0.00 ? 77  LEU A HG   5  
ATOM 10042 H HD11 . LEU A 1 77  ? 16.948  -18.566 17.214  1.00 0.00 ? 77  LEU A HD11 5  
ATOM 10043 H HD12 . LEU A 1 77  ? 17.577  -20.169 17.591  1.00 0.00 ? 77  LEU A HD12 5  
ATOM 10044 H HD13 . LEU A 1 77  ? 18.534  -19.054 16.617  1.00 0.00 ? 77  LEU A HD13 5  
ATOM 10045 H HD21 . LEU A 1 77  ? 17.157  -19.443 20.144  1.00 0.00 ? 77  LEU A HD21 5  
ATOM 10046 H HD22 . LEU A 1 77  ? 16.590  -17.924 19.451  1.00 0.00 ? 77  LEU A HD22 5  
ATOM 10047 H HD23 . LEU A 1 77  ? 17.887  -17.918 20.647  1.00 0.00 ? 77  LEU A HD23 5  
ATOM 10048 N N    . ILE A 1 78  ? 22.487  -21.187 18.690  1.00 0.00 ? 78  ILE A N    5  
ATOM 10049 C CA   . ILE A 1 78  ? 23.600  -21.868 19.341  1.00 0.00 ? 78  ILE A CA   5  
ATOM 10050 C C    . ILE A 1 78  ? 24.916  -21.146 19.075  1.00 0.00 ? 78  ILE A C    5  
ATOM 10051 O O    . ILE A 1 78  ? 25.778  -21.063 19.951  1.00 0.00 ? 78  ILE A O    5  
ATOM 10052 C CB   . ILE A 1 78  ? 23.722  -23.327 18.864  1.00 0.00 ? 78  ILE A CB   5  
ATOM 10053 C CG1  . ILE A 1 78  ? 22.377  -24.044 18.996  1.00 0.00 ? 78  ILE A CG1  5  
ATOM 10054 C CG2  . ILE A 1 78  ? 24.797  -24.055 19.658  1.00 0.00 ? 78  ILE A CG2  5  
ATOM 10055 C CD1  . ILE A 1 78  ? 22.375  -25.437 18.407  1.00 0.00 ? 78  ILE A CD1  5  
ATOM 10056 H H    . ILE A 1 78  ? 22.017  -21.633 17.955  1.00 0.00 ? 78  ILE A H    5  
ATOM 10057 H HA   . ILE A 1 78  ? 23.412  -21.872 20.405  1.00 0.00 ? 78  ILE A HA   5  
ATOM 10058 H HB   . ILE A 1 78  ? 24.018  -23.320 17.826  1.00 0.00 ? 78  ILE A HB   5  
ATOM 10059 H HG12 . ILE A 1 78  ? 22.121  -24.126 20.040  1.00 0.00 ? 78  ILE A HG12 5  
ATOM 10060 H HG13 . ILE A 1 78  ? 21.619  -23.467 18.488  1.00 0.00 ? 78  ILE A HG13 5  
ATOM 10061 H HG21 . ILE A 1 78  ? 25.678  -23.434 19.725  1.00 0.00 ? 78  ILE A HG21 5  
ATOM 10062 H HG22 . ILE A 1 78  ? 24.429  -24.265 20.651  1.00 0.00 ? 78  ILE A HG22 5  
ATOM 10063 H HG23 . ILE A 1 78  ? 25.046  -24.981 19.162  1.00 0.00 ? 78  ILE A HG23 5  
ATOM 10064 H HD11 . ILE A 1 78  ? 22.825  -25.414 17.425  1.00 0.00 ? 78  ILE A HD11 5  
ATOM 10065 H HD12 . ILE A 1 78  ? 22.936  -26.101 19.047  1.00 0.00 ? 78  ILE A HD12 5  
ATOM 10066 H HD13 . ILE A 1 78  ? 21.357  -25.792 18.326  1.00 0.00 ? 78  ILE A HD13 5  
ATOM 10067 N N    . ARG A 1 79  ? 25.065  -20.624 17.862  1.00 0.00 ? 79  ARG A N    5  
ATOM 10068 C CA   . ARG A 1 79  ? 26.277  -19.908 17.481  1.00 0.00 ? 79  ARG A CA   5  
ATOM 10069 C C    . ARG A 1 79  ? 26.429  -18.626 18.295  1.00 0.00 ? 79  ARG A C    5  
ATOM 10070 O O    . ARG A 1 79  ? 27.531  -18.097 18.440  1.00 0.00 ? 79  ARG A O    5  
ATOM 10071 C CB   . ARG A 1 79  ? 26.251  -19.578 15.988  1.00 0.00 ? 79  ARG A CB   5  
ATOM 10072 C CG   . ARG A 1 79  ? 26.744  -20.712 15.104  1.00 0.00 ? 79  ARG A CG   5  
ATOM 10073 C CD   . ARG A 1 79  ? 25.687  -21.132 14.095  1.00 0.00 ? 79  ARG A CD   5  
ATOM 10074 N NE   . ARG A 1 79  ? 26.201  -22.110 13.140  1.00 0.00 ? 79  ARG A NE   5  
ATOM 10075 C CZ   . ARG A 1 79  ? 25.435  -22.760 12.270  1.00 0.00 ? 79  ARG A CZ   5  
ATOM 10076 N NH1  . ARG A 1 79  ? 24.129  -22.536 12.235  1.00 0.00 ? 79  ARG A NH1  5  
ATOM 10077 N NH2  . ARG A 1 79  ? 25.976  -23.635 11.432  1.00 0.00 ? 79  ARG A NH2  5  
ATOM 10078 H H    . ARG A 1 79  ? 24.343  -20.723 17.207  1.00 0.00 ? 79  ARG A H    5  
ATOM 10079 H HA   . ARG A 1 79  ? 27.120  -20.552 17.684  1.00 0.00 ? 79  ARG A HA   5  
ATOM 10080 H HB2  . ARG A 1 79  ? 25.237  -19.342 15.700  1.00 0.00 ? 79  ARG A HB2  5  
ATOM 10081 H HB3  . ARG A 1 79  ? 26.876  -18.715 15.812  1.00 0.00 ? 79  ARG A HB3  5  
ATOM 10082 H HG2  . ARG A 1 79  ? 27.625  -20.384 14.572  1.00 0.00 ? 79  ARG A HG2  5  
ATOM 10083 H HG3  . ARG A 1 79  ? 26.992  -21.559 15.727  1.00 0.00 ? 79  ARG A HG3  5  
ATOM 10084 H HD2  . ARG A 1 79  ? 24.853  -21.566 14.626  1.00 0.00 ? 79  ARG A HD2  5  
ATOM 10085 H HD3  . ARG A 1 79  ? 25.355  -20.257 13.557  1.00 0.00 ? 79  ARG A HD3  5  
ATOM 10086 H HE   . ARG A 1 79  ? 27.163  -22.291 13.148  1.00 0.00 ? 79  ARG A HE   5  
ATOM 10087 H HH11 . ARG A 1 79  ? 23.718  -21.876 12.865  1.00 0.00 ? 79  ARG A HH11 5  
ATOM 10088 H HH12 . ARG A 1 79  ? 23.555  -23.026 11.579  1.00 0.00 ? 79  ARG A HH12 5  
ATOM 10089 H HH21 . ARG A 1 79  ? 26.961  -23.806 11.456  1.00 0.00 ? 79  ARG A HH21 5  
ATOM 10090 H HH22 . ARG A 1 79  ? 25.399  -24.124 10.779  1.00 0.00 ? 79  ARG A HH22 5  
ATOM 10091 N N    . LYS A 1 80  ? 25.315  -18.131 18.822  1.00 0.00 ? 80  LYS A N    5  
ATOM 10092 C CA   . LYS A 1 80  ? 25.323  -16.911 19.622  1.00 0.00 ? 80  LYS A CA   5  
ATOM 10093 C C    . LYS A 1 80  ? 26.015  -17.143 20.961  1.00 0.00 ? 80  LYS A C    5  
ATOM 10094 O O    . LYS A 1 80  ? 26.963  -16.440 21.310  1.00 0.00 ? 80  LYS A O    5  
ATOM 10095 C CB   . LYS A 1 80  ? 23.892  -16.420 19.853  1.00 0.00 ? 80  LYS A CB   5  
ATOM 10096 C CG   . LYS A 1 80  ? 23.818  -15.064 20.534  1.00 0.00 ? 80  LYS A CG   5  
ATOM 10097 C CD   . LYS A 1 80  ? 23.761  -15.202 22.046  1.00 0.00 ? 80  LYS A CD   5  
ATOM 10098 C CE   . LYS A 1 80  ? 24.627  -14.157 22.734  1.00 0.00 ? 80  LYS A CE   5  
ATOM 10099 N NZ   . LYS A 1 80  ? 25.792  -14.772 23.428  1.00 0.00 ? 80  LYS A NZ   5  
ATOM 10100 H H    . LYS A 1 80  ? 24.466  -18.597 18.671  1.00 0.00 ? 80  LYS A H    5  
ATOM 10101 H HA   . LYS A 1 80  ? 25.868  -16.159 19.073  1.00 0.00 ? 80  LYS A HA   5  
ATOM 10102 H HB2  . LYS A 1 80  ? 23.390  -16.348 18.900  1.00 0.00 ? 80  LYS A HB2  5  
ATOM 10103 H HB3  . LYS A 1 80  ? 23.373  -17.138 20.471  1.00 0.00 ? 80  LYS A HB3  5  
ATOM 10104 H HG2  . LYS A 1 80  ? 24.692  -14.489 20.268  1.00 0.00 ? 80  LYS A HG2  5  
ATOM 10105 H HG3  . LYS A 1 80  ? 22.929  -14.549 20.195  1.00 0.00 ? 80  LYS A HG3  5  
ATOM 10106 H HD2  . LYS A 1 80  ? 22.740  -15.077 22.373  1.00 0.00 ? 80  LYS A HD2  5  
ATOM 10107 H HD3  . LYS A 1 80  ? 24.112  -16.186 22.323  1.00 0.00 ? 80  LYS A HD3  5  
ATOM 10108 H HE2  . LYS A 1 80  ? 24.988  -13.462 21.991  1.00 0.00 ? 80  LYS A HE2  5  
ATOM 10109 H HE3  . LYS A 1 80  ? 24.024  -13.629 23.458  1.00 0.00 ? 80  LYS A HE3  5  
ATOM 10110 H HZ1  . LYS A 1 80  ? 25.540  -15.719 23.777  1.00 0.00 ? 80  LYS A HZ1  5  
ATOM 10111 H HZ2  . LYS A 1 80  ? 26.078  -14.183 24.236  1.00 0.00 ? 80  LYS A HZ2  5  
ATOM 10112 H HZ3  . LYS A 1 80  ? 26.595  -14.857 22.773  1.00 0.00 ? 80  LYS A HZ3  5  
ATOM 10113 N N    . ALA A 1 81  ? 25.536  -18.134 21.706  1.00 0.00 ? 81  ALA A N    5  
ATOM 10114 C CA   . ALA A 1 81  ? 26.112  -18.460 23.005  1.00 0.00 ? 81  ALA A CA   5  
ATOM 10115 C C    . ALA A 1 81  ? 27.621  -18.652 22.904  1.00 0.00 ? 81  ALA A C    5  
ATOM 10116 O O    . ALA A 1 81  ? 28.394  -17.875 23.463  1.00 0.00 ? 81  ALA A O    5  
ATOM 10117 C CB   . ALA A 1 81  ? 25.456  -19.709 23.574  1.00 0.00 ? 81  ALA A CB   5  
ATOM 10118 H H    . ALA A 1 81  ? 24.779  -18.659 21.373  1.00 0.00 ? 81  ALA A H    5  
ATOM 10119 H HA   . ALA A 1 81  ? 25.907  -17.638 23.676  1.00 0.00 ? 81  ALA A HA   5  
ATOM 10120 H HB1  . ALA A 1 81  ? 25.726  -20.564 22.970  1.00 0.00 ? 81  ALA A HB1  5  
ATOM 10121 H HB2  . ALA A 1 81  ? 25.793  -19.863 24.588  1.00 0.00 ? 81  ALA A HB2  5  
ATOM 10122 H HB3  . ALA A 1 81  ? 24.383  -19.588 23.565  1.00 0.00 ? 81  ALA A HB3  5  
ATOM 10123 N N    . ALA A 1 82  ? 28.034  -19.692 22.187  1.00 0.00 ? 82  ALA A N    5  
ATOM 10124 C CA   . ALA A 1 82  ? 29.451  -19.985 22.012  1.00 0.00 ? 82  ALA A CA   5  
ATOM 10125 C C    . ALA A 1 82  ? 30.159  -18.853 21.275  1.00 0.00 ? 82  ALA A C    5  
ATOM 10126 O O    . ALA A 1 82  ? 31.356  -18.635 21.455  1.00 0.00 ? 82  ALA A O    5  
ATOM 10127 C CB   . ALA A 1 82  ? 29.630  -21.298 21.264  1.00 0.00 ? 82  ALA A CB   5  
ATOM 10128 H H    . ALA A 1 82  ? 27.370  -20.276 21.765  1.00 0.00 ? 82  ALA A H    5  
ATOM 10129 H HA   . ALA A 1 82  ? 29.893  -20.094 22.992  1.00 0.00 ? 82  ALA A HA   5  
ATOM 10130 H HB1  . ALA A 1 82  ? 29.561  -21.118 20.201  1.00 0.00 ? 82  ALA A HB1  5  
ATOM 10131 H HB2  . ALA A 1 82  ? 30.599  -21.715 21.497  1.00 0.00 ? 82  ALA A HB2  5  
ATOM 10132 H HB3  . ALA A 1 82  ? 28.858  -21.991 21.564  1.00 0.00 ? 82  ALA A HB3  5  
ATOM 10133 N N    . GLY A 1 83  ? 29.410  -18.136 20.443  1.00 0.00 ? 83  GLY A N    5  
ATOM 10134 C CA   . GLY A 1 83  ? 29.983  -17.036 19.690  1.00 0.00 ? 83  GLY A CA   5  
ATOM 10135 C C    . GLY A 1 83  ? 31.224  -17.444 18.921  1.00 0.00 ? 83  GLY A C    5  
ATOM 10136 O O    . GLY A 1 83  ? 32.343  -17.315 19.419  1.00 0.00 ? 83  GLY A O    5  
ATOM 10137 H H    . GLY A 1 83  ? 28.460  -18.356 20.339  1.00 0.00 ? 83  GLY A H    5  
ATOM 10138 H HA2  . GLY A 1 83  ? 29.245  -16.667 18.993  1.00 0.00 ? 83  GLY A HA2  5  
ATOM 10139 H HA3  . GLY A 1 83  ? 30.244  -16.243 20.376  1.00 0.00 ? 83  GLY A HA3  5  
ATOM 10140 N N    . LEU A 1 84  ? 31.028  -17.940 17.704  1.00 0.00 ? 84  LEU A N    5  
ATOM 10141 C CA   . LEU A 1 84  ? 32.140  -18.370 16.865  1.00 0.00 ? 84  LEU A CA   5  
ATOM 10142 C C    . LEU A 1 84  ? 32.777  -17.181 16.153  1.00 0.00 ? 84  LEU A C    5  
ATOM 10143 O O    . LEU A 1 84  ? 33.999  -17.031 16.148  1.00 0.00 ? 84  LEU A O    5  
ATOM 10144 C CB   . LEU A 1 84  ? 31.662  -19.398 15.837  1.00 0.00 ? 84  LEU A CB   5  
ATOM 10145 C CG   . LEU A 1 84  ? 30.977  -20.643 16.402  1.00 0.00 ? 84  LEU A CG   5  
ATOM 10146 C CD1  . LEU A 1 84  ? 31.690  -21.120 17.658  1.00 0.00 ? 84  LEU A CD1  5  
ATOM 10147 C CD2  . LEU A 1 84  ? 29.511  -20.360 16.693  1.00 0.00 ? 84  LEU A CD2  5  
ATOM 10148 H H    . LEU A 1 84  ? 30.113  -18.019 17.361  1.00 0.00 ? 84  LEU A H    5  
ATOM 10149 H HA   . LEU A 1 84  ? 32.879  -18.830 17.504  1.00 0.00 ? 84  LEU A HA   5  
ATOM 10150 H HB2  . LEU A 1 84  ? 30.962  -18.906 15.179  1.00 0.00 ? 84  LEU A HB2  5  
ATOM 10151 H HB3  . LEU A 1 84  ? 32.522  -19.721 15.268  1.00 0.00 ? 84  LEU A HB3  5  
ATOM 10152 H HG   . LEU A 1 84  ? 31.027  -21.437 15.669  1.00 0.00 ? 84  LEU A HG   5  
ATOM 10153 H HD11 . LEU A 1 84  ? 31.594  -20.374 18.431  1.00 0.00 ? 84  LEU A HD11 5  
ATOM 10154 H HD12 . LEU A 1 84  ? 32.735  -21.281 17.439  1.00 0.00 ? 84  LEU A HD12 5  
ATOM 10155 H HD13 . LEU A 1 84  ? 31.246  -22.046 17.993  1.00 0.00 ? 84  LEU A HD13 5  
ATOM 10156 H HD21 . LEU A 1 84  ? 28.923  -21.237 16.464  1.00 0.00 ? 84  LEU A HD21 5  
ATOM 10157 H HD22 . LEU A 1 84  ? 29.176  -19.534 16.083  1.00 0.00 ? 84  LEU A HD22 5  
ATOM 10158 H HD23 . LEU A 1 84  ? 29.393  -20.110 17.736  1.00 0.00 ? 84  LEU A HD23 5  
ATOM 10159 N N    . GLU A 1 85  ? 31.941  -16.339 15.555  1.00 0.00 ? 85  GLU A N    5  
ATOM 10160 C CA   . GLU A 1 85  ? 32.424  -15.162 14.841  1.00 0.00 ? 85  GLU A CA   5  
ATOM 10161 C C    . GLU A 1 85  ? 31.488  -13.976 15.053  1.00 0.00 ? 85  GLU A C    5  
ATOM 10162 O O    . GLU A 1 85  ? 31.401  -13.081 14.212  1.00 0.00 ? 85  GLU A O    5  
ATOM 10163 C CB   . GLU A 1 85  ? 32.555  -15.462 13.347  1.00 0.00 ? 85  GLU A CB   5  
ATOM 10164 C CG   . GLU A 1 85  ? 33.766  -16.313 13.001  1.00 0.00 ? 85  GLU A CG   5  
ATOM 10165 C CD   . GLU A 1 85  ? 35.050  -15.508 12.954  1.00 0.00 ? 85  GLU A CD   5  
ATOM 10166 O OE1  . GLU A 1 85  ? 35.480  -15.013 14.017  1.00 0.00 ? 85  GLU A OE1  5  
ATOM 10167 O OE2  . GLU A 1 85  ? 35.625  -15.373 11.854  1.00 0.00 ? 85  GLU A OE2  5  
ATOM 10168 H H    . GLU A 1 85  ? 30.977  -16.513 15.593  1.00 0.00 ? 85  GLU A H    5  
ATOM 10169 H HA   . GLU A 1 85  ? 33.397  -14.911 15.235  1.00 0.00 ? 85  GLU A HA   5  
ATOM 10170 H HB2  . GLU A 1 85  ? 31.668  -15.984 13.017  1.00 0.00 ? 85  GLU A HB2  5  
ATOM 10171 H HB3  . GLU A 1 85  ? 32.632  -14.528 12.810  1.00 0.00 ? 85  GLU A HB3  5  
ATOM 10172 H HG2  . GLU A 1 85  ? 33.871  -17.087 13.746  1.00 0.00 ? 85  GLU A HG2  5  
ATOM 10173 H HG3  . GLU A 1 85  ? 33.607  -16.766 12.033  1.00 0.00 ? 85  GLU A HG3  5  
ATOM 10174 N N    . LYS A 1 86  ? 30.788  -13.976 16.182  1.00 0.00 ? 86  LYS A N    5  
ATOM 10175 C CA   . LYS A 1 86  ? 29.858  -12.901 16.507  1.00 0.00 ? 86  LYS A CA   5  
ATOM 10176 C C    . LYS A 1 86  ? 30.563  -11.548 16.491  1.00 0.00 ? 86  LYS A C    5  
ATOM 10177 O O    . LYS A 1 86  ? 31.757  -11.457 16.775  1.00 0.00 ? 86  LYS A O    5  
ATOM 10178 C CB   . LYS A 1 86  ? 29.225  -13.143 17.879  1.00 0.00 ? 86  LYS A CB   5  
ATOM 10179 C CG   . LYS A 1 86  ? 27.777  -12.694 17.968  1.00 0.00 ? 86  LYS A CG   5  
ATOM 10180 C CD   . LYS A 1 86  ? 27.490  -11.995 19.287  1.00 0.00 ? 86  LYS A CD   5  
ATOM 10181 C CE   . LYS A 1 86  ? 26.002  -11.738 19.469  1.00 0.00 ? 86  LYS A CE   5  
ATOM 10182 N NZ   . LYS A 1 86  ? 25.744  -10.639 20.441  1.00 0.00 ? 86  LYS A NZ   5  
ATOM 10183 H H    . LYS A 1 86  ? 30.900  -14.717 16.814  1.00 0.00 ? 86  LYS A H    5  
ATOM 10184 H HA   . LYS A 1 86  ? 29.081  -12.896 15.757  1.00 0.00 ? 86  LYS A HA   5  
ATOM 10185 H HB2  . LYS A 1 86  ? 29.267  -14.199 18.100  1.00 0.00 ? 86  LYS A HB2  5  
ATOM 10186 H HB3  . LYS A 1 86  ? 29.793  -12.604 18.624  1.00 0.00 ? 86  LYS A HB3  5  
ATOM 10187 H HG2  . LYS A 1 86  ? 27.570  -12.010 17.159  1.00 0.00 ? 86  LYS A HG2  5  
ATOM 10188 H HG3  . LYS A 1 86  ? 27.135  -13.560 17.884  1.00 0.00 ? 86  LYS A HG3  5  
ATOM 10189 H HD2  . LYS A 1 86  ? 27.838  -12.617 20.098  1.00 0.00 ? 86  LYS A HD2  5  
ATOM 10190 H HD3  . LYS A 1 86  ? 28.015  -11.050 19.305  1.00 0.00 ? 86  LYS A HD3  5  
ATOM 10191 H HE2  . LYS A 1 86  ? 25.577  -11.469 18.514  1.00 0.00 ? 86  LYS A HE2  5  
ATOM 10192 H HE3  . LYS A 1 86  ? 25.535  -12.642 19.829  1.00 0.00 ? 86  LYS A HE3  5  
ATOM 10193 H HZ1  . LYS A 1 86  ? 25.188  -10.997 21.244  1.00 0.00 ? 86  LYS A HZ1  5  
ATOM 10194 H HZ2  . LYS A 1 86  ? 25.214  -9.872  19.981  1.00 0.00 ? 86  LYS A HZ2  5  
ATOM 10195 H HZ3  . LYS A 1 86  ? 26.644  -10.259 20.798  1.00 0.00 ? 86  LYS A HZ3  5  
ATOM 10196 N N    . GLY A 1 87  ? 29.815  -10.500 16.160  1.00 0.00 ? 87  GLY A N    5  
ATOM 10197 C CA   . GLY A 1 87  ? 30.386  -9.166  16.116  1.00 0.00 ? 87  GLY A CA   5  
ATOM 10198 C C    . GLY A 1 87  ? 29.851  -8.269  17.215  1.00 0.00 ? 87  GLY A C    5  
ATOM 10199 O O    . GLY A 1 87  ? 29.232  -7.242  16.940  1.00 0.00 ? 87  GLY A O    5  
ATOM 10200 H H    . GLY A 1 87  ? 28.869  -10.633 15.944  1.00 0.00 ? 87  GLY A H    5  
ATOM 10201 H HA2  . GLY A 1 87  ? 31.458  -9.242  16.218  1.00 0.00 ? 87  GLY A HA2  5  
ATOM 10202 H HA3  . GLY A 1 87  ? 30.156  -8.720  15.160  1.00 0.00 ? 87  GLY A HA3  5  
ATOM 10203 N N    . ALA A 1 88  ? 30.087  -8.660  18.463  1.00 0.00 ? 88  ALA A N    5  
ATOM 10204 C CA   . ALA A 1 88  ? 29.624  -7.884  19.607  1.00 0.00 ? 88  ALA A CA   5  
ATOM 10205 C C    . ALA A 1 88  ? 30.590  -8.005  20.780  1.00 0.00 ? 88  ALA A C    5  
ATOM 10206 O O    . ALA A 1 88  ? 30.962  -7.006  21.397  1.00 0.00 ? 88  ALA A O    5  
ATOM 10207 C CB   . ALA A 1 88  ? 28.230  -8.333  20.020  1.00 0.00 ? 88  ALA A CB   5  
ATOM 10208 H H    . ALA A 1 88  ? 30.585  -9.489  18.618  1.00 0.00 ? 88  ALA A H    5  
ATOM 10209 H HA   . ALA A 1 88  ? 29.567  -6.847  19.306  1.00 0.00 ? 88  ALA A HA   5  
ATOM 10210 H HB1  . ALA A 1 88  ? 27.621  -7.465  20.229  1.00 0.00 ? 88  ALA A HB1  5  
ATOM 10211 H HB2  . ALA A 1 88  ? 27.783  -8.902  19.218  1.00 0.00 ? 88  ALA A HB2  5  
ATOM 10212 H HB3  . ALA A 1 88  ? 28.298  -8.948  20.904  1.00 0.00 ? 88  ALA A HB3  5  
ATOM 10213 N N    . HIS A 1 89  ? 30.994  -9.235  21.084  1.00 0.00 ? 89  HIS A N    5  
ATOM 10214 C CA   . HIS A 1 89  ? 31.917  -9.486  22.184  1.00 0.00 ? 89  HIS A CA   5  
ATOM 10215 C C    . HIS A 1 89  ? 31.344  -8.975  23.502  1.00 0.00 ? 89  HIS A C    5  
ATOM 10216 O O    . HIS A 1 89  ? 30.488  -8.090  23.518  1.00 0.00 ? 89  HIS A O    5  
ATOM 10217 C CB   . HIS A 1 89  ? 33.266  -8.820  21.908  1.00 0.00 ? 89  HIS A CB   5  
ATOM 10218 C CG   . HIS A 1 89  ? 33.449  -7.518  22.626  1.00 0.00 ? 89  HIS A CG   5  
ATOM 10219 N ND1  . HIS A 1 89  ? 33.692  -7.434  23.981  1.00 0.00 ? 89  HIS A ND1  5  
ATOM 10220 C CD2  . HIS A 1 89  ? 33.425  -6.245  22.169  1.00 0.00 ? 89  HIS A CD2  5  
ATOM 10221 C CE1  . HIS A 1 89  ? 33.808  -6.164  24.326  1.00 0.00 ? 89  HIS A CE1  5  
ATOM 10222 N NE2  . HIS A 1 89  ? 33.650  -5.422  23.245  1.00 0.00 ? 89  HIS A NE2  5  
ATOM 10223 H H    . HIS A 1 89  ? 30.663  -9.990  20.555  1.00 0.00 ? 89  HIS A H    5  
ATOM 10224 H HA   . HIS A 1 89  ? 32.061  -10.553 22.259  1.00 0.00 ? 89  HIS A HA   5  
ATOM 10225 H HB2  . HIS A 1 89  ? 34.058  -9.485  22.220  1.00 0.00 ? 89  HIS A HB2  5  
ATOM 10226 H HB3  . HIS A 1 89  ? 33.357  -8.631  20.848  1.00 0.00 ? 89  HIS A HB3  5  
ATOM 10227 H HD1  . HIS A 1 89  ? 33.767  -8.191  24.597  1.00 0.00 ? 89  HIS A HD1  5  
ATOM 10228 H HD2  . HIS A 1 89  ? 33.258  -5.932  21.147  1.00 0.00 ? 89  HIS A HD2  5  
ATOM 10229 H HE1  . HIS A 1 89  ? 33.999  -5.795  25.323  1.00 0.00 ? 89  HIS A HE1  5  
ATOM 10230 N N    . LYS A 1 90  ? 31.821  -9.538  24.607  1.00 0.00 ? 90  LYS A N    5  
ATOM 10231 C CA   . LYS A 1 90  ? 31.357  -9.140  25.931  1.00 0.00 ? 90  LYS A CA   5  
ATOM 10232 C C    . LYS A 1 90  ? 32.527  -9.013  26.902  1.00 0.00 ? 90  LYS A C    5  
ATOM 10233 O O    . LYS A 1 90  ? 33.575  -9.637  26.733  1.00 0.00 ? 90  LYS A O    5  
ATOM 10234 C CB   . LYS A 1 90  ? 30.344  -10.154 26.466  1.00 0.00 ? 90  LYS A CB   5  
ATOM 10235 C CG   . LYS A 1 90  ? 30.985  -11.364 27.125  1.00 0.00 ? 90  LYS A CG   5  
ATOM 10236 C CD   . LYS A 1 90  ? 31.875  -12.122 26.154  1.00 0.00 ? 90  LYS A CD   5  
ATOM 10237 C CE   . LYS A 1 90  ? 31.814  -13.622 26.397  1.00 0.00 ? 90  LYS A CE   5  
ATOM 10238 N NZ   . LYS A 1 90  ? 31.306  -14.357 25.206  1.00 0.00 ? 90  LYS A NZ   5  
ATOM 10239 H H    . LYS A 1 90  ? 32.503  -10.239 24.530  1.00 0.00 ? 90  LYS A H    5  
ATOM 10240 H HA   . LYS A 1 90  ? 30.876  -8.178  25.838  1.00 0.00 ? 90  LYS A HA   5  
ATOM 10241 H HB2  . LYS A 1 90  ? 29.713  -9.666  27.193  1.00 0.00 ? 90  LYS A HB2  5  
ATOM 10242 H HB3  . LYS A 1 90  ? 29.732  -10.500 25.645  1.00 0.00 ? 90  LYS A HB3  5  
ATOM 10243 H HG2  . LYS A 1 90  ? 31.583  -11.032 27.961  1.00 0.00 ? 90  LYS A HG2  5  
ATOM 10244 H HG3  . LYS A 1 90  ? 30.206  -12.025 27.477  1.00 0.00 ? 90  LYS A HG3  5  
ATOM 10245 H HD2  . LYS A 1 90  ? 31.548  -11.919 25.145  1.00 0.00 ? 90  LYS A HD2  5  
ATOM 10246 H HD3  . LYS A 1 90  ? 32.895  -11.787 26.278  1.00 0.00 ? 90  LYS A HD3  5  
ATOM 10247 H HE2  . LYS A 1 90  ? 32.806  -13.976 26.632  1.00 0.00 ? 90  LYS A HE2  5  
ATOM 10248 H HE3  . LYS A 1 90  ? 31.157  -13.811 27.234  1.00 0.00 ? 90  LYS A HE3  5  
ATOM 10249 H HZ1  . LYS A 1 90  ? 30.275  -14.243 25.129  1.00 0.00 ? 90  LYS A HZ1  5  
ATOM 10250 H HZ2  . LYS A 1 90  ? 31.525  -15.369 25.290  1.00 0.00 ? 90  LYS A HZ2  5  
ATOM 10251 H HZ3  . LYS A 1 90  ? 31.750  -13.987 24.342  1.00 0.00 ? 90  LYS A HZ3  5  
ATOM 10252 N N    . PRO A 1 91  ? 32.346  -8.188  27.944  1.00 0.00 ? 91  PRO A N    5  
ATOM 10253 C CA   . PRO A 1 91  ? 33.375  -7.963  28.963  1.00 0.00 ? 91  PRO A CA   5  
ATOM 10254 C C    . PRO A 1 91  ? 33.595  -9.187  29.845  1.00 0.00 ? 91  PRO A C    5  
ATOM 10255 O O    . PRO A 1 91  ? 32.644  -9.856  30.245  1.00 0.00 ? 91  PRO A O    5  
ATOM 10256 C CB   . PRO A 1 91  ? 32.808  -6.805  29.789  1.00 0.00 ? 91  PRO A CB   5  
ATOM 10257 C CG   . PRO A 1 91  ? 31.333  -6.893  29.603  1.00 0.00 ? 91  PRO A CG   5  
ATOM 10258 C CD   . PRO A 1 91  ? 31.122  -7.413  28.208  1.00 0.00 ? 91  PRO A CD   5  
ATOM 10259 H HA   . PRO A 1 91  ? 34.314  -7.666  28.520  1.00 0.00 ? 91  PRO A HA   5  
ATOM 10260 H HB2  . PRO A 1 91  ? 33.085  -6.930  30.826  1.00 0.00 ? 91  PRO A HB2  5  
ATOM 10261 H HB3  . PRO A 1 91  ? 33.198  -5.869  29.417  1.00 0.00 ? 91  PRO A HB3  5  
ATOM 10262 H HG2  . PRO A 1 91  ? 30.912  -7.575  30.325  1.00 0.00 ? 91  PRO A HG2  5  
ATOM 10263 H HG3  . PRO A 1 91  ? 30.891  -5.913  29.708  1.00 0.00 ? 91  PRO A HG3  5  
ATOM 10264 H HD2  . PRO A 1 91  ? 30.248  -8.047  28.169  1.00 0.00 ? 91  PRO A HD2  5  
ATOM 10265 H HD3  . PRO A 1 91  ? 31.027  -6.594  27.510  1.00 0.00 ? 91  PRO A HD3  5  
ATOM 10266 N N    . GLY A 1 92  ? 34.858  -9.475  30.145  1.00 0.00 ? 92  GLY A N    5  
ATOM 10267 C CA   . GLY A 1 92  ? 35.181  -10.619 30.978  1.00 0.00 ? 92  GLY A CA   5  
ATOM 10268 C C    . GLY A 1 92  ? 35.915  -11.704 30.214  1.00 0.00 ? 92  GLY A C    5  
ATOM 10269 O O    . GLY A 1 92  ? 36.630  -11.420 29.253  1.00 0.00 ? 92  GLY A O    5  
ATOM 10270 H H    . GLY A 1 92  ? 35.577  -8.906  29.798  1.00 0.00 ? 92  GLY A H    5  
ATOM 10271 H HA2  . GLY A 1 92  ? 35.800  -10.289 31.799  1.00 0.00 ? 92  GLY A HA2  5  
ATOM 10272 H HA3  . GLY A 1 92  ? 34.264  -11.031 31.374  1.00 0.00 ? 92  GLY A HA3  5  
ATOM 10273 N N    . ARG A 1 93  ? 35.739  -12.949 30.643  1.00 0.00 ? 93  ARG A N    5  
ATOM 10274 C CA   . ARG A 1 93  ? 36.393  -14.080 29.995  1.00 0.00 ? 93  ARG A CA   5  
ATOM 10275 C C    . ARG A 1 93  ? 35.647  -14.485 28.727  1.00 0.00 ? 93  ARG A C    5  
ATOM 10276 O O    . ARG A 1 93  ? 34.418  -14.459 28.684  1.00 0.00 ? 93  ARG A O    5  
ATOM 10277 C CB   . ARG A 1 93  ? 36.472  -15.269 30.955  1.00 0.00 ? 93  ARG A CB   5  
ATOM 10278 C CG   . ARG A 1 93  ? 37.443  -15.059 32.105  1.00 0.00 ? 93  ARG A CG   5  
ATOM 10279 C CD   . ARG A 1 93  ? 36.721  -14.623 33.371  1.00 0.00 ? 93  ARG A CD   5  
ATOM 10280 N NE   . ARG A 1 93  ? 37.535  -14.833 34.565  1.00 0.00 ? 93  ARG A NE   5  
ATOM 10281 C CZ   . ARG A 1 93  ? 37.210  -14.371 35.767  1.00 0.00 ? 93  ARG A CZ   5  
ATOM 10282 N NH1  . ARG A 1 93  ? 36.093  -13.676 35.933  1.00 0.00 ? 93  ARG A NH1  5  
ATOM 10283 N NH2  . ARG A 1 93  ? 38.002  -14.604 36.805  1.00 0.00 ? 93  ARG A NH2  5  
ATOM 10284 H H    . ARG A 1 93  ? 35.157  -13.112 31.415  1.00 0.00 ? 93  ARG A H    5  
ATOM 10285 H HA   . ARG A 1 93  ? 37.394  -13.776 29.729  1.00 0.00 ? 93  ARG A HA   5  
ATOM 10286 H HB2  . ARG A 1 93  ? 35.491  -15.448 31.369  1.00 0.00 ? 93  ARG A HB2  5  
ATOM 10287 H HB3  . ARG A 1 93  ? 36.786  -16.141 30.402  1.00 0.00 ? 93  ARG A HB3  5  
ATOM 10288 H HG2  . ARG A 1 93  ? 37.961  -15.987 32.301  1.00 0.00 ? 93  ARG A HG2  5  
ATOM 10289 H HG3  . ARG A 1 93  ? 38.157  -14.298 31.827  1.00 0.00 ? 93  ARG A HG3  5  
ATOM 10290 H HD2  . ARG A 1 93  ? 36.483  -13.573 33.290  1.00 0.00 ? 93  ARG A HD2  5  
ATOM 10291 H HD3  . ARG A 1 93  ? 35.809  -15.193 33.463  1.00 0.00 ? 93  ARG A HD3  5  
ATOM 10292 H HE   . ARG A 1 93  ? 38.365  -15.344 34.464  1.00 0.00 ? 93  ARG A HE   5  
ATOM 10293 H HH11 . ARG A 1 93  ? 35.493  -13.500 35.153  1.00 0.00 ? 93  ARG A HH11 5  
ATOM 10294 H HH12 . ARG A 1 93  ? 35.849  -13.330 36.840  1.00 0.00 ? 93  ARG A HH12 5  
ATOM 10295 H HH21 . ARG A 1 93  ? 38.845  -15.127 36.684  1.00 0.00 ? 93  ARG A HH21 5  
ATOM 10296 H HH22 . ARG A 1 93  ? 37.756  -14.256 37.709  1.00 0.00 ? 93  ARG A HH22 5  
ATOM 10297 N N    . GLU A 1 94  ? 36.400  -14.858 27.697  1.00 0.00 ? 94  GLU A N    5  
ATOM 10298 C CA   . GLU A 1 94  ? 35.810  -15.266 26.428  1.00 0.00 ? 94  GLU A CA   5  
ATOM 10299 C C    . GLU A 1 94  ? 36.347  -16.627 25.991  1.00 0.00 ? 94  GLU A C    5  
ATOM 10300 O O    . GLU A 1 94  ? 37.548  -16.887 26.068  1.00 0.00 ? 94  GLU A O    5  
ATOM 10301 C CB   . GLU A 1 94  ? 36.096  -14.222 25.347  1.00 0.00 ? 94  GLU A CB   5  
ATOM 10302 C CG   . GLU A 1 94  ? 37.529  -14.246 24.842  1.00 0.00 ? 94  GLU A CG   5  
ATOM 10303 C CD   . GLU A 1 94  ? 38.061  -12.861 24.529  1.00 0.00 ? 94  GLU A CD   5  
ATOM 10304 O OE1  . GLU A 1 94  ? 38.118  -12.025 25.456  1.00 0.00 ? 94  GLU A OE1  5  
ATOM 10305 O OE2  . GLU A 1 94  ? 38.419  -12.612 23.359  1.00 0.00 ? 94  GLU A OE2  5  
ATOM 10306 H H    . GLU A 1 94  ? 37.376  -14.858 27.793  1.00 0.00 ? 94  GLU A H    5  
ATOM 10307 H HA   . GLU A 1 94  ? 34.743  -15.343 26.568  1.00 0.00 ? 94  GLU A HA   5  
ATOM 10308 H HB2  . GLU A 1 94  ? 35.438  -14.398 24.510  1.00 0.00 ? 94  GLU A HB2  5  
ATOM 10309 H HB3  . GLU A 1 94  ? 35.896  -13.241 25.751  1.00 0.00 ? 94  GLU A HB3  5  
ATOM 10310 H HG2  . GLU A 1 94  ? 38.157  -14.693 25.598  1.00 0.00 ? 94  GLU A HG2  5  
ATOM 10311 H HG3  . GLU A 1 94  ? 37.571  -14.843 23.943  1.00 0.00 ? 94  GLU A HG3  5  
ATOM 10312 N N    . LYS A 1 95  ? 35.448  -17.492 25.534  1.00 0.00 ? 95  LYS A N    5  
ATOM 10313 C CA   . LYS A 1 95  ? 35.828  -18.825 25.084  1.00 0.00 ? 95  LYS A CA   5  
ATOM 10314 C C    . LYS A 1 95  ? 34.860  -19.339 24.023  1.00 0.00 ? 95  LYS A C    5  
ATOM 10315 O O    . LYS A 1 95  ? 33.707  -19.650 24.320  1.00 0.00 ? 95  LYS A O    5  
ATOM 10316 C CB   . LYS A 1 95  ? 35.865  -19.794 26.268  1.00 0.00 ? 95  LYS A CB   5  
ATOM 10317 C CG   . LYS A 1 95  ? 37.050  -19.580 27.193  1.00 0.00 ? 95  LYS A CG   5  
ATOM 10318 C CD   . LYS A 1 95  ? 38.369  -19.789 26.468  1.00 0.00 ? 95  LYS A CD   5  
ATOM 10319 C CE   . LYS A 1 95  ? 39.529  -19.912 27.445  1.00 0.00 ? 95  LYS A CE   5  
ATOM 10320 N NZ   . LYS A 1 95  ? 40.022  -21.313 27.547  1.00 0.00 ? 95  LYS A NZ   5  
ATOM 10321 H H    . LYS A 1 95  ? 34.505  -17.226 25.498  1.00 0.00 ? 95  LYS A H    5  
ATOM 10322 H HA   . LYS A 1 95  ? 36.815  -18.761 24.652  1.00 0.00 ? 95  LYS A HA   5  
ATOM 10323 H HB2  . LYS A 1 95  ? 34.959  -19.675 26.844  1.00 0.00 ? 95  LYS A HB2  5  
ATOM 10324 H HB3  . LYS A 1 95  ? 35.910  -20.805 25.889  1.00 0.00 ? 95  LYS A HB3  5  
ATOM 10325 H HG2  . LYS A 1 95  ? 37.019  -18.570 27.576  1.00 0.00 ? 95  LYS A HG2  5  
ATOM 10326 H HG3  . LYS A 1 95  ? 36.986  -20.280 28.014  1.00 0.00 ? 95  LYS A HG3  5  
ATOM 10327 H HD2  . LYS A 1 95  ? 38.308  -20.695 25.883  1.00 0.00 ? 95  LYS A HD2  5  
ATOM 10328 H HD3  . LYS A 1 95  ? 38.548  -18.948 25.814  1.00 0.00 ? 95  LYS A HD3  5  
ATOM 10329 H HE2  . LYS A 1 95  ? 40.335  -19.280 27.106  1.00 0.00 ? 95  LYS A HE2  5  
ATOM 10330 H HE3  . LYS A 1 95  ? 39.198  -19.583 28.419  1.00 0.00 ? 95  LYS A HE3  5  
ATOM 10331 H HZ1  . LYS A 1 95  ? 39.839  -21.687 28.501  1.00 0.00 ? 95  LYS A HZ1  5  
ATOM 10332 H HZ2  . LYS A 1 95  ? 41.045  -21.347 27.365  1.00 0.00 ? 95  LYS A HZ2  5  
ATOM 10333 H HZ3  . LYS A 1 95  ? 39.536  -21.915 26.852  1.00 0.00 ? 95  LYS A HZ3  5  
ATOM 10334 N N    . VAL A 1 96  ? 35.337  -19.425 22.785  1.00 0.00 ? 96  VAL A N    5  
ATOM 10335 C CA   . VAL A 1 96  ? 34.514  -19.903 21.681  1.00 0.00 ? 96  VAL A CA   5  
ATOM 10336 C C    . VAL A 1 96  ? 34.270  -21.404 21.787  1.00 0.00 ? 96  VAL A C    5  
ATOM 10337 O O    . VAL A 1 96  ? 35.141  -22.156 22.222  1.00 0.00 ? 96  VAL A O    5  
ATOM 10338 C CB   . VAL A 1 96  ? 35.167  -19.595 20.320  1.00 0.00 ? 96  VAL A CB   5  
ATOM 10339 C CG1  . VAL A 1 96  ? 36.589  -20.132 20.277  1.00 0.00 ? 96  VAL A CG1  5  
ATOM 10340 C CG2  . VAL A 1 96  ? 34.335  -20.176 19.187  1.00 0.00 ? 96  VAL A CG2  5  
ATOM 10341 H H    . VAL A 1 96  ? 36.264  -19.162 22.611  1.00 0.00 ? 96  VAL A H    5  
ATOM 10342 H HA   . VAL A 1 96  ? 33.564  -19.390 21.725  1.00 0.00 ? 96  VAL A HA   5  
ATOM 10343 H HB   . VAL A 1 96  ? 35.206  -18.523 20.197  1.00 0.00 ? 96  VAL A HB   5  
ATOM 10344 H HG11 . VAL A 1 96  ? 37.272  -19.324 20.061  1.00 0.00 ? 96  VAL A HG11 5  
ATOM 10345 H HG12 . VAL A 1 96  ? 36.839  -20.570 21.233  1.00 0.00 ? 96  VAL A HG12 5  
ATOM 10346 H HG13 . VAL A 1 96  ? 36.667  -20.884 19.505  1.00 0.00 ? 96  VAL A HG13 5  
ATOM 10347 H HG21 . VAL A 1 96  ? 33.326  -19.795 19.250  1.00 0.00 ? 96  VAL A HG21 5  
ATOM 10348 H HG22 . VAL A 1 96  ? 34.768  -19.891 18.239  1.00 0.00 ? 96  VAL A HG22 5  
ATOM 10349 H HG23 . VAL A 1 96  ? 34.319  -21.253 19.266  1.00 0.00 ? 96  VAL A HG23 5  
ATOM 10350 N N    . GLY A 1 97  ? 33.077  -21.834 21.386  1.00 0.00 ? 97  GLY A N    5  
ATOM 10351 C CA   . GLY A 1 97  ? 32.739  -23.244 21.444  1.00 0.00 ? 97  GLY A CA   5  
ATOM 10352 C C    . GLY A 1 97  ? 32.292  -23.677 22.826  1.00 0.00 ? 97  GLY A C    5  
ATOM 10353 O O    . GLY A 1 97  ? 31.959  -24.843 23.041  1.00 0.00 ? 97  GLY A O    5  
ATOM 10354 H H    . GLY A 1 97  ? 32.421  -21.189 21.048  1.00 0.00 ? 97  GLY A H    5  
ATOM 10355 H HA2  . GLY A 1 97  ? 31.943  -23.442 20.741  1.00 0.00 ? 97  GLY A HA2  5  
ATOM 10356 H HA3  . GLY A 1 97  ? 33.607  -23.823 21.161  1.00 0.00 ? 97  GLY A HA3  5  
ATOM 10357 N N    . ARG A 1 98  ? 32.285  -22.737 23.765  1.00 0.00 ? 98  ARG A N    5  
ATOM 10358 C CA   . ARG A 1 98  ? 31.878  -23.029 25.135  1.00 0.00 ? 98  ARG A CA   5  
ATOM 10359 C C    . ARG A 1 98  ? 30.427  -22.619 25.369  1.00 0.00 ? 98  ARG A C    5  
ATOM 10360 O O    . ARG A 1 98  ? 29.981  -21.576 24.891  1.00 0.00 ? 98  ARG A O    5  
ATOM 10361 C CB   . ARG A 1 98  ? 32.790  -22.304 26.125  1.00 0.00 ? 98  ARG A CB   5  
ATOM 10362 C CG   . ARG A 1 98  ? 32.181  -22.143 27.509  1.00 0.00 ? 98  ARG A CG   5  
ATOM 10363 C CD   . ARG A 1 98  ? 31.923  -23.490 28.164  1.00 0.00 ? 98  ARG A CD   5  
ATOM 10364 N NE   . ARG A 1 98  ? 32.541  -23.585 29.484  1.00 0.00 ? 98  ARG A NE   5  
ATOM 10365 C CZ   . ARG A 1 98  ? 33.825  -23.865 29.675  1.00 0.00 ? 98  ARG A CZ   5  
ATOM 10366 N NH1  . ARG A 1 98  ? 34.623  -24.076 28.638  1.00 0.00 ? 98  ARG A NH1  5  
ATOM 10367 N NH2  . ARG A 1 98  ? 34.313  -23.934 30.907  1.00 0.00 ? 98  ARG A NH2  5  
ATOM 10368 H H    . ARG A 1 98  ? 32.560  -21.826 23.532  1.00 0.00 ? 98  ARG A H    5  
ATOM 10369 H HA   . ARG A 1 98  ? 31.968  -24.093 25.288  1.00 0.00 ? 98  ARG A HA   5  
ATOM 10370 H HB2  . ARG A 1 98  ? 33.710  -22.861 26.224  1.00 0.00 ? 98  ARG A HB2  5  
ATOM 10371 H HB3  . ARG A 1 98  ? 33.014  -21.321 25.738  1.00 0.00 ? 98  ARG A HB3  5  
ATOM 10372 H HG2  . ARG A 1 98  ? 32.863  -21.579 28.129  1.00 0.00 ? 98  ARG A HG2  5  
ATOM 10373 H HG3  . ARG A 1 98  ? 31.246  -21.609 27.420  1.00 0.00 ? 98  ARG A HG3  5  
ATOM 10374 H HD2  . ARG A 1 98  ? 30.856  -23.628 28.266  1.00 0.00 ? 98  ARG A HD2  5  
ATOM 10375 H HD3  . ARG A 1 98  ? 32.326  -24.266 27.531  1.00 0.00 ? 98  ARG A HD3  5  
ATOM 10376 H HE   . ARG A 1 98  ? 31.969  -23.433 30.264  1.00 0.00 ? 98  ARG A HE   5  
ATOM 10377 H HH11 . ARG A 1 98  ? 34.258  -24.024 27.708  1.00 0.00 ? 98  ARG A HH11 5  
ATOM 10378 H HH12 . ARG A 1 98  ? 35.590  -24.286 28.785  1.00 0.00 ? 98  ARG A HH12 5  
ATOM 10379 H HH21 . ARG A 1 98  ? 33.715  -23.775 31.692  1.00 0.00 ? 98  ARG A HH21 5  
ATOM 10380 H HH22 . ARG A 1 98  ? 35.280  -24.145 31.050  1.00 0.00 ? 98  ARG A HH22 5  
ATOM 10381 N N    . ILE A 1 99  ? 29.696  -23.447 26.107  1.00 0.00 ? 99  ILE A N    5  
ATOM 10382 C CA   . ILE A 1 99  ? 28.296  -23.171 26.406  1.00 0.00 ? 99  ILE A CA   5  
ATOM 10383 C C    . ILE A 1 99  ? 27.892  -23.768 27.750  1.00 0.00 ? 99  ILE A C    5  
ATOM 10384 O O    . ILE A 1 99  ? 28.316  -24.867 28.107  1.00 0.00 ? 99  ILE A O    5  
ATOM 10385 C CB   . ILE A 1 99  ? 27.367  -23.726 25.310  1.00 0.00 ? 99  ILE A CB   5  
ATOM 10386 C CG1  . ILE A 1 99  ? 27.465  -25.252 25.252  1.00 0.00 ? 99  ILE A CG1  5  
ATOM 10387 C CG2  . ILE A 1 99  ? 27.715  -23.115 23.961  1.00 0.00 ? 99  ILE A CG2  5  
ATOM 10388 C CD1  . ILE A 1 99  ? 26.357  -25.958 26.001  1.00 0.00 ? 99  ILE A CD1  5  
ATOM 10389 H H    . ILE A 1 99  ? 30.108  -24.263 26.460  1.00 0.00 ? 99  ILE A H    5  
ATOM 10390 H HA   . ILE A 1 99  ? 28.170  -22.099 26.447  1.00 0.00 ? 99  ILE A HA   5  
ATOM 10391 H HB   . ILE A 1 99  ? 26.353  -23.447 25.554  1.00 0.00 ? 99  ILE A HB   5  
ATOM 10392 H HG12 . ILE A 1 99  ? 27.424  -25.570 24.222  1.00 0.00 ? 99  ILE A HG12 5  
ATOM 10393 H HG13 . ILE A 1 99  ? 28.407  -25.561 25.682  1.00 0.00 ? 99  ILE A HG13 5  
ATOM 10394 H HG21 . ILE A 1 99  ? 27.037  -23.493 23.209  1.00 0.00 ? 99  ILE A HG21 5  
ATOM 10395 H HG22 . ILE A 1 99  ? 27.624  -22.041 24.018  1.00 0.00 ? 99  ILE A HG22 5  
ATOM 10396 H HG23 . ILE A 1 99  ? 28.728  -23.378 23.697  1.00 0.00 ? 99  ILE A HG23 5  
ATOM 10397 H HD11 . ILE A 1 99  ? 26.514  -25.849 27.064  1.00 0.00 ? 99  ILE A HD11 5  
ATOM 10398 H HD12 . ILE A 1 99  ? 25.406  -25.526 25.730  1.00 0.00 ? 99  ILE A HD12 5  
ATOM 10399 H HD13 . ILE A 1 99  ? 26.361  -27.008 25.744  1.00 0.00 ? 99  ILE A HD13 5  
ATOM 10400 N N    . THR A 1 100 ? 27.067  -23.036 28.492  1.00 0.00 ? 100 THR A N    5  
ATOM 10401 C CA   . THR A 1 100 ? 26.604  -23.492 29.796  1.00 0.00 ? 100 THR A CA   5  
ATOM 10402 C C    . THR A 1 100 ? 25.274  -24.228 29.681  1.00 0.00 ? 100 THR A C    5  
ATOM 10403 O O    . THR A 1 100 ? 24.720  -24.362 28.590  1.00 0.00 ? 100 THR A O    5  
ATOM 10404 C CB   . THR A 1 100 ? 26.444  -22.317 30.779  1.00 0.00 ? 100 THR A CB   5  
ATOM 10405 O OG1  . THR A 1 100 ? 25.945  -21.166 30.088  1.00 0.00 ? 100 THR A OG1  5  
ATOM 10406 C CG2  . THR A 1 100 ? 27.771  -21.981 31.442  1.00 0.00 ? 100 THR A CG2  5  
ATOM 10407 H H    . THR A 1 100 ? 26.763  -22.168 28.153  1.00 0.00 ? 100 THR A H    5  
ATOM 10408 H HA   . THR A 1 100 ? 27.346  -24.169 30.195  1.00 0.00 ? 100 THR A HA   5  
ATOM 10409 H HB   . THR A 1 100 ? 25.737  -22.601 31.545  1.00 0.00 ? 100 THR A HB   5  
ATOM 10410 H HG1  . THR A 1 100 ? 25.861  -20.434 30.704  1.00 0.00 ? 100 THR A HG1  5  
ATOM 10411 H HG21 . THR A 1 100 ? 27.933  -22.643 32.279  1.00 0.00 ? 100 THR A HG21 5  
ATOM 10412 H HG22 . THR A 1 100 ? 27.751  -20.959 31.789  1.00 0.00 ? 100 THR A HG22 5  
ATOM 10413 H HG23 . THR A 1 100 ? 28.571  -22.102 30.727  1.00 0.00 ? 100 THR A HG23 5  
ATOM 10414 N N    . TRP A 1 101 ? 24.767  -24.703 30.813  1.00 0.00 ? 101 TRP A N    5  
ATOM 10415 C CA   . TRP A 1 101 ? 23.500  -25.425 30.839  1.00 0.00 ? 101 TRP A CA   5  
ATOM 10416 C C    . TRP A 1 101 ? 22.326  -24.473 30.640  1.00 0.00 ? 101 TRP A C    5  
ATOM 10417 O O    . TRP A 1 101 ? 21.183  -24.906 30.491  1.00 0.00 ? 101 TRP A O    5  
ATOM 10418 C CB   . TRP A 1 101 ? 23.344  -26.177 32.162  1.00 0.00 ? 101 TRP A CB   5  
ATOM 10419 C CG   . TRP A 1 101 ? 22.130  -27.054 32.207  1.00 0.00 ? 101 TRP A CG   5  
ATOM 10420 C CD1  . TRP A 1 101 ? 21.038  -26.901 33.014  1.00 0.00 ? 101 TRP A CD1  5  
ATOM 10421 C CD2  . TRP A 1 101 ? 21.885  -28.221 31.414  1.00 0.00 ? 101 TRP A CD2  5  
ATOM 10422 N NE1  . TRP A 1 101 ? 20.130  -27.903 32.770  1.00 0.00 ? 101 TRP A NE1  5  
ATOM 10423 C CE2  . TRP A 1 101 ? 20.625  -28.725 31.792  1.00 0.00 ? 101 TRP A CE2  5  
ATOM 10424 C CE3  . TRP A 1 101 ? 22.606  -28.888 30.420  1.00 0.00 ? 101 TRP A CE3  5  
ATOM 10425 C CZ2  . TRP A 1 101 ? 20.074  -29.864 31.212  1.00 0.00 ? 101 TRP A CZ2  5  
ATOM 10426 C CZ3  . TRP A 1 101 ? 22.059  -30.018 29.845  1.00 0.00 ? 101 TRP A CZ3  5  
ATOM 10427 C CH2  . TRP A 1 101 ? 20.803  -30.497 30.241  1.00 0.00 ? 101 TRP A CH2  5  
ATOM 10428 H H    . TRP A 1 101 ? 25.255  -24.565 31.652  1.00 0.00 ? 101 TRP A H    5  
ATOM 10429 H HA   . TRP A 1 101 ? 23.510  -26.140 30.028  1.00 0.00 ? 101 TRP A HA   5  
ATOM 10430 H HB2  . TRP A 1 101 ? 24.212  -26.800 32.319  1.00 0.00 ? 101 TRP A HB2  5  
ATOM 10431 H HB3  . TRP A 1 101 ? 23.270  -25.461 32.967  1.00 0.00 ? 101 TRP A HB3  5  
ATOM 10432 H HD1  . TRP A 1 101 ? 20.921  -26.106 33.734  1.00 0.00 ? 101 TRP A HD1  5  
ATOM 10433 H HE1  . TRP A 1 101 ? 19.266  -28.010 33.222  1.00 0.00 ? 101 TRP A HE1  5  
ATOM 10434 H HE3  . TRP A 1 101 ? 23.576  -28.534 30.102  1.00 0.00 ? 101 TRP A HE3  5  
ATOM 10435 H HZ2  . TRP A 1 101 ? 19.107  -30.245 31.505  1.00 0.00 ? 101 TRP A HZ2  5  
ATOM 10436 H HZ3  . TRP A 1 101 ? 22.602  -30.547 29.076  1.00 0.00 ? 101 TRP A HZ3  5  
ATOM 10437 H HH2  . TRP A 1 101 ? 20.414  -31.384 29.765  1.00 0.00 ? 101 TRP A HH2  5  
ATOM 10438 N N    . GLU A 1 102 ? 22.616  -23.176 30.637  1.00 0.00 ? 102 GLU A N    5  
ATOM 10439 C CA   . GLU A 1 102 ? 21.582  -22.163 30.457  1.00 0.00 ? 102 GLU A CA   5  
ATOM 10440 C C    . GLU A 1 102 ? 21.385  -21.844 28.977  1.00 0.00 ? 102 GLU A C    5  
ATOM 10441 O O    . GLU A 1 102 ? 20.258  -21.811 28.484  1.00 0.00 ? 102 GLU A O    5  
ATOM 10442 C CB   . GLU A 1 102 ? 21.946  -20.889 31.221  1.00 0.00 ? 102 GLU A CB   5  
ATOM 10443 C CG   . GLU A 1 102 ? 21.158  -19.667 30.778  1.00 0.00 ? 102 GLU A CG   5  
ATOM 10444 C CD   . GLU A 1 102 ? 19.693  -19.976 30.534  1.00 0.00 ? 102 GLU A CD   5  
ATOM 10445 O OE1  . GLU A 1 102 ? 19.133  -20.815 31.270  1.00 0.00 ? 102 GLU A OE1  5  
ATOM 10446 O OE2  . GLU A 1 102 ? 19.107  -19.379 29.607  1.00 0.00 ? 102 GLU A OE2  5  
ATOM 10447 H H    . GLU A 1 102 ? 23.546  -22.893 30.760  1.00 0.00 ? 102 GLU A H    5  
ATOM 10448 H HA   . GLU A 1 102 ? 20.659  -22.558 30.853  1.00 0.00 ? 102 GLU A HA   5  
ATOM 10449 H HB2  . GLU A 1 102 ? 21.763  -21.049 32.273  1.00 0.00 ? 102 GLU A HB2  5  
ATOM 10450 H HB3  . GLU A 1 102 ? 22.997  -20.684 31.075  1.00 0.00 ? 102 GLU A HB3  5  
ATOM 10451 H HG2  . GLU A 1 102 ? 21.227  -18.912 31.547  1.00 0.00 ? 102 GLU A HG2  5  
ATOM 10452 H HG3  . GLU A 1 102 ? 21.588  -19.288 29.863  1.00 0.00 ? 102 GLU A HG3  5  
ATOM 10453 N N    . GLN A 1 103 ? 22.490  -21.610 28.277  1.00 0.00 ? 103 GLN A N    5  
ATOM 10454 C CA   . GLN A 1 103 ? 22.439  -21.292 26.855  1.00 0.00 ? 103 GLN A CA   5  
ATOM 10455 C C    . GLN A 1 103 ? 21.705  -22.381 26.079  1.00 0.00 ? 103 GLN A C    5  
ATOM 10456 O O    . GLN A 1 103 ? 20.850  -22.093 25.243  1.00 0.00 ? 103 GLN A O    5  
ATOM 10457 C CB   . GLN A 1 103 ? 23.853  -21.118 26.298  1.00 0.00 ? 103 GLN A CB   5  
ATOM 10458 C CG   . GLN A 1 103 ? 24.728  -20.199 27.137  1.00 0.00 ? 103 GLN A CG   5  
ATOM 10459 C CD   . GLN A 1 103 ? 24.037  -18.898 27.490  1.00 0.00 ? 103 GLN A CD   5  
ATOM 10460 O OE1  . GLN A 1 103 ? 24.091  -18.443 28.633  1.00 0.00 ? 103 GLN A OE1  5  
ATOM 10461 N NE2  . GLN A 1 103 ? 23.381  -18.289 26.509  1.00 0.00 ? 103 GLN A NE2  5  
ATOM 10462 H H    . GLN A 1 103 ? 23.359  -21.651 28.726  1.00 0.00 ? 103 GLN A H    5  
ATOM 10463 H HA   . GLN A 1 103 ? 21.901  -20.363 26.742  1.00 0.00 ? 103 GLN A HA   5  
ATOM 10464 H HB2  . GLN A 1 103 ? 24.329  -22.086 26.248  1.00 0.00 ? 103 GLN A HB2  5  
ATOM 10465 H HB3  . GLN A 1 103 ? 23.787  -20.705 25.302  1.00 0.00 ? 103 GLN A HB3  5  
ATOM 10466 H HG2  . GLN A 1 103 ? 24.990  -20.710 28.052  1.00 0.00 ? 103 GLN A HG2  5  
ATOM 10467 H HG3  . GLN A 1 103 ? 25.626  -19.974 26.581  1.00 0.00 ? 103 GLN A HG3  5  
ATOM 10468 H HE21 . GLN A 1 103 ? 23.380  -18.710 25.623  1.00 0.00 ? 103 GLN A HE21 5  
ATOM 10469 H HE22 . GLN A 1 103 ? 22.925  -17.447 26.709  1.00 0.00 ? 103 GLN A HE22 5  
ATOM 10470 N N    . VAL A 1 104 ? 22.046  -23.634 26.363  1.00 0.00 ? 104 VAL A N    5  
ATOM 10471 C CA   . VAL A 1 104 ? 21.420  -24.767 25.693  1.00 0.00 ? 104 VAL A CA   5  
ATOM 10472 C C    . VAL A 1 104 ? 19.900  -24.650 25.720  1.00 0.00 ? 104 VAL A C    5  
ATOM 10473 O O    . VAL A 1 104 ? 19.230  -24.885 24.713  1.00 0.00 ? 104 VAL A O    5  
ATOM 10474 C CB   . VAL A 1 104 ? 21.832  -26.102 26.342  1.00 0.00 ? 104 VAL A CB   5  
ATOM 10475 C CG1  . VAL A 1 104 ? 21.646  -26.042 27.850  1.00 0.00 ? 104 VAL A CG1  5  
ATOM 10476 C CG2  . VAL A 1 104 ? 21.038  -27.253 25.744  1.00 0.00 ? 104 VAL A CG2  5  
ATOM 10477 H H    . VAL A 1 104 ? 22.736  -23.800 27.039  1.00 0.00 ? 104 VAL A H    5  
ATOM 10478 H HA   . VAL A 1 104 ? 21.753  -24.773 24.665  1.00 0.00 ? 104 VAL A HA   5  
ATOM 10479 H HB   . VAL A 1 104 ? 22.880  -26.270 26.137  1.00 0.00 ? 104 VAL A HB   5  
ATOM 10480 H HG11 . VAL A 1 104 ? 22.148  -25.168 28.240  1.00 0.00 ? 104 VAL A HG11 5  
ATOM 10481 H HG12 . VAL A 1 104 ? 20.593  -25.987 28.082  1.00 0.00 ? 104 VAL A HG12 5  
ATOM 10482 H HG13 . VAL A 1 104 ? 22.068  -26.928 28.300  1.00 0.00 ? 104 VAL A HG13 5  
ATOM 10483 H HG21 . VAL A 1 104 ? 19.991  -27.123 25.972  1.00 0.00 ? 104 VAL A HG21 5  
ATOM 10484 H HG22 . VAL A 1 104 ? 21.174  -27.266 24.672  1.00 0.00 ? 104 VAL A HG22 5  
ATOM 10485 H HG23 . VAL A 1 104 ? 21.385  -28.186 26.162  1.00 0.00 ? 104 VAL A HG23 5  
ATOM 10486 N N    . LEU A 1 105 ? 19.361  -24.285 26.878  1.00 0.00 ? 105 LEU A N    5  
ATOM 10487 C CA   . LEU A 1 105 ? 17.919  -24.135 27.037  1.00 0.00 ? 105 LEU A CA   5  
ATOM 10488 C C    . LEU A 1 105 ? 17.386  -23.014 26.150  1.00 0.00 ? 105 LEU A C    5  
ATOM 10489 O O    . LEU A 1 105 ? 16.312  -23.133 25.562  1.00 0.00 ? 105 LEU A O    5  
ATOM 10490 C CB   . LEU A 1 105 ? 17.574  -23.851 28.500  1.00 0.00 ? 105 LEU A CB   5  
ATOM 10491 C CG   . LEU A 1 105 ? 18.063  -24.883 29.518  1.00 0.00 ? 105 LEU A CG   5  
ATOM 10492 C CD1  . LEU A 1 105 ? 17.734  -24.434 30.933  1.00 0.00 ? 105 LEU A CD1  5  
ATOM 10493 C CD2  . LEU A 1 105 ? 17.448  -26.245 29.232  1.00 0.00 ? 105 LEU A CD2  5  
ATOM 10494 H H    . LEU A 1 105 ? 19.946  -24.112 27.644  1.00 0.00 ? 105 LEU A H    5  
ATOM 10495 H HA   . LEU A 1 105 ? 17.455  -25.064 26.741  1.00 0.00 ? 105 LEU A HA   5  
ATOM 10496 H HB2  . LEU A 1 105 ? 18.007  -22.898 28.762  1.00 0.00 ? 105 LEU A HB2  5  
ATOM 10497 H HB3  . LEU A 1 105 ? 16.498  -23.790 28.580  1.00 0.00 ? 105 LEU A HB3  5  
ATOM 10498 H HG   . LEU A 1 105 ? 19.137  -24.976 29.439  1.00 0.00 ? 105 LEU A HG   5  
ATOM 10499 H HD11 . LEU A 1 105 ? 16.715  -24.078 30.970  1.00 0.00 ? 105 LEU A HD11 5  
ATOM 10500 H HD12 . LEU A 1 105 ? 18.404  -23.638 31.223  1.00 0.00 ? 105 LEU A HD12 5  
ATOM 10501 H HD13 . LEU A 1 105 ? 17.850  -25.267 31.611  1.00 0.00 ? 105 LEU A HD13 5  
ATOM 10502 H HD21 . LEU A 1 105 ? 17.834  -26.968 29.936  1.00 0.00 ? 105 LEU A HD21 5  
ATOM 10503 H HD22 . LEU A 1 105 ? 17.702  -26.551 28.227  1.00 0.00 ? 105 LEU A HD22 5  
ATOM 10504 H HD23 . LEU A 1 105 ? 16.375  -26.184 29.330  1.00 0.00 ? 105 LEU A HD23 5  
ATOM 10505 N N    . GLU A 1 106 ? 18.147  -21.928 26.058  1.00 0.00 ? 106 GLU A N    5  
ATOM 10506 C CA   . GLU A 1 106 ? 17.751  -20.787 25.241  1.00 0.00 ? 106 GLU A CA   5  
ATOM 10507 C C    . GLU A 1 106 ? 17.418  -21.226 23.818  1.00 0.00 ? 106 GLU A C    5  
ATOM 10508 O O    . GLU A 1 106 ? 16.599  -20.604 23.141  1.00 0.00 ? 106 GLU A O    5  
ATOM 10509 C CB   . GLU A 1 106 ? 18.865  -19.738 25.216  1.00 0.00 ? 106 GLU A CB   5  
ATOM 10510 C CG   . GLU A 1 106 ? 19.293  -19.271 26.597  1.00 0.00 ? 106 GLU A CG   5  
ATOM 10511 C CD   . GLU A 1 106 ? 18.443  -18.128 27.115  1.00 0.00 ? 106 GLU A CD   5  
ATOM 10512 O OE1  . GLU A 1 106 ? 17.385  -18.400 27.718  1.00 0.00 ? 106 GLU A OE1  5  
ATOM 10513 O OE2  . GLU A 1 106 ? 18.838  -16.959 26.918  1.00 0.00 ? 106 GLU A OE2  5  
ATOM 10514 H H    . GLU A 1 106 ? 18.993  -21.893 26.551  1.00 0.00 ? 106 GLU A H    5  
ATOM 10515 H HA   . GLU A 1 106 ? 16.869  -20.350 25.686  1.00 0.00 ? 106 GLU A HA   5  
ATOM 10516 H HB2  . GLU A 1 106 ? 19.727  -20.158 24.717  1.00 0.00 ? 106 GLU A HB2  5  
ATOM 10517 H HB3  . GLU A 1 106 ? 18.522  -18.879 24.659  1.00 0.00 ? 106 GLU A HB3  5  
ATOM 10518 H HG2  . GLU A 1 106 ? 19.212  -20.100 27.284  1.00 0.00 ? 106 GLU A HG2  5  
ATOM 10519 H HG3  . GLU A 1 106 ? 20.321  -18.944 26.550  1.00 0.00 ? 106 GLU A HG3  5  
ATOM 10520 N N    . ILE A 1 107 ? 18.060  -22.300 23.371  1.00 0.00 ? 107 ILE A N    5  
ATOM 10521 C CA   . ILE A 1 107 ? 17.832  -22.822 22.030  1.00 0.00 ? 107 ILE A CA   5  
ATOM 10522 C C    . ILE A 1 107 ? 16.913  -24.038 22.062  1.00 0.00 ? 107 ILE A C    5  
ATOM 10523 O O    . ILE A 1 107 ? 16.173  -24.296 21.113  1.00 0.00 ? 107 ILE A O    5  
ATOM 10524 C CB   . ILE A 1 107 ? 19.155  -23.210 21.344  1.00 0.00 ? 107 ILE A CB   5  
ATOM 10525 C CG1  . ILE A 1 107 ? 20.084  -21.998 21.256  1.00 0.00 ? 107 ILE A CG1  5  
ATOM 10526 C CG2  . ILE A 1 107 ? 18.887  -23.781 19.960  1.00 0.00 ? 107 ILE A CG2  5  
ATOM 10527 C CD1  . ILE A 1 107 ? 21.117  -21.946 22.360  1.00 0.00 ? 107 ILE A CD1  5  
ATOM 10528 H H    . ILE A 1 107 ? 18.701  -22.752 23.958  1.00 0.00 ? 107 ILE A H    5  
ATOM 10529 H HA   . ILE A 1 107 ? 17.361  -22.044 21.445  1.00 0.00 ? 107 ILE A HA   5  
ATOM 10530 H HB   . ILE A 1 107 ? 19.630  -23.977 21.937  1.00 0.00 ? 107 ILE A HB   5  
ATOM 10531 H HG12 . ILE A 1 107 ? 20.608  -22.021 20.314  1.00 0.00 ? 107 ILE A HG12 5  
ATOM 10532 H HG13 . ILE A 1 107 ? 19.492  -21.096 21.312  1.00 0.00 ? 107 ILE A HG13 5  
ATOM 10533 H HG21 . ILE A 1 107 ? 18.046  -23.269 19.516  1.00 0.00 ? 107 ILE A HG21 5  
ATOM 10534 H HG22 . ILE A 1 107 ? 19.760  -23.643 19.339  1.00 0.00 ? 107 ILE A HG22 5  
ATOM 10535 H HG23 . ILE A 1 107 ? 18.665  -24.834 20.041  1.00 0.00 ? 107 ILE A HG23 5  
ATOM 10536 H HD11 . ILE A 1 107 ? 22.107  -21.969 21.929  1.00 0.00 ? 107 ILE A HD11 5  
ATOM 10537 H HD12 . ILE A 1 107 ? 20.992  -21.037 22.929  1.00 0.00 ? 107 ILE A HD12 5  
ATOM 10538 H HD13 . ILE A 1 107 ? 20.990  -22.799 23.012  1.00 0.00 ? 107 ILE A HD13 5  
ATOM 10539 N N    . ALA A 1 108 ? 16.965  -24.783 23.162  1.00 0.00 ? 108 ALA A N    5  
ATOM 10540 C CA   . ALA A 1 108 ? 16.134  -25.970 23.320  1.00 0.00 ? 108 ALA A CA   5  
ATOM 10541 C C    . ALA A 1 108 ? 14.652  -25.617 23.252  1.00 0.00 ? 108 ALA A C    5  
ATOM 10542 O O    . ALA A 1 108 ? 13.846  -26.376 22.714  1.00 0.00 ? 108 ALA A O    5  
ATOM 10543 C CB   . ALA A 1 108 ? 16.453  -26.666 24.635  1.00 0.00 ? 108 ALA A CB   5  
ATOM 10544 H H    . ALA A 1 108 ? 17.575  -24.526 23.884  1.00 0.00 ? 108 ALA A H    5  
ATOM 10545 H HA   . ALA A 1 108 ? 16.369  -26.652 22.515  1.00 0.00 ? 108 ALA A HA   5  
ATOM 10546 H HB1  . ALA A 1 108 ? 17.498  -26.937 24.654  1.00 0.00 ? 108 ALA A HB1  5  
ATOM 10547 H HB2  . ALA A 1 108 ? 16.240  -25.998 25.457  1.00 0.00 ? 108 ALA A HB2  5  
ATOM 10548 H HB3  . ALA A 1 108 ? 15.848  -27.555 24.728  1.00 0.00 ? 108 ALA A HB3  5  
ATOM 10549 N N    . LYS A 1 109 ? 14.299  -24.460 23.801  1.00 0.00 ? 109 LYS A N    5  
ATOM 10550 C CA   . LYS A 1 109 ? 12.914  -24.005 23.803  1.00 0.00 ? 109 LYS A CA   5  
ATOM 10551 C C    . LYS A 1 109 ? 12.323  -24.054 22.397  1.00 0.00 ? 109 LYS A C    5  
ATOM 10552 O O    . LYS A 1 109 ? 11.363  -24.781 22.144  1.00 0.00 ? 109 LYS A O    5  
ATOM 10553 C CB   . LYS A 1 109 ? 12.824  -22.580 24.356  1.00 0.00 ? 109 LYS A CB   5  
ATOM 10554 C CG   . LYS A 1 109 ? 13.105  -22.487 25.845  1.00 0.00 ? 109 LYS A CG   5  
ATOM 10555 C CD   . LYS A 1 109 ? 13.806  -21.186 26.200  1.00 0.00 ? 109 LYS A CD   5  
ATOM 10556 C CE   . LYS A 1 109 ? 13.072  -20.442 27.306  1.00 0.00 ? 109 LYS A CE   5  
ATOM 10557 N NZ   . LYS A 1 109 ? 13.714  -19.134 27.614  1.00 0.00 ? 109 LYS A NZ   5  
ATOM 10558 H H    . LYS A 1 109 ? 14.987  -23.898 24.216  1.00 0.00 ? 109 LYS A H    5  
ATOM 10559 H HA   . LYS A 1 109 ? 12.348  -24.666 24.442  1.00 0.00 ? 109 LYS A HA   5  
ATOM 10560 H HB2  . LYS A 1 109 ? 13.539  -21.960 23.836  1.00 0.00 ? 109 LYS A HB2  5  
ATOM 10561 H HB3  . LYS A 1 109 ? 11.830  -22.199 24.174  1.00 0.00 ? 109 LYS A HB3  5  
ATOM 10562 H HG2  . LYS A 1 109 ? 12.170  -22.538 26.383  1.00 0.00 ? 109 LYS A HG2  5  
ATOM 10563 H HG3  . LYS A 1 109 ? 13.735  -23.316 26.136  1.00 0.00 ? 109 LYS A HG3  5  
ATOM 10564 H HD2  . LYS A 1 109 ? 14.808  -21.407 26.534  1.00 0.00 ? 109 LYS A HD2  5  
ATOM 10565 H HD3  . LYS A 1 109 ? 13.847  -20.558 25.321  1.00 0.00 ? 109 LYS A HD3  5  
ATOM 10566 H HE2  . LYS A 1 109 ? 12.055  -20.269 26.992  1.00 0.00 ? 109 LYS A HE2  5  
ATOM 10567 H HE3  . LYS A 1 109 ? 13.075  -21.054 28.196  1.00 0.00 ? 109 LYS A HE3  5  
ATOM 10568 H HZ1  . LYS A 1 109 ? 12.987  -18.423 27.832  1.00 0.00 ? 109 LYS A HZ1  5  
ATOM 10569 H HZ2  . LYS A 1 109 ? 14.269  -18.807 26.797  1.00 0.00 ? 109 LYS A HZ2  5  
ATOM 10570 H HZ3  . LYS A 1 109 ? 14.347  -19.231 28.433  1.00 0.00 ? 109 LYS A HZ3  5  
ATOM 10571 N N    . GLN A 1 110 ? 12.904  -23.278 21.489  1.00 0.00 ? 110 GLN A N    5  
ATOM 10572 C CA   . GLN A 1 110 ? 12.435  -23.235 20.109  1.00 0.00 ? 110 GLN A CA   5  
ATOM 10573 C C    . GLN A 1 110 ? 12.585  -24.597 19.440  1.00 0.00 ? 110 GLN A C    5  
ATOM 10574 O O    . GLN A 1 110 ? 11.941  -24.879 18.429  1.00 0.00 ? 110 GLN A O    5  
ATOM 10575 C CB   . GLN A 1 110 ? 13.207  -22.177 19.318  1.00 0.00 ? 110 GLN A CB   5  
ATOM 10576 C CG   . GLN A 1 110 ? 12.555  -20.805 19.340  1.00 0.00 ? 110 GLN A CG   5  
ATOM 10577 C CD   . GLN A 1 110 ? 12.920  -19.966 18.131  1.00 0.00 ? 110 GLN A CD   5  
ATOM 10578 O OE1  . GLN A 1 110 ? 12.047  -19.436 17.442  1.00 0.00 ? 110 GLN A OE1  5  
ATOM 10579 N NE2  . GLN A 1 110 ? 14.215  -19.841 17.866  1.00 0.00 ? 110 GLN A NE2  5  
ATOM 10580 H H    . GLN A 1 110 ? 13.666  -22.721 21.752  1.00 0.00 ? 110 GLN A H    5  
ATOM 10581 H HA   . GLN A 1 110 ? 11.389  -22.968 20.123  1.00 0.00 ? 110 GLN A HA   5  
ATOM 10582 H HB2  . GLN A 1 110 ? 14.200  -22.087 19.734  1.00 0.00 ? 110 GLN A HB2  5  
ATOM 10583 H HB3  . GLN A 1 110 ? 13.284  -22.499 18.290  1.00 0.00 ? 110 GLN A HB3  5  
ATOM 10584 H HG2  . GLN A 1 110 ? 11.482  -20.930 19.361  1.00 0.00 ? 110 GLN A HG2  5  
ATOM 10585 H HG3  . GLN A 1 110 ? 12.872  -20.284 20.231  1.00 0.00 ? 110 GLN A HG3  5  
ATOM 10586 H HE21 . GLN A 1 110 ? 14.853  -20.292 18.457  1.00 0.00 ? 110 GLN A HE21 5  
ATOM 10587 H HE22 . GLN A 1 110 ? 14.479  -19.305 17.090  1.00 0.00 ? 110 GLN A HE22 5  
ATOM 10588 N N    . LYS A 1 111 ? 13.440  -25.440 20.010  1.00 0.00 ? 111 LYS A N    5  
ATOM 10589 C CA   . LYS A 1 111 ? 13.675  -26.774 19.471  1.00 0.00 ? 111 LYS A CA   5  
ATOM 10590 C C    . LYS A 1 111 ? 12.762  -27.799 20.137  1.00 0.00 ? 111 LYS A C    5  
ATOM 10591 O O    . LYS A 1 111 ? 13.187  -28.909 20.453  1.00 0.00 ? 111 LYS A O    5  
ATOM 10592 C CB   . LYS A 1 111 ? 15.139  -27.175 19.667  1.00 0.00 ? 111 LYS A CB   5  
ATOM 10593 C CG   . LYS A 1 111 ? 15.743  -27.880 18.465  1.00 0.00 ? 111 LYS A CG   5  
ATOM 10594 C CD   . LYS A 1 111 ? 15.300  -29.331 18.389  1.00 0.00 ? 111 LYS A CD   5  
ATOM 10595 C CE   . LYS A 1 111 ? 14.066  -29.491 17.514  1.00 0.00 ? 111 LYS A CE   5  
ATOM 10596 N NZ   . LYS A 1 111 ? 14.417  -29.573 16.069  1.00 0.00 ? 111 LYS A NZ   5  
ATOM 10597 H H    . LYS A 1 111 ? 13.924  -25.157 20.815  1.00 0.00 ? 111 LYS A H    5  
ATOM 10598 H HA   . LYS A 1 111 ? 13.457  -26.748 18.414  1.00 0.00 ? 111 LYS A HA   5  
ATOM 10599 H HB2  . LYS A 1 111 ? 15.719  -26.287 19.867  1.00 0.00 ? 111 LYS A HB2  5  
ATOM 10600 H HB3  . LYS A 1 111 ? 15.207  -27.838 20.518  1.00 0.00 ? 111 LYS A HB3  5  
ATOM 10601 H HG2  . LYS A 1 111 ? 15.430  -27.371 17.566  1.00 0.00 ? 111 LYS A HG2  5  
ATOM 10602 H HG3  . LYS A 1 111 ? 16.821  -27.845 18.543  1.00 0.00 ? 111 LYS A HG3  5  
ATOM 10603 H HD2  . LYS A 1 111 ? 16.102  -29.922 17.972  1.00 0.00 ? 111 LYS A HD2  5  
ATOM 10604 H HD3  . LYS A 1 111 ? 15.072  -29.682 19.385  1.00 0.00 ? 111 LYS A HD3  5  
ATOM 10605 H HE2  . LYS A 1 111 ? 13.551  -30.395 17.802  1.00 0.00 ? 111 LYS A HE2  5  
ATOM 10606 H HE3  . LYS A 1 111 ? 13.417  -28.642 17.671  1.00 0.00 ? 111 LYS A HE3  5  
ATOM 10607 H HZ1  . LYS A 1 111 ? 14.790  -28.660 15.740  1.00 0.00 ? 111 LYS A HZ1  5  
ATOM 10608 H HZ2  . LYS A 1 111 ? 13.573  -29.811 15.509  1.00 0.00 ? 111 LYS A HZ2  5  
ATOM 10609 H HZ3  . LYS A 1 111 ? 15.139  -30.306 15.917  1.00 0.00 ? 111 LYS A HZ3  5  
ATOM 10610 N N    . MET A 1 112 ? 11.506  -27.418 20.345  1.00 0.00 ? 112 MET A N    5  
ATOM 10611 C CA   . MET A 1 112 ? 10.533  -28.306 20.970  1.00 0.00 ? 112 MET A CA   5  
ATOM 10612 C C    . MET A 1 112 ? 9.280   -28.433 20.109  1.00 0.00 ? 112 MET A C    5  
ATOM 10613 O O    . MET A 1 112 ? 8.159   -28.515 20.610  1.00 0.00 ? 112 MET A O    5  
ATOM 10614 C CB   . MET A 1 112 ? 10.159  -27.789 22.361  1.00 0.00 ? 112 MET A CB   5  
ATOM 10615 C CG   . MET A 1 112 ? 11.301  -27.857 23.361  1.00 0.00 ? 112 MET A CG   5  
ATOM 10616 S SD   . MET A 1 112 ? 10.950  -28.961 24.743  1.00 0.00 ? 112 MET A SD   5  
ATOM 10617 C CE   . MET A 1 112 ? 9.758   -27.988 25.659  1.00 0.00 ? 112 MET A CE   5  
ATOM 10618 H H    . MET A 1 112 ? 11.226  -26.520 20.071  1.00 0.00 ? 112 MET A H    5  
ATOM 10619 H HA   . MET A 1 112 ? 10.989  -29.280 21.068  1.00 0.00 ? 112 MET A HA   5  
ATOM 10620 H HB2  . MET A 1 112 ? 9.843   -26.760 22.277  1.00 0.00 ? 112 MET A HB2  5  
ATOM 10621 H HB3  . MET A 1 112 ? 9.339   -28.379 22.743  1.00 0.00 ? 112 MET A HB3  5  
ATOM 10622 H HG2  . MET A 1 112 ? 12.187  -28.210 22.854  1.00 0.00 ? 112 MET A HG2  5  
ATOM 10623 H HG3  . MET A 1 112 ? 11.482  -26.865 23.748  1.00 0.00 ? 112 MET A HG3  5  
ATOM 10624 H HE1  . MET A 1 112 ? 9.861   -26.947 25.392  1.00 0.00 ? 112 MET A HE1  5  
ATOM 10625 H HE2  . MET A 1 112 ? 8.759   -28.324 25.420  1.00 0.00 ? 112 MET A HE2  5  
ATOM 10626 H HE3  . MET A 1 112 ? 9.934   -28.108 26.718  1.00 0.00 ? 112 MET A HE3  5  
ATOM 10627 N N    . PRO A 1 113 ? 9.473   -28.451 18.781  1.00 0.00 ? 113 PRO A N    5  
ATOM 10628 C CA   . PRO A 1 113 ? 8.370   -28.569 17.823  1.00 0.00 ? 113 PRO A CA   5  
ATOM 10629 C C    . PRO A 1 113 ? 7.727   -29.951 17.846  1.00 0.00 ? 113 PRO A C    5  
ATOM 10630 O O    . PRO A 1 113 ? 6.503   -30.075 17.907  1.00 0.00 ? 113 PRO A O    5  
ATOM 10631 C CB   . PRO A 1 113 ? 9.046   -28.316 16.473  1.00 0.00 ? 113 PRO A CB   5  
ATOM 10632 C CG   . PRO A 1 113 ? 10.470  -28.700 16.684  1.00 0.00 ? 113 PRO A CG   5  
ATOM 10633 C CD   . PRO A 1 113 ? 10.783  -28.359 18.114  1.00 0.00 ? 113 PRO A CD   5  
ATOM 10634 H HA   . PRO A 1 113 ? 7.614   -27.817 17.995  1.00 0.00 ? 113 PRO A HA   5  
ATOM 10635 H HB2  . PRO A 1 113 ? 8.579   -28.929 15.714  1.00 0.00 ? 113 PRO A HB2  5  
ATOM 10636 H HB3  . PRO A 1 113 ? 8.953   -27.274 16.209  1.00 0.00 ? 113 PRO A HB3  5  
ATOM 10637 H HG2  . PRO A 1 113 ? 10.594  -29.759 16.515  1.00 0.00 ? 113 PRO A HG2  5  
ATOM 10638 H HG3  . PRO A 1 113 ? 11.104  -28.135 16.017  1.00 0.00 ? 113 PRO A HG3  5  
ATOM 10639 H HD2  . PRO A 1 113 ? 11.478  -29.073 18.529  1.00 0.00 ? 113 PRO A HD2  5  
ATOM 10640 H HD3  . PRO A 1 113 ? 11.181  -27.357 18.185  1.00 0.00 ? 113 PRO A HD3  5  
ATOM 10641 N N    . ASP A 1 114 ? 8.557   -30.986 17.799  1.00 0.00 ? 114 ASP A N    5  
ATOM 10642 C CA   . ASP A 1 114 ? 8.069   -32.360 17.817  1.00 0.00 ? 114 ASP A CA   5  
ATOM 10643 C C    . ASP A 1 114 ? 8.345   -33.018 19.166  1.00 0.00 ? 114 ASP A C    5  
ATOM 10644 O O    . ASP A 1 114 ? 7.641   -33.943 19.573  1.00 0.00 ? 114 ASP A O    5  
ATOM 10645 C CB   . ASP A 1 114 ? 8.722   -33.171 16.697  1.00 0.00 ? 114 ASP A CB   5  
ATOM 10646 C CG   . ASP A 1 114 ? 8.561   -34.665 16.894  1.00 0.00 ? 114 ASP A CG   5  
ATOM 10647 O OD1  . ASP A 1 114 ? 7.543   -35.219 16.428  1.00 0.00 ? 114 ASP A OD1  5  
ATOM 10648 O OD2  . ASP A 1 114 ? 9.453   -35.281 17.513  1.00 0.00 ? 114 ASP A OD2  5  
ATOM 10649 H H    . ASP A 1 114 ? 9.523   -30.823 17.752  1.00 0.00 ? 114 ASP A H    5  
ATOM 10650 H HA   . ASP A 1 114 ? 7.002   -32.335 17.655  1.00 0.00 ? 114 ASP A HA   5  
ATOM 10651 H HB2  . ASP A 1 114 ? 8.270   -32.900 15.754  1.00 0.00 ? 114 ASP A HB2  5  
ATOM 10652 H HB3  . ASP A 1 114 ? 9.777   -32.942 16.664  1.00 0.00 ? 114 ASP A HB3  5  
ATOM 10653 N N    . LEU A 1 115 ? 9.373   -32.535 19.854  1.00 0.00 ? 115 LEU A N    5  
ATOM 10654 C CA   . LEU A 1 115 ? 9.744   -33.077 21.157  1.00 0.00 ? 115 LEU A CA   5  
ATOM 10655 C C    . LEU A 1 115 ? 8.535   -33.134 22.086  1.00 0.00 ? 115 LEU A C    5  
ATOM 10656 O O    . LEU A 1 115 ? 7.885   -32.120 22.337  1.00 0.00 ? 115 LEU A O    5  
ATOM 10657 C CB   . LEU A 1 115 ? 10.848  -32.228 21.789  1.00 0.00 ? 115 LEU A CB   5  
ATOM 10658 C CG   . LEU A 1 115 ? 12.275  -32.750 21.621  1.00 0.00 ? 115 LEU A CG   5  
ATOM 10659 C CD1  . LEU A 1 115 ? 12.502  -33.972 22.497  1.00 0.00 ? 115 LEU A CD1  5  
ATOM 10660 C CD2  . LEU A 1 115 ? 12.556  -33.077 20.162  1.00 0.00 ? 115 LEU A CD2  5  
ATOM 10661 H H    . LEU A 1 115 ? 9.897   -31.798 19.478  1.00 0.00 ? 115 LEU A H    5  
ATOM 10662 H HA   . LEU A 1 115 ? 10.114  -34.080 21.005  1.00 0.00 ? 115 LEU A HA   5  
ATOM 10663 H HB2  . LEU A 1 115 ? 10.802  -31.244 21.347  1.00 0.00 ? 115 LEU A HB2  5  
ATOM 10664 H HB3  . LEU A 1 115 ? 10.643  -32.155 22.847  1.00 0.00 ? 115 LEU A HB3  5  
ATOM 10665 H HG   . LEU A 1 115 ? 12.971  -31.983 21.932  1.00 0.00 ? 115 LEU A HG   5  
ATOM 10666 H HD11 . LEU A 1 115 ? 13.124  -33.703 23.337  1.00 0.00 ? 115 LEU A HD11 5  
ATOM 10667 H HD12 . LEU A 1 115 ? 12.991  -34.743 21.919  1.00 0.00 ? 115 LEU A HD12 5  
ATOM 10668 H HD13 . LEU A 1 115 ? 11.552  -34.340 22.855  1.00 0.00 ? 115 LEU A HD13 5  
ATOM 10669 H HD21 . LEU A 1 115 ? 13.615  -32.993 19.972  1.00 0.00 ? 115 LEU A HD21 5  
ATOM 10670 H HD22 . LEU A 1 115 ? 12.020  -32.385 19.528  1.00 0.00 ? 115 LEU A HD22 5  
ATOM 10671 H HD23 . LEU A 1 115 ? 12.230  -34.085 19.950  1.00 0.00 ? 115 LEU A HD23 5  
ATOM 10672 N N    . ASN A 1 116 ? 8.243   -34.326 22.595  1.00 0.00 ? 116 ASN A N    5  
ATOM 10673 C CA   . ASN A 1 116 ? 7.114   -34.515 23.499  1.00 0.00 ? 116 ASN A CA   5  
ATOM 10674 C C    . ASN A 1 116 ? 7.498   -34.160 24.932  1.00 0.00 ? 116 ASN A C    5  
ATOM 10675 O O    . ASN A 1 116 ? 6.693   -34.292 25.854  1.00 0.00 ? 116 ASN A O    5  
ATOM 10676 C CB   . ASN A 1 116 ? 6.619   -35.962 23.435  1.00 0.00 ? 116 ASN A CB   5  
ATOM 10677 C CG   . ASN A 1 116 ? 7.725   -36.963 23.707  1.00 0.00 ? 116 ASN A CG   5  
ATOM 10678 O OD1  . ASN A 1 116 ? 8.460   -37.355 22.800  1.00 0.00 ? 116 ASN A OD1  5  
ATOM 10679 N ND2  . ASN A 1 116 ? 7.849   -37.382 24.961  1.00 0.00 ? 116 ASN A ND2  5  
ATOM 10680 H H    . ASN A 1 116 ? 8.799   -35.097 22.358  1.00 0.00 ? 116 ASN A H    5  
ATOM 10681 H HA   . ASN A 1 116 ? 6.319   -33.858 23.178  1.00 0.00 ? 116 ASN A HA   5  
ATOM 10682 H HB2  . ASN A 1 116 ? 5.843   -36.103 24.173  1.00 0.00 ? 116 ASN A HB2  5  
ATOM 10683 H HB3  . ASN A 1 116 ? 6.216   -36.155 22.452  1.00 0.00 ? 116 ASN A HB3  5  
ATOM 10684 H HD21 . ASN A 1 116 ? 7.228   -37.027 25.631  1.00 0.00 ? 116 ASN A HD21 5  
ATOM 10685 H HD22 . ASN A 1 116 ? 8.556   -38.029 25.164  1.00 0.00 ? 116 ASN A HD22 5  
ATOM 10686 N N    . THR A 1 117 ? 8.736   -33.708 25.112  1.00 0.00 ? 117 THR A N    5  
ATOM 10687 C CA   . THR A 1 117 ? 9.228   -33.335 26.432  1.00 0.00 ? 117 THR A CA   5  
ATOM 10688 C C    . THR A 1 117 ? 8.743   -31.944 26.826  1.00 0.00 ? 117 THR A C    5  
ATOM 10689 O O    . THR A 1 117 ? 9.410   -30.944 26.559  1.00 0.00 ? 117 THR A O    5  
ATOM 10690 C CB   . THR A 1 117 ? 10.767  -33.364 26.487  1.00 0.00 ? 117 THR A CB   5  
ATOM 10691 O OG1  . THR A 1 117 ? 11.307  -33.196 25.171  1.00 0.00 ? 117 THR A OG1  5  
ATOM 10692 C CG2  . THR A 1 117 ? 11.263  -34.674 27.081  1.00 0.00 ? 117 THR A CG2  5  
ATOM 10693 H H    . THR A 1 117 ? 9.331   -33.626 24.338  1.00 0.00 ? 117 THR A H    5  
ATOM 10694 H HA   . THR A 1 117 ? 8.850   -34.053 27.145  1.00 0.00 ? 117 THR A HA   5  
ATOM 10695 H HB   . THR A 1 117 ? 11.105  -32.551 27.113  1.00 0.00 ? 117 THR A HB   5  
ATOM 10696 H HG1  . THR A 1 117 ? 12.237  -33.435 25.174  1.00 0.00 ? 117 THR A HG1  5  
ATOM 10697 H HG21 . THR A 1 117 ? 10.947  -35.495 26.455  1.00 0.00 ? 117 THR A HG21 5  
ATOM 10698 H HG22 . THR A 1 117 ? 10.852  -34.798 28.072  1.00 0.00 ? 117 THR A HG22 5  
ATOM 10699 H HG23 . THR A 1 117 ? 12.341  -34.658 27.136  1.00 0.00 ? 117 THR A HG23 5  
ATOM 10700 N N    . THR A 1 118 ? 7.578   -31.887 27.464  1.00 0.00 ? 118 THR A N    5  
ATOM 10701 C CA   . THR A 1 118 ? 7.004   -30.619 27.895  1.00 0.00 ? 118 THR A CA   5  
ATOM 10702 C C    . THR A 1 118 ? 8.011   -29.804 28.698  1.00 0.00 ? 118 THR A C    5  
ATOM 10703 O O    . THR A 1 118 ? 7.978   -28.573 28.686  1.00 0.00 ? 118 THR A O    5  
ATOM 10704 C CB   . THR A 1 118 ? 5.740   -30.836 28.748  1.00 0.00 ? 118 THR A CB   5  
ATOM 10705 O OG1  . THR A 1 118 ? 6.060   -31.607 29.911  1.00 0.00 ? 118 THR A OG1  5  
ATOM 10706 C CG2  . THR A 1 118 ? 4.660   -31.544 27.945  1.00 0.00 ? 118 THR A CG2  5  
ATOM 10707 H H    . THR A 1 118 ? 7.094   -32.719 27.648  1.00 0.00 ? 118 THR A H    5  
ATOM 10708 H HA   . THR A 1 118 ? 6.726   -30.062 27.012  1.00 0.00 ? 118 THR A HA   5  
ATOM 10709 H HB   . THR A 1 118 ? 5.363   -29.871 29.057  1.00 0.00 ? 118 THR A HB   5  
ATOM 10710 H HG1  . THR A 1 118 ? 5.898   -31.082 30.698  1.00 0.00 ? 118 THR A HG1  5  
ATOM 10711 H HG21 . THR A 1 118 ? 3.689   -31.182 28.249  1.00 0.00 ? 118 THR A HG21 5  
ATOM 10712 H HG22 . THR A 1 118 ? 4.719   -32.608 28.121  1.00 0.00 ? 118 THR A HG22 5  
ATOM 10713 H HG23 . THR A 1 118 ? 4.805   -31.345 26.894  1.00 0.00 ? 118 THR A HG23 5  
ATOM 10714 N N    . ASP A 1 119 ? 8.906   -30.497 29.393  1.00 0.00 ? 119 ASP A N    5  
ATOM 10715 C CA   . ASP A 1 119 ? 9.925   -29.836 30.201  1.00 0.00 ? 119 ASP A CA   5  
ATOM 10716 C C    . ASP A 1 119 ? 11.123  -29.438 29.345  1.00 0.00 ? 119 ASP A C    5  
ATOM 10717 O O    . ASP A 1 119 ? 11.631  -30.239 28.558  1.00 0.00 ? 119 ASP A O    5  
ATOM 10718 C CB   . ASP A 1 119 ? 10.377  -30.753 31.339  1.00 0.00 ? 119 ASP A CB   5  
ATOM 10719 C CG   . ASP A 1 119 ? 9.743   -30.384 32.666  1.00 0.00 ? 119 ASP A CG   5  
ATOM 10720 O OD1  . ASP A 1 119 ? 9.601   -29.174 32.940  1.00 0.00 ? 119 ASP A OD1  5  
ATOM 10721 O OD2  . ASP A 1 119 ? 9.389   -31.306 33.430  1.00 0.00 ? 119 ASP A OD2  5  
ATOM 10722 H H    . ASP A 1 119 ? 8.881   -31.476 29.362  1.00 0.00 ? 119 ASP A H    5  
ATOM 10723 H HA   . ASP A 1 119 ? 9.487   -28.944 30.622  1.00 0.00 ? 119 ASP A HA   5  
ATOM 10724 H HB2  . ASP A 1 119 ? 10.106  -31.771 31.102  1.00 0.00 ? 119 ASP A HB2  5  
ATOM 10725 H HB3  . ASP A 1 119 ? 11.450  -30.685 31.441  1.00 0.00 ? 119 ASP A HB3  5  
ATOM 10726 N N    . LEU A 1 120 ? 11.570  -28.197 29.502  1.00 0.00 ? 120 LEU A N    5  
ATOM 10727 C CA   . LEU A 1 120 ? 12.709  -27.692 28.743  1.00 0.00 ? 120 LEU A CA   5  
ATOM 10728 C C    . LEU A 1 120 ? 14.004  -28.358 29.196  1.00 0.00 ? 120 LEU A C    5  
ATOM 10729 O O    . LEU A 1 120 ? 14.846  -28.721 28.375  1.00 0.00 ? 120 LEU A O    5  
ATOM 10730 C CB   . LEU A 1 120 ? 12.820  -26.175 28.901  1.00 0.00 ? 120 LEU A CB   5  
ATOM 10731 C CG   . LEU A 1 120 ? 12.879  -25.367 27.605  1.00 0.00 ? 120 LEU A CG   5  
ATOM 10732 C CD1  . LEU A 1 120 ? 13.946  -25.925 26.676  1.00 0.00 ? 120 LEU A CD1  5  
ATOM 10733 C CD2  . LEU A 1 120 ? 11.521  -25.361 26.917  1.00 0.00 ? 120 LEU A CD2  5  
ATOM 10734 H H    . LEU A 1 120 ? 11.125  -27.606 30.144  1.00 0.00 ? 120 LEU A H    5  
ATOM 10735 H HA   . LEU A 1 120 ? 12.543  -27.926 27.702  1.00 0.00 ? 120 LEU A HA   5  
ATOM 10736 H HB2  . LEU A 1 120 ? 11.962  -25.837 29.462  1.00 0.00 ? 120 LEU A HB2  5  
ATOM 10737 H HB3  . LEU A 1 120 ? 13.719  -25.967 29.464  1.00 0.00 ? 120 LEU A HB3  5  
ATOM 10738 H HG   . LEU A 1 120 ? 13.142  -24.344 27.837  1.00 0.00 ? 120 LEU A HG   5  
ATOM 10739 H HD11 . LEU A 1 120 ? 14.532  -26.663 27.203  1.00 0.00 ? 120 LEU A HD11 5  
ATOM 10740 H HD12 . LEU A 1 120 ? 14.590  -25.124 26.345  1.00 0.00 ? 120 LEU A HD12 5  
ATOM 10741 H HD13 . LEU A 1 120 ? 13.474  -26.384 25.820  1.00 0.00 ? 120 LEU A HD13 5  
ATOM 10742 H HD21 . LEU A 1 120 ? 11.520  -26.089 26.119  1.00 0.00 ? 120 LEU A HD21 5  
ATOM 10743 H HD22 . LEU A 1 120 ? 11.329  -24.380 26.509  1.00 0.00 ? 120 LEU A HD22 5  
ATOM 10744 H HD23 . LEU A 1 120 ? 10.754  -25.611 27.634  1.00 0.00 ? 120 LEU A HD23 5  
ATOM 10745 N N    . GLU A 1 121 ? 14.155  -28.517 30.507  1.00 0.00 ? 121 GLU A N    5  
ATOM 10746 C CA   . GLU A 1 121 ? 15.348  -29.142 31.068  1.00 0.00 ? 121 GLU A CA   5  
ATOM 10747 C C    . GLU A 1 121 ? 15.451  -30.602 30.637  1.00 0.00 ? 121 GLU A C    5  
ATOM 10748 O O    . GLU A 1 121 ? 16.544  -31.109 30.385  1.00 0.00 ? 121 GLU A O    5  
ATOM 10749 C CB   . GLU A 1 121 ? 15.328  -29.049 32.595  1.00 0.00 ? 121 GLU A CB   5  
ATOM 10750 C CG   . GLU A 1 121 ? 13.986  -29.410 33.209  1.00 0.00 ? 121 GLU A CG   5  
ATOM 10751 C CD   . GLU A 1 121 ? 14.127  -30.155 34.523  1.00 0.00 ? 121 GLU A CD   5  
ATOM 10752 O OE1  . GLU A 1 121 ? 14.980  -31.064 34.601  1.00 0.00 ? 121 GLU A OE1  5  
ATOM 10753 O OE2  . GLU A 1 121 ? 13.385  -29.828 35.472  1.00 0.00 ? 121 GLU A OE2  5  
ATOM 10754 H H    . GLU A 1 121 ? 13.448  -28.207 31.111  1.00 0.00 ? 121 GLU A H    5  
ATOM 10755 H HA   . GLU A 1 121 ? 16.208  -28.607 30.695  1.00 0.00 ? 121 GLU A HA   5  
ATOM 10756 H HB2  . GLU A 1 121 ? 16.076  -29.719 32.994  1.00 0.00 ? 121 GLU A HB2  5  
ATOM 10757 H HB3  . GLU A 1 121 ? 15.573  -28.038 32.885  1.00 0.00 ? 121 GLU A HB3  5  
ATOM 10758 H HG2  . GLU A 1 121 ? 13.430  -28.502 33.387  1.00 0.00 ? 121 GLU A HG2  5  
ATOM 10759 H HG3  . GLU A 1 121 ? 13.443  -30.034 32.515  1.00 0.00 ? 121 GLU A HG3  5  
ATOM 10760 N N    . ALA A 1 122 ? 14.306  -31.271 30.554  1.00 0.00 ? 122 ALA A N    5  
ATOM 10761 C CA   . ALA A 1 122 ? 14.267  -32.672 30.153  1.00 0.00 ? 122 ALA A CA   5  
ATOM 10762 C C    . ALA A 1 122 ? 14.570  -32.825 28.666  1.00 0.00 ? 122 ALA A C    5  
ATOM 10763 O O    . ALA A 1 122 ? 15.026  -33.878 28.221  1.00 0.00 ? 122 ALA A O    5  
ATOM 10764 C CB   . ALA A 1 122 ? 12.911  -33.278 30.483  1.00 0.00 ? 122 ALA A CB   5  
ATOM 10765 H H    . ALA A 1 122 ? 13.468  -30.811 30.768  1.00 0.00 ? 122 ALA A H    5  
ATOM 10766 H HA   . ALA A 1 122 ? 15.019  -33.202 30.719  1.00 0.00 ? 122 ALA A HA   5  
ATOM 10767 H HB1  . ALA A 1 122 ? 13.028  -34.015 31.263  1.00 0.00 ? 122 ALA A HB1  5  
ATOM 10768 H HB2  . ALA A 1 122 ? 12.242  -32.500 30.818  1.00 0.00 ? 122 ALA A HB2  5  
ATOM 10769 H HB3  . ALA A 1 122 ? 12.503  -33.748 29.601  1.00 0.00 ? 122 ALA A HB3  5  
ATOM 10770 N N    . ALA A 1 123 ? 14.312  -31.768 27.902  1.00 0.00 ? 123 ALA A N    5  
ATOM 10771 C CA   . ALA A 1 123 ? 14.558  -31.786 26.466  1.00 0.00 ? 123 ALA A CA   5  
ATOM 10772 C C    . ALA A 1 123 ? 15.994  -31.381 26.150  1.00 0.00 ? 123 ALA A C    5  
ATOM 10773 O O    . ALA A 1 123 ? 16.577  -31.840 25.168  1.00 0.00 ? 123 ALA A O    5  
ATOM 10774 C CB   . ALA A 1 123 ? 13.579  -30.866 25.751  1.00 0.00 ? 123 ALA A CB   5  
ATOM 10775 H H    . ALA A 1 123 ? 13.949  -30.957 28.315  1.00 0.00 ? 123 ALA A H    5  
ATOM 10776 H HA   . ALA A 1 123 ? 14.392  -32.793 26.111  1.00 0.00 ? 123 ALA A HA   5  
ATOM 10777 H HB1  . ALA A 1 123 ? 13.017  -30.303 26.482  1.00 0.00 ? 123 ALA A HB1  5  
ATOM 10778 H HB2  . ALA A 1 123 ? 14.124  -30.186 25.114  1.00 0.00 ? 123 ALA A HB2  5  
ATOM 10779 H HB3  . ALA A 1 123 ? 12.902  -31.457 25.153  1.00 0.00 ? 123 ALA A HB3  5  
ATOM 10780 N N    . ALA A 1 124 ? 16.558  -30.518 26.988  1.00 0.00 ? 124 ALA A N    5  
ATOM 10781 C CA   . ALA A 1 124 ? 17.927  -30.052 26.798  1.00 0.00 ? 124 ALA A CA   5  
ATOM 10782 C C    . ALA A 1 124 ? 18.906  -31.221 26.775  1.00 0.00 ? 124 ALA A C    5  
ATOM 10783 O O    . ALA A 1 124 ? 20.003  -31.113 26.226  1.00 0.00 ? 124 ALA A O    5  
ATOM 10784 C CB   . ALA A 1 124 ? 18.305  -29.066 27.893  1.00 0.00 ? 124 ALA A CB   5  
ATOM 10785 H H    . ALA A 1 124 ? 16.043  -30.187 27.753  1.00 0.00 ? 124 ALA A H    5  
ATOM 10786 H HA   . ALA A 1 124 ? 17.975  -29.536 25.850  1.00 0.00 ? 124 ALA A HA   5  
ATOM 10787 H HB1  . ALA A 1 124 ? 18.666  -28.152 27.445  1.00 0.00 ? 124 ALA A HB1  5  
ATOM 10788 H HB2  . ALA A 1 124 ? 17.438  -28.852 28.500  1.00 0.00 ? 124 ALA A HB2  5  
ATOM 10789 H HB3  . ALA A 1 124 ? 19.080  -29.495 28.511  1.00 0.00 ? 124 ALA A HB3  5  
ATOM 10790 N N    . ARG A 1 125 ? 18.503  -32.337 27.373  1.00 0.00 ? 125 ARG A N    5  
ATOM 10791 C CA   . ARG A 1 125 ? 19.346  -33.525 27.422  1.00 0.00 ? 125 ARG A CA   5  
ATOM 10792 C C    . ARG A 1 125 ? 19.738  -33.972 26.017  1.00 0.00 ? 125 ARG A C    5  
ATOM 10793 O O    . ARG A 1 125 ? 20.802  -34.555 25.815  1.00 0.00 ? 125 ARG A O    5  
ATOM 10794 C CB   . ARG A 1 125 ? 18.622  -34.661 28.147  1.00 0.00 ? 125 ARG A CB   5  
ATOM 10795 C CG   . ARG A 1 125 ? 19.154  -34.928 29.546  1.00 0.00 ? 125 ARG A CG   5  
ATOM 10796 C CD   . ARG A 1 125 ? 20.189  -36.042 29.544  1.00 0.00 ? 125 ARG A CD   5  
ATOM 10797 N NE   . ARG A 1 125 ? 21.427  -35.638 28.883  1.00 0.00 ? 125 ARG A NE   5  
ATOM 10798 C CZ   . ARG A 1 125 ? 22.373  -34.915 29.472  1.00 0.00 ? 125 ARG A CZ   5  
ATOM 10799 N NH1  . ARG A 1 125 ? 22.223  -34.520 30.729  1.00 0.00 ? 125 ARG A NH1  5  
ATOM 10800 N NH2  . ARG A 1 125 ? 23.472  -34.587 28.805  1.00 0.00 ? 125 ARG A NH2  5  
ATOM 10801 H H    . ARG A 1 125 ? 17.617  -32.362 27.793  1.00 0.00 ? 125 ARG A H    5  
ATOM 10802 H HA   . ARG A 1 125 ? 20.242  -33.274 27.970  1.00 0.00 ? 125 ARG A HA   5  
ATOM 10803 H HB2  . ARG A 1 125 ? 17.574  -34.412 28.226  1.00 0.00 ? 125 ARG A HB2  5  
ATOM 10804 H HB3  . ARG A 1 125 ? 18.725  -35.566 27.567  1.00 0.00 ? 125 ARG A HB3  5  
ATOM 10805 H HG2  . ARG A 1 125 ? 19.612  -34.027 29.925  1.00 0.00 ? 125 ARG A HG2  5  
ATOM 10806 H HG3  . ARG A 1 125 ? 18.332  -35.213 30.185  1.00 0.00 ? 125 ARG A HG3  5  
ATOM 10807 H HD2  . ARG A 1 125 ? 20.410  -36.312 30.566  1.00 0.00 ? 125 ARG A HD2  5  
ATOM 10808 H HD3  . ARG A 1 125 ? 19.778  -36.897 29.027  1.00 0.00 ? 125 ARG A HD3  5  
ATOM 10809 H HE   . ARG A 1 125 ? 21.558  -35.920 27.954  1.00 0.00 ? 125 ARG A HE   5  
ATOM 10810 H HH11 . ARG A 1 125 ? 21.397  -34.766 31.235  1.00 0.00 ? 125 ARG A HH11 5  
ATOM 10811 H HH12 . ARG A 1 125 ? 22.937  -33.976 31.171  1.00 0.00 ? 125 ARG A HH12 5  
ATOM 10812 H HH21 . ARG A 1 125 ? 23.588  -34.884 27.857  1.00 0.00 ? 125 ARG A HH21 5  
ATOM 10813 H HH22 . ARG A 1 125 ? 24.182  -34.043 29.249  1.00 0.00 ? 125 ARG A HH22 5  
ATOM 10814 N N    . MET A 1 126 ? 18.869  -33.695 25.050  1.00 0.00 ? 126 MET A N    5  
ATOM 10815 C CA   . MET A 1 126 ? 19.125  -34.068 23.664  1.00 0.00 ? 126 MET A CA   5  
ATOM 10816 C C    . MET A 1 126 ? 19.587  -32.861 22.852  1.00 0.00 ? 126 MET A C    5  
ATOM 10817 O O    . MET A 1 126 ? 20.332  -33.003 21.882  1.00 0.00 ? 126 MET A O    5  
ATOM 10818 C CB   . MET A 1 126 ? 17.867  -34.669 23.034  1.00 0.00 ? 126 MET A CB   5  
ATOM 10819 C CG   . MET A 1 126 ? 17.274  -35.815 23.838  1.00 0.00 ? 126 MET A CG   5  
ATOM 10820 S SD   . MET A 1 126 ? 15.882  -36.601 23.003  1.00 0.00 ? 126 MET A SD   5  
ATOM 10821 C CE   . MET A 1 126 ? 14.602  -36.429 24.243  1.00 0.00 ? 126 MET A CE   5  
ATOM 10822 H H    . MET A 1 126 ? 18.037  -33.227 25.273  1.00 0.00 ? 126 MET A H    5  
ATOM 10823 H HA   . MET A 1 126 ? 19.908  -34.811 23.660  1.00 0.00 ? 126 MET A HA   5  
ATOM 10824 H HB2  . MET A 1 126 ? 17.119  -33.895 22.945  1.00 0.00 ? 126 MET A HB2  5  
ATOM 10825 H HB3  . MET A 1 126 ? 18.112  -35.038 22.049  1.00 0.00 ? 126 MET A HB3  5  
ATOM 10826 H HG2  . MET A 1 126 ? 18.041  -36.557 24.003  1.00 0.00 ? 126 MET A HG2  5  
ATOM 10827 H HG3  . MET A 1 126 ? 16.935  -35.432 24.789  1.00 0.00 ? 126 MET A HG3  5  
ATOM 10828 H HE1  . MET A 1 126 ? 14.815  -37.083 25.075  1.00 0.00 ? 126 MET A HE1  5  
ATOM 10829 H HE2  . MET A 1 126 ? 14.571  -35.406 24.588  1.00 0.00 ? 126 MET A HE2  5  
ATOM 10830 H HE3  . MET A 1 126 ? 13.647  -36.694 23.813  1.00 0.00 ? 126 MET A HE3  5  
ATOM 10831 N N    . ILE A 1 127 ? 19.140  -31.677 23.255  1.00 0.00 ? 127 ILE A N    5  
ATOM 10832 C CA   . ILE A 1 127 ? 19.509  -30.447 22.566  1.00 0.00 ? 127 ILE A CA   5  
ATOM 10833 C C    . ILE A 1 127 ? 20.973  -30.097 22.811  1.00 0.00 ? 127 ILE A C    5  
ATOM 10834 O O    . ILE A 1 127 ? 21.640  -29.534 21.944  1.00 0.00 ? 127 ILE A O    5  
ATOM 10835 C CB   . ILE A 1 127 ? 18.628  -29.265 23.013  1.00 0.00 ? 127 ILE A CB   5  
ATOM 10836 C CG1  . ILE A 1 127 ? 17.152  -29.577 22.762  1.00 0.00 ? 127 ILE A CG1  5  
ATOM 10837 C CG2  . ILE A 1 127 ? 19.038  -27.994 22.284  1.00 0.00 ? 127 ILE A CG2  5  
ATOM 10838 C CD1  . ILE A 1 127 ? 16.839  -29.896 21.317  1.00 0.00 ? 127 ILE A CD1  5  
ATOM 10839 H H    . ILE A 1 127 ? 18.549  -31.629 24.035  1.00 0.00 ? 127 ILE A H    5  
ATOM 10840 H HA   . ILE A 1 127 ? 19.359  -30.601 21.507  1.00 0.00 ? 127 ILE A HA   5  
ATOM 10841 H HB   . ILE A 1 127 ? 18.782  -29.111 24.070  1.00 0.00 ? 127 ILE A HB   5  
ATOM 10842 H HG12 . ILE A 1 127 ? 16.863  -30.428 23.358  1.00 0.00 ? 127 ILE A HG12 5  
ATOM 10843 H HG13 . ILE A 1 127 ? 16.557  -28.723 23.050  1.00 0.00 ? 127 ILE A HG13 5  
ATOM 10844 H HG21 . ILE A 1 127 ? 19.630  -28.250 21.418  1.00 0.00 ? 127 ILE A HG21 5  
ATOM 10845 H HG22 . ILE A 1 127 ? 18.154  -27.460 21.969  1.00 0.00 ? 127 ILE A HG22 5  
ATOM 10846 H HG23 . ILE A 1 127 ? 19.619  -27.370 22.946  1.00 0.00 ? 127 ILE A HG23 5  
ATOM 10847 H HD11 . ILE A 1 127 ? 17.094  -29.049 20.697  1.00 0.00 ? 127 ILE A HD11 5  
ATOM 10848 H HD12 . ILE A 1 127 ? 17.411  -30.757 21.005  1.00 0.00 ? 127 ILE A HD12 5  
ATOM 10849 H HD13 . ILE A 1 127 ? 15.784  -30.109 21.216  1.00 0.00 ? 127 ILE A HD13 5  
ATOM 10850 N N    . ALA A 1 128 ? 21.466  -30.436 23.997  1.00 0.00 ? 128 ALA A N    5  
ATOM 10851 C CA   . ALA A 1 128 ? 22.852  -30.161 24.355  1.00 0.00 ? 128 ALA A CA   5  
ATOM 10852 C C    . ALA A 1 128 ? 23.813  -30.782 23.348  1.00 0.00 ? 128 ALA A C    5  
ATOM 10853 O O    . ALA A 1 128 ? 24.942  -30.321 23.186  1.00 0.00 ? 128 ALA A O    5  
ATOM 10854 C CB   . ALA A 1 128 ? 23.147  -30.676 25.756  1.00 0.00 ? 128 ALA A CB   5  
ATOM 10855 H H    . ALA A 1 128 ? 20.884  -30.882 24.647  1.00 0.00 ? 128 ALA A H    5  
ATOM 10856 H HA   . ALA A 1 128 ? 22.990  -29.089 24.356  1.00 0.00 ? 128 ALA A HA   5  
ATOM 10857 H HB1  . ALA A 1 128 ? 24.032  -31.295 25.732  1.00 0.00 ? 128 ALA A HB1  5  
ATOM 10858 H HB2  . ALA A 1 128 ? 23.310  -29.841 26.420  1.00 0.00 ? 128 ALA A HB2  5  
ATOM 10859 H HB3  . ALA A 1 128 ? 22.309  -31.259 26.109  1.00 0.00 ? 128 ALA A HB3  5  
ATOM 10860 N N    . GLY A 1 129 ? 23.357  -31.833 22.672  1.00 0.00 ? 129 GLY A N    5  
ATOM 10861 C CA   . GLY A 1 129 ? 24.189  -32.501 21.689  1.00 0.00 ? 129 GLY A CA   5  
ATOM 10862 C C    . GLY A 1 129 ? 24.121  -31.840 20.326  1.00 0.00 ? 129 GLY A C    5  
ATOM 10863 O O    . GLY A 1 129 ? 25.026  -31.998 19.507  1.00 0.00 ? 129 GLY A O    5  
ATOM 10864 H H    . GLY A 1 129 ? 22.448  -32.157 22.843  1.00 0.00 ? 129 GLY A H    5  
ATOM 10865 H HA2  . GLY A 1 129 ? 25.213  -32.489 22.032  1.00 0.00 ? 129 GLY A HA2  5  
ATOM 10866 H HA3  . GLY A 1 129 ? 23.864  -33.527 21.595  1.00 0.00 ? 129 GLY A HA3  5  
ATOM 10867 N N    . SER A 1 130 ? 23.044  -31.100 20.082  1.00 0.00 ? 130 SER A N    5  
ATOM 10868 C CA   . SER A 1 130 ? 22.858  -30.418 18.807  1.00 0.00 ? 130 SER A CA   5  
ATOM 10869 C C    . SER A 1 130 ? 24.071  -29.556 18.471  1.00 0.00 ? 130 SER A C    5  
ATOM 10870 O O    . SER A 1 130 ? 24.410  -29.371 17.302  1.00 0.00 ? 130 SER A O    5  
ATOM 10871 C CB   . SER A 1 130 ? 21.598  -29.552 18.847  1.00 0.00 ? 130 SER A CB   5  
ATOM 10872 O OG   . SER A 1 130 ? 20.787  -29.778 17.707  1.00 0.00 ? 130 SER A OG   5  
ATOM 10873 H H    . SER A 1 130 ? 22.357  -31.013 20.776  1.00 0.00 ? 130 SER A H    5  
ATOM 10874 H HA   . SER A 1 130 ? 22.743  -31.171 18.042  1.00 0.00 ? 130 SER A HA   5  
ATOM 10875 H HB2  . SER A 1 130 ? 21.028  -29.791 19.732  1.00 0.00 ? 130 SER A HB2  5  
ATOM 10876 H HB3  . SER A 1 130 ? 21.881  -28.510 18.872  1.00 0.00 ? 130 SER A HB3  5  
ATOM 10877 H HG   . SER A 1 130 ? 21.337  -29.789 16.920  1.00 0.00 ? 130 SER A HG   5  
ATOM 10878 N N    . ALA A 1 131 ? 24.720  -29.029 19.504  1.00 0.00 ? 131 ALA A N    5  
ATOM 10879 C CA   . ALA A 1 131 ? 25.896  -28.188 19.320  1.00 0.00 ? 131 ALA A CA   5  
ATOM 10880 C C    . ALA A 1 131 ? 27.176  -29.016 19.363  1.00 0.00 ? 131 ALA A C    5  
ATOM 10881 O O    . ALA A 1 131 ? 28.215  -28.597 18.854  1.00 0.00 ? 131 ALA A O    5  
ATOM 10882 C CB   . ALA A 1 131 ? 25.935  -27.096 20.379  1.00 0.00 ? 131 ALA A CB   5  
ATOM 10883 H H    . ALA A 1 131 ? 24.401  -29.213 20.412  1.00 0.00 ? 131 ALA A H    5  
ATOM 10884 H HA   . ALA A 1 131 ? 25.819  -27.714 18.352  1.00 0.00 ? 131 ALA A HA   5  
ATOM 10885 H HB1  . ALA A 1 131 ? 26.423  -26.221 19.974  1.00 0.00 ? 131 ALA A HB1  5  
ATOM 10886 H HB2  . ALA A 1 131 ? 24.928  -26.844 20.673  1.00 0.00 ? 131 ALA A HB2  5  
ATOM 10887 H HB3  . ALA A 1 131 ? 26.484  -27.449 21.239  1.00 0.00 ? 131 ALA A HB3  5  
ATOM 10888 N N    . ARG A 1 132 ? 27.093  -30.193 19.974  1.00 0.00 ? 132 ARG A N    5  
ATOM 10889 C CA   . ARG A 1 132 ? 28.245  -31.079 20.086  1.00 0.00 ? 132 ARG A CA   5  
ATOM 10890 C C    . ARG A 1 132 ? 28.705  -31.549 18.708  1.00 0.00 ? 132 ARG A C    5  
ATOM 10891 O O    . ARG A 1 132 ? 29.841  -31.993 18.540  1.00 0.00 ? 132 ARG A O    5  
ATOM 10892 C CB   . ARG A 1 132 ? 27.904  -32.287 20.960  1.00 0.00 ? 132 ARG A CB   5  
ATOM 10893 C CG   . ARG A 1 132 ? 28.952  -33.387 20.915  1.00 0.00 ? 132 ARG A CG   5  
ATOM 10894 C CD   . ARG A 1 132 ? 28.626  -34.424 19.852  1.00 0.00 ? 132 ARG A CD   5  
ATOM 10895 N NE   . ARG A 1 132 ? 28.245  -35.707 20.437  1.00 0.00 ? 132 ARG A NE   5  
ATOM 10896 C CZ   . ARG A 1 132 ? 27.833  -36.748 19.722  1.00 0.00 ? 132 ARG A CZ   5  
ATOM 10897 N NH1  . ARG A 1 132 ? 27.751  -36.658 18.401  1.00 0.00 ? 132 ARG A NH1  5  
ATOM 10898 N NH2  . ARG A 1 132 ? 27.504  -37.882 20.327  1.00 0.00 ? 132 ARG A NH2  5  
ATOM 10899 H H    . ARG A 1 132 ? 26.236  -30.473 20.361  1.00 0.00 ? 132 ARG A H    5  
ATOM 10900 H HA   . ARG A 1 132 ? 29.047  -30.525 20.550  1.00 0.00 ? 132 ARG A HA   5  
ATOM 10901 H HB2  . ARG A 1 132 ? 27.803  -31.959 21.984  1.00 0.00 ? 132 ARG A HB2  5  
ATOM 10902 H HB3  . ARG A 1 132 ? 26.964  -32.702 20.629  1.00 0.00 ? 132 ARG A HB3  5  
ATOM 10903 H HG2  . ARG A 1 132 ? 29.913  -32.948 20.690  1.00 0.00 ? 132 ARG A HG2  5  
ATOM 10904 H HG3  . ARG A 1 132 ? 28.993  -33.873 21.879  1.00 0.00 ? 132 ARG A HG3  5  
ATOM 10905 H HD2  . ARG A 1 132 ? 27.808  -34.058 19.249  1.00 0.00 ? 132 ARG A HD2  5  
ATOM 10906 H HD3  . ARG A 1 132 ? 29.496  -34.568 19.229  1.00 0.00 ? 132 ARG A HD3  5  
ATOM 10907 H HE   . ARG A 1 132 ? 28.298  -35.795 21.411  1.00 0.00 ? 132 ARG A HE   5  
ATOM 10908 H HH11 . ARG A 1 132 ? 27.999  -35.805 17.942  1.00 0.00 ? 132 ARG A HH11 5  
ATOM 10909 H HH12 . ARG A 1 132 ? 27.441  -37.444 17.865  1.00 0.00 ? 132 ARG A HH12 5  
ATOM 10910 H HH21 . ARG A 1 132 ? 27.565  -37.953 21.322  1.00 0.00 ? 132 ARG A HH21 5  
ATOM 10911 H HH22 . ARG A 1 132 ? 27.194  -38.664 19.788  1.00 0.00 ? 132 ARG A HH22 5  
ATOM 10912 N N    . SER A 1 133 ? 27.815  -31.447 17.727  1.00 0.00 ? 133 SER A N    5  
ATOM 10913 C CA   . SER A 1 133 ? 28.128  -31.865 16.365  1.00 0.00 ? 133 SER A CA   5  
ATOM 10914 C C    . SER A 1 133 ? 28.648  -30.691 15.542  1.00 0.00 ? 133 SER A C    5  
ATOM 10915 O O    . SER A 1 133 ? 29.524  -30.853 14.693  1.00 0.00 ? 133 SER A O    5  
ATOM 10916 C CB   . SER A 1 133 ? 26.889  -32.463 15.695  1.00 0.00 ? 133 SER A CB   5  
ATOM 10917 O OG   . SER A 1 133 ? 25.949  -31.454 15.369  1.00 0.00 ? 133 SER A OG   5  
ATOM 10918 H H    . SER A 1 133 ? 26.926  -31.085 17.924  1.00 0.00 ? 133 SER A H    5  
ATOM 10919 H HA   . SER A 1 133 ? 28.898  -32.621 16.419  1.00 0.00 ? 133 SER A HA   5  
ATOM 10920 H HB2  . SER A 1 133 ? 27.183  -32.971 14.789  1.00 0.00 ? 133 SER A HB2  5  
ATOM 10921 H HB3  . SER A 1 133 ? 26.424  -33.168 16.369  1.00 0.00 ? 133 SER A HB3  5  
ATOM 10922 H HG   . SER A 1 133 ? 25.064  -31.827 15.378  1.00 0.00 ? 133 SER A HG   5  
ATOM 10923 N N    . MET A 1 134 ? 28.102  -29.507 15.801  1.00 0.00 ? 134 MET A N    5  
ATOM 10924 C CA   . MET A 1 134 ? 28.511  -28.304 15.085  1.00 0.00 ? 134 MET A CA   5  
ATOM 10925 C C    . MET A 1 134 ? 29.893  -27.846 15.538  1.00 0.00 ? 134 MET A C    5  
ATOM 10926 O O    . MET A 1 134 ? 30.607  -27.169 14.799  1.00 0.00 ? 134 MET A O    5  
ATOM 10927 C CB   . MET A 1 134 ? 27.492  -27.184 15.304  1.00 0.00 ? 134 MET A CB   5  
ATOM 10928 C CG   . MET A 1 134 ? 26.054  -27.615 15.068  1.00 0.00 ? 134 MET A CG   5  
ATOM 10929 S SD   . MET A 1 134 ? 25.049  -26.312 14.330  1.00 0.00 ? 134 MET A SD   5  
ATOM 10930 C CE   . MET A 1 134 ? 24.797  -25.239 15.742  1.00 0.00 ? 134 MET A CE   5  
ATOM 10931 H H    . MET A 1 134 ? 27.407  -29.440 16.489  1.00 0.00 ? 134 MET A H    5  
ATOM 10932 H HA   . MET A 1 134 ? 28.550  -28.542 14.033  1.00 0.00 ? 134 MET A HA   5  
ATOM 10933 H HB2  . MET A 1 134 ? 27.577  -26.829 16.320  1.00 0.00 ? 134 MET A HB2  5  
ATOM 10934 H HB3  . MET A 1 134 ? 27.716  -26.372 14.628  1.00 0.00 ? 134 MET A HB3  5  
ATOM 10935 H HG2  . MET A 1 134 ? 26.052  -28.469 14.407  1.00 0.00 ? 134 MET A HG2  5  
ATOM 10936 H HG3  . MET A 1 134 ? 25.617  -27.896 16.015  1.00 0.00 ? 134 MET A HG3  5  
ATOM 10937 H HE1  . MET A 1 134 ? 24.915  -25.808 16.652  1.00 0.00 ? 134 MET A HE1  5  
ATOM 10938 H HE2  . MET A 1 134 ? 25.522  -24.440 15.720  1.00 0.00 ? 134 MET A HE2  5  
ATOM 10939 H HE3  . MET A 1 134 ? 23.800  -24.824 15.704  1.00 0.00 ? 134 MET A HE3  5  
ATOM 10940 N N    . GLY A 1 135 ? 30.265  -28.219 16.759  1.00 0.00 ? 135 GLY A N    5  
ATOM 10941 C CA   . GLY A 1 135 ? 31.561  -27.836 17.290  1.00 0.00 ? 135 GLY A CA   5  
ATOM 10942 C C    . GLY A 1 135 ? 31.450  -27.066 18.590  1.00 0.00 ? 135 GLY A C    5  
ATOM 10943 O O    . GLY A 1 135 ? 31.977  -25.960 18.712  1.00 0.00 ? 135 GLY A O    5  
ATOM 10944 H H    . GLY A 1 135 ? 29.654  -28.758 17.304  1.00 0.00 ? 135 GLY A H    5  
ATOM 10945 H HA2  . GLY A 1 135 ? 32.145  -28.728 17.459  1.00 0.00 ? 135 GLY A HA2  5  
ATOM 10946 H HA3  . GLY A 1 135 ? 32.067  -27.219 16.562  1.00 0.00 ? 135 GLY A HA3  5  
ATOM 10947 N N    . VAL A 1 136 ? 30.762  -27.650 19.566  1.00 0.00 ? 136 VAL A N    5  
ATOM 10948 C CA   . VAL A 1 136 ? 30.583  -27.012 20.864  1.00 0.00 ? 136 VAL A CA   5  
ATOM 10949 C C    . VAL A 1 136 ? 30.747  -28.017 21.999  1.00 0.00 ? 136 VAL A C    5  
ATOM 10950 O O    . VAL A 1 136 ? 30.371  -29.182 21.867  1.00 0.00 ? 136 VAL A O    5  
ATOM 10951 C CB   . VAL A 1 136 ? 29.198  -26.348 20.978  1.00 0.00 ? 136 VAL A CB   5  
ATOM 10952 C CG1  . VAL A 1 136 ? 29.108  -25.513 22.246  1.00 0.00 ? 136 VAL A CG1  5  
ATOM 10953 C CG2  . VAL A 1 136 ? 28.912  -25.499 19.748  1.00 0.00 ? 136 VAL A CG2  5  
ATOM 10954 H H    . VAL A 1 136 ? 30.365  -28.533 19.409  1.00 0.00 ? 136 VAL A H    5  
ATOM 10955 H HA   . VAL A 1 136 ? 31.336  -26.244 20.965  1.00 0.00 ? 136 VAL A HA   5  
ATOM 10956 H HB   . VAL A 1 136 ? 28.451  -27.127 21.033  1.00 0.00 ? 136 VAL A HB   5  
ATOM 10957 H HG11 . VAL A 1 136 ? 29.826  -24.707 22.197  1.00 0.00 ? 136 VAL A HG11 5  
ATOM 10958 H HG12 . VAL A 1 136 ? 28.112  -25.105 22.338  1.00 0.00 ? 136 VAL A HG12 5  
ATOM 10959 H HG13 . VAL A 1 136 ? 29.324  -26.135 23.102  1.00 0.00 ? 136 VAL A HG13 5  
ATOM 10960 H HG21 . VAL A 1 136 ? 29.716  -24.792 19.605  1.00 0.00 ? 136 VAL A HG21 5  
ATOM 10961 H HG22 . VAL A 1 136 ? 28.835  -26.137 18.880  1.00 0.00 ? 136 VAL A HG22 5  
ATOM 10962 H HG23 . VAL A 1 136 ? 27.984  -24.966 19.886  1.00 0.00 ? 136 VAL A HG23 5  
ATOM 10963 N N    . GLU A 1 137 ? 31.310  -27.559 23.112  1.00 0.00 ? 137 GLU A N    5  
ATOM 10964 C CA   . GLU A 1 137 ? 31.524  -28.419 24.270  1.00 0.00 ? 137 GLU A CA   5  
ATOM 10965 C C    . GLU A 1 137 ? 30.551  -28.072 25.393  1.00 0.00 ? 137 GLU A C    5  
ATOM 10966 O O    . GLU A 1 137 ? 30.656  -27.015 26.015  1.00 0.00 ? 137 GLU A O    5  
ATOM 10967 C CB   . GLU A 1 137 ? 32.965  -28.290 24.770  1.00 0.00 ? 137 GLU A CB   5  
ATOM 10968 C CG   . GLU A 1 137 ? 33.654  -29.626 24.991  1.00 0.00 ? 137 GLU A CG   5  
ATOM 10969 C CD   . GLU A 1 137 ? 35.165  -29.504 25.026  1.00 0.00 ? 137 GLU A CD   5  
ATOM 10970 O OE1  . GLU A 1 137 ? 35.742  -28.998 24.040  1.00 0.00 ? 137 GLU A OE1  5  
ATOM 10971 O OE2  . GLU A 1 137 ? 35.771  -29.915 26.037  1.00 0.00 ? 137 GLU A OE2  5  
ATOM 10972 H H    . GLU A 1 137 ? 31.589  -26.620 23.156  1.00 0.00 ? 137 GLU A H    5  
ATOM 10973 H HA   . GLU A 1 137 ? 31.350  -29.439 23.961  1.00 0.00 ? 137 GLU A HA   5  
ATOM 10974 H HB2  . GLU A 1 137 ? 33.536  -27.729 24.045  1.00 0.00 ? 137 GLU A HB2  5  
ATOM 10975 H HB3  . GLU A 1 137 ? 32.961  -27.752 25.706  1.00 0.00 ? 137 GLU A HB3  5  
ATOM 10976 H HG2  . GLU A 1 137 ? 33.320  -30.038 25.931  1.00 0.00 ? 137 GLU A HG2  5  
ATOM 10977 H HG3  . GLU A 1 137 ? 33.380  -30.296 24.188  1.00 0.00 ? 137 GLU A HG3  5  
ATOM 10978 N N    . VAL A 1 138 ? 29.604  -28.970 25.646  1.00 0.00 ? 138 VAL A N    5  
ATOM 10979 C CA   . VAL A 1 138 ? 28.613  -28.760 26.694  1.00 0.00 ? 138 VAL A CA   5  
ATOM 10980 C C    . VAL A 1 138 ? 29.277  -28.612 28.058  1.00 0.00 ? 138 VAL A C    5  
ATOM 10981 O O    . VAL A 1 138 ? 30.248  -29.304 28.366  1.00 0.00 ? 138 VAL A O    5  
ATOM 10982 C CB   . VAL A 1 138 ? 27.602  -29.920 26.751  1.00 0.00 ? 138 VAL A CB   5  
ATOM 10983 C CG1  . VAL A 1 138 ? 28.318  -31.241 26.987  1.00 0.00 ? 138 VAL A CG1  5  
ATOM 10984 C CG2  . VAL A 1 138 ? 26.562  -29.668 27.832  1.00 0.00 ? 138 VAL A CG2  5  
ATOM 10985 H H    . VAL A 1 138 ? 29.573  -29.793 25.116  1.00 0.00 ? 138 VAL A H    5  
ATOM 10986 H HA   . VAL A 1 138 ? 28.074  -27.851 26.467  1.00 0.00 ? 138 VAL A HA   5  
ATOM 10987 H HB   . VAL A 1 138 ? 27.095  -29.976 25.799  1.00 0.00 ? 138 VAL A HB   5  
ATOM 10988 H HG11 . VAL A 1 138 ? 28.050  -31.627 27.959  1.00 0.00 ? 138 VAL A HG11 5  
ATOM 10989 H HG12 . VAL A 1 138 ? 28.028  -31.950 26.224  1.00 0.00 ? 138 VAL A HG12 5  
ATOM 10990 H HG13 . VAL A 1 138 ? 29.386  -31.084 26.944  1.00 0.00 ? 138 VAL A HG13 5  
ATOM 10991 H HG21 . VAL A 1 138 ? 26.888  -30.121 28.757  1.00 0.00 ? 138 VAL A HG21 5  
ATOM 10992 H HG22 . VAL A 1 138 ? 26.442  -28.604 27.976  1.00 0.00 ? 138 VAL A HG22 5  
ATOM 10993 H HG23 . VAL A 1 138 ? 25.618  -30.099 27.533  1.00 0.00 ? 138 VAL A HG23 5  
ATOM 10994 N N    . VAL A 1 139 ? 28.748  -27.705 28.874  1.00 0.00 ? 139 VAL A N    5  
ATOM 10995 C CA   . VAL A 1 139 ? 29.289  -27.467 30.207  1.00 0.00 ? 139 VAL A CA   5  
ATOM 10996 C C    . VAL A 1 139 ? 28.172  -27.253 31.222  1.00 0.00 ? 139 VAL A C    5  
ATOM 10997 O O    . VAL A 1 139 ? 27.485  -26.233 31.199  1.00 0.00 ? 139 VAL A O    5  
ATOM 10998 C CB   . VAL A 1 139 ? 30.224  -26.243 30.222  1.00 0.00 ? 139 VAL A CB   5  
ATOM 10999 C CG1  . VAL A 1 139 ? 30.736  -25.981 31.630  1.00 0.00 ? 139 VAL A CG1  5  
ATOM 11000 C CG2  . VAL A 1 139 ? 31.381  -26.445 29.255  1.00 0.00 ? 139 VAL A CG2  5  
ATOM 11001 H H    . VAL A 1 139 ? 27.975  -27.184 28.571  1.00 0.00 ? 139 VAL A H    5  
ATOM 11002 H HA   . VAL A 1 139 ? 29.862  -28.336 30.494  1.00 0.00 ? 139 VAL A HA   5  
ATOM 11003 H HB   . VAL A 1 139 ? 29.660  -25.380 29.901  1.00 0.00 ? 139 VAL A HB   5  
ATOM 11004 H HG11 . VAL A 1 139 ? 31.280  -26.845 31.982  1.00 0.00 ? 139 VAL A HG11 5  
ATOM 11005 H HG12 . VAL A 1 139 ? 31.390  -25.121 31.622  1.00 0.00 ? 139 VAL A HG12 5  
ATOM 11006 H HG13 . VAL A 1 139 ? 29.900  -25.791 32.287  1.00 0.00 ? 139 VAL A HG13 5  
ATOM 11007 H HG21 . VAL A 1 139 ? 32.277  -26.009 29.671  1.00 0.00 ? 139 VAL A HG21 5  
ATOM 11008 H HG22 . VAL A 1 139 ? 31.536  -27.502 29.094  1.00 0.00 ? 139 VAL A HG22 5  
ATOM 11009 H HG23 . VAL A 1 139 ? 31.151  -25.968 28.314  1.00 0.00 ? 139 VAL A HG23 5  
ATOM 11010 N N    . GLY A 1 140 ? 27.998  -28.222 32.115  1.00 0.00 ? 140 GLY A N    5  
ATOM 11011 C CA   . GLY A 1 140 ? 26.963  -28.121 33.128  1.00 0.00 ? 140 GLY A CA   5  
ATOM 11012 C C    . GLY A 1 140 ? 26.207  -29.421 33.317  1.00 0.00 ? 140 GLY A C    5  
ATOM 11013 O O    . GLY A 1 140 ? 26.714  -30.357 33.933  1.00 0.00 ? 140 GLY A O    5  
ATOM 11014 H H    . GLY A 1 140 ? 28.576  -29.013 32.086  1.00 0.00 ? 140 GLY A H    5  
ATOM 11015 H HA2  . GLY A 1 140 ? 27.419  -27.842 34.066  1.00 0.00 ? 140 GLY A HA2  5  
ATOM 11016 H HA3  . GLY A 1 140 ? 26.264  -27.350 32.836  1.00 0.00 ? 140 GLY A HA3  5  
ATOM 11017 N N    . ALA A 1 141 ? 24.990  -29.478 32.786  1.00 0.00 ? 141 ALA A N    5  
ATOM 11018 C CA   . ALA A 1 141 ? 24.162  -30.672 32.899  1.00 0.00 ? 141 ALA A CA   5  
ATOM 11019 C C    . ALA A 1 141 ? 23.830  -30.974 34.357  1.00 0.00 ? 141 ALA A C    5  
ATOM 11020 O O    . ALA A 1 141 ? 24.497  -30.507 35.280  1.00 0.00 ? 141 ALA A O    5  
ATOM 11021 C CB   . ALA A 1 141 ? 24.862  -31.862 32.258  1.00 0.00 ? 141 ALA A CB   5  
ATOM 11022 H H    . ALA A 1 141 ? 24.640  -28.698 32.307  1.00 0.00 ? 141 ALA A H    5  
ATOM 11023 H HA   . ALA A 1 141 ? 23.243  -30.494 32.361  1.00 0.00 ? 141 ALA A HA   5  
ATOM 11024 H HB1  . ALA A 1 141 ? 25.274  -32.495 33.031  1.00 0.00 ? 141 ALA A HB1  5  
ATOM 11025 H HB2  . ALA A 1 141 ? 24.151  -32.424 31.672  1.00 0.00 ? 141 ALA A HB2  5  
ATOM 11026 H HB3  . ALA A 1 141 ? 25.658  -31.509 31.619  1.00 0.00 ? 141 ALA A HB3  5  
ATOM 11027 N N    . PRO A 1 142 ? 22.775  -31.774 34.571  1.00 0.00 ? 142 PRO A N    5  
ATOM 11028 C CA   . PRO A 1 142 ? 22.330  -32.155 35.914  1.00 0.00 ? 142 PRO A CA   5  
ATOM 11029 C C    . PRO A 1 142 ? 23.309  -33.101 36.602  1.00 0.00 ? 142 PRO A C    5  
ATOM 11030 O O    . PRO A 1 142 ? 24.257  -33.584 35.984  1.00 0.00 ? 142 PRO A O    5  
ATOM 11031 C CB   . PRO A 1 142 ? 20.995  -32.860 35.660  1.00 0.00 ? 142 PRO A CB   5  
ATOM 11032 C CG   . PRO A 1 142 ? 21.096  -33.368 34.263  1.00 0.00 ? 142 PRO A CG   5  
ATOM 11033 C CD   . PRO A 1 142 ? 21.934  -32.366 33.517  1.00 0.00 ? 142 PRO A CD   5  
ATOM 11034 H HA   . PRO A 1 142 ? 22.168  -31.290 36.540  1.00 0.00 ? 142 PRO A HA   5  
ATOM 11035 H HB2  . PRO A 1 142 ? 20.872  -33.668 36.367  1.00 0.00 ? 142 PRO A HB2  5  
ATOM 11036 H HB3  . PRO A 1 142 ? 20.185  -32.154 35.766  1.00 0.00 ? 142 PRO A HB3  5  
ATOM 11037 H HG2  . PRO A 1 142 ? 21.574  -34.336 34.257  1.00 0.00 ? 142 PRO A HG2  5  
ATOM 11038 H HG3  . PRO A 1 142 ? 20.111  -33.433 33.824  1.00 0.00 ? 142 PRO A HG3  5  
ATOM 11039 H HD2  . PRO A 1 142 ? 22.540  -32.861 32.773  1.00 0.00 ? 142 PRO A HD2  5  
ATOM 11040 H HD3  . PRO A 1 142 ? 21.306  -31.617 33.058  1.00 0.00 ? 142 PRO A HD3  5  
ATOM 11041 N N    . GLU A 1 143 ? 23.072  -33.361 37.884  1.00 0.00 ? 143 GLU A N    5  
ATOM 11042 C CA   . GLU A 1 143 ? 23.935  -34.249 38.655  1.00 0.00 ? 143 GLU A CA   5  
ATOM 11043 C C    . GLU A 1 143 ? 23.128  -35.027 39.690  1.00 0.00 ? 143 GLU A C    5  
ATOM 11044 O O    . GLU A 1 143 ? 21.916  -34.848 39.812  1.00 0.00 ? 143 GLU A O    5  
ATOM 11045 C CB   . GLU A 1 143 ? 25.039  -33.449 39.349  1.00 0.00 ? 143 GLU A CB   5  
ATOM 11046 C CG   . GLU A 1 143 ? 26.438  -33.968 39.063  1.00 0.00 ? 143 GLU A CG   5  
ATOM 11047 C CD   . GLU A 1 143 ? 27.470  -33.425 40.032  1.00 0.00 ? 143 GLU A CD   5  
ATOM 11048 O OE1  . GLU A 1 143 ? 27.555  -32.188 40.179  1.00 0.00 ? 143 GLU A OE1  5  
ATOM 11049 O OE2  . GLU A 1 143 ? 28.194  -34.238 40.645  1.00 0.00 ? 143 GLU A OE2  5  
ATOM 11050 H H    . GLU A 1 143 ? 22.300  -32.946 38.322  1.00 0.00 ? 143 GLU A H    5  
ATOM 11051 H HA   . GLU A 1 143 ? 24.388  -34.949 37.969  1.00 0.00 ? 143 GLU A HA   5  
ATOM 11052 H HB2  . GLU A 1 143 ? 24.984  -32.422 39.019  1.00 0.00 ? 143 GLU A HB2  5  
ATOM 11053 H HB3  . GLU A 1 143 ? 24.875  -33.484 40.415  1.00 0.00 ? 143 GLU A HB3  5  
ATOM 11054 H HG2  . GLU A 1 143 ? 26.430  -35.045 39.136  1.00 0.00 ? 143 GLU A HG2  5  
ATOM 11055 H HG3  . GLU A 1 143 ? 26.719  -33.678 38.062  1.00 0.00 ? 143 GLU A HG3  5  
ATOM 11056 N N    . VAL A 1 144 ? 23.810  -35.893 40.434  1.00 0.00 ? 144 VAL A N    5  
ATOM 11057 C CA   . VAL A 1 144 ? 23.158  -36.699 41.459  1.00 0.00 ? 144 VAL A CA   5  
ATOM 11058 C C    . VAL A 1 144 ? 23.922  -36.634 42.777  1.00 0.00 ? 144 VAL A C    5  
ATOM 11059 O O    . VAL A 1 144 ? 25.126  -36.886 42.823  1.00 0.00 ? 144 VAL A O    5  
ATOM 11060 C CB   . VAL A 1 144 ? 23.035  -38.171 41.022  1.00 0.00 ? 144 VAL A CB   5  
ATOM 11061 C CG1  . VAL A 1 144 ? 22.311  -38.984 42.084  1.00 0.00 ? 144 VAL A CG1  5  
ATOM 11062 C CG2  . VAL A 1 144 ? 22.320  -38.271 39.683  1.00 0.00 ? 144 VAL A CG2  5  
ATOM 11063 H H    . VAL A 1 144 ? 24.774  -35.992 40.290  1.00 0.00 ? 144 VAL A H    5  
ATOM 11064 H HA   . VAL A 1 144 ? 22.163  -36.306 41.611  1.00 0.00 ? 144 VAL A HA   5  
ATOM 11065 H HB   . VAL A 1 144 ? 24.030  -38.575 40.907  1.00 0.00 ? 144 VAL A HB   5  
ATOM 11066 H HG11 . VAL A 1 144 ? 21.548  -38.375 42.546  1.00 0.00 ? 144 VAL A HG11 5  
ATOM 11067 H HG12 . VAL A 1 144 ? 21.854  -39.849 41.626  1.00 0.00 ? 144 VAL A HG12 5  
ATOM 11068 H HG13 . VAL A 1 144 ? 23.018  -39.306 42.835  1.00 0.00 ? 144 VAL A HG13 5  
ATOM 11069 H HG21 . VAL A 1 144 ? 21.291  -37.967 39.802  1.00 0.00 ? 144 VAL A HG21 5  
ATOM 11070 H HG22 . VAL A 1 144 ? 22.806  -37.624 38.966  1.00 0.00 ? 144 VAL A HG22 5  
ATOM 11071 H HG23 . VAL A 1 144 ? 22.357  -39.290 39.330  1.00 0.00 ? 144 VAL A HG23 5  
ATOM 11072 N N    . LYS A 1 145 ? 23.214  -36.293 43.849  1.00 0.00 ? 145 LYS A N    5  
ATOM 11073 C CA   . LYS A 1 145 ? 23.823  -36.196 45.170  1.00 0.00 ? 145 LYS A CA   5  
ATOM 11074 C C    . LYS A 1 145 ? 23.378  -37.352 46.060  1.00 0.00 ? 145 LYS A C    5  
ATOM 11075 O O    . LYS A 1 145 ? 22.471  -38.106 45.708  1.00 0.00 ? 145 LYS A O    5  
ATOM 11076 C CB   . LYS A 1 145 ? 23.457  -34.863 45.826  1.00 0.00 ? 145 LYS A CB   5  
ATOM 11077 C CG   . LYS A 1 145 ? 24.328  -33.703 45.374  1.00 0.00 ? 145 LYS A CG   5  
ATOM 11078 C CD   . LYS A 1 145 ? 24.364  -32.595 46.412  1.00 0.00 ? 145 LYS A CD   5  
ATOM 11079 C CE   . LYS A 1 145 ? 24.469  -31.224 45.761  1.00 0.00 ? 145 LYS A CE   5  
ATOM 11080 N NZ   . LYS A 1 145 ? 23.634  -30.211 46.464  1.00 0.00 ? 145 LYS A NZ   5  
ATOM 11081 H H    . LYS A 1 145 ? 22.257  -36.104 43.748  1.00 0.00 ? 145 LYS A H    5  
ATOM 11082 H HA   . LYS A 1 145 ? 24.894  -36.245 45.046  1.00 0.00 ? 145 LYS A HA   5  
ATOM 11083 H HB2  . LYS A 1 145 ? 22.430  -34.628 45.588  1.00 0.00 ? 145 LYS A HB2  5  
ATOM 11084 H HB3  . LYS A 1 145 ? 23.555  -34.963 46.897  1.00 0.00 ? 145 LYS A HB3  5  
ATOM 11085 H HG2  . LYS A 1 145 ? 25.334  -34.062 45.212  1.00 0.00 ? 145 LYS A HG2  5  
ATOM 11086 H HG3  . LYS A 1 145 ? 23.933  -33.306 44.450  1.00 0.00 ? 145 LYS A HG3  5  
ATOM 11087 H HD2  . LYS A 1 145 ? 23.458  -32.633 46.999  1.00 0.00 ? 145 LYS A HD2  5  
ATOM 11088 H HD3  . LYS A 1 145 ? 25.218  -32.744 47.057  1.00 0.00 ? 145 LYS A HD3  5  
ATOM 11089 H HE2  . LYS A 1 145 ? 25.500  -30.907 45.784  1.00 0.00 ? 145 LYS A HE2  5  
ATOM 11090 H HE3  . LYS A 1 145 ? 24.139  -31.301 44.736  1.00 0.00 ? 145 LYS A HE3  5  
ATOM 11091 H HZ1  . LYS A 1 145 ? 24.230  -29.427 46.799  1.00 0.00 ? 145 LYS A HZ1  5  
ATOM 11092 H HZ2  . LYS A 1 145 ? 23.159  -30.644 47.281  1.00 0.00 ? 145 LYS A HZ2  5  
ATOM 11093 H HZ3  . LYS A 1 145 ? 22.913  -29.831 45.818  1.00 0.00 ? 145 LYS A HZ3  5  
ATOM 11094 N N    . ASP A 1 146 ? 24.021  -37.484 47.215  1.00 0.00 ? 146 ASP A N    5  
ATOM 11095 C CA   . ASP A 1 146 ? 23.689  -38.546 48.158  1.00 0.00 ? 146 ASP A CA   5  
ATOM 11096 C C    . ASP A 1 146 ? 23.705  -38.025 49.592  1.00 0.00 ? 146 ASP A C    5  
ATOM 11097 O O    . ASP A 1 146 ? 22.826  -38.348 50.390  1.00 0.00 ? 146 ASP A O    5  
ATOM 11098 C CB   . ASP A 1 146 ? 24.671  -39.709 48.014  1.00 0.00 ? 146 ASP A CB   5  
ATOM 11099 C CG   . ASP A 1 146 ? 26.106  -39.241 47.868  1.00 0.00 ? 146 ASP A CG   5  
ATOM 11100 O OD1  . ASP A 1 146 ? 26.504  -38.893 46.737  1.00 0.00 ? 146 ASP A OD1  5  
ATOM 11101 O OD2  . ASP A 1 146 ? 26.831  -39.224 48.884  1.00 0.00 ? 146 ASP A OD2  5  
ATOM 11102 H H    . ASP A 1 146 ? 24.735  -36.851 47.440  1.00 0.00 ? 146 ASP A H    5  
ATOM 11103 H HA   . ASP A 1 146 ? 22.695  -38.896 47.927  1.00 0.00 ? 146 ASP A HA   5  
ATOM 11104 H HB2  . ASP A 1 146 ? 24.605  -40.338 48.890  1.00 0.00 ? 146 ASP A HB2  5  
ATOM 11105 H HB3  . ASP A 1 146 ? 24.409  -40.287 47.140  1.00 0.00 ? 146 ASP A HB3  5  
ATOM 11106 N N    . ALA A 1 147 ? 24.712  -37.218 49.911  1.00 0.00 ? 147 ALA A N    5  
ATOM 11107 C CA   . ALA A 1 147 ? 24.842  -36.652 51.248  1.00 0.00 ? 147 ALA A CA   5  
ATOM 11108 C C    . ALA A 1 147 ? 25.000  -37.748 52.296  1.00 0.00 ? 147 ALA A C    5  
ATOM 11109 O O    . ALA A 1 147 ? 25.897  -37.691 53.138  1.00 0.00 ? 147 ALA A O    5  
ATOM 11110 C CB   . ALA A 1 147 ? 23.638  -35.780 51.571  1.00 0.00 ? 147 ALA A CB   5  
ATOM 11111 H H    . ALA A 1 147 ? 25.382  -36.997 49.231  1.00 0.00 ? 147 ALA A H    5  
ATOM 11112 H HA   . ALA A 1 147 ? 25.723  -36.026 51.261  1.00 0.00 ? 147 ALA A HA   5  
ATOM 11113 H HB1  . ALA A 1 147 ? 23.043  -35.644 50.680  1.00 0.00 ? 147 ALA A HB1  5  
ATOM 11114 H HB2  . ALA A 1 147 ? 23.041  -36.259 52.333  1.00 0.00 ? 147 ALA A HB2  5  
ATOM 11115 H HB3  . ALA A 1 147 ? 23.975  -34.819 51.929  1.00 0.00 ? 147 ALA A HB3  5  
ATOM 11116 N N    . MET A 1 1   ? 14.848  -32.074 -20.350 1.00 0.00 ? 1   MET A N    6  
ATOM 11117 C CA   . MET A 1 1   ? 13.641  -32.321 -19.570 1.00 0.00 ? 1   MET A CA   6  
ATOM 11118 C C    . MET A 1 1   ? 13.918  -32.167 -18.078 1.00 0.00 ? 1   MET A C    6  
ATOM 11119 O O    . MET A 1 1   ? 13.022  -31.835 -17.301 1.00 0.00 ? 1   MET A O    6  
ATOM 11120 C CB   . MET A 1 1   ? 13.100  -33.722 -19.859 1.00 0.00 ? 1   MET A CB   6  
ATOM 11121 C CG   . MET A 1 1   ? 11.586  -33.774 -19.990 1.00 0.00 ? 1   MET A CG   6  
ATOM 11122 S SD   . MET A 1 1   ? 11.022  -33.421 -21.665 1.00 0.00 ? 1   MET A SD   6  
ATOM 11123 C CE   . MET A 1 1   ? 9.763   -34.678 -21.870 1.00 0.00 ? 1   MET A CE   6  
ATOM 11124 H H1   . MET A 1 1   ? 15.242  -32.808 -20.866 1.00 0.00 ? 1   MET A H1   6  
ATOM 11125 H HA   . MET A 1 1   ? 12.902  -31.591 -19.865 1.00 0.00 ? 1   MET A HA   6  
ATOM 11126 H HB2  . MET A 1 1   ? 13.532  -34.079 -20.782 1.00 0.00 ? 1   MET A HB2  6  
ATOM 11127 H HB3  . MET A 1 1   ? 13.392  -34.381 -19.055 1.00 0.00 ? 1   MET A HB3  6  
ATOM 11128 H HG2  . MET A 1 1   ? 11.247  -34.760 -19.712 1.00 0.00 ? 1   MET A HG2  6  
ATOM 11129 H HG3  . MET A 1 1   ? 11.156  -33.045 -19.318 1.00 0.00 ? 1   MET A HG3  6  
ATOM 11130 H HE1  . MET A 1 1   ? 10.142  -35.468 -22.502 1.00 0.00 ? 1   MET A HE1  6  
ATOM 11131 H HE2  . MET A 1 1   ? 9.499   -35.084 -20.905 1.00 0.00 ? 1   MET A HE2  6  
ATOM 11132 H HE3  . MET A 1 1   ? 8.888   -34.240 -22.328 1.00 0.00 ? 1   MET A HE3  6  
ATOM 11133 N N    . LYS A 1 2   ? 15.163  -32.411 -17.683 1.00 0.00 ? 2   LYS A N    6  
ATOM 11134 C CA   . LYS A 1 2   ? 15.558  -32.299 -16.284 1.00 0.00 ? 2   LYS A CA   6  
ATOM 11135 C C    . LYS A 1 2   ? 17.019  -31.877 -16.163 1.00 0.00 ? 2   LYS A C    6  
ATOM 11136 O O    . LYS A 1 2   ? 17.882  -32.682 -15.813 1.00 0.00 ? 2   LYS A O    6  
ATOM 11137 C CB   . LYS A 1 2   ? 15.339  -33.630 -15.563 1.00 0.00 ? 2   LYS A CB   6  
ATOM 11138 C CG   . LYS A 1 2   ? 15.852  -34.833 -16.337 1.00 0.00 ? 2   LYS A CG   6  
ATOM 11139 C CD   . LYS A 1 2   ? 15.742  -36.110 -15.520 1.00 0.00 ? 2   LYS A CD   6  
ATOM 11140 C CE   . LYS A 1 2   ? 14.954  -37.179 -16.261 1.00 0.00 ? 2   LYS A CE   6  
ATOM 11141 N NZ   . LYS A 1 2   ? 15.669  -37.649 -17.480 1.00 0.00 ? 2   LYS A NZ   6  
ATOM 11142 H H    . LYS A 1 2   ? 15.833  -32.672 -18.349 1.00 0.00 ? 2   LYS A H    6  
ATOM 11143 H HA   . LYS A 1 2   ? 14.939  -31.544 -15.824 1.00 0.00 ? 2   LYS A HA   6  
ATOM 11144 H HB2  . LYS A 1 2   ? 15.848  -33.598 -14.610 1.00 0.00 ? 2   LYS A HB2  6  
ATOM 11145 H HB3  . LYS A 1 2   ? 14.281  -33.764 -15.391 1.00 0.00 ? 2   LYS A HB3  6  
ATOM 11146 H HG2  . LYS A 1 2   ? 15.268  -34.944 -17.239 1.00 0.00 ? 2   LYS A HG2  6  
ATOM 11147 H HG3  . LYS A 1 2   ? 16.888  -34.668 -16.594 1.00 0.00 ? 2   LYS A HG3  6  
ATOM 11148 H HD2  . LYS A 1 2   ? 16.735  -36.484 -15.319 1.00 0.00 ? 2   LYS A HD2  6  
ATOM 11149 H HD3  . LYS A 1 2   ? 15.243  -35.888 -14.587 1.00 0.00 ? 2   LYS A HD3  6  
ATOM 11150 H HE2  . LYS A 1 2   ? 14.800  -38.017 -15.599 1.00 0.00 ? 2   LYS A HE2  6  
ATOM 11151 H HE3  . LYS A 1 2   ? 13.998  -36.768 -16.550 1.00 0.00 ? 2   LYS A HE3  6  
ATOM 11152 H HZ1  . LYS A 1 2   ? 15.287  -37.173 -18.323 1.00 0.00 ? 2   LYS A HZ1  6  
ATOM 11153 H HZ2  . LYS A 1 2   ? 15.548  -38.676 -17.592 1.00 0.00 ? 2   LYS A HZ2  6  
ATOM 11154 H HZ3  . LYS A 1 2   ? 16.684  -37.436 -17.405 1.00 0.00 ? 2   LYS A HZ3  6  
ATOM 11155 N N    . LYS A 1 3   ? 17.290  -30.609 -16.454 1.00 0.00 ? 3   LYS A N    6  
ATOM 11156 C CA   . LYS A 1 3   ? 18.646  -30.079 -16.376 1.00 0.00 ? 3   LYS A CA   6  
ATOM 11157 C C    . LYS A 1 3   ? 18.628  -28.581 -16.088 1.00 0.00 ? 3   LYS A C    6  
ATOM 11158 O O    . LYS A 1 3   ? 17.712  -27.870 -16.501 1.00 0.00 ? 3   LYS A O    6  
ATOM 11159 C CB   . LYS A 1 3   ? 19.397  -30.349 -17.681 1.00 0.00 ? 3   LYS A CB   6  
ATOM 11160 C CG   . LYS A 1 3   ? 20.891  -30.553 -17.492 1.00 0.00 ? 3   LYS A CG   6  
ATOM 11161 C CD   . LYS A 1 3   ? 21.428  -31.632 -18.418 1.00 0.00 ? 3   LYS A CD   6  
ATOM 11162 C CE   . LYS A 1 3   ? 21.643  -31.101 -19.827 1.00 0.00 ? 3   LYS A CE   6  
ATOM 11163 N NZ   . LYS A 1 3   ? 20.986  -31.961 -20.850 1.00 0.00 ? 3   LYS A NZ   6  
ATOM 11164 H H    . LYS A 1 3   ? 16.559  -30.015 -16.727 1.00 0.00 ? 3   LYS A H    6  
ATOM 11165 H HA   . LYS A 1 3   ? 19.153  -30.583 -15.567 1.00 0.00 ? 3   LYS A HA   6  
ATOM 11166 H HB2  . LYS A 1 3   ? 18.989  -31.237 -18.140 1.00 0.00 ? 3   LYS A HB2  6  
ATOM 11167 H HB3  . LYS A 1 3   ? 19.251  -29.511 -18.347 1.00 0.00 ? 3   LYS A HB3  6  
ATOM 11168 H HG2  . LYS A 1 3   ? 21.401  -29.626 -17.704 1.00 0.00 ? 3   LYS A HG2  6  
ATOM 11169 H HG3  . LYS A 1 3   ? 21.078  -30.844 -16.468 1.00 0.00 ? 3   LYS A HG3  6  
ATOM 11170 H HD2  . LYS A 1 3   ? 22.371  -31.989 -18.032 1.00 0.00 ? 3   LYS A HD2  6  
ATOM 11171 H HD3  . LYS A 1 3   ? 20.720  -32.448 -18.454 1.00 0.00 ? 3   LYS A HD3  6  
ATOM 11172 H HE2  . LYS A 1 3   ? 21.232  -30.105 -19.889 1.00 0.00 ? 3   LYS A HE2  6  
ATOM 11173 H HE3  . LYS A 1 3   ? 22.704  -31.065 -20.025 1.00 0.00 ? 3   LYS A HE3  6  
ATOM 11174 H HZ1  . LYS A 1 3   ? 21.133  -31.562 -21.799 1.00 0.00 ? 3   LYS A HZ1  6  
ATOM 11175 H HZ2  . LYS A 1 3   ? 19.965  -32.019 -20.665 1.00 0.00 ? 3   LYS A HZ2  6  
ATOM 11176 H HZ3  . LYS A 1 3   ? 21.388  -32.920 -20.822 1.00 0.00 ? 3   LYS A HZ3  6  
ATOM 11177 N N    . VAL A 1 4   ? 19.647  -28.107 -15.378 1.00 0.00 ? 4   VAL A N    6  
ATOM 11178 C CA   . VAL A 1 4   ? 19.750  -26.693 -15.038 1.00 0.00 ? 4   VAL A CA   6  
ATOM 11179 C C    . VAL A 1 4   ? 20.199  -25.870 -16.239 1.00 0.00 ? 4   VAL A C    6  
ATOM 11180 O O    . VAL A 1 4   ? 21.264  -25.251 -16.219 1.00 0.00 ? 4   VAL A O    6  
ATOM 11181 C CB   . VAL A 1 4   ? 20.736  -26.466 -13.876 1.00 0.00 ? 4   VAL A CB   6  
ATOM 11182 C CG1  . VAL A 1 4   ? 20.579  -25.063 -13.310 1.00 0.00 ? 4   VAL A CG1  6  
ATOM 11183 C CG2  . VAL A 1 4   ? 20.532  -27.513 -12.792 1.00 0.00 ? 4   VAL A CG2  6  
ATOM 11184 H H    . VAL A 1 4   ? 20.347  -28.723 -15.077 1.00 0.00 ? 4   VAL A H    6  
ATOM 11185 H HA   . VAL A 1 4   ? 18.774  -26.353 -14.725 1.00 0.00 ? 4   VAL A HA   6  
ATOM 11186 H HB   . VAL A 1 4   ? 21.741  -26.566 -14.259 1.00 0.00 ? 4   VAL A HB   6  
ATOM 11187 H HG11 . VAL A 1 4   ? 21.210  -24.380 -13.861 1.00 0.00 ? 4   VAL A HG11 6  
ATOM 11188 H HG12 . VAL A 1 4   ? 19.549  -24.752 -13.396 1.00 0.00 ? 4   VAL A HG12 6  
ATOM 11189 H HG13 . VAL A 1 4   ? 20.871  -25.060 -12.270 1.00 0.00 ? 4   VAL A HG13 6  
ATOM 11190 H HG21 . VAL A 1 4   ? 20.854  -28.477 -13.158 1.00 0.00 ? 4   VAL A HG21 6  
ATOM 11191 H HG22 . VAL A 1 4   ? 21.112  -27.247 -11.920 1.00 0.00 ? 4   VAL A HG22 6  
ATOM 11192 H HG23 . VAL A 1 4   ? 19.486  -27.559 -12.528 1.00 0.00 ? 4   VAL A HG23 6  
ATOM 11193 N N    . VAL A 1 5   ? 19.381  -25.866 -17.287 1.00 0.00 ? 5   VAL A N    6  
ATOM 11194 C CA   . VAL A 1 5   ? 19.692  -25.117 -18.498 1.00 0.00 ? 5   VAL A CA   6  
ATOM 11195 C C    . VAL A 1 5   ? 20.177  -23.710 -18.165 1.00 0.00 ? 5   VAL A C    6  
ATOM 11196 O O    . VAL A 1 5   ? 21.134  -23.215 -18.760 1.00 0.00 ? 5   VAL A O    6  
ATOM 11197 C CB   . VAL A 1 5   ? 18.469  -25.019 -19.428 1.00 0.00 ? 5   VAL A CB   6  
ATOM 11198 C CG1  . VAL A 1 5   ? 18.157  -26.374 -20.044 1.00 0.00 ? 5   VAL A CG1  6  
ATOM 11199 C CG2  . VAL A 1 5   ? 17.265  -24.479 -18.670 1.00 0.00 ? 5   VAL A CG2  6  
ATOM 11200 H H    . VAL A 1 5   ? 18.547  -26.378 -17.243 1.00 0.00 ? 5   VAL A H    6  
ATOM 11201 H HA   . VAL A 1 5   ? 20.477  -25.642 -19.023 1.00 0.00 ? 5   VAL A HA   6  
ATOM 11202 H HB   . VAL A 1 5   ? 18.703  -24.331 -20.227 1.00 0.00 ? 5   VAL A HB   6  
ATOM 11203 H HG11 . VAL A 1 5   ? 19.045  -26.769 -20.515 1.00 0.00 ? 5   VAL A HG11 6  
ATOM 11204 H HG12 . VAL A 1 5   ? 17.825  -27.054 -19.272 1.00 0.00 ? 5   VAL A HG12 6  
ATOM 11205 H HG13 . VAL A 1 5   ? 17.377  -26.263 -20.784 1.00 0.00 ? 5   VAL A HG13 6  
ATOM 11206 H HG21 . VAL A 1 5   ? 17.134  -25.041 -17.758 1.00 0.00 ? 5   VAL A HG21 6  
ATOM 11207 H HG22 . VAL A 1 5   ? 17.428  -23.438 -18.431 1.00 0.00 ? 5   VAL A HG22 6  
ATOM 11208 H HG23 . VAL A 1 5   ? 16.381  -24.574 -19.283 1.00 0.00 ? 5   VAL A HG23 6  
ATOM 11209 N N    . ALA A 1 6   ? 19.511  -23.071 -17.209 1.00 0.00 ? 6   ALA A N    6  
ATOM 11210 C CA   . ALA A 1 6   ? 19.875  -21.722 -16.795 1.00 0.00 ? 6   ALA A CA   6  
ATOM 11211 C C    . ALA A 1 6   ? 19.304  -21.398 -15.418 1.00 0.00 ? 6   ALA A C    6  
ATOM 11212 O O    . ALA A 1 6   ? 18.230  -21.875 -15.052 1.00 0.00 ? 6   ALA A O    6  
ATOM 11213 C CB   . ALA A 1 6   ? 19.394  -20.707 -17.821 1.00 0.00 ? 6   ALA A CB   6  
ATOM 11214 H H    . ALA A 1 6   ? 18.757  -23.518 -16.772 1.00 0.00 ? 6   ALA A H    6  
ATOM 11215 H HA   . ALA A 1 6   ? 20.953  -21.667 -16.748 1.00 0.00 ? 6   ALA A HA   6  
ATOM 11216 H HB1  . ALA A 1 6   ? 19.900  -19.766 -17.659 1.00 0.00 ? 6   ALA A HB1  6  
ATOM 11217 H HB2  . ALA A 1 6   ? 19.613  -21.068 -18.814 1.00 0.00 ? 6   ALA A HB2  6  
ATOM 11218 H HB3  . ALA A 1 6   ? 18.329  -20.565 -17.715 1.00 0.00 ? 6   ALA A HB3  6  
ATOM 11219 N N    . VAL A 1 7   ? 20.030  -20.583 -14.659 1.00 0.00 ? 7   VAL A N    6  
ATOM 11220 C CA   . VAL A 1 7   ? 19.595  -20.194 -13.323 1.00 0.00 ? 7   VAL A CA   6  
ATOM 11221 C C    . VAL A 1 7   ? 19.745  -18.692 -13.111 1.00 0.00 ? 7   VAL A C    6  
ATOM 11222 O O    . VAL A 1 7   ? 20.694  -18.077 -13.598 1.00 0.00 ? 7   VAL A O    6  
ATOM 11223 C CB   . VAL A 1 7   ? 20.393  -20.937 -12.235 1.00 0.00 ? 7   VAL A CB   6  
ATOM 11224 C CG1  . VAL A 1 7   ? 21.887  -20.764 -12.456 1.00 0.00 ? 7   VAL A CG1  6  
ATOM 11225 C CG2  . VAL A 1 7   ? 19.990  -20.448 -10.852 1.00 0.00 ? 7   VAL A CG2  6  
ATOM 11226 H H    . VAL A 1 7   ? 20.877  -20.234 -15.006 1.00 0.00 ? 7   VAL A H    6  
ATOM 11227 H HA   . VAL A 1 7   ? 18.553  -20.460 -13.220 1.00 0.00 ? 7   VAL A HA   6  
ATOM 11228 H HB   . VAL A 1 7   ? 20.161  -21.990 -12.302 1.00 0.00 ? 7   VAL A HB   6  
ATOM 11229 H HG11 . VAL A 1 7   ? 22.133  -21.026 -13.475 1.00 0.00 ? 7   VAL A HG11 6  
ATOM 11230 H HG12 . VAL A 1 7   ? 22.163  -19.736 -12.271 1.00 0.00 ? 7   VAL A HG12 6  
ATOM 11231 H HG13 . VAL A 1 7   ? 22.429  -21.409 -11.780 1.00 0.00 ? 7   VAL A HG13 6  
ATOM 11232 H HG21 . VAL A 1 7   ? 20.616  -19.614 -10.570 1.00 0.00 ? 7   VAL A HG21 6  
ATOM 11233 H HG22 . VAL A 1 7   ? 18.957  -20.133 -10.867 1.00 0.00 ? 7   VAL A HG22 6  
ATOM 11234 H HG23 . VAL A 1 7   ? 20.112  -21.248 -10.137 1.00 0.00 ? 7   VAL A HG23 6  
ATOM 11235 N N    . VAL A 1 8   ? 18.802  -18.106 -12.380 1.00 0.00 ? 8   VAL A N    6  
ATOM 11236 C CA   . VAL A 1 8   ? 18.830  -16.675 -12.102 1.00 0.00 ? 8   VAL A CA   6  
ATOM 11237 C C    . VAL A 1 8   ? 19.764  -16.359 -10.939 1.00 0.00 ? 8   VAL A C    6  
ATOM 11238 O O    . VAL A 1 8   ? 19.899  -17.149 -10.004 1.00 0.00 ? 8   VAL A O    6  
ATOM 11239 C CB   . VAL A 1 8   ? 17.424  -16.139 -11.776 1.00 0.00 ? 8   VAL A CB   6  
ATOM 11240 C CG1  . VAL A 1 8   ? 16.994  -16.577 -10.384 1.00 0.00 ? 8   VAL A CG1  6  
ATOM 11241 C CG2  . VAL A 1 8   ? 17.389  -14.623 -11.901 1.00 0.00 ? 8   VAL A CG2  6  
ATOM 11242 H H    . VAL A 1 8   ? 18.071  -18.649 -12.019 1.00 0.00 ? 8   VAL A H    6  
ATOM 11243 H HA   . VAL A 1 8   ? 19.189  -16.169 -12.987 1.00 0.00 ? 8   VAL A HA   6  
ATOM 11244 H HB   . VAL A 1 8   ? 16.728  -16.554 -12.491 1.00 0.00 ? 8   VAL A HB   6  
ATOM 11245 H HG11 . VAL A 1 8   ? 17.173  -17.636 -10.270 1.00 0.00 ? 8   VAL A HG11 6  
ATOM 11246 H HG12 . VAL A 1 8   ? 17.562  -16.033 -9.644  1.00 0.00 ? 8   VAL A HG12 6  
ATOM 11247 H HG13 . VAL A 1 8   ? 15.942  -16.374 -10.252 1.00 0.00 ? 8   VAL A HG13 6  
ATOM 11248 H HG21 . VAL A 1 8   ? 17.057  -14.193 -10.968 1.00 0.00 ? 8   VAL A HG21 6  
ATOM 11249 H HG22 . VAL A 1 8   ? 18.379  -14.258 -12.133 1.00 0.00 ? 8   VAL A HG22 6  
ATOM 11250 H HG23 . VAL A 1 8   ? 16.708  -14.342 -12.690 1.00 0.00 ? 8   VAL A HG23 6  
ATOM 11251 N N    . LYS A 1 9   ? 20.408  -15.198 -11.003 1.00 0.00 ? 9   LYS A N    6  
ATOM 11252 C CA   . LYS A 1 9   ? 21.329  -14.775 -9.955  1.00 0.00 ? 9   LYS A CA   6  
ATOM 11253 C C    . LYS A 1 9   ? 21.158  -13.291 -9.646  1.00 0.00 ? 9   LYS A C    6  
ATOM 11254 O O    . LYS A 1 9   ? 21.468  -12.434 -10.475 1.00 0.00 ? 9   LYS A O    6  
ATOM 11255 C CB   . LYS A 1 9   ? 22.774  -15.056 -10.373 1.00 0.00 ? 9   LYS A CB   6  
ATOM 11256 C CG   . LYS A 1 9   ? 23.123  -14.521 -11.751 1.00 0.00 ? 9   LYS A CG   6  
ATOM 11257 C CD   . LYS A 1 9   ? 24.462  -13.803 -11.748 1.00 0.00 ? 9   LYS A CD   6  
ATOM 11258 C CE   . LYS A 1 9   ? 25.617  -14.775 -11.935 1.00 0.00 ? 9   LYS A CE   6  
ATOM 11259 N NZ   . LYS A 1 9   ? 26.167  -14.722 -13.318 1.00 0.00 ? 9   LYS A NZ   6  
ATOM 11260 H H    . LYS A 1 9   ? 20.259  -14.611 -11.774 1.00 0.00 ? 9   LYS A H    6  
ATOM 11261 H HA   . LYS A 1 9   ? 21.104  -15.344 -9.065  1.00 0.00 ? 9   LYS A HA   6  
ATOM 11262 H HB2  . LYS A 1 9   ? 23.440  -14.602 -9.654  1.00 0.00 ? 9   LYS A HB2  6  
ATOM 11263 H HB3  . LYS A 1 9   ? 22.935  -16.125 -10.374 1.00 0.00 ? 9   LYS A HB3  6  
ATOM 11264 H HG2  . LYS A 1 9   ? 23.172  -15.347 -12.446 1.00 0.00 ? 9   LYS A HG2  6  
ATOM 11265 H HG3  . LYS A 1 9   ? 22.354  -13.830 -12.064 1.00 0.00 ? 9   LYS A HG3  6  
ATOM 11266 H HD2  . LYS A 1 9   ? 24.477  -13.084 -12.554 1.00 0.00 ? 9   LYS A HD2  6  
ATOM 11267 H HD3  . LYS A 1 9   ? 24.584  -13.291 -10.804 1.00 0.00 ? 9   LYS A HD3  6  
ATOM 11268 H HE2  . LYS A 1 9   ? 26.399  -14.523 -11.236 1.00 0.00 ? 9   LYS A HE2  6  
ATOM 11269 H HE3  . LYS A 1 9   ? 25.264  -15.776 -11.735 1.00 0.00 ? 9   LYS A HE3  6  
ATOM 11270 H HZ1  . LYS A 1 9   ? 26.291  -13.733 -13.616 1.00 0.00 ? 9   LYS A HZ1  6  
ATOM 11271 H HZ2  . LYS A 1 9   ? 25.517  -15.192 -13.980 1.00 0.00 ? 9   LYS A HZ2  6  
ATOM 11272 H HZ3  . LYS A 1 9   ? 27.089  -15.203 -13.355 1.00 0.00 ? 9   LYS A HZ3  6  
ATOM 11273 N N    . LEU A 1 10  ? 20.663  -12.994 -8.450  1.00 0.00 ? 10  LEU A N    6  
ATOM 11274 C CA   . LEU A 1 10  ? 20.452  -11.613 -8.031  1.00 0.00 ? 10  LEU A CA   6  
ATOM 11275 C C    . LEU A 1 10  ? 20.571  -11.479 -6.516  1.00 0.00 ? 10  LEU A C    6  
ATOM 11276 O O    . LEU A 1 10  ? 20.236  -12.402 -5.774  1.00 0.00 ? 10  LEU A O    6  
ATOM 11277 C CB   . LEU A 1 10  ? 19.078  -11.124 -8.491  1.00 0.00 ? 10  LEU A CB   6  
ATOM 11278 C CG   . LEU A 1 10  ? 19.062  -9.820  -9.289  1.00 0.00 ? 10  LEU A CG   6  
ATOM 11279 C CD1  . LEU A 1 10  ? 19.755  -8.711  -8.513  1.00 0.00 ? 10  LEU A CD1  6  
ATOM 11280 C CD2  . LEU A 1 10  ? 19.722  -10.017 -10.646 1.00 0.00 ? 10  LEU A CD2  6  
ATOM 11281 H H    . LEU A 1 10  ? 20.435  -13.720 -7.833  1.00 0.00 ? 10  LEU A H    6  
ATOM 11282 H HA   . LEU A 1 10  ? 21.215  -11.006 -8.495  1.00 0.00 ? 10  LEU A HA   6  
ATOM 11283 H HB2  . LEU A 1 10  ? 18.642  -11.895 -9.109  1.00 0.00 ? 10  LEU A HB2  6  
ATOM 11284 H HB3  . LEU A 1 10  ? 18.466  -10.982 -7.611  1.00 0.00 ? 10  LEU A HB3  6  
ATOM 11285 H HG   . LEU A 1 10  ? 18.036  -9.520  -9.456  1.00 0.00 ? 10  LEU A HG   6  
ATOM 11286 H HD11 . LEU A 1 10  ? 19.317  -7.760  -8.776  1.00 0.00 ? 10  LEU A HD11 6  
ATOM 11287 H HD12 . LEU A 1 10  ? 20.806  -8.703  -8.758  1.00 0.00 ? 10  LEU A HD12 6  
ATOM 11288 H HD13 . LEU A 1 10  ? 19.634  -8.883  -7.454  1.00 0.00 ? 10  LEU A HD13 6  
ATOM 11289 H HD21 . LEU A 1 10  ? 20.785  -10.150 -10.512 1.00 0.00 ? 10  LEU A HD21 6  
ATOM 11290 H HD22 . LEU A 1 10  ? 19.543  -9.148  -11.263 1.00 0.00 ? 10  LEU A HD22 6  
ATOM 11291 H HD23 . LEU A 1 10  ? 19.307  -10.891 -11.125 1.00 0.00 ? 10  LEU A HD23 6  
ATOM 11292 N N    . GLN A 1 11  ? 21.047  -10.323 -6.065  1.00 0.00 ? 11  GLN A N    6  
ATOM 11293 C CA   . GLN A 1 11  ? 21.208  -10.068 -4.638  1.00 0.00 ? 11  GLN A CA   6  
ATOM 11294 C C    . GLN A 1 11  ? 20.445  -8.817  -4.219  1.00 0.00 ? 11  GLN A C    6  
ATOM 11295 O O    . GLN A 1 11  ? 20.531  -7.776  -4.872  1.00 0.00 ? 11  GLN A O    6  
ATOM 11296 C CB   . GLN A 1 11  ? 22.690  -9.917  -4.290  1.00 0.00 ? 11  GLN A CB   6  
ATOM 11297 C CG   . GLN A 1 11  ? 22.941  -9.064  -3.056  1.00 0.00 ? 11  GLN A CG   6  
ATOM 11298 C CD   . GLN A 1 11  ? 24.406  -9.013  -2.670  1.00 0.00 ? 11  GLN A CD   6  
ATOM 11299 O OE1  . GLN A 1 11  ? 25.164  -9.945  -2.940  1.00 0.00 ? 11  GLN A OE1  6  
ATOM 11300 N NE2  . GLN A 1 11  ? 24.813  -7.920  -2.036  1.00 0.00 ? 11  GLN A NE2  6  
ATOM 11301 H H    . GLN A 1 11  ? 21.297  -9.626  -6.706  1.00 0.00 ? 11  GLN A H    6  
ATOM 11302 H HA   . GLN A 1 11  ? 20.807  -10.916 -4.103  1.00 0.00 ? 11  GLN A HA   6  
ATOM 11303 H HB2  . GLN A 1 11  ? 23.109  -10.896 -4.116  1.00 0.00 ? 11  GLN A HB2  6  
ATOM 11304 H HB3  . GLN A 1 11  ? 23.199  -9.460  -5.126  1.00 0.00 ? 11  GLN A HB3  6  
ATOM 11305 H HG2  . GLN A 1 11  ? 22.601  -8.058  -3.254  1.00 0.00 ? 11  GLN A HG2  6  
ATOM 11306 H HG3  . GLN A 1 11  ? 22.380  -9.476  -2.230  1.00 0.00 ? 11  GLN A HG3  6  
ATOM 11307 H HE21 . GLN A 1 11  ? 24.153  -7.218  -1.854  1.00 0.00 ? 11  GLN A HE21 6  
ATOM 11308 H HE22 . GLN A 1 11  ? 25.755  -7.860  -1.774  1.00 0.00 ? 11  GLN A HE22 6  
ATOM 11309 N N    . LEU A 1 12  ? 19.697  -8.924  -3.126  1.00 0.00 ? 12  LEU A N    6  
ATOM 11310 C CA   . LEU A 1 12  ? 18.917  -7.801  -2.619  1.00 0.00 ? 12  LEU A CA   6  
ATOM 11311 C C    . LEU A 1 12  ? 18.750  -7.892  -1.106  1.00 0.00 ? 12  LEU A C    6  
ATOM 11312 O O    . LEU A 1 12  ? 18.772  -8.974  -0.519  1.00 0.00 ? 12  LEU A O    6  
ATOM 11313 C CB   . LEU A 1 12  ? 17.544  -7.762  -3.294  1.00 0.00 ? 12  LEU A CB   6  
ATOM 11314 C CG   . LEU A 1 12  ? 17.543  -7.872  -4.819  1.00 0.00 ? 12  LEU A CG   6  
ATOM 11315 C CD1  . LEU A 1 12  ? 16.158  -8.246  -5.326  1.00 0.00 ? 12  LEU A CD1  6  
ATOM 11316 C CD2  . LEU A 1 12  ? 18.009  -6.568  -5.449  1.00 0.00 ? 12  LEU A CD2  6  
ATOM 11317 H H    . LEU A 1 12  ? 19.668  -9.779  -2.648  1.00 0.00 ? 12  LEU A H    6  
ATOM 11318 H HA   . LEU A 1 12  ? 19.451  -6.893  -2.856  1.00 0.00 ? 12  LEU A HA   6  
ATOM 11319 H HB2  . LEU A 1 12  ? 16.960  -8.580  -2.903  1.00 0.00 ? 12  LEU A HB2  6  
ATOM 11320 H HB3  . LEU A 1 12  ? 17.073  -6.826  -3.028  1.00 0.00 ? 12  LEU A HB3  6  
ATOM 11321 H HG   . LEU A 1 12  ? 18.229  -8.653  -5.118  1.00 0.00 ? 12  LEU A HG   6  
ATOM 11322 H HD11 . LEU A 1 12  ? 16.250  -8.961  -6.129  1.00 0.00 ? 12  LEU A HD11 6  
ATOM 11323 H HD12 . LEU A 1 12  ? 15.656  -7.360  -5.687  1.00 0.00 ? 12  LEU A HD12 6  
ATOM 11324 H HD13 . LEU A 1 12  ? 15.585  -8.680  -4.520  1.00 0.00 ? 12  LEU A HD13 6  
ATOM 11325 H HD21 . LEU A 1 12  ? 18.634  -6.784  -6.303  1.00 0.00 ? 12  LEU A HD21 6  
ATOM 11326 H HD22 . LEU A 1 12  ? 18.575  -6.000  -4.724  1.00 0.00 ? 12  LEU A HD22 6  
ATOM 11327 H HD23 . LEU A 1 12  ? 17.151  -5.994  -5.766  1.00 0.00 ? 12  LEU A HD23 6  
ATOM 11328 N N    . PRO A 1 13  ? 18.576  -6.731  -0.458  1.00 0.00 ? 13  PRO A N    6  
ATOM 11329 C CA   . PRO A 1 13  ? 18.399  -6.654  0.995   1.00 0.00 ? 13  PRO A CA   6  
ATOM 11330 C C    . PRO A 1 13  ? 17.056  -7.219  1.446   1.00 0.00 ? 13  PRO A C    6  
ATOM 11331 O O    . PRO A 1 13  ? 16.036  -7.021  0.787   1.00 0.00 ? 13  PRO A O    6  
ATOM 11332 C CB   . PRO A 1 13  ? 18.471  -5.152  1.282   1.00 0.00 ? 13  PRO A CB   6  
ATOM 11333 C CG   . PRO A 1 13  ? 18.054  -4.502  0.008   1.00 0.00 ? 13  PRO A CG   6  
ATOM 11334 C CD   . PRO A 1 13  ? 18.539  -5.403  -1.094  1.00 0.00 ? 13  PRO A CD   6  
ATOM 11335 H HA   . PRO A 1 13  ? 19.196  -7.161  1.519   1.00 0.00 ? 13  PRO A HA   6  
ATOM 11336 H HB2  . PRO A 1 13  ? 17.798  -4.905  2.091   1.00 0.00 ? 13  PRO A HB2  6  
ATOM 11337 H HB3  . PRO A 1 13  ? 19.481  -4.881  1.551   1.00 0.00 ? 13  PRO A HB3  6  
ATOM 11338 H HG2  . PRO A 1 13  ? 16.979  -4.415  -0.025  1.00 0.00 ? 13  PRO A HG2  6  
ATOM 11339 H HG3  . PRO A 1 13  ? 18.514  -3.529  -0.075  1.00 0.00 ? 13  PRO A HG3  6  
ATOM 11340 H HD2  . PRO A 1 13  ? 17.847  -5.392  -1.923  1.00 0.00 ? 13  PRO A HD2  6  
ATOM 11341 H HD3  . PRO A 1 13  ? 19.525  -5.105  -1.419  1.00 0.00 ? 13  PRO A HD3  6  
ATOM 11342 N N    . ALA A 1 14  ? 17.064  -7.922  2.574   1.00 0.00 ? 14  ALA A N    6  
ATOM 11343 C CA   . ALA A 1 14  ? 15.846  -8.513  3.113   1.00 0.00 ? 14  ALA A CA   6  
ATOM 11344 C C    . ALA A 1 14  ? 14.898  -7.438  3.635   1.00 0.00 ? 14  ALA A C    6  
ATOM 11345 O O    . ALA A 1 14  ? 15.284  -6.597  4.446   1.00 0.00 ? 14  ALA A O    6  
ATOM 11346 C CB   . ALA A 1 14  ? 16.184  -9.502  4.219   1.00 0.00 ? 14  ALA A CB   6  
ATOM 11347 H H    . ALA A 1 14  ? 17.909  -8.045  3.054   1.00 0.00 ? 14  ALA A H    6  
ATOM 11348 H HA   . ALA A 1 14  ? 15.356  -9.055  2.317   1.00 0.00 ? 14  ALA A HA   6  
ATOM 11349 H HB1  . ALA A 1 14  ? 15.455  -9.418  5.012   1.00 0.00 ? 14  ALA A HB1  6  
ATOM 11350 H HB2  . ALA A 1 14  ? 16.169  -10.506 3.821   1.00 0.00 ? 14  ALA A HB2  6  
ATOM 11351 H HB3  . ALA A 1 14  ? 17.167  -9.284  4.608   1.00 0.00 ? 14  ALA A HB3  6  
ATOM 11352 N N    . GLY A 1 15  ? 13.656  -7.471  3.163   1.00 0.00 ? 15  GLY A N    6  
ATOM 11353 C CA   . GLY A 1 15  ? 12.673  -6.493  3.592   1.00 0.00 ? 15  GLY A CA   6  
ATOM 11354 C C    . GLY A 1 15  ? 12.535  -5.342  2.616   1.00 0.00 ? 15  GLY A C    6  
ATOM 11355 O O    . GLY A 1 15  ? 13.521  -4.895  2.028   1.00 0.00 ? 15  GLY A O    6  
ATOM 11356 H H    . GLY A 1 15  ? 13.404  -8.165  2.518   1.00 0.00 ? 15  GLY A H    6  
ATOM 11357 H HA2  . GLY A 1 15  ? 11.715  -6.982  3.694   1.00 0.00 ? 15  GLY A HA2  6  
ATOM 11358 H HA3  . GLY A 1 15  ? 12.969  -6.101  4.554   1.00 0.00 ? 15  GLY A HA3  6  
ATOM 11359 N N    . LYS A 1 16  ? 11.310  -4.860  2.441   1.00 0.00 ? 16  LYS A N    6  
ATOM 11360 C CA   . LYS A 1 16  ? 11.045  -3.754  1.529   1.00 0.00 ? 16  LYS A CA   6  
ATOM 11361 C C    . LYS A 1 16  ? 11.195  -4.198  0.077   1.00 0.00 ? 16  LYS A C    6  
ATOM 11362 O O    . LYS A 1 16  ? 12.236  -3.982  -0.543  1.00 0.00 ? 16  LYS A O    6  
ATOM 11363 C CB   . LYS A 1 16  ? 11.995  -2.589  1.818   1.00 0.00 ? 16  LYS A CB   6  
ATOM 11364 C CG   . LYS A 1 16  ? 11.420  -1.231  1.454   1.00 0.00 ? 16  LYS A CG   6  
ATOM 11365 C CD   . LYS A 1 16  ? 11.571  -0.942  -0.030  1.00 0.00 ? 16  LYS A CD   6  
ATOM 11366 C CE   . LYS A 1 16  ? 12.070  0.474   -0.274  1.00 0.00 ? 16  LYS A CE   6  
ATOM 11367 N NZ   . LYS A 1 16  ? 11.062  1.494   0.128   1.00 0.00 ? 16  LYS A NZ   6  
ATOM 11368 H H    . LYS A 1 16  ? 10.564  -5.258  2.938   1.00 0.00 ? 16  LYS A H    6  
ATOM 11369 H HA   . LYS A 1 16  ? 10.029  -3.427  1.689   1.00 0.00 ? 16  LYS A HA   6  
ATOM 11370 H HB2  . LYS A 1 16  ? 12.231  -2.586  2.872   1.00 0.00 ? 16  LYS A HB2  6  
ATOM 11371 H HB3  . LYS A 1 16  ? 12.905  -2.734  1.254   1.00 0.00 ? 16  LYS A HB3  6  
ATOM 11372 H HG2  . LYS A 1 16  ? 10.371  -1.214  1.708   1.00 0.00 ? 16  LYS A HG2  6  
ATOM 11373 H HG3  . LYS A 1 16  ? 11.941  -0.468  2.015   1.00 0.00 ? 16  LYS A HG3  6  
ATOM 11374 H HD2  . LYS A 1 16  ? 12.279  -1.638  -0.454  1.00 0.00 ? 16  LYS A HD2  6  
ATOM 11375 H HD3  . LYS A 1 16  ? 10.611  -1.064  -0.511  1.00 0.00 ? 16  LYS A HD3  6  
ATOM 11376 H HE2  . LYS A 1 16  ? 12.972  0.627   0.297   1.00 0.00 ? 16  LYS A HE2  6  
ATOM 11377 H HE3  . LYS A 1 16  ? 12.286  0.589   -1.326  1.00 0.00 ? 16  LYS A HE3  6  
ATOM 11378 H HZ1  . LYS A 1 16  ? 10.105  1.162   -0.105  1.00 0.00 ? 16  LYS A HZ1  6  
ATOM 11379 H HZ2  . LYS A 1 16  ? 11.238  2.388   -0.374  1.00 0.00 ? 16  LYS A HZ2  6  
ATOM 11380 H HZ3  . LYS A 1 16  ? 11.118  1.667   1.152   1.00 0.00 ? 16  LYS A HZ3  6  
ATOM 11381 N N    . ALA A 1 17  ? 10.149  -4.817  -0.459  1.00 0.00 ? 17  ALA A N    6  
ATOM 11382 C CA   . ALA A 1 17  ? 10.164  -5.288  -1.838  1.00 0.00 ? 17  ALA A CA   6  
ATOM 11383 C C    . ALA A 1 17  ? 9.285   -4.414  -2.726  1.00 0.00 ? 17  ALA A C    6  
ATOM 11384 O O    . ALA A 1 17  ? 8.369   -3.745  -2.246  1.00 0.00 ? 17  ALA A O    6  
ATOM 11385 C CB   . ALA A 1 17  ? 9.709   -6.738  -1.906  1.00 0.00 ? 17  ALA A CB   6  
ATOM 11386 H H    . ALA A 1 17  ? 9.347   -4.960  0.086   1.00 0.00 ? 17  ALA A H    6  
ATOM 11387 H HA   . ALA A 1 17  ? 11.182  -5.238  -2.197  1.00 0.00 ? 17  ALA A HA   6  
ATOM 11388 H HB1  . ALA A 1 17  ? 10.268  -7.323  -1.190  1.00 0.00 ? 17  ALA A HB1  6  
ATOM 11389 H HB2  . ALA A 1 17  ? 8.656   -6.796  -1.677  1.00 0.00 ? 17  ALA A HB2  6  
ATOM 11390 H HB3  . ALA A 1 17  ? 9.884   -7.123  -2.900  1.00 0.00 ? 17  ALA A HB3  6  
ATOM 11391 N N    . THR A 1 18  ? 9.569   -4.422  -4.025  1.00 0.00 ? 18  THR A N    6  
ATOM 11392 C CA   . THR A 1 18  ? 8.805   -3.629  -4.980  1.00 0.00 ? 18  THR A CA   6  
ATOM 11393 C C    . THR A 1 18  ? 8.353   -4.477  -6.162  1.00 0.00 ? 18  THR A C    6  
ATOM 11394 O O    . THR A 1 18  ? 8.938   -5.515  -6.472  1.00 0.00 ? 18  THR A O    6  
ATOM 11395 C CB   . THR A 1 18  ? 9.627   -2.436  -5.503  1.00 0.00 ? 18  THR A CB   6  
ATOM 11396 O OG1  . THR A 1 18  ? 11.019  -2.772  -5.526  1.00 0.00 ? 18  THR A OG1  6  
ATOM 11397 C CG2  . THR A 1 18  ? 9.412   -1.207  -4.632  1.00 0.00 ? 18  THR A CG2  6  
ATOM 11398 H H    . THR A 1 18  ? 10.311  -4.975  -4.347  1.00 0.00 ? 18  THR A H    6  
ATOM 11399 H HA   . THR A 1 18  ? 7.934   -3.243  -4.471  1.00 0.00 ? 18  THR A HA   6  
ATOM 11400 H HB   . THR A 1 18  ? 9.302   -2.208  -6.508  1.00 0.00 ? 18  THR A HB   6  
ATOM 11401 H HG1  . THR A 1 18  ? 11.236  -3.178  -6.369  1.00 0.00 ? 18  THR A HG1  6  
ATOM 11402 H HG21 . THR A 1 18  ? 9.445   -1.493  -3.591  1.00 0.00 ? 18  THR A HG21 6  
ATOM 11403 H HG22 . THR A 1 18  ? 8.449   -0.771  -4.856  1.00 0.00 ? 18  THR A HG22 6  
ATOM 11404 H HG23 . THR A 1 18  ? 10.189  -0.484  -4.831  1.00 0.00 ? 18  THR A HG23 6  
ATOM 11405 N N    . PRO A 1 19  ? 7.287   -4.028  -6.841  1.00 0.00 ? 19  PRO A N    6  
ATOM 11406 C CA   . PRO A 1 19  ? 6.734   -4.731  -8.002  1.00 0.00 ? 19  PRO A CA   6  
ATOM 11407 C C    . PRO A 1 19  ? 7.656   -4.664  -9.214  1.00 0.00 ? 19  PRO A C    6  
ATOM 11408 O O    . PRO A 1 19  ? 7.392   -5.287  -10.242 1.00 0.00 ? 19  PRO A O    6  
ATOM 11409 C CB   . PRO A 1 19  ? 5.428   -3.982  -8.281  1.00 0.00 ? 19  PRO A CB   6  
ATOM 11410 C CG   . PRO A 1 19  ? 5.648   -2.618  -7.724  1.00 0.00 ? 19  PRO A CG   6  
ATOM 11411 C CD   . PRO A 1 19  ? 6.540   -2.798  -6.527  1.00 0.00 ? 19  PRO A CD   6  
ATOM 11412 H HA   . PRO A 1 19  ? 6.516   -5.764  -7.773  1.00 0.00 ? 19  PRO A HA   6  
ATOM 11413 H HB2  . PRO A 1 19  ? 5.249   -3.950  -9.347  1.00 0.00 ? 19  PRO A HB2  6  
ATOM 11414 H HB3  . PRO A 1 19  ? 4.609   -4.483  -7.788  1.00 0.00 ? 19  PRO A HB3  6  
ATOM 11415 H HG2  . PRO A 1 19  ? 6.129   -1.993  -8.461  1.00 0.00 ? 19  PRO A HG2  6  
ATOM 11416 H HG3  . PRO A 1 19  ? 4.703   -2.188  -7.425  1.00 0.00 ? 19  PRO A HG3  6  
ATOM 11417 H HD2  . PRO A 1 19  ? 7.209   -1.956  -6.425  1.00 0.00 ? 19  PRO A HD2  6  
ATOM 11418 H HD3  . PRO A 1 19  ? 5.950   -2.924  -5.632  1.00 0.00 ? 19  PRO A HD3  6  
ATOM 11419 N N    . ALA A 1 20  ? 8.739   -3.905  -9.086  1.00 0.00 ? 20  ALA A N    6  
ATOM 11420 C CA   . ALA A 1 20  ? 9.702   -3.759  -10.171 1.00 0.00 ? 20  ALA A CA   6  
ATOM 11421 C C    . ALA A 1 20  ? 11.085  -4.242  -9.746  1.00 0.00 ? 20  ALA A C    6  
ATOM 11422 O O    . ALA A 1 20  ? 12.053  -3.481  -9.717  1.00 0.00 ? 20  ALA A O    6  
ATOM 11423 C CB   . ALA A 1 20  ? 9.765   -2.310  -10.630 1.00 0.00 ? 20  ALA A CB   6  
ATOM 11424 H H    . ALA A 1 20  ? 8.895   -3.433  -8.242  1.00 0.00 ? 20  ALA A H    6  
ATOM 11425 H HA   . ALA A 1 20  ? 9.362   -4.360  -11.003 1.00 0.00 ? 20  ALA A HA   6  
ATOM 11426 H HB1  . ALA A 1 20  ? 8.797   -1.848  -10.495 1.00 0.00 ? 20  ALA A HB1  6  
ATOM 11427 H HB2  . ALA A 1 20  ? 10.501  -1.779  -10.045 1.00 0.00 ? 20  ALA A HB2  6  
ATOM 11428 H HB3  . ALA A 1 20  ? 10.039  -2.274  -11.673 1.00 0.00 ? 20  ALA A HB3  6  
ATOM 11429 N N    . PRO A 1 21  ? 11.182  -5.536  -9.408  1.00 0.00 ? 21  PRO A N    6  
ATOM 11430 C CA   . PRO A 1 21  ? 12.443  -6.149  -8.978  1.00 0.00 ? 21  PRO A CA   6  
ATOM 11431 C C    . PRO A 1 21  ? 13.447  -6.271  -10.119 1.00 0.00 ? 21  PRO A C    6  
ATOM 11432 O O    . PRO A 1 21  ? 13.126  -6.047  -11.287 1.00 0.00 ? 21  PRO A O    6  
ATOM 11433 C CB   . PRO A 1 21  ? 12.015  -7.536  -8.492  1.00 0.00 ? 21  PRO A CB   6  
ATOM 11434 C CG   . PRO A 1 21  ? 10.756  -7.826  -9.234  1.00 0.00 ? 21  PRO A CG   6  
ATOM 11435 C CD   . PRO A 1 21  ? 10.070  -6.501  -9.419  1.00 0.00 ? 21  PRO A CD   6  
ATOM 11436 H HA   . PRO A 1 21  ? 12.892  -5.602  -8.162  1.00 0.00 ? 21  PRO A HA   6  
ATOM 11437 H HB2  . PRO A 1 21  ? 12.787  -8.256  -8.726  1.00 0.00 ? 21  PRO A HB2  6  
ATOM 11438 H HB3  . PRO A 1 21  ? 11.848  -7.512  -7.426  1.00 0.00 ? 21  PRO A HB3  6  
ATOM 11439 H HG2  . PRO A 1 21  ? 10.988  -8.265  -10.193 1.00 0.00 ? 21  PRO A HG2  6  
ATOM 11440 H HG3  . PRO A 1 21  ? 10.134  -8.492  -8.655  1.00 0.00 ? 21  PRO A HG3  6  
ATOM 11441 H HD2  . PRO A 1 21  ? 9.547   -6.475  -10.364 1.00 0.00 ? 21  PRO A HD2  6  
ATOM 11442 H HD3  . PRO A 1 21  ? 9.388   -6.312  -8.603  1.00 0.00 ? 21  PRO A HD3  6  
ATOM 11443 N N    . PRO A 1 22  ? 14.692  -6.634  -9.777  1.00 0.00 ? 22  PRO A N    6  
ATOM 11444 C CA   . PRO A 1 22  ? 15.768  -6.794  -10.759 1.00 0.00 ? 22  PRO A CA   6  
ATOM 11445 C C    . PRO A 1 22  ? 15.556  -8.008  -11.658 1.00 0.00 ? 22  PRO A C    6  
ATOM 11446 O O    . PRO A 1 22  ? 16.276  -8.199  -12.638 1.00 0.00 ? 22  PRO A O    6  
ATOM 11447 C CB   . PRO A 1 22  ? 17.015  -6.982  -9.892  1.00 0.00 ? 22  PRO A CB   6  
ATOM 11448 C CG   . PRO A 1 22  ? 16.502  -7.531  -8.605  1.00 0.00 ? 22  PRO A CG   6  
ATOM 11449 C CD   . PRO A 1 22  ? 15.145  -6.916  -8.404  1.00 0.00 ? 22  PRO A CD   6  
ATOM 11450 H HA   . PRO A 1 22  ? 15.883  -5.911  -11.370 1.00 0.00 ? 22  PRO A HA   6  
ATOM 11451 H HB2  . PRO A 1 22  ? 17.692  -7.673  -10.375 1.00 0.00 ? 22  PRO A HB2  6  
ATOM 11452 H HB3  . PRO A 1 22  ? 17.505  -6.031  -9.747  1.00 0.00 ? 22  PRO A HB3  6  
ATOM 11453 H HG2  . PRO A 1 22  ? 16.421  -8.605  -8.670  1.00 0.00 ? 22  PRO A HG2  6  
ATOM 11454 H HG3  . PRO A 1 22  ? 17.163  -7.252  -7.798  1.00 0.00 ? 22  PRO A HG3  6  
ATOM 11455 H HD2  . PRO A 1 22  ? 14.482  -7.615  -7.916  1.00 0.00 ? 22  PRO A HD2  6  
ATOM 11456 H HD3  . PRO A 1 22  ? 15.225  -6.005  -7.830  1.00 0.00 ? 22  PRO A HD3  6  
ATOM 11457 N N    . VAL A 1 23  ? 14.564  -8.824  -11.318 1.00 0.00 ? 23  VAL A N    6  
ATOM 11458 C CA   . VAL A 1 23  ? 14.257  -10.019 -12.096 1.00 0.00 ? 23  VAL A CA   6  
ATOM 11459 C C    . VAL A 1 23  ? 12.829  -9.975  -12.628 1.00 0.00 ? 23  VAL A C    6  
ATOM 11460 O O    . VAL A 1 23  ? 12.370  -10.911 -13.282 1.00 0.00 ? 23  VAL A O    6  
ATOM 11461 C CB   . VAL A 1 23  ? 14.442  -11.297 -11.257 1.00 0.00 ? 23  VAL A CB   6  
ATOM 11462 C CG1  . VAL A 1 23  ? 13.392  -11.373 -10.159 1.00 0.00 ? 23  VAL A CG1  6  
ATOM 11463 C CG2  . VAL A 1 23  ? 14.385  -12.530 -12.146 1.00 0.00 ? 23  VAL A CG2  6  
ATOM 11464 H H    . VAL A 1 23  ? 14.026  -8.618  -10.526 1.00 0.00 ? 23  VAL A H    6  
ATOM 11465 H HA   . VAL A 1 23  ? 14.941  -10.059 -12.931 1.00 0.00 ? 23  VAL A HA   6  
ATOM 11466 H HB   . VAL A 1 23  ? 15.416  -11.260 -10.791 1.00 0.00 ? 23  VAL A HB   6  
ATOM 11467 H HG11 . VAL A 1 23  ? 13.841  -11.767 -9.259  1.00 0.00 ? 23  VAL A HG11 6  
ATOM 11468 H HG12 . VAL A 1 23  ? 13.002  -10.384 -9.965  1.00 0.00 ? 23  VAL A HG12 6  
ATOM 11469 H HG13 . VAL A 1 23  ? 12.588  -12.022 -10.473 1.00 0.00 ? 23  VAL A HG13 6  
ATOM 11470 H HG21 . VAL A 1 23  ? 15.286  -13.110 -12.014 1.00 0.00 ? 23  VAL A HG21 6  
ATOM 11471 H HG22 . VAL A 1 23  ? 13.527  -13.130 -11.876 1.00 0.00 ? 23  VAL A HG22 6  
ATOM 11472 H HG23 . VAL A 1 23  ? 14.299  -12.226 -13.179 1.00 0.00 ? 23  VAL A HG23 6  
ATOM 11473 N N    . GLY A 1 24  ? 12.130  -8.881  -12.343 1.00 0.00 ? 24  GLY A N    6  
ATOM 11474 C CA   . GLY A 1 24  ? 10.761  -8.735  -12.801 1.00 0.00 ? 24  GLY A CA   6  
ATOM 11475 C C    . GLY A 1 24  ? 10.587  -9.145  -14.251 1.00 0.00 ? 24  GLY A C    6  
ATOM 11476 O O    . GLY A 1 24  ? 9.922   -10.132 -14.564 1.00 0.00 ? 24  GLY A O    6  
ATOM 11477 H H    . GLY A 1 24  ? 12.547  -8.166  -11.818 1.00 0.00 ? 24  GLY A H    6  
ATOM 11478 H HA2  . GLY A 1 24  ? 10.119  -9.348  -12.186 1.00 0.00 ? 24  GLY A HA2  6  
ATOM 11479 H HA3  . GLY A 1 24  ? 10.465  -7.702  -12.694 1.00 0.00 ? 24  GLY A HA3  6  
ATOM 11480 N N    . PRO A 1 25  ? 11.196  -8.374  -15.164 1.00 0.00 ? 25  PRO A N    6  
ATOM 11481 C CA   . PRO A 1 25  ? 11.119  -8.641  -16.603 1.00 0.00 ? 25  PRO A CA   6  
ATOM 11482 C C    . PRO A 1 25  ? 11.893  -9.894  -17.002 1.00 0.00 ? 25  PRO A C    6  
ATOM 11483 O O    . PRO A 1 25  ? 11.831  -10.333 -18.150 1.00 0.00 ? 25  PRO A O    6  
ATOM 11484 C CB   . PRO A 1 25  ? 11.756  -7.398  -17.230 1.00 0.00 ? 25  PRO A CB   6  
ATOM 11485 C CG   . PRO A 1 25  ? 12.665  -6.867  -16.177 1.00 0.00 ? 25  PRO A CG   6  
ATOM 11486 C CD   . PRO A 1 25  ? 12.006  -7.182  -14.862 1.00 0.00 ? 25  PRO A CD   6  
ATOM 11487 H HA   . PRO A 1 25  ? 10.096  -8.731  -16.936 1.00 0.00 ? 25  PRO A HA   6  
ATOM 11488 H HB2  . PRO A 1 25  ? 12.301  -7.679  -18.119 1.00 0.00 ? 25  PRO A HB2  6  
ATOM 11489 H HB3  . PRO A 1 25  ? 10.986  -6.684  -17.483 1.00 0.00 ? 25  PRO A HB3  6  
ATOM 11490 H HG2  . PRO A 1 25  ? 13.626  -7.355  -16.241 1.00 0.00 ? 25  PRO A HG2  6  
ATOM 11491 H HG3  . PRO A 1 25  ? 12.777  -5.799  -16.293 1.00 0.00 ? 25  PRO A HG3  6  
ATOM 11492 H HD2  . PRO A 1 25  ? 12.749  -7.401  -14.110 1.00 0.00 ? 25  PRO A HD2  6  
ATOM 11493 H HD3  . PRO A 1 25  ? 11.379  -6.360  -14.548 1.00 0.00 ? 25  PRO A HD3  6  
ATOM 11494 N N    . ALA A 1 26  ? 12.619  -10.464 -16.047 1.00 0.00 ? 26  ALA A N    6  
ATOM 11495 C CA   . ALA A 1 26  ? 13.402  -11.667 -16.298 1.00 0.00 ? 26  ALA A CA   6  
ATOM 11496 C C    . ALA A 1 26  ? 12.732  -12.895 -15.691 1.00 0.00 ? 26  ALA A C    6  
ATOM 11497 O O    . ALA A 1 26  ? 13.247  -14.010 -15.791 1.00 0.00 ? 26  ALA A O    6  
ATOM 11498 C CB   . ALA A 1 26  ? 14.811  -11.505 -15.746 1.00 0.00 ? 26  ALA A CB   6  
ATOM 11499 H H    . ALA A 1 26  ? 12.628  -10.067 -15.151 1.00 0.00 ? 26  ALA A H    6  
ATOM 11500 H HA   . ALA A 1 26  ? 13.475  -11.801 -17.368 1.00 0.00 ? 26  ALA A HA   6  
ATOM 11501 H HB1  . ALA A 1 26  ? 15.289  -12.473 -15.691 1.00 0.00 ? 26  ALA A HB1  6  
ATOM 11502 H HB2  . ALA A 1 26  ? 15.380  -10.859 -16.397 1.00 0.00 ? 26  ALA A HB2  6  
ATOM 11503 H HB3  . ALA A 1 26  ? 14.763  -11.071 -14.759 1.00 0.00 ? 26  ALA A HB3  6  
ATOM 11504 N N    . LEU A 1 27  ? 11.582  -12.685 -15.061 1.00 0.00 ? 27  LEU A N    6  
ATOM 11505 C CA   . LEU A 1 27  ? 10.841  -13.775 -14.436 1.00 0.00 ? 27  LEU A CA   6  
ATOM 11506 C C    . LEU A 1 27  ? 9.450   -13.908 -15.046 1.00 0.00 ? 27  LEU A C    6  
ATOM 11507 O O    . LEU A 1 27  ? 8.689   -14.809 -14.695 1.00 0.00 ? 27  LEU A O    6  
ATOM 11508 C CB   . LEU A 1 27  ? 10.729  -13.544 -12.928 1.00 0.00 ? 27  LEU A CB   6  
ATOM 11509 C CG   . LEU A 1 27  ? 9.599   -12.620 -12.473 1.00 0.00 ? 27  LEU A CG   6  
ATOM 11510 C CD1  . LEU A 1 27  ? 8.358   -13.427 -12.122 1.00 0.00 ? 27  LEU A CD1  6  
ATOM 11511 C CD2  . LEU A 1 27  ? 10.043  -11.778 -11.285 1.00 0.00 ? 27  LEU A CD2  6  
ATOM 11512 H H    . LEU A 1 27  ? 11.222  -11.775 -15.013 1.00 0.00 ? 27  LEU A H    6  
ATOM 11513 H HA   . LEU A 1 27  ? 11.387  -14.690 -14.612 1.00 0.00 ? 27  LEU A HA   6  
ATOM 11514 H HB2  . LEU A 1 27  ? 10.582  -14.503 -12.456 1.00 0.00 ? 27  LEU A HB2  6  
ATOM 11515 H HB3  . LEU A 1 27  ? 11.663  -13.118 -12.589 1.00 0.00 ? 27  LEU A HB3  6  
ATOM 11516 H HG   . LEU A 1 27  ? 9.342   -11.949 -13.282 1.00 0.00 ? 27  LEU A HG   6  
ATOM 11517 H HD11 . LEU A 1 27  ? 8.151   -13.328 -11.068 1.00 0.00 ? 27  LEU A HD11 6  
ATOM 11518 H HD12 . LEU A 1 27  ? 8.526   -14.467 -12.360 1.00 0.00 ? 27  LEU A HD12 6  
ATOM 11519 H HD13 . LEU A 1 27  ? 7.517   -13.059 -12.692 1.00 0.00 ? 27  LEU A HD13 6  
ATOM 11520 H HD21 . LEU A 1 27  ? 9.209   -11.195 -10.926 1.00 0.00 ? 27  LEU A HD21 6  
ATOM 11521 H HD22 . LEU A 1 27  ? 10.840  -11.116 -11.592 1.00 0.00 ? 27  LEU A HD22 6  
ATOM 11522 H HD23 . LEU A 1 27  ? 10.396  -12.426 -10.497 1.00 0.00 ? 27  LEU A HD23 6  
ATOM 11523 N N    . GLY A 1 28  ? 9.123   -13.003 -15.965 1.00 0.00 ? 28  GLY A N    6  
ATOM 11524 C CA   . GLY A 1 28  ? 7.825   -13.038 -16.612 1.00 0.00 ? 28  GLY A CA   6  
ATOM 11525 C C    . GLY A 1 28  ? 7.516   -14.392 -17.220 1.00 0.00 ? 28  GLY A C    6  
ATOM 11526 O O    . GLY A 1 28  ? 6.367   -14.833 -17.216 1.00 0.00 ? 28  GLY A O    6  
ATOM 11527 H H    . GLY A 1 28  ? 9.770   -12.307 -16.206 1.00 0.00 ? 28  GLY A H    6  
ATOM 11528 H HA2  . GLY A 1 28  ? 7.065   -12.801 -15.882 1.00 0.00 ? 28  GLY A HA2  6  
ATOM 11529 H HA3  . GLY A 1 28  ? 7.804   -12.293 -17.393 1.00 0.00 ? 28  GLY A HA3  6  
ATOM 11530 N N    . GLN A 1 29  ? 8.543   -15.052 -17.745 1.00 0.00 ? 29  GLN A N    6  
ATOM 11531 C CA   . GLN A 1 29  ? 8.374   -16.362 -18.361 1.00 0.00 ? 29  GLN A CA   6  
ATOM 11532 C C    . GLN A 1 29  ? 8.666   -17.476 -17.361 1.00 0.00 ? 29  GLN A C    6  
ATOM 11533 O O    . GLN A 1 29  ? 8.993   -18.599 -17.745 1.00 0.00 ? 29  GLN A O    6  
ATOM 11534 C CB   . GLN A 1 29  ? 9.293   -16.499 -19.577 1.00 0.00 ? 29  GLN A CB   6  
ATOM 11535 C CG   . GLN A 1 29  ? 8.555   -16.849 -20.860 1.00 0.00 ? 29  GLN A CG   6  
ATOM 11536 C CD   . GLN A 1 29  ? 8.079   -18.288 -20.886 1.00 0.00 ? 29  GLN A CD   6  
ATOM 11537 O OE1  . GLN A 1 29  ? 8.795   -19.183 -21.336 1.00 0.00 ? 29  GLN A OE1  6  
ATOM 11538 N NE2  . GLN A 1 29  ? 6.865   -18.519 -20.401 1.00 0.00 ? 29  GLN A NE2  6  
ATOM 11539 H H    . GLN A 1 29  ? 9.435   -14.648 -17.717 1.00 0.00 ? 29  GLN A H    6  
ATOM 11540 H HA   . GLN A 1 29  ? 7.348   -16.446 -18.686 1.00 0.00 ? 29  GLN A HA   6  
ATOM 11541 H HB2  . GLN A 1 29  ? 9.812   -15.565 -19.729 1.00 0.00 ? 29  GLN A HB2  6  
ATOM 11542 H HB3  . GLN A 1 29  ? 10.017  -17.276 -19.381 1.00 0.00 ? 29  GLN A HB3  6  
ATOM 11543 H HG2  . GLN A 1 29  ? 7.697   -16.201 -20.955 1.00 0.00 ? 29  GLN A HG2  6  
ATOM 11544 H HG3  . GLN A 1 29  ? 9.220   -16.690 -21.696 1.00 0.00 ? 29  GLN A HG3  6  
ATOM 11545 H HE21 . GLN A 1 29  ? 6.351   -17.756 -20.059 1.00 0.00 ? 29  GLN A HE21 6  
ATOM 11546 H HE22 . GLN A 1 29  ? 6.532   -