data_2H9Y
# 
_entry.id   2H9Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2H9Y         
RCSB  RCSB038114   
WWPDB D_1000038114 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1J06 'apo mAChE'            unspecified 
PDB 1AMN 'TcAChE-TMTFA complex' unspecified 
PDB 2HA0 .                      unspecified 
PDB 2HA2 .                      unspecified 
PDB 2HA3 .                      unspecified 
PDB 2HA4 .                      unspecified 
PDB 2HA5 .                      unspecified 
PDB 2HA6 .                      unspecified 
PDB 2HA7 .                      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2H9Y 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, Y.'       1 
'Radic, Z.'        2 
'Sulzenbacher, G.' 3 
'Kim, E.'          4 
'Taylor, P.'       5 
'Marchot, P.'      6 
# 
_citation.id                        primary 
_citation.title                     
;Substrate and product trafficking through the active center gorge of acetylcholinesterase analyzed by crystallography and equilibrium binding
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                29256 
_citation.page_last                 29267 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16837465 
_citation.pdbx_database_id_DOI      10.1074/jbc.M603018200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bourne, Y.'       1 ? 
primary 'Radic, Z.'        2 ? 
primary 'Sulzenbacher, G.' 3 ? 
primary 'Kim, E.'          4 ? 
primary 'Taylor, P.'       5 ? 
primary 'Marchot, P.'      6 ? 
# 
_cell.entry_id           2H9Y 
_cell.length_a           79.013 
_cell.length_b           111.394 
_cell.length_c           226.934 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2H9Y 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                                   59764.488 2   3.1.1.7 ? 
'catalytic domain' ? 
2 branched    man 'alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose'  367.349   1   ?       ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                               221.208   2   ?       ? ? ? 
4 non-polymer syn 'M-(N,N,N-TRIMETHYLAMMONIO)-2,2,2-TRIFLUORO-1,1-DIHYDROXYETHYLBENZENE' 250.238   2   ?       ? ? ? 
5 non-polymer syn 'HEXAETHYLENE GLYCOL'                                                  282.331   1   ?       ? ? ? 
6 non-polymer syn 'TETRAETHYLENE GLYCOL'                                                 194.226   1   ?       ? ? ? 
7 water       nat water                                                                  18.015    422 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     Homo 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              'LAMBDA ZAP' 
_entity_src_gen.pdbx_host_org_cell_line            'HEK 293' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'HUMAN EMBRYONIC KIDNEY CELLS (HEK)' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           32 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2H9Y A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 2H9Y B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                                                ? 'C3 H7 N O2'        
89.093  
ARG 'L-peptide linking'           y ARGININE                                                               ? 'C6 H15 N4 O2 1'    
175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                             ? 'C4 H8 N2 O3'       
132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                                        ? 'C4 H7 N O4'        
133.103 
CYS 'L-peptide linking'           y CYSTEINE                                                               ? 'C3 H7 N O2 S'      
121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                                   ? 'C6 H12 O5'         
164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                                              ? 'C5 H10 N2 O3'      
146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                                        ? 'C5 H9 N O4'        
147.129 
GLY 'peptide linking'             y GLYCINE                                                                ? 'C2 H5 N O2'        
75.067  
HIS 'L-peptide linking'           y HISTIDINE                                                              ? 'C6 H10 N3 O2 1'    
156.162 
HOH non-polymer                   . WATER                                                                  ? 'H2 O'              
18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                             ? 'C6 H13 N O2'       
131.173 
LEU 'L-peptide linking'           y LEUCINE                                                                ? 'C6 H13 N O2'       
131.173 
LYS 'L-peptide linking'           y LYSINE                                                                 ? 'C6 H15 N2 O2 1'    
147.195 
MET 'L-peptide linking'           y METHIONINE                                                             ? 'C5 H11 N O2 S'     
149.211 
NAF non-polymer                   . 'M-(N,N,N-TRIMETHYLAMMONIO)-2,2,2-TRIFLUORO-1,1-DIHYDROXYETHYLBENZENE' ? 'C11 H15 F3 N O2 1' 
250.238 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                               ? 'C8 H15 N O6'       
221.208 
P6G non-polymer                   . 'HEXAETHYLENE GLYCOL'                                                  
'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'        282.331 
PG4 non-polymer                   . 'TETRAETHYLENE GLYCOL'                                                 ? 'C8 H18 O5'         
194.226 
PHE 'L-peptide linking'           y PHENYLALANINE                                                          ? 'C9 H11 N O2'       
165.189 
PRO 'L-peptide linking'           y PROLINE                                                                ? 'C5 H9 N O2'        
115.130 
SER 'L-peptide linking'           y SERINE                                                                 ? 'C3 H7 N O3'        
105.093 
THR 'L-peptide linking'           y THREONINE                                                              ? 'C4 H9 N O3'        
119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                             ? 'C11 H12 N2 O2'     
204.225 
TYR 'L-peptide linking'           y TYROSINE                                                               ? 'C9 H11 N O3'       
181.189 
VAL 'L-peptide linking'           y VALINE                                                                 ? 'C5 H11 N O2'       
117.146 
# 
_exptl.entry_id          2H9Y 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.17 
_exptl_crystal.density_percent_sol   70.53 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
'25-32% P550 MME or P600, 60-100mM HEPES or Na acetate, pH 6.5-8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2003-04-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     2H9Y 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.4 
_reflns.d_resolution_low             20 
_reflns.number_all                   ? 
_reflns.number_obs                   78296 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.082 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.3 
_reflns.B_iso_Wilson_estimate        52.6 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.5 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.447 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2H9Y 
_refine.ls_number_reflns_obs                     76568 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    99.16 
_refine.ls_R_factor_obs                          0.18664 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18607 
_refine.ls_R_factor_R_free                       0.21362 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1560 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               .959 
_refine.correlation_coeff_Fo_to_Fc_free          .943 
_refine.B_iso_mean                               64.463 
_refine.aniso_B[1][1]                            2.46 
_refine.aniso_B[2][2]                            4.35 
_refine.aniso_B[3][3]                            -6.82 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             .80 
_refine.pdbx_solvent_shrinkage_radii             .80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1J06 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       .210 
_refine.pdbx_overall_ESU_R_Free                  .177 
_refine.overall_SU_ML                            .143 
_refine.overall_SU_B                             11.667 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8350 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         116 
_refine_hist.number_atoms_solvent             422 
_refine_hist.number_atoms_total               8888 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             .010   .022   ? 8745  'X-RAY DIFFRACTION' ? 
r_bond_other_d               .002   .020   ? 5939  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.288  1.971  ? 11952 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            .963   3.002  ? 14308 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.430  5.000  ? 1066  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.578 22.832 ? 399   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.307 15.000 ? 1265  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.293 15.000 ? 74    'X-RAY DIFFRACTION' ? 
r_chiral_restr               .095   .200   ? 1292  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         .004   .020   ? 9762  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           .001   .020   ? 1874  'X-RAY DIFFRACTION' ? 
r_nbd_refined                .204   .200   ? 1796  'X-RAY DIFFRACTION' ? 
r_nbd_other                  .199   .200   ? 6242  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              .179   .200   ? 4266  'X-RAY DIFFRACTION' ? 
r_nbtor_other                .087   .200   ? 4366  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        .140   .200   ? 385   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       .118   .200   ? 15    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         .288   .200   ? 36    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     .151   .200   ? 11    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  .592   1.500  ? 5674  'X-RAY DIFFRACTION' ? 
r_mcbond_other               .108   1.500  ? 2146  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 .925   2.000  ? 8620  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.322  3.000  ? 3779  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.089  4.500  ? 3332  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 2867 .09  .50   'medium positional' 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 A 3788 .46  5.00  'loose positional'  1 'X-RAY DIFFRACTION' 2 ? ? ? 
1 A 2867 .42  2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 A 3788 1.13 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 4 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.461 
_refine_ls_shell.number_reflns_R_work             5361 
_refine_ls_shell.R_factor_R_work                  0.24 
_refine_ls_shell.percent_reflns_obs               99.33 
_refine_ls_shell.R_factor_R_free                  0.266 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             100 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1  A 
1 2  B 
1 3  A 
1 4  B 
1 5  A 
1 6  B 
1 7  A 
1 8  B 
1 9  A 
1 10 B 
1 11 A 
1 12 B 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1  A 4   A 15  1 6 A GLU 4   ? A GLY 15  ? 1 ? 
2  B 4   B 15  1 6 B GLU 4   ? B GLY 15  ? 1 ? 
3  A 16  A 56  2 5 A GLN 16  ? A TRP 56  ? 1 ? 
4  B 16  B 56  2 5 B GLN 16  ? B TRP 56  ? 1 ? 
5  A 60  A 74  3 5 A LEU 60  ? A ASP 74  ? 1 ? 
6  B 60  B 74  3 5 B LEU 60  ? B ASP 74  ? 1 ? 
7  A 80  A 256 4 5 A PHE 80  ? A GLY 256 ? 1 ? 
8  B 80  B 256 4 5 B PHE 80  ? B GLY 256 ? 1 ? 
9  A 265 A 490 5 5 A ASN 265 ? A ASN 490 ? 1 ? 
10 B 265 B 490 5 5 B ASN 265 ? B ASN 490 ? 1 ? 
11 A 508 A 539 6 5 A GLN 508 ? A LEU 539 ? 1 ? 
12 B 508 B 539 6 5 B GLN 508 ? B LEU 539 ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2H9Y 
_struct.title                     
'Crystal structure of mouse acetylcholinesterase complexed with m-(N,N,N-trimethylammonio)trifluoroacetophenone' 
_struct.pdbx_descriptor           'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2H9Y 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'HYDROLASE FOLD, SERINE ESTERASE, ACETYLCHOLINESTERASE, HOMODIMER, GLYCOSYLATED PROTEIN, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 3 ? 
I N N 4 ? 
J N N 7 ? 
K N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? THR A 275 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASN A 464 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P24 24 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P27 27 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P28 28 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SER B 203 ? SER B 215 ? SER B 203 SER B 215 1 ? 13 
HELX_P HELX_P36 36 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P37 37 SER B 240 ? VAL B 255 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P38 38 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 39 PRO B 277 ? ASP B 283 ? PRO B 277 ASP B 283 1 ? 7  
HELX_P HELX_P40 40 HIS B 284 ? LEU B 289 ? HIS B 284 LEU B 289 5 ? 6  
HELX_P HELX_P41 41 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 43 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 456 ? ASN B 464 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P50 50 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 ARG B 534 ? SER B 541 ? ARG B 534 SER B 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG    ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.076 ? ? 
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG    ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.105 ? ? 
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG    ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.062 ? ? 
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG    ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.054 ? ? 
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG    ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG    ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.071 ? ? 
covale1 covale none ? A SER 203 OG  ? ? ? 1_555 E NAF .   "C1'" ? ? A SER 203 A NAF 951 1_555 ? ? ? ? ? ? ? 1.852 ? ? 
covale2 covale one  ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1    ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.465 ? 
N-Glycosylation 
covale3 covale one  ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1    ? ? A ASN 464 A NAG 701 1_555 ? ? ? ? ? ? ? 1.447 ? 
N-Glycosylation 
covale4 covale none ? B SER 203 OG  ? ? ? 1_555 I NAF .   "C1'" ? ? B SER 203 B NAF 952 1_555 ? ? ? ? ? ? ? 1.877 ? ? 
covale5 covale one  ? B ASN 350 ND2 ? ? ? 1_555 H NAG .   C1    ? ? B ASN 350 B NAG 601 1_555 ? ? ? ? ? ? ? 1.465 ? 
N-Glycosylation 
covale6 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1    ? ? C NAG 1   C FUC 2   1_555 ? ? ? ? ? ? ? 1.453 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -5.03  
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 -1.58  
3 CYS 257 B . ? CYS 257 B PRO 258 B ? PRO 258 B 1 2.53   
4 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 -10.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 3  ? 
E ? 11 ? 
F ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? parallel      
E 5  6  ? parallel      
E 6  7  ? parallel      
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? parallel      
E 10 11 ? anti-parallel 
F 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
A 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
A 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
B 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
B 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
B 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
B 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
B 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
B 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
B 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
B 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
B 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
B 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
B 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
C 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
C 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
D 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
D 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
D 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
E 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
E 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
E 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
E 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
E 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
E 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
E 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
E 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
E 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
E 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
E 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
F 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
F 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 10  ? N VAL A 10  O LEU A 17  ? O LEU A 17  
A 2  3  N GLN A 16  ? N GLN A 16  O LEU A 60  ? O LEU A 60  
B 1  2  N LEU A 22  ? N LEU A 22  O VAL A 29  ? O VAL A 29  
B 2  3  N PHE A 32  ? N PHE A 32  O VAL A 101 ? O VAL A 101 
B 3  4  N ASN A 100 ? N ASN A 100 O SER A 148 ? O SER A 148 
B 4  5  O VAL A 147 ? O VAL A 147 N LEU A 115 ? N LEU A 115 
B 5  6  N VAL A 114 ? N VAL A 114 O SER A 196 ? O SER A 196 
B 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
B 7  8  N LEU A 227 ? N LEU A 227 O LEU A 327 ? O LEU A 327 
B 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
B 9  10 N ILE A 429 ? N ILE A 429 O LEU A 513 ? O LEU A 513 
B 10 11 N TYR A 510 ? N TYR A 510 O ARG A 521 ? O ARG A 521 
C 1  2  N VAL A 68  ? N VAL A 68  O SER A 93  ? O SER A 93  
D 1  2  N VAL B 10  ? N VAL B 10  O LEU B 17  ? O LEU B 17  
D 2  3  N GLN B 16  ? N GLN B 16  O LEU B 60  ? O LEU B 60  
E 1  2  N ILE B 20  ? N ILE B 20  O ALA B 31  ? O ALA B 31  
E 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
E 3  4  N ASN B 100 ? N ASN B 100 O SER B 148 ? O SER B 148 
E 4  5  O VAL B 147 ? O VAL B 147 N LEU B 115 ? N LEU B 115 
E 5  6  N ILE B 116 ? N ILE B 116 O THR B 198 ? O THR B 198 
E 6  7  N GLY B 201 ? N GLY B 201 O GLN B 228 ? O GLN B 228 
E 7  8  N LEU B 227 ? N LEU B 227 O LEU B 327 ? O LEU B 327 
E 8  9  N VAL B 328 ? N VAL B 328 O TYR B 426 ? O TYR B 426 
E 9  10 N ILE B 429 ? N ILE B 429 O LEU B 513 ? O LEU B 513 
E 10 11 N TYR B 510 ? N TYR B 510 O ARG B 521 ? O ARG B 521 
F 1  2  N VAL B 68  ? N VAL B 68  O SER B 93  ? O SER B 93  
# 
_database_PDB_matrix.entry_id          2H9Y 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2H9Y 
_atom_sites.fract_transf_matrix[1][1]   .012656 
_atom_sites.fract_transf_matrix[1][2]   .000000 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .008977 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .004407 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLU A 1 1   ? 31.833  14.121  55.923  1.00 92.37  ? 1    GLU A N     1 
ATOM   2    C CA    . GLU A 1 1   ? 30.378  14.191  55.603  1.00 92.43  ? 1    GLU A CA    1 
ATOM   3    C C     . GLU A 1 1   ? 29.688  14.909  56.755  1.00 92.12  ? 1    GLU A C     1 
ATOM   4    O O     . GLU A 1 1   ? 30.351  15.602  57.535  1.00 92.84  ? 1    GLU A O     1 
ATOM   5    C CB    . GLU A 1 1   ? 29.779  12.780  55.407  1.00 92.38  ? 1    GLU A CB    1 
ATOM   6    C CG    . GLU A 1 1   ? 30.632  11.822  54.584  1.00 92.66  ? 1    GLU A CG    1 
ATOM   7    C CD    . GLU A 1 1   ? 29.901  10.539  54.187  1.00 92.82  ? 1    GLU A CD    1 
ATOM   8    O OE1   . GLU A 1 1   ? 28.815  10.236  54.741  1.00 91.55  ? 1    GLU A OE1   1 
ATOM   9    O OE2   . GLU A 1 1   ? 30.430  9.826   53.302  1.00 94.23  ? 1    GLU A OE2   1 
ATOM   10   N N     . GLY A 1 2   ? 28.367  14.754  56.860  1.00 91.36  ? 2    GLY A N     1 
ATOM   11   C CA    . GLY A 1 2   ? 27.610  15.279  57.985  1.00 90.58  ? 2    GLY A CA    1 
ATOM   12   C C     . GLY A 1 2   ? 26.418  16.083  57.535  1.00 90.08  ? 2    GLY A C     1 
ATOM   13   O O     . GLY A 1 2   ? 25.276  15.673  57.757  1.00 89.62  ? 2    GLY A O     1 
ATOM   14   N N     . ARG A 1 3   ? 26.695  17.215  56.881  1.00 89.90  ? 3    ARG A N     1 
ATOM   15   C CA    . ARG A 1 3   ? 25.679  18.230  56.560  1.00 89.83  ? 3    ARG A CA    1 
ATOM   16   C C     . ARG A 1 3   ? 25.227  18.236  55.105  1.00 87.77  ? 3    ARG A C     1 
ATOM   17   O O     . ARG A 1 3   ? 24.403  19.060  54.728  1.00 87.81  ? 3    ARG A O     1 
ATOM   18   C CB    . ARG A 1 3   ? 26.199  19.630  56.915  1.00 90.99  ? 3    ARG A CB    1 
ATOM   19   C CG    . ARG A 1 3   ? 26.491  19.850  58.389  1.00 93.16  ? 3    ARG A CG    1 
ATOM   20   C CD    . ARG A 1 3   ? 25.208  19.843  59.233  1.00 94.71  ? 3    ARG A CD    1 
ATOM   21   N NE    . ARG A 1 3   ? 25.493  19.976  60.666  1.00 96.84  ? 3    ARG A NE    1 
ATOM   22   C CZ    . ARG A 1 3   ? 24.604  19.771  61.638  1.00 98.04  ? 3    ARG A CZ    1 
ATOM   23   N NH1   . ARG A 1 3   ? 23.354  19.411  61.348  1.00 96.63  ? 3    ARG A NH1   1 
ATOM   24   N NH2   . ARG A 1 3   ? 24.972  19.917  62.907  1.00 99.98  ? 3    ARG A NH2   1 
ATOM   25   N N     . GLU A 1 4   ? 25.742  17.322  54.291  1.00 85.79  ? 4    GLU A N     1 
ATOM   26   C CA    . GLU A 1 4   ? 25.425  17.334  52.872  1.00 84.04  ? 4    GLU A CA    1 
ATOM   27   C C     . GLU A 1 4   ? 24.303  16.388  52.541  1.00 82.68  ? 4    GLU A C     1 
ATOM   28   O O     . GLU A 1 4   ? 23.983  15.495  53.319  1.00 83.04  ? 4    GLU A O     1 
ATOM   29   C CB    . GLU A 1 4   ? 26.640  16.965  52.035  1.00 83.11  ? 4    GLU A CB    1 
ATOM   30   C CG    . GLU A 1 4   ? 27.863  17.769  52.383  1.00 85.33  ? 4    GLU A CG    1 
ATOM   31   C CD    . GLU A 1 4   ? 29.122  17.105  51.908  1.00 86.11  ? 4    GLU A CD    1 
ATOM   32   O OE1   . GLU A 1 4   ? 29.806  16.453  52.741  1.00 87.45  ? 4    GLU A OE1   1 
ATOM   33   O OE2   . GLU A 1 4   ? 29.397  17.230  50.698  1.00 84.89  ? 4    GLU A OE2   1 
ATOM   34   N N     . ASP A 1 5   ? 23.733  16.598  51.358  1.00 80.72  ? 5    ASP A N     1 
ATOM   35   C CA    . ASP A 1 5   ? 22.649  15.785  50.845  1.00 79.48  ? 5    ASP A CA    1 
ATOM   36   C C     . ASP A 1 5   ? 23.149  14.347  50.688  1.00 78.41  ? 5    ASP A C     1 
ATOM   37   O O     . ASP A 1 5   ? 24.065  14.094  49.893  1.00 76.77  ? 5    ASP A O     1 
ATOM   38   C CB    . ASP A 1 5   ? 22.163  16.346  49.503  1.00 78.18  ? 5    ASP A CB    1 
ATOM   39   C CG    . ASP A 1 5   ? 20.858  15.721  49.033  1.00 78.04  ? 5    ASP A CG    1 
ATOM   40   O OD1   . ASP A 1 5   ? 20.568  14.561  49.384  1.00 78.77  ? 5    ASP A OD1   1 
ATOM   41   O OD2   . ASP A 1 5   ? 20.114  16.400  48.292  1.00 78.35  ? 5    ASP A OD2   1 
ATOM   42   N N     . PRO A 1 6   ? 22.573  13.408  51.466  1.00 78.90  ? 6    PRO A N     1 
ATOM   43   C CA    . PRO A 1 6   ? 22.961  11.986  51.393  1.00 78.21  ? 6    PRO A CA    1 
ATOM   44   C C     . PRO A 1 6   ? 22.771  11.310  50.033  1.00 76.09  ? 6    PRO A C     1 
ATOM   45   O O     . PRO A 1 6   ? 23.388  10.280  49.779  1.00 75.28  ? 6    PRO A O     1 
ATOM   46   C CB    . PRO A 1 6   ? 22.054  11.317  52.436  1.00 79.75  ? 6    PRO A CB    1 
ATOM   47   C CG    . PRO A 1 6   ? 20.946  12.291  52.693  1.00 80.84  ? 6    PRO A CG    1 
ATOM   48   C CD    . PRO A 1 6   ? 21.542  13.634  52.497  1.00 80.43  ? 6    PRO A CD    1 
ATOM   49   N N     . GLN A 1 7   ? 21.924  11.866  49.168  1.00 74.82  ? 7    GLN A N     1 
ATOM   50   C CA    . GLN A 1 7   ? 21.774  11.317  47.821  1.00 73.13  ? 7    GLN A CA    1 
ATOM   51   C C     . GLN A 1 7   ? 22.868  11.741  46.850  1.00 70.36  ? 7    GLN A C     1 
ATOM   52   O O     . GLN A 1 7   ? 22.920  11.242  45.732  1.00 69.12  ? 7    GLN A O     1 
ATOM   53   C CB    . GLN A 1 7   ? 20.407  11.669  47.238  1.00 73.88  ? 7    GLN A CB    1 
ATOM   54   C CG    . GLN A 1 7   ? 19.296  10.707  47.681  1.00 76.89  ? 7    GLN A CG    1 
ATOM   55   C CD    . GLN A 1 7   ? 19.235  9.455   46.834  1.00 77.18  ? 7    GLN A CD    1 
ATOM   56   O OE1   . GLN A 1 7   ? 19.380  9.512   45.615  1.00 75.09  ? 7    GLN A OE1   1 
ATOM   57   N NE2   . GLN A 1 7   ? 19.017  8.312   47.479  1.00 80.42  ? 7    GLN A NE2   1 
ATOM   58   N N     . LEU A 1 8   ? 23.744  12.652  47.258  1.00 69.07  ? 8    LEU A N     1 
ATOM   59   C CA    . LEU A 1 8   ? 24.741  13.193  46.331  1.00 66.97  ? 8    LEU A CA    1 
ATOM   60   C C     . LEU A 1 8   ? 26.128  12.608  46.535  1.00 66.17  ? 8    LEU A C     1 
ATOM   61   O O     . LEU A 1 8   ? 27.064  13.001  45.847  1.00 65.59  ? 8    LEU A O     1 
ATOM   62   C CB    . LEU A 1 8   ? 24.766  14.729  46.405  1.00 66.77  ? 8    LEU A CB    1 
ATOM   63   C CG    . LEU A 1 8   ? 23.439  15.367  45.968  1.00 65.56  ? 8    LEU A CG    1 
ATOM   64   C CD1   . LEU A 1 8   ? 23.491  16.860  46.089  1.00 63.55  ? 8    LEU A CD1   1 
ATOM   65   C CD2   . LEU A 1 8   ? 23.075  14.955  44.547  1.00 62.58  ? 8    LEU A CD2   1 
ATOM   66   N N     . LEU A 1 9   ? 26.249  11.655  47.458  1.00 66.23  ? 9    LEU A N     1 
ATOM   67   C CA    . LEU A 1 9   ? 27.530  11.035  47.781  1.00 65.52  ? 9    LEU A CA    1 
ATOM   68   C C     . LEU A 1 9   ? 27.538  9.590   47.299  1.00 64.80  ? 9    LEU A C     1 
ATOM   69   O O     . LEU A 1 9   ? 26.704  8.782   47.719  1.00 64.67  ? 9    LEU A O     1 
ATOM   70   C CB    . LEU A 1 9   ? 27.782  11.114  49.287  1.00 66.79  ? 9    LEU A CB    1 
ATOM   71   C CG    . LEU A 1 9   ? 27.621  12.524  49.898  1.00 67.50  ? 9    LEU A CG    1 
ATOM   72   C CD1   . LEU A 1 9   ? 27.674  12.489  51.439  1.00 67.08  ? 9    LEU A CD1   1 
ATOM   73   C CD2   . LEU A 1 9   ? 28.666  13.500  49.314  1.00 65.20  ? 9    LEU A CD2   1 
ATOM   74   N N     . VAL A 1 10  ? 28.475  9.280   46.400  1.00 63.94  ? 10   VAL A N     1 
ATOM   75   C CA    . VAL A 1 10  ? 28.568  7.957   45.775  1.00 63.57  ? 10   VAL A CA    1 
ATOM   76   C C     . VAL A 1 10  ? 30.038  7.571   45.624  1.00 63.64  ? 10   VAL A C     1 
ATOM   77   O O     . VAL A 1 10  ? 30.900  8.426   45.401  1.00 63.58  ? 10   VAL A O     1 
ATOM   78   C CB    . VAL A 1 10  ? 27.859  7.911   44.371  1.00 62.78  ? 10   VAL A CB    1 
ATOM   79   C CG1   . VAL A 1 10  ? 28.049  6.560   43.696  1.00 62.16  ? 10   VAL A CG1   1 
ATOM   80   C CG2   . VAL A 1 10  ? 26.358  8.200   44.499  1.00 62.76  ? 10   VAL A CG2   1 
ATOM   81   N N     . ARG A 1 11  ? 30.317  6.280   45.765  1.00 63.67  ? 11   ARG A N     1 
ATOM   82   C CA    . ARG A 1 11  ? 31.648  5.753   45.590  1.00 63.71  ? 11   ARG A CA    1 
ATOM   83   C C     . ARG A 1 11  ? 31.691  4.932   44.308  1.00 62.80  ? 11   ARG A C     1 
ATOM   84   O O     . ARG A 1 11  ? 30.833  4.074   44.072  1.00 62.96  ? 11   ARG A O     1 
ATOM   85   C CB    . ARG A 1 11  ? 32.026  4.890   46.793  1.00 65.00  ? 11   ARG A CB    1 
ATOM   86   C CG    . ARG A 1 11  ? 33.330  4.146   46.662  1.00 65.66  ? 11   ARG A CG    1 
ATOM   87   C CD    . ARG A 1 11  ? 33.666  3.413   47.939  1.00 67.31  ? 11   ARG A CD    1 
ATOM   88   N NE    . ARG A 1 11  ? 34.171  4.293   48.999  1.00 68.71  ? 11   ARG A NE    1 
ATOM   89   C CZ    . ARG A 1 11  ? 35.447  4.653   49.155  1.00 69.47  ? 11   ARG A CZ    1 
ATOM   90   N NH1   . ARG A 1 11  ? 35.787  5.439   50.171  1.00 70.26  ? 11   ARG A NH1   1 
ATOM   91   N NH2   . ARG A 1 11  ? 36.380  4.263   48.296  1.00 69.99  ? 11   ARG A NH2   1 
ATOM   92   N N     . VAL A 1 12  ? 32.698  5.209   43.487  1.00 62.01  ? 12   VAL A N     1 
ATOM   93   C CA    . VAL A 1 12  ? 33.030  4.392   42.325  1.00 61.34  ? 12   VAL A CA    1 
ATOM   94   C C     . VAL A 1 12  ? 34.382  3.708   42.562  1.00 62.40  ? 12   VAL A C     1 
ATOM   95   O O     . VAL A 1 12  ? 34.991  3.886   43.618  1.00 62.67  ? 12   VAL A O     1 
ATOM   96   C CB    . VAL A 1 12  ? 33.055  5.243   41.039  1.00 59.81  ? 12   VAL A CB    1 
ATOM   97   C CG1   . VAL A 1 12  ? 31.666  5.759   40.741  1.00 57.70  ? 12   VAL A CG1   1 
ATOM   98   C CG2   . VAL A 1 12  ? 34.084  6.386   41.167  1.00 59.08  ? 12   VAL A CG2   1 
ATOM   99   N N     . ARG A 1 13  ? 34.837  2.932   41.581  1.00 63.23  ? 13   ARG A N     1 
ATOM   100  C CA    . ARG A 1 13  ? 36.056  2.114   41.709  1.00 64.86  ? 13   ARG A CA    1 
ATOM   101  C C     . ARG A 1 13  ? 37.313  2.953   42.017  1.00 65.33  ? 13   ARG A C     1 
ATOM   102  O O     . ARG A 1 13  ? 38.216  2.496   42.705  1.00 65.96  ? 13   ARG A O     1 
ATOM   103  C CB    . ARG A 1 13  ? 36.217  1.259   40.441  1.00 64.95  ? 13   ARG A CB    1 
ATOM   104  C CG    . ARG A 1 13  ? 37.543  0.519   40.214  1.00 66.15  ? 13   ARG A CG    1 
ATOM   105  C CD    . ARG A 1 13  ? 37.811  -0.600  41.184  1.00 70.50  ? 13   ARG A CD    1 
ATOM   106  N NE    . ARG A 1 13  ? 38.864  -0.150  42.083  1.00 72.78  ? 13   ARG A NE    1 
ATOM   107  C CZ    . ARG A 1 13  ? 40.062  -0.693  42.213  1.00 73.69  ? 13   ARG A CZ    1 
ATOM   108  N NH1   . ARG A 1 13  ? 40.397  -1.799  41.576  1.00 74.70  ? 13   ARG A NH1   1 
ATOM   109  N NH2   . ARG A 1 13  ? 40.917  -0.138  43.053  1.00 75.33  ? 13   ARG A NH2   1 
ATOM   110  N N     . GLY A 1 14  ? 37.344  4.196   41.551  1.00 64.75  ? 14   GLY A N     1 
ATOM   111  C CA    . GLY A 1 14  ? 38.481  5.071   41.816  1.00 65.33  ? 14   GLY A CA    1 
ATOM   112  C C     . GLY A 1 14  ? 38.411  5.906   43.085  1.00 65.83  ? 14   GLY A C     1 
ATOM   113  O O     . GLY A 1 14  ? 39.394  6.538   43.457  1.00 66.26  ? 14   GLY A O     1 
ATOM   114  N N     . GLY A 1 15  ? 37.253  5.942   43.738  1.00 65.94  ? 15   GLY A N     1 
ATOM   115  C CA    . GLY A 1 15  ? 37.093  6.750   44.941  1.00 66.67  ? 15   GLY A CA    1 
ATOM   116  C C     . GLY A 1 15  ? 35.717  7.357   45.101  1.00 66.41  ? 15   GLY A C     1 
ATOM   117  O O     . GLY A 1 15  ? 34.775  6.985   44.401  1.00 65.40  ? 15   GLY A O     1 
ATOM   118  N N     . GLN A 1 16  ? 35.622  8.309   46.030  1.00 67.13  ? 16   GLN A N     1 
ATOM   119  C CA    . GLN A 1 16  ? 34.355  8.923   46.422  1.00 67.29  ? 16   GLN A CA    1 
ATOM   120  C C     . GLN A 1 16  ? 34.054  10.141  45.585  1.00 65.77  ? 16   GLN A C     1 
ATOM   121  O O     . GLN A 1 16  ? 34.943  10.913  45.280  1.00 65.82  ? 16   GLN A O     1 
ATOM   122  C CB    . GLN A 1 16  ? 34.390  9.316   47.903  1.00 68.44  ? 16   GLN A CB    1 
ATOM   123  C CG    . GLN A 1 16  ? 34.193  8.142   48.845  1.00 70.58  ? 16   GLN A CG    1 
ATOM   124  C CD    . GLN A 1 16  ? 34.112  8.568   50.314  1.00 72.30  ? 16   GLN A CD    1 
ATOM   125  O OE1   . GLN A 1 16  ? 35.041  9.200   50.834  1.00 74.98  ? 16   GLN A OE1   1 
ATOM   126  N NE2   . GLN A 1 16  ? 32.999  8.227   50.982  1.00 72.34  ? 16   GLN A NE2   1 
ATOM   127  N N     . LEU A 1 17  ? 32.786  10.318  45.236  1.00 65.26  ? 17   LEU A N     1 
ATOM   128  C CA    . LEU A 1 17  ? 32.334  11.456  44.428  1.00 64.37  ? 17   LEU A CA    1 
ATOM   129  C C     . LEU A 1 17  ? 31.235  12.203  45.142  1.00 65.01  ? 17   LEU A C     1 
ATOM   130  O O     . LEU A 1 17  ? 30.448  11.594  45.868  1.00 65.48  ? 17   LEU A O     1 
ATOM   131  C CB    . LEU A 1 17  ? 31.751  10.973  43.105  1.00 63.05  ? 17   LEU A CB    1 
ATOM   132  C CG    . LEU A 1 17  ? 32.645  10.130  42.206  1.00 62.65  ? 17   LEU A CG    1 
ATOM   133  C CD1   . LEU A 1 17  ? 31.763  9.355   41.236  1.00 62.61  ? 17   LEU A CD1   1 
ATOM   134  C CD2   . LEU A 1 17  ? 33.662  10.998  41.487  1.00 60.89  ? 17   LEU A CD2   1 
ATOM   135  N N     . ARG A 1 18  ? 31.167  13.512  44.904  1.00 65.28  ? 18   ARG A N     1 
ATOM   136  C CA    . ARG A 1 18  ? 30.052  14.328  45.343  1.00 65.82  ? 18   ARG A CA    1 
ATOM   137  C C     . ARG A 1 18  ? 29.375  14.979  44.136  1.00 64.24  ? 18   ARG A C     1 
ATOM   138  O O     . ARG A 1 18  ? 29.986  15.783  43.444  1.00 63.73  ? 18   ARG A O     1 
ATOM   139  C CB    . ARG A 1 18  ? 30.513  15.401  46.323  1.00 67.02  ? 18   ARG A CB    1 
ATOM   140  C CG    . ARG A 1 18  ? 29.375  16.363  46.789  1.00 68.48  ? 18   ARG A CG    1 
ATOM   141  C CD    . ARG A 1 18  ? 29.818  17.245  47.966  1.00 71.33  ? 18   ARG A CD    1 
ATOM   142  N NE    . ARG A 1 18  ? 31.156  17.796  47.730  1.00 74.07  ? 18   ARG A NE    1 
ATOM   143  C CZ    . ARG A 1 18  ? 32.251  17.568  48.467  1.00 75.22  ? 18   ARG A CZ    1 
ATOM   144  N NH1   . ARG A 1 18  ? 32.232  16.836  49.583  1.00 75.43  ? 18   ARG A NH1   1 
ATOM   145  N NH2   . ARG A 1 18  ? 33.398  18.110  48.074  1.00 76.68  ? 18   ARG A NH2   1 
ATOM   146  N N     . GLY A 1 19  ? 28.109  14.635  43.906  1.00 63.52  ? 19   GLY A N     1 
ATOM   147  C CA    . GLY A 1 19  ? 27.330  15.212  42.818  1.00 62.57  ? 19   GLY A CA    1 
ATOM   148  C C     . GLY A 1 19  ? 26.623  16.514  43.181  1.00 63.22  ? 19   GLY A C     1 
ATOM   149  O O     . GLY A 1 19  ? 26.909  17.148  44.201  1.00 63.73  ? 19   GLY A O     1 
ATOM   150  N N     . ILE A 1 20  ? 25.683  16.893  42.324  1.00 62.79  ? 20   ILE A N     1 
ATOM   151  C CA    . ILE A 1 20  ? 24.885  18.092  42.501  1.00 63.85  ? 20   ILE A CA    1 
ATOM   152  C C     . ILE A 1 20  ? 23.416  17.782  42.173  1.00 63.96  ? 20   ILE A C     1 
ATOM   153  O O     . ILE A 1 20  ? 23.106  16.988  41.271  1.00 62.42  ? 20   ILE A O     1 
ATOM   154  C CB    . ILE A 1 20  ? 25.440  19.252  41.618  1.00 63.52  ? 20   ILE A CB    1 
ATOM   155  C CG1   . ILE A 1 20  ? 24.718  20.569  41.893  1.00 65.12  ? 20   ILE A CG1   1 
ATOM   156  C CG2   . ILE A 1 20  ? 25.364  18.902  40.141  1.00 61.61  ? 20   ILE A CG2   1 
ATOM   157  C CD1   . ILE A 1 20  ? 25.399  21.791  41.251  1.00 64.62  ? 20   ILE A CD1   1 
ATOM   158  N N     . ARG A 1 21  ? 22.525  18.386  42.947  1.00 65.39  ? 21   ARG A N     1 
ATOM   159  C CA    . ARG A 1 21  ? 21.096  18.259  42.742  1.00 66.42  ? 21   ARG A CA    1 
ATOM   160  C C     . ARG A 1 21  ? 20.719  19.395  41.799  1.00 65.94  ? 21   ARG A C     1 
ATOM   161  O O     . ARG A 1 21  ? 20.900  20.566  42.131  1.00 66.03  ? 21   ARG A O     1 
ATOM   162  C CB    . ARG A 1 21  ? 20.356  18.359  44.084  1.00 68.00  ? 21   ARG A CB    1 
ATOM   163  C CG    . ARG A 1 21  ? 18.856  18.123  44.021  1.00 69.30  ? 21   ARG A CG    1 
ATOM   164  C CD    . ARG A 1 21  ? 18.118  18.577  45.302  1.00 72.59  ? 21   ARG A CD    1 
ATOM   165  N NE    . ARG A 1 21  ? 16.867  19.270  44.960  1.00 76.94  ? 21   ARG A NE    1 
ATOM   166  C CZ    . ARG A 1 21  ? 15.770  19.343  45.725  1.00 80.41  ? 21   ARG A CZ    1 
ATOM   167  N NH1   . ARG A 1 21  ? 15.714  18.760  46.929  1.00 82.55  ? 21   ARG A NH1   1 
ATOM   168  N NH2   . ARG A 1 21  ? 14.702  20.013  45.273  1.00 80.25  ? 21   ARG A NH2   1 
ATOM   169  N N     . LEU A 1 22  ? 20.250  19.035  40.606  1.00 65.25  ? 22   LEU A N     1 
ATOM   170  C CA    . LEU A 1 22  ? 19.841  20.003  39.599  1.00 65.08  ? 22   LEU A CA    1 
ATOM   171  C C     . LEU A 1 22  ? 18.333  20.034  39.483  1.00 65.99  ? 22   LEU A C     1 
ATOM   172  O O     . LEU A 1 22  ? 17.660  19.055  39.772  1.00 65.22  ? 22   LEU A O     1 
ATOM   173  C CB    . LEU A 1 22  ? 20.431  19.649  38.235  1.00 63.86  ? 22   LEU A CB    1 
ATOM   174  C CG    . LEU A 1 22  ? 21.958  19.623  38.080  1.00 63.36  ? 22   LEU A CG    1 
ATOM   175  C CD1   . LEU A 1 22  ? 22.297  19.041  36.722  1.00 62.86  ? 22   LEU A CD1   1 
ATOM   176  C CD2   . LEU A 1 22  ? 22.566  21.003  38.242  1.00 63.35  ? 22   LEU A CD2   1 
ATOM   177  N N     . LYS A 1 23  ? 17.816  21.179  39.046  1.00 67.39  ? 23   LYS A N     1 
ATOM   178  C CA    . LYS A 1 23  ? 16.384  21.358  38.822  1.00 68.82  ? 23   LYS A CA    1 
ATOM   179  C C     . LYS A 1 23  ? 16.049  21.013  37.377  1.00 67.23  ? 23   LYS A C     1 
ATOM   180  O O     . LYS A 1 23  ? 16.654  21.552  36.466  1.00 66.36  ? 23   LYS A O     1 
ATOM   181  C CB    . LYS A 1 23  ? 15.978  22.805  39.103  1.00 70.33  ? 23   LYS A CB    1 
ATOM   182  C CG    . LYS A 1 23  ? 14.724  22.931  39.944  1.00 75.12  ? 23   LYS A CG    1 
ATOM   183  C CD    . LYS A 1 23  ? 13.443  22.669  39.137  1.00 77.73  ? 23   LYS A CD    1 
ATOM   184  C CE    . LYS A 1 23  ? 12.356  21.941  39.980  1.00 79.89  ? 23   LYS A CE    1 
ATOM   185  N NZ    . LYS A 1 23  ? 10.964  22.106  39.406  1.00 79.62  ? 23   LYS A NZ    1 
ATOM   186  N N     . ALA A 1 24  ? 15.119  20.084  37.183  1.00 66.79  ? 24   ALA A N     1 
ATOM   187  C CA    . ALA A 1 24  ? 14.470  19.886  35.893  1.00 65.65  ? 24   ALA A CA    1 
ATOM   188  C C     . ALA A 1 24  ? 13.012  20.330  36.054  1.00 66.65  ? 24   ALA A C     1 
ATOM   189  O O     . ALA A 1 24  ? 12.507  20.394  37.176  1.00 67.84  ? 24   ALA A O     1 
ATOM   190  C CB    . ALA A 1 24  ? 14.552  18.427  35.464  1.00 64.53  ? 24   ALA A CB    1 
ATOM   191  N N     . PRO A 1 25  ? 12.328  20.651  34.941  1.00 66.32  ? 25   PRO A N     1 
ATOM   192  C CA    . PRO A 1 25  ? 10.979  21.207  35.049  1.00 67.27  ? 25   PRO A CA    1 
ATOM   193  C C     . PRO A 1 25  ? 10.042  20.428  35.967  1.00 67.93  ? 25   PRO A C     1 
ATOM   194  O O     . PRO A 1 25  ? 9.325   21.030  36.742  1.00 69.79  ? 25   PRO A O     1 
ATOM   195  C CB    . PRO A 1 25  ? 10.480  21.177  33.608  1.00 66.68  ? 25   PRO A CB    1 
ATOM   196  C CG    . PRO A 1 25  ? 11.701  21.293  32.793  1.00 65.44  ? 25   PRO A CG    1 
ATOM   197  C CD    . PRO A 1 25  ? 12.759  20.543  33.534  1.00 65.20  ? 25   PRO A CD    1 
ATOM   198  N N     . GLY A 1 26  ? 10.064  19.104  35.895  1.00 66.90  ? 26   GLY A N     1 
ATOM   199  C CA    . GLY A 1 26  ? 9.164   18.277  36.695  1.00 67.63  ? 26   GLY A CA    1 
ATOM   200  C C     . GLY A 1 26  ? 9.675   17.907  38.077  1.00 67.71  ? 26   GLY A C     1 
ATOM   201  O O     . GLY A 1 26  ? 8.960   17.263  38.852  1.00 68.28  ? 26   GLY A O     1 
ATOM   202  N N     . GLY A 1 27  ? 10.909  18.296  38.388  1.00 66.59  ? 27   GLY A N     1 
ATOM   203  C CA    . GLY A 1 27  ? 11.523  17.941  39.661  1.00 66.67  ? 27   GLY A CA    1 
ATOM   204  C C     . GLY A 1 27  ? 13.031  17.793  39.603  1.00 65.43  ? 27   GLY A C     1 
ATOM   205  O O     . GLY A 1 27  ? 13.658  18.043  38.561  1.00 63.75  ? 27   GLY A O     1 
ATOM   206  N N     . PRO A 1 28  ? 13.629  17.385  40.731  1.00 65.57  ? 28   PRO A N     1 
ATOM   207  C CA    . PRO A 1 28  ? 15.071  17.315  40.837  1.00 64.63  ? 28   PRO A CA    1 
ATOM   208  C C     . PRO A 1 28  ? 15.677  16.085  40.179  1.00 63.49  ? 28   PRO A C     1 
ATOM   209  O O     . PRO A 1 28  ? 15.020  15.047  40.082  1.00 63.71  ? 28   PRO A O     1 
ATOM   210  C CB    . PRO A 1 28  ? 15.317  17.283  42.351  1.00 65.78  ? 28   PRO A CB    1 
ATOM   211  C CG    . PRO A 1 28  ? 14.085  16.677  42.928  1.00 67.35  ? 28   PRO A CG    1 
ATOM   212  C CD    . PRO A 1 28  ? 12.952  16.988  41.980  1.00 67.27  ? 28   PRO A CD    1 
ATOM   213  N N     . VAL A 1 29  ? 16.922  16.239  39.721  1.00 62.07  ? 29   VAL A N     1 
ATOM   214  C CA    . VAL A 1 29  ? 17.749  15.135  39.261  1.00 61.04  ? 29   VAL A CA    1 
ATOM   215  C C     . VAL A 1 29  ? 19.122  15.217  39.947  1.00 60.67  ? 29   VAL A C     1 
ATOM   216  O O     . VAL A 1 29  ? 19.506  16.272  40.468  1.00 60.26  ? 29   VAL A O     1 
ATOM   217  C CB    . VAL A 1 29  ? 17.903  15.126  37.711  1.00 60.05  ? 29   VAL A CB    1 
ATOM   218  C CG1   . VAL A 1 29  ? 16.547  14.988  37.036  1.00 59.44  ? 29   VAL A CG1   1 
ATOM   219  C CG2   . VAL A 1 29  ? 18.614  16.395  37.210  1.00 60.16  ? 29   VAL A CG2   1 
ATOM   220  N N     . SER A 1 30  ? 19.828  14.087  39.967  1.00 60.15  ? 30   SER A N     1 
ATOM   221  C CA    . SER A 1 30  ? 21.214  14.017  40.441  1.00 60.06  ? 30   SER A CA    1 
ATOM   222  C C     . SER A 1 30  ? 22.178  14.018  39.250  1.00 58.34  ? 30   SER A C     1 
ATOM   223  O O     . SER A 1 30  ? 21.999  13.261  38.293  1.00 57.07  ? 30   SER A O     1 
ATOM   224  C CB    . SER A 1 30  ? 21.463  12.744  41.253  1.00 60.56  ? 30   SER A CB    1 
ATOM   225  O OG    . SER A 1 30  ? 20.444  12.487  42.220  1.00 64.09  ? 30   SER A OG    1 
ATOM   226  N N     . ALA A 1 31  ? 23.213  14.852  39.332  1.00 57.77  ? 31   ALA A N     1 
ATOM   227  C CA    . ALA A 1 31  ? 24.235  14.923  38.305  1.00 56.41  ? 31   ALA A CA    1 
ATOM   228  C C     . ALA A 1 31  ? 25.611  14.735  38.928  1.00 56.32  ? 31   ALA A C     1 
ATOM   229  O O     . ALA A 1 31  ? 25.932  15.346  39.954  1.00 57.20  ? 31   ALA A O     1 
ATOM   230  C CB    . ALA A 1 31  ? 24.164  16.248  37.602  1.00 56.32  ? 31   ALA A CB    1 
ATOM   231  N N     . PHE A 1 32  ? 26.408  13.867  38.311  1.00 54.79  ? 32   PHE A N     1 
ATOM   232  C CA    . PHE A 1 32  ? 27.786  13.672  38.689  1.00 54.18  ? 32   PHE A CA    1 
ATOM   233  C C     . PHE A 1 32  ? 28.606  14.062  37.483  1.00 53.22  ? 32   PHE A C     1 
ATOM   234  O O     . PHE A 1 32  ? 28.733  13.297  36.553  1.00 52.70  ? 32   PHE A O     1 
ATOM   235  C CB    . PHE A 1 32  ? 27.997  12.230  39.139  1.00 53.92  ? 32   PHE A CB    1 
ATOM   236  C CG    . PHE A 1 32  ? 27.198  11.894  40.357  1.00 54.69  ? 32   PHE A CG    1 
ATOM   237  C CD1   . PHE A 1 32  ? 25.868  11.514  40.244  1.00 53.64  ? 32   PHE A CD1   1 
ATOM   238  C CD2   . PHE A 1 32  ? 27.752  12.020  41.624  1.00 55.15  ? 32   PHE A CD2   1 
ATOM   239  C CE1   . PHE A 1 32  ? 25.105  11.252  41.366  1.00 53.72  ? 32   PHE A CE1   1 
ATOM   240  C CE2   . PHE A 1 32  ? 26.990  11.750  42.760  1.00 55.35  ? 32   PHE A CE2   1 
ATOM   241  C CZ    . PHE A 1 32  ? 25.663  11.376  42.627  1.00 54.67  ? 32   PHE A CZ    1 
ATOM   242  N N     . LEU A 1 33  ? 29.115  15.290  37.489  1.00 53.54  ? 33   LEU A N     1 
ATOM   243  C CA    . LEU A 1 33  ? 29.766  15.874  36.319  1.00 53.00  ? 33   LEU A CA    1 
ATOM   244  C C     . LEU A 1 33  ? 31.267  15.975  36.498  1.00 53.51  ? 33   LEU A C     1 
ATOM   245  O O     . LEU A 1 33  ? 31.742  16.315  37.562  1.00 54.52  ? 33   LEU A O     1 
ATOM   246  C CB    . LEU A 1 33  ? 29.211  17.268  36.043  1.00 53.16  ? 33   LEU A CB    1 
ATOM   247  C CG    . LEU A 1 33  ? 27.690  17.388  35.896  1.00 51.92  ? 33   LEU A CG    1 
ATOM   248  C CD1   . LEU A 1 33  ? 27.328  18.854  35.843  1.00 50.42  ? 33   LEU A CD1   1 
ATOM   249  C CD2   . LEU A 1 33  ? 27.148  16.637  34.692  1.00 47.89  ? 33   LEU A CD2   1 
ATOM   250  N N     . GLY A 1 34  ? 32.016  15.672  35.446  1.00 53.31  ? 34   GLY A N     1 
ATOM   251  C CA    . GLY A 1 34  ? 33.468  15.768  35.504  1.00 53.57  ? 34   GLY A CA    1 
ATOM   252  C C     . GLY A 1 34  ? 34.148  14.641  36.256  1.00 53.86  ? 34   GLY A C     1 
ATOM   253  O O     . GLY A 1 34  ? 35.133  14.878  36.950  1.00 55.05  ? 34   GLY A O     1 
ATOM   254  N N     . ILE A 1 35  ? 33.644  13.415  36.102  1.00 53.66  ? 35   ILE A N     1 
ATOM   255  C CA    . ILE A 1 35  ? 34.296  12.217  36.678  1.00 54.07  ? 35   ILE A CA    1 
ATOM   256  C C     . ILE A 1 35  ? 35.421  11.741  35.747  1.00 54.36  ? 35   ILE A C     1 
ATOM   257  O O     . ILE A 1 35  ? 35.165  11.352  34.614  1.00 53.97  ? 35   ILE A O     1 
ATOM   258  C CB    . ILE A 1 35  ? 33.324  11.005  36.857  1.00 53.97  ? 35   ILE A CB    1 
ATOM   259  C CG1   . ILE A 1 35  ? 32.051  11.377  37.653  1.00 53.84  ? 35   ILE A CG1   1 
ATOM   260  C CG2   . ILE A 1 35  ? 34.068  9.833   37.514  1.00 53.76  ? 35   ILE A CG2   1 
ATOM   261  C CD1   . ILE A 1 35  ? 30.982  10.255  37.670  1.00 53.06  ? 35   ILE A CD1   1 
ATOM   262  N N     . PRO A 1 36  ? 36.668  11.734  36.228  1.00 55.63  ? 36   PRO A N     1 
ATOM   263  C CA    . PRO A 1 36  ? 37.767  11.320  35.346  1.00 55.74  ? 36   PRO A CA    1 
ATOM   264  C C     . PRO A 1 36  ? 37.738  9.798   35.111  1.00 55.77  ? 36   PRO A C     1 
ATOM   265  O O     . PRO A 1 36  ? 37.585  9.067   36.068  1.00 56.11  ? 36   PRO A O     1 
ATOM   266  C CB    . PRO A 1 36  ? 39.007  11.696  36.162  1.00 56.94  ? 36   PRO A CB    1 
ATOM   267  C CG    . PRO A 1 36  ? 38.554  11.589  37.609  1.00 56.63  ? 36   PRO A CG    1 
ATOM   268  C CD    . PRO A 1 36  ? 37.131  12.042  37.599  1.00 56.47  ? 36   PRO A CD    1 
ATOM   269  N N     . PHE A 1 37  ? 37.878  9.332   33.868  1.00 55.49  ? 37   PHE A N     1 
ATOM   270  C CA    . PHE A 1 37  ? 37.895  7.878   33.581  1.00 55.86  ? 37   PHE A CA    1 
ATOM   271  C C     . PHE A 1 37  ? 39.232  7.365   33.016  1.00 56.57  ? 37   PHE A C     1 
ATOM   272  O O     . PHE A 1 37  ? 39.412  6.148   32.820  1.00 57.10  ? 37   PHE A O     1 
ATOM   273  C CB    . PHE A 1 37  ? 36.727  7.486   32.662  1.00 55.63  ? 37   PHE A CB    1 
ATOM   274  C CG    . PHE A 1 37  ? 36.789  8.096   31.297  1.00 55.28  ? 37   PHE A CG    1 
ATOM   275  C CD1   . PHE A 1 37  ? 37.483  7.467   30.280  1.00 56.05  ? 37   PHE A CD1   1 
ATOM   276  C CD2   . PHE A 1 37  ? 36.156  9.312   31.028  1.00 56.30  ? 37   PHE A CD2   1 
ATOM   277  C CE1   . PHE A 1 37  ? 37.559  8.027   29.017  1.00 55.24  ? 37   PHE A CE1   1 
ATOM   278  C CE2   . PHE A 1 37  ? 36.226  9.879   29.757  1.00 54.97  ? 37   PHE A CE2   1 
ATOM   279  C CZ    . PHE A 1 37  ? 36.935  9.221   28.752  1.00 54.39  ? 37   PHE A CZ    1 
ATOM   280  N N     . ALA A 1 38  ? 40.167  8.291   32.802  1.00 56.80  ? 38   ALA A N     1 
ATOM   281  C CA    . ALA A 1 38  ? 41.489  8.010   32.269  1.00 57.51  ? 38   ALA A CA    1 
ATOM   282  C C     . ALA A 1 38  ? 42.532  8.872   32.976  1.00 58.77  ? 38   ALA A C     1 
ATOM   283  O O     . ALA A 1 38  ? 42.209  9.889   33.560  1.00 59.42  ? 38   ALA A O     1 
ATOM   284  C CB    . ALA A 1 38  ? 41.515  8.317   30.791  1.00 56.87  ? 38   ALA A CB    1 
ATOM   285  N N     . GLU A 1 39  ? 43.791  8.474   32.910  1.00 60.10  ? 39   GLU A N     1 
ATOM   286  C CA    . GLU A 1 39  ? 44.867  9.371   33.264  1.00 61.67  ? 39   GLU A CA    1 
ATOM   287  C C     . GLU A 1 39  ? 44.919  10.457  32.204  1.00 61.51  ? 39   GLU A C     1 
ATOM   288  O O     . GLU A 1 39  ? 44.721  10.167  31.023  1.00 61.75  ? 39   GLU A O     1 
ATOM   289  C CB    . GLU A 1 39  ? 46.190  8.618   33.311  1.00 63.30  ? 39   GLU A CB    1 
ATOM   290  C CG    . GLU A 1 39  ? 46.275  7.690   34.518  1.00 65.54  ? 39   GLU A CG    1 
ATOM   291  C CD    . GLU A 1 39  ? 46.308  8.477   35.820  1.00 67.85  ? 39   GLU A CD    1 
ATOM   292  O OE1   . GLU A 1 39  ? 47.294  9.213   36.033  1.00 71.69  ? 39   GLU A OE1   1 
ATOM   293  O OE2   . GLU A 1 39  ? 45.357  8.380   36.615  1.00 66.77  ? 39   GLU A OE2   1 
ATOM   294  N N     . PRO A 1 40  ? 45.165  11.713  32.604  1.00 61.60  ? 40   PRO A N     1 
ATOM   295  C CA    . PRO A 1 40  ? 45.243  12.769  31.592  1.00 61.16  ? 40   PRO A CA    1 
ATOM   296  C C     . PRO A 1 40  ? 46.205  12.407  30.461  1.00 61.60  ? 40   PRO A C     1 
ATOM   297  O O     . PRO A 1 40  ? 47.361  12.070  30.721  1.00 63.06  ? 40   PRO A O     1 
ATOM   298  C CB    . PRO A 1 40  ? 45.758  13.974  32.380  1.00 62.17  ? 40   PRO A CB    1 
ATOM   299  C CG    . PRO A 1 40  ? 45.400  13.695  33.802  1.00 62.40  ? 40   PRO A CG    1 
ATOM   300  C CD    . PRO A 1 40  ? 45.378  12.217  33.971  1.00 62.17  ? 40   PRO A CD    1 
ATOM   301  N N     . PRO A 1 41  ? 45.733  12.439  29.210  1.00 60.78  ? 41   PRO A N     1 
ATOM   302  C CA    . PRO A 1 41  ? 46.568  12.002  28.089  1.00 61.18  ? 41   PRO A CA    1 
ATOM   303  C C     . PRO A 1 41  ? 47.537  13.101  27.621  1.00 61.80  ? 41   PRO A C     1 
ATOM   304  O O     . PRO A 1 41  ? 47.497  13.530  26.454  1.00 60.83  ? 41   PRO A O     1 
ATOM   305  C CB    . PRO A 1 41  ? 45.526  11.674  27.014  1.00 60.24  ? 41   PRO A CB    1 
ATOM   306  C CG    . PRO A 1 41  ? 44.473  12.724  27.238  1.00 59.58  ? 41   PRO A CG    1 
ATOM   307  C CD    . PRO A 1 41  ? 44.394  12.857  28.756  1.00 59.84  ? 41   PRO A CD    1 
ATOM   308  N N     . VAL A 1 42  ? 48.415  13.523  28.530  1.00 62.65  ? 42   VAL A N     1 
ATOM   309  C CA    . VAL A 1 42  ? 49.242  14.707  28.315  1.00 63.35  ? 42   VAL A CA    1 
ATOM   310  C C     . VAL A 1 42  ? 50.724  14.354  28.269  1.00 65.31  ? 42   VAL A C     1 
ATOM   311  O O     . VAL A 1 42  ? 51.147  13.292  28.736  1.00 65.47  ? 42   VAL A O     1 
ATOM   312  C CB    . VAL A 1 42  ? 48.983  15.789  29.418  1.00 63.83  ? 42   VAL A CB    1 
ATOM   313  C CG1   . VAL A 1 42  ? 47.504  16.180  29.467  1.00 60.48  ? 42   VAL A CG1   1 
ATOM   314  C CG2   . VAL A 1 42  ? 49.472  15.313  30.800  1.00 63.38  ? 42   VAL A CG2   1 
ATOM   315  N N     . GLY A 1 43  ? 51.515  15.254  27.700  1.00 66.49  ? 43   GLY A N     1 
ATOM   316  C CA    . GLY A 1 43  ? 52.951  15.041  27.589  1.00 68.22  ? 43   GLY A CA    1 
ATOM   317  C C     . GLY A 1 43  ? 53.284  13.800  26.776  1.00 68.55  ? 43   GLY A C     1 
ATOM   318  O O     . GLY A 1 43  ? 52.884  13.669  25.612  1.00 68.05  ? 43   GLY A O     1 
ATOM   319  N N     . SER A 1 44  ? 54.001  12.877  27.402  1.00 69.51  ? 44   SER A N     1 
ATOM   320  C CA    . SER A 1 44  ? 54.436  11.654  26.744  1.00 70.01  ? 44   SER A CA    1 
ATOM   321  C C     . SER A 1 44  ? 53.273  10.739  26.359  1.00 68.57  ? 44   SER A C     1 
ATOM   322  O O     . SER A 1 44  ? 53.464  9.813   25.582  1.00 68.82  ? 44   SER A O     1 
ATOM   323  C CB    . SER A 1 44  ? 55.405  10.901  27.656  1.00 71.34  ? 44   SER A CB    1 
ATOM   324  O OG    . SER A 1 44  ? 54.752  10.517  28.854  1.00 70.59  ? 44   SER A OG    1 
ATOM   325  N N     . ARG A 1 45  ? 52.081  10.999  26.907  1.00 67.47  ? 45   ARG A N     1 
ATOM   326  C CA    . ARG A 1 45  ? 50.865  10.237  26.583  1.00 66.10  ? 45   ARG A CA    1 
ATOM   327  C C     . ARG A 1 45  ? 50.053  10.777  25.403  1.00 64.02  ? 45   ARG A C     1 
ATOM   328  O O     . ARG A 1 45  ? 49.039  10.184  25.040  1.00 62.28  ? 45   ARG A O     1 
ATOM   329  C CB    . ARG A 1 45  ? 49.941  10.165  27.796  1.00 65.95  ? 45   ARG A CB    1 
ATOM   330  C CG    . ARG A 1 45  ? 50.508  9.456   28.985  1.00 69.34  ? 45   ARG A CG    1 
ATOM   331  C CD    . ARG A 1 45  ? 51.032  8.037   28.668  1.00 75.44  ? 45   ARG A CD    1 
ATOM   332  N NE    . ARG A 1 45  ? 50.052  7.143   28.014  1.00 77.22  ? 45   ARG A NE    1 
ATOM   333  C CZ    . ARG A 1 45  ? 50.242  5.830   27.820  1.00 77.93  ? 45   ARG A CZ    1 
ATOM   334  N NH1   . ARG A 1 45  ? 51.353  5.237   28.241  1.00 79.77  ? 45   ARG A NH1   1 
ATOM   335  N NH2   . ARG A 1 45  ? 49.308  5.097   27.214  1.00 76.72  ? 45   ARG A NH2   1 
ATOM   336  N N     . ARG A 1 46  ? 50.483  11.894  24.816  1.00 63.48  ? 46   ARG A N     1 
ATOM   337  C CA    . ARG A 1 46  ? 49.829  12.418  23.616  1.00 62.10  ? 46   ARG A CA    1 
ATOM   338  C C     . ARG A 1 46  ? 49.934  11.398  22.499  1.00 62.06  ? 46   ARG A C     1 
ATOM   339  O O     . ARG A 1 46  ? 50.991  10.769  22.330  1.00 63.38  ? 46   ARG A O     1 
ATOM   340  C CB    . ARG A 1 46  ? 50.461  13.735  23.162  1.00 62.78  ? 46   ARG A CB    1 
ATOM   341  C CG    . ARG A 1 46  ? 49.679  14.448  22.053  1.00 61.45  ? 46   ARG A CG    1 
ATOM   342  C CD    . ARG A 1 46  ? 50.461  15.628  21.494  1.00 62.20  ? 46   ARG A CD    1 
ATOM   343  N NE    . ARG A 1 46  ? 50.286  16.836  22.293  1.00 61.88  ? 46   ARG A NE    1 
ATOM   344  C CZ    . ARG A 1 46  ? 50.866  18.001  22.023  1.00 63.82  ? 46   ARG A CZ    1 
ATOM   345  N NH1   . ARG A 1 46  ? 51.694  18.109  20.995  1.00 65.29  ? 46   ARG A NH1   1 
ATOM   346  N NH2   . ARG A 1 46  ? 50.637  19.054  22.798  1.00 63.36  ? 46   ARG A NH2   1 
ATOM   347  N N     . PHE A 1 47  ? 48.839  11.248  21.752  1.00 60.35  ? 47   PHE A N     1 
ATOM   348  C CA    . PHE A 1 47  ? 48.677  10.227  20.698  1.00 60.40  ? 47   PHE A CA    1 
ATOM   349  C C     . PHE A 1 47  ? 48.608  8.766   21.181  1.00 61.22  ? 47   PHE A C     1 
ATOM   350  O O     . PHE A 1 47  ? 48.408  7.865   20.362  1.00 61.78  ? 47   PHE A O     1 
ATOM   351  C CB    . PHE A 1 47  ? 49.747  10.347  19.612  1.00 61.19  ? 47   PHE A CB    1 
ATOM   352  C CG    . PHE A 1 47  ? 49.994  11.753  19.150  1.00 60.94  ? 47   PHE A CG    1 
ATOM   353  C CD1   . PHE A 1 47  ? 48.960  12.521  18.634  1.00 60.35  ? 47   PHE A CD1   1 
ATOM   354  C CD2   . PHE A 1 47  ? 51.262  12.307  19.229  1.00 61.45  ? 47   PHE A CD2   1 
ATOM   355  C CE1   . PHE A 1 47  ? 49.191  13.830  18.198  1.00 60.90  ? 47   PHE A CE1   1 
ATOM   356  C CE2   . PHE A 1 47  ? 51.496  13.592  18.806  1.00 61.77  ? 47   PHE A CE2   1 
ATOM   357  C CZ    . PHE A 1 47  ? 50.462  14.362  18.291  1.00 60.71  ? 47   PHE A CZ    1 
ATOM   358  N N     . MET A 1 48  ? 48.729  8.537   22.486  1.00 61.37  ? 48   MET A N     1 
ATOM   359  C CA    . MET A 1 48  ? 48.766  7.194   23.040  1.00 62.62  ? 48   MET A CA    1 
ATOM   360  C C     . MET A 1 48  ? 47.390  6.747   23.517  1.00 61.04  ? 48   MET A C     1 
ATOM   361  O O     . MET A 1 48  ? 46.610  7.566   23.980  1.00 60.17  ? 48   MET A O     1 
ATOM   362  C CB    . MET A 1 48  ? 49.708  7.159   24.249  1.00 63.99  ? 48   MET A CB    1 
ATOM   363  C CG    . MET A 1 48  ? 51.175  7.446   23.939  1.00 67.81  ? 48   MET A CG    1 
ATOM   364  S SD    . MET A 1 48  ? 52.147  5.947   24.112  1.00 76.62  ? 48   MET A SD    1 
ATOM   365  C CE    . MET A 1 48  ? 51.682  5.212   22.542  1.00 73.21  ? 48   MET A CE    1 
ATOM   366  N N     . PRO A 1 49  ? 47.118  5.436   23.480  1.00 61.19  ? 49   PRO A N     1 
ATOM   367  C CA    . PRO A 1 49  ? 45.888  4.903   24.061  1.00 60.75  ? 49   PRO A CA    1 
ATOM   368  C C     . PRO A 1 49  ? 45.681  5.395   25.498  1.00 61.00  ? 49   PRO A C     1 
ATOM   369  O O     . PRO A 1 49  ? 46.660  5.619   26.216  1.00 61.73  ? 49   PRO A O     1 
ATOM   370  C CB    . PRO A 1 49  ? 46.125  3.386   24.077  1.00 61.62  ? 49   PRO A CB    1 
ATOM   371  C CG    . PRO A 1 49  ? 47.193  3.129   23.077  1.00 62.30  ? 49   PRO A CG    1 
ATOM   372  C CD    . PRO A 1 49  ? 47.982  4.381   22.913  1.00 62.33  ? 49   PRO A CD    1 
ATOM   373  N N     . PRO A 1 50  ? 44.422  5.518   25.936  1.00 60.25  ? 50   PRO A N     1 
ATOM   374  C CA    . PRO A 1 50  ? 44.160  5.953   27.298  1.00 60.75  ? 50   PRO A CA    1 
ATOM   375  C C     . PRO A 1 50  ? 44.491  4.849   28.299  1.00 62.64  ? 50   PRO A C     1 
ATOM   376  O O     . PRO A 1 50  ? 44.257  3.665   28.027  1.00 62.51  ? 50   PRO A O     1 
ATOM   377  C CB    . PRO A 1 50  ? 42.651  6.211   27.302  1.00 59.60  ? 50   PRO A CB    1 
ATOM   378  C CG    . PRO A 1 50  ? 42.114  5.256   26.293  1.00 59.18  ? 50   PRO A CG    1 
ATOM   379  C CD    . PRO A 1 50  ? 43.186  5.180   25.217  1.00 59.70  ? 50   PRO A CD    1 
ATOM   380  N N     . GLU A 1 51  ? 45.041  5.249   29.441  1.00 64.39  ? 51   GLU A N     1 
ATOM   381  C CA    . GLU A 1 51  ? 45.208  4.354   30.586  1.00 66.29  ? 51   GLU A CA    1 
ATOM   382  C C     . GLU A 1 51  ? 44.119  4.676   31.606  1.00 64.74  ? 51   GLU A C     1 
ATOM   383  O O     . GLU A 1 51  ? 43.783  5.835   31.809  1.00 63.83  ? 51   GLU A O     1 
ATOM   384  C CB    . GLU A 1 51  ? 46.578  4.544   31.230  1.00 67.48  ? 51   GLU A CB    1 
ATOM   385  C CG    . GLU A 1 51  ? 47.723  4.620   30.245  1.00 70.63  ? 51   GLU A CG    1 
ATOM   386  C CD    . GLU A 1 51  ? 49.077  4.761   30.944  1.00 73.77  ? 51   GLU A CD    1 
ATOM   387  O OE1   . GLU A 1 51  ? 49.614  5.906   30.969  1.00 80.27  ? 51   GLU A OE1   1 
ATOM   388  O OE2   . GLU A 1 51  ? 49.592  3.732   31.464  1.00 78.57  ? 51   GLU A OE2   1 
ATOM   389  N N     . PRO A 1 52  ? 43.573  3.650   32.268  1.00 64.93  ? 52   PRO A N     1 
ATOM   390  C CA    . PRO A 1 52  ? 42.521  3.911   33.266  1.00 64.38  ? 52   PRO A CA    1 
ATOM   391  C C     . PRO A 1 52  ? 42.957  4.858   34.396  1.00 64.46  ? 52   PRO A C     1 
ATOM   392  O O     . PRO A 1 52  ? 44.099  4.797   34.857  1.00 65.59  ? 52   PRO A O     1 
ATOM   393  C CB    . PRO A 1 52  ? 42.221  2.531   33.845  1.00 65.03  ? 52   PRO A CB    1 
ATOM   394  C CG    . PRO A 1 52  ? 42.839  1.534   32.883  1.00 66.15  ? 52   PRO A CG    1 
ATOM   395  C CD    . PRO A 1 52  ? 43.925  2.224   32.149  1.00 65.59  ? 52   PRO A CD    1 
ATOM   396  N N     . LYS A 1 53  ? 42.035  5.690   34.855  1.00 63.52  ? 53   LYS A N     1 
ATOM   397  C CA    . LYS A 1 53  ? 42.311  6.634   35.932  1.00 64.19  ? 53   LYS A CA    1 
ATOM   398  C C     . LYS A 1 53  ? 42.698  5.916   37.210  1.00 65.43  ? 53   LYS A C     1 
ATOM   399  O O     . LYS A 1 53  ? 42.023  4.977   37.621  1.00 65.82  ? 53   LYS A O     1 
ATOM   400  C CB    . LYS A 1 53  ? 41.089  7.518   36.190  1.00 63.39  ? 53   LYS A CB    1 
ATOM   401  C CG    . LYS A 1 53  ? 41.210  8.451   37.381  1.00 64.02  ? 53   LYS A CG    1 
ATOM   402  C CD    . LYS A 1 53  ? 42.160  9.601   37.100  1.00 65.25  ? 53   LYS A CD    1 
ATOM   403  C CE    . LYS A 1 53  ? 42.226  10.549  38.291  1.00 65.94  ? 53   LYS A CE    1 
ATOM   404  N NZ    . LYS A 1 53  ? 43.211  11.633  38.064  1.00 67.89  ? 53   LYS A NZ    1 
ATOM   405  N N     . ARG A 1 54  ? 43.776  6.377   37.840  1.00 66.35  ? 54   ARG A N     1 
ATOM   406  C CA    . ARG A 1 54  ? 44.233  5.827   39.114  1.00 67.75  ? 54   ARG A CA    1 
ATOM   407  C C     . ARG A 1 54  ? 43.387  6.365   40.274  1.00 66.90  ? 54   ARG A C     1 
ATOM   408  O O     . ARG A 1 54  ? 43.006  7.540   40.268  1.00 66.52  ? 54   ARG A O     1 
ATOM   409  C CB    . ARG A 1 54  ? 45.721  6.147   39.318  1.00 69.40  ? 54   ARG A CB    1 
ATOM   410  C CG    . ARG A 1 54  ? 46.622  5.182   38.546  1.00 73.46  ? 54   ARG A CG    1 
ATOM   411  C CD    . ARG A 1 54  ? 47.852  5.841   37.932  1.00 78.84  ? 54   ARG A CD    1 
ATOM   412  N NE    . ARG A 1 54  ? 48.889  6.122   38.921  1.00 82.22  ? 54   ARG A NE    1 
ATOM   413  C CZ    . ARG A 1 54  ? 49.421  7.324   39.187  1.00 85.08  ? 54   ARG A CZ    1 
ATOM   414  N NH1   . ARG A 1 54  ? 49.053  8.433   38.536  1.00 83.91  ? 54   ARG A NH1   1 
ATOM   415  N NH2   . ARG A 1 54  ? 50.366  7.412   40.125  1.00 87.92  ? 54   ARG A NH2   1 
ATOM   416  N N     . PRO A 1 55  ? 43.082  5.510   41.270  1.00 66.86  ? 55   PRO A N     1 
ATOM   417  C CA    . PRO A 1 55  ? 42.262  5.955   42.390  1.00 66.95  ? 55   PRO A CA    1 
ATOM   418  C C     . PRO A 1 55  ? 42.730  7.265   43.026  1.00 67.81  ? 55   PRO A C     1 
ATOM   419  O O     . PRO A 1 55  ? 43.926  7.507   43.134  1.00 68.57  ? 55   PRO A O     1 
ATOM   420  C CB    . PRO A 1 55  ? 42.375  4.801   43.389  1.00 67.63  ? 55   PRO A CB    1 
ATOM   421  C CG    . PRO A 1 55  ? 42.601  3.623   42.566  1.00 67.58  ? 55   PRO A CG    1 
ATOM   422  C CD    . PRO A 1 55  ? 43.442  4.086   41.402  1.00 67.46  ? 55   PRO A CD    1 
ATOM   423  N N     . TRP A 1 56  ? 41.777  8.100   43.435  1.00 67.92  ? 56   TRP A N     1 
ATOM   424  C CA    . TRP A 1 56  ? 42.085  9.362   44.116  1.00 68.94  ? 56   TRP A CA    1 
ATOM   425  C C     . TRP A 1 56  ? 41.765  9.213   45.593  1.00 70.26  ? 56   TRP A C     1 
ATOM   426  O O     . TRP A 1 56  ? 41.087  8.256   46.008  1.00 70.57  ? 56   TRP A O     1 
ATOM   427  C CB    . TRP A 1 56  ? 41.286  10.524  43.523  1.00 68.14  ? 56   TRP A CB    1 
ATOM   428  C CG    . TRP A 1 56  ? 39.813  10.281  43.523  1.00 67.87  ? 56   TRP A CG    1 
ATOM   429  C CD1   . TRP A 1 56  ? 38.931  10.563  44.528  1.00 68.56  ? 56   TRP A CD1   1 
ATOM   430  C CD2   . TRP A 1 56  ? 39.048  9.687   42.475  1.00 66.48  ? 56   TRP A CD2   1 
ATOM   431  N NE1   . TRP A 1 56  ? 37.667  10.193  44.162  1.00 67.43  ? 56   TRP A NE1   1 
ATOM   432  C CE2   . TRP A 1 56  ? 37.710  9.648   42.907  1.00 66.59  ? 56   TRP A CE2   1 
ATOM   433  C CE3   . TRP A 1 56  ? 39.364  9.188   41.208  1.00 66.15  ? 56   TRP A CE3   1 
ATOM   434  C CZ2   . TRP A 1 56  ? 36.689  9.128   42.120  1.00 65.44  ? 56   TRP A CZ2   1 
ATOM   435  C CZ3   . TRP A 1 56  ? 38.353  8.668   40.429  1.00 65.24  ? 56   TRP A CZ3   1 
ATOM   436  C CH2   . TRP A 1 56  ? 37.030  8.640   40.888  1.00 65.28  ? 56   TRP A CH2   1 
ATOM   437  N N     . SER A 1 57  ? 42.260  10.152  46.393  1.00 71.35  ? 57   SER A N     1 
ATOM   438  C CA    . SER A 1 57  ? 41.947  10.154  47.805  1.00 72.50  ? 57   SER A CA    1 
ATOM   439  C C     . SER A 1 57  ? 40.939  11.264  48.096  1.00 71.89  ? 57   SER A C     1 
ATOM   440  O O     . SER A 1 57  ? 40.929  12.314  47.432  1.00 70.68  ? 57   SER A O     1 
ATOM   441  C CB    . SER A 1 57  ? 43.220  10.320  48.643  1.00 74.59  ? 57   SER A CB    1 
ATOM   442  O OG    . SER A 1 57  ? 43.684  11.663  48.605  1.00 76.39  ? 57   SER A OG    1 
ATOM   443  N N     . GLY A 1 58  ? 40.087  11.011  49.089  1.00 72.02  ? 58   GLY A N     1 
ATOM   444  C CA    . GLY A 1 58  ? 39.062  11.964  49.503  1.00 71.54  ? 58   GLY A CA    1 
ATOM   445  C C     . GLY A 1 58  ? 37.897  11.973  48.545  1.00 69.85  ? 58   GLY A C     1 
ATOM   446  O O     . GLY A 1 58  ? 37.764  11.076  47.703  1.00 68.75  ? 58   GLY A O     1 
ATOM   447  N N     . VAL A 1 59  ? 37.067  13.007  48.675  1.00 69.48  ? 59   VAL A N     1 
ATOM   448  C CA    . VAL A 1 59  ? 35.861  13.161  47.876  1.00 68.07  ? 59   VAL A CA    1 
ATOM   449  C C     . VAL A 1 59  ? 36.108  14.103  46.689  1.00 67.40  ? 59   VAL A C     1 
ATOM   450  O O     . VAL A 1 59  ? 36.344  15.309  46.866  1.00 67.36  ? 59   VAL A O     1 
ATOM   451  C CB    . VAL A 1 59  ? 34.677  13.703  48.729  1.00 68.53  ? 59   VAL A CB    1 
ATOM   452  C CG1   . VAL A 1 59  ? 33.390  13.727  47.906  1.00 66.18  ? 59   VAL A CG1   1 
ATOM   453  C CG2   . VAL A 1 59  ? 34.495  12.856  49.998  1.00 68.78  ? 59   VAL A CG2   1 
ATOM   454  N N     . LEU A 1 60  ? 36.053  13.531  45.486  1.00 66.27  ? 60   LEU A N     1 
ATOM   455  C CA    . LEU A 1 60  ? 36.173  14.295  44.246  1.00 65.77  ? 60   LEU A CA    1 
ATOM   456  C C     . LEU A 1 60  ? 34.902  15.098  44.037  1.00 65.59  ? 60   LEU A C     1 
ATOM   457  O O     . LEU A 1 60  ? 33.805  14.564  44.151  1.00 65.55  ? 60   LEU A O     1 
ATOM   458  C CB    . LEU A 1 60  ? 36.383  13.347  43.059  1.00 64.93  ? 60   LEU A CB    1 
ATOM   459  C CG    . LEU A 1 60  ? 36.805  13.933  41.704  1.00 63.97  ? 60   LEU A CG    1 
ATOM   460  C CD1   . LEU A 1 60  ? 38.297  13.777  41.472  1.00 65.74  ? 60   LEU A CD1   1 
ATOM   461  C CD2   . LEU A 1 60  ? 36.086  13.227  40.600  1.00 63.94  ? 60   LEU A CD2   1 
ATOM   462  N N     . ASP A 1 61  ? 35.047  16.382  43.741  1.00 65.96  ? 61   ASP A N     1 
ATOM   463  C CA    . ASP A 1 61  ? 33.900  17.212  43.439  1.00 65.87  ? 61   ASP A CA    1 
ATOM   464  C C     . ASP A 1 61  ? 33.401  16.954  42.015  1.00 63.71  ? 61   ASP A C     1 
ATOM   465  O O     . ASP A 1 61  ? 34.043  17.363  41.048  1.00 63.57  ? 61   ASP A O     1 
ATOM   466  C CB    . ASP A 1 61  ? 34.250  18.688  43.613  1.00 67.22  ? 61   ASP A CB    1 
ATOM   467  C CG    . ASP A 1 61  ? 33.073  19.591  43.315  1.00 69.55  ? 61   ASP A CG    1 
ATOM   468  O OD1   . ASP A 1 61  ? 32.801  19.848  42.120  1.00 70.90  ? 61   ASP A OD1   1 
ATOM   469  O OD2   . ASP A 1 61  ? 32.404  20.024  44.284  1.00 74.94  ? 61   ASP A OD2   1 
ATOM   470  N N     . ALA A 1 62  ? 32.257  16.283  41.883  1.00 62.23  ? 62   ALA A N     1 
ATOM   471  C CA    . ALA A 1 62  ? 31.657  16.042  40.570  1.00 60.15  ? 62   ALA A CA    1 
ATOM   472  C C     . ALA A 1 62  ? 30.400  16.915  40.349  1.00 59.76  ? 62   ALA A C     1 
ATOM   473  O O     . ALA A 1 62  ? 29.354  16.440  39.899  1.00 58.15  ? 62   ALA A O     1 
ATOM   474  C CB    . ALA A 1 62  ? 31.348  14.578  40.405  1.00 59.64  ? 62   ALA A CB    1 
ATOM   475  N N     . THR A 1 63  ? 30.536  18.210  40.630  1.00 60.16  ? 63   THR A N     1 
ATOM   476  C CA    . THR A 1 63  ? 29.414  19.149  40.566  1.00 60.25  ? 63   THR A CA    1 
ATOM   477  C C     . THR A 1 63  ? 29.476  20.081  39.358  1.00 60.22  ? 63   THR A C     1 
ATOM   478  O O     . THR A 1 63  ? 28.576  20.875  39.150  1.00 60.74  ? 63   THR A O     1 
ATOM   479  C CB    . THR A 1 63  ? 29.345  20.019  41.832  1.00 61.64  ? 63   THR A CB    1 
ATOM   480  O OG1   . THR A 1 63  ? 30.448  20.926  41.833  1.00 61.15  ? 63   THR A OG1   1 
ATOM   481  C CG2   . THR A 1 63  ? 29.358  19.149  43.132  1.00 60.48  ? 63   THR A CG2   1 
ATOM   482  N N     . THR A 1 64  ? 30.517  19.979  38.544  1.00 59.94  ? 64   THR A N     1 
ATOM   483  C CA    . THR A 1 64  ? 30.642  20.855  37.387  1.00 59.87  ? 64   THR A CA    1 
ATOM   484  C C     . THR A 1 64  ? 31.331  20.166  36.213  1.00 58.26  ? 64   THR A C     1 
ATOM   485  O O     . THR A 1 64  ? 32.158  19.276  36.411  1.00 58.65  ? 64   THR A O     1 
ATOM   486  C CB    . THR A 1 64  ? 31.388  22.161  37.752  1.00 61.22  ? 64   THR A CB    1 
ATOM   487  O OG1   . THR A 1 64  ? 31.265  23.077  36.655  1.00 65.61  ? 64   THR A OG1   1 
ATOM   488  C CG2   . THR A 1 64  ? 32.852  21.909  38.033  1.00 60.57  ? 64   THR A CG2   1 
ATOM   489  N N     . PHE A 1 65  ? 30.959  20.549  34.996  1.00 56.84  ? 65   PHE A N     1 
ATOM   490  C CA    . PHE A 1 65  ? 31.565  19.988  33.804  1.00 55.56  ? 65   PHE A CA    1 
ATOM   491  C C     . PHE A 1 65  ? 33.056  20.305  33.788  1.00 56.40  ? 65   PHE A C     1 
ATOM   492  O O     . PHE A 1 65  ? 33.494  21.401  34.203  1.00 57.27  ? 65   PHE A O     1 
ATOM   493  C CB    . PHE A 1 65  ? 30.940  20.541  32.529  1.00 54.92  ? 65   PHE A CB    1 
ATOM   494  C CG    . PHE A 1 65  ? 29.542  20.051  32.261  1.00 54.50  ? 65   PHE A CG    1 
ATOM   495  C CD1   . PHE A 1 65  ? 29.307  18.723  31.946  1.00 54.41  ? 65   PHE A CD1   1 
ATOM   496  C CD2   . PHE A 1 65  ? 28.464  20.928  32.297  1.00 55.67  ? 65   PHE A CD2   1 
ATOM   497  C CE1   . PHE A 1 65  ? 28.023  18.261  31.695  1.00 54.31  ? 65   PHE A CE1   1 
ATOM   498  C CE2   . PHE A 1 65  ? 27.178  20.481  32.045  1.00 55.71  ? 65   PHE A CE2   1 
ATOM   499  C CZ    . PHE A 1 65  ? 26.957  19.131  31.743  1.00 54.37  ? 65   PHE A CZ    1 
ATOM   500  N N     . GLN A 1 66  ? 33.828  19.346  33.285  1.00 55.54  ? 66   GLN A N     1 
ATOM   501  C CA    . GLN A 1 66  ? 35.259  19.490  33.169  1.00 56.04  ? 66   GLN A CA    1 
ATOM   502  C C     . GLN A 1 66  ? 35.698  20.034  31.799  1.00 55.52  ? 66   GLN A C     1 
ATOM   503  O O     . GLN A 1 66  ? 34.870  20.378  30.937  1.00 54.70  ? 66   GLN A O     1 
ATOM   504  C CB    . GLN A 1 66  ? 35.922  18.147  33.494  1.00 56.40  ? 66   GLN A CB    1 
ATOM   505  C CG    . GLN A 1 66  ? 36.355  18.072  34.945  1.00 58.06  ? 66   GLN A CG    1 
ATOM   506  C CD    . GLN A 1 66  ? 37.636  18.850  35.202  1.00 59.73  ? 66   GLN A CD    1 
ATOM   507  O OE1   . GLN A 1 66  ? 38.111  19.590  34.334  1.00 59.81  ? 66   GLN A OE1   1 
ATOM   508  N NE2   . GLN A 1 66  ? 38.219  18.664  36.390  1.00 59.57  ? 66   GLN A NE2   1 
ATOM   509  N N     . ASN A 1 67  ? 37.013  20.130  31.623  1.00 55.70  ? 67   ASN A N     1 
ATOM   510  C CA    . ASN A 1 67  ? 37.592  20.648  30.400  1.00 55.25  ? 67   ASN A CA    1 
ATOM   511  C C     . ASN A 1 67  ? 37.075  19.913  29.160  1.00 54.30  ? 67   ASN A C     1 
ATOM   512  O O     . ASN A 1 67  ? 36.787  18.703  29.186  1.00 53.15  ? 67   ASN A O     1 
ATOM   513  C CB    . ASN A 1 67  ? 39.111  20.518  30.416  1.00 55.81  ? 67   ASN A CB    1 
ATOM   514  C CG    . ASN A 1 67  ? 39.766  21.254  31.566  1.00 56.69  ? 67   ASN A CG    1 
ATOM   515  O OD1   . ASN A 1 67  ? 39.294  22.299  32.022  1.00 57.48  ? 67   ASN A OD1   1 
ATOM   516  N ND2   . ASN A 1 67  ? 40.888  20.716  32.023  1.00 54.90  ? 67   ASN A ND2   1 
ATOM   517  N N     . VAL A 1 68  ? 37.002  20.675  28.078  1.00 54.11  ? 68   VAL A N     1 
ATOM   518  C CA    . VAL A 1 68  ? 36.666  20.172  26.766  1.00 53.66  ? 68   VAL A CA    1 
ATOM   519  C C     . VAL A 1 68  ? 37.979  19.806  26.100  1.00 54.35  ? 68   VAL A C     1 
ATOM   520  O O     . VAL A 1 68  ? 39.006  20.466  26.318  1.00 55.47  ? 68   VAL A O     1 
ATOM   521  C CB    . VAL A 1 68  ? 35.939  21.252  25.943  1.00 53.73  ? 68   VAL A CB    1 
ATOM   522  C CG1   . VAL A 1 68  ? 35.863  20.863  24.476  1.00 53.38  ? 68   VAL A CG1   1 
ATOM   523  C CG2   . VAL A 1 68  ? 34.530  21.532  26.549  1.00 52.41  ? 68   VAL A CG2   1 
ATOM   524  N N     . CYS A 1 69  ? 37.952  18.739  25.313  1.00 53.91  ? 69   CYS A N     1 
ATOM   525  C CA    . CYS A 1 69  ? 39.143  18.259  24.632  1.00 55.09  ? 69   CYS A CA    1 
ATOM   526  C C     . CYS A 1 69  ? 39.667  19.295  23.635  1.00 55.17  ? 69   CYS A C     1 
ATOM   527  O O     . CYS A 1 69  ? 38.899  20.011  23.021  1.00 54.64  ? 69   CYS A O     1 
ATOM   528  C CB    . CYS A 1 69  ? 38.844  16.923  23.961  1.00 54.40  ? 69   CYS A CB    1 
ATOM   529  S SG    . CYS A 1 69  ? 38.702  15.573  25.165  1.00 56.18  ? 69   CYS A SG    1 
ATOM   530  N N     . TYR A 1 70  ? 40.981  19.388  23.503  1.00 56.40  ? 70   TYR A N     1 
ATOM   531  C CA    . TYR A 1 70  ? 41.577  20.457  22.703  1.00 57.12  ? 70   TYR A CA    1 
ATOM   532  C C     . TYR A 1 70  ? 41.126  20.331  21.254  1.00 56.25  ? 70   TYR A C     1 
ATOM   533  O O     . TYR A 1 70  ? 41.199  19.261  20.669  1.00 55.18  ? 70   TYR A O     1 
ATOM   534  C CB    . TYR A 1 70  ? 43.108  20.476  22.814  1.00 58.52  ? 70   TYR A CB    1 
ATOM   535  C CG    . TYR A 1 70  ? 43.645  21.896  22.764  1.00 60.02  ? 70   TYR A CG    1 
ATOM   536  C CD1   . TYR A 1 70  ? 44.068  22.554  23.918  1.00 61.78  ? 70   TYR A CD1   1 
ATOM   537  C CD2   . TYR A 1 70  ? 43.687  22.591  21.574  1.00 60.74  ? 70   TYR A CD2   1 
ATOM   538  C CE1   . TYR A 1 70  ? 44.538  23.866  23.874  1.00 61.79  ? 70   TYR A CE1   1 
ATOM   539  C CE2   . TYR A 1 70  ? 44.146  23.894  21.521  1.00 61.76  ? 70   TYR A CE2   1 
ATOM   540  C CZ    . TYR A 1 70  ? 44.576  24.524  22.676  1.00 62.32  ? 70   TYR A CZ    1 
ATOM   541  O OH    . TYR A 1 70  ? 45.036  25.826  22.610  1.00 64.40  ? 70   TYR A OH    1 
ATOM   542  N N     . GLN A 1 71  ? 40.638  21.430  20.690  1.00 56.45  ? 71   GLN A N     1 
ATOM   543  C CA    . GLN A 1 71  ? 40.005  21.377  19.384  1.00 56.04  ? 71   GLN A CA    1 
ATOM   544  C C     . GLN A 1 71  ? 39.939  22.710  18.659  1.00 57.28  ? 71   GLN A C     1 
ATOM   545  O O     . GLN A 1 71  ? 39.993  23.787  19.276  1.00 56.76  ? 71   GLN A O     1 
ATOM   546  C CB    . GLN A 1 71  ? 38.568  20.820  19.510  1.00 55.05  ? 71   GLN A CB    1 
ATOM   547  C CG    . GLN A 1 71  ? 37.648  21.648  20.384  1.00 53.87  ? 71   GLN A CG    1 
ATOM   548  C CD    . GLN A 1 71  ? 36.343  20.956  20.657  1.00 52.81  ? 71   GLN A CD    1 
ATOM   549  O OE1   . GLN A 1 71  ? 35.322  21.322  20.076  1.00 50.67  ? 71   GLN A OE1   1 
ATOM   550  N NE2   . GLN A 1 71  ? 36.359  19.937  21.529  1.00 49.03  ? 71   GLN A NE2   1 
ATOM   551  N N     . TYR A 1 72  ? 39.809  22.588  17.333  1.00 58.41  ? 72   TYR A N     1 
ATOM   552  C CA    . TYR A 1 72  ? 39.447  23.683  16.447  1.00 59.69  ? 72   TYR A CA    1 
ATOM   553  C C     . TYR A 1 72  ? 38.084  24.233  16.845  1.00 59.57  ? 72   TYR A C     1 
ATOM   554  O O     . TYR A 1 72  ? 37.148  23.478  17.082  1.00 58.27  ? 72   TYR A O     1 
ATOM   555  C CB    . TYR A 1 72  ? 39.419  23.201  14.992  1.00 60.43  ? 72   TYR A CB    1 
ATOM   556  C CG    . TYR A 1 72  ? 38.872  24.220  14.021  1.00 61.07  ? 72   TYR A CG    1 
ATOM   557  C CD1   . TYR A 1 72  ? 37.539  24.175  13.622  1.00 62.96  ? 72   TYR A CD1   1 
ATOM   558  C CD2   . TYR A 1 72  ? 39.674  25.232  13.507  1.00 63.23  ? 72   TYR A CD2   1 
ATOM   559  C CE1   . TYR A 1 72  ? 37.009  25.108  12.731  1.00 62.44  ? 72   TYR A CE1   1 
ATOM   560  C CE2   . TYR A 1 72  ? 39.157  26.173  12.610  1.00 64.16  ? 72   TYR A CE2   1 
ATOM   561  C CZ    . TYR A 1 72  ? 37.816  26.099  12.231  1.00 63.25  ? 72   TYR A CZ    1 
ATOM   562  O OH    . TYR A 1 72  ? 37.268  27.018  11.350  1.00 64.51  ? 72   TYR A OH    1 
ATOM   563  N N     . VAL A 1 73  ? 37.996  25.551  16.944  1.00 60.91  ? 73   VAL A N     1 
ATOM   564  C CA    . VAL A 1 73  ? 36.767  26.221  17.333  1.00 61.52  ? 73   VAL A CA    1 
ATOM   565  C C     . VAL A 1 73  ? 36.234  27.031  16.139  1.00 62.63  ? 73   VAL A C     1 
ATOM   566  O O     . VAL A 1 73  ? 36.924  27.881  15.576  1.00 63.65  ? 73   VAL A O     1 
ATOM   567  C CB    . VAL A 1 73  ? 36.997  27.123  18.567  1.00 62.54  ? 73   VAL A CB    1 
ATOM   568  C CG1   . VAL A 1 73  ? 35.750  27.971  18.876  1.00 62.06  ? 73   VAL A CG1   1 
ATOM   569  C CG2   . VAL A 1 73  ? 37.413  26.274  19.759  1.00 60.67  ? 73   VAL A CG2   1 
ATOM   570  N N     . ASP A 1 74  ? 35.005  26.724  15.751  1.00 63.21  ? 74   ASP A N     1 
ATOM   571  C CA    . ASP A 1 74  ? 34.354  27.341  14.600  1.00 63.99  ? 74   ASP A CA    1 
ATOM   572  C C     . ASP A 1 74  ? 34.245  28.826  14.821  1.00 65.96  ? 74   ASP A C     1 
ATOM   573  O O     . ASP A 1 74  ? 33.786  29.265  15.865  1.00 66.41  ? 74   ASP A O     1 
ATOM   574  C CB    . ASP A 1 74  ? 32.956  26.744  14.415  1.00 62.77  ? 74   ASP A CB    1 
ATOM   575  C CG    . ASP A 1 74  ? 32.164  27.404  13.305  1.00 63.23  ? 74   ASP A CG    1 
ATOM   576  O OD1   . ASP A 1 74  ? 32.760  28.022  12.401  1.00 63.72  ? 74   ASP A OD1   1 
ATOM   577  O OD2   . ASP A 1 74  ? 30.920  27.287  13.340  1.00 64.54  ? 74   ASP A OD2   1 
ATOM   578  N N     . THR A 1 75  ? 34.642  29.595  13.815  1.00 68.25  ? 75   THR A N     1 
ATOM   579  C CA    . THR A 1 75  ? 34.661  31.045  13.931  1.00 70.90  ? 75   THR A CA    1 
ATOM   580  C C     . THR A 1 75  ? 33.944  31.765  12.756  1.00 71.36  ? 75   THR A C     1 
ATOM   581  O O     . THR A 1 75  ? 33.994  32.983  12.645  1.00 72.32  ? 75   THR A O     1 
ATOM   582  C CB    . THR A 1 75  ? 36.134  31.488  14.079  1.00 72.35  ? 75   THR A CB    1 
ATOM   583  O OG1   . THR A 1 75  ? 36.194  32.763  14.732  1.00 74.73  ? 75   THR A OG1   1 
ATOM   584  C CG2   . THR A 1 75  ? 36.830  31.500  12.715  1.00 73.18  ? 75   THR A CG2   1 
ATOM   585  N N     . LEU A 1 76  ? 33.227  30.997  11.930  1.00 71.16  ? 76   LEU A N     1 
ATOM   586  C CA    . LEU A 1 76  ? 32.630  31.495  10.696  1.00 71.42  ? 76   LEU A CA    1 
ATOM   587  C C     . LEU A 1 76  ? 31.542  32.544  10.918  1.00 72.08  ? 76   LEU A C     1 
ATOM   588  O O     . LEU A 1 76  ? 31.514  33.548  10.198  1.00 72.76  ? 76   LEU A O     1 
ATOM   589  C CB    . LEU A 1 76  ? 32.054  30.334  9.882   1.00 70.63  ? 76   LEU A CB    1 
ATOM   590  C CG    . LEU A 1 76  ? 31.385  30.721  8.553   1.00 71.21  ? 76   LEU A CG    1 
ATOM   591  C CD1   . LEU A 1 76  ? 32.378  31.489  7.631   1.00 72.32  ? 76   LEU A CD1   1 
ATOM   592  C CD2   . LEU A 1 76  ? 30.808  29.486  7.861   1.00 70.06  ? 76   LEU A CD2   1 
ATOM   593  N N     . TYR A 1 77  ? 30.655  32.308  11.891  1.00 71.59  ? 77   TYR A N     1 
ATOM   594  C CA    . TYR A 1 77  ? 29.566  33.247  12.213  1.00 72.29  ? 77   TYR A CA    1 
ATOM   595  C C     . TYR A 1 77  ? 29.569  33.630  13.689  1.00 73.37  ? 77   TYR A C     1 
ATOM   596  O O     . TYR A 1 77  ? 28.745  33.140  14.463  1.00 73.30  ? 77   TYR A O     1 
ATOM   597  C CB    . TYR A 1 77  ? 28.197  32.663  11.856  1.00 71.07  ? 77   TYR A CB    1 
ATOM   598  C CG    . TYR A 1 77  ? 27.998  32.412  10.391  1.00 70.31  ? 77   TYR A CG    1 
ATOM   599  C CD1   . TYR A 1 77  ? 28.008  33.462  9.487   1.00 70.33  ? 77   TYR A CD1   1 
ATOM   600  C CD2   . TYR A 1 77  ? 27.798  31.117  9.904   1.00 69.37  ? 77   TYR A CD2   1 
ATOM   601  C CE1   . TYR A 1 77  ? 27.828  33.245  8.139   1.00 70.68  ? 77   TYR A CE1   1 
ATOM   602  C CE2   . TYR A 1 77  ? 27.613  30.881  8.558   1.00 69.64  ? 77   TYR A CE2   1 
ATOM   603  C CZ    . TYR A 1 77  ? 27.619  31.956  7.675   1.00 70.78  ? 77   TYR A CZ    1 
ATOM   604  O OH    . TYR A 1 77  ? 27.435  31.746  6.330   1.00 71.06  ? 77   TYR A OH    1 
ATOM   605  N N     . PRO A 1 78  ? 30.465  34.545  14.081  1.00 74.80  ? 78   PRO A N     1 
ATOM   606  C CA    . PRO A 1 78  ? 30.586  34.883  15.502  1.00 75.34  ? 78   PRO A CA    1 
ATOM   607  C C     . PRO A 1 78  ? 29.381  35.692  16.003  1.00 75.59  ? 78   PRO A C     1 
ATOM   608  O O     . PRO A 1 78  ? 28.814  36.491  15.248  1.00 76.75  ? 78   PRO A O     1 
ATOM   609  C CB    . PRO A 1 78  ? 31.871  35.715  15.546  1.00 76.93  ? 78   PRO A CB    1 
ATOM   610  C CG    . PRO A 1 78  ? 31.905  36.392  14.193  1.00 77.91  ? 78   PRO A CG    1 
ATOM   611  C CD    . PRO A 1 78  ? 31.378  35.342  13.238  1.00 75.99  ? 78   PRO A CD    1 
ATOM   612  N N     . GLY A 1 79  ? 28.994  35.475  17.261  1.00 74.82  ? 79   GLY A N     1 
ATOM   613  C CA    . GLY A 1 79  ? 27.810  36.121  17.844  1.00 74.66  ? 79   GLY A CA    1 
ATOM   614  C C     . GLY A 1 79  ? 26.508  35.358  17.608  1.00 72.93  ? 79   GLY A C     1 
ATOM   615  O O     . GLY A 1 79  ? 25.473  35.675  18.212  1.00 73.33  ? 79   GLY A O     1 
ATOM   616  N N     . PHE A 1 80  ? 26.569  34.337  16.752  1.00 70.30  ? 80   PHE A N     1 
ATOM   617  C CA    . PHE A 1 80  ? 25.383  33.686  16.205  1.00 68.47  ? 80   PHE A CA    1 
ATOM   618  C C     . PHE A 1 80  ? 25.117  32.405  16.969  1.00 66.94  ? 80   PHE A C     1 
ATOM   619  O O     . PHE A 1 80  ? 25.980  31.543  17.027  1.00 66.02  ? 80   PHE A O     1 
ATOM   620  C CB    . PHE A 1 80  ? 25.618  33.400  14.716  1.00 67.55  ? 80   PHE A CB    1 
ATOM   621  C CG    . PHE A 1 80  ? 24.507  32.664  14.047  1.00 66.22  ? 80   PHE A CG    1 
ATOM   622  C CD1   . PHE A 1 80  ? 23.224  33.206  14.006  1.00 64.97  ? 80   PHE A CD1   1 
ATOM   623  C CD2   . PHE A 1 80  ? 24.744  31.430  13.439  1.00 64.18  ? 80   PHE A CD2   1 
ATOM   624  C CE1   . PHE A 1 80  ? 22.197  32.524  13.395  1.00 64.58  ? 80   PHE A CE1   1 
ATOM   625  C CE2   . PHE A 1 80  ? 23.721  30.745  12.819  1.00 63.00  ? 80   PHE A CE2   1 
ATOM   626  C CZ    . PHE A 1 80  ? 22.443  31.293  12.791  1.00 64.72  ? 80   PHE A CZ    1 
ATOM   627  N N     . GLU A 1 81  ? 23.925  32.295  17.555  1.00 67.24  ? 81   GLU A N     1 
ATOM   628  C CA    . GLU A 1 81  ? 23.535  31.126  18.368  1.00 66.05  ? 81   GLU A CA    1 
ATOM   629  C C     . GLU A 1 81  ? 23.666  29.808  17.601  1.00 63.86  ? 81   GLU A C     1 
ATOM   630  O O     . GLU A 1 81  ? 24.052  28.782  18.171  1.00 62.87  ? 81   GLU A O     1 
ATOM   631  C CB    . GLU A 1 81  ? 22.107  31.302  18.903  1.00 67.02  ? 81   GLU A CB    1 
ATOM   632  C CG    . GLU A 1 81  ? 21.418  30.035  19.506  1.00 69.10  ? 81   GLU A CG    1 
ATOM   633  C CD    . GLU A 1 81  ? 21.845  29.711  20.955  1.00 76.60  ? 81   GLU A CD    1 
ATOM   634  O OE1   . GLU A 1 81  ? 22.594  30.536  21.556  1.00 80.72  ? 81   GLU A OE1   1 
ATOM   635  O OE2   . GLU A 1 81  ? 21.417  28.636  21.487  1.00 77.22  ? 81   GLU A OE2   1 
ATOM   636  N N     . GLY A 1 82  ? 23.364  29.847  16.308  1.00 62.27  ? 82   GLY A N     1 
ATOM   637  C CA    . GLY A 1 82  ? 23.389  28.650  15.476  1.00 60.56  ? 82   GLY A CA    1 
ATOM   638  C C     . GLY A 1 82  ? 24.716  27.926  15.425  1.00 58.93  ? 82   GLY A C     1 
ATOM   639  O O     . GLY A 1 82  ? 24.768  26.702  15.277  1.00 57.96  ? 82   GLY A O     1 
ATOM   640  N N     . THR A 1 83  ? 25.796  28.679  15.533  1.00 58.87  ? 83   THR A N     1 
ATOM   641  C CA    . THR A 1 83  ? 27.118  28.076  15.558  1.00 58.14  ? 83   THR A CA    1 
ATOM   642  C C     . THR A 1 83  ? 27.662  27.965  17.004  1.00 58.25  ? 83   THR A C     1 
ATOM   643  O O     . THR A 1 83  ? 28.277  26.957  17.357  1.00 57.10  ? 83   THR A O     1 
ATOM   644  C CB    . THR A 1 83  ? 28.096  28.842  14.630  1.00 58.87  ? 83   THR A CB    1 
ATOM   645  O OG1   . THR A 1 83  ? 28.103  30.231  14.966  1.00 57.87  ? 83   THR A OG1   1 
ATOM   646  C CG2   . THR A 1 83  ? 27.698  28.670  13.156  1.00 57.83  ? 83   THR A CG2   1 
ATOM   647  N N     . GLU A 1 84  ? 27.407  28.982  17.833  1.00 58.81  ? 84   GLU A N     1 
ATOM   648  C CA    . GLU A 1 84  ? 27.959  29.030  19.186  1.00 59.23  ? 84   GLU A CA    1 
ATOM   649  C C     . GLU A 1 84  ? 27.415  27.915  20.053  1.00 57.28  ? 84   GLU A C     1 
ATOM   650  O O     . GLU A 1 84  ? 28.090  27.470  20.971  1.00 57.20  ? 84   GLU A O     1 
ATOM   651  C CB    . GLU A 1 84  ? 27.662  30.368  19.865  1.00 61.08  ? 84   GLU A CB    1 
ATOM   652  C CG    . GLU A 1 84  ? 28.361  31.589  19.229  1.00 65.66  ? 84   GLU A CG    1 
ATOM   653  C CD    . GLU A 1 84  ? 29.846  31.685  19.560  1.00 71.50  ? 84   GLU A CD    1 
ATOM   654  O OE1   . GLU A 1 84  ? 30.381  30.799  20.306  1.00 72.13  ? 84   GLU A OE1   1 
ATOM   655  O OE2   . GLU A 1 84  ? 30.471  32.671  19.069  1.00 76.01  ? 84   GLU A OE2   1 
ATOM   656  N N     . MET A 1 85  ? 26.198  27.464  19.770  1.00 55.71  ? 85   MET A N     1 
ATOM   657  C CA    . MET A 1 85  ? 25.608  26.351  20.513  1.00 54.25  ? 85   MET A CA    1 
ATOM   658  C C     . MET A 1 85  ? 26.445  25.070  20.441  1.00 53.04  ? 85   MET A C     1 
ATOM   659  O O     . MET A 1 85  ? 26.311  24.213  21.297  1.00 53.13  ? 85   MET A O     1 
ATOM   660  C CB    . MET A 1 85  ? 24.192  26.065  20.047  1.00 53.62  ? 85   MET A CB    1 
ATOM   661  C CG    . MET A 1 85  ? 24.044  25.610  18.604  1.00 53.14  ? 85   MET A CG    1 
ATOM   662  S SD    . MET A 1 85  ? 22.288  25.253  18.265  1.00 53.56  ? 85   MET A SD    1 
ATOM   663  C CE    . MET A 1 85  ? 22.152  23.691  19.176  1.00 48.50  ? 85   MET A CE    1 
ATOM   664  N N     . TRP A 1 86  ? 27.302  24.955  19.429  1.00 51.86  ? 86   TRP A N     1 
ATOM   665  C CA    . TRP A 1 86  ? 28.162  23.783  19.266  1.00 51.14  ? 86   TRP A CA    1 
ATOM   666  C C     . TRP A 1 86  ? 29.582  24.006  19.772  1.00 51.03  ? 86   TRP A C     1 
ATOM   667  O O     . TRP A 1 86  ? 30.349  23.072  19.861  1.00 50.23  ? 86   TRP A O     1 
ATOM   668  C CB    . TRP A 1 86  ? 28.221  23.371  17.794  1.00 50.22  ? 86   TRP A CB    1 
ATOM   669  C CG    . TRP A 1 86  ? 26.881  23.190  17.189  1.00 49.62  ? 86   TRP A CG    1 
ATOM   670  C CD1   . TRP A 1 86  ? 26.291  23.990  16.269  1.00 50.27  ? 86   TRP A CD1   1 
ATOM   671  C CD2   . TRP A 1 86  ? 25.950  22.147  17.473  1.00 48.55  ? 86   TRP A CD2   1 
ATOM   672  N NE1   . TRP A 1 86  ? 25.049  23.503  15.941  1.00 49.76  ? 86   TRP A NE1   1 
ATOM   673  C CE2   . TRP A 1 86  ? 24.819  22.368  16.670  1.00 49.89  ? 86   TRP A CE2   1 
ATOM   674  C CE3   . TRP A 1 86  ? 25.965  21.042  18.325  1.00 49.03  ? 86   TRP A CE3   1 
ATOM   675  C CZ2   . TRP A 1 86  ? 23.712  21.524  16.693  1.00 49.22  ? 86   TRP A CZ2   1 
ATOM   676  C CZ3   . TRP A 1 86  ? 24.872  20.203  18.347  1.00 48.23  ? 86   TRP A CZ3   1 
ATOM   677  C CH2   . TRP A 1 86  ? 23.765  20.445  17.530  1.00 49.34  ? 86   TRP A CH2   1 
ATOM   678  N N     . ASN A 1 87  ? 29.923  25.238  20.095  1.00 51.98  ? 87   ASN A N     1 
ATOM   679  C CA    . ASN A 1 87  ? 31.284  25.575  20.476  1.00 53.07  ? 87   ASN A CA    1 
ATOM   680  C C     . ASN A 1 87  ? 31.586  25.173  21.913  1.00 53.38  ? 87   ASN A C     1 
ATOM   681  O O     . ASN A 1 87  ? 30.670  25.014  22.726  1.00 53.25  ? 87   ASN A O     1 
ATOM   682  C CB    . ASN A 1 87  ? 31.539  27.075  20.280  1.00 54.24  ? 87   ASN A CB    1 
ATOM   683  C CG    . ASN A 1 87  ? 31.664  27.469  18.808  1.00 55.61  ? 87   ASN A CG    1 
ATOM   684  O OD1   . ASN A 1 87  ? 31.809  26.609  17.938  1.00 59.07  ? 87   ASN A OD1   1 
ATOM   685  N ND2   . ASN A 1 87  ? 31.610  28.773  18.526  1.00 56.91  ? 87   ASN A ND2   1 
ATOM   686  N N     . PRO A 1 88  ? 32.880  24.980  22.230  1.00 53.84  ? 88   PRO A N     1 
ATOM   687  C CA    . PRO A 1 88  ? 33.262  24.617  23.599  1.00 54.09  ? 88   PRO A CA    1 
ATOM   688  C C     . PRO A 1 88  ? 32.741  25.584  24.655  1.00 54.42  ? 88   PRO A C     1 
ATOM   689  O O     . PRO A 1 88  ? 32.848  26.772  24.490  1.00 53.89  ? 88   PRO A O     1 
ATOM   690  C CB    . PRO A 1 88  ? 34.793  24.634  23.554  1.00 54.52  ? 88   PRO A CB    1 
ATOM   691  C CG    . PRO A 1 88  ? 35.126  24.392  22.093  1.00 54.14  ? 88   PRO A CG    1 
ATOM   692  C CD    . PRO A 1 88  ? 34.043  25.034  21.320  1.00 53.84  ? 88   PRO A CD    1 
ATOM   693  N N     . ASN A 1 89  ? 32.180  25.045  25.732  1.00 54.81  ? 89   ASN A N     1 
ATOM   694  C CA    . ASN A 1 89  ? 31.654  25.858  26.830  1.00 55.48  ? 89   ASN A CA    1 
ATOM   695  C C     . ASN A 1 89  ? 32.443  25.653  28.124  1.00 56.28  ? 89   ASN A C     1 
ATOM   696  O O     . ASN A 1 89  ? 32.024  26.089  29.171  1.00 56.96  ? 89   ASN A O     1 
ATOM   697  C CB    . ASN A 1 89  ? 30.169  25.560  27.048  1.00 55.00  ? 89   ASN A CB    1 
ATOM   698  C CG    . ASN A 1 89  ? 29.897  24.104  27.415  1.00 54.05  ? 89   ASN A CG    1 
ATOM   699  O OD1   . ASN A 1 89  ? 30.764  23.240  27.306  1.00 53.56  ? 89   ASN A OD1   1 
ATOM   700  N ND2   . ASN A 1 89  ? 28.672  23.827  27.828  1.00 54.50  ? 89   ASN A ND2   1 
ATOM   701  N N     . ARG A 1 90  ? 33.597  25.001  28.045  1.00 56.56  ? 90   ARG A N     1 
ATOM   702  C CA    . ARG A 1 90  ? 34.541  24.931  29.172  1.00 57.63  ? 90   ARG A CA    1 
ATOM   703  C C     . ARG A 1 90  ? 35.918  25.123  28.581  1.00 57.47  ? 90   ARG A C     1 
ATOM   704  O O     . ARG A 1 90  ? 36.071  25.183  27.369  1.00 57.21  ? 90   ARG A O     1 
ATOM   705  C CB    . ARG A 1 90  ? 34.440  23.589  29.930  1.00 58.10  ? 90   ARG A CB    1 
ATOM   706  C CG    . ARG A 1 90  ? 33.153  23.405  30.771  1.00 59.24  ? 90   ARG A CG    1 
ATOM   707  C CD    . ARG A 1 90  ? 33.127  24.335  32.013  1.00 64.27  ? 90   ARG A CD    1 
ATOM   708  N NE    . ARG A 1 90  ? 31.839  24.321  32.728  1.00 66.37  ? 90   ARG A NE    1 
ATOM   709  C CZ    . ARG A 1 90  ? 30.717  24.945  32.326  1.00 68.34  ? 90   ARG A CZ    1 
ATOM   710  N NH1   . ARG A 1 90  ? 30.678  25.633  31.201  1.00 69.13  ? 90   ARG A NH1   1 
ATOM   711  N NH2   . ARG A 1 90  ? 29.603  24.868  33.043  1.00 69.41  ? 90   ARG A NH2   1 
ATOM   712  N N     . GLU A 1 91  ? 36.920  25.252  29.427  1.00 57.87  ? 91   GLU A N     1 
ATOM   713  C CA    . GLU A 1 91  ? 38.281  25.433  28.955  1.00 58.14  ? 91   GLU A CA    1 
ATOM   714  C C     . GLU A 1 91  ? 38.772  24.263  28.080  1.00 56.92  ? 91   GLU A C     1 
ATOM   715  O O     . GLU A 1 91  ? 38.521  23.084  28.385  1.00 55.77  ? 91   GLU A O     1 
ATOM   716  C CB    . GLU A 1 91  ? 39.216  25.589  30.155  1.00 59.01  ? 91   GLU A CB    1 
ATOM   717  C CG    . GLU A 1 91  ? 40.667  25.706  29.790  1.00 59.60  ? 91   GLU A CG    1 
ATOM   718  C CD    . GLU A 1 91  ? 41.549  25.758  31.009  1.00 62.46  ? 91   GLU A CD    1 
ATOM   719  O OE1   . GLU A 1 91  ? 41.033  26.180  32.066  1.00 63.92  ? 91   GLU A OE1   1 
ATOM   720  O OE2   . GLU A 1 91  ? 42.740  25.362  30.918  1.00 64.53  ? 91   GLU A OE2   1 
ATOM   721  N N     . LEU A 1 92  ? 39.482  24.613  27.010  1.00 56.75  ? 92   LEU A N     1 
ATOM   722  C CA    . LEU A 1 92  ? 40.144  23.644  26.142  1.00 56.41  ? 92   LEU A CA    1 
ATOM   723  C C     . LEU A 1 92  ? 41.425  23.157  26.792  1.00 56.77  ? 92   LEU A C     1 
ATOM   724  O O     . LEU A 1 92  ? 42.261  23.953  27.176  1.00 58.48  ? 92   LEU A O     1 
ATOM   725  C CB    . LEU A 1 92  ? 40.514  24.262  24.791  1.00 56.70  ? 92   LEU A CB    1 
ATOM   726  C CG    . LEU A 1 92  ? 39.414  24.574  23.776  1.00 57.19  ? 92   LEU A CG    1 
ATOM   727  C CD1   . LEU A 1 92  ? 40.088  25.087  22.499  1.00 57.71  ? 92   LEU A CD1   1 
ATOM   728  C CD2   . LEU A 1 92  ? 38.567  23.335  23.485  1.00 56.03  ? 92   LEU A CD2   1 
ATOM   729  N N     . SER A 1 93  ? 41.577  21.847  26.887  1.00 55.88  ? 93   SER A N     1 
ATOM   730  C CA    . SER A 1 93  ? 42.744  21.247  27.501  1.00 56.43  ? 93   SER A CA    1 
ATOM   731  C C     . SER A 1 93  ? 42.948  19.850  26.960  1.00 56.07  ? 93   SER A C     1 
ATOM   732  O O     . SER A 1 93  ? 41.991  19.173  26.570  1.00 55.22  ? 93   SER A O     1 
ATOM   733  C CB    . SER A 1 93  ? 42.574  21.171  29.022  1.00 56.90  ? 93   SER A CB    1 
ATOM   734  O OG    . SER A 1 93  ? 43.725  20.628  29.652  1.00 55.63  ? 93   SER A OG    1 
ATOM   735  N N     . GLU A 1 94  ? 44.204  19.420  26.950  1.00 57.12  ? 94   GLU A N     1 
ATOM   736  C CA    . GLU A 1 94  ? 44.524  18.038  26.651  1.00 56.88  ? 94   GLU A CA    1 
ATOM   737  C C     . GLU A 1 94  ? 44.167  17.121  27.806  1.00 56.59  ? 94   GLU A C     1 
ATOM   738  O O     . GLU A 1 94  ? 44.017  15.919  27.612  1.00 56.20  ? 94   GLU A O     1 
ATOM   739  C CB    . GLU A 1 94  ? 45.985  17.894  26.306  1.00 58.25  ? 94   GLU A CB    1 
ATOM   740  C CG    . GLU A 1 94  ? 46.298  18.245  24.880  1.00 58.38  ? 94   GLU A CG    1 
ATOM   741  C CD    . GLU A 1 94  ? 47.747  17.977  24.566  1.00 60.04  ? 94   GLU A CD    1 
ATOM   742  O OE1   . GLU A 1 94  ? 48.052  16.850  24.118  1.00 60.47  ? 94   GLU A OE1   1 
ATOM   743  O OE2   . GLU A 1 94  ? 48.573  18.879  24.820  1.00 61.43  ? 94   GLU A OE2   1 
ATOM   744  N N     . ASP A 1 95  ? 44.041  17.690  29.002  1.00 57.19  ? 95   ASP A N     1 
ATOM   745  C CA    . ASP A 1 95  ? 43.495  16.980  30.163  1.00 57.27  ? 95   ASP A CA    1 
ATOM   746  C C     . ASP A 1 95  ? 41.977  17.146  30.101  1.00 56.05  ? 95   ASP A C     1 
ATOM   747  O O     . ASP A 1 95  ? 41.425  18.148  30.584  1.00 56.32  ? 95   ASP A O     1 
ATOM   748  C CB    . ASP A 1 95  ? 44.062  17.567  31.455  1.00 58.32  ? 95   ASP A CB    1 
ATOM   749  C CG    . ASP A 1 95  ? 43.539  16.876  32.702  1.00 60.07  ? 95   ASP A CG    1 
ATOM   750  O OD1   . ASP A 1 95  ? 42.727  15.923  32.614  1.00 61.25  ? 95   ASP A OD1   1 
ATOM   751  O OD2   . ASP A 1 95  ? 43.967  17.290  33.796  1.00 64.43  ? 95   ASP A OD2   1 
ATOM   752  N N     . CYS A 1 96  ? 41.317  16.169  29.486  1.00 54.65  ? 96   CYS A N     1 
ATOM   753  C CA    . CYS A 1 96  ? 39.908  16.308  29.122  1.00 53.49  ? 96   CYS A CA    1 
ATOM   754  C C     . CYS A 1 96  ? 39.068  15.030  29.203  1.00 52.38  ? 96   CYS A C     1 
ATOM   755  O O     . CYS A 1 96  ? 37.897  15.045  28.833  1.00 51.76  ? 96   CYS A O     1 
ATOM   756  C CB    . CYS A 1 96  ? 39.816  16.866  27.701  1.00 53.37  ? 96   CYS A CB    1 
ATOM   757  S SG    . CYS A 1 96  ? 40.373  15.733  26.386  1.00 53.30  ? 96   CYS A SG    1 
ATOM   758  N N     . LEU A 1 97  ? 39.648  13.940  29.692  1.00 52.09  ? 97   LEU A N     1 
ATOM   759  C CA    . LEU A 1 97  ? 38.984  12.650  29.674  1.00 51.49  ? 97   LEU A CA    1 
ATOM   760  C C     . LEU A 1 97  ? 38.120  12.460  30.931  1.00 51.25  ? 97   LEU A C     1 
ATOM   761  O O     . LEU A 1 97  ? 38.512  11.823  31.893  1.00 51.61  ? 97   LEU A O     1 
ATOM   762  C CB    . LEU A 1 97  ? 40.024  11.523  29.489  1.00 52.12  ? 97   LEU A CB    1 
ATOM   763  C CG    . LEU A 1 97  ? 40.698  11.525  28.103  1.00 51.68  ? 97   LEU A CG    1 
ATOM   764  C CD1   . LEU A 1 97  ? 41.547  10.299  27.927  1.00 51.19  ? 97   LEU A CD1   1 
ATOM   765  C CD2   . LEU A 1 97  ? 39.646  11.632  26.951  1.00 49.39  ? 97   LEU A CD2   1 
ATOM   766  N N     . TYR A 1 98  ? 36.930  13.043  30.891  1.00 50.86  ? 98   TYR A N     1 
ATOM   767  C CA    . TYR A 1 98  ? 36.013  13.033  32.015  1.00 51.13  ? 98   TYR A CA    1 
ATOM   768  C C     . TYR A 1 98  ? 34.637  12.616  31.509  1.00 50.29  ? 98   TYR A C     1 
ATOM   769  O O     . TYR A 1 98  ? 34.347  12.717  30.329  1.00 49.28  ? 98   TYR A O     1 
ATOM   770  C CB    . TYR A 1 98  ? 35.964  14.432  32.663  1.00 52.12  ? 98   TYR A CB    1 
ATOM   771  C CG    . TYR A 1 98  ? 37.312  14.904  33.207  1.00 53.12  ? 98   TYR A CG    1 
ATOM   772  C CD1   . TYR A 1 98  ? 37.693  14.628  34.516  1.00 54.61  ? 98   TYR A CD1   1 
ATOM   773  C CD2   . TYR A 1 98  ? 38.195  15.610  32.406  1.00 52.05  ? 98   TYR A CD2   1 
ATOM   774  C CE1   . TYR A 1 98  ? 38.928  15.037  35.013  1.00 55.52  ? 98   TYR A CE1   1 
ATOM   775  C CE2   . TYR A 1 98  ? 39.419  16.033  32.891  1.00 54.83  ? 98   TYR A CE2   1 
ATOM   776  C CZ    . TYR A 1 98  ? 39.785  15.747  34.198  1.00 56.26  ? 98   TYR A CZ    1 
ATOM   777  O OH    . TYR A 1 98  ? 41.019  16.157  34.678  1.00 56.79  ? 98   TYR A OH    1 
ATOM   778  N N     . LEU A 1 99  ? 33.784  12.138  32.398  1.00 50.60  ? 99   LEU A N     1 
ATOM   779  C CA    . LEU A 1 99  ? 32.445  11.758  31.986  1.00 50.37  ? 99   LEU A CA    1 
ATOM   780  C C     . LEU A 1 99  ? 31.404  12.249  32.987  1.00 51.12  ? 99   LEU A C     1 
ATOM   781  O O     . LEU A 1 99  ? 31.731  12.646  34.115  1.00 51.99  ? 99   LEU A O     1 
ATOM   782  C CB    . LEU A 1 99  ? 32.352  10.249  31.754  1.00 50.63  ? 99   LEU A CB    1 
ATOM   783  C CG    . LEU A 1 99  ? 32.613  9.280   32.909  1.00 51.72  ? 99   LEU A CG    1 
ATOM   784  C CD1   . LEU A 1 99  ? 31.407  9.240   33.856  1.00 51.49  ? 99   LEU A CD1   1 
ATOM   785  C CD2   . LEU A 1 99  ? 32.898  7.886   32.364  1.00 50.75  ? 99   LEU A CD2   1 
ATOM   786  N N     . ASN A 1 100 ? 30.159  12.210  32.531  1.00 50.57  ? 100  ASN A N     1 
ATOM   787  C CA    . ASN A 1 100 ? 29.019  12.767  33.218  1.00 50.84  ? 100  ASN A CA    1 
ATOM   788  C C     . ASN A 1 100 ? 27.921  11.727  33.373  1.00 51.07  ? 100  ASN A C     1 
ATOM   789  O O     . ASN A 1 100 ? 27.723  10.889  32.485  1.00 50.41  ? 100  ASN A O     1 
ATOM   790  C CB    . ASN A 1 100 ? 28.486  13.930  32.395  1.00 50.79  ? 100  ASN A CB    1 
ATOM   791  C CG    . ASN A 1 100 ? 29.580  14.922  32.015  1.00 51.03  ? 100  ASN A CG    1 
ATOM   792  O OD1   . ASN A 1 100 ? 30.222  15.515  32.890  1.00 53.69  ? 100  ASN A OD1   1 
ATOM   793  N ND2   . ASN A 1 100 ? 29.798  15.100  30.721  1.00 47.66  ? 100  ASN A ND2   1 
ATOM   794  N N     . VAL A 1 101 ? 27.225  11.780  34.510  1.00 51.98  ? 101  VAL A N     1 
ATOM   795  C CA    . VAL A 1 101 ? 26.117  10.880  34.810  1.00 52.18  ? 101  VAL A CA    1 
ATOM   796  C C     . VAL A 1 101 ? 24.968  11.683  35.369  1.00 53.14  ? 101  VAL A C     1 
ATOM   797  O O     . VAL A 1 101 ? 25.136  12.415  36.341  1.00 53.93  ? 101  VAL A O     1 
ATOM   798  C CB    . VAL A 1 101 ? 26.506  9.809   35.849  1.00 53.17  ? 101  VAL A CB    1 
ATOM   799  C CG1   . VAL A 1 101 ? 25.330  8.856   36.112  1.00 51.87  ? 101  VAL A CG1   1 
ATOM   800  C CG2   . VAL A 1 101 ? 27.762  9.028   35.394  1.00 51.83  ? 101  VAL A CG2   1 
ATOM   801  N N     . TRP A 1 102 ? 23.804  11.566  34.744  1.00 53.62  ? 102  TRP A N     1 
ATOM   802  C CA    . TRP A 1 102 ? 22.560  12.058  35.337  1.00 54.85  ? 102  TRP A CA    1 
ATOM   803  C C     . TRP A 1 102 ? 21.743  10.852  35.744  1.00 55.80  ? 102  TRP A C     1 
ATOM   804  O O     . TRP A 1 102 ? 21.690  9.863   35.015  1.00 55.61  ? 102  TRP A O     1 
ATOM   805  C CB    . TRP A 1 102 ? 21.736  12.880  34.347  1.00 54.38  ? 102  TRP A CB    1 
ATOM   806  C CG    . TRP A 1 102 ? 22.310  14.186  33.958  1.00 54.00  ? 102  TRP A CG    1 
ATOM   807  C CD1   . TRP A 1 102 ? 21.970  15.422  34.463  1.00 54.60  ? 102  TRP A CD1   1 
ATOM   808  C CD2   . TRP A 1 102 ? 23.287  14.426  32.938  1.00 52.87  ? 102  TRP A CD2   1 
ATOM   809  N NE1   . TRP A 1 102 ? 22.684  16.404  33.822  1.00 54.42  ? 102  TRP A NE1   1 
ATOM   810  C CE2   . TRP A 1 102 ? 23.503  15.822  32.887  1.00 53.88  ? 102  TRP A CE2   1 
ATOM   811  C CE3   . TRP A 1 102 ? 23.984  13.604  32.053  1.00 51.86  ? 102  TRP A CE3   1 
ATOM   812  C CZ2   . TRP A 1 102 ? 24.396  16.400  31.993  1.00 53.10  ? 102  TRP A CZ2   1 
ATOM   813  C CZ3   . TRP A 1 102 ? 24.876  14.167  31.182  1.00 51.50  ? 102  TRP A CZ3   1 
ATOM   814  C CH2   . TRP A 1 102 ? 25.079  15.550  31.150  1.00 52.87  ? 102  TRP A CH2   1 
ATOM   815  N N     . THR A 1 103 ? 21.103  10.943  36.906  1.00 57.30  ? 103  THR A N     1 
ATOM   816  C CA    . THR A 1 103 ? 20.197  9.918   37.377  1.00 58.37  ? 103  THR A CA    1 
ATOM   817  C C     . THR A 1 103 ? 19.016  10.598  38.054  1.00 59.64  ? 103  THR A C     1 
ATOM   818  O O     . THR A 1 103 ? 19.094  11.774  38.421  1.00 60.06  ? 103  THR A O     1 
ATOM   819  C CB    . THR A 1 103 ? 20.894  8.958   38.390  1.00 59.21  ? 103  THR A CB    1 
ATOM   820  O OG1   . THR A 1 103 ? 21.057  9.619   39.644  1.00 60.00  ? 103  THR A OG1   1 
ATOM   821  C CG2   . THR A 1 103 ? 22.262  8.549   37.899  1.00 58.73  ? 103  THR A CG2   1 
ATOM   822  N N     . PRO A 1 104 ? 17.898  9.877   38.194  1.00 60.55  ? 104  PRO A N     1 
ATOM   823  C CA    . PRO A 1 104 ? 16.809  10.374  39.015  1.00 62.09  ? 104  PRO A CA    1 
ATOM   824  C C     . PRO A 1 104 ? 17.220  10.761  40.441  1.00 63.01  ? 104  PRO A C     1 
ATOM   825  O O     . PRO A 1 104 ? 18.251  10.305  40.940  1.00 63.52  ? 104  PRO A O     1 
ATOM   826  C CB    . PRO A 1 104 ? 15.819  9.189   39.035  1.00 62.73  ? 104  PRO A CB    1 
ATOM   827  C CG    . PRO A 1 104 ? 16.044  8.529   37.724  1.00 61.62  ? 104  PRO A CG    1 
ATOM   828  C CD    . PRO A 1 104 ? 17.546  8.606   37.536  1.00 60.48  ? 104  PRO A CD    1 
ATOM   829  N N     . TYR A 1 105 ? 16.403  11.612  41.055  1.00 63.89  ? 105  TYR A N     1 
ATOM   830  C CA    . TYR A 1 105 ? 16.543  12.018  42.434  1.00 65.31  ? 105  TYR A CA    1 
ATOM   831  C C     . TYR A 1 105 ? 15.206  11.752  43.133  1.00 67.98  ? 105  TYR A C     1 
ATOM   832  O O     . TYR A 1 105 ? 14.192  12.332  42.746  1.00 67.87  ? 105  TYR A O     1 
ATOM   833  C CB    . TYR A 1 105 ? 16.900  13.502  42.506  1.00 64.45  ? 105  TYR A CB    1 
ATOM   834  C CG    . TYR A 1 105 ? 17.188  14.027  43.896  1.00 64.63  ? 105  TYR A CG    1 
ATOM   835  C CD1   . TYR A 1 105 ? 18.486  14.332  44.285  1.00 63.68  ? 105  TYR A CD1   1 
ATOM   836  C CD2   . TYR A 1 105 ? 16.160  14.254  44.818  1.00 65.57  ? 105  TYR A CD2   1 
ATOM   837  C CE1   . TYR A 1 105 ? 18.760  14.830  45.552  1.00 63.96  ? 105  TYR A CE1   1 
ATOM   838  C CE2   . TYR A 1 105 ? 16.437  14.747  46.096  1.00 66.23  ? 105  TYR A CE2   1 
ATOM   839  C CZ    . TYR A 1 105 ? 17.744  15.025  46.446  1.00 65.41  ? 105  TYR A CZ    1 
ATOM   840  O OH    . TYR A 1 105 ? 18.045  15.513  47.685  1.00 66.89  ? 105  TYR A OH    1 
ATOM   841  N N     . PRO A 1 106 ? 15.189  10.855  44.145  1.00 70.59  ? 106  PRO A N     1 
ATOM   842  C CA    . PRO A 1 106 ? 16.310  10.020  44.588  1.00 71.29  ? 106  PRO A CA    1 
ATOM   843  C C     . PRO A 1 106 ? 16.653  8.986   43.533  1.00 71.54  ? 106  PRO A C     1 
ATOM   844  O O     . PRO A 1 106 ? 15.850  8.744   42.629  1.00 71.36  ? 106  PRO A O     1 
ATOM   845  C CB    . PRO A 1 106 ? 15.771  9.338   45.846  1.00 72.77  ? 106  PRO A CB    1 
ATOM   846  C CG    . PRO A 1 106 ? 14.304  9.337   45.686  1.00 73.17  ? 106  PRO A CG    1 
ATOM   847  C CD    . PRO A 1 106 ? 13.976  10.600  44.946  1.00 72.28  ? 106  PRO A CD    1 
ATOM   848  N N     . ARG A 1 107 ? 17.839  8.395   43.635  1.00 72.61  ? 107  ARG A N     1 
ATOM   849  C CA    . ARG A 1 107 ? 18.271  7.392   42.669  1.00 73.15  ? 107  ARG A CA    1 
ATOM   850  C C     . ARG A 1 107 ? 17.326  6.209   42.717  1.00 74.70  ? 107  ARG A C     1 
ATOM   851  O O     . ARG A 1 107 ? 16.793  5.891   43.775  1.00 76.33  ? 107  ARG A O     1 
ATOM   852  C CB    . ARG A 1 107 ? 19.702  6.951   42.935  1.00 72.69  ? 107  ARG A CB    1 
ATOM   853  C CG    . ARG A 1 107 ? 20.718  8.077   42.737  1.00 72.98  ? 107  ARG A CG    1 
ATOM   854  C CD    . ARG A 1 107 ? 22.132  7.561   42.755  1.00 72.62  ? 107  ARG A CD    1 
ATOM   855  N NE    . ARG A 1 107 ? 22.434  6.839   43.992  1.00 75.62  ? 107  ARG A NE    1 
ATOM   856  C CZ    . ARG A 1 107 ? 22.960  7.384   45.091  1.00 76.26  ? 107  ARG A CZ    1 
ATOM   857  N NH1   . ARG A 1 107 ? 23.258  8.676   45.130  1.00 76.12  ? 107  ARG A NH1   1 
ATOM   858  N NH2   . ARG A 1 107 ? 23.193  6.623   46.155  1.00 77.05  ? 107  ARG A NH2   1 
ATOM   859  N N     . PRO A 1 108 ? 17.106  5.556   41.562  1.00 75.34  ? 108  PRO A N     1 
ATOM   860  C CA    . PRO A 1 108 ? 16.107  4.486   41.487  1.00 76.83  ? 108  PRO A CA    1 
ATOM   861  C C     . PRO A 1 108 ? 16.466  3.276   42.368  1.00 78.20  ? 108  PRO A C     1 
ATOM   862  O O     . PRO A 1 108 ? 17.645  2.921   42.510  1.00 77.82  ? 108  PRO A O     1 
ATOM   863  C CB    . PRO A 1 108 ? 16.101  4.109   39.998  1.00 75.94  ? 108  PRO A CB    1 
ATOM   864  C CG    . PRO A 1 108 ? 17.447  4.534   39.486  1.00 74.56  ? 108  PRO A CG    1 
ATOM   865  C CD    . PRO A 1 108 ? 17.795  5.766   40.269  1.00 73.98  ? 108  PRO A CD    1 
ATOM   866  N N     . ALA A 1 109 ? 15.439  2.668   42.947  1.00 79.85  ? 109  ALA A N     1 
ATOM   867  C CA    . ALA A 1 109 ? 15.607  1.541   43.858  1.00 81.43  ? 109  ALA A CA    1 
ATOM   868  C C     . ALA A 1 109 ? 15.964  0.235   43.127  1.00 81.30  ? 109  ALA A C     1 
ATOM   869  O O     . ALA A 1 109 ? 16.660  -0.620  43.686  1.00 81.77  ? 109  ALA A O     1 
ATOM   870  C CB    . ALA A 1 109 ? 14.330  1.347   44.681  1.00 83.25  ? 109  ALA A CB    1 
ATOM   871  N N     . SER A 1 110 ? 15.457  0.080   41.899  1.00 80.38  ? 110  SER A N     1 
ATOM   872  C CA    . SER A 1 110 ? 15.778  -1.074  41.053  1.00 79.52  ? 110  SER A CA    1 
ATOM   873  C C     . SER A 1 110 ? 16.576  -0.618  39.820  1.00 77.04  ? 110  SER A C     1 
ATOM   874  O O     . SER A 1 110 ? 16.397  0.512   39.357  1.00 75.80  ? 110  SER A O     1 
ATOM   875  C CB    . SER A 1 110 ? 14.494  -1.796  40.638  1.00 81.00  ? 110  SER A CB    1 
ATOM   876  O OG    . SER A 1 110 ? 13.683  -0.941  39.857  1.00 81.87  ? 110  SER A OG    1 
ATOM   877  N N     . PRO A 1 111 ? 17.451  -1.496  39.284  1.00 75.74  ? 111  PRO A N     1 
ATOM   878  C CA    . PRO A 1 111 ? 18.409  -1.124  38.231  1.00 73.90  ? 111  PRO A CA    1 
ATOM   879  C C     . PRO A 1 111 ? 17.769  -0.655  36.920  1.00 72.09  ? 111  PRO A C     1 
ATOM   880  O O     . PRO A 1 111 ? 16.939  -1.366  36.342  1.00 72.93  ? 111  PRO A O     1 
ATOM   881  C CB    . PRO A 1 111 ? 19.203  -2.414  37.989  1.00 74.17  ? 111  PRO A CB    1 
ATOM   882  C CG    . PRO A 1 111 ? 18.914  -3.289  39.138  1.00 75.94  ? 111  PRO A CG    1 
ATOM   883  C CD    . PRO A 1 111 ? 17.569  -2.919  39.641  1.00 77.11  ? 111  PRO A CD    1 
ATOM   884  N N     . THR A 1 112 ? 18.199  0.511   36.444  1.00 69.28  ? 112  THR A N     1 
ATOM   885  C CA    . THR A 1 112 ? 17.556  1.193   35.337  1.00 67.83  ? 112  THR A CA    1 
ATOM   886  C C     . THR A 1 112 ? 18.418  1.167   34.071  1.00 65.86  ? 112  THR A C     1 
ATOM   887  O O     . THR A 1 112 ? 19.626  1.353   34.147  1.00 64.80  ? 112  THR A O     1 
ATOM   888  C CB    . THR A 1 112 ? 17.277  2.655   35.733  1.00 67.30  ? 112  THR A CB    1 
ATOM   889  O OG1   . THR A 1 112 ? 16.474  2.670   36.921  1.00 69.91  ? 112  THR A OG1   1 
ATOM   890  C CG2   . THR A 1 112 ? 16.553  3.399   34.632  1.00 66.00  ? 112  THR A CG2   1 
ATOM   891  N N     . PRO A 1 113 ? 17.792  0.946   32.900  1.00 65.06  ? 113  PRO A N     1 
ATOM   892  C CA    . PRO A 1 113 ? 18.501  1.005   31.636  1.00 63.57  ? 113  PRO A CA    1 
ATOM   893  C C     . PRO A 1 113 ? 19.351  2.275   31.468  1.00 61.36  ? 113  PRO A C     1 
ATOM   894  O O     . PRO A 1 113 ? 18.943  3.386   31.858  1.00 61.38  ? 113  PRO A O     1 
ATOM   895  C CB    . PRO A 1 113 ? 17.367  0.968   30.605  1.00 64.01  ? 113  PRO A CB    1 
ATOM   896  C CG    . PRO A 1 113 ? 16.306  0.213   31.251  1.00 65.58  ? 113  PRO A CG    1 
ATOM   897  C CD    . PRO A 1 113 ? 16.368  0.611   32.692  1.00 66.47  ? 113  PRO A CD    1 
ATOM   898  N N     . VAL A 1 114 ? 20.530  2.088   30.897  1.00 59.19  ? 114  VAL A N     1 
ATOM   899  C CA    . VAL A 1 114 ? 21.515  3.145   30.781  1.00 56.73  ? 114  VAL A CA    1 
ATOM   900  C C     . VAL A 1 114 ? 21.602  3.598   29.321  1.00 55.35  ? 114  VAL A C     1 
ATOM   901  O O     . VAL A 1 114 ? 21.631  2.766   28.425  1.00 54.49  ? 114  VAL A O     1 
ATOM   902  C CB    . VAL A 1 114 ? 22.899  2.642   31.266  1.00 56.51  ? 114  VAL A CB    1 
ATOM   903  C CG1   . VAL A 1 114 ? 23.956  3.755   31.172  1.00 52.98  ? 114  VAL A CG1   1 
ATOM   904  C CG2   . VAL A 1 114 ? 22.789  2.073   32.680  1.00 56.29  ? 114  VAL A CG2   1 
ATOM   905  N N     . LEU A 1 115 ? 21.631  4.915   29.113  1.00 54.00  ? 115  LEU A N     1 
ATOM   906  C CA    . LEU A 1 115 ? 21.881  5.522   27.814  1.00 53.39  ? 115  LEU A CA    1 
ATOM   907  C C     . LEU A 1 115 ? 23.230  6.224   27.847  1.00 51.98  ? 115  LEU A C     1 
ATOM   908  O O     . LEU A 1 115 ? 23.486  7.039   28.728  1.00 51.43  ? 115  LEU A O     1 
ATOM   909  C CB    . LEU A 1 115 ? 20.809  6.560   27.477  1.00 53.70  ? 115  LEU A CB    1 
ATOM   910  C CG    . LEU A 1 115 ? 19.409  6.097   27.042  1.00 57.13  ? 115  LEU A CG    1 
ATOM   911  C CD1   . LEU A 1 115 ? 18.493  7.293   26.829  1.00 58.83  ? 115  LEU A CD1   1 
ATOM   912  C CD2   . LEU A 1 115 ? 19.497  5.311   25.758  1.00 60.75  ? 115  LEU A CD2   1 
ATOM   913  N N     . ILE A 1 116 ? 24.084  5.899   26.883  1.00 51.14  ? 116  ILE A N     1 
ATOM   914  C CA    . ILE A 1 116 ? 25.395  6.509   26.757  1.00 50.00  ? 116  ILE A CA    1 
ATOM   915  C C     . ILE A 1 116 ? 25.422  7.295   25.450  1.00 49.43  ? 116  ILE A C     1 
ATOM   916  O O     . ILE A 1 116 ? 25.269  6.717   24.373  1.00 48.88  ? 116  ILE A O     1 
ATOM   917  C CB    . ILE A 1 116 ? 26.532  5.488   26.730  1.00 50.48  ? 116  ILE A CB    1 
ATOM   918  C CG1   . ILE A 1 116 ? 26.417  4.548   27.941  1.00 50.62  ? 116  ILE A CG1   1 
ATOM   919  C CG2   . ILE A 1 116 ? 27.883  6.238   26.649  1.00 49.47  ? 116  ILE A CG2   1 
ATOM   920  C CD1   . ILE A 1 116 ? 27.509  3.544   28.064  1.00 51.12  ? 116  ILE A CD1   1 
ATOM   921  N N     . TRP A 1 117 ? 25.584  8.616   25.587  1.00 48.15  ? 117  TRP A N     1 
ATOM   922  C CA    . TRP A 1 117 ? 25.671  9.532   24.487  1.00 47.07  ? 117  TRP A CA    1 
ATOM   923  C C     . TRP A 1 117 ? 27.122  9.761   24.052  1.00 46.41  ? 117  TRP A C     1 
ATOM   924  O O     . TRP A 1 117 ? 28.014  9.987   24.881  1.00 45.58  ? 117  TRP A O     1 
ATOM   925  C CB    . TRP A 1 117 ? 25.058  10.874  24.891  1.00 47.49  ? 117  TRP A CB    1 
ATOM   926  C CG    . TRP A 1 117 ? 25.226  11.958  23.847  1.00 46.76  ? 117  TRP A CG    1 
ATOM   927  C CD1   . TRP A 1 117 ? 26.048  13.035  23.908  1.00 46.53  ? 117  TRP A CD1   1 
ATOM   928  C CD2   . TRP A 1 117 ? 24.538  12.041  22.601  1.00 45.73  ? 117  TRP A CD2   1 
ATOM   929  N NE1   . TRP A 1 117 ? 25.911  13.803  22.769  1.00 47.33  ? 117  TRP A NE1   1 
ATOM   930  C CE2   . TRP A 1 117 ? 24.989  13.204  21.949  1.00 47.04  ? 117  TRP A CE2   1 
ATOM   931  C CE3   . TRP A 1 117 ? 23.572  11.250  21.979  1.00 46.37  ? 117  TRP A CE3   1 
ATOM   932  C CZ2   . TRP A 1 117 ? 24.502  13.595  20.712  1.00 46.44  ? 117  TRP A CZ2   1 
ATOM   933  C CZ3   . TRP A 1 117 ? 23.091  11.635  20.751  1.00 46.39  ? 117  TRP A CZ3   1 
ATOM   934  C CH2   . TRP A 1 117 ? 23.555  12.791  20.128  1.00 46.14  ? 117  TRP A CH2   1 
ATOM   935  N N     . ILE A 1 118 ? 27.330  9.700   22.737  1.00 46.12  ? 118  ILE A N     1 
ATOM   936  C CA    . ILE A 1 118 ? 28.606  9.983   22.122  1.00 45.83  ? 118  ILE A CA    1 
ATOM   937  C C     . ILE A 1 118 ? 28.395  11.131  21.138  1.00 45.92  ? 118  ILE A C     1 
ATOM   938  O O     . ILE A 1 118 ? 27.774  10.944  20.098  1.00 45.47  ? 118  ILE A O     1 
ATOM   939  C CB    . ILE A 1 118 ? 29.178  8.749   21.381  1.00 46.02  ? 118  ILE A CB    1 
ATOM   940  C CG1   . ILE A 1 118 ? 29.222  7.520   22.309  1.00 45.72  ? 118  ILE A CG1   1 
ATOM   941  C CG2   . ILE A 1 118 ? 30.569  9.080   20.855  1.00 45.89  ? 118  ILE A CG2   1 
ATOM   942  C CD1   . ILE A 1 118 ? 29.710  6.221   21.625  1.00 45.91  ? 118  ILE A CD1   1 
ATOM   943  N N     . TYR A 1 119 ? 28.891  12.321  21.483  1.00 46.23  ? 119  TYR A N     1 
ATOM   944  C CA    . TYR A 1 119 ? 28.749  13.486  20.608  1.00 46.64  ? 119  TYR A CA    1 
ATOM   945  C C     . TYR A 1 119 ? 29.484  13.345  19.288  1.00 46.88  ? 119  TYR A C     1 
ATOM   946  O O     . TYR A 1 119 ? 30.466  12.611  19.172  1.00 47.07  ? 119  TYR A O     1 
ATOM   947  C CB    . TYR A 1 119 ? 29.237  14.776  21.272  1.00 47.35  ? 119  TYR A CB    1 
ATOM   948  C CG    . TYR A 1 119 ? 30.688  14.778  21.709  1.00 47.44  ? 119  TYR A CG    1 
ATOM   949  C CD1   . TYR A 1 119 ? 31.725  14.981  20.800  1.00 48.48  ? 119  TYR A CD1   1 
ATOM   950  C CD2   . TYR A 1 119 ? 31.013  14.611  23.043  1.00 48.38  ? 119  TYR A CD2   1 
ATOM   951  C CE1   . TYR A 1 119 ? 33.084  14.977  21.219  1.00 49.53  ? 119  TYR A CE1   1 
ATOM   952  C CE2   . TYR A 1 119 ? 32.328  14.606  23.471  1.00 51.72  ? 119  TYR A CE2   1 
ATOM   953  C CZ    . TYR A 1 119 ? 33.374  14.788  22.565  1.00 50.21  ? 119  TYR A CZ    1 
ATOM   954  O OH    . TYR A 1 119 ? 34.672  14.772  23.042  1.00 49.18  ? 119  TYR A OH    1 
ATOM   955  N N     . GLY A 1 120 ? 29.008  14.110  18.312  1.00 46.85  ? 120  GLY A N     1 
ATOM   956  C CA    . GLY A 1 120 ? 29.672  14.258  17.025  1.00 46.83  ? 120  GLY A CA    1 
ATOM   957  C C     . GLY A 1 120 ? 30.386  15.585  16.923  1.00 46.19  ? 120  GLY A C     1 
ATOM   958  O O     . GLY A 1 120 ? 30.588  16.274  17.936  1.00 46.42  ? 120  GLY A O     1 
ATOM   959  N N     . GLY A 1 121 ? 30.715  15.955  15.687  1.00 45.81  ? 121  GLY A N     1 
ATOM   960  C CA    . GLY A 1 121 ? 31.591  17.118  15.387  1.00 45.77  ? 121  GLY A CA    1 
ATOM   961  C C     . GLY A 1 121 ? 32.768  16.724  14.500  1.00 46.08  ? 121  GLY A C     1 
ATOM   962  O O     . GLY A 1 121 ? 33.886  17.238  14.662  1.00 45.63  ? 121  GLY A O     1 
ATOM   963  N N     . GLY A 1 122 ? 32.517  15.781  13.585  1.00 46.02  ? 122  GLY A N     1 
ATOM   964  C CA    . GLY A 1 122 ? 33.472  15.398  12.548  1.00 46.84  ? 122  GLY A CA    1 
ATOM   965  C C     . GLY A 1 122 ? 34.770  14.780  13.025  1.00 47.36  ? 122  GLY A C     1 
ATOM   966  O O     . GLY A 1 122 ? 35.730  14.737  12.282  1.00 47.94  ? 122  GLY A O     1 
ATOM   967  N N     . PHE A 1 123 ? 34.779  14.310  14.267  1.00 47.56  ? 123  PHE A N     1 
ATOM   968  C CA    . PHE A 1 123 ? 35.973  13.844  14.957  1.00 48.34  ? 123  PHE A CA    1 
ATOM   969  C C     . PHE A 1 123 ? 37.010  14.929  15.228  1.00 49.18  ? 123  PHE A C     1 
ATOM   970  O O     . PHE A 1 123 ? 38.111  14.593  15.641  1.00 50.68  ? 123  PHE A O     1 
ATOM   971  C CB    . PHE A 1 123 ? 36.629  12.659  14.221  1.00 48.73  ? 123  PHE A CB    1 
ATOM   972  C CG    . PHE A 1 123 ? 35.774  11.439  14.152  1.00 46.49  ? 123  PHE A CG    1 
ATOM   973  C CD1   . PHE A 1 123 ? 35.580  10.659  15.271  1.00 47.53  ? 123  PHE A CD1   1 
ATOM   974  C CD2   . PHE A 1 123 ? 35.181  11.062  12.964  1.00 47.78  ? 123  PHE A CD2   1 
ATOM   975  C CE1   . PHE A 1 123 ? 34.779  9.502   15.218  1.00 49.02  ? 123  PHE A CE1   1 
ATOM   976  C CE2   . PHE A 1 123 ? 34.374  9.927   12.885  1.00 47.87  ? 123  PHE A CE2   1 
ATOM   977  C CZ    . PHE A 1 123 ? 34.183  9.135   14.017  1.00 48.58  ? 123  PHE A CZ    1 
ATOM   978  N N     . TYR A 1 124 ? 36.668  16.201  15.006  1.00 49.59  ? 124  TYR A N     1 
ATOM   979  C CA    . TYR A 1 124 ? 37.579  17.336  15.259  1.00 50.75  ? 124  TYR A CA    1 
ATOM   980  C C     . TYR A 1 124 ? 37.015  18.293  16.313  1.00 51.00  ? 124  TYR A C     1 
ATOM   981  O O     . TYR A 1 124 ? 37.671  19.265  16.691  1.00 52.12  ? 124  TYR A O     1 
ATOM   982  C CB    . TYR A 1 124 ? 37.887  18.134  13.971  1.00 51.35  ? 124  TYR A CB    1 
ATOM   983  C CG    . TYR A 1 124 ? 36.705  18.854  13.413  1.00 51.70  ? 124  TYR A CG    1 
ATOM   984  C CD1   . TYR A 1 124 ? 36.374  20.135  13.855  1.00 53.83  ? 124  TYR A CD1   1 
ATOM   985  C CD2   . TYR A 1 124 ? 35.873  18.253  12.476  1.00 53.21  ? 124  TYR A CD2   1 
ATOM   986  C CE1   . TYR A 1 124 ? 35.256  20.805  13.369  1.00 51.28  ? 124  TYR A CE1   1 
ATOM   987  C CE2   . TYR A 1 124 ? 34.746  18.920  11.981  1.00 52.04  ? 124  TYR A CE2   1 
ATOM   988  C CZ    . TYR A 1 124 ? 34.457  20.194  12.436  1.00 51.56  ? 124  TYR A CZ    1 
ATOM   989  O OH    . TYR A 1 124 ? 33.356  20.861  11.956  1.00 51.82  ? 124  TYR A OH    1 
ATOM   990  N N     . SER A 1 125 ? 35.800  18.033  16.778  1.00 50.25  ? 125  SER A N     1 
ATOM   991  C CA    . SER A 1 125 ? 35.150  18.926  17.718  1.00 49.80  ? 125  SER A CA    1 
ATOM   992  C C     . SER A 1 125 ? 34.128  18.193  18.578  1.00 49.24  ? 125  SER A C     1 
ATOM   993  O O     . SER A 1 125 ? 33.837  16.990  18.373  1.00 47.98  ? 125  SER A O     1 
ATOM   994  C CB    . SER A 1 125 ? 34.484  20.077  16.963  1.00 49.96  ? 125  SER A CB    1 
ATOM   995  O OG    . SER A 1 125 ? 33.624  19.590  15.940  1.00 50.11  ? 125  SER A OG    1 
ATOM   996  N N     . GLY A 1 126 ? 33.594  18.928  19.549  1.00 49.19  ? 126  GLY A N     1 
ATOM   997  C CA    . GLY A 1 126 ? 32.514  18.422  20.382  1.00 49.30  ? 126  GLY A CA    1 
ATOM   998  C C     . GLY A 1 126 ? 32.880  18.332  21.843  1.00 49.82  ? 126  GLY A C     1 
ATOM   999  O O     . GLY A 1 126 ? 34.067  18.364  22.206  1.00 50.74  ? 126  GLY A O     1 
ATOM   1000 N N     . ALA A 1 127 ? 31.844  18.256  22.672  1.00 49.74  ? 127  ALA A N     1 
ATOM   1001 C CA    . ALA A 1 127 ? 31.983  18.093  24.121  1.00 50.50  ? 127  ALA A CA    1 
ATOM   1002 C C     . ALA A 1 127 ? 30.687  17.495  24.701  1.00 50.03  ? 127  ALA A C     1 
ATOM   1003 O O     . ALA A 1 127 ? 29.600  17.722  24.168  1.00 50.19  ? 127  ALA A O     1 
ATOM   1004 C CB    . ALA A 1 127 ? 32.289  19.446  24.775  1.00 50.42  ? 127  ALA A CB    1 
ATOM   1005 N N     . ALA A 1 128 ? 30.788  16.759  25.797  1.00 50.21  ? 128  ALA A N     1 
ATOM   1006 C CA    . ALA A 1 128 ? 29.591  16.223  26.456  1.00 50.14  ? 128  ALA A CA    1 
ATOM   1007 C C     . ALA A 1 128 ? 28.884  17.277  27.292  1.00 50.85  ? 128  ALA A C     1 
ATOM   1008 O O     . ALA A 1 128 ? 27.795  17.023  27.805  1.00 51.33  ? 128  ALA A O     1 
ATOM   1009 C CB    . ALA A 1 128 ? 29.942  15.007  27.313  1.00 50.41  ? 128  ALA A CB    1 
ATOM   1010 N N     . SER A 1 129 ? 29.489  18.461  27.411  1.00 51.15  ? 129  SER A N     1 
ATOM   1011 C CA    . SER A 1 129 ? 29.035  19.490  28.335  1.00 51.74  ? 129  SER A CA    1 
ATOM   1012 C C     . SER A 1 129 ? 28.098  20.514  27.693  1.00 52.00  ? 129  SER A C     1 
ATOM   1013 O O     . SER A 1 129 ? 27.534  21.363  28.384  1.00 52.86  ? 129  SER A O     1 
ATOM   1014 C CB    . SER A 1 129 ? 30.261  20.202  28.934  1.00 52.94  ? 129  SER A CB    1 
ATOM   1015 O OG    . SER A 1 129 ? 31.102  20.766  27.926  1.00 52.19  ? 129  SER A OG    1 
ATOM   1016 N N     . LEU A 1 130 ? 27.944  20.443  26.374  1.00 51.91  ? 130  LEU A N     1 
ATOM   1017 C CA    . LEU A 1 130 ? 27.060  21.342  25.634  1.00 51.94  ? 130  LEU A CA    1 
ATOM   1018 C C     . LEU A 1 130 ? 25.622  21.192  26.085  1.00 52.14  ? 130  LEU A C     1 
ATOM   1019 O O     . LEU A 1 130 ? 25.179  20.099  26.437  1.00 52.03  ? 130  LEU A O     1 
ATOM   1020 C CB    . LEU A 1 130 ? 27.123  21.065  24.131  1.00 51.59  ? 130  LEU A CB    1 
ATOM   1021 C CG    . LEU A 1 130 ? 28.483  21.057  23.416  1.00 52.60  ? 130  LEU A CG    1 
ATOM   1022 C CD1   . LEU A 1 130 ? 28.285  20.664  21.961  1.00 52.67  ? 130  LEU A CD1   1 
ATOM   1023 C CD2   . LEU A 1 130 ? 29.188  22.408  23.518  1.00 51.19  ? 130  LEU A CD2   1 
ATOM   1024 N N     . ASP A 1 131 ? 24.897  22.302  26.034  1.00 52.93  ? 131  ASP A N     1 
ATOM   1025 C CA    . ASP A 1 131 ? 23.534  22.399  26.563  1.00 53.89  ? 131  ASP A CA    1 
ATOM   1026 C C     . ASP A 1 131 ? 22.542  21.484  25.874  1.00 53.24  ? 131  ASP A C     1 
ATOM   1027 O O     . ASP A 1 131 ? 21.655  20.957  26.537  1.00 53.88  ? 131  ASP A O     1 
ATOM   1028 C CB    . ASP A 1 131 ? 23.025  23.843  26.488  1.00 54.42  ? 131  ASP A CB    1 
ATOM   1029 C CG    . ASP A 1 131 ? 23.702  24.749  27.487  1.00 56.40  ? 131  ASP A CG    1 
ATOM   1030 O OD1   . ASP A 1 131 ? 24.344  24.255  28.417  1.00 59.33  ? 131  ASP A OD1   1 
ATOM   1031 O OD2   . ASP A 1 131 ? 23.585  25.979  27.367  1.00 62.95  ? 131  ASP A OD2   1 
ATOM   1032 N N     . VAL A 1 132 ? 22.703  21.294  24.564  1.00 52.29  ? 132  VAL A N     1 
ATOM   1033 C CA    . VAL A 1 132 ? 21.871  20.362  23.806  1.00 52.15  ? 132  VAL A CA    1 
ATOM   1034 C C     . VAL A 1 132 ? 21.980  18.920  24.274  1.00 51.16  ? 132  VAL A C     1 
ATOM   1035 O O     . VAL A 1 132 ? 21.078  18.144  24.009  1.00 50.94  ? 132  VAL A O     1 
ATOM   1036 C CB    . VAL A 1 132 ? 22.197  20.355  22.283  1.00 51.93  ? 132  VAL A CB    1 
ATOM   1037 C CG1   . VAL A 1 132 ? 21.524  21.470  21.618  1.00 54.17  ? 132  VAL A CG1   1 
ATOM   1038 C CG2   . VAL A 1 132 ? 23.713  20.380  22.035  1.00 52.46  ? 132  VAL A CG2   1 
ATOM   1039 N N     . TYR A 1 133 ? 23.082  18.565  24.931  1.00 50.98  ? 133  TYR A N     1 
ATOM   1040 C CA    . TYR A 1 133 ? 23.302  17.188  25.428  1.00 51.06  ? 133  TYR A CA    1 
ATOM   1041 C C     . TYR A 1 133 ? 22.956  17.035  26.939  1.00 51.86  ? 133  TYR A C     1 
ATOM   1042 O O     . TYR A 1 133 ? 23.341  16.066  27.581  1.00 51.50  ? 133  TYR A O     1 
ATOM   1043 C CB    . TYR A 1 133 ? 24.753  16.745  25.170  1.00 50.04  ? 133  TYR A CB    1 
ATOM   1044 C CG    . TYR A 1 133 ? 25.276  16.954  23.748  1.00 49.18  ? 133  TYR A CG    1 
ATOM   1045 C CD1   . TYR A 1 133 ? 24.441  16.807  22.640  1.00 49.43  ? 133  TYR A CD1   1 
ATOM   1046 C CD2   . TYR A 1 133 ? 26.618  17.263  23.517  1.00 49.12  ? 133  TYR A CD2   1 
ATOM   1047 C CE1   . TYR A 1 133 ? 24.906  16.989  21.351  1.00 48.58  ? 133  TYR A CE1   1 
ATOM   1048 C CE2   . TYR A 1 133 ? 27.113  17.438  22.212  1.00 49.13  ? 133  TYR A CE2   1 
ATOM   1049 C CZ    . TYR A 1 133 ? 26.242  17.296  21.132  1.00 49.22  ? 133  TYR A CZ    1 
ATOM   1050 O OH    . TYR A 1 133 ? 26.682  17.463  19.836  1.00 47.92  ? 133  TYR A OH    1 
ATOM   1051 N N     . ASP A 1 134 ? 22.221  17.999  27.491  1.00 52.68  ? 134  ASP A N     1 
ATOM   1052 C CA    . ASP A 1 134 ? 21.829  17.974  28.903  1.00 53.24  ? 134  ASP A CA    1 
ATOM   1053 C C     . ASP A 1 134 ? 20.939  16.754  29.246  1.00 53.73  ? 134  ASP A C     1 
ATOM   1054 O O     . ASP A 1 134 ? 19.778  16.670  28.826  1.00 53.92  ? 134  ASP A O     1 
ATOM   1055 C CB    . ASP A 1 134 ? 21.102  19.265  29.211  1.00 54.02  ? 134  ASP A CB    1 
ATOM   1056 C CG    . ASP A 1 134 ? 20.867  19.479  30.680  1.00 55.45  ? 134  ASP A CG    1 
ATOM   1057 O OD1   . ASP A 1 134 ? 20.975  18.528  31.469  1.00 55.24  ? 134  ASP A OD1   1 
ATOM   1058 O OD2   . ASP A 1 134 ? 20.560  20.637  31.033  1.00 56.92  ? 134  ASP A OD2   1 
ATOM   1059 N N     . GLY A 1 135 ? 21.477  15.825  30.031  1.00 53.62  ? 135  GLY A N     1 
ATOM   1060 C CA    . GLY A 1 135 ? 20.740  14.615  30.377  1.00 53.98  ? 135  GLY A CA    1 
ATOM   1061 C C     . GLY A 1 135 ? 19.628  14.735  31.407  1.00 54.78  ? 135  GLY A C     1 
ATOM   1062 O O     . GLY A 1 135 ? 19.006  13.727  31.742  1.00 54.52  ? 135  GLY A O     1 
ATOM   1063 N N     . ARG A 1 136 ? 19.357  15.944  31.909  1.00 55.18  ? 136  ARG A N     1 
ATOM   1064 C CA    . ARG A 1 136 ? 18.423  16.083  33.037  1.00 56.59  ? 136  ARG A CA    1 
ATOM   1065 C C     . ARG A 1 136 ? 16.978  15.706  32.711  1.00 56.59  ? 136  ARG A C     1 
ATOM   1066 O O     . ARG A 1 136 ? 16.286  15.130  33.546  1.00 57.14  ? 136  ARG A O     1 
ATOM   1067 C CB    . ARG A 1 136 ? 18.500  17.482  33.689  1.00 57.03  ? 136  ARG A CB    1 
ATOM   1068 C CG    . ARG A 1 136 ? 17.951  18.636  32.896  1.00 58.18  ? 136  ARG A CG    1 
ATOM   1069 C CD    . ARG A 1 136 ? 18.089  19.968  33.679  1.00 59.34  ? 136  ARG A CD    1 
ATOM   1070 N NE    . ARG A 1 136 ? 19.478  20.438  33.689  1.00 61.48  ? 136  ARG A NE    1 
ATOM   1071 C CZ    . ARG A 1 136 ? 19.964  21.427  34.444  1.00 61.53  ? 136  ARG A CZ    1 
ATOM   1072 N NH1   . ARG A 1 136 ? 21.239  21.768  34.317  1.00 60.04  ? 136  ARG A NH1   1 
ATOM   1073 N NH2   . ARG A 1 136 ? 19.205  22.068  35.329  1.00 63.42  ? 136  ARG A NH2   1 
ATOM   1074 N N     . PHE A 1 137 ? 16.532  16.002  31.493  1.00 55.95  ? 137  PHE A N     1 
ATOM   1075 C CA    . PHE A 1 137 ? 15.137  15.797  31.140  1.00 56.02  ? 137  PHE A CA    1 
ATOM   1076 C C     . PHE A 1 137 ? 14.839  14.297  31.006  1.00 55.47  ? 137  PHE A C     1 
ATOM   1077 O O     . PHE A 1 137 ? 13.857  13.809  31.554  1.00 56.11  ? 137  PHE A O     1 
ATOM   1078 C CB    . PHE A 1 137 ? 14.789  16.554  29.865  1.00 55.84  ? 137  PHE A CB    1 
ATOM   1079 C CG    . PHE A 1 137 ? 15.192  18.002  29.900  1.00 56.68  ? 137  PHE A CG    1 
ATOM   1080 C CD1   . PHE A 1 137 ? 14.407  18.936  30.542  1.00 57.88  ? 137  PHE A CD1   1 
ATOM   1081 C CD2   . PHE A 1 137 ? 16.369  18.427  29.293  1.00 55.92  ? 137  PHE A CD2   1 
ATOM   1082 C CE1   . PHE A 1 137 ? 14.791  20.273  30.587  1.00 58.83  ? 137  PHE A CE1   1 
ATOM   1083 C CE2   . PHE A 1 137 ? 16.747  19.751  29.335  1.00 55.97  ? 137  PHE A CE2   1 
ATOM   1084 C CZ    . PHE A 1 137 ? 15.962  20.676  29.984  1.00 56.20  ? 137  PHE A CZ    1 
ATOM   1085 N N     . LEU A 1 138 ? 15.699  13.578  30.296  1.00 53.98  ? 138  LEU A N     1 
ATOM   1086 C CA    . LEU A 1 138 ? 15.568  12.125  30.156  1.00 54.07  ? 138  LEU A CA    1 
ATOM   1087 C C     . LEU A 1 138 ? 15.593  11.447  31.521  1.00 54.82  ? 138  LEU A C     1 
ATOM   1088 O O     . LEU A 1 138 ? 14.727  10.641  31.824  1.00 55.62  ? 138  LEU A O     1 
ATOM   1089 C CB    . LEU A 1 138 ? 16.688  11.570  29.272  1.00 52.71  ? 138  LEU A CB    1 
ATOM   1090 C CG    . LEU A 1 138 ? 16.553  11.857  27.779  1.00 51.81  ? 138  LEU A CG    1 
ATOM   1091 C CD1   . LEU A 1 138 ? 17.915  11.690  27.026  1.00 49.59  ? 138  LEU A CD1   1 
ATOM   1092 C CD2   . LEU A 1 138 ? 15.457  10.983  27.187  1.00 49.32  ? 138  LEU A CD2   1 
ATOM   1093 N N     . ALA A 1 139 ? 16.579  11.805  32.343  1.00 54.89  ? 139  ALA A N     1 
ATOM   1094 C CA    . ALA A 1 139 ? 16.669  11.325  33.732  1.00 55.96  ? 139  ALA A CA    1 
ATOM   1095 C C     . ALA A 1 139 ? 15.374  11.576  34.499  1.00 57.62  ? 139  ALA A C     1 
ATOM   1096 O O     . ALA A 1 139 ? 14.819  10.664  35.100  1.00 58.81  ? 139  ALA A O     1 
ATOM   1097 C CB    . ALA A 1 139 ? 17.829  12.000  34.449  1.00 55.04  ? 139  ALA A CB    1 
ATOM   1098 N N     . GLN A 1 140 ? 14.879  12.813  34.461  1.00 58.20  ? 140  GLN A N     1 
ATOM   1099 C CA    . GLN A 1 140 ? 13.714  13.180  35.262  1.00 59.66  ? 140  GLN A CA    1 
ATOM   1100 C C     . GLN A 1 140 ? 12.412  12.614  34.713  1.00 60.26  ? 140  GLN A C     1 
ATOM   1101 O O     . GLN A 1 140 ? 11.629  12.040  35.460  1.00 61.41  ? 140  GLN A O     1 
ATOM   1102 C CB    . GLN A 1 140 ? 13.598  14.701  35.406  1.00 59.78  ? 140  GLN A CB    1 
ATOM   1103 C CG    . GLN A 1 140 ? 12.858  15.130  36.655  1.00 61.06  ? 140  GLN A CG    1 
ATOM   1104 C CD    . GLN A 1 140 ? 11.333  15.031  36.545  1.00 63.92  ? 140  GLN A CD    1 
ATOM   1105 O OE1   . GLN A 1 140 ? 10.749  15.235  35.468  1.00 63.26  ? 140  GLN A OE1   1 
ATOM   1106 N NE2   . GLN A 1 140 ? 10.676  14.750  37.683  1.00 64.10  ? 140  GLN A NE2   1 
ATOM   1107 N N     . VAL A 1 141 ? 12.174  12.779  33.419  1.00 59.63  ? 141  VAL A N     1 
ATOM   1108 C CA    . VAL A 1 141 ? 10.886  12.387  32.841  1.00 60.53  ? 141  VAL A CA    1 
ATOM   1109 C C     . VAL A 1 141 ? 10.773  10.882  32.571  1.00 61.25  ? 141  VAL A C     1 
ATOM   1110 O O     . VAL A 1 141 ? 9.726   10.273  32.839  1.00 62.88  ? 141  VAL A O     1 
ATOM   1111 C CB    . VAL A 1 141 ? 10.603  13.170  31.565  1.00 60.00  ? 141  VAL A CB    1 
ATOM   1112 C CG1   . VAL A 1 141 ? 9.313   12.678  30.905  1.00 60.61  ? 141  VAL A CG1   1 
ATOM   1113 C CG2   . VAL A 1 141 ? 10.536  14.656  31.885  1.00 59.06  ? 141  VAL A CG2   1 
ATOM   1114 N N     . GLU A 1 142 ? 11.851  10.277  32.081  1.00 60.58  ? 142  GLU A N     1 
ATOM   1115 C CA    . GLU A 1 142 ? 11.852  8.856   31.742  1.00 60.91  ? 142  GLU A CA    1 
ATOM   1116 C C     . GLU A 1 142 ? 12.517  7.963   32.792  1.00 61.51  ? 142  GLU A C     1 
ATOM   1117 O O     . GLU A 1 142 ? 12.480  6.737   32.669  1.00 61.91  ? 142  GLU A O     1 
ATOM   1118 C CB    . GLU A 1 142 ? 12.497  8.645   30.373  1.00 59.83  ? 142  GLU A CB    1 
ATOM   1119 C CG    . GLU A 1 142 ? 11.665  9.226   29.229  1.00 61.06  ? 142  GLU A CG    1 
ATOM   1120 C CD    . GLU A 1 142 ? 10.310  8.545   29.068  1.00 65.34  ? 142  GLU A CD    1 
ATOM   1121 O OE1   . GLU A 1 142 ? 10.148  7.382   29.510  1.00 67.25  ? 142  GLU A OE1   1 
ATOM   1122 O OE2   . GLU A 1 142 ? 9.397   9.177   28.490  1.00 69.42  ? 142  GLU A OE2   1 
ATOM   1123 N N     . GLY A 1 143 ? 13.104  8.557   33.832  1.00 61.49  ? 143  GLY A N     1 
ATOM   1124 C CA    . GLY A 1 143 ? 13.774  7.773   34.880  1.00 61.56  ? 143  GLY A CA    1 
ATOM   1125 C C     . GLY A 1 143 ? 15.095  7.175   34.413  1.00 60.49  ? 143  GLY A C     1 
ATOM   1126 O O     . GLY A 1 143 ? 15.594  6.234   35.007  1.00 61.28  ? 143  GLY A O     1 
ATOM   1127 N N     . ALA A 1 144 ? 15.667  7.725   33.346  1.00 59.04  ? 144  ALA A N     1 
ATOM   1128 C CA    . ALA A 1 144 ? 16.879  7.167   32.739  1.00 57.88  ? 144  ALA A CA    1 
ATOM   1129 C C     . ALA A 1 144 ? 18.164  7.503   33.503  1.00 56.91  ? 144  ALA A C     1 
ATOM   1130 O O     . ALA A 1 144 ? 18.284  8.551   34.140  1.00 55.90  ? 144  ALA A O     1 
ATOM   1131 C CB    . ALA A 1 144 ? 17.010  7.664   31.287  1.00 57.11  ? 144  ALA A CB    1 
ATOM   1132 N N     . VAL A 1 145 ? 19.135  6.603   33.404  1.00 56.31  ? 145  VAL A N     1 
ATOM   1133 C CA    . VAL A 1 145 ? 20.501  6.909   33.774  1.00 55.50  ? 145  VAL A CA    1 
ATOM   1134 C C     . VAL A 1 145 ? 21.234  7.239   32.474  1.00 55.13  ? 145  VAL A C     1 
ATOM   1135 O O     . VAL A 1 145 ? 21.269  6.427   31.547  1.00 54.63  ? 145  VAL A O     1 
ATOM   1136 C CB    . VAL A 1 145 ? 21.136  5.747   34.559  1.00 56.26  ? 145  VAL A CB    1 
ATOM   1137 C CG1   . VAL A 1 145 ? 22.619  5.992   34.817  1.00 54.42  ? 145  VAL A CG1   1 
ATOM   1138 C CG2   . VAL A 1 145 ? 20.361  5.539   35.883  1.00 55.92  ? 145  VAL A CG2   1 
ATOM   1139 N N     . LEU A 1 146 ? 21.764  8.459   32.382  1.00 54.78  ? 146  LEU A N     1 
ATOM   1140 C CA    . LEU A 1 146 ? 22.400  8.905   31.159  1.00 54.34  ? 146  LEU A CA    1 
ATOM   1141 C C     . LEU A 1 146 ? 23.863  9.216   31.418  1.00 53.84  ? 146  LEU A C     1 
ATOM   1142 O O     . LEU A 1 146 ? 24.213  9.852   32.415  1.00 54.33  ? 146  LEU A O     1 
ATOM   1143 C CB    . LEU A 1 146 ? 21.674  10.118  30.561  1.00 54.76  ? 146  LEU A CB    1 
ATOM   1144 C CG    . LEU A 1 146 ? 22.007  10.390  29.077  1.00 55.49  ? 146  LEU A CG    1 
ATOM   1145 C CD1   . LEU A 1 146 ? 20.812  10.909  28.333  1.00 56.13  ? 146  LEU A CD1   1 
ATOM   1146 C CD2   . LEU A 1 146 ? 23.192  11.350  28.925  1.00 57.34  ? 146  LEU A CD2   1 
ATOM   1147 N N     . VAL A 1 147 ? 24.712  8.742   30.512  1.00 52.65  ? 147  VAL A N     1 
ATOM   1148 C CA    . VAL A 1 147 ? 26.134  8.908   30.624  1.00 51.52  ? 147  VAL A CA    1 
ATOM   1149 C C     . VAL A 1 147 ? 26.650  9.542   29.342  1.00 50.75  ? 147  VAL A C     1 
ATOM   1150 O O     . VAL A 1 147 ? 26.248  9.161   28.260  1.00 50.29  ? 147  VAL A O     1 
ATOM   1151 C CB    . VAL A 1 147 ? 26.846  7.540   30.847  1.00 52.35  ? 147  VAL A CB    1 
ATOM   1152 C CG1   . VAL A 1 147 ? 28.367  7.730   31.070  1.00 50.49  ? 147  VAL A CG1   1 
ATOM   1153 C CG2   . VAL A 1 147 ? 26.212  6.783   31.999  1.00 51.11  ? 147  VAL A CG2   1 
ATOM   1154 N N     . SER A 1 148 ? 27.544  10.515  29.473  1.00 50.23  ? 148  SER A N     1 
ATOM   1155 C CA    . SER A 1 148 ? 28.237  11.085  28.324  1.00 49.56  ? 148  SER A CA    1 
ATOM   1156 C C     . SER A 1 148 ? 29.713  11.282  28.661  1.00 49.39  ? 148  SER A C     1 
ATOM   1157 O O     . SER A 1 148 ? 30.051  11.700  29.757  1.00 50.00  ? 148  SER A O     1 
ATOM   1158 C CB    . SER A 1 148 ? 27.591  12.417  27.920  1.00 49.39  ? 148  SER A CB    1 
ATOM   1159 O OG    . SER A 1 148 ? 27.666  13.361  28.965  1.00 48.57  ? 148  SER A OG    1 
ATOM   1160 N N     . MET A 1 149 ? 30.587  10.951  27.724  1.00 49.37  ? 149  MET A N     1 
ATOM   1161 C CA    . MET A 1 149 ? 32.014  11.085  27.922  1.00 49.80  ? 149  MET A CA    1 
ATOM   1162 C C     . MET A 1 149 ? 32.622  12.034  26.909  1.00 49.72  ? 149  MET A C     1 
ATOM   1163 O O     . MET A 1 149 ? 32.181  12.127  25.746  1.00 49.34  ? 149  MET A O     1 
ATOM   1164 C CB    . MET A 1 149 ? 32.700  9.723   27.815  1.00 50.56  ? 149  MET A CB    1 
ATOM   1165 C CG    . MET A 1 149 ? 33.136  9.302   26.392  1.00 50.90  ? 149  MET A CG    1 
ATOM   1166 S SD    . MET A 1 149 ? 31.737  8.960   25.303  1.00 51.56  ? 149  MET A SD    1 
ATOM   1167 C CE    . MET A 1 149 ? 31.233  7.341   25.905  1.00 48.76  ? 149  MET A CE    1 
ATOM   1168 N N     . ASN A 1 150 ? 33.634  12.760  27.370  1.00 50.24  ? 150  ASN A N     1 
ATOM   1169 C CA    . ASN A 1 150 ? 34.547  13.447  26.478  1.00 50.03  ? 150  ASN A CA    1 
ATOM   1170 C C     . ASN A 1 150 ? 35.488  12.384  25.901  1.00 50.01  ? 150  ASN A C     1 
ATOM   1171 O O     . ASN A 1 150 ? 35.889  11.446  26.613  1.00 49.52  ? 150  ASN A O     1 
ATOM   1172 C CB    . ASN A 1 150 ? 35.343  14.495  27.230  1.00 50.50  ? 150  ASN A CB    1 
ATOM   1173 C CG    . ASN A 1 150 ? 34.580  15.793  27.456  1.00 51.79  ? 150  ASN A CG    1 
ATOM   1174 O OD1   . ASN A 1 150 ? 33.389  15.935  27.114  1.00 49.78  ? 150  ASN A OD1   1 
ATOM   1175 N ND2   . ASN A 1 150 ? 35.281  16.769  28.061  1.00 52.28  ? 150  ASN A ND2   1 
ATOM   1176 N N     . TYR A 1 151 ? 35.785  12.511  24.607  1.00 49.57  ? 151  TYR A N     1 
ATOM   1177 C CA    . TYR A 1 151 ? 36.836  11.724  23.957  1.00 50.02  ? 151  TYR A CA    1 
ATOM   1178 C C     . TYR A 1 151 ? 37.697  12.660  23.113  1.00 50.18  ? 151  TYR A C     1 
ATOM   1179 O O     . TYR A 1 151 ? 37.223  13.720  22.655  1.00 50.12  ? 151  TYR A O     1 
ATOM   1180 C CB    . TYR A 1 151 ? 36.260  10.585  23.108  1.00 49.95  ? 151  TYR A CB    1 
ATOM   1181 C CG    . TYR A 1 151 ? 35.398  11.027  21.947  1.00 49.40  ? 151  TYR A CG    1 
ATOM   1182 C CD1   . TYR A 1 151 ? 34.040  11.327  22.128  1.00 49.39  ? 151  TYR A CD1   1 
ATOM   1183 C CD2   . TYR A 1 151 ? 35.926  11.140  20.672  1.00 49.16  ? 151  TYR A CD2   1 
ATOM   1184 C CE1   . TYR A 1 151 ? 33.239  11.731  21.069  1.00 48.55  ? 151  TYR A CE1   1 
ATOM   1185 C CE2   . TYR A 1 151 ? 35.135  11.549  19.598  1.00 49.84  ? 151  TYR A CE2   1 
ATOM   1186 C CZ    . TYR A 1 151 ? 33.789  11.846  19.800  1.00 49.70  ? 151  TYR A CZ    1 
ATOM   1187 O OH    . TYR A 1 151 ? 33.006  12.251  18.729  1.00 49.17  ? 151  TYR A OH    1 
ATOM   1188 N N     . ARG A 1 152 ? 38.965  12.291  22.945  1.00 50.27  ? 152  ARG A N     1 
ATOM   1189 C CA    . ARG A 1 152 ? 39.930  13.115  22.210  1.00 50.52  ? 152  ARG A CA    1 
ATOM   1190 C C     . ARG A 1 152 ? 39.546  13.261  20.754  1.00 50.14  ? 152  ARG A C     1 
ATOM   1191 O O     . ARG A 1 152 ? 39.051  12.325  20.137  1.00 50.09  ? 152  ARG A O     1 
ATOM   1192 C CB    . ARG A 1 152 ? 41.340  12.527  22.309  1.00 51.38  ? 152  ARG A CB    1 
ATOM   1193 C CG    . ARG A 1 152 ? 42.046  12.870  23.607  1.00 52.08  ? 152  ARG A CG    1 
ATOM   1194 C CD    . ARG A 1 152 ? 43.368  12.178  23.718  1.00 52.95  ? 152  ARG A CD    1 
ATOM   1195 N NE    . ARG A 1 152 ? 43.182  10.770  24.009  1.00 53.04  ? 152  ARG A NE    1 
ATOM   1196 C CZ    . ARG A 1 152 ? 44.163  9.877   24.092  1.00 55.07  ? 152  ARG A CZ    1 
ATOM   1197 N NH1   . ARG A 1 152 ? 45.437  10.231  23.901  1.00 56.50  ? 152  ARG A NH1   1 
ATOM   1198 N NH2   . ARG A 1 152 ? 43.858  8.613   24.362  1.00 54.87  ? 152  ARG A NH2   1 
ATOM   1199 N N     . VAL A 1 153 ? 39.768  14.447  20.210  1.00 50.49  ? 153  VAL A N     1 
ATOM   1200 C CA    . VAL A 1 153 ? 39.389  14.740  18.831  1.00 50.28  ? 153  VAL A CA    1 
ATOM   1201 C C     . VAL A 1 153 ? 40.601  15.285  18.098  1.00 51.66  ? 153  VAL A C     1 
ATOM   1202 O O     . VAL A 1 153 ? 41.665  15.510  18.709  1.00 53.04  ? 153  VAL A O     1 
ATOM   1203 C CB    . VAL A 1 153 ? 38.201  15.732  18.755  1.00 49.71  ? 153  VAL A CB    1 
ATOM   1204 C CG1   . VAL A 1 153 ? 36.939  15.096  19.348  1.00 47.12  ? 153  VAL A CG1   1 
ATOM   1205 C CG2   . VAL A 1 153 ? 38.543  17.081  19.445  1.00 50.18  ? 153  VAL A CG2   1 
ATOM   1206 N N     . GLY A 1 154 ? 40.458  15.449  16.789  1.00 51.13  ? 154  GLY A N     1 
ATOM   1207 C CA    . GLY A 1 154 ? 41.512  16.015  15.982  1.00 51.91  ? 154  GLY A CA    1 
ATOM   1208 C C     . GLY A 1 154 ? 42.750  15.150  15.991  1.00 52.80  ? 154  GLY A C     1 
ATOM   1209 O O     . GLY A 1 154 ? 42.662  13.927  16.105  1.00 52.93  ? 154  GLY A O     1 
ATOM   1210 N N     . THR A 1 155 ? 43.907  15.791  15.887  1.00 53.46  ? 155  THR A N     1 
ATOM   1211 C CA    . THR A 1 155 ? 45.179  15.086  15.911  1.00 54.50  ? 155  THR A CA    1 
ATOM   1212 C C     . THR A 1 155 ? 45.335  14.304  17.218  1.00 54.64  ? 155  THR A C     1 
ATOM   1213 O O     . THR A 1 155 ? 45.815  13.170  17.214  1.00 55.57  ? 155  THR A O     1 
ATOM   1214 C CB    . THR A 1 155 ? 46.369  16.067  15.716  1.00 55.67  ? 155  THR A CB    1 
ATOM   1215 O OG1   . THR A 1 155 ? 46.344  17.069  16.739  1.00 56.47  ? 155  THR A OG1   1 
ATOM   1216 C CG2   . THR A 1 155 ? 46.294  16.751  14.363  1.00 54.38  ? 155  THR A CG2   1 
ATOM   1217 N N     . PHE A 1 156 ? 44.881  14.891  18.326  1.00 54.14  ? 156  PHE A N     1 
ATOM   1218 C CA    . PHE A 1 156 ? 45.035  14.294  19.664  1.00 54.12  ? 156  PHE A CA    1 
ATOM   1219 C C     . PHE A 1 156 ? 44.296  12.974  19.778  1.00 53.62  ? 156  PHE A C     1 
ATOM   1220 O O     . PHE A 1 156 ? 44.747  12.055  20.472  1.00 54.39  ? 156  PHE A O     1 
ATOM   1221 C CB    . PHE A 1 156 ? 44.535  15.259  20.745  1.00 54.27  ? 156  PHE A CB    1 
ATOM   1222 C CG    . PHE A 1 156 ? 45.059  16.649  20.583  1.00 54.69  ? 156  PHE A CG    1 
ATOM   1223 C CD1   . PHE A 1 156 ? 46.344  16.959  20.974  1.00 56.54  ? 156  PHE A CD1   1 
ATOM   1224 C CD2   . PHE A 1 156 ? 44.295  17.617  19.977  1.00 54.47  ? 156  PHE A CD2   1 
ATOM   1225 C CE1   . PHE A 1 156 ? 46.850  18.215  20.784  1.00 58.13  ? 156  PHE A CE1   1 
ATOM   1226 C CE2   . PHE A 1 156 ? 44.794  18.884  19.794  1.00 56.53  ? 156  PHE A CE2   1 
ATOM   1227 C CZ    . PHE A 1 156 ? 46.084  19.181  20.200  1.00 57.24  ? 156  PHE A CZ    1 
ATOM   1228 N N     . GLY A 1 157 ? 43.171  12.875  19.078  1.00 52.36  ? 157  GLY A N     1 
ATOM   1229 C CA    . GLY A 1 157 ? 42.372  11.658  19.096  1.00 51.70  ? 157  GLY A CA    1 
ATOM   1230 C C     . GLY A 1 157 ? 42.659  10.667  17.989  1.00 51.88  ? 157  GLY A C     1 
ATOM   1231 O O     . GLY A 1 157 ? 42.475  9.450   18.179  1.00 51.72  ? 157  GLY A O     1 
ATOM   1232 N N     . PHE A 1 158 ? 43.111  11.176  16.842  1.00 52.34  ? 158  PHE A N     1 
ATOM   1233 C CA    . PHE A 1 158 ? 43.100  10.396  15.605  1.00 53.05  ? 158  PHE A CA    1 
ATOM   1234 C C     . PHE A 1 158 ? 44.312  10.465  14.686  1.00 54.89  ? 158  PHE A C     1 
ATOM   1235 O O     . PHE A 1 158 ? 44.355  9.739   13.694  1.00 55.87  ? 158  PHE A O     1 
ATOM   1236 C CB    . PHE A 1 158 ? 41.821  10.715  14.850  1.00 51.94  ? 158  PHE A CB    1 
ATOM   1237 C CG    . PHE A 1 158 ? 40.612  10.334  15.614  1.00 50.89  ? 158  PHE A CG    1 
ATOM   1238 C CD1   . PHE A 1 158 ? 40.228  9.011   15.677  1.00 50.07  ? 158  PHE A CD1   1 
ATOM   1239 C CD2   . PHE A 1 158 ? 39.912  11.270  16.347  1.00 50.82  ? 158  PHE A CD2   1 
ATOM   1240 C CE1   . PHE A 1 158 ? 39.157  8.633   16.426  1.00 49.76  ? 158  PHE A CE1   1 
ATOM   1241 C CE2   . PHE A 1 158 ? 38.812  10.891  17.107  1.00 49.06  ? 158  PHE A CE2   1 
ATOM   1242 C CZ    . PHE A 1 158 ? 38.440  9.576   17.136  1.00 50.49  ? 158  PHE A CZ    1 
ATOM   1243 N N     . LEU A 1 159 ? 45.298  11.301  15.012  1.00 56.31  ? 159  LEU A N     1 
ATOM   1244 C CA    . LEU A 1 159 ? 46.573  11.312  14.269  1.00 57.87  ? 159  LEU A CA    1 
ATOM   1245 C C     . LEU A 1 159 ? 47.227  9.966   14.444  1.00 59.09  ? 159  LEU A C     1 
ATOM   1246 O O     . LEU A 1 159 ? 47.425  9.526   15.566  1.00 59.98  ? 159  LEU A O     1 
ATOM   1247 C CB    . LEU A 1 159 ? 47.520  12.421  14.753  1.00 58.17  ? 159  LEU A CB    1 
ATOM   1248 C CG    . LEU A 1 159 ? 48.854  12.599  13.988  1.00 59.20  ? 159  LEU A CG    1 
ATOM   1249 C CD1   . LEU A 1 159 ? 49.272  14.080  13.911  1.00 57.59  ? 159  LEU A CD1   1 
ATOM   1250 C CD2   . LEU A 1 159 ? 49.949  11.754  14.605  1.00 55.61  ? 159  LEU A CD2   1 
ATOM   1251 N N     . ALA A 1 160 ? 47.565  9.322   13.331  1.00 60.44  ? 160  ALA A N     1 
ATOM   1252 C CA    . ALA A 1 160 ? 48.070  7.949   13.338  1.00 61.48  ? 160  ALA A CA    1 
ATOM   1253 C C     . ALA A 1 160 ? 49.272  7.800   12.426  1.00 63.46  ? 160  ALA A C     1 
ATOM   1254 O O     . ALA A 1 160 ? 49.306  8.343   11.321  1.00 63.92  ? 160  ALA A O     1 
ATOM   1255 C CB    . ALA A 1 160 ? 46.977  6.992   12.898  1.00 60.79  ? 160  ALA A CB    1 
ATOM   1256 N N     . LEU A 1 161 ? 50.276  7.083   12.915  1.00 65.28  ? 161  LEU A N     1 
ATOM   1257 C CA    . LEU A 1 161 ? 51.326  6.540   12.070  1.00 66.95  ? 161  LEU A CA    1 
ATOM   1258 C C     . LEU A 1 161 ? 51.178  5.044   12.201  1.00 67.46  ? 161  LEU A C     1 
ATOM   1259 O O     . LEU A 1 161 ? 51.758  4.450   13.087  1.00 67.95  ? 161  LEU A O     1 
ATOM   1260 C CB    . LEU A 1 161 ? 52.677  7.053   12.529  1.00 68.31  ? 161  LEU A CB    1 
ATOM   1261 C CG    . LEU A 1 161 ? 52.795  8.530   12.126  1.00 68.78  ? 161  LEU A CG    1 
ATOM   1262 C CD1   . LEU A 1 161 ? 53.637  9.286   13.108  1.00 72.24  ? 161  LEU A CD1   1 
ATOM   1263 C CD2   . LEU A 1 161 ? 53.340  8.677   10.708  1.00 68.32  ? 161  LEU A CD2   1 
ATOM   1264 N N     . PRO A 1 162 ? 50.317  4.444   11.364  1.00 67.88  ? 162  PRO A N     1 
ATOM   1265 C CA    . PRO A 1 162 ? 49.900  3.061   11.605  1.00 68.77  ? 162  PRO A CA    1 
ATOM   1266 C C     . PRO A 1 162 ? 51.057  2.068   11.654  1.00 71.20  ? 162  PRO A C     1 
ATOM   1267 O O     . PRO A 1 162 ? 51.959  2.125   10.832  1.00 72.48  ? 162  PRO A O     1 
ATOM   1268 C CB    . PRO A 1 162 ? 48.946  2.770   10.435  1.00 68.43  ? 162  PRO A CB    1 
ATOM   1269 C CG    . PRO A 1 162 ? 48.469  4.113   9.983   1.00 66.95  ? 162  PRO A CG    1 
ATOM   1270 C CD    . PRO A 1 162 ? 49.648  5.009   10.174  1.00 67.47  ? 162  PRO A CD    1 
ATOM   1271 N N     . GLY A 1 163 ? 51.026  1.178   12.638  1.00 72.33  ? 163  GLY A N     1 
ATOM   1272 C CA    . GLY A 1 163 ? 52.117  0.240   12.873  1.00 74.87  ? 163  GLY A CA    1 
ATOM   1273 C C     . GLY A 1 163 ? 53.076  0.719   13.949  1.00 76.02  ? 163  GLY A C     1 
ATOM   1274 O O     . GLY A 1 163 ? 53.806  -0.091  14.536  1.00 77.59  ? 163  GLY A O     1 
ATOM   1275 N N     . SER A 1 164 ? 53.091  2.030   14.203  1.00 75.67  ? 164  SER A N     1 
ATOM   1276 C CA    . SER A 1 164 ? 53.893  2.598   15.283  1.00 76.52  ? 164  SER A CA    1 
ATOM   1277 C C     . SER A 1 164 ? 53.314  2.250   16.648  1.00 76.60  ? 164  SER A C     1 
ATOM   1278 O O     . SER A 1 164 ? 52.104  2.029   16.789  1.00 75.91  ? 164  SER A O     1 
ATOM   1279 C CB    . SER A 1 164 ? 53.976  4.118   15.154  1.00 75.91  ? 164  SER A CB    1 
ATOM   1280 O OG    . SER A 1 164 ? 52.759  4.753   15.543  1.00 72.80  ? 164  SER A OG    1 
ATOM   1281 N N     . ARG A 1 165 ? 54.180  2.213   17.652  1.00 78.41  ? 165  ARG A N     1 
ATOM   1282 C CA    . ARG A 1 165 ? 53.758  2.006   19.031  1.00 78.67  ? 165  ARG A CA    1 
ATOM   1283 C C     . ARG A 1 165 ? 53.284  3.335   19.625  1.00 76.37  ? 165  ARG A C     1 
ATOM   1284 O O     . ARG A 1 165 ? 52.385  3.353   20.469  1.00 75.66  ? 165  ARG A O     1 
ATOM   1285 C CB    . ARG A 1 165 ? 54.912  1.465   19.882  1.00 81.06  ? 165  ARG A CB    1 
ATOM   1286 C CG    . ARG A 1 165 ? 55.483  0.096   19.444  1.00 87.39  ? 165  ARG A CG    1 
ATOM   1287 C CD    . ARG A 1 165 ? 54.515  -1.111  19.720  1.00 92.09  ? 165  ARG A CD    1 
ATOM   1288 N NE    . ARG A 1 165 ? 53.645  -1.416  18.569  1.00 93.09  ? 165  ARG A NE    1 
ATOM   1289 C CZ    . ARG A 1 165 ? 54.025  -2.089  17.473  1.00 95.99  ? 165  ARG A CZ    1 
ATOM   1290 N NH1   . ARG A 1 165 ? 55.271  -2.563  17.336  1.00 97.92  ? 165  ARG A NH1   1 
ATOM   1291 N NH2   . ARG A 1 165 ? 53.146  -2.293  16.495  1.00 95.92  ? 165  ARG A NH2   1 
ATOM   1292 N N     . GLU A 1 166 ? 53.883  4.437   19.173  1.00 75.25  ? 166  GLU A N     1 
ATOM   1293 C CA    . GLU A 1 166 ? 53.702  5.737   19.820  1.00 73.31  ? 166  GLU A CA    1 
ATOM   1294 C C     . GLU A 1 166 ? 52.501  6.542   19.296  1.00 70.68  ? 166  GLU A C     1 
ATOM   1295 O O     . GLU A 1 166 ? 52.055  7.481   19.956  1.00 69.52  ? 166  GLU A O     1 
ATOM   1296 C CB    . GLU A 1 166 ? 54.982  6.582   19.709  1.00 75.21  ? 166  GLU A CB    1 
ATOM   1297 C CG    . GLU A 1 166 ? 56.267  5.885   20.199  1.00 78.47  ? 166  GLU A CG    1 
ATOM   1298 C CD    . GLU A 1 166 ? 57.038  5.133   19.095  1.00 81.33  ? 166  GLU A CD    1 
ATOM   1299 O OE1   . GLU A 1 166 ? 56.571  5.077   17.932  1.00 80.21  ? 166  GLU A OE1   1 
ATOM   1300 O OE2   . GLU A 1 166 ? 58.132  4.603   19.405  1.00 84.98  ? 166  GLU A OE2   1 
ATOM   1301 N N     . ALA A 1 167 ? 51.998  6.189   18.116  1.00 69.15  ? 167  ALA A N     1 
ATOM   1302 C CA    . ALA A 1 167 ? 50.812  6.842   17.537  1.00 66.88  ? 167  ALA A CA    1 
ATOM   1303 C C     . ALA A 1 167 ? 50.004  5.846   16.695  1.00 65.55  ? 167  ALA A C     1 
ATOM   1304 O O     . ALA A 1 167 ? 49.925  5.977   15.473  1.00 64.42  ? 167  ALA A O     1 
ATOM   1305 C CB    . ALA A 1 167 ? 51.218  8.042   16.706  1.00 66.27  ? 167  ALA A CB    1 
ATOM   1306 N N     . PRO A 1 168 ? 49.409  4.836   17.357  1.00 65.21  ? 168  PRO A N     1 
ATOM   1307 C CA    . PRO A 1 168 ? 48.726  3.734   16.660  1.00 65.52  ? 168  PRO A CA    1 
ATOM   1308 C C     . PRO A 1 168 ? 47.405  4.126   15.985  1.00 64.34  ? 168  PRO A C     1 
ATOM   1309 O O     . PRO A 1 168 ? 46.924  3.386   15.120  1.00 65.57  ? 168  PRO A O     1 
ATOM   1310 C CB    . PRO A 1 168 ? 48.466  2.717   17.781  1.00 65.62  ? 168  PRO A CB    1 
ATOM   1311 C CG    . PRO A 1 168 ? 48.365  3.561   19.046  1.00 64.84  ? 168  PRO A CG    1 
ATOM   1312 C CD    . PRO A 1 168 ? 49.353  4.684   18.829  1.00 65.12  ? 168  PRO A CD    1 
ATOM   1313 N N     . GLY A 1 169 ? 46.827  5.265   16.366  1.00 62.75  ? 169  GLY A N     1 
ATOM   1314 C CA    . GLY A 1 169 ? 45.569  5.754   15.762  1.00 61.19  ? 169  GLY A CA    1 
ATOM   1315 C C     . GLY A 1 169 ? 44.348  5.243   16.509  1.00 59.29  ? 169  GLY A C     1 
ATOM   1316 O O     . GLY A 1 169 ? 44.459  4.366   17.340  1.00 59.65  ? 169  GLY A O     1 
ATOM   1317 N N     . ASN A 1 170 ? 43.188  5.819   16.234  1.00 57.81  ? 170  ASN A N     1 
ATOM   1318 C CA    . ASN A 1 170 ? 41.924  5.394   16.864  1.00 56.68  ? 170  ASN A CA    1 
ATOM   1319 C C     . ASN A 1 170 ? 41.825  5.533   18.407  1.00 56.04  ? 170  ASN A C     1 
ATOM   1320 O O     . ASN A 1 170 ? 40.938  4.949   19.018  1.00 55.86  ? 170  ASN A O     1 
ATOM   1321 C CB    . ASN A 1 170 ? 41.604  3.932   16.458  1.00 57.11  ? 170  ASN A CB    1 
ATOM   1322 C CG    . ASN A 1 170 ? 41.315  3.785   14.972  1.00 56.96  ? 170  ASN A CG    1 
ATOM   1323 O OD1   . ASN A 1 170 ? 40.863  4.733   14.309  1.00 53.42  ? 170  ASN A OD1   1 
ATOM   1324 N ND2   . ASN A 1 170 ? 41.585  2.598   14.437  1.00 56.66  ? 170  ASN A ND2   1 
ATOM   1325 N N     . VAL A 1 171 ? 42.713  6.309   19.025  1.00 55.98  ? 171  VAL A N     1 
ATOM   1326 C CA    . VAL A 1 171 ? 42.789  6.397   20.483  1.00 55.38  ? 171  VAL A CA    1 
ATOM   1327 C C     . VAL A 1 171 ? 41.589  7.152   21.045  1.00 54.33  ? 171  VAL A C     1 
ATOM   1328 O O     . VAL A 1 171 ? 41.183  6.896   22.180  1.00 54.69  ? 171  VAL A O     1 
ATOM   1329 C CB    . VAL A 1 171 ? 44.142  7.005   20.990  1.00 56.07  ? 171  VAL A CB    1 
ATOM   1330 C CG1   . VAL A 1 171 ? 45.342  6.248   20.366  1.00 56.90  ? 171  VAL A CG1   1 
ATOM   1331 C CG2   . VAL A 1 171 ? 44.239  8.509   20.725  1.00 54.43  ? 171  VAL A CG2   1 
ATOM   1332 N N     . GLY A 1 172 ? 41.017  8.065   20.254  1.00 53.42  ? 172  GLY A N     1 
ATOM   1333 C CA    . GLY A 1 172 ? 39.749  8.711   20.605  1.00 52.26  ? 172  GLY A CA    1 
ATOM   1334 C C     . GLY A 1 172 ? 38.615  7.713   20.751  1.00 51.80  ? 172  GLY A C     1 
ATOM   1335 O O     . GLY A 1 172 ? 37.725  7.877   21.578  1.00 51.39  ? 172  GLY A O     1 
ATOM   1336 N N     . LEU A 1 173 ? 38.648  6.662   19.944  1.00 52.38  ? 173  LEU A N     1 
ATOM   1337 C CA    . LEU A 1 173 ? 37.670  5.585   20.052  1.00 52.04  ? 173  LEU A CA    1 
ATOM   1338 C C     . LEU A 1 173 ? 37.964  4.731   21.276  1.00 52.44  ? 173  LEU A C     1 
ATOM   1339 O O     . LEU A 1 173 ? 37.052  4.170   21.908  1.00 52.16  ? 173  LEU A O     1 
ATOM   1340 C CB    . LEU A 1 173 ? 37.689  4.719   18.791  1.00 52.60  ? 173  LEU A CB    1 
ATOM   1341 C CG    . LEU A 1 173 ? 37.059  5.330   17.538  1.00 52.00  ? 173  LEU A CG    1 
ATOM   1342 C CD1   . LEU A 1 173 ? 37.321  4.415   16.357  1.00 52.20  ? 173  LEU A CD1   1 
ATOM   1343 C CD2   . LEU A 1 173 ? 35.549  5.613   17.717  1.00 48.67  ? 173  LEU A CD2   1 
ATOM   1344 N N     . LEU A 1 174 ? 39.247  4.629   21.604  1.00 52.98  ? 174  LEU A N     1 
ATOM   1345 C CA    . LEU A 1 174 ? 39.673  3.882   22.778  1.00 53.29  ? 174  LEU A CA    1 
ATOM   1346 C C     . LEU A 1 174 ? 39.257  4.640   24.043  1.00 52.54  ? 174  LEU A C     1 
ATOM   1347 O O     . LEU A 1 174 ? 38.880  4.027   25.046  1.00 52.59  ? 174  LEU A O     1 
ATOM   1348 C CB    . LEU A 1 174 ? 41.178  3.606   22.729  1.00 54.13  ? 174  LEU A CB    1 
ATOM   1349 C CG    . LEU A 1 174 ? 41.630  2.487   21.755  1.00 55.25  ? 174  LEU A CG    1 
ATOM   1350 C CD1   . LEU A 1 174 ? 43.150  2.350   21.729  1.00 53.01  ? 174  LEU A CD1   1 
ATOM   1351 C CD2   . LEU A 1 174 ? 40.992  1.128   22.078  1.00 52.64  ? 174  LEU A CD2   1 
ATOM   1352 N N     . ASP A 1 175 ? 39.286  5.973   23.989  1.00 51.60  ? 175  ASP A N     1 
ATOM   1353 C CA    . ASP A 1 175 ? 38.756  6.769   25.102  1.00 50.52  ? 175  ASP A CA    1 
ATOM   1354 C C     . ASP A 1 175 ? 37.289  6.395   25.331  1.00 50.20  ? 175  ASP A C     1 
ATOM   1355 O O     . ASP A 1 175 ? 36.879  6.128   26.459  1.00 49.95  ? 175  ASP A O     1 
ATOM   1356 C CB    . ASP A 1 175 ? 38.866  8.266   24.837  1.00 49.51  ? 175  ASP A CB    1 
ATOM   1357 C CG    . ASP A 1 175 ? 40.283  8.733   24.588  1.00 49.82  ? 175  ASP A CG    1 
ATOM   1358 O OD1   . ASP A 1 175 ? 41.277  8.067   25.008  1.00 50.79  ? 175  ASP A OD1   1 
ATOM   1359 O OD2   . ASP A 1 175 ? 40.404  9.797   23.953  1.00 46.32  ? 175  ASP A OD2   1 
ATOM   1360 N N     . GLN A 1 176 ? 36.506  6.371   24.249  1.00 50.45  ? 176  GLN A N     1 
ATOM   1361 C CA    . GLN A 1 176 ? 35.086  5.989   24.318  1.00 50.29  ? 176  GLN A CA    1 
ATOM   1362 C C     . GLN A 1 176 ? 34.944  4.595   24.874  1.00 51.31  ? 176  GLN A C     1 
ATOM   1363 O O     . GLN A 1 176 ? 34.116  4.361   25.748  1.00 52.00  ? 176  GLN A O     1 
ATOM   1364 C CB    . GLN A 1 176 ? 34.426  6.025   22.954  1.00 49.65  ? 176  GLN A CB    1 
ATOM   1365 C CG    . GLN A 1 176 ? 34.305  7.411   22.331  1.00 48.35  ? 176  GLN A CG    1 
ATOM   1366 C CD    . GLN A 1 176 ? 33.875  7.322   20.881  1.00 48.73  ? 176  GLN A CD    1 
ATOM   1367 O OE1   . GLN A 1 176 ? 33.447  6.240   20.426  1.00 48.59  ? 176  GLN A OE1   1 
ATOM   1368 N NE2   . GLN A 1 176 ? 34.027  8.434   20.122  1.00 46.14  ? 176  GLN A NE2   1 
ATOM   1369 N N     . ARG A 1 177 ? 35.751  3.662   24.376  1.00 52.57  ? 177  ARG A N     1 
ATOM   1370 C CA    . ARG A 1 177 ? 35.708  2.295   24.904  1.00 53.54  ? 177  ARG A CA    1 
ATOM   1371 C C     . ARG A 1 177 ? 35.991  2.267   26.406  1.00 53.72  ? 177  ARG A C     1 
ATOM   1372 O O     . ARG A 1 177 ? 35.309  1.555   27.131  1.00 54.13  ? 177  ARG A O     1 
ATOM   1373 C CB    . ARG A 1 177 ? 36.690  1.366   24.184  1.00 54.48  ? 177  ARG A CB    1 
ATOM   1374 C CG    . ARG A 1 177 ? 36.591  -0.102  24.654  1.00 56.03  ? 177  ARG A CG    1 
ATOM   1375 C CD    . ARG A 1 177 ? 37.503  -1.002  23.838  1.00 57.23  ? 177  ARG A CD    1 
ATOM   1376 N NE    . ARG A 1 177 ? 36.904  -1.297  22.538  1.00 58.43  ? 177  ARG A NE    1 
ATOM   1377 C CZ    . ARG A 1 177 ? 37.563  -1.799  21.493  1.00 58.82  ? 177  ARG A CZ    1 
ATOM   1378 N NH1   . ARG A 1 177 ? 38.862  -2.090  21.574  1.00 60.12  ? 177  ARG A NH1   1 
ATOM   1379 N NH2   . ARG A 1 177 ? 36.914  -2.030  20.362  1.00 57.22  ? 177  ARG A NH2   1 
ATOM   1380 N N     . LEU A 1 178 ? 36.991  3.023   26.869  1.00 53.60  ? 178  LEU A N     1 
ATOM   1381 C CA    . LEU A 1 178 ? 37.319  3.062   28.305  1.00 54.18  ? 178  LEU A CA    1 
ATOM   1382 C C     . LEU A 1 178 ? 36.158  3.604   29.137  1.00 53.86  ? 178  LEU A C     1 
ATOM   1383 O O     . LEU A 1 178 ? 35.865  3.083   30.209  1.00 54.36  ? 178  LEU A O     1 
ATOM   1384 C CB    . LEU A 1 178 ? 38.585  3.885   28.553  1.00 54.68  ? 178  LEU A CB    1 
ATOM   1385 C CG    . LEU A 1 178 ? 39.169  3.974   29.968  1.00 55.15  ? 178  LEU A CG    1 
ATOM   1386 C CD1   . LEU A 1 178 ? 39.499  2.590   30.578  1.00 55.47  ? 178  LEU A CD1   1 
ATOM   1387 C CD2   . LEU A 1 178 ? 40.411  4.881   29.927  1.00 54.28  ? 178  LEU A CD2   1 
ATOM   1388 N N     . ALA A 1 179 ? 35.478  4.628   28.619  1.00 53.25  ? 179  ALA A N     1 
ATOM   1389 C CA    . ALA A 1 179 ? 34.257  5.141   29.247  1.00 52.60  ? 179  ALA A CA    1 
ATOM   1390 C C     . ALA A 1 179 ? 33.169  4.062   29.297  1.00 53.21  ? 179  ALA A C     1 
ATOM   1391 O O     . ALA A 1 179 ? 32.450  3.974   30.291  1.00 54.19  ? 179  ALA A O     1 
ATOM   1392 C CB    . ALA A 1 179 ? 33.766  6.384   28.544  1.00 50.87  ? 179  ALA A CB    1 
ATOM   1393 N N     . LEU A 1 180 ? 33.053  3.228   28.262  1.00 53.53  ? 180  LEU A N     1 
ATOM   1394 C CA    . LEU A 1 180 ? 32.092  2.096   28.309  1.00 54.20  ? 180  LEU A CA    1 
ATOM   1395 C C     . LEU A 1 180 ? 32.436  1.048   29.373  1.00 55.02  ? 180  LEU A C     1 
ATOM   1396 O O     . LEU A 1 180 ? 31.531  0.499   30.032  1.00 54.74  ? 180  LEU A O     1 
ATOM   1397 C CB    . LEU A 1 180 ? 31.904  1.409   26.943  1.00 54.33  ? 180  LEU A CB    1 
ATOM   1398 C CG    . LEU A 1 180 ? 31.516  2.271   25.720  1.00 55.30  ? 180  LEU A CG    1 
ATOM   1399 C CD1   . LEU A 1 180 ? 30.826  1.420   24.647  1.00 55.50  ? 180  LEU A CD1   1 
ATOM   1400 C CD2   . LEU A 1 180 ? 30.647  3.485   26.075  1.00 54.49  ? 180  LEU A CD2   1 
ATOM   1401 N N     . GLN A 1 181 ? 33.729  0.767   29.531  1.00 55.78  ? 181  GLN A N     1 
ATOM   1402 C CA    . GLN A 1 181 ? 34.211  -0.141  30.589  1.00 57.23  ? 181  GLN A CA    1 
ATOM   1403 C C     . GLN A 1 181 ? 33.957  0.445   31.989  1.00 56.56  ? 181  GLN A C     1 
ATOM   1404 O O     . GLN A 1 181 ? 33.566  -0.273  32.917  1.00 56.68  ? 181  GLN A O     1 
ATOM   1405 C CB    . GLN A 1 181 ? 35.700  -0.443  30.398  1.00 58.04  ? 181  GLN A CB    1 
ATOM   1406 C CG    . GLN A 1 181 ? 35.995  -1.178  29.075  1.00 60.58  ? 181  GLN A CG    1 
ATOM   1407 C CD    . GLN A 1 181 ? 37.479  -1.304  28.733  1.00 61.07  ? 181  GLN A CD    1 
ATOM   1408 O OE1   . GLN A 1 181 ? 38.283  -0.444  29.084  1.00 64.69  ? 181  GLN A OE1   1 
ATOM   1409 N NE2   . GLN A 1 181 ? 37.834  -2.370  28.012  1.00 62.88  ? 181  GLN A NE2   1 
ATOM   1410 N N     . TRP A 1 182 ? 34.159  1.759   32.131  1.00 55.47  ? 182  TRP A N     1 
ATOM   1411 C CA    . TRP A 1 182 ? 33.830  2.446   33.378  1.00 54.91  ? 182  TRP A CA    1 
ATOM   1412 C C     . TRP A 1 182 ? 32.363  2.262   33.757  1.00 54.73  ? 182  TRP A C     1 
ATOM   1413 O O     . TRP A 1 182 ? 32.052  2.097   34.933  1.00 55.29  ? 182  TRP A O     1 
ATOM   1414 C CB    . TRP A 1 182 ? 34.171  3.935   33.298  1.00 54.12  ? 182  TRP A CB    1 
ATOM   1415 C CG    . TRP A 1 182 ? 33.965  4.684   34.588  1.00 54.09  ? 182  TRP A CG    1 
ATOM   1416 C CD1   . TRP A 1 182 ? 34.920  5.029   35.487  1.00 54.86  ? 182  TRP A CD1   1 
ATOM   1417 C CD2   . TRP A 1 182 ? 32.725  5.189   35.108  1.00 53.07  ? 182  TRP A CD2   1 
ATOM   1418 N NE1   . TRP A 1 182 ? 34.358  5.724   36.539  1.00 55.06  ? 182  TRP A NE1   1 
ATOM   1419 C CE2   . TRP A 1 182 ? 33.012  5.827   36.332  1.00 54.35  ? 182  TRP A CE2   1 
ATOM   1420 C CE3   . TRP A 1 182 ? 31.406  5.168   34.656  1.00 52.24  ? 182  TRP A CE3   1 
ATOM   1421 C CZ2   . TRP A 1 182 ? 32.025  6.446   37.109  1.00 55.53  ? 182  TRP A CZ2   1 
ATOM   1422 C CZ3   . TRP A 1 182 ? 30.427  5.793   35.418  1.00 53.53  ? 182  TRP A CZ3   1 
ATOM   1423 C CH2   . TRP A 1 182 ? 30.739  6.412   36.636  1.00 54.39  ? 182  TRP A CH2   1 
ATOM   1424 N N     . VAL A 1 183 ? 31.469  2.294   32.776  1.00 53.81  ? 183  VAL A N     1 
ATOM   1425 C CA    . VAL A 1 183 ? 30.046  2.151   33.055  1.00 53.82  ? 183  VAL A CA    1 
ATOM   1426 C C     . VAL A 1 183 ? 29.790  0.715   33.533  1.00 55.09  ? 183  VAL A C     1 
ATOM   1427 O O     . VAL A 1 183 ? 29.143  0.491   34.548  1.00 55.70  ? 183  VAL A O     1 
ATOM   1428 C CB    . VAL A 1 183 ? 29.172  2.547   31.816  1.00 53.07  ? 183  VAL A CB    1 
ATOM   1429 C CG1   . VAL A 1 183 ? 27.753  2.037   31.934  1.00 51.87  ? 183  VAL A CG1   1 
ATOM   1430 C CG2   . VAL A 1 183 ? 29.177  4.082   31.611  1.00 52.24  ? 183  VAL A CG2   1 
ATOM   1431 N N     . GLN A 1 184 ? 30.325  -0.258  32.821  1.00 55.85  ? 184  GLN A N     1 
ATOM   1432 C CA    . GLN A 1 184 ? 30.193  -1.650  33.242  1.00 57.34  ? 184  GLN A CA    1 
ATOM   1433 C C     . GLN A 1 184 ? 30.586  -1.841  34.701  1.00 58.64  ? 184  GLN A C     1 
ATOM   1434 O O     . GLN A 1 184 ? 29.849  -2.466  35.472  1.00 59.14  ? 184  GLN A O     1 
ATOM   1435 C CB    . GLN A 1 184 ? 31.024  -2.566  32.357  1.00 57.13  ? 184  GLN A CB    1 
ATOM   1436 C CG    . GLN A 1 184 ? 30.419  -2.739  30.989  1.00 57.03  ? 184  GLN A CG    1 
ATOM   1437 C CD    . GLN A 1 184 ? 29.005  -3.314  31.016  1.00 57.30  ? 184  GLN A CD    1 
ATOM   1438 O OE1   . GLN A 1 184 ? 28.784  -4.415  31.519  1.00 59.65  ? 184  GLN A OE1   1 
ATOM   1439 N NE2   . GLN A 1 184 ? 28.053  -2.583  30.455  1.00 55.24  ? 184  GLN A NE2   1 
ATOM   1440 N N     . GLU A 1 185 ? 31.728  -1.284  35.096  1.00 58.89  ? 185  GLU A N     1 
ATOM   1441 C CA    . GLU A 1 185 ? 32.165  -1.487  36.464  1.00 60.07  ? 185  GLU A CA    1 
ATOM   1442 C C     . GLU A 1 185 ? 31.385  -0.663  37.477  1.00 59.25  ? 185  GLU A C     1 
ATOM   1443 O O     . GLU A 1 185 ? 31.137  -1.140  38.570  1.00 59.70  ? 185  GLU A O     1 
ATOM   1444 C CB    . GLU A 1 185 ? 33.657  -1.221  36.650  1.00 60.59  ? 185  GLU A CB    1 
ATOM   1445 C CG    . GLU A 1 185 ? 34.039  -1.415  38.116  1.00 64.09  ? 185  GLU A CG    1 
ATOM   1446 C CD    . GLU A 1 185 ? 35.474  -1.768  38.367  1.00 66.90  ? 185  GLU A CD    1 
ATOM   1447 O OE1   . GLU A 1 185 ? 35.716  -2.397  39.422  1.00 67.94  ? 185  GLU A OE1   1 
ATOM   1448 O OE2   . GLU A 1 185 ? 36.343  -1.391  37.550  1.00 69.67  ? 185  GLU A OE2   1 
ATOM   1449 N N     . ASN A 1 186 ? 31.018  0.566   37.116  1.00 57.62  ? 186  ASN A N     1 
ATOM   1450 C CA    . ASN A 1 186 ? 30.612  1.563   38.107  1.00 57.13  ? 186  ASN A CA    1 
ATOM   1451 C C     . ASN A 1 186 ? 29.170  2.043   38.087  1.00 56.50  ? 186  ASN A C     1 
ATOM   1452 O O     . ASN A 1 186 ? 28.729  2.642   39.060  1.00 57.03  ? 186  ASN A O     1 
ATOM   1453 C CB    . ASN A 1 186 ? 31.507  2.794   37.982  1.00 56.31  ? 186  ASN A CB    1 
ATOM   1454 C CG    . ASN A 1 186 ? 32.953  2.474   38.212  1.00 56.20  ? 186  ASN A CG    1 
ATOM   1455 O OD1   . ASN A 1 186 ? 33.339  2.132   39.323  1.00 57.39  ? 186  ASN A OD1   1 
ATOM   1456 N ND2   . ASN A 1 186 ? 33.767  2.583   37.167  1.00 53.79  ? 186  ASN A ND2   1 
ATOM   1457 N N     . ILE A 1 187 ? 28.433  1.800   37.009  1.00 55.76  ? 187  ILE A N     1 
ATOM   1458 C CA    . ILE A 1 187 ? 27.114  2.421   36.858  1.00 55.31  ? 187  ILE A CA    1 
ATOM   1459 C C     . ILE A 1 187 ? 26.044  1.931   37.872  1.00 56.64  ? 187  ILE A C     1 
ATOM   1460 O O     . ILE A 1 187 ? 25.099  2.665   38.212  1.00 56.67  ? 187  ILE A O     1 
ATOM   1461 C CB    . ILE A 1 187 ? 26.611  2.349   35.390  1.00 54.39  ? 187  ILE A CB    1 
ATOM   1462 C CG1   . ILE A 1 187 ? 25.695  3.552   35.107  1.00 53.96  ? 187  ILE A CG1   1 
ATOM   1463 C CG2   . ILE A 1 187 ? 25.945  1.021   35.072  1.00 54.10  ? 187  ILE A CG2   1 
ATOM   1464 C CD1   . ILE A 1 187 ? 26.406  4.930   35.213  1.00 51.87  ? 187  ILE A CD1   1 
ATOM   1465 N N     . ALA A 1 188 ? 26.222  0.723   38.383  1.00 57.42  ? 188  ALA A N     1 
ATOM   1466 C CA    . ALA A 1 188 ? 25.353  0.210   39.424  1.00 59.13  ? 188  ALA A CA    1 
ATOM   1467 C C     . ALA A 1 188 ? 25.365  1.062   40.714  1.00 59.59  ? 188  ALA A C     1 
ATOM   1468 O O     . ALA A 1 188 ? 24.391  1.059   41.454  1.00 60.28  ? 188  ALA A O     1 
ATOM   1469 C CB    . ALA A 1 188 ? 25.706  -1.254  39.732  1.00 59.68  ? 188  ALA A CB    1 
ATOM   1470 N N     . ALA A 1 189 ? 26.455  1.788   40.972  1.00 59.41  ? 189  ALA A N     1 
ATOM   1471 C CA    . ALA A 1 189 ? 26.539  2.683   42.132  1.00 59.62  ? 189  ALA A CA    1 
ATOM   1472 C C     . ALA A 1 189 ? 25.536  3.839   42.044  1.00 59.73  ? 189  ALA A C     1 
ATOM   1473 O O     . ALA A 1 189 ? 25.182  4.446   43.053  1.00 60.72  ? 189  ALA A O     1 
ATOM   1474 C CB    . ALA A 1 189 ? 27.960  3.224   42.276  1.00 59.31  ? 189  ALA A CB    1 
ATOM   1475 N N     . PHE A 1 190 ? 25.093  4.139   40.825  1.00 59.26  ? 190  PHE A N     1 
ATOM   1476 C CA    . PHE A 1 190 ? 24.147  5.204   40.540  1.00 58.53  ? 190  PHE A CA    1 
ATOM   1477 C C     . PHE A 1 190 ? 22.747  4.642   40.270  1.00 59.70  ? 190  PHE A C     1 
ATOM   1478 O O     . PHE A 1 190 ? 21.823  5.399   39.936  1.00 59.98  ? 190  PHE A O     1 
ATOM   1479 C CB    . PHE A 1 190 ? 24.617  5.981   39.299  1.00 57.11  ? 190  PHE A CB    1 
ATOM   1480 C CG    . PHE A 1 190 ? 26.011  6.520   39.413  1.00 55.19  ? 190  PHE A CG    1 
ATOM   1481 C CD1   . PHE A 1 190 ? 27.096  5.755   39.028  1.00 56.43  ? 190  PHE A CD1   1 
ATOM   1482 C CD2   . PHE A 1 190 ? 26.238  7.780   39.914  1.00 55.13  ? 190  PHE A CD2   1 
ATOM   1483 C CE1   . PHE A 1 190 ? 28.392  6.247   39.138  1.00 55.85  ? 190  PHE A CE1   1 
ATOM   1484 C CE2   . PHE A 1 190 ? 27.520  8.284   40.030  1.00 55.07  ? 190  PHE A CE2   1 
ATOM   1485 C CZ    . PHE A 1 190 ? 28.599  7.523   39.643  1.00 55.23  ? 190  PHE A CZ    1 
ATOM   1486 N N     . GLY A 1 191 ? 22.589  3.325   40.398  1.00 60.35  ? 191  GLY A N     1 
ATOM   1487 C CA    . GLY A 1 191 ? 21.323  2.674   40.110  1.00 61.09  ? 191  GLY A CA    1 
ATOM   1488 C C     . GLY A 1 191 ? 21.134  2.274   38.660  1.00 60.78  ? 191  GLY A C     1 
ATOM   1489 O O     . GLY A 1 191 ? 20.049  1.845   38.273  1.00 61.11  ? 191  GLY A O     1 
ATOM   1490 N N     . GLY A 1 192 ? 22.181  2.410   37.847  1.00 60.25  ? 192  GLY A N     1 
ATOM   1491 C CA    . GLY A 1 192 ? 22.134  1.957   36.455  1.00 59.79  ? 192  GLY A CA    1 
ATOM   1492 C C     . GLY A 1 192 ? 22.302  0.453   36.327  1.00 60.58  ? 192  GLY A C     1 
ATOM   1493 O O     . GLY A 1 192 ? 22.951  -0.175  37.156  1.00 61.35  ? 192  GLY A O     1 
ATOM   1494 N N     . ASP A 1 193 ? 21.712  -0.118  35.280  1.00 61.01  ? 193  ASP A N     1 
ATOM   1495 C CA    . ASP A 1 193 ? 21.788  -1.554  34.998  1.00 61.86  ? 193  ASP A CA    1 
ATOM   1496 C C     . ASP A 1 193 ? 22.853  -1.776  33.940  1.00 61.25  ? 193  ASP A C     1 
ATOM   1497 O O     . ASP A 1 193 ? 22.645  -1.435  32.784  1.00 60.58  ? 193  ASP A O     1 
ATOM   1498 C CB    . ASP A 1 193 ? 20.430  -2.061  34.487  1.00 62.70  ? 193  ASP A CB    1 
ATOM   1499 C CG    . ASP A 1 193 ? 20.394  -3.583  34.251  1.00 64.41  ? 193  ASP A CG    1 
ATOM   1500 O OD1   . ASP A 1 193 ? 21.426  -4.271  34.434  1.00 63.20  ? 193  ASP A OD1   1 
ATOM   1501 O OD2   . ASP A 1 193 ? 19.300  -4.087  33.880  1.00 66.40  ? 193  ASP A OD2   1 
ATOM   1502 N N     . PRO A 1 194 ? 23.997  -2.375  34.318  1.00 61.85  ? 194  PRO A N     1 
ATOM   1503 C CA    . PRO A 1 194 ? 25.045  -2.582  33.322  1.00 61.23  ? 194  PRO A CA    1 
ATOM   1504 C C     . PRO A 1 194 ? 24.692  -3.642  32.270  1.00 62.06  ? 194  PRO A C     1 
ATOM   1505 O O     . PRO A 1 194 ? 25.395  -3.748  31.267  1.00 62.37  ? 194  PRO A O     1 
ATOM   1506 C CB    . PRO A 1 194 ? 26.245  -3.034  34.164  1.00 61.70  ? 194  PRO A CB    1 
ATOM   1507 C CG    . PRO A 1 194 ? 25.654  -3.653  35.369  1.00 62.36  ? 194  PRO A CG    1 
ATOM   1508 C CD    . PRO A 1 194 ? 24.374  -2.921  35.638  1.00 62.78  ? 194  PRO A CD    1 
ATOM   1509 N N     . MET A 1 195 ? 23.627  -4.411  32.491  1.00 62.75  ? 195  MET A N     1 
ATOM   1510 C CA    . MET A 1 195 ? 23.188  -5.429  31.538  1.00 63.72  ? 195  MET A CA    1 
ATOM   1511 C C     . MET A 1 195 ? 22.137  -4.881  30.577  1.00 62.33  ? 195  MET A C     1 
ATOM   1512 O O     . MET A 1 195 ? 21.548  -5.641  29.800  1.00 62.91  ? 195  MET A O     1 
ATOM   1513 C CB    . MET A 1 195 ? 22.616  -6.654  32.279  1.00 65.39  ? 195  MET A CB    1 
ATOM   1514 C CG    . MET A 1 195 ? 23.589  -7.312  33.245  1.00 66.55  ? 195  MET A CG    1 
ATOM   1515 S SD    . MET A 1 195 ? 23.035  -8.929  33.834  1.00 71.13  ? 195  MET A SD    1 
ATOM   1516 C CE    . MET A 1 195 ? 23.895  -9.983  32.658  1.00 73.28  ? 195  MET A CE    1 
ATOM   1517 N N     . SER A 1 196 ? 21.886  -3.573  30.651  1.00 60.19  ? 196  SER A N     1 
ATOM   1518 C CA    . SER A 1 196 ? 21.049  -2.879  29.680  1.00 58.94  ? 196  SER A CA    1 
ATOM   1519 C C     . SER A 1 196 ? 21.608  -1.477  29.418  1.00 57.09  ? 196  SER A C     1 
ATOM   1520 O O     . SER A 1 196 ? 21.216  -0.495  30.064  1.00 56.42  ? 196  SER A O     1 
ATOM   1521 C CB    . SER A 1 196 ? 19.603  -2.801  30.163  1.00 59.80  ? 196  SER A CB    1 
ATOM   1522 O OG    . SER A 1 196 ? 18.803  -2.079  29.234  1.00 58.92  ? 196  SER A OG    1 
ATOM   1523 N N     . VAL A 1 197 ? 22.514  -1.417  28.448  1.00 55.72  ? 197  VAL A N     1 
ATOM   1524 C CA    . VAL A 1 197 ? 23.228  -0.221  28.036  1.00 54.00  ? 197  VAL A CA    1 
ATOM   1525 C C     . VAL A 1 197 ? 22.999  -0.028  26.544  1.00 53.37  ? 197  VAL A C     1 
ATOM   1526 O O     . VAL A 1 197 ? 23.233  -0.940  25.736  1.00 54.60  ? 197  VAL A O     1 
ATOM   1527 C CB    . VAL A 1 197 ? 24.767  -0.337  28.251  1.00 53.84  ? 197  VAL A CB    1 
ATOM   1528 C CG1   . VAL A 1 197 ? 25.502  0.860   27.580  1.00 50.86  ? 197  VAL A CG1   1 
ATOM   1529 C CG2   . VAL A 1 197 ? 25.105  -0.448  29.724  1.00 53.24  ? 197  VAL A CG2   1 
ATOM   1530 N N     . THR A 1 198 ? 22.541  1.158   26.189  1.00 52.03  ? 198  THR A N     1 
ATOM   1531 C CA    . THR A 1 198 ? 22.253  1.511   24.819  1.00 51.60  ? 198  THR A CA    1 
ATOM   1532 C C     . THR A 1 198 ? 23.165  2.695   24.483  1.00 50.80  ? 198  THR A C     1 
ATOM   1533 O O     . THR A 1 198 ? 23.144  3.709   25.173  1.00 49.64  ? 198  THR A O     1 
ATOM   1534 C CB    . THR A 1 198 ? 20.762  1.897   24.659  1.00 51.64  ? 198  THR A CB    1 
ATOM   1535 O OG1   . THR A 1 198 ? 19.946  0.772   24.960  1.00 52.89  ? 198  THR A OG1   1 
ATOM   1536 C CG2   . THR A 1 198 ? 20.425  2.364   23.245  1.00 51.19  ? 198  THR A CG2   1 
ATOM   1537 N N     . LEU A 1 199 ? 23.995  2.535   23.460  1.00 50.88  ? 199  LEU A N     1 
ATOM   1538 C CA    . LEU A 1 199 ? 24.771  3.655   22.942  1.00 50.63  ? 199  LEU A CA    1 
ATOM   1539 C C     . LEU A 1 199 ? 23.895  4.473   22.003  1.00 50.49  ? 199  LEU A C     1 
ATOM   1540 O O     . LEU A 1 199 ? 23.101  3.920   21.248  1.00 52.30  ? 199  LEU A O     1 
ATOM   1541 C CB    . LEU A 1 199 ? 25.992  3.169   22.172  1.00 50.44  ? 199  LEU A CB    1 
ATOM   1542 C CG    . LEU A 1 199 ? 26.874  2.101   22.806  1.00 50.86  ? 199  LEU A CG    1 
ATOM   1543 C CD1   . LEU A 1 199 ? 28.102  1.900   21.917  1.00 50.63  ? 199  LEU A CD1   1 
ATOM   1544 C CD2   . LEU A 1 199 ? 27.268  2.489   24.236  1.00 50.69  ? 199  LEU A CD2   1 
ATOM   1545 N N     . PHE A 1 200 ? 24.019  5.785   22.061  1.00 49.68  ? 200  PHE A N     1 
ATOM   1546 C CA    . PHE A 1 200 ? 23.437  6.625   21.040  1.00 49.38  ? 200  PHE A CA    1 
ATOM   1547 C C     . PHE A 1 200 ? 24.347  7.812   20.771  1.00 48.85  ? 200  PHE A C     1 
ATOM   1548 O O     . PHE A 1 200 ? 25.084  8.242   21.637  1.00 48.56  ? 200  PHE A O     1 
ATOM   1549 C CB    . PHE A 1 200 ? 21.971  7.000   21.325  1.00 49.63  ? 200  PHE A CB    1 
ATOM   1550 C CG    . PHE A 1 200 ? 21.738  8.026   22.432  1.00 49.88  ? 200  PHE A CG    1 
ATOM   1551 C CD1   . PHE A 1 200 ? 22.308  7.897   23.687  1.00 50.77  ? 200  PHE A CD1   1 
ATOM   1552 C CD2   . PHE A 1 200 ? 20.847  9.077   22.223  1.00 49.41  ? 200  PHE A CD2   1 
ATOM   1553 C CE1   . PHE A 1 200 ? 22.038  8.831   24.698  1.00 50.88  ? 200  PHE A CE1   1 
ATOM   1554 C CE2   . PHE A 1 200 ? 20.573  10.003  23.223  1.00 50.12  ? 200  PHE A CE2   1 
ATOM   1555 C CZ    . PHE A 1 200 ? 21.169  9.882   24.463  1.00 50.15  ? 200  PHE A CZ    1 
ATOM   1556 N N     . GLY A 1 201 ? 24.323  8.284   19.534  1.00 48.32  ? 201  GLY A N     1 
ATOM   1557 C CA    . GLY A 1 201 ? 25.148  9.385   19.135  1.00 48.51  ? 201  GLY A CA    1 
ATOM   1558 C C     . GLY A 1 201 ? 24.692  9.961   17.819  1.00 48.14  ? 201  GLY A C     1 
ATOM   1559 O O     . GLY A 1 201 ? 23.869  9.359   17.115  1.00 48.23  ? 201  GLY A O     1 
ATOM   1560 N N     . GLU A 1 202 ? 25.233  11.127  17.500  1.00 47.34  ? 202  GLU A N     1 
ATOM   1561 C CA    . GLU A 1 202 ? 24.866  11.804  16.293  1.00 47.49  ? 202  GLU A CA    1 
ATOM   1562 C C     . GLU A 1 202 ? 26.085  12.185  15.487  1.00 47.46  ? 202  GLU A C     1 
ATOM   1563 O O     . GLU A 1 202 ? 27.127  12.563  16.023  1.00 46.95  ? 202  GLU A O     1 
ATOM   1564 C CB    . GLU A 1 202 ? 23.972  13.007  16.581  1.00 47.42  ? 202  GLU A CB    1 
ATOM   1565 C CG    . GLU A 1 202 ? 23.423  13.722  15.322  1.00 48.10  ? 202  GLU A CG    1 
ATOM   1566 C CD    . GLU A 1 202 ? 24.227  14.959  14.932  1.00 50.79  ? 202  GLU A CD    1 
ATOM   1567 O OE1   . GLU A 1 202 ? 25.199  15.300  15.659  1.00 50.52  ? 202  GLU A OE1   1 
ATOM   1568 O OE2   . GLU A 1 202 ? 23.878  15.587  13.893  1.00 50.80  ? 202  GLU A OE2   1 
ATOM   1569 N N     . SER A 1 203 ? 25.944  12.043  14.177  1.00 48.05  ? 203  SER A N     1 
ATOM   1570 C CA    . SER A 1 203 ? 26.994  12.400  13.264  1.00 48.33  ? 203  SER A CA    1 
ATOM   1571 C C     . SER A 1 203 ? 28.246  11.529  13.476  1.00 48.20  ? 203  SER A C     1 
ATOM   1572 O O     . SER A 1 203 ? 28.143  10.308  13.394  1.00 49.40  ? 203  SER A O     1 
ATOM   1573 C CB    . SER A 1 203 ? 27.227  13.887  13.431  1.00 48.38  ? 203  SER A CB    1 
ATOM   1574 O OG    . SER A 1 203 ? 27.728  14.399  12.228  1.00 49.43  ? 203  SER A OG    1 
ATOM   1575 N N     . ALA A 1 204 ? 29.400  12.116  13.780  1.00 48.19  ? 204  ALA A N     1 
ATOM   1576 C CA    . ALA A 1 204 ? 30.617  11.339  14.140  1.00 48.64  ? 204  ALA A CA    1 
ATOM   1577 C C     . ALA A 1 204 ? 30.383  10.454  15.365  1.00 48.80  ? 204  ALA A C     1 
ATOM   1578 O O     . ALA A 1 204 ? 31.056  9.432   15.544  1.00 49.09  ? 204  ALA A O     1 
ATOM   1579 C CB    . ALA A 1 204 ? 31.803  12.273  14.396  1.00 48.12  ? 204  ALA A CB    1 
ATOM   1580 N N     . GLY A 1 205 ? 29.447  10.880  16.217  1.00 48.43  ? 205  GLY A N     1 
ATOM   1581 C CA    . GLY A 1 205 ? 29.005  10.099  17.354  1.00 48.31  ? 205  GLY A CA    1 
ATOM   1582 C C     . GLY A 1 205 ? 28.326  8.833   16.898  1.00 49.04  ? 205  GLY A C     1 
ATOM   1583 O O     . GLY A 1 205 ? 28.568  7.760   17.456  1.00 49.36  ? 205  GLY A O     1 
ATOM   1584 N N     . ALA A 1 206 ? 27.480  8.961   15.875  1.00 49.06  ? 206  ALA A N     1 
ATOM   1585 C CA    . ALA A 1 206 ? 26.796  7.813   15.278  1.00 49.70  ? 206  ALA A CA    1 
ATOM   1586 C C     . ALA A 1 206 ? 27.811  6.881   14.581  1.00 50.19  ? 206  ALA A C     1 
ATOM   1587 O O     . ALA A 1 206 ? 27.740  5.643   14.711  1.00 50.64  ? 206  ALA A O     1 
ATOM   1588 C CB    . ALA A 1 206 ? 25.729  8.297   14.283  1.00 49.72  ? 206  ALA A CB    1 
ATOM   1589 N N     . ALA A 1 207 ? 28.747  7.480   13.845  1.00 49.25  ? 207  ALA A N     1 
ATOM   1590 C CA    . ALA A 1 207 ? 29.831  6.722   13.245  1.00 49.88  ? 207  ALA A CA    1 
ATOM   1591 C C     . ALA A 1 207 ? 30.574  5.908   14.308  1.00 50.54  ? 207  ALA A C     1 
ATOM   1592 O O     . ALA A 1 207 ? 30.847  4.722   14.115  1.00 51.28  ? 207  ALA A O     1 
ATOM   1593 C CB    . ALA A 1 207 ? 30.786  7.649   12.531  1.00 49.49  ? 207  ALA A CB    1 
ATOM   1594 N N     . SER A 1 208 ? 30.884  6.555   15.436  1.00 50.25  ? 208  SER A N     1 
ATOM   1595 C CA    . SER A 1 208 ? 31.566  5.902   16.575  1.00 50.07  ? 208  SER A CA    1 
ATOM   1596 C C     . SER A 1 208 ? 30.770  4.733   17.130  1.00 50.34  ? 208  SER A C     1 
ATOM   1597 O O     . SER A 1 208 ? 31.341  3.679   17.447  1.00 51.30  ? 208  SER A O     1 
ATOM   1598 C CB    . SER A 1 208 ? 31.824  6.916   17.701  1.00 49.90  ? 208  SER A CB    1 
ATOM   1599 O OG    . SER A 1 208 ? 32.525  8.082   17.253  1.00 49.68  ? 208  SER A OG    1 
ATOM   1600 N N     . VAL A 1 209 ? 29.459  4.916   17.277  1.00 49.66  ? 209  VAL A N     1 
ATOM   1601 C CA    . VAL A 1 209 ? 28.567  3.839   17.735  1.00 50.13  ? 209  VAL A CA    1 
ATOM   1602 C C     . VAL A 1 209 ? 28.699  2.658   16.785  1.00 51.85  ? 209  VAL A C     1 
ATOM   1603 O O     . VAL A 1 209 ? 28.899  1.518   17.223  1.00 52.66  ? 209  VAL A O     1 
ATOM   1604 C CB    . VAL A 1 209 ? 27.072  4.323   17.822  1.00 50.15  ? 209  VAL A CB    1 
ATOM   1605 C CG1   . VAL A 1 209 ? 26.103  3.160   18.064  1.00 48.62  ? 209  VAL A CG1   1 
ATOM   1606 C CG2   . VAL A 1 209 ? 26.925  5.389   18.899  1.00 47.86  ? 209  VAL A CG2   1 
ATOM   1607 N N     . GLY A 1 210 ? 28.651  2.942   15.480  1.00 52.22  ? 210  GLY A N     1 
ATOM   1608 C CA    . GLY A 1 210 ? 28.781  1.908   14.456  1.00 53.62  ? 210  GLY A CA    1 
ATOM   1609 C C     . GLY A 1 210 ? 30.114  1.184   14.532  1.00 54.99  ? 210  GLY A C     1 
ATOM   1610 O O     . GLY A 1 210 ? 30.198  -0.027  14.332  1.00 56.17  ? 210  GLY A O     1 
ATOM   1611 N N     . MET A 1 211 ? 31.161  1.921   14.846  1.00 55.00  ? 211  MET A N     1 
ATOM   1612 C CA    . MET A 1 211 ? 32.474  1.322   15.019  1.00 56.90  ? 211  MET A CA    1 
ATOM   1613 C C     . MET A 1 211 ? 32.621  0.476   16.278  1.00 56.37  ? 211  MET A C     1 
ATOM   1614 O O     . MET A 1 211 ? 33.379  -0.493  16.275  1.00 58.29  ? 211  MET A O     1 
ATOM   1615 C CB    . MET A 1 211 ? 33.526  2.418   14.954  1.00 56.45  ? 211  MET A CB    1 
ATOM   1616 C CG    . MET A 1 211 ? 33.659  2.879   13.517  1.00 57.79  ? 211  MET A CG    1 
ATOM   1617 S SD    . MET A 1 211 ? 34.788  4.206   13.325  1.00 60.09  ? 211  MET A SD    1 
ATOM   1618 C CE    . MET A 1 211 ? 34.183  4.966   11.798  1.00 55.90  ? 211  MET A CE    1 
ATOM   1619 N N     . HIS A 1 212 ? 31.884  0.814   17.334  1.00 54.93  ? 212  HIS A N     1 
ATOM   1620 C CA    . HIS A 1 212 ? 31.785  -0.059  18.494  1.00 55.03  ? 212  HIS A CA    1 
ATOM   1621 C C     . HIS A 1 212 ? 31.005  -1.319  18.173  1.00 56.14  ? 212  HIS A C     1 
ATOM   1622 O O     . HIS A 1 212 ? 31.302  -2.362  18.723  1.00 57.17  ? 212  HIS A O     1 
ATOM   1623 C CB    . HIS A 1 212 ? 31.175  0.658   19.693  1.00 53.61  ? 212  HIS A CB    1 
ATOM   1624 C CG    . HIS A 1 212 ? 32.071  1.709   20.253  1.00 52.58  ? 212  HIS A CG    1 
ATOM   1625 N ND1   . HIS A 1 212 ? 33.299  1.413   20.804  1.00 51.83  ? 212  HIS A ND1   1 
ATOM   1626 C CD2   . HIS A 1 212 ? 31.947  3.055   20.304  1.00 50.06  ? 212  HIS A CD2   1 
ATOM   1627 C CE1   . HIS A 1 212 ? 33.884  2.532   21.190  1.00 50.73  ? 212  HIS A CE1   1 
ATOM   1628 N NE2   . HIS A 1 212 ? 33.091  3.544   20.884  1.00 50.43  ? 212  HIS A NE2   1 
ATOM   1629 N N     . ILE A 1 213 ? 30.026  -1.233  17.275  1.00 56.06  ? 213  ILE A N     1 
ATOM   1630 C CA    . ILE A 1 213 ? 29.346  -2.440  16.796  1.00 57.55  ? 213  ILE A CA    1 
ATOM   1631 C C     . ILE A 1 213 ? 30.317  -3.329  15.989  1.00 59.24  ? 213  ILE A C     1 
ATOM   1632 O O     . ILE A 1 213 ? 30.253  -4.544  16.067  1.00 60.61  ? 213  ILE A O     1 
ATOM   1633 C CB    . ILE A 1 213 ? 28.113  -2.098  15.932  1.00 57.56  ? 213  ILE A CB    1 
ATOM   1634 C CG1   . ILE A 1 213 ? 27.059  -1.351  16.776  1.00 56.86  ? 213  ILE A CG1   1 
ATOM   1635 C CG2   . ILE A 1 213 ? 27.514  -3.372  15.280  1.00 57.43  ? 213  ILE A CG2   1 
ATOM   1636 C CD1   . ILE A 1 213 ? 25.907  -0.770  15.968  1.00 55.47  ? 213  ILE A CD1   1 
ATOM   1637 N N     . LEU A 1 214 ? 31.215  -2.720  15.222  1.00 59.11  ? 214  LEU A N     1 
ATOM   1638 C CA    . LEU A 1 214 ? 32.072  -3.474  14.325  1.00 60.58  ? 214  LEU A CA    1 
ATOM   1639 C C     . LEU A 1 214 ? 33.393  -3.923  14.970  1.00 61.55  ? 214  LEU A C     1 
ATOM   1640 O O     . LEU A 1 214 ? 34.180  -4.627  14.332  1.00 62.25  ? 214  LEU A O     1 
ATOM   1641 C CB    . LEU A 1 214 ? 32.347  -2.642  13.064  1.00 60.29  ? 214  LEU A CB    1 
ATOM   1642 C CG    . LEU A 1 214 ? 31.112  -2.278  12.219  1.00 59.60  ? 214  LEU A CG    1 
ATOM   1643 C CD1   . LEU A 1 214 ? 31.480  -1.274  11.138  1.00 57.47  ? 214  LEU A CD1   1 
ATOM   1644 C CD2   . LEU A 1 214 ? 30.475  -3.523  11.615  1.00 60.33  ? 214  LEU A CD2   1 
ATOM   1645 N N     . SER A 1 215 ? 33.635  -3.513  16.219  1.00 61.33  ? 215  SER A N     1 
ATOM   1646 C CA    . SER A 1 215 ? 34.876  -3.851  16.920  1.00 61.95  ? 215  SER A CA    1 
ATOM   1647 C C     . SER A 1 215 ? 34.564  -4.749  18.092  1.00 63.41  ? 215  SER A C     1 
ATOM   1648 O O     . SER A 1 215 ? 33.947  -4.316  19.061  1.00 62.15  ? 215  SER A O     1 
ATOM   1649 C CB    . SER A 1 215 ? 35.583  -2.587  17.398  1.00 60.96  ? 215  SER A CB    1 
ATOM   1650 O OG    . SER A 1 215 ? 36.913  -2.885  17.743  1.00 59.88  ? 215  SER A OG    1 
ATOM   1651 N N     . LEU A 1 216 ? 35.007  -6.003  17.997  1.00 66.26  ? 216  LEU A N     1 
ATOM   1652 C CA    . LEU A 1 216 ? 34.556  -7.072  18.887  1.00 67.60  ? 216  LEU A CA    1 
ATOM   1653 C C     . LEU A 1 216 ? 34.754  -6.788  20.382  1.00 66.92  ? 216  LEU A C     1 
ATOM   1654 O O     . LEU A 1 216 ? 33.849  -7.030  21.166  1.00 66.96  ? 216  LEU A O     1 
ATOM   1655 C CB    . LEU A 1 216 ? 35.197  -8.419  18.464  1.00 69.83  ? 216  LEU A CB    1 
ATOM   1656 C CG    . LEU A 1 216 ? 34.723  -9.676  19.203  1.00 72.05  ? 216  LEU A CG    1 
ATOM   1657 C CD1   . LEU A 1 216 ? 33.173  -9.786  19.217  1.00 74.31  ? 216  LEU A CD1   1 
ATOM   1658 C CD2   . LEU A 1 216 ? 35.369  -10.951 18.611  1.00 74.27  ? 216  LEU A CD2   1 
ATOM   1659 N N     . PRO A 1 217 ? 35.926  -6.262  20.787  1.00 66.78  ? 217  PRO A N     1 
ATOM   1660 C CA    . PRO A 1 217 ? 36.102  -5.866  22.197  1.00 66.13  ? 217  PRO A CA    1 
ATOM   1661 C C     . PRO A 1 217 ? 35.075  -4.880  22.768  1.00 64.67  ? 217  PRO A C     1 
ATOM   1662 O O     . PRO A 1 217 ? 34.864  -4.869  23.981  1.00 65.06  ? 217  PRO A O     1 
ATOM   1663 C CB    . PRO A 1 217 ? 37.513  -5.257  22.221  1.00 65.94  ? 217  PRO A CB    1 
ATOM   1664 C CG    . PRO A 1 217 ? 38.230  -5.929  21.089  1.00 67.10  ? 217  PRO A CG    1 
ATOM   1665 C CD    . PRO A 1 217 ? 37.167  -6.065  20.014  1.00 67.28  ? 217  PRO A CD    1 
ATOM   1666 N N     . SER A 1 218 ? 34.453  -4.056  21.931  1.00 63.61  ? 218  SER A N     1 
ATOM   1667 C CA    . SER A 1 218 ? 33.388  -3.152  22.396  1.00 62.35  ? 218  SER A CA    1 
ATOM   1668 C C     . SER A 1 218 ? 32.048  -3.866  22.620  1.00 63.32  ? 218  SER A C     1 
ATOM   1669 O O     . SER A 1 218 ? 31.216  -3.390  23.384  1.00 62.21  ? 218  SER A O     1 
ATOM   1670 C CB    . SER A 1 218 ? 33.172  -2.003  21.414  1.00 61.14  ? 218  SER A CB    1 
ATOM   1671 O OG    . SER A 1 218 ? 34.275  -1.122  21.398  1.00 59.91  ? 218  SER A OG    1 
ATOM   1672 N N     . ARG A 1 219 ? 31.846  -5.004  21.957  1.00 64.93  ? 219  ARG A N     1 
ATOM   1673 C CA    . ARG A 1 219 ? 30.529  -5.639  21.912  1.00 66.14  ? 219  ARG A CA    1 
ATOM   1674 C C     . ARG A 1 219 ? 29.991  -6.123  23.247  1.00 66.39  ? 219  ARG A C     1 
ATOM   1675 O O     . ARG A 1 219 ? 28.780  -6.130  23.446  1.00 66.99  ? 219  ARG A O     1 
ATOM   1676 C CB    . ARG A 1 219 ? 30.517  -6.794  20.908  1.00 67.95  ? 219  ARG A CB    1 
ATOM   1677 C CG    . ARG A 1 219 ? 30.690  -6.354  19.467  1.00 69.37  ? 219  ARG A CG    1 
ATOM   1678 C CD    . ARG A 1 219 ? 29.633  -5.334  19.063  1.00 71.97  ? 219  ARG A CD    1 
ATOM   1679 N NE    . ARG A 1 219 ? 28.279  -5.882  19.136  1.00 73.32  ? 219  ARG A NE    1 
ATOM   1680 C CZ    . ARG A 1 219 ? 27.721  -6.641  18.195  1.00 76.10  ? 219  ARG A CZ    1 
ATOM   1681 N NH1   . ARG A 1 219 ? 28.373  -6.948  17.074  1.00 77.47  ? 219  ARG A NH1   1 
ATOM   1682 N NH2   . ARG A 1 219 ? 26.488  -7.094  18.377  1.00 78.05  ? 219  ARG A NH2   1 
ATOM   1683 N N     . SER A 1 220 ? 30.868  -6.505  24.163  1.00 66.37  ? 220  SER A N     1 
ATOM   1684 C CA    . SER A 1 220 ? 30.434  -6.925  25.486  1.00 66.86  ? 220  SER A CA    1 
ATOM   1685 C C     . SER A 1 220 ? 30.043  -5.758  26.387  1.00 64.88  ? 220  SER A C     1 
ATOM   1686 O O     . SER A 1 220 ? 29.502  -5.973  27.479  1.00 65.53  ? 220  SER A O     1 
ATOM   1687 C CB    . SER A 1 220 ? 31.525  -7.753  26.169  1.00 68.25  ? 220  SER A CB    1 
ATOM   1688 O OG    . SER A 1 220 ? 32.747  -7.034  26.203  1.00 69.37  ? 220  SER A OG    1 
ATOM   1689 N N     . LEU A 1 221 ? 30.294  -4.531  25.938  1.00 62.52  ? 221  LEU A N     1 
ATOM   1690 C CA    . LEU A 1 221 ? 30.123  -3.364  26.789  1.00 60.79  ? 221  LEU A CA    1 
ATOM   1691 C C     . LEU A 1 221 ? 28.787  -2.666  26.600  1.00 59.94  ? 221  LEU A C     1 
ATOM   1692 O O     . LEU A 1 221 ? 28.499  -1.695  27.314  1.00 60.16  ? 221  LEU A O     1 
ATOM   1693 C CB    . LEU A 1 221 ? 31.270  -2.363  26.559  1.00 59.66  ? 221  LEU A CB    1 
ATOM   1694 C CG    . LEU A 1 221 ? 32.697  -2.944  26.652  1.00 59.60  ? 221  LEU A CG    1 
ATOM   1695 C CD1   . LEU A 1 221 ? 33.713  -1.833  26.361  1.00 56.64  ? 221  LEU A CD1   1 
ATOM   1696 C CD2   . LEU A 1 221 ? 32.961  -3.628  28.017  1.00 55.76  ? 221  LEU A CD2   1 
ATOM   1697 N N     . PHE A 1 222 ? 27.978  -3.131  25.650  1.00 59.79  ? 222  PHE A N     1 
ATOM   1698 C CA    . PHE A 1 222 ? 26.672  -2.513  25.374  1.00 59.42  ? 222  PHE A CA    1 
ATOM   1699 C C     . PHE A 1 222 ? 25.761  -3.498  24.685  1.00 60.34  ? 222  PHE A C     1 
ATOM   1700 O O     . PHE A 1 222 ? 26.210  -4.555  24.258  1.00 61.11  ? 222  PHE A O     1 
ATOM   1701 C CB    . PHE A 1 222 ? 26.821  -1.244  24.516  1.00 58.44  ? 222  PHE A CB    1 
ATOM   1702 C CG    . PHE A 1 222 ? 27.213  -1.517  23.085  1.00 59.06  ? 222  PHE A CG    1 
ATOM   1703 C CD1   . PHE A 1 222 ? 28.535  -1.778  22.751  1.00 59.18  ? 222  PHE A CD1   1 
ATOM   1704 C CD2   . PHE A 1 222 ? 26.256  -1.499  22.066  1.00 60.37  ? 222  PHE A CD2   1 
ATOM   1705 C CE1   . PHE A 1 222 ? 28.900  -2.033  21.432  1.00 60.09  ? 222  PHE A CE1   1 
ATOM   1706 C CE2   . PHE A 1 222 ? 26.612  -1.756  20.735  1.00 59.68  ? 222  PHE A CE2   1 
ATOM   1707 C CZ    . PHE A 1 222 ? 27.931  -2.018  20.421  1.00 59.93  ? 222  PHE A CZ    1 
ATOM   1708 N N     . HIS A 1 223 ? 24.482  -3.152  24.573  1.00 60.51  ? 223  HIS A N     1 
ATOM   1709 C CA    . HIS A 1 223 ? 23.475  -4.123  24.108  1.00 62.15  ? 223  HIS A CA    1 
ATOM   1710 C C     . HIS A 1 223 ? 22.641  -3.657  22.927  1.00 61.97  ? 223  HIS A C     1 
ATOM   1711 O O     . HIS A 1 223 ? 22.104  -4.488  22.176  1.00 63.81  ? 223  HIS A O     1 
ATOM   1712 C CB    . HIS A 1 223 ? 22.569  -4.516  25.278  1.00 62.99  ? 223  HIS A CB    1 
ATOM   1713 C CG    . HIS A 1 223 ? 23.336  -4.851  26.518  1.00 63.19  ? 223  HIS A CG    1 
ATOM   1714 N ND1   . HIS A 1 223 ? 23.703  -6.138  26.840  1.00 62.23  ? 223  HIS A ND1   1 
ATOM   1715 C CD2   . HIS A 1 223 ? 23.886  -4.049  27.463  1.00 61.04  ? 223  HIS A CD2   1 
ATOM   1716 C CE1   . HIS A 1 223 ? 24.410  -6.116  27.956  1.00 64.17  ? 223  HIS A CE1   1 
ATOM   1717 N NE2   . HIS A 1 223 ? 24.545  -4.857  28.345  1.00 62.26  ? 223  HIS A NE2   1 
ATOM   1718 N N     . ARG A 1 224 ? 22.539  -2.341  22.754  1.00 60.53  ? 224  ARG A N     1 
ATOM   1719 C CA    . ARG A 1 224 ? 21.724  -1.755  21.692  1.00 59.97  ? 224  ARG A CA    1 
ATOM   1720 C C     . ARG A 1 224 ? 22.341  -0.445  21.250  1.00 57.39  ? 224  ARG A C     1 
ATOM   1721 O O     . ARG A 1 224 ? 23.165  0.141   21.970  1.00 56.72  ? 224  ARG A O     1 
ATOM   1722 C CB    . ARG A 1 224 ? 20.293  -1.534  22.190  1.00 60.01  ? 224  ARG A CB    1 
ATOM   1723 C CG    . ARG A 1 224 ? 19.490  -2.797  22.181  1.00 63.31  ? 224  ARG A CG    1 
ATOM   1724 C CD    . ARG A 1 224 ? 18.172  -2.652  22.882  1.00 64.87  ? 224  ARG A CD    1 
ATOM   1725 N NE    . ARG A 1 224 ? 18.354  -2.541  24.315  1.00 67.84  ? 224  ARG A NE    1 
ATOM   1726 C CZ    . ARG A 1 224 ? 18.585  -3.558  25.133  1.00 69.35  ? 224  ARG A CZ    1 
ATOM   1727 N NH1   . ARG A 1 224 ? 18.675  -4.797  24.677  1.00 73.61  ? 224  ARG A NH1   1 
ATOM   1728 N NH2   . ARG A 1 224 ? 18.733  -3.325  26.423  1.00 69.12  ? 224  ARG A NH2   1 
ATOM   1729 N N     . ALA A 1 225 ? 21.945  0.017   20.071  1.00 56.02  ? 225  ALA A N     1 
ATOM   1730 C CA    . ALA A 1 225 ? 22.598  1.162   19.464  1.00 54.38  ? 225  ALA A CA    1 
ATOM   1731 C C     . ALA A 1 225 ? 21.608  2.017   18.690  1.00 53.49  ? 225  ALA A C     1 
ATOM   1732 O O     . ALA A 1 225 ? 20.664  1.502   18.072  1.00 53.52  ? 225  ALA A O     1 
ATOM   1733 C CB    . ALA A 1 225 ? 23.757  0.699   18.548  1.00 54.14  ? 225  ALA A CB    1 
ATOM   1734 N N     . VAL A 1 226 ? 21.836  3.329   18.755  1.00 52.02  ? 226  VAL A N     1 
ATOM   1735 C CA    . VAL A 1 226 ? 21.094  4.314   17.995  1.00 50.83  ? 226  VAL A CA    1 
ATOM   1736 C C     . VAL A 1 226 ? 22.110  5.143   17.229  1.00 50.41  ? 226  VAL A C     1 
ATOM   1737 O O     . VAL A 1 226 ? 23.042  5.713   17.820  1.00 49.73  ? 226  VAL A O     1 
ATOM   1738 C CB    . VAL A 1 226 ? 20.286  5.220   18.915  1.00 50.89  ? 226  VAL A CB    1 
ATOM   1739 C CG1   . VAL A 1 226 ? 19.492  6.285   18.095  1.00 50.08  ? 226  VAL A CG1   1 
ATOM   1740 C CG2   . VAL A 1 226 ? 19.366  4.388   19.849  1.00 50.86  ? 226  VAL A CG2   1 
ATOM   1741 N N     . LEU A 1 227 ? 21.967  5.181   15.909  1.00 50.73  ? 227  LEU A N     1 
ATOM   1742 C CA    . LEU A 1 227 ? 22.826  6.004   15.057  1.00 49.81  ? 227  LEU A CA    1 
ATOM   1743 C C     . LEU A 1 227 ? 21.989  7.088   14.387  1.00 49.33  ? 227  LEU A C     1 
ATOM   1744 O O     . LEU A 1 227 ? 21.159  6.780   13.551  1.00 49.77  ? 227  LEU A O     1 
ATOM   1745 C CB    . LEU A 1 227 ? 23.505  5.131   13.991  1.00 50.20  ? 227  LEU A CB    1 
ATOM   1746 C CG    . LEU A 1 227 ? 24.456  4.011   14.453  1.00 51.30  ? 227  LEU A CG    1 
ATOM   1747 C CD1   . LEU A 1 227 ? 23.684  2.734   14.834  1.00 49.56  ? 227  LEU A CD1   1 
ATOM   1748 C CD2   . LEU A 1 227 ? 25.549  3.712   13.371  1.00 50.27  ? 227  LEU A CD2   1 
ATOM   1749 N N     . GLN A 1 228 ? 22.221  8.344   14.759  1.00 48.82  ? 228  GLN A N     1 
ATOM   1750 C CA    . GLN A 1 228 ? 21.480  9.504   14.240  1.00 49.05  ? 228  GLN A CA    1 
ATOM   1751 C C     . GLN A 1 228 ? 22.366  10.284  13.252  1.00 48.73  ? 228  GLN A C     1 
ATOM   1752 O O     . GLN A 1 228 ? 23.423  10.777  13.633  1.00 47.65  ? 228  GLN A O     1 
ATOM   1753 C CB    . GLN A 1 228 ? 21.075  10.449  15.395  1.00 48.83  ? 228  GLN A CB    1 
ATOM   1754 C CG    . GLN A 1 228 ? 20.350  9.787   16.578  1.00 49.49  ? 228  GLN A CG    1 
ATOM   1755 C CD    . GLN A 1 228 ? 20.075  10.728  17.767  1.00 50.17  ? 228  GLN A CD    1 
ATOM   1756 O OE1   . GLN A 1 228 ? 19.879  10.254  18.894  1.00 51.36  ? 228  GLN A OE1   1 
ATOM   1757 N NE2   . GLN A 1 228 ? 20.072  12.055  17.528  1.00 50.01  ? 228  GLN A NE2   1 
ATOM   1758 N N     . SER A 1 229 ? 21.951  10.355  11.987  1.00 48.93  ? 229  SER A N     1 
ATOM   1759 C CA    . SER A 1 229 ? 22.661  11.131  10.960  1.00 48.88  ? 229  SER A CA    1 
ATOM   1760 C C     . SER A 1 229 ? 24.155  10.855  10.901  1.00 48.46  ? 229  SER A C     1 
ATOM   1761 O O     . SER A 1 229 ? 24.979  11.770  10.823  1.00 48.29  ? 229  SER A O     1 
ATOM   1762 C CB    . SER A 1 229 ? 22.391  12.635  11.149  1.00 48.66  ? 229  SER A CB    1 
ATOM   1763 O OG    . SER A 1 229 ? 20.982  12.877  11.181  1.00 50.38  ? 229  SER A OG    1 
ATOM   1764 N N     . GLY A 1 230 ? 24.511  9.581   10.933  1.00 49.19  ? 230  GLY A N     1 
ATOM   1765 C CA    . GLY A 1 230 ? 25.909  9.189   10.780  1.00 49.06  ? 230  GLY A CA    1 
ATOM   1766 C C     . GLY A 1 230 ? 26.072  7.692   10.782  1.00 49.43  ? 230  GLY A C     1 
ATOM   1767 O O     . GLY A 1 230 ? 25.226  6.992   11.328  1.00 49.21  ? 230  GLY A O     1 
ATOM   1768 N N     . THR A 1 231 ? 27.182  7.222   10.196  1.00 50.15  ? 231  THR A N     1 
ATOM   1769 C CA    . THR A 1 231 ? 27.459  5.782   9.981   1.00 51.01  ? 231  THR A CA    1 
ATOM   1770 C C     . THR A 1 231 ? 28.973  5.488   9.941   1.00 51.43  ? 231  THR A C     1 
ATOM   1771 O O     . THR A 1 231 ? 29.783  6.370   9.630   1.00 51.94  ? 231  THR A O     1 
ATOM   1772 C CB    . THR A 1 231 ? 26.823  5.279   8.638   1.00 52.03  ? 231  THR A CB    1 
ATOM   1773 O OG1   . THR A 1 231 ? 27.429  5.946   7.528   1.00 51.67  ? 231  THR A OG1   1 
ATOM   1774 C CG2   . THR A 1 231 ? 25.306  5.528   8.593   1.00 51.13  ? 231  THR A CG2   1 
ATOM   1775 N N     . PRO A 1 232 ? 29.382  4.263   10.285  1.00 52.28  ? 232  PRO A N     1 
ATOM   1776 C CA    . PRO A 1 232 ? 30.826  3.942   10.195  1.00 52.83  ? 232  PRO A CA    1 
ATOM   1777 C C     . PRO A 1 232 ? 31.324  3.754   8.748   1.00 53.84  ? 232  PRO A C     1 
ATOM   1778 O O     . PRO A 1 232 ? 32.472  4.047   8.433   1.00 54.02  ? 232  PRO A O     1 
ATOM   1779 C CB    . PRO A 1 232 ? 30.930  2.646   10.995  1.00 53.61  ? 232  PRO A CB    1 
ATOM   1780 C CG    . PRO A 1 232 ? 29.575  2.002   10.830  1.00 54.20  ? 232  PRO A CG    1 
ATOM   1781 C CD    . PRO A 1 232 ? 28.590  3.131   10.803  1.00 52.61  ? 232  PRO A CD    1 
ATOM   1782 N N     . ASN A 1 233 ? 30.447  3.246   7.892   1.00 54.76  ? 233  ASN A N     1 
ATOM   1783 C CA    . ASN A 1 233 ? 30.646  3.223   6.451   1.00 55.57  ? 233  ASN A CA    1 
ATOM   1784 C C     . ASN A 1 233 ? 30.382  4.615   5.845   1.00 55.04  ? 233  ASN A C     1 
ATOM   1785 O O     . ASN A 1 233 ? 29.874  5.514   6.528   1.00 53.91  ? 233  ASN A O     1 
ATOM   1786 C CB    . ASN A 1 233 ? 29.698  2.199   5.823   1.00 56.28  ? 233  ASN A CB    1 
ATOM   1787 C CG    . ASN A 1 233 ? 28.235  2.503   6.134   1.00 56.26  ? 233  ASN A CG    1 
ATOM   1788 O OD1   . ASN A 1 233 ? 27.840  2.506   7.295   1.00 56.52  ? 233  ASN A OD1   1 
ATOM   1789 N ND2   . ASN A 1 233 ? 27.440  2.780   5.108   1.00 55.76  ? 233  ASN A ND2   1 
ATOM   1790 N N     . GLY A 1 234 ? 30.718  4.786   4.566   1.00 55.95  ? 234  GLY A N     1 
ATOM   1791 C CA    . GLY A 1 234 ? 30.587  6.082   3.899   1.00 55.73  ? 234  GLY A CA    1 
ATOM   1792 C C     . GLY A 1 234 ? 31.923  6.772   3.650   1.00 56.08  ? 234  GLY A C     1 
ATOM   1793 O O     . GLY A 1 234 ? 32.970  6.265   4.036   1.00 57.07  ? 234  GLY A O     1 
ATOM   1794 N N     . PRO A 1 235 ? 31.897  7.947   3.008   1.00 55.66  ? 235  PRO A N     1 
ATOM   1795 C CA    . PRO A 1 235 ? 33.115  8.551   2.470   1.00 55.84  ? 235  PRO A CA    1 
ATOM   1796 C C     . PRO A 1 235 ? 34.015  9.350   3.440   1.00 55.27  ? 235  PRO A C     1 
ATOM   1797 O O     . PRO A 1 235 ? 35.164  9.703   3.066   1.00 56.16  ? 235  PRO A O     1 
ATOM   1798 C CB    . PRO A 1 235 ? 32.576  9.457   1.367   1.00 55.57  ? 235  PRO A CB    1 
ATOM   1799 C CG    . PRO A 1 235 ? 31.230  9.855   1.836   1.00 55.50  ? 235  PRO A CG    1 
ATOM   1800 C CD    . PRO A 1 235 ? 30.703  8.748   2.706   1.00 55.27  ? 235  PRO A CD    1 
ATOM   1801 N N     . TRP A 1 236 ? 33.537  9.600   4.659   1.00 53.77  ? 236  TRP A N     1 
ATOM   1802 C CA    . TRP A 1 236 ? 34.229  10.489  5.608   1.00 52.98  ? 236  TRP A CA    1 
ATOM   1803 C C     . TRP A 1 236 ? 34.619  9.855   6.946   1.00 52.70  ? 236  TRP A C     1 
ATOM   1804 O O     . TRP A 1 236 ? 35.560  10.331  7.576   1.00 53.44  ? 236  TRP A O     1 
ATOM   1805 C CB    . TRP A 1 236 ? 33.389  11.747  5.891   1.00 51.73  ? 236  TRP A CB    1 
ATOM   1806 C CG    . TRP A 1 236 ? 32.015  11.445  6.450   1.00 51.40  ? 236  TRP A CG    1 
ATOM   1807 C CD1   . TRP A 1 236 ? 30.861  11.316  5.735   1.00 51.44  ? 236  TRP A CD1   1 
ATOM   1808 C CD2   . TRP A 1 236 ? 31.659  11.212  7.825   1.00 51.54  ? 236  TRP A CD2   1 
ATOM   1809 N NE1   . TRP A 1 236 ? 29.813  11.027  6.569   1.00 51.61  ? 236  TRP A NE1   1 
ATOM   1810 C CE2   . TRP A 1 236 ? 30.273  10.945  7.856   1.00 50.88  ? 236  TRP A CE2   1 
ATOM   1811 C CE3   . TRP A 1 236 ? 32.376  11.201  9.033   1.00 51.64  ? 236  TRP A CE3   1 
ATOM   1812 C CZ2   . TRP A 1 236 ? 29.583  10.676  9.046   1.00 49.94  ? 236  TRP A CZ2   1 
ATOM   1813 C CZ3   . TRP A 1 236 ? 31.697  10.923  10.209  1.00 50.24  ? 236  TRP A CZ3   1 
ATOM   1814 C CH2   . TRP A 1 236 ? 30.307  10.667  10.206  1.00 49.74  ? 236  TRP A CH2   1 
ATOM   1815 N N     . ALA A 1 237 ? 33.919  8.817   7.395   1.00 52.11  ? 237  ALA A N     1 
ATOM   1816 C CA    . ALA A 1 237 ? 34.110  8.306   8.785   1.00 51.93  ? 237  ALA A CA    1 
ATOM   1817 C C     . ALA A 1 237 ? 35.458  7.603   9.033   1.00 52.39  ? 237  ALA A C     1 
ATOM   1818 O O     . ALA A 1 237 ? 35.913  7.515   10.173  1.00 51.72  ? 237  ALA A O     1 
ATOM   1819 C CB    . ALA A 1 237 ? 32.947  7.387   9.198   1.00 51.04  ? 237  ALA A CB    1 
ATOM   1820 N N     . THR A 1 238 ? 36.094  7.111   7.974   1.00 53.17  ? 238  THR A N     1 
ATOM   1821 C CA    . THR A 1 238 ? 37.396  6.452   8.103   1.00 54.25  ? 238  THR A CA    1 
ATOM   1822 C C     . THR A 1 238 ? 38.333  6.876   7.006   1.00 55.01  ? 238  THR A C     1 
ATOM   1823 O O     . THR A 1 238 ? 37.912  7.433   6.000   1.00 55.69  ? 238  THR A O     1 
ATOM   1824 C CB    . THR A 1 238 ? 37.281  4.907   8.010   1.00 54.89  ? 238  THR A CB    1 
ATOM   1825 O OG1   . THR A 1 238 ? 36.619  4.553   6.791   1.00 54.81  ? 238  THR A OG1   1 
ATOM   1826 C CG2   . THR A 1 238 ? 36.503  4.347   9.187   1.00 53.84  ? 238  THR A CG2   1 
ATOM   1827 N N     . VAL A 1 239 ? 39.612  6.604   7.216   1.00 55.99  ? 239  VAL A N     1 
ATOM   1828 C CA    . VAL A 1 239 ? 40.620  6.683   6.164   1.00 56.51  ? 239  VAL A CA    1 
ATOM   1829 C C     . VAL A 1 239 ? 41.457  5.397   6.189   1.00 57.96  ? 239  VAL A C     1 
ATOM   1830 O O     . VAL A 1 239 ? 41.492  4.675   7.195   1.00 57.57  ? 239  VAL A O     1 
ATOM   1831 C CB    . VAL A 1 239 ? 41.561  7.921   6.328   1.00 56.72  ? 239  VAL A CB    1 
ATOM   1832 C CG1   . VAL A 1 239 ? 40.837  9.236   5.955   1.00 53.82  ? 239  VAL A CG1   1 
ATOM   1833 C CG2   . VAL A 1 239 ? 42.180  7.975   7.735   1.00 55.18  ? 239  VAL A CG2   1 
ATOM   1834 N N     . SER A 1 240 ? 42.132  5.123   5.079   1.00 59.40  ? 240  SER A N     1 
ATOM   1835 C CA    . SER A 1 240 ? 43.072  4.005   4.991   1.00 61.36  ? 240  SER A CA    1 
ATOM   1836 C C     . SER A 1 240 ? 44.308  4.289   5.812   1.00 61.91  ? 240  SER A C     1 
ATOM   1837 O O     . SER A 1 240 ? 44.558  5.431   6.192   1.00 60.93  ? 240  SER A O     1 
ATOM   1838 C CB    . SER A 1 240 ? 43.515  3.800   3.552   1.00 62.43  ? 240  SER A CB    1 
ATOM   1839 O OG    . SER A 1 240 ? 44.198  4.960   3.117   1.00 62.12  ? 240  SER A OG    1 
ATOM   1840 N N     . ALA A 1 241 ? 45.096  3.247   6.057   1.00 63.47  ? 241  ALA A N     1 
ATOM   1841 C CA    . ALA A 1 241 ? 46.320  3.389   6.825   1.00 64.53  ? 241  ALA A CA    1 
ATOM   1842 C C     . ALA A 1 241 ? 47.293  4.286   6.075   1.00 65.60  ? 241  ALA A C     1 
ATOM   1843 O O     . ALA A 1 241 ? 47.948  5.129   6.677   1.00 65.95  ? 241  ALA A O     1 
ATOM   1844 C CB    . ALA A 1 241 ? 46.951  2.012   7.123   1.00 66.02  ? 241  ALA A CB    1 
ATOM   1845 N N     . GLY A 1 242 ? 47.368  4.117   4.758   1.00 66.79  ? 242  GLY A N     1 
ATOM   1846 C CA    . GLY A 1 242 ? 48.220  4.959   3.922   1.00 67.72  ? 242  GLY A CA    1 
ATOM   1847 C C     . GLY A 1 242 ? 47.841  6.435   3.947   1.00 66.25  ? 242  GLY A C     1 
ATOM   1848 O O     . GLY A 1 242 ? 48.711  7.300   3.987   1.00 67.15  ? 242  GLY A O     1 
ATOM   1849 N N     . GLU A 1 243 ? 46.548  6.732   3.923   1.00 64.55  ? 243  GLU A N     1 
ATOM   1850 C CA    . GLU A 1 243 ? 46.091  8.127   3.953   1.00 62.99  ? 243  GLU A CA    1 
ATOM   1851 C C     . GLU A 1 243 ? 46.332  8.775   5.328   1.00 62.08  ? 243  GLU A C     1 
ATOM   1852 O O     . GLU A 1 243 ? 46.775  9.923   5.412   1.00 62.18  ? 243  GLU A O     1 
ATOM   1853 C CB    . GLU A 1 243 ? 44.625  8.204   3.538   1.00 61.82  ? 243  GLU A CB    1 
ATOM   1854 C CG    . GLU A 1 243 ? 44.005  9.618   3.514   1.00 61.47  ? 243  GLU A CG    1 
ATOM   1855 C CD    . GLU A 1 243 ? 44.620  10.562  2.498   1.00 62.28  ? 243  GLU A CD    1 
ATOM   1856 O OE1   . GLU A 1 243 ? 44.269  11.753  2.538   1.00 64.05  ? 243  GLU A OE1   1 
ATOM   1857 O OE2   . GLU A 1 243 ? 45.455  10.152  1.665   1.00 65.00  ? 243  GLU A OE2   1 
ATOM   1858 N N     . ALA A 1 244 ? 46.060  8.037   6.398   1.00 61.23  ? 244  ALA A N     1 
ATOM   1859 C CA    . ALA A 1 244 ? 46.415  8.479   7.751   1.00 60.59  ? 244  ALA A CA    1 
ATOM   1860 C C     . ALA A 1 244 ? 47.906  8.831   7.869   1.00 61.72  ? 244  ALA A C     1 
ATOM   1861 O O     . ALA A 1 244 ? 48.267  9.881   8.398   1.00 61.09  ? 244  ALA A O     1 
ATOM   1862 C CB    . ALA A 1 244 ? 46.055  7.405   8.778   1.00 59.77  ? 244  ALA A CB    1 
ATOM   1863 N N     . ARG A 1 245 ? 48.761  7.931   7.401   1.00 63.32  ? 245  ARG A N     1 
ATOM   1864 C CA    . ARG A 1 245 ? 50.209  8.143   7.457   1.00 65.31  ? 245  ARG A CA    1 
ATOM   1865 C C     . ARG A 1 245 ? 50.575  9.404   6.664   1.00 65.94  ? 245  ARG A C     1 
ATOM   1866 O O     . ARG A 1 245 ? 51.317  10.245  7.126   1.00 66.53  ? 245  ARG A O     1 
ATOM   1867 C CB    . ARG A 1 245 ? 50.955  6.916   6.913   1.00 66.77  ? 245  ARG A CB    1 
ATOM   1868 C CG    . ARG A 1 245 ? 52.472  7.100   6.723   1.00 68.34  ? 245  ARG A CG    1 
ATOM   1869 C CD    . ARG A 1 245 ? 53.189  5.749   6.575   1.00 69.95  ? 245  ARG A CD    1 
ATOM   1870 N NE    . ARG A 1 245 ? 53.098  4.964   7.808   1.00 68.90  ? 245  ARG A NE    1 
ATOM   1871 C CZ    . ARG A 1 245 ? 53.886  5.125   8.865   1.00 70.71  ? 245  ARG A CZ    1 
ATOM   1872 N NH1   . ARG A 1 245 ? 54.883  5.999   8.857   1.00 73.16  ? 245  ARG A NH1   1 
ATOM   1873 N NH2   . ARG A 1 245 ? 53.697  4.379   9.936   1.00 70.70  ? 245  ARG A NH2   1 
ATOM   1874 N N     . ARG A 1 246 ? 49.997  9.534   5.486   1.00 66.05  ? 246  ARG A N     1 
ATOM   1875 C CA    . ARG A 1 246 ? 50.248  10.660  4.625   1.00 67.27  ? 246  ARG A CA    1 
ATOM   1876 C C     . ARG A 1 246 ? 49.873  12.007  5.289   1.00 66.44  ? 246  ARG A C     1 
ATOM   1877 O O     . ARG A 1 246 ? 50.627  12.998  5.189   1.00 66.54  ? 246  ARG A O     1 
ATOM   1878 C CB    . ARG A 1 246 ? 49.432  10.446  3.358   1.00 67.43  ? 246  ARG A CB    1 
ATOM   1879 C CG    . ARG A 1 246 ? 49.855  11.254  2.163   1.00 70.15  ? 246  ARG A CG    1 
ATOM   1880 C CD    . ARG A 1 246 ? 48.625  11.727  1.367   1.00 71.40  ? 246  ARG A CD    1 
ATOM   1881 N NE    . ARG A 1 246 ? 48.564  13.177  1.482   1.00 71.84  ? 246  ARG A NE    1 
ATOM   1882 C CZ    . ARG A 1 246 ? 47.537  13.911  1.863   1.00 70.41  ? 246  ARG A CZ    1 
ATOM   1883 N NH1   . ARG A 1 246 ? 46.349  13.396  2.145   1.00 69.87  ? 246  ARG A NH1   1 
ATOM   1884 N NH2   . ARG A 1 246 ? 47.718  15.212  1.914   1.00 73.26  ? 246  ARG A NH2   1 
ATOM   1885 N N     . ARG A 1 247 ? 48.707  12.043  5.949   1.00 64.47  ? 247  ARG A N     1 
ATOM   1886 C CA    . ARG A 1 247 ? 48.248  13.266  6.630   1.00 63.48  ? 247  ARG A CA    1 
ATOM   1887 C C     . ARG A 1 247 ? 49.073  13.566  7.886   1.00 63.84  ? 247  ARG A C     1 
ATOM   1888 O O     . ARG A 1 247 ? 49.469  14.710  8.116   1.00 64.40  ? 247  ARG A O     1 
ATOM   1889 C CB    . ARG A 1 247 ? 46.759  13.188  6.980   1.00 61.78  ? 247  ARG A CB    1 
ATOM   1890 C CG    . ARG A 1 247 ? 45.854  13.105  5.770   1.00 60.51  ? 247  ARG A CG    1 
ATOM   1891 C CD    . ARG A 1 247 ? 44.408  12.823  6.180   1.00 59.42  ? 247  ARG A CD    1 
ATOM   1892 N NE    . ARG A 1 247 ? 43.531  12.694  5.019   1.00 57.75  ? 247  ARG A NE    1 
ATOM   1893 C CZ    . ARG A 1 247 ? 42.201  12.642  5.063   1.00 56.51  ? 247  ARG A CZ    1 
ATOM   1894 N NH1   . ARG A 1 247 ? 41.540  12.748  6.203   1.00 55.91  ? 247  ARG A NH1   1 
ATOM   1895 N NH2   . ARG A 1 247 ? 41.518  12.508  3.937   1.00 56.16  ? 247  ARG A NH2   1 
ATOM   1896 N N     . ALA A 1 248 ? 49.357  12.536  8.677   1.00 63.99  ? 248  ALA A N     1 
ATOM   1897 C CA    . ALA A 1 248 ? 50.175  12.690  9.885   1.00 64.31  ? 248  ALA A CA    1 
ATOM   1898 C C     . ALA A 1 248 ? 51.550  13.264  9.560   1.00 66.02  ? 248  ALA A C     1 
ATOM   1899 O O     . ALA A 1 248 ? 52.040  14.133  10.269  1.00 66.76  ? 248  ALA A O     1 
ATOM   1900 C CB    . ALA A 1 248 ? 50.321  11.377  10.597  1.00 64.23  ? 248  ALA A CB    1 
ATOM   1901 N N     . THR A 1 249 ? 52.164  12.811  8.473   1.00 67.12  ? 249  THR A N     1 
ATOM   1902 C CA    . THR A 1 249 ? 53.518  13.255  8.166   1.00 68.56  ? 249  THR A CA    1 
ATOM   1903 C C     . THR A 1 249 ? 53.503  14.640  7.504   1.00 68.63  ? 249  THR A C     1 
ATOM   1904 O O     . THR A 1 249 ? 54.400  15.436  7.724   1.00 69.54  ? 249  THR A O     1 
ATOM   1905 C CB    . THR A 1 249 ? 54.413  12.151  7.452   1.00 70.31  ? 249  THR A CB    1 
ATOM   1906 O OG1   . THR A 1 249 ? 55.128  12.708  6.338   1.00 72.21  ? 249  THR A OG1   1 
ATOM   1907 C CG2   . THR A 1 249 ? 53.627  10.954  6.996   1.00 68.13  ? 249  THR A CG2   1 
ATOM   1908 N N     . LEU A 1 250 ? 52.454  14.966  6.762   1.00 68.17  ? 250  LEU A N     1 
ATOM   1909 C CA    . LEU A 1 250 ? 52.311  16.334  6.260   1.00 68.09  ? 250  LEU A CA    1 
ATOM   1910 C C     . LEU A 1 250 ? 52.132  17.321  7.424   1.00 68.03  ? 250  LEU A C     1 
ATOM   1911 O O     . LEU A 1 250 ? 52.748  18.394  7.434   1.00 69.03  ? 250  LEU A O     1 
ATOM   1912 C CB    . LEU A 1 250 ? 51.163  16.451  5.261   1.00 66.89  ? 250  LEU A CB    1 
ATOM   1913 C CG    . LEU A 1 250 ? 50.923  17.845  4.646   1.00 67.01  ? 250  LEU A CG    1 
ATOM   1914 C CD1   . LEU A 1 250 ? 52.210  18.433  4.002   1.00 66.79  ? 250  LEU A CD1   1 
ATOM   1915 C CD2   . LEU A 1 250 ? 49.772  17.808  3.645   1.00 64.77  ? 250  LEU A CD2   1 
ATOM   1916 N N     . LEU A 1 251 ? 51.313  16.948  8.406   1.00 66.86  ? 251  LEU A N     1 
ATOM   1917 C CA    . LEU A 1 251 ? 51.077  17.812  9.560   1.00 66.62  ? 251  LEU A CA    1 
ATOM   1918 C C     . LEU A 1 251 ? 52.375  18.079  10.301  1.00 68.36  ? 251  LEU A C     1 
ATOM   1919 O O     . LEU A 1 251 ? 52.679  19.225  10.650  1.00 68.25  ? 251  LEU A O     1 
ATOM   1920 C CB    . LEU A 1 251 ? 50.074  17.178  10.528  1.00 65.07  ? 251  LEU A CB    1 
ATOM   1921 C CG    . LEU A 1 251 ? 49.763  18.083  11.727  1.00 64.50  ? 251  LEU A CG    1 
ATOM   1922 C CD1   . LEU A 1 251 ? 48.503  18.915  11.486  1.00 62.15  ? 251  LEU A CD1   1 
ATOM   1923 C CD2   . LEU A 1 251 ? 49.676  17.293  13.012  1.00 64.11  ? 251  LEU A CD2   1 
ATOM   1924 N N     . ALA A 1 252 ? 53.116  17.005  10.555  1.00 69.77  ? 252  ALA A N     1 
ATOM   1925 C CA    . ALA A 1 252 ? 54.430  17.080  11.192  1.00 72.18  ? 252  ALA A CA    1 
ATOM   1926 C C     . ALA A 1 252 ? 55.338  18.093  10.487  1.00 74.53  ? 252  ALA A C     1 
ATOM   1927 O O     . ALA A 1 252 ? 55.899  18.976  11.135  1.00 75.02  ? 252  ALA A O     1 
ATOM   1928 C CB    . ALA A 1 252 ? 55.079  15.700  11.225  1.00 72.69  ? 252  ALA A CB    1 
ATOM   1929 N N     . ARG A 1 253 ? 55.456  17.972  9.163   1.00 76.31  ? 253  ARG A N     1 
ATOM   1930 C CA    . ARG A 1 253 ? 56.194  18.949  8.344   1.00 78.96  ? 253  ARG A CA    1 
ATOM   1931 C C     . ARG A 1 253 ? 55.722  20.376  8.606   1.00 78.23  ? 253  ARG A C     1 
ATOM   1932 O O     . ARG A 1 253 ? 56.527  21.269  8.793   1.00 79.99  ? 253  ARG A O     1 
ATOM   1933 C CB    . ARG A 1 253 ? 56.011  18.679  6.846   1.00 78.94  ? 253  ARG A CB    1 
ATOM   1934 C CG    . ARG A 1 253 ? 56.736  17.483  6.301   1.00 81.33  ? 253  ARG A CG    1 
ATOM   1935 C CD    . ARG A 1 253 ? 56.686  17.443  4.763   1.00 83.56  ? 253  ARG A CD    1 
ATOM   1936 N NE    . ARG A 1 253 ? 57.997  17.057  4.228   1.00 89.72  ? 253  ARG A NE    1 
ATOM   1937 C CZ    . ARG A 1 253 ? 58.467  15.807  4.150   1.00 91.76  ? 253  ARG A CZ    1 
ATOM   1938 N NH1   . ARG A 1 253 ? 59.692  15.596  3.672   1.00 93.62  ? 253  ARG A NH1   1 
ATOM   1939 N NH2   . ARG A 1 253 ? 57.727  14.764  4.541   1.00 91.77  ? 253  ARG A NH2   1 
ATOM   1940 N N     . LEU A 1 254 ? 54.411  20.586  8.611   1.00 76.48  ? 254  LEU A N     1 
ATOM   1941 C CA    . LEU A 1 254 ? 53.860  21.946  8.697   1.00 76.08  ? 254  LEU A CA    1 
ATOM   1942 C C     . LEU A 1 254 ? 54.148  22.606  10.031  1.00 76.79  ? 254  LEU A C     1 
ATOM   1943 O O     . LEU A 1 254 ? 54.125  23.828  10.130  1.00 77.00  ? 254  LEU A O     1 
ATOM   1944 C CB    . LEU A 1 254 ? 52.354  21.950  8.449   1.00 73.50  ? 254  LEU A CB    1 
ATOM   1945 C CG    . LEU A 1 254 ? 51.894  21.606  7.033   1.00 72.81  ? 254  LEU A CG    1 
ATOM   1946 C CD1   . LEU A 1 254 ? 50.374  21.431  7.005   1.00 68.74  ? 254  LEU A CD1   1 
ATOM   1947 C CD2   . LEU A 1 254 ? 52.342  22.656  6.022   1.00 70.59  ? 254  LEU A CD2   1 
ATOM   1948 N N     . VAL A 1 255 ? 54.399  21.791  11.053  1.00 77.50  ? 255  VAL A N     1 
ATOM   1949 C CA    . VAL A 1 255 ? 54.728  22.293  12.389  1.00 78.45  ? 255  VAL A CA    1 
ATOM   1950 C C     . VAL A 1 255 ? 56.219  22.162  12.728  1.00 81.37  ? 255  VAL A C     1 
ATOM   1951 O O     . VAL A 1 255 ? 56.618  22.433  13.851  1.00 82.37  ? 255  VAL A O     1 
ATOM   1952 C CB    . VAL A 1 255 ? 53.855  21.626  13.490  1.00 76.78  ? 255  VAL A CB    1 
ATOM   1953 C CG1   . VAL A 1 255 ? 52.398  21.991  13.284  1.00 73.58  ? 255  VAL A CG1   1 
ATOM   1954 C CG2   . VAL A 1 255 ? 54.059  20.114  13.528  1.00 75.26  ? 255  VAL A CG2   1 
ATOM   1955 N N     . GLY A 1 256 ? 57.037  21.766  11.756  1.00 83.49  ? 256  GLY A N     1 
ATOM   1956 C CA    . GLY A 1 256 ? 58.492  21.787  11.915  1.00 86.63  ? 256  GLY A CA    1 
ATOM   1957 C C     . GLY A 1 256 ? 59.152  20.499  12.382  1.00 87.92  ? 256  GLY A C     1 
ATOM   1958 O O     . GLY A 1 256 ? 60.271  20.529  12.891  1.00 90.15  ? 256  GLY A O     1 
ATOM   1959 N N     . CYS A 1 257 ? 58.478  19.373  12.171  1.00 87.46  ? 257  CYS A N     1 
ATOM   1960 C CA    . CYS A 1 257 ? 58.961  18.061  12.578  1.00 88.53  ? 257  CYS A CA    1 
ATOM   1961 C C     . CYS A 1 257 ? 59.322  17.222  11.349  1.00 90.71  ? 257  CYS A C     1 
ATOM   1962 O O     . CYS A 1 257 ? 58.464  16.935  10.528  1.00 89.78  ? 257  CYS A O     1 
ATOM   1963 C CB    . CYS A 1 257 ? 57.896  17.354  13.418  1.00 86.18  ? 257  CYS A CB    1 
ATOM   1964 S SG    . CYS A 1 257 ? 57.713  18.062  15.084  1.00 84.30  ? 257  CYS A SG    1 
ATOM   1965 N N     . PRO A 1 258 ? 60.585  16.760  11.251  1.00 94.61  ? 258  PRO A N     1 
ATOM   1966 C CA    . PRO A 1 258 ? 61.031  16.244  9.950   1.00 96.33  ? 258  PRO A CA    1 
ATOM   1967 C C     . PRO A 1 258 ? 60.399  14.882  9.602   1.00 95.90  ? 258  PRO A C     1 
ATOM   1968 O O     . PRO A 1 258 ? 60.817  13.845  10.138  1.00 97.08  ? 258  PRO A O     1 
ATOM   1969 C CB    . PRO A 1 258 ? 62.555  16.119  10.114  1.00 99.00  ? 258  PRO A CB    1 
ATOM   1970 C CG    . PRO A 1 258 ? 62.863  16.427  11.571  1.00 98.86  ? 258  PRO A CG    1 
ATOM   1971 C CD    . PRO A 1 258 ? 61.600  16.570  12.311  1.00 95.86  ? 258  PRO A CD    1 
ATOM   1972 N N     . ASN A 1 265 ? 61.787  6.946   10.301  1.00 94.14  ? 265  ASN A N     1 
ATOM   1973 C CA    . ASN A 1 265 ? 61.629  6.548   11.706  1.00 93.33  ? 265  ASN A CA    1 
ATOM   1974 C C     . ASN A 1 265 ? 60.482  7.320   12.380  1.00 90.26  ? 265  ASN A C     1 
ATOM   1975 O O     . ASN A 1 265 ? 60.519  8.550   12.481  1.00 89.99  ? 265  ASN A O     1 
ATOM   1976 C CB    . ASN A 1 265 ? 62.964  6.757   12.444  1.00 95.58  ? 265  ASN A CB    1 
ATOM   1977 C CG    . ASN A 1 265 ? 62.878  6.462   13.934  1.00 95.52  ? 265  ASN A CG    1 
ATOM   1978 O OD1   . ASN A 1 265 ? 62.352  7.264   14.706  1.00 94.35  ? 265  ASN A OD1   1 
ATOM   1979 N ND2   . ASN A 1 265 ? 63.437  5.327   14.349  1.00 97.68  ? 265  ASN A ND2   1 
ATOM   1980 N N     . ASP A 1 266 ? 59.465  6.593   12.838  1.00 88.00  ? 266  ASP A N     1 
ATOM   1981 C CA    . ASP A 1 266 ? 58.273  7.213   13.435  1.00 84.98  ? 266  ASP A CA    1 
ATOM   1982 C C     . ASP A 1 266 ? 58.492  7.712   14.857  1.00 84.19  ? 266  ASP A C     1 
ATOM   1983 O O     . ASP A 1 266 ? 57.886  8.697   15.259  1.00 82.59  ? 266  ASP A O     1 
ATOM   1984 C CB    . ASP A 1 266 ? 57.094  6.239   13.437  1.00 83.50  ? 266  ASP A CB    1 
ATOM   1985 C CG    . ASP A 1 266 ? 56.621  5.881   12.044  1.00 83.05  ? 266  ASP A CG    1 
ATOM   1986 O OD1   . ASP A 1 266 ? 56.814  6.679   11.099  1.00 82.06  ? 266  ASP A OD1   1 
ATOM   1987 O OD2   . ASP A 1 266 ? 56.044  4.788   11.897  1.00 82.81  ? 266  ASP A OD2   1 
ATOM   1988 N N     . THR A 1 267 ? 59.338  7.029   15.621  1.00 84.87  ? 267  THR A N     1 
ATOM   1989 C CA    . THR A 1 267 ? 59.618  7.437   16.999  1.00 84.61  ? 267  THR A CA    1 
ATOM   1990 C C     . THR A 1 267 ? 60.093  8.885   17.075  1.00 84.66  ? 267  THR A C     1 
ATOM   1991 O O     . THR A 1 267 ? 59.652  9.638   17.933  1.00 83.64  ? 267  THR A O     1 
ATOM   1992 C CB    . THR A 1 267 ? 60.681  6.523   17.661  1.00 86.36  ? 267  THR A CB    1 
ATOM   1993 O OG1   . THR A 1 267 ? 60.179  5.186   17.724  1.00 86.14  ? 267  THR A OG1   1 
ATOM   1994 C CG2   . THR A 1 267 ? 61.012  6.990   19.078  1.00 86.47  ? 267  THR A CG2   1 
ATOM   1995 N N     . GLU A 1 268 ? 60.996  9.259   16.174  1.00 86.17  ? 268  GLU A N     1 
ATOM   1996 C CA    . GLU A 1 268 ? 61.600  10.594  16.176  1.00 86.78  ? 268  GLU A CA    1 
ATOM   1997 C C     . GLU A 1 268 ? 60.588  11.663  15.753  1.00 84.04  ? 268  GLU A C     1 
ATOM   1998 O O     . GLU A 1 268 ? 60.593  12.762  16.297  1.00 83.85  ? 268  GLU A O     1 
ATOM   1999 C CB    . GLU A 1 268 ? 62.854  10.634  15.278  1.00 88.98  ? 268  GLU A CB    1 
ATOM   2000 C CG    . GLU A 1 268 ? 63.581  11.986  15.288  1.00 90.85  ? 268  GLU A CG    1 
ATOM   2001 C CD    . GLU A 1 268 ? 64.867  12.010  14.441  1.00 94.00  ? 268  GLU A CD    1 
ATOM   2002 O OE1   . GLU A 1 268 ? 64.844  12.632  13.345  1.00 94.10  ? 268  GLU A OE1   1 
ATOM   2003 O OE2   . GLU A 1 268 ? 65.892  11.413  14.876  1.00 96.82  ? 268  GLU A OE2   1 
ATOM   2004 N N     . LEU A 1 269 ? 59.733  11.325  14.790  1.00 81.84  ? 269  LEU A N     1 
ATOM   2005 C CA    . LEU A 1 269 ? 58.698  12.226  14.290  1.00 79.67  ? 269  LEU A CA    1 
ATOM   2006 C C     . LEU A 1 269 ? 57.631  12.506  15.346  1.00 77.38  ? 269  LEU A C     1 
ATOM   2007 O O     . LEU A 1 269 ? 57.238  13.660  15.564  1.00 76.84  ? 269  LEU A O     1 
ATOM   2008 C CB    . LEU A 1 269 ? 58.048  11.627  13.034  1.00 78.82  ? 269  LEU A CB    1 
ATOM   2009 C CG    . LEU A 1 269 ? 56.975  12.460  12.325  1.00 77.68  ? 269  LEU A CG    1 
ATOM   2010 C CD1   . LEU A 1 269 ? 56.859  12.066  10.870  1.00 78.36  ? 269  LEU A CD1   1 
ATOM   2011 C CD2   . LEU A 1 269 ? 55.619  12.304  12.997  1.00 76.41  ? 269  LEU A CD2   1 
ATOM   2012 N N     . ILE A 1 270 ? 57.154  11.437  15.977  1.00 76.03  ? 270  ILE A N     1 
ATOM   2013 C CA    . ILE A 1 270 ? 56.109  11.523  16.993  1.00 73.82  ? 270  ILE A CA    1 
ATOM   2014 C C     . ILE A 1 270 ? 56.643  12.252  18.218  1.00 74.29  ? 270  ILE A C     1 
ATOM   2015 O O     . ILE A 1 270 ? 55.953  13.081  18.793  1.00 73.06  ? 270  ILE A O     1 
ATOM   2016 C CB    . ILE A 1 270 ? 55.591  10.117  17.377  1.00 73.16  ? 270  ILE A CB    1 
ATOM   2017 C CG1   . ILE A 1 270 ? 54.908  9.457   16.170  1.00 72.37  ? 270  ILE A CG1   1 
ATOM   2018 C CG2   . ILE A 1 270 ? 54.623  10.187  18.557  1.00 71.82  ? 270  ILE A CG2   1 
ATOM   2019 C CD1   . ILE A 1 270 ? 54.778  7.951   16.278  1.00 72.08  ? 270  ILE A CD1   1 
ATOM   2020 N N     . ALA A 1 271 ? 57.883  11.960  18.597  1.00 75.92  ? 271  ALA A N     1 
ATOM   2021 C CA    . ALA A 1 271 ? 58.503  12.617  19.749  1.00 77.05  ? 271  ALA A CA    1 
ATOM   2022 C C     . ALA A 1 271 ? 58.608  14.123  19.515  1.00 77.25  ? 271  ALA A C     1 
ATOM   2023 O O     . ALA A 1 271 ? 58.401  14.916  20.424  1.00 77.36  ? 271  ALA A O     1 
ATOM   2024 C CB    . ALA A 1 271 ? 59.885  12.009  20.061  1.00 78.44  ? 271  ALA A CB    1 
ATOM   2025 N N     . CYS A 1 272 ? 58.929  14.516  18.294  1.00 78.49  ? 272  CYS A N     1 
ATOM   2026 C CA    . CYS A 1 272 ? 58.962  15.932  17.939  1.00 78.45  ? 272  CYS A CA    1 
ATOM   2027 C C     . CYS A 1 272 ? 57.536  16.524  17.964  1.00 75.52  ? 272  CYS A C     1 
ATOM   2028 O O     . CYS A 1 272 ? 57.341  17.626  18.466  1.00 74.64  ? 272  CYS A O     1 
ATOM   2029 C CB    . CYS A 1 272 ? 59.655  16.130  16.580  1.00 80.23  ? 272  CYS A CB    1 
ATOM   2030 S SG    . CYS A 1 272 ? 59.619  17.823  15.945  1.00 82.81  ? 272  CYS A SG    1 
ATOM   2031 N N     . LEU A 1 273 ? 56.547  15.779  17.469  1.00 73.54  ? 273  LEU A N     1 
ATOM   2032 C CA    . LEU A 1 273 ? 55.138  16.216  17.555  1.00 71.61  ? 273  LEU A CA    1 
ATOM   2033 C C     . LEU A 1 273 ? 54.651  16.416  19.008  1.00 70.76  ? 273  LEU A C     1 
ATOM   2034 O O     . LEU A 1 273 ? 53.835  17.305  19.272  1.00 69.34  ? 273  LEU A O     1 
ATOM   2035 C CB    . LEU A 1 273 ? 54.187  15.238  16.835  1.00 70.19  ? 273  LEU A CB    1 
ATOM   2036 C CG    . LEU A 1 273 ? 53.934  15.379  15.320  1.00 70.14  ? 273  LEU A CG    1 
ATOM   2037 C CD1   . LEU A 1 273 ? 53.029  14.225  14.834  1.00 66.36  ? 273  LEU A CD1   1 
ATOM   2038 C CD2   . LEU A 1 273 ? 53.351  16.766  14.908  1.00 66.79  ? 273  LEU A CD2   1 
ATOM   2039 N N     . ARG A 1 274 ? 55.155  15.599  19.938  1.00 70.85  ? 274  ARG A N     1 
ATOM   2040 C CA    . ARG A 1 274 ? 54.788  15.715  21.353  1.00 70.29  ? 274  ARG A CA    1 
ATOM   2041 C C     . ARG A 1 274 ? 55.370  16.960  22.016  1.00 71.00  ? 274  ARG A C     1 
ATOM   2042 O O     . ARG A 1 274 ? 54.885  17.378  23.061  1.00 70.36  ? 274  ARG A O     1 
ATOM   2043 C CB    . ARG A 1 274 ? 55.198  14.465  22.145  1.00 70.16  ? 274  ARG A CB    1 
ATOM   2044 C CG    . ARG A 1 274 ? 54.387  13.223  21.805  1.00 69.45  ? 274  ARG A CG    1 
ATOM   2045 C CD    . ARG A 1 274 ? 54.479  12.144  22.865  1.00 70.19  ? 274  ARG A CD    1 
ATOM   2046 N NE    . ARG A 1 274 ? 55.874  11.796  23.137  1.00 74.49  ? 274  ARG A NE    1 
ATOM   2047 C CZ    . ARG A 1 274 ? 56.570  10.849  22.509  1.00 75.77  ? 274  ARG A CZ    1 
ATOM   2048 N NH1   . ARG A 1 274 ? 56.009  10.103  21.558  1.00 76.16  ? 274  ARG A NH1   1 
ATOM   2049 N NH2   . ARG A 1 274 ? 57.844  10.648  22.833  1.00 77.41  ? 274  ARG A NH2   1 
ATOM   2050 N N     . THR A 1 275 ? 56.402  17.554  21.425  1.00 72.28  ? 275  THR A N     1 
ATOM   2051 C CA    . THR A 1 275 ? 56.945  18.798  21.961  1.00 73.75  ? 275  THR A CA    1 
ATOM   2052 C C     . THR A 1 275 ? 56.190  20.038  21.485  1.00 73.09  ? 275  THR A C     1 
ATOM   2053 O O     . THR A 1 275 ? 56.449  21.133  21.973  1.00 73.91  ? 275  THR A O     1 
ATOM   2054 C CB    . THR A 1 275 ? 58.453  18.991  21.606  1.00 76.15  ? 275  THR A CB    1 
ATOM   2055 O OG1   . THR A 1 275 ? 58.596  19.143  20.188  1.00 76.80  ? 275  THR A OG1   1 
ATOM   2056 C CG2   . THR A 1 275 ? 59.277  17.826  22.087  1.00 75.43  ? 275  THR A CG2   1 
ATOM   2057 N N     . ARG A 1 276 ? 55.276  19.878  20.535  1.00 71.99  ? 276  ARG A N     1 
ATOM   2058 C CA    . ARG A 1 276 ? 54.624  21.028  19.912  1.00 72.20  ? 276  ARG A CA    1 
ATOM   2059 C C     . ARG A 1 276 ? 53.424  21.478  20.753  1.00 70.55  ? 276  ARG A C     1 
ATOM   2060 O O     . ARG A 1 276 ? 52.732  20.651  21.322  1.00 69.34  ? 276  ARG A O     1 
ATOM   2061 C CB    . ARG A 1 276 ? 54.195  20.699  18.477  1.00 71.86  ? 276  ARG A CB    1 
ATOM   2062 C CG    . ARG A 1 276 ? 55.362  20.382  17.517  1.00 74.76  ? 276  ARG A CG    1 
ATOM   2063 C CD    . ARG A 1 276 ? 56.153  21.618  17.112  1.00 79.78  ? 276  ARG A CD    1 
ATOM   2064 N NE    . ARG A 1 276 ? 57.458  21.664  17.773  1.00 84.30  ? 276  ARG A NE    1 
ATOM   2065 C CZ    . ARG A 1 276 ? 58.648  21.614  17.163  1.00 87.14  ? 276  ARG A CZ    1 
ATOM   2066 N NH1   . ARG A 1 276 ? 58.764  21.547  15.832  1.00 87.88  ? 276  ARG A NH1   1 
ATOM   2067 N NH2   . ARG A 1 276 ? 59.748  21.649  17.900  1.00 88.99  ? 276  ARG A NH2   1 
ATOM   2068 N N     . PRO A 1 277 ? 53.221  22.799  20.895  1.00 70.56  ? 277  PRO A N     1 
ATOM   2069 C CA    . PRO A 1 277 ? 52.024  23.302  21.575  1.00 69.00  ? 277  PRO A CA    1 
ATOM   2070 C C     . PRO A 1 277 ? 50.732  22.795  20.937  1.00 66.90  ? 277  PRO A C     1 
ATOM   2071 O O     . PRO A 1 277 ? 50.666  22.655  19.724  1.00 66.92  ? 277  PRO A O     1 
ATOM   2072 C CB    . PRO A 1 277 ? 52.138  24.818  21.417  1.00 69.83  ? 277  PRO A CB    1 
ATOM   2073 C CG    . PRO A 1 277 ? 53.595  25.069  21.234  1.00 72.53  ? 277  PRO A CG    1 
ATOM   2074 C CD    . PRO A 1 277 ? 54.129  23.886  20.492  1.00 72.10  ? 277  PRO A CD    1 
ATOM   2075 N N     . ALA A 1 278 ? 49.715  22.531  21.753  1.00 65.25  ? 278  ALA A N     1 
ATOM   2076 C CA    . ALA A 1 278 ? 48.444  22.010  21.264  1.00 63.14  ? 278  ALA A CA    1 
ATOM   2077 C C     . ALA A 1 278 ? 47.871  22.895  20.155  1.00 62.91  ? 278  ALA A C     1 
ATOM   2078 O O     . ALA A 1 278 ? 47.361  22.408  19.139  1.00 61.34  ? 278  ALA A O     1 
ATOM   2079 C CB    . ALA A 1 278 ? 47.456  21.876  22.420  1.00 61.89  ? 278  ALA A CB    1 
ATOM   2080 N N     . GLN A 1 279 ? 47.982  24.207  20.336  1.00 63.97  ? 279  GLN A N     1 
ATOM   2081 C CA    . GLN A 1 279 ? 47.370  25.123  19.402  1.00 63.68  ? 279  GLN A CA    1 
ATOM   2082 C C     . GLN A 1 279 ? 48.050  25.067  18.036  1.00 64.25  ? 279  GLN A C     1 
ATOM   2083 O O     . GLN A 1 279 ? 47.375  25.272  17.021  1.00 63.66  ? 279  GLN A O     1 
ATOM   2084 C CB    . GLN A 1 279 ? 47.360  26.545  19.966  1.00 65.10  ? 279  GLN A CB    1 
ATOM   2085 C CG    . GLN A 1 279 ? 46.395  27.489  19.232  1.00 65.82  ? 279  GLN A CG    1 
ATOM   2086 C CD    . GLN A 1 279 ? 44.964  27.032  19.336  1.00 64.89  ? 279  GLN A CD    1 
ATOM   2087 O OE1   . GLN A 1 279 ? 44.453  26.820  20.438  1.00 65.90  ? 279  GLN A OE1   1 
ATOM   2088 N NE2   . GLN A 1 279 ? 44.308  26.868  18.195  1.00 63.21  ? 279  GLN A NE2   1 
ATOM   2089 N N     . ASP A 1 280 ? 49.365  24.797  18.003  1.00 65.40  ? 280  ASP A N     1 
ATOM   2090 C CA    . ASP A 1 280 ? 50.113  24.623  16.734  1.00 66.28  ? 280  ASP A CA    1 
ATOM   2091 C C     . ASP A 1 280 ? 49.548  23.494  15.887  1.00 64.71  ? 280  ASP A C     1 
ATOM   2092 O O     . ASP A 1 280 ? 49.477  23.603  14.663  1.00 64.64  ? 280  ASP A O     1 
ATOM   2093 C CB    . ASP A 1 280 ? 51.608  24.332  16.970  1.00 68.26  ? 280  ASP A CB    1 
ATOM   2094 C CG    . ASP A 1 280 ? 52.400  25.565  17.323  1.00 71.18  ? 280  ASP A CG    1 
ATOM   2095 O OD1   . ASP A 1 280 ? 51.785  26.639  17.456  1.00 71.98  ? 280  ASP A OD1   1 
ATOM   2096 O OD2   . ASP A 1 280 ? 53.650  25.461  17.469  1.00 76.64  ? 280  ASP A OD2   1 
ATOM   2097 N N     . LEU A 1 281 ? 49.155  22.412  16.547  1.00 63.62  ? 281  LEU A N     1 
ATOM   2098 C CA    . LEU A 1 281 ? 48.566  21.274  15.854  1.00 62.58  ? 281  LEU A CA    1 
ATOM   2099 C C     . LEU A 1 281 ? 47.202  21.641  15.294  1.00 61.25  ? 281  LEU A C     1 
ATOM   2100 O O     . LEU A 1 281 ? 46.929  21.368  14.123  1.00 60.88  ? 281  LEU A O     1 
ATOM   2101 C CB    . LEU A 1 281 ? 48.489  20.048  16.778  1.00 61.82  ? 281  LEU A CB    1 
ATOM   2102 C CG    . LEU A 1 281 ? 49.844  19.522  17.311  1.00 62.99  ? 281  LEU A CG    1 
ATOM   2103 C CD1   . LEU A 1 281 ? 49.698  18.172  18.001  1.00 61.67  ? 281  LEU A CD1   1 
ATOM   2104 C CD2   . LEU A 1 281 ? 50.875  19.419  16.204  1.00 62.46  ? 281  LEU A CD2   1 
ATOM   2105 N N     . VAL A 1 282 ? 46.367  22.293  16.106  1.00 60.90  ? 282  VAL A N     1 
ATOM   2106 C CA    . VAL A 1 282 ? 45.022  22.714  15.665  1.00 59.77  ? 282  VAL A CA    1 
ATOM   2107 C C     . VAL A 1 282 ? 45.121  23.697  14.488  1.00 60.92  ? 282  VAL A C     1 
ATOM   2108 O O     . VAL A 1 282 ? 44.378  23.581  13.515  1.00 59.88  ? 282  VAL A O     1 
ATOM   2109 C CB    . VAL A 1 282 ? 44.172  23.308  16.838  1.00 59.23  ? 282  VAL A CB    1 
ATOM   2110 C CG1   . VAL A 1 282 ? 42.805  23.864  16.335  1.00 57.11  ? 282  VAL A CG1   1 
ATOM   2111 C CG2   . VAL A 1 282 ? 43.942  22.238  17.929  1.00 58.32  ? 282  VAL A CG2   1 
ATOM   2112 N N     . ASP A 1 283 ? 46.062  24.634  14.558  1.00 63.01  ? 283  ASP A N     1 
ATOM   2113 C CA    . ASP A 1 283 ? 46.230  25.637  13.492  1.00 64.63  ? 283  ASP A CA    1 
ATOM   2114 C C     . ASP A 1 283 ? 46.559  25.050  12.103  1.00 64.59  ? 283  ASP A C     1 
ATOM   2115 O O     . ASP A 1 283 ? 46.289  25.697  11.110  1.00 64.52  ? 283  ASP A O     1 
ATOM   2116 C CB    . ASP A 1 283 ? 47.293  26.687  13.872  1.00 66.45  ? 283  ASP A CB    1 
ATOM   2117 C CG    . ASP A 1 283 ? 46.850  27.607  15.024  1.00 68.07  ? 283  ASP A CG    1 
ATOM   2118 O OD1   . ASP A 1 283 ? 45.675  27.560  15.474  1.00 67.48  ? 283  ASP A OD1   1 
ATOM   2119 O OD2   . ASP A 1 283 ? 47.712  28.379  15.495  1.00 72.51  ? 283  ASP A OD2   1 
ATOM   2120 N N     . HIS A 1 284 ? 47.122  23.844  12.020  1.00 65.08  ? 284  HIS A N     1 
ATOM   2121 C CA    . HIS A 1 284 ? 47.400  23.233  10.706  1.00 65.91  ? 284  HIS A CA    1 
ATOM   2122 C C     . HIS A 1 284 ? 46.544  22.027  10.352  1.00 65.37  ? 284  HIS A C     1 
ATOM   2123 O O     . HIS A 1 284 ? 46.709  21.430  9.300   1.00 65.52  ? 284  HIS A O     1 
ATOM   2124 C CB    . HIS A 1 284 ? 48.879  22.898  10.584  1.00 67.69  ? 284  HIS A CB    1 
ATOM   2125 C CG    . HIS A 1 284 ? 49.756  24.105  10.656  1.00 69.45  ? 284  HIS A CG    1 
ATOM   2126 N ND1   . HIS A 1 284 ? 50.301  24.550  11.839  1.00 70.38  ? 284  HIS A ND1   1 
ATOM   2127 C CD2   . HIS A 1 284 ? 50.144  24.987  9.705   1.00 70.82  ? 284  HIS A CD2   1 
ATOM   2128 C CE1   . HIS A 1 284 ? 51.009  25.641  11.610  1.00 72.42  ? 284  HIS A CE1   1 
ATOM   2129 N NE2   . HIS A 1 284 ? 50.929  25.928  10.322  1.00 72.64  ? 284  HIS A NE2   1 
ATOM   2130 N N     . GLU A 1 285 ? 45.603  21.703  11.220  1.00 65.51  ? 285  GLU A N     1 
ATOM   2131 C CA    . GLU A 1 285 ? 44.741  20.527  11.071  1.00 65.98  ? 285  GLU A CA    1 
ATOM   2132 C C     . GLU A 1 285 ? 44.045  20.417  9.692   1.00 65.30  ? 285  GLU A C     1 
ATOM   2133 O O     . GLU A 1 285 ? 44.076  19.362  9.044   1.00 64.76  ? 285  GLU A O     1 
ATOM   2134 C CB    . GLU A 1 285 ? 43.700  20.579  12.189  1.00 64.90  ? 285  GLU A CB    1 
ATOM   2135 C CG    . GLU A 1 285 ? 42.818  19.396  12.267  1.00 65.90  ? 285  GLU A CG    1 
ATOM   2136 C CD    . GLU A 1 285 ? 41.978  19.389  13.524  1.00 65.61  ? 285  GLU A CD    1 
ATOM   2137 O OE1   . GLU A 1 285 ? 42.407  19.982  14.539  1.00 69.48  ? 285  GLU A OE1   1 
ATOM   2138 O OE2   . GLU A 1 285 ? 40.898  18.765  13.492  1.00 67.54  ? 285  GLU A OE2   1 
ATOM   2139 N N     . TRP A 1 286 ? 43.446  21.519  9.246   1.00 65.30  ? 286  TRP A N     1 
ATOM   2140 C CA    . TRP A 1 286 ? 42.740  21.565  7.959   1.00 65.19  ? 286  TRP A CA    1 
ATOM   2141 C C     . TRP A 1 286 ? 43.669  21.643  6.742   1.00 65.96  ? 286  TRP A C     1 
ATOM   2142 O O     . TRP A 1 286 ? 43.221  21.540  5.610   1.00 66.01  ? 286  TRP A O     1 
ATOM   2143 C CB    . TRP A 1 286 ? 41.780  22.758  7.936   1.00 65.44  ? 286  TRP A CB    1 
ATOM   2144 C CG    . TRP A 1 286 ? 40.777  22.652  8.991   1.00 65.09  ? 286  TRP A CG    1 
ATOM   2145 C CD1   . TRP A 1 286 ? 40.789  23.268  10.206  1.00 65.71  ? 286  TRP A CD1   1 
ATOM   2146 C CD2   . TRP A 1 286 ? 39.620  21.825  8.969   1.00 64.97  ? 286  TRP A CD2   1 
ATOM   2147 N NE1   . TRP A 1 286 ? 39.705  22.880  10.942  1.00 65.01  ? 286  TRP A NE1   1 
ATOM   2148 C CE2   . TRP A 1 286 ? 38.968  21.990  10.208  1.00 64.09  ? 286  TRP A CE2   1 
ATOM   2149 C CE3   . TRP A 1 286 ? 39.072  20.950  8.023   1.00 64.80  ? 286  TRP A CE3   1 
ATOM   2150 C CZ2   . TRP A 1 286 ? 37.789  21.340  10.520  1.00 63.05  ? 286  TRP A CZ2   1 
ATOM   2151 C CZ3   . TRP A 1 286 ? 37.898  20.284  8.340   1.00 63.63  ? 286  TRP A CZ3   1 
ATOM   2152 C CH2   . TRP A 1 286 ? 37.268  20.487  9.577   1.00 63.11  ? 286  TRP A CH2   1 
ATOM   2153 N N     . HIS A 1 287 ? 44.962  21.820  6.958   1.00 66.83  ? 287  HIS A N     1 
ATOM   2154 C CA    . HIS A 1 287 ? 45.883  21.988  5.834   1.00 67.87  ? 287  HIS A CA    1 
ATOM   2155 C C     . HIS A 1 287 ? 46.286  20.689  5.143   1.00 67.13  ? 287  HIS A C     1 
ATOM   2156 O O     . HIS A 1 287 ? 46.989  20.731  4.138   1.00 68.08  ? 287  HIS A O     1 
ATOM   2157 C CB    . HIS A 1 287 ? 47.132  22.739  6.287   1.00 69.59  ? 287  HIS A CB    1 
ATOM   2158 C CG    . HIS A 1 287 ? 46.867  24.151  6.710   1.00 71.58  ? 287  HIS A CG    1 
ATOM   2159 N ND1   . HIS A 1 287 ? 45.690  24.808  6.426   1.00 73.18  ? 287  HIS A ND1   1 
ATOM   2160 C CD2   . HIS A 1 287 ? 47.648  25.047  7.356   1.00 74.72  ? 287  HIS A CD2   1 
ATOM   2161 C CE1   . HIS A 1 287 ? 45.749  26.040  6.900   1.00 73.93  ? 287  HIS A CE1   1 
ATOM   2162 N NE2   . HIS A 1 287 ? 46.928  26.211  7.468   1.00 74.48  ? 287  HIS A NE2   1 
ATOM   2163 N N     . VAL A 1 288 ? 45.844  19.545  5.666   1.00 65.28  ? 288  VAL A N     1 
ATOM   2164 C CA    . VAL A 1 288 ? 46.330  18.250  5.191   1.00 64.80  ? 288  VAL A CA    1 
ATOM   2165 C C     . VAL A 1 288 ? 45.318  17.467  4.351   1.00 64.01  ? 288  VAL A C     1 
ATOM   2166 O O     . VAL A 1 288 ? 45.631  16.372  3.893   1.00 64.04  ? 288  VAL A O     1 
ATOM   2167 C CB    . VAL A 1 288 ? 46.854  17.362  6.367   1.00 64.88  ? 288  VAL A CB    1 
ATOM   2168 C CG1   . VAL A 1 288 ? 47.920  18.127  7.193   1.00 64.90  ? 288  VAL A CG1   1 
ATOM   2169 C CG2   . VAL A 1 288 ? 45.703  16.830  7.245   1.00 61.40  ? 288  VAL A CG2   1 
ATOM   2170 N N     . LEU A 1 289 ? 44.122  18.019  4.141   1.00 63.00  ? 289  LEU A N     1 
ATOM   2171 C CA    . LEU A 1 289 ? 43.108  17.356  3.307   1.00 62.73  ? 289  LEU A CA    1 
ATOM   2172 C C     . LEU A 1 289 ? 43.564  17.323  1.856   1.00 64.43  ? 289  LEU A C     1 
ATOM   2173 O O     . LEU A 1 289 ? 44.158  18.285  1.374   1.00 65.83  ? 289  LEU A O     1 
ATOM   2174 C CB    . LEU A 1 289 ? 41.740  18.045  3.404   1.00 60.95  ? 289  LEU A CB    1 
ATOM   2175 C CG    . LEU A 1 289 ? 40.938  17.856  4.696   1.00 59.00  ? 289  LEU A CG    1 
ATOM   2176 C CD1   . LEU A 1 289 ? 39.741  18.824  4.709   1.00 57.79  ? 289  LEU A CD1   1 
ATOM   2177 C CD2   . LEU A 1 289 ? 40.485  16.420  4.880   1.00 55.23  ? 289  LEU A CD2   1 
ATOM   2178 N N     . PRO A 1 290 ? 43.326  16.203  1.161   1.00 65.34  ? 290  PRO A N     1 
ATOM   2179 C CA    . PRO A 1 290 ? 43.872  16.065  -0.187  1.00 67.23  ? 290  PRO A CA    1 
ATOM   2180 C C     . PRO A 1 290 ? 43.256  16.987  -1.230  1.00 67.89  ? 290  PRO A C     1 
ATOM   2181 O O     . PRO A 1 290 ? 43.959  17.443  -2.119  1.00 68.93  ? 290  PRO A O     1 
ATOM   2182 C CB    . PRO A 1 290 ? 43.621  14.594  -0.527  1.00 67.47  ? 290  PRO A CB    1 
ATOM   2183 C CG    . PRO A 1 290 ? 42.518  14.162  0.379   1.00 65.93  ? 290  PRO A CG    1 
ATOM   2184 C CD    . PRO A 1 290 ? 42.599  15.001  1.601   1.00 64.64  ? 290  PRO A CD    1 
ATOM   2185 N N     . GLN A 1 291 ? 41.956  17.248  -1.133  1.00 68.09  ? 291  GLN A N     1 
ATOM   2186 C CA    . GLN A 1 291 ? 41.275  18.157  -2.062  1.00 68.92  ? 291  GLN A CA    1 
ATOM   2187 C C     . GLN A 1 291 ? 40.529  19.253  -1.314  1.00 67.90  ? 291  GLN A C     1 
ATOM   2188 O O     . GLN A 1 291 ? 40.258  19.135  -0.122  1.00 67.15  ? 291  GLN A O     1 
ATOM   2189 C CB    . GLN A 1 291 ? 40.264  17.392  -2.940  1.00 69.32  ? 291  GLN A CB    1 
ATOM   2190 C CG    . GLN A 1 291 ? 40.793  16.116  -3.600  1.00 71.60  ? 291  GLN A CG    1 
ATOM   2191 C CD    . GLN A 1 291 ? 40.666  14.899  -2.711  1.00 74.28  ? 291  GLN A CD    1 
ATOM   2192 O OE1   . GLN A 1 291 ? 41.321  13.869  -2.940  1.00 75.48  ? 291  GLN A OE1   1 
ATOM   2193 N NE2   . GLN A 1 291 ? 39.828  15.009  -1.669  1.00 73.94  ? 291  GLN A NE2   1 
ATOM   2194 N N     . GLU A 1 292 ? 40.185  20.315  -2.035  1.00 68.14  ? 292  GLU A N     1 
ATOM   2195 C CA    . GLU A 1 292 ? 39.213  21.279  -1.561  1.00 67.74  ? 292  GLU A CA    1 
ATOM   2196 C C     . GLU A 1 292 ? 37.883  20.538  -1.389  1.00 65.54  ? 292  GLU A C     1 
ATOM   2197 O O     . GLU A 1 292 ? 37.402  19.894  -2.322  1.00 66.19  ? 292  GLU A O     1 
ATOM   2198 C CB    . GLU A 1 292 ? 39.066  22.422  -2.565  1.00 68.52  ? 292  GLU A CB    1 
ATOM   2199 C CG    . GLU A 1 292 ? 38.129  23.534  -2.088  1.00 69.97  ? 292  GLU A CG    1 
ATOM   2200 C CD    . GLU A 1 292 ? 37.818  24.565  -3.156  1.00 71.66  ? 292  GLU A CD    1 
ATOM   2201 O OE1   . GLU A 1 292 ? 38.541  24.612  -4.184  1.00 78.73  ? 292  GLU A OE1   1 
ATOM   2202 O OE2   . GLU A 1 292 ? 36.848  25.341  -2.957  1.00 76.49  ? 292  GLU A OE2   1 
ATOM   2203 N N     . SER A 1 293 ? 37.293  20.618  -0.203  1.00 63.35  ? 293  SER A N     1 
ATOM   2204 C CA    . SER A 1 293 ? 36.203  19.710  0.155   1.00 61.45  ? 293  SER A CA    1 
ATOM   2205 C C     . SER A 1 293 ? 35.318  20.235  1.283   1.00 59.59  ? 293  SER A C     1 
ATOM   2206 O O     . SER A 1 293 ? 35.744  21.085  2.062   1.00 59.90  ? 293  SER A O     1 
ATOM   2207 C CB    . SER A 1 293 ? 36.785  18.348  0.561   1.00 61.54  ? 293  SER A CB    1 
ATOM   2208 O OG    . SER A 1 293 ? 37.690  18.450  1.656   1.00 61.53  ? 293  SER A OG    1 
ATOM   2209 N N     . ILE A 1 294 ? 34.075  19.753  1.339   1.00 57.37  ? 294  ILE A N     1 
ATOM   2210 C CA    . ILE A 1 294 ? 33.269  19.846  2.545   1.00 54.97  ? 294  ILE A CA    1 
ATOM   2211 C C     . ILE A 1 294 ? 32.912  18.424  2.996   1.00 54.43  ? 294  ILE A C     1 
ATOM   2212 O O     . ILE A 1 294 ? 33.053  17.449  2.236   1.00 54.49  ? 294  ILE A O     1 
ATOM   2213 C CB    . ILE A 1 294 ? 31.983  20.727  2.396   1.00 55.08  ? 294  ILE A CB    1 
ATOM   2214 C CG1   . ILE A 1 294 ? 31.037  20.204  1.307   1.00 55.11  ? 294  ILE A CG1   1 
ATOM   2215 C CG2   . ILE A 1 294 ? 32.336  22.190  2.150   1.00 53.39  ? 294  ILE A CG2   1 
ATOM   2216 C CD1   . ILE A 1 294 ? 29.607  20.636  1.506   1.00 53.25  ? 294  ILE A CD1   1 
ATOM   2217 N N     . PHE A 1 295 ? 32.507  18.307  4.258   1.00 52.86  ? 295  PHE A N     1 
ATOM   2218 C CA    . PHE A 1 295 ? 32.168  17.020  4.858   1.00 51.93  ? 295  PHE A CA    1 
ATOM   2219 C C     . PHE A 1 295 ? 33.350  16.050  4.772   1.00 51.99  ? 295  PHE A C     1 
ATOM   2220 O O     . PHE A 1 295 ? 33.170  14.841  4.576   1.00 52.01  ? 295  PHE A O     1 
ATOM   2221 C CB    . PHE A 1 295 ? 30.906  16.439  4.196   1.00 51.77  ? 295  PHE A CB    1 
ATOM   2222 C CG    . PHE A 1 295 ? 29.956  15.787  5.156   1.00 51.31  ? 295  PHE A CG    1 
ATOM   2223 C CD1   . PHE A 1 295 ? 30.398  14.847  6.080   1.00 51.59  ? 295  PHE A CD1   1 
ATOM   2224 C CD2   . PHE A 1 295 ? 28.601  16.092  5.117   1.00 51.36  ? 295  PHE A CD2   1 
ATOM   2225 C CE1   . PHE A 1 295 ? 29.518  14.249  6.950   1.00 50.94  ? 295  PHE A CE1   1 
ATOM   2226 C CE2   . PHE A 1 295 ? 27.715  15.490  5.993   1.00 49.88  ? 295  PHE A CE2   1 
ATOM   2227 C CZ    . PHE A 1 295 ? 28.176  14.566  6.905   1.00 50.81  ? 295  PHE A CZ    1 
ATOM   2228 N N     . ARG A 1 296 ? 34.560  16.598  4.898   1.00 51.97  ? 296  ARG A N     1 
ATOM   2229 C CA    . ARG A 1 296 ? 35.770  15.807  5.051   1.00 51.86  ? 296  ARG A CA    1 
ATOM   2230 C C     . ARG A 1 296 ? 36.610  16.391  6.180   1.00 51.76  ? 296  ARG A C     1 
ATOM   2231 O O     . ARG A 1 296 ? 36.759  17.607  6.304   1.00 51.21  ? 296  ARG A O     1 
ATOM   2232 C CB    . ARG A 1 296 ? 36.595  15.774  3.776   1.00 52.63  ? 296  ARG A CB    1 
ATOM   2233 C CG    . ARG A 1 296 ? 35.946  15.073  2.615   1.00 53.42  ? 296  ARG A CG    1 
ATOM   2234 C CD    . ARG A 1 296 ? 35.712  13.584  2.820   1.00 54.28  ? 296  ARG A CD    1 
ATOM   2235 N NE    . ARG A 1 296 ? 35.171  13.013  1.583   1.00 55.30  ? 296  ARG A NE    1 
ATOM   2236 C CZ    . ARG A 1 296 ? 33.875  12.874  1.300   1.00 56.61  ? 296  ARG A CZ    1 
ATOM   2237 N NH1   . ARG A 1 296 ? 32.926  13.265  2.147   1.00 57.18  ? 296  ARG A NH1   1 
ATOM   2238 N NH2   . ARG A 1 296 ? 33.512  12.356  0.135   1.00 56.56  ? 296  ARG A NH2   1 
ATOM   2239 N N     . PHE A 1 297 ? 37.170  15.487  6.985   1.00 51.68  ? 297  PHE A N     1 
ATOM   2240 C CA    . PHE A 1 297 ? 37.837  15.830  8.223   1.00 51.29  ? 297  PHE A CA    1 
ATOM   2241 C C     . PHE A 1 297 ? 39.200  15.146  8.261   1.00 52.31  ? 297  PHE A C     1 
ATOM   2242 O O     . PHE A 1 297 ? 39.350  13.998  7.841   1.00 52.71  ? 297  PHE A O     1 
ATOM   2243 C CB    . PHE A 1 297 ? 36.935  15.416  9.389   1.00 49.79  ? 297  PHE A CB    1 
ATOM   2244 C CG    . PHE A 1 297 ? 35.491  15.718  9.133   1.00 48.70  ? 297  PHE A CG    1 
ATOM   2245 C CD1   . PHE A 1 297 ? 35.060  17.050  9.020   1.00 47.88  ? 297  PHE A CD1   1 
ATOM   2246 C CD2   . PHE A 1 297 ? 34.571  14.691  8.922   1.00 46.44  ? 297  PHE A CD2   1 
ATOM   2247 C CE1   . PHE A 1 297 ? 33.715  17.338  8.742   1.00 47.90  ? 297  PHE A CE1   1 
ATOM   2248 C CE2   . PHE A 1 297 ? 33.240  14.975  8.638   1.00 46.31  ? 297  PHE A CE2   1 
ATOM   2249 C CZ    . PHE A 1 297 ? 32.808  16.305  8.552   1.00 46.35  ? 297  PHE A CZ    1 
ATOM   2250 N N     . SER A 1 298 ? 40.197  15.877  8.744   1.00 52.89  ? 298  SER A N     1 
ATOM   2251 C CA    . SER A 1 298 ? 41.584  15.478  8.566   1.00 53.81  ? 298  SER A CA    1 
ATOM   2252 C C     . SER A 1 298 ? 41.963  14.251  9.385   1.00 53.77  ? 298  SER A C     1 
ATOM   2253 O O     . SER A 1 298 ? 42.619  13.340  8.881   1.00 54.90  ? 298  SER A O     1 
ATOM   2254 C CB    . SER A 1 298 ? 42.495  16.642  8.930   1.00 54.58  ? 298  SER A CB    1 
ATOM   2255 O OG    . SER A 1 298 ? 42.351  17.684  7.986   1.00 54.84  ? 298  SER A OG    1 
ATOM   2256 N N     . PHE A 1 299 ? 41.550  14.226  10.648  1.00 53.03  ? 299  PHE A N     1 
ATOM   2257 C CA    . PHE A 1 299 ? 41.950  13.155  11.567  1.00 52.63  ? 299  PHE A CA    1 
ATOM   2258 C C     . PHE A 1 299 ? 40.733  12.414  12.109  1.00 51.70  ? 299  PHE A C     1 
ATOM   2259 O O     . PHE A 1 299 ? 40.002  12.929  12.945  1.00 51.73  ? 299  PHE A O     1 
ATOM   2260 C CB    . PHE A 1 299 ? 42.844  13.744  12.646  1.00 52.57  ? 299  PHE A CB    1 
ATOM   2261 C CG    . PHE A 1 299 ? 44.103  14.358  12.076  1.00 53.49  ? 299  PHE A CG    1 
ATOM   2262 C CD1   . PHE A 1 299 ? 45.160  13.544  11.675  1.00 54.02  ? 299  PHE A CD1   1 
ATOM   2263 C CD2   . PHE A 1 299 ? 44.192  15.729  11.843  1.00 52.84  ? 299  PHE A CD2   1 
ATOM   2264 C CE1   . PHE A 1 299 ? 46.307  14.079  11.099  1.00 53.63  ? 299  PHE A CE1   1 
ATOM   2265 C CE2   . PHE A 1 299 ? 45.341  16.278  11.275  1.00 53.94  ? 299  PHE A CE2   1 
ATOM   2266 C CZ    . PHE A 1 299 ? 46.404  15.446  10.909  1.00 55.51  ? 299  PHE A CZ    1 
ATOM   2267 N N     . VAL A 1 300 ? 40.529  11.203  11.584  1.00 51.87  ? 300  VAL A N     1 
ATOM   2268 C CA    . VAL A 1 300 ? 39.342  10.379  11.811  1.00 50.90  ? 300  VAL A CA    1 
ATOM   2269 C C     . VAL A 1 300 ? 39.773  8.910   12.049  1.00 52.24  ? 300  VAL A C     1 
ATOM   2270 O O     . VAL A 1 300 ? 40.945  8.574   11.916  1.00 53.22  ? 300  VAL A O     1 
ATOM   2271 C CB    . VAL A 1 300 ? 38.390  10.464  10.580  1.00 50.84  ? 300  VAL A CB    1 
ATOM   2272 C CG1   . VAL A 1 300 ? 37.883  11.910  10.352  1.00 49.15  ? 300  VAL A CG1   1 
ATOM   2273 C CG2   . VAL A 1 300 ? 39.071  9.954   9.320   1.00 50.13  ? 300  VAL A CG2   1 
ATOM   2274 N N     . PRO A 1 301 ? 38.841  8.035   12.458  1.00 52.27  ? 301  PRO A N     1 
ATOM   2275 C CA    . PRO A 1 301 ? 39.216  6.630   12.580  1.00 52.86  ? 301  PRO A CA    1 
ATOM   2276 C C     . PRO A 1 301 ? 39.993  6.052   11.375  1.00 54.47  ? 301  PRO A C     1 
ATOM   2277 O O     . PRO A 1 301 ? 39.675  6.326   10.214  1.00 54.04  ? 301  PRO A O     1 
ATOM   2278 C CB    . PRO A 1 301 ? 37.873  5.926   12.785  1.00 52.33  ? 301  PRO A CB    1 
ATOM   2279 C CG    . PRO A 1 301 ? 37.042  6.970   13.518  1.00 51.97  ? 301  PRO A CG    1 
ATOM   2280 C CD    . PRO A 1 301 ? 37.461  8.293   12.934  1.00 51.23  ? 301  PRO A CD    1 
ATOM   2281 N N     . VAL A 1 302 ? 41.028  5.275   11.686  1.00 55.67  ? 302  VAL A N     1 
ATOM   2282 C CA    . VAL A 1 302 ? 41.860  4.624   10.682  1.00 57.27  ? 302  VAL A CA    1 
ATOM   2283 C C     . VAL A 1 302 ? 41.573  3.116   10.669  1.00 58.75  ? 302  VAL A C     1 
ATOM   2284 O O     . VAL A 1 302 ? 41.433  2.472   11.729  1.00 58.60  ? 302  VAL A O     1 
ATOM   2285 C CB    . VAL A 1 302 ? 43.387  4.877   10.924  1.00 58.11  ? 302  VAL A CB    1 
ATOM   2286 C CG1   . VAL A 1 302 ? 43.811  4.418   12.319  1.00 57.01  ? 302  VAL A CG1   1 
ATOM   2287 C CG2   . VAL A 1 302 ? 44.236  4.198   9.846   1.00 58.96  ? 302  VAL A CG2   1 
ATOM   2288 N N     . VAL A 1 303 ? 41.487  2.569   9.457   1.00 59.90  ? 303  VAL A N     1 
ATOM   2289 C CA    . VAL A 1 303 ? 41.381  1.136   9.260   1.00 61.05  ? 303  VAL A CA    1 
ATOM   2290 C C     . VAL A 1 303 ? 42.785  0.641   9.527   1.00 63.09  ? 303  VAL A C     1 
ATOM   2291 O O     . VAL A 1 303 ? 43.661  0.682   8.651   1.00 64.27  ? 303  VAL A O     1 
ATOM   2292 C CB    . VAL A 1 303 ? 40.847  0.788   7.844   1.00 61.60  ? 303  VAL A CB    1 
ATOM   2293 C CG1   . VAL A 1 303 ? 40.720  -0.714  7.662   1.00 62.06  ? 303  VAL A CG1   1 
ATOM   2294 C CG2   . VAL A 1 303 ? 39.489  1.478   7.617   1.00 58.84  ? 303  VAL A CG2   1 
ATOM   2295 N N     . ASP A 1 304 ? 42.987  0.232   10.779  1.00 63.90  ? 304  ASP A N     1 
ATOM   2296 C CA    . ASP A 1 304 ? 44.297  -0.133  11.320  1.00 65.39  ? 304  ASP A CA    1 
ATOM   2297 C C     . ASP A 1 304 ? 44.526  -1.641  11.334  1.00 67.38  ? 304  ASP A C     1 
ATOM   2298 O O     . ASP A 1 304 ? 45.649  -2.094  11.572  1.00 68.84  ? 304  ASP A O     1 
ATOM   2299 C CB    . ASP A 1 304 ? 44.493  0.446   12.746  1.00 64.44  ? 304  ASP A CB    1 
ATOM   2300 C CG    . ASP A 1 304 ? 43.408  0.000   13.750  1.00 64.27  ? 304  ASP A CG    1 
ATOM   2301 O OD1   . ASP A 1 304 ? 42.324  -0.480  13.332  1.00 64.45  ? 304  ASP A OD1   1 
ATOM   2302 O OD2   . ASP A 1 304 ? 43.638  0.151   14.980  1.00 63.59  ? 304  ASP A OD2   1 
ATOM   2303 N N     . GLY A 1 305 ? 43.472  -2.416  11.079  1.00 67.73  ? 305  GLY A N     1 
ATOM   2304 C CA    . GLY A 1 305 ? 43.562  -3.874  11.146  1.00 69.30  ? 305  GLY A CA    1 
ATOM   2305 C C     . GLY A 1 305 ? 43.595  -4.365  12.582  1.00 69.53  ? 305  GLY A C     1 
ATOM   2306 O O     . GLY A 1 305 ? 44.062  -5.456  12.844  1.00 70.79  ? 305  GLY A O     1 
ATOM   2307 N N     . ASP A 1 306 ? 43.086  -3.551  13.509  1.00 68.49  ? 306  ASP A N     1 
ATOM   2308 C CA    . ASP A 1 306 ? 43.136  -3.840  14.947  1.00 68.02  ? 306  ASP A CA    1 
ATOM   2309 C C     . ASP A 1 306 ? 41.804  -3.409  15.569  1.00 66.28  ? 306  ASP A C     1 
ATOM   2310 O O     . ASP A 1 306 ? 40.927  -4.255  15.722  1.00 66.45  ? 306  ASP A O     1 
ATOM   2311 C CB    . ASP A 1 306 ? 44.355  -3.148  15.580  1.00 68.44  ? 306  ASP A CB    1 
ATOM   2312 C CG    . ASP A 1 306 ? 44.434  -3.316  17.102  1.00 69.33  ? 306  ASP A CG    1 
ATOM   2313 O OD1   . ASP A 1 306 ? 43.740  -4.184  17.702  1.00 70.46  ? 306  ASP A OD1   1 
ATOM   2314 O OD2   . ASP A 1 306 ? 45.233  -2.556  17.699  1.00 72.33  ? 306  ASP A OD2   1 
ATOM   2315 N N     . PHE A 1 307 ? 41.618  -2.123  15.903  1.00 64.26  ? 307  PHE A N     1 
ATOM   2316 C CA    . PHE A 1 307 ? 40.269  -1.658  16.292  1.00 62.77  ? 307  PHE A CA    1 
ATOM   2317 C C     . PHE A 1 307 ? 39.321  -2.000  15.148  1.00 62.74  ? 307  PHE A C     1 
ATOM   2318 O O     . PHE A 1 307 ? 38.274  -2.594  15.361  1.00 62.73  ? 307  PHE A O     1 
ATOM   2319 C CB    . PHE A 1 307 ? 40.209  -0.153  16.619  1.00 61.07  ? 307  PHE A CB    1 
ATOM   2320 C CG    . PHE A 1 307 ? 38.934  0.272   17.323  1.00 59.91  ? 307  PHE A CG    1 
ATOM   2321 C CD1   . PHE A 1 307 ? 37.745  0.435   16.618  1.00 58.83  ? 307  PHE A CD1   1 
ATOM   2322 C CD2   . PHE A 1 307 ? 38.917  0.495   18.699  1.00 59.96  ? 307  PHE A CD2   1 
ATOM   2323 C CE1   . PHE A 1 307 ? 36.558  0.809   17.275  1.00 56.63  ? 307  PHE A CE1   1 
ATOM   2324 C CE2   . PHE A 1 307 ? 37.732  0.877   19.365  1.00 57.97  ? 307  PHE A CE2   1 
ATOM   2325 C CZ    . PHE A 1 307 ? 36.557  1.022   18.656  1.00 56.75  ? 307  PHE A CZ    1 
ATOM   2326 N N     . LEU A 1 308 ? 39.711  -1.635  13.930  1.00 63.03  ? 308  LEU A N     1 
ATOM   2327 C CA    . LEU A 1 308 ? 38.949  -1.971  12.743  1.00 63.33  ? 308  LEU A CA    1 
ATOM   2328 C C     . LEU A 1 308 ? 39.725  -3.017  11.960  1.00 65.58  ? 308  LEU A C     1 
ATOM   2329 O O     . LEU A 1 308 ? 40.679  -2.692  11.253  1.00 65.94  ? 308  LEU A O     1 
ATOM   2330 C CB    . LEU A 1 308 ? 38.703  -0.723  11.893  1.00 62.44  ? 308  LEU A CB    1 
ATOM   2331 C CG    . LEU A 1 308 ? 37.786  0.345   12.507  1.00 60.26  ? 308  LEU A CG    1 
ATOM   2332 C CD1   . LEU A 1 308 ? 37.671  1.537   11.576  1.00 58.00  ? 308  LEU A CD1   1 
ATOM   2333 C CD2   . LEU A 1 308 ? 36.407  -0.233  12.800  1.00 59.71  ? 308  LEU A CD2   1 
ATOM   2334 N N     . SER A 1 309 ? 39.320  -4.277  12.106  1.00 66.89  ? 309  SER A N     1 
ATOM   2335 C CA    . SER A 1 309 ? 40.010  -5.386  11.459  1.00 69.31  ? 309  SER A CA    1 
ATOM   2336 C C     . SER A 1 309 ? 39.962  -5.291  9.932   1.00 69.90  ? 309  SER A C     1 
ATOM   2337 O O     . SER A 1 309 ? 40.857  -5.773  9.258   1.00 71.34  ? 309  SER A O     1 
ATOM   2338 C CB    . SER A 1 309 ? 39.437  -6.733  11.947  1.00 70.71  ? 309  SER A CB    1 
ATOM   2339 O OG    . SER A 1 309 ? 38.038  -6.807  11.731  1.00 70.78  ? 309  SER A OG    1 
ATOM   2340 N N     . ASP A 1 310 ? 38.920  -4.663  9.401   1.00 69.25  ? 310  ASP A N     1 
ATOM   2341 C CA    . ASP A 1 310 ? 38.792  -4.402  7.973   1.00 69.92  ? 310  ASP A CA    1 
ATOM   2342 C C     . ASP A 1 310 ? 38.071  -3.056  7.778   1.00 68.64  ? 310  ASP A C     1 
ATOM   2343 O O     . ASP A 1 310 ? 37.721  -2.388  8.752   1.00 67.67  ? 310  ASP A O     1 
ATOM   2344 C CB    . ASP A 1 310 ? 38.003  -5.536  7.322   1.00 70.99  ? 310  ASP A CB    1 
ATOM   2345 C CG    . ASP A 1 310 ? 38.378  -5.761  5.869   1.00 73.01  ? 310  ASP A CG    1 
ATOM   2346 O OD1   . ASP A 1 310 ? 38.812  -4.800  5.197   1.00 72.37  ? 310  ASP A OD1   1 
ATOM   2347 O OD2   . ASP A 1 310 ? 38.244  -6.915  5.394   1.00 75.85  ? 310  ASP A OD2   1 
ATOM   2348 N N     . THR A 1 311 ? 37.845  -2.652  6.533   1.00 69.24  ? 311  THR A N     1 
ATOM   2349 C CA    . THR A 1 311 ? 37.018  -1.475  6.260   1.00 68.07  ? 311  THR A CA    1 
ATOM   2350 C C     . THR A 1 311 ? 35.626  -1.738  6.826   1.00 68.09  ? 311  THR A C     1 
ATOM   2351 O O     . THR A 1 311 ? 35.178  -2.894  6.829   1.00 68.92  ? 311  THR A O     1 
ATOM   2352 C CB    . THR A 1 311 ? 36.880  -1.204  4.748   1.00 68.66  ? 311  THR A CB    1 
ATOM   2353 O OG1   . THR A 1 311 ? 36.258  -2.332  4.126   1.00 69.96  ? 311  THR A OG1   1 
ATOM   2354 C CG2   . THR A 1 311 ? 38.247  -0.959  4.091   1.00 68.20  ? 311  THR A CG2   1 
ATOM   2355 N N     . PRO A 1 312 ? 34.948  -0.689  7.339   1.00 66.90  ? 312  PRO A N     1 
ATOM   2356 C CA    . PRO A 1 312 ? 33.549  -0.810  7.726   1.00 66.95  ? 312  PRO A CA    1 
ATOM   2357 C C     . PRO A 1 312 ? 32.642  -1.366  6.631   1.00 68.62  ? 312  PRO A C     1 
ATOM   2358 O O     . PRO A 1 312 ? 31.679  -2.042  6.943   1.00 68.86  ? 312  PRO A O     1 
ATOM   2359 C CB    . PRO A 1 312 ? 33.157  0.636   8.070   1.00 65.22  ? 312  PRO A CB    1 
ATOM   2360 C CG    . PRO A 1 312 ? 34.395  1.228   8.553   1.00 64.49  ? 312  PRO A CG    1 
ATOM   2361 C CD    . PRO A 1 312 ? 35.458  0.658   7.643   1.00 65.88  ? 312  PRO A CD    1 
ATOM   2362 N N     . GLU A 1 313 ? 32.951  -1.075  5.369   1.00 70.28  ? 313  GLU A N     1 
ATOM   2363 C CA    . GLU A 1 313 ? 32.199  -1.616  4.232   1.00 72.56  ? 313  GLU A CA    1 
ATOM   2364 C C     . GLU A 1 313 ? 32.288  -3.138  4.233   1.00 73.67  ? 313  GLU A C     1 
ATOM   2365 O O     . GLU A 1 313 ? 31.285  -3.832  4.086   1.00 74.17  ? 313  GLU A O     1 
ATOM   2366 C CB    . GLU A 1 313 ? 32.732  -1.057  2.893   1.00 72.98  ? 313  GLU A CB    1 
ATOM   2367 C CG    . GLU A 1 313 ? 31.671  -1.022  1.778   1.00 75.43  ? 313  GLU A CG    1 
ATOM   2368 C CD    . GLU A 1 313 ? 32.248  -1.010  0.350   1.00 77.69  ? 313  GLU A CD    1 
ATOM   2369 O OE1   . GLU A 1 313 ? 33.356  -1.562  0.117   1.00 83.45  ? 313  GLU A OE1   1 
ATOM   2370 O OE2   . GLU A 1 313 ? 31.560  -0.470  -0.558  1.00 81.85  ? 313  GLU A OE2   1 
ATOM   2371 N N     . ALA A 1 314 ? 33.499  -3.649  4.420   1.00 74.51  ? 314  ALA A N     1 
ATOM   2372 C CA    . ALA A 1 314 ? 33.725  -5.093  4.451   1.00 76.22  ? 314  ALA A CA    1 
ATOM   2373 C C     . ALA A 1 314 ? 32.999  -5.698  5.639   1.00 76.14  ? 314  ALA A C     1 
ATOM   2374 O O     . ALA A 1 314 ? 32.290  -6.685  5.494   1.00 77.59  ? 314  ALA A O     1 
ATOM   2375 C CB    . ALA A 1 314 ? 35.222  -5.411  4.508   1.00 76.58  ? 314  ALA A CB    1 
ATOM   2376 N N     . LEU A 1 315 ? 33.153  -5.080  6.808   1.00 75.13  ? 315  LEU A N     1 
ATOM   2377 C CA    . LEU A 1 315 ? 32.606  -5.627  8.052   1.00 75.03  ? 315  LEU A CA    1 
ATOM   2378 C C     . LEU A 1 315 ? 31.076  -5.610  8.107   1.00 75.51  ? 315  LEU A C     1 
ATOM   2379 O O     . LEU A 1 315 ? 30.477  -6.541  8.644   1.00 76.40  ? 315  LEU A O     1 
ATOM   2380 C CB    . LEU A 1 315 ? 33.197  -4.912  9.270   1.00 73.39  ? 315  LEU A CB    1 
ATOM   2381 C CG    . LEU A 1 315 ? 34.714  -5.040  9.460   1.00 73.03  ? 315  LEU A CG    1 
ATOM   2382 C CD1   . LEU A 1 315 ? 35.185  -4.127  10.573  1.00 70.23  ? 315  LEU A CD1   1 
ATOM   2383 C CD2   . LEU A 1 315 ? 35.152  -6.492  9.722   1.00 73.10  ? 315  LEU A CD2   1 
ATOM   2384 N N     . ILE A 1 316 ? 30.432  -4.584  7.553   1.00 75.31  ? 316  ILE A N     1 
ATOM   2385 C CA    . ILE A 1 316 ? 28.959  -4.610  7.465   1.00 76.33  ? 316  ILE A CA    1 
ATOM   2386 C C     . ILE A 1 316 ? 28.433  -5.602  6.397   1.00 78.71  ? 316  ILE A C     1 
ATOM   2387 O O     . ILE A 1 316 ? 27.364  -6.177  6.582   1.00 79.40  ? 316  ILE A O     1 
ATOM   2388 C CB    . ILE A 1 316 ? 28.298  -3.197  7.288   1.00 74.17  ? 316  ILE A CB    1 
ATOM   2389 C CG1   . ILE A 1 316 ? 28.469  -2.641  5.870   1.00 74.61  ? 316  ILE A CG1   1 
ATOM   2390 C CG2   . ILE A 1 316 ? 28.832  -2.222  8.321   1.00 72.37  ? 316  ILE A CG2   1 
ATOM   2391 C CD1   . ILE A 1 316 ? 27.541  -1.413  5.559   1.00 73.02  ? 316  ILE A CD1   1 
ATOM   2392 N N     . ASN A 1 317 ? 29.165  -5.796  5.296   1.00 80.31  ? 317  ASN A N     1 
ATOM   2393 C CA    . ASN A 1 317 ? 28.724  -6.730  4.254   1.00 82.73  ? 317  ASN A CA    1 
ATOM   2394 C C     . ASN A 1 317 ? 28.834  -8.197  4.711   1.00 85.07  ? 317  ASN A C     1 
ATOM   2395 O O     . ASN A 1 317 ? 28.091  -9.041  4.219   1.00 87.02  ? 317  ASN A O     1 
ATOM   2396 C CB    . ASN A 1 317 ? 29.512  -6.555  2.942   1.00 83.62  ? 317  ASN A CB    1 
ATOM   2397 C CG    . ASN A 1 317 ? 29.153  -5.269  2.161   1.00 84.02  ? 317  ASN A CG    1 
ATOM   2398 O OD1   . ASN A 1 317 ? 28.182  -4.555  2.463   1.00 85.51  ? 317  ASN A OD1   1 
ATOM   2399 N ND2   . ASN A 1 317 ? 29.957  -4.980  1.129   1.00 85.35  ? 317  ASN A ND2   1 
ATOM   2400 N N     . THR A 1 318 ? 29.750  -8.507  5.634   1.00 85.33  ? 318  THR A N     1 
ATOM   2401 C CA    . THR A 1 318 ? 29.990  -9.907  6.045   1.00 87.41  ? 318  THR A CA    1 
ATOM   2402 C C     . THR A 1 318 ? 29.690  -10.211 7.515   1.00 87.27  ? 318  THR A C     1 
ATOM   2403 O O     . THR A 1 318 ? 29.830  -11.348 7.942   1.00 88.85  ? 318  THR A O     1 
ATOM   2404 C CB    . THR A 1 318 ? 31.463  -10.324 5.799   1.00 88.60  ? 318  THR A CB    1 
ATOM   2405 O OG1   . THR A 1 318 ? 32.313  -9.682  6.764   1.00 87.86  ? 318  THR A OG1   1 
ATOM   2406 C CG2   . THR A 1 318 ? 31.912  -9.947  4.387   1.00 89.18  ? 318  THR A CG2   1 
ATOM   2407 N N     . GLY A 1 319 ? 29.295  -9.209  8.292   1.00 85.65  ? 319  GLY A N     1 
ATOM   2408 C CA    . GLY A 1 319 ? 29.075  -9.400  9.722   1.00 85.47  ? 319  GLY A CA    1 
ATOM   2409 C C     . GLY A 1 319 ? 27.847  -10.234 10.062  1.00 86.74  ? 319  GLY A C     1 
ATOM   2410 O O     . GLY A 1 319 ? 26.912  -10.348 9.262   1.00 87.43  ? 319  GLY A O     1 
ATOM   2411 N N     . ASP A 1 320 ? 27.870  -10.820 11.258  1.00 87.16  ? 320  ASP A N     1 
ATOM   2412 C CA    . ASP A 1 320 ? 26.731  -11.528 11.827  1.00 88.25  ? 320  ASP A CA    1 
ATOM   2413 C C     . ASP A 1 320 ? 26.185  -10.663 12.963  1.00 86.37  ? 320  ASP A C     1 
ATOM   2414 O O     . ASP A 1 320 ? 26.843  -10.516 13.998  1.00 85.83  ? 320  ASP A O     1 
ATOM   2415 C CB    . ASP A 1 320 ? 27.183  -12.895 12.354  1.00 90.41  ? 320  ASP A CB    1 
ATOM   2416 C CG    . ASP A 1 320 ? 26.074  -13.656 13.066  1.00 92.23  ? 320  ASP A CG    1 
ATOM   2417 O OD1   . ASP A 1 320 ? 24.927  -13.154 13.120  1.00 92.07  ? 320  ASP A OD1   1 
ATOM   2418 O OD2   . ASP A 1 320 ? 26.354  -14.768 13.569  1.00 95.11  ? 320  ASP A OD2   1 
ATOM   2419 N N     . PHE A 1 321 ? 24.992  -10.095 12.770  1.00 85.43  ? 321  PHE A N     1 
ATOM   2420 C CA    . PHE A 1 321 ? 24.447  -9.083  13.691  1.00 83.61  ? 321  PHE A CA    1 
ATOM   2421 C C     . PHE A 1 321 ? 23.135  -9.521  14.329  1.00 84.39  ? 321  PHE A C     1 
ATOM   2422 O O     . PHE A 1 321 ? 22.221  -8.708  14.535  1.00 83.07  ? 321  PHE A O     1 
ATOM   2423 C CB    . PHE A 1 321 ? 24.229  -7.774  12.935  1.00 82.00  ? 321  PHE A CB    1 
ATOM   2424 C CG    . PHE A 1 321 ? 25.462  -7.243  12.304  1.00 80.68  ? 321  PHE A CG    1 
ATOM   2425 C CD1   . PHE A 1 321 ? 26.493  -6.767  13.090  1.00 79.10  ? 321  PHE A CD1   1 
ATOM   2426 C CD2   . PHE A 1 321 ? 25.600  -7.222  10.925  1.00 80.88  ? 321  PHE A CD2   1 
ATOM   2427 C CE1   . PHE A 1 321 ? 27.642  -6.271  12.518  1.00 79.20  ? 321  PHE A CE1   1 
ATOM   2428 C CE2   . PHE A 1 321 ? 26.745  -6.729  10.343  1.00 80.80  ? 321  PHE A CE2   1 
ATOM   2429 C CZ    . PHE A 1 321 ? 27.773  -6.250  11.142  1.00 79.93  ? 321  PHE A CZ    1 
ATOM   2430 N N     . GLN A 1 322 ? 23.078  -10.800 14.688  1.00 86.12  ? 322  GLN A N     1 
ATOM   2431 C CA    . GLN A 1 322 ? 21.818  -11.483 14.940  1.00 87.59  ? 322  GLN A CA    1 
ATOM   2432 C C     . GLN A 1 322 ? 21.182  -11.101 16.271  1.00 86.02  ? 322  GLN A C     1 
ATOM   2433 O O     . GLN A 1 322 ? 19.964  -10.943 16.353  1.00 86.66  ? 322  GLN A O     1 
ATOM   2434 C CB    . GLN A 1 322 ? 22.029  -13.000 14.869  1.00 90.16  ? 322  GLN A CB    1 
ATOM   2435 C CG    . GLN A 1 322 ? 20.846  -13.771 14.300  1.00 93.18  ? 322  GLN A CG    1 
ATOM   2436 C CD    . GLN A 1 322 ? 21.262  -15.108 13.701  1.00 95.77  ? 322  GLN A CD    1 
ATOM   2437 O OE1   . GLN A 1 322 ? 20.753  -16.160 14.093  1.00 99.41  ? 322  GLN A OE1   1 
ATOM   2438 N NE2   . GLN A 1 322 ? 22.199  -15.070 12.747  1.00 97.25  ? 322  GLN A NE2   1 
ATOM   2439 N N     . ASP A 1 323 ? 21.989  -10.952 17.313  1.00 84.22  ? 323  ASP A N     1 
ATOM   2440 C CA    . ASP A 1 323 ? 21.446  -10.579 18.615  1.00 82.87  ? 323  ASP A CA    1 
ATOM   2441 C C     . ASP A 1 323 ? 21.680  -9.054  18.857  1.00 79.79  ? 323  ASP A C     1 
ATOM   2442 O O     . ASP A 1 323 ? 22.130  -8.631  19.925  1.00 78.29  ? 323  ASP A O     1 
ATOM   2443 C CB    . ASP A 1 323 ? 22.019  -11.496 19.724  1.00 84.40  ? 323  ASP A CB    1 
ATOM   2444 C CG    . ASP A 1 323 ? 21.485  -12.990 19.634  1.00 89.18  ? 323  ASP A CG    1 
ATOM   2445 O OD1   . ASP A 1 323 ? 20.658  -13.391 20.491  1.00 90.95  ? 323  ASP A OD1   1 
ATOM   2446 O OD2   . ASP A 1 323 ? 21.887  -13.768 18.723  1.00 91.77  ? 323  ASP A OD2   1 
ATOM   2447 N N     . LEU A 1 324 ? 21.353  -8.249  17.842  1.00 77.61  ? 324  LEU A N     1 
ATOM   2448 C CA    . LEU A 1 324 ? 21.567  -6.791  17.874  1.00 75.26  ? 324  LEU A CA    1 
ATOM   2449 C C     . LEU A 1 324 ? 20.320  -6.036  17.433  1.00 73.01  ? 324  LEU A C     1 
ATOM   2450 O O     . LEU A 1 324 ? 19.756  -6.313  16.376  1.00 73.15  ? 324  LEU A O     1 
ATOM   2451 C CB    . LEU A 1 324 ? 22.734  -6.381  16.957  1.00 74.47  ? 324  LEU A CB    1 
ATOM   2452 C CG    . LEU A 1 324 ? 23.122  -4.892  17.000  1.00 72.77  ? 324  LEU A CG    1 
ATOM   2453 C CD1   . LEU A 1 324 ? 23.777  -4.541  18.330  1.00 71.47  ? 324  LEU A CD1   1 
ATOM   2454 C CD2   . LEU A 1 324 ? 24.028  -4.527  15.843  1.00 72.21  ? 324  LEU A CD2   1 
ATOM   2455 N N     . GLN A 1 325 ? 19.897  -5.080  18.247  1.00 70.55  ? 325  GLN A N     1 
ATOM   2456 C CA    . GLN A 1 325 ? 18.817  -4.183  17.862  1.00 69.30  ? 325  GLN A CA    1 
ATOM   2457 C C     . GLN A 1 325 ? 19.386  -2.806  17.649  1.00 66.17  ? 325  GLN A C     1 
ATOM   2458 O O     . GLN A 1 325 ? 20.189  -2.338  18.459  1.00 65.19  ? 325  GLN A O     1 
ATOM   2459 C CB    . GLN A 1 325 ? 17.715  -4.136  18.921  1.00 69.99  ? 325  GLN A CB    1 
ATOM   2460 C CG    . GLN A 1 325 ? 17.121  -5.488  19.255  1.00 72.74  ? 325  GLN A CG    1 
ATOM   2461 C CD    . GLN A 1 325 ? 17.785  -6.153  20.447  1.00 74.99  ? 325  GLN A CD    1 
ATOM   2462 O OE1   . GLN A 1 325 ? 18.226  -5.488  21.381  1.00 73.01  ? 325  GLN A OE1   1 
ATOM   2463 N NE2   . GLN A 1 325 ? 17.838  -7.485  20.426  1.00 78.81  ? 325  GLN A NE2   1 
ATOM   2464 N N     . VAL A 1 326 ? 18.965  -2.161  16.562  1.00 64.73  ? 326  VAL A N     1 
ATOM   2465 C CA    . VAL A 1 326 ? 19.514  -0.873  16.142  1.00 62.25  ? 326  VAL A CA    1 
ATOM   2466 C C     . VAL A 1 326 ? 18.422  0.087   15.646  1.00 61.68  ? 326  VAL A C     1 
ATOM   2467 O O     . VAL A 1 326 ? 17.523  -0.312  14.900  1.00 62.53  ? 326  VAL A O     1 
ATOM   2468 C CB    . VAL A 1 326 ? 20.553  -1.039  14.995  1.00 62.21  ? 326  VAL A CB    1 
ATOM   2469 C CG1   . VAL A 1 326 ? 21.394  0.211   14.851  1.00 59.98  ? 326  VAL A CG1   1 
ATOM   2470 C CG2   . VAL A 1 326 ? 21.453  -2.243  15.231  1.00 62.88  ? 326  VAL A CG2   1 
ATOM   2471 N N     . LEU A 1 327 ? 18.538  1.351   16.057  1.00 59.79  ? 327  LEU A N     1 
ATOM   2472 C CA    . LEU A 1 327 ? 17.689  2.435   15.615  1.00 59.11  ? 327  LEU A CA    1 
ATOM   2473 C C     . LEU A 1 327 ? 18.546  3.428   14.811  1.00 57.37  ? 327  LEU A C     1 
ATOM   2474 O O     . LEU A 1 327 ? 19.617  3.834   15.254  1.00 55.77  ? 327  LEU A O     1 
ATOM   2475 C CB    . LEU A 1 327 ? 17.070  3.131   16.838  1.00 59.14  ? 327  LEU A CB    1 
ATOM   2476 C CG    . LEU A 1 327 ? 16.151  4.353   16.640  1.00 59.46  ? 327  LEU A CG    1 
ATOM   2477 C CD1   . LEU A 1 327 ? 14.935  4.014   15.812  1.00 61.49  ? 327  LEU A CD1   1 
ATOM   2478 C CD2   . LEU A 1 327 ? 15.729  4.918   18.012  1.00 59.72  ? 327  LEU A CD2   1 
ATOM   2479 N N     . VAL A 1 328 ? 18.090  3.794   13.618  1.00 56.72  ? 328  VAL A N     1 
ATOM   2480 C CA    . VAL A 1 328 ? 18.904  4.597   12.711  1.00 55.82  ? 328  VAL A CA    1 
ATOM   2481 C C     . VAL A 1 328 ? 17.999  5.596   12.020  1.00 55.11  ? 328  VAL A C     1 
ATOM   2482 O O     . VAL A 1 328 ? 16.837  5.299   11.765  1.00 55.31  ? 328  VAL A O     1 
ATOM   2483 C CB    . VAL A 1 328 ? 19.654  3.734   11.632  1.00 56.67  ? 328  VAL A CB    1 
ATOM   2484 C CG1   . VAL A 1 328 ? 20.455  2.612   12.285  1.00 57.35  ? 328  VAL A CG1   1 
ATOM   2485 C CG2   . VAL A 1 328 ? 18.676  3.126   10.613  1.00 57.18  ? 328  VAL A CG2   1 
ATOM   2486 N N     . GLY A 1 329 ? 18.525  6.780   11.724  1.00 53.25  ? 329  GLY A N     1 
ATOM   2487 C CA    . GLY A 1 329 ? 17.760  7.724   10.948  1.00 52.81  ? 329  GLY A CA    1 
ATOM   2488 C C     . GLY A 1 329 ? 18.505  8.953   10.514  1.00 51.56  ? 329  GLY A C     1 
ATOM   2489 O O     . GLY A 1 329 ? 19.720  9.080   10.728  1.00 51.16  ? 329  GLY A O     1 
ATOM   2490 N N     . VAL A 1 330 ? 17.747  9.846   9.885   1.00 51.01  ? 330  VAL A N     1 
ATOM   2491 C CA    . VAL A 1 330 ? 18.260  11.023  9.237   1.00 50.75  ? 330  VAL A CA    1 
ATOM   2492 C C     . VAL A 1 330 ? 17.291  12.177  9.441   1.00 51.12  ? 330  VAL A C     1 
ATOM   2493 O O     . VAL A 1 330 ? 16.142  11.963  9.808   1.00 51.97  ? 330  VAL A O     1 
ATOM   2494 C CB    . VAL A 1 330 ? 18.463  10.792  7.716   1.00 51.27  ? 330  VAL A CB    1 
ATOM   2495 C CG1   . VAL A 1 330 ? 19.461  9.655   7.461   1.00 50.67  ? 330  VAL A CG1   1 
ATOM   2496 C CG2   . VAL A 1 330 ? 17.118  10.509  7.020   1.00 51.52  ? 330  VAL A CG2   1 
ATOM   2497 N N     . VAL A 1 331 ? 17.777  13.395  9.233   1.00 51.15  ? 331  VAL A N     1 
ATOM   2498 C CA    . VAL A 1 331 ? 16.927  14.590  9.210   1.00 52.01  ? 331  VAL A CA    1 
ATOM   2499 C C     . VAL A 1 331 ? 16.578  14.906  7.759   1.00 52.86  ? 331  VAL A C     1 
ATOM   2500 O O     . VAL A 1 331 ? 17.184  14.358  6.840   1.00 53.36  ? 331  VAL A O     1 
ATOM   2501 C CB    . VAL A 1 331 ? 17.597  15.814  9.879   1.00 51.34  ? 331  VAL A CB    1 
ATOM   2502 C CG1   . VAL A 1 331 ? 17.927  15.489  11.318  1.00 50.58  ? 331  VAL A CG1   1 
ATOM   2503 C CG2   . VAL A 1 331 ? 18.853  16.248  9.118   1.00 50.04  ? 331  VAL A CG2   1 
ATOM   2504 N N     . LYS A 1 332 ? 15.585  15.766  7.557   1.00 53.80  ? 332  LYS A N     1 
ATOM   2505 C CA    . LYS A 1 332 ? 15.047  16.008  6.220   1.00 54.56  ? 332  LYS A CA    1 
ATOM   2506 C C     . LYS A 1 332 ? 16.116  16.659  5.325   1.00 54.07  ? 332  LYS A C     1 
ATOM   2507 O O     . LYS A 1 332 ? 16.187  16.360  4.132   1.00 54.04  ? 332  LYS A O     1 
ATOM   2508 C CB    . LYS A 1 332 ? 13.768  16.865  6.312   1.00 55.38  ? 332  LYS A CB    1 
ATOM   2509 C CG    . LYS A 1 332 ? 13.020  17.114  5.002   1.00 56.20  ? 332  LYS A CG    1 
ATOM   2510 C CD    . LYS A 1 332 ? 11.678  17.859  5.229   1.00 58.31  ? 332  LYS A CD    1 
ATOM   2511 C CE    . LYS A 1 332 ? 11.506  19.125  4.311   1.00 63.18  ? 332  LYS A CE    1 
ATOM   2512 N NZ    . LYS A 1 332 ? 12.501  20.330  4.588   1.00 61.51  ? 332  LYS A NZ    1 
ATOM   2513 N N     . ASP A 1 333 ? 16.971  17.513  5.904   1.00 53.34  ? 333  ASP A N     1 
ATOM   2514 C CA    . ASP A 1 333 ? 17.951  18.265  5.106   1.00 52.86  ? 333  ASP A CA    1 
ATOM   2515 C C     . ASP A 1 333 ? 19.387  18.124  5.627   1.00 52.12  ? 333  ASP A C     1 
ATOM   2516 O O     . ASP A 1 333 ? 19.983  19.078  6.156   1.00 51.88  ? 333  ASP A O     1 
ATOM   2517 C CB    . ASP A 1 333 ? 17.527  19.734  5.017   1.00 52.76  ? 333  ASP A CB    1 
ATOM   2518 C CG    . ASP A 1 333 ? 16.158  19.905  4.370   1.00 54.10  ? 333  ASP A CG    1 
ATOM   2519 O OD1   . ASP A 1 333 ? 15.156  20.049  5.083   1.00 55.95  ? 333  ASP A OD1   1 
ATOM   2520 O OD2   . ASP A 1 333 ? 16.059  19.854  3.137   1.00 57.63  ? 333  ASP A OD2   1 
ATOM   2521 N N     . GLU A 1 334 ? 19.955  16.941  5.427   1.00 51.72  ? 334  GLU A N     1 
ATOM   2522 C CA    . GLU A 1 334 ? 21.291  16.631  5.936   1.00 51.41  ? 334  GLU A CA    1 
ATOM   2523 C C     . GLU A 1 334 ? 22.399  17.561  5.376   1.00 51.23  ? 334  GLU A C     1 
ATOM   2524 O O     . GLU A 1 334 ? 23.305  17.946  6.112   1.00 51.40  ? 334  GLU A O     1 
ATOM   2525 C CB    . GLU A 1 334 ? 21.640  15.166  5.643   1.00 51.59  ? 334  GLU A CB    1 
ATOM   2526 C CG    . GLU A 1 334 ? 20.843  14.158  6.434   1.00 52.30  ? 334  GLU A CG    1 
ATOM   2527 C CD    . GLU A 1 334 ? 21.221  14.103  7.927   1.00 53.34  ? 334  GLU A CD    1 
ATOM   2528 O OE1   . GLU A 1 334 ? 22.200  14.785  8.338   1.00 50.99  ? 334  GLU A OE1   1 
ATOM   2529 O OE2   . GLU A 1 334 ? 20.525  13.369  8.686   1.00 52.03  ? 334  GLU A OE2   1 
ATOM   2530 N N     . GLY A 1 335 ? 22.315  17.927  4.096   1.00 50.99  ? 335  GLY A N     1 
ATOM   2531 C CA    . GLY A 1 335 ? 23.391  18.654  3.438   1.00 50.72  ? 335  GLY A CA    1 
ATOM   2532 C C     . GLY A 1 335 ? 23.479  20.152  3.678   1.00 50.56  ? 335  GLY A C     1 
ATOM   2533 O O     . GLY A 1 335 ? 24.546  20.717  3.563   1.00 50.75  ? 335  GLY A O     1 
ATOM   2534 N N     . SER A 1 336 ? 22.371  20.800  4.013   1.00 50.71  ? 336  SER A N     1 
ATOM   2535 C CA    . SER A 1 336 ? 22.287  22.259  3.941   1.00 51.26  ? 336  SER A CA    1 
ATOM   2536 C C     . SER A 1 336 ? 23.323  22.947  4.820   1.00 51.01  ? 336  SER A C     1 
ATOM   2537 O O     . SER A 1 336 ? 24.043  23.820  4.375   1.00 51.07  ? 336  SER A O     1 
ATOM   2538 C CB    . SER A 1 336 ? 20.858  22.740  4.280   1.00 51.73  ? 336  SER A CB    1 
ATOM   2539 O OG    . SER A 1 336 ? 20.412  22.295  5.565   1.00 51.78  ? 336  SER A OG    1 
ATOM   2540 N N     . TYR A 1 337 ? 23.434  22.494  6.058   1.00 50.99  ? 337  TYR A N     1 
ATOM   2541 C CA    . TYR A 1 337 ? 24.369  23.072  7.031   1.00 50.80  ? 337  TYR A CA    1 
ATOM   2542 C C     . TYR A 1 337 ? 25.813  23.113  6.523   1.00 50.95  ? 337  TYR A C     1 
ATOM   2543 O O     . TYR A 1 337 ? 26.542  24.084  6.754   1.00 50.79  ? 337  TYR A O     1 
ATOM   2544 C CB    . TYR A 1 337 ? 24.251  22.292  8.330   1.00 50.68  ? 337  TYR A CB    1 
ATOM   2545 C CG    . TYR A 1 337 ? 25.342  22.471  9.324   1.00 51.60  ? 337  TYR A CG    1 
ATOM   2546 C CD1   . TYR A 1 337 ? 25.279  23.468  10.294  1.00 53.18  ? 337  TYR A CD1   1 
ATOM   2547 C CD2   . TYR A 1 337 ? 26.423  21.624  9.331   1.00 52.30  ? 337  TYR A CD2   1 
ATOM   2548 C CE1   . TYR A 1 337 ? 26.296  23.632  11.229  1.00 52.25  ? 337  TYR A CE1   1 
ATOM   2549 C CE2   . TYR A 1 337 ? 27.448  21.785  10.254  1.00 53.65  ? 337  TYR A CE2   1 
ATOM   2550 C CZ    . TYR A 1 337 ? 27.371  22.783  11.203  1.00 52.45  ? 337  TYR A CZ    1 
ATOM   2551 O OH    . TYR A 1 337 ? 28.397  22.899  12.121  1.00 53.41  ? 337  TYR A OH    1 
ATOM   2552 N N     . PHE A 1 338 ? 26.198  22.067  5.803   1.00 50.67  ? 338  PHE A N     1 
ATOM   2553 C CA    . PHE A 1 338 ? 27.559  21.918  5.319   1.00 51.13  ? 338  PHE A CA    1 
ATOM   2554 C C     . PHE A 1 338 ? 27.910  22.827  4.152   1.00 51.57  ? 338  PHE A C     1 
ATOM   2555 O O     . PHE A 1 338 ? 29.082  23.084  3.905   1.00 51.02  ? 338  PHE A O     1 
ATOM   2556 C CB    . PHE A 1 338 ? 27.803  20.448  4.955   1.00 51.08  ? 338  PHE A CB    1 
ATOM   2557 C CG    . PHE A 1 338 ? 27.746  19.547  6.145   1.00 50.80  ? 338  PHE A CG    1 
ATOM   2558 C CD1   . PHE A 1 338 ? 26.549  18.951  6.521   1.00 50.40  ? 338  PHE A CD1   1 
ATOM   2559 C CD2   . PHE A 1 338 ? 28.867  19.372  6.947   1.00 50.23  ? 338  PHE A CD2   1 
ATOM   2560 C CE1   . PHE A 1 338 ? 26.478  18.165  7.664   1.00 50.01  ? 338  PHE A CE1   1 
ATOM   2561 C CE2   . PHE A 1 338 ? 28.803  18.566  8.083   1.00 50.78  ? 338  PHE A CE2   1 
ATOM   2562 C CZ    . PHE A 1 338 ? 27.612  17.957  8.432   1.00 49.32  ? 338  PHE A CZ    1 
ATOM   2563 N N     . LEU A 1 339 ? 26.894  23.319  3.448   1.00 51.84  ? 339  LEU A N     1 
ATOM   2564 C CA    . LEU A 1 339 ? 27.135  24.118  2.254   1.00 52.75  ? 339  LEU A CA    1 
ATOM   2565 C C     . LEU A 1 339 ? 27.790  25.463  2.552   1.00 53.42  ? 339  LEU A C     1 
ATOM   2566 O O     . LEU A 1 339 ? 28.532  25.986  1.731   1.00 54.09  ? 339  LEU A O     1 
ATOM   2567 C CB    . LEU A 1 339 ? 25.835  24.321  1.484   1.00 52.64  ? 339  LEU A CB    1 
ATOM   2568 C CG    . LEU A 1 339 ? 25.142  23.033  1.028   1.00 51.83  ? 339  LEU A CG    1 
ATOM   2569 C CD1   . LEU A 1 339 ? 23.906  23.374  0.190   1.00 51.61  ? 339  LEU A CD1   1 
ATOM   2570 C CD2   . LEU A 1 339 ? 26.105  22.091  0.267   1.00 50.29  ? 339  LEU A CD2   1 
ATOM   2571 N N     . VAL A 1 340 ? 27.525  26.007  3.733   1.00 54.05  ? 340  VAL A N     1 
ATOM   2572 C CA    . VAL A 1 340 ? 28.021  27.333  4.109   1.00 55.00  ? 340  VAL A CA    1 
ATOM   2573 C C     . VAL A 1 340 ? 29.447  27.276  4.667   1.00 55.74  ? 340  VAL A C     1 
ATOM   2574 O O     . VAL A 1 340 ? 30.063  28.302  4.875   1.00 56.97  ? 340  VAL A O     1 
ATOM   2575 C CB    . VAL A 1 340 ? 27.064  28.036  5.114   1.00 54.83  ? 340  VAL A CB    1 
ATOM   2576 C CG1   . VAL A 1 340 ? 25.644  28.055  4.560   1.00 54.77  ? 340  VAL A CG1   1 
ATOM   2577 C CG2   . VAL A 1 340 ? 27.092  27.358  6.506   1.00 53.65  ? 340  VAL A CG2   1 
ATOM   2578 N N     . TYR A 1 341 ? 29.973  26.080  4.886   1.00 56.06  ? 341  TYR A N     1 
ATOM   2579 C CA    . TYR A 1 341 ? 31.362  25.909  5.330   1.00 57.08  ? 341  TYR A CA    1 
ATOM   2580 C C     . TYR A 1 341 ? 32.317  25.557  4.172   1.00 57.95  ? 341  TYR A C     1 
ATOM   2581 O O     . TYR A 1 341 ? 33.303  24.837  4.367   1.00 58.50  ? 341  TYR A O     1 
ATOM   2582 C CB    . TYR A 1 341 ? 31.431  24.838  6.453   1.00 56.82  ? 341  TYR A CB    1 
ATOM   2583 C CG    . TYR A 1 341 ? 30.840  25.348  7.760   1.00 57.26  ? 341  TYR A CG    1 
ATOM   2584 C CD1   . TYR A 1 341 ? 29.495  25.148  8.077   1.00 55.45  ? 341  TYR A CD1   1 
ATOM   2585 C CD2   . TYR A 1 341 ? 31.614  26.097  8.641   1.00 58.33  ? 341  TYR A CD2   1 
ATOM   2586 C CE1   . TYR A 1 341 ? 28.952  25.652  9.247   1.00 54.92  ? 341  TYR A CE1   1 
ATOM   2587 C CE2   . TYR A 1 341 ? 31.074  26.598  9.824   1.00 57.54  ? 341  TYR A CE2   1 
ATOM   2588 C CZ    . TYR A 1 341 ? 29.753  26.373  10.114  1.00 56.79  ? 341  TYR A CZ    1 
ATOM   2589 O OH    . TYR A 1 341 ? 29.244  26.878  11.288  1.00 58.04  ? 341  TYR A OH    1 
ATOM   2590 N N     . GLY A 1 342 ? 32.056  26.066  2.970   1.00 58.66  ? 342  GLY A N     1 
ATOM   2591 C CA    . GLY A 1 342 ? 32.972  25.801  1.855   1.00 59.24  ? 342  GLY A CA    1 
ATOM   2592 C C     . GLY A 1 342 ? 32.474  25.846  0.420   1.00 59.65  ? 342  GLY A C     1 
ATOM   2593 O O     . GLY A 1 342 ? 33.297  25.938  -0.478  1.00 60.82  ? 342  GLY A O     1 
ATOM   2594 N N     . VAL A 1 343 ? 31.164  25.764  0.169   1.00 58.92  ? 343  VAL A N     1 
ATOM   2595 C CA    . VAL A 1 343 ? 30.672  25.849  -1.224  1.00 59.03  ? 343  VAL A CA    1 
ATOM   2596 C C     . VAL A 1 343 ? 30.424  27.307  -1.646  1.00 59.56  ? 343  VAL A C     1 
ATOM   2597 O O     . VAL A 1 343 ? 29.559  27.971  -1.085  1.00 60.18  ? 343  VAL A O     1 
ATOM   2598 C CB    . VAL A 1 343 ? 29.412  25.009  -1.456  1.00 58.11  ? 343  VAL A CB    1 
ATOM   2599 C CG1   . VAL A 1 343 ? 29.014  25.030  -2.940  1.00 57.52  ? 343  VAL A CG1   1 
ATOM   2600 C CG2   . VAL A 1 343 ? 29.645  23.569  -0.989  1.00 57.95  ? 343  VAL A CG2   1 
ATOM   2601 N N     . PRO A 1 344 ? 31.176  27.816  -2.634  1.00 60.02  ? 344  PRO A N     1 
ATOM   2602 C CA    . PRO A 1 344 ? 30.923  29.203  -3.006  1.00 60.83  ? 344  PRO A CA    1 
ATOM   2603 C C     . PRO A 1 344 ? 29.487  29.423  -3.495  1.00 60.68  ? 344  PRO A C     1 
ATOM   2604 O O     . PRO A 1 344 ? 28.932  28.590  -4.222  1.00 60.30  ? 344  PRO A O     1 
ATOM   2605 C CB    . PRO A 1 344 ? 31.940  29.466  -4.136  1.00 61.90  ? 344  PRO A CB    1 
ATOM   2606 C CG    . PRO A 1 344 ? 33.010  28.468  -3.935  1.00 61.40  ? 344  PRO A CG    1 
ATOM   2607 C CD    . PRO A 1 344 ? 32.256  27.231  -3.445  1.00 60.93  ? 344  PRO A CD    1 
ATOM   2608 N N     . GLY A 1 345 ? 28.898  30.536  -3.065  1.00 60.83  ? 345  GLY A N     1 
ATOM   2609 C CA    . GLY A 1 345 ? 27.536  30.891  -3.423  1.00 60.52  ? 345  GLY A CA    1 
ATOM   2610 C C     . GLY A 1 345 ? 26.555  30.754  -2.287  1.00 59.62  ? 345  GLY A C     1 
ATOM   2611 O O     . GLY A 1 345 ? 25.434  31.235  -2.400  1.00 59.95  ? 345  GLY A O     1 
ATOM   2612 N N     . PHE A 1 346 ? 26.986  30.116  -1.197  1.00 59.10  ? 346  PHE A N     1 
ATOM   2613 C CA    . PHE A 1 346 ? 26.119  29.729  -0.078  1.00 58.57  ? 346  PHE A CA    1 
ATOM   2614 C C     . PHE A 1 346 ? 26.429  30.525  1.204   1.00 59.05  ? 346  PHE A C     1 
ATOM   2615 O O     . PHE A 1 346 ? 27.577  30.724  1.555   1.00 59.26  ? 346  PHE A O     1 
ATOM   2616 C CB    . PHE A 1 346 ? 26.251  28.218  0.199   1.00 57.97  ? 346  PHE A CB    1 
ATOM   2617 C CG    . PHE A 1 346 ? 25.627  27.337  -0.879  1.00 57.50  ? 346  PHE A CG    1 
ATOM   2618 C CD1   . PHE A 1 346 ? 26.348  26.969  -1.996  1.00 56.68  ? 346  PHE A CD1   1 
ATOM   2619 C CD2   . PHE A 1 346 ? 24.309  26.882  -0.751  1.00 57.10  ? 346  PHE A CD2   1 
ATOM   2620 C CE1   . PHE A 1 346 ? 25.772  26.174  -2.983  1.00 57.60  ? 346  PHE A CE1   1 
ATOM   2621 C CE2   . PHE A 1 346 ? 23.726  26.113  -1.731  1.00 57.46  ? 346  PHE A CE2   1 
ATOM   2622 C CZ    . PHE A 1 346 ? 24.458  25.757  -2.859  1.00 57.59  ? 346  PHE A CZ    1 
ATOM   2623 N N     . SER A 1 347 ? 25.380  30.961  1.896   1.00 59.68  ? 347  SER A N     1 
ATOM   2624 C CA    . SER A 1 347 ? 25.492  31.787  3.101   1.00 60.16  ? 347  SER A CA    1 
ATOM   2625 C C     . SER A 1 347 ? 24.222  31.663  3.930   1.00 60.04  ? 347  SER A C     1 
ATOM   2626 O O     . SER A 1 347 ? 23.145  31.443  3.380   1.00 60.07  ? 347  SER A O     1 
ATOM   2627 C CB    . SER A 1 347 ? 25.698  33.258  2.730   1.00 61.26  ? 347  SER A CB    1 
ATOM   2628 O OG    . SER A 1 347 ? 25.586  34.079  3.879   1.00 61.50  ? 347  SER A OG    1 
ATOM   2629 N N     . LYS A 1 348 ? 24.345  31.805  5.246   1.00 60.12  ? 348  LYS A N     1 
ATOM   2630 C CA    . LYS A 1 348 ? 23.175  31.783  6.116   1.00 60.49  ? 348  LYS A CA    1 
ATOM   2631 C C     . LYS A 1 348 ? 22.389  33.092  6.011   1.00 61.50  ? 348  LYS A C     1 
ATOM   2632 O O     . LYS A 1 348 ? 21.235  33.130  6.397   1.00 61.24  ? 348  LYS A O     1 
ATOM   2633 C CB    . LYS A 1 348 ? 23.576  31.546  7.578   1.00 60.28  ? 348  LYS A CB    1 
ATOM   2634 C CG    . LYS A 1 348 ? 23.941  32.819  8.334   1.00 62.06  ? 348  LYS A CG    1 
ATOM   2635 C CD    . LYS A 1 348 ? 24.370  32.556  9.769   1.00 61.86  ? 348  LYS A CD    1 
ATOM   2636 C CE    . LYS A 1 348 ? 24.604  33.877  10.519  1.00 62.93  ? 348  LYS A CE    1 
ATOM   2637 N NZ    . LYS A 1 348 ? 23.360  34.734  10.550  1.00 64.14  ? 348  LYS A NZ    1 
ATOM   2638 N N     . ASP A 1 349 ? 23.038  34.154  5.514   1.00 62.78  ? 349  ASP A N     1 
ATOM   2639 C CA    . ASP A 1 349 ? 22.488  35.521  5.530   1.00 64.27  ? 349  ASP A CA    1 
ATOM   2640 C C     . ASP A 1 349 ? 21.799  35.950  4.231   1.00 64.98  ? 349  ASP A C     1 
ATOM   2641 O O     . ASP A 1 349 ? 21.338  37.084  4.141   1.00 66.16  ? 349  ASP A O     1 
ATOM   2642 C CB    . ASP A 1 349 ? 23.593  36.537  5.895   1.00 65.41  ? 349  ASP A CB    1 
ATOM   2643 C CG    . ASP A 1 349 ? 24.150  36.321  7.300   1.00 65.74  ? 349  ASP A CG    1 
ATOM   2644 O OD1   . ASP A 1 349 ? 23.329  36.076  8.223   1.00 65.00  ? 349  ASP A OD1   1 
ATOM   2645 O OD2   . ASP A 1 349 ? 25.398  36.378  7.472   1.00 65.44  ? 349  ASP A OD2   1 
ATOM   2646 N N     . ASN A 1 350 ? 21.750  35.060  3.234   1.00 64.60  ? 350  ASN A N     1 
ATOM   2647 C CA    . ASN A 1 350 ? 20.866  35.216  2.073   1.00 65.21  ? 350  ASN A CA    1 
ATOM   2648 C C     . ASN A 1 350 ? 20.269  33.870  1.682   1.00 63.76  ? 350  ASN A C     1 
ATOM   2649 O O     . ASN A 1 350 ? 20.520  32.870  2.343   1.00 62.22  ? 350  ASN A O     1 
ATOM   2650 C CB    . ASN A 1 350 ? 21.582  35.895  0.882   1.00 66.31  ? 350  ASN A CB    1 
ATOM   2651 C CG    . ASN A 1 350 ? 22.785  35.101  0.370   1.00 68.13  ? 350  ASN A CG    1 
ATOM   2652 O OD1   . ASN A 1 350 ? 22.710  33.886  0.159   1.00 66.53  ? 350  ASN A OD1   1 
ATOM   2653 N ND2   . ASN A 1 350 ? 23.913  35.812  0.177   1.00 72.28  ? 350  ASN A ND2   1 
ATOM   2654 N N     . GLU A 1 351 ? 19.476  33.870  0.610   1.00 63.92  ? 351  GLU A N     1 
ATOM   2655 C CA    . GLU A 1 351 ? 18.714  32.703  0.146   1.00 63.34  ? 351  GLU A CA    1 
ATOM   2656 C C     . GLU A 1 351 ? 19.550  31.677  -0.600  1.00 61.66  ? 351  GLU A C     1 
ATOM   2657 O O     . GLU A 1 351 ? 19.059  30.598  -0.900  1.00 60.80  ? 351  GLU A O     1 
ATOM   2658 C CB    . GLU A 1 351 ? 17.566  33.152  -0.769  1.00 65.02  ? 351  GLU A CB    1 
ATOM   2659 C CG    . GLU A 1 351 ? 16.450  33.884  -0.059  1.00 68.74  ? 351  GLU A CG    1 
ATOM   2660 C CD    . GLU A 1 351 ? 16.094  33.186  1.222   1.00 73.38  ? 351  GLU A CD    1 
ATOM   2661 O OE1   . GLU A 1 351 ? 15.414  32.125  1.164   1.00 75.96  ? 351  GLU A OE1   1 
ATOM   2662 O OE2   . GLU A 1 351 ? 16.549  33.675  2.285   1.00 77.76  ? 351  GLU A OE2   1 
ATOM   2663 N N     . SER A 1 352 ? 20.797  32.029  -0.908  1.00 60.73  ? 352  SER A N     1 
ATOM   2664 C CA    . SER A 1 352 ? 21.777  31.107  -1.498  1.00 59.57  ? 352  SER A CA    1 
ATOM   2665 C C     . SER A 1 352 ? 21.307  30.513  -2.838  1.00 59.73  ? 352  SER A C     1 
ATOM   2666 O O     . SER A 1 352 ? 21.613  29.379  -3.182  1.00 59.42  ? 352  SER A O     1 
ATOM   2667 C CB    . SER A 1 352 ? 22.198  30.030  -0.487  1.00 58.48  ? 352  SER A CB    1 
ATOM   2668 O OG    . SER A 1 352 ? 22.826  30.623  0.651   1.00 56.46  ? 352  SER A OG    1 
ATOM   2669 N N     . LEU A 1 353 ? 20.587  31.323  -3.603  1.00 60.12  ? 353  LEU A N     1 
ATOM   2670 C CA    . LEU A 1 353 ? 20.227  30.977  -4.954  1.00 60.45  ? 353  LEU A CA    1 
ATOM   2671 C C     . LEU A 1 353 ? 21.487  30.994  -5.792  1.00 60.71  ? 353  LEU A C     1 
ATOM   2672 O O     . LEU A 1 353 ? 22.177  32.020  -5.862  1.00 62.73  ? 353  LEU A O     1 
ATOM   2673 C CB    . LEU A 1 353 ? 19.220  31.983  -5.491  1.00 61.17  ? 353  LEU A CB    1 
ATOM   2674 C CG    . LEU A 1 353 ? 17.886  32.053  -4.748  1.00 60.90  ? 353  LEU A CG    1 
ATOM   2675 C CD1   . LEU A 1 353 ? 16.915  32.887  -5.587  1.00 62.82  ? 353  LEU A CD1   1 
ATOM   2676 C CD2   . LEU A 1 353 ? 17.314  30.679  -4.459  1.00 57.07  ? 353  LEU A CD2   1 
ATOM   2677 N N     . ILE A 1 354 ? 21.805  29.862  -6.411  1.00 59.82  ? 354  ILE A N     1 
ATOM   2678 C CA    . ILE A 1 354 ? 23.055  29.710  -7.135  1.00 59.42  ? 354  ILE A CA    1 
ATOM   2679 C C     . ILE A 1 354 ? 22.847  29.508  -8.631  1.00 60.40  ? 354  ILE A C     1 
ATOM   2680 O O     . ILE A 1 354 ? 21.770  29.140  -9.082  1.00 60.79  ? 354  ILE A O     1 
ATOM   2681 C CB    . ILE A 1 354 ? 23.919  28.546  -6.563  1.00 58.67  ? 354  ILE A CB    1 
ATOM   2682 C CG1   . ILE A 1 354 ? 23.133  27.221  -6.517  1.00 57.71  ? 354  ILE A CG1   1 
ATOM   2683 C CG2   . ILE A 1 354 ? 24.479  28.923  -5.174  1.00 57.54  ? 354  ILE A CG2   1 
ATOM   2684 C CD1   . ILE A 1 354 ? 24.029  25.971  -6.599  1.00 56.43  ? 354  ILE A CD1   1 
ATOM   2685 N N     . SER A 1 355 ? 23.903  29.761  -9.392  1.00 61.46  ? 355  SER A N     1 
ATOM   2686 C CA    . SER A 1 355 ? 23.922  29.503  -10.822 1.00 62.29  ? 355  SER A CA    1 
ATOM   2687 C C     . SER A 1 355 ? 24.255  28.041  -11.076 1.00 62.17  ? 355  SER A C     1 
ATOM   2688 O O     . SER A 1 355 ? 24.703  27.314  -10.188 1.00 61.36  ? 355  SER A O     1 
ATOM   2689 C CB    . SER A 1 355 ? 24.975  30.373  -11.507 1.00 63.08  ? 355  SER A CB    1 
ATOM   2690 O OG    . SER A 1 355 ? 26.299  29.963  -11.142 1.00 62.51  ? 355  SER A OG    1 
ATOM   2691 N N     . ARG A 1 356 ? 24.067  27.629  -12.317 1.00 63.37  ? 356  ARG A N     1 
ATOM   2692 C CA    . ARG A 1 356 ? 24.463  26.301  -12.734 1.00 63.99  ? 356  ARG A CA    1 
ATOM   2693 C C     . ARG A 1 356 ? 25.960  26.081  -12.607 1.00 63.61  ? 356  ARG A C     1 
ATOM   2694 O O     . ARG A 1 356 ? 26.387  25.023  -12.173 1.00 62.91  ? 356  ARG A O     1 
ATOM   2695 C CB    . ARG A 1 356 ? 24.021  26.017  -14.169 1.00 65.50  ? 356  ARG A CB    1 
ATOM   2696 C CG    . ARG A 1 356 ? 23.893  24.542  -14.379 1.00 66.89  ? 356  ARG A CG    1 
ATOM   2697 C CD    . ARG A 1 356 ? 23.169  24.134  -15.622 1.00 69.13  ? 356  ARG A CD    1 
ATOM   2698 N NE    . ARG A 1 356 ? 23.416  22.711  -15.832 1.00 70.61  ? 356  ARG A NE    1 
ATOM   2699 C CZ    . ARG A 1 356 ? 22.925  21.720  -15.086 1.00 69.95  ? 356  ARG A CZ    1 
ATOM   2700 N NH1   . ARG A 1 356 ? 22.099  21.964  -14.071 1.00 70.46  ? 356  ARG A NH1   1 
ATOM   2701 N NH2   . ARG A 1 356 ? 23.252  20.466  -15.380 1.00 70.26  ? 356  ARG A NH2   1 
ATOM   2702 N N     . ALA A 1 357 ? 26.751  27.082  -12.984 1.00 64.19  ? 357  ALA A N     1 
ATOM   2703 C CA    . ALA A 1 357 ? 28.204  27.003  -12.826 1.00 64.26  ? 357  ALA A CA    1 
ATOM   2704 C C     . ALA A 1 357 ? 28.578  26.763  -11.361 1.00 62.94  ? 357  ALA A C     1 
ATOM   2705 O O     . ALA A 1 357 ? 29.441  25.932  -11.059 1.00 63.03  ? 357  ALA A O     1 
ATOM   2706 C CB    . ALA A 1 357 ? 28.893  28.267  -13.370 1.00 65.24  ? 357  ALA A CB    1 
ATOM   2707 N N     . GLN A 1 358 ? 27.916  27.474  -10.453 1.00 61.83  ? 358  GLN A N     1 
ATOM   2708 C CA    . GLN A 1 358 ? 28.186  27.313  -9.036  1.00 60.94  ? 358  GLN A CA    1 
ATOM   2709 C C     . GLN A 1 358 ? 27.794  25.917  -8.562  1.00 59.91  ? 358  GLN A C     1 
ATOM   2710 O O     . GLN A 1 358 ? 28.487  25.328  -7.735  1.00 59.71  ? 358  GLN A O     1 
ATOM   2711 C CB    . GLN A 1 358 ? 27.486  28.392  -8.221  1.00 60.77  ? 358  GLN A CB    1 
ATOM   2712 C CG    . GLN A 1 358 ? 28.019  29.829  -8.479  1.00 62.32  ? 358  GLN A CG    1 
ATOM   2713 C CD    . GLN A 1 358 ? 27.195  30.882  -7.753  1.00 62.73  ? 358  GLN A CD    1 
ATOM   2714 O OE1   . GLN A 1 358 ? 25.963  30.855  -7.789  1.00 64.25  ? 358  GLN A OE1   1 
ATOM   2715 N NE2   . GLN A 1 358 ? 27.869  31.791  -7.064  1.00 64.11  ? 358  GLN A NE2   1 
ATOM   2716 N N     . PHE A 1 359 ? 26.700  25.383  -9.100  1.00 59.48  ? 359  PHE A N     1 
ATOM   2717 C CA    . PHE A 1 359 ? 26.306  23.998  -8.850  1.00 58.44  ? 359  PHE A CA    1 
ATOM   2718 C C     . PHE A 1 359 ? 27.385  23.005  -9.273  1.00 58.72  ? 359  PHE A C     1 
ATOM   2719 O O     . PHE A 1 359 ? 27.807  22.188  -8.468  1.00 57.55  ? 359  PHE A O     1 
ATOM   2720 C CB    . PHE A 1 359 ? 24.983  23.693  -9.566  1.00 58.82  ? 359  PHE A CB    1 
ATOM   2721 C CG    . PHE A 1 359 ? 24.476  22.311  -9.345  1.00 57.78  ? 359  PHE A CG    1 
ATOM   2722 C CD1   . PHE A 1 359 ? 24.341  21.432  -10.406 1.00 59.18  ? 359  PHE A CD1   1 
ATOM   2723 C CD2   . PHE A 1 359 ? 24.131  21.883  -8.075  1.00 57.35  ? 359  PHE A CD2   1 
ATOM   2724 C CE1   . PHE A 1 359 ? 23.864  20.143  -10.210 1.00 59.13  ? 359  PHE A CE1   1 
ATOM   2725 C CE2   . PHE A 1 359 ? 23.674  20.599  -7.864  1.00 57.45  ? 359  PHE A CE2   1 
ATOM   2726 C CZ    . PHE A 1 359 ? 23.537  19.724  -8.937  1.00 58.57  ? 359  PHE A CZ    1 
ATOM   2727 N N     . LEU A 1 360 ? 27.837  23.082  -10.525 1.00 59.96  ? 360  LEU A N     1 
ATOM   2728 C CA    . LEU A 1 360 ? 28.902  22.191  -11.005 1.00 61.08  ? 360  LEU A CA    1 
ATOM   2729 C C     . LEU A 1 360 ? 30.184  22.297  -10.170 1.00 60.89  ? 360  LEU A C     1 
ATOM   2730 O O     . LEU A 1 360 ? 30.808  21.274  -9.851  1.00 61.60  ? 360  LEU A O     1 
ATOM   2731 C CB    . LEU A 1 360 ? 29.244  22.451  -12.471 1.00 62.48  ? 360  LEU A CB    1 
ATOM   2732 C CG    . LEU A 1 360 ? 28.125  22.357  -13.523 1.00 64.60  ? 360  LEU A CG    1 
ATOM   2733 C CD1   . LEU A 1 360 ? 28.731  22.396  -14.953 1.00 67.10  ? 360  LEU A CD1   1 
ATOM   2734 C CD2   . LEU A 1 360 ? 27.248  21.137  -13.359 1.00 64.29  ? 360  LEU A CD2   1 
ATOM   2735 N N     . ALA A 1 361 ? 30.572  23.522  -9.816  1.00 60.56  ? 361  ALA A N     1 
ATOM   2736 C CA    . ALA A 1 361 ? 31.725  23.751  -8.929  1.00 60.45  ? 361  ALA A CA    1 
ATOM   2737 C C     . ALA A 1 361 ? 31.481  23.155  -7.540  1.00 59.52  ? 361  ALA A C     1 
ATOM   2738 O O     . ALA A 1 361 ? 32.356  22.497  -6.964  1.00 59.60  ? 361  ALA A O     1 
ATOM   2739 C CB    . ALA A 1 361 ? 32.021  25.252  -8.817  1.00 60.66  ? 361  ALA A CB    1 
ATOM   2740 N N     . GLY A 1 362 ? 30.279  23.376  -7.011  1.00 58.65  ? 362  GLY A N     1 
ATOM   2741 C CA    . GLY A 1 362 ? 29.909  22.847  -5.708  1.00 57.65  ? 362  GLY A CA    1 
ATOM   2742 C C     . GLY A 1 362 ? 29.958  21.324  -5.630  1.00 57.28  ? 362  GLY A C     1 
ATOM   2743 O O     . GLY A 1 362 ? 30.355  20.773  -4.609  1.00 56.50  ? 362  GLY A O     1 
ATOM   2744 N N     . VAL A 1 363 ? 29.560  20.657  -6.711  1.00 57.62  ? 363  VAL A N     1 
ATOM   2745 C CA    . VAL A 1 363 ? 29.567  19.205  -6.777  1.00 57.81  ? 363  VAL A CA    1 
ATOM   2746 C C     . VAL A 1 363 ? 30.992  18.649  -6.679  1.00 58.88  ? 363  VAL A C     1 
ATOM   2747 O O     . VAL A 1 363 ? 31.199  17.617  -6.061  1.00 58.93  ? 363  VAL A O     1 
ATOM   2748 C CB    . VAL A 1 363 ? 28.883  18.673  -8.080  1.00 58.44  ? 363  VAL A CB    1 
ATOM   2749 C CG1   . VAL A 1 363 ? 29.190  17.190  -8.284  1.00 58.61  ? 363  VAL A CG1   1 
ATOM   2750 C CG2   . VAL A 1 363 ? 27.379  18.909  -8.050  1.00 56.53  ? 363  VAL A CG2   1 
ATOM   2751 N N     . ARG A 1 364 ? 31.972  19.323  -7.282  1.00 60.24  ? 364  ARG A N     1 
ATOM   2752 C CA    . ARG A 1 364 ? 33.360  18.888  -7.160  1.00 61.26  ? 364  ARG A CA    1 
ATOM   2753 C C     . ARG A 1 364 ? 33.850  19.000  -5.714  1.00 60.39  ? 364  ARG A C     1 
ATOM   2754 O O     . ARG A 1 364 ? 34.643  18.176  -5.263  1.00 59.94  ? 364  ARG A O     1 
ATOM   2755 C CB    . ARG A 1 364 ? 34.291  19.685  -8.074  1.00 62.78  ? 364  ARG A CB    1 
ATOM   2756 C CG    . ARG A 1 364 ? 33.943  19.674  -9.560  1.00 65.98  ? 364  ARG A CG    1 
ATOM   2757 C CD    . ARG A 1 364 ? 33.391  18.334  -10.068 1.00 68.78  ? 364  ARG A CD    1 
ATOM   2758 N NE    . ARG A 1 364 ? 34.352  17.228  -10.005 1.00 70.57  ? 364  ARG A NE    1 
ATOM   2759 C CZ    . ARG A 1 364 ? 35.344  17.030  -10.881 1.00 73.32  ? 364  ARG A CZ    1 
ATOM   2760 N NH1   . ARG A 1 364 ? 35.537  17.866  -11.900 1.00 74.42  ? 364  ARG A NH1   1 
ATOM   2761 N NH2   . ARG A 1 364 ? 36.154  15.983  -10.735 1.00 73.66  ? 364  ARG A NH2   1 
ATOM   2762 N N     . ILE A 1 365 ? 33.391  20.033  -5.004  1.00 59.62  ? 365  ILE A N     1 
ATOM   2763 C CA    . ILE A 1 365 ? 33.768  20.245  -3.596  1.00 58.56  ? 365  ILE A CA    1 
ATOM   2764 C C     . ILE A 1 365 ? 32.991  19.281  -2.684  1.00 57.58  ? 365  ILE A C     1 
ATOM   2765 O O     . ILE A 1 365 ? 33.515  18.791  -1.699  1.00 57.48  ? 365  ILE A O     1 
ATOM   2766 C CB    . ILE A 1 365 ? 33.549  21.724  -3.177  1.00 58.11  ? 365  ILE A CB    1 
ATOM   2767 C CG1   . ILE A 1 365 ? 34.499  22.634  -3.964  1.00 59.21  ? 365  ILE A CG1   1 
ATOM   2768 C CG2   . ILE A 1 365 ? 33.770  21.915  -1.676  1.00 57.86  ? 365  ILE A CG2   1 
ATOM   2769 C CD1   . ILE A 1 365 ? 34.031  24.051  -4.115  1.00 58.01  ? 365  ILE A CD1   1 
ATOM   2770 N N     . GLY A 1 366 ? 31.750  19.000  -3.045  1.00 57.10  ? 366  GLY A N     1 
ATOM   2771 C CA    . GLY A 1 366 ? 30.874  18.144  -2.252  1.00 56.87  ? 366  GLY A CA    1 
ATOM   2772 C C     . GLY A 1 366 ? 31.076  16.650  -2.452  1.00 57.15  ? 366  GLY A C     1 
ATOM   2773 O O     . GLY A 1 366 ? 30.649  15.857  -1.615  1.00 56.89  ? 366  GLY A O     1 
ATOM   2774 N N     . VAL A 1 367 ? 31.705  16.280  -3.568  1.00 57.95  ? 367  VAL A N     1 
ATOM   2775 C CA    . VAL A 1 367 ? 32.069  14.905  -3.886  1.00 58.46  ? 367  VAL A CA    1 
ATOM   2776 C C     . VAL A 1 367 ? 33.545  14.942  -4.304  1.00 59.78  ? 367  VAL A C     1 
ATOM   2777 O O     . VAL A 1 367 ? 33.888  14.725  -5.468  1.00 60.35  ? 367  VAL A O     1 
ATOM   2778 C CB    . VAL A 1 367 ? 31.170  14.312  -5.023  1.00 59.18  ? 367  VAL A CB    1 
ATOM   2779 C CG1   . VAL A 1 367 ? 31.296  12.792  -5.062  1.00 59.08  ? 367  VAL A CG1   1 
ATOM   2780 C CG2   . VAL A 1 367 ? 29.715  14.687  -4.830  1.00 57.27  ? 367  VAL A CG2   1 
ATOM   2781 N N     . PRO A 1 368 ? 34.432  15.270  -3.348  1.00 60.26  ? 368  PRO A N     1 
ATOM   2782 C CA    . PRO A 1 368 ? 35.826  15.565  -3.683  1.00 61.60  ? 368  PRO A CA    1 
ATOM   2783 C C     . PRO A 1 368 ? 36.624  14.389  -4.239  1.00 63.55  ? 368  PRO A C     1 
ATOM   2784 O O     . PRO A 1 368 ? 37.581  14.605  -4.973  1.00 64.57  ? 368  PRO A O     1 
ATOM   2785 C CB    . PRO A 1 368 ? 36.398  16.060  -2.358  1.00 60.77  ? 368  PRO A CB    1 
ATOM   2786 C CG    . PRO A 1 368 ? 35.541  15.458  -1.334  1.00 59.67  ? 368  PRO A CG    1 
ATOM   2787 C CD    . PRO A 1 368 ? 34.186  15.408  -1.903  1.00 59.03  ? 368  PRO A CD    1 
ATOM   2788 N N     . GLN A 1 369 ? 36.221  13.163  -3.934  1.00 64.80  ? 369  GLN A N     1 
ATOM   2789 C CA    . GLN A 1 369 ? 36.938  11.984  -4.450  1.00 67.10  ? 369  GLN A CA    1 
ATOM   2790 C C     . GLN A 1 369 ? 36.432  11.507  -5.817  1.00 68.53  ? 369  GLN A C     1 
ATOM   2791 O O     . GLN A 1 369 ? 36.944  10.510  -6.348  1.00 70.35  ? 369  GLN A O     1 
ATOM   2792 C CB    . GLN A 1 369 ? 36.906  10.840  -3.426  1.00 66.88  ? 369  GLN A CB    1 
ATOM   2793 C CG    . GLN A 1 369 ? 37.939  11.004  -2.286  1.00 67.56  ? 369  GLN A CG    1 
ATOM   2794 C CD    . GLN A 1 369 ? 37.527  12.038  -1.233  1.00 67.03  ? 369  GLN A CD    1 
ATOM   2795 O OE1   . GLN A 1 369 ? 36.571  11.834  -0.478  1.00 64.70  ? 369  GLN A OE1   1 
ATOM   2796 N NE2   . GLN A 1 369 ? 38.263  13.143  -1.175  1.00 66.96  ? 369  GLN A NE2   1 
ATOM   2797 N N     . ALA A 1 370 ? 35.468  12.230  -6.398  1.00 68.12  ? 370  ALA A N     1 
ATOM   2798 C CA    . ALA A 1 370 ? 34.863  11.851  -7.681  1.00 68.86  ? 370  ALA A CA    1 
ATOM   2799 C C     . ALA A 1 370 ? 35.681  12.291  -8.887  1.00 69.97  ? 370  ALA A C     1 
ATOM   2800 O O     . ALA A 1 370 ? 36.141  13.421  -8.964  1.00 69.69  ? 370  ALA A O     1 
ATOM   2801 C CB    . ALA A 1 370 ? 33.455  12.421  -7.799  1.00 67.81  ? 370  ALA A CB    1 
ATOM   2802 N N     . SER A 1 371 ? 35.816  11.385  -9.848  1.00 71.47  ? 371  SER A N     1 
ATOM   2803 C CA    . SER A 1 371 ? 36.404  11.693  -11.142 1.00 72.83  ? 371  SER A CA    1 
ATOM   2804 C C     . SER A 1 371 ? 35.542  12.701  -11.893 1.00 72.41  ? 371  SER A C     1 
ATOM   2805 O O     . SER A 1 371 ? 34.480  13.103  -11.415 1.00 71.44  ? 371  SER A O     1 
ATOM   2806 C CB    . SER A 1 371 ? 36.529  10.404  -11.961 1.00 74.60  ? 371  SER A CB    1 
ATOM   2807 O OG    . SER A 1 371 ? 35.272  9.742   -12.060 1.00 74.89  ? 371  SER A OG    1 
ATOM   2808 N N     . ASP A 1 372 ? 36.001  13.119  -13.067 1.00 73.32  ? 372  ASP A N     1 
ATOM   2809 C CA    . ASP A 1 372 ? 35.231  14.027  -13.899 1.00 73.20  ? 372  ASP A CA    1 
ATOM   2810 C C     . ASP A 1 372 ? 33.930  13.357  -14.337 1.00 72.74  ? 372  ASP A C     1 
ATOM   2811 O O     . ASP A 1 372 ? 32.856  13.976  -14.290 1.00 71.29  ? 372  ASP A O     1 
ATOM   2812 C CB    . ASP A 1 372 ? 36.027  14.469  -15.130 1.00 74.93  ? 372  ASP A CB    1 
ATOM   2813 C CG    . ASP A 1 372 ? 37.209  15.379  -14.782 1.00 77.10  ? 372  ASP A CG    1 
ATOM   2814 O OD1   . ASP A 1 372 ? 37.364  15.764  -13.601 1.00 77.56  ? 372  ASP A OD1   1 
ATOM   2815 O OD2   . ASP A 1 372 ? 38.000  15.700  -15.706 1.00 81.34  ? 372  ASP A OD2   1 
ATOM   2816 N N     . LEU A 1 373 ? 34.046  12.091  -14.749 1.00 73.29  ? 373  LEU A N     1 
ATOM   2817 C CA    . LEU A 1 373 ? 32.900  11.292  -15.194 1.00 73.26  ? 373  LEU A CA    1 
ATOM   2818 C C     . LEU A 1 373 ? 31.860  11.080  -14.081 1.00 71.35  ? 373  LEU A C     1 
ATOM   2819 O O     . LEU A 1 373 ? 30.659  11.226  -14.313 1.00 71.07  ? 373  LEU A O     1 
ATOM   2820 C CB    . LEU A 1 373 ? 33.381  9.939   -15.737 1.00 74.81  ? 373  LEU A CB    1 
ATOM   2821 C CG    . LEU A 1 373 ? 32.328  9.025   -16.376 1.00 76.04  ? 373  LEU A CG    1 
ATOM   2822 C CD1   . LEU A 1 373 ? 31.530  9.762   -17.460 1.00 76.75  ? 373  LEU A CD1   1 
ATOM   2823 C CD2   . LEU A 1 373 ? 32.975  7.765   -16.946 1.00 77.43  ? 373  LEU A CD2   1 
ATOM   2824 N N     . ALA A 1 374 ? 32.331  10.733  -12.883 1.00 70.11  ? 374  ALA A N     1 
ATOM   2825 C CA    . ALA A 1 374 ? 31.454  10.517  -11.728 1.00 68.16  ? 374  ALA A CA    1 
ATOM   2826 C C     . ALA A 1 374 ? 30.736  11.803  -11.352 1.00 66.43  ? 374  ALA A C     1 
ATOM   2827 O O     . ALA A 1 374 ? 29.544  11.791  -11.069 1.00 65.73  ? 374  ALA A O     1 
ATOM   2828 C CB    . ALA A 1 374 ? 32.247  9.997   -10.542 1.00 67.52  ? 374  ALA A CB    1 
ATOM   2829 N N     . ALA A 1 375 ? 31.469  12.909  -11.367 1.00 65.63  ? 375  ALA A N     1 
ATOM   2830 C CA    . ALA A 1 375 ? 30.905  14.209  -11.038 1.00 64.19  ? 375  ALA A CA    1 
ATOM   2831 C C     . ALA A 1 375 ? 29.810  14.580  -12.028 1.00 64.40  ? 375  ALA A C     1 
ATOM   2832 O O     . ALA A 1 375 ? 28.784  15.139  -11.642 1.00 63.49  ? 375  ALA A O     1 
ATOM   2833 C CB    . ALA A 1 375 ? 31.992  15.273  -11.012 1.00 63.79  ? 375  ALA A CB    1 
ATOM   2834 N N     . GLU A 1 376 ? 30.013  14.257  -13.302 1.00 65.72  ? 376  GLU A N     1 
ATOM   2835 C CA    . GLU A 1 376 ? 28.987  14.541  -14.302 1.00 66.42  ? 376  GLU A CA    1 
ATOM   2836 C C     . GLU A 1 376 ? 27.788  13.602  -14.161 1.00 65.04  ? 376  GLU A C     1 
ATOM   2837 O O     . GLU A 1 376 ? 26.672  14.010  -14.436 1.00 64.66  ? 376  GLU A O     1 
ATOM   2838 C CB    . GLU A 1 376 ? 29.542  14.538  -15.731 1.00 68.77  ? 376  GLU A CB    1 
ATOM   2839 C CG    . GLU A 1 376 ? 29.765  15.967  -16.316 1.00 73.31  ? 376  GLU A CG    1 
ATOM   2840 C CD    . GLU A 1 376 ? 28.513  16.910  -16.224 1.00 77.43  ? 376  GLU A CD    1 
ATOM   2841 O OE1   . GLU A 1 376 ? 28.673  18.082  -15.775 1.00 79.58  ? 376  GLU A OE1   1 
ATOM   2842 O OE2   . GLU A 1 376 ? 27.382  16.488  -16.591 1.00 79.32  ? 376  GLU A OE2   1 
ATOM   2843 N N     . ALA A 1 377 ? 28.011  12.366  -13.721 1.00 63.96  ? 377  ALA A N     1 
ATOM   2844 C CA    . ALA A 1 377 ? 26.900  11.479  -13.402 1.00 63.21  ? 377  ALA A CA    1 
ATOM   2845 C C     . ALA A 1 377 ? 26.032  12.096  -12.302 1.00 61.39  ? 377  ALA A C     1 
ATOM   2846 O O     . ALA A 1 377 ? 24.802  12.089  -12.406 1.00 61.49  ? 377  ALA A O     1 
ATOM   2847 C CB    . ALA A 1 377 ? 27.391  10.116  -12.988 1.00 63.20  ? 377  ALA A CB    1 
ATOM   2848 N N     . VAL A 1 378 ? 26.680  12.638  -11.267 1.00 59.87  ? 378  VAL A N     1 
ATOM   2849 C CA    . VAL A 1 378 ? 25.992  13.300  -10.155 1.00 58.06  ? 378  VAL A CA    1 
ATOM   2850 C C     . VAL A 1 378 ? 25.181  14.481  -10.675 1.00 57.99  ? 378  VAL A C     1 
ATOM   2851 O O     . VAL A 1 378 ? 23.996  14.610  -10.366 1.00 57.92  ? 378  VAL A O     1 
ATOM   2852 C CB    . VAL A 1 378 ? 26.995  13.797  -9.052  1.00 57.24  ? 378  VAL A CB    1 
ATOM   2853 C CG1   . VAL A 1 378 ? 26.287  14.633  -7.974  1.00 54.73  ? 378  VAL A CG1   1 
ATOM   2854 C CG2   . VAL A 1 378 ? 27.739  12.631  -8.416  1.00 55.87  ? 378  VAL A CG2   1 
ATOM   2855 N N     . VAL A 1 379 ? 25.812  15.327  -11.477 1.00 58.22  ? 379  VAL A N     1 
ATOM   2856 C CA    . VAL A 1 379 ? 25.148  16.527  -12.006 1.00 58.29  ? 379  VAL A CA    1 
ATOM   2857 C C     . VAL A 1 379 ? 23.920  16.162  -12.861 1.00 59.70  ? 379  VAL A C     1 
ATOM   2858 O O     . VAL A 1 379 ? 22.859  16.787  -12.769 1.00 58.44  ? 379  VAL A O     1 
ATOM   2859 C CB    . VAL A 1 379 ? 26.136  17.386  -12.832 1.00 58.66  ? 379  VAL A CB    1 
ATOM   2860 C CG1   . VAL A 1 379 ? 25.400  18.498  -13.590 1.00 57.96  ? 379  VAL A CG1   1 
ATOM   2861 C CG2   . VAL A 1 379 ? 27.240  17.979  -11.916 1.00 57.00  ? 379  VAL A CG2   1 
ATOM   2862 N N     . LEU A 1 380 ? 24.083  15.130  -13.681 1.00 61.55  ? 380  LEU A N     1 
ATOM   2863 C CA    . LEU A 1 380 ? 23.041  14.702  -14.576 1.00 62.96  ? 380  LEU A CA    1 
ATOM   2864 C C     . LEU A 1 380 ? 21.899  14.058  -13.789 1.00 62.73  ? 380  LEU A C     1 
ATOM   2865 O O     . LEU A 1 380 ? 20.733  14.219  -14.134 1.00 63.08  ? 380  LEU A O     1 
ATOM   2866 C CB    . LEU A 1 380 ? 23.619  13.785  -15.656 1.00 64.68  ? 380  LEU A CB    1 
ATOM   2867 C CG    . LEU A 1 380 ? 24.534  14.497  -16.668 1.00 66.47  ? 380  LEU A CG    1 
ATOM   2868 C CD1   . LEU A 1 380 ? 25.288  13.508  -17.552 1.00 69.31  ? 380  LEU A CD1   1 
ATOM   2869 C CD2   . LEU A 1 380 ? 23.741  15.467  -17.547 1.00 68.56  ? 380  LEU A CD2   1 
ATOM   2870 N N     . HIS A 1 381 ? 22.228  13.373  -12.706 1.00 62.48  ? 381  HIS A N     1 
ATOM   2871 C CA    . HIS A 1 381 ? 21.203  12.768  -11.847 1.00 62.48  ? 381  HIS A CA    1 
ATOM   2872 C C     . HIS A 1 381 ? 20.401  13.790  -11.042 1.00 61.16  ? 381  HIS A C     1 
ATOM   2873 O O     . HIS A 1 381 ? 19.195  13.650  -10.879 1.00 60.98  ? 381  HIS A O     1 
ATOM   2874 C CB    . HIS A 1 381 ? 21.838  11.766  -10.884 1.00 62.26  ? 381  HIS A CB    1 
ATOM   2875 C CG    . HIS A 1 381 ? 20.853  11.070  -9.997  1.00 62.88  ? 381  HIS A CG    1 
ATOM   2876 N ND1   . HIS A 1 381 ? 20.195  9.919   -10.374 1.00 65.90  ? 381  HIS A ND1   1 
ATOM   2877 C CD2   . HIS A 1 381 ? 20.418  11.360  -8.748  1.00 63.16  ? 381  HIS A CD2   1 
ATOM   2878 C CE1   . HIS A 1 381 ? 19.403  9.526   -9.390  1.00 66.04  ? 381  HIS A CE1   1 
ATOM   2879 N NE2   . HIS A 1 381 ? 19.517  10.385  -8.391  1.00 64.00  ? 381  HIS A NE2   1 
ATOM   2880 N N     . TYR A 1 382 ? 21.075  14.800  -10.514 1.00 60.30  ? 382  TYR A N     1 
ATOM   2881 C CA    . TYR A 1 382 ? 20.415  15.761  -9.632  1.00 59.47  ? 382  TYR A CA    1 
ATOM   2882 C C     . TYR A 1 382 ? 19.805  16.937  -10.361 1.00 60.09  ? 382  TYR A C     1 
ATOM   2883 O O     . TYR A 1 382 ? 18.957  17.623  -9.795  1.00 60.16  ? 382  TYR A O     1 
ATOM   2884 C CB    . TYR A 1 382 ? 21.368  16.242  -8.547  1.00 58.31  ? 382  TYR A CB    1 
ATOM   2885 C CG    . TYR A 1 382 ? 21.470  15.253  -7.420  1.00 57.71  ? 382  TYR A CG    1 
ATOM   2886 C CD1   . TYR A 1 382 ? 22.343  14.180  -7.490  1.00 57.79  ? 382  TYR A CD1   1 
ATOM   2887 C CD2   . TYR A 1 382 ? 20.656  15.367  -6.296  1.00 57.64  ? 382  TYR A CD2   1 
ATOM   2888 C CE1   . TYR A 1 382 ? 22.428  13.262  -6.460  1.00 58.06  ? 382  TYR A CE1   1 
ATOM   2889 C CE2   . TYR A 1 382 ? 20.730  14.455  -5.261  1.00 56.92  ? 382  TYR A CE2   1 
ATOM   2890 C CZ    . TYR A 1 382 ? 21.619  13.410  -5.345  1.00 57.48  ? 382  TYR A CZ    1 
ATOM   2891 O OH    . TYR A 1 382 ? 21.696  12.502  -4.318  1.00 57.37  ? 382  TYR A OH    1 
ATOM   2892 N N     . THR A 1 383 ? 20.207  17.174  -11.607 1.00 61.04  ? 383  THR A N     1 
ATOM   2893 C CA    . THR A 1 383 ? 19.559  18.207  -12.415 1.00 61.64  ? 383  THR A CA    1 
ATOM   2894 C C     . THR A 1 383 ? 18.101  17.832  -12.651 1.00 62.81  ? 383  THR A C     1 
ATOM   2895 O O     . THR A 1 383 ? 17.780  16.670  -12.919 1.00 63.94  ? 383  THR A O     1 
ATOM   2896 C CB    . THR A 1 383 ? 20.297  18.440  -13.749 1.00 62.39  ? 383  THR A CB    1 
ATOM   2897 O OG1   . THR A 1 383 ? 21.613  18.917  -13.461 1.00 61.61  ? 383  THR A OG1   1 
ATOM   2898 C CG2   . THR A 1 383 ? 19.567  19.456  -14.654 1.00 62.40  ? 383  THR A CG2   1 
ATOM   2899 N N     . ASP A 1 384 ? 17.229  18.819  -12.475 1.00 62.97  ? 384  ASP A N     1 
ATOM   2900 C CA    . ASP A 1 384 ? 15.867  18.774  -12.963 1.00 64.17  ? 384  ASP A CA    1 
ATOM   2901 C C     . ASP A 1 384 ? 15.877  19.253  -14.403 1.00 65.39  ? 384  ASP A C     1 
ATOM   2902 O O     . ASP A 1 384 ? 16.021  20.452  -14.653 1.00 65.07  ? 384  ASP A O     1 
ATOM   2903 C CB    . ASP A 1 384 ? 14.988  19.705  -12.135 1.00 64.04  ? 384  ASP A CB    1 
ATOM   2904 C CG    . ASP A 1 384 ? 13.532  19.679  -12.577 1.00 66.74  ? 384  ASP A CG    1 
ATOM   2905 O OD1   . ASP A 1 384 ? 13.252  19.355  -13.746 1.00 69.20  ? 384  ASP A OD1   1 
ATOM   2906 O OD2   . ASP A 1 384 ? 12.659  19.993  -11.748 1.00 70.56  ? 384  ASP A OD2   1 
ATOM   2907 N N     . TRP A 1 385 ? 15.703  18.331  -15.354 1.00 66.73  ? 385  TRP A N     1 
ATOM   2908 C CA    . TRP A 1 385 ? 15.886  18.677  -16.768 1.00 67.94  ? 385  TRP A CA    1 
ATOM   2909 C C     . TRP A 1 385 ? 14.725  19.472  -17.371 1.00 69.32  ? 385  TRP A C     1 
ATOM   2910 O O     . TRP A 1 385 ? 14.824  19.926  -18.500 1.00 70.17  ? 385  TRP A O     1 
ATOM   2911 C CB    . TRP A 1 385 ? 16.281  17.443  -17.601 1.00 68.63  ? 385  TRP A CB    1 
ATOM   2912 C CG    . TRP A 1 385 ? 17.657  16.993  -17.246 1.00 67.31  ? 385  TRP A CG    1 
ATOM   2913 C CD1   . TRP A 1 385 ? 17.998  15.957  -16.434 1.00 66.37  ? 385  TRP A CD1   1 
ATOM   2914 C CD2   . TRP A 1 385 ? 18.878  17.632  -17.614 1.00 66.55  ? 385  TRP A CD2   1 
ATOM   2915 N NE1   . TRP A 1 385 ? 19.361  15.880  -16.311 1.00 65.30  ? 385  TRP A NE1   1 
ATOM   2916 C CE2   . TRP A 1 385 ? 19.927  16.906  -17.012 1.00 65.69  ? 385  TRP A CE2   1 
ATOM   2917 C CE3   . TRP A 1 385 ? 19.189  18.751  -18.396 1.00 66.85  ? 385  TRP A CE3   1 
ATOM   2918 C CZ2   . TRP A 1 385 ? 21.270  17.260  -17.164 1.00 66.71  ? 385  TRP A CZ2   1 
ATOM   2919 C CZ3   . TRP A 1 385 ? 20.524  19.102  -18.561 1.00 67.07  ? 385  TRP A CZ3   1 
ATOM   2920 C CH2   . TRP A 1 385 ? 21.549  18.354  -17.953 1.00 67.21  ? 385  TRP A CH2   1 
ATOM   2921 N N     . LEU A 1 386 ? 13.653  19.668  -16.607 1.00 70.02  ? 386  LEU A N     1 
ATOM   2922 C CA    . LEU A 1 386 ? 12.635  20.675  -16.958 1.00 71.74  ? 386  LEU A CA    1 
ATOM   2923 C C     . LEU A 1 386 ? 13.079  22.098  -16.608 1.00 71.53  ? 386  LEU A C     1 
ATOM   2924 O O     . LEU A 1 386 ? 12.659  23.064  -17.250 1.00 72.88  ? 386  LEU A O     1 
ATOM   2925 C CB    . LEU A 1 386 ? 11.307  20.400  -16.252 1.00 71.75  ? 386  LEU A CB    1 
ATOM   2926 C CG    . LEU A 1 386 ? 10.283  19.583  -17.026 1.00 74.63  ? 386  LEU A CG    1 
ATOM   2927 C CD1   . LEU A 1 386 ? 9.098   19.328  -16.118 1.00 74.98  ? 386  LEU A CD1   1 
ATOM   2928 C CD2   . LEU A 1 386 ? 9.852   20.295  -18.328 1.00 75.81  ? 386  LEU A CD2   1 
ATOM   2929 N N     . HIS A 1 387 ? 13.880  22.225  -15.555 1.00 70.67  ? 387  HIS A N     1 
ATOM   2930 C CA    . HIS A 1 387 ? 14.318  23.527  -15.071 1.00 70.32  ? 387  HIS A CA    1 
ATOM   2931 C C     . HIS A 1 387 ? 15.795  23.460  -14.733 1.00 69.11  ? 387  HIS A C     1 
ATOM   2932 O O     . HIS A 1 387 ? 16.185  23.708  -13.593 1.00 68.28  ? 387  HIS A O     1 
ATOM   2933 C CB    . HIS A 1 387 ? 13.516  23.932  -13.833 1.00 70.21  ? 387  HIS A CB    1 
ATOM   2934 C CG    . HIS A 1 387 ? 12.038  23.958  -14.048 1.00 71.81  ? 387  HIS A CG    1 
ATOM   2935 N ND1   . HIS A 1 387 ? 11.188  23.042  -13.463 1.00 73.10  ? 387  HIS A ND1   1 
ATOM   2936 C CD2   . HIS A 1 387 ? 11.255  24.788  -14.776 1.00 75.18  ? 387  HIS A CD2   1 
ATOM   2937 C CE1   . HIS A 1 387 ? 9.941   23.310  -13.818 1.00 74.83  ? 387  HIS A CE1   1 
ATOM   2938 N NE2   . HIS A 1 387 ? 9.952   24.362  -14.618 1.00 75.46  ? 387  HIS A NE2   1 
ATOM   2939 N N     . PRO A 1 388 ? 16.632  23.129  -15.729 1.00 69.47  ? 388  PRO A N     1 
ATOM   2940 C CA    . PRO A 1 388 ? 18.046  22.889  -15.456 1.00 68.61  ? 388  PRO A CA    1 
ATOM   2941 C C     . PRO A 1 388 ? 18.800  24.082  -14.873 1.00 67.93  ? 388  PRO A C     1 
ATOM   2942 O O     . PRO A 1 388 ? 19.890  23.897  -14.338 1.00 67.63  ? 388  PRO A O     1 
ATOM   2943 C CB    . PRO A 1 388 ? 18.616  22.507  -16.826 1.00 69.43  ? 388  PRO A CB    1 
ATOM   2944 C CG    . PRO A 1 388 ? 17.651  23.028  -17.809 1.00 70.90  ? 388  PRO A CG    1 
ATOM   2945 C CD    . PRO A 1 388 ? 16.317  22.975  -17.160 1.00 70.69  ? 388  PRO A CD    1 
ATOM   2946 N N     . GLU A 1 389 ? 18.224  25.276  -14.959 1.00 68.24  ? 389  GLU A N     1 
ATOM   2947 C CA    . GLU A 1 389 ? 18.903  26.495  -14.546 1.00 68.41  ? 389  GLU A CA    1 
ATOM   2948 C C     . GLU A 1 389 ? 18.174  27.281  -13.459 1.00 66.87  ? 389  GLU A C     1 
ATOM   2949 O O     . GLU A 1 389 ? 18.568  28.395  -13.145 1.00 66.44  ? 389  GLU A O     1 
ATOM   2950 C CB    . GLU A 1 389 ? 19.141  27.402  -15.771 1.00 70.41  ? 389  GLU A CB    1 
ATOM   2951 C CG    . GLU A 1 389 ? 19.856  26.703  -16.927 1.00 73.75  ? 389  GLU A CG    1 
ATOM   2952 C CD    . GLU A 1 389 ? 20.958  27.537  -17.516 1.00 78.87  ? 389  GLU A CD    1 
ATOM   2953 O OE1   . GLU A 1 389 ? 22.116  27.448  -17.024 1.00 80.72  ? 389  GLU A OE1   1 
ATOM   2954 O OE2   . GLU A 1 389 ? 20.660  28.289  -18.472 1.00 83.87  ? 389  GLU A OE2   1 
ATOM   2955 N N     . ASP A 1 390 ? 17.128  26.708  -12.871 1.00 65.98  ? 390  ASP A N     1 
ATOM   2956 C CA    . ASP A 1 390 ? 16.429  27.383  -11.783 1.00 64.79  ? 390  ASP A CA    1 
ATOM   2957 C C     . ASP A 1 390 ? 17.325  27.444  -10.546 1.00 62.96  ? 390  ASP A C     1 
ATOM   2958 O O     . ASP A 1 390 ? 17.739  26.410  -10.040 1.00 61.86  ? 390  ASP A O     1 
ATOM   2959 C CB    . ASP A 1 390 ? 15.136  26.678  -11.424 1.00 64.79  ? 390  ASP A CB    1 
ATOM   2960 C CG    . ASP A 1 390 ? 14.349  27.446  -10.398 1.00 65.71  ? 390  ASP A CG    1 
ATOM   2961 O OD1   . ASP A 1 390 ? 13.862  28.527  -10.722 1.00 70.35  ? 390  ASP A OD1   1 
ATOM   2962 O OD2   . ASP A 1 390 ? 14.242  27.015  -9.253  1.00 67.17  ? 390  ASP A OD2   1 
ATOM   2963 N N     . PRO A 1 391 ? 17.626  28.660  -10.060 1.00 62.25  ? 391  PRO A N     1 
ATOM   2964 C CA    . PRO A 1 391 ? 18.521  28.833  -8.919  1.00 61.06  ? 391  PRO A CA    1 
ATOM   2965 C C     . PRO A 1 391 ? 18.065  28.151  -7.623  1.00 59.87  ? 391  PRO A C     1 
ATOM   2966 O O     . PRO A 1 391 ? 18.905  27.699  -6.855  1.00 58.75  ? 391  PRO A O     1 
ATOM   2967 C CB    . PRO A 1 391 ? 18.539  30.351  -8.719  1.00 61.33  ? 391  PRO A CB    1 
ATOM   2968 C CG    . PRO A 1 391 ? 18.117  30.922  -9.969  1.00 62.72  ? 391  PRO A CG    1 
ATOM   2969 C CD    . PRO A 1 391 ? 17.148  29.960  -10.560 1.00 63.21  ? 391  PRO A CD    1 
ATOM   2970 N N     . THR A 1 392 ? 16.758  28.116  -7.374  1.00 59.90  ? 392  THR A N     1 
ATOM   2971 C CA    . THR A 1 392 ? 16.209  27.472  -6.185  1.00 59.32  ? 392  THR A CA    1 
ATOM   2972 C C     . THR A 1 392 ? 16.393  25.956  -6.259  1.00 59.35  ? 392  THR A C     1 
ATOM   2973 O O     . THR A 1 392 ? 16.820  25.346  -5.278  1.00 58.03  ? 392  THR A O     1 
ATOM   2974 C CB    . THR A 1 392 ? 14.704  27.805  -5.985  1.00 59.91  ? 392  THR A CB    1 
ATOM   2975 O OG1   . THR A 1 392 ? 14.534  29.227  -5.876  1.00 60.01  ? 392  THR A OG1   1 
ATOM   2976 C CG2   . THR A 1 392 ? 14.150  27.120  -4.742  1.00 57.68  ? 392  THR A CG2   1 
ATOM   2977 N N     . HIS A 1 393 ? 16.067  25.345  -7.403  1.00 60.46  ? 393  HIS A N     1 
ATOM   2978 C CA    . HIS A 1 393 ? 16.310  23.910  -7.550  1.00 61.07  ? 393  HIS A CA    1 
ATOM   2979 C C     . HIS A 1 393 ? 17.794  23.569  -7.457  1.00 59.56  ? 393  HIS A C     1 
ATOM   2980 O O     . HIS A 1 393 ? 18.152  22.544  -6.905  1.00 59.56  ? 393  HIS A O     1 
ATOM   2981 C CB    . HIS A 1 393 ? 15.771  23.309  -8.845  1.00 62.73  ? 393  HIS A CB    1 
ATOM   2982 C CG    . HIS A 1 393 ? 16.210  21.883  -9.031  1.00 67.21  ? 393  HIS A CG    1 
ATOM   2983 N ND1   . HIS A 1 393 ? 15.530  20.809  -8.482  1.00 71.29  ? 393  HIS A ND1   1 
ATOM   2984 C CD2   . HIS A 1 393 ? 17.327  21.363  -9.604  1.00 69.49  ? 393  HIS A CD2   1 
ATOM   2985 C CE1   . HIS A 1 393 ? 16.187  19.690  -8.751  1.00 71.26  ? 393  HIS A CE1   1 
ATOM   2986 N NE2   . HIS A 1 393 ? 17.282  20.000  -9.431  1.00 70.49  ? 393  HIS A NE2   1 
ATOM   2987 N N     . LEU A 1 394 ? 18.655  24.400  -8.026  1.00 58.90  ? 394  LEU A N     1 
ATOM   2988 C CA    . LEU A 1 394 ? 20.085  24.125  -7.984  1.00 57.91  ? 394  LEU A CA    1 
ATOM   2989 C C     . LEU A 1 394 ? 20.610  24.134  -6.540  1.00 56.51  ? 394  LEU A C     1 
ATOM   2990 O O     . LEU A 1 394 ? 21.381  23.247  -6.145  1.00 55.49  ? 394  LEU A O     1 
ATOM   2991 C CB    . LEU A 1 394 ? 20.854  25.114  -8.865  1.00 58.30  ? 394  LEU A CB    1 
ATOM   2992 C CG    . LEU A 1 394 ? 20.631  24.898  -10.375 1.00 59.49  ? 394  LEU A CG    1 
ATOM   2993 C CD1   . LEU A 1 394 ? 21.156  26.084  -11.196 1.00 57.56  ? 394  LEU A CD1   1 
ATOM   2994 C CD2   . LEU A 1 394 ? 21.250  23.579  -10.855 1.00 58.71  ? 394  LEU A CD2   1 
ATOM   2995 N N     . ARG A 1 395 ? 20.171  25.124  -5.766  1.00 55.66  ? 395  ARG A N     1 
ATOM   2996 C CA    . ARG A 1 395 ? 20.524  25.236  -4.357  1.00 54.71  ? 395  ARG A CA    1 
ATOM   2997 C C     . ARG A 1 395 ? 20.087  24.004  -3.572  1.00 54.10  ? 395  ARG A C     1 
ATOM   2998 O O     . ARG A 1 395 ? 20.884  23.420  -2.821  1.00 53.48  ? 395  ARG A O     1 
ATOM   2999 C CB    . ARG A 1 395 ? 19.927  26.511  -3.773  1.00 54.91  ? 395  ARG A CB    1 
ATOM   3000 C CG    . ARG A 1 395 ? 20.107  26.699  -2.275  1.00 54.46  ? 395  ARG A CG    1 
ATOM   3001 C CD    . ARG A 1 395 ? 18.756  26.565  -1.591  1.00 56.66  ? 395  ARG A CD    1 
ATOM   3002 N NE    . ARG A 1 395 ? 18.074  27.834  -1.570  1.00 56.39  ? 395  ARG A NE    1 
ATOM   3003 C CZ    . ARG A 1 395 ? 16.768  28.012  -1.427  1.00 56.54  ? 395  ARG A CZ    1 
ATOM   3004 N NH1   . ARG A 1 395 ? 15.923  27.000  -1.344  1.00 56.37  ? 395  ARG A NH1   1 
ATOM   3005 N NH2   . ARG A 1 395 ? 16.303  29.250  -1.405  1.00 58.22  ? 395  ARG A NH2   1 
ATOM   3006 N N     . ASP A 1 396 ? 18.847  23.584  -3.791  1.00 54.15  ? 396  ASP A N     1 
ATOM   3007 C CA    . ASP A 1 396 ? 18.291  22.436  -3.101  1.00 54.01  ? 396  ASP A CA    1 
ATOM   3008 C C     . ASP A 1 396 ? 18.944  21.129  -3.569  1.00 54.07  ? 396  ASP A C     1 
ATOM   3009 O O     . ASP A 1 396 ? 19.163  20.227  -2.760  1.00 53.82  ? 396  ASP A O     1 
ATOM   3010 C CB    . ASP A 1 396 ? 16.768  22.401  -3.280  1.00 54.95  ? 396  ASP A CB    1 
ATOM   3011 C CG    . ASP A 1 396 ? 16.055  23.566  -2.558  1.00 55.00  ? 396  ASP A CG    1 
ATOM   3012 O OD1   . ASP A 1 396 ? 16.658  24.167  -1.652  1.00 53.23  ? 396  ASP A OD1   1 
ATOM   3013 O OD2   . ASP A 1 396 ? 14.885  23.868  -2.882  1.00 57.95  ? 396  ASP A OD2   1 
ATOM   3014 N N     . ALA A 1 397 ? 19.266  21.032  -4.860  1.00 54.38  ? 397  ALA A N     1 
ATOM   3015 C CA    . ALA A 1 397 ? 19.996  19.863  -5.398  1.00 54.58  ? 397  ALA A CA    1 
ATOM   3016 C C     . ALA A 1 397 ? 21.402  19.750  -4.800  1.00 53.72  ? 397  ALA A C     1 
ATOM   3017 O O     . ALA A 1 397 ? 21.886  18.649  -4.532  1.00 54.07  ? 397  ALA A O     1 
ATOM   3018 C CB    . ALA A 1 397 ? 20.087  19.926  -6.920  1.00 54.84  ? 397  ALA A CB    1 
ATOM   3019 N N     . MET A 1 398 ? 22.046  20.891  -4.584  1.00 53.33  ? 398  MET A N     1 
ATOM   3020 C CA    . MET A 1 398 ? 23.361  20.923  -3.954  1.00 53.09  ? 398  MET A CA    1 
ATOM   3021 C C     . MET A 1 398 ? 23.293  20.379  -2.525  1.00 52.04  ? 398  MET A C     1 
ATOM   3022 O O     . MET A 1 398 ? 24.156  19.618  -2.098  1.00 51.54  ? 398  MET A O     1 
ATOM   3023 C CB    . MET A 1 398 ? 23.899  22.350  -3.953  1.00 53.40  ? 398  MET A CB    1 
ATOM   3024 C CG    . MET A 1 398 ? 25.393  22.470  -3.659  1.00 54.76  ? 398  MET A CG    1 
ATOM   3025 S SD    . MET A 1 398 ? 26.444  21.631  -4.848  1.00 55.47  ? 398  MET A SD    1 
ATOM   3026 C CE    . MET A 1 398 ? 26.889  20.149  -3.956  1.00 53.40  ? 398  MET A CE    1 
ATOM   3027 N N     . SER A 1 399 ? 22.251  20.762  -1.798  1.00 51.60  ? 399  SER A N     1 
ATOM   3028 C CA    . SER A 1 399 ? 22.049  20.259  -0.455  1.00 51.05  ? 399  SER A CA    1 
ATOM   3029 C C     . SER A 1 399 ? 21.849  18.752  -0.468  1.00 50.98  ? 399  SER A C     1 
ATOM   3030 O O     . SER A 1 399 ? 22.453  18.036  0.338   1.00 50.59  ? 399  SER A O     1 
ATOM   3031 C CB    . SER A 1 399 ? 20.846  20.926  0.194   1.00 50.79  ? 399  SER A CB    1 
ATOM   3032 O OG    . SER A 1 399 ? 20.627  20.389  1.494   1.00 51.99  ? 399  SER A OG    1 
ATOM   3033 N N     . ALA A 1 400 ? 21.008  18.287  -1.393  1.00 51.54  ? 400  ALA A N     1 
ATOM   3034 C CA    . ALA A 1 400 ? 20.666  16.861  -1.535  1.00 51.75  ? 400  ALA A CA    1 
ATOM   3035 C C     . ALA A 1 400 ? 21.885  16.023  -1.906  1.00 51.84  ? 400  ALA A C     1 
ATOM   3036 O O     . ALA A 1 400 ? 22.117  14.974  -1.338  1.00 51.73  ? 400  ALA A O     1 
ATOM   3037 C CB    . ALA A 1 400 ? 19.548  16.668  -2.576  1.00 51.69  ? 400  ALA A CB    1 
ATOM   3038 N N     . VAL A 1 401 ? 22.662  16.489  -2.870  1.00 52.76  ? 401  VAL A N     1 
ATOM   3039 C CA    . VAL A 1 401 ? 23.905  15.804  -3.232  1.00 53.34  ? 401  VAL A CA    1 
ATOM   3040 C C     . VAL A 1 401 ? 24.756  15.512  -1.999  1.00 53.22  ? 401  VAL A C     1 
ATOM   3041 O O     . VAL A 1 401 ? 25.181  14.380  -1.767  1.00 53.98  ? 401  VAL A O     1 
ATOM   3042 C CB    . VAL A 1 401 ? 24.736  16.650  -4.239  1.00 53.69  ? 401  VAL A CB    1 
ATOM   3043 C CG1   . VAL A 1 401 ? 26.201  16.152  -4.324  1.00 52.21  ? 401  VAL A CG1   1 
ATOM   3044 C CG2   . VAL A 1 401 ? 24.058  16.668  -5.605  1.00 53.48  ? 401  VAL A CG2   1 
ATOM   3045 N N     . VAL A 1 402 ? 24.983  16.542  -1.202  1.00 53.15  ? 402  VAL A N     1 
ATOM   3046 C CA    . VAL A 1 402 ? 25.915  16.455  -0.074  1.00 52.71  ? 402  VAL A CA    1 
ATOM   3047 C C     . VAL A 1 402 ? 25.350  15.592  1.043   1.00 52.40  ? 402  VAL A C     1 
ATOM   3048 O O     . VAL A 1 402 ? 26.051  14.732  1.615   1.00 52.89  ? 402  VAL A O     1 
ATOM   3049 C CB    . VAL A 1 402 ? 26.257  17.867  0.439   1.00 52.13  ? 402  VAL A CB    1 
ATOM   3050 C CG1   . VAL A 1 402 ? 27.030  17.809  1.732   1.00 50.38  ? 402  VAL A CG1   1 
ATOM   3051 C CG2   . VAL A 1 402 ? 27.024  18.604  -0.643  1.00 52.01  ? 402  VAL A CG2   1 
ATOM   3052 N N     . GLY A 1 403 ? 24.077  15.804  1.337   1.00 51.79  ? 403  GLY A N     1 
ATOM   3053 C CA    . GLY A 1 403 ? 23.397  14.986  2.336   1.00 51.53  ? 403  GLY A CA    1 
ATOM   3054 C C     . GLY A 1 403 ? 23.266  13.525  1.956   1.00 51.78  ? 403  GLY A C     1 
ATOM   3055 O O     . GLY A 1 403 ? 23.412  12.649  2.804   1.00 51.95  ? 403  GLY A O     1 
ATOM   3056 N N     . ASP A 1 404 ? 22.967  13.253  0.690   1.00 52.50  ? 404  ASP A N     1 
ATOM   3057 C CA    . ASP A 1 404 ? 22.771  11.872  0.230   1.00 53.31  ? 404  ASP A CA    1 
ATOM   3058 C C     . ASP A 1 404 ? 24.085  11.105  0.208   1.00 53.43  ? 404  ASP A C     1 
ATOM   3059 O O     . ASP A 1 404 ? 24.179  9.971   0.694   1.00 53.84  ? 404  ASP A O     1 
ATOM   3060 C CB    . ASP A 1 404 ? 22.159  11.845  -1.168  1.00 54.13  ? 404  ASP A CB    1 
ATOM   3061 C CG    . ASP A 1 404 ? 20.744  12.363  -1.200  1.00 53.97  ? 404  ASP A CG    1 
ATOM   3062 O OD1   . ASP A 1 404 ? 20.150  12.549  -0.115  1.00 53.41  ? 404  ASP A OD1   1 
ATOM   3063 O OD2   . ASP A 1 404 ? 20.222  12.578  -2.318  1.00 55.07  ? 404  ASP A OD2   1 
ATOM   3064 N N     . HIS A 1 405 ? 25.088  11.731  -0.389  1.00 52.98  ? 405  HIS A N     1 
ATOM   3065 C CA    . HIS A 1 405 ? 26.418  11.150  -0.484  1.00 53.34  ? 405  HIS A CA    1 
ATOM   3066 C C     . HIS A 1 405 ? 26.967  10.803  0.898   1.00 52.70  ? 405  HIS A C     1 
ATOM   3067 O O     . HIS A 1 405 ? 27.424  9.698   1.123   1.00 53.41  ? 405  HIS A O     1 
ATOM   3068 C CB    . HIS A 1 405 ? 27.334  12.145  -1.201  1.00 53.41  ? 405  HIS A CB    1 
ATOM   3069 C CG    . HIS A 1 405 ? 28.763  11.718  -1.296  1.00 53.10  ? 405  HIS A CG    1 
ATOM   3070 N ND1   . HIS A 1 405 ? 29.143  10.468  -1.727  1.00 54.31  ? 405  HIS A ND1   1 
ATOM   3071 C CD2   . HIS A 1 405 ? 29.907  12.398  -1.056  1.00 52.84  ? 405  HIS A CD2   1 
ATOM   3072 C CE1   . HIS A 1 405 ? 30.462  10.388  -1.735  1.00 53.98  ? 405  HIS A CE1   1 
ATOM   3073 N NE2   . HIS A 1 405 ? 30.950  11.545  -1.330  1.00 54.24  ? 405  HIS A NE2   1 
ATOM   3074 N N     . ASN A 1 406 ? 26.880  11.748  1.826   1.00 52.02  ? 406  ASN A N     1 
ATOM   3075 C CA    . ASN A 1 406 ? 27.557  11.634  3.122   1.00 51.06  ? 406  ASN A CA    1 
ATOM   3076 C C     . ASN A 1 406 ? 26.769  11.037  4.254   1.00 50.52  ? 406  ASN A C     1 
ATOM   3077 O O     . ASN A 1 406 ? 27.385  10.534  5.189   1.00 50.60  ? 406  ASN A O     1 
ATOM   3078 C CB    . ASN A 1 406 ? 28.054  13.002  3.574   1.00 50.33  ? 406  ASN A CB    1 
ATOM   3079 C CG    . ASN A 1 406 ? 29.174  13.503  2.720   1.00 51.26  ? 406  ASN A CG    1 
ATOM   3080 O OD1   . ASN A 1 406 ? 30.237  12.875  2.666   1.00 51.53  ? 406  ASN A OD1   1 
ATOM   3081 N ND2   . ASN A 1 406 ? 28.948  14.622  2.017   1.00 50.60  ? 406  ASN A ND2   1 
ATOM   3082 N N     . VAL A 1 407 ? 25.437  11.103  4.204   1.00 50.22  ? 407  VAL A N     1 
ATOM   3083 C CA    . VAL A 1 407 ? 24.604  10.612  5.313   1.00 49.96  ? 407  VAL A CA    1 
ATOM   3084 C C     . VAL A 1 407 ? 23.476  9.672   4.866   1.00 50.86  ? 407  VAL A C     1 
ATOM   3085 O O     . VAL A 1 407 ? 23.435  8.524   5.272   1.00 50.46  ? 407  VAL A O     1 
ATOM   3086 C CB    . VAL A 1 407 ? 23.953  11.770  6.122   1.00 49.40  ? 407  VAL A CB    1 
ATOM   3087 C CG1   . VAL A 1 407 ? 23.165  11.209  7.315   1.00 47.59  ? 407  VAL A CG1   1 
ATOM   3088 C CG2   . VAL A 1 407 ? 25.001  12.808  6.589   1.00 48.23  ? 407  VAL A CG2   1 
ATOM   3089 N N     . VAL A 1 408 ? 22.560  10.176  4.040   1.00 51.69  ? 408  VAL A N     1 
ATOM   3090 C CA    . VAL A 1 408 ? 21.324  9.453   3.770   1.00 52.47  ? 408  VAL A CA    1 
ATOM   3091 C C     . VAL A 1 408 ? 21.591  8.120   3.091   1.00 53.90  ? 408  VAL A C     1 
ATOM   3092 O O     . VAL A 1 408 ? 20.936  7.127   3.423   1.00 54.66  ? 408  VAL A O     1 
ATOM   3093 C CB    . VAL A 1 408 ? 20.301  10.257  2.925   1.00 52.59  ? 408  VAL A CB    1 
ATOM   3094 C CG1   . VAL A 1 408 ? 19.076  9.398   2.644   1.00 51.90  ? 408  VAL A CG1   1 
ATOM   3095 C CG2   . VAL A 1 408 ? 19.893  11.542  3.628   1.00 51.06  ? 408  VAL A CG2   1 
ATOM   3096 N N     . CYS A 1 409 ? 22.539  8.071   2.156   1.00 54.25  ? 409  CYS A N     1 
ATOM   3097 C CA    . CYS A 1 409 ? 22.771  6.802   1.448   1.00 55.91  ? 409  CYS A CA    1 
ATOM   3098 C C     . CYS A 1 409 ? 23.661  5.816   2.184   1.00 55.57  ? 409  CYS A C     1 
ATOM   3099 O O     . CYS A 1 409 ? 23.397  4.623   2.124   1.00 56.73  ? 409  CYS A O     1 
ATOM   3100 C CB    . CYS A 1 409 ? 23.226  7.025   0.014   1.00 56.67  ? 409  CYS A CB    1 
ATOM   3101 S SG    . CYS A 1 409 ? 21.927  7.776   -0.996  1.00 57.77  ? 409  CYS A SG    1 
ATOM   3102 N N     . PRO A 1 410 ? 24.720  6.292   2.860   1.00 54.81  ? 410  PRO A N     1 
ATOM   3103 C CA    . PRO A 1 410 ? 25.383  5.431   3.837   1.00 54.91  ? 410  PRO A CA    1 
ATOM   3104 C C     . PRO A 1 410 ? 24.450  4.864   4.919   1.00 54.95  ? 410  PRO A C     1 
ATOM   3105 O O     . PRO A 1 410 ? 24.584  3.690   5.289   1.00 54.85  ? 410  PRO A O     1 
ATOM   3106 C CB    . PRO A 1 410 ? 26.463  6.334   4.430   1.00 53.78  ? 410  PRO A CB    1 
ATOM   3107 C CG    . PRO A 1 410 ? 26.777  7.292   3.339   1.00 53.89  ? 410  PRO A CG    1 
ATOM   3108 C CD    . PRO A 1 410 ? 25.452  7.564   2.686   1.00 54.60  ? 410  PRO A CD    1 
ATOM   3109 N N     . VAL A 1 411 ? 23.493  5.651   5.399   1.00 54.24  ? 411  VAL A N     1 
ATOM   3110 C CA    . VAL A 1 411 ? 22.530  5.104   6.357   1.00 54.54  ? 411  VAL A CA    1 
ATOM   3111 C C     . VAL A 1 411 ? 21.638  4.012   5.740   1.00 56.27  ? 411  VAL A C     1 
ATOM   3112 O O     . VAL A 1 411 ? 21.365  2.998   6.391   1.00 57.05  ? 411  VAL A O     1 
ATOM   3113 C CB    . VAL A 1 411 ? 21.668  6.200   7.009   1.00 53.76  ? 411  VAL A CB    1 
ATOM   3114 C CG1   . VAL A 1 411 ? 20.476  5.587   7.761   1.00 53.65  ? 411  VAL A CG1   1 
ATOM   3115 C CG2   . VAL A 1 411 ? 22.511  7.032   7.944   1.00 52.62  ? 411  VAL A CG2   1 
ATOM   3116 N N     . ALA A 1 412 ? 21.190  4.217   4.502   1.00 57.01  ? 412  ALA A N     1 
ATOM   3117 C CA    . ALA A 1 412 ? 20.371  3.226   3.797   1.00 58.64  ? 412  ALA A CA    1 
ATOM   3118 C C     . ALA A 1 412 ? 21.148  1.929   3.592   1.00 59.89  ? 412  ALA A C     1 
ATOM   3119 O O     . ALA A 1 412 ? 20.634  0.831   3.831   1.00 61.46  ? 412  ALA A O     1 
ATOM   3120 C CB    . ALA A 1 412 ? 19.913  3.778   2.466   1.00 58.94  ? 412  ALA A CB    1 
ATOM   3121 N N     . GLN A 1 413 ? 22.392  2.074   3.159   1.00 59.86  ? 413  GLN A N     1 
ATOM   3122 C CA    . GLN A 1 413 ? 23.328  0.960   3.038   1.00 61.20  ? 413  GLN A CA    1 
ATOM   3123 C C     . GLN A 1 413 ? 23.478  0.242   4.374   1.00 60.86  ? 413  GLN A C     1 
ATOM   3124 O O     . GLN A 1 413 ? 23.314  -0.977  4.452   1.00 61.86  ? 413  GLN A O     1 
ATOM   3125 C CB    . GLN A 1 413 ? 24.686  1.483   2.567   1.00 61.34  ? 413  GLN A CB    1 
ATOM   3126 C CG    . GLN A 1 413 ? 25.722  0.431   2.277   1.00 64.66  ? 413  GLN A CG    1 
ATOM   3127 C CD    . GLN A 1 413 ? 25.652  -0.058  0.862   1.00 70.87  ? 413  GLN A CD    1 
ATOM   3128 O OE1   . GLN A 1 413 ? 24.733  -0.791  0.486   1.00 72.94  ? 413  GLN A OE1   1 
ATOM   3129 N NE2   . GLN A 1 413 ? 26.625  0.363   0.045   1.00 75.29  ? 413  GLN A NE2   1 
ATOM   3130 N N     . LEU A 1 414 ? 23.768  0.998   5.431   1.00 59.34  ? 414  LEU A N     1 
ATOM   3131 C CA    . LEU A 1 414 ? 23.893  0.404   6.764   1.00 59.32  ? 414  LEU A CA    1 
ATOM   3132 C C     . LEU A 1 414 ? 22.641  -0.390  7.144   1.00 60.25  ? 414  LEU A C     1 
ATOM   3133 O O     . LEU A 1 414 ? 22.745  -1.582  7.446   1.00 61.50  ? 414  LEU A O     1 
ATOM   3134 C CB    . LEU A 1 414 ? 24.198  1.460   7.829   1.00 57.88  ? 414  LEU A CB    1 
ATOM   3135 C CG    . LEU A 1 414 ? 24.425  0.940   9.255   1.00 57.51  ? 414  LEU A CG    1 
ATOM   3136 C CD1   . LEU A 1 414 ? 25.592  -0.049  9.293   1.00 57.57  ? 414  LEU A CD1   1 
ATOM   3137 C CD2   . LEU A 1 414 ? 24.649  2.083   10.212  1.00 55.94  ? 414  LEU A CD2   1 
ATOM   3138 N N     . ALA A 1 415 ? 21.478  0.258   7.109   1.00 59.64  ? 415  ALA A N     1 
ATOM   3139 C CA    . ALA A 1 415 ? 20.208  -0.379  7.502   1.00 60.76  ? 415  ALA A CA    1 
ATOM   3140 C C     . ALA A 1 415 ? 19.938  -1.686  6.744   1.00 63.12  ? 415  ALA A C     1 
ATOM   3141 O O     . ALA A 1 415 ? 19.462  -2.666  7.320   1.00 63.45  ? 415  ALA A O     1 
ATOM   3142 C CB    . ALA A 1 415 ? 19.045  0.589   7.300   1.00 59.58  ? 415  ALA A CB    1 
ATOM   3143 N N     . GLY A 1 416 ? 20.248  -1.681  5.446   1.00 64.41  ? 416  GLY A N     1 
ATOM   3144 C CA    . GLY A 1 416 ? 20.033  -2.839  4.583   1.00 66.69  ? 416  GLY A CA    1 
ATOM   3145 C C     . GLY A 1 416 ? 20.930  -4.011  4.907   1.00 68.15  ? 416  GLY A C     1 
ATOM   3146 O O     . GLY A 1 416 ? 20.473  -5.153  4.968   1.00 70.07  ? 416  GLY A O     1 
ATOM   3147 N N     . ARG A 1 417 ? 22.211  -3.744  5.116   1.00 68.18  ? 417  ARG A N     1 
ATOM   3148 C CA    . ARG A 1 417 ? 23.138  -4.810  5.465   1.00 70.19  ? 417  ARG A CA    1 
ATOM   3149 C C     . ARG A 1 417 ? 22.812  -5.378  6.848   1.00 70.27  ? 417  ARG A C     1 
ATOM   3150 O O     . ARG A 1 417 ? 22.761  -6.584  7.032   1.00 71.99  ? 417  ARG A O     1 
ATOM   3151 C CB    . ARG A 1 417 ? 24.589  -4.336  5.413   1.00 69.58  ? 417  ARG A CB    1 
ATOM   3152 C CG    . ARG A 1 417 ? 25.076  -3.818  4.062   1.00 71.80  ? 417  ARG A CG    1 
ATOM   3153 C CD    . ARG A 1 417 ? 24.712  -4.650  2.838   1.00 77.76  ? 417  ARG A CD    1 
ATOM   3154 N NE    . ARG A 1 417 ? 25.327  -5.978  2.835   1.00 81.79  ? 417  ARG A NE    1 
ATOM   3155 C CZ    . ARG A 1 417 ? 25.685  -6.665  1.741   1.00 85.54  ? 417  ARG A CZ    1 
ATOM   3156 N NH1   . ARG A 1 417 ? 25.518  -6.161  0.513   1.00 86.07  ? 417  ARG A NH1   1 
ATOM   3157 N NH2   . ARG A 1 417 ? 26.243  -7.870  1.876   1.00 86.98  ? 417  ARG A NH2   1 
ATOM   3158 N N     . LEU A 1 418 ? 22.577  -4.494  7.809   1.00 69.12  ? 418  LEU A N     1 
ATOM   3159 C CA    . LEU A 1 418 ? 22.216  -4.898  9.175   1.00 69.13  ? 418  LEU A CA    1 
ATOM   3160 C C     . LEU A 1 418 ? 20.981  -5.795  9.192   1.00 70.59  ? 418  LEU A C     1 
ATOM   3161 O O     . LEU A 1 418 ? 20.993  -6.857  9.798   1.00 71.80  ? 418  LEU A O     1 
ATOM   3162 C CB    . LEU A 1 418 ? 21.994  -3.654  10.055  1.00 67.35  ? 418  LEU A CB    1 
ATOM   3163 C CG    . LEU A 1 418 ? 23.127  -3.131  10.957  1.00 66.17  ? 418  LEU A CG    1 
ATOM   3164 C CD1   . LEU A 1 418 ? 24.528  -3.605  10.583  1.00 66.42  ? 418  LEU A CD1   1 
ATOM   3165 C CD2   . LEU A 1 418 ? 23.069  -1.623  10.982  1.00 65.25  ? 418  LEU A CD2   1 
ATOM   3166 N N     . ALA A 1 419 ? 19.933  -5.364  8.504   1.00 70.83  ? 419  ALA A N     1 
ATOM   3167 C CA    . ALA A 1 419 ? 18.684  -6.111  8.416   1.00 72.68  ? 419  ALA A CA    1 
ATOM   3168 C C     . ALA A 1 419 ? 18.842  -7.460  7.693   1.00 75.30  ? 419  ALA A C     1 
ATOM   3169 O O     . ALA A 1 419 ? 18.285  -8.477  8.115   1.00 76.78  ? 419  ALA A O     1 
ATOM   3170 C CB    . ALA A 1 419 ? 17.625  -5.256  7.721   1.00 72.17  ? 419  ALA A CB    1 
ATOM   3171 N N     . ALA A 1 420 ? 19.605  -7.460  6.603   1.00 76.06  ? 420  ALA A N     1 
ATOM   3172 C CA    . ALA A 1 420 ? 19.844  -8.674  5.822   1.00 78.40  ? 420  ALA A CA    1 
ATOM   3173 C C     . ALA A 1 420 ? 20.677  -9.698  6.589   1.00 79.65  ? 420  ALA A C     1 
ATOM   3174 O O     . ALA A 1 420 ? 20.647  -10.885 6.272   1.00 81.77  ? 420  ALA A O     1 
ATOM   3175 C CB    . ALA A 1 420 ? 20.523  -8.329  4.498   1.00 78.17  ? 420  ALA A CB    1 
ATOM   3176 N N     . GLN A 1 421 ? 21.411  -9.238  7.600   1.00 78.65  ? 421  GLN A N     1 
ATOM   3177 C CA    . GLN A 1 421 ? 22.315  -10.098 8.358   1.00 79.49  ? 421  GLN A CA    1 
ATOM   3178 C C     . GLN A 1 421 ? 21.908  -10.256 9.827   1.00 78.45  ? 421  GLN A C     1 
ATOM   3179 O O     . GLN A 1 421 ? 22.763  -10.383 10.707  1.00 78.32  ? 421  GLN A O     1 
ATOM   3180 C CB    . GLN A 1 421 ? 23.746  -9.572  8.194   1.00 78.80  ? 421  GLN A CB    1 
ATOM   3181 C CG    . GLN A 1 421 ? 24.311  -9.904  6.794   1.00 82.49  ? 421  GLN A CG    1 
ATOM   3182 C CD    . GLN A 1 421 ? 25.002  -8.737  6.132   1.00 84.27  ? 421  GLN A CD    1 
ATOM   3183 O OE1   . GLN A 1 421 ? 24.910  -8.542  4.904   1.00 86.97  ? 421  GLN A OE1   1 
ATOM   3184 N NE2   . GLN A 1 421 ? 25.699  -7.942  6.935   1.00 84.28  ? 421  GLN A NE2   1 
ATOM   3185 N N     . GLY A 1 422 ? 20.598  -10.254 10.078  1.00 77.86  ? 422  GLY A N     1 
ATOM   3186 C CA    . GLY A 1 422 ? 20.050  -10.691 11.360  1.00 77.58  ? 422  GLY A CA    1 
ATOM   3187 C C     . GLY A 1 422 ? 19.611  -9.648  12.372  1.00 75.32  ? 422  GLY A C     1 
ATOM   3188 O O     . GLY A 1 422 ? 18.961  -9.995  13.360  1.00 75.94  ? 422  GLY A O     1 
ATOM   3189 N N     . ALA A 1 423 ? 19.949  -8.380  12.145  1.00 72.66  ? 423  ALA A N     1 
ATOM   3190 C CA    . ALA A 1 423 ? 19.634  -7.317  13.104  1.00 70.21  ? 423  ALA A CA    1 
ATOM   3191 C C     . ALA A 1 423 ? 18.173  -6.908  13.030  1.00 69.69  ? 423  ALA A C     1 
ATOM   3192 O O     . ALA A 1 423 ? 17.535  -7.025  11.978  1.00 70.34  ? 423  ALA A O     1 
ATOM   3193 C CB    . ALA A 1 423 ? 20.537  -6.092  12.884  1.00 67.72  ? 423  ALA A CB    1 
ATOM   3194 N N     . ARG A 1 424 ? 17.658  -6.437  14.165  1.00 68.44  ? 424  ARG A N     1 
ATOM   3195 C CA    . ARG A 1 424 ? 16.383  -5.750  14.211  1.00 67.87  ? 424  ARG A CA    1 
ATOM   3196 C C     . ARG A 1 424 ? 16.684  -4.269  14.083  1.00 64.89  ? 424  ARG A C     1 
ATOM   3197 O O     . ARG A 1 424 ? 17.330  -3.670  14.955  1.00 62.97  ? 424  ARG A O     1 
ATOM   3198 C CB    . ARG A 1 424 ? 15.643  -6.039  15.519  1.00 68.76  ? 424  ARG A CB    1 
ATOM   3199 C CG    A ARG A 1 424 ? 14.124  -5.881  15.439  0.50 69.72  ? 424  ARG A CG    1 
ATOM   3200 C CG    B ARG A 1 424 ? 14.102  -6.001  15.402  0.50 70.47  ? 424  ARG A CG    1 
ATOM   3201 C CD    A ARG A 1 424 ? 13.433  -6.706  16.529  0.50 71.53  ? 424  ARG A CD    1 
ATOM   3202 C CD    B ARG A 1 424 ? 13.466  -7.257  16.052  0.50 73.84  ? 424  ARG A CD    1 
ATOM   3203 N NE    A ARG A 1 424 ? 13.126  -5.943  17.745  0.50 70.85  ? 424  ARG A NE    1 
ATOM   3204 N NE    B ARG A 1 424 ? 12.167  -7.620  15.471  0.50 75.68  ? 424  ARG A NE    1 
ATOM   3205 C CZ    A ARG A 1 424 ? 13.188  -6.424  18.987  0.50 71.34  ? 424  ARG A CZ    1 
ATOM   3206 C CZ    B ARG A 1 424 ? 10.994  -7.613  16.108  0.50 76.62  ? 424  ARG A CZ    1 
ATOM   3207 N NH1   A ARG A 1 424 ? 13.588  -7.671  19.233  0.50 72.83  ? 424  ARG A NH1   1 
ATOM   3208 N NH1   B ARG A 1 424 ? 10.891  -7.265  17.389  0.50 75.81  ? 424  ARG A NH1   1 
ATOM   3209 N NH2   A ARG A 1 424 ? 12.864  -5.643  20.001  0.50 70.31  ? 424  ARG A NH2   1 
ATOM   3210 N NH2   B ARG A 1 424 ? 9.899   -7.972  15.448  0.50 78.72  ? 424  ARG A NH2   1 
ATOM   3211 N N     . VAL A 1 425 ? 16.214  -3.693  12.980  1.00 63.46  ? 425  VAL A N     1 
ATOM   3212 C CA    . VAL A 1 425 ? 16.505  -2.332  12.621  1.00 60.42  ? 425  VAL A CA    1 
ATOM   3213 C C     . VAL A 1 425 ? 15.207  -1.530  12.610  1.00 60.14  ? 425  VAL A C     1 
ATOM   3214 O O     . VAL A 1 425 ? 14.204  -1.988  12.083  1.00 60.36  ? 425  VAL A O     1 
ATOM   3215 C CB    . VAL A 1 425 ? 17.170  -2.256  11.214  1.00 60.42  ? 425  VAL A CB    1 
ATOM   3216 C CG1   . VAL A 1 425 ? 17.616  -0.821  10.906  1.00 56.00  ? 425  VAL A CG1   1 
ATOM   3217 C CG2   . VAL A 1 425 ? 18.340  -3.238  11.106  1.00 59.27  ? 425  VAL A CG2   1 
ATOM   3218 N N     . TYR A 1 426 ? 15.253  -0.332  13.196  1.00 58.36  ? 426  TYR A N     1 
ATOM   3219 C CA    . TYR A 1 426 ? 14.165  0.628   13.121  1.00 57.87  ? 426  TYR A CA    1 
ATOM   3220 C C     . TYR A 1 426 ? 14.731  1.917   12.531  1.00 56.38  ? 426  TYR A C     1 
ATOM   3221 O O     . TYR A 1 426 ? 15.746  2.408   13.002  1.00 55.15  ? 426  TYR A O     1 
ATOM   3222 C CB    . TYR A 1 426 ? 13.571  0.899   14.508  1.00 57.79  ? 426  TYR A CB    1 
ATOM   3223 C CG    . TYR A 1 426 ? 12.828  -0.274  15.107  1.00 58.87  ? 426  TYR A CG    1 
ATOM   3224 C CD1   . TYR A 1 426 ? 13.474  -1.164  15.961  1.00 58.91  ? 426  TYR A CD1   1 
ATOM   3225 C CD2   . TYR A 1 426 ? 11.484  -0.504  14.813  1.00 61.20  ? 426  TYR A CD2   1 
ATOM   3226 C CE1   . TYR A 1 426 ? 12.812  -2.247  16.518  1.00 61.33  ? 426  TYR A CE1   1 
ATOM   3227 C CE2   . TYR A 1 426 ? 10.799  -1.601  15.374  1.00 62.60  ? 426  TYR A CE2   1 
ATOM   3228 C CZ    . TYR A 1 426 ? 11.479  -2.466  16.222  1.00 62.33  ? 426  TYR A CZ    1 
ATOM   3229 O OH    . TYR A 1 426 ? 10.846  -3.548  16.766  1.00 63.82  ? 426  TYR A OH    1 
ATOM   3230 N N     . ALA A 1 427 ? 14.063  2.460   11.512  1.00 56.26  ? 427  ALA A N     1 
ATOM   3231 C CA    . ALA A 1 427 ? 14.562  3.619   10.783  1.00 55.09  ? 427  ALA A CA    1 
ATOM   3232 C C     . ALA A 1 427 ? 13.557  4.765   10.801  1.00 54.71  ? 427  ALA A C     1 
ATOM   3233 O O     . ALA A 1 427 ? 12.367  4.532   10.771  1.00 54.98  ? 427  ALA A O     1 
ATOM   3234 C CB    . ALA A 1 427 ? 14.900  3.231   9.333   1.00 55.38  ? 427  ALA A CB    1 
ATOM   3235 N N     . TYR A 1 428 ? 14.056  6.000   10.825  1.00 54.09  ? 428  TYR A N     1 
ATOM   3236 C CA    . TYR A 1 428 ? 13.218  7.203   10.811  1.00 54.31  ? 428  TYR A CA    1 
ATOM   3237 C C     . TYR A 1 428 ? 13.794  8.271   9.878   1.00 54.34  ? 428  TYR A C     1 
ATOM   3238 O O     . TYR A 1 428 ? 14.996  8.271   9.537   1.00 52.95  ? 428  TYR A O     1 
ATOM   3239 C CB    . TYR A 1 428 ? 13.093  7.814   12.226  1.00 53.49  ? 428  TYR A CB    1 
ATOM   3240 C CG    . TYR A 1 428 ? 14.413  8.354   12.766  1.00 52.64  ? 428  TYR A CG    1 
ATOM   3241 C CD1   . TYR A 1 428 ? 14.856  9.638   12.452  1.00 50.63  ? 428  TYR A CD1   1 
ATOM   3242 C CD2   . TYR A 1 428 ? 15.230  7.564   13.577  1.00 51.65  ? 428  TYR A CD2   1 
ATOM   3243 C CE1   . TYR A 1 428 ? 16.082  10.113  12.930  1.00 49.54  ? 428  TYR A CE1   1 
ATOM   3244 C CE2   . TYR A 1 428 ? 16.433  8.029   14.059  1.00 49.97  ? 428  TYR A CE2   1 
ATOM   3245 C CZ    . TYR A 1 428 ? 16.867  9.300   13.736  1.00 50.87  ? 428  TYR A CZ    1 
ATOM   3246 O OH    . TYR A 1 428 ? 18.094  9.735   14.224  1.00 49.60  ? 428  TYR A OH    1 
ATOM   3247 N N     . ILE A 1 429 ? 12.912  9.183   9.473   1.00 55.36  ? 429  ILE A N     1 
ATOM   3248 C CA    . ILE A 1 429 ? 13.322  10.482  8.958   1.00 55.23  ? 429  ILE A CA    1 
ATOM   3249 C C     . ILE A 1 429 ? 12.667  11.514  9.873   1.00 55.14  ? 429  ILE A C     1 
ATOM   3250 O O     . ILE A 1 429 ? 11.478  11.432  10.153  1.00 57.21  ? 429  ILE A O     1 
ATOM   3251 C CB    . ILE A 1 429 ? 12.935  10.689  7.483   1.00 55.65  ? 429  ILE A CB    1 
ATOM   3252 C CG1   . ILE A 1 429 ? 13.587  11.968  6.952   1.00 56.00  ? 429  ILE A CG1   1 
ATOM   3253 C CG2   . ILE A 1 429 ? 11.422  10.743  7.305   1.00 56.93  ? 429  ILE A CG2   1 
ATOM   3254 C CD1   . ILE A 1 429 ? 13.251  12.281  5.524   1.00 56.05  ? 429  ILE A CD1   1 
ATOM   3255 N N     . PHE A 1 430 ? 13.472  12.428  10.396  1.00 54.59  ? 430  PHE A N     1 
ATOM   3256 C CA    . PHE A 1 430 ? 13.019  13.468  11.311  1.00 54.51  ? 430  PHE A CA    1 
ATOM   3257 C C     . PHE A 1 430 ? 12.782  14.715  10.487  1.00 54.58  ? 430  PHE A C     1 
ATOM   3258 O O     . PHE A 1 430 ? 13.679  15.169  9.795   1.00 53.41  ? 430  PHE A O     1 
ATOM   3259 C CB    . PHE A 1 430 ? 14.085  13.709  12.378  1.00 53.77  ? 430  PHE A CB    1 
ATOM   3260 C CG    . PHE A 1 430 ? 13.763  14.825  13.326  1.00 53.63  ? 430  PHE A CG    1 
ATOM   3261 C CD1   . PHE A 1 430 ? 14.149  16.120  13.047  1.00 54.29  ? 430  PHE A CD1   1 
ATOM   3262 C CD2   . PHE A 1 430 ? 13.135  14.573  14.530  1.00 54.70  ? 430  PHE A CD2   1 
ATOM   3263 C CE1   . PHE A 1 430 ? 13.865  17.146  13.926  1.00 54.11  ? 430  PHE A CE1   1 
ATOM   3264 C CE2   . PHE A 1 430 ? 12.875  15.597  15.412  1.00 54.26  ? 430  PHE A CE2   1 
ATOM   3265 C CZ    . PHE A 1 430 ? 13.220  16.878  15.101  1.00 53.38  ? 430  PHE A CZ    1 
ATOM   3266 N N     . GLU A 1 431 ? 11.562  15.244  10.535  1.00 56.21  ? 431  GLU A N     1 
ATOM   3267 C CA    . GLU A 1 431 ? 11.154  16.306  9.627   1.00 57.35  ? 431  GLU A CA    1 
ATOM   3268 C C     . GLU A 1 431 ? 10.546  17.504  10.317  1.00 57.43  ? 431  GLU A C     1 
ATOM   3269 O O     . GLU A 1 431 ? 9.861   18.292  9.659   1.00 58.76  ? 431  GLU A O     1 
ATOM   3270 C CB    . GLU A 1 431 ? 10.100  15.813  8.650   1.00 58.46  ? 431  GLU A CB    1 
ATOM   3271 C CG    . GLU A 1 431 ? 10.383  14.527  7.944   1.00 60.30  ? 431  GLU A CG    1 
ATOM   3272 C CD    . GLU A 1 431 ? 9.284   14.210  6.950   1.00 61.51  ? 431  GLU A CD    1 
ATOM   3273 O OE1   . GLU A 1 431 ? 8.119   14.075  7.391   1.00 63.32  ? 431  GLU A OE1   1 
ATOM   3274 O OE2   . GLU A 1 431 ? 9.592   14.142  5.733   1.00 64.96  ? 431  GLU A OE2   1 
ATOM   3275 N N     . HIS A 1 432 ? 10.755  17.673  11.616  1.00 56.66  ? 432  HIS A N     1 
ATOM   3276 C CA    . HIS A 1 432 ? 10.247  18.876  12.247  1.00 56.36  ? 432  HIS A CA    1 
ATOM   3277 C C     . HIS A 1 432 ? 11.328  19.965  12.398  1.00 55.74  ? 432  HIS A C     1 
ATOM   3278 O O     . HIS A 1 432 ? 12.367  19.744  13.012  1.00 54.57  ? 432  HIS A O     1 
ATOM   3279 C CB    . HIS A 1 432 ? 9.602   18.591  13.598  1.00 56.32  ? 432  HIS A CB    1 
ATOM   3280 C CG    . HIS A 1 432 ? 9.201   19.843  14.306  1.00 56.40  ? 432  HIS A CG    1 
ATOM   3281 N ND1   . HIS A 1 432 ? 8.162   20.637  13.868  1.00 54.76  ? 432  HIS A ND1   1 
ATOM   3282 C CD2   . HIS A 1 432 ? 9.759   20.492  15.356  1.00 55.57  ? 432  HIS A CD2   1 
ATOM   3283 C CE1   . HIS A 1 432 ? 8.066   21.692  14.652  1.00 56.68  ? 432  HIS A CE1   1 
ATOM   3284 N NE2   . HIS A 1 432 ? 9.026   21.633  15.558  1.00 55.96  ? 432  HIS A NE2   1 
ATOM   3285 N N     . ARG A 1 433 ? 11.046  21.147  11.854  1.00 56.32  ? 433  ARG A N     1 
ATOM   3286 C CA    . ARG A 1 433 ? 11.926  22.304  11.999  1.00 56.25  ? 433  ARG A CA    1 
ATOM   3287 C C     . ARG A 1 433 ? 11.602  23.072  13.272  1.00 56.76  ? 433  ARG A C     1 
ATOM   3288 O O     . ARG A 1 433 ? 10.475  23.568  13.452  1.00 57.20  ? 433  ARG A O     1 
ATOM   3289 C CB    . ARG A 1 433 ? 11.779  23.230  10.812  1.00 56.24  ? 433  ARG A CB    1 
ATOM   3290 C CG    . ARG A 1 433 ? 12.816  24.344  10.795  1.00 57.83  ? 433  ARG A CG    1 
ATOM   3291 C CD    . ARG A 1 433 ? 12.598  25.302  9.634   1.00 57.83  ? 433  ARG A CD    1 
ATOM   3292 N NE    . ARG A 1 433 ? 13.103  26.647  9.917   1.00 58.41  ? 433  ARG A NE    1 
ATOM   3293 C CZ    . ARG A 1 433 ? 14.311  27.097  9.586   1.00 58.47  ? 433  ARG A CZ    1 
ATOM   3294 N NH1   . ARG A 1 433 ? 15.191  26.337  8.941   1.00 59.04  ? 433  ARG A NH1   1 
ATOM   3295 N NH2   . ARG A 1 433 ? 14.638  28.341  9.881   1.00 58.90  ? 433  ARG A NH2   1 
ATOM   3296 N N     . ALA A 1 434 ? 12.598  23.196  14.150  1.00 56.42  ? 434  ALA A N     1 
ATOM   3297 C CA    . ALA A 1 434 ? 12.381  23.844  15.439  1.00 56.91  ? 434  ALA A CA    1 
ATOM   3298 C C     . ALA A 1 434 ? 11.866  25.251  15.183  1.00 57.81  ? 434  ALA A C     1 
ATOM   3299 O O     . ALA A 1 434 ? 12.386  25.949  14.309  1.00 57.84  ? 434  ALA A O     1 
ATOM   3300 C CB    . ALA A 1 434 ? 13.677  23.876  16.265  1.00 55.80  ? 434  ALA A CB    1 
ATOM   3301 N N     . SER A 1 435 ? 10.838  25.654  15.928  1.00 59.02  ? 435  SER A N     1 
ATOM   3302 C CA    . SER A 1 435 ? 10.337  27.031  15.880  1.00 60.59  ? 435  SER A CA    1 
ATOM   3303 C C     . SER A 1 435 ? 11.406  28.059  16.307  1.00 60.71  ? 435  SER A C     1 
ATOM   3304 O O     . SER A 1 435 ? 11.351  29.218  15.913  1.00 61.85  ? 435  SER A O     1 
ATOM   3305 C CB    . SER A 1 435 ? 9.081   27.184  16.755  1.00 61.71  ? 435  SER A CB    1 
ATOM   3306 O OG    . SER A 1 435 ? 9.345   26.864  18.108  1.00 61.61  ? 435  SER A OG    1 
ATOM   3307 N N     . THR A 1 436 ? 12.375  27.612  17.097  1.00 60.28  ? 436  THR A N     1 
ATOM   3308 C CA    . THR A 1 436 ? 13.433  28.454  17.650  1.00 60.26  ? 436  THR A CA    1 
ATOM   3309 C C     . THR A 1 436 ? 14.712  28.456  16.797  1.00 59.75  ? 436  THR A C     1 
ATOM   3310 O O     . THR A 1 436 ? 15.719  29.052  17.179  1.00 60.08  ? 436  THR A O     1 
ATOM   3311 C CB    . THR A 1 436 ? 13.814  27.927  19.039  1.00 59.94  ? 436  THR A CB    1 
ATOM   3312 O OG1   . THR A 1 436 ? 14.270  26.580  18.902  1.00 59.41  ? 436  THR A OG1   1 
ATOM   3313 C CG2   . THR A 1 436 ? 12.612  27.935  19.980  1.00 59.83  ? 436  THR A CG2   1 
ATOM   3314 N N     . LEU A 1 437 ? 14.684  27.803  15.643  1.00 59.43  ? 437  LEU A N     1 
ATOM   3315 C CA    . LEU A 1 437 ? 15.888  27.643  14.837  1.00 58.77  ? 437  LEU A CA    1 
ATOM   3316 C C     . LEU A 1 437 ? 16.341  29.007  14.332  1.00 59.14  ? 437  LEU A C     1 
ATOM   3317 O O     . LEU A 1 437 ? 15.529  29.811  13.916  1.00 60.80  ? 437  LEU A O     1 
ATOM   3318 C CB    . LEU A 1 437 ? 15.609  26.692  13.668  1.00 58.55  ? 437  LEU A CB    1 
ATOM   3319 C CG    . LEU A 1 437 ? 16.765  25.957  12.971  1.00 57.69  ? 437  LEU A CG    1 
ATOM   3320 C CD1   . LEU A 1 437 ? 17.590  25.186  13.915  1.00 56.29  ? 437  LEU A CD1   1 
ATOM   3321 C CD2   . LEU A 1 437 ? 16.184  25.022  11.929  1.00 58.16  ? 437  LEU A CD2   1 
ATOM   3322 N N     . THR A 1 438 ? 17.637  29.270  14.398  1.00 58.82  ? 438  THR A N     1 
ATOM   3323 C CA    . THR A 1 438 ? 18.200  30.576  14.051  1.00 59.08  ? 438  THR A CA    1 
ATOM   3324 C C     . THR A 1 438 ? 18.845  30.531  12.677  1.00 58.59  ? 438  THR A C     1 
ATOM   3325 O O     . THR A 1 438 ? 19.100  31.582  12.085  1.00 59.65  ? 438  THR A O     1 
ATOM   3326 C CB    . THR A 1 438 ? 19.270  31.002  15.085  1.00 59.36  ? 438  THR A CB    1 
ATOM   3327 O OG1   . THR A 1 438 ? 20.215  29.927  15.270  1.00 58.75  ? 438  THR A OG1   1 
ATOM   3328 C CG2   . THR A 1 438 ? 18.617  31.316  16.420  1.00 59.58  ? 438  THR A CG2   1 
ATOM   3329 N N     . TRP A 1 439 ? 19.146  29.326  12.187  1.00 56.96  ? 439  TRP A N     1 
ATOM   3330 C CA    . TRP A 1 439 ? 19.569  29.137  10.792  1.00 56.44  ? 439  TRP A CA    1 
ATOM   3331 C C     . TRP A 1 439 ? 18.417  29.515  9.853   1.00 57.10  ? 439  TRP A C     1 
ATOM   3332 O O     . TRP A 1 439 ? 17.256  29.457  10.256  1.00 57.39  ? 439  TRP A O     1 
ATOM   3333 C CB    . TRP A 1 439 ? 19.983  27.686  10.532  1.00 54.94  ? 439  TRP A CB    1 
ATOM   3334 C CG    . TRP A 1 439 ? 21.216  27.277  11.223  1.00 53.08  ? 439  TRP A CG    1 
ATOM   3335 C CD1   . TRP A 1 439 ? 21.300  26.555  12.360  1.00 52.70  ? 439  TRP A CD1   1 
ATOM   3336 C CD2   . TRP A 1 439 ? 22.560  27.577  10.832  1.00 53.46  ? 439  TRP A CD2   1 
ATOM   3337 N NE1   . TRP A 1 439 ? 22.625  26.378  12.718  1.00 53.19  ? 439  TRP A NE1   1 
ATOM   3338 C CE2   . TRP A 1 439 ? 23.417  26.991  11.788  1.00 53.31  ? 439  TRP A CE2   1 
ATOM   3339 C CE3   . TRP A 1 439 ? 23.126  28.273  9.763   1.00 53.70  ? 439  TRP A CE3   1 
ATOM   3340 C CZ2   . TRP A 1 439 ? 24.799  27.088  11.713  1.00 52.43  ? 439  TRP A CZ2   1 
ATOM   3341 C CZ3   . TRP A 1 439 ? 24.502  28.363  9.689   1.00 53.73  ? 439  TRP A CZ3   1 
ATOM   3342 C CH2   . TRP A 1 439 ? 25.323  27.770  10.657  1.00 53.19  ? 439  TRP A CH2   1 
ATOM   3343 N N     . PRO A 1 440 ? 18.740  29.925  8.607   1.00 57.45  ? 440  PRO A N     1 
ATOM   3344 C CA    . PRO A 1 440 ? 17.726  30.404  7.666   1.00 57.93  ? 440  PRO A CA    1 
ATOM   3345 C C     . PRO A 1 440 ? 16.775  29.317  7.199   1.00 57.96  ? 440  PRO A C     1 
ATOM   3346 O O     . PRO A 1 440 ? 17.085  28.126  7.326   1.00 57.71  ? 440  PRO A O     1 
ATOM   3347 C CB    . PRO A 1 440 ? 18.561  30.920  6.484   1.00 58.10  ? 440  PRO A CB    1 
ATOM   3348 C CG    . PRO A 1 440 ? 19.814  30.167  6.547   1.00 57.51  ? 440  PRO A CG    1 
ATOM   3349 C CD    . PRO A 1 440 ? 20.090  29.950  8.007   1.00 57.16  ? 440  PRO A CD    1 
ATOM   3350 N N     . LEU A 1 441 ? 15.637  29.734  6.644   1.00 58.97  ? 441  LEU A N     1 
ATOM   3351 C CA    . LEU A 1 441 ? 14.575  28.815  6.248   1.00 59.28  ? 441  LEU A CA    1 
ATOM   3352 C C     . LEU A 1 441 ? 14.984  27.867  5.130   1.00 58.77  ? 441  LEU A C     1 
ATOM   3353 O O     . LEU A 1 441 ? 14.481  26.734  5.069   1.00 58.32  ? 441  LEU A O     1 
ATOM   3354 C CB    . LEU A 1 441 ? 13.325  29.581  5.805   1.00 60.89  ? 441  LEU A CB    1 
ATOM   3355 C CG    . LEU A 1 441 ? 12.301  29.911  6.894   1.00 63.35  ? 441  LEU A CG    1 
ATOM   3356 C CD1   . LEU A 1 441 ? 11.317  30.990  6.395   1.00 64.36  ? 441  LEU A CD1   1 
ATOM   3357 C CD2   . LEU A 1 441 ? 11.574  28.626  7.331   1.00 64.64  ? 441  LEU A CD2   1 
ATOM   3358 N N     . TRP A 1 442 ? 15.877  28.318  4.241   1.00 58.17  ? 442  TRP A N     1 
ATOM   3359 C CA    . TRP A 1 442 ? 16.262  27.492  3.107   1.00 57.57  ? 442  TRP A CA    1 
ATOM   3360 C C     . TRP A 1 442 ? 16.964  26.200  3.531   1.00 56.81  ? 442  TRP A C     1 
ATOM   3361 O O     . TRP A 1 442 ? 16.949  25.192  2.794   1.00 55.95  ? 442  TRP A O     1 
ATOM   3362 C CB    . TRP A 1 442 ? 17.096  28.277  2.085   1.00 57.88  ? 442  TRP A CB    1 
ATOM   3363 C CG    . TRP A 1 442 ? 18.500  28.655  2.469   1.00 56.89  ? 442  TRP A CG    1 
ATOM   3364 C CD1   . TRP A 1 442 ? 18.938  29.894  2.889   1.00 57.61  ? 442  TRP A CD1   1 
ATOM   3365 C CD2   . TRP A 1 442 ? 19.666  27.829  2.387   1.00 56.36  ? 442  TRP A CD2   1 
ATOM   3366 N NE1   . TRP A 1 442 ? 20.299  29.863  3.118   1.00 57.49  ? 442  TRP A NE1   1 
ATOM   3367 C CE2   . TRP A 1 442 ? 20.769  28.612  2.813   1.00 55.97  ? 442  TRP A CE2   1 
ATOM   3368 C CE3   . TRP A 1 442 ? 19.886  26.498  2.017   1.00 56.08  ? 442  TRP A CE3   1 
ATOM   3369 C CZ2   . TRP A 1 442 ? 22.058  28.109  2.872   1.00 56.53  ? 442  TRP A CZ2   1 
ATOM   3370 C CZ3   . TRP A 1 442 ? 21.167  25.992  2.090   1.00 55.82  ? 442  TRP A CZ3   1 
ATOM   3371 C CH2   . TRP A 1 442 ? 22.245  26.799  2.513   1.00 56.52  ? 442  TRP A CH2   1 
ATOM   3372 N N     . MET A 1 443 ? 17.578  26.216  4.715   1.00 56.32  ? 443  MET A N     1 
ATOM   3373 C CA    . MET A 1 443 ? 18.290  25.031  5.194   1.00 55.81  ? 443  MET A CA    1 
ATOM   3374 C C     . MET A 1 443 ? 17.321  23.951  5.678   1.00 54.56  ? 443  MET A C     1 
ATOM   3375 O O     . MET A 1 443 ? 17.752  22.842  5.971   1.00 53.96  ? 443  MET A O     1 
ATOM   3376 C CB    . MET A 1 443 ? 19.283  25.391  6.296   1.00 55.32  ? 443  MET A CB    1 
ATOM   3377 C CG    . MET A 1 443 ? 20.411  26.276  5.817   1.00 57.68  ? 443  MET A CG    1 
ATOM   3378 S SD    . MET A 1 443 ? 21.595  26.605  7.129   1.00 59.36  ? 443  MET A SD    1 
ATOM   3379 C CE    . MET A 1 443 ? 23.045  27.059  6.184   1.00 60.78  ? 443  MET A CE    1 
ATOM   3380 N N     . GLY A 1 444 ? 16.028  24.276  5.774   1.00 54.25  ? 444  GLY A N     1 
ATOM   3381 C CA    . GLY A 1 444 ? 15.006  23.290  6.135   1.00 53.87  ? 444  GLY A CA    1 
ATOM   3382 C C     . GLY A 1 444 ? 15.205  22.716  7.531   1.00 53.19  ? 444  GLY A C     1 
ATOM   3383 O O     . GLY A 1 444 ? 15.249  23.457  8.507   1.00 53.07  ? 444  GLY A O     1 
ATOM   3384 N N     . VAL A 1 445 ? 15.330  21.397  7.625   1.00 52.59  ? 445  VAL A N     1 
ATOM   3385 C CA    . VAL A 1 445 ? 15.584  20.729  8.900   1.00 52.28  ? 445  VAL A CA    1 
ATOM   3386 C C     . VAL A 1 445 ? 17.024  20.253  8.863   1.00 52.07  ? 445  VAL A C     1 
ATOM   3387 O O     . VAL A 1 445 ? 17.310  19.152  8.358   1.00 52.42  ? 445  VAL A O     1 
ATOM   3388 C CB    . VAL A 1 445 ? 14.640  19.522  9.133   1.00 52.85  ? 445  VAL A CB    1 
ATOM   3389 C CG1   . VAL A 1 445 ? 14.888  18.925  10.534  1.00 51.88  ? 445  VAL A CG1   1 
ATOM   3390 C CG2   . VAL A 1 445 ? 13.151  19.921  8.932   1.00 52.00  ? 445  VAL A CG2   1 
ATOM   3391 N N     . PRO A 1 446 ? 17.954  21.081  9.371   1.00 51.61  ? 446  PRO A N     1 
ATOM   3392 C CA    . PRO A 1 446 ? 19.331  20.769  9.143   1.00 50.85  ? 446  PRO A CA    1 
ATOM   3393 C C     . PRO A 1 446 ? 19.885  19.717  10.078  1.00 50.73  ? 446  PRO A C     1 
ATOM   3394 O O     . PRO A 1 446 ? 19.313  19.403  11.121  1.00 50.45  ? 446  PRO A O     1 
ATOM   3395 C CB    . PRO A 1 446 ? 20.041  22.109  9.390   1.00 50.99  ? 446  PRO A CB    1 
ATOM   3396 C CG    . PRO A 1 446 ? 18.968  23.103  9.639   1.00 51.52  ? 446  PRO A CG    1 
ATOM   3397 C CD    . PRO A 1 446 ? 17.831  22.319  10.150  1.00 51.89  ? 446  PRO A CD    1 
ATOM   3398 N N     . HIS A 1 447 ? 21.014  19.183  9.657   1.00 50.57  ? 447  HIS A N     1 
ATOM   3399 C CA    . HIS A 1 447 ? 21.833  18.300  10.452  1.00 50.45  ? 447  HIS A CA    1 
ATOM   3400 C C     . HIS A 1 447 ? 22.068  18.882  11.869  1.00 49.96  ? 447  HIS A C     1 
ATOM   3401 O O     . HIS A 1 447 ? 22.432  20.044  12.025  1.00 49.15  ? 447  HIS A O     1 
ATOM   3402 C CB    . HIS A 1 447 ? 23.143  18.135  9.689   1.00 50.47  ? 447  HIS A CB    1 
ATOM   3403 C CG    . HIS A 1 447 ? 24.058  17.108  10.247  1.00 50.51  ? 447  HIS A CG    1 
ATOM   3404 N ND1   . HIS A 1 447 ? 23.865  15.758  10.044  1.00 52.14  ? 447  HIS A ND1   1 
ATOM   3405 C CD2   . HIS A 1 447 ? 25.204  17.229  10.953  1.00 49.99  ? 447  HIS A CD2   1 
ATOM   3406 C CE1   . HIS A 1 447 ? 24.845  15.087  10.628  1.00 51.47  ? 447  HIS A CE1   1 
ATOM   3407 N NE2   . HIS A 1 447 ? 25.668  15.955  11.187  1.00 51.72  ? 447  HIS A NE2   1 
ATOM   3408 N N     . GLY A 1 448 ? 21.816  18.065  12.888  1.00 50.13  ? 448  GLY A N     1 
ATOM   3409 C CA    . GLY A 1 448 ? 22.019  18.458  14.281  1.00 49.92  ? 448  GLY A CA    1 
ATOM   3410 C C     . GLY A 1 448 ? 20.760  18.871  15.033  1.00 49.86  ? 448  GLY A C     1 
ATOM   3411 O O     . GLY A 1 448 ? 20.776  18.917  16.264  1.00 50.30  ? 448  GLY A O     1 
ATOM   3412 N N     . TYR A 1 449 ? 19.669  19.162  14.324  1.00 49.41  ? 449  TYR A N     1 
ATOM   3413 C CA    . TYR A 1 449 ? 18.513  19.807  14.960  1.00 49.85  ? 449  TYR A CA    1 
ATOM   3414 C C     . TYR A 1 449 ? 17.368  18.890  15.371  1.00 50.32  ? 449  TYR A C     1 
ATOM   3415 O O     . TYR A 1 449 ? 16.275  19.352  15.717  1.00 51.54  ? 449  TYR A O     1 
ATOM   3416 C CB    . TYR A 1 449 ? 18.082  21.034  14.134  1.00 50.30  ? 449  TYR A CB    1 
ATOM   3417 C CG    . TYR A 1 449 ? 19.188  22.038  14.249  1.00 49.84  ? 449  TYR A CG    1 
ATOM   3418 C CD1   . TYR A 1 449 ? 20.288  21.994  13.396  1.00 49.89  ? 449  TYR A CD1   1 
ATOM   3419 C CD2   . TYR A 1 449 ? 19.225  22.928  15.316  1.00 50.99  ? 449  TYR A CD2   1 
ATOM   3420 C CE1   . TYR A 1 449 ? 21.384  22.875  13.570  1.00 49.37  ? 449  TYR A CE1   1 
ATOM   3421 C CE2   . TYR A 1 449 ? 20.301  23.804  15.493  1.00 50.10  ? 449  TYR A CE2   1 
ATOM   3422 C CZ    . TYR A 1 449 ? 21.364  23.763  14.619  1.00 49.59  ? 449  TYR A CZ    1 
ATOM   3423 O OH    . TYR A 1 449 ? 22.403  24.613  14.819  1.00 51.26  ? 449  TYR A OH    1 
ATOM   3424 N N     . GLU A 1 450 ? 17.637  17.587  15.395  1.00 49.81  ? 450  GLU A N     1 
ATOM   3425 C CA    . GLU A 1 450 ? 16.762  16.646  16.078  1.00 50.06  ? 450  GLU A CA    1 
ATOM   3426 C C     . GLU A 1 450 ? 17.165  16.485  17.546  1.00 49.90  ? 450  GLU A C     1 
ATOM   3427 O O     . GLU A 1 450 ? 16.332  16.158  18.388  1.00 49.80  ? 450  GLU A O     1 
ATOM   3428 C CB    . GLU A 1 450 ? 16.775  15.296  15.375  1.00 49.99  ? 450  GLU A CB    1 
ATOM   3429 C CG    . GLU A 1 450 ? 17.869  14.351  15.822  1.00 51.09  ? 450  GLU A CG    1 
ATOM   3430 C CD    . GLU A 1 450 ? 19.216  14.602  15.175  1.00 51.73  ? 450  GLU A CD    1 
ATOM   3431 O OE1   . GLU A 1 450 ? 19.534  15.742  14.798  1.00 52.91  ? 450  GLU A OE1   1 
ATOM   3432 O OE2   . GLU A 1 450 ? 19.985  13.629  15.063  1.00 56.69  ? 450  GLU A OE2   1 
ATOM   3433 N N     . ILE A 1 451 ? 18.445  16.728  17.839  1.00 49.61  ? 451  ILE A N     1 
ATOM   3434 C CA    . ILE A 1 451 ? 19.047  16.345  19.117  1.00 49.33  ? 451  ILE A CA    1 
ATOM   3435 C C     . ILE A 1 451 ? 18.350  17.010  20.315  1.00 49.97  ? 451  ILE A C     1 
ATOM   3436 O O     . ILE A 1 451 ? 18.022  16.340  21.316  1.00 49.93  ? 451  ILE A O     1 
ATOM   3437 C CB    . ILE A 1 451 ? 20.560  16.666  19.156  1.00 49.05  ? 451  ILE A CB    1 
ATOM   3438 C CG1   . ILE A 1 451 ? 21.323  15.899  18.058  1.00 48.25  ? 451  ILE A CG1   1 
ATOM   3439 C CG2   . ILE A 1 451 ? 21.141  16.309  20.545  1.00 48.86  ? 451  ILE A CG2   1 
ATOM   3440 C CD1   . ILE A 1 451 ? 22.829  16.337  17.891  1.00 48.06  ? 451  ILE A CD1   1 
ATOM   3441 N N     . GLU A 1 452 ? 18.105  18.315  20.198  1.00 50.17  ? 452  GLU A N     1 
ATOM   3442 C CA    . GLU A 1 452 ? 17.412  19.085  21.248  1.00 50.87  ? 452  GLU A CA    1 
ATOM   3443 C C     . GLU A 1 452 ? 16.036  18.507  21.592  1.00 51.01  ? 452  GLU A C     1 
ATOM   3444 O O     . GLU A 1 452 ? 15.601  18.586  22.744  1.00 51.51  ? 452  GLU A O     1 
ATOM   3445 C CB    . GLU A 1 452 ? 17.297  20.571  20.854  1.00 51.33  ? 452  GLU A CB    1 
ATOM   3446 C CG    . GLU A 1 452 ? 16.459  20.864  19.592  1.00 51.97  ? 452  GLU A CG    1 
ATOM   3447 C CD    . GLU A 1 452 ? 16.847  22.176  18.921  1.00 52.65  ? 452  GLU A CD    1 
ATOM   3448 O OE1   . GLU A 1 452 ? 15.968  23.037  18.766  1.00 56.53  ? 452  GLU A OE1   1 
ATOM   3449 O OE2   . GLU A 1 452 ? 18.037  22.372  18.583  1.00 54.77  ? 452  GLU A OE2   1 
ATOM   3450 N N     . PHE A 1 453 ? 15.366  17.899  20.617  1.00 50.75  ? 453  PHE A N     1 
ATOM   3451 C CA    . PHE A 1 453 ? 14.105  17.171  20.886  1.00 51.70  ? 453  PHE A CA    1 
ATOM   3452 C C     . PHE A 1 453 ? 14.288  15.812  21.586  1.00 51.78  ? 453  PHE A C     1 
ATOM   3453 O O     . PHE A 1 453 ? 13.579  15.525  22.536  1.00 52.30  ? 453  PHE A O     1 
ATOM   3454 C CB    . PHE A 1 453 ? 13.295  17.006  19.599  1.00 51.79  ? 453  PHE A CB    1 
ATOM   3455 C CG    . PHE A 1 453 ? 12.830  18.312  19.043  1.00 51.75  ? 453  PHE A CG    1 
ATOM   3456 C CD1   . PHE A 1 453 ? 11.646  18.882  19.487  1.00 52.16  ? 453  PHE A CD1   1 
ATOM   3457 C CD2   . PHE A 1 453 ? 13.597  18.997  18.122  1.00 50.66  ? 453  PHE A CD2   1 
ATOM   3458 C CE1   . PHE A 1 453 ? 11.231  20.105  19.006  1.00 53.37  ? 453  PHE A CE1   1 
ATOM   3459 C CE2   . PHE A 1 453 ? 13.181  20.226  17.623  1.00 51.84  ? 453  PHE A CE2   1 
ATOM   3460 C CZ    . PHE A 1 453 ? 11.999  20.779  18.067  1.00 52.74  ? 453  PHE A CZ    1 
ATOM   3461 N N     . ILE A 1 454 ? 15.240  14.992  21.142  1.00 51.51  ? 454  ILE A N     1 
ATOM   3462 C CA    . ILE A 1 454 ? 15.480  13.685  21.781  1.00 51.76  ? 454  ILE A CA    1 
ATOM   3463 C C     . ILE A 1 454 ? 15.813  13.897  23.258  1.00 51.98  ? 454  ILE A C     1 
ATOM   3464 O O     . ILE A 1 454 ? 15.359  13.134  24.109  1.00 52.63  ? 454  ILE A O     1 
ATOM   3465 C CB    . ILE A 1 454 ? 16.673  12.893  21.126  1.00 51.61  ? 454  ILE A CB    1 
ATOM   3466 C CG1   . ILE A 1 454 ? 16.493  12.734  19.610  1.00 52.39  ? 454  ILE A CG1   1 
ATOM   3467 C CG2   . ILE A 1 454 ? 16.835  11.510  21.760  1.00 51.07  ? 454  ILE A CG2   1 
ATOM   3468 C CD1   . ILE A 1 454 ? 15.152  12.274  19.222  1.00 53.61  ? 454  ILE A CD1   1 
ATOM   3469 N N     . PHE A 1 455 ? 16.620  14.927  23.544  1.00 51.48  ? 455  PHE A N     1 
ATOM   3470 C CA    . PHE A 1 455 ? 17.066  15.236  24.907  1.00 51.25  ? 455  PHE A CA    1 
ATOM   3471 C C     . PHE A 1 455 ? 16.022  15.990  25.723  1.00 51.96  ? 455  PHE A C     1 
ATOM   3472 O O     . PHE A 1 455 ? 16.184  16.154  26.934  1.00 52.17  ? 455  PHE A O     1 
ATOM   3473 C CB    . PHE A 1 455 ? 18.397  16.016  24.889  1.00 50.42  ? 455  PHE A CB    1 
ATOM   3474 C CG    . PHE A 1 455 ? 19.618  15.129  24.818  1.00 49.44  ? 455  PHE A CG    1 
ATOM   3475 C CD1   . PHE A 1 455 ? 20.093  14.659  23.596  1.00 50.15  ? 455  PHE A CD1   1 
ATOM   3476 C CD2   . PHE A 1 455 ? 20.288  14.752  25.971  1.00 49.58  ? 455  PHE A CD2   1 
ATOM   3477 C CE1   . PHE A 1 455 ? 21.231  13.826  23.526  1.00 48.88  ? 455  PHE A CE1   1 
ATOM   3478 C CE2   . PHE A 1 455 ? 21.421  13.932  25.907  1.00 49.17  ? 455  PHE A CE2   1 
ATOM   3479 C CZ    . PHE A 1 455 ? 21.889  13.476  24.682  1.00 48.67  ? 455  PHE A CZ    1 
ATOM   3480 N N     . GLY A 1 456 ? 14.963  16.459  25.068  1.00 52.44  ? 456  GLY A N     1 
ATOM   3481 C CA    . GLY A 1 456 ? 13.821  17.037  25.777  1.00 53.59  ? 456  GLY A CA    1 
ATOM   3482 C C     . GLY A 1 456 ? 13.988  18.474  26.214  1.00 53.98  ? 456  GLY A C     1 
ATOM   3483 O O     . GLY A 1 456 ? 13.270  18.930  27.095  1.00 55.03  ? 456  GLY A O     1 
ATOM   3484 N N     . LEU A 1 457 ? 14.904  19.213  25.583  1.00 53.87  ? 457  LEU A N     1 
ATOM   3485 C CA    . LEU A 1 457 ? 15.025  20.663  25.839  1.00 54.54  ? 457  LEU A CA    1 
ATOM   3486 C C     . LEU A 1 457 ? 13.704  21.448  25.767  1.00 56.42  ? 457  LEU A C     1 
ATOM   3487 O O     . LEU A 1 457 ? 13.499  22.377  26.561  1.00 57.39  ? 457  LEU A O     1 
ATOM   3488 C CB    . LEU A 1 457 ? 16.057  21.315  24.917  1.00 53.71  ? 457  LEU A CB    1 
ATOM   3489 C CG    . LEU A 1 457 ? 17.490  21.356  25.475  1.00 53.30  ? 457  LEU A CG    1 
ATOM   3490 C CD1   . LEU A 1 457 ? 18.082  19.941  25.529  1.00 51.66  ? 457  LEU A CD1   1 
ATOM   3491 C CD2   . LEU A 1 457 ? 18.362  22.287  24.664  1.00 52.02  ? 457  LEU A CD2   1 
ATOM   3492 N N     . PRO A 1 458 ? 12.826  21.126  24.790  1.00 57.27  ? 458  PRO A N     1 
ATOM   3493 C CA    . PRO A 1 458 ? 11.528  21.787  24.744  1.00 59.05  ? 458  PRO A CA    1 
ATOM   3494 C C     . PRO A 1 458 ? 10.706  21.735  26.044  1.00 61.07  ? 458  PRO A C     1 
ATOM   3495 O O     . PRO A 1 458 ? 9.846   22.582  26.233  1.00 61.86  ? 458  PRO A O     1 
ATOM   3496 C CB    . PRO A 1 458 ? 10.811  21.063  23.606  1.00 58.88  ? 458  PRO A CB    1 
ATOM   3497 C CG    . PRO A 1 458 ? 11.883  20.662  22.718  1.00 57.50  ? 458  PRO A CG    1 
ATOM   3498 C CD    . PRO A 1 458 ? 12.998  20.241  23.629  1.00 56.58  ? 458  PRO A CD    1 
ATOM   3499 N N     . LEU A 1 459 ? 10.989  20.778  26.928  1.00 61.99  ? 459  LEU A N     1 
ATOM   3500 C CA    . LEU A 1 459 ? 10.330  20.725  28.235  1.00 63.93  ? 459  LEU A CA    1 
ATOM   3501 C C     . LEU A 1 459 ? 10.649  21.923  29.138  1.00 65.18  ? 459  LEU A C     1 
ATOM   3502 O O     . LEU A 1 459 ? 9.908   22.185  30.081  1.00 67.02  ? 459  LEU A O     1 
ATOM   3503 C CB    . LEU A 1 459 ? 10.666  19.417  28.970  1.00 63.74  ? 459  LEU A CB    1 
ATOM   3504 C CG    . LEU A 1 459 ? 9.837   18.178  28.583  1.00 64.42  ? 459  LEU A CG    1 
ATOM   3505 C CD1   . LEU A 1 459 ? 9.796   17.942  27.081  1.00 64.56  ? 459  LEU A CD1   1 
ATOM   3506 C CD2   . LEU A 1 459 ? 10.384  16.970  29.264  1.00 63.73  ? 459  LEU A CD2   1 
ATOM   3507 N N     . ASP A 1 460 ? 11.732  22.645  28.858  1.00 65.29  ? 460  ASP A N     1 
ATOM   3508 C CA    . ASP A 1 460 ? 12.131  23.789  29.675  1.00 66.65  ? 460  ASP A CA    1 
ATOM   3509 C C     . ASP A 1 460 ? 11.391  25.023  29.169  1.00 67.73  ? 460  ASP A C     1 
ATOM   3510 O O     . ASP A 1 460 ? 11.687  25.528  28.088  1.00 66.88  ? 460  ASP A O     1 
ATOM   3511 C CB    . ASP A 1 460 ? 13.655  23.992  29.610  1.00 66.05  ? 460  ASP A CB    1 
ATOM   3512 C CG    . ASP A 1 460 ? 14.148  25.122  30.517  1.00 67.97  ? 460  ASP A CG    1 
ATOM   3513 O OD1   . ASP A 1 460 ? 13.323  25.896  31.036  1.00 72.00  ? 460  ASP A OD1   1 
ATOM   3514 O OD2   . ASP A 1 460 ? 15.374  25.246  30.705  1.00 69.75  ? 460  ASP A OD2   1 
ATOM   3515 N N     . PRO A 1 461 ? 10.426  25.526  29.957  1.00 69.80  ? 461  PRO A N     1 
ATOM   3516 C CA    . PRO A 1 461 ? 9.542   26.553  29.387  1.00 71.07  ? 461  PRO A CA    1 
ATOM   3517 C C     . PRO A 1 461 ? 10.261  27.881  29.139  1.00 71.04  ? 461  PRO A C     1 
ATOM   3518 O O     . PRO A 1 461 ? 9.812   28.665  28.310  1.00 71.97  ? 461  PRO A O     1 
ATOM   3519 C CB    . PRO A 1 461 ? 8.422   26.685  30.427  1.00 72.74  ? 461  PRO A CB    1 
ATOM   3520 C CG    . PRO A 1 461 ? 9.029   26.229  31.707  1.00 72.94  ? 461  PRO A CG    1 
ATOM   3521 C CD    . PRO A 1 461 ? 10.117  25.242  31.369  1.00 70.95  ? 461  PRO A CD    1 
ATOM   3522 N N     . SER A 1 462 ? 11.383  28.105  29.818  1.00 70.50  ? 462  SER A N     1 
ATOM   3523 C CA    . SER A 1 462 ? 12.220  29.266  29.547  1.00 70.56  ? 462  SER A CA    1 
ATOM   3524 C C     . SER A 1 462 ? 12.853  29.287  28.140  1.00 69.47  ? 462  SER A C     1 
ATOM   3525 O O     . SER A 1 462 ? 13.310  30.349  27.691  1.00 70.41  ? 462  SER A O     1 
ATOM   3526 C CB    . SER A 1 462 ? 13.321  29.381  30.604  1.00 70.74  ? 462  SER A CB    1 
ATOM   3527 O OG    . SER A 1 462 ? 14.299  28.379  30.424  1.00 68.85  ? 462  SER A OG    1 
ATOM   3528 N N     . LEU A 1 463 ? 12.872  28.143  27.446  1.00 67.89  ? 463  LEU A N     1 
ATOM   3529 C CA    . LEU A 1 463 ? 13.417  28.062  26.079  1.00 66.21  ? 463  LEU A CA    1 
ATOM   3530 C C     . LEU A 1 463 ? 12.437  28.429  24.936  1.00 66.08  ? 463  LEU A C     1 
ATOM   3531 O O     . LEU A 1 463 ? 12.860  28.575  23.789  1.00 65.07  ? 463  LEU A O     1 
ATOM   3532 C CB    . LEU A 1 463 ? 14.045  26.679  25.826  1.00 64.48  ? 463  LEU A CB    1 
ATOM   3533 C CG    . LEU A 1 463 ? 15.250  26.280  26.704  1.00 63.90  ? 463  LEU A CG    1 
ATOM   3534 C CD1   . LEU A 1 463 ? 15.806  24.919  26.267  1.00 61.31  ? 463  LEU A CD1   1 
ATOM   3535 C CD2   . LEU A 1 463 ? 16.379  27.328  26.717  1.00 61.87  ? 463  LEU A CD2   1 
ATOM   3536 N N     . ASN A 1 464 ? 11.148  28.564  25.224  1.00 67.18  ? 464  ASN A N     1 
ATOM   3537 C CA    . ASN A 1 464 ? 10.183  29.164  24.255  1.00 68.21  ? 464  ASN A CA    1 
ATOM   3538 C C     . ASN A 1 464 ? 9.794   28.295  23.056  1.00 66.51  ? 464  ASN A C     1 
ATOM   3539 O O     . ASN A 1 464 ? 9.403   28.806  22.007  1.00 66.27  ? 464  ASN A O     1 
ATOM   3540 C CB    . ASN A 1 464 ? 10.671  30.532  23.716  1.00 68.90  ? 464  ASN A CB    1 
ATOM   3541 C CG    . ASN A 1 464 ? 10.832  31.574  24.801  1.00 73.22  ? 464  ASN A CG    1 
ATOM   3542 O OD1   . ASN A 1 464 ? 10.230  31.474  25.875  1.00 73.55  ? 464  ASN A OD1   1 
ATOM   3543 N ND2   . ASN A 1 464 ? 11.649  32.598  24.518  1.00 79.42  ? 464  ASN A ND2   1 
ATOM   3544 N N     . TYR A 1 465 ? 9.901   26.983  23.207  1.00 64.86  ? 465  TYR A N     1 
ATOM   3545 C CA    . TYR A 1 465 ? 9.294   26.083  22.245  1.00 63.42  ? 465  TYR A CA    1 
ATOM   3546 C C     . TYR A 1 465 ? 7.779   26.172  22.378  1.00 64.43  ? 465  TYR A C     1 
ATOM   3547 O O     . TYR A 1 465 ? 7.267   26.575  23.406  1.00 65.20  ? 465  TYR A O     1 
ATOM   3548 C CB    . TYR A 1 465 ? 9.747   24.653  22.499  1.00 61.84  ? 465  TYR A CB    1 
ATOM   3549 C CG    . TYR A 1 465 ? 11.190  24.399  22.172  1.00 59.47  ? 465  TYR A CG    1 
ATOM   3550 C CD1   . TYR A 1 465 ? 11.554  23.907  20.933  1.00 57.73  ? 465  TYR A CD1   1 
ATOM   3551 C CD2   . TYR A 1 465 ? 12.193  24.648  23.102  1.00 58.72  ? 465  TYR A CD2   1 
ATOM   3552 C CE1   . TYR A 1 465 ? 12.873  23.650  20.627  1.00 57.76  ? 465  TYR A CE1   1 
ATOM   3553 C CE2   . TYR A 1 465 ? 13.523  24.390  22.810  1.00 58.24  ? 465  TYR A CE2   1 
ATOM   3554 C CZ    . TYR A 1 465 ? 13.860  23.895  21.570  1.00 57.37  ? 465  TYR A CZ    1 
ATOM   3555 O OH    . TYR A 1 465 ? 15.169  23.623  21.257  1.00 55.73  ? 465  TYR A OH    1 
ATOM   3556 N N     . THR A 1 466 ? 7.069   25.791  21.329  1.00 64.65  ? 466  THR A N     1 
ATOM   3557 C CA    . THR A 1 466 ? 5.616   25.716  21.374  1.00 65.86  ? 466  THR A CA    1 
ATOM   3558 C C     . THR A 1 466 ? 5.175   24.510  22.212  1.00 66.58  ? 466  THR A C     1 
ATOM   3559 O O     . THR A 1 466 ? 5.946   23.571  22.445  1.00 65.21  ? 466  THR A O     1 
ATOM   3560 C CB    . THR A 1 466 ? 5.015   25.569  19.967  1.00 65.75  ? 466  THR A CB    1 
ATOM   3561 O OG1   . THR A 1 466 ? 5.349   24.280  19.433  1.00 64.87  ? 466  THR A OG1   1 
ATOM   3562 C CG2   . THR A 1 466 ? 5.520   26.658  19.040  1.00 64.27  ? 466  THR A CG2   1 
ATOM   3563 N N     . THR A 1 467 ? 3.928   24.553  22.661  1.00 68.55  ? 467  THR A N     1 
ATOM   3564 C CA    . THR A 1 467 ? 3.311   23.459  23.415  1.00 69.72  ? 467  THR A CA    1 
ATOM   3565 C C     . THR A 1 467 ? 3.350   22.145  22.619  1.00 69.09  ? 467  THR A C     1 
ATOM   3566 O O     . THR A 1 467 ? 3.615   21.073  23.165  1.00 68.34  ? 467  THR A O     1 
ATOM   3567 C CB    . THR A 1 467 ? 1.839   23.829  23.801  1.00 72.02  ? 467  THR A CB    1 
ATOM   3568 O OG1   . THR A 1 467 ? 1.851   24.800  24.862  1.00 72.57  ? 467  THR A OG1   1 
ATOM   3569 C CG2   . THR A 1 467 ? 1.038   22.591  24.235  1.00 72.82  ? 467  THR A CG2   1 
ATOM   3570 N N     . GLU A 1 468 ? 3.117   22.258  21.317  1.00 69.25  ? 468  GLU A N     1 
ATOM   3571 C CA    . GLU A 1 468 ? 3.105   21.104  20.424  1.00 69.22  ? 468  GLU A CA    1 
ATOM   3572 C C     . GLU A 1 468 ? 4.494   20.471  20.384  1.00 66.78  ? 468  GLU A C     1 
ATOM   3573 O O     . GLU A 1 468 ? 4.616   19.248  20.393  1.00 66.17  ? 468  GLU A O     1 
ATOM   3574 C CB    . GLU A 1 468 ? 2.650   21.509  19.013  1.00 69.87  ? 468  GLU A CB    1 
ATOM   3575 C CG    . GLU A 1 468 ? 1.321   22.283  18.964  1.00 75.29  ? 468  GLU A CG    1 
ATOM   3576 C CD    . GLU A 1 468 ? 1.474   23.804  19.245  1.00 80.15  ? 468  GLU A CD    1 
ATOM   3577 O OE1   . GLU A 1 468 ? 1.135   24.250  20.373  1.00 82.70  ? 468  GLU A OE1   1 
ATOM   3578 O OE2   . GLU A 1 468 ? 1.944   24.544  18.342  1.00 82.34  ? 468  GLU A OE2   1 
ATOM   3579 N N     . GLU A 1 469 ? 5.529   21.315  20.350  1.00 65.15  ? 469  GLU A N     1 
ATOM   3580 C CA    . GLU A 1 469 ? 6.924   20.847  20.385  1.00 63.49  ? 469  GLU A CA    1 
ATOM   3581 C C     . GLU A 1 469 ? 7.293   20.156  21.692  1.00 62.91  ? 469  GLU A C     1 
ATOM   3582 O O     . GLU A 1 469 ? 8.030   19.192  21.683  1.00 61.56  ? 469  GLU A O     1 
ATOM   3583 C CB    . GLU A 1 469 ? 7.890   21.999  20.115  1.00 62.82  ? 469  GLU A CB    1 
ATOM   3584 C CG    . GLU A 1 469 ? 7.886   22.421  18.671  1.00 62.31  ? 469  GLU A CG    1 
ATOM   3585 C CD    . GLU A 1 469 ? 8.729   23.640  18.402  1.00 61.86  ? 469  GLU A CD    1 
ATOM   3586 O OE1   . GLU A 1 469 ? 8.697   24.602  19.204  1.00 61.61  ? 469  GLU A OE1   1 
ATOM   3587 O OE2   . GLU A 1 469 ? 9.419   23.631  17.365  1.00 61.18  ? 469  GLU A OE2   1 
ATOM   3588 N N     . ARG A 1 470 ? 6.761   20.655  22.803  1.00 64.20  ? 470  ARG A N     1 
ATOM   3589 C CA    . ARG A 1 470 ? 6.869   19.985  24.100  1.00 64.79  ? 470  ARG A CA    1 
ATOM   3590 C C     . ARG A 1 470 ? 6.309   18.569  24.029  1.00 64.11  ? 470  ARG A C     1 
ATOM   3591 O O     . ARG A 1 470 ? 6.942   17.634  24.471  1.00 64.05  ? 470  ARG A O     1 
ATOM   3592 C CB    . ARG A 1 470 ? 6.123   20.770  25.192  1.00 66.77  ? 470  ARG A CB    1 
ATOM   3593 C CG    . ARG A 1 470 ? 6.744   20.642  26.581  1.00 70.64  ? 470  ARG A CG    1 
ATOM   3594 C CD    . ARG A 1 470 ? 5.752   20.220  27.715  1.00 76.66  ? 470  ARG A CD    1 
ATOM   3595 N NE    . ARG A 1 470 ? 4.445   20.869  27.629  1.00 80.34  ? 470  ARG A NE    1 
ATOM   3596 C CZ    . ARG A 1 470 ? 3.266   20.240  27.567  1.00 83.02  ? 470  ARG A CZ    1 
ATOM   3597 N NH1   . ARG A 1 470 ? 3.179   18.904  27.600  1.00 82.89  ? 470  ARG A NH1   1 
ATOM   3598 N NH2   . ARG A 1 470 ? 2.150   20.967  27.485  1.00 84.09  ? 470  ARG A NH2   1 
ATOM   3599 N N     . ILE A 1 471 ? 5.115   18.424  23.464  1.00 64.33  ? 471  ILE A N     1 
ATOM   3600 C CA    . ILE A 1 471 ? 4.445   17.122  23.336  1.00 64.14  ? 471  ILE A CA    1 
ATOM   3601 C C     . ILE A 1 471 ? 5.223   16.180  22.397  1.00 62.31  ? 471  ILE A C     1 
ATOM   3602 O O     . ILE A 1 471 ? 5.329   14.984  22.649  1.00 61.84  ? 471  ILE A O     1 
ATOM   3603 C CB    . ILE A 1 471 ? 2.969   17.327  22.860  1.00 65.39  ? 471  ILE A CB    1 
ATOM   3604 C CG1   . ILE A 1 471 ? 2.146   17.971  23.983  1.00 67.05  ? 471  ILE A CG1   1 
ATOM   3605 C CG2   . ILE A 1 471 ? 2.318   16.019  22.435  1.00 65.60  ? 471  ILE A CG2   1 
ATOM   3606 C CD1   . ILE A 1 471 ? 0.979   18.794  23.482  1.00 68.34  ? 471  ILE A CD1   1 
ATOM   3607 N N     . PHE A 1 472 ? 5.768   16.754  21.331  1.00 60.94  ? 472  PHE A N     1 
ATOM   3608 C CA    . PHE A 1 472 ? 6.595   16.046  20.352  1.00 59.74  ? 472  PHE A CA    1 
ATOM   3609 C C     . PHE A 1 472 ? 7.910   15.556  20.976  1.00 58.78  ? 472  PHE A C     1 
ATOM   3610 O O     . PHE A 1 472 ? 8.304   14.409  20.784  1.00 58.70  ? 472  PHE A O     1 
ATOM   3611 C CB    . PHE A 1 472 ? 6.830   16.986  19.164  1.00 59.15  ? 472  PHE A CB    1 
ATOM   3612 C CG    . PHE A 1 472 ? 7.742   16.448  18.108  1.00 57.91  ? 472  PHE A CG    1 
ATOM   3613 C CD1   . PHE A 1 472 ? 7.528   15.197  17.545  1.00 58.11  ? 472  PHE A CD1   1 
ATOM   3614 C CD2   . PHE A 1 472 ? 8.798   17.220  17.644  1.00 56.06  ? 472  PHE A CD2   1 
ATOM   3615 C CE1   . PHE A 1 472 ? 8.367   14.712  16.561  1.00 56.84  ? 472  PHE A CE1   1 
ATOM   3616 C CE2   . PHE A 1 472 ? 9.648   16.737  16.663  1.00 56.51  ? 472  PHE A CE2   1 
ATOM   3617 C CZ    . PHE A 1 472 ? 9.433   15.484  16.121  1.00 56.47  ? 472  PHE A CZ    1 
ATOM   3618 N N     . ALA A 1 473 ? 8.570   16.396  21.761  1.00 58.59  ? 473  ALA A N     1 
ATOM   3619 C CA    . ALA A 1 473 ? 9.779   15.966  22.478  1.00 58.17  ? 473  ALA A CA    1 
ATOM   3620 C C     . ALA A 1 473 ? 9.469   14.778  23.401  1.00 59.29  ? 473  ALA A C     1 
ATOM   3621 O O     . ALA A 1 473 ? 10.191  13.793  23.416  1.00 58.36  ? 473  ALA A O     1 
ATOM   3622 C CB    . ALA A 1 473 ? 10.366  17.113  23.269  1.00 57.79  ? 473  ALA A CB    1 
ATOM   3623 N N     . GLN A 1 474 ? 8.377   14.875  24.155  1.00 61.16  ? 474  GLN A N     1 
ATOM   3624 C CA    . GLN A 1 474 ? 7.970   13.800  25.056  1.00 62.83  ? 474  GLN A CA    1 
ATOM   3625 C C     . GLN A 1 474 ? 7.779   12.476  24.310  1.00 62.85  ? 474  GLN A C     1 
ATOM   3626 O O     . GLN A 1 474 ? 8.221   11.424  24.786  1.00 62.63  ? 474  GLN A O     1 
ATOM   3627 C CB    . GLN A 1 474 ? 6.693   14.186  25.803  1.00 64.14  ? 474  GLN A CB    1 
ATOM   3628 C CG    . GLN A 1 474 ? 6.912   15.260  26.856  1.00 65.52  ? 474  GLN A CG    1 
ATOM   3629 C CD    . GLN A 1 474 ? 5.617   15.662  27.550  1.00 67.83  ? 474  GLN A CD    1 
ATOM   3630 O OE1   . GLN A 1 474 ? 4.680   16.158  26.920  1.00 72.08  ? 474  GLN A OE1   1 
ATOM   3631 N NE2   . GLN A 1 474 ? 5.562   15.446  28.850  1.00 70.31  ? 474  GLN A NE2   1 
ATOM   3632 N N     . ARG A 1 475 ? 7.124   12.544  23.147  1.00 62.91  ? 475  ARG A N     1 
ATOM   3633 C CA    . ARG A 1 475 ? 7.036   11.404  22.230  1.00 63.51  ? 475  ARG A CA    1 
ATOM   3634 C C     . ARG A 1 475 ? 8.393   10.790  21.848  1.00 61.78  ? 475  ARG A C     1 
ATOM   3635 O O     . ARG A 1 475 ? 8.550   9.563   21.934  1.00 61.66  ? 475  ARG A O     1 
ATOM   3636 C CB    . ARG A 1 475 ? 6.312   11.797  20.942  1.00 63.56  ? 475  ARG A CB    1 
ATOM   3637 C CG    . ARG A 1 475 ? 4.857   11.540  20.982  1.00 66.73  ? 475  ARG A CG    1 
ATOM   3638 C CD    . ARG A 1 475 ? 4.200   11.985  19.689  1.00 68.22  ? 475  ARG A CD    1 
ATOM   3639 N NE    . ARG A 1 475 ? 4.730   11.220  18.568  1.00 69.90  ? 475  ARG A NE    1 
ATOM   3640 C CZ    . ARG A 1 475 ? 4.802   11.648  17.312  1.00 70.03  ? 475  ARG A CZ    1 
ATOM   3641 N NH1   . ARG A 1 475 ? 4.362   12.858  16.969  1.00 70.44  ? 475  ARG A NH1   1 
ATOM   3642 N NH2   . ARG A 1 475 ? 5.335   10.852  16.393  1.00 70.08  ? 475  ARG A NH2   1 
ATOM   3643 N N     . LEU A 1 476 ? 9.336   11.625  21.393  1.00 60.02  ? 476  LEU A N     1 
ATOM   3644 C CA    . LEU A 1 476 ? 10.662  11.129  20.954  1.00 59.53  ? 476  LEU A CA    1 
ATOM   3645 C C     . LEU A 1 476 ? 11.445  10.494  22.094  1.00 59.02  ? 476  LEU A C     1 
ATOM   3646 O O     . LEU A 1 476 ? 12.056  9.448   21.913  1.00 58.72  ? 476  LEU A O     1 
ATOM   3647 C CB    . LEU A 1 476 ? 11.517  12.233  20.301  1.00 58.32  ? 476  LEU A CB    1 
ATOM   3648 C CG    . LEU A 1 476 ? 10.961  12.856  19.011  1.00 59.02  ? 476  LEU A CG    1 
ATOM   3649 C CD1   . LEU A 1 476 ? 12.028  13.652  18.291  1.00 58.38  ? 476  LEU A CD1   1 
ATOM   3650 C CD2   . LEU A 1 476 ? 10.396  11.791  18.086  1.00 59.35  ? 476  LEU A CD2   1 
ATOM   3651 N N     . MET A 1 477 ? 11.405  11.139  23.260  1.00 59.19  ? 477  MET A N     1 
ATOM   3652 C CA    . MET A 1 477 ? 12.040  10.640  24.466  1.00 59.08  ? 477  MET A CA    1 
ATOM   3653 C C     . MET A 1 477 ? 11.482  9.270   24.839  1.00 59.49  ? 477  MET A C     1 
ATOM   3654 O O     . MET A 1 477 ? 12.236  8.418   25.277  1.00 59.22  ? 477  MET A O     1 
ATOM   3655 C CB    . MET A 1 477 ? 11.836  11.606  25.638  1.00 59.04  ? 477  MET A CB    1 
ATOM   3656 C CG    . MET A 1 477 ? 12.511  12.958  25.531  1.00 59.07  ? 477  MET A CG    1 
ATOM   3657 S SD    . MET A 1 477 ? 11.849  14.109  26.785  1.00 61.77  ? 477  MET A SD    1 
ATOM   3658 C CE    . MET A 1 477 ? 12.903  13.704  28.169  1.00 59.04  ? 477  MET A CE    1 
ATOM   3659 N N     . LYS A 1 478 ? 10.169  9.073   24.686  1.00 60.50  ? 478  LYS A N     1 
ATOM   3660 C CA    . LYS A 1 478 ? 9.545   7.756   24.913  1.00 61.97  ? 478  LYS A CA    1 
ATOM   3661 C C     . LYS A 1 478 ? 10.058  6.712   23.935  1.00 60.62  ? 478  LYS A C     1 
ATOM   3662 O O     . LYS A 1 478 ? 10.417  5.602   24.332  1.00 60.62  ? 478  LYS A O     1 
ATOM   3663 C CB    . LYS A 1 478 ? 8.021   7.799   24.764  1.00 64.16  ? 478  LYS A CB    1 
ATOM   3664 C CG    . LYS A 1 478 ? 7.257   8.163   25.997  1.00 67.23  ? 478  LYS A CG    1 
ATOM   3665 C CD    . LYS A 1 478 ? 7.350   7.097   27.074  1.00 70.72  ? 478  LYS A CD    1 
ATOM   3666 C CE    . LYS A 1 478 ? 6.353   7.373   28.225  1.00 71.95  ? 478  LYS A CE    1 
ATOM   3667 N NZ    . LYS A 1 478 ? 6.057   8.836   28.383  1.00 72.30  ? 478  LYS A NZ    1 
ATOM   3668 N N     . TYR A 1 479 ? 10.069  7.061   22.652  1.00 59.04  ? 479  TYR A N     1 
ATOM   3669 C CA    . TYR A 1 479 ? 10.582  6.142   21.644  1.00 58.14  ? 479  TYR A CA    1 
ATOM   3670 C C     . TYR A 1 479 ? 11.998  5.691   21.974  1.00 56.63  ? 479  TYR A C     1 
ATOM   3671 O O     . TYR A 1 479 ? 12.273  4.499   21.966  1.00 56.71  ? 479  TYR A O     1 
ATOM   3672 C CB    . TYR A 1 479 ? 10.597  6.767   20.260  1.00 57.41  ? 479  TYR A CB    1 
ATOM   3673 C CG    . TYR A 1 479 ? 9.268   7.050   19.631  1.00 57.49  ? 479  TYR A CG    1 
ATOM   3674 C CD1   . TYR A 1 479 ? 8.208   6.150   19.714  1.00 60.13  ? 479  TYR A CD1   1 
ATOM   3675 C CD2   . TYR A 1 479 ? 9.091   8.205   18.903  1.00 56.16  ? 479  TYR A CD2   1 
ATOM   3676 C CE1   . TYR A 1 479 ? 6.986   6.430   19.102  1.00 60.12  ? 479  TYR A CE1   1 
ATOM   3677 C CE2   . TYR A 1 479 ? 7.917   8.481   18.292  1.00 58.45  ? 479  TYR A CE2   1 
ATOM   3678 C CZ    . TYR A 1 479 ? 6.863   7.602   18.388  1.00 59.56  ? 479  TYR A CZ    1 
ATOM   3679 O OH    . TYR A 1 479 ? 5.703   7.947   17.756  1.00 60.73  ? 479  TYR A OH    1 
ATOM   3680 N N     . TRP A 1 480 ? 12.877  6.649   22.269  1.00 55.10  ? 480  TRP A N     1 
ATOM   3681 C CA    . TRP A 1 480 ? 14.310  6.361   22.503  1.00 54.19  ? 480  TRP A CA    1 
ATOM   3682 C C     . TRP A 1 480 ? 14.545  5.516   23.754  1.00 54.87  ? 480  TRP A C     1 
ATOM   3683 O O     . TRP A 1 480 ? 15.330  4.554   23.738  1.00 54.70  ? 480  TRP A O     1 
ATOM   3684 C CB    . TRP A 1 480 ? 15.122  7.656   22.601  1.00 52.80  ? 480  TRP A CB    1 
ATOM   3685 C CG    . TRP A 1 480 ? 15.863  8.051   21.350  1.00 51.10  ? 480  TRP A CG    1 
ATOM   3686 C CD1   . TRP A 1 480 ? 17.204  8.260   21.231  1.00 50.13  ? 480  TRP A CD1   1 
ATOM   3687 C CD2   . TRP A 1 480 ? 15.306  8.311   20.060  1.00 50.98  ? 480  TRP A CD2   1 
ATOM   3688 N NE1   . TRP A 1 480 ? 17.512  8.630   19.945  1.00 48.69  ? 480  TRP A NE1   1 
ATOM   3689 C CE2   . TRP A 1 480 ? 16.364  8.663   19.209  1.00 48.06  ? 480  TRP A CE2   1 
ATOM   3690 C CE3   . TRP A 1 480 ? 14.010  8.256   19.533  1.00 52.79  ? 480  TRP A CE3   1 
ATOM   3691 C CZ2   . TRP A 1 480 ? 16.171  8.968   17.869  1.00 50.57  ? 480  TRP A CZ2   1 
ATOM   3692 C CZ3   . TRP A 1 480 ? 13.818  8.565   18.203  1.00 51.42  ? 480  TRP A CZ3   1 
ATOM   3693 C CH2   . TRP A 1 480 ? 14.889  8.925   17.387  1.00 50.85  ? 480  TRP A CH2   1 
ATOM   3694 N N     . THR A 1 481 ? 13.836  5.860   24.828  1.00 55.62  ? 481  THR A N     1 
ATOM   3695 C CA    . THR A 1 481 ? 13.922  5.114   26.082  1.00 56.16  ? 481  THR A CA    1 
ATOM   3696 C C     . THR A 1 481 ? 13.179  3.777   25.998  1.00 57.82  ? 481  THR A C     1 
ATOM   3697 O O     . THR A 1 481 ? 13.610  2.806   26.614  1.00 59.27  ? 481  THR A O     1 
ATOM   3698 C CB    . THR A 1 481 ? 13.402  5.949   27.252  1.00 56.24  ? 481  THR A CB    1 
ATOM   3699 O OG1   . THR A 1 481 ? 12.090  6.425   26.939  1.00 58.37  ? 481  THR A OG1   1 
ATOM   3700 C CG2   . THR A 1 481 ? 14.311  7.152   27.509  1.00 54.39  ? 481  THR A CG2   1 
ATOM   3701 N N     . ASN A 1 482 ? 12.082  3.700   25.246  1.00 58.44  ? 482  ASN A N     1 
ATOM   3702 C CA    . ASN A 1 482 ? 11.432  2.396   25.016  1.00 59.83  ? 482  ASN A CA    1 
ATOM   3703 C C     . ASN A 1 482 ? 12.403  1.492   24.291  1.00 59.59  ? 482  ASN A C     1 
ATOM   3704 O O     . ASN A 1 482 ? 12.581  0.345   24.670  1.00 60.14  ? 482  ASN A O     1 
ATOM   3705 C CB    . ASN A 1 482 ? 10.164  2.507   24.156  1.00 60.76  ? 482  ASN A CB    1 
ATOM   3706 C CG    . ASN A 1 482 ? 8.956   3.004   24.924  1.00 62.28  ? 482  ASN A CG    1 
ATOM   3707 O OD1   . ASN A 1 482 ? 8.888   2.909   26.143  1.00 63.66  ? 482  ASN A OD1   1 
ATOM   3708 N ND2   . ASN A 1 482 ? 7.978   3.524   24.195  1.00 63.31  ? 482  ASN A ND2   1 
ATOM   3709 N N     . PHE A 1 483 ? 13.019  2.014   23.231  1.00 58.71  ? 483  PHE A N     1 
ATOM   3710 C CA    . PHE A 1 483 ? 14.054  1.270   22.523  1.00 58.93  ? 483  PHE A CA    1 
ATOM   3711 C C     . PHE A 1 483 ? 15.223  0.853   23.433  1.00 58.91  ? 483  PHE A C     1 
ATOM   3712 O O     . PHE A 1 483 ? 15.725  -0.269  23.339  1.00 59.45  ? 483  PHE A O     1 
ATOM   3713 C CB    . PHE A 1 483 ? 14.603  2.059   21.336  1.00 57.74  ? 483  PHE A CB    1 
ATOM   3714 C CG    . PHE A 1 483 ? 15.667  1.316   20.591  1.00 57.87  ? 483  PHE A CG    1 
ATOM   3715 C CD1   . PHE A 1 483 ? 15.328  0.283   19.722  1.00 58.81  ? 483  PHE A CD1   1 
ATOM   3716 C CD2   . PHE A 1 483 ? 17.008  1.587   20.815  1.00 56.79  ? 483  PHE A CD2   1 
ATOM   3717 C CE1   . PHE A 1 483 ? 16.307  -0.424  19.053  1.00 59.05  ? 483  PHE A CE1   1 
ATOM   3718 C CE2   . PHE A 1 483 ? 17.991  0.877   20.150  1.00 57.05  ? 483  PHE A CE2   1 
ATOM   3719 C CZ    . PHE A 1 483 ? 17.642  -0.116  19.260  1.00 57.79  ? 483  PHE A CZ    1 
ATOM   3720 N N     . ALA A 1 484 ? 15.661  1.756   24.301  1.00 58.71  ? 484  ALA A N     1 
ATOM   3721 C CA    . ALA A 1 484 ? 16.724  1.434   25.251  1.00 59.23  ? 484  ALA A CA    1 
ATOM   3722 C C     . ALA A 1 484 ? 16.312  0.294   26.164  1.00 61.43  ? 484  ALA A C     1 
ATOM   3723 O O     . ALA A 1 484 ? 17.101  -0.614  26.403  1.00 61.95  ? 484  ALA A O     1 
ATOM   3724 C CB    . ALA A 1 484 ? 17.113  2.648   26.062  1.00 58.15  ? 484  ALA A CB    1 
ATOM   3725 N N     . ARG A 1 485 ? 15.074  0.342   26.654  1.00 63.26  ? 485  ARG A N     1 
ATOM   3726 C CA    . ARG A 1 485 ? 14.532  -0.670  27.562  1.00 65.94  ? 485  ARG A CA    1 
ATOM   3727 C C     . ARG A 1 485 ? 14.395  -2.048  26.925  1.00 66.18  ? 485  ARG A C     1 
ATOM   3728 O O     . ARG A 1 485 ? 14.766  -3.055  27.522  1.00 67.06  ? 485  ARG A O     1 
ATOM   3729 C CB    . ARG A 1 485 ? 13.119  -0.277  28.039  1.00 67.33  ? 485  ARG A CB    1 
ATOM   3730 C CG    . ARG A 1 485 ? 13.005  0.681   29.240  1.00 69.66  ? 485  ARG A CG    1 
ATOM   3731 C CD    . ARG A 1 485 ? 11.493  0.894   29.679  1.00 71.58  ? 485  ARG A CD    1 
ATOM   3732 N NE    . ARG A 1 485 ? 10.878  2.027   28.963  1.00 73.31  ? 485  ARG A NE    1 
ATOM   3733 C CZ    . ARG A 1 485 ? 11.164  3.319   29.193  1.00 73.93  ? 485  ARG A CZ    1 
ATOM   3734 N NH1   . ARG A 1 485 ? 12.035  3.661   30.145  1.00 74.36  ? 485  ARG A NH1   1 
ATOM   3735 N NH2   . ARG A 1 485 ? 10.579  4.286   28.472  1.00 72.85  ? 485  ARG A NH2   1 
ATOM   3736 N N     . THR A 1 486 ? 13.811  -2.082  25.732  1.00 65.77  ? 486  THR A N     1 
ATOM   3737 C CA    . THR A 1 486 ? 13.278  -3.317  25.159  1.00 66.92  ? 486  THR A CA    1 
ATOM   3738 C C     . THR A 1 486 ? 13.842  -3.688  23.785  1.00 66.70  ? 486  THR A C     1 
ATOM   3739 O O     . THR A 1 486 ? 13.685  -4.828  23.343  1.00 67.33  ? 486  THR A O     1 
ATOM   3740 C CB    . THR A 1 486 ? 11.761  -3.211  25.006  1.00 68.05  ? 486  THR A CB    1 
ATOM   3741 O OG1   . THR A 1 486 ? 11.452  -2.213  24.029  1.00 66.92  ? 486  THR A OG1   1 
ATOM   3742 C CG2   . THR A 1 486 ? 11.095  -2.845  26.344  1.00 68.06  ? 486  THR A CG2   1 
ATOM   3743 N N     . GLY A 1 487 ? 14.504  -2.738  23.121  1.00 65.11  ? 487  GLY A N     1 
ATOM   3744 C CA    . GLY A 1 487 ? 14.942  -2.927  21.743  1.00 64.97  ? 487  GLY A CA    1 
ATOM   3745 C C     . GLY A 1 487 ? 13.840  -2.663  20.740  1.00 65.65  ? 487  GLY A C     1 
ATOM   3746 O O     . GLY A 1 487 ? 13.977  -3.012  19.580  1.00 65.99  ? 487  GLY A O     1 
ATOM   3747 N N     . ASP A 1 488 ? 12.760  -2.024  21.189  1.00 66.50  ? 488  ASP A N     1 
ATOM   3748 C CA    . ASP A 1 488 ? 11.574  -1.730  20.371  1.00 67.63  ? 488  ASP A CA    1 
ATOM   3749 C C     . ASP A 1 488 ? 11.066  -0.343  20.792  1.00 66.79  ? 488  ASP A C     1 
ATOM   3750 O O     . ASP A 1 488 ? 10.757  -0.149  21.959  1.00 66.20  ? 488  ASP A O     1 
ATOM   3751 C CB    . ASP A 1 488 ? 10.503  -2.803  20.642  1.00 69.42  ? 488  ASP A CB    1 
ATOM   3752 C CG    . ASP A 1 488 ? 9.244   -2.635  19.796  1.00 70.17  ? 488  ASP A CG    1 
ATOM   3753 O OD1   . ASP A 1 488 ? 9.060   -1.595  19.125  1.00 69.44  ? 488  ASP A OD1   1 
ATOM   3754 O OD2   . ASP A 1 488 ? 8.418   -3.564  19.801  1.00 72.07  ? 488  ASP A OD2   1 
ATOM   3755 N N     . PRO A 1 489 ? 10.997  0.632   19.858  1.00 67.09  ? 489  PRO A N     1 
ATOM   3756 C CA    . PRO A 1 489 ? 10.558  1.989   20.242  1.00 67.05  ? 489  PRO A CA    1 
ATOM   3757 C C     . PRO A 1 489 ? 9.058   2.098   20.556  1.00 69.98  ? 489  PRO A C     1 
ATOM   3758 O O     . PRO A 1 489 ? 8.620   3.093   21.139  1.00 69.74  ? 489  PRO A O     1 
ATOM   3759 C CB    . PRO A 1 489 ? 10.902  2.829   19.008  1.00 66.00  ? 489  PRO A CB    1 
ATOM   3760 C CG    . PRO A 1 489 ? 10.855  1.860   17.875  1.00 66.39  ? 489  PRO A CG    1 
ATOM   3761 C CD    . PRO A 1 489 ? 11.315  0.549   18.420  1.00 66.82  ? 489  PRO A CD    1 
ATOM   3762 N N     . ASN A 1 490 ? 8.292   1.088   20.151  1.00 73.37  ? 490  ASN A N     1 
ATOM   3763 C CA    . ASN A 1 490 ? 6.851   1.065   20.338  1.00 76.52  ? 490  ASN A CA    1 
ATOM   3764 C C     . ASN A 1 490 ? 6.468   0.894   21.796  1.00 79.88  ? 490  ASN A C     1 
ATOM   3765 O O     . ASN A 1 490 ? 7.158   0.205   22.555  1.00 79.59  ? 490  ASN A O     1 
ATOM   3766 C CB    . ASN A 1 490 ? 6.230   -0.077  19.534  1.00 77.60  ? 490  ASN A CB    1 
ATOM   3767 C CG    . ASN A 1 490 ? 6.268   0.165   18.047  1.00 75.29  ? 490  ASN A CG    1 
ATOM   3768 O OD1   . ASN A 1 490 ? 5.554   1.028   17.533  1.00 73.15  ? 490  ASN A OD1   1 
ATOM   3769 N ND2   . ASN A 1 490 ? 7.075   -0.618  17.338  1.00 70.58  ? 490  ASN A ND2   1 
ATOM   3770 N N     . ASP A 1 491 ? 5.356   1.517   22.176  1.00 83.90  ? 491  ASP A N     1 
ATOM   3771 C CA    . ASP A 1 491 ? 4.816   1.356   23.520  1.00 88.15  ? 491  ASP A CA    1 
ATOM   3772 C C     . ASP A 1 491 ? 4.190   -0.037  23.676  1.00 91.07  ? 491  ASP A C     1 
ATOM   3773 O O     . ASP A 1 491 ? 3.377   -0.453  22.838  1.00 92.12  ? 491  ASP A O     1 
ATOM   3774 C CB    . ASP A 1 491 ? 3.768   2.429   23.836  1.00 88.92  ? 491  ASP A CB    1 
ATOM   3775 C CG    . ASP A 1 491 ? 3.468   2.536   25.342  1.00 91.77  ? 491  ASP A CG    1 
ATOM   3776 O OD1   . ASP A 1 491 ? 3.950   3.516   25.966  1.00 93.79  ? 491  ASP A OD1   1 
ATOM   3777 O OD2   . ASP A 1 491 ? 2.774   1.645   25.901  1.00 94.46  ? 491  ASP A OD2   1 
ATOM   3778 N N     . PRO A 1 492 ? 4.564   -0.753  24.753  1.00 93.32  ? 492  PRO A N     1 
ATOM   3779 C CA    . PRO A 1 492 ? 4.003   -2.082  25.031  1.00 96.38  ? 492  PRO A CA    1 
ATOM   3780 C C     . PRO A 1 492 ? 2.473   -2.089  25.137  1.00 100.34 ? 492  PRO A C     1 
ATOM   3781 O O     . PRO A 1 492 ? 1.825   -2.937  24.525  1.00 102.15 ? 492  PRO A O     1 
ATOM   3782 C CB    . PRO A 1 492 ? 4.628   -2.462  26.383  1.00 96.75  ? 492  PRO A CB    1 
ATOM   3783 C CG    . PRO A 1 492 ? 5.830   -1.588  26.527  1.00 94.00  ? 492  PRO A CG    1 
ATOM   3784 C CD    . PRO A 1 492 ? 5.542   -0.334  25.776  1.00 91.96  ? 492  PRO A CD    1 
ATOM   3785 N N     . ARG A 1 493 ? 1.913   -1.143  25.894  1.00 102.29 ? 493  ARG A N     1 
ATOM   3786 C CA    . ARG A 1 493 ? 0.460   -1.073  26.097  1.00 105.93 ? 493  ARG A CA    1 
ATOM   3787 C C     . ARG A 1 493 ? -0.219  -0.382  24.907  1.00 106.53 ? 493  ARG A C     1 
ATOM   3788 O O     . ARG A 1 493 ? -1.002  -1.004  24.183  1.00 108.49 ? 493  ARG A O     1 
ATOM   3789 C CB    . ARG A 1 493 ? 0.085   -0.342  27.413  1.00 106.89 ? 493  ARG A CB    1 
ATOM   3790 C CG    . ARG A 1 493 ? 0.959   -0.645  28.663  1.00 107.63 ? 493  ARG A CG    1 
ATOM   3791 C CD    . ARG A 1 493 ? 1.990   0.477   28.933  1.00 107.05 ? 493  ARG A CD    1 
ATOM   3792 N NE    . ARG A 1 493 ? 2.670   0.328   30.225  1.00 107.36 ? 493  ARG A NE    1 
ATOM   3793 C CZ    . ARG A 1 493 ? 3.699   1.077   30.638  1.00 107.11 ? 493  ARG A CZ    1 
ATOM   3794 N NH1   . ARG A 1 493 ? 4.190   2.045   29.862  1.00 106.13 ? 493  ARG A NH1   1 
ATOM   3795 N NH2   . ARG A 1 493 ? 4.247   0.860   31.836  1.00 106.66 ? 493  ARG A NH2   1 
ATOM   3796 N N     . ASP A 1 494 ? 0.101   0.898   24.716  1.00 105.57 ? 494  ASP A N     1 
ATOM   3797 C CA    . ASP A 1 494 ? -0.553  1.757   23.714  1.00 106.02 ? 494  ASP A CA    1 
ATOM   3798 C C     . ASP A 1 494 ? -0.396  1.237   22.276  1.00 106.23 ? 494  ASP A C     1 
ATOM   3799 O O     . ASP A 1 494 ? 0.690   1.338   21.675  1.00 104.94 ? 494  ASP A O     1 
ATOM   3800 C CB    . ASP A 1 494 ? -0.016  3.198   23.820  1.00 104.21 ? 494  ASP A CB    1 
ATOM   3801 C CG    . ASP A 1 494 ? -0.448  4.083   22.653  1.00 104.36 ? 494  ASP A CG    1 
ATOM   3802 O OD1   . ASP A 1 494 ? 0.338   4.982   22.287  1.00 103.14 ? 494  ASP A OD1   1 
ATOM   3803 O OD2   . ASP A 1 494 ? -1.557  3.882   22.102  1.00 106.15 ? 494  ASP A OD2   1 
ATOM   3804 N N     . SER A 1 495 ? -1.499  0.709   21.736  1.00 108.20 ? 495  SER A N     1 
ATOM   3805 C CA    . SER A 1 495 ? -1.538  0.117   20.392  1.00 108.44 ? 495  SER A CA    1 
ATOM   3806 C C     . SER A 1 495 ? -2.551  0.772   19.429  1.00 109.17 ? 495  SER A C     1 
ATOM   3807 O O     . SER A 1 495 ? -2.544  0.461   18.232  1.00 109.56 ? 495  SER A O     1 
ATOM   3808 C CB    . SER A 1 495 ? -1.847  -1.380  20.502  1.00 110.75 ? 495  SER A CB    1 
ATOM   3809 O OG    . SER A 1 495 ? -3.118  -1.596  21.102  1.00 112.62 ? 495  SER A OG    1 
ATOM   3810 N N     . LYS A 1 496 ? -3.429  1.643   19.942  1.00 109.16 ? 496  LYS A N     1 
ATOM   3811 C CA    . LYS A 1 496 ? -4.270  2.496   19.080  1.00 108.98 ? 496  LYS A CA    1 
ATOM   3812 C C     . LYS A 1 496 ? -3.392  3.485   18.280  1.00 105.60 ? 496  LYS A C     1 
ATOM   3813 O O     . LYS A 1 496 ? -3.686  3.796   17.118  1.00 105.75 ? 496  LYS A O     1 
ATOM   3814 C CB    . LYS A 1 496 ? -5.315  3.254   19.910  1.00 109.90 ? 496  LYS A CB    1 
ATOM   3815 N N     . SER A 1 497 ? -2.315  3.967   18.902  1.00 102.22 ? 497  SER A N     1 
ATOM   3816 C CA    . SER A 1 497 ? -1.292  4.730   18.182  1.00 99.02  ? 497  SER A CA    1 
ATOM   3817 C C     . SER A 1 497 ? -0.740  3.895   17.023  1.00 97.41  ? 497  SER A C     1 
ATOM   3818 O O     . SER A 1 497 ? -0.807  2.655   17.056  1.00 98.91  ? 497  SER A O     1 
ATOM   3819 C CB    . SER A 1 497 ? -0.133  5.120   19.109  1.00 97.35  ? 497  SER A CB    1 
ATOM   3820 O OG    . SER A 1 497 ? -0.518  6.125   20.029  1.00 97.98  ? 497  SER A OG    1 
ATOM   3821 N N     . PRO A 1 498 ? -0.173  4.563   16.003  1.00 93.87  ? 498  PRO A N     1 
ATOM   3822 C CA    . PRO A 1 498 ? 0.336   3.781   14.880  1.00 92.06  ? 498  PRO A CA    1 
ATOM   3823 C C     . PRO A 1 498 ? 1.687   3.177   15.258  1.00 88.45  ? 498  PRO A C     1 
ATOM   3824 O O     . PRO A 1 498 ? 2.458   3.813   15.975  1.00 86.37  ? 498  PRO A O     1 
ATOM   3825 C CB    . PRO A 1 498 ? 0.470   4.812   13.742  1.00 91.43  ? 498  PRO A CB    1 
ATOM   3826 C CG    . PRO A 1 498 ? 0.204   6.172   14.360  1.00 91.48  ? 498  PRO A CG    1 
ATOM   3827 C CD    . PRO A 1 498 ? 0.089   6.005   15.842  1.00 92.40  ? 498  PRO A CD    1 
ATOM   3828 N N     . GLN A 1 499 ? 1.943   1.956   14.790  1.00 86.42  ? 499  GLN A N     1 
ATOM   3829 C CA    . GLN A 1 499 ? 3.157   1.222   15.124  1.00 83.45  ? 499  GLN A CA    1 
ATOM   3830 C C     . GLN A 1 499 ? 4.329   1.614   14.227  1.00 79.20  ? 499  GLN A C     1 
ATOM   3831 O O     . GLN A 1 499 ? 4.151   2.060   13.102  1.00 78.50  ? 499  GLN A O     1 
ATOM   3832 C CB    . GLN A 1 499 ? 2.920   -0.289  15.020  1.00 85.39  ? 499  GLN A CB    1 
ATOM   3833 C CG    . GLN A 1 499 ? 1.979   -0.845  16.084  1.00 88.41  ? 499  GLN A CG    1 
ATOM   3834 C CD    . GLN A 1 499 ? 2.606   -0.846  17.476  1.00 88.65  ? 499  GLN A CD    1 
ATOM   3835 O OE1   . GLN A 1 499 ? 3.610   -1.534  17.726  1.00 87.88  ? 499  GLN A OE1   1 
ATOM   3836 N NE2   . GLN A 1 499 ? 2.008   -0.079  18.394  1.00 88.57  ? 499  GLN A NE2   1 
ATOM   3837 N N     . TRP A 1 500 ? 5.524   1.440   14.768  1.00 75.14  ? 500  TRP A N     1 
ATOM   3838 C CA    . TRP A 1 500 ? 6.773   1.625   14.047  1.00 71.73  ? 500  TRP A CA    1 
ATOM   3839 C C     . TRP A 1 500 ? 7.249   0.217   13.673  1.00 71.68  ? 500  TRP A C     1 
ATOM   3840 O O     . TRP A 1 500 ? 7.717   -0.539  14.532  1.00 71.34  ? 500  TRP A O     1 
ATOM   3841 C CB    . TRP A 1 500 ? 7.765   2.327   14.968  1.00 68.88  ? 500  TRP A CB    1 
ATOM   3842 C CG    . TRP A 1 500 ? 9.038   2.791   14.364  1.00 66.76  ? 500  TRP A CG    1 
ATOM   3843 C CD1   . TRP A 1 500 ? 9.654   2.329   13.226  1.00 66.14  ? 500  TRP A CD1   1 
ATOM   3844 C CD2   . TRP A 1 500 ? 9.896   3.791   14.901  1.00 64.07  ? 500  TRP A CD2   1 
ATOM   3845 N NE1   . TRP A 1 500 ? 10.831  2.992   13.022  1.00 63.44  ? 500  TRP A NE1   1 
ATOM   3846 C CE2   . TRP A 1 500 ? 11.008  3.897   14.036  1.00 63.29  ? 500  TRP A CE2   1 
ATOM   3847 C CE3   . TRP A 1 500 ? 9.838   4.611   16.030  1.00 62.92  ? 500  TRP A CE3   1 
ATOM   3848 C CZ2   . TRP A 1 500 ? 12.042  4.795   14.268  1.00 61.42  ? 500  TRP A CZ2   1 
ATOM   3849 C CZ3   . TRP A 1 500 ? 10.859  5.515   16.244  1.00 61.72  ? 500  TRP A CZ3   1 
ATOM   3850 C CH2   . TRP A 1 500 ? 11.947  5.593   15.375  1.00 61.06  ? 500  TRP A CH2   1 
ATOM   3851 N N     . PRO A 1 501 ? 7.115   -0.148  12.389  1.00 71.32  ? 501  PRO A N     1 
ATOM   3852 C CA    . PRO A 1 501 ? 7.492   -1.484  11.987  1.00 71.63  ? 501  PRO A CA    1 
ATOM   3853 C C     . PRO A 1 501 ? 8.992   -1.534  11.748  1.00 69.73  ? 501  PRO A C     1 
ATOM   3854 O O     . PRO A 1 501 ? 9.575   -0.528  11.347  1.00 67.86  ? 501  PRO A O     1 
ATOM   3855 C CB    . PRO A 1 501 ? 6.733   -1.682  10.667  1.00 72.94  ? 501  PRO A CB    1 
ATOM   3856 C CG    . PRO A 1 501 ? 6.572   -0.324  10.094  1.00 72.10  ? 501  PRO A CG    1 
ATOM   3857 C CD    . PRO A 1 501 ? 6.675   0.670   11.239  1.00 71.21  ? 501  PRO A CD    1 
ATOM   3858 N N     . PRO A 1 502 ? 9.624   -2.689  12.003  1.00 69.85  ? 502  PRO A N     1 
ATOM   3859 C CA    . PRO A 1 502 ? 11.036  -2.840  11.674  1.00 68.48  ? 502  PRO A CA    1 
ATOM   3860 C C     . PRO A 1 502 ? 11.340  -2.540  10.203  1.00 68.06  ? 502  PRO A C     1 
ATOM   3861 O O     . PRO A 1 502 ? 10.506  -2.775  9.326   1.00 68.67  ? 502  PRO A O     1 
ATOM   3862 C CB    . PRO A 1 502 ? 11.312  -4.318  11.973  1.00 70.00  ? 502  PRO A CB    1 
ATOM   3863 C CG    . PRO A 1 502 ? 10.280  -4.720  12.939  1.00 71.15  ? 502  PRO A CG    1 
ATOM   3864 C CD    . PRO A 1 502 ? 9.072   -3.899  12.638  1.00 71.35  ? 502  PRO A CD    1 
ATOM   3865 N N     . TYR A 1 503 ? 12.527  -2.006  9.949   1.00 66.52  ? 503  TYR A N     1 
ATOM   3866 C CA    . TYR A 1 503 ? 13.026  -1.881  8.593   1.00 66.42  ? 503  TYR A CA    1 
ATOM   3867 C C     . TYR A 1 503 ? 13.522  -3.237  8.102   1.00 67.36  ? 503  TYR A C     1 
ATOM   3868 O O     . TYR A 1 503 ? 14.285  -3.899  8.785   1.00 66.98  ? 503  TYR A O     1 
ATOM   3869 C CB    . TYR A 1 503 ? 14.156  -0.874  8.551   1.00 65.09  ? 503  TYR A CB    1 
ATOM   3870 C CG    . TYR A 1 503 ? 14.753  -0.656  7.186   1.00 65.43  ? 503  TYR A CG    1 
ATOM   3871 C CD1   . TYR A 1 503 ? 15.792  -1.459  6.729   1.00 66.14  ? 503  TYR A CD1   1 
ATOM   3872 C CD2   . TYR A 1 503 ? 14.297  0.366   6.360   1.00 65.59  ? 503  TYR A CD2   1 
ATOM   3873 C CE1   . TYR A 1 503 ? 16.358  -1.263  5.498   1.00 65.74  ? 503  TYR A CE1   1 
ATOM   3874 C CE2   . TYR A 1 503 ? 14.862  0.576   5.125   1.00 65.91  ? 503  TYR A CE2   1 
ATOM   3875 C CZ    . TYR A 1 503 ? 15.895  -0.244  4.701   1.00 66.38  ? 503  TYR A CZ    1 
ATOM   3876 O OH    . TYR A 1 503 ? 16.464  -0.049  3.474   1.00 67.11  ? 503  TYR A OH    1 
ATOM   3877 N N     . THR A 1 504 ? 13.072  -3.631  6.913   1.00 68.43  ? 504  THR A N     1 
ATOM   3878 C CA    . THR A 1 504 ? 13.517  -4.856  6.255   1.00 69.92  ? 504  THR A CA    1 
ATOM   3879 C C     . THR A 1 504 ? 13.940  -4.572  4.809   1.00 70.25  ? 504  THR A C     1 
ATOM   3880 O O     . THR A 1 504 ? 13.483  -3.605  4.199   1.00 69.00  ? 504  THR A O     1 
ATOM   3881 C CB    . THR A 1 504 ? 12.388  -5.888  6.214   1.00 71.89  ? 504  THR A CB    1 
ATOM   3882 O OG1   . THR A 1 504 ? 11.278  -5.320  5.510   1.00 72.05  ? 504  THR A OG1   1 
ATOM   3883 C CG2   . THR A 1 504 ? 11.952  -6.277  7.623   1.00 70.51  ? 504  THR A CG2   1 
ATOM   3884 N N     . THR A 1 505 ? 14.799  -5.429  4.261   1.00 71.66  ? 505  THR A N     1 
ATOM   3885 C CA    . THR A 1 505 ? 15.182  -5.323  2.852   1.00 72.33  ? 505  THR A CA    1 
ATOM   3886 C C     . THR A 1 505 ? 13.957  -5.541  1.952   1.00 74.00  ? 505  THR A C     1 
ATOM   3887 O O     . THR A 1 505 ? 13.830  -4.904  0.913   1.00 74.01  ? 505  THR A O     1 
ATOM   3888 C CB    . THR A 1 505 ? 16.313  -6.333  2.457   1.00 73.44  ? 505  THR A CB    1 
ATOM   3889 O OG1   . THR A 1 505 ? 15.827  -7.669  2.549   1.00 74.59  ? 505  THR A OG1   1 
ATOM   3890 C CG2   . THR A 1 505 ? 17.551  -6.179  3.354   1.00 72.27  ? 505  THR A CG2   1 
ATOM   3891 N N     . ALA A 1 506 ? 13.050  -6.418  2.371   1.00 75.54  ? 506  ALA A N     1 
ATOM   3892 C CA    . ALA A 1 506 ? 11.857  -6.706  1.583   1.00 77.72  ? 506  ALA A CA    1 
ATOM   3893 C C     . ALA A 1 506 ? 10.936  -5.501  1.497   1.00 76.62  ? 506  ALA A C     1 
ATOM   3894 O O     . ALA A 1 506 ? 10.555  -5.098  0.400   1.00 77.76  ? 506  ALA A O     1 
ATOM   3895 C CB    . ALA A 1 506 ? 11.090  -7.913  2.157   1.00 79.64  ? 506  ALA A CB    1 
ATOM   3896 N N     . ALA A 1 507 ? 10.573  -4.940  2.649   1.00 75.04  ? 507  ALA A N     1 
ATOM   3897 C CA    . ALA A 1 507 ? 9.570   -3.868  2.704   1.00 74.07  ? 507  ALA A CA    1 
ATOM   3898 C C     . ALA A 1 507 ? 10.163  -2.458  2.907   1.00 71.27  ? 507  ALA A C     1 
ATOM   3899 O O     . ALA A 1 507 ? 9.507   -1.463  2.606   1.00 70.65  ? 507  ALA A O     1 
ATOM   3900 C CB    . ALA A 1 507 ? 8.509   -4.190  3.773   1.00 74.65  ? 507  ALA A CB    1 
ATOM   3901 N N     . GLN A 1 508 ? 11.395  -2.368  3.404   1.00 69.78  ? 508  GLN A N     1 
ATOM   3902 C CA    . GLN A 1 508 ? 12.122  -1.078  3.490   1.00 67.68  ? 508  GLN A CA    1 
ATOM   3903 C C     . GLN A 1 508 ? 11.346  0.042   4.219   1.00 66.17  ? 508  GLN A C     1 
ATOM   3904 O O     . GLN A 1 508 ? 11.439  1.216   3.858   1.00 64.92  ? 508  GLN A O     1 
ATOM   3905 C CB    . GLN A 1 508 ? 12.557  -0.614  2.088   1.00 67.49  ? 508  GLN A CB    1 
ATOM   3906 C CG    . GLN A 1 508 ? 13.411  -1.633  1.307   1.00 68.67  ? 508  GLN A CG    1 
ATOM   3907 C CD    . GLN A 1 508 ? 13.799  -1.144  -0.088  1.00 68.45  ? 508  GLN A CD    1 
ATOM   3908 O OE1   . GLN A 1 508 ? 14.389  -0.077  -0.237  1.00 68.50  ? 508  GLN A OE1   1 
ATOM   3909 N NE2   . GLN A 1 508 ? 13.472  -1.923  -1.105  1.00 68.51  ? 508  GLN A NE2   1 
ATOM   3910 N N     . GLN A 1 509 ? 10.631  -0.330  5.278   1.00 66.14  ? 509  GLN A N     1 
ATOM   3911 C CA    . GLN A 1 509 ? 9.779   0.601   6.011   1.00 65.55  ? 509  GLN A CA    1 
ATOM   3912 C C     . GLN A 1 509 ? 10.508  1.456   7.059   1.00 63.48  ? 509  GLN A C     1 
ATOM   3913 O O     . GLN A 1 509 ? 11.381  0.965   7.784   1.00 63.08  ? 509  GLN A O     1 
ATOM   3914 C CB    . GLN A 1 509 ? 8.663   -0.155  6.705   1.00 67.19  ? 509  GLN A CB    1 
ATOM   3915 C CG    . GLN A 1 509 ? 7.766   -0.876  5.756   1.00 69.71  ? 509  GLN A CG    1 
ATOM   3916 C CD    . GLN A 1 509 ? 6.712   -1.650  6.471   1.00 72.64  ? 509  GLN A CD    1 
ATOM   3917 O OE1   . GLN A 1 509 ? 7.002   -2.677  7.087   1.00 73.54  ? 509  GLN A OE1   1 
ATOM   3918 N NE2   . GLN A 1 509 ? 5.466   -1.174  6.392   1.00 73.62  ? 509  GLN A NE2   1 
ATOM   3919 N N     . TYR A 1 510 ? 10.114  2.728   7.122   1.00 61.87  ? 510  TYR A N     1 
ATOM   3920 C CA    . TYR A 1 510 ? 10.628  3.698   8.081   1.00 60.28  ? 510  TYR A CA    1 
ATOM   3921 C C     . TYR A 1 510 ? 9.531   4.700   8.409   1.00 60.53  ? 510  TYR A C     1 
ATOM   3922 O O     . TYR A 1 510 ? 8.513   4.766   7.717   1.00 62.01  ? 510  TYR A O     1 
ATOM   3923 C CB    . TYR A 1 510 ? 11.835  4.426   7.510   1.00 58.41  ? 510  TYR A CB    1 
ATOM   3924 C CG    . TYR A 1 510 ? 11.551  5.320   6.321   1.00 58.15  ? 510  TYR A CG    1 
ATOM   3925 C CD1   . TYR A 1 510 ? 11.323  4.781   5.050   1.00 58.93  ? 510  TYR A CD1   1 
ATOM   3926 C CD2   . TYR A 1 510 ? 11.544  6.714   6.459   1.00 56.59  ? 510  TYR A CD2   1 
ATOM   3927 C CE1   . TYR A 1 510 ? 11.075  5.605   3.952   1.00 58.94  ? 510  TYR A CE1   1 
ATOM   3928 C CE2   . TYR A 1 510 ? 11.299  7.546   5.384   1.00 56.13  ? 510  TYR A CE2   1 
ATOM   3929 C CZ    . TYR A 1 510 ? 11.071  6.996   4.119   1.00 58.80  ? 510  TYR A CZ    1 
ATOM   3930 O OH    . TYR A 1 510 ? 10.826  7.833   3.035   1.00 58.17  ? 510  TYR A OH    1 
ATOM   3931 N N     . VAL A 1 511 ? 9.726   5.491   9.453   1.00 59.37  ? 511  VAL A N     1 
ATOM   3932 C CA    . VAL A 1 511 ? 8.655   6.364   9.919   1.00 59.52  ? 511  VAL A CA    1 
ATOM   3933 C C     . VAL A 1 511 ? 9.060   7.814   9.847   1.00 58.31  ? 511  VAL A C     1 
ATOM   3934 O O     . VAL A 1 511 ? 10.237  8.146   10.037  1.00 58.00  ? 511  VAL A O     1 
ATOM   3935 C CB    . VAL A 1 511 ? 8.197   6.030   11.362  1.00 59.88  ? 511  VAL A CB    1 
ATOM   3936 C CG1   . VAL A 1 511 ? 7.562   4.661   11.400  1.00 60.97  ? 511  VAL A CG1   1 
ATOM   3937 C CG2   . VAL A 1 511 ? 9.366   6.146   12.359  1.00 58.08  ? 511  VAL A CG2   1 
ATOM   3938 N N     . SER A 1 512 ? 8.081   8.667   9.557   1.00 58.45  ? 512  SER A N     1 
ATOM   3939 C CA    . SER A 1 512 ? 8.262   10.106  9.619   1.00 57.88  ? 512  SER A CA    1 
ATOM   3940 C C     . SER A 1 512 ? 8.123   10.550  11.070  1.00 57.70  ? 512  SER A C     1 
ATOM   3941 O O     . SER A 1 512 ? 7.138   10.218  11.729  1.00 58.60  ? 512  SER A O     1 
ATOM   3942 C CB    . SER A 1 512 ? 7.225   10.821  8.746   1.00 58.30  ? 512  SER A CB    1 
ATOM   3943 O OG    . SER A 1 512 ? 5.905   10.441  9.112   1.00 61.30  ? 512  SER A OG    1 
ATOM   3944 N N     . LEU A 1 513 ? 9.123   11.284  11.562  1.00 56.66  ? 513  LEU A N     1 
ATOM   3945 C CA    . LEU A 1 513 ? 9.064   11.890  12.890  1.00 56.23  ? 513  LEU A CA    1 
ATOM   3946 C C     . LEU A 1 513 ? 8.779   13.380  12.743  1.00 56.21  ? 513  LEU A C     1 
ATOM   3947 O O     . LEU A 1 513 ? 9.651   14.157  12.336  1.00 55.21  ? 513  LEU A O     1 
ATOM   3948 C CB    . LEU A 1 513 ? 10.381  11.663  13.660  1.00 55.17  ? 513  LEU A CB    1 
ATOM   3949 C CG    . LEU A 1 513 ? 10.712  10.242  14.117  1.00 53.83  ? 513  LEU A CG    1 
ATOM   3950 C CD1   . LEU A 1 513 ? 11.955  10.260  14.979  1.00 50.49  ? 513  LEU A CD1   1 
ATOM   3951 C CD2   . LEU A 1 513 ? 9.550   9.615   14.871  1.00 55.23  ? 513  LEU A CD2   1 
ATOM   3952 N N     . ASN A 1 514 ? 7.548   13.766  13.054  1.00 57.88  ? 514  ASN A N     1 
ATOM   3953 C CA    . ASN A 1 514 ? 7.116   15.176  12.999  1.00 58.79  ? 514  ASN A CA    1 
ATOM   3954 C C     . ASN A 1 514 ? 5.946   15.396  13.967  1.00 59.96  ? 514  ASN A C     1 
ATOM   3955 O O     . ASN A 1 514 ? 5.614   14.490  14.723  1.00 60.64  ? 514  ASN A O     1 
ATOM   3956 C CB    . ASN A 1 514 ? 6.793   15.600  11.543  1.00 58.85  ? 514  ASN A CB    1 
ATOM   3957 C CG    . ASN A 1 514 ? 5.770   14.678  10.863  1.00 60.51  ? 514  ASN A CG    1 
ATOM   3958 O OD1   . ASN A 1 514 ? 4.759   14.324  11.456  1.00 61.47  ? 514  ASN A OD1   1 
ATOM   3959 N ND2   . ASN A 1 514 ? 6.043   14.287  9.612   1.00 59.50  ? 514  ASN A ND2   1 
ATOM   3960 N N     . LEU A 1 515 ? 5.335   16.580  13.955  1.00 60.91  ? 515  LEU A N     1 
ATOM   3961 C CA    . LEU A 1 515 ? 4.208   16.900  14.858  1.00 62.42  ? 515  LEU A CA    1 
ATOM   3962 C C     . LEU A 1 515 ? 2.961   16.023  14.690  1.00 64.47  ? 515  LEU A C     1 
ATOM   3963 O O     . LEU A 1 515 ? 2.138   15.944  15.594  1.00 65.75  ? 515  LEU A O     1 
ATOM   3964 C CB    . LEU A 1 515 ? 3.790   18.373  14.708  1.00 62.64  ? 515  LEU A CB    1 
ATOM   3965 C CG    . LEU A 1 515 ? 4.851   19.429  15.027  1.00 61.79  ? 515  LEU A CG    1 
ATOM   3966 C CD1   . LEU A 1 515 ? 4.265   20.829  14.949  1.00 60.18  ? 515  LEU A CD1   1 
ATOM   3967 C CD2   . LEU A 1 515 ? 5.491   19.166  16.396  1.00 60.39  ? 515  LEU A CD2   1 
ATOM   3968 N N     . LYS A 1 516 ? 2.823   15.394  13.529  1.00 65.54  ? 516  LYS A N     1 
ATOM   3969 C CA    . LYS A 1 516 ? 1.735   14.471  13.246  1.00 67.80  ? 516  LYS A CA    1 
ATOM   3970 C C     . LYS A 1 516 ? 2.046   13.060  13.748  1.00 68.10  ? 516  LYS A C     1 
ATOM   3971 O O     . LYS A 1 516 ? 3.206   12.716  13.994  1.00 67.03  ? 516  LYS A O     1 
ATOM   3972 C CB    . LYS A 1 516 ? 1.474   14.440  11.743  1.00 68.50  ? 516  LYS A CB    1 
ATOM   3973 C CG    . LYS A 1 516 ? 0.989   15.780  11.196  1.00 71.16  ? 516  LYS A CG    1 
ATOM   3974 C CD    . LYS A 1 516 ? 1.430   16.014  9.744   1.00 73.60  ? 516  LYS A CD    1 
ATOM   3975 C CE    . LYS A 1 516 ? 0.573   15.232  8.753   1.00 76.48  ? 516  LYS A CE    1 
ATOM   3976 N NZ    . LYS A 1 516 ? 0.927   15.547  7.323   1.00 76.22  ? 516  LYS A NZ    1 
ATOM   3977 N N     . PRO A 1 517 ? 1.004   12.228  13.916  1.00 69.88  ? 517  PRO A N     1 
ATOM   3978 C CA    . PRO A 1 517 ? 1.276   10.845  14.319  1.00 70.24  ? 517  PRO A CA    1 
ATOM   3979 C C     . PRO A 1 517 ? 2.161   10.117  13.305  1.00 69.54  ? 517  PRO A C     1 
ATOM   3980 O O     . PRO A 1 517 ? 2.190   10.499  12.129  1.00 69.40  ? 517  PRO A O     1 
ATOM   3981 C CB    . PRO A 1 517 ? -0.124  10.208  14.378  1.00 72.40  ? 517  PRO A CB    1 
ATOM   3982 C CG    . PRO A 1 517 ? -1.065  11.341  14.483  1.00 72.88  ? 517  PRO A CG    1 
ATOM   3983 C CD    . PRO A 1 517 ? -0.439  12.489  13.767  1.00 71.42  ? 517  PRO A CD    1 
ATOM   3984 N N     . LEU A 1 518 ? 2.874   9.086   13.757  1.00 69.30  ? 518  LEU A N     1 
ATOM   3985 C CA    . LEU A 1 518 ? 3.760   8.312   12.877  1.00 68.89  ? 518  LEU A CA    1 
ATOM   3986 C C     . LEU A 1 518 ? 3.098   7.938   11.548  1.00 69.93  ? 518  LEU A C     1 
ATOM   3987 O O     . LEU A 1 518 ? 2.023   7.351   11.533  1.00 71.73  ? 518  LEU A O     1 
ATOM   3988 C CB    . LEU A 1 518 ? 4.201   7.004   13.550  1.00 68.92  ? 518  LEU A CB    1 
ATOM   3989 C CG    . LEU A 1 518 ? 5.161   7.008   14.729  1.00 67.93  ? 518  LEU A CG    1 
ATOM   3990 C CD1   . LEU A 1 518 ? 5.420   5.563   15.151  1.00 67.86  ? 518  LEU A CD1   1 
ATOM   3991 C CD2   . LEU A 1 518 ? 6.477   7.725   14.420  1.00 65.93  ? 518  LEU A CD2   1 
ATOM   3992 N N     . GLU A 1 519 ? 3.752   8.280   10.446  1.00 69.38  ? 519  GLU A N     1 
ATOM   3993 C CA    . GLU A 1 519 ? 3.381   7.772   9.125   1.00 70.84  ? 519  GLU A CA    1 
ATOM   3994 C C     . GLU A 1 519 ? 4.498   6.843   8.614   1.00 69.30  ? 519  GLU A C     1 
ATOM   3995 O O     . GLU A 1 519 ? 5.677   7.175   8.665   1.00 67.48  ? 519  GLU A O     1 
ATOM   3996 C CB    . GLU A 1 519 ? 3.085   8.936   8.158   1.00 70.60  ? 519  GLU A CB    1 
ATOM   3997 C CG    . GLU A 1 519 ? 3.426   8.692   6.694   1.00 72.25  ? 519  GLU A CG    1 
ATOM   3998 C CD    . GLU A 1 519 ? 3.002   9.853   5.782   1.00 73.20  ? 519  GLU A CD    1 
ATOM   3999 O OE1   . GLU A 1 519 ? 1.793   10.185  5.778   1.00 78.22  ? 519  GLU A OE1   1 
ATOM   4000 O OE2   . GLU A 1 519 ? 3.866   10.426  5.065   1.00 74.64  ? 519  GLU A OE2   1 
ATOM   4001 N N     . VAL A 1 520 ? 4.102   5.669   8.147   1.00 69.95  ? 520  VAL A N     1 
ATOM   4002 C CA    . VAL A 1 520 ? 5.023   4.663   7.657   1.00 69.42  ? 520  VAL A CA    1 
ATOM   4003 C C     . VAL A 1 520 ? 5.260   4.930   6.185   1.00 69.39  ? 520  VAL A C     1 
ATOM   4004 O O     . VAL A 1 520 ? 4.313   5.164   5.428   1.00 69.81  ? 520  VAL A O     1 
ATOM   4005 C CB    . VAL A 1 520 ? 4.437   3.237   7.827   1.00 71.21  ? 520  VAL A CB    1 
ATOM   4006 C CG1   . VAL A 1 520 ? 5.338   2.200   7.184   1.00 71.21  ? 520  VAL A CG1   1 
ATOM   4007 C CG2   . VAL A 1 520 ? 4.201   2.920   9.310   1.00 70.29  ? 520  VAL A CG2   1 
ATOM   4008 N N     . ARG A 1 521 ? 6.530   4.905   5.788   1.00 68.52  ? 521  ARG A N     1 
ATOM   4009 C CA    . ARG A 1 521 ? 6.921   5.128   4.403   1.00 68.80  ? 521  ARG A CA    1 
ATOM   4010 C C     . ARG A 1 521 ? 7.818   3.999   3.966   1.00 69.42  ? 521  ARG A C     1 
ATOM   4011 O O     . ARG A 1 521 ? 8.415   3.325   4.793   1.00 69.11  ? 521  ARG A O     1 
ATOM   4012 C CB    . ARG A 1 521 ? 7.637   6.466   4.260   1.00 67.02  ? 521  ARG A CB    1 
ATOM   4013 C CG    . ARG A 1 521 ? 6.741   7.644   4.587   1.00 67.13  ? 521  ARG A CG    1 
ATOM   4014 C CD    . ARG A 1 521 ? 7.478   8.960   4.438   1.00 66.03  ? 521  ARG A CD    1 
ATOM   4015 N NE    . ARG A 1 521 ? 6.719   10.079  4.986   1.00 66.15  ? 521  ARG A NE    1 
ATOM   4016 C CZ    . ARG A 1 521 ? 7.213   11.303  5.168   1.00 66.24  ? 521  ARG A CZ    1 
ATOM   4017 N NH1   . ARG A 1 521 ? 8.479   11.580  4.874   1.00 64.57  ? 521  ARG A NH1   1 
ATOM   4018 N NH2   . ARG A 1 521 ? 6.445   12.253  5.687   1.00 66.51  ? 521  ARG A NH2   1 
ATOM   4019 N N     . ARG A 1 522 ? 7.897   3.779   2.663   1.00 70.75  ? 522  ARG A N     1 
ATOM   4020 C CA    . ARG A 1 522 ? 8.690   2.688   2.130   1.00 72.22  ? 522  ARG A CA    1 
ATOM   4021 C C     . ARG A 1 522 ? 9.821   3.236   1.288   1.00 71.09  ? 522  ARG A C     1 
ATOM   4022 O O     . ARG A 1 522 ? 9.614   4.141   0.471   1.00 71.27  ? 522  ARG A O     1 
ATOM   4023 C CB    . ARG A 1 522 ? 7.812   1.753   1.310   1.00 73.91  ? 522  ARG A CB    1 
ATOM   4024 C CG    . ARG A 1 522 ? 6.779   1.016   2.158   1.00 76.82  ? 522  ARG A CG    1 
ATOM   4025 C CD    . ARG A 1 522 ? 6.035   -0.066  1.363   1.00 81.06  ? 522  ARG A CD    1 
ATOM   4026 N NE    . ARG A 1 522 ? 6.971   -0.936  0.636   1.00 84.80  ? 522  ARG A NE    1 
ATOM   4027 C CZ    . ARG A 1 522 ? 6.638   -1.825  -0.301  1.00 88.19  ? 522  ARG A CZ    1 
ATOM   4028 N NH1   . ARG A 1 522 ? 5.360   -2.011  -0.654  1.00 91.19  ? 522  ARG A NH1   1 
ATOM   4029 N NH2   . ARG A 1 522 ? 7.602   -2.540  -0.892  1.00 87.86  ? 522  ARG A NH2   1 
ATOM   4030 N N     . GLY A 1 523 ? 11.018  2.704   1.517   1.00 70.72  ? 523  GLY A N     1 
ATOM   4031 C CA    . GLY A 1 523 ? 12.182  3.013   0.701   1.00 70.46  ? 523  GLY A CA    1 
ATOM   4032 C C     . GLY A 1 523 ? 12.849  4.320   1.064   1.00 69.09  ? 523  GLY A C     1 
ATOM   4033 O O     . GLY A 1 523 ? 12.316  5.389   0.793   1.00 69.04  ? 523  GLY A O     1 
ATOM   4034 N N     . LEU A 1 524 ? 14.021  4.224   1.688   1.00 68.90  ? 524  LEU A N     1 
ATOM   4035 C CA    . LEU A 1 524 ? 14.859  5.385   1.982   1.00 67.85  ? 524  LEU A CA    1 
ATOM   4036 C C     . LEU A 1 524 ? 15.600  5.852   0.743   1.00 67.23  ? 524  LEU A C     1 
ATOM   4037 O O     . LEU A 1 524 ? 16.644  5.291   0.397   1.00 67.32  ? 524  LEU A O     1 
ATOM   4038 C CB    . LEU A 1 524 ? 15.884  5.036   3.063   1.00 67.76  ? 524  LEU A CB    1 
ATOM   4039 C CG    . LEU A 1 524 ? 15.524  5.460   4.482   1.00 70.07  ? 524  LEU A CG    1 
ATOM   4040 C CD1   . LEU A 1 524 ? 16.352  4.669   5.491   1.00 72.31  ? 524  LEU A CD1   1 
ATOM   4041 C CD2   . LEU A 1 524 ? 15.721  6.991   4.640   1.00 70.68  ? 524  LEU A CD2   1 
ATOM   4042 N N     . ARG A 1 525 ? 15.069  6.874   0.075   1.00 66.75  ? 525  ARG A N     1 
ATOM   4043 C CA    . ARG A 1 525 ? 15.682  7.393   -1.148  1.00 66.69  ? 525  ARG A CA    1 
ATOM   4044 C C     . ARG A 1 525 ? 16.136  6.239   -2.045  1.00 66.52  ? 525  ARG A C     1 
ATOM   4045 O O     . ARG A 1 525 ? 17.252  6.246   -2.553  1.00 65.85  ? 525  ARG A O     1 
ATOM   4046 C CB    . ARG A 1 525 ? 16.897  8.267   -0.799  1.00 66.16  ? 525  ARG A CB    1 
ATOM   4047 C CG    . ARG A 1 525 ? 16.588  9.544   -0.041  1.00 67.32  ? 525  ARG A CG    1 
ATOM   4048 C CD    . ARG A 1 525 ? 16.247  10.672  -0.968  1.00 70.93  ? 525  ARG A CD    1 
ATOM   4049 N NE    . ARG A 1 525 ? 16.983  11.891  -0.643  1.00 72.35  ? 525  ARG A NE    1 
ATOM   4050 C CZ    . ARG A 1 525 ? 16.691  12.722  0.353   1.00 72.53  ? 525  ARG A CZ    1 
ATOM   4051 N NH1   . ARG A 1 525 ? 15.688  12.465  1.177   1.00 74.60  ? 525  ARG A NH1   1 
ATOM   4052 N NH2   . ARG A 1 525 ? 17.418  13.817  0.532   1.00 72.39  ? 525  ARG A NH2   1 
ATOM   4053 N N     . ALA A 1 526 ? 15.268  5.244   -2.211  1.00 67.04  ? 526  ALA A N     1 
ATOM   4054 C CA    . ALA A 1 526 ? 15.610  4.004   -2.913  1.00 67.51  ? 526  ALA A CA    1 
ATOM   4055 C C     . ALA A 1 526 ? 16.330  4.233   -4.254  1.00 67.42  ? 526  ALA A C     1 
ATOM   4056 O O     . ALA A 1 526 ? 17.415  3.693   -4.442  1.00 66.97  ? 526  ALA A O     1 
ATOM   4057 C CB    . ALA A 1 526 ? 14.362  3.139   -3.105  1.00 69.20  ? 526  ALA A CB    1 
ATOM   4058 N N     . GLN A 1 527 ? 15.760  5.037   -5.163  1.00 66.97  ? 527  GLN A N     1 
ATOM   4059 C CA    . GLN A 1 527 ? 16.368  5.215   -6.504  1.00 67.54  ? 527  GLN A CA    1 
ATOM   4060 C C     . GLN A 1 527 ? 17.716  5.934   -6.482  1.00 65.87  ? 527  GLN A C     1 
ATOM   4061 O O     . GLN A 1 527 ? 18.660  5.503   -7.143  1.00 66.03  ? 527  GLN A O     1 
ATOM   4062 C CB    . GLN A 1 527 ? 15.450  5.966   -7.481  1.00 67.74  ? 527  GLN A CB    1 
ATOM   4063 C CG    . GLN A 1 527 ? 14.304  5.169   -8.073  1.00 70.84  ? 527  GLN A CG    1 
ATOM   4064 C CD    . GLN A 1 527 ? 14.702  3.806   -8.622  1.00 72.95  ? 527  GLN A CD    1 
ATOM   4065 O OE1   . GLN A 1 527 ? 14.303  2.778   -8.069  1.00 75.81  ? 527  GLN A OE1   1 
ATOM   4066 N NE2   . GLN A 1 527 ? 15.469  3.787   -9.714  1.00 73.26  ? 527  GLN A NE2   1 
ATOM   4067 N N     . THR A 1 528 ? 17.779  7.051   -5.762  1.00 64.08  ? 528  THR A N     1 
ATOM   4068 C CA    . THR A 1 528 ? 18.998  7.848   -5.671  1.00 62.90  ? 528  THR A CA    1 
ATOM   4069 C C     . THR A 1 528 ? 20.120  7.117   -4.933  1.00 62.62  ? 528  THR A C     1 
ATOM   4070 O O     . THR A 1 528 ? 21.292  7.290   -5.255  1.00 62.60  ? 528  THR A O     1 
ATOM   4071 C CB    . THR A 1 528 ? 18.731  9.198   -4.965  1.00 61.65  ? 528  THR A CB    1 
ATOM   4072 O OG1   . THR A 1 528 ? 17.895  10.008  -5.793  1.00 61.99  ? 528  THR A OG1   1 
ATOM   4073 C CG2   . THR A 1 528 ? 20.025  9.956   -4.697  1.00 60.55  ? 528  THR A CG2   1 
ATOM   4074 N N     . CYS A 1 529 ? 19.774  6.310   -3.938  1.00 62.34  ? 529  CYS A N     1 
ATOM   4075 C CA    . CYS A 1 529 ? 20.795  5.589   -3.198  1.00 62.19  ? 529  CYS A CA    1 
ATOM   4076 C C     . CYS A 1 529 ? 21.324  4.393   -3.985  1.00 63.17  ? 529  CYS A C     1 
ATOM   4077 O O     . CYS A 1 529 ? 22.468  3.994   -3.792  1.00 63.03  ? 529  CYS A O     1 
ATOM   4078 C CB    . CYS A 1 529 ? 20.303  5.214   -1.795  1.00 61.74  ? 529  CYS A CB    1 
ATOM   4079 S SG    . CYS A 1 529 ? 20.201  6.692   -0.686  1.00 61.33  ? 529  CYS A SG    1 
ATOM   4080 N N     . ALA A 1 530 ? 20.510  3.854   -4.889  1.00 64.07  ? 530  ALA A N     1 
ATOM   4081 C CA    . ALA A 1 530 ? 20.986  2.881   -5.863  1.00 65.51  ? 530  ALA A CA    1 
ATOM   4082 C C     . ALA A 1 530 ? 22.094  3.502   -6.693  1.00 65.58  ? 530  ALA A C     1 
ATOM   4083 O O     . ALA A 1 530 ? 23.085  2.838   -6.992  1.00 66.75  ? 530  ALA A O     1 
ATOM   4084 C CB    . ALA A 1 530 ? 19.862  2.423   -6.769  1.00 66.73  ? 530  ALA A CB    1 
ATOM   4085 N N     . PHE A 1 531 ? 21.931  4.776   -7.056  1.00 64.41  ? 531  PHE A N     1 
ATOM   4086 C CA    . PHE A 1 531 ? 22.973  5.515   -7.761  1.00 64.03  ? 531  PHE A CA    1 
ATOM   4087 C C     . PHE A 1 531 ? 24.281  5.566   -6.962  1.00 63.27  ? 531  PHE A C     1 
ATOM   4088 O O     . PHE A 1 531 ? 25.333  5.193   -7.469  1.00 63.70  ? 531  PHE A O     1 
ATOM   4089 C CB    . PHE A 1 531 ? 22.495  6.933   -8.096  1.00 63.03  ? 531  PHE A CB    1 
ATOM   4090 C CG    . PHE A 1 531 ? 23.561  7.814   -8.692  1.00 62.79  ? 531  PHE A CG    1 
ATOM   4091 C CD1   . PHE A 1 531 ? 23.934  7.671   -10.028 1.00 64.01  ? 531  PHE A CD1   1 
ATOM   4092 C CD2   . PHE A 1 531 ? 24.186  8.791   -7.922  1.00 61.32  ? 531  PHE A CD2   1 
ATOM   4093 C CE1   . PHE A 1 531 ? 24.916  8.471   -10.591 1.00 63.41  ? 531  PHE A CE1   1 
ATOM   4094 C CE2   . PHE A 1 531 ? 25.171  9.604   -8.474  1.00 62.03  ? 531  PHE A CE2   1 
ATOM   4095 C CZ    . PHE A 1 531 ? 25.538  9.439   -9.822  1.00 63.08  ? 531  PHE A CZ    1 
ATOM   4096 N N     . TRP A 1 532 ? 24.213  6.018   -5.717  1.00 61.92  ? 532  TRP A N     1 
ATOM   4097 C CA    . TRP A 1 532 ? 25.426  6.182   -4.896  1.00 61.47  ? 532  TRP A CA    1 
ATOM   4098 C C     . TRP A 1 532 ? 26.036  4.857   -4.435  1.00 63.02  ? 532  TRP A C     1 
ATOM   4099 O O     . TRP A 1 532 ? 27.258  4.722   -4.387  1.00 63.32  ? 532  TRP A O     1 
ATOM   4100 C CB    . TRP A 1 532 ? 25.128  7.014   -3.651  1.00 59.20  ? 532  TRP A CB    1 
ATOM   4101 C CG    . TRP A 1 532 ? 24.804  8.429   -3.925  1.00 57.73  ? 532  TRP A CG    1 
ATOM   4102 C CD1   . TRP A 1 532 ? 23.569  9.000   -3.933  1.00 57.21  ? 532  TRP A CD1   1 
ATOM   4103 C CD2   . TRP A 1 532 ? 25.730  9.472   -4.218  1.00 56.60  ? 532  TRP A CD2   1 
ATOM   4104 N NE1   . TRP A 1 532 ? 23.668  10.344  -4.206  1.00 56.16  ? 532  TRP A NE1   1 
ATOM   4105 C CE2   . TRP A 1 532 ? 24.986  10.656  -4.391  1.00 55.86  ? 532  TRP A CE2   1 
ATOM   4106 C CE3   . TRP A 1 532 ? 27.120  9.525   -4.348  1.00 57.76  ? 532  TRP A CE3   1 
ATOM   4107 C CZ2   . TRP A 1 532 ? 25.586  11.875  -4.693  1.00 56.23  ? 532  TRP A CZ2   1 
ATOM   4108 C CZ3   . TRP A 1 532 ? 27.716  10.749  -4.651  1.00 56.24  ? 532  TRP A CZ3   1 
ATOM   4109 C CH2   . TRP A 1 532 ? 26.949  11.897  -4.813  1.00 56.34  ? 532  TRP A CH2   1 
ATOM   4110 N N     . ASN A 1 533 ? 25.181  3.901   -4.081  1.00 64.27  ? 533  ASN A N     1 
ATOM   4111 C CA    . ASN A 1 533 ? 25.618  2.661   -3.430  1.00 65.72  ? 533  ASN A CA    1 
ATOM   4112 C C     . ASN A 1 533 ? 25.862  1.501   -4.389  1.00 68.19  ? 533  ASN A C     1 
ATOM   4113 O O     . ASN A 1 533 ? 26.642  0.621   -4.078  1.00 69.36  ? 533  ASN A O     1 
ATOM   4114 C CB    . ASN A 1 533 ? 24.599  2.222   -2.364  1.00 65.20  ? 533  ASN A CB    1 
ATOM   4115 C CG    . ASN A 1 533 ? 24.403  3.261   -1.270  1.00 63.52  ? 533  ASN A CG    1 
ATOM   4116 O OD1   . ASN A 1 533 ? 25.246  4.126   -1.069  1.00 63.26  ? 533  ASN A OD1   1 
ATOM   4117 N ND2   . ASN A 1 533 ? 23.290  3.168   -0.545  1.00 62.80  ? 533  ASN A ND2   1 
ATOM   4118 N N     . ARG A 1 534 ? 25.184  1.486   -5.533  1.00 69.97  ? 534  ARG A N     1 
ATOM   4119 C CA    . ARG A 1 534 ? 25.359  0.415   -6.520  1.00 72.42  ? 534  ARG A CA    1 
ATOM   4120 C C     . ARG A 1 534 ? 26.057  0.899   -7.781  1.00 73.56  ? 534  ARG A C     1 
ATOM   4121 O O     . ARG A 1 534 ? 27.001  0.258   -8.235  1.00 74.84  ? 534  ARG A O     1 
ATOM   4122 C CB    . ARG A 1 534 ? 24.020  -0.231  -6.885  1.00 73.40  ? 534  ARG A CB    1 
ATOM   4123 C CG    . ARG A 1 534 ? 23.331  -0.929  -5.728  1.00 73.15  ? 534  ARG A CG    1 
ATOM   4124 C CD    . ARG A 1 534 ? 21.838  -1.091  -5.976  1.00 74.14  ? 534  ARG A CD    1 
ATOM   4125 N NE    . ARG A 1 534 ? 21.132  -1.565  -4.783  1.00 74.58  ? 534  ARG A NE    1 
ATOM   4126 C CZ    . ARG A 1 534 ? 21.022  -2.847  -4.412  1.00 75.63  ? 534  ARG A CZ    1 
ATOM   4127 N NH1   . ARG A 1 534 ? 21.572  -3.827  -5.130  1.00 76.29  ? 534  ARG A NH1   1 
ATOM   4128 N NH2   . ARG A 1 534 ? 20.348  -3.152  -3.308  1.00 74.60  ? 534  ARG A NH2   1 
ATOM   4129 N N     . PHE A 1 535 ? 25.623  2.025   -8.351  1.00 73.46  ? 535  PHE A N     1 
ATOM   4130 C CA    . PHE A 1 535 ? 26.227  2.467   -9.605  1.00 74.48  ? 535  PHE A CA    1 
ATOM   4131 C C     . PHE A 1 535 ? 27.622  3.063   -9.455  1.00 75.11  ? 535  PHE A C     1 
ATOM   4132 O O     . PHE A 1 535 ? 28.551  2.580   -10.082 1.00 76.30  ? 535  PHE A O     1 
ATOM   4133 C CB    . PHE A 1 535 ? 25.356  3.421   -10.424 1.00 73.37  ? 535  PHE A CB    1 
ATOM   4134 C CG    . PHE A 1 535 ? 26.032  3.855   -11.691 1.00 73.02  ? 535  PHE A CG    1 
ATOM   4135 C CD1   . PHE A 1 535 ? 26.245  2.939   -12.714 1.00 73.63  ? 535  PHE A CD1   1 
ATOM   4136 C CD2   . PHE A 1 535 ? 26.552  5.135   -11.821 1.00 71.02  ? 535  PHE A CD2   1 
ATOM   4137 C CE1   . PHE A 1 535 ? 26.922  3.302   -13.864 1.00 74.62  ? 535  PHE A CE1   1 
ATOM   4138 C CE2   . PHE A 1 535 ? 27.226  5.509   -12.974 1.00 72.15  ? 535  PHE A CE2   1 
ATOM   4139 C CZ    . PHE A 1 535 ? 27.410  4.590   -13.998 1.00 74.01  ? 535  PHE A CZ    1 
ATOM   4140 N N     . LEU A 1 536 ? 27.771  4.122   -8.665  1.00 75.30  ? 536  LEU A N     1 
ATOM   4141 C CA    . LEU A 1 536 ? 29.067  4.827   -8.584  1.00 76.42  ? 536  LEU A CA    1 
ATOM   4142 C C     . LEU A 1 536 ? 30.286  3.920   -8.276  1.00 79.12  ? 536  LEU A C     1 
ATOM   4143 O O     . LEU A 1 536 ? 31.335  4.057   -8.908  1.00 79.74  ? 536  LEU A O     1 
ATOM   4144 C CB    . LEU A 1 536 ? 29.014  5.983   -7.582  1.00 74.05  ? 536  LEU A CB    1 
ATOM   4145 C CG    . LEU A 1 536 ? 28.498  7.321   -8.107  1.00 73.49  ? 536  LEU A CG    1 
ATOM   4146 C CD1   . LEU A 1 536 ? 28.756  8.420   -7.072  1.00 70.84  ? 536  LEU A CD1   1 
ATOM   4147 C CD2   . LEU A 1 536 ? 29.124  7.701   -9.457  1.00 74.09  ? 536  LEU A CD2   1 
ATOM   4148 N N     . PRO A 1 537 ? 30.157  3.005   -7.298  1.00 81.26  ? 537  PRO A N     1 
ATOM   4149 C CA    . PRO A 1 537 ? 31.267  2.095   -7.030  1.00 83.96  ? 537  PRO A CA    1 
ATOM   4150 C C     . PRO A 1 537 ? 31.652  1.210   -8.225  1.00 87.09  ? 537  PRO A C     1 
ATOM   4151 O O     . PRO A 1 537 ? 32.815  0.818   -8.342  1.00 88.69  ? 537  PRO A O     1 
ATOM   4152 C CB    . PRO A 1 537 ? 30.746  1.233   -5.869  1.00 83.33  ? 537  PRO A CB    1 
ATOM   4153 C CG    . PRO A 1 537 ? 29.655  2.017   -5.261  1.00 81.22  ? 537  PRO A CG    1 
ATOM   4154 C CD    . PRO A 1 537 ? 29.026  2.767   -6.388  1.00 80.57  ? 537  PRO A CD    1 
ATOM   4155 N N     . LYS A 1 538 ? 30.691  0.879   -9.087  1.00 89.15  ? 538  LYS A N     1 
ATOM   4156 C CA    . LYS A 1 538 ? 30.984  0.099   -10.301 1.00 91.77  ? 538  LYS A CA    1 
ATOM   4157 C C     . LYS A 1 538 ? 31.687  0.941   -11.366 1.00 93.06  ? 538  LYS A C     1 
ATOM   4158 O O     . LYS A 1 538 ? 32.461  0.418   -12.165 1.00 94.97  ? 538  LYS A O     1 
ATOM   4159 C CB    . LYS A 1 538 ? 29.714  -0.551  -10.865 1.00 93.05  ? 538  LYS A CB    1 
ATOM   4160 C CG    . LYS A 1 538 ? 29.505  -1.967  -10.350 1.00 94.49  ? 538  LYS A CG    1 
ATOM   4161 C CD    . LYS A 1 538 ? 28.083  -2.449  -10.537 1.00 95.24  ? 538  LYS A CD    1 
ATOM   4162 C CE    . LYS A 1 538 ? 27.916  -3.881  -10.017 1.00 97.52  ? 538  LYS A CE    1 
ATOM   4163 N NZ    . LYS A 1 538 ? 28.698  -4.874  -10.823 1.00 100.29 ? 538  LYS A NZ    1 
ATOM   4164 N N     . LEU A 1 539 ? 31.416  2.241   -11.366 1.00 92.54  ? 539  LEU A N     1 
ATOM   4165 C CA    . LEU A 1 539 ? 32.137  3.187   -12.205 1.00 93.38  ? 539  LEU A CA    1 
ATOM   4166 C C     . LEU A 1 539 ? 33.576  3.267   -11.722 1.00 94.30  ? 539  LEU A C     1 
ATOM   4167 O O     . LEU A 1 539 ? 34.509  3.177   -12.517 1.00 95.86  ? 539  LEU A O     1 
ATOM   4168 C CB    . LEU A 1 539 ? 31.473  4.571   -12.137 1.00 91.76  ? 539  LEU A CB    1 
ATOM   4169 C CG    . LEU A 1 539 ? 31.873  5.661   -13.130 1.00 91.36  ? 539  LEU A CG    1 
ATOM   4170 C CD1   . LEU A 1 539 ? 31.809  5.148   -14.564 1.00 92.24  ? 539  LEU A CD1   1 
ATOM   4171 C CD2   . LEU A 1 539 ? 30.977  6.882   -12.949 1.00 89.54  ? 539  LEU A CD2   1 
ATOM   4172 N N     . LEU A 1 540 ? 33.737  3.408   -10.405 1.00 93.92  ? 540  LEU A N     1 
ATOM   4173 C CA    . LEU A 1 540 ? 35.055  3.427   -9.737  1.00 94.41  ? 540  LEU A CA    1 
ATOM   4174 C C     . LEU A 1 540 ? 35.976  2.270   -10.165 1.00 96.78  ? 540  LEU A C     1 
ATOM   4175 O O     . LEU A 1 540 ? 37.184  2.460   -10.309 1.00 97.30  ? 540  LEU A O     1 
ATOM   4176 C CB    . LEU A 1 540 ? 34.879  3.426   -8.205  1.00 92.98  ? 540  LEU A CB    1 
ATOM   4177 C CG    . LEU A 1 540 ? 36.081  3.839   -7.349  1.00 92.14  ? 540  LEU A CG    1 
ATOM   4178 C CD1   . LEU A 1 540 ? 36.731  5.133   -7.864  1.00 91.64  ? 540  LEU A CD1   1 
ATOM   4179 C CD2   . LEU A 1 540 ? 35.642  3.984   -5.892  1.00 90.53  ? 540  LEU A CD2   1 
ATOM   4180 N N     . SER A 1 541 ? 35.394  1.086   -10.357 1.00 98.37  ? 541  SER A N     1 
ATOM   4181 C CA    . SER A 1 541 ? 36.079  -0.037  -11.002 1.00 101.00 ? 541  SER A CA    1 
ATOM   4182 C C     . SER A 1 541 ? 36.246  0.245   -12.511 1.00 102.60 ? 541  SER A C     1 
ATOM   4183 O O     . SER A 1 541 ? 35.426  -0.177  -13.339 1.00 103.56 ? 541  SER A O     1 
ATOM   4184 C CB    . SER A 1 541 ? 35.301  -1.341  -10.765 1.00 102.07 ? 541  SER A CB    1 
ATOM   4185 O OG    . SER A 1 541 ? 34.863  -1.442  -9.417  1.00 100.16 ? 541  SER A OG    1 
ATOM   4186 N N     . ALA A 1 542 ? 37.318  0.974   -12.840 1.00 102.95 ? 542  ALA A N     1 
ATOM   4187 C CA    . ALA A 1 542 ? 37.621  1.430   -14.205 1.00 103.97 ? 542  ALA A CA    1 
ATOM   4188 C C     . ALA A 1 542 ? 36.751  2.626   -14.597 1.00 102.74 ? 542  ALA A C     1 
ATOM   4189 O O     . ALA A 1 542 ? 37.110  3.783   -14.350 1.00 101.22 ? 542  ALA A O     1 
ATOM   4190 C CB    . ALA A 1 542 ? 37.470  0.290   -15.214 1.00 106.31 ? 542  ALA A CB    1 
ATOM   4191 N N     . GLU B 1 4   ? -17.248 5.996   -69.928 1.00 100.83 ? 4    GLU B N     1 
ATOM   4192 C CA    . GLU B 1 4   ? -16.069 6.206   -69.041 1.00 98.26  ? 4    GLU B CA    1 
ATOM   4193 C C     . GLU B 1 4   ? -16.277 7.474   -68.197 1.00 97.73  ? 4    GLU B C     1 
ATOM   4194 O O     . GLU B 1 4   ? -16.770 8.490   -68.695 1.00 99.38  ? 4    GLU B O     1 
ATOM   4195 C CB    . GLU B 1 4   ? -14.786 6.280   -69.889 1.00 97.03  ? 4    GLU B CB    1 
ATOM   4196 C CG    . GLU B 1 4   ? -13.503 6.584   -69.104 1.00 95.34  ? 4    GLU B CG    1 
ATOM   4197 C CD    . GLU B 1 4   ? -12.220 5.936   -69.689 1.00 94.09  ? 4    GLU B CD    1 
ATOM   4198 O OE1   . GLU B 1 4   ? -11.274 5.710   -68.903 1.00 92.83  ? 4    GLU B OE1   1 
ATOM   4199 O OE2   . GLU B 1 4   ? -12.144 5.667   -70.909 1.00 94.94  ? 4    GLU B OE2   1 
ATOM   4200 N N     . ASP B 1 5   ? -15.916 7.403   -66.918 1.00 95.59  ? 5    ASP B N     1 
ATOM   4201 C CA    . ASP B 1 5   ? -16.115 8.515   -65.977 1.00 94.77  ? 5    ASP B CA    1 
ATOM   4202 C C     . ASP B 1 5   ? -14.953 9.521   -66.059 1.00 93.15  ? 5    ASP B C     1 
ATOM   4203 O O     . ASP B 1 5   ? -13.828 9.188   -65.697 1.00 91.05  ? 5    ASP B O     1 
ATOM   4204 C CB    . ASP B 1 5   ? -16.238 7.956   -64.554 1.00 93.83  ? 5    ASP B CB    1 
ATOM   4205 C CG    . ASP B 1 5   ? -16.680 8.992   -63.535 1.00 93.28  ? 5    ASP B CG    1 
ATOM   4206 O OD1   . ASP B 1 5   ? -17.035 8.564   -62.416 1.00 91.97  ? 5    ASP B OD1   1 
ATOM   4207 O OD2   . ASP B 1 5   ? -16.668 10.209  -63.833 1.00 92.07  ? 5    ASP B OD2   1 
ATOM   4208 N N     . PRO B 1 6   ? -15.223 10.760  -66.521 1.00 94.09  ? 6    PRO B N     1 
ATOM   4209 C CA    . PRO B 1 6   ? -14.149 11.753  -66.674 1.00 92.84  ? 6    PRO B CA    1 
ATOM   4210 C C     . PRO B 1 6   ? -13.449 12.156  -65.372 1.00 90.66  ? 6    PRO B C     1 
ATOM   4211 O O     . PRO B 1 6   ? -12.354 12.711  -65.425 1.00 89.60  ? 6    PRO B O     1 
ATOM   4212 C CB    . PRO B 1 6   ? -14.867 12.967  -67.284 1.00 95.11  ? 6    PRO B CB    1 
ATOM   4213 C CG    . PRO B 1 6   ? -16.307 12.782  -66.972 1.00 96.84  ? 6    PRO B CG    1 
ATOM   4214 C CD    . PRO B 1 6   ? -16.536 11.304  -66.928 1.00 96.60  ? 6    PRO B CD    1 
ATOM   4215 N N     . GLN B 1 7   ? -14.076 11.901  -64.225 1.00 89.90  ? 7    GLN B N     1 
ATOM   4216 C CA    . GLN B 1 7   ? -13.419 12.101  -62.934 1.00 87.77  ? 7    GLN B CA    1 
ATOM   4217 C C     . GLN B 1 7   ? -12.281 11.120  -62.704 1.00 85.40  ? 7    GLN B C     1 
ATOM   4218 O O     . GLN B 1 7   ? -11.329 11.425  -61.982 1.00 83.73  ? 7    GLN B O     1 
ATOM   4219 C CB    . GLN B 1 7   ? -14.421 11.973  -61.789 1.00 88.43  ? 7    GLN B CB    1 
ATOM   4220 C CG    . GLN B 1 7   ? -15.350 13.166  -61.665 1.00 90.40  ? 7    GLN B CG    1 
ATOM   4221 C CD    . GLN B 1 7   ? -14.603 14.457  -61.410 1.00 90.01  ? 7    GLN B CD    1 
ATOM   4222 O OE1   . GLN B 1 7   ? -13.669 14.498  -60.614 1.00 87.97  ? 7    GLN B OE1   1 
ATOM   4223 N NE2   . GLN B 1 7   ? -15.018 15.525  -62.082 1.00 92.85  ? 7    GLN B NE2   1 
ATOM   4224 N N     . LEU B 1 8   ? -12.388 9.944   -63.316 1.00 84.95  ? 8    LEU B N     1 
ATOM   4225 C CA    . LEU B 1 8   ? -11.400 8.897   -63.163 1.00 82.97  ? 8    LEU B CA    1 
ATOM   4226 C C     . LEU B 1 8   ? -10.361 8.887   -64.288 1.00 82.22  ? 8    LEU B C     1 
ATOM   4227 O O     . LEU B 1 8   ? -9.561  7.959   -64.371 1.00 81.18  ? 8    LEU B O     1 
ATOM   4228 C CB    . LEU B 1 8   ? -12.097 7.537   -63.093 1.00 83.47  ? 8    LEU B CB    1 
ATOM   4229 C CG    . LEU B 1 8   ? -13.205 7.434   -62.045 1.00 84.50  ? 8    LEU B CG    1 
ATOM   4230 C CD1   . LEU B 1 8   ? -13.882 6.058   -62.106 1.00 85.13  ? 8    LEU B CD1   1 
ATOM   4231 C CD2   . LEU B 1 8   ? -12.639 7.721   -60.661 1.00 82.65  ? 8    LEU B CD2   1 
ATOM   4232 N N     . LEU B 1 9   ? -10.350 9.913   -65.133 1.00 82.73  ? 9    LEU B N     1 
ATOM   4233 C CA    . LEU B 1 9   ? -9.418  9.961   -66.260 1.00 82.43  ? 9    LEU B CA    1 
ATOM   4234 C C     . LEU B 1 9   ? -8.473  11.155  -66.117 1.00 81.37  ? 9    LEU B C     1 
ATOM   4235 O O     . LEU B 1 9   ? -8.917  12.303  -66.181 1.00 82.32  ? 9    LEU B O     1 
ATOM   4236 C CB    . LEU B 1 9   ? -10.195 10.062  -67.573 1.00 84.48  ? 9    LEU B CB    1 
ATOM   4237 C CG    . LEU B 1 9   ? -9.753  9.168   -68.735 1.00 85.26  ? 9    LEU B CG    1 
ATOM   4238 C CD1   . LEU B 1 9   ? -10.439 9.689   -70.020 1.00 87.55  ? 9    LEU B CD1   1 
ATOM   4239 C CD2   . LEU B 1 9   ? -8.218  9.078   -68.900 1.00 82.74  ? 9    LEU B CD2   1 
ATOM   4240 N N     . VAL B 1 10  ? -7.179  10.877  -65.934 1.00 79.27  ? 10   VAL B N     1 
ATOM   4241 C CA    . VAL B 1 10  ? -6.178  11.913  -65.691 1.00 78.38  ? 10   VAL B CA    1 
ATOM   4242 C C     . VAL B 1 10  ? -4.980  11.769  -66.618 1.00 77.80  ? 10   VAL B C     1 
ATOM   4243 O O     . VAL B 1 10  ? -4.509  10.654  -66.858 1.00 77.46  ? 10   VAL B O     1 
ATOM   4244 C CB    . VAL B 1 10  ? -5.655  11.843  -64.244 1.00 76.87  ? 10   VAL B CB    1 
ATOM   4245 C CG1   . VAL B 1 10  ? -4.673  12.970  -63.967 1.00 76.24  ? 10   VAL B CG1   1 
ATOM   4246 C CG2   . VAL B 1 10  ? -6.811  11.909  -63.278 1.00 77.78  ? 10   VAL B CG2   1 
ATOM   4247 N N     . ARG B 1 11  ? -4.485  12.903  -67.112 1.00 77.88  ? 11   ARG B N     1 
ATOM   4248 C CA    . ARG B 1 11  ? -3.268  12.960  -67.898 1.00 77.90  ? 11   ARG B CA    1 
ATOM   4249 C C     . ARG B 1 11  ? -2.107  13.498  -67.051 1.00 76.09  ? 11   ARG B C     1 
ATOM   4250 O O     . ARG B 1 11  ? -2.134  14.635  -66.597 1.00 76.08  ? 11   ARG B O     1 
ATOM   4251 C CB    . ARG B 1 11  ? -3.467  13.820  -69.154 1.00 79.57  ? 11   ARG B CB    1 
ATOM   4252 C CG    . ARG B 1 11  ? -2.157  14.191  -69.865 1.00 80.47  ? 11   ARG B CG    1 
ATOM   4253 C CD    . ARG B 1 11  ? -2.360  14.534  -71.339 1.00 83.33  ? 11   ARG B CD    1 
ATOM   4254 N NE    . ARG B 1 11  ? -2.132  13.359  -72.195 1.00 85.99  ? 11   ARG B NE    1 
ATOM   4255 C CZ    . ARG B 1 11  ? -2.984  12.875  -73.099 1.00 87.78  ? 11   ARG B CZ    1 
ATOM   4256 N NH1   . ARG B 1 11  ? -4.164  13.452  -73.330 1.00 90.18  ? 11   ARG B NH1   1 
ATOM   4257 N NH2   . ARG B 1 11  ? -2.643  11.801  -73.797 1.00 88.16  ? 11   ARG B NH2   1 
ATOM   4258 N N     . VAL B 1 12  ? -1.092  12.658  -66.849 1.00 74.58  ? 12   VAL B N     1 
ATOM   4259 C CA    . VAL B 1 12  ? 0.145   13.056  -66.182 1.00 73.22  ? 12   VAL B CA    1 
ATOM   4260 C C     . VAL B 1 12  ? 1.241   13.166  -67.251 1.00 73.68  ? 12   VAL B C     1 
ATOM   4261 O O     . VAL B 1 12  ? 0.988   12.858  -68.417 1.00 74.46  ? 12   VAL B O     1 
ATOM   4262 C CB    . VAL B 1 12  ? 0.520   12.055  -65.061 1.00 71.75  ? 12   VAL B CB    1 
ATOM   4263 C CG1   . VAL B 1 12  ? -0.578  12.031  -63.991 1.00 70.69  ? 12   VAL B CG1   1 
ATOM   4264 C CG2   . VAL B 1 12  ? 0.771   10.640  -65.617 1.00 70.47  ? 12   VAL B CG2   1 
ATOM   4265 N N     . ARG B 1 13  ? 2.439   13.607  -66.874 1.00 73.11  ? 13   ARG B N     1 
ATOM   4266 C CA    . ARG B 1 13  ? 3.519   13.806  -67.858 1.00 74.45  ? 13   ARG B CA    1 
ATOM   4267 C C     . ARG B 1 13  ? 3.856   12.537  -68.643 1.00 73.50  ? 13   ARG B C     1 
ATOM   4268 O O     . ARG B 1 13  ? 4.193   12.611  -69.816 1.00 74.97  ? 13   ARG B O     1 
ATOM   4269 C CB    . ARG B 1 13  ? 4.794   14.353  -67.199 1.00 74.21  ? 13   ARG B CB    1 
ATOM   4270 C CG    . ARG B 1 13  ? 4.671   15.811  -66.728 1.00 75.97  ? 13   ARG B CG    1 
ATOM   4271 C CD    . ARG B 1 13  ? 6.024   16.397  -66.288 1.00 77.38  ? 13   ARG B CD    1 
ATOM   4272 N NE    . ARG B 1 13  ? 5.856   17.643  -65.523 1.00 81.17  ? 13   ARG B NE    1 
ATOM   4273 C CZ    . ARG B 1 13  ? 6.837   18.498  -65.195 1.00 83.59  ? 13   ARG B CZ    1 
ATOM   4274 N NH1   . ARG B 1 13  ? 8.098   18.272  -65.570 1.00 84.44  ? 13   ARG B NH1   1 
ATOM   4275 N NH2   . ARG B 1 13  ? 6.552   19.599  -64.489 1.00 83.25  ? 13   ARG B NH2   1 
ATOM   4276 N N     . GLY B 1 14  ? 3.752   11.380  -68.003 1.00 71.30  ? 14   GLY B N     1 
ATOM   4277 C CA    . GLY B 1 14  ? 4.062   10.115  -68.657 1.00 70.77  ? 14   GLY B CA    1 
ATOM   4278 C C     . GLY B 1 14  ? 2.979   9.623   -69.592 1.00 70.98  ? 14   GLY B C     1 
ATOM   4279 O O     . GLY B 1 14  ? 3.245   8.836   -70.473 1.00 71.25  ? 14   GLY B O     1 
ATOM   4280 N N     . GLY B 1 15  ? 1.754   10.081  -69.384 1.00 71.10  ? 15   GLY B N     1 
ATOM   4281 C CA    . GLY B 1 15  ? 0.624   9.696   -70.220 1.00 71.85  ? 15   GLY B CA    1 
ATOM   4282 C C     . GLY B 1 15  ? -0.670  9.675   -69.438 1.00 71.52  ? 15   GLY B C     1 
ATOM   4283 O O     . GLY B 1 15  ? -0.757  10.231  -68.347 1.00 70.14  ? 15   GLY B O     1 
ATOM   4284 N N     . GLN B 1 16  ? -1.669  8.999   -69.994 1.00 72.65  ? 16   GLN B N     1 
ATOM   4285 C CA    . GLN B 1 16  ? -2.998  8.943   -69.397 1.00 73.39  ? 16   GLN B CA    1 
ATOM   4286 C C     . GLN B 1 16  ? -3.211  7.777   -68.435 1.00 72.09  ? 16   GLN B C     1 
ATOM   4287 O O     . GLN B 1 16  ? -2.710  6.684   -68.658 1.00 71.57  ? 16   GLN B O     1 
ATOM   4288 C CB    . GLN B 1 16  ? -4.042  8.860   -70.497 1.00 75.73  ? 16   GLN B CB    1 
ATOM   4289 C CG    . GLN B 1 16  ? -4.237  10.141  -71.252 1.00 78.80  ? 16   GLN B CG    1 
ATOM   4290 C CD    . GLN B 1 16  ? -5.614  10.206  -71.856 1.00 84.18  ? 16   GLN B CD    1 
ATOM   4291 O OE1   . GLN B 1 16  ? -5.888  9.565   -72.879 1.00 85.62  ? 16   GLN B OE1   1 
ATOM   4292 N NE2   . GLN B 1 16  ? -6.511  10.968  -71.210 1.00 87.50  ? 16   GLN B NE2   1 
ATOM   4293 N N     . LEU B 1 17  ? -3.982  8.026   -67.380 1.00 71.89  ? 17   LEU B N     1 
ATOM   4294 C CA    . LEU B 1 17  ? -4.327  7.020   -66.377 1.00 71.34  ? 17   LEU B CA    1 
ATOM   4295 C C     . LEU B 1 17  ? -5.842  6.920   -66.192 1.00 72.62  ? 17   LEU B C     1 
ATOM   4296 O O     . LEU B 1 17  ? -6.569  7.898   -66.405 1.00 73.25  ? 17   LEU B O     1 
ATOM   4297 C CB    . LEU B 1 17  ? -3.732  7.401   -65.018 1.00 70.19  ? 17   LEU B CB    1 
ATOM   4298 C CG    . LEU B 1 17  ? -2.233  7.646   -64.916 1.00 68.90  ? 17   LEU B CG    1 
ATOM   4299 C CD1   . LEU B 1 17  ? -1.943  8.428   -63.649 1.00 66.90  ? 17   LEU B CD1   1 
ATOM   4300 C CD2   . LEU B 1 17  ? -1.464  6.321   -64.959 1.00 68.88  ? 17   LEU B CD2   1 
ATOM   4301 N N     . ARG B 1 18  ? -6.302  5.741   -65.778 1.00 72.84  ? 18   ARG B N     1 
ATOM   4302 C CA    . ARG B 1 18  ? -7.688  5.536   -65.369 1.00 73.94  ? 18   ARG B CA    1 
ATOM   4303 C C     . ARG B 1 18  ? -7.708  5.004   -63.951 1.00 72.33  ? 18   ARG B C     1 
ATOM   4304 O O     . ARG B 1 18  ? -7.213  3.907   -63.675 1.00 71.41  ? 18   ARG B O     1 
ATOM   4305 C CB    . ARG B 1 18  ? -8.431  4.552   -66.281 1.00 75.14  ? 18   ARG B CB    1 
ATOM   4306 C CG    . ARG B 1 18  ? -9.952  4.409   -65.942 1.00 77.40  ? 18   ARG B CG    1 
ATOM   4307 C CD    . ARG B 1 18  ? -10.690 3.432   -66.861 1.00 80.62  ? 18   ARG B CD    1 
ATOM   4308 N NE    . ARG B 1 18  ? -9.742  2.450   -67.399 1.00 83.86  ? 18   ARG B NE    1 
ATOM   4309 C CZ    . ARG B 1 18  ? -9.368  2.333   -68.676 1.00 84.44  ? 18   ARG B CZ    1 
ATOM   4310 N NH1   . ARG B 1 18  ? -9.887  3.101   -69.636 1.00 85.16  ? 18   ARG B NH1   1 
ATOM   4311 N NH2   . ARG B 1 18  ? -8.458  1.413   -68.989 1.00 84.99  ? 18   ARG B NH2   1 
ATOM   4312 N N     . GLY B 1 19  ? -8.298  5.791   -63.064 1.00 72.11  ? 19   GLY B N     1 
ATOM   4313 C CA    . GLY B 1 19  ? -8.499  5.396   -61.692 1.00 71.28  ? 19   GLY B CA    1 
ATOM   4314 C C     . GLY B 1 19  ? -9.843  4.736   -61.490 1.00 72.62  ? 19   GLY B C     1 
ATOM   4315 O O     . GLY B 1 19  ? -10.548 4.388   -62.451 1.00 73.50  ? 19   GLY B O     1 
ATOM   4316 N N     . ILE B 1 20  ? -10.191 4.582   -60.219 1.00 72.42  ? 20   ILE B N     1 
ATOM   4317 C CA    . ILE B 1 20  ? -11.361 3.832   -59.814 1.00 74.09  ? 20   ILE B CA    1 
ATOM   4318 C C     . ILE B 1 20  ? -12.091 4.592   -58.710 1.00 75.05  ? 20   ILE B C     1 
ATOM   4319 O O     . ILE B 1 20  ? -11.464 5.161   -57.801 1.00 73.68  ? 20   ILE B O     1 
ATOM   4320 C CB    . ILE B 1 20  ? -10.959 2.410   -59.342 1.00 73.77  ? 20   ILE B CB    1 
ATOM   4321 C CG1   . ILE B 1 20  ? -12.194 1.569   -59.019 1.00 75.10  ? 20   ILE B CG1   1 
ATOM   4322 C CG2   . ILE B 1 20  ? -10.003 2.472   -58.148 1.00 71.20  ? 20   ILE B CG2   1 
ATOM   4323 C CD1   . ILE B 1 20  ? -11.864 0.114   -58.699 1.00 75.25  ? 20   ILE B CD1   1 
ATOM   4324 N N     . ARG B 1 21  ? -13.415 4.621   -58.805 1.00 77.17  ? 21   ARG B N     1 
ATOM   4325 C CA    . ARG B 1 21  ? -14.225 5.222   -57.774 1.00 78.89  ? 21   ARG B CA    1 
ATOM   4326 C C     . ARG B 1 21  ? -14.389 4.226   -56.645 1.00 78.57  ? 21   ARG B C     1 
ATOM   4327 O O     . ARG B 1 21  ? -14.862 3.115   -56.854 1.00 79.50  ? 21   ARG B O     1 
ATOM   4328 C CB    . ARG B 1 21  ? -15.586 5.644   -58.320 1.00 81.17  ? 21   ARG B CB    1 
ATOM   4329 C CG    . ARG B 1 21  ? -16.365 6.496   -57.360 1.00 82.83  ? 21   ARG B CG    1 
ATOM   4330 C CD    . ARG B 1 21  ? -17.565 7.114   -58.034 1.00 86.66  ? 21   ARG B CD    1 
ATOM   4331 N NE    . ARG B 1 21  ? -18.590 6.122   -58.370 1.00 90.51  ? 21   ARG B NE    1 
ATOM   4332 C CZ    . ARG B 1 21  ? -19.815 6.068   -57.841 1.00 94.37  ? 21   ARG B CZ    1 
ATOM   4333 N NH1   . ARG B 1 21  ? -20.233 6.959   -56.928 1.00 95.03  ? 21   ARG B NH1   1 
ATOM   4334 N NH2   . ARG B 1 21  ? -20.651 5.114   -58.250 1.00 96.92  ? 21   ARG B NH2   1 
ATOM   4335 N N     . LEU B 1 22  ? -13.957 4.618   -55.457 1.00 77.93  ? 22   LEU B N     1 
ATOM   4336 C CA    . LEU B 1 22  ? -14.102 3.785   -54.283 1.00 78.50  ? 22   LEU B CA    1 
ATOM   4337 C C     . LEU B 1 22  ? -15.175 4.393   -53.400 1.00 80.03  ? 22   LEU B C     1 
ATOM   4338 O O     . LEU B 1 22  ? -15.406 5.604   -53.424 1.00 80.26  ? 22   LEU B O     1 
ATOM   4339 C CB    . LEU B 1 22  ? -12.783 3.683   -53.511 1.00 76.63  ? 22   LEU B CB    1 
ATOM   4340 C CG    . LEU B 1 22  ? -11.546 3.171   -54.263 1.00 75.72  ? 22   LEU B CG    1 
ATOM   4341 C CD1   . LEU B 1 22  ? -10.341 3.243   -53.346 1.00 75.15  ? 22   LEU B CD1   1 
ATOM   4342 C CD2   . LEU B 1 22  ? -11.725 1.757   -54.801 1.00 77.19  ? 22   LEU B CD2   1 
ATOM   4343 N N     . LYS B 1 23  ? -15.836 3.543   -52.627 1.00 81.48  ? 23   LYS B N     1 
ATOM   4344 C CA    . LYS B 1 23  ? -16.838 4.003   -51.675 1.00 83.11  ? 23   LYS B CA    1 
ATOM   4345 C C     . LYS B 1 23  ? -16.178 4.248   -50.324 1.00 81.41  ? 23   LYS B C     1 
ATOM   4346 O O     . LYS B 1 23  ? -15.555 3.350   -49.770 1.00 80.67  ? 23   LYS B O     1 
ATOM   4347 C CB    . LYS B 1 23  ? -17.973 2.983   -51.540 1.00 85.58  ? 23   LYS B CB    1 
ATOM   4348 C CG    . LYS B 1 23  ? -18.838 3.211   -50.303 1.00 88.08  ? 23   LYS B CG    1 
ATOM   4349 C CD    . LYS B 1 23  ? -20.333 3.098   -50.587 1.00 92.07  ? 23   LYS B CD    1 
ATOM   4350 C CE    . LYS B 1 23  ? -21.149 3.838   -49.513 1.00 93.84  ? 23   LYS B CE    1 
ATOM   4351 N NZ    . LYS B 1 23  ? -20.723 5.277   -49.352 1.00 93.03  ? 23   LYS B NZ    1 
ATOM   4352 N N     . ALA B 1 24  ? -16.294 5.475   -49.822 1.00 80.88  ? 24   ALA B N     1 
ATOM   4353 C CA    . ALA B 1 24  ? -15.999 5.776   -48.422 1.00 79.89  ? 24   ALA B CA    1 
ATOM   4354 C C     . ALA B 1 24  ? -17.335 5.901   -47.678 1.00 81.65  ? 24   ALA B C     1 
ATOM   4355 O O     . ALA B 1 24  ? -18.369 6.139   -48.301 1.00 83.52  ? 24   ALA B O     1 
ATOM   4356 C CB    . ALA B 1 24  ? -15.182 7.054   -48.297 1.00 78.01  ? 24   ALA B CB    1 
ATOM   4357 N N     . PRO B 1 25  ? -17.323 5.739   -46.342 1.00 81.25  ? 25   PRO B N     1 
ATOM   4358 C CA    . PRO B 1 25  ? -18.568 5.757   -45.571 1.00 83.00  ? 25   PRO B CA    1 
ATOM   4359 C C     . PRO B 1 25  ? -19.458 6.967   -45.853 1.00 84.19  ? 25   PRO B C     1 
ATOM   4360 O O     . PRO B 1 25  ? -20.679 6.827   -45.951 1.00 86.38  ? 25   PRO B O     1 
ATOM   4361 C CB    . PRO B 1 25  ? -18.078 5.780   -44.120 1.00 82.04  ? 25   PRO B CB    1 
ATOM   4362 C CG    . PRO B 1 25  ? -16.759 5.135   -44.164 1.00 80.18  ? 25   PRO B CG    1 
ATOM   4363 C CD    . PRO B 1 25  ? -16.149 5.522   -45.475 1.00 79.23  ? 25   PRO B CD    1 
ATOM   4364 N N     . GLY B 1 26  ? -18.844 8.137   -45.996 1.00 82.69  ? 26   GLY B N     1 
ATOM   4365 C CA    . GLY B 1 26  ? -19.587 9.381   -46.204 1.00 83.85  ? 26   GLY B CA    1 
ATOM   4366 C C     . GLY B 1 26  ? -19.813 9.739   -47.662 1.00 84.17  ? 26   GLY B C     1 
ATOM   4367 O O     . GLY B 1 26  ? -20.569 10.658  -47.961 1.00 85.50  ? 26   GLY B O     1 
ATOM   4368 N N     . GLY B 1 27  ? -19.152 9.028   -48.571 1.00 82.90  ? 27   GLY B N     1 
ATOM   4369 C CA    . GLY B 1 27  ? -19.300 9.301   -50.002 1.00 83.24  ? 27   GLY B CA    1 
ATOM   4370 C C     . GLY B 1 27  ? -18.202 8.674   -50.834 1.00 81.27  ? 27   GLY B C     1 
ATOM   4371 O O     . GLY B 1 27  ? -17.335 7.985   -50.293 1.00 79.74  ? 27   GLY B O     1 
ATOM   4372 N N     . PRO B 1 28  ? -18.224 8.918   -52.158 1.00 81.34  ? 28   PRO B N     1 
ATOM   4373 C CA    . PRO B 1 28  ? -17.225 8.335   -53.056 1.00 79.60  ? 28   PRO B CA    1 
ATOM   4374 C C     . PRO B 1 28  ? -15.889 9.067   -53.016 1.00 77.23  ? 28   PRO B C     1 
ATOM   4375 O O     . PRO B 1 28  ? -15.829 10.246  -52.661 1.00 77.31  ? 28   PRO B O     1 
ATOM   4376 C CB    . PRO B 1 28  ? -17.867 8.492   -54.437 1.00 81.23  ? 28   PRO B CB    1 
ATOM   4377 C CG    . PRO B 1 28  ? -18.738 9.708   -54.313 1.00 82.70  ? 28   PRO B CG    1 
ATOM   4378 C CD    . PRO B 1 28  ? -19.190 9.770   -52.879 1.00 83.28  ? 28   PRO B CD    1 
ATOM   4379 N N     . VAL B 1 29  ? -14.828 8.357   -53.377 1.00 75.45  ? 29   VAL B N     1 
ATOM   4380 C CA    . VAL B 1 29  ? -13.513 8.957   -53.607 1.00 73.26  ? 29   VAL B CA    1 
ATOM   4381 C C     . VAL B 1 29  ? -12.934 8.415   -54.922 1.00 72.34  ? 29   VAL B C     1 
ATOM   4382 O O     . VAL B 1 29  ? -13.382 7.381   -55.423 1.00 72.57  ? 29   VAL B O     1 
ATOM   4383 C CB    . VAL B 1 29  ? -12.533 8.692   -52.419 1.00 71.70  ? 29   VAL B CB    1 
ATOM   4384 C CG1   . VAL B 1 29  ? -13.150 9.164   -51.107 1.00 71.65  ? 29   VAL B CG1   1 
ATOM   4385 C CG2   . VAL B 1 29  ? -12.154 7.223   -52.331 1.00 71.27  ? 29   VAL B CG2   1 
ATOM   4386 N N     . SER B 1 30  ? -11.972 9.146   -55.485 1.00 70.98  ? 30   SER B N     1 
ATOM   4387 C CA    . SER B 1 30  ? -11.244 8.719   -56.682 1.00 70.37  ? 30   SER B CA    1 
ATOM   4388 C C     . SER B 1 30  ? -9.898  8.191   -56.232 1.00 68.34  ? 30   SER B C     1 
ATOM   4389 O O     . SER B 1 30  ? -9.185  8.869   -55.492 1.00 67.90  ? 30   SER B O     1 
ATOM   4390 C CB    . SER B 1 30  ? -11.020 9.888   -57.652 1.00 70.68  ? 30   SER B CB    1 
ATOM   4391 O OG    . SER B 1 30  ? -12.245 10.465  -58.101 1.00 73.14  ? 30   SER B OG    1 
ATOM   4392 N N     . ALA B 1 31  ? -9.549  6.988   -56.671 1.00 67.58  ? 31   ALA B N     1 
ATOM   4393 C CA    . ALA B 1 31  ? -8.261  6.410   -56.356 1.00 65.36  ? 31   ALA B CA    1 
ATOM   4394 C C     . ALA B 1 31  ? -7.550  6.054   -57.637 1.00 65.05  ? 31   ALA B C     1 
ATOM   4395 O O     . ALA B 1 31  ? -8.156  5.550   -58.579 1.00 66.11  ? 31   ALA B O     1 
ATOM   4396 C CB    . ALA B 1 31  ? -8.423  5.175   -55.489 1.00 65.36  ? 31   ALA B CB    1 
ATOM   4397 N N     . PHE B 1 32  ? -6.249  6.321   -57.650 1.00 63.23  ? 32   PHE B N     1 
ATOM   4398 C CA    . PHE B 1 32  ? -5.382  6.024   -58.762 1.00 62.22  ? 32   PHE B CA    1 
ATOM   4399 C C     . PHE B 1 32  ? -4.236  5.228   -58.166 1.00 60.65  ? 32   PHE B C     1 
ATOM   4400 O O     . PHE B 1 32  ? -3.317  5.798   -57.556 1.00 58.73  ? 32   PHE B O     1 
ATOM   4401 C CB    . PHE B 1 32  ? -4.886  7.320   -59.401 1.00 62.62  ? 32   PHE B CB    1 
ATOM   4402 C CG    . PHE B 1 32  ? -5.996  8.222   -59.863 1.00 63.67  ? 32   PHE B CG    1 
ATOM   4403 C CD1   . PHE B 1 32  ? -6.572  9.130   -58.992 1.00 64.27  ? 32   PHE B CD1   1 
ATOM   4404 C CD2   . PHE B 1 32  ? -6.470  8.147   -61.162 1.00 65.15  ? 32   PHE B CD2   1 
ATOM   4405 C CE1   . PHE B 1 32  ? -7.596  9.963   -59.412 1.00 66.53  ? 32   PHE B CE1   1 
ATOM   4406 C CE2   . PHE B 1 32  ? -7.493  8.966   -61.591 1.00 68.01  ? 32   PHE B CE2   1 
ATOM   4407 C CZ    . PHE B 1 32  ? -8.064  9.879   -60.712 1.00 67.64  ? 32   PHE B CZ    1 
ATOM   4408 N N     . LEU B 1 33  ? -4.334  3.906   -58.313 1.00 60.25  ? 33   LEU B N     1 
ATOM   4409 C CA    . LEU B 1 33  ? -3.494  2.971   -57.604 1.00 59.46  ? 33   LEU B CA    1 
ATOM   4410 C C     . LEU B 1 33  ? -2.518  2.316   -58.552 1.00 59.60  ? 33   LEU B C     1 
ATOM   4411 O O     . LEU B 1 33  ? -2.882  1.935   -59.652 1.00 61.22  ? 33   LEU B O     1 
ATOM   4412 C CB    . LEU B 1 33  ? -4.355  1.893   -56.937 1.00 59.88  ? 33   LEU B CB    1 
ATOM   4413 C CG    . LEU B 1 33  ? -5.444  2.378   -55.968 1.00 59.90  ? 33   LEU B CG    1 
ATOM   4414 C CD1   . LEU B 1 33  ? -6.262  1.197   -55.440 1.00 59.11  ? 33   LEU B CD1   1 
ATOM   4415 C CD2   . LEU B 1 33  ? -4.854  3.192   -54.818 1.00 56.89  ? 33   LEU B CD2   1 
ATOM   4416 N N     . GLY B 1 34  ? -1.278  2.166   -58.121 1.00 58.89  ? 34   GLY B N     1 
ATOM   4417 C CA    . GLY B 1 34  ? -0.290  1.416   -58.897 1.00 59.42  ? 34   GLY B CA    1 
ATOM   4418 C C     . GLY B 1 34  ? 0.268   2.193   -60.069 1.00 59.45  ? 34   GLY B C     1 
ATOM   4419 O O     . GLY B 1 34  ? 0.486   1.635   -61.139 1.00 60.56  ? 34   GLY B O     1 
ATOM   4420 N N     . ILE B 1 35  ? 0.504   3.483   -59.857 1.00 58.79  ? 35   ILE B N     1 
ATOM   4421 C CA    . ILE B 1 35  ? 1.058   4.355   -60.891 1.00 58.47  ? 35   ILE B CA    1 
ATOM   4422 C C     . ILE B 1 35  ? 2.574   4.234   -60.870 1.00 57.86  ? 35   ILE B C     1 
ATOM   4423 O O     . ILE B 1 35  ? 3.184   4.424   -59.824 1.00 57.25  ? 35   ILE B O     1 
ATOM   4424 C CB    . ILE B 1 35  ? 0.689   5.847   -60.635 1.00 58.27  ? 35   ILE B CB    1 
ATOM   4425 C CG1   . ILE B 1 35  ? -0.833  6.043   -60.572 1.00 58.47  ? 35   ILE B CG1   1 
ATOM   4426 C CG2   . ILE B 1 35  ? 1.318   6.723   -61.694 1.00 57.89  ? 35   ILE B CG2   1 
ATOM   4427 C CD1   . ILE B 1 35  ? -1.281  7.447   -60.050 1.00 58.10  ? 35   ILE B CD1   1 
ATOM   4428 N N     . PRO B 1 36  ? 3.197   3.930   -62.017 1.00 58.91  ? 36   PRO B N     1 
ATOM   4429 C CA    . PRO B 1 36  ? 4.662   3.764   -62.038 1.00 58.41  ? 36   PRO B CA    1 
ATOM   4430 C C     . PRO B 1 36  ? 5.383   5.096   -61.996 1.00 58.47  ? 36   PRO B C     1 
ATOM   4431 O O     . PRO B 1 36  ? 5.071   5.964   -62.798 1.00 59.16  ? 36   PRO B O     1 
ATOM   4432 C CB    . PRO B 1 36  ? 4.917   3.106   -63.390 1.00 59.31  ? 36   PRO B CB    1 
ATOM   4433 C CG    . PRO B 1 36  ? 3.757   3.519   -64.248 1.00 60.12  ? 36   PRO B CG    1 
ATOM   4434 C CD    . PRO B 1 36  ? 2.587   3.721   -63.349 1.00 59.80  ? 36   PRO B CD    1 
ATOM   4435 N N     . PHE B 1 37  ? 6.334   5.263   -61.077 1.00 58.14  ? 37   PHE B N     1 
ATOM   4436 C CA    . PHE B 1 37  ? 7.126   6.519   -61.007 1.00 58.19  ? 37   PHE B CA    1 
ATOM   4437 C C     . PHE B 1 37  ? 8.603   6.327   -61.358 1.00 58.52  ? 37   PHE B C     1 
ATOM   4438 O O     . PHE B 1 37  ? 9.341   7.302   -61.489 1.00 58.65  ? 37   PHE B O     1 
ATOM   4439 C CB    . PHE B 1 37  ? 6.973   7.218   -59.645 1.00 57.10  ? 37   PHE B CB    1 
ATOM   4440 C CG    . PHE B 1 37  ? 7.581   6.474   -58.487 1.00 56.05  ? 37   PHE B CG    1 
ATOM   4441 C CD1   . PHE B 1 37  ? 8.907   6.657   -58.147 1.00 56.83  ? 37   PHE B CD1   1 
ATOM   4442 C CD2   . PHE B 1 37  ? 6.820   5.627   -57.715 1.00 56.26  ? 37   PHE B CD2   1 
ATOM   4443 C CE1   . PHE B 1 37  ? 9.469   5.984   -57.081 1.00 56.33  ? 37   PHE B CE1   1 
ATOM   4444 C CE2   . PHE B 1 37  ? 7.375   4.946   -56.641 1.00 55.71  ? 37   PHE B CE2   1 
ATOM   4445 C CZ    . PHE B 1 37  ? 8.701   5.133   -56.320 1.00 55.21  ? 37   PHE B CZ    1 
ATOM   4446 N N     . ALA B 1 38  ? 9.014   5.070   -61.516 1.00 58.85  ? 38   ALA B N     1 
ATOM   4447 C CA    . ALA B 1 38  ? 10.365  4.719   -61.912 1.00 59.25  ? 38   ALA B CA    1 
ATOM   4448 C C     . ALA B 1 38  ? 10.358  3.553   -62.921 1.00 60.44  ? 38   ALA B C     1 
ATOM   4449 O O     . ALA B 1 38  ? 9.373   2.822   -63.046 1.00 60.45  ? 38   ALA B O     1 
ATOM   4450 C CB    . ALA B 1 38  ? 11.168  4.351   -60.688 1.00 58.44  ? 38   ALA B CB    1 
ATOM   4451 N N     . GLU B 1 39  ? 11.460  3.408   -63.650 1.00 61.42  ? 39   GLU B N     1 
ATOM   4452 C CA    . GLU B 1 39  ? 11.727  2.205   -64.425 1.00 62.26  ? 39   GLU B CA    1 
ATOM   4453 C C     . GLU B 1 39  ? 11.944  1.056   -63.456 1.00 62.24  ? 39   GLU B C     1 
ATOM   4454 O O     . GLU B 1 39  ? 12.641  1.232   -62.453 1.00 61.66  ? 39   GLU B O     1 
ATOM   4455 C CB    . GLU B 1 39  ? 12.997  2.372   -65.266 1.00 63.05  ? 39   GLU B CB    1 
ATOM   4456 C CG    . GLU B 1 39  ? 12.847  3.338   -66.390 1.00 63.23  ? 39   GLU B CG    1 
ATOM   4457 C CD    . GLU B 1 39  ? 11.876  2.826   -67.408 1.00 63.87  ? 39   GLU B CD    1 
ATOM   4458 O OE1   . GLU B 1 39  ? 12.228  1.875   -68.157 1.00 65.61  ? 39   GLU B OE1   1 
ATOM   4459 O OE2   . GLU B 1 39  ? 10.754  3.352   -67.437 1.00 61.87  ? 39   GLU B OE2   1 
ATOM   4460 N N     . PRO B 1 40  ? 11.359  -0.125  -63.743 1.00 62.89  ? 40   PRO B N     1 
ATOM   4461 C CA    . PRO B 1 40  ? 11.570  -1.266  -62.839 1.00 62.95  ? 40   PRO B CA    1 
ATOM   4462 C C     . PRO B 1 40  ? 13.054  -1.503  -62.519 1.00 63.30  ? 40   PRO B C     1 
ATOM   4463 O O     . PRO B 1 40  ? 13.846  -1.681  -63.442 1.00 64.53  ? 40   PRO B O     1 
ATOM   4464 C CB    . PRO B 1 40  ? 10.969  -2.434  -63.624 1.00 63.90  ? 40   PRO B CB    1 
ATOM   4465 C CG    . PRO B 1 40  ? 9.876   -1.787  -64.442 1.00 63.35  ? 40   PRO B CG    1 
ATOM   4466 C CD    . PRO B 1 40  ? 10.463  -0.472  -64.862 1.00 62.95  ? 40   PRO B CD    1 
ATOM   4467 N N     . PRO B 1 41  ? 13.431  -1.491  -61.216 1.00 62.77  ? 41   PRO B N     1 
ATOM   4468 C CA    . PRO B 1 41  ? 14.828  -1.572  -60.805 1.00 63.04  ? 41   PRO B CA    1 
ATOM   4469 C C     . PRO B 1 41  ? 15.300  -3.014  -60.768 1.00 63.98  ? 41   PRO B C     1 
ATOM   4470 O O     . PRO B 1 41  ? 15.641  -3.545  -59.711 1.00 63.61  ? 41   PRO B O     1 
ATOM   4471 C CB    . PRO B 1 41  ? 14.804  -0.955  -59.408 1.00 62.09  ? 41   PRO B CB    1 
ATOM   4472 C CG    . PRO B 1 41  ? 13.495  -1.355  -58.871 1.00 61.37  ? 41   PRO B CG    1 
ATOM   4473 C CD    . PRO B 1 41  ? 12.543  -1.394  -60.043 1.00 61.73  ? 41   PRO B CD    1 
ATOM   4474 N N     . VAL B 1 42  ? 15.342  -3.617  -61.948 1.00 65.25  ? 42   VAL B N     1 
ATOM   4475 C CA    . VAL B 1 42  ? 15.537  -5.048  -62.102 1.00 66.47  ? 42   VAL B CA    1 
ATOM   4476 C C     . VAL B 1 42  ? 16.754  -5.333  -62.966 1.00 67.79  ? 42   VAL B C     1 
ATOM   4477 O O     . VAL B 1 42  ? 17.190  -4.490  -63.738 1.00 68.05  ? 42   VAL B O     1 
ATOM   4478 C CB    . VAL B 1 42  ? 14.281  -5.701  -62.735 1.00 66.75  ? 42   VAL B CB    1 
ATOM   4479 C CG1   . VAL B 1 42  ? 13.092  -5.557  -61.799 1.00 65.56  ? 42   VAL B CG1   1 
ATOM   4480 C CG2   . VAL B 1 42  ? 13.966  -5.075  -64.099 1.00 66.88  ? 42   VAL B CG2   1 
ATOM   4481 N N     . GLY B 1 43  ? 17.300  -6.530  -62.826 1.00 69.27  ? 43   GLY B N     1 
ATOM   4482 C CA    . GLY B 1 43  ? 18.499  -6.923  -63.566 1.00 70.93  ? 43   GLY B CA    1 
ATOM   4483 C C     . GLY B 1 43  ? 19.696  -6.076  -63.170 1.00 71.38  ? 43   GLY B C     1 
ATOM   4484 O O     . GLY B 1 43  ? 20.123  -6.084  -62.001 1.00 71.09  ? 43   GLY B O     1 
ATOM   4485 N N     . SER B 1 44  ? 20.210  -5.318  -64.138 1.00 72.30  ? 44   SER B N     1 
ATOM   4486 C CA    . SER B 1 44  ? 21.405  -4.484  -63.953 1.00 73.09  ? 44   SER B CA    1 
ATOM   4487 C C     . SER B 1 44  ? 21.115  -3.277  -63.093 1.00 71.59  ? 44   SER B C     1 
ATOM   4488 O O     . SER B 1 44  ? 22.038  -2.606  -62.636 1.00 72.66  ? 44   SER B O     1 
ATOM   4489 C CB    . SER B 1 44  ? 21.925  -3.970  -65.302 1.00 74.53  ? 44   SER B CB    1 
ATOM   4490 O OG    . SER B 1 44  ? 21.137  -2.868  -65.775 1.00 74.38  ? 44   SER B OG    1 
ATOM   4491 N N     . ARG B 1 45  ? 19.836  -2.984  -62.904 1.00 69.93  ? 45   ARG B N     1 
ATOM   4492 C CA    . ARG B 1 45  ? 19.409  -1.818  -62.131 1.00 68.53  ? 45   ARG B CA    1 
ATOM   4493 C C     . ARG B 1 45  ? 19.253  -2.100  -60.640 1.00 67.17  ? 45   ARG B C     1 
ATOM   4494 O O     . ARG B 1 45  ? 19.009  -1.178  -59.861 1.00 66.36  ? 45   ARG B O     1 
ATOM   4495 C CB    A ARG B 1 45  ? 18.110  -1.274  -62.712 0.50 67.85  ? 45   ARG B CB    1 
ATOM   4496 C CB    B ARG B 1 45  ? 18.096  -1.279  -62.672 0.50 67.89  ? 45   ARG B CB    1 
ATOM   4497 C CG    A ARG B 1 45  ? 18.314  -0.445  -63.968 0.50 69.09  ? 45   ARG B CG    1 
ATOM   4498 C CG    B ARG B 1 45  ? 18.214  -0.627  -64.017 0.50 69.41  ? 45   ARG B CG    1 
ATOM   4499 C CD    A ARG B 1 45  ? 18.700  0.993   -63.622 0.50 70.33  ? 45   ARG B CD    1 
ATOM   4500 C CD    B ARG B 1 45  ? 16.838  -0.377  -64.575 0.50 70.84  ? 45   ARG B CD    1 
ATOM   4501 N NE    A ARG B 1 45  ? 20.101  1.323   -63.875 0.50 71.48  ? 45   ARG B NE    1 
ATOM   4502 N NE    B ARG B 1 45  ? 16.866  0.490   -65.748 0.50 72.19  ? 45   ARG B NE    1 
ATOM   4503 C CZ    A ARG B 1 45  ? 20.681  2.463   -63.500 0.50 72.15  ? 45   ARG B CZ    1 
ATOM   4504 C CZ    B ARG B 1 45  ? 15.945  0.474   -66.707 0.50 73.48  ? 45   ARG B CZ    1 
ATOM   4505 N NH1   A ARG B 1 45  ? 19.996  3.394   -62.827 0.50 70.32  ? 45   ARG B NH1   1 
ATOM   4506 N NH1   B ARG B 1 45  ? 14.921  -0.384  -66.654 0.50 72.90  ? 45   ARG B NH1   1 
ATOM   4507 N NH2   A ARG B 1 45  ? 21.961  2.673   -63.789 0.50 73.87  ? 45   ARG B NH2   1 
ATOM   4508 N NH2   B ARG B 1 45  ? 16.056  1.312   -67.738 0.50 74.51  ? 45   ARG B NH2   1 
ATOM   4509 N N     . ARG B 1 46  ? 19.413  -3.358  -60.236 1.00 66.83  ? 46   ARG B N     1 
ATOM   4510 C CA    . ARG B 1 46  ? 19.422  -3.697  -58.818 1.00 65.56  ? 46   ARG B CA    1 
ATOM   4511 C C     . ARG B 1 46  ? 20.574  -2.978  -58.096 1.00 65.71  ? 46   ARG B C     1 
ATOM   4512 O O     . ARG B 1 46  ? 21.697  -2.936  -58.608 1.00 66.85  ? 46   ARG B O     1 
ATOM   4513 C CB    . ARG B 1 46  ? 19.557  -5.203  -58.634 1.00 66.39  ? 46   ARG B CB    1 
ATOM   4514 C CG    . ARG B 1 46  ? 19.410  -5.660  -57.205 1.00 65.33  ? 46   ARG B CG    1 
ATOM   4515 C CD    . ARG B 1 46  ? 19.816  -7.102  -57.063 1.00 66.36  ? 46   ARG B CD    1 
ATOM   4516 N NE    . ARG B 1 46  ? 18.724  -8.031  -57.318 1.00 64.93  ? 46   ARG B NE    1 
ATOM   4517 C CZ    . ARG B 1 46  ? 18.858  -9.354  -57.231 1.00 66.52  ? 46   ARG B CZ    1 
ATOM   4518 N NH1   . ARG B 1 46  ? 20.036  -9.891  -56.917 1.00 67.29  ? 46   ARG B NH1   1 
ATOM   4519 N NH2   . ARG B 1 46  ? 17.819  -10.141 -57.462 1.00 66.31  ? 46   ARG B NH2   1 
ATOM   4520 N N     . PHE B 1 47  ? 20.259  -2.418  -56.920 1.00 64.45  ? 47   PHE B N     1 
ATOM   4521 C CA    . PHE B 1 47  ? 21.173  -1.632  -56.086 1.00 64.10  ? 47   PHE B CA    1 
ATOM   4522 C C     . PHE B 1 47  ? 21.467  -0.244  -56.654 1.00 64.43  ? 47   PHE B C     1 
ATOM   4523 O O     . PHE B 1 47  ? 22.218  0.537   -56.052 1.00 64.19  ? 47   PHE B O     1 
ATOM   4524 C CB    . PHE B 1 47  ? 22.499  -2.363  -55.827 1.00 65.36  ? 47   PHE B CB    1 
ATOM   4525 C CG    . PHE B 1 47  ? 22.347  -3.791  -55.387 1.00 65.21  ? 47   PHE B CG    1 
ATOM   4526 C CD1   . PHE B 1 47  ? 21.572  -4.116  -54.278 1.00 64.75  ? 47   PHE B CD1   1 
ATOM   4527 C CD2   . PHE B 1 47  ? 22.999  -4.810  -56.066 1.00 66.10  ? 47   PHE B CD2   1 
ATOM   4528 C CE1   . PHE B 1 47  ? 21.435  -5.441  -53.860 1.00 65.25  ? 47   PHE B CE1   1 
ATOM   4529 C CE2   . PHE B 1 47  ? 22.876  -6.130  -55.655 1.00 67.33  ? 47   PHE B CE2   1 
ATOM   4530 C CZ    . PHE B 1 47  ? 22.091  -6.445  -54.545 1.00 66.80  ? 47   PHE B CZ    1 
ATOM   4531 N N     . MET B 1 48  ? 20.871  0.079   -57.795 1.00 65.05  ? 48   MET B N     1 
ATOM   4532 C CA    . MET B 1 48  ? 21.154  1.344   -58.477 1.00 66.10  ? 48   MET B CA    1 
ATOM   4533 C C     . MET B 1 48  ? 20.103  2.404   -58.196 1.00 64.18  ? 48   MET B C     1 
ATOM   4534 O O     . MET B 1 48  ? 18.930  2.083   -58.039 1.00 63.14  ? 48   MET B O     1 
ATOM   4535 C CB    . MET B 1 48  ? 21.193  1.113   -59.980 1.00 67.65  ? 48   MET B CB    1 
ATOM   4536 C CG    . MET B 1 48  ? 22.251  0.126   -60.423 1.00 72.50  ? 48   MET B CG    1 
ATOM   4537 S SD    . MET B 1 48  ? 23.558  0.948   -61.334 1.00 81.12  ? 48   MET B SD    1 
ATOM   4538 C CE    . MET B 1 48  ? 24.229  1.943   -60.001 1.00 76.74  ? 48   MET B CE    1 
ATOM   4539 N N     . PRO B 1 49  ? 20.506  3.681   -58.200 1.00 64.37  ? 49   PRO B N     1 
ATOM   4540 C CA    . PRO B 1 49  ? 19.493  4.747   -58.096 1.00 63.32  ? 49   PRO B CA    1 
ATOM   4541 C C     . PRO B 1 49  ? 18.357  4.570   -59.115 1.00 63.27  ? 49   PRO B C     1 
ATOM   4542 O O     . PRO B 1 49  ? 18.587  4.071   -60.207 1.00 64.11  ? 49   PRO B O     1 
ATOM   4543 C CB    . PRO B 1 49  ? 20.290  6.027   -58.386 1.00 63.78  ? 49   PRO B CB    1 
ATOM   4544 C CG    . PRO B 1 49  ? 21.698  5.698   -58.036 1.00 64.95  ? 49   PRO B CG    1 
ATOM   4545 C CD    . PRO B 1 49  ? 21.876  4.223   -58.318 1.00 65.36  ? 49   PRO B CD    1 
ATOM   4546 N N     . PRO B 1 50  ? 17.132  4.977   -58.759 1.00 62.88  ? 50   PRO B N     1 
ATOM   4547 C CA    . PRO B 1 50  ? 15.991  4.801   -59.663 1.00 63.28  ? 50   PRO B CA    1 
ATOM   4548 C C     . PRO B 1 50  ? 16.023  5.763   -60.848 1.00 64.58  ? 50   PRO B C     1 
ATOM   4549 O O     . PRO B 1 50  ? 16.488  6.885   -60.712 1.00 64.74  ? 50   PRO B O     1 
ATOM   4550 C CB    . PRO B 1 50  ? 14.797  5.134   -58.773 1.00 61.76  ? 50   PRO B CB    1 
ATOM   4551 C CG    . PRO B 1 50  ? 15.332  6.108   -57.819 1.00 61.30  ? 50   PRO B CG    1 
ATOM   4552 C CD    . PRO B 1 50  ? 16.731  5.653   -57.516 1.00 61.70  ? 50   PRO B CD    1 
ATOM   4553 N N     . GLU B 1 51  ? 15.511  5.329   -61.992 1.00 65.97  ? 51   GLU B N     1 
ATOM   4554 C CA    . GLU B 1 51  ? 15.418  6.190   -63.164 1.00 67.86  ? 51   GLU B CA    1 
ATOM   4555 C C     . GLU B 1 51  ? 13.961  6.536   -63.392 1.00 66.65  ? 51   GLU B C     1 
ATOM   4556 O O     . GLU B 1 51  ? 13.091  5.728   -63.106 1.00 66.29  ? 51   GLU B O     1 
ATOM   4557 C CB    . GLU B 1 51  ? 16.002  5.500   -64.396 1.00 68.77  ? 51   GLU B CB    1 
ATOM   4558 C CG    . GLU B 1 51  ? 17.488  5.217   -64.271 1.00 71.76  ? 51   GLU B CG    1 
ATOM   4559 C CD    . GLU B 1 51  ? 17.989  4.155   -65.260 1.00 74.89  ? 51   GLU B CD    1 
ATOM   4560 O OE1   . GLU B 1 51  ? 17.194  3.253   -65.665 1.00 80.19  ? 51   GLU B OE1   1 
ATOM   4561 O OE2   . GLU B 1 51  ? 19.196  4.217   -65.630 1.00 82.90  ? 51   GLU B OE2   1 
ATOM   4562 N N     . PRO B 1 52  ? 13.688  7.745   -63.902 1.00 66.73  ? 52   PRO B N     1 
ATOM   4563 C CA    . PRO B 1 52  ? 12.308  8.136   -64.200 1.00 66.30  ? 52   PRO B CA    1 
ATOM   4564 C C     . PRO B 1 52  ? 11.613  7.190   -65.184 1.00 66.25  ? 52   PRO B C     1 
ATOM   4565 O O     . PRO B 1 52  ? 12.228  6.724   -66.147 1.00 66.57  ? 52   PRO B O     1 
ATOM   4566 C CB    . PRO B 1 52  ? 12.458  9.528   -64.830 1.00 67.16  ? 52   PRO B CB    1 
ATOM   4567 C CG    . PRO B 1 52  ? 13.793  10.022  -64.398 1.00 67.98  ? 52   PRO B CG    1 
ATOM   4568 C CD    . PRO B 1 52  ? 14.655  8.810   -64.230 1.00 67.54  ? 52   PRO B CD    1 
ATOM   4569 N N     . LYS B 1 53  ? 10.339  6.927   -64.923 1.00 65.50  ? 53   LYS B N     1 
ATOM   4570 C CA    . LYS B 1 53  ? 9.520   6.062   -65.756 1.00 65.97  ? 53   LYS B CA    1 
ATOM   4571 C C     . LYS B 1 53  ? 9.386   6.645   -67.157 1.00 67.28  ? 53   LYS B C     1 
ATOM   4572 O O     . LYS B 1 53  ? 9.039   7.826   -67.315 1.00 67.82  ? 53   LYS B O     1 
ATOM   4573 C CB    . LYS B 1 53  ? 8.133   5.902   -65.115 1.00 65.39  ? 53   LYS B CB    1 
ATOM   4574 C CG    . LYS B 1 53  ? 7.106   5.079   -65.895 1.00 65.92  ? 53   LYS B CG    1 
ATOM   4575 C CD    . LYS B 1 53  ? 7.538   3.618   -66.073 1.00 65.87  ? 53   LYS B CD    1 
ATOM   4576 C CE    . LYS B 1 53  ? 6.573   2.842   -66.960 1.00 66.46  ? 53   LYS B CE    1 
ATOM   4577 N NZ    . LYS B 1 53  ? 6.775   3.126   -68.402 1.00 66.58  ? 53   LYS B NZ    1 
ATOM   4578 N N     . ARG B 1 54  ? 9.645   5.817   -68.168 1.00 67.75  ? 54   ARG B N     1 
ATOM   4579 C CA    . ARG B 1 54  ? 9.435   6.215   -69.554 1.00 68.74  ? 54   ARG B CA    1 
ATOM   4580 C C     . ARG B 1 54  ? 7.933   6.441   -69.791 1.00 68.89  ? 54   ARG B C     1 
ATOM   4581 O O     . ARG B 1 54  ? 7.093   5.791   -69.174 1.00 67.54  ? 54   ARG B O     1 
ATOM   4582 C CB    . ARG B 1 54  ? 9.981   5.145   -70.515 1.00 69.65  ? 54   ARG B CB    1 
ATOM   4583 C CG    . ARG B 1 54  ? 11.485  4.935   -70.410 1.00 69.55  ? 54   ARG B CG    1 
ATOM   4584 C CD    . ARG B 1 54  ? 12.000  3.753   -71.237 1.00 70.32  ? 54   ARG B CD    1 
ATOM   4585 N NE    . ARG B 1 54  ? 11.317  2.501   -70.899 1.00 69.87  ? 54   ARG B NE    1 
ATOM   4586 C CZ    . ARG B 1 54  ? 10.548  1.794   -71.731 1.00 69.67  ? 54   ARG B CZ    1 
ATOM   4587 N NH1   . ARG B 1 54  ? 9.977   0.688   -71.293 1.00 69.62  ? 54   ARG B NH1   1 
ATOM   4588 N NH2   . ARG B 1 54  ? 10.331  2.172   -72.985 1.00 68.99  ? 54   ARG B NH2   1 
ATOM   4589 N N     . PRO B 1 55  ? 7.585   7.413   -70.641 1.00 70.20  ? 55   PRO B N     1 
ATOM   4590 C CA    . PRO B 1 55  ? 6.178   7.606   -71.008 1.00 70.76  ? 55   PRO B CA    1 
ATOM   4591 C C     . PRO B 1 55  ? 5.559   6.382   -71.678 1.00 70.89  ? 55   PRO B C     1 
ATOM   4592 O O     . PRO B 1 55  ? 6.261   5.626   -72.329 1.00 71.56  ? 55   PRO B O     1 
ATOM   4593 C CB    . PRO B 1 55  ? 6.230   8.781   -71.996 1.00 72.22  ? 55   PRO B CB    1 
ATOM   4594 C CG    . PRO B 1 55  ? 7.486   9.497   -71.656 1.00 72.30  ? 55   PRO B CG    1 
ATOM   4595 C CD    . PRO B 1 55  ? 8.453   8.432   -71.252 1.00 71.25  ? 55   PRO B CD    1 
ATOM   4596 N N     . TRP B 1 56  ? 4.249   6.217   -71.519 1.00 70.57  ? 56   TRP B N     1 
ATOM   4597 C CA    . TRP B 1 56  ? 3.519   5.049   -72.021 1.00 70.53  ? 56   TRP B CA    1 
ATOM   4598 C C     . TRP B 1 56  ? 2.425   5.487   -72.994 1.00 71.73  ? 56   TRP B C     1 
ATOM   4599 O O     . TRP B 1 56  ? 2.027   6.651   -72.998 1.00 72.34  ? 56   TRP B O     1 
ATOM   4600 C CB    . TRP B 1 56  ? 2.885   4.280   -70.860 1.00 68.89  ? 56   TRP B CB    1 
ATOM   4601 C CG    . TRP B 1 56  ? 1.964   5.125   -70.035 1.00 68.22  ? 56   TRP B CG    1 
ATOM   4602 C CD1   . TRP B 1 56  ? 0.651   5.389   -70.284 1.00 68.35  ? 56   TRP B CD1   1 
ATOM   4603 C CD2   . TRP B 1 56  ? 2.294   5.835   -68.835 1.00 66.18  ? 56   TRP B CD2   1 
ATOM   4604 N NE1   . TRP B 1 56  ? 0.141   6.224   -69.316 1.00 67.35  ? 56   TRP B NE1   1 
ATOM   4605 C CE2   . TRP B 1 56  ? 1.130   6.514   -68.417 1.00 66.93  ? 56   TRP B CE2   1 
ATOM   4606 C CE3   . TRP B 1 56  ? 3.461   5.976   -68.083 1.00 64.70  ? 56   TRP B CE3   1 
ATOM   4607 C CZ2   . TRP B 1 56  ? 1.098   7.304   -67.259 1.00 65.99  ? 56   TRP B CZ2   1 
ATOM   4608 C CZ3   . TRP B 1 56  ? 3.433   6.758   -66.948 1.00 64.48  ? 56   TRP B CZ3   1 
ATOM   4609 C CH2   . TRP B 1 56  ? 2.258   7.417   -66.544 1.00 64.87  ? 56   TRP B CH2   1 
ATOM   4610 N N     . SER B 1 57  ? 1.943   4.536   -73.794 1.00 72.11  ? 57   SER B N     1 
ATOM   4611 C CA    . SER B 1 57  ? 0.896   4.771   -74.779 1.00 73.52  ? 57   SER B CA    1 
ATOM   4612 C C     . SER B 1 57  ? -0.479  4.565   -74.159 1.00 73.28  ? 57   SER B C     1 
ATOM   4613 O O     . SER B 1 57  ? -0.594  3.968   -73.116 1.00 72.30  ? 57   SER B O     1 
ATOM   4614 C CB    . SER B 1 57  ? 1.061   3.796   -75.951 1.00 74.64  ? 57   SER B CB    1 
ATOM   4615 O OG    . SER B 1 57  ? 0.734   2.469   -75.559 1.00 74.06  ? 57   SER B OG    1 
ATOM   4616 N N     . GLY B 1 58  ? -1.524  5.062   -74.805 1.00 74.48  ? 58   GLY B N     1 
ATOM   4617 C CA    . GLY B 1 58  ? -2.888  4.797   -74.352 1.00 74.76  ? 58   GLY B CA    1 
ATOM   4618 C C     . GLY B 1 58  ? -3.201  5.171   -72.909 1.00 73.63  ? 58   GLY B C     1 
ATOM   4619 O O     . GLY B 1 58  ? -2.587  6.087   -72.339 1.00 72.40  ? 58   GLY B O     1 
ATOM   4620 N N     . VAL B 1 59  ? -4.172  4.459   -72.329 1.00 73.63  ? 59   VAL B N     1 
ATOM   4621 C CA    . VAL B 1 59  ? -4.621  4.710   -70.963 1.00 72.97  ? 59   VAL B CA    1 
ATOM   4622 C C     . VAL B 1 59  ? -4.175  3.604   -70.029 1.00 72.33  ? 59   VAL B C     1 
ATOM   4623 O O     . VAL B 1 59  ? -4.602  2.453   -70.181 1.00 72.66  ? 59   VAL B O     1 
ATOM   4624 C CB    . VAL B 1 59  ? -6.156  4.821   -70.873 1.00 74.42  ? 59   VAL B CB    1 
ATOM   4625 C CG1   . VAL B 1 59  ? -6.568  5.185   -69.448 1.00 72.30  ? 59   VAL B CG1   1 
ATOM   4626 C CG2   . VAL B 1 59  ? -6.680  5.845   -71.889 1.00 75.00  ? 59   VAL B CG2   1 
ATOM   4627 N N     . LEU B 1 60  ? -3.329  3.964   -69.059 1.00 71.58  ? 60   LEU B N     1 
ATOM   4628 C CA    . LEU B 1 60  ? -2.800  3.012   -68.079 1.00 71.01  ? 60   LEU B CA    1 
ATOM   4629 C C     . LEU B 1 60  ? -3.831  2.710   -66.993 1.00 71.09  ? 60   LEU B C     1 
ATOM   4630 O O     . LEU B 1 60  ? -4.399  3.620   -66.393 1.00 70.96  ? 60   LEU B O     1 
ATOM   4631 C CB    . LEU B 1 60  ? -1.507  3.548   -67.450 1.00 69.75  ? 60   LEU B CB    1 
ATOM   4632 C CG    . LEU B 1 60  ? -0.656  2.536   -66.664 1.00 68.89  ? 60   LEU B CG    1 
ATOM   4633 C CD1   . LEU B 1 60  ? 0.033   1.553   -67.582 1.00 70.93  ? 60   LEU B CD1   1 
ATOM   4634 C CD2   . LEU B 1 60  ? 0.375   3.233   -65.837 1.00 68.12  ? 60   LEU B CD2   1 
ATOM   4635 N N     . ASP B 1 61  ? -4.052  1.424   -66.741 1.00 71.75  ? 61   ASP B N     1 
ATOM   4636 C CA    . ASP B 1 61  ? -5.000  0.969   -65.729 1.00 72.40  ? 61   ASP B CA    1 
ATOM   4637 C C     . ASP B 1 61  ? -4.426  1.179   -64.336 1.00 70.46  ? 61   ASP B C     1 
ATOM   4638 O O     . ASP B 1 61  ? -3.527  0.455   -63.918 1.00 69.92  ? 61   ASP B O     1 
ATOM   4639 C CB    . ASP B 1 61  ? -5.337  -0.511  -65.949 1.00 73.88  ? 61   ASP B CB    1 
ATOM   4640 C CG    . ASP B 1 61  ? -6.057  -1.151  -64.751 1.00 76.38  ? 61   ASP B CG    1 
ATOM   4641 O OD1   . ASP B 1 61  ? -5.730  -2.318  -64.411 1.00 80.14  ? 61   ASP B OD1   1 
ATOM   4642 O OD2   . ASP B 1 61  ? -6.931  -0.496  -64.151 1.00 77.91  ? 61   ASP B OD2   1 
ATOM   4643 N N     . ALA B 1 62  ? -4.957  2.177   -63.631 1.00 69.69  ? 62   ALA B N     1 
ATOM   4644 C CA    . ALA B 1 62  ? -4.525  2.513   -62.269 1.00 67.91  ? 62   ALA B CA    1 
ATOM   4645 C C     . ALA B 1 62  ? -5.669  2.257   -61.290 1.00 67.89  ? 62   ALA B C     1 
ATOM   4646 O O     . ALA B 1 62  ? -6.019  3.132   -60.495 1.00 66.76  ? 62   ALA B O     1 
ATOM   4647 C CB    . ALA B 1 62  ? -4.076  3.983   -62.194 1.00 66.96  ? 62   ALA B CB    1 
ATOM   4648 N N     . THR B 1 63  ? -6.262  1.066   -61.369 1.00 68.54  ? 63   THR B N     1 
ATOM   4649 C CA    . THR B 1 63  ? -7.422  0.729   -60.542 1.00 69.52  ? 63   THR B CA    1 
ATOM   4650 C C     . THR B 1 63  ? -7.075  -0.262  -59.435 1.00 69.40  ? 63   THR B C     1 
ATOM   4651 O O     . THR B 1 63  ? -7.942  -0.642  -58.639 1.00 69.90  ? 63   THR B O     1 
ATOM   4652 C CB    . THR B 1 63  ? -8.598  0.151   -61.391 1.00 71.52  ? 63   THR B CB    1 
ATOM   4653 O OG1   . THR B 1 63  ? -8.208  -1.101  -61.970 1.00 71.30  ? 63   THR B OG1   1 
ATOM   4654 C CG2   . THR B 1 63  ? -9.045  1.142   -62.489 1.00 70.66  ? 63   THR B CG2   1 
ATOM   4655 N N     . THR B 1 64  ? -5.801  -0.644  -59.361 1.00 68.76  ? 64   THR B N     1 
ATOM   4656 C CA    . THR B 1 64  ? -5.381  -1.733  -58.508 1.00 69.09  ? 64   THR B CA    1 
ATOM   4657 C C     . THR B 1 64  ? -3.991  -1.477  -57.911 1.00 67.28  ? 64   THR B C     1 
ATOM   4658 O O     . THR B 1 64  ? -3.121  -0.858  -58.543 1.00 66.63  ? 64   THR B O     1 
ATOM   4659 C CB    . THR B 1 64  ? -5.369  -3.037  -59.325 1.00 70.89  ? 64   THR B CB    1 
ATOM   4660 O OG1   . THR B 1 64  ? -5.180  -4.151  -58.446 1.00 73.98  ? 64   THR B OG1   1 
ATOM   4661 C CG2   . THR B 1 64  ? -4.245  -3.019  -60.392 1.00 71.25  ? 64   THR B CG2   1 
ATOM   4662 N N     . PHE B 1 65  ? -3.786  -1.936  -56.683 1.00 66.25  ? 65   PHE B N     1 
ATOM   4663 C CA    . PHE B 1 65  ? -2.473  -1.861  -56.065 1.00 64.33  ? 65   PHE B CA    1 
ATOM   4664 C C     . PHE B 1 65  ? -1.483  -2.740  -56.816 1.00 64.19  ? 65   PHE B C     1 
ATOM   4665 O O     . PHE B 1 65  ? -1.794  -3.865  -57.217 1.00 65.16  ? 65   PHE B O     1 
ATOM   4666 C CB    . PHE B 1 65  ? -2.520  -2.307  -54.602 1.00 64.06  ? 65   PHE B CB    1 
ATOM   4667 C CG    . PHE B 1 65  ? -3.086  -1.275  -53.663 1.00 63.66  ? 65   PHE B CG    1 
ATOM   4668 C CD1   . PHE B 1 65  ? -2.482  -0.035  -53.524 1.00 61.86  ? 65   PHE B CD1   1 
ATOM   4669 C CD2   . PHE B 1 65  ? -4.201  -1.563  -52.886 1.00 64.01  ? 65   PHE B CD2   1 
ATOM   4670 C CE1   . PHE B 1 65  ? -2.996  0.914   -52.656 1.00 62.38  ? 65   PHE B CE1   1 
ATOM   4671 C CE2   . PHE B 1 65  ? -4.711  -0.631  -52.013 1.00 63.94  ? 65   PHE B CE2   1 
ATOM   4672 C CZ    . PHE B 1 65  ? -4.112  0.623   -51.903 1.00 63.28  ? 65   PHE B CZ    1 
ATOM   4673 N N     . GLN B 1 66  ? -0.275  -2.226  -56.970 1.00 63.06  ? 66   GLN B N     1 
ATOM   4674 C CA    . GLN B 1 66  ? 0.803   -2.959  -57.617 1.00 63.08  ? 66   GLN B CA    1 
ATOM   4675 C C     . GLN B 1 66  ? 1.585   -3.825  -56.625 1.00 62.63  ? 66   GLN B C     1 
ATOM   4676 O O     . GLN B 1 66  ? 1.281   -3.859  -55.430 1.00 62.60  ? 66   GLN B O     1 
ATOM   4677 C CB    . GLN B 1 66  ? 1.721   -1.969  -58.348 1.00 62.73  ? 66   GLN B CB    1 
ATOM   4678 C CG    . GLN B 1 66  ? 1.309   -1.767  -59.794 1.00 63.96  ? 66   GLN B CG    1 
ATOM   4679 C CD    . GLN B 1 66  ? 1.710   -2.940  -60.681 1.00 66.54  ? 66   GLN B CD    1 
ATOM   4680 O OE1   . GLN B 1 66  ? 2.347   -3.910  -60.224 1.00 67.97  ? 66   GLN B OE1   1 
ATOM   4681 N NE2   . GLN B 1 66  ? 1.347   -2.859  -61.951 1.00 67.28  ? 66   GLN B NE2   1 
ATOM   4682 N N     . ASN B 1 67  ? 2.586   -4.545  -57.125 1.00 62.72  ? 67   ASN B N     1 
ATOM   4683 C CA    . ASN B 1 67  ? 3.348   -5.478  -56.297 1.00 62.45  ? 67   ASN B CA    1 
ATOM   4684 C C     . ASN B 1 67  ? 4.070   -4.833  -55.122 1.00 61.35  ? 67   ASN B C     1 
ATOM   4685 O O     . ASN B 1 67  ? 4.449   -3.660  -55.168 1.00 60.66  ? 67   ASN B O     1 
ATOM   4686 C CB    . ASN B 1 67  ? 4.338   -6.254  -57.156 1.00 62.86  ? 67   ASN B CB    1 
ATOM   4687 C CG    . ASN B 1 67  ? 3.634   -7.204  -58.138 1.00 65.73  ? 67   ASN B CG    1 
ATOM   4688 O OD1   . ASN B 1 67  ? 2.481   -7.589  -57.923 1.00 67.23  ? 67   ASN B OD1   1 
ATOM   4689 N ND2   . ASN B 1 67  ? 4.327   -7.575  -59.217 1.00 67.06  ? 67   ASN B ND2   1 
ATOM   4690 N N     . VAL B 1 68  ? 4.231   -5.618  -54.061 1.00 61.23  ? 68   VAL B N     1 
ATOM   4691 C CA    . VAL B 1 68  ? 5.015   -5.234  -52.897 1.00 60.30  ? 68   VAL B CA    1 
ATOM   4692 C C     . VAL B 1 68  ? 6.507   -5.455  -53.208 1.00 60.40  ? 68   VAL B C     1 
ATOM   4693 O O     . VAL B 1 68  ? 6.872   -6.455  -53.855 1.00 61.29  ? 68   VAL B O     1 
ATOM   4694 C CB    . VAL B 1 68  ? 4.559   -6.061  -51.647 1.00 60.65  ? 68   VAL B CB    1 
ATOM   4695 C CG1   . VAL B 1 68  ? 5.565   -5.975  -50.500 1.00 59.34  ? 68   VAL B CG1   1 
ATOM   4696 C CG2   . VAL B 1 68  ? 3.184   -5.609  -51.194 1.00 59.78  ? 68   VAL B CG2   1 
ATOM   4697 N N     . CYS B 1 69  ? 7.362   -4.536  -52.761 1.00 59.19  ? 69   CYS B N     1 
ATOM   4698 C CA    . CYS B 1 69  ? 8.811   -4.680  -52.960 1.00 59.67  ? 69   CYS B CA    1 
ATOM   4699 C C     . CYS B 1 69  ? 9.326   -5.936  -52.277 1.00 59.98  ? 69   CYS B C     1 
ATOM   4700 O O     . CYS B 1 69  ? 8.856   -6.310  -51.209 1.00 59.92  ? 69   CYS B O     1 
ATOM   4701 C CB    . CYS B 1 69  ? 9.567   -3.451  -52.448 1.00 59.04  ? 69   CYS B CB    1 
ATOM   4702 S SG    . CYS B 1 69  ? 9.284   -1.948  -53.436 1.00 61.25  ? 69   CYS B SG    1 
ATOM   4703 N N     . TYR B 1 70  ? 10.289  -6.601  -52.905 1.00 60.79  ? 70   TYR B N     1 
ATOM   4704 C CA    . TYR B 1 70  ? 10.736  -7.878  -52.402 1.00 61.30  ? 70   TYR B CA    1 
ATOM   4705 C C     . TYR B 1 70  ? 11.339  -7.726  -51.008 1.00 61.25  ? 70   TYR B C     1 
ATOM   4706 O O     . TYR B 1 70  ? 12.199  -6.878  -50.762 1.00 60.07  ? 70   TYR B O     1 
ATOM   4707 C CB    . TYR B 1 70  ? 11.693  -8.588  -53.357 1.00 61.88  ? 70   TYR B CB    1 
ATOM   4708 C CG    . TYR B 1 70  ? 11.597  -10.078 -53.170 1.00 63.00  ? 70   TYR B CG    1 
ATOM   4709 C CD1   . TYR B 1 70  ? 10.714  -10.839 -53.928 1.00 63.91  ? 70   TYR B CD1   1 
ATOM   4710 C CD2   . TYR B 1 70  ? 12.343  -10.723 -52.195 1.00 64.04  ? 70   TYR B CD2   1 
ATOM   4711 C CE1   . TYR B 1 70  ? 10.597  -12.206 -53.738 1.00 64.78  ? 70   TYR B CE1   1 
ATOM   4712 C CE2   . TYR B 1 70  ? 12.236  -12.088 -52.003 1.00 65.17  ? 70   TYR B CE2   1 
ATOM   4713 C CZ    . TYR B 1 70  ? 11.355  -12.821 -52.770 1.00 65.58  ? 70   TYR B CZ    1 
ATOM   4714 O OH    . TYR B 1 70  ? 11.234  -14.170 -52.572 1.00 66.41  ? 70   TYR B OH    1 
ATOM   4715 N N     . GLN B 1 71  ? 10.860  -8.558  -50.093 1.00 62.26  ? 71   GLN B N     1 
ATOM   4716 C CA    . GLN B 1 71  ? 11.191  -8.398  -48.696 1.00 62.50  ? 71   GLN B CA    1 
ATOM   4717 C C     . GLN B 1 71  ? 11.013  -9.697  -47.929 1.00 64.17  ? 71   GLN B C     1 
ATOM   4718 O O     . GLN B 1 71  ? 10.326  -10.622 -48.373 1.00 64.39  ? 71   GLN B O     1 
ATOM   4719 C CB    . GLN B 1 71  ? 10.317  -7.298  -48.056 1.00 61.34  ? 71   GLN B CB    1 
ATOM   4720 C CG    . GLN B 1 71  ? 8.807   -7.549  -48.125 1.00 60.65  ? 71   GLN B CG    1 
ATOM   4721 C CD    . GLN B 1 71  ? 7.994   -6.337  -47.687 1.00 60.48  ? 71   GLN B CD    1 
ATOM   4722 O OE1   . GLN B 1 71  ? 7.316   -6.365  -46.646 1.00 58.49  ? 71   GLN B OE1   1 
ATOM   4723 N NE2   . GLN B 1 71  ? 8.070   -5.257  -48.472 1.00 57.56  ? 71   GLN B NE2   1 
ATOM   4724 N N     . TYR B 1 72  ? 11.670  -9.718  -46.775 1.00 65.15  ? 72   TYR B N     1 
ATOM   4725 C CA    . TYR B 1 72  ? 11.440  -10.680 -45.725 1.00 66.93  ? 72   TYR B CA    1 
ATOM   4726 C C     . TYR B 1 72  ? 10.008  -10.593 -45.239 1.00 67.22  ? 72   TYR B C     1 
ATOM   4727 O O     . TYR B 1 72  ? 9.484   -9.495  -45.028 1.00 65.39  ? 72   TYR B O     1 
ATOM   4728 C CB    . TYR B 1 72  ? 12.383  -10.379 -44.554 1.00 67.14  ? 72   TYR B CB    1 
ATOM   4729 C CG    . TYR B 1 72  ? 12.149  -11.253 -43.349 1.00 68.60  ? 72   TYR B CG    1 
ATOM   4730 C CD1   . TYR B 1 72  ? 11.571  -10.732 -42.201 1.00 67.90  ? 72   TYR B CD1   1 
ATOM   4731 C CD2   . TYR B 1 72  ? 12.478  -12.616 -43.369 1.00 70.85  ? 72   TYR B CD2   1 
ATOM   4732 C CE1   . TYR B 1 72  ? 11.345  -11.517 -41.088 1.00 68.86  ? 72   TYR B CE1   1 
ATOM   4733 C CE2   . TYR B 1 72  ? 12.247  -13.419 -42.253 1.00 72.32  ? 72   TYR B CE2   1 
ATOM   4734 C CZ    . TYR B 1 72  ? 11.675  -12.852 -41.111 1.00 71.17  ? 72   TYR B CZ    1 
ATOM   4735 O OH    . TYR B 1 72  ? 11.430  -13.611 -39.984 1.00 72.43  ? 72   TYR B OH    1 
ATOM   4736 N N     . VAL B 1 73  ? 9.385   -11.758 -45.048 1.00 69.34  ? 73   VAL B N     1 
ATOM   4737 C CA    . VAL B 1 73  ? 8.027   -11.821 -44.516 1.00 70.32  ? 73   VAL B CA    1 
ATOM   4738 C C     . VAL B 1 73  ? 8.043   -12.504 -43.149 1.00 71.83  ? 73   VAL B C     1 
ATOM   4739 O O     . VAL B 1 73  ? 8.608   -13.570 -42.984 1.00 73.54  ? 73   VAL B O     1 
ATOM   4740 C CB    . VAL B 1 73  ? 7.067   -12.516 -45.500 1.00 71.22  ? 73   VAL B CB    1 
ATOM   4741 C CG1   . VAL B 1 73  ? 5.687   -12.663 -44.890 1.00 72.55  ? 73   VAL B CG1   1 
ATOM   4742 C CG2   . VAL B 1 73  ? 6.985   -11.729 -46.806 1.00 69.50  ? 73   VAL B CG2   1 
ATOM   4743 N N     . ASP B 1 74  ? 7.433   -11.854 -42.166 1.00 72.37  ? 74   ASP B N     1 
ATOM   4744 C CA    . ASP B 1 74  ? 7.367   -12.361 -40.799 1.00 73.86  ? 74   ASP B CA    1 
ATOM   4745 C C     . ASP B 1 74  ? 6.531   -13.636 -40.678 1.00 76.06  ? 74   ASP B C     1 
ATOM   4746 O O     . ASP B 1 74  ? 5.416   -13.708 -41.202 1.00 76.45  ? 74   ASP B O     1 
ATOM   4747 C CB    . ASP B 1 74  ? 6.757   -11.299 -39.900 1.00 72.95  ? 74   ASP B CB    1 
ATOM   4748 C CG    . ASP B 1 74  ? 6.700   -11.716 -38.443 1.00 74.83  ? 74   ASP B CG    1 
ATOM   4749 O OD1   . ASP B 1 74  ? 5.820   -11.192 -37.734 1.00 76.87  ? 74   ASP B OD1   1 
ATOM   4750 O OD2   . ASP B 1 74  ? 7.534   -12.536 -37.998 1.00 76.77  ? 74   ASP B OD2   1 
ATOM   4751 N N     . THR B 1 75  ? 7.064   -14.614 -39.948 1.00 77.62  ? 75   THR B N     1 
ATOM   4752 C CA    . THR B 1 75  ? 6.406   -15.908 -39.767 1.00 80.08  ? 75   THR B CA    1 
ATOM   4753 C C     . THR B 1 75  ? 6.332   -16.333 -38.292 1.00 81.35  ? 75   THR B C     1 
ATOM   4754 O O     . THR B 1 75  ? 6.119   -17.499 -37.999 1.00 83.58  ? 75   THR B O     1 
ATOM   4755 C CB    . THR B 1 75  ? 7.142   -16.986 -40.599 1.00 81.22  ? 75   THR B CB    1 
ATOM   4756 O OG1   . THR B 1 75  ? 8.548   -16.919 -40.327 1.00 80.89  ? 75   THR B OG1   1 
ATOM   4757 C CG2   . THR B 1 75  ? 6.909   -16.764 -42.100 1.00 79.77  ? 75   THR B CG2   1 
ATOM   4758 N N     . LEU B 1 76  ? 6.482   -15.377 -37.374 1.00 80.67  ? 76   LEU B N     1 
ATOM   4759 C CA    . LEU B 1 76  ? 6.508   -15.656 -35.929 1.00 81.74  ? 76   LEU B CA    1 
ATOM   4760 C C     . LEU B 1 76  ? 5.171   -16.183 -35.402 1.00 83.39  ? 76   LEU B C     1 
ATOM   4761 O O     . LEU B 1 76  ? 5.150   -17.048 -34.525 1.00 85.60  ? 76   LEU B O     1 
ATOM   4762 C CB    . LEU B 1 76  ? 6.910   -14.392 -35.134 1.00 80.19  ? 76   LEU B CB    1 
ATOM   4763 C CG    . LEU B 1 76  ? 7.072   -14.541 -33.608 1.00 81.06  ? 76   LEU B CG    1 
ATOM   4764 C CD1   . LEU B 1 76  ? 8.191   -15.523 -33.238 1.00 82.11  ? 76   LEU B CD1   1 
ATOM   4765 C CD2   . LEU B 1 76  ? 7.316   -13.198 -32.953 1.00 79.18  ? 76   LEU B CD2   1 
ATOM   4766 N N     . TYR B 1 77  ? 4.068   -15.640 -35.914 1.00 82.85  ? 77   TYR B N     1 
ATOM   4767 C CA    . TYR B 1 77  ? 2.724   -16.069 -35.520 1.00 84.17  ? 77   TYR B CA    1 
ATOM   4768 C C     . TYR B 1 77  ? 1.814   -16.183 -36.752 1.00 84.37  ? 77   TYR B C     1 
ATOM   4769 O O     . TYR B 1 77  ? 1.044   -15.264 -37.044 1.00 83.36  ? 77   TYR B O     1 
ATOM   4770 C CB    . TYR B 1 77  ? 2.109   -15.084 -34.521 1.00 83.23  ? 77   TYR B CB    1 
ATOM   4771 C CG    . TYR B 1 77  ? 2.879   -14.890 -33.234 1.00 83.05  ? 77   TYR B CG    1 
ATOM   4772 C CD1   . TYR B 1 77  ? 3.021   -15.929 -32.317 1.00 84.77  ? 77   TYR B CD1   1 
ATOM   4773 C CD2   . TYR B 1 77  ? 3.437   -13.651 -32.914 1.00 81.26  ? 77   TYR B CD2   1 
ATOM   4774 C CE1   . TYR B 1 77  ? 3.717   -15.746 -31.120 1.00 84.79  ? 77   TYR B CE1   1 
ATOM   4775 C CE2   . TYR B 1 77  ? 4.133   -13.455 -31.728 1.00 81.31  ? 77   TYR B CE2   1 
ATOM   4776 C CZ    . TYR B 1 77  ? 4.266   -14.504 -30.833 1.00 83.38  ? 77   TYR B CZ    1 
ATOM   4777 O OH    . TYR B 1 77  ? 4.953   -14.311 -29.656 1.00 83.46  ? 77   TYR B OH    1 
ATOM   4778 N N     . PRO B 1 78  ? 1.903   -17.309 -37.484 1.00 85.86  ? 78   PRO B N     1 
ATOM   4779 C CA    . PRO B 1 78  ? 1.082   -17.507 -38.686 1.00 86.12  ? 78   PRO B CA    1 
ATOM   4780 C C     . PRO B 1 78  ? -0.414  -17.356 -38.424 1.00 86.81  ? 78   PRO B C     1 
ATOM   4781 O O     . PRO B 1 78  ? -0.906  -17.807 -37.392 1.00 88.25  ? 78   PRO B O     1 
ATOM   4782 C CB    . PRO B 1 78  ? 1.403   -18.950 -39.102 1.00 88.05  ? 78   PRO B CB    1 
ATOM   4783 C CG    . PRO B 1 78  ? 2.744   -19.226 -38.524 1.00 88.24  ? 78   PRO B CG    1 
ATOM   4784 C CD    . PRO B 1 78  ? 2.787   -18.462 -37.228 1.00 87.52  ? 78   PRO B CD    1 
ATOM   4785 N N     . GLY B 1 79  ? -1.118  -16.702 -39.346 1.00 85.96  ? 79   GLY B N     1 
ATOM   4786 C CA    . GLY B 1 79  ? -2.575  -16.562 -39.266 1.00 86.74  ? 79   GLY B CA    1 
ATOM   4787 C C     . GLY B 1 79  ? -3.102  -15.664 -38.159 1.00 86.14  ? 79   GLY B C     1 
ATOM   4788 O O     . GLY B 1 79  ? -4.289  -15.708 -37.845 1.00 87.05  ? 79   GLY B O     1 
ATOM   4789 N N     . PHE B 1 80  ? -2.225  -14.843 -37.577 1.00 84.53  ? 80   PHE B N     1 
ATOM   4790 C CA    . PHE B 1 80  ? -2.590  -13.951 -36.478 1.00 83.69  ? 80   PHE B CA    1 
ATOM   4791 C C     . PHE B 1 80  ? -2.720  -12.541 -37.045 1.00 81.67  ? 80   PHE B C     1 
ATOM   4792 O O     . PHE B 1 80  ? -1.791  -12.042 -37.668 1.00 80.03  ? 80   PHE B O     1 
ATOM   4793 C CB    . PHE B 1 80  ? -1.525  -14.031 -35.377 1.00 83.23  ? 80   PHE B CB    1 
ATOM   4794 C CG    . PHE B 1 80  ? -1.668  -12.984 -34.304 1.00 82.10  ? 80   PHE B CG    1 
ATOM   4795 C CD1   . PHE B 1 80  ? -2.805  -12.930 -33.513 1.00 82.79  ? 80   PHE B CD1   1 
ATOM   4796 C CD2   . PHE B 1 80  ? -0.662  -12.062 -34.082 1.00 79.93  ? 80   PHE B CD2   1 
ATOM   4797 C CE1   . PHE B 1 80  ? -2.940  -11.969 -32.527 1.00 82.44  ? 80   PHE B CE1   1 
ATOM   4798 C CE2   . PHE B 1 80  ? -0.789  -11.097 -33.092 1.00 79.91  ? 80   PHE B CE2   1 
ATOM   4799 C CZ    . PHE B 1 80  ? -1.930  -11.052 -32.311 1.00 80.84  ? 80   PHE B CZ    1 
ATOM   4800 N N     . GLU B 1 81  ? -3.868  -11.901 -36.842 1.00 82.16  ? 81   GLU B N     1 
ATOM   4801 C CA    . GLU B 1 81  ? -4.134  -10.605 -37.483 1.00 80.40  ? 81   GLU B CA    1 
ATOM   4802 C C     . GLU B 1 81  ? -3.173  -9.491  -37.042 1.00 77.57  ? 81   GLU B C     1 
ATOM   4803 O O     . GLU B 1 81  ? -2.899  -8.575  -37.816 1.00 75.90  ? 81   GLU B O     1 
ATOM   4804 C CB    . GLU B 1 81  ? -5.596  -10.171 -37.267 1.00 81.96  ? 81   GLU B CB    1 
ATOM   4805 C CG    . GLU B 1 81  ? -6.023  -8.870  -38.038 1.00 82.05  ? 81   GLU B CG    1 
ATOM   4806 C CD    . GLU B 1 81  ? -5.894  -8.975  -39.581 1.00 85.38  ? 81   GLU B CD    1 
ATOM   4807 O OE1   . GLU B 1 81  ? -6.430  -9.942  -40.180 1.00 87.63  ? 81   GLU B OE1   1 
ATOM   4808 O OE2   . GLU B 1 81  ? -5.273  -8.073  -40.197 1.00 85.15  ? 81   GLU B OE2   1 
ATOM   4809 N N     . GLY B 1 82  ? -2.658  -9.579  -35.817 1.00 76.70  ? 82   GLY B N     1 
ATOM   4810 C CA    . GLY B 1 82  ? -1.730  -8.584  -35.282 1.00 74.29  ? 82   GLY B CA    1 
ATOM   4811 C C     . GLY B 1 82  ? -0.398  -8.545  -36.004 1.00 72.51  ? 82   GLY B C     1 
ATOM   4812 O O     . GLY B 1 82  ? 0.296   -7.512  -36.003 1.00 70.66  ? 82   GLY B O     1 
ATOM   4813 N N     . THR B 1 83  ? -0.032  -9.669  -36.614 1.00 72.63  ? 83   THR B N     1 
ATOM   4814 C CA    . THR B 1 83  ? 1.163   -9.737  -37.446 1.00 71.25  ? 83   THR B CA    1 
ATOM   4815 C C     . THR B 1 83  ? 0.834   -9.686  -38.942 1.00 70.83  ? 83   THR B C     1 
ATOM   4816 O O     . THR B 1 83  ? 1.556   -9.058  -39.716 1.00 69.31  ? 83   THR B O     1 
ATOM   4817 C CB    . THR B 1 83  ? 1.995   -10.996 -37.133 1.00 72.47  ? 83   THR B CB    1 
ATOM   4818 O OG1   . THR B 1 83  ? 1.150   -12.155 -37.146 1.00 74.20  ? 83   THR B OG1   1 
ATOM   4819 C CG2   . THR B 1 83  ? 2.692   -10.865 -35.776 1.00 71.03  ? 83   THR B CG2   1 
ATOM   4820 N N     . GLU B 1 84  ? -0.255  -10.337 -39.338 1.00 72.08  ? 84   GLU B N     1 
ATOM   4821 C CA    . GLU B 1 84  ? -0.645  -10.417 -40.748 1.00 72.47  ? 84   GLU B CA    1 
ATOM   4822 C C     . GLU B 1 84  ? -1.028  -9.073  -41.346 1.00 70.32  ? 84   GLU B C     1 
ATOM   4823 O O     . GLU B 1 84  ? -0.916  -8.882  -42.565 1.00 70.08  ? 84   GLU B O     1 
ATOM   4824 C CB    . GLU B 1 84  ? -1.827  -11.373 -40.935 1.00 74.81  ? 84   GLU B CB    1 
ATOM   4825 C CG    . GLU B 1 84  ? -1.492  -12.834 -40.702 1.00 78.99  ? 84   GLU B CG    1 
ATOM   4826 C CD    . GLU B 1 84  ? -0.551  -13.415 -41.737 1.00 83.07  ? 84   GLU B CD    1 
ATOM   4827 O OE1   . GLU B 1 84  ? -0.538  -12.932 -42.908 1.00 83.64  ? 84   GLU B OE1   1 
ATOM   4828 O OE2   . GLU B 1 84  ? 0.169   -14.376 -41.365 1.00 86.59  ? 84   GLU B OE2   1 
ATOM   4829 N N     . MET B 1 85  ? -1.499  -8.155  -40.500 1.00 68.57  ? 85   MET B N     1 
ATOM   4830 C CA    . MET B 1 85  ? -1.891  -6.821  -40.949 1.00 66.61  ? 85   MET B CA    1 
ATOM   4831 C C     . MET B 1 85  ? -0.709  -5.993  -41.459 1.00 64.30  ? 85   MET B C     1 
ATOM   4832 O O     . MET B 1 85  ? -0.917  -4.931  -42.055 1.00 63.22  ? 85   MET B O     1 
ATOM   4833 C CB    . MET B 1 85  ? -2.590  -6.054  -39.820 1.00 66.55  ? 85   MET B CB    1 
ATOM   4834 C CG    . MET B 1 85  ? -1.720  -5.768  -38.612 1.00 65.09  ? 85   MET B CG    1 
ATOM   4835 S SD    . MET B 1 85  ? -2.633  -4.888  -37.342 1.00 66.30  ? 85   MET B SD    1 
ATOM   4836 C CE    . MET B 1 85  ? -2.729  -3.244  -38.081 1.00 61.19  ? 85   MET B CE    1 
ATOM   4837 N N     . TRP B 1 86  ? 0.511   -6.456  -41.190 1.00 63.05  ? 86   TRP B N     1 
ATOM   4838 C CA    . TRP B 1 86  ? 1.728   -5.794  -41.659 1.00 61.57  ? 86   TRP B CA    1 
ATOM   4839 C C     . TRP B 1 86  ? 2.434   -6.561  -42.785 1.00 61.86  ? 86   TRP B C     1 
ATOM   4840 O O     . TRP B 1 86  ? 3.387   -6.047  -43.383 1.00 60.41  ? 86   TRP B O     1 
ATOM   4841 C CB    . TRP B 1 86  ? 2.712   -5.627  -40.500 1.00 60.61  ? 86   TRP B CB    1 
ATOM   4842 C CG    . TRP B 1 86  ? 2.142   -4.974  -39.303 1.00 59.84  ? 86   TRP B CG    1 
ATOM   4843 C CD1   . TRP B 1 86  ? 1.910   -5.553  -38.101 1.00 60.42  ? 86   TRP B CD1   1 
ATOM   4844 C CD2   . TRP B 1 86  ? 1.732   -3.604  -39.181 1.00 59.34  ? 86   TRP B CD2   1 
ATOM   4845 N NE1   . TRP B 1 86  ? 1.379   -4.634  -37.226 1.00 60.64  ? 86   TRP B NE1   1 
ATOM   4846 C CE2   . TRP B 1 86  ? 1.258   -3.427  -37.863 1.00 59.89  ? 86   TRP B CE2   1 
ATOM   4847 C CE3   . TRP B 1 86  ? 1.723   -2.510  -40.053 1.00 58.04  ? 86   TRP B CE3   1 
ATOM   4848 C CZ2   . TRP B 1 86  ? 0.784   -2.191  -37.388 1.00 58.49  ? 86   TRP B CZ2   1 
ATOM   4849 C CZ3   . TRP B 1 86  ? 1.236   -1.275  -39.579 1.00 57.33  ? 86   TRP B CZ3   1 
ATOM   4850 C CH2   . TRP B 1 86  ? 0.778   -1.137  -38.260 1.00 57.03  ? 86   TRP B CH2   1 
ATOM   4851 N N     . ASN B 1 87  ? 1.985   -7.794  -43.051 1.00 63.17  ? 87   ASN B N     1 
ATOM   4852 C CA    . ASN B 1 87  ? 2.589   -8.626  -44.087 1.00 63.63  ? 87   ASN B CA    1 
ATOM   4853 C C     . ASN B 1 87  ? 2.141   -8.204  -45.483 1.00 63.28  ? 87   ASN B C     1 
ATOM   4854 O O     . ASN B 1 87  ? 1.056   -7.655  -45.641 1.00 63.54  ? 87   ASN B O     1 
ATOM   4855 C CB    . ASN B 1 87  ? 2.245   -10.109 -43.873 1.00 65.53  ? 87   ASN B CB    1 
ATOM   4856 C CG    . ASN B 1 87  ? 3.050   -10.758 -42.753 1.00 66.02  ? 87   ASN B CG    1 
ATOM   4857 O OD1   . ASN B 1 87  ? 4.069   -10.240 -42.313 1.00 64.35  ? 87   ASN B OD1   1 
ATOM   4858 N ND2   . ASN B 1 87  ? 2.590   -11.921 -42.304 1.00 68.36  ? 87   ASN B ND2   1 
ATOM   4859 N N     . PRO B 1 88  ? 2.963   -8.491  -46.510 1.00 63.34  ? 88   PRO B N     1 
ATOM   4860 C CA    . PRO B 1 88  ? 2.575   -8.125  -47.865 1.00 63.03  ? 88   PRO B CA    1 
ATOM   4861 C C     . PRO B 1 88  ? 1.202   -8.680  -48.220 1.00 64.16  ? 88   PRO B C     1 
ATOM   4862 O O     . PRO B 1 88  ? 0.922   -9.851  -47.942 1.00 65.32  ? 88   PRO B O     1 
ATOM   4863 C CB    . PRO B 1 88  ? 3.658   -8.775  -48.739 1.00 63.31  ? 88   PRO B CB    1 
ATOM   4864 C CG    . PRO B 1 88  ? 4.816   -8.994  -47.850 1.00 62.76  ? 88   PRO B CG    1 
ATOM   4865 C CD    . PRO B 1 88  ? 4.269   -9.186  -46.475 1.00 63.73  ? 88   PRO B CD    1 
ATOM   4866 N N     . ASN B 1 89  ? 0.358   -7.830  -48.800 1.00 63.97  ? 89   ASN B N     1 
ATOM   4867 C CA    . ASN B 1 89  ? -0.972  -8.228  -49.263 1.00 65.29  ? 89   ASN B CA    1 
ATOM   4868 C C     . ASN B 1 89  ? -1.083  -8.203  -50.786 1.00 65.59  ? 89   ASN B C     1 
ATOM   4869 O O     . ASN B 1 89  ? -2.171  -8.336  -51.323 1.00 66.78  ? 89   ASN B O     1 
ATOM   4870 C CB    . ASN B 1 89  ? -2.065  -7.357  -48.618 1.00 65.16  ? 89   ASN B CB    1 
ATOM   4871 C CG    . ASN B 1 89  ? -1.935  -5.894  -48.968 1.00 63.83  ? 89   ASN B CG    1 
ATOM   4872 O OD1   . ASN B 1 89  ? -0.872  -5.435  -49.373 1.00 64.72  ? 89   ASN B OD1   1 
ATOM   4873 N ND2   . ASN B 1 89  ? -3.015  -5.150  -48.812 1.00 63.54  ? 89   ASN B ND2   1 
ATOM   4874 N N     . ARG B 1 90  ? 0.035   -8.016  -51.479 1.00 65.16  ? 90   ARG B N     1 
ATOM   4875 C CA    . ARG B 1 90  ? 0.110   -8.257  -52.924 1.00 65.83  ? 90   ARG B CA    1 
ATOM   4876 C C     . ARG B 1 90  ? 1.346   -9.113  -53.216 1.00 66.08  ? 90   ARG B C     1 
ATOM   4877 O O     . ARG B 1 90  ? 2.135   -9.410  -52.311 1.00 65.54  ? 90   ARG B O     1 
ATOM   4878 C CB    . ARG B 1 90  ? 0.166   -6.938  -53.698 1.00 65.35  ? 90   ARG B CB    1 
ATOM   4879 C CG    . ARG B 1 90  ? -1.112  -6.096  -53.633 1.00 66.60  ? 90   ARG B CG    1 
ATOM   4880 C CD    . ARG B 1 90  ? -2.295  -6.798  -54.310 1.00 69.94  ? 90   ARG B CD    1 
ATOM   4881 N NE    . ARG B 1 90  ? -3.510  -5.987  -54.329 1.00 70.83  ? 90   ARG B NE    1 
ATOM   4882 C CZ    . ARG B 1 90  ? -4.306  -5.779  -53.277 1.00 72.55  ? 90   ARG B CZ    1 
ATOM   4883 N NH1   . ARG B 1 90  ? -4.028  -6.316  -52.095 1.00 71.92  ? 90   ARG B NH1   1 
ATOM   4884 N NH2   . ARG B 1 90  ? -5.391  -5.015  -53.404 1.00 72.99  ? 90   ARG B NH2   1 
ATOM   4885 N N     . GLU B 1 91  ? 1.511   -9.530  -54.467 1.00 66.56  ? 91   GLU B N     1 
ATOM   4886 C CA    . GLU B 1 91  ? 2.652   -10.368 -54.822 1.00 67.19  ? 91   GLU B CA    1 
ATOM   4887 C C     . GLU B 1 91  ? 3.942   -9.601  -54.583 1.00 65.00  ? 91   GLU B C     1 
ATOM   4888 O O     . GLU B 1 91  ? 3.990   -8.392  -54.763 1.00 63.73  ? 91   GLU B O     1 
ATOM   4889 C CB    . GLU B 1 91  ? 2.583   -10.835 -56.279 1.00 68.53  ? 91   GLU B CB    1 
ATOM   4890 C CG    . GLU B 1 91  ? 1.577   -11.950 -56.535 1.00 73.27  ? 91   GLU B CG    1 
ATOM   4891 C CD    . GLU B 1 91  ? 2.058   -13.313 -56.029 1.00 78.74  ? 91   GLU B CD    1 
ATOM   4892 O OE1   . GLU B 1 91  ? 3.184   -13.746 -56.403 1.00 80.54  ? 91   GLU B OE1   1 
ATOM   4893 O OE2   . GLU B 1 91  ? 1.297   -13.955 -55.266 1.00 82.68  ? 91   GLU B OE2   1 
ATOM   4894 N N     . LEU B 1 92  ? 4.969   -10.322 -54.151 1.00 64.66  ? 92   LEU B N     1 
ATOM   4895 C CA    . LEU B 1 92  ? 6.298   -9.770  -53.993 1.00 63.19  ? 92   LEU B CA    1 
ATOM   4896 C C     . LEU B 1 92  ? 6.984   -9.685  -55.352 1.00 63.07  ? 92   LEU B C     1 
ATOM   4897 O O     . LEU B 1 92  ? 6.910   -10.620 -56.153 1.00 64.45  ? 92   LEU B O     1 
ATOM   4898 C CB    . LEU B 1 92  ? 7.144   -10.658 -53.073 1.00 63.56  ? 92   LEU B CB    1 
ATOM   4899 C CG    . LEU B 1 92  ? 6.874   -10.721 -51.569 1.00 63.14  ? 92   LEU B CG    1 
ATOM   4900 C CD1   . LEU B 1 92  ? 8.017   -11.454 -50.884 1.00 62.08  ? 92   LEU B CD1   1 
ATOM   4901 C CD2   . LEU B 1 92  ? 6.734   -9.333  -50.979 1.00 61.41  ? 92   LEU B CD2   1 
ATOM   4902 N N     . SER B 1 93  ? 7.681   -8.579  -55.593 1.00 61.74  ? 93   SER B N     1 
ATOM   4903 C CA    . SER B 1 93  ? 8.457   -8.408  -56.815 1.00 61.25  ? 93   SER B CA    1 
ATOM   4904 C C     . SER B 1 93  ? 9.502   -7.321  -56.645 1.00 60.55  ? 93   SER B C     1 
ATOM   4905 O O     . SER B 1 93  ? 9.296   -6.369  -55.873 1.00 59.67  ? 93   SER B O     1 
ATOM   4906 C CB    . SER B 1 93  ? 7.522   -8.041  -57.975 1.00 61.33  ? 93   SER B CB    1 
ATOM   4907 O OG    . SER B 1 93  ? 8.252   -7.713  -59.140 1.00 59.46  ? 93   SER B OG    1 
ATOM   4908 N N     . GLU B 1 94  ? 10.600  -7.434  -57.389 1.00 60.72  ? 94   GLU B N     1 
ATOM   4909 C CA    . GLU B 1 94  ? 11.566  -6.336  -57.476 1.00 60.20  ? 94   GLU B CA    1 
ATOM   4910 C C     . GLU B 1 94  ? 11.043  -5.194  -58.322 1.00 59.86  ? 94   GLU B C     1 
ATOM   4911 O O     . GLU B 1 94  ? 11.454  -4.050  -58.143 1.00 59.81  ? 94   GLU B O     1 
ATOM   4912 C CB    . GLU B 1 94  ? 12.905  -6.802  -58.014 1.00 61.29  ? 94   GLU B CB    1 
ATOM   4913 C CG    . GLU B 1 94  ? 13.694  -7.611  -57.010 1.00 61.28  ? 94   GLU B CG    1 
ATOM   4914 C CD    . GLU B 1 94  ? 15.070  -7.922  -57.531 1.00 63.02  ? 94   GLU B CD    1 
ATOM   4915 O OE1   . GLU B 1 94  ? 15.954  -7.041  -57.392 1.00 62.69  ? 94   GLU B OE1   1 
ATOM   4916 O OE2   . GLU B 1 94  ? 15.253  -9.043  -58.074 1.00 63.50  ? 94   GLU B OE2   1 
ATOM   4917 N N     . ASP B 1 95  ? 10.130  -5.511  -59.232 1.00 60.34  ? 95   ASP B N     1 
ATOM   4918 C CA    . ASP B 1 95  ? 9.374   -4.518  -59.955 1.00 60.07  ? 95   ASP B CA    1 
ATOM   4919 C C     . ASP B 1 95  ? 8.264   -4.003  -59.048 1.00 59.49  ? 95   ASP B C     1 
ATOM   4920 O O     . ASP B 1 95  ? 7.183   -4.574  -58.992 1.00 60.10  ? 95   ASP B O     1 
ATOM   4921 C CB    . ASP B 1 95  ? 8.804   -5.148  -61.228 1.00 61.06  ? 95   ASP B CB    1 
ATOM   4922 C CG    . ASP B 1 95  ? 8.042   -4.175  -62.081 1.00 60.71  ? 95   ASP B CG    1 
ATOM   4923 O OD1   . ASP B 1 95  ? 7.835   -3.008  -61.689 1.00 59.88  ? 95   ASP B OD1   1 
ATOM   4924 O OD2   . ASP B 1 95  ? 7.652   -4.597  -63.170 1.00 62.46  ? 95   ASP B OD2   1 
ATOM   4925 N N     . CYS B 1 96  ? 8.527   -2.913  -58.332 1.00 58.55  ? 96   CYS B N     1 
ATOM   4926 C CA    . CYS B 1 96  ? 7.598   -2.478  -57.292 1.00 57.60  ? 96   CYS B CA    1 
ATOM   4927 C C     . CYS B 1 96  ? 7.487   -0.959  -57.115 1.00 56.36  ? 96   CYS B C     1 
ATOM   4928 O O     . CYS B 1 96  ? 6.818   -0.497  -56.181 1.00 55.92  ? 96   CYS B O     1 
ATOM   4929 C CB    . CYS B 1 96  ? 8.013   -3.110  -55.967 1.00 57.51  ? 96   CYS B CB    1 
ATOM   4930 S SG    . CYS B 1 96  ? 9.639   -2.540  -55.371 1.00 59.88  ? 96   CYS B SG    1 
ATOM   4931 N N     . LEU B 1 97  ? 8.095   -0.192  -58.019 1.00 55.33  ? 97   LEU B N     1 
ATOM   4932 C CA    . LEU B 1 97  ? 8.189   1.231   -57.844 1.00 54.30  ? 97   LEU B CA    1 
ATOM   4933 C C     . LEU B 1 97  ? 6.951   1.912   -58.437 1.00 54.28  ? 97   LEU B C     1 
ATOM   4934 O O     . LEU B 1 97  ? 6.954   2.430   -59.559 1.00 54.35  ? 97   LEU B O     1 
ATOM   4935 C CB    . LEU B 1 97  ? 9.516   1.759   -58.395 1.00 54.17  ? 97   LEU B CB    1 
ATOM   4936 C CG    . LEU B 1 97  ? 10.760  1.333   -57.576 1.00 53.85  ? 97   LEU B CG    1 
ATOM   4937 C CD1   . LEU B 1 97  ? 12.015  1.995   -58.115 1.00 50.42  ? 97   LEU B CD1   1 
ATOM   4938 C CD2   . LEU B 1 97  ? 10.610  1.635   -56.064 1.00 52.08  ? 97   LEU B CD2   1 
ATOM   4939 N N     . TYR B 1 98  ? 5.894   1.893   -57.628 1.00 54.11  ? 98   TYR B N     1 
ATOM   4940 C CA    . TYR B 1 98  ? 4.580   2.446   -57.975 1.00 54.41  ? 98   TYR B CA    1 
ATOM   4941 C C     . TYR B 1 98  ? 4.031   3.246   -56.799 1.00 53.75  ? 98   TYR B C     1 
ATOM   4942 O O     . TYR B 1 98  ? 4.331   2.955   -55.641 1.00 53.03  ? 98   TYR B O     1 
ATOM   4943 C CB    . TYR B 1 98  ? 3.592   1.311   -58.330 1.00 55.06  ? 98   TYR B CB    1 
ATOM   4944 C CG    . TYR B 1 98  ? 4.071   0.452   -59.484 1.00 56.38  ? 98   TYR B CG    1 
ATOM   4945 C CD1   . TYR B 1 98  ? 3.718   0.747   -60.804 1.00 56.96  ? 98   TYR B CD1   1 
ATOM   4946 C CD2   . TYR B 1 98  ? 4.908   -0.635  -59.261 1.00 56.11  ? 98   TYR B CD2   1 
ATOM   4947 C CE1   . TYR B 1 98  ? 4.182   -0.031  -61.854 1.00 58.11  ? 98   TYR B CE1   1 
ATOM   4948 C CE2   . TYR B 1 98  ? 5.380   -1.414  -60.311 1.00 56.69  ? 98   TYR B CE2   1 
ATOM   4949 C CZ    . TYR B 1 98  ? 5.020   -1.103  -61.597 1.00 57.85  ? 98   TYR B CZ    1 
ATOM   4950 O OH    . TYR B 1 98  ? 5.484   -1.874  -62.634 1.00 59.55  ? 98   TYR B OH    1 
ATOM   4951 N N     . LEU B 1 99  ? 3.200   4.233   -57.103 1.00 54.28  ? 99   LEU B N     1 
ATOM   4952 C CA    . LEU B 1 99  ? 2.591   5.068   -56.082 1.00 54.02  ? 99   LEU B CA    1 
ATOM   4953 C C     . LEU B 1 99  ? 1.078   5.126   -56.241 1.00 55.19  ? 99   LEU B C     1 
ATOM   4954 O O     . LEU B 1 99  ? 0.528   4.766   -57.286 1.00 56.33  ? 99   LEU B O     1 
ATOM   4955 C CB    . LEU B 1 99  ? 3.226   6.466   -56.066 1.00 53.61  ? 99   LEU B CB    1 
ATOM   4956 C CG    . LEU B 1 99  ? 3.184   7.389   -57.292 1.00 54.91  ? 99   LEU B CG    1 
ATOM   4957 C CD1   . LEU B 1 99  ? 1.834   8.050   -57.441 1.00 53.52  ? 99   LEU B CD1   1 
ATOM   4958 C CD2   . LEU B 1 99  ? 4.276   8.493   -57.206 1.00 54.08  ? 99   LEU B CD2   1 
ATOM   4959 N N     . ASN B 1 100 ? 0.416   5.549   -55.168 1.00 55.35  ? 100  ASN B N     1 
ATOM   4960 C CA    . ASN B 1 100 ? -1.041  5.580   -55.076 1.00 56.37  ? 100  ASN B CA    1 
ATOM   4961 C C     . ASN B 1 100 ? -1.511  6.974   -54.716 1.00 56.71  ? 100  ASN B C     1 
ATOM   4962 O O     . ASN B 1 100 ? -0.887  7.642   -53.890 1.00 56.21  ? 100  ASN B O     1 
ATOM   4963 C CB    . ASN B 1 100 ? -1.495  4.599   -54.007 1.00 55.98  ? 100  ASN B CB    1 
ATOM   4964 C CG    . ASN B 1 100 ? -0.852  3.244   -54.171 1.00 55.50  ? 100  ASN B CG    1 
ATOM   4965 O OD1   . ASN B 1 100 ? -1.054  2.586   -55.184 1.00 55.69  ? 100  ASN B OD1   1 
ATOM   4966 N ND2   . ASN B 1 100 ? -0.045  2.832   -53.192 1.00 53.87  ? 100  ASN B ND2   1 
ATOM   4967 N N     . VAL B 1 101 ? -2.607  7.415   -55.334 1.00 58.30  ? 101  VAL B N     1 
ATOM   4968 C CA    . VAL B 1 101 ? -3.197  8.732   -55.044 1.00 58.26  ? 101  VAL B CA    1 
ATOM   4969 C C     . VAL B 1 101 ? -4.682  8.583   -54.761 1.00 60.04  ? 101  VAL B C     1 
ATOM   4970 O O     . VAL B 1 101 ? -5.387  7.926   -55.504 1.00 61.03  ? 101  VAL B O     1 
ATOM   4971 C CB    . VAL B 1 101 ? -3.019  9.709   -56.221 1.00 58.73  ? 101  VAL B CB    1 
ATOM   4972 C CG1   . VAL B 1 101 ? -3.646  11.100  -55.896 1.00 58.35  ? 101  VAL B CG1   1 
ATOM   4973 C CG2   . VAL B 1 101 ? -1.538  9.841   -56.601 1.00 56.84  ? 101  VAL B CG2   1 
ATOM   4974 N N     . TRP B 1 102 ? -5.153  9.202   -53.679 1.00 61.11  ? 102  TRP B N     1 
ATOM   4975 C CA    . TRP B 1 102 ? -6.583  9.304   -53.389 1.00 62.35  ? 102  TRP B CA    1 
ATOM   4976 C C     . TRP B 1 102 ? -6.969  10.760  -53.409 1.00 63.70  ? 102  TRP B C     1 
ATOM   4977 O O     . TRP B 1 102 ? -6.279  11.588  -52.816 1.00 63.05  ? 102  TRP B O     1 
ATOM   4978 C CB    . TRP B 1 102 ? -6.910  8.774   -52.001 1.00 61.88  ? 102  TRP B CB    1 
ATOM   4979 C CG    . TRP B 1 102 ? -6.865  7.312   -51.853 1.00 61.30  ? 102  TRP B CG    1 
ATOM   4980 C CD1   . TRP B 1 102 ? -7.905  6.451   -51.986 1.00 62.92  ? 102  TRP B CD1   1 
ATOM   4981 C CD2   . TRP B 1 102 ? -5.732  6.526   -51.491 1.00 58.73  ? 102  TRP B CD2   1 
ATOM   4982 N NE1   . TRP B 1 102 ? -7.487  5.164   -51.747 1.00 62.56  ? 102  TRP B NE1   1 
ATOM   4983 C CE2   . TRP B 1 102 ? -6.155  5.186   -51.435 1.00 60.60  ? 102  TRP B CE2   1 
ATOM   4984 C CE3   . TRP B 1 102 ? -4.400  6.823   -51.210 1.00 59.11  ? 102  TRP B CE3   1 
ATOM   4985 C CZ2   . TRP B 1 102 ? -5.290  4.143   -51.119 1.00 60.06  ? 102  TRP B CZ2   1 
ATOM   4986 C CZ3   . TRP B 1 102 ? -3.541  5.787   -50.886 1.00 58.64  ? 102  TRP B CZ3   1 
ATOM   4987 C CH2   . TRP B 1 102 ? -3.989  4.466   -50.843 1.00 58.77  ? 102  TRP B CH2   1 
ATOM   4988 N N     . THR B 1 103 ? -8.077  11.073  -54.078 1.00 65.92  ? 103  THR B N     1 
ATOM   4989 C CA    . THR B 1 103 ? -8.612  12.428  -54.071 1.00 67.50  ? 103  THR B CA    1 
ATOM   4990 C C     . THR B 1 103 ? -10.107 12.359  -53.822 1.00 69.50  ? 103  THR B C     1 
ATOM   4991 O O     . THR B 1 103 ? -10.709 11.292  -53.974 1.00 70.11  ? 103  THR B O     1 
ATOM   4992 C CB    . THR B 1 103 ? -8.393  13.169  -55.408 1.00 68.18  ? 103  THR B CB    1 
ATOM   4993 O OG1   . THR B 1 103 ? -9.338  12.693  -56.379 1.00 70.85  ? 103  THR B OG1   1 
ATOM   4994 C CG2   . THR B 1 103 ? -6.991  12.967  -55.913 1.00 66.51  ? 103  THR B CG2   1 
ATOM   4995 N N     . PRO B 1 104 ? -10.706 13.492  -53.420 1.00 70.83  ? 104  PRO B N     1 
ATOM   4996 C CA    . PRO B 1 104 ? -12.155 13.624  -53.387 1.00 73.09  ? 104  PRO B CA    1 
ATOM   4997 C C     . PRO B 1 104 ? -12.779 13.391  -54.755 1.00 75.05  ? 104  PRO B C     1 
ATOM   4998 O O     . PRO B 1 104 ? -12.170 13.717  -55.767 1.00 74.92  ? 104  PRO B O     1 
ATOM   4999 C CB    . PRO B 1 104 ? -12.362 15.079  -52.975 1.00 73.47  ? 104  PRO B CB    1 
ATOM   5000 C CG    . PRO B 1 104 ? -11.138 15.455  -52.277 1.00 71.96  ? 104  PRO B CG    1 
ATOM   5001 C CD    . PRO B 1 104 ? -10.038 14.714  -52.939 1.00 70.36  ? 104  PRO B CD    1 
ATOM   5002 N N     . TYR B 1 105 ? -13.984 12.824  -54.761 1.00 77.56  ? 105  TYR B N     1 
ATOM   5003 C CA    . TYR B 1 105 ? -14.815 12.696  -55.949 1.00 79.82  ? 105  TYR B CA    1 
ATOM   5004 C C     . TYR B 1 105 ? -16.011 13.599  -55.730 1.00 82.94  ? 105  TYR B C     1 
ATOM   5005 O O     . TYR B 1 105 ? -16.748 13.395  -54.766 1.00 83.97  ? 105  TYR B O     1 
ATOM   5006 C CB    . TYR B 1 105 ? -15.288 11.249  -56.096 1.00 80.14  ? 105  TYR B CB    1 
ATOM   5007 C CG    . TYR B 1 105 ? -16.127 10.971  -57.323 1.00 81.57  ? 105  TYR B CG    1 
ATOM   5008 C CD1   . TYR B 1 105 ? -15.589 10.303  -58.415 1.00 81.20  ? 105  TYR B CD1   1 
ATOM   5009 C CD2   . TYR B 1 105 ? -17.469 11.366  -57.390 1.00 84.34  ? 105  TYR B CD2   1 
ATOM   5010 C CE1   . TYR B 1 105 ? -16.350 10.036  -59.545 1.00 82.84  ? 105  TYR B CE1   1 
ATOM   5011 C CE2   . TYR B 1 105 ? -18.239 11.104  -58.517 1.00 85.91  ? 105  TYR B CE2   1 
ATOM   5012 C CZ    . TYR B 1 105 ? -17.672 10.435  -59.592 1.00 85.43  ? 105  TYR B CZ    1 
ATOM   5013 O OH    . TYR B 1 105 ? -18.425 10.168  -60.715 1.00 87.01  ? 105  TYR B OH    1 
ATOM   5014 N N     . PRO B 1 106 ? -16.218 14.610  -56.601 1.00 85.42  ? 106  PRO B N     1 
ATOM   5015 C CA    . PRO B 1 106 ? -15.412 15.002  -57.757 1.00 85.76  ? 106  PRO B CA    1 
ATOM   5016 C C     . PRO B 1 106 ? -14.094 15.627  -57.309 1.00 84.93  ? 106  PRO B C     1 
ATOM   5017 O O     . PRO B 1 106 ? -13.961 16.003  -56.140 1.00 84.19  ? 106  PRO B O     1 
ATOM   5018 C CB    . PRO B 1 106 ? -16.292 16.039  -58.455 1.00 87.87  ? 106  PRO B CB    1 
ATOM   5019 C CG    . PRO B 1 106 ? -17.063 16.648  -57.356 1.00 88.60  ? 106  PRO B CG    1 
ATOM   5020 C CD    . PRO B 1 106 ? -17.371 15.511  -56.425 1.00 87.62  ? 106  PRO B CD    1 
ATOM   5021 N N     . ARG B 1 107 ? -13.129 15.740  -58.220 1.00 85.49  ? 107  ARG B N     1 
ATOM   5022 C CA    . ARG B 1 107 ? -11.791 16.166  -57.817 1.00 85.24  ? 107  ARG B CA    1 
ATOM   5023 C C     . ARG B 1 107 ? -11.807 17.634  -57.397 1.00 85.75  ? 107  ARG B C     1 
ATOM   5024 O O     . ARG B 1 107 ? -12.627 18.401  -57.882 1.00 87.93  ? 107  ARG B O     1 
ATOM   5025 C CB    . ARG B 1 107 ? -10.728 15.845  -58.891 1.00 84.60  ? 107  ARG B CB    1 
ATOM   5026 C CG    . ARG B 1 107 ? -10.451 16.905  -59.974 1.00 86.90  ? 107  ARG B CG    1 
ATOM   5027 C CD    . ARG B 1 107 ? -9.158  16.531  -60.737 1.00 86.33  ? 107  ARG B CD    1 
ATOM   5028 N NE    . ARG B 1 107 ? -9.239  15.180  -61.319 1.00 87.92  ? 107  ARG B NE    1 
ATOM   5029 C CZ    . ARG B 1 107 ? -9.254  14.892  -62.626 1.00 89.58  ? 107  ARG B CZ    1 
ATOM   5030 N NH1   . ARG B 1 107 ? -9.355  13.626  -63.015 1.00 89.87  ? 107  ARG B NH1   1 
ATOM   5031 N NH2   . ARG B 1 107 ? -9.154  15.840  -63.554 1.00 91.35  ? 107  ARG B NH2   1 
ATOM   5032 N N     . PRO B 1 108 ? -10.915 18.020  -56.470 1.00 84.70  ? 108  PRO B N     1 
ATOM   5033 C CA    . PRO B 1 108 ? -10.992 19.342  -55.870 1.00 85.65  ? 108  PRO B CA    1 
ATOM   5034 C C     . PRO B 1 108 ? -11.059 20.484  -56.886 1.00 87.58  ? 108  PRO B C     1 
ATOM   5035 O O     . PRO B 1 108 ? -10.281 20.509  -57.845 1.00 87.56  ? 108  PRO B O     1 
ATOM   5036 C CB    . PRO B 1 108 ? -9.698  19.422  -55.062 1.00 83.67  ? 108  PRO B CB    1 
ATOM   5037 C CG    . PRO B 1 108 ? -9.377  18.021  -54.740 1.00 81.84  ? 108  PRO B CG    1 
ATOM   5038 C CD    . PRO B 1 108 ? -9.771  17.257  -55.944 1.00 82.44  ? 108  PRO B CD    1 
ATOM   5039 N N     . ALA B 1 109 ? -11.991 21.408  -56.660 1.00 89.63  ? 109  ALA B N     1 
ATOM   5040 C CA    . ALA B 1 109 ? -12.156 22.606  -57.493 1.00 91.63  ? 109  ALA B CA    1 
ATOM   5041 C C     . ALA B 1 109 ? -10.969 23.566  -57.375 1.00 90.94  ? 109  ALA B C     1 
ATOM   5042 O O     . ALA B 1 109 ? -10.645 24.287  -58.331 1.00 92.18  ? 109  ALA B O     1 
ATOM   5043 C CB    . ALA B 1 109 ? -13.446 23.338  -57.114 1.00 93.62  ? 109  ALA B CB    1 
ATOM   5044 N N     . SER B 1 110 ? -10.346 23.595  -56.196 1.00 88.96  ? 110  SER B N     1 
ATOM   5045 C CA    . SER B 1 110 ? -9.168  24.421  -55.965 1.00 87.55  ? 110  SER B CA    1 
ATOM   5046 C C     . SER B 1 110 ? -8.042  23.567  -55.385 1.00 84.59  ? 110  SER B C     1 
ATOM   5047 O O     . SER B 1 110 ? -8.309  22.534  -54.771 1.00 83.43  ? 110  SER B O     1 
ATOM   5048 C CB    . SER B 1 110 ? -9.515  25.569  -55.028 1.00 88.88  ? 110  SER B CB    1 
ATOM   5049 O OG    . SER B 1 110 ? -10.075 25.070  -53.831 1.00 89.65  ? 110  SER B OG    1 
ATOM   5050 N N     . PRO B 1 111 ? -6.780  23.995  -55.579 1.00 82.97  ? 111  PRO B N     1 
ATOM   5051 C CA    . PRO B 1 111 ? -5.606  23.224  -55.160 1.00 80.33  ? 111  PRO B CA    1 
ATOM   5052 C C     . PRO B 1 111 ? -5.616  22.842  -53.675 1.00 77.72  ? 111  PRO B C     1 
ATOM   5053 O O     . PRO B 1 111 ? -5.709  23.712  -52.814 1.00 77.81  ? 111  PRO B O     1 
ATOM   5054 C CB    . PRO B 1 111 ? -4.445  24.181  -55.455 1.00 80.43  ? 111  PRO B CB    1 
ATOM   5055 C CG    . PRO B 1 111 ? -4.938  25.028  -56.541 1.00 82.88  ? 111  PRO B CG    1 
ATOM   5056 C CD    . PRO B 1 111 ? -6.378  25.265  -56.209 1.00 84.34  ? 111  PRO B CD    1 
ATOM   5057 N N     . THR B 1 112 ? -5.501  21.548  -53.392 1.00 75.05  ? 112  THR B N     1 
ATOM   5058 C CA    . THR B 1 112 ? -5.660  21.030  -52.035 1.00 73.32  ? 112  THR B CA    1 
ATOM   5059 C C     . THR B 1 112 ? -4.323  20.582  -51.429 1.00 70.37  ? 112  THR B C     1 
ATOM   5060 O O     . THR B 1 112 ? -3.487  20.021  -52.129 1.00 69.50  ? 112  THR B O     1 
ATOM   5061 C CB    . THR B 1 112 ? -6.636  19.852  -52.033 1.00 73.17  ? 112  THR B CB    1 
ATOM   5062 O OG1   . THR B 1 112 ? -7.858  20.266  -52.644 1.00 77.51  ? 112  THR B OG1   1 
ATOM   5063 C CG2   . THR B 1 112 ? -6.937  19.395  -50.628 1.00 72.70  ? 112  THR B CG2   1 
ATOM   5064 N N     . PRO B 1 113 ? -4.122  20.821  -50.120 1.00 68.56  ? 113  PRO B N     1 
ATOM   5065 C CA    . PRO B 1 113 ? -2.905  20.313  -49.493 1.00 66.24  ? 113  PRO B CA    1 
ATOM   5066 C C     . PRO B 1 113 ? -2.739  18.817  -49.689 1.00 64.38  ? 113  PRO B C     1 
ATOM   5067 O O     . PRO B 1 113 ? -3.722  18.065  -49.642 1.00 64.68  ? 113  PRO B O     1 
ATOM   5068 C CB    . PRO B 1 113 ? -3.074  20.652  -48.012 1.00 66.06  ? 113  PRO B CB    1 
ATOM   5069 C CG    . PRO B 1 113 ? -4.124  21.712  -47.961 1.00 68.33  ? 113  PRO B CG    1 
ATOM   5070 C CD    . PRO B 1 113 ? -4.965  21.587  -49.186 1.00 69.54  ? 113  PRO B CD    1 
ATOM   5071 N N     . VAL B 1 114 ? -1.490  18.415  -49.924 1.00 62.26  ? 114  VAL B N     1 
ATOM   5072 C CA    . VAL B 1 114 ? -1.133  17.043  -50.228 1.00 60.37  ? 114  VAL B CA    1 
ATOM   5073 C C     . VAL B 1 114 ? -0.406  16.438  -49.035 1.00 58.91  ? 114  VAL B C     1 
ATOM   5074 O O     . VAL B 1 114 ? 0.495   17.055  -48.486 1.00 58.52  ? 114  VAL B O     1 
ATOM   5075 C CB    . VAL B 1 114 ? -0.215  16.978  -51.474 1.00 60.32  ? 114  VAL B CB    1 
ATOM   5076 C CG1   . VAL B 1 114 ? 0.199   15.528  -51.790 1.00 57.01  ? 114  VAL B CG1   1 
ATOM   5077 C CG2   . VAL B 1 114 ? -0.901  17.646  -52.675 1.00 60.00  ? 114  VAL B CG2   1 
ATOM   5078 N N     . LEU B 1 115 ? -0.819  15.239  -48.633 1.00 58.25  ? 115  LEU B N     1 
ATOM   5079 C CA    . LEU B 1 115 ? -0.113  14.456  -47.622 1.00 57.08  ? 115  LEU B CA    1 
ATOM   5080 C C     . LEU B 1 115 ? 0.552   13.270  -48.319 1.00 56.31  ? 115  LEU B C     1 
ATOM   5081 O O     . LEU B 1 115 ? -0.097  12.527  -49.082 1.00 57.04  ? 115  LEU B O     1 
ATOM   5082 C CB    . LEU B 1 115 ? -1.076  13.960  -46.528 1.00 57.43  ? 115  LEU B CB    1 
ATOM   5083 C CG    . LEU B 1 115 ? -1.469  14.896  -45.364 1.00 58.71  ? 115  LEU B CG    1 
ATOM   5084 C CD1   . LEU B 1 115 ? -2.737  14.477  -44.673 1.00 59.41  ? 115  LEU B CD1   1 
ATOM   5085 C CD2   . LEU B 1 115 ? -0.364  14.925  -44.341 1.00 59.91  ? 115  LEU B CD2   1 
ATOM   5086 N N     . ILE B 1 116 ? 1.843   13.092  -48.070 1.00 54.96  ? 116  ILE B N     1 
ATOM   5087 C CA    . ILE B 1 116 ? 2.565   11.959  -48.623 1.00 53.94  ? 116  ILE B CA    1 
ATOM   5088 C C     . ILE B 1 116 ? 2.998   11.020  -47.508 1.00 53.23  ? 116  ILE B C     1 
ATOM   5089 O O     . ILE B 1 116 ? 3.784   11.409  -46.647 1.00 52.76  ? 116  ILE B O     1 
ATOM   5090 C CB    . ILE B 1 116 ? 3.800   12.399  -49.449 1.00 53.97  ? 116  ILE B CB    1 
ATOM   5091 C CG1   . ILE B 1 116 ? 3.394   13.414  -50.537 1.00 54.31  ? 116  ILE B CG1   1 
ATOM   5092 C CG2   . ILE B 1 116 ? 4.473   11.177  -50.088 1.00 52.19  ? 116  ILE B CG2   1 
ATOM   5093 C CD1   . ILE B 1 116 ? 4.573   13.925  -51.393 1.00 54.69  ? 116  ILE B CD1   1 
ATOM   5094 N N     . TRP B 1 117 ? 2.487   9.785   -47.552 1.00 52.75  ? 117  TRP B N     1 
ATOM   5095 C CA    . TRP B 1 117 ? 2.780   8.753   -46.578 1.00 51.86  ? 117  TRP B CA    1 
ATOM   5096 C C     . TRP B 1 117 ? 3.975   7.884   -46.979 1.00 51.47  ? 117  TRP B C     1 
ATOM   5097 O O     . TRP B 1 117 ? 4.046   7.380   -48.109 1.00 52.03  ? 117  TRP B O     1 
ATOM   5098 C CB    . TRP B 1 117 ? 1.558   7.863   -46.402 1.00 52.68  ? 117  TRP B CB    1 
ATOM   5099 C CG    . TRP B 1 117 ? 1.777   6.715   -45.485 1.00 52.53  ? 117  TRP B CG    1 
ATOM   5100 C CD1   . TRP B 1 117 ? 1.882   5.404   -45.829 1.00 52.95  ? 117  TRP B CD1   1 
ATOM   5101 C CD2   . TRP B 1 117 ? 1.913   6.773   -44.064 1.00 52.87  ? 117  TRP B CD2   1 
ATOM   5102 N NE1   . TRP B 1 117 ? 2.075   4.637   -44.708 1.00 53.34  ? 117  TRP B NE1   1 
ATOM   5103 C CE2   . TRP B 1 117 ? 2.083   5.453   -43.607 1.00 52.63  ? 117  TRP B CE2   1 
ATOM   5104 C CE3   . TRP B 1 117 ? 1.897   7.819   -43.127 1.00 52.73  ? 117  TRP B CE3   1 
ATOM   5105 C CZ2   . TRP B 1 117 ? 2.250   5.148   -42.259 1.00 52.26  ? 117  TRP B CZ2   1 
ATOM   5106 C CZ3   . TRP B 1 117 ? 2.048   7.517   -41.794 1.00 52.06  ? 117  TRP B CZ3   1 
ATOM   5107 C CH2   . TRP B 1 117 ? 2.237   6.191   -41.370 1.00 52.59  ? 117  TRP B CH2   1 
ATOM   5108 N N     . ILE B 1 118 ? 4.908   7.715   -46.040 1.00 50.55  ? 118  ILE B N     1 
ATOM   5109 C CA    . ILE B 1 118 ? 6.065   6.837   -46.214 1.00 50.09  ? 118  ILE B CA    1 
ATOM   5110 C C     . ILE B 1 118 ? 5.964   5.770   -45.125 1.00 50.25  ? 118  ILE B C     1 
ATOM   5111 O O     . ILE B 1 118 ? 6.105   6.058   -43.939 1.00 50.54  ? 118  ILE B O     1 
ATOM   5112 C CB    . ILE B 1 118 ? 7.410   7.602   -46.061 1.00 49.81  ? 118  ILE B CB    1 
ATOM   5113 C CG1   . ILE B 1 118 ? 7.453   8.833   -46.972 1.00 49.62  ? 118  ILE B CG1   1 
ATOM   5114 C CG2   . ILE B 1 118 ? 8.579   6.688   -46.353 1.00 48.44  ? 118  ILE B CG2   1 
ATOM   5115 C CD1   . ILE B 1 118 ? 8.715   9.686   -46.805 1.00 48.66  ? 118  ILE B CD1   1 
ATOM   5116 N N     . TYR B 1 119 ? 5.685   4.547   -45.514 1.00 50.68  ? 119  TYR B N     1 
ATOM   5117 C CA    . TYR B 1 119 ? 5.554   3.482   -44.531 1.00 51.32  ? 119  TYR B CA    1 
ATOM   5118 C C     . TYR B 1 119 ? 6.869   3.141   -43.833 1.00 50.92  ? 119  TYR B C     1 
ATOM   5119 O O     . TYR B 1 119 ? 7.956   3.378   -44.365 1.00 50.72  ? 119  TYR B O     1 
ATOM   5120 C CB    . TYR B 1 119 ? 4.983   2.194   -45.160 1.00 51.54  ? 119  TYR B CB    1 
ATOM   5121 C CG    . TYR B 1 119 ? 5.779   1.638   -46.308 1.00 51.17  ? 119  TYR B CG    1 
ATOM   5122 C CD1   . TYR B 1 119 ? 6.958   0.934   -46.100 1.00 51.58  ? 119  TYR B CD1   1 
ATOM   5123 C CD2   . TYR B 1 119 ? 5.331   1.784   -47.614 1.00 53.11  ? 119  TYR B CD2   1 
ATOM   5124 C CE1   . TYR B 1 119 ? 7.684   0.416   -47.167 1.00 51.68  ? 119  TYR B CE1   1 
ATOM   5125 C CE2   . TYR B 1 119 ? 6.052   1.262   -48.693 1.00 52.74  ? 119  TYR B CE2   1 
ATOM   5126 C CZ    . TYR B 1 119 ? 7.222   0.583   -48.464 1.00 51.77  ? 119  TYR B CZ    1 
ATOM   5127 O OH    . TYR B 1 119 ? 7.919   0.061   -49.536 1.00 51.93  ? 119  TYR B OH    1 
ATOM   5128 N N     . GLY B 1 120 ? 6.731   2.555   -42.647 1.00 51.08  ? 120  GLY B N     1 
ATOM   5129 C CA    . GLY B 1 120 ? 7.838   1.942   -41.929 1.00 51.55  ? 120  GLY B CA    1 
ATOM   5130 C C     . GLY B 1 120 ? 7.868   0.436   -42.118 1.00 52.27  ? 120  GLY B C     1 
ATOM   5131 O O     . GLY B 1 120 ? 7.168   -0.103  -42.975 1.00 52.75  ? 120  GLY B O     1 
ATOM   5132 N N     . GLY B 1 121 ? 8.667   -0.224  -41.279 1.00 52.59  ? 121  GLY B N     1 
ATOM   5133 C CA    . GLY B 1 121 ? 9.015   -1.632  -41.420 1.00 53.22  ? 121  GLY B CA    1 
ATOM   5134 C C     . GLY B 1 121 ? 10.514  -1.915  -41.306 1.00 53.82  ? 121  GLY B C     1 
ATOM   5135 O O     . GLY B 1 121 ? 10.998  -2.921  -41.844 1.00 54.24  ? 121  GLY B O     1 
ATOM   5136 N N     . GLY B 1 122 ? 11.246  -1.034  -40.608 1.00 53.42  ? 122  GLY B N     1 
ATOM   5137 C CA    . GLY B 1 122 ? 12.682  -1.209  -40.340 1.00 53.76  ? 122  GLY B CA    1 
ATOM   5138 C C     . GLY B 1 122 ? 13.602  -1.125  -41.539 1.00 53.83  ? 122  GLY B C     1 
ATOM   5139 O O     . GLY B 1 122 ? 14.753  -1.566  -41.476 1.00 54.34  ? 122  GLY B O     1 
ATOM   5140 N N     . PHE B 1 123 ? 13.104  -0.540  -42.624 1.00 53.62  ? 123  PHE B N     1 
ATOM   5141 C CA    . PHE B 1 123 ? 13.779  -0.567  -43.931 1.00 54.13  ? 123  PHE B CA    1 
ATOM   5142 C C     . PHE B 1 123 ? 13.945  -1.976  -44.510 1.00 55.28  ? 123  PHE B C     1 
ATOM   5143 O O     . PHE B 1 123 ? 14.643  -2.132  -45.511 1.00 55.98  ? 123  PHE B O     1 
ATOM   5144 C CB    . PHE B 1 123 ? 15.145  0.146   -43.875 1.00 54.21  ? 123  PHE B CB    1 
ATOM   5145 C CG    . PHE B 1 123 ? 15.056  1.590   -43.451 1.00 51.93  ? 123  PHE B CG    1 
ATOM   5146 C CD1   . PHE B 1 123 ? 14.582  2.552   -44.332 1.00 51.62  ? 123  PHE B CD1   1 
ATOM   5147 C CD2   . PHE B 1 123 ? 15.444  1.981   -42.190 1.00 52.03  ? 123  PHE B CD2   1 
ATOM   5148 C CE1   . PHE B 1 123 ? 14.483  3.877   -43.958 1.00 50.90  ? 123  PHE B CE1   1 
ATOM   5149 C CE2   . PHE B 1 123 ? 15.359  3.315   -41.800 1.00 52.02  ? 123  PHE B CE2   1 
ATOM   5150 C CZ    . PHE B 1 123 ? 14.873  4.263   -42.689 1.00 51.95  ? 123  PHE B CZ    1 
ATOM   5151 N N     . TYR B 1 124 ? 13.304  -2.989  -43.907 1.00 56.00  ? 124  TYR B N     1 
ATOM   5152 C CA    . TYR B 1 124 ? 13.363  -4.371  -44.428 1.00 57.27  ? 124  TYR B CA    1 
ATOM   5153 C C     . TYR B 1 124 ? 11.992  -4.867  -44.895 1.00 57.40  ? 124  TYR B C     1 
ATOM   5154 O O     . TYR B 1 124 ? 11.895  -5.969  -45.423 1.00 58.28  ? 124  TYR B O     1 
ATOM   5155 C CB    . TYR B 1 124 ? 13.941  -5.353  -43.384 1.00 58.87  ? 124  TYR B CB    1 
ATOM   5156 C CG    . TYR B 1 124 ? 13.037  -5.584  -42.185 1.00 59.41  ? 124  TYR B CG    1 
ATOM   5157 C CD1   . TYR B 1 124 ? 12.022  -6.534  -42.231 1.00 60.95  ? 124  TYR B CD1   1 
ATOM   5158 C CD2   . TYR B 1 124 ? 13.189  -4.844  -41.019 1.00 60.02  ? 124  TYR B CD2   1 
ATOM   5159 C CE1   . TYR B 1 124 ? 11.165  -6.736  -41.155 1.00 62.05  ? 124  TYR B CE1   1 
ATOM   5160 C CE2   . TYR B 1 124 ? 12.334  -5.045  -39.916 1.00 61.08  ? 124  TYR B CE2   1 
ATOM   5161 C CZ    . TYR B 1 124 ? 11.324  -5.994  -39.996 1.00 61.17  ? 124  TYR B CZ    1 
ATOM   5162 O OH    . TYR B 1 124 ? 10.463  -6.206  -38.936 1.00 60.37  ? 124  TYR B OH    1 
ATOM   5163 N N     . SER B 1 125 ? 10.939  -4.062  -44.698 1.00 56.47  ? 125  SER B N     1 
ATOM   5164 C CA    . SER B 1 125 ? 9.570   -4.501  -44.965 1.00 55.98  ? 125  SER B CA    1 
ATOM   5165 C C     . SER B 1 125 ? 8.653   -3.313  -45.176 1.00 55.55  ? 125  SER B C     1 
ATOM   5166 O O     . SER B 1 125 ? 9.081   -2.153  -45.068 1.00 54.34  ? 125  SER B O     1 
ATOM   5167 C CB    . SER B 1 125 ? 9.047   -5.363  -43.816 1.00 56.33  ? 125  SER B CB    1 
ATOM   5168 O OG    . SER B 1 125 ? 8.989   -4.631  -42.603 1.00 55.35  ? 125  SER B OG    1 
ATOM   5169 N N     . GLY B 1 126 ? 7.398   -3.615  -45.510 1.00 56.09  ? 126  GLY B N     1 
ATOM   5170 C CA    . GLY B 1 126 ? 6.365   -2.603  -45.682 1.00 55.86  ? 126  GLY B CA    1 
ATOM   5171 C C     . GLY B 1 126 ? 5.812   -2.530  -47.088 1.00 56.04  ? 126  GLY B C     1 
ATOM   5172 O O     . GLY B 1 126 ? 6.386   -3.095  -48.017 1.00 56.63  ? 126  GLY B O     1 
ATOM   5173 N N     . ALA B 1 127 ? 4.694   -1.817  -47.228 1.00 55.95  ? 127  ALA B N     1 
ATOM   5174 C CA    . ALA B 1 127 ? 4.016   -1.626  -48.519 1.00 56.47  ? 127  ALA B CA    1 
ATOM   5175 C C     . ALA B 1 127 ? 2.961   -0.549  -48.371 1.00 56.00  ? 127  ALA B C     1 
ATOM   5176 O O     . ALA B 1 127 ? 2.405   -0.416  -47.312 1.00 56.21  ? 127  ALA B O     1 
ATOM   5177 C CB    . ALA B 1 127 ? 3.368   -2.909  -48.967 1.00 57.09  ? 127  ALA B CB    1 
ATOM   5178 N N     . ALA B 1 128 ? 2.684   0.207   -49.428 1.00 56.20  ? 128  ALA B N     1 
ATOM   5179 C CA    . ALA B 1 128 ? 1.653   1.262   -49.392 1.00 56.39  ? 128  ALA B CA    1 
ATOM   5180 C C     . ALA B 1 128 ? 0.237   0.692   -49.586 1.00 57.57  ? 128  ALA B C     1 
ATOM   5181 O O     . ALA B 1 128 ? -0.743  1.418   -49.479 1.00 57.78  ? 128  ALA B O     1 
ATOM   5182 C CB    . ALA B 1 128 ? 1.950   2.330   -50.437 1.00 55.89  ? 128  ALA B CB    1 
ATOM   5183 N N     . SER B 1 129 ? 0.141   -0.612  -49.846 1.00 58.27  ? 129  SER B N     1 
ATOM   5184 C CA    . SER B 1 129 ? -1.131  -1.273  -50.122 1.00 59.62  ? 129  SER B CA    1 
ATOM   5185 C C     . SER B 1 129 ? -1.844  -1.804  -48.867 1.00 60.60  ? 129  SER B C     1 
ATOM   5186 O O     . SER B 1 129 ? -2.966  -2.319  -48.960 1.00 61.97  ? 129  SER B O     1 
ATOM   5187 C CB    . SER B 1 129 ? -0.896  -2.428  -51.119 1.00 60.38  ? 129  SER B CB    1 
ATOM   5188 O OG    . SER B 1 129 ? 0.236   -3.215  -50.757 1.00 59.44  ? 129  SER B OG    1 
ATOM   5189 N N     . LEU B 1 130 ? -1.196  -1.687  -47.708 1.00 60.30  ? 130  LEU B N     1 
ATOM   5190 C CA    . LEU B 1 130 ? -1.710  -2.252  -46.461 1.00 61.04  ? 130  LEU B CA    1 
ATOM   5191 C C     . LEU B 1 130 ? -2.982  -1.529  -46.079 1.00 61.93  ? 130  LEU B C     1 
ATOM   5192 O O     . LEU B 1 130 ? -3.089  -0.319  -46.278 1.00 61.12  ? 130  LEU B O     1 
ATOM   5193 C CB    . LEU B 1 130 ? -0.685  -2.132  -45.326 1.00 60.13  ? 130  LEU B CB    1 
ATOM   5194 C CG    . LEU B 1 130 ? 0.688   -2.806  -45.521 1.00 59.48  ? 130  LEU B CG    1 
ATOM   5195 C CD1   . LEU B 1 130 ? 1.545   -2.666  -44.247 1.00 55.71  ? 130  LEU B CD1   1 
ATOM   5196 C CD2   . LEU B 1 130 ? 0.567   -4.284  -45.954 1.00 57.32  ? 130  LEU B CD2   1 
ATOM   5197 N N     . ASP B 1 131 ? -3.945  -2.278  -45.541 1.00 63.63  ? 131  ASP B N     1 
ATOM   5198 C CA    . ASP B 1 131 ? -5.273  -1.725  -45.225 1.00 65.09  ? 131  ASP B CA    1 
ATOM   5199 C C     . ASP B 1 131 ? -5.241  -0.542  -44.276 1.00 63.90  ? 131  ASP B C     1 
ATOM   5200 O O     . ASP B 1 131 ? -6.096  0.326   -44.374 1.00 64.25  ? 131  ASP B O     1 
ATOM   5201 C CB    . ASP B 1 131 ? -6.178  -2.785  -44.609 1.00 67.00  ? 131  ASP B CB    1 
ATOM   5202 C CG    . ASP B 1 131 ? -6.583  -3.842  -45.588 1.00 70.13  ? 131  ASP B CG    1 
ATOM   5203 O OD1   . ASP B 1 131 ? -6.405  -3.633  -46.812 1.00 71.87  ? 131  ASP B OD1   1 
ATOM   5204 O OD2   . ASP B 1 131 ? -7.090  -4.885  -45.122 1.00 74.41  ? 131  ASP B OD2   1 
ATOM   5205 N N     . VAL B 1 132 ? -4.275  -0.528  -43.356 1.00 62.73  ? 132  VAL B N     1 
ATOM   5206 C CA    . VAL B 1 132 ? -4.113  0.581   -42.411 1.00 61.89  ? 132  VAL B CA    1 
ATOM   5207 C C     . VAL B 1 132 ? -3.637  1.882   -43.044 1.00 60.51  ? 132  VAL B C     1 
ATOM   5208 O O     . VAL B 1 132 ? -3.764  2.934   -42.416 1.00 60.71  ? 132  VAL B O     1 
ATOM   5209 C CB    . VAL B 1 132 ? -3.153  0.243   -41.227 1.00 61.57  ? 132  VAL B CB    1 
ATOM   5210 C CG1   . VAL B 1 132 ? -3.942  -0.298  -40.057 1.00 62.66  ? 132  VAL B CG1   1 
ATOM   5211 C CG2   . VAL B 1 132 ? -2.027  -0.727  -41.662 1.00 61.19  ? 132  VAL B CG2   1 
ATOM   5212 N N     . TYR B 1 133 ? -3.080  1.818   -44.255 1.00 59.68  ? 133  TYR B N     1 
ATOM   5213 C CA    . TYR B 1 133 ? -2.625  3.017   -44.966 1.00 58.85  ? 133  TYR B CA    1 
ATOM   5214 C C     . TYR B 1 133 ? -3.629  3.472   -46.014 1.00 59.78  ? 133  TYR B C     1 
ATOM   5215 O O     . TYR B 1 133 ? -3.291  4.264   -46.880 1.00 59.58  ? 133  TYR B O     1 
ATOM   5216 C CB    . TYR B 1 133 ? -1.261  2.800   -45.635 1.00 57.99  ? 133  TYR B CB    1 
ATOM   5217 C CG    . TYR B 1 133 ? -0.194  2.191   -44.748 1.00 56.77  ? 133  TYR B CG    1 
ATOM   5218 C CD1   . TYR B 1 133 ? -0.123  2.506   -43.415 1.00 56.30  ? 133  TYR B CD1   1 
ATOM   5219 C CD2   . TYR B 1 133 ? 0.753   1.307   -45.262 1.00 56.46  ? 133  TYR B CD2   1 
ATOM   5220 C CE1   . TYR B 1 133 ? 0.847   1.968   -42.602 1.00 56.43  ? 133  TYR B CE1   1 
ATOM   5221 C CE2   . TYR B 1 133 ? 1.732   0.746   -44.442 1.00 55.84  ? 133  TYR B CE2   1 
ATOM   5222 C CZ    . TYR B 1 133 ? 1.767   1.096   -43.103 1.00 55.95  ? 133  TYR B CZ    1 
ATOM   5223 O OH    . TYR B 1 133 ? 2.699   0.596   -42.224 1.00 56.48  ? 133  TYR B OH    1 
ATOM   5224 N N     . ASP B 1 134 ? -4.866  2.989   -45.918 1.00 61.36  ? 134  ASP B N     1 
ATOM   5225 C CA    . ASP B 1 134 ? -5.926  3.338   -46.859 1.00 62.45  ? 134  ASP B CA    1 
ATOM   5226 C C     . ASP B 1 134 ? -6.234  4.830   -46.742 1.00 62.29  ? 134  ASP B C     1 
ATOM   5227 O O     . ASP B 1 134 ? -6.685  5.298   -45.698 1.00 62.09  ? 134  ASP B O     1 
ATOM   5228 C CB    . ASP B 1 134 ? -7.172  2.487   -46.569 1.00 64.14  ? 134  ASP B CB    1 
ATOM   5229 C CG    . ASP B 1 134 ? -8.289  2.659   -47.610 1.00 67.00  ? 134  ASP B CG    1 
ATOM   5230 O OD1   . ASP B 1 134 ? -8.401  3.736   -48.230 1.00 69.03  ? 134  ASP B OD1   1 
ATOM   5231 O OD2   . ASP B 1 134 ? -9.080  1.705   -47.790 1.00 69.64  ? 134  ASP B OD2   1 
ATOM   5232 N N     . GLY B 1 135 ? -5.996  5.564   -47.828 1.00 62.35  ? 135  GLY B N     1 
ATOM   5233 C CA    . GLY B 1 135 ? -6.188  7.025   -47.861 1.00 62.43  ? 135  GLY B CA    1 
ATOM   5234 C C     . GLY B 1 135 ? -7.604  7.519   -48.139 1.00 63.76  ? 135  GLY B C     1 
ATOM   5235 O O     . GLY B 1 135 ? -7.836  8.726   -48.181 1.00 64.00  ? 135  GLY B O     1 
ATOM   5236 N N     . ARG B 1 136 ? -8.558  6.611   -48.312 1.00 64.69  ? 136  ARG B N     1 
ATOM   5237 C CA    . ARG B 1 136 ? -9.916  7.016   -48.697 1.00 66.77  ? 136  ARG B CA    1 
ATOM   5238 C C     . ARG B 1 136 ? -10.647 7.871   -47.645 1.00 66.68  ? 136  ARG B C     1 
ATOM   5239 O O     . ARG B 1 136 ? -11.452 8.737   -47.988 1.00 67.67  ? 136  ARG B O     1 
ATOM   5240 C CB    . ARG B 1 136 ? -10.766 5.796   -49.093 1.00 67.89  ? 136  ARG B CB    1 
ATOM   5241 C CG    . ARG B 1 136 ? -11.321 4.988   -47.929 1.00 69.85  ? 136  ARG B CG    1 
ATOM   5242 C CD    . ARG B 1 136 ? -12.222 3.851   -48.408 1.00 71.95  ? 136  ARG B CD    1 
ATOM   5243 N NE    . ARG B 1 136 ? -11.450 2.775   -49.024 1.00 73.61  ? 136  ARG B NE    1 
ATOM   5244 C CZ    . ARG B 1 136 ? -11.971 1.795   -49.764 1.00 75.35  ? 136  ARG B CZ    1 
ATOM   5245 N NH1   . ARG B 1 136 ? -13.275 1.745   -50.025 1.00 78.49  ? 136  ARG B NH1   1 
ATOM   5246 N NH2   . ARG B 1 136 ? -11.174 0.869   -50.274 1.00 74.31  ? 136  ARG B NH2   1 
ATOM   5247 N N     . PHE B 1 137 ? -10.360 7.638   -46.373 1.00 65.73  ? 137  PHE B N     1 
ATOM   5248 C CA    . PHE B 1 137 ? -11.046 8.357   -45.294 1.00 66.32  ? 137  PHE B CA    1 
ATOM   5249 C C     . PHE B 1 137 ? -10.623 9.829   -45.218 1.00 65.19  ? 137  PHE B C     1 
ATOM   5250 O O     . PHE B 1 137 ? -11.475 10.720  -45.157 1.00 65.73  ? 137  PHE B O     1 
ATOM   5251 C CB    . PHE B 1 137 ? -10.806 7.654   -43.959 1.00 66.17  ? 137  PHE B CB    1 
ATOM   5252 C CG    . PHE B 1 137 ? -11.201 6.210   -43.973 1.00 67.55  ? 137  PHE B CG    1 
ATOM   5253 C CD1   . PHE B 1 137 ? -12.532 5.844   -43.835 1.00 69.89  ? 137  PHE B CD1   1 
ATOM   5254 C CD2   . PHE B 1 137 ? -10.253 5.218   -44.165 1.00 67.25  ? 137  PHE B CD2   1 
ATOM   5255 C CE1   . PHE B 1 137 ? -12.908 4.504   -43.870 1.00 71.02  ? 137  PHE B CE1   1 
ATOM   5256 C CE2   . PHE B 1 137 ? -10.622 3.874   -44.198 1.00 68.37  ? 137  PHE B CE2   1 
ATOM   5257 C CZ    . PHE B 1 137 ? -11.950 3.520   -44.050 1.00 69.70  ? 137  PHE B CZ    1 
ATOM   5258 N N     . LEU B 1 138 ? -9.309  10.068  -45.233 1.00 63.26  ? 138  LEU B N     1 
ATOM   5259 C CA    . LEU B 1 138 ? -8.750  11.427  -45.240 1.00 62.66  ? 138  LEU B CA    1 
ATOM   5260 C C     . LEU B 1 138 ? -9.193  12.208  -46.483 1.00 63.87  ? 138  LEU B C     1 
ATOM   5261 O O     . LEU B 1 138 ? -9.571  13.380  -46.400 1.00 64.74  ? 138  LEU B O     1 
ATOM   5262 C CB    . LEU B 1 138 ? -7.227  11.378  -45.164 1.00 60.76  ? 138  LEU B CB    1 
ATOM   5263 C CG    . LEU B 1 138 ? -6.665  10.962  -43.802 1.00 59.21  ? 138  LEU B CG    1 
ATOM   5264 C CD1   . LEU B 1 138 ? -5.257  10.411  -43.944 1.00 57.55  ? 138  LEU B CD1   1 
ATOM   5265 C CD2   . LEU B 1 138 ? -6.702  12.135  -42.820 1.00 58.06  ? 138  LEU B CD2   1 
ATOM   5266 N N     . ALA B 1 139 ? -9.172  11.535  -47.626 1.00 64.09  ? 139  ALA B N     1 
ATOM   5267 C CA    . ALA B 1 139 ? -9.655  12.108  -48.875 1.00 65.11  ? 139  ALA B CA    1 
ATOM   5268 C C     . ALA B 1 139 ? -11.125 12.518  -48.760 1.00 67.34  ? 139  ALA B C     1 
ATOM   5269 O O     . ALA B 1 139 ? -11.494 13.652  -49.053 1.00 68.11  ? 139  ALA B O     1 
ATOM   5270 C CB    . ALA B 1 139 ? -9.457  11.097  -50.034 1.00 64.52  ? 139  ALA B CB    1 
ATOM   5271 N N     . GLN B 1 140 ? -11.960 11.596  -48.304 1.00 68.41  ? 140  GLN B N     1 
ATOM   5272 C CA    . GLN B 1 140 ? -13.391 11.830  -48.292 1.00 70.60  ? 140  GLN B CA    1 
ATOM   5273 C C     . GLN B 1 140 ? -13.802 12.833  -47.233 1.00 71.39  ? 140  GLN B C     1 
ATOM   5274 O O     . GLN B 1 140 ? -14.535 13.776  -47.526 1.00 73.22  ? 140  GLN B O     1 
ATOM   5275 C CB    . GLN B 1 140 ? -14.150 10.509  -48.097 1.00 71.57  ? 140  GLN B CB    1 
ATOM   5276 C CG    . GLN B 1 140 ? -15.599 10.571  -48.529 1.00 73.25  ? 140  GLN B CG    1 
ATOM   5277 C CD    . GLN B 1 140 ? -16.491 11.176  -47.470 1.00 74.65  ? 140  GLN B CD    1 
ATOM   5278 O OE1   . GLN B 1 140 ? -16.425 10.800  -46.295 1.00 74.05  ? 140  GLN B OE1   1 
ATOM   5279 N NE2   . GLN B 1 140 ? -17.337 12.113  -47.879 1.00 75.78  ? 140  GLN B NE2   1 
ATOM   5280 N N     . VAL B 1 141 ? -13.339 12.627  -46.004 1.00 70.62  ? 141  VAL B N     1 
ATOM   5281 C CA    . VAL B 1 141 ? -13.831 13.400  -44.862 1.00 71.13  ? 141  VAL B CA    1 
ATOM   5282 C C     . VAL B 1 141 ? -13.167 14.778  -44.779 1.00 71.11  ? 141  VAL B C     1 
ATOM   5283 O O     . VAL B 1 141 ? -13.842 15.785  -44.550 1.00 72.77  ? 141  VAL B O     1 
ATOM   5284 C CB    . VAL B 1 141 ? -13.638 12.616  -43.551 1.00 70.33  ? 141  VAL B CB    1 
ATOM   5285 C CG1   . VAL B 1 141 ? -13.991 13.465  -42.354 1.00 70.12  ? 141  VAL B CG1   1 
ATOM   5286 C CG2   . VAL B 1 141 ? -14.482 11.358  -43.572 1.00 70.88  ? 141  VAL B CG2   1 
ATOM   5287 N N     . GLU B 1 142 ? -11.854 14.816  -44.991 1.00 69.99  ? 142  GLU B N     1 
ATOM   5288 C CA    . GLU B 1 142 ? -11.077 16.046  -44.886 1.00 69.77  ? 142  GLU B CA    1 
ATOM   5289 C C     . GLU B 1 142 ? -10.780 16.723  -46.232 1.00 70.14  ? 142  GLU B C     1 
ATOM   5290 O O     . GLU B 1 142 ? -10.237 17.825  -46.261 1.00 70.31  ? 142  GLU B O     1 
ATOM   5291 C CB    . GLU B 1 142 ? -9.767  15.763  -44.137 1.00 68.00  ? 142  GLU B CB    1 
ATOM   5292 C CG    . GLU B 1 142 ? -9.960  15.421  -42.653 1.00 69.13  ? 142  GLU B CG    1 
ATOM   5293 C CD    . GLU B 1 142 ? -10.651 16.539  -41.851 1.00 72.41  ? 142  GLU B CD    1 
ATOM   5294 O OE1   . GLU B 1 142 ? -10.499 17.732  -42.220 1.00 73.42  ? 142  GLU B OE1   1 
ATOM   5295 O OE2   . GLU B 1 142 ? -11.345 16.213  -40.851 1.00 73.80  ? 142  GLU B OE2   1 
ATOM   5296 N N     . GLY B 1 143 ? -11.135 16.084  -47.341 1.00 70.94  ? 143  GLY B N     1 
ATOM   5297 C CA    . GLY B 1 143 ? -10.919 16.674  -48.663 1.00 71.59  ? 143  GLY B CA    1 
ATOM   5298 C C     . GLY B 1 143 ? -9.449  16.698  -49.067 1.00 70.43  ? 143  GLY B C     1 
ATOM   5299 O O     . GLY B 1 143 ? -9.036  17.543  -49.865 1.00 72.11  ? 143  GLY B O     1 
ATOM   5300 N N     . ALA B 1 144 ? -8.663  15.770  -48.530 1.00 68.16  ? 144  ALA B N     1 
ATOM   5301 C CA    . ALA B 1 144 ? -7.227  15.755  -48.737 1.00 66.07  ? 144  ALA B CA    1 
ATOM   5302 C C     . ALA B 1 144 ? -6.833  14.988  -49.998 1.00 65.33  ? 144  ALA B C     1 
ATOM   5303 O O     . ALA B 1 144 ? -7.523  14.056  -50.412 1.00 65.83  ? 144  ALA B O     1 
ATOM   5304 C CB    . ALA B 1 144 ? -6.546  15.130  -47.521 1.00 64.79  ? 144  ALA B CB    1 
ATOM   5305 N N     . VAL B 1 145 ? -5.716  15.382  -50.606 1.00 63.99  ? 145  VAL B N     1 
ATOM   5306 C CA    . VAL B 1 145 ? -5.076  14.563  -51.618 1.00 63.05  ? 145  VAL B CA    1 
ATOM   5307 C C     . VAL B 1 145 ? -3.985  13.769  -50.891 1.00 61.87  ? 145  VAL B C     1 
ATOM   5308 O O     . VAL B 1 145 ? -3.043  14.339  -50.342 1.00 61.04  ? 145  VAL B O     1 
ATOM   5309 C CB    . VAL B 1 145 ? -4.521  15.398  -52.788 1.00 63.43  ? 145  VAL B CB    1 
ATOM   5310 C CG1   . VAL B 1 145 ? -3.655  14.548  -53.707 1.00 62.09  ? 145  VAL B CG1   1 
ATOM   5311 C CG2   . VAL B 1 145 ? -5.666  16.012  -53.573 1.00 63.56  ? 145  VAL B CG2   1 
ATOM   5312 N N     . LEU B 1 146 ? -4.156  12.453  -50.839 1.00 61.39  ? 146  LEU B N     1 
ATOM   5313 C CA    . LEU B 1 146 ? -3.219  11.601  -50.152 1.00 60.45  ? 146  LEU B CA    1 
ATOM   5314 C C     . LEU B 1 146 ? -2.431  10.764  -51.162 1.00 59.78  ? 146  LEU B C     1 
ATOM   5315 O O     . LEU B 1 146 ? -3.008  10.163  -52.078 1.00 60.79  ? 146  LEU B O     1 
ATOM   5316 C CB    . LEU B 1 146 ? -3.946  10.714  -49.135 1.00 60.91  ? 146  LEU B CB    1 
ATOM   5317 C CG    . LEU B 1 146 ? -2.968  10.031  -48.155 1.00 61.78  ? 146  LEU B CG    1 
ATOM   5318 C CD1   . LEU B 1 146 ? -3.478  10.065  -46.711 1.00 62.29  ? 146  LEU B CD1   1 
ATOM   5319 C CD2   . LEU B 1 146 ? -2.608  8.603   -48.618 1.00 61.73  ? 146  LEU B CD2   1 
ATOM   5320 N N     . VAL B 1 147 ? -1.108  10.750  -50.994 1.00 58.45  ? 147  VAL B N     1 
ATOM   5321 C CA    . VAL B 1 147 ? -0.209  9.990   -51.850 1.00 57.54  ? 147  VAL B CA    1 
ATOM   5322 C C     . VAL B 1 147 ? 0.615   9.028   -50.996 1.00 56.80  ? 147  VAL B C     1 
ATOM   5323 O O     . VAL B 1 147 ? 1.027   9.382   -49.897 1.00 56.78  ? 147  VAL B O     1 
ATOM   5324 C CB    . VAL B 1 147 ? 0.747   10.934  -52.604 1.00 57.63  ? 147  VAL B CB    1 
ATOM   5325 C CG1   . VAL B 1 147 ? 1.697   10.146  -53.534 1.00 56.31  ? 147  VAL B CG1   1 
ATOM   5326 C CG2   . VAL B 1 147 ? -0.036  11.983  -53.382 1.00 57.06  ? 147  VAL B CG2   1 
ATOM   5327 N N     . SER B 1 148 ? 0.835   7.813   -51.497 1.00 56.64  ? 148  SER B N     1 
ATOM   5328 C CA    . SER B 1 148 ? 1.749   6.844   -50.874 1.00 55.59  ? 148  SER B CA    1 
ATOM   5329 C C     . SER B 1 148 ? 2.540   6.099   -51.951 1.00 55.41  ? 148  SER B C     1 
ATOM   5330 O O     . SER B 1 148 ? 2.009   5.789   -53.013 1.00 55.89  ? 148  SER B O     1 
ATOM   5331 C CB    . SER B 1 148 ? 0.987   5.834   -50.003 1.00 55.83  ? 148  SER B CB    1 
ATOM   5332 O OG    . SER B 1 148 ? 0.066   5.059   -50.748 1.00 55.71  ? 148  SER B OG    1 
ATOM   5333 N N     . MET B 1 149 ? 3.805   5.807   -51.663 1.00 54.70  ? 149  MET B N     1 
ATOM   5334 C CA    . MET B 1 149 ? 4.678   5.157   -52.625 1.00 54.74  ? 149  MET B CA    1 
ATOM   5335 C C     . MET B 1 149 ? 5.279   3.909   -52.042 1.00 54.41  ? 149  MET B C     1 
ATOM   5336 O O     . MET B 1 149 ? 5.468   3.803   -50.824 1.00 53.79  ? 149  MET B O     1 
ATOM   5337 C CB    . MET B 1 149 ? 5.801   6.103   -53.076 1.00 54.73  ? 149  MET B CB    1 
ATOM   5338 C CG    . MET B 1 149 ? 7.076   6.124   -52.197 1.00 55.42  ? 149  MET B CG    1 
ATOM   5339 S SD    . MET B 1 149 ? 6.891   6.917   -50.588 1.00 55.38  ? 149  MET B SD    1 
ATOM   5340 C CE    . MET B 1 149 ? 6.836   8.656   -51.068 1.00 53.85  ? 149  MET B CE    1 
ATOM   5341 N N     . ASN B 1 150 ? 5.584   2.964   -52.925 1.00 54.77  ? 150  ASN B N     1 
ATOM   5342 C CA    . ASN B 1 150 ? 6.454   1.855   -52.573 1.00 54.93  ? 150  ASN B CA    1 
ATOM   5343 C C     . ASN B 1 150 ? 7.893   2.306   -52.736 1.00 54.57  ? 150  ASN B C     1 
ATOM   5344 O O     . ASN B 1 150 ? 8.219   3.016   -53.685 1.00 54.31  ? 150  ASN B O     1 
ATOM   5345 C CB    . ASN B 1 150 ? 6.194   0.642   -53.453 1.00 55.78  ? 150  ASN B CB    1 
ATOM   5346 C CG    . ASN B 1 150 ? 5.011   -0.179  -52.979 1.00 58.11  ? 150  ASN B CG    1 
ATOM   5347 O OD1   . ASN B 1 150 ? 4.364   0.168   -51.989 1.00 58.54  ? 150  ASN B OD1   1 
ATOM   5348 N ND2   . ASN B 1 150 ? 4.721   -1.287  -53.689 1.00 59.09  ? 150  ASN B ND2   1 
ATOM   5349 N N     . TYR B 1 151 ? 8.744   1.910   -51.790 1.00 54.29  ? 151  TYR B N     1 
ATOM   5350 C CA    . TYR B 1 151 ? 10.176  2.101   -51.918 1.00 54.18  ? 151  TYR B CA    1 
ATOM   5351 C C     . TYR B 1 151 ? 10.915  0.793   -51.615 1.00 54.38  ? 151  TYR B C     1 
ATOM   5352 O O     . TYR B 1 151 ? 10.454  -0.040  -50.834 1.00 54.33  ? 151  TYR B O     1 
ATOM   5353 C CB    . TYR B 1 151 ? 10.648  3.254   -51.025 1.00 54.21  ? 151  TYR B CB    1 
ATOM   5354 C CG    . TYR B 1 151 ? 10.495  3.056   -49.531 1.00 53.64  ? 151  TYR B CG    1 
ATOM   5355 C CD1   . TYR B 1 151 ? 9.334   3.433   -48.868 1.00 54.95  ? 151  TYR B CD1   1 
ATOM   5356 C CD2   . TYR B 1 151 ? 11.538  2.526   -48.777 1.00 54.06  ? 151  TYR B CD2   1 
ATOM   5357 C CE1   . TYR B 1 151 ? 9.208   3.266   -47.472 1.00 55.23  ? 151  TYR B CE1   1 
ATOM   5358 C CE2   . TYR B 1 151 ? 11.428  2.344   -47.407 1.00 53.28  ? 151  TYR B CE2   1 
ATOM   5359 C CZ    . TYR B 1 151 ? 10.271  2.710   -46.754 1.00 54.42  ? 151  TYR B CZ    1 
ATOM   5360 O OH    . TYR B 1 151 ? 10.188  2.519   -45.391 1.00 53.78  ? 151  TYR B OH    1 
ATOM   5361 N N     . ARG B 1 152 ? 12.064  0.614   -52.249 1.00 54.42  ? 152  ARG B N     1 
ATOM   5362 C CA    . ARG B 1 152 ? 12.834  -0.599  -52.074 1.00 54.75  ? 152  ARG B CA    1 
ATOM   5363 C C     . ARG B 1 152 ? 13.346  -0.705  -50.634 1.00 54.26  ? 152  ARG B C     1 
ATOM   5364 O O     . ARG B 1 152 ? 13.776  0.284   -50.027 1.00 53.48  ? 152  ARG B O     1 
ATOM   5365 C CB    . ARG B 1 152 ? 13.989  -0.647  -53.067 1.00 55.41  ? 152  ARG B CB    1 
ATOM   5366 C CG    . ARG B 1 152 ? 13.568  -1.009  -54.480 1.00 55.99  ? 152  ARG B CG    1 
ATOM   5367 C CD    . ARG B 1 152 ? 14.754  -0.909  -55.427 1.00 57.03  ? 152  ARG B CD    1 
ATOM   5368 N NE    . ARG B 1 152 ? 15.042  0.483   -55.777 1.00 56.98  ? 152  ARG B NE    1 
ATOM   5369 C CZ    . ARG B 1 152 ? 16.103  0.886   -56.471 1.00 58.15  ? 152  ARG B CZ    1 
ATOM   5370 N NH1   . ARG B 1 152 ? 16.998  0.018   -56.927 1.00 59.60  ? 152  ARG B NH1   1 
ATOM   5371 N NH2   . ARG B 1 152 ? 16.253  2.177   -56.727 1.00 58.62  ? 152  ARG B NH2   1 
ATOM   5372 N N     . VAL B 1 153 ? 13.264  -1.917  -50.097 1.00 54.52  ? 153  VAL B N     1 
ATOM   5373 C CA    . VAL B 1 153 ? 13.623  -2.207  -48.716 1.00 54.31  ? 153  VAL B CA    1 
ATOM   5374 C C     . VAL B 1 153 ? 14.640  -3.335  -48.715 1.00 55.58  ? 153  VAL B C     1 
ATOM   5375 O O     . VAL B 1 153 ? 14.899  -3.953  -49.757 1.00 56.39  ? 153  VAL B O     1 
ATOM   5376 C CB    . VAL B 1 153 ? 12.363  -2.587  -47.872 1.00 54.35  ? 153  VAL B CB    1 
ATOM   5377 C CG1   . VAL B 1 153 ? 11.440  -1.354  -47.684 1.00 52.38  ? 153  VAL B CG1   1 
ATOM   5378 C CG2   . VAL B 1 153 ? 11.593  -3.805  -48.491 1.00 53.63  ? 153  VAL B CG2   1 
ATOM   5379 N N     . GLY B 1 154 ? 15.247  -3.593  -47.559 1.00 56.11  ? 154  GLY B N     1 
ATOM   5380 C CA    . GLY B 1 154 ? 16.237  -4.677  -47.448 1.00 57.05  ? 154  GLY B CA    1 
ATOM   5381 C C     . GLY B 1 154 ? 17.468  -4.399  -48.288 1.00 57.46  ? 154  GLY B C     1 
ATOM   5382 O O     . GLY B 1 154 ? 17.794  -3.239  -48.568 1.00 56.52  ? 154  GLY B O     1 
ATOM   5383 N N     . THR B 1 155 ? 18.151  -5.470  -48.692 1.00 59.03  ? 155  THR B N     1 
ATOM   5384 C CA    . THR B 1 155 ? 19.334  -5.376  -49.565 1.00 59.83  ? 155  THR B CA    1 
ATOM   5385 C C     . THR B 1 155 ? 19.039  -4.568  -50.840 1.00 59.21  ? 155  THR B C     1 
ATOM   5386 O O     . THR B 1 155 ? 19.851  -3.751  -51.276 1.00 59.28  ? 155  THR B O     1 
ATOM   5387 C CB    . THR B 1 155 ? 19.804  -6.771  -49.992 1.00 61.31  ? 155  THR B CB    1 
ATOM   5388 O OG1   . THR B 1 155 ? 18.690  -7.470  -50.537 1.00 62.01  ? 155  THR B OG1   1 
ATOM   5389 C CG2   . THR B 1 155 ? 20.376  -7.566  -48.810 1.00 61.74  ? 155  THR B CG2   1 
ATOM   5390 N N     . PHE B 1 156 ? 17.853  -4.777  -51.404 1.00 58.40  ? 156  PHE B N     1 
ATOM   5391 C CA    . PHE B 1 156 ? 17.467  -4.140  -52.662 1.00 58.03  ? 156  PHE B CA    1 
ATOM   5392 C C     . PHE B 1 156 ? 17.419  -2.622  -52.560 1.00 57.09  ? 156  PHE B C     1 
ATOM   5393 O O     . PHE B 1 156 ? 17.651  -1.926  -53.553 1.00 57.16  ? 156  PHE B O     1 
ATOM   5394 C CB    . PHE B 1 156 ? 16.120  -4.685  -53.153 1.00 57.85  ? 156  PHE B CB    1 
ATOM   5395 C CG    . PHE B 1 156 ? 16.052  -6.179  -53.134 1.00 58.78  ? 156  PHE B CG    1 
ATOM   5396 C CD1   . PHE B 1 156 ? 16.675  -6.921  -54.121 1.00 60.28  ? 156  PHE B CD1   1 
ATOM   5397 C CD2   . PHE B 1 156 ? 15.426  -6.844  -52.092 1.00 58.93  ? 156  PHE B CD2   1 
ATOM   5398 C CE1   . PHE B 1 156 ? 16.654  -8.312  -54.086 1.00 61.99  ? 156  PHE B CE1   1 
ATOM   5399 C CE2   . PHE B 1 156 ? 15.411  -8.232  -52.045 1.00 61.14  ? 156  PHE B CE2   1 
ATOM   5400 C CZ    . PHE B 1 156 ? 16.026  -8.968  -53.048 1.00 61.34  ? 156  PHE B CZ    1 
ATOM   5401 N N     . GLY B 1 157 ? 17.116  -2.119  -51.367 1.00 56.15  ? 157  GLY B N     1 
ATOM   5402 C CA    . GLY B 1 157 ? 16.990  -0.683  -51.135 1.00 55.35  ? 157  GLY B CA    1 
ATOM   5403 C C     . GLY B 1 157 ? 18.211  -0.061  -50.471 1.00 55.59  ? 157  GLY B C     1 
ATOM   5404 O O     . GLY B 1 157 ? 18.455  1.121   -50.636 1.00 55.40  ? 157  GLY B O     1 
ATOM   5405 N N     . PHE B 1 158 ? 18.977  -0.846  -49.718 1.00 56.49  ? 158  PHE B N     1 
ATOM   5406 C CA    . PHE B 1 158 ? 19.973  -0.279  -48.804 1.00 57.02  ? 158  PHE B CA    1 
ATOM   5407 C C     . PHE B 1 158 ? 21.329  -0.970  -48.727 1.00 58.91  ? 158  PHE B C     1 
ATOM   5408 O O     . PHE B 1 158 ? 22.239  -0.456  -48.058 1.00 59.85  ? 158  PHE B O     1 
ATOM   5409 C CB    . PHE B 1 158 ? 19.339  -0.127  -47.414 1.00 56.06  ? 158  PHE B CB    1 
ATOM   5410 C CG    . PHE B 1 158 ? 18.187  0.844   -47.416 1.00 53.96  ? 158  PHE B CG    1 
ATOM   5411 C CD1   . PHE B 1 158 ? 18.425  2.208   -47.430 1.00 52.36  ? 158  PHE B CD1   1 
ATOM   5412 C CD2   . PHE B 1 158 ? 16.890  0.393   -47.505 1.00 52.86  ? 158  PHE B CD2   1 
ATOM   5413 C CE1   . PHE B 1 158 ? 17.371  3.115   -47.498 1.00 53.43  ? 158  PHE B CE1   1 
ATOM   5414 C CE2   . PHE B 1 158 ? 15.832  1.288   -47.569 1.00 52.86  ? 158  PHE B CE2   1 
ATOM   5415 C CZ    . PHE B 1 158 ? 16.076  2.654   -47.569 1.00 52.52  ? 158  PHE B CZ    1 
ATOM   5416 N N     . LEU B 1 159 ? 21.497  -2.092  -49.425 1.00 60.07  ? 159  LEU B N     1 
ATOM   5417 C CA    . LEU B 1 159 ? 22.825  -2.706  -49.551 1.00 61.88  ? 159  LEU B CA    1 
ATOM   5418 C C     . LEU B 1 159 ? 23.763  -1.705  -50.220 1.00 63.12  ? 159  LEU B C     1 
ATOM   5419 O O     . LEU B 1 159 ? 23.495  -1.228  -51.323 1.00 63.44  ? 159  LEU B O     1 
ATOM   5420 C CB    . LEU B 1 159 ? 22.768  -4.011  -50.345 1.00 62.26  ? 159  LEU B CB    1 
ATOM   5421 C CG    . LEU B 1 159 ? 24.103  -4.757  -50.493 1.00 63.98  ? 159  LEU B CG    1 
ATOM   5422 C CD1   . LEU B 1 159 ? 23.952  -6.262  -50.248 1.00 63.31  ? 159  LEU B CD1   1 
ATOM   5423 C CD2   . LEU B 1 159 ? 24.740  -4.483  -51.856 1.00 62.99  ? 159  LEU B CD2   1 
ATOM   5424 N N     . ALA B 1 160 ? 24.847  -1.359  -49.531 1.00 64.59  ? 160  ALA B N     1 
ATOM   5425 C CA    . ALA B 1 160 ? 25.787  -0.370  -50.040 1.00 65.52  ? 160  ALA B CA    1 
ATOM   5426 C C     . ALA B 1 160 ? 27.187  -0.906  -49.986 1.00 67.56  ? 160  ALA B C     1 
ATOM   5427 O O     . ALA B 1 160 ? 27.567  -1.625  -49.058 1.00 68.49  ? 160  ALA B O     1 
ATOM   5428 C CB    . ALA B 1 160 ? 25.701  0.929   -49.248 1.00 64.80  ? 160  ALA B CB    1 
ATOM   5429 N N     . LEU B 1 161 ? 27.939  -0.562  -51.019 1.00 69.09  ? 161  LEU B N     1 
ATOM   5430 C CA    . LEU B 1 161 ? 29.388  -0.670  -51.023 1.00 71.19  ? 161  LEU B CA    1 
ATOM   5431 C C     . LEU B 1 161 ? 29.828  0.763   -51.251 1.00 71.49  ? 161  LEU B C     1 
ATOM   5432 O O     . LEU B 1 161 ? 30.013  1.181   -52.388 1.00 71.92  ? 161  LEU B O     1 
ATOM   5433 C CB    . LEU B 1 161 ? 29.844  -1.607  -52.132 1.00 72.53  ? 161  LEU B CB    1 
ATOM   5434 C CG    . LEU B 1 161 ? 29.603  -3.068  -51.751 1.00 73.07  ? 161  LEU B CG    1 
ATOM   5435 C CD1   . LEU B 1 161 ? 29.557  -3.946  -52.963 1.00 75.68  ? 161  LEU B CD1   1 
ATOM   5436 C CD2   . LEU B 1 161 ? 30.674  -3.560  -50.783 1.00 74.87  ? 161  LEU B CD2   1 
ATOM   5437 N N     . PRO B 1 162 ? 29.911  1.545   -50.161 1.00 71.44  ? 162  PRO B N     1 
ATOM   5438 C CA    . PRO B 1 162 ? 30.060  2.995   -50.261 1.00 71.67  ? 162  PRO B CA    1 
ATOM   5439 C C     . PRO B 1 162 ? 31.245  3.434   -51.107 1.00 73.95  ? 162  PRO B C     1 
ATOM   5440 O O     . PRO B 1 162 ? 32.347  2.911   -50.942 1.00 75.34  ? 162  PRO B O     1 
ATOM   5441 C CB    . PRO B 1 162 ? 30.245  3.428   -48.805 1.00 71.35  ? 162  PRO B CB    1 
ATOM   5442 C CG    . PRO B 1 162 ? 29.606  2.363   -48.015 1.00 70.19  ? 162  PRO B CG    1 
ATOM   5443 C CD    . PRO B 1 162 ? 29.838  1.103   -48.756 1.00 70.77  ? 162  PRO B CD    1 
ATOM   5444 N N     . GLY B 1 163 ? 30.998  4.385   -52.006 1.00 74.53  ? 163  GLY B N     1 
ATOM   5445 C CA    . GLY B 1 163 ? 32.015  4.899   -52.917 1.00 76.95  ? 163  GLY B CA    1 
ATOM   5446 C C     . GLY B 1 163 ? 32.054  4.175   -54.247 1.00 78.42  ? 163  GLY B C     1 
ATOM   5447 O O     . GLY B 1 163 ? 32.804  4.567   -55.144 1.00 79.73  ? 163  GLY B O     1 
ATOM   5448 N N     . SER B 1 164 ? 31.264  3.108   -54.367 1.00 78.39  ? 164  SER B N     1 
ATOM   5449 C CA    . SER B 1 164 ? 31.114  2.383   -55.625 1.00 79.66  ? 164  SER B CA    1 
ATOM   5450 C C     . SER B 1 164 ? 30.076  3.084   -56.489 1.00 79.52  ? 164  SER B C     1 
ATOM   5451 O O     . SER B 1 164 ? 29.203  3.789   -55.976 1.00 78.54  ? 164  SER B O     1 
ATOM   5452 C CB    . SER B 1 164 ? 30.678  0.934   -55.370 1.00 79.22  ? 164  SER B CB    1 
ATOM   5453 O OG    . SER B 1 164 ? 29.346  0.858   -54.868 1.00 77.22  ? 164  SER B OG    1 
ATOM   5454 N N     . ARG B 1 165 ? 30.164  2.871   -57.795 1.00 81.36  ? 165  ARG B N     1 
ATOM   5455 C CA    . ARG B 1 165 ? 29.209  3.437   -58.740 1.00 81.89  ? 165  ARG B CA    1 
ATOM   5456 C C     . ARG B 1 165 ? 27.956  2.568   -58.795 1.00 79.40  ? 165  ARG B C     1 
ATOM   5457 O O     . ARG B 1 165 ? 26.871  3.070   -59.074 1.00 78.35  ? 165  ARG B O     1 
ATOM   5458 C CB    . ARG B 1 165 ? 29.828  3.557   -60.145 1.00 83.74  ? 165  ARG B CB    1 
ATOM   5459 C CG    . ARG B 1 165 ? 31.203  4.271   -60.183 1.00 88.23  ? 165  ARG B CG    1 
ATOM   5460 C CD    . ARG B 1 165 ? 31.762  4.403   -61.618 1.00 91.71  ? 165  ARG B CD    1 
ATOM   5461 N NE    . ARG B 1 165 ? 30.947  5.303   -62.450 1.00 94.83  ? 165  ARG B NE    1 
ATOM   5462 C CZ    . ARG B 1 165 ? 30.924  5.303   -63.788 1.00 97.25  ? 165  ARG B CZ    1 
ATOM   5463 N NH1   . ARG B 1 165 ? 31.666  4.446   -64.500 1.00 99.70  ? 165  ARG B NH1   1 
ATOM   5464 N NH2   . ARG B 1 165 ? 30.141  6.170   -64.430 1.00 96.87  ? 165  ARG B NH2   1 
ATOM   5465 N N     . GLU B 1 166 ? 28.101  1.280   -58.483 1.00 78.88  ? 166  GLU B N     1 
ATOM   5466 C CA    . GLU B 1 166 ? 27.036  0.297   -58.749 1.00 77.61  ? 166  GLU B CA    1 
ATOM   5467 C C     . GLU B 1 166 ? 26.182  -0.103  -57.532 1.00 74.81  ? 166  GLU B C     1 
ATOM   5468 O O     . GLU B 1 166 ? 25.112  -0.684  -57.699 1.00 74.10  ? 166  GLU B O     1 
ATOM   5469 C CB    . GLU B 1 166 ? 27.597  -0.942  -59.475 1.00 79.62  ? 166  GLU B CB    1 
ATOM   5470 C CG    . GLU B 1 166 ? 28.960  -1.416  -58.987 1.00 83.86  ? 166  GLU B CG    1 
ATOM   5471 C CD    . GLU B 1 166 ? 30.136  -0.717  -59.645 1.00 87.56  ? 166  GLU B CD    1 
ATOM   5472 O OE1   . GLU B 1 166 ? 30.264  -0.809  -60.884 1.00 90.91  ? 166  GLU B OE1   1 
ATOM   5473 O OE2   . GLU B 1 166 ? 30.946  -0.102  -58.911 1.00 89.82  ? 166  GLU B OE2   1 
ATOM   5474 N N     . ALA B 1 167 ? 26.644  0.207   -56.326 1.00 73.12  ? 167  ALA B N     1 
ATOM   5475 C CA    . ALA B 1 167 ? 25.863  0.007   -55.105 1.00 70.71  ? 167  ALA B CA    1 
ATOM   5476 C C     . ALA B 1 167 ? 26.211  1.134   -54.142 1.00 69.70  ? 167  ALA B C     1 
ATOM   5477 O O     . ALA B 1 167 ? 26.877  0.904   -53.134 1.00 69.87  ? 167  ALA B O     1 
ATOM   5478 C CB    . ALA B 1 167 ? 26.169  -1.334  -54.488 1.00 71.06  ? 167  ALA B CB    1 
ATOM   5479 N N     . PRO B 1 168 ? 25.789  2.370   -54.475 1.00 68.38  ? 168  PRO B N     1 
ATOM   5480 C CA    . PRO B 1 168 ? 26.234  3.560   -53.754 1.00 67.98  ? 168  PRO B CA    1 
ATOM   5481 C C     . PRO B 1 168 ? 25.535  3.755   -52.422 1.00 66.44  ? 168  PRO B C     1 
ATOM   5482 O O     . PRO B 1 168 ? 26.007  4.538   -51.601 1.00 66.73  ? 168  PRO B O     1 
ATOM   5483 C CB    . PRO B 1 168 ? 25.879  4.702   -54.710 1.00 67.75  ? 168  PRO B CB    1 
ATOM   5484 C CG    . PRO B 1 168 ? 24.669  4.214   -55.419 1.00 67.21  ? 168  PRO B CG    1 
ATOM   5485 C CD    . PRO B 1 168 ? 24.866  2.716   -55.573 1.00 67.89  ? 168  PRO B CD    1 
ATOM   5486 N N     . GLY B 1 169 ? 24.424  3.048   -52.215 1.00 65.07  ? 169  GLY B N     1 
ATOM   5487 C CA    . GLY B 1 169 ? 23.647  3.150   -50.977 1.00 63.48  ? 169  GLY B CA    1 
ATOM   5488 C C     . GLY B 1 169 ? 22.503  4.150   -51.056 1.00 61.72  ? 169  GLY B C     1 
ATOM   5489 O O     . GLY B 1 169 ? 22.467  5.010   -51.948 1.00 62.27  ? 169  GLY B O     1 
ATOM   5490 N N     . ASN B 1 170 ? 21.568  4.010   -50.120 1.00 59.78  ? 170  ASN B N     1 
ATOM   5491 C CA    . ASN B 1 170 ? 20.415  4.904   -49.959 1.00 58.06  ? 170  ASN B CA    1 
ATOM   5492 C C     . ASN B 1 170 ? 19.414  4.961   -51.121 1.00 57.25  ? 170  ASN B C     1 
ATOM   5493 O O     . ASN B 1 170 ? 18.624  5.896   -51.212 1.00 56.90  ? 170  ASN B O     1 
ATOM   5494 C CB    . ASN B 1 170 ? 20.890  6.330   -49.613 1.00 58.35  ? 170  ASN B CB    1 
ATOM   5495 C CG    . ASN B 1 170 ? 21.693  6.390   -48.320 1.00 57.81  ? 170  ASN B CG    1 
ATOM   5496 O OD1   . ASN B 1 170 ? 21.339  5.762   -47.327 1.00 58.23  ? 170  ASN B OD1   1 
ATOM   5497 N ND2   . ASN B 1 170 ? 22.783  7.150   -48.333 1.00 57.79  ? 170  ASN B ND2   1 
ATOM   5498 N N     . VAL B 1 171 ? 19.410  3.955   -51.986 1.00 57.60  ? 171  VAL B N     1 
ATOM   5499 C CA    . VAL B 1 171 ? 18.590  3.998   -53.214 1.00 56.81  ? 171  VAL B CA    1 
ATOM   5500 C C     . VAL B 1 171 ? 17.101  3.920   -52.861 1.00 55.91  ? 171  VAL B C     1 
ATOM   5501 O O     . VAL B 1 171 ? 16.263  4.582   -53.495 1.00 55.13  ? 171  VAL B O     1 
ATOM   5502 C CB    . VAL B 1 171 ? 19.037  2.935   -54.276 1.00 57.91  ? 171  VAL B CB    1 
ATOM   5503 C CG1   . VAL B 1 171 ? 20.521  3.118   -54.612 1.00 57.86  ? 171  VAL B CG1   1 
ATOM   5504 C CG2   . VAL B 1 171 ? 18.755  1.483   -53.824 1.00 56.57  ? 171  VAL B CG2   1 
ATOM   5505 N N     . GLY B 1 172 ? 16.781  3.166   -51.808 1.00 55.27  ? 172  GLY B N     1 
ATOM   5506 C CA    . GLY B 1 172 ? 15.439  3.203   -51.245 1.00 54.23  ? 172  GLY B CA    1 
ATOM   5507 C C     . GLY B 1 172 ? 14.986  4.612   -50.884 1.00 53.53  ? 172  GLY B C     1 
ATOM   5508 O O     . GLY B 1 172 ? 13.819  4.951   -51.033 1.00 52.84  ? 172  GLY B O     1 
ATOM   5509 N N     . LEU B 1 173 ? 15.904  5.437   -50.390 1.00 54.07  ? 173  LEU B N     1 
ATOM   5510 C CA    . LEU B 1 173 ? 15.574  6.832   -50.050 1.00 53.62  ? 173  LEU B CA    1 
ATOM   5511 C C     . LEU B 1 173 ? 15.414  7.654   -51.329 1.00 53.86  ? 173  LEU B C     1 
ATOM   5512 O O     . LEU B 1 173 ? 14.564  8.532   -51.386 1.00 54.23  ? 173  LEU B O     1 
ATOM   5513 C CB    . LEU B 1 173 ? 16.652  7.456   -49.144 1.00 53.97  ? 173  LEU B CB    1 
ATOM   5514 C CG    . LEU B 1 173 ? 16.749  6.988   -47.670 1.00 53.02  ? 173  LEU B CG    1 
ATOM   5515 C CD1   . LEU B 1 173 ? 17.985  7.566   -47.005 1.00 51.35  ? 173  LEU B CD1   1 
ATOM   5516 C CD2   . LEU B 1 173 ? 15.509  7.324   -46.880 1.00 51.22  ? 173  LEU B CD2   1 
ATOM   5517 N N     . LEU B 1 174 ? 16.227  7.353   -52.345 1.00 53.94  ? 174  LEU B N     1 
ATOM   5518 C CA    . LEU B 1 174 ? 16.096  7.970   -53.659 1.00 54.16  ? 174  LEU B CA    1 
ATOM   5519 C C     . LEU B 1 174 ? 14.790  7.595   -54.366 1.00 53.95  ? 174  LEU B C     1 
ATOM   5520 O O     . LEU B 1 174 ? 14.248  8.401   -55.127 1.00 54.69  ? 174  LEU B O     1 
ATOM   5521 C CB    . LEU B 1 174 ? 17.300  7.633   -54.531 1.00 54.92  ? 174  LEU B CB    1 
ATOM   5522 C CG    . LEU B 1 174 ? 18.631  8.227   -54.023 1.00 55.54  ? 174  LEU B CG    1 
ATOM   5523 C CD1   . LEU B 1 174 ? 19.776  7.867   -54.934 1.00 53.53  ? 174  LEU B CD1   1 
ATOM   5524 C CD2   . LEU B 1 174 ? 18.543  9.742   -53.865 1.00 54.44  ? 174  LEU B CD2   1 
ATOM   5525 N N     . ASP B 1 175 ? 14.278  6.394   -54.103 1.00 53.15  ? 175  ASP B N     1 
ATOM   5526 C CA    . ASP B 1 175 ? 12.961  5.991   -54.604 1.00 52.79  ? 175  ASP B CA    1 
ATOM   5527 C C     . ASP B 1 175 ? 11.900  6.929   -54.050 1.00 52.34  ? 175  ASP B C     1 
ATOM   5528 O O     . ASP B 1 175 ? 11.025  7.403   -54.784 1.00 52.23  ? 175  ASP B O     1 
ATOM   5529 C CB    . ASP B 1 175 ? 12.603  4.545   -54.189 1.00 52.30  ? 175  ASP B CB    1 
ATOM   5530 C CG    . ASP B 1 175 ? 13.501  3.496   -54.822 1.00 53.08  ? 175  ASP B CG    1 
ATOM   5531 O OD1   . ASP B 1 175 ? 14.232  3.798   -55.788 1.00 54.56  ? 175  ASP B OD1   1 
ATOM   5532 O OD2   . ASP B 1 175 ? 13.475  2.342   -54.353 1.00 53.44  ? 175  ASP B OD2   1 
ATOM   5533 N N     . GLN B 1 176 ? 11.984  7.191   -52.749 1.00 51.96  ? 176  GLN B N     1 
ATOM   5534 C CA    . GLN B 1 176 ? 11.060  8.104   -52.095 1.00 51.92  ? 176  GLN B CA    1 
ATOM   5535 C C     . GLN B 1 176 ? 11.188  9.499   -52.672 1.00 52.88  ? 176  GLN B C     1 
ATOM   5536 O O     . GLN B 1 176 ? 10.185  10.124  -53.011 1.00 53.14  ? 176  GLN B O     1 
ATOM   5537 C CB    . GLN B 1 176 ? 11.277  8.134   -50.590 1.00 51.15  ? 176  GLN B CB    1 
ATOM   5538 C CG    . GLN B 1 176 ? 11.112  6.770   -49.875 1.00 51.29  ? 176  GLN B CG    1 
ATOM   5539 C CD    . GLN B 1 176 ? 11.621  6.815   -48.437 1.00 51.06  ? 176  GLN B CD    1 
ATOM   5540 O OE1   . GLN B 1 176 ? 11.925  7.889   -47.924 1.00 50.68  ? 176  GLN B OE1   1 
ATOM   5541 N NE2   . GLN B 1 176 ? 11.717  5.649   -47.787 1.00 49.56  ? 176  GLN B NE2   1 
ATOM   5542 N N     . ARG B 1 177 ? 12.417  9.984   -52.808 1.00 53.84  ? 177  ARG B N     1 
ATOM   5543 C CA    . ARG B 1 177 ? 12.642  11.309  -53.387 1.00 54.99  ? 177  ARG B CA    1 
ATOM   5544 C C     . ARG B 1 177 ? 12.075  11.425  -54.819 1.00 55.41  ? 177  ARG B C     1 
ATOM   5545 O O     . ARG B 1 177 ? 11.546  12.473  -55.210 1.00 55.04  ? 177  ARG B O     1 
ATOM   5546 C CB    . ARG B 1 177 ? 14.135  11.632  -53.377 1.00 55.28  ? 177  ARG B CB    1 
ATOM   5547 C CG    . ARG B 1 177 ? 14.472  12.997  -53.945 1.00 57.19  ? 177  ARG B CG    1 
ATOM   5548 C CD    . ARG B 1 177 ? 15.953  13.224  -53.953 1.00 59.00  ? 177  ARG B CD    1 
ATOM   5549 N NE    . ARG B 1 177 ? 16.422  13.603  -52.626 1.00 61.61  ? 177  ARG B NE    1 
ATOM   5550 C CZ    . ARG B 1 177 ? 17.697  13.604  -52.256 1.00 62.83  ? 177  ARG B CZ    1 
ATOM   5551 N NH1   . ARG B 1 177 ? 18.650  13.240  -53.111 1.00 64.50  ? 177  ARG B NH1   1 
ATOM   5552 N NH2   . ARG B 1 177 ? 18.023  13.972  -51.024 1.00 62.70  ? 177  ARG B NH2   1 
ATOM   5553 N N     . LEU B 1 178 ? 12.208  10.353  -55.602 1.00 55.67  ? 178  LEU B N     1 
ATOM   5554 C CA    . LEU B 1 178 ? 11.654  10.339  -56.958 1.00 56.37  ? 178  LEU B CA    1 
ATOM   5555 C C     . LEU B 1 178 ? 10.123  10.454  -56.926 1.00 55.81  ? 178  LEU B C     1 
ATOM   5556 O O     . LEU B 1 178 ? 9.550   11.213  -57.689 1.00 56.01  ? 178  LEU B O     1 
ATOM   5557 C CB    . LEU B 1 178 ? 12.112  9.094   -57.735 1.00 56.45  ? 178  LEU B CB    1 
ATOM   5558 C CG    . LEU B 1 178 ? 11.787  9.023   -59.235 1.00 57.89  ? 178  LEU B CG    1 
ATOM   5559 C CD1   . LEU B 1 178 ? 12.259  10.275  -59.983 1.00 58.14  ? 178  LEU B CD1   1 
ATOM   5560 C CD2   . LEU B 1 178 ? 12.420  7.759   -59.845 1.00 58.12  ? 178  LEU B CD2   1 
ATOM   5561 N N     . ALA B 1 179 ? 9.468   9.703   -56.040 1.00 55.37  ? 179  ALA B N     1 
ATOM   5562 C CA    . ALA B 1 179 ? 8.014   9.846   -55.840 1.00 55.30  ? 179  ALA B CA    1 
ATOM   5563 C C     . ALA B 1 179 ? 7.636   11.269  -55.402 1.00 55.43  ? 179  ALA B C     1 
ATOM   5564 O O     . ALA B 1 179 ? 6.572   11.762  -55.762 1.00 56.18  ? 179  ALA B O     1 
ATOM   5565 C CB    . ALA B 1 179 ? 7.478   8.804   -54.837 1.00 53.64  ? 179  ALA B CB    1 
ATOM   5566 N N     . LEU B 1 180 ? 8.507   11.923  -54.635 1.00 55.46  ? 180  LEU B N     1 
ATOM   5567 C CA    . LEU B 1 180 ? 8.280   13.305  -54.193 1.00 55.79  ? 180  LEU B CA    1 
ATOM   5568 C C     . LEU B 1 180 ? 8.359   14.265  -55.388 1.00 57.24  ? 180  LEU B C     1 
ATOM   5569 O O     . LEU B 1 180 ? 7.557   15.189  -55.513 1.00 57.49  ? 180  LEU B O     1 
ATOM   5570 C CB    . LEU B 1 180 ? 9.297   13.707  -53.118 1.00 55.50  ? 180  LEU B CB    1 
ATOM   5571 C CG    . LEU B 1 180 ? 8.965   13.506  -51.630 1.00 55.40  ? 180  LEU B CG    1 
ATOM   5572 C CD1   . LEU B 1 180 ? 8.370   12.148  -51.357 1.00 55.95  ? 180  LEU B CD1   1 
ATOM   5573 C CD2   . LEU B 1 180 ? 10.200  13.741  -50.760 1.00 54.40  ? 180  LEU B CD2   1 
ATOM   5574 N N     . GLN B 1 181 ? 9.350   14.040  -56.254 1.00 57.85  ? 181  GLN B N     1 
ATOM   5575 C CA    . GLN B 1 181 ? 9.511   14.806  -57.498 1.00 58.74  ? 181  GLN B CA    1 
ATOM   5576 C C     . GLN B 1 181 ? 8.289   14.598  -58.399 1.00 58.77  ? 181  GLN B C     1 
ATOM   5577 O O     . GLN B 1 181 ? 7.763   15.552  -58.969 1.00 59.39  ? 181  GLN B O     1 
ATOM   5578 C CB    A GLN B 1 181 ? 10.824  14.430  -58.206 0.50 59.13  ? 181  GLN B CB    1 
ATOM   5579 C CB    B GLN B 1 181 ? 10.789  14.364  -58.225 0.50 59.18  ? 181  GLN B CB    1 
ATOM   5580 C CG    A GLN B 1 181 ? 12.055  15.154  -57.611 0.50 59.80  ? 181  GLN B CG    1 
ATOM   5581 C CG    B GLN B 1 181 ? 11.126  15.142  -59.490 0.50 61.08  ? 181  GLN B CG    1 
ATOM   5582 C CD    A GLN B 1 181 ? 13.395  14.449  -57.848 0.50 60.12  ? 181  GLN B CD    1 
ATOM   5583 C CD    B GLN B 1 181 ? 11.303  16.628  -59.233 0.50 62.83  ? 181  GLN B CD    1 
ATOM   5584 O OE1   A GLN B 1 181 ? 13.456  13.339  -58.381 0.50 60.79  ? 181  GLN B OE1   1 
ATOM   5585 O OE1   B GLN B 1 181 ? 10.493  17.445  -59.674 0.50 63.92  ? 181  GLN B OE1   1 
ATOM   5586 N NE2   A GLN B 1 181 ? 14.477  15.102  -57.436 0.50 60.09  ? 181  GLN B NE2   1 
ATOM   5587 N NE2   B GLN B 1 181 ? 12.357  16.983  -58.501 0.50 63.12  ? 181  GLN B NE2   1 
ATOM   5588 N N     . TRP B 1 182 ? 7.825   13.356  -58.484 1.00 57.90  ? 182  TRP B N     1 
ATOM   5589 C CA    . TRP B 1 182 ? 6.656   13.008  -59.273 1.00 58.26  ? 182  TRP B CA    1 
ATOM   5590 C C     . TRP B 1 182 ? 5.434   13.820  -58.825 1.00 58.66  ? 182  TRP B C     1 
ATOM   5591 O O     . TRP B 1 182 ? 4.667   14.313  -59.651 1.00 60.05  ? 182  TRP B O     1 
ATOM   5592 C CB    . TRP B 1 182 ? 6.369   11.508  -59.157 1.00 57.51  ? 182  TRP B CB    1 
ATOM   5593 C CG    . TRP B 1 182 ? 5.291   11.043  -60.079 1.00 58.17  ? 182  TRP B CG    1 
ATOM   5594 C CD1   . TRP B 1 182 ? 5.455   10.497  -61.314 1.00 58.35  ? 182  TRP B CD1   1 
ATOM   5595 C CD2   . TRP B 1 182 ? 3.871   11.110  -59.851 1.00 58.71  ? 182  TRP B CD2   1 
ATOM   5596 N NE1   . TRP B 1 182 ? 4.234   10.217  -61.871 1.00 59.50  ? 182  TRP B NE1   1 
ATOM   5597 C CE2   . TRP B 1 182 ? 3.243   10.581  -60.999 1.00 58.92  ? 182  TRP B CE2   1 
ATOM   5598 C CE3   . TRP B 1 182 ? 3.076   11.564  -58.790 1.00 56.88  ? 182  TRP B CE3   1 
ATOM   5599 C CZ2   . TRP B 1 182 ? 1.854   10.482  -61.120 1.00 59.59  ? 182  TRP B CZ2   1 
ATOM   5600 C CZ3   . TRP B 1 182 ? 1.696   11.467  -58.906 1.00 58.41  ? 182  TRP B CZ3   1 
ATOM   5601 C CH2   . TRP B 1 182 ? 1.095   10.934  -60.067 1.00 59.24  ? 182  TRP B CH2   1 
ATOM   5602 N N     . VAL B 1 183 ? 5.262   13.949  -57.516 1.00 58.00  ? 183  VAL B N     1 
ATOM   5603 C CA    . VAL B 1 183 ? 4.197   14.761  -56.949 1.00 58.43  ? 183  VAL B CA    1 
ATOM   5604 C C     . VAL B 1 183 ? 4.334   16.256  -57.329 1.00 60.05  ? 183  VAL B C     1 
ATOM   5605 O O     . VAL B 1 183 ? 3.355   16.901  -57.712 1.00 60.84  ? 183  VAL B O     1 
ATOM   5606 C CB    . VAL B 1 183 ? 4.115   14.549  -55.399 1.00 57.61  ? 183  VAL B CB    1 
ATOM   5607 C CG1   . VAL B 1 183 ? 3.325   15.662  -54.710 1.00 56.07  ? 183  VAL B CG1   1 
ATOM   5608 C CG2   . VAL B 1 183 ? 3.518   13.167  -55.101 1.00 56.49  ? 183  VAL B CG2   1 
ATOM   5609 N N     . GLN B 1 184 ? 5.534   16.811  -57.235 1.00 60.66  ? 184  GLN B N     1 
ATOM   5610 C CA    . GLN B 1 184 ? 5.741   18.193  -57.682 1.00 62.48  ? 184  GLN B CA    1 
ATOM   5611 C C     . GLN B 1 184 ? 5.304   18.395  -59.132 1.00 64.22  ? 184  GLN B C     1 
ATOM   5612 O O     . GLN B 1 184 ? 4.645   19.386  -59.457 1.00 65.63  ? 184  GLN B O     1 
ATOM   5613 C CB    . GLN B 1 184 ? 7.209   18.605  -57.532 1.00 62.47  ? 184  GLN B CB    1 
ATOM   5614 C CG    . GLN B 1 184 ? 7.593   18.885  -56.119 1.00 62.72  ? 184  GLN B CG    1 
ATOM   5615 C CD    . GLN B 1 184 ? 6.735   19.987  -55.521 1.00 63.95  ? 184  GLN B CD    1 
ATOM   5616 O OE1   . GLN B 1 184 ? 6.786   21.118  -55.980 1.00 64.74  ? 184  GLN B OE1   1 
ATOM   5617 N NE2   . GLN B 1 184 ? 5.926   19.649  -54.512 1.00 62.22  ? 184  GLN B NE2   1 
ATOM   5618 N N     . GLU B 1 185 ? 5.664   17.447  -59.989 1.00 64.20  ? 185  GLU B N     1 
ATOM   5619 C CA    . GLU B 1 185 ? 5.451   17.573  -61.421 1.00 66.22  ? 185  GLU B CA    1 
ATOM   5620 C C     . GLU B 1 185 ? 4.031   17.245  -61.861 1.00 65.75  ? 185  GLU B C     1 
ATOM   5621 O O     . GLU B 1 185 ? 3.611   17.691  -62.932 1.00 67.06  ? 185  GLU B O     1 
ATOM   5622 C CB    . GLU B 1 185 ? 6.432   16.646  -62.172 1.00 66.05  ? 185  GLU B CB    1 
ATOM   5623 C CG    . GLU B 1 185 ? 7.884   17.123  -62.087 1.00 68.57  ? 185  GLU B CG    1 
ATOM   5624 C CD    . GLU B 1 185 ? 8.910   16.080  -62.506 1.00 69.59  ? 185  GLU B CD    1 
ATOM   5625 O OE1   . GLU B 1 185 ? 8.500   14.970  -62.928 1.00 74.53  ? 185  GLU B OE1   1 
ATOM   5626 O OE2   . GLU B 1 185 ? 10.133  16.375  -62.397 1.00 74.39  ? 185  GLU B OE2   1 
ATOM   5627 N N     . ASN B 1 186 ? 3.306   16.453  -61.064 1.00 64.19  ? 186  ASN B N     1 
ATOM   5628 C CA    . ASN B 1 186 ? 2.061   15.825  -61.531 1.00 64.11  ? 186  ASN B CA    1 
ATOM   5629 C C     . ASN B 1 186 ? 0.805   16.001  -60.680 1.00 63.13  ? 186  ASN B C     1 
ATOM   5630 O O     . ASN B 1 186 ? -0.290  15.782  -61.169 1.00 63.42  ? 186  ASN B O     1 
ATOM   5631 C CB    . ASN B 1 186 ? 2.300   14.325  -61.734 1.00 63.55  ? 186  ASN B CB    1 
ATOM   5632 C CG    . ASN B 1 186 ? 3.194   14.039  -62.921 1.00 64.84  ? 186  ASN B CG    1 
ATOM   5633 O OD1   . ASN B 1 186 ? 2.845   14.373  -64.050 1.00 66.58  ? 186  ASN B OD1   1 
ATOM   5634 N ND2   . ASN B 1 186 ? 4.356   13.434  -62.673 1.00 63.59  ? 186  ASN B ND2   1 
ATOM   5635 N N     . ILE B 1 187 ? 0.953   16.381  -59.420 1.00 61.97  ? 187  ILE B N     1 
ATOM   5636 C CA    . ILE B 1 187 ? -0.163  16.306  -58.484 1.00 61.48  ? 187  ILE B CA    1 
ATOM   5637 C C     . ILE B 1 187 ? -1.242  17.364  -58.767 1.00 63.17  ? 187  ILE B C     1 
ATOM   5638 O O     . ILE B 1 187 ? -2.416  17.139  -58.463 1.00 63.78  ? 187  ILE B O     1 
ATOM   5639 C CB    . ILE B 1 187 ? 0.325   16.353  -57.010 1.00 60.24  ? 187  ILE B CB    1 
ATOM   5640 C CG1   . ILE B 1 187 ? -0.652  15.589  -56.101 1.00 59.60  ? 187  ILE B CG1   1 
ATOM   5641 C CG2   . ILE B 1 187 ? 0.564   17.803  -56.542 1.00 59.87  ? 187  ILE B CG2   1 
ATOM   5642 C CD1   . ILE B 1 187 ? -0.762  14.077  -56.417 1.00 57.78  ? 187  ILE B CD1   1 
ATOM   5643 N N     . ALA B 1 188 ? -0.857  18.489  -59.375 1.00 63.87  ? 188  ALA B N     1 
ATOM   5644 C CA    . ALA B 1 188 ? -1.836  19.493  -59.811 1.00 65.93  ? 188  ALA B CA    1 
ATOM   5645 C C     . ALA B 1 188 ? -2.922  18.900  -60.728 1.00 66.95  ? 188  ALA B C     1 
ATOM   5646 O O     . ALA B 1 188 ? -4.060  19.360  -60.710 1.00 68.20  ? 188  ALA B O     1 
ATOM   5647 C CB    . ALA B 1 188 ? -1.142  20.688  -60.503 1.00 66.38  ? 188  ALA B CB    1 
ATOM   5648 N N     . ALA B 1 189 ? -2.578  17.884  -61.516 1.00 66.81  ? 189  ALA B N     1 
ATOM   5649 C CA    . ALA B 1 189 ? -3.557  17.213  -62.385 1.00 67.88  ? 189  ALA B CA    1 
ATOM   5650 C C     . ALA B 1 189 ? -4.690  16.567  -61.587 1.00 68.20  ? 189  ALA B C     1 
ATOM   5651 O O     . ALA B 1 189 ? -5.796  16.425  -62.094 1.00 70.02  ? 189  ALA B O     1 
ATOM   5652 C CB    . ALA B 1 189 ? -2.872  16.169  -63.251 1.00 67.02  ? 189  ALA B CB    1 
ATOM   5653 N N     . PHE B 1 190 ? -4.415  16.186  -60.340 1.00 67.30  ? 190  PHE B N     1 
ATOM   5654 C CA    . PHE B 1 190 ? -5.404  15.538  -59.468 1.00 67.31  ? 190  PHE B CA    1 
ATOM   5655 C C     . PHE B 1 190 ? -6.097  16.531  -58.529 1.00 68.13  ? 190  PHE B C     1 
ATOM   5656 O O     . PHE B 1 190 ? -6.944  16.130  -57.728 1.00 68.35  ? 190  PHE B O     1 
ATOM   5657 C CB    . PHE B 1 190 ? -4.737  14.453  -58.611 1.00 65.62  ? 190  PHE B CB    1 
ATOM   5658 C CG    . PHE B 1 190 ? -3.996  13.416  -59.394 1.00 64.69  ? 190  PHE B CG    1 
ATOM   5659 C CD1   . PHE B 1 190 ? -2.719  13.670  -59.870 1.00 64.00  ? 190  PHE B CD1   1 
ATOM   5660 C CD2   . PHE B 1 190 ? -4.554  12.168  -59.622 1.00 65.46  ? 190  PHE B CD2   1 
ATOM   5661 C CE1   . PHE B 1 190 ? -2.017  12.713  -60.567 1.00 63.85  ? 190  PHE B CE1   1 
ATOM   5662 C CE2   . PHE B 1 190 ? -3.845  11.180  -60.332 1.00 65.13  ? 190  PHE B CE2   1 
ATOM   5663 C CZ    . PHE B 1 190 ? -2.585  11.453  -60.806 1.00 64.40  ? 190  PHE B CZ    1 
ATOM   5664 N N     . GLY B 1 191 ? -5.734  17.812  -58.624 1.00 68.90  ? 191  GLY B N     1 
ATOM   5665 C CA    . GLY B 1 191 ? -6.275  18.858  -57.754 1.00 69.48  ? 191  GLY B CA    1 
ATOM   5666 C C     . GLY B 1 191 ? -5.444  19.140  -56.506 1.00 68.33  ? 191  GLY B C     1 
ATOM   5667 O O     . GLY B 1 191 ? -5.852  19.944  -55.668 1.00 68.97  ? 191  GLY B O     1 
ATOM   5668 N N     . GLY B 1 192 ? -4.285  18.491  -56.380 1.00 66.79  ? 192  GLY B N     1 
ATOM   5669 C CA    . GLY B 1 192 ? -3.376  18.727  -55.263 1.00 65.46  ? 192  GLY B CA    1 
ATOM   5670 C C     . GLY B 1 192 ? -2.545  19.982  -55.467 1.00 65.96  ? 192  GLY B C     1 
ATOM   5671 O O     . GLY B 1 192 ? -2.299  20.383  -56.601 1.00 67.11  ? 192  GLY B O     1 
ATOM   5672 N N     . ASP B 1 193 ? -2.120  20.600  -54.365 1.00 65.45  ? 193  ASP B N     1 
ATOM   5673 C CA    . ASP B 1 193 ? -1.287  21.804  -54.383 1.00 65.85  ? 193  ASP B CA    1 
ATOM   5674 C C     . ASP B 1 193 ? 0.158   21.373  -54.180 1.00 64.70  ? 193  ASP B C     1 
ATOM   5675 O O     . ASP B 1 193 ? 0.515   20.951  -53.081 1.00 63.74  ? 193  ASP B O     1 
ATOM   5676 C CB    . ASP B 1 193 ? -1.705  22.750  -53.249 1.00 66.24  ? 193  ASP B CB    1 
ATOM   5677 C CG    . ASP B 1 193 ? -1.077  24.161  -53.356 1.00 67.81  ? 193  ASP B CG    1 
ATOM   5678 O OD1   . ASP B 1 193 ? -0.272  24.422  -54.284 1.00 69.11  ? 193  ASP B OD1   1 
ATOM   5679 O OD2   . ASP B 1 193 ? -1.413  25.024  -52.499 1.00 67.39  ? 193  ASP B OD2   1 
ATOM   5680 N N     . PRO B 1 194 ? 1.005   21.476  -55.227 1.00 65.13  ? 194  PRO B N     1 
ATOM   5681 C CA    . PRO B 1 194 ? 2.412   21.082  -55.032 1.00 64.06  ? 194  PRO B CA    1 
ATOM   5682 C C     . PRO B 1 194 ? 3.186   22.074  -54.156 1.00 64.38  ? 194  PRO B C     1 
ATOM   5683 O O     . PRO B 1 194 ? 4.272   21.748  -53.679 1.00 63.12  ? 194  PRO B O     1 
ATOM   5684 C CB    . PRO B 1 194 ? 2.976   21.036  -56.454 1.00 64.77  ? 194  PRO B CB    1 
ATOM   5685 C CG    . PRO B 1 194 ? 2.074   21.927  -57.272 1.00 66.41  ? 194  PRO B CG    1 
ATOM   5686 C CD    . PRO B 1 194 ? 0.738   21.972  -56.592 1.00 66.30  ? 194  PRO B CD    1 
ATOM   5687 N N     . MET B 1 195 ? 2.616   23.261  -53.933 1.00 65.77  ? 195  MET B N     1 
ATOM   5688 C CA    . MET B 1 195 ? 3.195   24.239  -53.011 1.00 67.19  ? 195  MET B CA    1 
ATOM   5689 C C     . MET B 1 195 ? 2.764   24.022  -51.568 1.00 64.93  ? 195  MET B C     1 
ATOM   5690 O O     . MET B 1 195 ? 3.025   24.883  -50.715 1.00 65.58  ? 195  MET B O     1 
ATOM   5691 C CB    . MET B 1 195 ? 2.826   25.672  -53.428 1.00 68.84  ? 195  MET B CB    1 
ATOM   5692 C CG    . MET B 1 195 ? 3.246   25.999  -54.844 1.00 71.68  ? 195  MET B CG    1 
ATOM   5693 S SD    . MET B 1 195 ? 3.239   27.762  -55.201 1.00 78.15  ? 195  MET B SD    1 
ATOM   5694 C CE    . MET B 1 195 ? 1.590   28.303  -54.663 1.00 79.21  ? 195  MET B CE    1 
ATOM   5695 N N     . SER B 1 196 ? 2.093   22.901  -51.301 1.00 62.67  ? 196  SER B N     1 
ATOM   5696 C CA    . SER B 1 196 ? 1.695   22.539  -49.950 1.00 61.05  ? 196  SER B CA    1 
ATOM   5697 C C     . SER B 1 196 ? 1.671   21.020  -49.790 1.00 59.24  ? 196  SER B C     1 
ATOM   5698 O O     . SER B 1 196 ? 0.638   20.377  -49.932 1.00 58.77  ? 196  SER B O     1 
ATOM   5699 C CB    . SER B 1 196 ? 0.332   23.134  -49.599 1.00 62.09  ? 196  SER B CB    1 
ATOM   5700 O OG    . SER B 1 196 ? -0.086  22.681  -48.321 1.00 61.37  ? 196  SER B OG    1 
ATOM   5701 N N     . VAL B 1 197 ? 2.834   20.475  -49.452 1.00 57.59  ? 197  VAL B N     1 
ATOM   5702 C CA    . VAL B 1 197 ? 3.061   19.060  -49.388 1.00 55.93  ? 197  VAL B CA    1 
ATOM   5703 C C     . VAL B 1 197 ? 3.591   18.749  -48.009 1.00 55.02  ? 197  VAL B C     1 
ATOM   5704 O O     . VAL B 1 197 ? 4.579   19.340  -47.573 1.00 55.10  ? 197  VAL B O     1 
ATOM   5705 C CB    . VAL B 1 197 ? 4.090   18.595  -50.445 1.00 55.93  ? 197  VAL B CB    1 
ATOM   5706 C CG1   . VAL B 1 197 ? 4.522   17.159  -50.176 1.00 53.13  ? 197  VAL B CG1   1 
ATOM   5707 C CG2   . VAL B 1 197 ? 3.499   18.725  -51.853 1.00 56.43  ? 197  VAL B CG2   1 
ATOM   5708 N N     . THR B 1 198 ? 2.933   17.814  -47.328 1.00 54.03  ? 198  THR B N     1 
ATOM   5709 C CA    . THR B 1 198 ? 3.342   17.389  -46.012 1.00 52.98  ? 198  THR B CA    1 
ATOM   5710 C C     . THR B 1 198 ? 3.729   15.919  -46.093 1.00 52.31  ? 198  THR B C     1 
ATOM   5711 O O     . THR B 1 198 ? 2.936   15.073  -46.567 1.00 51.95  ? 198  THR B O     1 
ATOM   5712 C CB    . THR B 1 198 ? 2.201   17.596  -45.000 1.00 53.01  ? 198  THR B CB    1 
ATOM   5713 O OG1   . THR B 1 198 ? 1.794   18.965  -45.051 1.00 55.39  ? 198  THR B OG1   1 
ATOM   5714 C CG2   . THR B 1 198 ? 2.641   17.282  -43.588 1.00 51.82  ? 198  THR B CG2   1 
ATOM   5715 N N     . LEU B 1 199 ? 4.957   15.619  -45.665 1.00 51.60  ? 199  LEU B N     1 
ATOM   5716 C CA    . LEU B 1 199 ? 5.394   14.240  -45.536 1.00 51.09  ? 199  LEU B CA    1 
ATOM   5717 C C     . LEU B 1 199 ? 4.956   13.726  -44.181 1.00 51.32  ? 199  LEU B C     1 
ATOM   5718 O O     . LEU B 1 199 ? 5.078   14.422  -43.187 1.00 52.17  ? 199  LEU B O     1 
ATOM   5719 C CB    . LEU B 1 199 ? 6.901   14.126  -45.633 1.00 50.95  ? 199  LEU B CB    1 
ATOM   5720 C CG    . LEU B 1 199 ? 7.593   14.767  -46.835 1.00 51.52  ? 199  LEU B CG    1 
ATOM   5721 C CD1   . LEU B 1 199 ? 9.072   14.470  -46.780 1.00 48.52  ? 199  LEU B CD1   1 
ATOM   5722 C CD2   . LEU B 1 199 ? 6.947   14.319  -48.148 1.00 50.90  ? 199  LEU B CD2   1 
ATOM   5723 N N     . PHE B 1 200 ? 4.416   12.524  -44.137 1.00 51.22  ? 200  PHE B N     1 
ATOM   5724 C CA    . PHE B 1 200 ? 4.218   11.860  -42.862 1.00 51.16  ? 200  PHE B CA    1 
ATOM   5725 C C     . PHE B 1 200 ? 4.576   10.392  -42.963 1.00 50.80  ? 200  PHE B C     1 
ATOM   5726 O O     . PHE B 1 200 ? 4.502   9.794   -44.029 1.00 50.75  ? 200  PHE B O     1 
ATOM   5727 C CB    . PHE B 1 200 ? 2.827   12.132  -42.241 1.00 51.90  ? 200  PHE B CB    1 
ATOM   5728 C CG    . PHE B 1 200 ? 1.655   11.434  -42.897 1.00 52.89  ? 200  PHE B CG    1 
ATOM   5729 C CD1   . PHE B 1 200 ? 1.463   11.446  -44.269 1.00 53.71  ? 200  PHE B CD1   1 
ATOM   5730 C CD2   . PHE B 1 200 ? 0.665   10.859  -42.100 1.00 53.87  ? 200  PHE B CD2   1 
ATOM   5731 C CE1   . PHE B 1 200 ? 0.334   10.838  -44.835 1.00 54.48  ? 200  PHE B CE1   1 
ATOM   5732 C CE2   . PHE B 1 200 ? -0.454  10.256  -42.662 1.00 53.65  ? 200  PHE B CE2   1 
ATOM   5733 C CZ    . PHE B 1 200 ? -0.613  10.240  -44.027 1.00 53.92  ? 200  PHE B CZ    1 
ATOM   5734 N N     . GLY B 1 201 ? 5.043   9.840   -41.858 1.00 50.55  ? 201  GLY B N     1 
ATOM   5735 C CA    . GLY B 1 201 ? 5.466   8.455   -41.855 1.00 51.66  ? 201  GLY B CA    1 
ATOM   5736 C C     . GLY B 1 201 ? 5.597   7.967   -40.443 1.00 51.91  ? 201  GLY B C     1 
ATOM   5737 O O     . GLY B 1 201 ? 5.629   8.775   -39.525 1.00 52.42  ? 201  GLY B O     1 
ATOM   5738 N N     . GLU B 1 202 ? 5.638   6.646   -40.285 1.00 52.56  ? 202  GLU B N     1 
ATOM   5739 C CA    . GLU B 1 202 ? 5.769   6.014   -38.976 1.00 52.52  ? 202  GLU B CA    1 
ATOM   5740 C C     . GLU B 1 202 ? 6.955   5.052   -38.968 1.00 52.46  ? 202  GLU B C     1 
ATOM   5741 O O     . GLU B 1 202 ? 7.191   4.321   -39.926 1.00 52.10  ? 202  GLU B O     1 
ATOM   5742 C CB    . GLU B 1 202 ? 4.480   5.294   -38.598 1.00 53.02  ? 202  GLU B CB    1 
ATOM   5743 C CG    . GLU B 1 202 ? 4.473   4.637   -37.215 1.00 53.84  ? 202  GLU B CG    1 
ATOM   5744 C CD    . GLU B 1 202 ? 4.810   3.123   -37.231 1.00 56.11  ? 202  GLU B CD    1 
ATOM   5745 O OE1   . GLU B 1 202 ? 5.005   2.538   -38.320 1.00 55.33  ? 202  GLU B OE1   1 
ATOM   5746 O OE2   . GLU B 1 202 ? 4.906   2.524   -36.135 1.00 57.72  ? 202  GLU B OE2   1 
ATOM   5747 N N     . SER B 1 203 ? 7.711   5.096   -37.880 1.00 52.41  ? 203  SER B N     1 
ATOM   5748 C CA    . SER B 1 203 ? 8.805   4.193   -37.668 1.00 52.40  ? 203  SER B CA    1 
ATOM   5749 C C     . SER B 1 203 ? 9.931   4.449   -38.687 1.00 52.20  ? 203  SER B C     1 
ATOM   5750 O O     . SER B 1 203 ? 10.367  5.583   -38.792 1.00 52.97  ? 203  SER B O     1 
ATOM   5751 C CB    . SER B 1 203 ? 8.250   2.790   -37.698 1.00 53.13  ? 203  SER B CB    1 
ATOM   5752 O OG    . SER B 1 203 ? 9.096   1.948   -36.969 1.00 52.79  ? 203  SER B OG    1 
ATOM   5753 N N     . ALA B 1 204 ? 10.380  3.453   -39.447 1.00 52.21  ? 204  ALA B N     1 
ATOM   5754 C CA    . ALA B 1 204 ? 11.354  3.690   -40.524 1.00 52.24  ? 204  ALA B CA    1 
ATOM   5755 C C     . ALA B 1 204 ? 10.861  4.772   -41.503 1.00 51.86  ? 204  ALA B C     1 
ATOM   5756 O O     . ALA B 1 204 ? 11.667  5.525   -42.061 1.00 51.90  ? 204  ALA B O     1 
ATOM   5757 C CB    . ALA B 1 204 ? 11.705  2.384   -41.269 1.00 51.61  ? 204  ALA B CB    1 
ATOM   5758 N N     . GLY B 1 205 ? 9.546   4.867   -41.685 1.00 51.70  ? 205  GLY B N     1 
ATOM   5759 C CA    . GLY B 1 205 ? 8.953   5.945   -42.486 1.00 51.87  ? 205  GLY B CA    1 
ATOM   5760 C C     . GLY B 1 205 ? 9.177   7.354   -41.928 1.00 51.45  ? 205  GLY B C     1 
ATOM   5761 O O     . GLY B 1 205 ? 9.374   8.300   -42.678 1.00 51.09  ? 205  GLY B O     1 
ATOM   5762 N N     . ALA B 1 206 ? 9.124   7.481   -40.604 1.00 51.69  ? 206  ALA B N     1 
ATOM   5763 C CA    . ALA B 1 206 ? 9.389   8.738   -39.904 1.00 51.03  ? 206  ALA B CA    1 
ATOM   5764 C C     . ALA B 1 206 ? 10.873  9.043   -39.967 1.00 50.88  ? 206  ALA B C     1 
ATOM   5765 O O     . ALA B 1 206 ? 11.269  10.197  -40.180 1.00 51.30  ? 206  ALA B O     1 
ATOM   5766 C CB    . ALA B 1 206 ? 8.911   8.660   -38.436 1.00 50.96  ? 206  ALA B CB    1 
ATOM   5767 N N     . ALA B 1 207 ? 11.699  8.017   -39.800 1.00 50.65  ? 207  ALA B N     1 
ATOM   5768 C CA    . ALA B 1 207 ? 13.146  8.178   -39.999 1.00 50.98  ? 207  ALA B CA    1 
ATOM   5769 C C     . ALA B 1 207 ? 13.453  8.700   -41.404 1.00 51.27  ? 207  ALA B C     1 
ATOM   5770 O O     . ALA B 1 207 ? 14.294  9.593   -41.574 1.00 51.66  ? 207  ALA B O     1 
ATOM   5771 C CB    . ALA B 1 207 ? 13.871  6.865   -39.748 1.00 51.05  ? 207  ALA B CB    1 
ATOM   5772 N N     . SER B 1 208 ? 12.757  8.126   -42.393 1.00 51.39  ? 208  SER B N     1 
ATOM   5773 C CA    . SER B 1 208 ? 12.856  8.521   -43.801 1.00 51.36  ? 208  SER B CA    1 
ATOM   5774 C C     . SER B 1 208 ? 12.460  9.974   -43.992 1.00 50.86  ? 208  SER B C     1 
ATOM   5775 O O     . SER B 1 208 ? 13.214  10.743  -44.572 1.00 50.41  ? 208  SER B O     1 
ATOM   5776 C CB    . SER B 1 208 ? 11.956  7.638   -44.672 1.00 51.74  ? 208  SER B CB    1 
ATOM   5777 O OG    . SER B 1 208 ? 12.362  6.281   -44.645 1.00 52.33  ? 208  SER B OG    1 
ATOM   5778 N N     . VAL B 1 209 ? 11.274  10.348  -43.503 1.00 50.56  ? 209  VAL B N     1 
ATOM   5779 C CA    . VAL B 1 209 ? 10.862  11.773  -43.462 1.00 50.30  ? 209  VAL B CA    1 
ATOM   5780 C C     . VAL B 1 209 ? 11.997  12.644  -42.873 1.00 51.38  ? 209  VAL B C     1 
ATOM   5781 O O     . VAL B 1 209 ? 12.351  13.701  -43.422 1.00 51.28  ? 209  VAL B O     1 
ATOM   5782 C CB    . VAL B 1 209 ? 9.535   11.971  -42.655 1.00 50.14  ? 209  VAL B CB    1 
ATOM   5783 C CG1   . VAL B 1 209 ? 9.187   13.473  -42.484 1.00 48.68  ? 209  VAL B CG1   1 
ATOM   5784 C CG2   . VAL B 1 209 ? 8.366   11.201  -43.333 1.00 48.04  ? 209  VAL B CG2   1 
ATOM   5785 N N     . GLY B 1 210 ? 12.604  12.165  -41.784 1.00 52.12  ? 210  GLY B N     1 
ATOM   5786 C CA    . GLY B 1 210 ? 13.719  12.875  -41.151 1.00 53.07  ? 210  GLY B CA    1 
ATOM   5787 C C     . GLY B 1 210 ? 14.925  13.051  -42.050 1.00 54.08  ? 210  GLY B C     1 
ATOM   5788 O O     . GLY B 1 210 ? 15.588  14.083  -42.038 1.00 54.06  ? 210  GLY B O     1 
ATOM   5789 N N     . MET B 1 211 ? 15.217  12.024  -42.831 1.00 55.09  ? 211  MET B N     1 
ATOM   5790 C CA    . MET B 1 211 ? 16.334  12.090  -43.758 1.00 56.82  ? 211  MET B CA    1 
ATOM   5791 C C     . MET B 1 211 ? 16.089  13.056  -44.917 1.00 56.05  ? 211  MET B C     1 
ATOM   5792 O O     . MET B 1 211 ? 17.021  13.689  -45.402 1.00 57.11  ? 211  MET B O     1 
ATOM   5793 C CB    . MET B 1 211 ? 16.751  10.680  -44.182 1.00 56.42  ? 211  MET B CB    1 
ATOM   5794 C CG    . MET B 1 211 ? 17.653  10.090  -43.085 1.00 58.41  ? 211  MET B CG    1 
ATOM   5795 S SD    . MET B 1 211 ? 17.744  8.317   -43.049 1.00 62.92  ? 211  MET B SD    1 
ATOM   5796 C CE    . MET B 1 211 ? 17.929  7.947   -41.290 1.00 57.93  ? 211  MET B CE    1 
ATOM   5797 N N     . HIS B 1 212 ? 14.834  13.229  -45.306 1.00 55.16  ? 212  HIS B N     1 
ATOM   5798 C CA    . HIS B 1 212 ? 14.491  14.236  -46.303 1.00 55.11  ? 212  HIS B CA    1 
ATOM   5799 C C     . HIS B 1 212 ? 14.614  15.647  -45.729 1.00 55.82  ? 212  HIS B C     1 
ATOM   5800 O O     . HIS B 1 212 ? 14.928  16.588  -46.461 1.00 57.59  ? 212  HIS B O     1 
ATOM   5801 C CB    . HIS B 1 212 ? 13.092  13.986  -46.861 1.00 54.49  ? 212  HIS B CB    1 
ATOM   5802 C CG    . HIS B 1 212 ? 12.975  12.706  -47.628 1.00 53.31  ? 212  HIS B CG    1 
ATOM   5803 N ND1   . HIS B 1 212 ? 13.616  12.497  -48.832 1.00 51.63  ? 212  HIS B ND1   1 
ATOM   5804 C CD2   . HIS B 1 212 ? 12.314  11.557  -47.345 1.00 51.63  ? 212  HIS B CD2   1 
ATOM   5805 C CE1   . HIS B 1 212 ? 13.343  11.275  -49.257 1.00 54.26  ? 212  HIS B CE1   1 
ATOM   5806 N NE2   . HIS B 1 212 ? 12.551  10.687  -48.376 1.00 51.58  ? 212  HIS B NE2   1 
ATOM   5807 N N     . ILE B 1 213 ? 14.365  15.801  -44.433 1.00 54.78  ? 213  ILE B N     1 
ATOM   5808 C CA    . ILE B 1 213 ? 14.636  17.062  -43.758 1.00 55.17  ? 213  ILE B CA    1 
ATOM   5809 C C     . ILE B 1 213 ? 16.142  17.377  -43.788 1.00 55.92  ? 213  ILE B C     1 
ATOM   5810 O O     . ILE B 1 213 ? 16.542  18.530  -43.957 1.00 56.57  ? 213  ILE B O     1 
ATOM   5811 C CB    . ILE B 1 213 ? 14.118  17.070  -42.277 1.00 54.59  ? 213  ILE B CB    1 
ATOM   5812 C CG1   . ILE B 1 213 ? 12.582  17.029  -42.242 1.00 54.76  ? 213  ILE B CG1   1 
ATOM   5813 C CG2   . ILE B 1 213 ? 14.632  18.316  -41.524 1.00 54.32  ? 213  ILE B CG2   1 
ATOM   5814 C CD1   . ILE B 1 213 ? 11.948  16.892  -40.828 1.00 53.49  ? 213  ILE B CD1   1 
ATOM   5815 N N     . LEU B 1 214 ? 16.966  16.350  -43.627 1.00 55.89  ? 214  LEU B N     1 
ATOM   5816 C CA    . LEU B 1 214 ? 18.412  16.528  -43.498 1.00 56.96  ? 214  LEU B CA    1 
ATOM   5817 C C     . LEU B 1 214 ? 19.205  16.447  -44.816 1.00 58.24  ? 214  LEU B C     1 
ATOM   5818 O O     . LEU B 1 214 ? 20.429  16.591  -44.800 1.00 59.62  ? 214  LEU B O     1 
ATOM   5819 C CB    . LEU B 1 214 ? 18.969  15.530  -42.480 1.00 55.97  ? 214  LEU B CB    1 
ATOM   5820 C CG    . LEU B 1 214 ? 18.383  15.674  -41.071 1.00 55.57  ? 214  LEU B CG    1 
ATOM   5821 C CD1   . LEU B 1 214 ? 18.806  14.487  -40.194 1.00 54.48  ? 214  LEU B CD1   1 
ATOM   5822 C CD2   . LEU B 1 214 ? 18.753  17.039  -40.409 1.00 55.46  ? 214  LEU B CD2   1 
ATOM   5823 N N     . SER B 1 215 ? 18.515  16.246  -45.942 1.00 58.77  ? 215  SER B N     1 
ATOM   5824 C CA    . SER B 1 215 ? 19.152  16.139  -47.263 1.00 59.53  ? 215  SER B CA    1 
ATOM   5825 C C     . SER B 1 215 ? 18.618  17.223  -48.194 1.00 60.96  ? 215  SER B C     1 
ATOM   5826 O O     . SER B 1 215 ? 17.442  17.218  -48.554 1.00 60.29  ? 215  SER B O     1 
ATOM   5827 C CB    . SER B 1 215 ? 18.887  14.764  -47.864 1.00 58.93  ? 215  SER B CB    1 
ATOM   5828 O OG    . SER B 1 215 ? 19.707  14.540  -48.989 1.00 59.91  ? 215  SER B OG    1 
ATOM   5829 N N     . LEU B 1 216 ? 19.497  18.140  -48.592 1.00 63.07  ? 216  LEU B N     1 
ATOM   5830 C CA    . LEU B 1 216 ? 19.089  19.384  -49.243 1.00 64.72  ? 216  LEU B CA    1 
ATOM   5831 C C     . LEU B 1 216 ? 18.274  19.203  -50.521 1.00 64.60  ? 216  LEU B C     1 
ATOM   5832 O O     . LEU B 1 216 ? 17.322  19.942  -50.740 1.00 64.96  ? 216  LEU B O     1 
ATOM   5833 C CB    . LEU B 1 216 ? 20.310  20.262  -49.548 1.00 66.73  ? 216  LEU B CB    1 
ATOM   5834 C CG    . LEU B 1 216 ? 20.027  21.766  -49.609 1.00 69.18  ? 216  LEU B CG    1 
ATOM   5835 C CD1   . LEU B 1 216 ? 19.824  22.277  -48.175 1.00 70.57  ? 216  LEU B CD1   1 
ATOM   5836 C CD2   . LEU B 1 216 ? 21.156  22.547  -50.320 1.00 70.12  ? 216  LEU B CD2   1 
ATOM   5837 N N     . PRO B 1 217 ? 18.667  18.261  -51.394 1.00 64.76  ? 217  PRO B N     1 
ATOM   5838 C CA    . PRO B 1 217 ? 17.846  18.032  -52.596 1.00 64.89  ? 217  PRO B CA    1 
ATOM   5839 C C     . PRO B 1 217 ? 16.384  17.586  -52.347 1.00 63.87  ? 217  PRO B C     1 
ATOM   5840 O O     . PRO B 1 217 ? 15.534  17.776  -53.218 1.00 64.63  ? 217  PRO B O     1 
ATOM   5841 C CB    . PRO B 1 217 ? 18.640  16.965  -53.366 1.00 65.07  ? 217  PRO B CB    1 
ATOM   5842 C CG    . PRO B 1 217 ? 20.050  17.091  -52.850 1.00 65.13  ? 217  PRO B CG    1 
ATOM   5843 C CD    . PRO B 1 217 ? 19.874  17.414  -51.395 1.00 65.03  ? 217  PRO B CD    1 
ATOM   5844 N N     . SER B 1 218 ? 16.081  17.028  -51.178 1.00 62.89  ? 218  SER B N     1 
ATOM   5845 C CA    . SER B 1 218 ? 14.692  16.679  -50.838 1.00 61.76  ? 218  SER B CA    1 
ATOM   5846 C C     . SER B 1 218 ? 13.898  17.897  -50.408 1.00 62.18  ? 218  SER B C     1 
ATOM   5847 O O     . SER B 1 218 ? 12.686  17.912  -50.531 1.00 61.63  ? 218  SER B O     1 
ATOM   5848 C CB    . SER B 1 218 ? 14.620  15.630  -49.727 1.00 60.25  ? 218  SER B CB    1 
ATOM   5849 O OG    . SER B 1 218 ? 15.053  14.360  -50.169 1.00 60.14  ? 218  SER B OG    1 
ATOM   5850 N N     . ARG B 1 219 ? 14.589  18.913  -49.901 1.00 63.49  ? 219  ARG B N     1 
ATOM   5851 C CA    . ARG B 1 219 ? 13.939  20.047  -49.230 1.00 63.98  ? 219  ARG B CA    1 
ATOM   5852 C C     . ARG B 1 219 ? 13.019  20.885  -50.099 1.00 64.53  ? 219  ARG B C     1 
ATOM   5853 O O     . ARG B 1 219 ? 12.036  21.438  -49.594 1.00 64.98  ? 219  ARG B O     1 
ATOM   5854 C CB    . ARG B 1 219 ? 14.987  20.946  -48.556 1.00 64.96  ? 219  ARG B CB    1 
ATOM   5855 C CG    . ARG B 1 219 ? 15.662  20.290  -47.345 1.00 65.32  ? 219  ARG B CG    1 
ATOM   5856 C CD    . ARG B 1 219 ? 14.659  19.948  -46.235 1.00 66.54  ? 219  ARG B CD    1 
ATOM   5857 N NE    . ARG B 1 219 ? 14.110  21.156  -45.631 1.00 67.94  ? 219  ARG B NE    1 
ATOM   5858 C CZ    . ARG B 1 219 ? 14.674  21.834  -44.629 1.00 69.26  ? 219  ARG B CZ    1 
ATOM   5859 N NH1   . ARG B 1 219 ? 15.809  21.429  -44.072 1.00 69.13  ? 219  ARG B NH1   1 
ATOM   5860 N NH2   . ARG B 1 219 ? 14.087  22.938  -44.171 1.00 71.22  ? 219  ARG B NH2   1 
ATOM   5861 N N     . SER B 1 220 ? 13.313  20.975  -51.392 1.00 64.93  ? 220  SER B N     1 
ATOM   5862 C CA    . SER B 1 220 ? 12.442  21.713  -52.308 1.00 65.62  ? 220  SER B CA    1 
ATOM   5863 C C     . SER B 1 220 ? 11.195  20.908  -52.725 1.00 64.27  ? 220  SER B C     1 
ATOM   5864 O O     . SER B 1 220 ? 10.382  21.381  -53.516 1.00 64.91  ? 220  SER B O     1 
ATOM   5865 C CB    . SER B 1 220 ? 13.234  22.169  -53.541 1.00 66.95  ? 220  SER B CB    1 
ATOM   5866 O OG    . SER B 1 220 ? 13.900  21.081  -54.166 1.00 68.54  ? 220  SER B OG    1 
ATOM   5867 N N     . LEU B 1 221 ? 11.030  19.705  -52.186 1.00 62.33  ? 221  LEU B N     1 
ATOM   5868 C CA    . LEU B 1 221 ? 9.946   18.819  -52.604 1.00 61.16  ? 221  LEU B CA    1 
ATOM   5869 C C     . LEU B 1 221 ? 8.832   18.680  -51.566 1.00 60.34  ? 221  LEU B C     1 
ATOM   5870 O O     . LEU B 1 221 ? 7.836   17.990  -51.817 1.00 60.05  ? 221  LEU B O     1 
ATOM   5871 C CB    . LEU B 1 221 ? 10.511  17.442  -52.904 1.00 60.26  ? 221  LEU B CB    1 
ATOM   5872 C CG    . LEU B 1 221 ? 11.664  17.384  -53.896 1.00 60.66  ? 221  LEU B CG    1 
ATOM   5873 C CD1   . LEU B 1 221 ? 12.165  15.949  -53.991 1.00 58.97  ? 221  LEU B CD1   1 
ATOM   5874 C CD2   . LEU B 1 221 ? 11.204  17.909  -55.245 1.00 59.98  ? 221  LEU B CD2   1 
ATOM   5875 N N     . PHE B 1 222 ? 9.013   19.303  -50.401 1.00 59.66  ? 222  PHE B N     1 
ATOM   5876 C CA    . PHE B 1 222 ? 7.974   19.351  -49.370 1.00 59.02  ? 222  PHE B CA    1 
ATOM   5877 C C     . PHE B 1 222 ? 8.127   20.594  -48.490 1.00 59.66  ? 222  PHE B C     1 
ATOM   5878 O O     . PHE B 1 222 ? 9.150   21.271  -48.531 1.00 60.09  ? 222  PHE B O     1 
ATOM   5879 C CB    . PHE B 1 222 ? 7.989   18.078  -48.519 1.00 57.51  ? 222  PHE B CB    1 
ATOM   5880 C CG    . PHE B 1 222 ? 9.213   17.923  -47.670 1.00 56.63  ? 222  PHE B CG    1 
ATOM   5881 C CD1   . PHE B 1 222 ? 10.424  17.547  -48.234 1.00 56.55  ? 222  PHE B CD1   1 
ATOM   5882 C CD2   . PHE B 1 222 ? 9.153   18.136  -46.292 1.00 56.57  ? 222  PHE B CD2   1 
ATOM   5883 C CE1   . PHE B 1 222 ? 11.565  17.403  -47.448 1.00 57.20  ? 222  PHE B CE1   1 
ATOM   5884 C CE2   . PHE B 1 222 ? 10.284  17.986  -45.489 1.00 55.75  ? 222  PHE B CE2   1 
ATOM   5885 C CZ    . PHE B 1 222 ? 11.497  17.622  -46.069 1.00 56.22  ? 222  PHE B CZ    1 
ATOM   5886 N N     . HIS B 1 223 ? 7.097   20.872  -47.691 1.00 59.90  ? 223  HIS B N     1 
ATOM   5887 C CA    . HIS B 1 223 ? 7.015   22.100  -46.891 1.00 60.49  ? 223  HIS B CA    1 
ATOM   5888 C C     . HIS B 1 223 ? 6.843   21.840  -45.386 1.00 59.48  ? 223  HIS B C     1 
ATOM   5889 O O     . HIS B 1 223 ? 7.244   22.648  -44.568 1.00 60.28  ? 223  HIS B O     1 
ATOM   5890 C CB    . HIS B 1 223 ? 5.875   22.964  -47.435 1.00 61.58  ? 223  HIS B CB    1 
ATOM   5891 C CG    . HIS B 1 223 ? 5.859   23.039  -48.933 1.00 63.11  ? 223  HIS B CG    1 
ATOM   5892 N ND1   . HIS B 1 223 ? 6.439   24.075  -49.632 1.00 64.87  ? 223  HIS B ND1   1 
ATOM   5893 C CD2   . HIS B 1 223 ? 5.384   22.178  -49.864 1.00 61.71  ? 223  HIS B CD2   1 
ATOM   5894 C CE1   . HIS B 1 223 ? 6.308   23.851  -50.930 1.00 65.77  ? 223  HIS B CE1   1 
ATOM   5895 N NE2   . HIS B 1 223 ? 5.676   22.703  -51.096 1.00 63.14  ? 223  HIS B NE2   1 
ATOM   5896 N N     . ARG B 1 224 ? 6.254   20.709  -45.024 1.00 58.45  ? 224  ARG B N     1 
ATOM   5897 C CA    . ARG B 1 224 ? 6.026   20.357  -43.619 1.00 57.57  ? 224  ARG B CA    1 
ATOM   5898 C C     . ARG B 1 224 ? 6.296   18.872  -43.428 1.00 54.98  ? 224  ARG B C     1 
ATOM   5899 O O     . ARG B 1 224 ? 6.348   18.134  -44.398 1.00 53.71  ? 224  ARG B O     1 
ATOM   5900 C CB    . ARG B 1 224 ? 4.587   20.683  -43.235 1.00 57.86  ? 224  ARG B CB    1 
ATOM   5901 C CG    . ARG B 1 224 ? 4.415   22.111  -42.846 1.00 60.76  ? 224  ARG B CG    1 
ATOM   5902 C CD    . ARG B 1 224 ? 2.955   22.510  -42.778 1.00 61.79  ? 224  ARG B CD    1 
ATOM   5903 N NE    . ARG B 1 224 ? 2.365   22.590  -44.107 1.00 64.08  ? 224  ARG B NE    1 
ATOM   5904 C CZ    . ARG B 1 224 ? 2.534   23.601  -44.952 1.00 65.59  ? 224  ARG B CZ    1 
ATOM   5905 N NH1   . ARG B 1 224 ? 3.292   24.644  -44.635 1.00 66.72  ? 224  ARG B NH1   1 
ATOM   5906 N NH2   . ARG B 1 224 ? 1.951   23.551  -46.139 1.00 66.49  ? 224  ARG B NH2   1 
ATOM   5907 N N     . ALA B 1 225 ? 6.464   18.447  -42.177 1.00 53.90  ? 225  ALA B N     1 
ATOM   5908 C CA    . ALA B 1 225 ? 6.785   17.038  -41.877 1.00 52.81  ? 225  ALA B CA    1 
ATOM   5909 C C     . ALA B 1 225 ? 6.147   16.516  -40.583 1.00 52.00  ? 225  ALA B C     1 
ATOM   5910 O O     . ALA B 1 225 ? 5.970   17.248  -39.616 1.00 52.05  ? 225  ALA B O     1 
ATOM   5911 C CB    . ALA B 1 225 ? 8.301   16.841  -41.840 1.00 52.07  ? 225  ALA B CB    1 
ATOM   5912 N N     . VAL B 1 226 ? 5.797   15.235  -40.597 1.00 51.47  ? 226  VAL B N     1 
ATOM   5913 C CA    . VAL B 1 226 ? 5.286   14.527  -39.441 1.00 50.95  ? 226  VAL B CA    1 
ATOM   5914 C C     . VAL B 1 226 ? 6.068   13.240  -39.277 1.00 50.75  ? 226  VAL B C     1 
ATOM   5915 O O     . VAL B 1 226 ? 6.167   12.441  -40.215 1.00 50.17  ? 226  VAL B O     1 
ATOM   5916 C CB    . VAL B 1 226 ? 3.801   14.149  -39.581 1.00 51.40  ? 226  VAL B CB    1 
ATOM   5917 C CG1   . VAL B 1 226 ? 3.304   13.497  -38.295 1.00 51.19  ? 226  VAL B CG1   1 
ATOM   5918 C CG2   . VAL B 1 226 ? 2.944   15.374  -39.943 1.00 51.60  ? 226  VAL B CG2   1 
ATOM   5919 N N     . LEU B 1 227 ? 6.623   13.060  -38.075 1.00 51.12  ? 227  LEU B N     1 
ATOM   5920 C CA    . LEU B 1 227 ? 7.429   11.888  -37.719 1.00 50.91  ? 227  LEU B CA    1 
ATOM   5921 C C     . LEU B 1 227 ? 6.763   11.180  -36.557 1.00 51.08  ? 227  LEU B C     1 
ATOM   5922 O O     . LEU B 1 227 ? 6.787   11.669  -35.428 1.00 50.95  ? 227  LEU B O     1 
ATOM   5923 C CB    . LEU B 1 227 ? 8.847   12.287  -37.295 1.00 50.69  ? 227  LEU B CB    1 
ATOM   5924 C CG    . LEU B 1 227 ? 9.811   12.838  -38.356 1.00 51.39  ? 227  LEU B CG    1 
ATOM   5925 C CD1   . LEU B 1 227 ? 9.544   14.328  -38.627 1.00 49.02  ? 227  LEU B CD1   1 
ATOM   5926 C CD2   . LEU B 1 227 ? 11.280  12.622  -37.912 1.00 50.62  ? 227  LEU B CD2   1 
ATOM   5927 N N     . GLN B 1 228 ? 6.188   10.021  -36.843 1.00 51.29  ? 228  GLN B N     1 
ATOM   5928 C CA    . GLN B 1 228 ? 5.492   9.229   -35.855 1.00 51.74  ? 228  GLN B CA    1 
ATOM   5929 C C     . GLN B 1 228 ? 6.397   8.084   -35.426 1.00 51.94  ? 228  GLN B C     1 
ATOM   5930 O O     . GLN B 1 228 ? 6.714   7.201   -36.228 1.00 51.53  ? 228  GLN B O     1 
ATOM   5931 C CB    . GLN B 1 228 ? 4.216   8.672   -36.468 1.00 52.35  ? 228  GLN B CB    1 
ATOM   5932 C CG    . GLN B 1 228 ? 3.253   9.751   -37.016 1.00 53.39  ? 228  GLN B CG    1 
ATOM   5933 C CD    . GLN B 1 228 ? 2.054   9.176   -37.770 1.00 53.54  ? 228  GLN B CD    1 
ATOM   5934 O OE1   . GLN B 1 228 ? 1.555   9.809   -38.694 1.00 55.65  ? 228  GLN B OE1   1 
ATOM   5935 N NE2   . GLN B 1 228 ? 1.610   7.971   -37.401 1.00 54.21  ? 228  GLN B NE2   1 
ATOM   5936 N N     . SER B 1 229 ? 6.840   8.106   -34.168 1.00 51.90  ? 229  SER B N     1 
ATOM   5937 C CA    . SER B 1 229 ? 7.562   6.959   -33.586 1.00 51.89  ? 229  SER B CA    1 
ATOM   5938 C C     . SER B 1 229 ? 8.786   6.538   -34.400 1.00 51.23  ? 229  SER B C     1 
ATOM   5939 O O     . SER B 1 229 ? 8.983   5.365   -34.678 1.00 52.09  ? 229  SER B O     1 
ATOM   5940 C CB    . SER B 1 229 ? 6.603   5.766   -33.433 1.00 52.40  ? 229  SER B CB    1 
ATOM   5941 O OG    . SER B 1 229 ? 5.494   6.099   -32.605 1.00 52.87  ? 229  SER B OG    1 
ATOM   5942 N N     . GLY B 1 230 ? 9.604   7.502   -34.783 1.00 50.51  ? 230  GLY B N     1 
ATOM   5943 C CA    . GLY B 1 230 ? 10.820  7.227   -35.528 1.00 50.28  ? 230  GLY B CA    1 
ATOM   5944 C C     . GLY B 1 230 ? 11.576  8.502   -35.854 1.00 50.08  ? 230  GLY B C     1 
ATOM   5945 O O     . GLY B 1 230 ? 10.974  9.558   -36.020 1.00 49.39  ? 230  GLY B O     1 
ATOM   5946 N N     . THR B 1 231 ? 12.898  8.383   -35.976 1.00 50.40  ? 231  THR B N     1 
ATOM   5947 C CA    . THR B 1 231 ? 13.789  9.527   -36.116 1.00 50.53  ? 231  THR B CA    1 
ATOM   5948 C C     . THR B 1 231 ? 14.986  9.145   -36.962 1.00 50.55  ? 231  THR B C     1 
ATOM   5949 O O     . THR B 1 231 ? 15.345  7.987   -36.999 1.00 51.28  ? 231  THR B O     1 
ATOM   5950 C CB    . THR B 1 231 ? 14.314  9.987   -34.718 1.00 50.91  ? 231  THR B CB    1 
ATOM   5951 O OG1   . THR B 1 231 ? 15.054  8.917   -34.107 1.00 50.89  ? 231  THR B OG1   1 
ATOM   5952 C CG2   . THR B 1 231 ? 13.164  10.404  -33.807 1.00 49.32  ? 231  THR B CG2   1 
ATOM   5953 N N     . PRO B 1 232 ? 15.605  10.110  -37.650 1.00 50.75  ? 232  PRO B N     1 
ATOM   5954 C CA    . PRO B 1 232 ? 16.842  9.822   -38.415 1.00 51.76  ? 232  PRO B CA    1 
ATOM   5955 C C     . PRO B 1 232 ? 18.088  9.631   -37.543 1.00 53.10  ? 232  PRO B C     1 
ATOM   5956 O O     . PRO B 1 232 ? 18.982  8.856   -37.882 1.00 53.72  ? 232  PRO B O     1 
ATOM   5957 C CB    . PRO B 1 232 ? 17.004  11.055  -39.307 1.00 51.63  ? 232  PRO B CB    1 
ATOM   5958 C CG    . PRO B 1 232 ? 16.278  12.151  -38.575 1.00 51.59  ? 232  PRO B CG    1 
ATOM   5959 C CD    . PRO B 1 232 ? 15.156  11.504  -37.813 1.00 50.42  ? 232  PRO B CD    1 
ATOM   5960 N N     . ASN B 1 233 ? 18.151  10.385  -36.447 1.00 53.98  ? 233  ASN B N     1 
ATOM   5961 C CA    . ASN B 1 233 ? 19.126  10.166  -35.391 1.00 54.71  ? 233  ASN B CA    1 
ATOM   5962 C C     . ASN B 1 233 ? 18.727  8.916   -34.624 1.00 54.96  ? 233  ASN B C     1 
ATOM   5963 O O     . ASN B 1 233 ? 17.661  8.357   -34.853 1.00 54.64  ? 233  ASN B O     1 
ATOM   5964 C CB    . ASN B 1 233 ? 19.167  11.372  -34.445 1.00 54.52  ? 233  ASN B CB    1 
ATOM   5965 C CG    . ASN B 1 233 ? 17.797  11.726  -33.892 1.00 54.60  ? 233  ASN B CG    1 
ATOM   5966 O OD1   . ASN B 1 233 ? 16.895  12.059  -34.649 1.00 54.29  ? 233  ASN B OD1   1 
ATOM   5967 N ND2   . ASN B 1 233 ? 17.636  11.657  -32.565 1.00 55.92  ? 233  ASN B ND2   1 
ATOM   5968 N N     . GLY B 1 234 ? 19.567  8.494   -33.691 1.00 56.07  ? 234  GLY B N     1 
ATOM   5969 C CA    . GLY B 1 234 ? 19.267  7.306   -32.906 1.00 56.49  ? 234  GLY B CA    1 
ATOM   5970 C C     . GLY B 1 234 ? 20.025  6.086   -33.396 1.00 57.22  ? 234  GLY B C     1 
ATOM   5971 O O     . GLY B 1 234 ? 20.710  6.145   -34.419 1.00 58.02  ? 234  GLY B O     1 
ATOM   5972 N N     . PRO B 1 235 ? 19.907  4.972   -32.657 1.00 57.47  ? 235  PRO B N     1 
ATOM   5973 C CA    . PRO B 1 235 ? 20.819  3.825   -32.806 1.00 58.13  ? 235  PRO B CA    1 
ATOM   5974 C C     . PRO B 1 235 ? 20.584  2.854   -33.984 1.00 57.94  ? 235  PRO B C     1 
ATOM   5975 O O     . PRO B 1 235 ? 21.474  2.054   -34.290 1.00 58.97  ? 235  PRO B O     1 
ATOM   5976 C CB    . PRO B 1 235 ? 20.666  3.104   -31.466 1.00 58.58  ? 235  PRO B CB    1 
ATOM   5977 C CG    . PRO B 1 235 ? 19.234  3.381   -31.083 1.00 58.46  ? 235  PRO B CG    1 
ATOM   5978 C CD    . PRO B 1 235 ? 18.925  4.768   -31.575 1.00 56.93  ? 235  PRO B CD    1 
ATOM   5979 N N     . TRP B 1 236 ? 19.433  2.932   -34.646 1.00 56.58  ? 236  TRP B N     1 
ATOM   5980 C CA    . TRP B 1 236 ? 19.036  1.914   -35.629 1.00 56.36  ? 236  TRP B CA    1 
ATOM   5981 C C     . TRP B 1 236 ? 18.837  2.423   -37.066 1.00 55.66  ? 236  TRP B C     1 
ATOM   5982 O O     . TRP B 1 236 ? 18.788  1.624   -37.999 1.00 55.84  ? 236  TRP B O     1 
ATOM   5983 C CB    . TRP B 1 236 ? 17.755  1.224   -35.166 1.00 55.70  ? 236  TRP B CB    1 
ATOM   5984 C CG    . TRP B 1 236 ? 16.624  2.187   -34.912 1.00 55.17  ? 236  TRP B CG    1 
ATOM   5985 C CD1   . TRP B 1 236 ? 16.282  2.743   -33.713 1.00 55.22  ? 236  TRP B CD1   1 
ATOM   5986 C CD2   . TRP B 1 236 ? 15.704  2.720   -35.875 1.00 54.18  ? 236  TRP B CD2   1 
ATOM   5987 N NE1   . TRP B 1 236 ? 15.215  3.593   -33.867 1.00 55.05  ? 236  TRP B NE1   1 
ATOM   5988 C CE2   . TRP B 1 236 ? 14.830  3.586   -35.183 1.00 55.30  ? 236  TRP B CE2   1 
ATOM   5989 C CE3   . TRP B 1 236 ? 15.531  2.551   -37.257 1.00 55.36  ? 236  TRP B CE3   1 
ATOM   5990 C CZ2   . TRP B 1 236 ? 13.793  4.277   -35.825 1.00 53.16  ? 236  TRP B CZ2   1 
ATOM   5991 C CZ3   . TRP B 1 236 ? 14.498  3.244   -37.894 1.00 53.70  ? 236  TRP B CZ3   1 
ATOM   5992 C CH2   . TRP B 1 236 ? 13.648  4.093   -37.175 1.00 53.06  ? 236  TRP B CH2   1 
ATOM   5993 N N     . ALA B 1 237 ? 18.714  3.734   -37.254 1.00 54.95  ? 237  ALA B N     1 
ATOM   5994 C CA    . ALA B 1 237 ? 18.211  4.275   -38.530 1.00 54.32  ? 237  ALA B CA    1 
ATOM   5995 C C     . ALA B 1 237 ? 19.315  4.475   -39.572 1.00 54.79  ? 237  ALA B C     1 
ATOM   5996 O O     . ALA B 1 237 ? 19.043  4.479   -40.763 1.00 54.95  ? 237  ALA B O     1 
ATOM   5997 C CB    . ALA B 1 237 ? 17.438  5.569   -38.301 1.00 53.51  ? 237  ALA B CB    1 
ATOM   5998 N N     . THR B 1 238 ? 20.553  4.636   -39.126 1.00 55.22  ? 238  THR B N     1 
ATOM   5999 C CA    . THR B 1 238 ? 21.696  4.685   -40.027 1.00 55.86  ? 238  THR B CA    1 
ATOM   6000 C C     . THR B 1 238 ? 22.817  3.743   -39.576 1.00 57.24  ? 238  THR B C     1 
ATOM   6001 O O     . THR B 1 238 ? 22.886  3.310   -38.411 1.00 57.18  ? 238  THR B O     1 
ATOM   6002 C CB    . THR B 1 238 ? 22.308  6.092   -40.092 1.00 55.90  ? 238  THR B CB    1 
ATOM   6003 O OG1   . THR B 1 238 ? 22.714  6.480   -38.779 1.00 55.34  ? 238  THR B OG1   1 
ATOM   6004 C CG2   . THR B 1 238 ? 21.316  7.115   -40.645 1.00 54.67  ? 238  THR B CG2   1 
ATOM   6005 N N     . VAL B 1 239 ? 23.693  3.441   -40.524 1.00 58.30  ? 239  VAL B N     1 
ATOM   6006 C CA    . VAL B 1 239 ? 24.993  2.856   -40.235 1.00 59.73  ? 239  VAL B CA    1 
ATOM   6007 C C     . VAL B 1 239 ? 26.082  3.711   -40.869 1.00 60.98  ? 239  VAL B C     1 
ATOM   6008 O O     . VAL B 1 239 ? 25.810  4.555   -41.730 1.00 60.47  ? 239  VAL B O     1 
ATOM   6009 C CB    . VAL B 1 239 ? 25.101  1.422   -40.766 1.00 60.44  ? 239  VAL B CB    1 
ATOM   6010 C CG1   . VAL B 1 239 ? 24.128  0.521   -40.018 1.00 60.08  ? 239  VAL B CG1   1 
ATOM   6011 C CG2   . VAL B 1 239 ? 24.859  1.375   -42.282 1.00 59.72  ? 239  VAL B CG2   1 
ATOM   6012 N N     . SER B 1 240 ? 27.318  3.485   -40.439 1.00 62.79  ? 240  SER B N     1 
ATOM   6013 C CA    . SER B 1 240 ? 28.472  4.113   -41.062 1.00 64.34  ? 240  SER B CA    1 
ATOM   6014 C C     . SER B 1 240 ? 28.738  3.422   -42.386 1.00 65.48  ? 240  SER B C     1 
ATOM   6015 O O     . SER B 1 240 ? 28.219  2.334   -42.648 1.00 65.38  ? 240  SER B O     1 
ATOM   6016 C CB    . SER B 1 240 ? 29.698  3.983   -40.164 1.00 65.78  ? 240  SER B CB    1 
ATOM   6017 O OG    . SER B 1 240 ? 30.149  2.639   -40.151 1.00 67.54  ? 240  SER B OG    1 
ATOM   6018 N N     . ALA B 1 241 ? 29.563  4.055   -43.212 1.00 66.91  ? 241  ALA B N     1 
ATOM   6019 C CA    . ALA B 1 241 ? 29.991  3.480   -44.477 1.00 67.99  ? 241  ALA B CA    1 
ATOM   6020 C C     . ALA B 1 241 ? 30.811  2.202   -44.250 1.00 69.83  ? 241  ALA B C     1 
ATOM   6021 O O     . ALA B 1 241 ? 30.677  1.233   -44.992 1.00 70.32  ? 241  ALA B O     1 
ATOM   6022 C CB    . ALA B 1 241 ? 30.800  4.502   -45.257 1.00 69.02  ? 241  ALA B CB    1 
ATOM   6023 N N     . GLY B 1 242 ? 31.657  2.202   -43.225 1.00 70.87  ? 242  GLY B N     1 
ATOM   6024 C CA    . GLY B 1 242 ? 32.416  1.009   -42.870 1.00 72.28  ? 242  GLY B CA    1 
ATOM   6025 C C     . GLY B 1 242 ? 31.537  -0.172  -42.480 1.00 71.60  ? 242  GLY B C     1 
ATOM   6026 O O     . GLY B 1 242 ? 31.792  -1.298  -42.896 1.00 72.58  ? 242  GLY B O     1 
ATOM   6027 N N     . GLU B 1 243 ? 30.500  0.076   -41.681 1.00 69.96  ? 243  GLU B N     1 
ATOM   6028 C CA    . GLU B 1 243 ? 29.609  -1.009  -41.248 1.00 69.17  ? 243  GLU B CA    1 
ATOM   6029 C C     . GLU B 1 243 ? 28.687  -1.489  -42.376 1.00 68.11  ? 243  GLU B C     1 
ATOM   6030 O O     . GLU B 1 243 ? 28.373  -2.676  -42.448 1.00 68.63  ? 243  GLU B O     1 
ATOM   6031 C CB    . GLU B 1 243 ? 28.804  -0.596  -40.019 1.00 67.87  ? 243  GLU B CB    1 
ATOM   6032 C CG    . GLU B 1 243 ? 27.802  -1.645  -39.512 1.00 67.97  ? 243  GLU B CG    1 
ATOM   6033 C CD    . GLU B 1 243 ? 28.433  -2.889  -38.878 1.00 70.17  ? 243  GLU B CD    1 
ATOM   6034 O OE1   . GLU B 1 243 ? 27.642  -3.735  -38.396 1.00 69.09  ? 243  GLU B OE1   1 
ATOM   6035 O OE2   . GLU B 1 243 ? 29.684  -3.026  -38.835 1.00 72.22  ? 243  GLU B OE2   1 
ATOM   6036 N N     . ALA B 1 244 ? 28.266  -0.581  -43.256 1.00 66.59  ? 244  ALA B N     1 
ATOM   6037 C CA    . ALA B 1 244 ? 27.527  -0.978  -44.469 1.00 65.83  ? 244  ALA B CA    1 
ATOM   6038 C C     . ALA B 1 244 ? 28.375  -1.900  -45.345 1.00 67.23  ? 244  ALA B C     1 
ATOM   6039 O O     . ALA B 1 244 ? 27.931  -2.971  -45.743 1.00 66.74  ? 244  ALA B O     1 
ATOM   6040 C CB    . ALA B 1 244 ? 27.081  0.255   -45.273 1.00 64.57  ? 244  ALA B CB    1 
ATOM   6041 N N     . ARG B 1 245 ? 29.602  -1.474  -45.626 1.00 68.83  ? 245  ARG B N     1 
ATOM   6042 C CA    . ARG B 1 245 ? 30.527  -2.242  -46.440 1.00 71.01  ? 245  ARG B CA    1 
ATOM   6043 C C     . ARG B 1 245 ? 30.699  -3.650  -45.879 1.00 72.36  ? 245  ARG B C     1 
ATOM   6044 O O     . ARG B 1 245 ? 30.621  -4.645  -46.601 1.00 73.19  ? 245  ARG B O     1 
ATOM   6045 C CB    . ARG B 1 245 ? 31.882  -1.536  -46.507 1.00 72.49  ? 245  ARG B CB    1 
ATOM   6046 C CG    . ARG B 1 245 ? 32.929  -2.288  -47.330 1.00 74.83  ? 245  ARG B CG    1 
ATOM   6047 C CD    . ARG B 1 245 ? 34.100  -1.390  -47.679 1.00 76.37  ? 245  ARG B CD    1 
ATOM   6048 N NE    . ARG B 1 245 ? 33.747  -0.463  -48.743 1.00 75.60  ? 245  ARG B NE    1 
ATOM   6049 C CZ    . ARG B 1 245 ? 33.678  -0.786  -50.030 1.00 76.45  ? 245  ARG B CZ    1 
ATOM   6050 N NH1   . ARG B 1 245 ? 33.330  0.134   -50.922 1.00 75.97  ? 245  ARG B NH1   1 
ATOM   6051 N NH2   . ARG B 1 245 ? 33.959  -2.015  -50.435 1.00 77.98  ? 245  ARG B NH2   1 
ATOM   6052 N N     . ARG B 1 246 ? 30.919  -3.713  -44.576 1.00 73.06  ? 246  ARG B N     1 
ATOM   6053 C CA    . ARG B 1 246 ? 31.149  -4.967  -43.871 1.00 74.68  ? 246  ARG B CA    1 
ATOM   6054 C C     . ARG B 1 246 ? 29.966  -5.940  -44.043 1.00 73.63  ? 246  ARG B C     1 
ATOM   6055 O O     . ARG B 1 246 ? 30.151  -7.118  -44.347 1.00 74.48  ? 246  ARG B O     1 
ATOM   6056 C CB    . ARG B 1 246 ? 31.378  -4.621  -42.408 1.00 75.15  ? 246  ARG B CB    1 
ATOM   6057 C CG    . ARG B 1 246 ? 31.785  -5.743  -41.494 1.00 78.41  ? 246  ARG B CG    1 
ATOM   6058 C CD    . ARG B 1 246 ? 30.985  -5.645  -40.182 1.00 80.07  ? 246  ARG B CD    1 
ATOM   6059 N NE    . ARG B 1 246 ? 30.482  -6.965  -39.850 1.00 82.14  ? 246  ARG B NE    1 
ATOM   6060 C CZ    . ARG B 1 246 ? 29.296  -7.246  -39.330 1.00 80.62  ? 246  ARG B CZ    1 
ATOM   6061 N NH1   . ARG B 1 246 ? 28.435  -6.294  -39.030 1.00 77.07  ? 246  ARG B NH1   1 
ATOM   6062 N NH2   . ARG B 1 246 ? 28.990  -8.526  -39.102 1.00 83.75  ? 246  ARG B NH2   1 
ATOM   6063 N N     . ARG B 1 247 ? 28.754  -5.427  -43.864 1.00 71.49  ? 247  ARG B N     1 
ATOM   6064 C CA    . ARG B 1 247 ? 27.538  -6.224  -44.007 1.00 70.56  ? 247  ARG B CA    1 
ATOM   6065 C C     . ARG B 1 247 ? 27.291  -6.672  -45.444 1.00 70.73  ? 247  ARG B C     1 
ATOM   6066 O O     . ARG B 1 247 ? 26.896  -7.810  -45.679 1.00 71.57  ? 247  ARG B O     1 
ATOM   6067 C CB    . ARG B 1 247 ? 26.337  -5.429  -43.499 1.00 68.26  ? 247  ARG B CB    1 
ATOM   6068 C CG    . ARG B 1 247 ? 26.384  -5.176  -41.996 1.00 68.40  ? 247  ARG B CG    1 
ATOM   6069 C CD    . ARG B 1 247 ? 25.199  -4.352  -41.539 1.00 66.59  ? 247  ARG B CD    1 
ATOM   6070 N NE    . ARG B 1 247 ? 25.303  -3.953  -40.147 1.00 66.74  ? 247  ARG B NE    1 
ATOM   6071 C CZ    . ARG B 1 247 ? 24.361  -3.277  -39.497 1.00 65.23  ? 247  ARG B CZ    1 
ATOM   6072 N NH1   . ARG B 1 247 ? 23.231  -2.946  -40.097 1.00 64.36  ? 247  ARG B NH1   1 
ATOM   6073 N NH2   . ARG B 1 247 ? 24.544  -2.943  -38.233 1.00 65.66  ? 247  ARG B NH2   1 
ATOM   6074 N N     . ALA B 1 248 ? 27.502  -5.769  -46.400 1.00 70.38  ? 248  ALA B N     1 
ATOM   6075 C CA    . ALA B 1 248 ? 27.417  -6.104  -47.821 1.00 70.71  ? 248  ALA B CA    1 
ATOM   6076 C C     . ALA B 1 248 ? 28.433  -7.186  -48.196 1.00 72.78  ? 248  ALA B C     1 
ATOM   6077 O O     . ALA B 1 248 ? 28.113  -8.124  -48.923 1.00 73.68  ? 248  ALA B O     1 
ATOM   6078 C CB    . ALA B 1 248 ? 27.627  -4.860  -48.677 1.00 69.87  ? 248  ALA B CB    1 
ATOM   6079 N N     . THR B 1 249 ? 29.657  -7.045  -47.704 1.00 73.95  ? 249  THR B N     1 
ATOM   6080 C CA    . THR B 1 249 ? 30.723  -7.999  -47.997 1.00 76.30  ? 249  THR B CA    1 
ATOM   6081 C C     . THR B 1 249 ? 30.469  -9.382  -47.373 1.00 77.25  ? 249  THR B C     1 
ATOM   6082 O O     . THR B 1 249 ? 30.864  -10.412 -47.924 1.00 79.05  ? 249  THR B O     1 
ATOM   6083 C CB    . THR B 1 249 ? 32.081  -7.436  -47.527 1.00 77.79  ? 249  THR B CB    1 
ATOM   6084 O OG1   . THR B 1 249 ? 32.275  -6.137  -48.103 1.00 77.04  ? 249  THR B OG1   1 
ATOM   6085 C CG2   . THR B 1 249 ? 33.244  -8.352  -47.935 1.00 79.72  ? 249  THR B CG2   1 
ATOM   6086 N N     . LEU B 1 250 ? 29.797  -9.401  -46.231 1.00 76.44  ? 250  LEU B N     1 
ATOM   6087 C CA    . LEU B 1 250 ? 29.482  -10.647 -45.544 1.00 77.50  ? 250  LEU B CA    1 
ATOM   6088 C C     . LEU B 1 250 ? 28.281  -11.333 -46.195 1.00 77.24  ? 250  LEU B C     1 
ATOM   6089 O O     . LEU B 1 250 ? 28.268  -12.552 -46.365 1.00 78.37  ? 250  LEU B O     1 
ATOM   6090 C CB    . LEU B 1 250 ? 29.227  -10.378 -44.050 1.00 76.95  ? 250  LEU B CB    1 
ATOM   6091 C CG    . LEU B 1 250 ? 28.841  -11.574 -43.173 1.00 77.75  ? 250  LEU B CG    1 
ATOM   6092 C CD1   . LEU B 1 250 ? 29.814  -12.742 -43.336 1.00 79.00  ? 250  LEU B CD1   1 
ATOM   6093 C CD2   . LEU B 1 250 ? 28.717  -11.149 -41.715 1.00 76.44  ? 250  LEU B CD2   1 
ATOM   6094 N N     . LEU B 1 251 ? 27.264  -10.556 -46.549 1.00 75.76  ? 251  LEU B N     1 
ATOM   6095 C CA    . LEU B 1 251 ? 26.119  -11.114 -47.260 1.00 75.73  ? 251  LEU B CA    1 
ATOM   6096 C C     . LEU B 1 251 ? 26.584  -11.791 -48.548 1.00 77.40  ? 251  LEU B C     1 
ATOM   6097 O O     . LEU B 1 251 ? 26.143  -12.894 -48.874 1.00 77.95  ? 251  LEU B O     1 
ATOM   6098 C CB    . LEU B 1 251 ? 25.097  -10.022 -47.589 1.00 73.63  ? 251  LEU B CB    1 
ATOM   6099 C CG    . LEU B 1 251 ? 23.868  -10.529 -48.356 1.00 73.37  ? 251  LEU B CG    1 
ATOM   6100 C CD1   . LEU B 1 251 ? 22.949  -11.301 -47.410 1.00 74.09  ? 251  LEU B CD1   1 
ATOM   6101 C CD2   . LEU B 1 251 ? 23.130  -9.383  -49.042 1.00 72.28  ? 251  LEU B CD2   1 
ATOM   6102 N N     . ALA B 1 252 ? 27.471  -11.108 -49.270 1.00 78.45  ? 252  ALA B N     1 
ATOM   6103 C CA    . ALA B 1 252 ? 28.019  -11.598 -50.520 1.00 80.22  ? 252  ALA B CA    1 
ATOM   6104 C C     . ALA B 1 252 ? 28.753  -12.903 -50.285 1.00 83.23  ? 252  ALA B C     1 
ATOM   6105 O O     . ALA B 1 252 ? 28.555  -13.861 -51.020 1.00 84.39  ? 252  ALA B O     1 
ATOM   6106 C CB    . ALA B 1 252 ? 28.952  -10.577 -51.114 1.00 80.45  ? 252  ALA B CB    1 
ATOM   6107 N N     . ARG B 1 253 ? 29.585  -12.946 -49.250 1.00 85.11  ? 253  ARG B N     1 
ATOM   6108 C CA    . ARG B 1 253 ? 30.262  -14.185 -48.876 1.00 88.61  ? 253  ARG B CA    1 
ATOM   6109 C C     . ARG B 1 253 ? 29.239  -15.278 -48.606 1.00 88.45  ? 253  ARG B C     1 
ATOM   6110 O O     . ARG B 1 253 ? 29.381  -16.397 -49.087 1.00 90.20  ? 253  ARG B O     1 
ATOM   6111 C CB    . ARG B 1 253 ? 31.145  -13.997 -47.632 1.00 89.38  ? 253  ARG B CB    1 
ATOM   6112 C CG    . ARG B 1 253 ? 32.210  -15.077 -47.471 1.00 93.47  ? 253  ARG B CG    1 
ATOM   6113 C CD    . ARG B 1 253 ? 32.684  -15.231 -46.020 1.00 96.02  ? 253  ARG B CD    1 
ATOM   6114 N NE    . ARG B 1 253 ? 32.016  -16.336 -45.309 1.00 99.30  ? 253  ARG B NE    1 
ATOM   6115 C CZ    . ARG B 1 253 ? 31.661  -16.327 -44.015 1.00 100.60 ? 253  ARG B CZ    1 
ATOM   6116 N NH1   . ARG B 1 253 ? 31.873  -15.263 -43.229 1.00 100.09 ? 253  ARG B NH1   1 
ATOM   6117 N NH2   . ARG B 1 253 ? 31.063  -17.397 -43.496 1.00 101.50 ? 253  ARG B NH2   1 
ATOM   6118 N N     . LEU B 1 254 ? 28.199  -14.943 -47.849 1.00 87.01  ? 254  LEU B N     1 
ATOM   6119 C CA    . LEU B 1 254 ? 27.195  -15.928 -47.451 1.00 87.39  ? 254  LEU B CA    1 
ATOM   6120 C C     . LEU B 1 254 ? 26.434  -16.519 -48.638 1.00 87.68  ? 254  LEU B C     1 
ATOM   6121 O O     . LEU B 1 254 ? 25.945  -17.640 -48.551 1.00 88.83  ? 254  LEU B O     1 
ATOM   6122 C CB    . LEU B 1 254 ? 26.206  -15.325 -46.447 1.00 85.61  ? 254  LEU B CB    1 
ATOM   6123 C CG    . LEU B 1 254 ? 26.630  -15.247 -44.979 1.00 85.88  ? 254  LEU B CG    1 
ATOM   6124 C CD1   . LEU B 1 254 ? 25.606  -14.434 -44.210 1.00 84.29  ? 254  LEU B CD1   1 
ATOM   6125 C CD2   . LEU B 1 254 ? 26.766  -16.646 -44.389 1.00 87.91  ? 254  LEU B CD2   1 
ATOM   6126 N N     . VAL B 1 255 ? 26.336  -15.774 -49.739 1.00 87.15  ? 255  VAL B N     1 
ATOM   6127 C CA    . VAL B 1 255 ? 25.683  -16.283 -50.952 1.00 87.63  ? 255  VAL B CA    1 
ATOM   6128 C C     . VAL B 1 255 ? 26.675  -16.765 -52.030 1.00 90.26  ? 255  VAL B C     1 
ATOM   6129 O O     . VAL B 1 255 ? 26.279  -17.032 -53.157 1.00 90.57  ? 255  VAL B O     1 
ATOM   6130 C CB    . VAL B 1 255 ? 24.651  -15.265 -51.534 1.00 85.19  ? 255  VAL B CB    1 
ATOM   6131 C CG1   . VAL B 1 255 ? 23.488  -15.127 -50.589 1.00 83.68  ? 255  VAL B CG1   1 
ATOM   6132 C CG2   . VAL B 1 255 ? 25.280  -13.906 -51.806 1.00 83.44  ? 255  VAL B CG2   1 
ATOM   6133 N N     . GLY B 1 256 ? 27.953  -16.900 -51.681 1.00 92.76  ? 256  GLY B N     1 
ATOM   6134 C CA    . GLY B 1 256 ? 28.948  -17.446 -52.602 1.00 95.59  ? 256  GLY B CA    1 
ATOM   6135 C C     . GLY B 1 256 ? 29.552  -16.472 -53.603 1.00 96.09  ? 256  GLY B C     1 
ATOM   6136 O O     . GLY B 1 256 ? 30.179  -16.895 -54.574 1.00 97.99  ? 256  GLY B O     1 
ATOM   6137 N N     . CYS B 1 257 ? 29.385  -15.176 -53.361 1.00 95.30  ? 257  CYS B N     1 
ATOM   6138 C CA    . CYS B 1 257 ? 29.938  -14.131 -54.224 1.00 95.86  ? 257  CYS B CA    1 
ATOM   6139 C C     . CYS B 1 257 ? 31.247  -13.602 -53.642 1.00 98.31  ? 257  CYS B C     1 
ATOM   6140 O O     . CYS B 1 257 ? 31.355  -13.421 -52.429 1.00 98.36  ? 257  CYS B O     1 
ATOM   6141 C CB    . CYS B 1 257 ? 28.947  -12.967 -54.364 1.00 92.96  ? 257  CYS B CB    1 
ATOM   6142 S SG    . CYS B 1 257 ? 27.536  -13.327 -55.412 1.00 91.20  ? 257  CYS B SG    1 
ATOM   6143 N N     . PRO B 1 258 ? 32.246  -13.331 -54.500 1.00 101.14 ? 258  PRO B N     1 
ATOM   6144 C CA    . PRO B 1 258 ? 32.224  -13.433 -55.958 1.00 102.16 ? 258  PRO B CA    1 
ATOM   6145 C C     . PRO B 1 258 ? 32.798  -14.779 -56.432 1.00 104.84 ? 258  PRO B C     1 
ATOM   6146 O O     . PRO B 1 258 ? 33.248  -15.575 -55.599 1.00 106.23 ? 258  PRO B O     1 
ATOM   6147 C CB    . PRO B 1 258 ? 33.120  -12.264 -56.390 1.00 102.60 ? 258  PRO B CB    1 
ATOM   6148 C CG    . PRO B 1 258 ? 34.076  -12.030 -55.180 1.00 103.71 ? 258  PRO B CG    1 
ATOM   6149 C CD    . PRO B 1 258 ? 33.572  -12.884 -54.027 1.00 102.84 ? 258  PRO B CD    1 
ATOM   6150 N N     . ASN B 1 265 ? 37.540  -6.164  -55.419 1.00 99.21  ? 265  ASN B N     1 
ATOM   6151 C CA    . ASN B 1 265 ? 36.930  -5.269  -56.398 1.00 98.03  ? 265  ASN B CA    1 
ATOM   6152 C C     . ASN B 1 265 ? 35.392  -5.235  -56.309 1.00 94.93  ? 265  ASN B C     1 
ATOM   6153 O O     . ASN B 1 265 ? 34.724  -6.250  -56.542 1.00 94.54  ? 265  ASN B O     1 
ATOM   6154 C CB    . ASN B 1 265 ? 37.366  -5.681  -57.796 1.00 99.98  ? 265  ASN B CB    1 
ATOM   6155 C CG    . ASN B 1 265 ? 36.791  -4.792  -58.876 1.00 100.07 ? 265  ASN B CG    1 
ATOM   6156 O OD1   . ASN B 1 265 ? 35.652  -4.974  -59.304 1.00 99.85  ? 265  ASN B OD1   1 
ATOM   6157 N ND2   . ASN B 1 265 ? 37.588  -3.840  -59.345 1.00 102.80 ? 265  ASN B ND2   1 
ATOM   6158 N N     . ASP B 1 266 ? 34.846  -4.058  -55.992 1.00 92.53  ? 266  ASP B N     1 
ATOM   6159 C CA    . ASP B 1 266 ? 33.397  -3.876  -55.835 1.00 89.58  ? 266  ASP B CA    1 
ATOM   6160 C C     . ASP B 1 266 ? 32.595  -4.300  -57.055 1.00 88.79  ? 266  ASP B C     1 
ATOM   6161 O O     . ASP B 1 266 ? 31.555  -4.957  -56.927 1.00 87.24  ? 266  ASP B O     1 
ATOM   6162 C CB    . ASP B 1 266 ? 33.064  -2.411  -55.522 1.00 88.05  ? 266  ASP B CB    1 
ATOM   6163 C CG    . ASP B 1 266 ? 33.437  -2.016  -54.111 1.00 87.51  ? 266  ASP B CG    1 
ATOM   6164 O OD1   . ASP B 1 266 ? 33.796  -2.917  -53.323 1.00 86.48  ? 266  ASP B OD1   1 
ATOM   6165 O OD2   . ASP B 1 266 ? 33.367  -0.806  -53.798 1.00 85.79  ? 266  ASP B OD2   1 
ATOM   6166 N N     . THR B 1 267 ? 33.074  -3.903  -58.231 1.00 89.53  ? 267  THR B N     1 
ATOM   6167 C CA    . THR B 1 267 ? 32.365  -4.162  -59.476 1.00 89.01  ? 267  THR B CA    1 
ATOM   6168 C C     . THR B 1 267 ? 32.023  -5.642  -59.602 1.00 89.05  ? 267  THR B C     1 
ATOM   6169 O O     . THR B 1 267 ? 30.870  -5.999  -59.872 1.00 87.79  ? 267  THR B O     1 
ATOM   6170 C CB    . THR B 1 267 ? 33.187  -3.672  -60.695 1.00 90.88  ? 267  THR B CB    1 
ATOM   6171 O OG1   . THR B 1 267 ? 33.277  -2.242  -60.643 1.00 90.62  ? 267  THR B OG1   1 
ATOM   6172 C CG2   . THR B 1 267 ? 32.544  -4.099  -62.024 1.00 90.58  ? 267  THR B CG2   1 
ATOM   6173 N N     . GLU B 1 268 ? 33.021  -6.491  -59.374 1.00 90.43  ? 268  GLU B N     1 
ATOM   6174 C CA    . GLU B 1 268 ? 32.852  -7.939  -59.479 1.00 91.00  ? 268  GLU B CA    1 
ATOM   6175 C C     . GLU B 1 268 ? 31.877  -8.479  -58.426 1.00 88.30  ? 268  GLU B C     1 
ATOM   6176 O O     . GLU B 1 268 ? 31.006  -9.291  -58.740 1.00 87.73  ? 268  GLU B O     1 
ATOM   6177 C CB    . GLU B 1 268 ? 34.212  -8.655  -59.367 1.00 93.58  ? 268  GLU B CB    1 
ATOM   6178 C CG    . GLU B 1 268 ? 35.124  -8.468  -60.584 1.00 96.38  ? 268  GLU B CG    1 
ATOM   6179 C CD    . GLU B 1 268 ? 36.384  -9.348  -60.531 1.00 100.06 ? 268  GLU B CD    1 
ATOM   6180 O OE1   . GLU B 1 268 ? 36.923  -9.585  -59.411 1.00 102.04 ? 268  GLU B OE1   1 
ATOM   6181 O OE2   . GLU B 1 268 ? 36.836  -9.794  -61.616 1.00 103.05 ? 268  GLU B OE2   1 
ATOM   6182 N N     . LEU B 1 269 ? 32.032  -8.028  -57.187 1.00 86.55  ? 269  LEU B N     1 
ATOM   6183 C CA    . LEU B 1 269 ? 31.173  -8.470  -56.087 1.00 84.72  ? 269  LEU B CA    1 
ATOM   6184 C C     . LEU B 1 269 ? 29.696  -8.141  -56.353 1.00 82.08  ? 269  LEU B C     1 
ATOM   6185 O O     . LEU B 1 269 ? 28.831  -8.999  -56.188 1.00 81.51  ? 269  LEU B O     1 
ATOM   6186 C CB    . LEU B 1 269 ? 31.649  -7.847  -54.768 1.00 84.15  ? 269  LEU B CB    1 
ATOM   6187 C CG    . LEU B 1 269 ? 30.864  -8.154  -53.487 1.00 83.23  ? 269  LEU B CG    1 
ATOM   6188 C CD1   . LEU B 1 269 ? 31.765  -8.156  -52.255 1.00 83.07  ? 269  LEU B CD1   1 
ATOM   6189 C CD2   . LEU B 1 269 ? 29.719  -7.150  -53.303 1.00 81.27  ? 269  LEU B CD2   1 
ATOM   6190 N N     . ILE B 1 270 ? 29.422  -6.915  -56.789 1.00 80.35  ? 270  ILE B N     1 
ATOM   6191 C CA    . ILE B 1 270 ? 28.047  -6.478  -57.048 1.00 78.45  ? 270  ILE B CA    1 
ATOM   6192 C C     . ILE B 1 270 ? 27.452  -7.171  -58.276 1.00 78.87  ? 270  ILE B C     1 
ATOM   6193 O O     . ILE B 1 270 ? 26.248  -7.459  -58.308 1.00 77.75  ? 270  ILE B O     1 
ATOM   6194 C CB    . ILE B 1 270 ? 27.950  -4.941  -57.220 1.00 77.24  ? 270  ILE B CB    1 
ATOM   6195 C CG1   . ILE B 1 270 ? 28.448  -4.238  -55.955 1.00 76.85  ? 270  ILE B CG1   1 
ATOM   6196 C CG2   . ILE B 1 270 ? 26.510  -4.515  -57.515 1.00 75.09  ? 270  ILE B CG2   1 
ATOM   6197 C CD1   . ILE B 1 270 ? 29.133  -2.916  -56.203 1.00 76.56  ? 270  ILE B CD1   1 
ATOM   6198 N N     . ALA B 1 271 ? 28.289  -7.443  -59.277 1.00 80.49  ? 271  ALA B N     1 
ATOM   6199 C CA    . ALA B 1 271 ? 27.842  -8.162  -60.465 1.00 81.15  ? 271  ALA B CA    1 
ATOM   6200 C C     . ALA B 1 271 ? 27.321  -9.548  -60.099 1.00 81.43  ? 271  ALA B C     1 
ATOM   6201 O O     . ALA B 1 271 ? 26.291  -9.978  -60.606 1.00 80.90  ? 271  ALA B O     1 
ATOM   6202 C CB    . ALA B 1 271 ? 28.969  -8.267  -61.480 1.00 83.08  ? 271  ALA B CB    1 
ATOM   6203 N N     . CYS B 1 272 ? 28.028  -10.234 -59.205 1.00 82.96  ? 272  CYS B N     1 
ATOM   6204 C CA    . CYS B 1 272 ? 27.628  -11.572 -58.770 1.00 83.55  ? 272  CYS B CA    1 
ATOM   6205 C C     . CYS B 1 272 ? 26.376  -11.517 -57.903 1.00 81.25  ? 272  CYS B C     1 
ATOM   6206 O O     . CYS B 1 272 ? 25.497  -12.370 -58.032 1.00 81.24  ? 272  CYS B O     1 
ATOM   6207 C CB    . CYS B 1 272 ? 28.777  -12.275 -58.034 1.00 85.88  ? 272  CYS B CB    1 
ATOM   6208 S SG    . CYS B 1 272 ? 28.367  -13.876 -57.245 1.00 88.23  ? 272  CYS B SG    1 
ATOM   6209 N N     . LEU B 1 273 ? 26.292  -10.513 -57.031 1.00 79.33  ? 273  LEU B N     1 
ATOM   6210 C CA    . LEU B 1 273 ? 25.084  -10.288 -56.242 1.00 77.13  ? 273  LEU B CA    1 
ATOM   6211 C C     . LEU B 1 273 ? 23.873  -10.065 -57.145 1.00 75.82  ? 273  LEU B C     1 
ATOM   6212 O O     . LEU B 1 273 ? 22.791  -10.572 -56.859 1.00 75.30  ? 273  LEU B O     1 
ATOM   6213 C CB    . LEU B 1 273 ? 25.246  -9.096  -55.289 1.00 76.05  ? 273  LEU B CB    1 
ATOM   6214 C CG    . LEU B 1 273 ? 26.024  -9.301  -53.982 1.00 76.47  ? 273  LEU B CG    1 
ATOM   6215 C CD1   . LEU B 1 273 ? 26.064  -8.003  -53.192 1.00 74.09  ? 273  LEU B CD1   1 
ATOM   6216 C CD2   . LEU B 1 273 ? 25.420  -10.410 -53.132 1.00 76.06  ? 273  LEU B CD2   1 
ATOM   6217 N N     . ARG B 1 274 ? 24.062  -9.321  -58.237 1.00 75.30  ? 274  ARG B N     1 
ATOM   6218 C CA    . ARG B 1 274 ? 22.993  -9.079  -59.215 1.00 74.14  ? 274  ARG B CA    1 
ATOM   6219 C C     . ARG B 1 274 ? 22.498  -10.330 -59.955 1.00 74.55  ? 274  ARG B C     1 
ATOM   6220 O O     . ARG B 1 274 ? 21.407  -10.327 -60.497 1.00 74.02  ? 274  ARG B O     1 
ATOM   6221 C CB    . ARG B 1 274 ? 23.426  -8.030  -60.242 1.00 74.16  ? 274  ARG B CB    1 
ATOM   6222 C CG    . ARG B 1 274 ? 23.446  -6.609  -59.710 1.00 73.34  ? 274  ARG B CG    1 
ATOM   6223 C CD    . ARG B 1 274 ? 23.366  -5.595  -60.840 1.00 73.81  ? 274  ARG B CD    1 
ATOM   6224 N NE    . ARG B 1 274 ? 24.423  -5.798  -61.827 1.00 76.19  ? 274  ARG B NE    1 
ATOM   6225 C CZ    . ARG B 1 274 ? 25.600  -5.169  -61.844 1.00 78.50  ? 274  ARG B CZ    1 
ATOM   6226 N NH1   . ARG B 1 274 ? 25.919  -4.272  -60.917 1.00 78.87  ? 274  ARG B NH1   1 
ATOM   6227 N NH2   . ARG B 1 274 ? 26.478  -5.449  -62.798 1.00 80.55  ? 274  ARG B NH2   1 
ATOM   6228 N N     . THR B 1 275 ? 23.289  -11.394 -59.981 1.00 75.98  ? 275  THR B N     1 
ATOM   6229 C CA    . THR B 1 275 ? 22.862  -12.636 -60.617 1.00 76.82  ? 275  THR B CA    1 
ATOM   6230 C C     . THR B 1 275 ? 21.957  -13.474 -59.719 1.00 76.72  ? 275  THR B C     1 
ATOM   6231 O O     . THR B 1 275 ? 21.302  -14.415 -60.186 1.00 77.32  ? 275  THR B O     1 
ATOM   6232 C CB    . THR B 1 275 ? 24.073  -13.507 -61.024 1.00 78.91  ? 275  THR B CB    1 
ATOM   6233 O OG1   . THR B 1 275 ? 24.798  -13.910 -59.855 1.00 78.07  ? 275  THR B OG1   1 
ATOM   6234 C CG2   . THR B 1 275 ? 24.988  -12.732 -61.957 1.00 79.20  ? 275  THR B CG2   1 
ATOM   6235 N N     . ARG B 1 276 ? 21.929  -13.144 -58.433 1.00 76.02  ? 276  ARG B N     1 
ATOM   6236 C CA    . ARG B 1 276 ? 21.289  -14.002 -57.445 1.00 76.35  ? 276  ARG B CA    1 
ATOM   6237 C C     . ARG B 1 276 ? 19.780  -13.789 -57.390 1.00 74.67  ? 276  ARG B C     1 
ATOM   6238 O O     . ARG B 1 276 ? 19.327  -12.664 -57.318 1.00 73.13  ? 276  ARG B O     1 
ATOM   6239 C CB    . ARG B 1 276 ? 21.910  -13.777 -56.059 1.00 76.16  ? 276  ARG B CB    1 
ATOM   6240 C CG    . ARG B 1 276 ? 23.330  -14.315 -55.946 1.00 78.97  ? 276  ARG B CG    1 
ATOM   6241 C CD    . ARG B 1 276 ? 23.346  -15.845 -55.953 1.00 82.18  ? 276  ARG B CD    1 
ATOM   6242 N NE    . ARG B 1 276 ? 24.665  -16.405 -55.654 1.00 84.78  ? 276  ARG B NE    1 
ATOM   6243 C CZ    . ARG B 1 276 ? 25.638  -16.558 -56.553 1.00 87.05  ? 276  ARG B CZ    1 
ATOM   6244 N NH1   . ARG B 1 276 ? 25.453  -16.189 -57.820 1.00 87.57  ? 276  ARG B NH1   1 
ATOM   6245 N NH2   . ARG B 1 276 ? 26.809  -17.082 -56.189 1.00 88.02  ? 276  ARG B NH2   1 
ATOM   6246 N N     . PRO B 1 277 ? 18.998  -14.883 -57.438 1.00 75.06  ? 277  PRO B N     1 
ATOM   6247 C CA    . PRO B 1 277 ? 17.573  -14.795 -57.159 1.00 73.59  ? 277  PRO B CA    1 
ATOM   6248 C C     . PRO B 1 277 ? 17.284  -13.991 -55.892 1.00 71.69  ? 277  PRO B C     1 
ATOM   6249 O O     . PRO B 1 277 ? 18.023  -14.082 -54.918 1.00 71.36  ? 277  PRO B O     1 
ATOM   6250 C CB    . PRO B 1 277 ? 17.165  -16.261 -56.989 1.00 75.13  ? 277  PRO B CB    1 
ATOM   6251 C CG    . PRO B 1 277 ? 18.096  -17.000 -57.851 1.00 76.91  ? 277  PRO B CG    1 
ATOM   6252 C CD    . PRO B 1 277 ? 19.400  -16.262 -57.773 1.00 76.93  ? 277  PRO B CD    1 
ATOM   6253 N N     . ALA B 1 278 ? 16.212  -13.205 -55.927 1.00 69.92  ? 278  ALA B N     1 
ATOM   6254 C CA    . ALA B 1 278 ? 15.876  -12.283 -54.843 1.00 68.33  ? 278  ALA B CA    1 
ATOM   6255 C C     . ALA B 1 278 ? 15.823  -12.983 -53.476 1.00 68.82  ? 278  ALA B C     1 
ATOM   6256 O O     . ALA B 1 278 ? 16.425  -12.509 -52.503 1.00 68.19  ? 278  ALA B O     1 
ATOM   6257 C CB    . ALA B 1 278 ? 14.538  -11.550 -55.149 1.00 66.59  ? 278  ALA B CB    1 
ATOM   6258 N N     . GLN B 1 279 ? 15.136  -14.122 -53.404 1.00 70.02  ? 279  GLN B N     1 
ATOM   6259 C CA    . GLN B 1 279 ? 15.003  -14.848 -52.129 1.00 70.91  ? 279  GLN B CA    1 
ATOM   6260 C C     . GLN B 1 279 ? 16.341  -15.335 -51.568 1.00 71.91  ? 279  GLN B C     1 
ATOM   6261 O O     . GLN B 1 279 ? 16.450  -15.522 -50.359 1.00 72.02  ? 279  GLN B O     1 
ATOM   6262 C CB    . GLN B 1 279 ? 14.032  -16.042 -52.246 1.00 72.06  ? 279  GLN B CB    1 
ATOM   6263 C CG    . GLN B 1 279 ? 13.613  -16.648 -50.889 1.00 72.16  ? 279  GLN B CG    1 
ATOM   6264 C CD    . GLN B 1 279 ? 13.100  -15.612 -49.887 1.00 69.39  ? 279  GLN B CD    1 
ATOM   6265 O OE1   . GLN B 1 279 ? 12.323  -14.731 -50.237 1.00 68.88  ? 279  GLN B OE1   1 
ATOM   6266 N NE2   . GLN B 1 279 ? 13.535  -15.721 -48.642 1.00 67.71  ? 279  GLN B NE2   1 
ATOM   6267 N N     . ASP B 1 280 ? 17.338  -15.544 -52.433 1.00 72.82  ? 280  ASP B N     1 
ATOM   6268 C CA    . ASP B 1 280 ? 18.689  -15.923 -51.981 1.00 74.44  ? 280  ASP B CA    1 
ATOM   6269 C C     . ASP B 1 280 ? 19.317  -14.821 -51.116 1.00 73.32  ? 280  ASP B C     1 
ATOM   6270 O O     . ASP B 1 280 ? 19.966  -15.102 -50.110 1.00 73.96  ? 280  ASP B O     1 
ATOM   6271 C CB    . ASP B 1 280 ? 19.621  -16.258 -53.164 1.00 75.77  ? 280  ASP B CB    1 
ATOM   6272 C CG    . ASP B 1 280 ? 19.267  -17.575 -53.850 1.00 78.74  ? 280  ASP B CG    1 
ATOM   6273 O OD1   . ASP B 1 280 ? 18.136  -18.081 -53.671 1.00 80.93  ? 280  ASP B OD1   1 
ATOM   6274 O OD2   . ASP B 1 280 ? 20.127  -18.111 -54.583 1.00 82.53  ? 280  ASP B OD2   1 
ATOM   6275 N N     . LEU B 1 281 ? 19.103  -13.567 -51.502 1.00 72.11  ? 281  LEU B N     1 
ATOM   6276 C CA    . LEU B 1 281 ? 19.568  -12.426 -50.702 1.00 70.94  ? 281  LEU B CA    1 
ATOM   6277 C C     . LEU B 1 281 ? 18.828  -12.344 -49.357 1.00 70.41  ? 281  LEU B C     1 
ATOM   6278 O O     . LEU B 1 281 ? 19.457  -12.244 -48.298 1.00 70.98  ? 281  LEU B O     1 
ATOM   6279 C CB    . LEU B 1 281 ? 19.424  -11.118 -51.494 1.00 69.33  ? 281  LEU B CB    1 
ATOM   6280 C CG    . LEU B 1 281 ? 20.192  -11.013 -52.828 1.00 70.14  ? 281  LEU B CG    1 
ATOM   6281 C CD1   . LEU B 1 281 ? 20.168  -9.591  -53.338 1.00 68.86  ? 281  LEU B CD1   1 
ATOM   6282 C CD2   . LEU B 1 281 ? 21.642  -11.497 -52.732 1.00 71.13  ? 281  LEU B CD2   1 
ATOM   6283 N N     . VAL B 1 282 ? 17.502  -12.415 -49.402 1.00 69.80  ? 282  VAL B N     1 
ATOM   6284 C CA    . VAL B 1 282 ? 16.669  -12.337 -48.203 1.00 69.33  ? 282  VAL B CA    1 
ATOM   6285 C C     . VAL B 1 282 ? 16.921  -13.482 -47.195 1.00 70.99  ? 282  VAL B C     1 
ATOM   6286 O O     . VAL B 1 282 ? 16.827  -13.264 -45.983 1.00 70.36  ? 282  VAL B O     1 
ATOM   6287 C CB    . VAL B 1 282 ? 15.167  -12.257 -48.595 1.00 68.72  ? 282  VAL B CB    1 
ATOM   6288 C CG1   . VAL B 1 282 ? 14.252  -12.450 -47.384 1.00 68.68  ? 282  VAL B CG1   1 
ATOM   6289 C CG2   . VAL B 1 282 ? 14.873  -10.926 -49.278 1.00 67.06  ? 282  VAL B CG2   1 
ATOM   6290 N N     . ASP B 1 283 ? 17.244  -14.685 -47.690 1.00 72.92  ? 283  ASP B N     1 
ATOM   6291 C CA    . ASP B 1 283 ? 17.571  -15.841 -46.829 1.00 74.77  ? 283  ASP B CA    1 
ATOM   6292 C C     . ASP B 1 283 ? 18.701  -15.582 -45.819 1.00 75.63  ? 283  ASP B C     1 
ATOM   6293 O O     . ASP B 1 283 ? 18.766  -16.228 -44.762 1.00 76.33  ? 283  ASP B O     1 
ATOM   6294 C CB    . ASP B 1 283 ? 17.997  -17.046 -47.675 1.00 77.02  ? 283  ASP B CB    1 
ATOM   6295 C CG    . ASP B 1 283 ? 16.827  -17.792 -48.302 1.00 77.81  ? 283  ASP B CG    1 
ATOM   6296 O OD1   . ASP B 1 283 ? 15.643  -17.509 -47.999 1.00 76.00  ? 283  ASP B OD1   1 
ATOM   6297 O OD2   . ASP B 1 283 ? 17.120  -18.689 -49.116 1.00 81.13  ? 283  ASP B OD2   1 
ATOM   6298 N N     . HIS B 1 284 ? 19.601  -14.666 -46.168 1.00 75.52  ? 284  HIS B N     1 
ATOM   6299 C CA    . HIS B 1 284 ? 20.777  -14.373 -45.367 1.00 76.33  ? 284  HIS B CA    1 
ATOM   6300 C C     . HIS B 1 284 ? 20.769  -12.958 -44.798 1.00 75.13  ? 284  HIS B C     1 
ATOM   6301 O O     . HIS B 1 284 ? 21.746  -12.513 -44.189 1.00 75.37  ? 284  HIS B O     1 
ATOM   6302 C CB    . HIS B 1 284 ? 22.030  -14.607 -46.211 1.00 77.61  ? 284  HIS B CB    1 
ATOM   6303 C CG    . HIS B 1 284 ? 22.378  -16.053 -46.366 1.00 79.29  ? 284  HIS B CG    1 
ATOM   6304 N ND1   . HIS B 1 284 ? 22.632  -16.871 -45.287 1.00 80.20  ? 284  HIS B ND1   1 
ATOM   6305 C CD2   . HIS B 1 284 ? 22.503  -16.829 -47.469 1.00 80.11  ? 284  HIS B CD2   1 
ATOM   6306 C CE1   . HIS B 1 284 ? 22.902  -18.090 -45.720 1.00 82.68  ? 284  HIS B CE1   1 
ATOM   6307 N NE2   . HIS B 1 284 ? 22.832  -18.091 -47.040 1.00 82.25  ? 284  HIS B NE2   1 
ATOM   6308 N N     . GLU B 1 285 ? 19.650  -12.268 -44.964 1.00 74.28  ? 285  GLU B N     1 
ATOM   6309 C CA    . GLU B 1 285 ? 19.552  -10.855 -44.598 1.00 73.08  ? 285  GLU B CA    1 
ATOM   6310 C C     . GLU B 1 285 ? 19.860  -10.609 -43.115 1.00 73.41  ? 285  GLU B C     1 
ATOM   6311 O O     . GLU B 1 285 ? 20.555  -9.653  -42.758 1.00 72.64  ? 285  GLU B O     1 
ATOM   6312 C CB    . GLU B 1 285 ? 18.154  -10.337 -44.920 1.00 71.38  ? 285  GLU B CB    1 
ATOM   6313 C CG    . GLU B 1 285 ? 18.109  -8.843  -45.059 1.00 71.15  ? 285  GLU B CG    1 
ATOM   6314 C CD    . GLU B 1 285 ? 16.709  -8.306  -45.233 1.00 69.77  ? 285  GLU B CD    1 
ATOM   6315 O OE1   . GLU B 1 285 ? 15.997  -8.804  -46.132 1.00 70.11  ? 285  GLU B OE1   1 
ATOM   6316 O OE2   . GLU B 1 285 ? 16.347  -7.372  -44.477 1.00 70.17  ? 285  GLU B OE2   1 
ATOM   6317 N N     . TRP B 1 286 ? 19.336  -11.486 -42.263 1.00 74.57  ? 286  TRP B N     1 
ATOM   6318 C CA    . TRP B 1 286 ? 19.448  -11.329 -40.824 1.00 74.85  ? 286  TRP B CA    1 
ATOM   6319 C C     . TRP B 1 286 ? 20.736  -11.908 -40.266 1.00 76.36  ? 286  TRP B C     1 
ATOM   6320 O O     . TRP B 1 286 ? 21.008  -11.751 -39.082 1.00 77.34  ? 286  TRP B O     1 
ATOM   6321 C CB    . TRP B 1 286 ? 18.238  -11.956 -40.125 1.00 75.44  ? 286  TRP B CB    1 
ATOM   6322 C CG    . TRP B 1 286 ? 16.960  -11.232 -40.439 1.00 74.83  ? 286  TRP B CG    1 
ATOM   6323 C CD1   . TRP B 1 286 ? 16.016  -11.592 -41.361 1.00 75.23  ? 286  TRP B CD1   1 
ATOM   6324 C CD2   . TRP B 1 286 ? 16.500  -10.004 -39.856 1.00 73.96  ? 286  TRP B CD2   1 
ATOM   6325 N NE1   . TRP B 1 286 ? 14.997  -10.678 -41.375 1.00 73.90  ? 286  TRP B NE1   1 
ATOM   6326 C CE2   . TRP B 1 286 ? 15.266  -9.692  -40.462 1.00 73.07  ? 286  TRP B CE2   1 
ATOM   6327 C CE3   . TRP B 1 286 ? 17.009  -9.142  -38.874 1.00 73.16  ? 286  TRP B CE3   1 
ATOM   6328 C CZ2   . TRP B 1 286 ? 14.530  -8.554  -40.121 1.00 71.51  ? 286  TRP B CZ2   1 
ATOM   6329 C CZ3   . TRP B 1 286 ? 16.276  -8.007  -38.539 1.00 72.08  ? 286  TRP B CZ3   1 
ATOM   6330 C CH2   . TRP B 1 286 ? 15.050  -7.724  -39.162 1.00 71.02  ? 286  TRP B CH2   1 
ATOM   6331 N N     . HIS B 1 287 ? 21.547  -12.547 -41.102 1.00 77.21  ? 287  HIS B N     1 
ATOM   6332 C CA    . HIS B 1 287 ? 22.781  -13.159 -40.616 1.00 78.67  ? 287  HIS B CA    1 
ATOM   6333 C C     . HIS B 1 287 ? 23.976  -12.210 -40.560 1.00 77.84  ? 287  HIS B C     1 
ATOM   6334 O O     . HIS B 1 287 ? 25.064  -12.643 -40.192 1.00 79.74  ? 287  HIS B O     1 
ATOM   6335 C CB    . HIS B 1 287 ? 23.143  -14.390 -41.455 1.00 80.64  ? 287  HIS B CB    1 
ATOM   6336 C CG    . HIS B 1 287 ? 22.086  -15.448 -41.452 1.00 81.94  ? 287  HIS B CG    1 
ATOM   6337 N ND1   . HIS B 1 287 ? 22.042  -16.459 -42.387 1.00 84.25  ? 287  HIS B ND1   1 
ATOM   6338 C CD2   . HIS B 1 287 ? 21.021  -15.639 -40.639 1.00 82.55  ? 287  HIS B CD2   1 
ATOM   6339 C CE1   . HIS B 1 287 ? 21.002  -17.236 -42.141 1.00 85.13  ? 287  HIS B CE1   1 
ATOM   6340 N NE2   . HIS B 1 287 ? 20.364  -16.757 -41.087 1.00 84.16  ? 287  HIS B NE2   1 
ATOM   6341 N N     . VAL B 1 288 ? 23.790  -10.934 -40.899 1.00 75.28  ? 288  VAL B N     1 
ATOM   6342 C CA    . VAL B 1 288 ? 24.921  -9.996  -41.007 1.00 74.72  ? 288  VAL B CA    1 
ATOM   6343 C C     . VAL B 1 288 ? 25.014  -8.992  -39.869 1.00 73.85  ? 288  VAL B C     1 
ATOM   6344 O O     . VAL B 1 288 ? 25.948  -8.192  -39.836 1.00 73.46  ? 288  VAL B O     1 
ATOM   6345 C CB    . VAL B 1 288 ? 24.916  -9.223  -42.349 1.00 73.68  ? 288  VAL B CB    1 
ATOM   6346 C CG1   . VAL B 1 288 ? 25.097  -10.185 -43.510 1.00 74.42  ? 288  VAL B CG1   1 
ATOM   6347 C CG2   . VAL B 1 288 ? 23.643  -8.393  -42.502 1.00 71.44  ? 288  VAL B CG2   1 
ATOM   6348 N N     . LEU B 1 289 ? 24.062  -9.039  -38.940 1.00 73.50  ? 289  LEU B N     1 
ATOM   6349 C CA    . LEU B 1 289 ? 24.068  -8.144  -37.786 1.00 73.39  ? 289  LEU B CA    1 
ATOM   6350 C C     . LEU B 1 289 ? 25.220  -8.528  -36.841 1.00 75.16  ? 289  LEU B C     1 
ATOM   6351 O O     . LEU B 1 289 ? 25.488  -9.711  -36.655 1.00 76.85  ? 289  LEU B O     1 
ATOM   6352 C CB    . LEU B 1 289 ? 22.712  -8.177  -37.053 1.00 72.31  ? 289  LEU B CB    1 
ATOM   6353 C CG    . LEU B 1 289 ? 21.549  -7.399  -37.687 1.00 70.16  ? 289  LEU B CG    1 
ATOM   6354 C CD1   . LEU B 1 289 ? 20.228  -7.693  -36.961 1.00 69.11  ? 289  LEU B CD1   1 
ATOM   6355 C CD2   . LEU B 1 289 ? 21.830  -5.894  -37.711 1.00 66.63  ? 289  LEU B CD2   1 
ATOM   6356 N N     . PRO B 1 290 ? 25.909  -7.525  -36.255 1.00 75.31  ? 290  PRO B N     1 
ATOM   6357 C CA    . PRO B 1 290 ? 27.122  -7.759  -35.446 1.00 77.45  ? 290  PRO B CA    1 
ATOM   6358 C C     . PRO B 1 290 ? 26.907  -8.430  -34.080 1.00 78.74  ? 290  PRO B C     1 
ATOM   6359 O O     . PRO B 1 290 ? 27.823  -9.062  -33.572 1.00 80.82  ? 290  PRO B O     1 
ATOM   6360 C CB    . PRO B 1 290 ? 27.708  -6.353  -35.270 1.00 76.55  ? 290  PRO B CB    1 
ATOM   6361 C CG    . PRO B 1 290 ? 26.545  -5.429  -35.412 1.00 74.02  ? 290  PRO B CG    1 
ATOM   6362 C CD    . PRO B 1 290 ? 25.568  -6.093  -36.344 1.00 73.22  ? 290  PRO B CD    1 
ATOM   6363 N N     . GLN B 1 291 ? 25.724  -8.276  -33.491 1.00 78.43  ? 291  GLN B N     1 
ATOM   6364 C CA    . GLN B 1 291 ? 25.360  -8.966  -32.251 1.00 79.63  ? 291  GLN B CA    1 
ATOM   6365 C C     . GLN B 1 291 ? 23.911  -9.425  -32.293 1.00 79.38  ? 291  GLN B C     1 
ATOM   6366 O O     . GLN B 1 291 ? 23.106  -8.932  -33.096 1.00 77.98  ? 291  GLN B O     1 
ATOM   6367 C CB    . GLN B 1 291 ? 25.503  -8.057  -31.021 1.00 79.76  ? 291  GLN B CB    1 
ATOM   6368 C CG    . GLN B 1 291 ? 26.802  -7.263  -30.916 1.00 81.36  ? 291  GLN B CG    1 
ATOM   6369 C CD    . GLN B 1 291 ? 26.723  -5.924  -31.612 1.00 80.18  ? 291  GLN B CD    1 
ATOM   6370 O OE1   . GLN B 1 291 ? 27.707  -5.183  -31.679 1.00 80.64  ? 291  GLN B OE1   1 
ATOM   6371 N NE2   . GLN B 1 291 ? 25.546  -5.604  -32.135 1.00 79.44  ? 291  GLN B NE2   1 
ATOM   6372 N N     . GLU B 1 292 ? 23.594  -10.356 -31.395 1.00 80.94  ? 292  GLU B N     1 
ATOM   6373 C CA    . GLU B 1 292 ? 22.214  -10.714 -31.062 1.00 80.56  ? 292  GLU B CA    1 
ATOM   6374 C C     . GLU B 1 292 ? 21.491  -9.453  -30.566 1.00 77.42  ? 292  GLU B C     1 
ATOM   6375 O O     . GLU B 1 292 ? 21.908  -8.825  -29.586 1.00 77.61  ? 292  GLU B O     1 
ATOM   6376 C CB    . GLU B 1 292 ? 22.206  -11.797 -29.968 1.00 82.46  ? 292  GLU B CB    1 
ATOM   6377 C CG    . GLU B 1 292 ? 20.863  -12.511 -29.757 1.00 83.56  ? 292  GLU B CG    1 
ATOM   6378 C CD    . GLU B 1 292 ? 20.885  -13.491 -28.569 1.00 87.34  ? 292  GLU B CD    1 
ATOM   6379 O OE1   . GLU B 1 292 ? 21.986  -13.935 -28.145 1.00 91.90  ? 292  GLU B OE1   1 
ATOM   6380 O OE2   . GLU B 1 292 ? 19.788  -13.823 -28.057 1.00 92.12  ? 292  GLU B OE2   1 
ATOM   6381 N N     . SER B 1 293 ? 20.408  -9.092  -31.235 1.00 74.77  ? 293  SER B N     1 
ATOM   6382 C CA    . SER B 1 293 ? 19.743  -7.829  -30.967 1.00 72.03  ? 293  SER B CA    1 
ATOM   6383 C C     . SER B 1 293 ? 18.266  -7.835  -31.332 1.00 70.42  ? 293  SER B C     1 
ATOM   6384 O O     . SER B 1 293 ? 17.783  -8.725  -32.018 1.00 70.73  ? 293  SER B O     1 
ATOM   6385 C CB    . SER B 1 293 ? 20.450  -6.709  -31.731 1.00 71.06  ? 293  SER B CB    1 
ATOM   6386 O OG    . SER B 1 293 ? 20.488  -6.971  -33.123 1.00 70.50  ? 293  SER B OG    1 
ATOM   6387 N N     . ILE B 1 294 ? 17.550  -6.827  -30.841 1.00 68.61  ? 294  ILE B N     1 
ATOM   6388 C CA    . ILE B 1 294 ? 16.233  -6.489  -31.367 1.00 66.56  ? 294  ILE B CA    1 
ATOM   6389 C C     . ILE B 1 294 ? 16.293  -5.013  -31.704 1.00 64.62  ? 294  ILE B C     1 
ATOM   6390 O O     . ILE B 1 294 ? 17.169  -4.302  -31.220 1.00 64.27  ? 294  ILE B O     1 
ATOM   6391 C CB    . ILE B 1 294 ? 15.073  -6.776  -30.365 1.00 67.09  ? 294  ILE B CB    1 
ATOM   6392 C CG1   . ILE B 1 294 ? 15.340  -6.135  -29.002 1.00 66.54  ? 294  ILE B CG1   1 
ATOM   6393 C CG2   . ILE B 1 294 ? 14.822  -8.281  -30.210 1.00 67.88  ? 294  ILE B CG2   1 
ATOM   6394 C CD1   . ILE B 1 294 ? 14.083  -5.996  -28.164 1.00 66.96  ? 294  ILE B CD1   1 
ATOM   6395 N N     . PHE B 1 295 ? 15.358  -4.562  -32.536 1.00 62.98  ? 295  PHE B N     1 
ATOM   6396 C CA    . PHE B 1 295 ? 15.319  -3.184  -33.007 1.00 60.84  ? 295  PHE B CA    1 
ATOM   6397 C C     . PHE B 1 295 ? 16.614  -2.831  -33.723 1.00 60.49  ? 295  PHE B C     1 
ATOM   6398 O O     . PHE B 1 295 ? 17.109  -1.716  -33.617 1.00 59.95  ? 295  PHE B O     1 
ATOM   6399 C CB    . PHE B 1 295 ? 15.045  -2.208  -31.847 1.00 60.19  ? 295  PHE B CB    1 
ATOM   6400 C CG    . PHE B 1 295 ? 14.085  -1.095  -32.197 1.00 58.56  ? 295  PHE B CG    1 
ATOM   6401 C CD1   . PHE B 1 295 ? 14.301  -0.281  -33.301 1.00 56.72  ? 295  PHE B CD1   1 
ATOM   6402 C CD2   . PHE B 1 295 ? 12.951  -0.869  -31.421 1.00 58.26  ? 295  PHE B CD2   1 
ATOM   6403 C CE1   . PHE B 1 295 ? 13.417  0.724   -33.613 1.00 54.42  ? 295  PHE B CE1   1 
ATOM   6404 C CE2   . PHE B 1 295 ? 12.072  0.146   -31.737 1.00 56.16  ? 295  PHE B CE2   1 
ATOM   6405 C CZ    . PHE B 1 295 ? 12.310  0.936   -32.838 1.00 54.77  ? 295  PHE B CZ    1 
ATOM   6406 N N     . ARG B 1 296 ? 17.155  -3.796  -34.458 1.00 60.97  ? 296  ARG B N     1 
ATOM   6407 C CA    . ARG B 1 296 ? 18.302  -3.563  -35.311 1.00 60.97  ? 296  ARG B CA    1 
ATOM   6408 C C     . ARG B 1 296 ? 18.052  -4.243  -36.640 1.00 61.00  ? 296  ARG B C     1 
ATOM   6409 O O     . ARG B 1 296 ? 17.537  -5.361  -36.683 1.00 62.00  ? 296  ARG B O     1 
ATOM   6410 C CB    . ARG B 1 296 ? 19.568  -4.102  -34.668 1.00 62.43  ? 296  ARG B CB    1 
ATOM   6411 C CG    . ARG B 1 296 ? 19.983  -3.362  -33.417 1.00 62.59  ? 296  ARG B CG    1 
ATOM   6412 C CD    . ARG B 1 296 ? 20.373  -1.937  -33.724 1.00 62.48  ? 296  ARG B CD    1 
ATOM   6413 N NE    . ARG B 1 296 ? 20.895  -1.284  -32.539 1.00 63.16  ? 296  ARG B NE    1 
ATOM   6414 C CZ    . ARG B 1 296 ? 20.161  -0.667  -31.616 1.00 62.47  ? 296  ARG B CZ    1 
ATOM   6415 N NH1   . ARG B 1 296 ? 18.848  -0.568  -31.741 1.00 60.89  ? 296  ARG B NH1   1 
ATOM   6416 N NH2   . ARG B 1 296 ? 20.760  -0.126  -30.554 1.00 62.84  ? 296  ARG B NH2   1 
ATOM   6417 N N     . PHE B 1 297 ? 18.399  -3.546  -37.721 1.00 59.85  ? 297  PHE B N     1 
ATOM   6418 C CA    . PHE B 1 297 ? 18.065  -3.978  -39.068 1.00 59.18  ? 297  PHE B CA    1 
ATOM   6419 C C     . PHE B 1 297 ? 19.319  -3.934  -39.935 1.00 59.48  ? 297  PHE B C     1 
ATOM   6420 O O     . PHE B 1 297 ? 20.163  -3.044  -39.774 1.00 58.95  ? 297  PHE B O     1 
ATOM   6421 C CB    . PHE B 1 297 ? 16.936  -3.105  -39.597 1.00 57.91  ? 297  PHE B CB    1 
ATOM   6422 C CG    . PHE B 1 297 ? 15.904  -2.783  -38.541 1.00 57.35  ? 297  PHE B CG    1 
ATOM   6423 C CD1   . PHE B 1 297 ? 15.156  -3.803  -37.961 1.00 58.26  ? 297  PHE B CD1   1 
ATOM   6424 C CD2   . PHE B 1 297 ? 15.722  -1.487  -38.090 1.00 55.73  ? 297  PHE B CD2   1 
ATOM   6425 C CE1   . PHE B 1 297 ? 14.218  -3.527  -36.955 1.00 57.84  ? 297  PHE B CE1   1 
ATOM   6426 C CE2   . PHE B 1 297 ? 14.791  -1.203  -37.088 1.00 55.44  ? 297  PHE B CE2   1 
ATOM   6427 C CZ    . PHE B 1 297 ? 14.034  -2.227  -36.528 1.00 55.74  ? 297  PHE B CZ    1 
ATOM   6428 N N     . SER B 1 298 ? 19.454  -4.926  -40.816 1.00 59.81  ? 298  SER B N     1 
ATOM   6429 C CA    . SER B 1 298 ? 20.722  -5.171  -41.491 1.00 60.98  ? 298  SER B CA    1 
ATOM   6430 C C     . SER B 1 298 ? 21.051  -4.127  -42.549 1.00 60.27  ? 298  SER B C     1 
ATOM   6431 O O     . SER B 1 298 ? 22.197  -3.679  -42.633 1.00 60.64  ? 298  SER B O     1 
ATOM   6432 C CB    . SER B 1 298 ? 20.743  -6.568  -42.126 1.00 62.46  ? 298  SER B CB    1 
ATOM   6433 O OG    . SER B 1 298 ? 20.543  -7.586  -41.157 1.00 62.59  ? 298  SER B OG    1 
ATOM   6434 N N     . PHE B 1 299 ? 20.059  -3.744  -43.358 1.00 59.07  ? 299  PHE B N     1 
ATOM   6435 C CA    . PHE B 1 299 ? 20.307  -2.823  -44.469 1.00 58.30  ? 299  PHE B CA    1 
ATOM   6436 C C     . PHE B 1 299 ? 19.413  -1.596  -44.352 1.00 57.25  ? 299  PHE B C     1 
ATOM   6437 O O     . PHE B 1 299 ? 18.216  -1.662  -44.590 1.00 56.89  ? 299  PHE B O     1 
ATOM   6438 C CB    . PHE B 1 299 ? 20.160  -3.550  -45.804 1.00 58.76  ? 299  PHE B CB    1 
ATOM   6439 C CG    . PHE B 1 299 ? 21.127  -4.689  -45.949 1.00 59.31  ? 299  PHE B CG    1 
ATOM   6440 C CD1   . PHE B 1 299 ? 22.431  -4.452  -46.365 1.00 60.60  ? 299  PHE B CD1   1 
ATOM   6441 C CD2   . PHE B 1 299 ? 20.762  -5.970  -45.586 1.00 59.19  ? 299  PHE B CD2   1 
ATOM   6442 C CE1   . PHE B 1 299 ? 23.361  -5.490  -46.453 1.00 62.07  ? 299  PHE B CE1   1 
ATOM   6443 C CE2   . PHE B 1 299 ? 21.667  -7.014  -45.672 1.00 61.33  ? 299  PHE B CE2   1 
ATOM   6444 C CZ    . PHE B 1 299 ? 22.978  -6.771  -46.107 1.00 62.84  ? 299  PHE B CZ    1 
ATOM   6445 N N     . VAL B 1 300 ? 20.044  -0.487  -43.963 1.00 56.70  ? 300  VAL B N     1 
ATOM   6446 C CA    . VAL B 1 300 ? 19.388  0.746   -43.592 1.00 55.45  ? 300  VAL B CA    1 
ATOM   6447 C C     . VAL B 1 300 ? 20.176  1.885   -44.256 1.00 55.77  ? 300  VAL B C     1 
ATOM   6448 O O     . VAL B 1 300 ? 21.244  1.648   -44.845 1.00 56.60  ? 300  VAL B O     1 
ATOM   6449 C CB    . VAL B 1 300 ? 19.359  0.919   -42.027 1.00 55.25  ? 300  VAL B CB    1 
ATOM   6450 C CG1   . VAL B 1 300 ? 18.601  -0.216  -41.357 1.00 54.73  ? 300  VAL B CG1   1 
ATOM   6451 C CG2   . VAL B 1 300 ? 20.761  1.016   -41.455 1.00 56.25  ? 300  VAL B CG2   1 
ATOM   6452 N N     . PRO B 1 301 ? 19.646  3.118   -44.207 1.00 55.03  ? 301  PRO B N     1 
ATOM   6453 C CA    . PRO B 1 301 ? 20.384  4.259   -44.744 1.00 55.65  ? 301  PRO B CA    1 
ATOM   6454 C C     . PRO B 1 301 ? 21.828  4.351   -44.252 1.00 56.98  ? 301  PRO B C     1 
ATOM   6455 O O     . PRO B 1 301 ? 22.105  4.040   -43.101 1.00 57.73  ? 301  PRO B O     1 
ATOM   6456 C CB    . PRO B 1 301 ? 19.560  5.442   -44.252 1.00 54.75  ? 301  PRO B CB    1 
ATOM   6457 C CG    . PRO B 1 301 ? 18.169  4.915   -44.255 1.00 53.20  ? 301  PRO B CG    1 
ATOM   6458 C CD    . PRO B 1 301 ? 18.302  3.516   -43.752 1.00 53.95  ? 301  PRO B CD    1 
ATOM   6459 N N     . VAL B 1 302 ? 22.742  4.752   -45.128 1.00 57.92  ? 302  VAL B N     1 
ATOM   6460 C CA    . VAL B 1 302 ? 24.162  4.791   -44.793 1.00 58.87  ? 302  VAL B CA    1 
ATOM   6461 C C     . VAL B 1 302 ? 24.651  6.230   -44.827 1.00 59.51  ? 302  VAL B C     1 
ATOM   6462 O O     . VAL B 1 302 ? 24.227  7.002   -45.681 1.00 59.86  ? 302  VAL B O     1 
ATOM   6463 C CB    . VAL B 1 302 ? 25.000  3.932   -45.768 1.00 59.82  ? 302  VAL B CB    1 
ATOM   6464 C CG1   . VAL B 1 302 ? 24.845  4.425   -47.226 1.00 60.43  ? 302  VAL B CG1   1 
ATOM   6465 C CG2   . VAL B 1 302 ? 26.465  3.909   -45.355 1.00 60.11  ? 302  VAL B CG2   1 
ATOM   6466 N N     . VAL B 1 303 ? 25.534  6.589   -43.901 1.00 60.28  ? 303  VAL B N     1 
ATOM   6467 C CA    . VAL B 1 303 ? 26.158  7.901   -43.919 1.00 61.25  ? 303  VAL B CA    1 
ATOM   6468 C C     . VAL B 1 303 ? 27.207  7.858   -45.013 1.00 63.30  ? 303  VAL B C     1 
ATOM   6469 O O     . VAL B 1 303 ? 28.345  7.419   -44.801 1.00 65.29  ? 303  VAL B O     1 
ATOM   6470 C CB    . VAL B 1 303 ? 26.770  8.310   -42.535 1.00 61.65  ? 303  VAL B CB    1 
ATOM   6471 C CG1   . VAL B 1 303 ? 27.269  9.745   -42.567 1.00 61.71  ? 303  VAL B CG1   1 
ATOM   6472 C CG2   . VAL B 1 303 ? 25.736  8.168   -41.439 1.00 60.16  ? 303  VAL B CG2   1 
ATOM   6473 N N     . ASP B 1 304 ? 26.791  8.302   -46.194 1.00 63.74  ? 304  ASP B N     1 
ATOM   6474 C CA    . ASP B 1 304 ? 27.576  8.199   -47.424 1.00 65.26  ? 304  ASP B CA    1 
ATOM   6475 C C     . ASP B 1 304 ? 28.361  9.449   -47.764 1.00 66.81  ? 304  ASP B C     1 
ATOM   6476 O O     . ASP B 1 304 ? 29.199  9.415   -48.664 1.00 68.65  ? 304  ASP B O     1 
ATOM   6477 C CB    . ASP B 1 304 ? 26.661  7.862   -48.618 1.00 64.39  ? 304  ASP B CB    1 
ATOM   6478 C CG    . ASP B 1 304 ? 25.482  8.832   -48.767 1.00 62.99  ? 304  ASP B CG    1 
ATOM   6479 O OD1   . ASP B 1 304 ? 25.233  9.632   -47.849 1.00 60.90  ? 304  ASP B OD1   1 
ATOM   6480 O OD2   . ASP B 1 304 ? 24.787  8.791   -49.803 1.00 63.11  ? 304  ASP B OD2   1 
ATOM   6481 N N     . GLY B 1 305 ? 28.080  10.552  -47.083 1.00 66.84  ? 305  GLY B N     1 
ATOM   6482 C CA    . GLY B 1 305 ? 28.633  11.851  -47.462 1.00 68.31  ? 305  GLY B CA    1 
ATOM   6483 C C     . GLY B 1 305 ? 28.014  12.434  -48.728 1.00 68.56  ? 305  GLY B C     1 
ATOM   6484 O O     . GLY B 1 305 ? 28.545  13.395  -49.282 1.00 69.64  ? 305  GLY B O     1 
ATOM   6485 N N     . ASP B 1 306 ? 26.895  11.862  -49.185 1.00 67.91  ? 306  ASP B N     1 
ATOM   6486 C CA    . ASP B 1 306 ? 26.175  12.342  -50.383 1.00 67.60  ? 306  ASP B CA    1 
ATOM   6487 C C     . ASP B 1 306 ? 24.730  12.656  -49.983 1.00 65.73  ? 306  ASP B C     1 
ATOM   6488 O O     . ASP B 1 306 ? 24.419  13.813  -49.693 1.00 65.34  ? 306  ASP B O     1 
ATOM   6489 C CB    . ASP B 1 306 ? 26.265  11.324  -51.550 1.00 68.34  ? 306  ASP B CB    1 
ATOM   6490 C CG    . ASP B 1 306 ? 25.515  11.782  -52.822 1.00 69.71  ? 306  ASP B CG    1 
ATOM   6491 O OD1   . ASP B 1 306 ? 24.995  12.925  -52.868 1.00 73.59  ? 306  ASP B OD1   1 
ATOM   6492 O OD2   . ASP B 1 306 ? 25.443  10.989  -53.797 1.00 72.96  ? 306  ASP B OD2   1 
ATOM   6493 N N     . PHE B 1 307 ? 23.856  11.643  -49.951 1.00 64.36  ? 307  PHE B N     1 
ATOM   6494 C CA    . PHE B 1 307 ? 22.467  11.846  -49.520 1.00 62.61  ? 307  PHE B CA    1 
ATOM   6495 C C     . PHE B 1 307 ? 22.473  12.437  -48.123 1.00 62.23  ? 307  PHE B C     1 
ATOM   6496 O O     . PHE B 1 307 ? 21.703  13.356  -47.822 1.00 61.16  ? 307  PHE B O     1 
ATOM   6497 C CB    . PHE B 1 307 ? 21.664  10.532  -49.519 1.00 61.49  ? 307  PHE B CB    1 
ATOM   6498 C CG    . PHE B 1 307 ? 20.174  10.736  -49.359 1.00 60.22  ? 307  PHE B CG    1 
ATOM   6499 C CD1   . PHE B 1 307 ? 19.627  11.092  -48.133 1.00 58.35  ? 307  PHE B CD1   1 
ATOM   6500 C CD2   . PHE B 1 307 ? 19.318  10.605  -50.446 1.00 60.25  ? 307  PHE B CD2   1 
ATOM   6501 C CE1   . PHE B 1 307 ? 18.256  11.288  -47.991 1.00 56.84  ? 307  PHE B CE1   1 
ATOM   6502 C CE2   . PHE B 1 307 ? 17.941  10.811  -50.301 1.00 58.27  ? 307  PHE B CE2   1 
ATOM   6503 C CZ    . PHE B 1 307 ? 17.421  11.145  -49.075 1.00 57.07  ? 307  PHE B CZ    1 
ATOM   6504 N N     . LEU B 1 308 ? 23.344  11.869  -47.285 1.00 62.60  ? 308  LEU B N     1 
ATOM   6505 C CA    . LEU B 1 308 ? 23.579  12.328  -45.936 1.00 62.62  ? 308  LEU B CA    1 
ATOM   6506 C C     . LEU B 1 308 ? 25.012  12.839  -45.848 1.00 64.44  ? 308  LEU B C     1 
ATOM   6507 O O     . LEU B 1 308 ? 25.960  12.051  -45.751 1.00 64.98  ? 308  LEU B O     1 
ATOM   6508 C CB    . LEU B 1 308 ? 23.379  11.180  -44.942 1.00 61.94  ? 308  LEU B CB    1 
ATOM   6509 C CG    . LEU B 1 308 ? 21.976  10.609  -44.693 1.00 60.62  ? 308  LEU B CG    1 
ATOM   6510 C CD1   . LEU B 1 308 ? 22.081  9.403   -43.756 1.00 58.64  ? 308  LEU B CD1   1 
ATOM   6511 C CD2   . LEU B 1 308 ? 20.992  11.668  -44.125 1.00 59.02  ? 308  LEU B CD2   1 
ATOM   6512 N N     . SER B 1 309 ? 25.177  14.159  -45.854 1.00 65.50  ? 309  SER B N     1 
ATOM   6513 C CA    . SER B 1 309 ? 26.524  14.756  -45.851 1.00 67.67  ? 309  SER B CA    1 
ATOM   6514 C C     . SER B 1 309 ? 27.333  14.419  -44.586 1.00 68.38  ? 309  SER B C     1 
ATOM   6515 O O     . SER B 1 309 ? 28.549  14.301  -44.640 1.00 70.14  ? 309  SER B O     1 
ATOM   6516 C CB    . SER B 1 309 ? 26.435  16.272  -46.044 1.00 68.14  ? 309  SER B CB    1 
ATOM   6517 O OG    . SER B 1 309 ? 25.507  16.847  -45.137 1.00 68.57  ? 309  SER B OG    1 
ATOM   6518 N N     . ASP B 1 310 ? 26.643  14.259  -43.462 1.00 67.77  ? 310  ASP B N     1 
ATOM   6519 C CA    . ASP B 1 310 ? 27.250  13.881  -42.196 1.00 68.32  ? 310  ASP B CA    1 
ATOM   6520 C C     . ASP B 1 310 ? 26.270  12.971  -41.460 1.00 67.06  ? 310  ASP B C     1 
ATOM   6521 O O     . ASP B 1 310 ? 25.182  12.687  -41.969 1.00 66.09  ? 310  ASP B O     1 
ATOM   6522 C CB    . ASP B 1 310 ? 27.499  15.135  -41.371 1.00 69.10  ? 310  ASP B CB    1 
ATOM   6523 C CG    . ASP B 1 310 ? 28.702  15.017  -40.440 1.00 71.49  ? 310  ASP B CG    1 
ATOM   6524 O OD1   . ASP B 1 310 ? 29.071  13.897  -40.020 1.00 72.88  ? 310  ASP B OD1   1 
ATOM   6525 O OD2   . ASP B 1 310 ? 29.268  16.078  -40.112 1.00 74.07  ? 310  ASP B OD2   1 
ATOM   6526 N N     . THR B 1 311 ? 26.640  12.526  -40.263 1.00 67.53  ? 311  THR B N     1 
ATOM   6527 C CA    . THR B 1 311 ? 25.727  11.739  -39.429 1.00 66.54  ? 311  THR B CA    1 
ATOM   6528 C C     . THR B 1 311 ? 24.502  12.595  -39.129 1.00 65.95  ? 311  THR B C     1 
ATOM   6529 O O     . THR B 1 311 ? 24.618  13.806  -38.980 1.00 66.06  ? 311  THR B O     1 
ATOM   6530 C CB    . THR B 1 311 ? 26.362  11.332  -38.077 1.00 67.12  ? 311  THR B CB    1 
ATOM   6531 O OG1   . THR B 1 311 ? 26.609  12.508  -37.292 1.00 67.31  ? 311  THR B OG1   1 
ATOM   6532 C CG2   . THR B 1 311 ? 27.678  10.557  -38.287 1.00 67.28  ? 311  THR B CG2   1 
ATOM   6533 N N     . PRO B 1 312 ? 23.319  11.977  -39.055 1.00 65.52  ? 312  PRO B N     1 
ATOM   6534 C CA    . PRO B 1 312 ? 22.133  12.739  -38.665 1.00 65.18  ? 312  PRO B CA    1 
ATOM   6535 C C     . PRO B 1 312 ? 22.284  13.498  -37.354 1.00 65.86  ? 312  PRO B C     1 
ATOM   6536 O O     . PRO B 1 312 ? 21.741  14.587  -37.230 1.00 65.39  ? 312  PRO B O     1 
ATOM   6537 C CB    . PRO B 1 312 ? 21.050  11.658  -38.540 1.00 64.16  ? 312  PRO B CB    1 
ATOM   6538 C CG    . PRO B 1 312 ? 21.480  10.620  -39.488 1.00 64.23  ? 312  PRO B CG    1 
ATOM   6539 C CD    . PRO B 1 312 ? 22.984  10.578  -39.361 1.00 65.02  ? 312  PRO B CD    1 
ATOM   6540 N N     . GLU B 1 313 ? 23.009  12.915  -36.398 1.00 67.79  ? 313  GLU B N     1 
ATOM   6541 C CA    . GLU B 1 313 ? 23.326  13.567  -35.120 1.00 68.58  ? 313  GLU B CA    1 
ATOM   6542 C C     . GLU B 1 313 ? 24.019  14.902  -35.364 1.00 69.20  ? 313  GLU B C     1 
ATOM   6543 O O     . GLU B 1 313 ? 23.587  15.936  -34.852 1.00 69.05  ? 313  GLU B O     1 
ATOM   6544 C CB    . GLU B 1 313 ? 24.223  12.657  -34.275 1.00 70.00  ? 313  GLU B CB    1 
ATOM   6545 C CG    . GLU B 1 313 ? 24.713  13.247  -32.929 1.00 72.38  ? 313  GLU B CG    1 
ATOM   6546 C CD    . GLU B 1 313 ? 23.864  12.822  -31.712 1.00 77.93  ? 313  GLU B CD    1 
ATOM   6547 O OE1   . GLU B 1 313 ? 22.630  12.539  -31.865 1.00 78.45  ? 313  GLU B OE1   1 
ATOM   6548 O OE2   . GLU B 1 313 ? 24.454  12.780  -30.594 1.00 81.48  ? 313  GLU B OE2   1 
ATOM   6549 N N     . ALA B 1 314 ? 25.091  14.863  -36.150 1.00 70.00  ? 314  ALA B N     1 
ATOM   6550 C CA    . ALA B 1 314 ? 25.806  16.067  -36.550 1.00 71.23  ? 314  ALA B CA    1 
ATOM   6551 C C     . ALA B 1 314 ? 24.903  17.039  -37.307 1.00 70.96  ? 314  ALA B C     1 
ATOM   6552 O O     . ALA B 1 314 ? 24.987  18.251  -37.098 1.00 71.96  ? 314  ALA B O     1 
ATOM   6553 C CB    . ALA B 1 314 ? 27.037  15.714  -37.407 1.00 72.21  ? 314  ALA B CB    1 
ATOM   6554 N N     . LEU B 1 315 ? 24.051  16.511  -38.185 1.00 70.00  ? 315  LEU B N     1 
ATOM   6555 C CA    . LEU B 1 315 ? 23.198  17.347  -39.026 1.00 69.56  ? 315  LEU B CA    1 
ATOM   6556 C C     . LEU B 1 315 ? 22.068  18.037  -38.248 1.00 69.52  ? 315  LEU B C     1 
ATOM   6557 O O     . LEU B 1 315 ? 21.720  19.176  -38.564 1.00 69.80  ? 315  LEU B O     1 
ATOM   6558 C CB    . LEU B 1 315 ? 22.637  16.539  -40.203 1.00 68.56  ? 315  LEU B CB    1 
ATOM   6559 C CG    . LEU B 1 315 ? 23.666  15.985  -41.202 1.00 68.19  ? 315  LEU B CG    1 
ATOM   6560 C CD1   . LEU B 1 315 ? 22.988  15.273  -42.354 1.00 65.30  ? 315  LEU B CD1   1 
ATOM   6561 C CD2   . LEU B 1 315 ? 24.590  17.082  -41.725 1.00 68.69  ? 315  LEU B CD2   1 
ATOM   6562 N N     . ILE B 1 316 ? 21.506  17.368  -37.240 1.00 69.34  ? 316  ILE B N     1 
ATOM   6563 C CA    . ILE B 1 316 ? 20.454  17.986  -36.420 1.00 69.66  ? 316  ILE B CA    1 
ATOM   6564 C C     . ILE B 1 316 ? 21.052  19.010  -35.455 1.00 71.20  ? 316  ILE B C     1 
ATOM   6565 O O     . ILE B 1 316 ? 20.418  20.017  -35.151 1.00 70.99  ? 316  ILE B O     1 
ATOM   6566 C CB    . ILE B 1 316 ? 19.562  16.955  -35.628 1.00 68.65  ? 316  ILE B CB    1 
ATOM   6567 C CG1   . ILE B 1 316 ? 20.342  16.277  -34.491 1.00 69.13  ? 316  ILE B CG1   1 
ATOM   6568 C CG2   . ILE B 1 316 ? 18.947  15.888  -36.569 1.00 66.87  ? 316  ILE B CG2   1 
ATOM   6569 C CD1   . ILE B 1 316 ? 19.512  15.292  -33.672 1.00 68.32  ? 316  ILE B CD1   1 
ATOM   6570 N N     . ASN B 1 317 ? 22.269  18.748  -34.977 1.00 72.90  ? 317  ASN B N     1 
ATOM   6571 C CA    . ASN B 1 317 ? 22.943  19.662  -34.052 1.00 74.27  ? 317  ASN B CA    1 
ATOM   6572 C C     . ASN B 1 317 ? 23.280  20.987  -34.720 1.00 75.65  ? 317  ASN B C     1 
ATOM   6573 O O     . ASN B 1 317 ? 23.250  22.017  -34.064 1.00 76.66  ? 317  ASN B O     1 
ATOM   6574 C CB    . ASN B 1 317 ? 24.227  19.037  -33.473 1.00 75.11  ? 317  ASN B CB    1 
ATOM   6575 C CG    . ASN B 1 317 ? 23.953  17.909  -32.473 1.00 74.90  ? 317  ASN B CG    1 
ATOM   6576 O OD1   . ASN B 1 317 ? 22.808  17.619  -32.129 1.00 75.49  ? 317  ASN B OD1   1 
ATOM   6577 N ND2   . ASN B 1 317 ? 25.016  17.272  -32.003 1.00 75.99  ? 317  ASN B ND2   1 
ATOM   6578 N N     . THR B 1 318 ? 23.580  20.963  -36.017 1.00 76.26  ? 318  THR B N     1 
ATOM   6579 C CA    . THR B 1 318 ? 24.121  22.130  -36.706 1.00 77.99  ? 318  THR B CA    1 
ATOM   6580 C C     . THR B 1 318 ? 23.247  22.702  -37.820 1.00 78.17  ? 318  THR B C     1 
ATOM   6581 O O     . THR B 1 318 ? 23.663  23.644  -38.502 1.00 79.47  ? 318  THR B O     1 
ATOM   6582 C CB    . THR B 1 318 ? 25.485  21.792  -37.351 1.00 79.57  ? 318  THR B CB    1 
ATOM   6583 O OG1   . THR B 1 318 ? 25.282  20.981  -38.520 1.00 78.08  ? 318  THR B OG1   1 
ATOM   6584 C CG2   . THR B 1 318 ? 26.402  21.073  -36.338 1.00 80.06  ? 318  THR B CG2   1 
ATOM   6585 N N     . GLY B 1 319 ? 22.064  22.133  -38.031 1.00 76.98  ? 319  GLY B N     1 
ATOM   6586 C CA    . GLY B 1 319 ? 21.190  22.576  -39.114 1.00 77.09  ? 319  GLY B CA    1 
ATOM   6587 C C     . GLY B 1 319 ? 20.460  23.876  -38.817 1.00 77.66  ? 319  GLY B C     1 
ATOM   6588 O O     . GLY B 1 319 ? 20.324  24.279  -37.664 1.00 77.61  ? 319  GLY B O     1 
ATOM   6589 N N     . ASP B 1 320 ? 20.003  24.538  -39.872 1.00 78.40  ? 320  ASP B N     1 
ATOM   6590 C CA    . ASP B 1 320 ? 19.111  25.675  -39.741 1.00 78.97  ? 320  ASP B CA    1 
ATOM   6591 C C     . ASP B 1 320 ? 17.726  25.245  -40.197 1.00 77.55  ? 320  ASP B C     1 
ATOM   6592 O O     . ASP B 1 320 ? 17.539  24.886  -41.363 1.00 77.27  ? 320  ASP B O     1 
ATOM   6593 C CB    . ASP B 1 320 ? 19.585  26.849  -40.598 1.00 81.24  ? 320  ASP B CB    1 
ATOM   6594 C CG    . ASP B 1 320 ? 18.691  28.075  -40.451 1.00 82.91  ? 320  ASP B CG    1 
ATOM   6595 O OD1   . ASP B 1 320 ? 17.996  28.160  -39.416 1.00 83.69  ? 320  ASP B OD1   1 
ATOM   6596 O OD2   . ASP B 1 320 ? 18.693  28.945  -41.352 1.00 85.71  ? 320  ASP B OD2   1 
ATOM   6597 N N     . PHE B 1 321 ? 16.762  25.290  -39.275 1.00 76.45  ? 321  PHE B N     1 
ATOM   6598 C CA    . PHE B 1 321 ? 15.416  24.787  -39.536 1.00 75.27  ? 321  PHE B CA    1 
ATOM   6599 C C     . PHE B 1 321 ? 14.350  25.869  -39.393 1.00 75.98  ? 321  PHE B C     1 
ATOM   6600 O O     . PHE B 1 321 ? 13.199  25.568  -39.066 1.00 75.39  ? 321  PHE B O     1 
ATOM   6601 C CB    . PHE B 1 321 ? 15.112  23.617  -38.599 1.00 73.66  ? 321  PHE B CB    1 
ATOM   6602 C CG    . PHE B 1 321 ? 16.089  22.481  -38.708 1.00 72.66  ? 321  PHE B CG    1 
ATOM   6603 C CD1   . PHE B 1 321 ? 16.123  21.685  -39.852 1.00 71.83  ? 321  PHE B CD1   1 
ATOM   6604 C CD2   . PHE B 1 321 ? 16.972  22.199  -37.669 1.00 71.56  ? 321  PHE B CD2   1 
ATOM   6605 C CE1   . PHE B 1 321 ? 17.025  20.627  -39.965 1.00 71.12  ? 321  PHE B CE1   1 
ATOM   6606 C CE2   . PHE B 1 321 ? 17.867  21.139  -37.769 1.00 72.06  ? 321  PHE B CE2   1 
ATOM   6607 C CZ    . PHE B 1 321 ? 17.894  20.352  -38.925 1.00 71.54  ? 321  PHE B CZ    1 
ATOM   6608 N N     . GLN B 1 322 ? 14.730  27.113  -39.692 1.00 77.56  ? 322  GLN B N     1 
ATOM   6609 C CA    . GLN B 1 322 ? 13.882  28.284  -39.468 1.00 78.55  ? 322  GLN B CA    1 
ATOM   6610 C C     . GLN B 1 322 ? 12.504  28.199  -40.125 1.00 77.51  ? 322  GLN B C     1 
ATOM   6611 O O     . GLN B 1 322 ? 11.489  28.384  -39.448 1.00 78.00  ? 322  GLN B O     1 
ATOM   6612 C CB    . GLN B 1 322 ? 14.596  29.564  -39.918 1.00 80.85  ? 322  GLN B CB    1 
ATOM   6613 C CG    . GLN B 1 322 ? 15.736  30.021  -38.986 1.00 83.80  ? 322  GLN B CG    1 
ATOM   6614 C CD    . GLN B 1 322 ? 15.351  31.168  -38.050 1.00 87.91  ? 322  GLN B CD    1 
ATOM   6615 O OE1   . GLN B 1 322 ? 14.680  30.962  -37.023 1.00 88.63  ? 322  GLN B OE1   1 
ATOM   6616 N NE2   . GLN B 1 322 ? 15.799  32.383  -38.390 1.00 89.69  ? 322  GLN B NE2   1 
ATOM   6617 N N     . ASP B 1 323 ? 12.436  27.901  -41.416 1.00 76.54  ? 323  ASP B N     1 
ATOM   6618 C CA    . ASP B 1 323 ? 11.123  27.913  -42.091 1.00 75.81  ? 323  ASP B CA    1 
ATOM   6619 C C     . ASP B 1 323 ? 10.509  26.498  -42.223 1.00 73.59  ? 323  ASP B C     1 
ATOM   6620 O O     . ASP B 1 323 ? 9.955   26.144  -43.263 1.00 73.47  ? 323  ASP B O     1 
ATOM   6621 C CB    . ASP B 1 323 ? 11.206  28.652  -43.450 1.00 78.06  ? 323  ASP B CB    1 
ATOM   6622 C CG    . ASP B 1 323 ? 11.168  30.205  -43.303 1.00 81.63  ? 323  ASP B CG    1 
ATOM   6623 O OD1   . ASP B 1 323 ? 10.704  30.883  -44.251 1.00 85.27  ? 323  ASP B OD1   1 
ATOM   6624 O OD2   . ASP B 1 323 ? 11.596  30.758  -42.257 1.00 84.81  ? 323  ASP B OD2   1 
ATOM   6625 N N     . LEU B 1 324 ? 10.589  25.716  -41.142 1.00 70.87  ? 324  LEU B N     1 
ATOM   6626 C CA    . LEU B 1 324 ? 10.076  24.349  -41.101 1.00 68.66  ? 324  LEU B CA    1 
ATOM   6627 C C     . LEU B 1 324 ? 9.084   24.171  -39.947 1.00 66.13  ? 324  LEU B C     1 
ATOM   6628 O O     . LEU B 1 324 ? 9.299   24.680  -38.858 1.00 65.70  ? 324  LEU B O     1 
ATOM   6629 C CB    . LEU B 1 324 ? 11.241  23.369  -40.931 1.00 68.00  ? 324  LEU B CB    1 
ATOM   6630 C CG    . LEU B 1 324 ? 10.930  21.867  -41.057 1.00 67.11  ? 324  LEU B CG    1 
ATOM   6631 C CD1   . LEU B 1 324 ? 10.606  21.479  -42.513 1.00 66.28  ? 324  LEU B CD1   1 
ATOM   6632 C CD2   . LEU B 1 324 ? 12.082  21.047  -40.508 1.00 65.89  ? 324  LEU B CD2   1 
ATOM   6633 N N     . GLN B 1 325 ? 7.989   23.468  -40.206 1.00 64.10  ? 325  GLN B N     1 
ATOM   6634 C CA    . GLN B 1 325 ? 7.078   23.036  -39.160 1.00 62.41  ? 325  GLN B CA    1 
ATOM   6635 C C     . GLN B 1 325 ? 7.119   21.528  -39.094 1.00 60.62  ? 325  GLN B C     1 
ATOM   6636 O O     . GLN B 1 325 ? 7.175   20.857  -40.133 1.00 59.75  ? 325  GLN B O     1 
ATOM   6637 C CB    . GLN B 1 325 ? 5.643   23.490  -39.411 1.00 62.96  ? 325  GLN B CB    1 
ATOM   6638 C CG    . GLN B 1 325 ? 5.461   24.989  -39.564 1.00 64.09  ? 325  GLN B CG    1 
ATOM   6639 C CD    . GLN B 1 325 ? 5.621   25.440  -40.983 1.00 64.18  ? 325  GLN B CD    1 
ATOM   6640 O OE1   . GLN B 1 325 ? 5.097   24.820  -41.896 1.00 65.49  ? 325  GLN B OE1   1 
ATOM   6641 N NE2   . GLN B 1 325 ? 6.358   26.514  -41.183 1.00 65.88  ? 325  GLN B NE2   1 
ATOM   6642 N N     . VAL B 1 326 ? 7.093   21.003  -37.868 1.00 59.31  ? 326  VAL B N     1 
ATOM   6643 C CA    . VAL B 1 326 ? 7.207   19.572  -37.638 1.00 58.22  ? 326  VAL B CA    1 
ATOM   6644 C C     . VAL B 1 326 ? 6.259   19.111  -36.538 1.00 57.49  ? 326  VAL B C     1 
ATOM   6645 O O     . VAL B 1 326 ? 6.139   19.756  -35.510 1.00 57.78  ? 326  VAL B O     1 
ATOM   6646 C CB    . VAL B 1 326 ? 8.663   19.135  -37.283 1.00 58.05  ? 326  VAL B CB    1 
ATOM   6647 C CG1   . VAL B 1 326 ? 8.804   17.621  -37.402 1.00 57.86  ? 326  VAL B CG1   1 
ATOM   6648 C CG2   . VAL B 1 326 ? 9.685   19.792  -38.198 1.00 57.72  ? 326  VAL B CG2   1 
ATOM   6649 N N     . LEU B 1 327 ? 5.582   17.995  -36.792 1.00 56.59  ? 327  LEU B N     1 
ATOM   6650 C CA    . LEU B 1 327 ? 4.778   17.289  -35.805 1.00 56.08  ? 327  LEU B CA    1 
ATOM   6651 C C     . LEU B 1 327 ? 5.476   15.964  -35.478 1.00 54.74  ? 327  LEU B C     1 
ATOM   6652 O O     . LEU B 1 327 ? 5.768   15.180  -36.372 1.00 53.81  ? 327  LEU B O     1 
ATOM   6653 C CB    . LEU B 1 327 ? 3.393   17.041  -36.390 1.00 56.58  ? 327  LEU B CB    1 
ATOM   6654 C CG    . LEU B 1 327 ? 2.339   16.281  -35.592 1.00 57.71  ? 327  LEU B CG    1 
ATOM   6655 C CD1   . LEU B 1 327 ? 2.023   16.989  -34.277 1.00 58.83  ? 327  LEU B CD1   1 
ATOM   6656 C CD2   . LEU B 1 327 ? 1.077   16.143  -36.463 1.00 58.38  ? 327  LEU B CD2   1 
ATOM   6657 N N     . VAL B 1 328 ? 5.796   15.733  -34.211 1.00 54.28  ? 328  VAL B N     1 
ATOM   6658 C CA    . VAL B 1 328 ? 6.447   14.482  -33.825 1.00 54.11  ? 328  VAL B CA    1 
ATOM   6659 C C     . VAL B 1 328 ? 5.738   13.854  -32.645 1.00 54.00  ? 328  VAL B C     1 
ATOM   6660 O O     . VAL B 1 328 ? 5.117   14.550  -31.860 1.00 54.45  ? 328  VAL B O     1 
ATOM   6661 C CB    . VAL B 1 328 ? 7.958   14.659  -33.465 1.00 54.24  ? 328  VAL B CB    1 
ATOM   6662 C CG1   . VAL B 1 328 ? 8.767   14.971  -34.689 1.00 55.11  ? 328  VAL B CG1   1 
ATOM   6663 C CG2   . VAL B 1 328 ? 8.161   15.740  -32.421 1.00 54.48  ? 328  VAL B CG2   1 
ATOM   6664 N N     . GLY B 1 329 ? 5.826   12.534  -32.519 1.00 53.58  ? 329  GLY B N     1 
ATOM   6665 C CA    . GLY B 1 329 ? 5.348   11.904  -31.308 1.00 53.59  ? 329  GLY B CA    1 
ATOM   6666 C C     . GLY B 1 329 ? 5.608   10.433  -31.192 1.00 53.07  ? 329  GLY B C     1 
ATOM   6667 O O     . GLY B 1 329 ? 6.262   9.844   -32.042 1.00 52.84  ? 329  GLY B O     1 
ATOM   6668 N N     . VAL B 1 330 ? 5.088   9.859   -30.110 1.00 53.15  ? 330  VAL B N     1 
ATOM   6669 C CA    . VAL B 1 330 ? 5.356   8.480   -29.718 1.00 53.53  ? 330  VAL B CA    1 
ATOM   6670 C C     . VAL B 1 330 ? 4.066   7.869   -29.190 1.00 54.59  ? 330  VAL B C     1 
ATOM   6671 O O     . VAL B 1 330 ? 3.146   8.601   -28.825 1.00 55.08  ? 330  VAL B O     1 
ATOM   6672 C CB    . VAL B 1 330 ? 6.465   8.414   -28.629 1.00 53.39  ? 330  VAL B CB    1 
ATOM   6673 C CG1   . VAL B 1 330 ? 7.745   9.070   -29.135 1.00 52.88  ? 330  VAL B CG1   1 
ATOM   6674 C CG2   . VAL B 1 330 ? 6.026   9.113   -27.340 1.00 53.41  ? 330  VAL B CG2   1 
ATOM   6675 N N     . VAL B 1 331 ? 3.988   6.539   -29.181 1.00 55.45  ? 331  VAL B N     1 
ATOM   6676 C CA    . VAL B 1 331 ? 2.888   5.833   -28.516 1.00 56.82  ? 331  VAL B CA    1 
ATOM   6677 C C     . VAL B 1 331 ? 3.306   5.508   -27.087 1.00 57.82  ? 331  VAL B C     1 
ATOM   6678 O O     . VAL B 1 331 ? 4.500   5.547   -26.771 1.00 57.49  ? 331  VAL B O     1 
ATOM   6679 C CB    . VAL B 1 331 ? 2.466   4.539   -29.254 1.00 57.10  ? 331  VAL B CB    1 
ATOM   6680 C CG1   . VAL B 1 331 ? 1.932   4.879   -30.645 1.00 56.59  ? 331  VAL B CG1   1 
ATOM   6681 C CG2   . VAL B 1 331 ? 3.617   3.523   -29.323 1.00 56.72  ? 331  VAL B CG2   1 
ATOM   6682 N N     . LYS B 1 332 ? 2.329   5.177   -26.237 1.00 59.21  ? 332  LYS B N     1 
ATOM   6683 C CA    . LYS B 1 332 ? 2.584   4.977   -24.804 1.00 60.05  ? 332  LYS B CA    1 
ATOM   6684 C C     . LYS B 1 332 ? 3.563   3.836   -24.523 1.00 59.94  ? 332  LYS B C     1 
ATOM   6685 O O     . LYS B 1 332 ? 4.312   3.895   -23.552 1.00 59.68  ? 332  LYS B O     1 
ATOM   6686 C CB    . LYS B 1 332 ? 1.270   4.773   -24.015 1.00 61.56  ? 332  LYS B CB    1 
ATOM   6687 C CG    . LYS B 1 332 ? 1.460   4.537   -22.495 1.00 62.36  ? 332  LYS B CG    1 
ATOM   6688 C CD    . LYS B 1 332 ? 0.134   4.484   -21.690 1.00 64.71  ? 332  LYS B CD    1 
ATOM   6689 C CE    . LYS B 1 332 ? 0.077   3.259   -20.689 1.00 68.84  ? 332  LYS B CE    1 
ATOM   6690 N NZ    . LYS B 1 332 ? -0.240  1.849   -21.329 1.00 67.94  ? 332  LYS B NZ    1 
ATOM   6691 N N     . ASP B 1 333 ? 3.575   2.816   -25.375 1.00 60.12  ? 333  ASP B N     1 
ATOM   6692 C CA    . ASP B 1 333 ? 4.395   1.629   -25.128 1.00 60.60  ? 333  ASP B CA    1 
ATOM   6693 C C     . ASP B 1 333 ? 5.224   1.210   -26.335 1.00 59.79  ? 333  ASP B C     1 
ATOM   6694 O O     . ASP B 1 333 ? 5.044   0.122   -26.904 1.00 59.94  ? 333  ASP B O     1 
ATOM   6695 C CB    . ASP B 1 333 ? 3.485   0.497   -24.675 1.00 62.24  ? 333  ASP B CB    1 
ATOM   6696 C CG    . ASP B 1 333 ? 2.787   0.822   -23.391 1.00 62.97  ? 333  ASP B CG    1 
ATOM   6697 O OD1   . ASP B 1 333 ? 1.615   1.264   -23.426 1.00 63.22  ? 333  ASP B OD1   1 
ATOM   6698 O OD2   . ASP B 1 333 ? 3.438   0.665   -22.343 1.00 64.61  ? 333  ASP B OD2   1 
ATOM   6699 N N     . GLU B 1 334 ? 6.152   2.079   -26.700 1.00 58.50  ? 334  GLU B N     1 
ATOM   6700 C CA    . GLU B 1 334 ? 6.989   1.884   -27.894 1.00 57.99  ? 334  GLU B CA    1 
ATOM   6701 C C     . GLU B 1 334 ? 7.728   0.552   -27.947 1.00 58.45  ? 334  GLU B C     1 
ATOM   6702 O O     . GLU B 1 334 ? 7.891   -0.007  -29.024 1.00 59.54  ? 334  GLU B O     1 
ATOM   6703 C CB    . GLU B 1 334 ? 8.018   3.025   -28.031 1.00 57.08  ? 334  GLU B CB    1 
ATOM   6704 C CG    . GLU B 1 334 ? 7.436   4.381   -28.451 1.00 56.57  ? 334  GLU B CG    1 
ATOM   6705 C CD    . GLU B 1 334 ? 6.884   4.393   -29.887 1.00 58.52  ? 334  GLU B CD    1 
ATOM   6706 O OE1   . GLU B 1 334 ? 7.223   3.477   -30.672 1.00 59.03  ? 334  GLU B OE1   1 
ATOM   6707 O OE2   . GLU B 1 334 ? 6.114   5.324   -30.241 1.00 57.90  ? 334  GLU B OE2   1 
ATOM   6708 N N     . GLY B 1 335 ? 8.184   0.037   -26.813 1.00 58.71  ? 335  GLY B N     1 
ATOM   6709 C CA    . GLY B 1 335 ? 9.081   -1.119  -26.821 1.00 59.24  ? 335  GLY B CA    1 
ATOM   6710 C C     . GLY B 1 335 ? 8.454   -2.506  -26.815 1.00 60.41  ? 335  GLY B C     1 
ATOM   6711 O O     . GLY B 1 335 ? 9.082   -3.464  -27.262 1.00 60.72  ? 335  GLY B O     1 
ATOM   6712 N N     . SER B 1 336 ? 7.231   -2.615  -26.301 1.00 60.90  ? 336  SER B N     1 
ATOM   6713 C CA    . SER B 1 336 ? 6.612   -3.899  -26.019 1.00 62.46  ? 336  SER B CA    1 
ATOM   6714 C C     . SER B 1 336 ? 6.593   -4.851  -27.222 1.00 63.11  ? 336  SER B C     1 
ATOM   6715 O O     . SER B 1 336 ? 6.932   -6.022  -27.090 1.00 64.49  ? 336  SER B O     1 
ATOM   6716 C CB    . SER B 1 336 ? 5.188   -3.693  -25.481 1.00 63.10  ? 336  SER B CB    1 
ATOM   6717 O OG    . SER B 1 336 ? 4.340   -3.044  -26.420 1.00 61.68  ? 336  SER B OG    1 
ATOM   6718 N N     . TYR B 1 337 ? 6.219   -4.335  -28.389 1.00 62.34  ? 337  TYR B N     1 
ATOM   6719 C CA    . TYR B 1 337 ? 6.028   -5.148  -29.598 1.00 62.86  ? 337  TYR B CA    1 
ATOM   6720 C C     . TYR B 1 337 ? 7.298   -5.889  -30.013 1.00 62.95  ? 337  TYR B C     1 
ATOM   6721 O O     . TYR B 1 337 ? 7.233   -7.025  -30.487 1.00 63.65  ? 337  TYR B O     1 
ATOM   6722 C CB    . TYR B 1 337 ? 5.478   -4.252  -30.733 1.00 62.34  ? 337  TYR B CB    1 
ATOM   6723 C CG    . TYR B 1 337 ? 5.643   -4.735  -32.156 1.00 62.73  ? 337  TYR B CG    1 
ATOM   6724 C CD1   . TYR B 1 337 ? 4.627   -5.439  -32.811 1.00 64.26  ? 337  TYR B CD1   1 
ATOM   6725 C CD2   . TYR B 1 337 ? 6.800   -4.438  -32.870 1.00 63.18  ? 337  TYR B CD2   1 
ATOM   6726 C CE1   . TYR B 1 337 ? 4.781   -5.863  -34.142 1.00 63.77  ? 337  TYR B CE1   1 
ATOM   6727 C CE2   . TYR B 1 337 ? 6.973   -4.863  -34.196 1.00 63.62  ? 337  TYR B CE2   1 
ATOM   6728 C CZ    . TYR B 1 337 ? 5.966   -5.564  -34.828 1.00 63.57  ? 337  TYR B CZ    1 
ATOM   6729 O OH    . TYR B 1 337 ? 6.164   -5.958  -36.144 1.00 64.23  ? 337  TYR B OH    1 
ATOM   6730 N N     . PHE B 1 338 ? 8.442   -5.249  -29.808 1.00 61.80  ? 338  PHE B N     1 
ATOM   6731 C CA    . PHE B 1 338 ? 9.729   -5.780  -30.244 1.00 62.10  ? 338  PHE B CA    1 
ATOM   6732 C C     . PHE B 1 338 ? 10.264  -6.865  -29.327 1.00 63.55  ? 338  PHE B C     1 
ATOM   6733 O O     . PHE B 1 338 ? 11.117  -7.655  -29.729 1.00 63.83  ? 338  PHE B O     1 
ATOM   6734 C CB    . PHE B 1 338 ? 10.758  -4.654  -30.315 1.00 61.30  ? 338  PHE B CB    1 
ATOM   6735 C CG    . PHE B 1 338 ? 10.418  -3.601  -31.326 1.00 60.37  ? 338  PHE B CG    1 
ATOM   6736 C CD1   . PHE B 1 338 ? 9.639   -2.507  -30.972 1.00 58.56  ? 338  PHE B CD1   1 
ATOM   6737 C CD2   . PHE B 1 338 ? 10.848  -3.727  -32.639 1.00 59.28  ? 338  PHE B CD2   1 
ATOM   6738 C CE1   . PHE B 1 338 ? 9.317   -1.555  -31.900 1.00 58.32  ? 338  PHE B CE1   1 
ATOM   6739 C CE2   . PHE B 1 338 ? 10.532  -2.773  -33.577 1.00 59.17  ? 338  PHE B CE2   1 
ATOM   6740 C CZ    . PHE B 1 338 ? 9.761   -1.678  -33.208 1.00 58.30  ? 338  PHE B CZ    1 
ATOM   6741 N N     . LEU B 1 339 ? 9.767   -6.897  -28.097 1.00 64.03  ? 339  LEU B N     1 
ATOM   6742 C CA    . LEU B 1 339 ? 10.252  -7.849  -27.109 1.00 65.59  ? 339  LEU B CA    1 
ATOM   6743 C C     . LEU B 1 339 ? 9.995   -9.289  -27.529 1.00 67.10  ? 339  LEU B C     1 
ATOM   6744 O O     . LEU B 1 339 ? 10.815  -10.168 -27.271 1.00 67.90  ? 339  LEU B O     1 
ATOM   6745 C CB    . LEU B 1 339 ? 9.635   -7.566  -25.734 1.00 65.76  ? 339  LEU B CB    1 
ATOM   6746 C CG    . LEU B 1 339 ? 9.989   -6.182  -25.173 1.00 63.53  ? 339  LEU B CG    1 
ATOM   6747 C CD1   . LEU B 1 339 ? 9.337   -5.924  -23.811 1.00 61.85  ? 339  LEU B CD1   1 
ATOM   6748 C CD2   . LEU B 1 339 ? 11.504  -6.017  -25.109 1.00 62.07  ? 339  LEU B CD2   1 
ATOM   6749 N N     . VAL B 1 340 ? 8.874   -9.513  -28.204 1.00 67.53  ? 340  VAL B N     1 
ATOM   6750 C CA    . VAL B 1 340 ? 8.470   -10.858 -28.608 1.00 69.37  ? 340  VAL B CA    1 
ATOM   6751 C C     . VAL B 1 340 ? 9.247   -11.361 -29.835 1.00 70.12  ? 340  VAL B C     1 
ATOM   6752 O O     . VAL B 1 340 ? 9.134   -12.523 -30.204 1.00 71.29  ? 340  VAL B O     1 
ATOM   6753 C CB    . VAL B 1 340 ? 6.939   -10.930 -28.861 1.00 69.70  ? 340  VAL B CB    1 
ATOM   6754 C CG1   . VAL B 1 340 ? 6.177   -10.493 -27.607 1.00 68.88  ? 340  VAL B CG1   1 
ATOM   6755 C CG2   . VAL B 1 340 ? 6.526   -10.091 -30.071 1.00 66.35  ? 340  VAL B CG2   1 
ATOM   6756 N N     . TYR B 1 341 ? 10.047  -10.476 -30.438 1.00 69.59  ? 341  TYR B N     1 
ATOM   6757 C CA    . TYR B 1 341 ? 10.861  -10.796 -31.601 1.00 69.99  ? 341  TYR B CA    1 
ATOM   6758 C C     . TYR B 1 341 ? 12.328  -11.054 -31.254 1.00 71.19  ? 341  TYR B C     1 
ATOM   6759 O O     . TYR B 1 341 ? 13.203  -10.839 -32.094 1.00 71.19  ? 341  TYR B O     1 
ATOM   6760 C CB    . TYR B 1 341 ? 10.754  -9.664  -32.632 1.00 68.23  ? 341  TYR B CB    1 
ATOM   6761 C CG    . TYR B 1 341 ? 9.445   -9.704  -33.378 1.00 68.41  ? 341  TYR B CG    1 
ATOM   6762 C CD1   . TYR B 1 341 ? 8.383   -8.879  -33.021 1.00 66.47  ? 341  TYR B CD1   1 
ATOM   6763 C CD2   . TYR B 1 341 ? 9.253   -10.615 -34.414 1.00 68.54  ? 341  TYR B CD2   1 
ATOM   6764 C CE1   . TYR B 1 341 ? 7.165   -8.950  -33.697 1.00 66.84  ? 341  TYR B CE1   1 
ATOM   6765 C CE2   . TYR B 1 341 ? 8.057   -10.685 -35.087 1.00 68.58  ? 341  TYR B CE2   1 
ATOM   6766 C CZ    . TYR B 1 341 ? 7.014   -9.858  -34.728 1.00 67.86  ? 341  TYR B CZ    1 
ATOM   6767 O OH    . TYR B 1 341 ? 5.826   -9.961  -35.417 1.00 69.13  ? 341  TYR B OH    1 
ATOM   6768 N N     . GLY B 1 342 ? 12.615  -11.521 -30.040 1.00 72.58  ? 342  GLY B N     1 
ATOM   6769 C CA    . GLY B 1 342 ? 14.006  -11.832 -29.687 1.00 73.59  ? 342  GLY B CA    1 
ATOM   6770 C C     . GLY B 1 342 ? 14.408  -11.972 -28.226 1.00 74.34  ? 342  GLY B C     1 
ATOM   6771 O O     . GLY B 1 342 ? 15.366  -12.679 -27.930 1.00 76.54  ? 342  GLY B O     1 
ATOM   6772 N N     . VAL B 1 343 ? 13.714  -11.307 -27.312 1.00 73.30  ? 343  VAL B N     1 
ATOM   6773 C CA    . VAL B 1 343 ? 14.091  -11.380 -25.901 1.00 73.95  ? 343  VAL B CA    1 
ATOM   6774 C C     . VAL B 1 343 ? 13.443  -12.594 -25.250 1.00 75.99  ? 343  VAL B C     1 
ATOM   6775 O O     . VAL B 1 343 ? 12.215  -12.690 -25.226 1.00 76.14  ? 343  VAL B O     1 
ATOM   6776 C CB    . VAL B 1 343 ? 13.691  -10.119 -25.101 1.00 72.35  ? 343  VAL B CB    1 
ATOM   6777 C CG1   . VAL B 1 343 ? 14.290  -10.181 -23.702 1.00 71.34  ? 343  VAL B CG1   1 
ATOM   6778 C CG2   . VAL B 1 343 ? 14.141  -8.858  -25.831 1.00 70.06  ? 343  VAL B CG2   1 
ATOM   6779 N N     . PRO B 1 344 ? 14.258  -13.518 -24.708 1.00 77.72  ? 344  PRO B N     1 
ATOM   6780 C CA    . PRO B 1 344 ? 13.651  -14.673 -24.042 1.00 80.08  ? 344  PRO B CA    1 
ATOM   6781 C C     . PRO B 1 344 ? 12.751  -14.285 -22.862 1.00 80.15  ? 344  PRO B C     1 
ATOM   6782 O O     . PRO B 1 344 ? 13.056  -13.332 -22.139 1.00 78.91  ? 344  PRO B O     1 
ATOM   6783 C CB    . PRO B 1 344 ? 14.864  -15.500 -23.573 1.00 81.89  ? 344  PRO B CB    1 
ATOM   6784 C CG    . PRO B 1 344 ? 15.998  -15.047 -24.430 1.00 80.84  ? 344  PRO B CG    1 
ATOM   6785 C CD    . PRO B 1 344 ? 15.729  -13.585 -24.683 1.00 78.32  ? 344  PRO B CD    1 
ATOM   6786 N N     . GLY B 1 345 ? 11.650  -15.029 -22.706 1.00 81.51  ? 345  GLY B N     1 
ATOM   6787 C CA    . GLY B 1 345 ? 10.640  -14.783 -21.673 1.00 81.85  ? 345  GLY B CA    1 
ATOM   6788 C C     . GLY B 1 345 ? 9.397   -14.064 -22.186 1.00 80.58  ? 345  GLY B C     1 
ATOM   6789 O O     . GLY B 1 345 ? 8.356   -14.054 -21.514 1.00 81.15  ? 345  GLY B O     1 
ATOM   6790 N N     . PHE B 1 346 ? 9.501   -13.469 -23.377 1.00 78.80  ? 346  PHE B N     1 
ATOM   6791 C CA    . PHE B 1 346 ? 8.441   -12.631 -23.929 1.00 77.20  ? 346  PHE B CA    1 
ATOM   6792 C C     . PHE B 1 346 ? 7.682   -13.308 -25.063 1.00 78.03  ? 346  PHE B C     1 
ATOM   6793 O O     . PHE B 1 346 ? 8.277   -13.937 -25.931 1.00 78.51  ? 346  PHE B O     1 
ATOM   6794 C CB    . PHE B 1 346 ? 9.029   -11.304 -24.388 1.00 74.68  ? 346  PHE B CB    1 
ATOM   6795 C CG    . PHE B 1 346 ? 9.484   -10.440 -23.255 1.00 73.64  ? 346  PHE B CG    1 
ATOM   6796 C CD1   . PHE B 1 346 ? 10.744  -10.590 -22.718 1.00 73.92  ? 346  PHE B CD1   1 
ATOM   6797 C CD2   . PHE B 1 346 ? 8.635   -9.505  -22.701 1.00 72.61  ? 346  PHE B CD2   1 
ATOM   6798 C CE1   . PHE B 1 346 ? 11.156  -9.811  -21.662 1.00 73.71  ? 346  PHE B CE1   1 
ATOM   6799 C CE2   . PHE B 1 346 ? 9.043   -8.722  -21.647 1.00 72.25  ? 346  PHE B CE2   1 
ATOM   6800 C CZ    . PHE B 1 346 ? 10.304  -8.874  -21.127 1.00 73.06  ? 346  PHE B CZ    1 
ATOM   6801 N N     . SER B 1 347 ? 6.359   -13.156 -25.036 1.00 78.58  ? 347  SER B N     1 
ATOM   6802 C CA    . SER B 1 347 ? 5.452   -13.851 -25.942 1.00 79.41  ? 347  SER B CA    1 
ATOM   6803 C C     . SER B 1 347 ? 4.085   -13.191 -25.894 1.00 79.32  ? 347  SER B C     1 
ATOM   6804 O O     . SER B 1 347 ? 3.660   -12.731 -24.837 1.00 79.73  ? 347  SER B O     1 
ATOM   6805 C CB    . SER B 1 347 ? 5.306   -15.310 -25.520 1.00 81.93  ? 347  SER B CB    1 
ATOM   6806 O OG    . SER B 1 347 ? 4.284   -15.963 -26.266 1.00 83.01  ? 347  SER B OG    1 
ATOM   6807 N N     . LYS B 1 348 ? 3.392   -13.156 -27.029 1.00 79.24  ? 348  LYS B N     1 
ATOM   6808 C CA    . LYS B 1 348 ? 2.031   -12.624 -27.072 1.00 79.49  ? 348  LYS B CA    1 
ATOM   6809 C C     . LYS B 1 348 ? 1.039   -13.555 -26.372 1.00 82.29  ? 348  LYS B C     1 
ATOM   6810 O O     . LYS B 1 348 ? -0.036  -13.119 -25.959 1.00 82.69  ? 348  LYS B O     1 
ATOM   6811 C CB    . LYS B 1 348 ? 1.575   -12.370 -28.518 1.00 78.47  ? 348  LYS B CB    1 
ATOM   6812 C CG    . LYS B 1 348 ? 1.027   -13.591 -29.254 1.00 80.38  ? 348  LYS B CG    1 
ATOM   6813 C CD    . LYS B 1 348 ? 0.094   -13.204 -30.382 1.00 79.67  ? 348  LYS B CD    1 
ATOM   6814 C CE    . LYS B 1 348 ? -0.315  -14.419 -31.189 1.00 81.31  ? 348  LYS B CE    1 
ATOM   6815 N NZ    . LYS B 1 348 ? -1.281  -15.286 -30.478 1.00 83.95  ? 348  LYS B NZ    1 
ATOM   6816 N N     . ASP B 1 349 ? 1.399   -14.834 -26.258 1.00 84.50  ? 349  ASP B N     1 
ATOM   6817 C CA    . ASP B 1 349 ? 0.486   -15.855 -25.764 1.00 87.51  ? 349  ASP B CA    1 
ATOM   6818 C C     . ASP B 1 349 ? 0.466   -16.022 -24.238 1.00 89.07  ? 349  ASP B C     1 
ATOM   6819 O O     . ASP B 1 349 ? -0.346  -16.798 -23.728 1.00 91.70  ? 349  ASP B O     1 
ATOM   6820 C CB    . ASP B 1 349 ? 0.787   -17.202 -26.447 1.00 89.00  ? 349  ASP B CB    1 
ATOM   6821 C CG    . ASP B 1 349 ? 0.500   -17.174 -27.942 1.00 88.49  ? 349  ASP B CG    1 
ATOM   6822 O OD1   . ASP B 1 349 ? -0.443  -16.457 -28.336 1.00 87.69  ? 349  ASP B OD1   1 
ATOM   6823 O OD2   . ASP B 1 349 ? 1.202   -17.875 -28.720 1.00 88.49  ? 349  ASP B OD2   1 
ATOM   6824 N N     . ASN B 1 350 ? 1.346   -15.329 -23.513 1.00 88.00  ? 350  ASN B N     1 
ATOM   6825 C CA    . ASN B 1 350 ? 1.243   -15.255 -22.042 1.00 89.21  ? 350  ASN B CA    1 
ATOM   6826 C C     . ASN B 1 350 ? 1.484   -13.832 -21.510 1.00 86.84  ? 350  ASN B C     1 
ATOM   6827 O O     . ASN B 1 350 ? 1.661   -12.899 -22.294 1.00 84.64  ? 350  ASN B O     1 
ATOM   6828 C CB    . ASN B 1 350 ? 2.107   -16.340 -21.337 1.00 91.47  ? 350  ASN B CB    1 
ATOM   6829 C CG    . ASN B 1 350 ? 3.621   -16.233 -21.621 1.00 92.75  ? 350  ASN B CG    1 
ATOM   6830 O OD1   . ASN B 1 350 ? 4.162   -15.147 -21.875 1.00 90.03  ? 350  ASN B OD1   1 
ATOM   6831 N ND2   . ASN B 1 350 ? 4.315   -17.393 -21.509 1.00 98.64  ? 350  ASN B ND2   1 
ATOM   6832 N N     . GLU B 1 351 ? 1.446   -13.659 -20.191 1.00 87.37  ? 351  GLU B N     1 
ATOM   6833 C CA    . GLU B 1 351 ? 1.595   -12.332 -19.574 1.00 85.74  ? 351  GLU B CA    1 
ATOM   6834 C C     . GLU B 1 351 ? 3.043   -11.827 -19.559 1.00 83.12  ? 351  GLU B C     1 
ATOM   6835 O O     . GLU B 1 351 ? 3.284   -10.685 -19.202 1.00 81.82  ? 351  GLU B O     1 
ATOM   6836 C CB    . GLU B 1 351 ? 1.018   -12.314 -18.149 1.00 87.16  ? 351  GLU B CB    1 
ATOM   6837 C CG    . GLU B 1 351 ? -0.480  -12.029 -18.083 1.00 88.75  ? 351  GLU B CG    1 
ATOM   6838 C CD    . GLU B 1 351 ? -1.068  -12.214 -16.675 1.00 91.44  ? 351  GLU B CD    1 
ATOM   6839 O OE1   . GLU B 1 351 ? -0.670  -11.488 -15.735 1.00 92.39  ? 351  GLU B OE1   1 
ATOM   6840 O OE2   . GLU B 1 351 ? -1.940  -13.096 -16.509 1.00 96.91  ? 351  GLU B OE2   1 
ATOM   6841 N N     . SER B 1 352 ? 3.988   -12.679 -19.949 1.00 82.74  ? 352  SER B N     1 
ATOM   6842 C CA    . SER B 1 352 ? 5.397   -12.317 -20.094 1.00 80.79  ? 352  SER B CA    1 
ATOM   6843 C C     . SER B 1 352 ? 6.021   -11.768 -18.813 1.00 80.56  ? 352  SER B C     1 
ATOM   6844 O O     . SER B 1 352 ? 6.812   -10.819 -18.840 1.00 78.84  ? 352  SER B O     1 
ATOM   6845 C CB    . SER B 1 352 ? 5.596   -11.360 -21.272 1.00 78.29  ? 352  SER B CB    1 
ATOM   6846 O OG    . SER B 1 352 ? 5.342   -12.037 -22.486 1.00 77.64  ? 352  SER B OG    1 
ATOM   6847 N N     . LEU B 1 353 ? 5.670   -12.393 -17.694 1.00 82.05  ? 353  LEU B N     1 
ATOM   6848 C CA    . LEU B 1 353 ? 6.272   -12.076 -16.409 1.00 82.39  ? 353  LEU B CA    1 
ATOM   6849 C C     . LEU B 1 353 ? 7.681   -12.666 -16.370 1.00 82.82  ? 353  LEU B C     1 
ATOM   6850 O O     . LEU B 1 353 ? 7.838   -13.864 -16.535 1.00 85.04  ? 353  LEU B O     1 
ATOM   6851 C CB    . LEU B 1 353 ? 5.408   -12.645 -15.280 1.00 84.31  ? 353  LEU B CB    1 
ATOM   6852 C CG    . LEU B 1 353 ? 4.005   -12.033 -15.163 1.00 84.06  ? 353  LEU B CG    1 
ATOM   6853 C CD1   . LEU B 1 353 ? 3.202   -12.718 -14.065 1.00 86.19  ? 353  LEU B CD1   1 
ATOM   6854 C CD2   . LEU B 1 353 ? 4.064   -10.510 -14.901 1.00 81.13  ? 353  LEU B CD2   1 
ATOM   6855 N N     . ILE B 1 354 ? 8.703   -11.836 -16.158 1.00 81.34  ? 354  ILE B N     1 
ATOM   6856 C CA    . ILE B 1 354 ? 10.093  -12.305 -16.239 1.00 81.45  ? 354  ILE B CA    1 
ATOM   6857 C C     . ILE B 1 354 ? 10.898  -12.127 -14.947 1.00 82.70  ? 354  ILE B C     1 
ATOM   6858 O O     . ILE B 1 354 ? 10.556  -11.321 -14.087 1.00 82.05  ? 354  ILE B O     1 
ATOM   6859 C CB    . ILE B 1 354 ? 10.847  -11.627 -17.391 1.00 79.43  ? 354  ILE B CB    1 
ATOM   6860 C CG1   . ILE B 1 354 ? 10.780  -10.093 -17.270 1.00 76.85  ? 354  ILE B CG1   1 
ATOM   6861 C CG2   . ILE B 1 354 ? 10.275  -12.094 -18.731 1.00 78.23  ? 354  ILE B CG2   1 
ATOM   6862 C CD1   . ILE B 1 354 ? 11.881  -9.369  -18.014 1.00 75.33  ? 354  ILE B CD1   1 
ATOM   6863 N N     . SER B 1 355 ? 11.978  -12.898 -14.837 1.00 84.28  ? 355  SER B N     1 
ATOM   6864 C CA    . SER B 1 355 ? 12.897  -12.819 -13.704 1.00 85.48  ? 355  SER B CA    1 
ATOM   6865 C C     . SER B 1 355 ? 13.891  -11.680 -13.872 1.00 83.75  ? 355  SER B C     1 
ATOM   6866 O O     . SER B 1 355 ? 14.043  -11.118 -14.965 1.00 81.87  ? 355  SER B O     1 
ATOM   6867 C CB    . SER B 1 355 ? 13.699  -14.114 -13.598 1.00 87.96  ? 355  SER B CB    1 
ATOM   6868 O OG    . SER B 1 355 ? 14.576  -14.230 -14.714 1.00 87.84  ? 355  SER B OG    1 
ATOM   6869 N N     . ARG B 1 356 ? 14.601  -11.371 -12.792 1.00 84.59  ? 356  ARG B N     1 
ATOM   6870 C CA    . ARG B 1 356 ? 15.697  -10.414 -12.862 1.00 83.73  ? 356  ARG B CA    1 
ATOM   6871 C C     . ARG B 1 356 ? 16.780  -10.875 -13.842 1.00 83.73  ? 356  ARG B C     1 
ATOM   6872 O O     . ARG B 1 356 ? 17.276  -10.082 -14.635 1.00 82.09  ? 356  ARG B O     1 
ATOM   6873 C CB    . ARG B 1 356 ? 16.307  -10.179 -11.480 1.00 85.16  ? 356  ARG B CB    1 
ATOM   6874 C CG    . ARG B 1 356 ? 17.328  -9.043  -11.471 1.00 85.10  ? 356  ARG B CG    1 
ATOM   6875 C CD    . ARG B 1 356 ? 17.394  -8.346  -10.125 1.00 86.85  ? 356  ARG B CD    1 
ATOM   6876 N NE    . ARG B 1 356 ? 18.240  -7.156  -10.169 1.00 86.22  ? 356  ARG B NE    1 
ATOM   6877 C CZ    . ARG B 1 356 ? 17.887  -5.986  -10.708 1.00 84.66  ? 356  ARG B CZ    1 
ATOM   6878 N NH1   . ARG B 1 356 ? 16.690  -5.822  -11.264 1.00 83.46  ? 356  ARG B NH1   1 
ATOM   6879 N NH2   . ARG B 1 356 ? 18.742  -4.965  -10.686 1.00 83.69  ? 356  ARG B NH2   1 
ATOM   6880 N N     . ALA B 1 357 ? 17.131  -12.161 -13.790 1.00 85.63  ? 357  ALA B N     1 
ATOM   6881 C CA    . ALA B 1 357 ? 18.143  -12.728 -14.685 1.00 85.91  ? 357  ALA B CA    1 
ATOM   6882 C C     . ALA B 1 357 ? 17.794  -12.451 -16.133 1.00 83.62  ? 357  ALA B C     1 
ATOM   6883 O O     . ALA B 1 357 ? 18.659  -12.078 -16.925 1.00 82.67  ? 357  ALA B O     1 
ATOM   6884 C CB    . ALA B 1 357 ? 18.289  -14.251 -14.455 1.00 88.53  ? 357  ALA B CB    1 
ATOM   6885 N N     . GLN B 1 358 ? 16.516  -12.643 -16.458 1.00 82.94  ? 358  GLN B N     1 
ATOM   6886 C CA    . GLN B 1 358 ? 15.990  -12.412 -17.799 1.00 80.94  ? 358  GLN B CA    1 
ATOM   6887 C C     . GLN B 1 358 ? 15.955  -10.922 -18.151 1.00 78.15  ? 358  GLN B C     1 
ATOM   6888 O O     . GLN B 1 358 ? 16.070  -10.552 -19.321 1.00 76.41  ? 358  GLN B O     1 
ATOM   6889 C CB    . GLN B 1 358 ? 14.587  -13.013 -17.921 1.00 81.36  ? 358  GLN B CB    1 
ATOM   6890 C CG    . GLN B 1 358 ? 14.571  -14.531 -17.990 1.00 84.08  ? 358  GLN B CG    1 
ATOM   6891 C CD    . GLN B 1 358 ? 13.164  -15.121 -17.950 1.00 85.03  ? 358  GLN B CD    1 
ATOM   6892 O OE1   . GLN B 1 358 ? 12.334  -14.732 -17.124 1.00 85.99  ? 358  GLN B OE1   1 
ATOM   6893 N NE2   . GLN B 1 358 ? 12.906  -16.092 -18.821 1.00 86.33  ? 358  GLN B NE2   1 
ATOM   6894 N N     . PHE B 1 359 ? 15.781  -10.065 -17.148 1.00 77.41  ? 359  PHE B N     1 
ATOM   6895 C CA    . PHE B 1 359 ? 15.864  -8.622  -17.378 1.00 75.06  ? 359  PHE B CA    1 
ATOM   6896 C C     . PHE B 1 359 ? 17.290  -8.259  -17.783 1.00 74.64  ? 359  PHE B C     1 
ATOM   6897 O O     . PHE B 1 359 ? 17.497  -7.628  -18.823 1.00 72.98  ? 359  PHE B O     1 
ATOM   6898 C CB    . PHE B 1 359 ? 15.415  -7.837  -16.147 1.00 74.86  ? 359  PHE B CB    1 
ATOM   6899 C CG    . PHE B 1 359 ? 15.497  -6.339  -16.308 1.00 72.95  ? 359  PHE B CG    1 
ATOM   6900 C CD1   . PHE B 1 359 ? 16.174  -5.562  -15.378 1.00 73.40  ? 359  PHE B CD1   1 
ATOM   6901 C CD2   . PHE B 1 359 ? 14.900  -5.708  -17.384 1.00 71.05  ? 359  PHE B CD2   1 
ATOM   6902 C CE1   . PHE B 1 359 ? 16.250  -4.187  -15.520 1.00 71.17  ? 359  PHE B CE1   1 
ATOM   6903 C CE2   . PHE B 1 359 ? 14.973  -4.345  -17.529 1.00 69.94  ? 359  PHE B CE2   1 
ATOM   6904 C CZ    . PHE B 1 359 ? 15.652  -3.579  -16.593 1.00 69.53  ? 359  PHE B CZ    1 
ATOM   6905 N N     . LEU B 1 360 ? 18.266  -8.702  -16.990 1.00 76.27  ? 360  LEU B N     1 
ATOM   6906 C CA    . LEU B 1 360 ? 19.682  -8.456  -17.286 1.00 76.70  ? 360  LEU B CA    1 
ATOM   6907 C C     . LEU B 1 360 ? 20.100  -8.955  -18.664 1.00 76.57  ? 360  LEU B C     1 
ATOM   6908 O O     . LEU B 1 360 ? 20.885  -8.303  -19.351 1.00 75.64  ? 360  LEU B O     1 
ATOM   6909 C CB    . LEU B 1 360 ? 20.587  -9.111  -16.242 1.00 79.12  ? 360  LEU B CB    1 
ATOM   6910 C CG    . LEU B 1 360 ? 20.493  -8.686  -14.770 1.00 80.52  ? 360  LEU B CG    1 
ATOM   6911 C CD1   . LEU B 1 360 ? 21.878  -8.787  -14.129 1.00 83.42  ? 360  LEU B CD1   1 
ATOM   6912 C CD2   . LEU B 1 360 ? 19.929  -7.288  -14.572 1.00 78.85  ? 360  LEU B CD2   1 
ATOM   6913 N N     . ALA B 1 361 ? 19.577  -10.115 -19.055 1.00 77.63  ? 361  ALA B N     1 
ATOM   6914 C CA    . ALA B 1 361 ? 19.891  -10.709 -20.350 1.00 77.80  ? 361  ALA B CA    1 
ATOM   6915 C C     . ALA B 1 361 ? 19.202  -9.957  -21.483 1.00 75.77  ? 361  ALA B C     1 
ATOM   6916 O O     . ALA B 1 361 ? 19.746  -9.831  -22.583 1.00 75.49  ? 361  ALA B O     1 
ATOM   6917 C CB    . ALA B 1 361 ? 19.488  -12.192 -20.369 1.00 79.48  ? 361  ALA B CB    1 
ATOM   6918 N N     . GLY B 1 362 ? 17.998  -9.464  -21.216 1.00 74.80  ? 362  GLY B N     1 
ATOM   6919 C CA    . GLY B 1 362 ? 17.239  -8.732  -22.214 1.00 72.76  ? 362  GLY B CA    1 
ATOM   6920 C C     . GLY B 1 362 ? 17.860  -7.391  -22.531 1.00 71.17  ? 362  GLY B C     1 
ATOM   6921 O O     . GLY B 1 362 ? 17.826  -6.938  -23.670 1.00 70.13  ? 362  GLY B O     1 
ATOM   6922 N N     . VAL B 1 363 ? 18.434  -6.750  -21.520 1.00 71.36  ? 363  VAL B N     1 
ATOM   6923 C CA    . VAL B 1 363 ? 19.098  -5.460  -21.713 1.00 69.97  ? 363  VAL B CA    1 
ATOM   6924 C C     . VAL B 1 363 ? 20.296  -5.574  -22.674 1.00 70.62  ? 363  VAL B C     1 
ATOM   6925 O O     . VAL B 1 363 ? 20.514  -4.678  -23.482 1.00 69.16  ? 363  VAL B O     1 
ATOM   6926 C CB    . VAL B 1 363 ? 19.514  -4.832  -20.359 1.00 70.26  ? 363  VAL B CB    1 
ATOM   6927 C CG1   . VAL B 1 363 ? 20.337  -3.554  -20.560 1.00 69.60  ? 363  VAL B CG1   1 
ATOM   6928 C CG2   . VAL B 1 363 ? 18.279  -4.547  -19.508 1.00 68.84  ? 363  VAL B CG2   1 
ATOM   6929 N N     . ARG B 1 364 ? 21.050  -6.674  -22.617 1.00 72.72  ? 364  ARG B N     1 
ATOM   6930 C CA    . ARG B 1 364 ? 22.192  -6.838  -23.512 1.00 73.63  ? 364  ARG B CA    1 
ATOM   6931 C C     . ARG B 1 364 ? 21.712  -6.996  -24.960 1.00 72.91  ? 364  ARG B C     1 
ATOM   6932 O O     . ARG B 1 364 ? 22.331  -6.486  -25.887 1.00 72.04  ? 364  ARG B O     1 
ATOM   6933 C CB    . ARG B 1 364 ? 23.059  -8.034  -23.118 1.00 76.24  ? 364  ARG B CB    1 
ATOM   6934 C CG    . ARG B 1 364 ? 23.479  -8.097  -21.647 1.00 78.83  ? 364  ARG B CG    1 
ATOM   6935 C CD    . ARG B 1 364 ? 24.030  -6.768  -21.101 1.00 79.52  ? 364  ARG B CD    1 
ATOM   6936 N NE    . ARG B 1 364 ? 25.162  -6.253  -21.877 1.00 80.14  ? 364  ARG B NE    1 
ATOM   6937 C CZ    . ARG B 1 364 ? 26.451  -6.555  -21.679 1.00 82.08  ? 364  ARG B CZ    1 
ATOM   6938 N NH1   . ARG B 1 364 ? 26.843  -7.402  -20.721 1.00 83.07  ? 364  ARG B NH1   1 
ATOM   6939 N NH2   . ARG B 1 364 ? 27.365  -5.994  -22.463 1.00 81.92  ? 364  ARG B NH2   1 
ATOM   6940 N N     . ILE B 1 365 ? 20.603  -7.711  -25.137 1.00 73.08  ? 365  ILE B N     1 
ATOM   6941 C CA    . ILE B 1 365 ? 19.989  -7.894  -26.449 1.00 72.08  ? 365  ILE B CA    1 
ATOM   6942 C C     . ILE B 1 365 ? 19.330  -6.586  -26.893 1.00 69.84  ? 365  ILE B C     1 
ATOM   6943 O O     . ILE B 1 365 ? 19.403  -6.206  -28.070 1.00 68.65  ? 365  ILE B O     1 
ATOM   6944 C CB    . ILE B 1 365 ? 18.932  -9.035  -26.421 1.00 72.82  ? 365  ILE B CB    1 
ATOM   6945 C CG1   . ILE B 1 365 ? 19.600  -10.363 -26.053 1.00 75.15  ? 365  ILE B CG1   1 
ATOM   6946 C CG2   . ILE B 1 365 ? 18.212  -9.143  -27.762 1.00 71.55  ? 365  ILE B CG2   1 
ATOM   6947 C CD1   . ILE B 1 365 ? 18.667  -11.574 -26.101 1.00 76.37  ? 365  ILE B CD1   1 
ATOM   6948 N N     . GLY B 1 366 ? 18.707  -5.902  -25.935 1.00 69.02  ? 366  GLY B N     1 
ATOM   6949 C CA    . GLY B 1 366 ? 17.933  -4.683  -26.207 1.00 67.53  ? 366  GLY B CA    1 
ATOM   6950 C C     . GLY B 1 366 ? 18.750  -3.412  -26.388 1.00 66.48  ? 366  GLY B C     1 
ATOM   6951 O O     . GLY B 1 366 ? 18.287  -2.452  -27.000 1.00 65.77  ? 366  GLY B O     1 
ATOM   6952 N N     . VAL B 1 367 ? 19.954  -3.407  -25.830 1.00 67.28  ? 367  VAL B N     1 
ATOM   6953 C CA    . VAL B 1 367 ? 20.911  -2.329  -26.001 1.00 66.73  ? 367  VAL B CA    1 
ATOM   6954 C C     . VAL B 1 367 ? 22.218  -2.997  -26.436 1.00 68.27  ? 367  VAL B C     1 
ATOM   6955 O O     . VAL B 1 367 ? 23.176  -3.040  -25.683 1.00 69.12  ? 367  VAL B O     1 
ATOM   6956 C CB    . VAL B 1 367 ? 21.075  -1.506  -24.692 1.00 66.66  ? 367  VAL B CB    1 
ATOM   6957 C CG1   . VAL B 1 367 ? 21.926  -0.261  -24.930 1.00 64.87  ? 367  VAL B CG1   1 
ATOM   6958 C CG2   . VAL B 1 367 ? 19.703  -1.108  -24.142 1.00 65.09  ? 367  VAL B CG2   1 
ATOM   6959 N N     . PRO B 1 368 ? 22.244  -3.527  -27.673 1.00 68.89  ? 368  PRO B N     1 
ATOM   6960 C CA    . PRO B 1 368 ? 23.288  -4.441  -28.151 1.00 70.55  ? 368  PRO B CA    1 
ATOM   6961 C C     . PRO B 1 368 ? 24.670  -3.818  -28.282 1.00 71.63  ? 368  PRO B C     1 
ATOM   6962 O O     . PRO B 1 368 ? 25.662  -4.529  -28.208 1.00 72.63  ? 368  PRO B O     1 
ATOM   6963 C CB    . PRO B 1 368 ? 22.763  -4.879  -29.527 1.00 70.05  ? 368  PRO B CB    1 
ATOM   6964 C CG    . PRO B 1 368 ? 21.918  -3.777  -29.977 1.00 67.92  ? 368  PRO B CG    1 
ATOM   6965 C CD    . PRO B 1 368 ? 21.255  -3.244  -28.735 1.00 67.62  ? 368  PRO B CD    1 
ATOM   6966 N N     . GLN B 1 369 ? 24.730  -2.503  -28.471 1.00 71.63  ? 369  GLN B N     1 
ATOM   6967 C CA    . GLN B 1 369 ? 26.012  -1.802  -28.558 1.00 72.99  ? 369  GLN B CA    1 
ATOM   6968 C C     . GLN B 1 369 ? 26.541  -1.412  -27.183 1.00 74.24  ? 369  GLN B C     1 
ATOM   6969 O O     . GLN B 1 369 ? 27.679  -0.954  -27.077 1.00 75.62  ? 369  GLN B O     1 
ATOM   6970 C CB    . GLN B 1 369 ? 25.905  -0.572  -29.469 1.00 71.89  ? 369  GLN B CB    1 
ATOM   6971 C CG    . GLN B 1 369 ? 26.033  -0.889  -30.991 1.00 72.21  ? 369  GLN B CG    1 
ATOM   6972 C CD    . GLN B 1 369 ? 24.843  -1.660  -31.574 1.00 71.24  ? 369  GLN B CD    1 
ATOM   6973 O OE1   . GLN B 1 369 ? 23.734  -1.130  -31.683 1.00 68.55  ? 369  GLN B OE1   1 
ATOM   6974 N NE2   . GLN B 1 369 ? 25.087  -2.907  -31.987 1.00 71.71  ? 369  GLN B NE2   1 
ATOM   6975 N N     . ALA B 1 370 ? 25.737  -1.618  -26.135 1.00 74.28  ? 370  ALA B N     1 
ATOM   6976 C CA    . ALA B 1 370 ? 26.130  -1.267  -24.765 1.00 75.06  ? 370  ALA B CA    1 
ATOM   6977 C C     . ALA B 1 370 ? 27.243  -2.153  -24.235 1.00 77.43  ? 370  ALA B C     1 
ATOM   6978 O O     . ALA B 1 370 ? 27.196  -3.379  -24.375 1.00 78.77  ? 370  ALA B O     1 
ATOM   6979 C CB    . ALA B 1 370 ? 24.929  -1.342  -23.818 1.00 74.40  ? 370  ALA B CB    1 
ATOM   6980 N N     . SER B 1 371 ? 28.236  -1.520  -23.615 1.00 78.32  ? 371  SER B N     1 
ATOM   6981 C CA    . SER B 1 371 ? 29.290  -2.228  -22.896 1.00 80.37  ? 371  SER B CA    1 
ATOM   6982 C C     . SER B 1 371 ? 28.732  -2.803  -21.606 1.00 80.77  ? 371  SER B C     1 
ATOM   6983 O O     . SER B 1 371 ? 27.612  -2.476  -21.207 1.00 79.58  ? 371  SER B O     1 
ATOM   6984 C CB    . SER B 1 371 ? 30.432  -1.272  -22.551 1.00 81.26  ? 371  SER B CB    1 
ATOM   6985 O OG    . SER B 1 371 ? 30.031  -0.307  -21.585 1.00 80.66  ? 371  SER B OG    1 
ATOM   6986 N N     . ASP B 1 372 ? 29.527  -3.635  -20.943 1.00 82.38  ? 372  ASP B N     1 
ATOM   6987 C CA    . ASP B 1 372 ? 29.130  -4.211  -19.657 1.00 83.13  ? 372  ASP B CA    1 
ATOM   6988 C C     . ASP B 1 372 ? 28.715  -3.121  -18.662 1.00 81.54  ? 372  ASP B C     1 
ATOM   6989 O O     . ASP B 1 372 ? 27.655  -3.210  -18.056 1.00 80.87  ? 372  ASP B O     1 
ATOM   6990 C CB    . ASP B 1 372 ? 30.261  -5.067  -19.053 1.00 85.76  ? 372  ASP B CB    1 
ATOM   6991 C CG    . ASP B 1 372 ? 30.621  -6.273  -19.919 1.00 87.51  ? 372  ASP B CG    1 
ATOM   6992 O OD1   . ASP B 1 372 ? 30.191  -6.322  -21.090 1.00 85.94  ? 372  ASP B OD1   1 
ATOM   6993 O OD2   . ASP B 1 372 ? 31.352  -7.166  -19.432 1.00 90.68  ? 372  ASP B OD2   1 
ATOM   6994 N N     . LEU B 1 373 ? 29.551  -2.096  -18.508 1.00 81.04  ? 373  LEU B N     1 
ATOM   6995 C CA    . LEU B 1 373 ? 29.283  -1.012  -17.563 1.00 79.91  ? 373  LEU B CA    1 
ATOM   6996 C C     . LEU B 1 373 ? 28.031  -0.223  -17.936 1.00 77.44  ? 373  LEU B C     1 
ATOM   6997 O O     . LEU B 1 373 ? 27.205  0.081   -17.071 1.00 77.00  ? 373  LEU B O     1 
ATOM   6998 C CB    . LEU B 1 373 ? 30.492  -0.075  -17.474 1.00 80.69  ? 373  LEU B CB    1 
ATOM   6999 C CG    . LEU B 1 373 ? 30.444  1.158   -16.552 1.00 80.42  ? 373  LEU B CG    1 
ATOM   7000 C CD1   . LEU B 1 373 ? 30.179  0.800   -15.077 1.00 80.85  ? 373  LEU B CD1   1 
ATOM   7001 C CD2   . LEU B 1 373 ? 31.752  1.927   -16.697 1.00 80.79  ? 373  LEU B CD2   1 
ATOM   7002 N N     . ALA B 1 374 ? 27.901  0.118   -19.218 1.00 75.93  ? 374  ALA B N     1 
ATOM   7003 C CA    . ALA B 1 374 ? 26.725  0.835   -19.727 1.00 73.39  ? 374  ALA B CA    1 
ATOM   7004 C C     . ALA B 1 374 ? 25.447  0.024   -19.520 1.00 72.45  ? 374  ALA B C     1 
ATOM   7005 O O     . ALA B 1 374 ? 24.408  0.577   -19.166 1.00 71.75  ? 374  ALA B O     1 
ATOM   7006 C CB    . ALA B 1 374 ? 26.902  1.184   -21.207 1.00 72.36  ? 374  ALA B CB    1 
ATOM   7007 N N     . ALA B 1 375 ? 25.534  -1.286  -19.734 1.00 72.90  ? 375  ALA B N     1 
ATOM   7008 C CA    . ALA B 1 375 ? 24.411  -2.190  -19.500 1.00 72.37  ? 375  ALA B CA    1 
ATOM   7009 C C     . ALA B 1 375 ? 24.066  -2.247  -18.013 1.00 72.66  ? 375  ALA B C     1 
ATOM   7010 O O     . ALA B 1 375 ? 22.895  -2.328  -17.646 1.00 72.19  ? 375  ALA B O     1 
ATOM   7011 C CB    . ALA B 1 375 ? 24.723  -3.588  -20.035 1.00 73.61  ? 375  ALA B CB    1 
ATOM   7012 N N     . GLU B 1 376 ? 25.073  -2.190  -17.150 1.00 73.40  ? 376  GLU B N     1 
ATOM   7013 C CA    . GLU B 1 376 ? 24.790  -2.123  -15.716 1.00 73.92  ? 376  GLU B CA    1 
ATOM   7014 C C     . GLU B 1 376 ? 24.102  -0.787  -15.353 1.00 71.65  ? 376  GLU B C     1 
ATOM   7015 O O     . GLU B 1 376 ? 23.197  -0.762  -14.525 1.00 71.23  ? 376  GLU B O     1 
ATOM   7016 C CB    A GLU B 1 376 ? 26.057  -2.326  -14.887 0.50 75.79  ? 376  GLU B CB    1 
ATOM   7017 C CB    B GLU B 1 376 ? 26.068  -2.339  -14.891 0.50 75.78  ? 376  GLU B CB    1 
ATOM   7018 C CG    A GLU B 1 376 ? 25.791  -2.636  -13.418 0.50 77.32  ? 376  GLU B CG    1 
ATOM   7019 C CG    B GLU B 1 376 ? 26.602  -3.781  -14.934 0.50 77.97  ? 376  GLU B CG    1 
ATOM   7020 C CD    A GLU B 1 376 ? 25.086  -3.968  -13.192 0.50 78.53  ? 376  GLU B CD    1 
ATOM   7021 C CD    B GLU B 1 376 ? 28.017  -3.932  -14.374 0.50 80.18  ? 376  GLU B CD    1 
ATOM   7022 O OE1   A GLU B 1 376 ? 25.298  -4.911  -13.990 0.50 78.76  ? 376  GLU B OE1   1 
ATOM   7023 O OE1   B GLU B 1 376 ? 28.690  -2.912  -14.116 0.50 80.99  ? 376  GLU B OE1   1 
ATOM   7024 O OE2   A GLU B 1 376 ? 24.326  -4.071  -12.204 0.50 78.47  ? 376  GLU B OE2   1 
ATOM   7025 O OE2   B GLU B 1 376 ? 28.465  -5.082  -14.194 0.50 82.35  ? 376  GLU B OE2   1 
ATOM   7026 N N     . ALA B 1 377 ? 24.502  0.308   -15.995 1.00 69.75  ? 377  ALA B N     1 
ATOM   7027 C CA    . ALA B 1 377 ? 23.861  1.603   -15.744 1.00 67.82  ? 377  ALA B CA    1 
ATOM   7028 C C     . ALA B 1 377 ? 22.384  1.569   -16.141 1.00 65.84  ? 377  ALA B C     1 
ATOM   7029 O O     . ALA B 1 377 ? 21.551  2.073   -15.413 1.00 65.21  ? 377  ALA B O     1 
ATOM   7030 C CB    . ALA B 1 377 ? 24.599  2.738   -16.469 1.00 66.79  ? 377  ALA B CB    1 
ATOM   7031 N N     . VAL B 1 378 ? 22.066  0.961   -17.285 1.00 65.12  ? 378  VAL B N     1 
ATOM   7032 C CA    . VAL B 1 378 ? 20.675  0.801   -17.722 1.00 63.71  ? 378  VAL B CA    1 
ATOM   7033 C C     . VAL B 1 378 ? 19.866  -0.038  -16.724 1.00 64.82  ? 378  VAL B C     1 
ATOM   7034 O O     . VAL B 1 378 ? 18.767  0.345   -16.335 1.00 64.21  ? 378  VAL B O     1 
ATOM   7035 C CB    . VAL B 1 378 ? 20.575  0.176   -19.156 1.00 63.60  ? 378  VAL B CB    1 
ATOM   7036 C CG1   . VAL B 1 378 ? 19.127  -0.064  -19.561 1.00 61.26  ? 378  VAL B CG1   1 
ATOM   7037 C CG2   . VAL B 1 378 ? 21.264  1.060   -20.181 1.00 61.73  ? 378  VAL B CG2   1 
ATOM   7038 N N     . VAL B 1 379 ? 20.409  -1.166  -16.282 1.00 66.67  ? 379  VAL B N     1 
ATOM   7039 C CA    . VAL B 1 379 ? 19.704  -1.986  -15.303 1.00 67.87  ? 379  VAL B CA    1 
ATOM   7040 C C     . VAL B 1 379 ? 19.485  -1.239  -13.980 1.00 68.62  ? 379  VAL B C     1 
ATOM   7041 O O     . VAL B 1 379 ? 18.401  -1.275  -13.394 1.00 68.56  ? 379  VAL B O     1 
ATOM   7042 C CB    . VAL B 1 379 ? 20.445  -3.311  -15.046 1.00 70.13  ? 379  VAL B CB    1 
ATOM   7043 C CG1   . VAL B 1 379 ? 19.901  -4.010  -13.785 1.00 70.64  ? 379  VAL B CG1   1 
ATOM   7044 C CG2   . VAL B 1 379 ? 20.332  -4.219  -16.270 1.00 69.31  ? 379  VAL B CG2   1 
ATOM   7045 N N     . LEU B 1 380 ? 20.507  -0.546  -13.512 1.00 69.50  ? 380  LEU B N     1 
ATOM   7046 C CA    . LEU B 1 380 ? 20.392  0.174   -12.261 1.00 70.42  ? 380  LEU B CA    1 
ATOM   7047 C C     . LEU B 1 380 ? 19.409  1.359   -12.351 1.00 68.72  ? 380  LEU B C     1 
ATOM   7048 O O     . LEU B 1 380 ? 18.710  1.661   -11.393 1.00 69.27  ? 380  LEU B O     1 
ATOM   7049 C CB    . LEU B 1 380 ? 21.782  0.606   -11.759 1.00 71.54  ? 380  LEU B CB    1 
ATOM   7050 C CG    . LEU B 1 380 ? 22.769  -0.516  -11.341 1.00 74.65  ? 380  LEU B CG    1 
ATOM   7051 C CD1   . LEU B 1 380 ? 23.941  0.054   -10.543 1.00 76.05  ? 380  LEU B CD1   1 
ATOM   7052 C CD2   . LEU B 1 380 ? 22.126  -1.653  -10.525 1.00 77.01  ? 380  LEU B CD2   1 
ATOM   7053 N N     . HIS B 1 381 ? 19.333  2.007   -13.500 1.00 67.63  ? 381  HIS B N     1 
ATOM   7054 C CA    . HIS B 1 381 ? 18.383  3.127   -13.712 1.00 66.56  ? 381  HIS B CA    1 
ATOM   7055 C C     . HIS B 1 381 ? 16.918  2.662   -13.799 1.00 66.02  ? 381  HIS B C     1 
ATOM   7056 O O     . HIS B 1 381 ? 16.028  3.302   -13.265 1.00 65.80  ? 381  HIS B O     1 
ATOM   7057 C CB    . HIS B 1 381 ? 18.764  3.884   -14.991 1.00 65.52  ? 381  HIS B CB    1 
ATOM   7058 C CG    . HIS B 1 381 ? 17.840  5.008   -15.336 1.00 65.67  ? 381  HIS B CG    1 
ATOM   7059 N ND1   . HIS B 1 381 ? 18.030  6.294   -14.874 1.00 66.63  ? 381  HIS B ND1   1 
ATOM   7060 C CD2   . HIS B 1 381 ? 16.728  5.044   -16.113 1.00 65.44  ? 381  HIS B CD2   1 
ATOM   7061 C CE1   . HIS B 1 381 ? 17.061  7.068   -15.336 1.00 66.09  ? 381  HIS B CE1   1 
ATOM   7062 N NE2   . HIS B 1 381 ? 16.259  6.335   -16.090 1.00 64.85  ? 381  HIS B NE2   1 
ATOM   7063 N N     . TYR B 1 382 ? 16.687  1.537   -14.461 1.00 66.28  ? 382  TYR B N     1 
ATOM   7064 C CA    . TYR B 1 382 ? 15.339  1.064   -14.756 1.00 66.16  ? 382  TYR B CA    1 
ATOM   7065 C C     . TYR B 1 382 ? 14.781  0.103   -13.711 1.00 68.04  ? 382  TYR B C     1 
ATOM   7066 O O     . TYR B 1 382 ? 13.572  -0.168  -13.701 1.00 68.36  ? 382  TYR B O     1 
ATOM   7067 C CB    . TYR B 1 382 ? 15.302  0.399   -16.145 1.00 65.55  ? 382  TYR B CB    1 
ATOM   7068 C CG    . TYR B 1 382 ? 15.151  1.380   -17.280 1.00 63.38  ? 382  TYR B CG    1 
ATOM   7069 C CD1   . TYR B 1 382 ? 16.267  1.857   -17.977 1.00 63.27  ? 382  TYR B CD1   1 
ATOM   7070 C CD2   . TYR B 1 382 ? 13.896  1.844   -17.652 1.00 61.77  ? 382  TYR B CD2   1 
ATOM   7071 C CE1   . TYR B 1 382 ? 16.127  2.770   -19.034 1.00 62.30  ? 382  TYR B CE1   1 
ATOM   7072 C CE2   . TYR B 1 382 ? 13.742  2.743   -18.705 1.00 61.17  ? 382  TYR B CE2   1 
ATOM   7073 C CZ    . TYR B 1 382 ? 14.861  3.205   -19.398 1.00 60.87  ? 382  TYR B CZ    1 
ATOM   7074 O OH    . TYR B 1 382 ? 14.707  4.105   -20.439 1.00 59.19  ? 382  TYR B OH    1 
ATOM   7075 N N     . THR B 1 383 ? 15.646  -0.426  -12.848 1.00 69.61  ? 383  THR B N     1 
ATOM   7076 C CA    . THR B 1 383 ? 15.185  -1.178  -11.691 1.00 71.15  ? 383  THR B CA    1 
ATOM   7077 C C     . THR B 1 383 ? 14.389  -0.271  -10.753 1.00 71.42  ? 383  THR B C     1 
ATOM   7078 O O     . THR B 1 383 ? 14.796  0.854   -10.451 1.00 70.66  ? 383  THR B O     1 
ATOM   7079 C CB    . THR B 1 383 ? 16.351  -1.797  -10.929 1.00 72.65  ? 383  THR B CB    1 
ATOM   7080 O OG1   . THR B 1 383 ? 17.007  -2.752  -11.771 1.00 72.89  ? 383  THR B OG1   1 
ATOM   7081 C CG2   . THR B 1 383 ? 15.866  -2.484  -9.649  1.00 74.26  ? 383  THR B CG2   1 
ATOM   7082 N N     . ASP B 1 384 ? 13.234  -0.758  -10.321 1.00 72.72  ? 384  ASP B N     1 
ATOM   7083 C CA    . ASP B 1 384 ? 12.492  -0.125  -9.233  1.00 73.57  ? 384  ASP B CA    1 
ATOM   7084 C C     . ASP B 1 384 ? 13.019  -0.745  -7.941  1.00 75.11  ? 384  ASP B C     1 
ATOM   7085 O O     . ASP B 1 384 ? 12.704  -1.892  -7.619  1.00 75.83  ? 384  ASP B O     1 
ATOM   7086 C CB    . ASP B 1 384 ? 10.986  -0.358  -9.393  1.00 73.87  ? 384  ASP B CB    1 
ATOM   7087 C CG    . ASP B 1 384 ? 10.159  0.421   -8.387  1.00 75.92  ? 384  ASP B CG    1 
ATOM   7088 O OD1   . ASP B 1 384 ? 10.459  0.349   -7.175  1.00 79.02  ? 384  ASP B OD1   1 
ATOM   7089 O OD2   . ASP B 1 384 ? 9.191   1.095   -8.813  1.00 78.09  ? 384  ASP B OD2   1 
ATOM   7090 N N     . TRP B 1 385 ? 13.827  0.016   -7.207  1.00 75.21  ? 385  TRP B N     1 
ATOM   7091 C CA    . TRP B 1 385 ? 14.573  -0.552  -6.076  1.00 77.20  ? 385  TRP B CA    1 
ATOM   7092 C C     . TRP B 1 385 ? 13.717  -0.846  -4.843  1.00 79.28  ? 385  TRP B C     1 
ATOM   7093 O O     . TRP B 1 385 ? 14.207  -1.443  -3.881  1.00 81.15  ? 385  TRP B O     1 
ATOM   7094 C CB    . TRP B 1 385 ? 15.816  0.295   -5.762  1.00 76.38  ? 385  TRP B CB    1 
ATOM   7095 C CG    . TRP B 1 385 ? 16.827  0.106   -6.821  1.00 75.04  ? 385  TRP B CG    1 
ATOM   7096 C CD1   . TRP B 1 385 ? 17.137  0.969   -7.827  1.00 73.06  ? 385  TRP B CD1   1 
ATOM   7097 C CD2   . TRP B 1 385 ? 17.605  -1.069  -7.046  1.00 75.93  ? 385  TRP B CD2   1 
ATOM   7098 N NE1   . TRP B 1 385 ? 18.084  0.420   -8.650  1.00 73.08  ? 385  TRP B NE1   1 
ATOM   7099 C CE2   . TRP B 1 385 ? 18.394  -0.834  -8.192  1.00 75.19  ? 385  TRP B CE2   1 
ATOM   7100 C CE3   . TRP B 1 385 ? 17.722  -2.295  -6.384  1.00 77.70  ? 385  TRP B CE3   1 
ATOM   7101 C CZ2   . TRP B 1 385 ? 19.284  -1.786  -8.698  1.00 75.58  ? 385  TRP B CZ2   1 
ATOM   7102 C CZ3   . TRP B 1 385 ? 18.612  -3.240  -6.882  1.00 79.05  ? 385  TRP B CZ3   1 
ATOM   7103 C CH2   . TRP B 1 385 ? 19.380  -2.977  -8.030  1.00 77.99  ? 385  TRP B CH2   1 
ATOM   7104 N N     . LEU B 1 386 ? 12.441  -0.464  -4.895  1.00 79.61  ? 386  LEU B N     1 
ATOM   7105 C CA    . LEU B 1 386 ? 11.432  -0.959  -3.948  1.00 82.42  ? 386  LEU B CA    1 
ATOM   7106 C C     . LEU B 1 386 ? 10.861  -2.336  -4.345  1.00 83.70  ? 386  LEU B C     1 
ATOM   7107 O O     . LEU B 1 386 ? 10.440  -3.109  -3.482  1.00 85.58  ? 386  LEU B O     1 
ATOM   7108 C CB    . LEU B 1 386 ? 10.291  0.050   -3.823  1.00 81.88  ? 386  LEU B CB    1 
ATOM   7109 C CG    . LEU B 1 386 ? 10.641  1.291   -3.000  1.00 82.32  ? 386  LEU B CG    1 
ATOM   7110 C CD1   . LEU B 1 386 ? 9.876   2.524   -3.476  1.00 81.74  ? 386  LEU B CD1   1 
ATOM   7111 C CD2   . LEU B 1 386 ? 10.377  1.001   -1.535  1.00 85.43  ? 386  LEU B CD2   1 
ATOM   7112 N N     . HIS B 1 387 ? 10.842  -2.621  -5.647  1.00 82.96  ? 387  HIS B N     1 
ATOM   7113 C CA    . HIS B 1 387 ? 10.304  -3.874  -6.182  1.00 84.18  ? 387  HIS B CA    1 
ATOM   7114 C C     . HIS B 1 387 ? 11.272  -4.491  -7.203  1.00 83.77  ? 387  HIS B C     1 
ATOM   7115 O O     . HIS B 1 387 ? 10.876  -4.779  -8.336  1.00 82.91  ? 387  HIS B O     1 
ATOM   7116 C CB    . HIS B 1 387 ? 8.941   -3.618  -6.854  1.00 83.74  ? 387  HIS B CB    1 
ATOM   7117 C CG    . HIS B 1 387 ? 7.975   -2.859  -5.998  1.00 84.79  ? 387  HIS B CG    1 
ATOM   7118 N ND1   . HIS B 1 387 ? 7.668   -1.531  -6.218  1.00 84.51  ? 387  HIS B ND1   1 
ATOM   7119 C CD2   . HIS B 1 387 ? 7.257   -3.238  -4.912  1.00 87.82  ? 387  HIS B CD2   1 
ATOM   7120 C CE1   . HIS B 1 387 ? 6.803   -1.124  -5.304  1.00 85.12  ? 387  HIS B CE1   1 
ATOM   7121 N NE2   . HIS B 1 387 ? 6.536   -2.140  -4.500  1.00 87.30  ? 387  HIS B NE2   1 
ATOM   7122 N N     . PRO B 1 388 ? 12.545  -4.700  -6.802  1.00 84.41  ? 388  PRO B N     1 
ATOM   7123 C CA    . PRO B 1 388 ? 13.607  -5.092  -7.748  1.00 83.97  ? 388  PRO B CA    1 
ATOM   7124 C C     . PRO B 1 388 ? 13.436  -6.451  -8.419  1.00 84.98  ? 388  PRO B C     1 
ATOM   7125 O O     . PRO B 1 388 ? 13.986  -6.675  -9.496  1.00 84.15  ? 388  PRO B O     1 
ATOM   7126 C CB    . PRO B 1 388 ? 14.876  -5.086  -6.885  1.00 85.25  ? 388  PRO B CB    1 
ATOM   7127 C CG    . PRO B 1 388 ? 14.394  -5.225  -5.472  1.00 86.73  ? 388  PRO B CG    1 
ATOM   7128 C CD    . PRO B 1 388 ? 13.055  -4.562  -5.423  1.00 85.71  ? 388  PRO B CD    1 
ATOM   7129 N N     . GLU B 1 389 ? 12.692  -7.350  -7.787  1.00 87.00  ? 389  GLU B N     1 
ATOM   7130 C CA    . GLU B 1 389 ? 12.510  -8.706  -8.309  1.00 88.47  ? 389  GLU B CA    1 
ATOM   7131 C C     . GLU B 1 389 ? 11.114  -8.911  -8.895  1.00 87.42  ? 389  GLU B C     1 
ATOM   7132 O O     . GLU B 1 389 ? 10.807  -10.003 -9.383  1.00 88.50  ? 389  GLU B O     1 
ATOM   7133 C CB    . GLU B 1 389 ? 12.746  -9.731  -7.194  1.00 91.53  ? 389  GLU B CB    1 
ATOM   7134 C CG    . GLU B 1 389 ? 13.969  -9.438  -6.307  1.00 94.50  ? 389  GLU B CG    1 
ATOM   7135 C CD    . GLU B 1 389 ? 15.232  -10.199 -6.716  1.00 98.48  ? 389  GLU B CD    1 
ATOM   7136 O OE1   . GLU B 1 389 ? 15.432  -10.475 -7.922  1.00 99.04  ? 389  GLU B OE1   1 
ATOM   7137 O OE2   . GLU B 1 389 ? 16.035  -10.516 -5.806  1.00 102.40 ? 389  GLU B OE2   1 
ATOM   7138 N N     . ASP B 1 390 ? 10.269  -7.878  -8.853  1.00 85.32  ? 390  ASP B N     1 
ATOM   7139 C CA    . ASP B 1 390 ? 8.868   -8.036  -9.251  1.00 84.90  ? 390  ASP B CA    1 
ATOM   7140 C C     . ASP B 1 390 ? 8.745   -8.259  -10.758 1.00 83.06  ? 390  ASP B C     1 
ATOM   7141 O O     . ASP B 1 390 ? 9.092   -7.374  -11.535 1.00 81.09  ? 390  ASP B O     1 
ATOM   7142 C CB    . ASP B 1 390 ? 8.043   -6.819  -8.845  1.00 83.93  ? 390  ASP B CB    1 
ATOM   7143 C CG    . ASP B 1 390 ? 6.575   -6.975  -9.195  1.00 84.61  ? 390  ASP B CG    1 
ATOM   7144 O OD1   . ASP B 1 390 ? 5.986   -8.000  -8.781  1.00 87.21  ? 390  ASP B OD1   1 
ATOM   7145 O OD2   . ASP B 1 390 ? 6.016   -6.083  -9.881  1.00 82.71  ? 390  ASP B OD2   1 
ATOM   7146 N N     . PRO B 1 391 ? 8.256   -9.439  -11.176 1.00 83.66  ? 391  PRO B N     1 
ATOM   7147 C CA    . PRO B 1 391 ? 8.191   -9.773  -12.604 1.00 82.31  ? 391  PRO B CA    1 
ATOM   7148 C C     . PRO B 1 391 ? 7.395   -8.814  -13.507 1.00 79.95  ? 391  PRO B C     1 
ATOM   7149 O O     . PRO B 1 391 ? 7.783   -8.606  -14.654 1.00 77.98  ? 391  PRO B O     1 
ATOM   7150 C CB    . PRO B 1 391 ? 7.551   -11.170 -12.604 1.00 84.43  ? 391  PRO B CB    1 
ATOM   7151 C CG    . PRO B 1 391 ? 7.872   -11.730 -11.280 1.00 86.76  ? 391  PRO B CG    1 
ATOM   7152 C CD    . PRO B 1 391 ? 7.769   -10.559 -10.350 1.00 86.41  ? 391  PRO B CD    1 
ATOM   7153 N N     . THR B 1 392 ? 6.291   -8.263  -13.000 1.00 80.02  ? 392  THR B N     1 
ATOM   7154 C CA    . THR B 1 392 ? 5.503   -7.252  -13.726 1.00 78.27  ? 392  THR B CA    1 
ATOM   7155 C C     . THR B 1 392 ? 6.325   -5.975  -13.939 1.00 76.24  ? 392  THR B C     1 
ATOM   7156 O O     . THR B 1 392 ? 6.312   -5.393  -15.029 1.00 74.43  ? 392  THR B O     1 
ATOM   7157 C CB    . THR B 1 392 ? 4.180   -6.893  -12.967 1.00 78.97  ? 392  THR B CB    1 
ATOM   7158 O OG1   . THR B 1 392 ? 3.339   -8.053  -12.872 1.00 81.66  ? 392  THR B OG1   1 
ATOM   7159 C CG2   . THR B 1 392 ? 3.408   -5.783  -13.677 1.00 76.99  ? 392  THR B CG2   1 
ATOM   7160 N N     . HIS B 1 393 ? 7.028   -5.539  -12.893 1.00 76.61  ? 393  HIS B N     1 
ATOM   7161 C CA    . HIS B 1 393 ? 7.912   -4.369  -12.997 1.00 75.07  ? 393  HIS B CA    1 
ATOM   7162 C C     . HIS B 1 393 ? 9.044   -4.633  -13.983 1.00 73.88  ? 393  HIS B C     1 
ATOM   7163 O O     . HIS B 1 393 ? 9.344   -3.795  -14.821 1.00 72.03  ? 393  HIS B O     1 
ATOM   7164 C CB    . HIS B 1 393 ? 8.516   -4.005  -11.644 1.00 75.86  ? 393  HIS B CB    1 
ATOM   7165 C CG    . HIS B 1 393 ? 7.652   -3.111  -10.812 1.00 77.50  ? 393  HIS B CG    1 
ATOM   7166 N ND1   . HIS B 1 393 ? 6.698   -3.596  -9.935  1.00 80.13  ? 393  HIS B ND1   1 
ATOM   7167 C CD2   . HIS B 1 393 ? 7.618   -1.761  -10.700 1.00 75.92  ? 393  HIS B CD2   1 
ATOM   7168 C CE1   . HIS B 1 393 ? 6.109   -2.579  -9.328  1.00 80.04  ? 393  HIS B CE1   1 
ATOM   7169 N NE2   . HIS B 1 393 ? 6.651   -1.456  -9.770  1.00 77.80  ? 393  HIS B NE2   1 
ATOM   7170 N N     . LEU B 1 394 ? 9.663   -5.805  -13.880 1.00 74.89  ? 394  LEU B N     1 
ATOM   7171 C CA    . LEU B 1 394 ? 10.820  -6.128  -14.714 1.00 74.37  ? 394  LEU B CA    1 
ATOM   7172 C C     . LEU B 1 394 ? 10.422  -6.202  -16.184 1.00 73.19  ? 394  LEU B C     1 
ATOM   7173 O O     . LEU B 1 394 ? 11.093  -5.617  -17.039 1.00 71.94  ? 394  LEU B O     1 
ATOM   7174 C CB    . LEU B 1 394 ? 11.482  -7.425  -14.247 1.00 76.20  ? 394  LEU B CB    1 
ATOM   7175 C CG    . LEU B 1 394 ? 12.181  -7.293  -12.885 1.00 77.20  ? 394  LEU B CG    1 
ATOM   7176 C CD1   . LEU B 1 394 ? 12.454  -8.659  -12.260 1.00 78.06  ? 394  LEU B CD1   1 
ATOM   7177 C CD2   . LEU B 1 394 ? 13.482  -6.456  -13.002 1.00 74.52  ? 394  LEU B CD2   1 
ATOM   7178 N N     . ARG B 1 395 ? 9.315   -6.891  -16.463 1.00 73.54  ? 395  ARG B N     1 
ATOM   7179 C CA    . ARG B 1 395 ? 8.743   -6.931  -17.811 1.00 72.32  ? 395  ARG B CA    1 
ATOM   7180 C C     . ARG B 1 395 ? 8.458   -5.534  -18.385 1.00 69.63  ? 395  ARG B C     1 
ATOM   7181 O O     . ARG B 1 395 ? 8.833   -5.246  -19.515 1.00 68.15  ? 395  ARG B O     1 
ATOM   7182 C CB    . ARG B 1 395 ? 7.468   -7.787  -17.827 1.00 73.90  ? 395  ARG B CB    1 
ATOM   7183 C CG    . ARG B 1 395 ? 6.658   -7.723  -19.143 1.00 73.56  ? 395  ARG B CG    1 
ATOM   7184 C CD    . ARG B 1 395 ? 5.353   -6.964  -18.969 1.00 74.59  ? 395  ARG B CD    1 
ATOM   7185 N NE    . ARG B 1 395 ? 4.270   -7.845  -18.563 1.00 76.54  ? 395  ARG B NE    1 
ATOM   7186 C CZ    . ARG B 1 395 ? 3.168   -7.457  -17.918 1.00 77.83  ? 395  ARG B CZ    1 
ATOM   7187 N NH1   . ARG B 1 395 ? 2.966   -6.193  -17.569 1.00 73.97  ? 395  ARG B NH1   1 
ATOM   7188 N NH2   . ARG B 1 395 ? 2.245   -8.368  -17.607 1.00 81.17  ? 395  ARG B NH2   1 
ATOM   7189 N N     . ASP B 1 396 ? 7.798   -4.682  -17.610 1.00 69.12  ? 396  ASP B N     1 
ATOM   7190 C CA    . ASP B 1 396 ? 7.458   -3.332  -18.071 1.00 67.40  ? 396  ASP B CA    1 
ATOM   7191 C C     . ASP B 1 396 ? 8.704   -2.468  -18.236 1.00 65.99  ? 396  ASP B C     1 
ATOM   7192 O O     . ASP B 1 396 ? 8.767   -1.657  -19.154 1.00 65.25  ? 396  ASP B O     1 
ATOM   7193 C CB    . ASP B 1 396 ? 6.440   -2.662  -17.139 1.00 67.65  ? 396  ASP B CB    1 
ATOM   7194 C CG    . ASP B 1 396 ? 5.058   -3.304  -17.222 1.00 69.76  ? 396  ASP B CG    1 
ATOM   7195 O OD1   . ASP B 1 396 ? 4.752   -3.930  -18.263 1.00 69.88  ? 396  ASP B OD1   1 
ATOM   7196 O OD2   . ASP B 1 396 ? 4.268   -3.184  -16.255 1.00 72.26  ? 396  ASP B OD2   1 
ATOM   7197 N N     . ALA B 1 397 ? 9.697   -2.657  -17.371 1.00 66.35  ? 397  ALA B N     1 
ATOM   7198 C CA    . ALA B 1 397 ? 10.972  -1.948  -17.493 1.00 65.31  ? 397  ALA B CA    1 
ATOM   7199 C C     . ALA B 1 397 ? 11.696  -2.376  -18.762 1.00 64.66  ? 397  ALA B C     1 
ATOM   7200 O O     . ALA B 1 397 ? 12.253  -1.545  -19.467 1.00 64.00  ? 397  ALA B O     1 
ATOM   7201 C CB    . ALA B 1 397 ? 11.858  -2.186  -16.264 1.00 66.04  ? 397  ALA B CB    1 
ATOM   7202 N N     . MET B 1 398 ? 11.678  -3.667  -19.063 1.00 65.72  ? 398  MET B N     1 
ATOM   7203 C CA    . MET B 1 398 ? 12.293  -4.165  -20.290 1.00 65.59  ? 398  MET B CA    1 
ATOM   7204 C C     . MET B 1 398 ? 11.693  -3.452  -21.511 1.00 63.95  ? 398  MET B C     1 
ATOM   7205 O O     . MET B 1 398 ? 12.416  -2.999  -22.399 1.00 63.04  ? 398  MET B O     1 
ATOM   7206 C CB    . MET B 1 398 ? 12.110  -5.683  -20.401 1.00 67.07  ? 398  MET B CB    1 
ATOM   7207 C CG    . MET B 1 398 ? 12.868  -6.339  -21.540 1.00 67.80  ? 398  MET B CG    1 
ATOM   7208 S SD    . MET B 1 398 ? 14.653  -6.359  -21.314 1.00 69.94  ? 398  MET B SD    1 
ATOM   7209 C CE    . MET B 1 398 ? 15.188  -5.085  -22.450 1.00 66.82  ? 398  MET B CE    1 
ATOM   7210 N N     . SER B 1 399 ? 10.372  -3.345  -21.543 1.00 63.88  ? 399  SER B N     1 
ATOM   7211 C CA    . SER B 1 399 ? 9.696   -2.616  -22.609 1.00 62.58  ? 399  SER B CA    1 
ATOM   7212 C C     . SER B 1 399 ? 10.168  -1.172  -22.638 1.00 61.09  ? 399  SER B C     1 
ATOM   7213 O O     . SER B 1 399 ? 10.486  -0.636  -23.707 1.00 60.37  ? 399  SER B O     1 
ATOM   7214 C CB    . SER B 1 399 ? 8.175   -2.670  -22.428 1.00 62.94  ? 399  SER B CB    1 
ATOM   7215 O OG    . SER B 1 399 ? 7.539   -1.679  -23.212 1.00 61.96  ? 399  SER B OG    1 
ATOM   7216 N N     . ALA B 1 400 ? 10.235  -0.545  -21.468 1.00 60.97  ? 400  ALA B N     1 
ATOM   7217 C CA    . ALA B 1 400 ? 10.662  0.865   -21.385 1.00 59.90  ? 400  ALA B CA    1 
ATOM   7218 C C     . ALA B 1 400 ? 12.078  1.065   -21.923 1.00 59.52  ? 400  ALA B C     1 
ATOM   7219 O O     . ALA B 1 400 ? 12.328  2.005   -22.680 1.00 58.68  ? 400  ALA B O     1 
ATOM   7220 C CB    . ALA B 1 400 ? 10.557  1.380   -19.953 1.00 59.85  ? 400  ALA B CB    1 
ATOM   7221 N N     . VAL B 1 401 ? 13.004  0.185   -21.540 1.00 60.43  ? 401  VAL B N     1 
ATOM   7222 C CA    . VAL B 1 401 ? 14.385  0.287   -22.021 1.00 60.46  ? 401  VAL B CA    1 
ATOM   7223 C C     . VAL B 1 401 ? 14.434  0.316   -23.549 1.00 59.94  ? 401  VAL B C     1 
ATOM   7224 O O     . VAL B 1 401 ? 15.101  1.151   -24.150 1.00 59.47  ? 401  VAL B O     1 
ATOM   7225 C CB    . VAL B 1 401 ? 15.267  -0.887  -21.519 1.00 62.15  ? 401  VAL B CB    1 
ATOM   7226 C CG1   . VAL B 1 401 ? 16.573  -0.958  -22.323 1.00 61.81  ? 401  VAL B CG1   1 
ATOM   7227 C CG2   . VAL B 1 401 ? 15.540  -0.760  -20.022 1.00 61.33  ? 401  VAL B CG2   1 
ATOM   7228 N N     . VAL B 1 402 ? 13.699  -0.587  -24.178 1.00 60.52  ? 402  VAL B N     1 
ATOM   7229 C CA    . VAL B 1 402 ? 13.767  -0.720  -25.620 1.00 59.91  ? 402  VAL B CA    1 
ATOM   7230 C C     . VAL B 1 402 ? 13.090  0.451   -26.317 1.00 58.63  ? 402  VAL B C     1 
ATOM   7231 O O     . VAL B 1 402 ? 13.616  0.977   -27.294 1.00 58.22  ? 402  VAL B O     1 
ATOM   7232 C CB    . VAL B 1 402 ? 13.191  -2.083  -26.079 1.00 60.92  ? 402  VAL B CB    1 
ATOM   7233 C CG1   . VAL B 1 402 ? 13.083  -2.154  -27.618 1.00 59.09  ? 402  VAL B CG1   1 
ATOM   7234 C CG2   . VAL B 1 402 ? 14.073  -3.209  -25.530 1.00 61.16  ? 402  VAL B CG2   1 
ATOM   7235 N N     . GLY B 1 403 ? 11.938  0.864   -25.798 1.00 58.13  ? 403  GLY B N     1 
ATOM   7236 C CA    . GLY B 1 403 ? 11.202  1.984   -26.358 1.00 56.73  ? 403  GLY B CA    1 
ATOM   7237 C C     . GLY B 1 403 ? 11.912  3.317   -26.191 1.00 55.91  ? 403  GLY B C     1 
ATOM   7238 O O     . GLY B 1 403 ? 11.898  4.138   -27.107 1.00 54.59  ? 403  GLY B O     1 
ATOM   7239 N N     . ASP B 1 404 ? 12.535  3.525   -25.030 1.00 55.96  ? 404  ASP B N     1 
ATOM   7240 C CA    . ASP B 1 404 ? 13.231  4.776   -24.748 1.00 55.54  ? 404  ASP B CA    1 
ATOM   7241 C C     . ASP B 1 404 ? 14.525  4.894   -25.548 1.00 55.14  ? 404  ASP B C     1 
ATOM   7242 O O     . ASP B 1 404 ? 14.795  5.920   -26.156 1.00 54.30  ? 404  ASP B O     1 
ATOM   7243 C CB    . ASP B 1 404 ? 13.543  4.901   -23.251 1.00 56.59  ? 404  ASP B CB    1 
ATOM   7244 C CG    . ASP B 1 404 ? 12.287  5.012   -22.382 1.00 57.34  ? 404  ASP B CG    1 
ATOM   7245 O OD1   . ASP B 1 404 ? 11.196  5.288   -22.922 1.00 56.47  ? 404  ASP B OD1   1 
ATOM   7246 O OD2   . ASP B 1 404 ? 12.407  4.834   -21.146 1.00 59.13  ? 404  ASP B OD2   1 
ATOM   7247 N N     . HIS B 1 405 ? 15.328  3.842   -25.519 1.00 55.45  ? 405  HIS B N     1 
ATOM   7248 C CA    . HIS B 1 405 ? 16.582  3.795   -26.261 1.00 55.89  ? 405  HIS B CA    1 
ATOM   7249 C C     . HIS B 1 405 ? 16.381  4.033   -27.770 1.00 54.81  ? 405  HIS B C     1 
ATOM   7250 O O     . HIS B 1 405 ? 17.158  4.740   -28.410 1.00 54.30  ? 405  HIS B O     1 
ATOM   7251 C CB    . HIS B 1 405 ? 17.249  2.428   -26.022 1.00 56.90  ? 405  HIS B CB    1 
ATOM   7252 C CG    . HIS B 1 405 ? 18.498  2.197   -26.819 1.00 57.46  ? 405  HIS B CG    1 
ATOM   7253 N ND1   . HIS B 1 405 ? 19.517  3.126   -26.901 1.00 59.12  ? 405  HIS B ND1   1 
ATOM   7254 C CD2   . HIS B 1 405 ? 18.916  1.115   -27.524 1.00 57.53  ? 405  HIS B CD2   1 
ATOM   7255 C CE1   . HIS B 1 405 ? 20.500  2.632   -27.641 1.00 58.96  ? 405  HIS B CE1   1 
ATOM   7256 N NE2   . HIS B 1 405 ? 20.159  1.416   -28.033 1.00 57.98  ? 405  HIS B NE2   1 
ATOM   7257 N N     . ASN B 1 406 ? 15.325  3.447   -28.319 1.00 54.54  ? 406  ASN B N     1 
ATOM   7258 C CA    . ASN B 1 406 ? 15.147  3.393   -29.761 1.00 54.15  ? 406  ASN B CA    1 
ATOM   7259 C C     . ASN B 1 406 ? 14.204  4.426   -30.321 1.00 53.70  ? 406  ASN B C     1 
ATOM   7260 O O     . ASN B 1 406 ? 14.377  4.815   -31.478 1.00 54.16  ? 406  ASN B O     1 
ATOM   7261 C CB    . ASN B 1 406 ? 14.675  2.010   -30.179 1.00 54.41  ? 406  ASN B CB    1 
ATOM   7262 C CG    . ASN B 1 406 ? 15.739  0.976   -30.010 1.00 54.62  ? 406  ASN B CG    1 
ATOM   7263 O OD1   . ASN B 1 406 ? 16.805  1.083   -30.608 1.00 53.73  ? 406  ASN B OD1   1 
ATOM   7264 N ND2   . ASN B 1 406 ? 15.471  -0.031  -29.193 1.00 54.61  ? 406  ASN B ND2   1 
ATOM   7265 N N     . VAL B 1 407 ? 13.219  4.868   -29.534 1.00 53.29  ? 407  VAL B N     1 
ATOM   7266 C CA    . VAL B 1 407 ? 12.226  5.834   -30.029 1.00 52.77  ? 407  VAL B CA    1 
ATOM   7267 C C     . VAL B 1 407 ? 12.091  7.099   -29.168 1.00 52.75  ? 407  VAL B C     1 
ATOM   7268 O O     . VAL B 1 407 ? 12.417  8.185   -29.631 1.00 52.83  ? 407  VAL B O     1 
ATOM   7269 C CB    . VAL B 1 407 ? 10.845  5.169   -30.233 1.00 52.82  ? 407  VAL B CB    1 
ATOM   7270 C CG1   . VAL B 1 407 ? 9.852   6.163   -30.835 1.00 51.88  ? 407  VAL B CG1   1 
ATOM   7271 C CG2   . VAL B 1 407 ? 10.977  3.921   -31.134 1.00 53.51  ? 407  VAL B CG2   1 
ATOM   7272 N N     . VAL B 1 408 ? 11.653  6.971   -27.920 1.00 53.61  ? 408  VAL B N     1 
ATOM   7273 C CA    . VAL B 1 408 ? 11.259  8.150   -27.133 1.00 53.89  ? 408  VAL B CA    1 
ATOM   7274 C C     . VAL B 1 408 ? 12.395  9.158   -26.960 1.00 54.61  ? 408  VAL B C     1 
ATOM   7275 O O     . VAL B 1 408 ? 12.191  10.373  -27.128 1.00 54.99  ? 408  VAL B O     1 
ATOM   7276 C CB    . VAL B 1 408 ? 10.681  7.787   -25.727 1.00 54.65  ? 408  VAL B CB    1 
ATOM   7277 C CG1   . VAL B 1 408 ? 10.127  9.055   -25.022 1.00 52.50  ? 408  VAL B CG1   1 
ATOM   7278 C CG2   . VAL B 1 408 ? 9.602   6.693   -25.839 1.00 53.57  ? 408  VAL B CG2   1 
ATOM   7279 N N     . CYS B 1 409 ? 13.585  8.682   -26.614 1.00 55.18  ? 409  CYS B N     1 
ATOM   7280 C CA    . CYS B 1 409 ? 14.676  9.611   -26.354 1.00 55.89  ? 409  CYS B CA    1 
ATOM   7281 C C     . CYS B 1 409 ? 15.308  10.175  -27.619 1.00 55.73  ? 409  CYS B C     1 
ATOM   7282 O O     . CYS B 1 409 ? 15.668  11.361  -27.637 1.00 56.07  ? 409  CYS B O     1 
ATOM   7283 C CB    . CYS B 1 409 ? 15.713  8.997   -25.413 1.00 56.84  ? 409  CYS B CB    1 
ATOM   7284 S SG    . CYS B 1 409 ? 15.007  8.665   -23.789 1.00 58.20  ? 409  CYS B SG    1 
ATOM   7285 N N     . PRO B 1 410 ? 15.498  9.339   -28.659 1.00 55.68  ? 410  PRO B N     1 
ATOM   7286 C CA    . PRO B 1 410 ? 15.763  9.908   -29.982 1.00 55.45  ? 410  PRO B CA    1 
ATOM   7287 C C     . PRO B 1 410 ? 14.750  10.975  -30.403 1.00 54.71  ? 410  PRO B C     1 
ATOM   7288 O O     . PRO B 1 410 ? 15.141  12.028  -30.921 1.00 54.82  ? 410  PRO B O     1 
ATOM   7289 C CB    . PRO B 1 410 ? 15.697  8.688   -30.898 1.00 55.48  ? 410  PRO B CB    1 
ATOM   7290 C CG    . PRO B 1 410 ? 16.208  7.589   -30.042 1.00 56.20  ? 410  PRO B CG    1 
ATOM   7291 C CD    . PRO B 1 410 ? 15.624  7.870   -28.677 1.00 55.98  ? 410  PRO B CD    1 
ATOM   7292 N N     . VAL B 1 411 ? 13.472  10.726  -30.158 1.00 54.13  ? 411  VAL B N     1 
ATOM   7293 C CA    . VAL B 1 411 ? 12.445  11.725  -30.488 1.00 53.89  ? 411  VAL B CA    1 
ATOM   7294 C C     . VAL B 1 411 ? 12.627  13.028  -29.680 1.00 54.47  ? 411  VAL B C     1 
ATOM   7295 O O     . VAL B 1 411 ? 12.591  14.115  -30.270 1.00 54.33  ? 411  VAL B O     1 
ATOM   7296 C CB    . VAL B 1 411 ? 11.016  11.172  -30.313 1.00 53.38  ? 411  VAL B CB    1 
ATOM   7297 C CG1   . VAL B 1 411 ? 10.019  12.278  -30.317 1.00 51.78  ? 411  VAL B CG1   1 
ATOM   7298 C CG2   . VAL B 1 411 ? 10.698  10.147  -31.415 1.00 53.33  ? 411  VAL B CG2   1 
ATOM   7299 N N     . ALA B 1 412 ? 12.834  12.920  -28.359 1.00 54.89  ? 412  ALA B N     1 
ATOM   7300 C CA    . ALA B 1 412 ? 13.021  14.107  -27.507 1.00 55.37  ? 412  ALA B CA    1 
ATOM   7301 C C     . ALA B 1 412 ? 14.232  14.896  -27.964 1.00 56.02  ? 412  ALA B C     1 
ATOM   7302 O O     . ALA B 1 412 ? 14.211  16.132  -28.043 1.00 56.53  ? 412  ALA B O     1 
ATOM   7303 C CB    . ALA B 1 412 ? 13.171  13.718  -26.024 1.00 55.92  ? 412  ALA B CB    1 
ATOM   7304 N N     . GLN B 1 413 ? 15.291  14.168  -28.278 1.00 56.44  ? 413  GLN B N     1 
ATOM   7305 C CA    . GLN B 1 413 ? 16.512  14.775  -28.794 1.00 57.19  ? 413  GLN B CA    1 
ATOM   7306 C C     . GLN B 1 413 ? 16.261  15.568  -30.083 1.00 56.27  ? 413  GLN B C     1 
ATOM   7307 O O     . GLN B 1 413 ? 16.739  16.698  -30.227 1.00 55.97  ? 413  GLN B O     1 
ATOM   7308 C CB    . GLN B 1 413 ? 17.533  13.673  -29.040 1.00 58.24  ? 413  GLN B CB    1 
ATOM   7309 C CG    . GLN B 1 413 ? 18.724  14.074  -29.851 1.00 61.81  ? 413  GLN B CG    1 
ATOM   7310 C CD    . GLN B 1 413 ? 19.948  14.126  -29.025 1.00 68.51  ? 413  GLN B CD    1 
ATOM   7311 O OE1   . GLN B 1 413 ? 20.112  15.024  -28.188 1.00 72.81  ? 413  GLN B OE1   1 
ATOM   7312 N NE2   . GLN B 1 413 ? 20.832  13.145  -29.224 1.00 71.83  ? 413  GLN B NE2   1 
ATOM   7313 N N     . LEU B 1 414 ? 15.529  14.966  -31.021 1.00 55.06  ? 414  LEU B N     1 
ATOM   7314 C CA    . LEU B 1 414 ? 15.215  15.630  -32.278 1.00 54.76  ? 414  LEU B CA    1 
ATOM   7315 C C     . LEU B 1 414 ? 14.333  16.869  -32.062 1.00 54.70  ? 414  LEU B C     1 
ATOM   7316 O O     . LEU B 1 414 ? 14.620  17.945  -32.577 1.00 54.52  ? 414  LEU B O     1 
ATOM   7317 C CB    . LEU B 1 414 ? 14.519  14.658  -33.211 1.00 54.38  ? 414  LEU B CB    1 
ATOM   7318 C CG    . LEU B 1 414 ? 14.130  15.185  -34.596 1.00 54.58  ? 414  LEU B CG    1 
ATOM   7319 C CD1   . LEU B 1 414 ? 15.339  15.348  -35.480 1.00 53.68  ? 414  LEU B CD1   1 
ATOM   7320 C CD2   . LEU B 1 414 ? 13.105  14.256  -35.218 1.00 54.40  ? 414  LEU B CD2   1 
ATOM   7321 N N     . ALA B 1 415 ? 13.260  16.694  -31.303 1.00 54.44  ? 415  ALA B N     1 
ATOM   7322 C CA    . ALA B 1 415 ? 12.326  17.760  -31.000 1.00 55.06  ? 415  ALA B CA    1 
ATOM   7323 C C     . ALA B 1 415 ? 13.063  18.968  -30.452 1.00 56.30  ? 415  ALA B C     1 
ATOM   7324 O O     . ALA B 1 415 ? 12.814  20.096  -30.858 1.00 56.75  ? 415  ALA B O     1 
ATOM   7325 C CB    . ALA B 1 415 ? 11.284  17.274  -29.993 1.00 54.46  ? 415  ALA B CB    1 
ATOM   7326 N N     . GLY B 1 416 ? 13.981  18.713  -29.530 1.00 57.28  ? 416  GLY B N     1 
ATOM   7327 C CA    . GLY B 1 416 ? 14.736  19.761  -28.882 1.00 58.47  ? 416  GLY B CA    1 
ATOM   7328 C C     . GLY B 1 416 ? 15.710  20.480  -29.782 1.00 59.65  ? 416  GLY B C     1 
ATOM   7329 O O     . GLY B 1 416 ? 15.854  21.706  -29.674 1.00 61.12  ? 416  GLY B O     1 
ATOM   7330 N N     . ARG B 1 417 ? 16.399  19.736  -30.644 1.00 59.88  ? 417  ARG B N     1 
ATOM   7331 C CA    . ARG B 1 417 ? 17.340  20.336  -31.591 1.00 61.38  ? 417  ARG B CA    1 
ATOM   7332 C C     . ARG B 1 417 ? 16.606  21.155  -32.637 1.00 61.39  ? 417  ARG B C     1 
ATOM   7333 O O     . ARG B 1 417 ? 16.984  22.287  -32.911 1.00 62.37  ? 417  ARG B O     1 
ATOM   7334 C CB    . ARG B 1 417 ? 18.215  19.289  -32.295 1.00 61.76  ? 417  ARG B CB    1 
ATOM   7335 C CG    . ARG B 1 417 ? 19.260  18.549  -31.449 1.00 64.38  ? 417  ARG B CG    1 
ATOM   7336 C CD    . ARG B 1 417 ? 19.930  19.377  -30.366 1.00 70.44  ? 417  ARG B CD    1 
ATOM   7337 N NE    . ARG B 1 417 ? 20.872  20.369  -30.897 1.00 74.99  ? 417  ARG B NE    1 
ATOM   7338 C CZ    . ARG B 1 417 ? 22.117  20.579  -30.444 1.00 77.95  ? 417  ARG B CZ    1 
ATOM   7339 N NH1   . ARG B 1 417 ? 22.614  19.879  -29.418 1.00 79.18  ? 417  ARG B NH1   1 
ATOM   7340 N NH2   . ARG B 1 417 ? 22.883  21.507  -31.025 1.00 78.35  ? 417  ARG B NH2   1 
ATOM   7341 N N     . LEU B 1 418 ? 15.557  20.584  -33.215 1.00 60.91  ? 418  LEU B N     1 
ATOM   7342 C CA    . LEU B 1 418 ? 14.736  21.297  -34.193 1.00 61.40  ? 418  LEU B CA    1 
ATOM   7343 C C     . LEU B 1 418 ? 14.175  22.589  -33.604 1.00 62.19  ? 418  LEU B C     1 
ATOM   7344 O O     . LEU B 1 418 ? 14.228  23.643  -34.238 1.00 63.23  ? 418  LEU B O     1 
ATOM   7345 C CB    . LEU B 1 418 ? 13.584  20.409  -34.678 1.00 60.79  ? 418  LEU B CB    1 
ATOM   7346 C CG    . LEU B 1 418 ? 13.909  19.191  -35.546 1.00 60.63  ? 418  LEU B CG    1 
ATOM   7347 C CD1   . LEU B 1 418 ? 12.656  18.390  -35.780 1.00 60.00  ? 418  LEU B CD1   1 
ATOM   7348 C CD2   . LEU B 1 418 ? 14.516  19.570  -36.861 1.00 60.70  ? 418  LEU B CD2   1 
ATOM   7349 N N     . ALA B 1 419 ? 13.651  22.502  -32.384 1.00 62.25  ? 419  ALA B N     1 
ATOM   7350 C CA    . ALA B 1 419 ? 13.112  23.671  -31.686 1.00 63.68  ? 419  ALA B CA    1 
ATOM   7351 C C     . ALA B 1 419 ? 14.188  24.737  -31.417 1.00 65.01  ? 419  ALA B C     1 
ATOM   7352 O O     . ALA B 1 419 ? 13.941  25.924  -31.608 1.00 66.33  ? 419  ALA B O     1 
ATOM   7353 C CB    . ALA B 1 419 ? 12.450  23.242  -30.378 1.00 62.97  ? 419  ALA B CB    1 
ATOM   7354 N N     . ALA B 1 420 ? 15.371  24.309  -30.971 1.00 65.21  ? 420  ALA B N     1 
ATOM   7355 C CA    . ALA B 1 420 ? 16.481  25.231  -30.688 1.00 66.48  ? 420  ALA B CA    1 
ATOM   7356 C C     . ALA B 1 420 ? 17.016  25.890  -31.966 1.00 67.57  ? 420  ALA B C     1 
ATOM   7357 O O     . ALA B 1 420 ? 17.480  27.037  -31.940 1.00 69.04  ? 420  ALA B O     1 
ATOM   7358 C CB    . ALA B 1 420 ? 17.625  24.492  -29.960 1.00 66.32  ? 420  ALA B CB    1 
ATOM   7359 N N     . GLN B 1 421 ? 16.960  25.154  -33.072 1.00 66.94  ? 421  GLN B N     1 
ATOM   7360 C CA    . GLN B 1 421 ? 17.493  25.616  -34.336 1.00 67.77  ? 421  GLN B CA    1 
ATOM   7361 C C     . GLN B 1 421 ? 16.426  26.221  -35.269 1.00 67.36  ? 421  GLN B C     1 
ATOM   7362 O O     . GLN B 1 421 ? 16.615  26.256  -36.479 1.00 67.79  ? 421  GLN B O     1 
ATOM   7363 C CB    . GLN B 1 421 ? 18.280  24.483  -35.025 1.00 67.83  ? 421  GLN B CB    1 
ATOM   7364 C CG    . GLN B 1 421 ? 19.781  24.424  -34.605 1.00 70.92  ? 421  GLN B CG    1 
ATOM   7365 C CD    . GLN B 1 421 ? 20.112  23.306  -33.645 1.00 73.20  ? 421  GLN B CD    1 
ATOM   7366 O OE1   . GLN B 1 421 ? 20.508  23.545  -32.501 1.00 75.84  ? 421  GLN B OE1   1 
ATOM   7367 N NE2   . GLN B 1 421 ? 19.961  22.067  -34.107 1.00 74.40  ? 421  GLN B NE2   1 
ATOM   7368 N N     . GLY B 1 422 ? 15.314  26.697  -34.707 1.00 66.64  ? 422  GLY B N     1 
ATOM   7369 C CA    . GLY B 1 422 ? 14.379  27.553  -35.444 1.00 66.80  ? 422  GLY B CA    1 
ATOM   7370 C C     . GLY B 1 422 ? 13.085  26.937  -35.952 1.00 65.57  ? 422  GLY B C     1 
ATOM   7371 O O     . GLY B 1 422 ? 12.191  27.657  -36.406 1.00 65.97  ? 422  GLY B O     1 
ATOM   7372 N N     . ALA B 1 423 ? 12.980  25.612  -35.887 1.00 63.92  ? 423  ALA B N     1 
ATOM   7373 C CA    . ALA B 1 423 ? 11.767  24.917  -36.327 1.00 62.50  ? 423  ALA B CA    1 
ATOM   7374 C C     . ALA B 1 423 ? 10.590  25.193  -35.395 1.00 62.13  ? 423  ALA B C     1 
ATOM   7375 O O     . ALA B 1 423 ? 10.757  25.414  -34.193 1.00 62.24  ? 423  ALA B O     1 
ATOM   7376 C CB    . ALA B 1 423 ? 12.016  23.419  -36.411 1.00 61.18  ? 423  ALA B CB    1 
ATOM   7377 N N     . ARG B 1 424 ? 9.399   25.199  -35.978 1.00 61.58  ? 424  ARG B N     1 
ATOM   7378 C CA    . ARG B 1 424 ? 8.150   25.149  -35.228 1.00 61.49  ? 424  ARG B CA    1 
ATOM   7379 C C     . ARG B 1 424 ? 7.798   23.681  -35.006 1.00 58.52  ? 424  ARG B C     1 
ATOM   7380 O O     . ARG B 1 424 ? 7.595   22.954  -35.962 1.00 57.83  ? 424  ARG B O     1 
ATOM   7381 C CB    . ARG B 1 424 ? 7.075   25.838  -36.047 1.00 62.45  ? 424  ARG B CB    1 
ATOM   7382 C CG    . ARG B 1 424 ? 5.646   25.711  -35.555 1.00 64.81  ? 424  ARG B CG    1 
ATOM   7383 C CD    . ARG B 1 424 ? 4.750   26.659  -36.402 1.00 66.92  ? 424  ARG B CD    1 
ATOM   7384 N NE    . ARG B 1 424 ? 3.793   27.419  -35.611 1.00 71.69  ? 424  ARG B NE    1 
ATOM   7385 C CZ    . ARG B 1 424 ? 4.101   28.227  -34.592 1.00 71.43  ? 424  ARG B CZ    1 
ATOM   7386 N NH1   . ARG B 1 424 ? 5.346   28.405  -34.173 1.00 72.59  ? 424  ARG B NH1   1 
ATOM   7387 N NH2   . ARG B 1 424 ? 3.136   28.847  -33.970 1.00 71.76  ? 424  ARG B NH2   1 
ATOM   7388 N N     . VAL B 1 425 ? 7.735   23.253  -33.748 1.00 56.57  ? 425  VAL B N     1 
ATOM   7389 C CA    . VAL B 1 425 ? 7.575   21.833  -33.417 1.00 54.05  ? 425  VAL B CA    1 
ATOM   7390 C C     . VAL B 1 425 ? 6.331   21.620  -32.557 1.00 53.68  ? 425  VAL B C     1 
ATOM   7391 O O     . VAL B 1 425 ? 6.078   22.381  -31.631 1.00 53.89  ? 425  VAL B O     1 
ATOM   7392 C CB    . VAL B 1 425 ? 8.830   21.295  -32.650 1.00 53.79  ? 425  VAL B CB    1 
ATOM   7393 C CG1   . VAL B 1 425 ? 8.717   19.772  -32.354 1.00 51.47  ? 425  VAL B CG1   1 
ATOM   7394 C CG2   . VAL B 1 425 ? 10.125  21.625  -33.410 1.00 51.28  ? 425  VAL B CG2   1 
ATOM   7395 N N     . TYR B 1 426 ? 5.557   20.582  -32.866 1.00 52.80  ? 426  TYR B N     1 
ATOM   7396 C CA    . TYR B 1 426 ? 4.457   20.134  -32.010 1.00 52.49  ? 426  TYR B CA    1 
ATOM   7397 C C     . TYR B 1 426 ? 4.669   18.657  -31.679 1.00 52.14  ? 426  TYR B C     1 
ATOM   7398 O O     . TYR B 1 426 ? 4.916   17.863  -32.577 1.00 52.00  ? 426  TYR B O     1 
ATOM   7399 C CB    . TYR B 1 426 ? 3.118   20.302  -32.722 1.00 52.34  ? 426  TYR B CB    1 
ATOM   7400 C CG    . TYR B 1 426 ? 2.740   21.735  -33.017 1.00 52.68  ? 426  TYR B CG    1 
ATOM   7401 C CD1   . TYR B 1 426 ? 3.131   22.356  -34.206 1.00 53.63  ? 426  TYR B CD1   1 
ATOM   7402 C CD2   . TYR B 1 426 ? 1.979   22.461  -32.133 1.00 50.43  ? 426  TYR B CD2   1 
ATOM   7403 C CE1   . TYR B 1 426 ? 2.779   23.677  -34.480 1.00 52.51  ? 426  TYR B CE1   1 
ATOM   7404 C CE2   . TYR B 1 426 ? 1.622   23.748  -32.408 1.00 53.45  ? 426  TYR B CE2   1 
ATOM   7405 C CZ    . TYR B 1 426 ? 2.016   24.353  -33.577 1.00 53.35  ? 426  TYR B CZ    1 
ATOM   7406 O OH    . TYR B 1 426 ? 1.643   25.655  -33.812 1.00 55.55  ? 426  TYR B OH    1 
ATOM   7407 N N     . ALA B 1 427 ? 4.570   18.304  -30.395 1.00 52.29  ? 427  ALA B N     1 
ATOM   7408 C CA    . ALA B 1 427 ? 4.831   16.948  -29.917 1.00 51.99  ? 427  ALA B CA    1 
ATOM   7409 C C     . ALA B 1 427 ? 3.598   16.341  -29.250 1.00 52.71  ? 427  ALA B C     1 
ATOM   7410 O O     . ALA B 1 427 ? 2.814   17.045  -28.622 1.00 53.18  ? 427  ALA B O     1 
ATOM   7411 C CB    . ALA B 1 427 ? 5.995   16.953  -28.947 1.00 51.70  ? 427  ALA B CB    1 
ATOM   7412 N N     . TYR B 1 428 ? 3.444   15.030  -29.392 1.00 52.80  ? 428  TYR B N     1 
ATOM   7413 C CA    . TYR B 1 428 ? 2.346   14.287  -28.772 1.00 53.70  ? 428  TYR B CA    1 
ATOM   7414 C C     . TYR B 1 428 ? 2.844   12.963  -28.205 1.00 53.84  ? 428  TYR B C     1 
ATOM   7415 O O     . TYR B 1 428 ? 3.885   12.442  -28.606 1.00 52.05  ? 428  TYR B O     1 
ATOM   7416 C CB    . TYR B 1 428 ? 1.230   13.972  -29.789 1.00 54.15  ? 428  TYR B CB    1 
ATOM   7417 C CG    . TYR B 1 428 ? 1.648   12.983  -30.877 1.00 53.78  ? 428  TYR B CG    1 
ATOM   7418 C CD1   . TYR B 1 428 ? 1.658   11.609  -30.643 1.00 53.54  ? 428  TYR B CD1   1 
ATOM   7419 C CD2   . TYR B 1 428 ? 2.053   13.435  -32.127 1.00 53.56  ? 428  TYR B CD2   1 
ATOM   7420 C CE1   . TYR B 1 428 ? 2.060   10.708  -31.622 1.00 53.07  ? 428  TYR B CE1   1 
ATOM   7421 C CE2   . TYR B 1 428 ? 2.455   12.551  -33.113 1.00 53.68  ? 428  TYR B CE2   1 
ATOM   7422 C CZ    . TYR B 1 428 ? 2.460   11.189  -32.861 1.00 54.10  ? 428  TYR B CZ    1 
ATOM   7423 O OH    . TYR B 1 428 ? 2.878   10.326  -33.853 1.00 52.42  ? 428  TYR B OH    1 
ATOM   7424 N N     . ILE B 1 429 ? 2.071   12.442  -27.255 1.00 55.78  ? 429  ILE B N     1 
ATOM   7425 C CA    . ILE B 1 429 ? 2.106   11.021  -26.887 1.00 56.66  ? 429  ILE B CA    1 
ATOM   7426 C C     . ILE B 1 429 ? 0.719   10.462  -27.094 1.00 57.20  ? 429  ILE B C     1 
ATOM   7427 O O     . ILE B 1 429 ? -0.263  11.074  -26.697 1.00 58.01  ? 429  ILE B O     1 
ATOM   7428 C CB    . ILE B 1 429 ? 2.554   10.780  -25.431 1.00 57.20  ? 429  ILE B CB    1 
ATOM   7429 C CG1   . ILE B 1 429 ? 2.598   9.276   -25.150 1.00 57.67  ? 429  ILE B CG1   1 
ATOM   7430 C CG2   . ILE B 1 429 ? 1.619   11.498  -24.440 1.00 58.15  ? 429  ILE B CG2   1 
ATOM   7431 C CD1   . ILE B 1 429 ? 3.454   8.902   -23.945 1.00 58.61  ? 429  ILE B CD1   1 
ATOM   7432 N N     . PHE B 1 430 ? 0.652   9.309   -27.747 1.00 57.67  ? 430  PHE B N     1 
ATOM   7433 C CA    . PHE B 1 430 ? -0.602  8.686   -28.113 1.00 58.56  ? 430  PHE B CA    1 
ATOM   7434 C C     . PHE B 1 430 ? -0.879  7.536   -27.145 1.00 59.70  ? 430  PHE B C     1 
ATOM   7435 O O     . PHE B 1 430 ? -0.086  6.598   -27.058 1.00 59.60  ? 430  PHE B O     1 
ATOM   7436 C CB    . PHE B 1 430 ? -0.500  8.189   -29.550 1.00 58.15  ? 430  PHE B CB    1 
ATOM   7437 C CG    . PHE B 1 430 ? -1.724  7.478   -30.030 1.00 59.69  ? 430  PHE B CG    1 
ATOM   7438 C CD1   . PHE B 1 430 ? -1.874  6.109   -29.826 1.00 60.69  ? 430  PHE B CD1   1 
ATOM   7439 C CD2   . PHE B 1 430 ? -2.731  8.169   -30.687 1.00 59.83  ? 430  PHE B CD2   1 
ATOM   7440 C CE1   . PHE B 1 430 ? -3.022  5.446   -30.266 1.00 61.67  ? 430  PHE B CE1   1 
ATOM   7441 C CE2   . PHE B 1 430 ? -3.882  7.512   -31.128 1.00 61.04  ? 430  PHE B CE2   1 
ATOM   7442 C CZ    . PHE B 1 430 ? -4.022  6.148   -30.919 1.00 61.76  ? 430  PHE B CZ    1 
ATOM   7443 N N     . GLU B 1 431 ? -2.009  7.591   -26.440 1.00 61.33  ? 431  GLU B N     1 
ATOM   7444 C CA    . GLU B 1 431 ? -2.227  6.722   -25.279 1.00 63.04  ? 431  GLU B CA    1 
ATOM   7445 C C     . GLU B 1 431 ? -3.498  5.910   -25.296 1.00 64.38  ? 431  GLU B C     1 
ATOM   7446 O O     . GLU B 1 431 ? -3.856  5.330   -24.271 1.00 65.92  ? 431  GLU B O     1 
ATOM   7447 C CB    . GLU B 1 431 ? -2.264  7.549   -24.001 1.00 63.44  ? 431  GLU B CB    1 
ATOM   7448 C CG    . GLU B 1 431 ? -1.055  8.397   -23.719 1.00 63.16  ? 431  GLU B CG    1 
ATOM   7449 C CD    . GLU B 1 431 ? -1.195  9.111   -22.385 1.00 64.20  ? 431  GLU B CD    1 
ATOM   7450 O OE1   . GLU B 1 431 ? -2.305  9.604   -22.083 1.00 67.85  ? 431  GLU B OE1   1 
ATOM   7451 O OE2   . GLU B 1 431 ? -0.213  9.135   -21.621 1.00 66.40  ? 431  GLU B OE2   1 
ATOM   7452 N N     . HIS B 1 432 ? -4.195  5.877   -26.424 1.00 64.57  ? 432  HIS B N     1 
ATOM   7453 C CA    . HIS B 1 432 ? -5.403  5.075   -26.540 1.00 65.56  ? 432  HIS B CA    1 
ATOM   7454 C C     . HIS B 1 432 ? -5.097  3.704   -27.145 1.00 65.90  ? 432  HIS B C     1 
ATOM   7455 O O     . HIS B 1 432 ? -4.540  3.622   -28.240 1.00 64.87  ? 432  HIS B O     1 
ATOM   7456 C CB    . HIS B 1 432 ? -6.448  5.781   -27.397 1.00 65.86  ? 432  HIS B CB    1 
ATOM   7457 C CG    . HIS B 1 432 ? -7.624  4.915   -27.718 1.00 67.31  ? 432  HIS B CG    1 
ATOM   7458 N ND1   . HIS B 1 432 ? -8.514  4.487   -26.757 1.00 69.17  ? 432  HIS B ND1   1 
ATOM   7459 C CD2   . HIS B 1 432 ? -8.021  4.347   -28.880 1.00 67.34  ? 432  HIS B CD2   1 
ATOM   7460 C CE1   . HIS B 1 432 ? -9.421  3.708   -27.319 1.00 71.10  ? 432  HIS B CE1   1 
ATOM   7461 N NE2   . HIS B 1 432 ? -9.146  3.609   -28.607 1.00 69.70  ? 432  HIS B NE2   1 
ATOM   7462 N N     . ARG B 1 433 ? -5.487  2.642   -26.438 1.00 67.38  ? 433  ARG B N     1 
ATOM   7463 C CA    . ARG B 1 433 ? -5.385  1.268   -26.942 1.00 68.19  ? 433  ARG B CA    1 
ATOM   7464 C C     . ARG B 1 433 ? -6.674  0.886   -27.677 1.00 69.39  ? 433  ARG B C     1 
ATOM   7465 O O     . ARG B 1 433 ? -7.758  0.898   -27.092 1.00 70.83  ? 433  ARG B O     1 
ATOM   7466 C CB    . ARG B 1 433 ? -5.152  0.285   -25.787 1.00 69.23  ? 433  ARG B CB    1 
ATOM   7467 C CG    . ARG B 1 433 ? -4.914  -1.167  -26.225 1.00 70.02  ? 433  ARG B CG    1 
ATOM   7468 C CD    . ARG B 1 433 ? -4.939  -2.109  -25.024 1.00 71.93  ? 433  ARG B CD    1 
ATOM   7469 N NE    . ARG B 1 433 ? -5.230  -3.510  -25.370 1.00 72.69  ? 433  ARG B NE    1 
ATOM   7470 C CZ    . ARG B 1 433 ? -4.305  -4.431  -25.638 1.00 72.81  ? 433  ARG B CZ    1 
ATOM   7471 N NH1   . ARG B 1 433 ? -3.005  -4.135  -25.600 1.00 71.12  ? 433  ARG B NH1   1 
ATOM   7472 N NH2   . ARG B 1 433 ? -4.684  -5.668  -25.935 1.00 73.47  ? 433  ARG B NH2   1 
ATOM   7473 N N     . ALA B 1 434 ? -6.542  0.536   -28.953 1.00 68.88  ? 434  ALA B N     1 
ATOM   7474 C CA    . ALA B 1 434 ? -7.683  0.182   -29.782 1.00 70.10  ? 434  ALA B CA    1 
ATOM   7475 C C     . ALA B 1 434 ? -8.463  -0.977  -29.172 1.00 72.31  ? 434  ALA B C     1 
ATOM   7476 O O     . ALA B 1 434 ? -7.878  -1.978  -28.759 1.00 72.78  ? 434  ALA B O     1 
ATOM   7477 C CB    . ALA B 1 434 ? -7.224  -0.178  -31.178 1.00 69.21  ? 434  ALA B CB    1 
ATOM   7478 N N     . SER B 1 435 ? -9.785  -0.832  -29.120 1.00 73.94  ? 435  SER B N     1 
ATOM   7479 C CA    . SER B 1 435 ? -10.671 -1.882  -28.616 1.00 76.38  ? 435  SER B CA    1 
ATOM   7480 C C     . SER B 1 435 ? -10.552 -3.174  -29.433 1.00 77.02  ? 435  SER B C     1 
ATOM   7481 O O     . SER B 1 435 ? -10.819 -4.263  -28.934 1.00 78.62  ? 435  SER B O     1 
ATOM   7482 C CB    . SER B 1 435 ? -12.129 -1.383  -28.594 1.00 77.95  ? 435  SER B CB    1 
ATOM   7483 O OG    . SER B 1 435 ? -12.576 -1.000  -29.890 1.00 77.56  ? 435  SER B OG    1 
ATOM   7484 N N     . THR B 1 436 ? -10.124 -3.041  -30.682 1.00 76.21  ? 436  THR B N     1 
ATOM   7485 C CA    . THR B 1 436 ? -10.008 -4.168  -31.608 1.00 77.03  ? 436  THR B CA    1 
ATOM   7486 C C     . THR B 1 436 ? -8.625  -4.865  -31.613 1.00 76.11  ? 436  THR B C     1 
ATOM   7487 O O     . THR B 1 436 ? -8.429  -5.854  -32.330 1.00 76.19  ? 436  THR B O     1 
ATOM   7488 C CB    . THR B 1 436 ? -10.328 -3.676  -33.033 1.00 76.56  ? 436  THR B CB    1 
ATOM   7489 O OG1   . THR B 1 436 ? -9.531  -2.513  -33.325 1.00 74.81  ? 436  THR B OG1   1 
ATOM   7490 C CG2   . THR B 1 436 ? -11.811 -3.321  -33.139 1.00 77.56  ? 436  THR B CG2   1 
ATOM   7491 N N     . LEU B 1 437 ? -7.689  -4.359  -30.804 1.00 74.97  ? 437  LEU B N     1 
ATOM   7492 C CA    . LEU B 1 437 ? -6.305  -4.845  -30.778 1.00 73.96  ? 437  LEU B CA    1 
ATOM   7493 C C     . LEU B 1 437 ? -6.223  -6.316  -30.413 1.00 75.40  ? 437  LEU B C     1 
ATOM   7494 O O     . LEU B 1 437 ? -6.849  -6.752  -29.456 1.00 77.29  ? 437  LEU B O     1 
ATOM   7495 C CB    . LEU B 1 437 ? -5.479  -4.020  -29.777 1.00 73.17  ? 437  LEU B CB    1 
ATOM   7496 C CG    . LEU B 1 437 ? -3.942  -4.058  -29.844 1.00 71.81  ? 437  LEU B CG    1 
ATOM   7497 C CD1   . LEU B 1 437 ? -3.400  -3.899  -31.254 1.00 70.06  ? 437  LEU B CD1   1 
ATOM   7498 C CD2   . LEU B 1 437 ? -3.369  -2.983  -28.941 1.00 70.50  ? 437  LEU B CD2   1 
ATOM   7499 N N     . THR B 1 438 ? -5.439  -7.073  -31.174 1.00 74.92  ? 438  THR B N     1 
ATOM   7500 C CA    . THR B 1 438 ? -5.326  -8.526  -30.987 1.00 76.36  ? 438  THR B CA    1 
ATOM   7501 C C     . THR B 1 438 ? -4.061  -8.939  -30.222 1.00 75.79  ? 438  THR B C     1 
ATOM   7502 O O     . THR B 1 438 ? -3.939  -10.095 -29.809 1.00 77.27  ? 438  THR B O     1 
ATOM   7503 C CB    . THR B 1 438 ? -5.336  -9.240  -32.339 1.00 76.55  ? 438  THR B CB    1 
ATOM   7504 O OG1   . THR B 1 438 ? -4.293  -8.701  -33.165 1.00 74.87  ? 438  THR B OG1   1 
ATOM   7505 C CG2   . THR B 1 438 ? -6.678  -9.039  -33.024 1.00 77.24  ? 438  THR B CG2   1 
ATOM   7506 N N     . TRP B 1 439 ? -3.119  -8.007  -30.057 1.00 73.43  ? 439  TRP B N     1 
ATOM   7507 C CA    . TRP B 1 439 ? -1.965  -8.231  -29.188 1.00 72.81  ? 439  TRP B CA    1 
ATOM   7508 C C     . TRP B 1 439 ? -2.442  -8.198  -27.750 1.00 73.57  ? 439  TRP B C     1 
ATOM   7509 O O     . TRP B 1 439 ? -3.425  -7.528  -27.453 1.00 73.28  ? 439  TRP B O     1 
ATOM   7510 C CB    . TRP B 1 439 ? -0.903  -7.150  -29.392 1.00 70.82  ? 439  TRP B CB    1 
ATOM   7511 C CG    . TRP B 1 439 ? -0.239  -7.197  -30.727 1.00 69.72  ? 439  TRP B CG    1 
ATOM   7512 C CD1   . TRP B 1 439 ? -0.512  -6.404  -31.797 1.00 69.01  ? 439  TRP B CD1   1 
ATOM   7513 C CD2   . TRP B 1 439 ? 0.813   -8.079  -31.137 1.00 69.91  ? 439  TRP B CD2   1 
ATOM   7514 N NE1   . TRP B 1 439 ? 0.300   -6.739  -32.848 1.00 68.64  ? 439  TRP B NE1   1 
ATOM   7515 C CE2   . TRP B 1 439 ? 1.122   -7.764  -32.471 1.00 69.09  ? 439  TRP B CE2   1 
ATOM   7516 C CE3   . TRP B 1 439 ? 1.520   -9.108  -30.509 1.00 71.52  ? 439  TRP B CE3   1 
ATOM   7517 C CZ2   . TRP B 1 439 ? 2.110   -8.436  -33.188 1.00 69.08  ? 439  TRP B CZ2   1 
ATOM   7518 C CZ3   . TRP B 1 439 ? 2.500   -9.773  -31.221 1.00 71.00  ? 439  TRP B CZ3   1 
ATOM   7519 C CH2   . TRP B 1 439 ? 2.787   -9.433  -32.544 1.00 69.91  ? 439  TRP B CH2   1 
ATOM   7520 N N     . PRO B 1 440 ? -1.741  -8.906  -26.849 1.00 74.34  ? 440  PRO B N     1 
ATOM   7521 C CA    . PRO B 1 440 ? -2.175  -8.988  -25.452 1.00 75.78  ? 440  PRO B CA    1 
ATOM   7522 C C     . PRO B 1 440 ? -2.076  -7.674  -24.674 1.00 74.59  ? 440  PRO B C     1 
ATOM   7523 O O     . PRO B 1 440 ? -1.308  -6.787  -25.031 1.00 72.82  ? 440  PRO B O     1 
ATOM   7524 C CB    . PRO B 1 440 ? -1.215  -10.013 -24.854 1.00 76.44  ? 440  PRO B CB    1 
ATOM   7525 C CG    . PRO B 1 440 ? -0.005  -9.855  -25.644 1.00 74.97  ? 440  PRO B CG    1 
ATOM   7526 C CD    . PRO B 1 440 ? -0.497  -9.660  -27.055 1.00 74.08  ? 440  PRO B CD    1 
ATOM   7527 N N     . LEU B 1 441 ? -2.841  -7.598  -23.594 1.00 76.09  ? 441  LEU B N     1 
ATOM   7528 C CA    . LEU B 1 441 ? -2.942  -6.406  -22.759 1.00 75.86  ? 441  LEU B CA    1 
ATOM   7529 C C     . LEU B 1 441 ? -1.622  -5.888  -22.214 1.00 74.36  ? 441  LEU B C     1 
ATOM   7530 O O     . LEU B 1 441 ? -1.465  -4.685  -22.001 1.00 72.78  ? 441  LEU B O     1 
ATOM   7531 C CB    . LEU B 1 441 ? -3.886  -6.674  -21.581 1.00 78.15  ? 441  LEU B CB    1 
ATOM   7532 C CG    . LEU B 1 441 ? -5.369  -6.509  -21.925 1.00 80.70  ? 441  LEU B CG    1 
ATOM   7533 C CD1   . LEU B 1 441 ? -6.264  -7.288  -20.950 1.00 84.46  ? 441  LEU B CD1   1 
ATOM   7534 C CD2   . LEU B 1 441 ? -5.735  -5.017  -21.946 1.00 80.25  ? 441  LEU B CD2   1 
ATOM   7535 N N     . TRP B 1 442 ? -0.678  -6.786  -21.963 1.00 74.79  ? 442  TRP B N     1 
ATOM   7536 C CA    . TRP B 1 442 ? 0.565   -6.372  -21.314 1.00 73.74  ? 442  TRP B CA    1 
ATOM   7537 C C     . TRP B 1 442 ? 1.370   -5.462  -22.231 1.00 71.11  ? 442  TRP B C     1 
ATOM   7538 O O     . TRP B 1 442 ? 2.162   -4.676  -21.747 1.00 69.93  ? 442  TRP B O     1 
ATOM   7539 C CB    . TRP B 1 442 ? 1.394   -7.581  -20.810 1.00 74.98  ? 442  TRP B CB    1 
ATOM   7540 C CG    . TRP B 1 442 ? 2.073   -8.398  -21.869 1.00 74.82  ? 442  TRP B CG    1 
ATOM   7541 C CD1   . TRP B 1 442 ? 1.682   -9.613  -22.335 1.00 76.51  ? 442  TRP B CD1   1 
ATOM   7542 C CD2   . TRP B 1 442 ? 3.276   -8.061  -22.581 1.00 73.61  ? 442  TRP B CD2   1 
ATOM   7543 N NE1   . TRP B 1 442 ? 2.557   -10.055 -23.300 1.00 76.06  ? 442  TRP B NE1   1 
ATOM   7544 C CE2   . TRP B 1 442 ? 3.544   -9.121  -23.468 1.00 74.02  ? 442  TRP B CE2   1 
ATOM   7545 C CE3   . TRP B 1 442 ? 4.154   -6.964  -22.553 1.00 71.52  ? 442  TRP B CE3   1 
ATOM   7546 C CZ2   . TRP B 1 442 ? 4.649   -9.119  -24.322 1.00 72.95  ? 442  TRP B CZ2   1 
ATOM   7547 C CZ3   . TRP B 1 442 ? 5.244   -6.961  -23.403 1.00 70.75  ? 442  TRP B CZ3   1 
ATOM   7548 C CH2   . TRP B 1 442 ? 5.483   -8.032  -24.278 1.00 71.19  ? 442  TRP B CH2   1 
ATOM   7549 N N     . MET B 1 443 ? 1.152   -5.556  -23.544 1.00 70.34  ? 443  MET B N     1 
ATOM   7550 C CA    . MET B 1 443 ? 1.865   -4.706  -24.505 1.00 68.48  ? 443  MET B CA    1 
ATOM   7551 C C     . MET B 1 443 ? 1.373   -3.250  -24.530 1.00 66.93  ? 443  MET B C     1 
ATOM   7552 O O     . MET B 1 443 ? 2.012   -2.393  -25.153 1.00 65.86  ? 443  MET B O     1 
ATOM   7553 C CB    . MET B 1 443 ? 1.781   -5.289  -25.914 1.00 68.38  ? 443  MET B CB    1 
ATOM   7554 C CG    . MET B 1 443 ? 2.462   -6.635  -26.072 1.00 69.92  ? 443  MET B CG    1 
ATOM   7555 S SD    . MET B 1 443 ? 2.747   -7.072  -27.796 1.00 70.09  ? 443  MET B SD    1 
ATOM   7556 C CE    . MET B 1 443 ? 3.466   -8.685  -27.594 1.00 72.38  ? 443  MET B CE    1 
ATOM   7557 N N     . GLY B 1 444 ? 0.258   -2.976  -23.857 1.00 67.03  ? 444  GLY B N     1 
ATOM   7558 C CA    . GLY B 1 444 ? -0.289  -1.636  -23.765 1.00 66.01  ? 444  GLY B CA    1 
ATOM   7559 C C     . GLY B 1 444 ? -0.715  -1.041  -25.101 1.00 64.74  ? 444  GLY B C     1 
ATOM   7560 O O     . GLY B 1 444 ? -1.516  -1.633  -25.828 1.00 65.17  ? 444  GLY B O     1 
ATOM   7561 N N     . VAL B 1 445 ? -0.200  0.155   -25.392 1.00 62.80  ? 445  VAL B N     1 
ATOM   7562 C CA    . VAL B 1 445 ? -0.396  0.816   -26.674 1.00 61.53  ? 445  VAL B CA    1 
ATOM   7563 C C     . VAL B 1 445 ? 0.876   0.591   -27.484 1.00 60.43  ? 445  VAL B C     1 
ATOM   7564 O O     . VAL B 1 445 ? 1.847   1.313   -27.329 1.00 59.21  ? 445  VAL B O     1 
ATOM   7565 C CB    . VAL B 1 445 ? -0.654  2.324   -26.500 1.00 60.85  ? 445  VAL B CB    1 
ATOM   7566 C CG1   . VAL B 1 445 ? -1.072  2.947   -27.832 1.00 58.61  ? 445  VAL B CG1   1 
ATOM   7567 C CG2   . VAL B 1 445 ? -1.712  2.558   -25.416 1.00 61.06  ? 445  VAL B CG2   1 
ATOM   7568 N N     . PRO B 1 446 ? 0.895   -0.455  -28.322 1.00 60.94  ? 446  PRO B N     1 
ATOM   7569 C CA    . PRO B 1 446 ? 2.166   -0.809  -28.938 1.00 60.30  ? 446  PRO B CA    1 
ATOM   7570 C C     . PRO B 1 446 ? 2.515   0.051   -30.140 1.00 59.06  ? 446  PRO B C     1 
ATOM   7571 O O     . PRO B 1 446 ? 1.647   0.708   -30.709 1.00 58.66  ? 446  PRO B O     1 
ATOM   7572 C CB    . PRO B 1 446 ? 1.958   -2.273  -29.370 1.00 61.10  ? 446  PRO B CB    1 
ATOM   7573 C CG    . PRO B 1 446 ? 0.567   -2.641  -28.898 1.00 62.69  ? 446  PRO B CG    1 
ATOM   7574 C CD    . PRO B 1 446 ? -0.169  -1.370  -28.749 1.00 61.85  ? 446  PRO B CD    1 
ATOM   7575 N N     . HIS B 1 447 ? 3.797   0.025   -30.497 1.00 58.83  ? 447  HIS B N     1 
ATOM   7576 C CA    . HIS B 1 447 ? 4.330   0.650   -31.705 1.00 58.13  ? 447  HIS B CA    1 
ATOM   7577 C C     . HIS B 1 447 ? 3.419   0.303   -32.894 1.00 58.27  ? 447  HIS B C     1 
ATOM   7578 O O     . HIS B 1 447 ? 3.047   -0.853  -33.075 1.00 59.02  ? 447  HIS B O     1 
ATOM   7579 C CB    . HIS B 1 447 ? 5.760   0.124   -31.903 1.00 58.61  ? 447  HIS B CB    1 
ATOM   7580 C CG    . HIS B 1 447 ? 6.520   0.761   -33.025 1.00 59.18  ? 447  HIS B CG    1 
ATOM   7581 N ND1   . HIS B 1 447 ? 7.260   1.912   -32.865 1.00 60.60  ? 447  HIS B ND1   1 
ATOM   7582 C CD2   . HIS B 1 447 ? 6.710   0.369   -34.309 1.00 60.33  ? 447  HIS B CD2   1 
ATOM   7583 C CE1   . HIS B 1 447 ? 7.835   2.229   -34.013 1.00 59.10  ? 447  HIS B CE1   1 
ATOM   7584 N NE2   . HIS B 1 447 ? 7.524   1.305   -34.903 1.00 59.55  ? 447  HIS B NE2   1 
ATOM   7585 N N     . GLY B 1 448 ? 3.007   1.313   -33.662 1.00 57.36  ? 448  GLY B N     1 
ATOM   7586 C CA    . GLY B 1 448 ? 2.212   1.089   -34.875 1.00 56.90  ? 448  GLY B CA    1 
ATOM   7587 C C     . GLY B 1 448 ? 0.705   1.240   -34.727 1.00 57.46  ? 448  GLY B C     1 
ATOM   7588 O O     . GLY B 1 448 ? -0.003  1.360   -35.733 1.00 57.67  ? 448  GLY B O     1 
ATOM   7589 N N     . TYR B 1 449 ? 0.187   1.251   -33.500 1.00 57.34  ? 449  TYR B N     1 
ATOM   7590 C CA    . TYR B 1 449 ? -1.274  1.226   -33.331 1.00 58.18  ? 449  TYR B CA    1 
ATOM   7591 C C     . TYR B 1 449 ? -1.980  2.593   -33.193 1.00 57.72  ? 449  TYR B C     1 
ATOM   7592 O O     . TYR B 1 449 ? -3.179  2.654   -32.929 1.00 58.17  ? 449  TYR B O     1 
ATOM   7593 C CB    . TYR B 1 449 ? -1.674  0.167   -32.283 1.00 58.98  ? 449  TYR B CB    1 
ATOM   7594 C CG    . TYR B 1 449 ? -1.375  -1.193  -32.871 1.00 58.81  ? 449  TYR B CG    1 
ATOM   7595 C CD1   . TYR B 1 449 ? -0.118  -1.765  -32.744 1.00 57.09  ? 449  TYR B CD1   1 
ATOM   7596 C CD2   . TYR B 1 449 ? -2.313  -1.840  -33.659 1.00 59.90  ? 449  TYR B CD2   1 
ATOM   7597 C CE1   . TYR B 1 449 ? 0.178   -2.974  -33.333 1.00 59.13  ? 449  TYR B CE1   1 
ATOM   7598 C CE2   . TYR B 1 449 ? -2.041  -3.057  -34.248 1.00 60.68  ? 449  TYR B CE2   1 
ATOM   7599 C CZ    . TYR B 1 449 ? -0.789  -3.618  -34.089 1.00 60.53  ? 449  TYR B CZ    1 
ATOM   7600 O OH    . TYR B 1 449 ? -0.516  -4.815  -34.689 1.00 60.44  ? 449  TYR B OH    1 
ATOM   7601 N N     . GLU B 1 450 ? -1.252  3.673   -33.472 1.00 56.76  ? 450  GLU B N     1 
ATOM   7602 C CA    . GLU B 1 450 ? -1.885  4.986   -33.721 1.00 56.54  ? 450  GLU B CA    1 
ATOM   7603 C C     . GLU B 1 450 ? -2.309  5.154   -35.185 1.00 56.68  ? 450  GLU B C     1 
ATOM   7604 O O     . GLU B 1 450 ? -3.211  5.934   -35.483 1.00 57.31  ? 450  GLU B O     1 
ATOM   7605 C CB    . GLU B 1 450 ? -0.947  6.135   -33.327 1.00 55.76  ? 450  GLU B CB    1 
ATOM   7606 C CG    . GLU B 1 450 ? 0.048   6.602   -34.404 1.00 54.95  ? 450  GLU B CG    1 
ATOM   7607 C CD    . GLU B 1 450 ? 1.217   5.651   -34.639 1.00 54.97  ? 450  GLU B CD    1 
ATOM   7608 O OE1   . GLU B 1 450 ? 1.112   4.423   -34.385 1.00 55.46  ? 450  GLU B OE1   1 
ATOM   7609 O OE2   . GLU B 1 450 ? 2.248   6.147   -35.112 1.00 54.40  ? 450  GLU B OE2   1 
ATOM   7610 N N     . ILE B 1 451 ? -1.660  4.428   -36.094 1.00 56.47  ? 451  ILE B N     1 
ATOM   7611 C CA    . ILE B 1 451 ? -1.793  4.697   -37.526 1.00 56.64  ? 451  ILE B CA    1 
ATOM   7612 C C     . ILE B 1 451 ? -3.238  4.538   -38.002 1.00 58.22  ? 451  ILE B C     1 
ATOM   7613 O O     . ILE B 1 451 ? -3.757  5.386   -38.728 1.00 58.46  ? 451  ILE B O     1 
ATOM   7614 C CB    . ILE B 1 451 ? -0.858  3.778   -38.376 1.00 56.53  ? 451  ILE B CB    1 
ATOM   7615 C CG1   . ILE B 1 451 ? 0.614   4.085   -38.089 1.00 54.77  ? 451  ILE B CG1   1 
ATOM   7616 C CG2   . ILE B 1 451 ? -1.149  3.934   -39.882 1.00 56.14  ? 451  ILE B CG2   1 
ATOM   7617 C CD1   . ILE B 1 451 ? 1.563   3.058   -38.660 1.00 55.12  ? 451  ILE B CD1   1 
ATOM   7618 N N     . GLU B 1 452 ? -3.881  3.450   -37.603 1.00 59.59  ? 452  GLU B N     1 
ATOM   7619 C CA    . GLU B 1 452 ? -5.258  3.174   -38.030 1.00 61.63  ? 452  GLU B CA    1 
ATOM   7620 C C     . GLU B 1 452 ? -6.244  4.273   -37.624 1.00 61.78  ? 452  GLU B C     1 
ATOM   7621 O O     . GLU B 1 452 ? -7.264  4.464   -38.281 1.00 62.83  ? 452  GLU B O     1 
ATOM   7622 C CB    . GLU B 1 452 ? -5.720  1.827   -37.481 1.00 62.91  ? 452  GLU B CB    1 
ATOM   7623 C CG    . GLU B 1 452 ? -5.796  1.746   -35.943 1.00 64.59  ? 452  GLU B CG    1 
ATOM   7624 C CD    . GLU B 1 452 ? -5.791  0.312   -35.440 1.00 66.48  ? 452  GLU B CD    1 
ATOM   7625 O OE1   . GLU B 1 452 ? -6.780  -0.084  -34.790 1.00 70.61  ? 452  GLU B OE1   1 
ATOM   7626 O OE2   . GLU B 1 452 ? -4.810  -0.429  -35.723 1.00 70.02  ? 452  GLU B OE2   1 
ATOM   7627 N N     . PHE B 1 453 ? -5.941  4.987   -36.540 1.00 61.15  ? 453  PHE B N     1 
ATOM   7628 C CA    . PHE B 1 453 ? -6.737  6.145   -36.129 1.00 61.40  ? 453  PHE B CA    1 
ATOM   7629 C C     . PHE B 1 453 ? -6.477  7.403   -36.975 1.00 60.41  ? 453  PHE B C     1 
ATOM   7630 O O     . PHE B 1 453 ? -7.413  8.097   -37.344 1.00 61.05  ? 453  PHE B O     1 
ATOM   7631 C CB    . PHE B 1 453 ? -6.508  6.435   -34.635 1.00 61.61  ? 453  PHE B CB    1 
ATOM   7632 C CG    . PHE B 1 453 ? -7.076  5.382   -33.741 1.00 62.33  ? 453  PHE B CG    1 
ATOM   7633 C CD1   . PHE B 1 453 ? -8.410  5.423   -33.372 1.00 64.32  ? 453  PHE B CD1   1 
ATOM   7634 C CD2   . PHE B 1 453 ? -6.291  4.322   -33.309 1.00 61.68  ? 453  PHE B CD2   1 
ATOM   7635 C CE1   . PHE B 1 453 ? -8.954  4.427   -32.558 1.00 66.31  ? 453  PHE B CE1   1 
ATOM   7636 C CE2   . PHE B 1 453 ? -6.812  3.331   -32.497 1.00 62.56  ? 453  PHE B CE2   1 
ATOM   7637 C CZ    . PHE B 1 453 ? -8.149  3.374   -32.125 1.00 65.70  ? 453  PHE B CZ    1 
ATOM   7638 N N     . ILE B 1 454 ? -5.214  7.695   -37.267 1.00 59.04  ? 454  ILE B N     1 
ATOM   7639 C CA    . ILE B 1 454 ? -4.849  8.847   -38.103 1.00 58.69  ? 454  ILE B CA    1 
ATOM   7640 C C     . ILE B 1 454 ? -5.433  8.686   -39.517 1.00 59.16  ? 454  ILE B C     1 
ATOM   7641 O O     . ILE B 1 454 ? -5.884  9.665   -40.125 1.00 59.31  ? 454  ILE B O     1 
ATOM   7642 C CB    . ILE B 1 454 ? -3.294  9.029   -38.205 1.00 57.74  ? 454  ILE B CB    1 
ATOM   7643 C CG1   . ILE B 1 454 ? -2.653  9.218   -36.817 1.00 58.17  ? 454  ILE B CG1   1 
ATOM   7644 C CG2   . ILE B 1 454 ? -2.920  10.208  -39.110 1.00 56.59  ? 454  ILE B CG2   1 
ATOM   7645 C CD1   . ILE B 1 454 ? -3.361  10.259  -35.953 1.00 60.20  ? 454  ILE B CD1   1 
ATOM   7646 N N     . PHE B 1 455 ? -5.436  7.455   -40.034 1.00 59.19  ? 455  PHE B N     1 
ATOM   7647 C CA    . PHE B 1 455 ? -5.997  7.198   -41.362 1.00 60.03  ? 455  PHE B CA    1 
ATOM   7648 C C     . PHE B 1 455 ? -7.536  7.115   -41.380 1.00 61.42  ? 455  PHE B C     1 
ATOM   7649 O O     . PHE B 1 455 ? -8.139  7.191   -42.444 1.00 61.42  ? 455  PHE B O     1 
ATOM   7650 C CB    . PHE B 1 455 ? -5.358  5.974   -42.010 1.00 60.01  ? 455  PHE B CB    1 
ATOM   7651 C CG    . PHE B 1 455 ? -4.069  6.277   -42.715 1.00 59.12  ? 455  PHE B CG    1 
ATOM   7652 C CD1   . PHE B 1 455 ? -2.877  6.320   -42.021 1.00 59.04  ? 455  PHE B CD1   1 
ATOM   7653 C CD2   . PHE B 1 455 ? -4.049  6.517   -44.076 1.00 59.89  ? 455  PHE B CD2   1 
ATOM   7654 C CE1   . PHE B 1 455 ? -1.683  6.601   -42.672 1.00 57.89  ? 455  PHE B CE1   1 
ATOM   7655 C CE2   . PHE B 1 455 ? -2.853  6.781   -44.734 1.00 59.11  ? 455  PHE B CE2   1 
ATOM   7656 C CZ    . PHE B 1 455 ? -1.678  6.826   -44.030 1.00 57.39  ? 455  PHE B CZ    1 
ATOM   7657 N N     . GLY B 1 456 ? -8.148  6.969   -40.206 1.00 62.20  ? 456  GLY B N     1 
ATOM   7658 C CA    . GLY B 1 456 ? -9.590  7.110   -40.055 1.00 64.26  ? 456  GLY B CA    1 
ATOM   7659 C C     . GLY B 1 456 ? -10.372 5.820   -40.229 1.00 65.78  ? 456  GLY B C     1 
ATOM   7660 O O     . GLY B 1 456 ? -11.554 5.846   -40.559 1.00 67.22  ? 456  GLY B O     1 
ATOM   7661 N N     . LEU B 1 457 ? -9.715  4.693   -39.977 1.00 65.92  ? 457  LEU B N     1 
ATOM   7662 C CA    . LEU B 1 457 ? -10.337 3.378   -40.146 1.00 67.52  ? 457  LEU B CA    1 
ATOM   7663 C C     . LEU B 1 457 ? -11.534 3.155   -39.233 1.00 69.63  ? 457  LEU B C     1 
ATOM   7664 O O     . LEU B 1 457 ? -12.478 2.479   -39.620 1.00 71.56  ? 457  LEU B O     1 
ATOM   7665 C CB    . LEU B 1 457 ? -9.310  2.253   -39.955 1.00 66.70  ? 457  LEU B CB    1 
ATOM   7666 C CG    . LEU B 1 457 ? -8.637  1.764   -41.239 1.00 66.27  ? 457  LEU B CG    1 
ATOM   7667 C CD1   . LEU B 1 457 ? -7.674  2.796   -41.826 1.00 63.03  ? 457  LEU B CD1   1 
ATOM   7668 C CD2   . LEU B 1 457 ? -7.921  0.457   -40.957 1.00 65.96  ? 457  LEU B CD2   1 
ATOM   7669 N N     . PRO B 1 458 ? -11.494 3.685   -38.004 1.00 70.30  ? 458  PRO B N     1 
ATOM   7670 C CA    . PRO B 1 458 ? -12.706 3.658   -37.165 1.00 72.72  ? 458  PRO B CA    1 
ATOM   7671 C C     . PRO B 1 458 ? -14.003 4.201   -37.788 1.00 74.77  ? 458  PRO B C     1 
ATOM   7672 O O     . PRO B 1 458 ? -15.091 3.858   -37.315 1.00 76.90  ? 458  PRO B O     1 
ATOM   7673 C CB    . PRO B 1 458 ? -12.295 4.478   -35.949 1.00 71.96  ? 458  PRO B CB    1 
ATOM   7674 C CG    . PRO B 1 458 ? -10.791 4.265   -35.867 1.00 69.71  ? 458  PRO B CG    1 
ATOM   7675 C CD    . PRO B 1 458 ? -10.329 4.226   -37.274 1.00 68.37  ? 458  PRO B CD    1 
ATOM   7676 N N     . LEU B 1 459 ? -13.905 5.008   -38.843 1.00 74.89  ? 459  LEU B N     1 
ATOM   7677 C CA    . LEU B 1 459 ? -15.102 5.531   -39.526 1.00 76.82  ? 459  LEU B CA    1 
ATOM   7678 C C     . LEU B 1 459 ? -15.814 4.490   -40.411 1.00 78.66  ? 459  LEU B C     1 
ATOM   7679 O O     . LEU B 1 459 ? -16.916 4.743   -40.888 1.00 80.67  ? 459  LEU B O     1 
ATOM   7680 C CB    . LEU B 1 459 ? -14.751 6.766   -40.370 1.00 75.92  ? 459  LEU B CB    1 
ATOM   7681 C CG    . LEU B 1 459 ? -14.470 8.107   -39.682 1.00 74.84  ? 459  LEU B CG    1 
ATOM   7682 C CD1   . LEU B 1 459 ? -13.412 8.019   -38.579 1.00 72.64  ? 459  LEU B CD1   1 
ATOM   7683 C CD2   . LEU B 1 459 ? -14.052 9.109   -40.742 1.00 74.21  ? 459  LEU B CD2   1 
ATOM   7684 N N     . ASP B 1 460 ? -15.183 3.343   -40.647 1.00 78.80  ? 460  ASP B N     1 
ATOM   7685 C CA    . ASP B 1 460 ? -15.824 2.228   -41.349 1.00 80.52  ? 460  ASP B CA    1 
ATOM   7686 C C     . ASP B 1 460 ? -16.563 1.385   -40.316 1.00 83.04  ? 460  ASP B C     1 
ATOM   7687 O O     . ASP B 1 460 ? -15.928 0.703   -39.507 1.00 82.66  ? 460  ASP B O     1 
ATOM   7688 C CB    . ASP B 1 460 ? -14.786 1.369   -42.081 1.00 79.47  ? 460  ASP B CB    1 
ATOM   7689 C CG    . ASP B 1 460 ? -15.411 0.188   -42.839 1.00 80.98  ? 460  ASP B CG    1 
ATOM   7690 O OD1   . ASP B 1 460 ? -16.641 -0.042  -42.740 1.00 84.00  ? 460  ASP B OD1   1 
ATOM   7691 O OD2   . ASP B 1 460 ? -14.656 -0.516  -43.545 1.00 80.96  ? 460  ASP B OD2   1 
ATOM   7692 N N     . PRO B 1 461 ? -17.908 1.420   -40.340 1.00 86.01  ? 461  PRO B N     1 
ATOM   7693 C CA    . PRO B 1 461 ? -18.685 0.780   -39.273 1.00 88.25  ? 461  PRO B CA    1 
ATOM   7694 C C     . PRO B 1 461 ? -18.550 -0.743  -39.236 1.00 89.06  ? 461  PRO B C     1 
ATOM   7695 O O     . PRO B 1 461 ? -18.785 -1.354  -38.189 1.00 90.58  ? 461  PRO B O     1 
ATOM   7696 C CB    . PRO B 1 461 ? -20.129 1.199   -39.587 1.00 90.60  ? 461  PRO B CB    1 
ATOM   7697 C CG    . PRO B 1 461 ? -20.138 1.466   -41.047 1.00 90.16  ? 461  PRO B CG    1 
ATOM   7698 C CD    . PRO B 1 461 ? -18.783 2.033   -41.360 1.00 87.35  ? 461  PRO B CD    1 
ATOM   7699 N N     . SER B 1 462 ? -18.165 -1.343  -40.358 1.00 88.56  ? 462  SER B N     1 
ATOM   7700 C CA    . SER B 1 462 ? -17.947 -2.786  -40.428 1.00 89.23  ? 462  SER B CA    1 
ATOM   7701 C C     . SER B 1 462 ? -16.707 -3.254  -39.651 1.00 87.64  ? 462  SER B C     1 
ATOM   7702 O O     . SER B 1 462 ? -16.549 -4.452  -39.418 1.00 88.53  ? 462  SER B O     1 
ATOM   7703 C CB    . SER B 1 462 ? -17.822 -3.223  -41.888 1.00 89.16  ? 462  SER B CB    1 
ATOM   7704 O OG    . SER B 1 462 ? -16.586 -2.798  -42.437 1.00 87.06  ? 462  SER B OG    1 
ATOM   7705 N N     . LEU B 1 463 ? -15.832 -2.325  -39.255 1.00 85.44  ? 463  LEU B N     1 
ATOM   7706 C CA    . LEU B 1 463 ? -14.622 -2.675  -38.510 1.00 83.75  ? 463  LEU B CA    1 
ATOM   7707 C C     . LEU B 1 463 ? -14.835 -2.766  -36.998 1.00 84.52  ? 463  LEU B C     1 
ATOM   7708 O O     . LEU B 1 463 ? -13.924 -3.161  -36.275 1.00 83.92  ? 463  LEU B O     1 
ATOM   7709 C CB    . LEU B 1 463 ? -13.492 -1.695  -38.830 1.00 81.28  ? 463  LEU B CB    1 
ATOM   7710 C CG    . LEU B 1 463 ? -12.986 -1.701  -40.280 1.00 80.24  ? 463  LEU B CG    1 
ATOM   7711 C CD1   . LEU B 1 463 ? -11.861 -0.718  -40.448 1.00 75.51  ? 463  LEU B CD1   1 
ATOM   7712 C CD2   . LEU B 1 463 ? -12.549 -3.107  -40.739 1.00 80.10  ? 463  LEU B CD2   1 
ATOM   7713 N N     . ASN B 1 464 ? -16.028 -2.406  -36.530 1.00 86.29  ? 464  ASN B N     1 
ATOM   7714 C CA    . ASN B 1 464 ? -16.451 -2.608  -35.129 1.00 87.81  ? 464  ASN B CA    1 
ATOM   7715 C C     . ASN B 1 464 ? -15.676 -1.810  -34.073 1.00 85.74  ? 464  ASN B C     1 
ATOM   7716 O O     . ASN B 1 464 ? -15.488 -2.272  -32.944 1.00 86.36  ? 464  ASN B O     1 
ATOM   7717 C CB    . ASN B 1 464 ? -16.456 -4.109  -34.748 1.00 89.67  ? 464  ASN B CB    1 
ATOM   7718 C CG    . ASN B 1 464 ? -17.290 -4.962  -35.700 1.00 92.51  ? 464  ASN B CG    1 
ATOM   7719 O OD1   . ASN B 1 464 ? -18.442 -4.642  -35.993 1.00 95.73  ? 464  ASN B OD1   1 
ATOM   7720 N ND2   . ASN B 1 464 ? -16.705 -6.054  -36.185 1.00 94.41  ? 464  ASN B ND2   1 
ATOM   7721 N N     . TYR B 1 465 ? -15.245 -0.604  -34.426 1.00 83.47  ? 465  TYR B N     1 
ATOM   7722 C CA    . TYR B 1 465 ? -14.703 0.317   -33.430 1.00 81.72  ? 465  TYR B CA    1 
ATOM   7723 C C     . TYR B 1 465 ? -15.877 0.930   -32.663 1.00 83.02  ? 465  TYR B C     1 
ATOM   7724 O O     . TYR B 1 465 ? -16.990 0.989   -33.182 1.00 84.60  ? 465  TYR B O     1 
ATOM   7725 C CB    . TYR B 1 465 ? -13.895 1.423   -34.100 1.00 79.54  ? 465  TYR B CB    1 
ATOM   7726 C CG    . TYR B 1 465 ? -12.553 1.015   -34.681 1.00 77.80  ? 465  TYR B CG    1 
ATOM   7727 C CD1   . TYR B 1 465 ? -11.370 1.192   -33.955 1.00 76.12  ? 465  TYR B CD1   1 
ATOM   7728 C CD2   . TYR B 1 465 ? -12.455 0.493   -35.968 1.00 77.35  ? 465  TYR B CD2   1 
ATOM   7729 C CE1   . TYR B 1 465 ? -10.129 0.835   -34.486 1.00 73.87  ? 465  TYR B CE1   1 
ATOM   7730 C CE2   . TYR B 1 465 ? -11.216 0.150   -36.514 1.00 75.58  ? 465  TYR B CE2   1 
ATOM   7731 C CZ    . TYR B 1 465 ? -10.058 0.323   -35.763 1.00 74.11  ? 465  TYR B CZ    1 
ATOM   7732 O OH    . TYR B 1 465 ? -8.827  -0.014  -36.291 1.00 73.21  ? 465  TYR B OH    1 
ATOM   7733 N N     . THR B 1 466 ? -15.629 1.387   -31.438 1.00 82.35  ? 466  THR B N     1 
ATOM   7734 C CA    . THR B 1 466 ? -16.645 2.082   -30.647 1.00 83.57  ? 466  THR B CA    1 
ATOM   7735 C C     . THR B 1 466 ? -16.918 3.469   -31.238 1.00 83.21  ? 466  THR B C     1 
ATOM   7736 O O     . THR B 1 466 ? -16.126 3.975   -32.035 1.00 80.97  ? 466  THR B O     1 
ATOM   7737 C CB    . THR B 1 466 ? -16.209 2.263   -29.168 1.00 83.37  ? 466  THR B CB    1 
ATOM   7738 O OG1   . THR B 1 466 ? -15.169 3.249   -29.080 1.00 80.82  ? 466  THR B OG1   1 
ATOM   7739 C CG2   . THR B 1 466 ? -15.721 0.946   -28.567 1.00 82.72  ? 466  THR B CG2   1 
ATOM   7740 N N     . THR B 1 467 ? -18.028 4.092   -30.836 1.00 85.10  ? 467  THR B N     1 
ATOM   7741 C CA    . THR B 1 467 ? -18.377 5.424   -31.357 1.00 85.22  ? 467  THR B CA    1 
ATOM   7742 C C     . THR B 1 467 ? -17.386 6.472   -30.826 1.00 83.40  ? 467  THR B C     1 
ATOM   7743 O O     . THR B 1 467 ? -17.059 7.434   -31.523 1.00 82.59  ? 467  THR B O     1 
ATOM   7744 C CB    . THR B 1 467 ? -19.850 5.842   -31.058 1.00 87.85  ? 467  THR B CB    1 
ATOM   7745 O OG1   . THR B 1 467 ? -19.939 6.472   -29.777 1.00 88.31  ? 467  THR B OG1   1 
ATOM   7746 C CG2   . THR B 1 467 ? -20.790 4.641   -31.111 1.00 90.35  ? 467  THR B CG2   1 
ATOM   7747 N N     . GLU B 1 468 ? -16.901 6.254   -29.604 1.00 83.01  ? 468  GLU B N     1 
ATOM   7748 C CA    . GLU B 1 468 ? -15.817 7.042   -29.024 1.00 81.16  ? 468  GLU B CA    1 
ATOM   7749 C C     . GLU B 1 468 ? -14.562 7.011   -29.922 1.00 78.37  ? 468  GLU B C     1 
ATOM   7750 O O     . GLU B 1 468 ? -13.956 8.035   -30.199 1.00 76.91  ? 468  GLU B O     1 
ATOM   7751 C CB    . GLU B 1 468 ? -15.464 6.510   -27.624 1.00 81.58  ? 468  GLU B CB    1 
ATOM   7752 C CG    . GLU B 1 468 ? -16.540 6.725   -26.534 1.00 85.66  ? 468  GLU B CG    1 
ATOM   7753 C CD    . GLU B 1 468 ? -17.679 5.670   -26.529 1.00 90.31  ? 468  GLU B CD    1 
ATOM   7754 O OE1   . GLU B 1 468 ? -17.616 4.649   -27.253 1.00 91.18  ? 468  GLU B OE1   1 
ATOM   7755 O OE2   . GLU B 1 468 ? -18.653 5.868   -25.779 1.00 94.30  ? 468  GLU B OE2   1 
ATOM   7756 N N     . GLU B 1 469 ? -14.183 5.821   -30.370 1.00 77.75  ? 469  GLU B N     1 
ATOM   7757 C CA    . GLU B 1 469 ? -13.015 5.644   -31.235 1.00 75.56  ? 469  GLU B CA    1 
ATOM   7758 C C     . GLU B 1 469 ? -13.168 6.329   -32.600 1.00 75.28  ? 469  GLU B C     1 
ATOM   7759 O O     . GLU B 1 469 ? -12.186 6.815   -33.181 1.00 73.29  ? 469  GLU B O     1 
ATOM   7760 C CB    . GLU B 1 469 ? -12.716 4.155   -31.402 1.00 75.34  ? 469  GLU B CB    1 
ATOM   7761 C CG    . GLU B 1 469 ? -12.065 3.582   -30.167 1.00 74.84  ? 469  GLU B CG    1 
ATOM   7762 C CD    . GLU B 1 469 ? -11.802 2.093   -30.242 1.00 75.69  ? 469  GLU B CD    1 
ATOM   7763 O OE1   . GLU B 1 469 ? -12.620 1.351   -30.836 1.00 78.56  ? 469  GLU B OE1   1 
ATOM   7764 O OE2   . GLU B 1 469 ? -10.784 1.655   -29.668 1.00 74.00  ? 469  GLU B OE2   1 
ATOM   7765 N N     . ARG B 1 470 ? -14.406 6.375   -33.088 1.00 76.97  ? 470  ARG B N     1 
ATOM   7766 C CA    . ARG B 1 470 ? -14.736 7.041   -34.342 1.00 77.14  ? 470  ARG B CA    1 
ATOM   7767 C C     . ARG B 1 470 ? -14.610 8.565   -34.215 1.00 75.69  ? 470  ARG B C     1 
ATOM   7768 O O     . ARG B 1 470 ? -14.017 9.222   -35.063 1.00 74.57  ? 470  ARG B O     1 
ATOM   7769 C CB    . ARG B 1 470 ? -16.151 6.648   -34.766 1.00 79.87  ? 470  ARG B CB    1 
ATOM   7770 C CG    . ARG B 1 470 ? -16.437 6.821   -36.247 1.00 82.61  ? 470  ARG B CG    1 
ATOM   7771 C CD    . ARG B 1 470 ? -17.428 7.954   -36.523 1.00 87.49  ? 470  ARG B CD    1 
ATOM   7772 N NE    . ARG B 1 470 ? -18.789 7.589   -36.115 1.00 91.18  ? 470  ARG B NE    1 
ATOM   7773 C CZ    . ARG B 1 470 ? -19.605 8.334   -35.363 1.00 94.25  ? 470  ARG B CZ    1 
ATOM   7774 N NH1   . ARG B 1 470 ? -19.243 9.541   -34.917 1.00 94.18  ? 470  ARG B NH1   1 
ATOM   7775 N NH2   . ARG B 1 470 ? -20.817 7.868   -35.064 1.00 96.57  ? 470  ARG B NH2   1 
ATOM   7776 N N     . ILE B 1 471 ? -15.174 9.113   -33.145 1.00 75.89  ? 471  ILE B N     1 
ATOM   7777 C CA    . ILE B 1 471 ? -15.062 10.537  -32.826 1.00 74.73  ? 471  ILE B CA    1 
ATOM   7778 C C     . ILE B 1 471 ? -13.597 10.931  -32.620 1.00 72.17  ? 471  ILE B C     1 
ATOM   7779 O O     . ILE B 1 471 ? -13.158 11.981  -33.079 1.00 71.32  ? 471  ILE B O     1 
ATOM   7780 C CB    . ILE B 1 471 ? -15.852 10.873  -31.537 1.00 76.30  ? 471  ILE B CB    1 
ATOM   7781 C CG1   . ILE B 1 471 ? -17.360 10.753  -31.783 1.00 78.77  ? 471  ILE B CG1   1 
ATOM   7782 C CG2   . ILE B 1 471 ? -15.509 12.277  -31.019 1.00 74.71  ? 471  ILE B CG2   1 
ATOM   7783 C CD1   . ILE B 1 471 ? -18.169 10.779  -30.499 1.00 80.46  ? 471  ILE B CD1   1 
ATOM   7784 N N     . PHE B 1 472 ? -12.855 10.079  -31.923 1.00 70.65  ? 472  PHE B N     1 
ATOM   7785 C CA    . PHE B 1 472 ? -11.440 10.305  -31.655 1.00 68.57  ? 472  PHE B CA    1 
ATOM   7786 C C     . PHE B 1 472 ? -10.638 10.300  -32.955 1.00 67.47  ? 472  PHE B C     1 
ATOM   7787 O O     . PHE B 1 472 ? -9.812  11.175  -33.176 1.00 66.16  ? 472  PHE B O     1 
ATOM   7788 C CB    . PHE B 1 472 ? -10.960 9.232   -30.680 1.00 68.14  ? 472  PHE B CB    1 
ATOM   7789 C CG    . PHE B 1 472 ? -9.475  9.219   -30.420 1.00 65.81  ? 472  PHE B CG    1 
ATOM   7790 C CD1   . PHE B 1 472 ? -8.820  10.345  -29.970 1.00 64.50  ? 472  PHE B CD1   1 
ATOM   7791 C CD2   . PHE B 1 472 ? -8.757  8.040   -30.562 1.00 63.65  ? 472  PHE B CD2   1 
ATOM   7792 C CE1   . PHE B 1 472 ? -7.478  10.316  -29.696 1.00 62.90  ? 472  PHE B CE1   1 
ATOM   7793 C CE2   . PHE B 1 472 ? -7.428  7.993   -30.282 1.00 63.36  ? 472  PHE B CE2   1 
ATOM   7794 C CZ    . PHE B 1 472 ? -6.774  9.139   -29.847 1.00 63.67  ? 472  PHE B CZ    1 
ATOM   7795 N N     . ALA B 1 473 ? -10.898 9.318   -33.817 1.00 68.31  ? 473  ALA B N     1 
ATOM   7796 C CA    . ALA B 1 473 ? -10.260 9.262   -35.130 1.00 67.56  ? 473  ALA B CA    1 
ATOM   7797 C C     . ALA B 1 473 ? -10.541 10.538  -35.936 1.00 68.05  ? 473  ALA B C     1 
ATOM   7798 O O     . ALA B 1 473 ? -9.660  11.045  -36.616 1.00 66.75  ? 473  ALA B O     1 
ATOM   7799 C CB    . ALA B 1 473 ? -10.710 8.031   -35.892 1.00 67.93  ? 473  ALA B CB    1 
ATOM   7800 N N     . GLN B 1 474 ? -11.757 11.071  -35.838 1.00 70.20  ? 474  GLN B N     1 
ATOM   7801 C CA    . GLN B 1 474 ? -12.080 12.333  -36.519 1.00 71.18  ? 474  GLN B CA    1 
ATOM   7802 C C     . GLN B 1 474 ? -11.277 13.510  -35.951 1.00 69.90  ? 474  GLN B C     1 
ATOM   7803 O O     . GLN B 1 474 ? -10.871 14.399  -36.701 1.00 69.13  ? 474  GLN B O     1 
ATOM   7804 C CB    . GLN B 1 474 ? -13.594 12.609  -36.488 1.00 73.13  ? 474  GLN B CB    1 
ATOM   7805 C CG    . GLN B 1 474 ? -14.395 11.666  -37.394 1.00 75.23  ? 474  GLN B CG    1 
ATOM   7806 C CD    . GLN B 1 474 ? -15.912 11.907  -37.360 1.00 79.04  ? 474  GLN B CD    1 
ATOM   7807 O OE1   . GLN B 1 474 ? -16.607 11.521  -36.410 1.00 82.39  ? 474  GLN B OE1   1 
ATOM   7808 N NE2   . GLN B 1 474 ? -16.431 12.535  -38.419 1.00 83.82  ? 474  GLN B NE2   1 
ATOM   7809 N N     . ARG B 1 475 ? -11.046 13.512  -34.637 1.00 69.66  ? 475  ARG B N     1 
ATOM   7810 C CA    . ARG B 1 475 ? -10.178 14.518  -34.020 1.00 69.43  ? 475  ARG B CA    1 
ATOM   7811 C C     . ARG B 1 475 ? -8.753  14.448  -34.586 1.00 66.84  ? 475  ARG B C     1 
ATOM   7812 O O     . ARG B 1 475 ? -8.180  15.465  -34.939 1.00 66.22  ? 475  ARG B O     1 
ATOM   7813 C CB    . ARG B 1 475 ? -10.136 14.379  -32.486 1.00 69.70  ? 475  ARG B CB    1 
ATOM   7814 C CG    . ARG B 1 475 ? -11.374 14.915  -31.772 1.00 73.20  ? 475  ARG B CG    1 
ATOM   7815 C CD    . ARG B 1 475 ? -11.296 14.853  -30.209 1.00 73.24  ? 475  ARG B CD    1 
ATOM   7816 N NE    . ARG B 1 475 ? -9.970  15.202  -29.687 1.00 72.25  ? 475  ARG B NE    1 
ATOM   7817 C CZ    . ARG B 1 475 ? -9.272  14.496  -28.791 1.00 71.62  ? 475  ARG B CZ    1 
ATOM   7818 N NH1   . ARG B 1 475 ? -9.760  13.383  -28.249 1.00 71.83  ? 475  ARG B NH1   1 
ATOM   7819 N NH2   . ARG B 1 475 ? -8.062  14.915  -28.428 1.00 69.44  ? 475  ARG B NH2   1 
ATOM   7820 N N     . LEU B 1 476 ? -8.197  13.250  -34.668 1.00 65.53  ? 476  LEU B N     1 
ATOM   7821 C CA    . LEU B 1 476 ? -6.838  13.070  -35.167 1.00 64.48  ? 476  LEU B CA    1 
ATOM   7822 C C     . LEU B 1 476 ? -6.675  13.433  -36.643 1.00 64.30  ? 476  LEU B C     1 
ATOM   7823 O O     . LEU B 1 476 ? -5.697  14.082  -37.017 1.00 63.53  ? 476  LEU B O     1 
ATOM   7824 C CB    . LEU B 1 476 ? -6.360  11.638  -34.918 1.00 63.93  ? 476  LEU B CB    1 
ATOM   7825 C CG    . LEU B 1 476 ? -6.237  11.273  -33.436 1.00 64.81  ? 476  LEU B CG    1 
ATOM   7826 C CD1   . LEU B 1 476 ? -5.615  9.914   -33.273 1.00 65.47  ? 476  LEU B CD1   1 
ATOM   7827 C CD2   . LEU B 1 476 ? -5.417  12.310  -32.676 1.00 65.04  ? 476  LEU B CD2   1 
ATOM   7828 N N     . MET B 1 477 ? -7.629  13.023  -37.474 1.00 65.14  ? 477  MET B N     1 
ATOM   7829 C CA    . MET B 1 477 ? -7.623  13.396  -38.880 1.00 65.34  ? 477  MET B CA    1 
ATOM   7830 C C     . MET B 1 477 ? -7.586  14.910  -39.055 1.00 65.10  ? 477  MET B C     1 
ATOM   7831 O O     . MET B 1 477 ? -6.943  15.410  -39.982 1.00 64.57  ? 477  MET B O     1 
ATOM   7832 C CB    . MET B 1 477 ? -8.851  12.827  -39.589 1.00 66.66  ? 477  MET B CB    1 
ATOM   7833 C CG    . MET B 1 477 ? -8.842  11.290  -39.740 1.00 68.04  ? 477  MET B CG    1 
ATOM   7834 S SD    . MET B 1 477 ? -10.407 10.643  -40.380 1.00 70.66  ? 477  MET B SD    1 
ATOM   7835 C CE    . MET B 1 477 ? -10.099 10.823  -42.123 1.00 70.23  ? 477  MET B CE    1 
ATOM   7836 N N     . LYS B 1 478 ? -8.275  15.630  -38.166 1.00 65.60  ? 478  LYS B N     1 
ATOM   7837 C CA    . LYS B 1 478 ? -8.300  17.090  -38.184 1.00 66.10  ? 478  LYS B CA    1 
ATOM   7838 C C     . LYS B 1 478 ? -6.972  17.709  -37.775 1.00 64.23  ? 478  LYS B C     1 
ATOM   7839 O O     . LYS B 1 478 ? -6.551  18.720  -38.352 1.00 63.83  ? 478  LYS B O     1 
ATOM   7840 C CB    . LYS B 1 478 ? -9.376  17.637  -37.239 1.00 68.01  ? 478  LYS B CB    1 
ATOM   7841 C CG    . LYS B 1 478 ? -10.700 17.898  -37.872 1.00 71.22  ? 478  LYS B CG    1 
ATOM   7842 C CD    . LYS B 1 478 ? -10.806 19.274  -38.501 1.00 73.52  ? 478  LYS B CD    1 
ATOM   7843 C CE    . LYS B 1 478 ? -12.220 19.505  -39.056 1.00 76.00  ? 478  LYS B CE    1 
ATOM   7844 N NZ    . LYS B 1 478 ? -12.592 18.548  -40.159 1.00 76.87  ? 478  LYS B NZ    1 
ATOM   7845 N N     . TYR B 1 479 ? -6.347  17.149  -36.741 1.00 62.88  ? 479  TYR B N     1 
ATOM   7846 C CA    . TYR B 1 479 ? -5.060  17.670  -36.277 1.00 61.43  ? 479  TYR B CA    1 
ATOM   7847 C C     . TYR B 1 479 ? -4.041  17.531  -37.390 1.00 59.61  ? 479  TYR B C     1 
ATOM   7848 O O     . TYR B 1 479 ? -3.271  18.447  -37.654 1.00 59.21  ? 479  TYR B O     1 
ATOM   7849 C CB    . TYR B 1 479 ? -4.521  16.893  -35.079 1.00 61.07  ? 479  TYR B CB    1 
ATOM   7850 C CG    . TYR B 1 479 ? -5.248  17.062  -33.783 1.00 62.00  ? 479  TYR B CG    1 
ATOM   7851 C CD1   . TYR B 1 479 ? -5.686  18.306  -33.355 1.00 63.55  ? 479  TYR B CD1   1 
ATOM   7852 C CD2   . TYR B 1 479 ? -5.442  15.968  -32.942 1.00 62.33  ? 479  TYR B CD2   1 
ATOM   7853 C CE1   . TYR B 1 479 ? -6.358  18.447  -32.133 1.00 64.79  ? 479  TYR B CE1   1 
ATOM   7854 C CE2   . TYR B 1 479 ? -6.096  16.098  -31.725 1.00 63.43  ? 479  TYR B CE2   1 
ATOM   7855 C CZ    . TYR B 1 479 ? -6.553  17.333  -31.330 1.00 64.00  ? 479  TYR B CZ    1 
ATOM   7856 O OH    . TYR B 1 479 ? -7.204  17.446  -30.132 1.00 65.71  ? 479  TYR B OH    1 
ATOM   7857 N N     . TRP B 1 480 ? -4.043  16.368  -38.028 1.00 58.44  ? 480  TRP B N     1 
ATOM   7858 C CA    . TRP B 1 480 ? -3.063  16.065  -39.063 1.00 57.52  ? 480  TRP B CA    1 
ATOM   7859 C C     . TRP B 1 480 ? -3.272  16.920  -40.303 1.00 57.70  ? 480  TRP B C     1 
ATOM   7860 O O     . TRP B 1 480 ? -2.303  17.428  -40.864 1.00 57.24  ? 480  TRP B O     1 
ATOM   7861 C CB    . TRP B 1 480 ? -3.096  14.574  -39.438 1.00 57.46  ? 480  TRP B CB    1 
ATOM   7862 C CG    . TRP B 1 480 ? -2.021  13.762  -38.782 1.00 56.21  ? 480  TRP B CG    1 
ATOM   7863 C CD1   . TRP B 1 480 ? -1.054  13.071  -39.403 1.00 55.84  ? 480  TRP B CD1   1 
ATOM   7864 C CD2   . TRP B 1 480 ? -1.811  13.582  -37.378 1.00 56.53  ? 480  TRP B CD2   1 
ATOM   7865 N NE1   . TRP B 1 480 ? -0.246  12.451  -38.492 1.00 55.67  ? 480  TRP B NE1   1 
ATOM   7866 C CE2   . TRP B 1 480 ? -0.686  12.750  -37.233 1.00 54.60  ? 480  TRP B CE2   1 
ATOM   7867 C CE3   . TRP B 1 480 ? -2.471  14.040  -36.227 1.00 57.54  ? 480  TRP B CE3   1 
ATOM   7868 C CZ2   . TRP B 1 480 ? -0.188  12.361  -35.987 1.00 54.22  ? 480  TRP B CZ2   1 
ATOM   7869 C CZ3   . TRP B 1 480 ? -1.980  13.653  -34.979 1.00 57.18  ? 480  TRP B CZ3   1 
ATOM   7870 C CH2   . TRP B 1 480 ? -0.847  12.810  -34.875 1.00 56.23  ? 480  TRP B CH2   1 
ATOM   7871 N N     . THR B 1 481 ? -4.525  17.083  -40.725 1.00 58.25  ? 481  THR B N     1 
ATOM   7872 C CA    . THR B 1 481 ? -4.808  17.837  -41.930 1.00 59.09  ? 481  THR B CA    1 
ATOM   7873 C C     . THR B 1 481 ? -4.765  19.347  -41.656 1.00 59.92  ? 481  THR B C     1 
ATOM   7874 O O     . THR B 1 481 ? -4.402  20.117  -42.531 1.00 60.58  ? 481  THR B O     1 
ATOM   7875 C CB    . THR B 1 481 ? -6.143  17.415  -42.562 1.00 60.17  ? 481  THR B CB    1 
ATOM   7876 O OG1   . THR B 1 481 ? -7.197  17.634  -41.627 1.00 63.99  ? 481  THR B OG1   1 
ATOM   7877 C CG2   . THR B 1 481 ? -6.129  15.937  -42.953 1.00 58.36  ? 481  THR B CG2   1 
ATOM   7878 N N     . ASN B 1 482 ? -5.106  19.782  -40.445 1.00 60.64  ? 482  ASN B N     1 
ATOM   7879 C CA    . ASN B 1 482 ? -4.885  21.191  -40.072 1.00 61.25  ? 482  ASN B CA    1 
ATOM   7880 C C     . ASN B 1 482 ? -3.399  21.506  -40.133 1.00 60.03  ? 482  ASN B C     1 
ATOM   7881 O O     . ASN B 1 482 ? -2.992  22.556  -40.638 1.00 59.97  ? 482  ASN B O     1 
ATOM   7882 C CB    . ASN B 1 482 ? -5.387  21.508  -38.669 1.00 61.49  ? 482  ASN B CB    1 
ATOM   7883 C CG    . ASN B 1 482 ? -6.891  21.675  -38.594 1.00 63.22  ? 482  ASN B CG    1 
ATOM   7884 O OD1   . ASN B 1 482 ? -7.563  21.933  -39.588 1.00 62.69  ? 482  ASN B OD1   1 
ATOM   7885 N ND2   . ASN B 1 482 ? -7.423  21.554  -37.380 1.00 65.11  ? 482  ASN B ND2   1 
ATOM   7886 N N     . PHE B 1 483 ? -2.601  20.592  -39.599 1.00 58.89  ? 483  PHE B N     1 
ATOM   7887 C CA    . PHE B 1 483 ? -1.161  20.747  -39.640 1.00 58.50  ? 483  PHE B CA    1 
ATOM   7888 C C     . PHE B 1 483 ? -0.675  20.804  -41.105 1.00 58.68  ? 483  PHE B C     1 
ATOM   7889 O O     . PHE B 1 483 ? 0.105   21.689  -41.470 1.00 58.34  ? 483  PHE B O     1 
ATOM   7890 C CB    . PHE B 1 483 ? -0.458  19.623  -38.867 1.00 57.00  ? 483  PHE B CB    1 
ATOM   7891 C CG    . PHE B 1 483 ? 1.032   19.691  -38.964 1.00 56.46  ? 483  PHE B CG    1 
ATOM   7892 C CD1   . PHE B 1 483 ? 1.741   20.644  -38.238 1.00 56.13  ? 483  PHE B CD1   1 
ATOM   7893 C CD2   . PHE B 1 483 ? 1.726   18.848  -39.820 1.00 55.07  ? 483  PHE B CD2   1 
ATOM   7894 C CE1   . PHE B 1 483 ? 3.125   20.728  -38.345 1.00 55.47  ? 483  PHE B CE1   1 
ATOM   7895 C CE2   . PHE B 1 483 ? 3.120   18.935  -39.936 1.00 53.80  ? 483  PHE B CE2   1 
ATOM   7896 C CZ    . PHE B 1 483 ? 3.811   19.871  -39.200 1.00 54.14  ? 483  PHE B CZ    1 
ATOM   7897 N N     . ALA B 1 484 ? -1.163  19.895  -41.949 1.00 59.13  ? 484  ALA B N     1 
ATOM   7898 C CA    . ALA B 1 484 ? -0.778  19.912  -43.371 1.00 59.39  ? 484  ALA B CA    1 
ATOM   7899 C C     . ALA B 1 484 ? -1.198  21.223  -44.040 1.00 61.08  ? 484  ALA B C     1 
ATOM   7900 O O     . ALA B 1 484 ? -0.445  21.797  -44.813 1.00 60.78  ? 484  ALA B O     1 
ATOM   7901 C CB    . ALA B 1 484 ? -1.336  18.689  -44.126 1.00 58.89  ? 484  ALA B CB    1 
ATOM   7902 N N     . ARG B 1 485 ? -2.393  21.695  -43.712 1.00 63.20  ? 485  ARG B N     1 
ATOM   7903 C CA    . ARG B 1 485 ? -2.931  22.932  -44.273 1.00 65.88  ? 485  ARG B CA    1 
ATOM   7904 C C     . ARG B 1 485 ? -2.118  24.151  -43.855 1.00 65.63  ? 485  ARG B C     1 
ATOM   7905 O O     . ARG B 1 485 ? -1.845  25.018  -44.676 1.00 66.37  ? 485  ARG B O     1 
ATOM   7906 C CB    . ARG B 1 485 ? -4.391  23.153  -43.829 1.00 67.15  ? 485  ARG B CB    1 
ATOM   7907 C CG    . ARG B 1 485 ? -5.453  22.613  -44.765 1.00 70.68  ? 485  ARG B CG    1 
ATOM   7908 C CD    . ARG B 1 485 ? -6.901  23.042  -44.356 1.00 73.21  ? 485  ARG B CD    1 
ATOM   7909 N NE    . ARG B 1 485 ? -7.400  22.236  -43.226 1.00 77.53  ? 485  ARG B NE    1 
ATOM   7910 C CZ    . ARG B 1 485 ? -7.838  20.967  -43.300 1.00 78.08  ? 485  ARG B CZ    1 
ATOM   7911 N NH1   . ARG B 1 485 ? -7.881  20.319  -44.465 1.00 78.63  ? 485  ARG B NH1   1 
ATOM   7912 N NH2   . ARG B 1 485 ? -8.247  20.333  -42.191 1.00 77.10  ? 485  ARG B NH2   1 
ATOM   7913 N N     . THR B 1 486 ? -1.752  24.209  -42.574 1.00 64.79  ? 486  THR B N     1 
ATOM   7914 C CA    . THR B 1 486 ? -1.289  25.450  -41.948 1.00 64.89  ? 486  THR B CA    1 
ATOM   7915 C C     . THR B 1 486 ? 0.048   25.369  -41.197 1.00 63.64  ? 486  THR B C     1 
ATOM   7916 O O     . THR B 1 486 ? 0.605   26.399  -40.821 1.00 63.65  ? 486  THR B O     1 
ATOM   7917 C CB    . THR B 1 486 ? -2.321  25.904  -40.925 1.00 65.77  ? 486  THR B CB    1 
ATOM   7918 O OG1   . THR B 1 486 ? -2.443  24.911  -39.900 1.00 64.05  ? 486  THR B OG1   1 
ATOM   7919 C CG2   . THR B 1 486 ? -3.682  26.109  -41.591 1.00 68.05  ? 486  THR B CG2   1 
ATOM   7920 N N     . GLY B 1 487 ? 0.541   24.160  -40.939 1.00 61.70  ? 487  GLY B N     1 
ATOM   7921 C CA    . GLY B 1 487 ? 1.690   23.989  -40.065 1.00 60.89  ? 487  GLY B CA    1 
ATOM   7922 C C     . GLY B 1 487 ? 1.397   24.132  -38.585 1.00 61.00  ? 487  GLY B C     1 
ATOM   7923 O O     . GLY B 1 487 ? 2.313   24.211  -37.782 1.00 60.48  ? 487  GLY B O     1 
ATOM   7924 N N     . ASP B 1 488 ? 0.113   24.137  -38.236 1.00 62.27  ? 488  ASP B N     1 
ATOM   7925 C CA    . ASP B 1 488 ? -0.378  24.266  -36.871 1.00 62.48  ? 488  ASP B CA    1 
ATOM   7926 C C     . ASP B 1 488 ? -1.545  23.273  -36.783 1.00 63.09  ? 488  ASP B C     1 
ATOM   7927 O O     . ASP B 1 488 ? -2.515  23.416  -37.518 1.00 63.65  ? 488  ASP B O     1 
ATOM   7928 C CB    . ASP B 1 488 ? -0.852  25.705  -36.637 1.00 63.58  ? 488  ASP B CB    1 
ATOM   7929 C CG    . ASP B 1 488 ? -1.319  25.967  -35.205 1.00 63.43  ? 488  ASP B CG    1 
ATOM   7930 O OD1   . ASP B 1 488 ? -1.671  25.029  -34.484 1.00 62.26  ? 488  ASP B OD1   1 
ATOM   7931 O OD2   . ASP B 1 488 ? -1.334  27.140  -34.782 1.00 65.86  ? 488  ASP B OD2   1 
ATOM   7932 N N     . PRO B 1 489 ? -1.475  22.289  -35.871 1.00 63.57  ? 489  PRO B N     1 
ATOM   7933 C CA    . PRO B 1 489 ? -2.549  21.286  -35.824 1.00 65.00  ? 489  PRO B CA    1 
ATOM   7934 C C     . PRO B 1 489 ? -3.846  21.771  -35.154 1.00 67.92  ? 489  PRO B C     1 
ATOM   7935 O O     . PRO B 1 489 ? -4.833  21.050  -35.154 1.00 68.25  ? 489  PRO B O     1 
ATOM   7936 C CB    . PRO B 1 489 ? -1.925  20.132  -35.015 1.00 63.47  ? 489  PRO B CB    1 
ATOM   7937 C CG    . PRO B 1 489 ? -0.897  20.771  -34.149 1.00 62.70  ? 489  PRO B CG    1 
ATOM   7938 C CD    . PRO B 1 489 ? -0.463  22.066  -34.820 1.00 62.73  ? 489  PRO B CD    1 
ATOM   7939 N N     . ASN B 1 490 ? -3.834  22.973  -34.584 1.00 70.76  ? 490  ASN B N     1 
ATOM   7940 C CA    . ASN B 1 490 ? -5.008  23.526  -33.926 1.00 73.89  ? 490  ASN B CA    1 
ATOM   7941 C C     . ASN B 1 490 ? -6.016  23.999  -34.963 1.00 77.73  ? 490  ASN B C     1 
ATOM   7942 O O     . ASN B 1 490 ? -5.639  24.515  -36.021 1.00 77.81  ? 490  ASN B O     1 
ATOM   7943 C CB    . ASN B 1 490 ? -4.624  24.692  -33.006 1.00 73.89  ? 490  ASN B CB    1 
ATOM   7944 C CG    . ASN B 1 490 ? -3.847  24.251  -31.778 1.00 71.44  ? 490  ASN B CG    1 
ATOM   7945 O OD1   . ASN B 1 490 ? -4.425  23.797  -30.793 1.00 68.40  ? 490  ASN B OD1   1 
ATOM   7946 N ND2   . ASN B 1 490 ? -2.530  24.422  -31.819 1.00 68.79  ? 490  ASN B ND2   1 
ATOM   7947 N N     . ASP B 1 491 ? -7.296  23.829  -34.641 1.00 82.14  ? 491  ASP B N     1 
ATOM   7948 C CA    . ASP B 1 491 ? -8.390  24.209  -35.531 1.00 86.50  ? 491  ASP B CA    1 
ATOM   7949 C C     . ASP B 1 491 ? -8.570  25.738  -35.498 1.00 88.75  ? 491  ASP B C     1 
ATOM   7950 O O     . ASP B 1 491 ? -8.930  26.297  -34.453 1.00 89.77  ? 491  ASP B O     1 
ATOM   7951 C CB    . ASP B 1 491 ? -9.678  23.482  -35.114 1.00 87.80  ? 491  ASP B CB    1 
ATOM   7952 C CG    . ASP B 1 491 ? -10.704 23.379  -36.249 1.00 91.71  ? 491  ASP B CG    1 
ATOM   7953 O OD1   . ASP B 1 491 ? -10.893 24.370  -37.000 1.00 95.32  ? 491  ASP B OD1   1 
ATOM   7954 O OD2   . ASP B 1 491 ? -11.335 22.300  -36.381 1.00 95.02  ? 491  ASP B OD2   1 
ATOM   7955 N N     . PRO B 1 492 ? -8.344  26.417  -36.647 1.00 90.63  ? 492  PRO B N     1 
ATOM   7956 C CA    . PRO B 1 492 ? -8.281  27.889  -36.642 1.00 92.43  ? 492  PRO B CA    1 
ATOM   7957 C C     . PRO B 1 492 ? -9.633  28.588  -36.556 1.00 95.96  ? 492  PRO B C     1 
ATOM   7958 O O     . PRO B 1 492 ? -9.672  29.763  -36.209 1.00 97.13  ? 492  PRO B O     1 
ATOM   7959 C CB    . PRO B 1 492 ? -7.599  28.238  -37.980 1.00 92.65  ? 492  PRO B CB    1 
ATOM   7960 C CG    . PRO B 1 492 ? -7.545  26.970  -38.783 1.00 91.13  ? 492  PRO B CG    1 
ATOM   7961 C CD    . PRO B 1 492 ? -8.199  25.864  -38.010 1.00 90.34  ? 492  PRO B CD    1 
ATOM   7962 N N     . ARG B 1 493 ? -10.713 27.878  -36.887 1.00 98.06  ? 493  ARG B N     1 
ATOM   7963 C CA    . ARG B 1 493 ? -12.080 28.414  -36.794 1.00 101.42 ? 493  ARG B CA    1 
ATOM   7964 C C     . ARG B 1 493 ? -12.779 27.985  -35.492 1.00 102.64 ? 493  ARG B C     1 
ATOM   7965 O O     . ARG B 1 493 ? -13.816 28.547  -35.125 1.00 104.82 ? 493  ARG B O     1 
ATOM   7966 C CB    . ARG B 1 493 ? -12.914 27.981  -38.015 1.00 102.50 ? 493  ARG B CB    1 
ATOM   7967 N N     . ASP B 1 494 ? -12.207 27.000  -34.795 1.00 101.69 ? 494  ASP B N     1 
ATOM   7968 C CA    . ASP B 1 494 ? -12.718 26.576  -33.487 1.00 102.57 ? 494  ASP B CA    1 
ATOM   7969 C C     . ASP B 1 494 ? -12.012 27.357  -32.371 1.00 102.46 ? 494  ASP B C     1 
ATOM   7970 O O     . ASP B 1 494 ? -10.807 27.612  -32.448 1.00 100.93 ? 494  ASP B O     1 
ATOM   7971 C CB    . ASP B 1 494 ? -12.505 25.063  -33.301 1.00 101.26 ? 494  ASP B CB    1 
ATOM   7972 C CG    . ASP B 1 494 ? -12.842 24.573  -31.887 1.00 101.84 ? 494  ASP B CG    1 
ATOM   7973 O OD1   . ASP B 1 494 ? -14.015 24.698  -31.456 1.00 103.29 ? 494  ASP B OD1   1 
ATOM   7974 O OD2   . ASP B 1 494 ? -11.921 24.048  -31.217 1.00 101.00 ? 494  ASP B OD2   1 
ATOM   7975 N N     . SER B 1 495 ? -12.771 27.743  -31.345 1.00 104.35 ? 495  SER B N     1 
ATOM   7976 C CA    . SER B 1 495 ? -12.182 28.241  -30.102 1.00 104.23 ? 495  SER B CA    1 
ATOM   7977 C C     . SER B 1 495 ? -11.728 27.050  -29.233 1.00 103.03 ? 495  SER B C     1 
ATOM   7978 O O     . SER B 1 495 ? -10.816 26.295  -29.642 1.00 101.35 ? 495  SER B O     1 
ATOM   7979 C CB    . SER B 1 495 ? -13.137 29.167  -29.345 1.00 106.49 ? 495  SER B CB    1 
ATOM   7980 O OG    . SER B 1 495 ? -12.619 29.471  -28.055 1.00 105.66 ? 495  SER B OG    1 
ATOM   7981 N N     . LYS B 1 496 ? -12.367 26.853  -28.072 1.00 103.71 ? 496  LYS B N     1 
ATOM   7982 C CA    . LYS B 1 496 ? -11.762 26.024  -27.019 1.00 102.32 ? 496  LYS B CA    1 
ATOM   7983 C C     . LYS B 1 496 ? -11.677 24.526  -27.320 1.00 100.58 ? 496  LYS B C     1 
ATOM   7984 O O     . LYS B 1 496 ? -12.241 24.015  -28.304 1.00 101.04 ? 496  LYS B O     1 
ATOM   7985 C CB    . LYS B 1 496 ? -12.368 26.317  -25.642 1.00 103.91 ? 496  LYS B CB    1 
ATOM   7986 C CG    . LYS B 1 496 ? -11.663 27.502  -24.927 1.00 105.20 ? 496  LYS B CG    1 
ATOM   7987 C CD    . LYS B 1 496 ? -10.717 27.069  -23.776 1.00 104.63 ? 496  LYS B CD    1 
ATOM   7988 C CE    . LYS B 1 496 ? -9.448  26.348  -24.238 1.00 101.51 ? 496  LYS B CE    1 
ATOM   7989 N NZ    . LYS B 1 496 ? -8.471  26.218  -23.108 1.00 100.35 ? 496  LYS B NZ    1 
ATOM   7990 N N     . SER B 1 497 ? -10.937 23.841  -26.446 1.00 98.20  ? 497  SER B N     1 
ATOM   7991 C CA    . SER B 1 497 ? -10.086 22.757  -26.874 1.00 94.91  ? 497  SER B CA    1 
ATOM   7992 C C     . SER B 1 497 ? -9.534  21.898  -25.707 1.00 92.31  ? 497  SER B C     1 
ATOM   7993 O O     . SER B 1 497 ? -10.057 20.795  -25.511 1.00 93.42  ? 497  SER B O     1 
ATOM   7994 C CB    . SER B 1 497 ? -9.007  23.369  -27.760 1.00 93.94  ? 497  SER B CB    1 
ATOM   7995 O OG    . SER B 1 497 ? -8.785  24.721  -27.360 1.00 94.38  ? 497  SER B OG    1 
ATOM   7996 N N     . PRO B 1 498 ? -8.497  22.349  -24.941 1.00 88.39  ? 498  PRO B N     1 
ATOM   7997 C CA    . PRO B 1 498 ? -7.536  23.468  -25.000 1.00 85.59  ? 498  PRO B CA    1 
ATOM   7998 C C     . PRO B 1 498 ? -6.518  23.364  -26.136 1.00 81.12  ? 498  PRO B C     1 
ATOM   7999 O O     . PRO B 1 498 ? -6.420  22.321  -26.780 1.00 80.26  ? 498  PRO B O     1 
ATOM   8000 C CB    . PRO B 1 498 ? -6.798  23.373  -23.653 1.00 85.39  ? 498  PRO B CB    1 
ATOM   8001 C CG    . PRO B 1 498 ? -6.918  21.941  -23.257 1.00 85.94  ? 498  PRO B CG    1 
ATOM   8002 C CD    . PRO B 1 498 ? -8.285  21.547  -23.714 1.00 87.94  ? 498  PRO B CD    1 
ATOM   8003 N N     . GLN B 1 499 ? -5.785  24.448  -26.374 1.00 77.52  ? 499  GLN B N     1 
ATOM   8004 C CA    . GLN B 1 499 ? -4.866  24.530  -27.511 1.00 73.83  ? 499  GLN B CA    1 
ATOM   8005 C C     . GLN B 1 499 ? -3.637  23.634  -27.308 1.00 69.37  ? 499  GLN B C     1 
ATOM   8006 O O     . GLN B 1 499 ? -3.150  23.455  -26.204 1.00 67.91  ? 499  GLN B O     1 
ATOM   8007 C CB    . GLN B 1 499 ? -4.411  25.989  -27.783 1.00 74.25  ? 499  GLN B CB    1 
ATOM   8008 C CG    . GLN B 1 499 ? -5.522  26.996  -28.127 1.00 75.84  ? 499  GLN B CG    1 
ATOM   8009 C CD    . GLN B 1 499 ? -6.249  26.740  -29.458 1.00 76.97  ? 499  GLN B CD    1 
ATOM   8010 O OE1   . GLN B 1 499 ? -5.729  27.018  -30.545 1.00 76.02  ? 499  GLN B OE1   1 
ATOM   8011 N NE2   . GLN B 1 499 ? -7.483  26.263  -29.366 1.00 78.54  ? 499  GLN B NE2   1 
ATOM   8012 N N     . TRP B 1 500 ? -3.161  23.081  -28.411 1.00 65.80  ? 500  TRP B N     1 
ATOM   8013 C CA    . TRP B 1 500 ? -1.913  22.338  -28.467 1.00 62.65  ? 500  TRP B CA    1 
ATOM   8014 C C     . TRP B 1 500 ? -0.731  23.323  -28.624 1.00 61.66  ? 500  TRP B C     1 
ATOM   8015 O O     . TRP B 1 500 ? -0.556  23.898  -29.697 1.00 61.57  ? 500  TRP B O     1 
ATOM   8016 C CB    . TRP B 1 500 ? -2.000  21.402  -29.671 1.00 61.53  ? 500  TRP B CB    1 
ATOM   8017 C CG    . TRP B 1 500 ? -0.906  20.409  -29.838 1.00 59.61  ? 500  TRP B CG    1 
ATOM   8018 C CD1   . TRP B 1 500 ? 0.367   20.469  -29.336 1.00 58.29  ? 500  TRP B CD1   1 
ATOM   8019 C CD2   . TRP B 1 500 ? -0.973  19.214  -30.615 1.00 58.66  ? 500  TRP B CD2   1 
ATOM   8020 N NE1   . TRP B 1 500 ? 1.086   19.382  -29.747 1.00 57.53  ? 500  TRP B NE1   1 
ATOM   8021 C CE2   . TRP B 1 500 ? 0.289   18.593  -30.533 1.00 57.14  ? 500  TRP B CE2   1 
ATOM   8022 C CE3   . TRP B 1 500 ? -1.986  18.603  -31.370 1.00 58.74  ? 500  TRP B CE3   1 
ATOM   8023 C CZ2   . TRP B 1 500 ? 0.568   17.398  -31.172 1.00 56.96  ? 500  TRP B CZ2   1 
ATOM   8024 C CZ3   . TRP B 1 500 ? -1.706  17.408  -32.007 1.00 57.95  ? 500  TRP B CZ3   1 
ATOM   8025 C CH2   . TRP B 1 500 ? -0.444  16.820  -31.907 1.00 57.58  ? 500  TRP B CH2   1 
ATOM   8026 N N     . PRO B 1 501 ? 0.076   23.529  -27.563 1.00 60.48  ? 501  PRO B N     1 
ATOM   8027 C CA    . PRO B 1 501 ? 1.192   24.478  -27.661 1.00 60.56  ? 501  PRO B CA    1 
ATOM   8028 C C     . PRO B 1 501 ? 2.397   23.918  -28.416 1.00 59.13  ? 501  PRO B C     1 
ATOM   8029 O O     . PRO B 1 501 ? 2.619   22.700  -28.411 1.00 57.85  ? 501  PRO B O     1 
ATOM   8030 C CB    . PRO B 1 501 ? 1.571   24.709  -26.202 1.00 60.39  ? 501  PRO B CB    1 
ATOM   8031 C CG    . PRO B 1 501 ? 1.243   23.423  -25.549 1.00 60.13  ? 501  PRO B CG    1 
ATOM   8032 C CD    . PRO B 1 501 ? 0.017   22.918  -26.229 1.00 60.36  ? 501  PRO B CD    1 
ATOM   8033 N N     . PRO B 1 502 ? 3.176   24.794  -29.068 1.00 58.93  ? 502  PRO B N     1 
ATOM   8034 C CA    . PRO B 1 502 ? 4.423   24.310  -29.651 1.00 58.13  ? 502  PRO B CA    1 
ATOM   8035 C C     . PRO B 1 502 ? 5.380   23.732  -28.601 1.00 57.57  ? 502  PRO B C     1 
ATOM   8036 O O     . PRO B 1 502 ? 5.435   24.202  -27.462 1.00 57.49  ? 502  PRO B O     1 
ATOM   8037 C CB    . PRO B 1 502 ? 5.030   25.562  -30.292 1.00 58.75  ? 502  PRO B CB    1 
ATOM   8038 C CG    . PRO B 1 502 ? 3.922   26.522  -30.430 1.00 59.88  ? 502  PRO B CG    1 
ATOM   8039 C CD    . PRO B 1 502 ? 2.964   26.224  -29.322 1.00 60.26  ? 502  PRO B CD    1 
ATOM   8040 N N     . TYR B 1 503 ? 6.117   22.702  -28.992 1.00 57.22  ? 503  TYR B N     1 
ATOM   8041 C CA    . TYR B 1 503 ? 7.164   22.155  -28.151 1.00 57.14  ? 503  TYR B CA    1 
ATOM   8042 C C     . TYR B 1 503 ? 8.365   23.074  -28.216 1.00 57.50  ? 503  TYR B C     1 
ATOM   8043 O O     . TYR B 1 503 ? 8.811   23.419  -29.297 1.00 57.43  ? 503  TYR B O     1 
ATOM   8044 C CB    . TYR B 1 503 ? 7.552   20.757  -28.620 1.00 56.76  ? 503  TYR B CB    1 
ATOM   8045 C CG    . TYR B 1 503 ? 8.636   20.120  -27.785 1.00 56.81  ? 503  TYR B CG    1 
ATOM   8046 C CD1   . TYR B 1 503 ? 9.977   20.381  -28.039 1.00 57.45  ? 503  TYR B CD1   1 
ATOM   8047 C CD2   . TYR B 1 503 ? 8.320   19.247  -26.745 1.00 57.50  ? 503  TYR B CD2   1 
ATOM   8048 C CE1   . TYR B 1 503 ? 10.980  19.805  -27.273 1.00 57.90  ? 503  TYR B CE1   1 
ATOM   8049 C CE2   . TYR B 1 503 ? 9.311   18.653  -25.987 1.00 57.47  ? 503  TYR B CE2   1 
ATOM   8050 C CZ    . TYR B 1 503 ? 10.638  18.942  -26.254 1.00 57.22  ? 503  TYR B CZ    1 
ATOM   8051 O OH    . TYR B 1 503 ? 11.620  18.371  -25.502 1.00 57.52  ? 503  TYR B OH    1 
ATOM   8052 N N     . THR B 1 504 ? 8.882   23.461  -27.055 1.00 58.52  ? 504  THR B N     1 
ATOM   8053 C CA    . THR B 1 504 ? 10.055  24.319  -26.958 1.00 59.68  ? 504  THR B CA    1 
ATOM   8054 C C     . THR B 1 504 ? 11.071  23.722  -25.980 1.00 60.22  ? 504  THR B C     1 
ATOM   8055 O O     . THR B 1 504 ? 10.728  22.895  -25.145 1.00 59.03  ? 504  THR B O     1 
ATOM   8056 C CB    . THR B 1 504 ? 9.661   25.721  -26.465 1.00 60.82  ? 504  THR B CB    1 
ATOM   8057 O OG1   . THR B 1 504 ? 9.141   25.612  -25.140 1.00 61.13  ? 504  THR B OG1   1 
ATOM   8058 C CG2   . THR B 1 504 ? 8.599   26.356  -27.389 1.00 60.81  ? 504  THR B CG2   1 
ATOM   8059 N N     . THR B 1 505 ? 12.326  24.156  -26.078 1.00 61.98  ? 505  THR B N     1 
ATOM   8060 C CA    . THR B 1 505 ? 13.374  23.635  -25.192 1.00 63.10  ? 505  THR B CA    1 
ATOM   8061 C C     . THR B 1 505 ? 13.135  24.106  -23.748 1.00 64.07  ? 505  THR B C     1 
ATOM   8062 O O     . THR B 1 505 ? 13.331  23.342  -22.810 1.00 64.30  ? 505  THR B O     1 
ATOM   8063 C CB    . THR B 1 505 ? 14.809  24.007  -25.688 1.00 63.92  ? 505  THR B CB    1 
ATOM   8064 O OG1   . THR B 1 505 ? 14.924  25.426  -25.859 1.00 66.33  ? 505  THR B OG1   1 
ATOM   8065 C CG2   . THR B 1 505 ? 15.120  23.311  -27.005 1.00 62.68  ? 505  THR B CG2   1 
ATOM   8066 N N     . ALA B 1 506 ? 12.669  25.344  -23.589 1.00 65.05  ? 506  ALA B N     1 
ATOM   8067 C CA    . ALA B 1 506 ? 12.287  25.883  -22.277 1.00 65.88  ? 506  ALA B CA    1 
ATOM   8068 C C     . ALA B 1 506 ? 11.137  25.105  -21.630 1.00 65.47  ? 506  ALA B C     1 
ATOM   8069 O O     . ALA B 1 506 ? 11.341  24.391  -20.639 1.00 66.91  ? 506  ALA B O     1 
ATOM   8070 C CB    . ALA B 1 506 ? 11.903  27.366  -22.413 1.00 66.93  ? 506  ALA B CB    1 
ATOM   8071 N N     . ALA B 1 507 ? 9.934   25.221  -22.197 1.00 64.50  ? 507  ALA B N     1 
ATOM   8072 C CA    . ALA B 1 507 ? 8.718   24.678  -21.567 1.00 63.03  ? 507  ALA B CA    1 
ATOM   8073 C C     . ALA B 1 507 ? 8.516   23.179  -21.826 1.00 61.70  ? 507  ALA B C     1 
ATOM   8074 O O     . ALA B 1 507 ? 7.839   22.507  -21.057 1.00 61.58  ? 507  ALA B O     1 
ATOM   8075 C CB    . ALA B 1 507 ? 7.497   25.472  -22.022 1.00 63.21  ? 507  ALA B CB    1 
ATOM   8076 N N     . GLN B 1 508 ? 9.075   22.675  -22.926 1.00 60.58  ? 508  GLN B N     1 
ATOM   8077 C CA    . GLN B 1 508 ? 8.996   21.254  -23.304 1.00 59.46  ? 508  GLN B CA    1 
ATOM   8078 C C     . GLN B 1 508 ? 7.586   20.673  -23.297 1.00 58.38  ? 508  GLN B C     1 
ATOM   8079 O O     . GLN B 1 508 ? 7.383   19.502  -22.934 1.00 57.66  ? 508  GLN B O     1 
ATOM   8080 C CB    . GLN B 1 508 ? 9.904   20.420  -22.413 1.00 59.25  ? 508  GLN B CB    1 
ATOM   8081 C CG    . GLN B 1 508 ? 11.350  20.873  -22.439 1.00 60.58  ? 508  GLN B CG    1 
ATOM   8082 C CD    . GLN B 1 508 ? 12.239  20.024  -21.554 1.00 60.96  ? 508  GLN B CD    1 
ATOM   8083 O OE1   . GLN B 1 508 ? 12.192  18.789  -21.603 1.00 63.40  ? 508  GLN B OE1   1 
ATOM   8084 N NE2   . GLN B 1 508 ? 13.044  20.677  -20.738 1.00 61.07  ? 508  GLN B NE2   1 
ATOM   8085 N N     . GLN B 1 509 ? 6.625   21.471  -23.760 1.00 57.61  ? 509  GLN B N     1 
ATOM   8086 C CA    . GLN B 1 509 ? 5.227   21.053  -23.772 1.00 57.07  ? 509  GLN B CA    1 
ATOM   8087 C C     . GLN B 1 509 ? 4.862   20.091  -24.903 1.00 56.05  ? 509  GLN B C     1 
ATOM   8088 O O     . GLN B 1 509 ? 5.275   20.255  -26.056 1.00 55.14  ? 509  GLN B O     1 
ATOM   8089 C CB    . GLN B 1 509 ? 4.312   22.260  -23.850 1.00 57.54  ? 509  GLN B CB    1 
ATOM   8090 C CG    . GLN B 1 509 ? 4.387   23.129  -22.632 1.00 59.30  ? 509  GLN B CG    1 
ATOM   8091 C CD    . GLN B 1 509 ? 3.836   24.508  -22.899 1.00 61.41  ? 509  GLN B CD    1 
ATOM   8092 O OE1   . GLN B 1 509 ? 4.351   25.243  -23.749 1.00 62.11  ? 509  GLN B OE1   1 
ATOM   8093 N NE2   . GLN B 1 509 ? 2.787   24.867  -22.184 1.00 60.47  ? 509  GLN B NE2   1 
ATOM   8094 N N     . TYR B 1 510 ? 4.040   19.111  -24.551 1.00 55.59  ? 510  TYR B N     1 
ATOM   8095 C CA    . TYR B 1 510 ? 3.492   18.161  -25.505 1.00 55.22  ? 510  TYR B CA    1 
ATOM   8096 C C     . TYR B 1 510 ? 2.106   17.761  -25.025 1.00 55.59  ? 510  TYR B C     1 
ATOM   8097 O O     . TYR B 1 510 ? 1.725   18.058  -23.897 1.00 56.89  ? 510  TYR B O     1 
ATOM   8098 C CB    . TYR B 1 510 ? 4.407   16.945  -25.633 1.00 54.24  ? 510  TYR B CB    1 
ATOM   8099 C CG    . TYR B 1 510 ? 4.517   16.116  -24.377 1.00 54.95  ? 510  TYR B CG    1 
ATOM   8100 C CD1   . TYR B 1 510 ? 5.291   16.540  -23.301 1.00 54.51  ? 510  TYR B CD1   1 
ATOM   8101 C CD2   . TYR B 1 510 ? 3.858   14.891  -24.271 1.00 55.18  ? 510  TYR B CD2   1 
ATOM   8102 C CE1   . TYR B 1 510 ? 5.388   15.775  -22.153 1.00 55.32  ? 510  TYR B CE1   1 
ATOM   8103 C CE2   . TYR B 1 510 ? 3.953   14.120  -23.130 1.00 54.66  ? 510  TYR B CE2   1 
ATOM   8104 C CZ    . TYR B 1 510 ? 4.725   14.560  -22.082 1.00 55.51  ? 510  TYR B CZ    1 
ATOM   8105 O OH    . TYR B 1 510 ? 4.812   13.786  -20.952 1.00 56.79  ? 510  TYR B OH    1 
ATOM   8106 N N     . VAL B 1 511 ? 1.332   17.109  -25.872 1.00 55.23  ? 511  VAL B N     1 
ATOM   8107 C CA    . VAL B 1 511 ? -0.038  16.790  -25.498 1.00 55.85  ? 511  VAL B CA    1 
ATOM   8108 C C     . VAL B 1 511 ? -0.278  15.285  -25.510 1.00 55.97  ? 511  VAL B C     1 
ATOM   8109 O O     . VAL B 1 511 ? 0.423   14.530  -26.183 1.00 54.26  ? 511  VAL B O     1 
ATOM   8110 C CB    . VAL B 1 511 ? -1.047  17.501  -26.423 1.00 56.42  ? 511  VAL B CB    1 
ATOM   8111 C CG1   . VAL B 1 511 ? -0.787  19.021  -26.430 1.00 55.31  ? 511  VAL B CG1   1 
ATOM   8112 C CG2   . VAL B 1 511 ? -0.997  16.917  -27.838 1.00 55.16  ? 511  VAL B CG2   1 
ATOM   8113 N N     . SER B 1 512 ? -1.272  14.858  -24.736 1.00 57.45  ? 512  SER B N     1 
ATOM   8114 C CA    . SER B 1 512 ? -1.726  13.467  -24.765 1.00 57.69  ? 512  SER B CA    1 
ATOM   8115 C C     . SER B 1 512 ? -2.877  13.330  -25.754 1.00 58.44  ? 512  SER B C     1 
ATOM   8116 O O     . SER B 1 512 ? -3.843  14.096  -25.727 1.00 59.26  ? 512  SER B O     1 
ATOM   8117 C CB    . SER B 1 512 ? -2.161  12.996  -23.383 1.00 58.40  ? 512  SER B CB    1 
ATOM   8118 O OG    . SER B 1 512 ? -3.098  13.901  -22.831 1.00 59.73  ? 512  SER B OG    1 
ATOM   8119 N N     . LEU B 1 513 ? -2.735  12.361  -26.645 1.00 58.41  ? 513  LEU B N     1 
ATOM   8120 C CA    . LEU B 1 513 ? -3.777  11.987  -27.574 1.00 58.95  ? 513  LEU B CA    1 
ATOM   8121 C C     . LEU B 1 513 ? -4.430  10.716  -27.027 1.00 60.29  ? 513  LEU B C     1 
ATOM   8122 O O     . LEU B 1 513 ? -3.826  9.624   -27.056 1.00 59.79  ? 513  LEU B O     1 
ATOM   8123 C CB    . LEU B 1 513 ? -3.178  11.746  -28.971 1.00 57.83  ? 513  LEU B CB    1 
ATOM   8124 C CG    . LEU B 1 513 ? -2.514  12.959  -29.628 1.00 55.49  ? 513  LEU B CG    1 
ATOM   8125 C CD1   . LEU B 1 513 ? -1.988  12.627  -31.023 1.00 52.21  ? 513  LEU B CD1   1 
ATOM   8126 C CD2   . LEU B 1 513 ? -3.497  14.142  -29.680 1.00 55.51  ? 513  LEU B CD2   1 
ATOM   8127 N N     . ASN B 1 514 ? -5.641  10.879  -26.497 1.00 61.90  ? 514  ASN B N     1 
ATOM   8128 C CA    . ASN B 1 514 ? -6.449  9.770   -25.998 1.00 63.81  ? 514  ASN B CA    1 
ATOM   8129 C C     . ASN B 1 514 ? -7.920  10.179  -26.086 1.00 66.19  ? 514  ASN B C     1 
ATOM   8130 O O     . ASN B 1 514 ? -8.227  11.204  -26.692 1.00 66.38  ? 514  ASN B O     1 
ATOM   8131 C CB    . ASN B 1 514 ? -6.020  9.380   -24.579 1.00 63.63  ? 514  ASN B CB    1 
ATOM   8132 C CG    . ASN B 1 514 ? -6.115  10.530  -23.600 1.00 64.13  ? 514  ASN B CG    1 
ATOM   8133 O OD1   . ASN B 1 514 ? -7.047  11.319  -23.650 1.00 65.60  ? 514  ASN B OD1   1 
ATOM   8134 N ND2   . ASN B 1 514 ? -5.141  10.632  -22.701 1.00 64.56  ? 514  ASN B ND2   1 
ATOM   8135 N N     . LEU B 1 515 ? -8.828  9.400   -25.504 1.00 68.46  ? 515  LEU B N     1 
ATOM   8136 C CA    . LEU B 1 515 ? -10.260 9.681   -25.654 1.00 70.78  ? 515  LEU B CA    1 
ATOM   8137 C C     . LEU B 1 515 ? -10.680 10.949  -24.926 1.00 71.85  ? 515  LEU B C     1 
ATOM   8138 O O     . LEU B 1 515 ? -11.686 11.543  -25.277 1.00 73.06  ? 515  LEU B O     1 
ATOM   8139 C CB    . LEU B 1 515 ? -11.114 8.510   -25.181 1.00 72.17  ? 515  LEU B CB    1 
ATOM   8140 C CG    . LEU B 1 515 ? -10.994 7.223   -25.992 1.00 72.85  ? 515  LEU B CG    1 
ATOM   8141 C CD1   . LEU B 1 515 ? -11.981 6.194   -25.447 1.00 74.16  ? 515  LEU B CD1   1 
ATOM   8142 C CD2   . LEU B 1 515 ? -11.236 7.452   -27.487 1.00 72.52  ? 515  LEU B CD2   1 
ATOM   8143 N N     . LYS B 1 516 ? -9.906  11.362  -23.928 1.00 71.89  ? 516  LYS B N     1 
ATOM   8144 C CA    . LYS B 1 516 ? -10.176 12.615  -23.218 1.00 73.46  ? 516  LYS B CA    1 
ATOM   8145 C C     . LYS B 1 516 ? -9.711  13.807  -24.053 1.00 72.17  ? 516  LYS B C     1 
ATOM   8146 O O     . LYS B 1 516 ? -8.918  13.643  -24.970 1.00 71.05  ? 516  LYS B O     1 
ATOM   8147 C CB    . LYS B 1 516 ? -9.481  12.616  -21.856 1.00 73.27  ? 516  LYS B CB    1 
ATOM   8148 C CG    . LYS B 1 516 ? -9.792  11.364  -21.020 1.00 75.72  ? 516  LYS B CG    1 
ATOM   8149 C CD    . LYS B 1 516 ? -9.563  11.587  -19.520 1.00 76.76  ? 516  LYS B CD    1 
ATOM   8150 C CE    . LYS B 1 516 ? -8.079  11.573  -19.153 1.00 77.28  ? 516  LYS B CE    1 
ATOM   8151 N NZ    . LYS B 1 516 ? -7.877  11.966  -17.715 1.00 78.21  ? 516  LYS B NZ    1 
ATOM   8152 N N     . PRO B 1 517 ? -10.235 15.007  -23.772 1.00 73.25  ? 517  PRO B N     1 
ATOM   8153 C CA    . PRO B 1 517 ? -9.706  16.236  -24.382 1.00 72.48  ? 517  PRO B CA    1 
ATOM   8154 C C     . PRO B 1 517 ? -8.198  16.386  -24.210 1.00 70.60  ? 517  PRO B C     1 
ATOM   8155 O O     . PRO B 1 517 ? -7.643  15.878  -23.240 1.00 70.20  ? 517  PRO B O     1 
ATOM   8156 C CB    . PRO B 1 517 ? -10.421 17.348  -23.597 1.00 74.03  ? 517  PRO B CB    1 
ATOM   8157 C CG    . PRO B 1 517 ? -11.711 16.724  -23.154 1.00 75.52  ? 517  PRO B CG    1 
ATOM   8158 C CD    . PRO B 1 517 ? -11.380 15.283  -22.883 1.00 75.31  ? 517  PRO B CD    1 
ATOM   8159 N N     . LEU B 1 518 ? -7.548  17.091  -25.132 1.00 69.73  ? 518  LEU B N     1 
ATOM   8160 C CA    . LEU B 1 518 ? -6.100  17.343  -25.031 1.00 68.41  ? 518  LEU B CA    1 
ATOM   8161 C C     . LEU B 1 518 ? -5.701  17.773  -23.620 1.00 68.47  ? 518  LEU B C     1 
ATOM   8162 O O     . LEU B 1 518 ? -6.262  18.707  -23.075 1.00 69.17  ? 518  LEU B O     1 
ATOM   8163 C CB    . LEU B 1 518 ? -5.646  18.465  -25.978 1.00 67.87  ? 518  LEU B CB    1 
ATOM   8164 C CG    . LEU B 1 518 ? -5.396  18.268  -27.465 1.00 67.13  ? 518  LEU B CG    1 
ATOM   8165 C CD1   . LEU B 1 518 ? -4.528  19.429  -27.944 1.00 67.15  ? 518  LEU B CD1   1 
ATOM   8166 C CD2   . LEU B 1 518 ? -4.729  16.955  -27.783 1.00 64.82  ? 518  LEU B CD2   1 
ATOM   8167 N N     . GLU B 1 519 ? -4.719  17.092  -23.053 1.00 67.70  ? 519  GLU B N     1 
ATOM   8168 C CA    . GLU B 1 519 ? -4.075  17.528  -21.826 1.00 68.16  ? 519  GLU B CA    1 
ATOM   8169 C C     . GLU B 1 519 ? -2.647  17.919  -22.215 1.00 65.66  ? 519  GLU B C     1 
ATOM   8170 O O     . GLU B 1 519 ? -2.006  17.199  -22.966 1.00 64.75  ? 519  GLU B O     1 
ATOM   8171 C CB    . GLU B 1 519 ? -4.099  16.385  -20.810 1.00 68.56  ? 519  GLU B CB    1 
ATOM   8172 C CG    . GLU B 1 519 ? -3.313  16.580  -19.520 1.00 70.04  ? 519  GLU B CG    1 
ATOM   8173 C CD    . GLU B 1 519 ? -3.393  15.330  -18.629 1.00 71.52  ? 519  GLU B CD    1 
ATOM   8174 O OE1   . GLU B 1 519 ? -4.493  15.090  -18.056 1.00 76.80  ? 519  GLU B OE1   1 
ATOM   8175 O OE2   . GLU B 1 519 ? -2.376  14.592  -18.508 1.00 72.11  ? 519  GLU B OE2   1 
ATOM   8176 N N     . VAL B 1 520 ? -2.178  19.068  -21.730 1.00 64.81  ? 520  VAL B N     1 
ATOM   8177 C CA    . VAL B 1 520 ? -0.812  19.518  -21.954 1.00 63.29  ? 520  VAL B CA    1 
ATOM   8178 C C     . VAL B 1 520 ? 0.093   19.030  -20.815 1.00 63.05  ? 520  VAL B C     1 
ATOM   8179 O O     . VAL B 1 520 ? -0.216  19.225  -19.646 1.00 63.65  ? 520  VAL B O     1 
ATOM   8180 C CB    . VAL B 1 520 ? -0.729  21.071  -22.053 1.00 63.58  ? 520  VAL B CB    1 
ATOM   8181 C CG1   . VAL B 1 520 ? 0.692   21.520  -22.329 1.00 61.87  ? 520  VAL B CG1   1 
ATOM   8182 C CG2   . VAL B 1 520 ? -1.669  21.593  -23.135 1.00 63.69  ? 520  VAL B CG2   1 
ATOM   8183 N N     . ARG B 1 521 ? 1.202   18.386  -21.168 1.00 62.00  ? 521  ARG B N     1 
ATOM   8184 C CA    . ARG B 1 521 ? 2.201   17.955  -20.199 1.00 61.88  ? 521  ARG B CA    1 
ATOM   8185 C C     . ARG B 1 521 ? 3.556   18.566  -20.541 1.00 61.19  ? 521  ARG B C     1 
ATOM   8186 O O     . ARG B 1 521 ? 3.760   19.099  -21.636 1.00 60.22  ? 521  ARG B O     1 
ATOM   8187 C CB    . ARG B 1 521 ? 2.308   16.431  -20.206 1.00 61.70  ? 521  ARG B CB    1 
ATOM   8188 C CG    . ARG B 1 521 ? 1.007   15.744  -19.885 1.00 62.81  ? 521  ARG B CG    1 
ATOM   8189 C CD    . ARG B 1 521 ? 1.083   14.237  -20.048 1.00 62.54  ? 521  ARG B CD    1 
ATOM   8190 N NE    . ARG B 1 521 ? -0.243  13.610  -19.917 1.00 62.97  ? 521  ARG B NE    1 
ATOM   8191 C CZ    . ARG B 1 521 ? -0.498  12.333  -20.209 1.00 64.23  ? 521  ARG B CZ    1 
ATOM   8192 N NH1   . ARG B 1 521 ? 0.459   11.534  -20.671 1.00 63.37  ? 521  ARG B NH1   1 
ATOM   8193 N NH2   . ARG B 1 521 ? -1.725  11.852  -20.061 1.00 66.62  ? 521  ARG B NH2   1 
ATOM   8194 N N     . ARG B 1 522 ? 4.491   18.482  -19.606 1.00 61.54  ? 522  ARG B N     1 
ATOM   8195 C CA    . ARG B 1 522 ? 5.816   19.053  -19.825 1.00 61.88  ? 522  ARG B CA    1 
ATOM   8196 C C     . ARG B 1 522 ? 6.898   18.038  -19.545 1.00 61.74  ? 522  ARG B C     1 
ATOM   8197 O O     . ARG B 1 522 ? 6.894   17.397  -18.497 1.00 62.17  ? 522  ARG B O     1 
ATOM   8198 C CB    . ARG B 1 522 ? 6.030   20.289  -18.959 1.00 62.07  ? 522  ARG B CB    1 
ATOM   8199 C CG    . ARG B 1 522 ? 5.097   21.405  -19.299 1.00 63.06  ? 522  ARG B CG    1 
ATOM   8200 C CD    . ARG B 1 522 ? 5.185   22.561  -18.320 1.00 64.38  ? 522  ARG B CD    1 
ATOM   8201 N NE    . ARG B 1 522 ? 6.502   23.207  -18.334 1.00 65.14  ? 522  ARG B NE    1 
ATOM   8202 C CZ    . ARG B 1 522 ? 6.776   24.384  -17.769 1.00 65.29  ? 522  ARG B CZ    1 
ATOM   8203 N NH1   . ARG B 1 522 ? 5.829   25.068  -17.140 1.00 65.11  ? 522  ARG B NH1   1 
ATOM   8204 N NH2   . ARG B 1 522 ? 8.010   24.884  -17.844 1.00 64.78  ? 522  ARG B NH2   1 
ATOM   8205 N N     . GLY B 1 523 ? 7.816   17.903  -20.495 1.00 61.56  ? 523  GLY B N     1 
ATOM   8206 C CA    . GLY B 1 523 ? 9.005   17.090  -20.313 1.00 61.86  ? 523  GLY B CA    1 
ATOM   8207 C C     . GLY B 1 523 ? 8.737   15.686  -20.770 1.00 62.11  ? 523  GLY B C     1 
ATOM   8208 O O     . GLY B 1 523 ? 8.043   14.928  -20.114 1.00 62.59  ? 523  GLY B O     1 
ATOM   8209 N N     . LEU B 1 524 ? 9.304   15.342  -21.909 1.00 62.45  ? 524  LEU B N     1 
ATOM   8210 C CA    . LEU B 1 524 ? 9.082   14.049  -22.529 1.00 63.20  ? 524  LEU B CA    1 
ATOM   8211 C C     . LEU B 1 524 ? 10.115  13.048  -21.989 1.00 63.10  ? 524  LEU B C     1 
ATOM   8212 O O     . LEU B 1 524 ? 11.173  12.871  -22.582 1.00 63.77  ? 524  LEU B O     1 
ATOM   8213 C CB    . LEU B 1 524 ? 9.218   14.260  -24.040 1.00 62.74  ? 524  LEU B CB    1 
ATOM   8214 C CG    . LEU B 1 524 ? 8.646   13.330  -25.082 1.00 63.62  ? 524  LEU B CG    1 
ATOM   8215 C CD1   . LEU B 1 524 ? 7.155   13.057  -24.870 1.00 64.42  ? 524  LEU B CD1   1 
ATOM   8216 C CD2   . LEU B 1 524 ? 8.918   14.035  -26.413 1.00 63.11  ? 524  LEU B CD2   1 
ATOM   8217 N N     . ARG B 1 525 ? 9.823   12.438  -20.846 1.00 63.45  ? 525  ARG B N     1 
ATOM   8218 C CA    . ARG B 1 525 ? 10.771  11.554  -20.146 1.00 64.12  ? 525  ARG B CA    1 
ATOM   8219 C C     . ARG B 1 525 ? 12.093  12.265  -19.872 1.00 63.21  ? 525  ARG B C     1 
ATOM   8220 O O     . ARG B 1 525 ? 13.175  11.730  -20.163 1.00 63.00  ? 525  ARG B O     1 
ATOM   8221 C CB    . ARG B 1 525 ? 11.064  10.302  -20.969 1.00 64.51  ? 525  ARG B CB    1 
ATOM   8222 C CG    . ARG B 1 525 ? 9.887   9.435   -21.237 1.00 67.19  ? 525  ARG B CG    1 
ATOM   8223 C CD    . ARG B 1 525 ? 9.742   8.382   -20.181 1.00 72.29  ? 525  ARG B CD    1 
ATOM   8224 N NE    . ARG B 1 525 ? 9.467   7.074   -20.761 1.00 75.00  ? 525  ARG B NE    1 
ATOM   8225 C CZ    . ARG B 1 525 ? 8.330   6.716   -21.359 1.00 75.80  ? 525  ARG B CZ    1 
ATOM   8226 N NH1   . ARG B 1 525 ? 7.324   7.581   -21.509 1.00 76.77  ? 525  ARG B NH1   1 
ATOM   8227 N NH2   . ARG B 1 525 ? 8.209   5.479   -21.829 1.00 75.97  ? 525  ARG B NH2   1 
ATOM   8228 N N     . ALA B 1 526 ? 12.004  13.464  -19.317 1.00 62.37  ? 526  ALA B N     1 
ATOM   8229 C CA    . ALA B 1 526 ? 13.152  14.354  -19.274 1.00 61.79  ? 526  ALA B CA    1 
ATOM   8230 C C     . ALA B 1 526 ? 14.345  13.739  -18.550 1.00 61.75  ? 526  ALA B C     1 
ATOM   8231 O O     . ALA B 1 526 ? 15.458  13.799  -19.067 1.00 61.50  ? 526  ALA B O     1 
ATOM   8232 C CB    . ALA B 1 526 ? 12.775  15.694  -18.656 1.00 62.21  ? 526  ALA B CB    1 
ATOM   8233 N N     . GLN B 1 527 ? 14.117  13.144  -17.375 1.00 61.75  ? 527  GLN B N     1 
ATOM   8234 C CA    . GLN B 1 527 ? 15.221  12.601  -16.565 1.00 62.36  ? 527  GLN B CA    1 
ATOM   8235 C C     . GLN B 1 527 ? 15.845  11.383  -17.215 1.00 61.80  ? 527  GLN B C     1 
ATOM   8236 O O     . GLN B 1 527 ? 17.068  11.272  -17.289 1.00 61.74  ? 527  GLN B O     1 
ATOM   8237 C CB    . GLN B 1 527 ? 14.766  12.237  -15.146 1.00 63.27  ? 527  GLN B CB    1 
ATOM   8238 C CG    . GLN B 1 527 ? 14.322  13.434  -14.304 1.00 65.33  ? 527  GLN B CG    1 
ATOM   8239 C CD    . GLN B 1 527 ? 15.388  14.514  -14.202 1.00 66.99  ? 527  GLN B CD    1 
ATOM   8240 O OE1   . GLN B 1 527 ? 15.211  15.634  -14.705 1.00 69.65  ? 527  GLN B OE1   1 
ATOM   8241 N NE2   . GLN B 1 527 ? 16.509  14.179  -13.567 1.00 67.90  ? 527  GLN B NE2   1 
ATOM   8242 N N     . THR B 1 528 ? 14.995  10.473  -17.677 1.00 61.32  ? 528  THR B N     1 
ATOM   8243 C CA    . THR B 1 528 ? 15.447  9.249   -18.302 1.00 61.43  ? 528  THR B CA    1 
ATOM   8244 C C     . THR B 1 528 ? 16.126  9.532   -19.638 1.00 60.89  ? 528  THR B C     1 
ATOM   8245 O O     . THR B 1 528 ? 17.131  8.915   -19.951 1.00 61.85  ? 528  THR B O     1 
ATOM   8246 C CB    . THR B 1 528 ? 14.283  8.224   -18.441 1.00 61.68  ? 528  THR B CB    1 
ATOM   8247 O OG1   . THR B 1 528 ? 13.951  7.709   -17.144 1.00 62.84  ? 528  THR B OG1   1 
ATOM   8248 C CG2   . THR B 1 528 ? 14.665  7.052   -19.348 1.00 61.16  ? 528  THR B CG2   1 
ATOM   8249 N N     . CYS B 1 529 ? 15.616  10.471  -20.423 1.00 60.14  ? 529  CYS B N     1 
ATOM   8250 C CA    . CYS B 1 529 ? 16.274  10.778  -21.697 1.00 59.82  ? 529  CYS B CA    1 
ATOM   8251 C C     . CYS B 1 529 ? 17.577  11.531  -21.508 1.00 60.02  ? 529  CYS B C     1 
ATOM   8252 O O     . CYS B 1 529 ? 18.456  11.436  -22.341 1.00 60.80  ? 529  CYS B O     1 
ATOM   8253 C CB    . CYS B 1 529 ? 15.329  11.504  -22.657 1.00 58.93  ? 529  CYS B CB    1 
ATOM   8254 S SG    . CYS B 1 529 ? 14.016  10.400  -23.246 1.00 60.24  ? 529  CYS B SG    1 
ATOM   8255 N N     . ALA B 1 530 ? 17.722  12.263  -20.410 1.00 60.11  ? 530  ALA B N     1 
ATOM   8256 C CA    . ALA B 1 530 ? 19.019  12.851  -20.063 1.00 60.55  ? 530  ALA B CA    1 
ATOM   8257 C C     . ALA B 1 530 ? 20.041  11.748  -19.784 1.00 61.06  ? 530  ALA B C     1 
ATOM   8258 O O     . ALA B 1 530 ? 21.221  11.895  -20.067 1.00 61.31  ? 530  ALA B O     1 
ATOM   8259 C CB    . ALA B 1 530 ? 18.895  13.777  -18.856 1.00 60.62  ? 530  ALA B CB    1 
ATOM   8260 N N     . PHE B 1 531 ? 19.576  10.651  -19.202 1.00 61.13  ? 531  PHE B N     1 
ATOM   8261 C CA    . PHE B 1 531 ? 20.419  9.482   -19.020 1.00 62.01  ? 531  PHE B CA    1 
ATOM   8262 C C     . PHE B 1 531 ? 20.874  8.934   -20.383 1.00 61.95  ? 531  PHE B C     1 
ATOM   8263 O O     . PHE B 1 531 ? 22.063  8.711   -20.602 1.00 62.73  ? 531  PHE B O     1 
ATOM   8264 C CB    . PHE B 1 531 ? 19.667  8.420   -18.222 1.00 61.95  ? 531  PHE B CB    1 
ATOM   8265 C CG    . PHE B 1 531 ? 20.309  7.074   -18.257 1.00 62.46  ? 531  PHE B CG    1 
ATOM   8266 C CD1   . PHE B 1 531 ? 21.445  6.818   -17.508 1.00 64.04  ? 531  PHE B CD1   1 
ATOM   8267 C CD2   . PHE B 1 531 ? 19.771  6.056   -19.017 1.00 61.83  ? 531  PHE B CD2   1 
ATOM   8268 C CE1   . PHE B 1 531 ? 22.033  5.572   -17.522 1.00 64.61  ? 531  PHE B CE1   1 
ATOM   8269 C CE2   . PHE B 1 531 ? 20.357  4.806   -19.039 1.00 63.49  ? 531  PHE B CE2   1 
ATOM   8270 C CZ    . PHE B 1 531 ? 21.485  4.564   -18.290 1.00 64.56  ? 531  PHE B CZ    1 
ATOM   8271 N N     . TRP B 1 532 ? 19.925  8.743   -21.296 1.00 61.18  ? 532  TRP B N     1 
ATOM   8272 C CA    . TRP B 1 532 ? 20.240  8.209   -22.617 1.00 61.35  ? 532  TRP B CA    1 
ATOM   8273 C C     . TRP B 1 532 ? 21.002  9.176   -23.514 1.00 61.64  ? 532  TRP B C     1 
ATOM   8274 O O     . TRP B 1 532 ? 21.935  8.767   -24.188 1.00 62.01  ? 532  TRP B O     1 
ATOM   8275 C CB    . TRP B 1 532 ? 18.976  7.756   -23.343 1.00 59.83  ? 532  TRP B CB    1 
ATOM   8276 C CG    . TRP B 1 532 ? 18.389  6.474   -22.824 1.00 59.86  ? 532  TRP B CG    1 
ATOM   8277 C CD1   . TRP B 1 532 ? 17.280  6.347   -22.058 1.00 59.29  ? 532  TRP B CD1   1 
ATOM   8278 C CD2   . TRP B 1 532 ? 18.883  5.140   -23.040 1.00 59.59  ? 532  TRP B CD2   1 
ATOM   8279 N NE1   . TRP B 1 532 ? 17.039  5.024   -21.788 1.00 60.00  ? 532  TRP B NE1   1 
ATOM   8280 C CE2   . TRP B 1 532 ? 18.007  4.261   -22.375 1.00 59.15  ? 532  TRP B CE2   1 
ATOM   8281 C CE3   . TRP B 1 532 ? 19.977  4.610   -23.726 1.00 60.27  ? 532  TRP B CE3   1 
ATOM   8282 C CZ2   . TRP B 1 532 ? 18.176  2.882   -22.384 1.00 60.27  ? 532  TRP B CZ2   1 
ATOM   8283 C CZ3   . TRP B 1 532 ? 20.154  3.232   -23.729 1.00 61.33  ? 532  TRP B CZ3   1 
ATOM   8284 C CH2   . TRP B 1 532 ? 19.252  2.385   -23.064 1.00 61.69  ? 532  TRP B CH2   1 
ATOM   8285 N N     . ASN B 1 533 ? 20.607  10.444  -23.512 1.00 62.11  ? 533  ASN B N     1 
ATOM   8286 C CA    . ASN B 1 533 ? 21.142  11.447  -24.454 1.00 62.61  ? 533  ASN B CA    1 
ATOM   8287 C C     . ASN B 1 533 ? 22.366  12.209  -23.985 1.00 64.63  ? 533  ASN B C     1 
ATOM   8288 O O     . ASN B 1 533 ? 23.152  12.678  -24.820 1.00 65.27  ? 533  ASN B O     1 
ATOM   8289 C CB    . ASN B 1 533 ? 20.041  12.449  -24.851 1.00 61.55  ? 533  ASN B CB    1 
ATOM   8290 C CG    . ASN B 1 533 ? 18.869  11.769  -25.539 1.00 60.06  ? 533  ASN B CG    1 
ATOM   8291 O OD1   . ASN B 1 533 ? 19.015  10.659  -26.047 1.00 60.69  ? 533  ASN B OD1   1 
ATOM   8292 N ND2   . ASN B 1 533 ? 17.708  12.417  -25.548 1.00 56.70  ? 533  ASN B ND2   1 
ATOM   8293 N N     . ARG B 1 534 ? 22.530  12.354  -22.672 1.00 66.36  ? 534  ARG B N     1 
ATOM   8294 C CA    . ARG B 1 534 ? 23.677  13.080  -22.118 1.00 68.74  ? 534  ARG B CA    1 
ATOM   8295 C C     . ARG B 1 534 ? 24.650  12.177  -21.380 1.00 70.02  ? 534  ARG B C     1 
ATOM   8296 O O     . ARG B 1 534 ? 25.858  12.319  -21.554 1.00 71.48  ? 534  ARG B O     1 
ATOM   8297 C CB    . ARG B 1 534 ? 23.235  14.206  -21.184 1.00 68.81  ? 534  ARG B CB    1 
ATOM   8298 C CG    . ARG B 1 534 ? 22.468  15.326  -21.867 1.00 69.52  ? 534  ARG B CG    1 
ATOM   8299 C CD    . ARG B 1 534 ? 21.776  16.219  -20.854 1.00 70.44  ? 534  ARG B CD    1 
ATOM   8300 N NE    . ARG B 1 534 ? 20.560  16.807  -21.425 1.00 72.91  ? 534  ARG B NE    1 
ATOM   8301 C CZ    . ARG B 1 534 ? 20.446  18.051  -21.912 1.00 73.61  ? 534  ARG B CZ    1 
ATOM   8302 N NH1   . ARG B 1 534 ? 21.475  18.912  -21.905 1.00 73.19  ? 534  ARG B NH1   1 
ATOM   8303 N NH2   . ARG B 1 534 ? 19.272  18.440  -22.409 1.00 72.42  ? 534  ARG B NH2   1 
ATOM   8304 N N     . PHE B 1 535 ? 24.159  11.254  -20.555 1.00 70.39  ? 535  PHE B N     1 
ATOM   8305 C CA    . PHE B 1 535 ? 25.092  10.449  -19.762 1.00 72.01  ? 535  PHE B CA    1 
ATOM   8306 C C     . PHE B 1 535 ? 25.774  9.347   -20.551 1.00 73.46  ? 535  PHE B C     1 
ATOM   8307 O O     . PHE B 1 535 ? 27.003  9.258   -20.548 1.00 74.24  ? 535  PHE B O     1 
ATOM   8308 C CB    . PHE B 1 535 ? 24.475  9.835   -18.503 1.00 71.46  ? 535  PHE B CB    1 
ATOM   8309 C CG    . PHE B 1 535 ? 25.464  9.041   -17.717 1.00 71.77  ? 535  PHE B CG    1 
ATOM   8310 C CD1   . PHE B 1 535 ? 26.537  9.678   -17.106 1.00 72.31  ? 535  PHE B CD1   1 
ATOM   8311 C CD2   . PHE B 1 535 ? 25.381  7.659   -17.652 1.00 71.75  ? 535  PHE B CD2   1 
ATOM   8312 C CE1   . PHE B 1 535 ? 27.490  8.957   -16.405 1.00 73.71  ? 535  PHE B CE1   1 
ATOM   8313 C CE2   . PHE B 1 535 ? 26.339  6.926   -16.956 1.00 73.48  ? 535  PHE B CE2   1 
ATOM   8314 C CZ    . PHE B 1 535 ? 27.392  7.578   -16.328 1.00 74.42  ? 535  PHE B CZ    1 
ATOM   8315 N N     . LEU B 1 536 ? 24.994  8.487   -21.190 1.00 74.23  ? 536  LEU B N     1 
ATOM   8316 C CA    . LEU B 1 536 ? 25.581  7.300   -21.821 1.00 76.57  ? 536  LEU B CA    1 
ATOM   8317 C C     . LEU B 1 536 ? 26.630  7.621   -22.893 1.00 78.67  ? 536  LEU B C     1 
ATOM   8318 O O     . LEU B 1 536 ? 27.654  6.940   -22.966 1.00 80.24  ? 536  LEU B O     1 
ATOM   8319 C CB    . LEU B 1 536 ? 24.508  6.373   -22.395 1.00 75.57  ? 536  LEU B CB    1 
ATOM   8320 C CG    . LEU B 1 536 ? 23.835  5.412   -21.417 1.00 76.02  ? 536  LEU B CG    1 
ATOM   8321 C CD1   . LEU B 1 536 ? 22.976  4.410   -22.199 1.00 75.37  ? 536  LEU B CD1   1 
ATOM   8322 C CD2   . LEU B 1 536 ? 24.862  4.683   -20.548 1.00 77.47  ? 536  LEU B CD2   1 
ATOM   8323 N N     . PRO B 1 537 ? 26.374  8.637   -23.740 1.00 79.77  ? 537  PRO B N     1 
ATOM   8324 C CA    . PRO B 1 537 ? 27.411  9.084   -24.673 1.00 81.76  ? 537  PRO B CA    1 
ATOM   8325 C C     . PRO B 1 537 ? 28.721  9.455   -23.977 1.00 84.90  ? 537  PRO B C     1 
ATOM   8326 O O     . PRO B 1 537 ? 29.795  9.071   -24.450 1.00 86.49  ? 537  PRO B O     1 
ATOM   8327 C CB    . PRO B 1 537 ? 26.774  10.309  -25.339 1.00 80.55  ? 537  PRO B CB    1 
ATOM   8328 C CG    . PRO B 1 537 ? 25.317  10.037  -25.267 1.00 78.50  ? 537  PRO B CG    1 
ATOM   8329 C CD    . PRO B 1 537 ? 25.120  9.387   -23.932 1.00 78.19  ? 537  PRO B CD    1 
ATOM   8330 N N     . LYS B 1 538 ? 28.631  10.179  -22.863 1.00 86.80  ? 538  LYS B N     1 
ATOM   8331 C CA    . LYS B 1 538 ? 29.815  10.508  -22.061 1.00 89.95  ? 538  LYS B CA    1 
ATOM   8332 C C     . LYS B 1 538 ? 30.483  9.271   -21.489 1.00 92.20  ? 538  LYS B C     1 
ATOM   8333 O O     . LYS B 1 538 ? 31.700  9.259   -21.297 1.00 94.13  ? 538  LYS B O     1 
ATOM   8334 C CB    . LYS B 1 538 ? 29.483  11.481  -20.924 1.00 89.81  ? 538  LYS B CB    1 
ATOM   8335 C CG    . LYS B 1 538 ? 29.411  12.924  -21.377 1.00 90.29  ? 538  LYS B CG    1 
ATOM   8336 C CD    . LYS B 1 538 ? 29.493  13.908  -20.220 1.00 91.27  ? 538  LYS B CD    1 
ATOM   8337 C CE    . LYS B 1 538 ? 28.116  14.320  -19.703 1.00 91.77  ? 538  LYS B CE    1 
ATOM   8338 N NZ    . LYS B 1 538 ? 28.187  15.654  -19.016 1.00 93.37  ? 538  LYS B NZ    1 
ATOM   8339 N N     . LEU B 1 539 ? 29.696  8.236   -21.216 1.00 93.17  ? 539  LEU B N     1 
ATOM   8340 C CA    . LEU B 1 539 ? 30.238  7.018   -20.635 1.00 95.69  ? 539  LEU B CA    1 
ATOM   8341 C C     . LEU B 1 539 ? 31.165  6.336   -21.622 1.00 98.42  ? 539  LEU B C     1 
ATOM   8342 O O     . LEU B 1 539 ? 32.363  6.217   -21.373 1.00 100.20 ? 539  LEU B O     1 
ATOM   8343 C CB    . LEU B 1 539 ? 29.122  6.058   -20.199 1.00 94.91  ? 539  LEU B CB    1 
ATOM   8344 C CG    . LEU B 1 539 ? 29.545  4.738   -19.555 1.00 95.54  ? 539  LEU B CG    1 
ATOM   8345 C CD1   . LEU B 1 539 ? 30.647  4.942   -18.519 1.00 96.81  ? 539  LEU B CD1   1 
ATOM   8346 C CD2   . LEU B 1 539 ? 28.337  4.059   -18.938 1.00 95.10  ? 539  LEU B CD2   1 
ATOM   8347 N N     . LEU B 1 540 ? 30.621  5.917   -22.757 1.00 99.69  ? 540  LEU B N     1 
ATOM   8348 C CA    . LEU B 1 540 ? 31.388  5.091   -23.691 1.00 102.49 ? 540  LEU B CA    1 
ATOM   8349 C C     . LEU B 1 540 ? 32.414  5.867   -24.545 1.00 103.93 ? 540  LEU B C     1 
ATOM   8350 O O     . LEU B 1 540 ? 33.250  5.245   -25.200 1.00 105.49 ? 540  LEU B O     1 
ATOM   8351 C CB    . LEU B 1 540 ? 30.434  4.247   -24.552 1.00 101.43 ? 540  LEU B CB    1 
ATOM   8352 C CG    . LEU B 1 540 ? 29.531  3.287   -23.747 1.00 101.54 ? 540  LEU B CG    1 
ATOM   8353 C CD1   . LEU B 1 540 ? 28.895  2.209   -24.655 1.00 101.29 ? 540  LEU B CD1   1 
ATOM   8354 C CD2   . LEU B 1 540 ? 30.295  2.628   -22.589 1.00 102.04 ? 540  LEU B CD2   1 
ATOM   8355 N N     . SER B 1 541 ? 32.375  7.204   -24.511 1.00 104.34 ? 541  SER B N     1 
ATOM   8356 C CA    . SER B 1 541 ? 33.430  8.036   -25.118 1.00 105.86 ? 541  SER B CA    1 
ATOM   8357 C C     . SER B 1 541 ? 34.533  8.358   -24.094 1.00 108.90 ? 541  SER B C     1 
ATOM   8358 O O     . SER B 1 541 ? 34.954  9.512   -23.952 1.00 109.44 ? 541  SER B O     1 
ATOM   8359 C CB    . SER B 1 541 ? 32.840  9.335   -25.700 1.00 104.82 ? 541  SER B CB    1 
ATOM   8360 O OG    . SER B 1 541 ? 32.726  10.359  -24.718 1.00 104.23 ? 541  SER B OG    1 
ATOM   8361 N N     . ALA B 1 542 ? 35.005  7.322   -23.401 1.00 111.20 ? 542  ALA B N     1 
ATOM   8362 C CA    . ALA B 1 542 ? 35.932  7.463   -22.272 1.00 113.81 ? 542  ALA B CA    1 
ATOM   8363 C C     . ALA B 1 542 ? 36.028  6.114   -21.551 1.00 115.20 ? 542  ALA B C     1 
ATOM   8364 O O     . ALA B 1 542 ? 37.099  5.492   -21.509 1.00 117.45 ? 542  ALA B O     1 
ATOM   8365 C CB    . ALA B 1 542 ? 35.452  8.555   -21.303 1.00 112.96 ? 542  ALA B CB    1 
ATOM   8366 N N     . THR B 1 543 ? 34.888  5.686   -20.993 1.00 114.27 ? 543  THR B N     1 
ATOM   8367 C CA    . THR B 1 543 ? 34.702  4.360   -20.369 1.00 115.06 ? 543  THR B CA    1 
ATOM   8368 C C     . THR B 1 543 ? 35.407  4.230   -18.994 1.00 117.04 ? 543  THR B C     1 
ATOM   8369 O O     . THR B 1 543 ? 35.751  3.142   -18.516 1.00 118.46 ? 543  THR B O     1 
ATOM   8370 C CB    . THR B 1 543 ? 35.111  3.200   -21.344 1.00 116.12 ? 543  THR B CB    1 
ATOM   8371 O OG1   . THR B 1 543 ? 34.794  3.560   -22.698 1.00 114.90 ? 543  THR B OG1   1 
ATOM   8372 C CG2   . THR B 1 543 ? 34.383  1.895   -20.985 1.00 116.41 ? 543  THR B CG2   1 
ATOM   8373 O OXT   . THR B 1 543 ? 35.635  5.223   -18.296 1.00 117.20 ? 543  THR B OXT   1 
HETATM 8374 C C1    . NAG C 2 .   ? 24.985  35.243  -0.643  1.00 95.51  ? 1    NAG C C1    1 
HETATM 8375 C C2    . NAG C 2 .   ? 25.239  35.641  -2.111  1.00 98.30  ? 1    NAG C C2    1 
HETATM 8376 C C3    . NAG C 2 .   ? 26.471  34.972  -2.731  1.00 98.58  ? 1    NAG C C3    1 
HETATM 8377 C C4    . NAG C 2 .   ? 27.670  35.257  -1.838  1.00 98.82  ? 1    NAG C C4    1 
HETATM 8378 C C5    . NAG C 2 .   ? 27.356  34.732  -0.439  1.00 99.22  ? 1    NAG C C5    1 
HETATM 8379 C C6    . NAG C 2 .   ? 28.521  34.873  0.549   1.00 101.58 ? 1    NAG C C6    1 
HETATM 8380 C C7    . NAG C 2 .   ? 23.426  36.573  -3.411  1.00 101.18 ? 1    NAG C C7    1 
HETATM 8381 C C8    . NAG C 2 .   ? 23.084  36.554  -4.876  1.00 101.72 ? 1    NAG C C8    1 
HETATM 8382 N N2    . NAG C 2 .   ? 24.034  35.484  -2.920  1.00 99.62  ? 1    NAG C N2    1 
HETATM 8383 O O3    . NAG C 2 .   ? 26.730  35.432  -4.045  1.00 97.92  ? 1    NAG C O3    1 
HETATM 8384 O O4    . NAG C 2 .   ? 28.814  34.632  -2.378  1.00 99.10  ? 1    NAG C O4    1 
HETATM 8385 O O5    . NAG C 2 .   ? 26.206  35.368  0.081   1.00 96.19  ? 1    NAG C O5    1 
HETATM 8386 O O6    . NAG C 2 .   ? 29.123  36.159  0.561   1.00 105.09 ? 1    NAG C O6    1 
HETATM 8387 O O7    . NAG C 2 .   ? 23.151  37.561  -2.718  1.00 101.57 ? 1    NAG C O7    1 
HETATM 8388 C C1    . FUC C 2 .   ? 28.556  37.086  1.526   1.00 108.07 ? 2    FUC C C1    1 
HETATM 8389 C C2    . FUC C 2 .   ? 29.302  38.391  1.873   1.00 109.55 ? 2    FUC C C2    1 
HETATM 8390 C C3    . FUC C 2 .   ? 28.361  39.552  1.571   1.00 110.78 ? 2    FUC C C3    1 
HETATM 8391 C C4    . FUC C 2 .   ? 27.034  39.344  2.311   1.00 110.91 ? 2    FUC C C4    1 
HETATM 8392 C C5    . FUC C 2 .   ? 26.417  37.967  2.035   1.00 109.83 ? 2    FUC C C5    1 
HETATM 8393 C C6    . FUC C 2 .   ? 25.193  37.778  2.927   1.00 109.45 ? 2    FUC C C6    1 
HETATM 8394 O O2    . FUC C 2 .   ? 30.518  38.494  1.161   1.00 110.15 ? 2    FUC C O2    1 
HETATM 8395 O O3    . FUC C 2 .   ? 28.955  40.779  1.939   1.00 111.30 ? 2    FUC C O3    1 
HETATM 8396 O O4    . FUC C 2 .   ? 27.212  39.510  3.707   1.00 111.52 ? 2    FUC C O4    1 
HETATM 8397 O O5    . FUC C 2 .   ? 27.345  36.907  2.243   1.00 108.79 ? 2    FUC C O5    1 
HETATM 8398 C C1    . NAG D 3 .   ? 11.771  33.521  25.626  1.00 98.50  ? 701  NAG A C1    1 
HETATM 8399 C C2    . NAG D 3 .   ? 13.091  34.270  25.390  1.00 101.11 ? 701  NAG A C2    1 
HETATM 8400 C C3    . NAG D 3 .   ? 13.202  35.524  26.268  1.00 102.05 ? 701  NAG A C3    1 
HETATM 8401 C C4    . NAG D 3 .   ? 11.912  36.340  26.173  1.00 102.57 ? 701  NAG A C4    1 
HETATM 8402 C C5    . NAG D 3 .   ? 10.765  35.429  26.628  1.00 102.70 ? 701  NAG A C5    1 
HETATM 8403 C C6    . NAG D 3 .   ? 9.414   36.130  26.840  1.00 103.35 ? 701  NAG A C6    1 
HETATM 8404 C C7    . NAG D 3 .   ? 14.938  32.786  24.693  1.00 101.44 ? 701  NAG A C7    1 
HETATM 8405 C C8    . NAG D 3 .   ? 15.692  31.546  25.087  1.00 100.83 ? 701  NAG A C8    1 
HETATM 8406 N N2    . NAG D 3 .   ? 14.218  33.378  25.651  1.00 101.25 ? 701  NAG A N2    1 
HETATM 8407 O O3    . NAG D 3 .   ? 14.323  36.300  25.898  1.00 102.10 ? 701  NAG A O3    1 
HETATM 8408 O O4    . NAG D 3 .   ? 12.001  37.522  26.942  1.00 103.25 ? 701  NAG A O4    1 
HETATM 8409 O O5    . NAG D 3 .   ? 10.655  34.398  25.660  1.00 100.38 ? 701  NAG A O5    1 
HETATM 8410 O O6    . NAG D 3 .   ? 9.054   36.955  25.748  1.00 104.39 ? 701  NAG A O6    1 
HETATM 8411 O O7    . NAG D 3 .   ? 15.012  33.207  23.538  1.00 101.87 ? 701  NAG A O7    1 
HETATM 8412 C C1    . NAF E 4 .   ? 28.220  18.718  13.761  1.00 55.92  ? 951  NAF A C1    1 
HETATM 8413 C C2    . NAF E 4 .   ? 28.325  17.362  13.434  1.00 54.60  ? 951  NAF A C2    1 
HETATM 8414 C C3    . NAF E 4 .   ? 29.222  16.932  12.437  1.00 55.67  ? 951  NAF A C3    1 
HETATM 8415 C C4    . NAF E 4 .   ? 30.003  17.853  11.735  1.00 55.59  ? 951  NAF A C4    1 
HETATM 8416 C C5    . NAF E 4 .   ? 29.888  19.201  12.060  1.00 56.76  ? 951  NAF A C5    1 
HETATM 8417 C C6    . NAF E 4 .   ? 29.017  19.624  13.060  1.00 55.69  ? 951  NAF A C6    1 
HETATM 8418 C "C1'" . NAF E 4 .   ? 29.236  15.473  12.191  1.00 54.33  ? 951  NAF A "C1'" 1 
HETATM 8419 O "O1'" . NAF E 4 .   ? 29.887  14.799  13.276  1.00 51.50  ? 951  NAF A "O1'" 1 
HETATM 8420 C "C2'" . NAF E 4 .   ? 29.799  14.950  10.878  1.00 54.17  ? 951  NAF A "C2'" 1 
HETATM 8421 F "F1'" . NAF E 4 .   ? 31.035  15.336  10.717  1.00 55.02  ? 951  NAF A "F1'" 1 
HETATM 8422 F "F2'" . NAF E 4 .   ? 28.995  15.390  9.941   1.00 55.85  ? 951  NAF A "F2'" 1 
HETATM 8423 F "F3'" . NAF E 4 .   ? 29.786  13.634  10.823  1.00 53.75  ? 951  NAF A "F3'" 1 
HETATM 8424 N N1    . NAF E 4 .   ? 27.351  19.150  14.802  1.00 56.02  ? 951  NAF A N1    1 
HETATM 8425 C CM1   . NAF E 4 .   ? 27.274  20.615  14.912  1.00 54.02  ? 951  NAF A CM1   1 
HETATM 8426 C CM2   . NAF E 4 .   ? 27.923  18.684  16.076  1.00 55.54  ? 951  NAF A CM2   1 
HETATM 8427 C CM3   . NAF E 4 .   ? 26.000  18.577  14.628  1.00 54.70  ? 951  NAF A CM3   1 
HETATM 8428 O O1    . P6G F 5 .   ? 15.477  5.755   -12.099 1.00 82.85  ? 901  P6G A O1    1 
HETATM 8429 C C2    . P6G F 5 .   ? 16.528  6.670   -11.732 1.00 82.82  ? 901  P6G A C2    1 
HETATM 8430 C C3    . P6G F 5 .   ? 18.052  6.470   -11.562 1.00 82.48  ? 901  P6G A C3    1 
HETATM 8431 O O4    . P6G F 5 .   ? 18.514  5.951   -10.164 1.00 82.83  ? 901  P6G A O4    1 
HETATM 8432 C C5    . P6G F 5 .   ? 19.047  4.614   -10.160 1.00 83.11  ? 901  P6G A C5    1 
HETATM 8433 C C6    . P6G F 5 .   ? 20.464  4.740   -10.343 1.00 83.39  ? 901  P6G A C6    1 
HETATM 8434 O O7    . P6G F 5 .   ? 21.000  4.645   -11.781 1.00 83.29  ? 901  P6G A O7    1 
HETATM 8435 C C8    . P6G F 5 .   ? 22.412  4.380   -11.868 1.00 80.85  ? 901  P6G A C8    1 
HETATM 8436 C C9    . P6G F 5 .   ? 22.942  4.849   -13.239 1.00 78.94  ? 901  P6G A C9    1 
HETATM 8437 O O10   . P6G F 5 .   ? 22.940  6.438   -13.488 1.00 76.88  ? 901  P6G A O10   1 
HETATM 8438 C C11   . P6G F 5 .   ? 23.992  6.957   -14.301 1.00 76.91  ? 901  P6G A C11   1 
HETATM 8439 C C12   . P6G F 5 .   ? 24.011  8.402   -14.202 1.00 78.22  ? 901  P6G A C12   1 
HETATM 8440 O O13   . P6G F 5 .   ? 22.665  9.194   -14.438 1.00 81.35  ? 901  P6G A O13   1 
HETATM 8441 C C14   . P6G F 5 .   ? 22.684  10.266  -15.427 1.00 82.20  ? 901  P6G A C14   1 
HETATM 8442 C C15   . P6G F 5 .   ? 21.487  11.078  -15.387 1.00 83.98  ? 901  P6G A C15   1 
HETATM 8443 O O16   . P6G F 5 .   ? 20.172  10.262  -15.140 1.00 87.09  ? 901  P6G A O16   1 
HETATM 8444 C C17   . P6G F 5 .   ? 19.041  10.939  -14.557 1.00 86.84  ? 901  P6G A C17   1 
HETATM 8445 C C18   . P6G F 5 .   ? 18.452  10.044  -13.625 1.00 86.86  ? 901  P6G A C18   1 
HETATM 8446 O O19   . P6G F 5 .   ? 17.459  10.745  -12.596 1.00 86.61  ? 901  P6G A O19   1 
HETATM 8447 O O1    . PG4 G 6 .   ? 41.575  26.891  8.255   1.00 99.60  ? 902  PG4 A O1    1 
HETATM 8448 C C1    . PG4 G 6 .   ? 40.263  27.347  8.646   1.00 99.80  ? 902  PG4 A C1    1 
HETATM 8449 C C2    . PG4 G 6 .   ? 39.246  27.156  7.515   1.00 99.25  ? 902  PG4 A C2    1 
HETATM 8450 O O2    . PG4 G 6 .   ? 38.833  25.783  7.399   1.00 98.29  ? 902  PG4 A O2    1 
HETATM 8451 C C3    . PG4 G 6 .   ? 37.847  25.359  8.349   1.00 96.59  ? 902  PG4 A C3    1 
HETATM 8452 C C4    . PG4 G 6 .   ? 36.736  24.565  7.662   1.00 95.64  ? 902  PG4 A C4    1 
HETATM 8453 O O3    . PG4 G 6 .   ? 35.970  23.890  8.666   1.00 94.55  ? 902  PG4 A O3    1 
HETATM 8454 C C5    . PG4 G 6 .   ? 34.904  23.067  8.169   1.00 93.34  ? 902  PG4 A C5    1 
HETATM 8455 C C6    . PG4 G 6 .   ? 33.784  23.093  9.212   1.00 92.83  ? 902  PG4 A C6    1 
HETATM 8456 O O4    . PG4 G 6 .   ? 32.703  22.181  8.914   1.00 91.22  ? 902  PG4 A O4    1 
HETATM 8457 C C7    . PG4 G 6 .   ? 31.584  22.135  9.833   1.00 89.02  ? 902  PG4 A C7    1 
HETATM 8458 C C8    . PG4 G 6 .   ? 31.425  23.294  10.839  1.00 87.81  ? 902  PG4 A C8    1 
HETATM 8459 O O5    . PG4 G 6 .   ? 32.117  23.109  12.100  1.00 87.01  ? 902  PG4 A O5    1 
HETATM 8460 C C1    . NAG H 3 .   ? 5.684   -17.491 -22.021 1.00 96.51  ? 601  NAG B C1    1 
HETATM 8461 C C2    . NAG H 3 .   ? 6.647   -18.115 -20.986 1.00 99.67  ? 601  NAG B C2    1 
HETATM 8462 C C3    . NAG H 3 .   ? 8.045   -18.249 -21.604 1.00 99.62  ? 601  NAG B C3    1 
HETATM 8463 C C4    . NAG H 3 .   ? 8.018   -19.071 -22.896 1.00 99.68  ? 601  NAG B C4    1 
HETATM 8464 C C5    . NAG H 3 .   ? 6.940   -18.543 -23.855 1.00 98.72  ? 601  NAG B C5    1 
HETATM 8465 C C6    . NAG H 3 .   ? 6.765   -19.475 -25.075 1.00 98.59  ? 601  NAG B C6    1 
HETATM 8466 C C7    . NAG H 3 .   ? 6.076   -17.479 -18.643 1.00 102.60 ? 601  NAG B C7    1 
HETATM 8467 C C8    . NAG H 3 .   ? 5.566   -16.222 -17.979 1.00 101.95 ? 601  NAG B C8    1 
HETATM 8468 N N2    . NAG H 3 .   ? 6.780   -17.306 -19.772 1.00 101.79 ? 601  NAG B N2    1 
HETATM 8469 O O3    . NAG H 3 .   ? 8.968   -18.785 -20.676 1.00 99.20  ? 601  NAG B O3    1 
HETATM 8470 O O4    . NAG H 3 .   ? 9.302   -19.067 -23.504 1.00 99.46  ? 601  NAG B O4    1 
HETATM 8471 O O5    . NAG H 3 .   ? 5.701   -18.331 -23.176 1.00 97.82  ? 601  NAG B O5    1 
HETATM 8472 O O6    . NAG H 3 .   ? 5.483   -20.075 -25.176 1.00 97.42  ? 601  NAG B O6    1 
HETATM 8473 O O7    . NAG H 3 .   ? 5.853   -18.585 -18.146 1.00 102.60 ? 601  NAG B O7    1 
HETATM 8474 C C1    . NAF I 4 .   ? 6.871   -1.954  -37.973 1.00 60.02  ? 952  NAF B C1    1 
HETATM 8475 C C2    . NAF I 4 .   ? 7.708   -0.843  -37.947 1.00 59.92  ? 952  NAF B C2    1 
HETATM 8476 C C3    . NAF I 4 .   ? 9.061   -0.956  -37.605 1.00 60.25  ? 952  NAF B C3    1 
HETATM 8477 C C4    . NAF I 4 .   ? 9.615   -2.187  -37.262 1.00 60.19  ? 952  NAF B C4    1 
HETATM 8478 C C5    . NAF I 4 .   ? 8.778   -3.308  -37.289 1.00 61.02  ? 952  NAF B C5    1 
HETATM 8479 C C6    . NAF I 4 .   ? 7.427   -3.195  -37.636 1.00 60.42  ? 952  NAF B C6    1 
HETATM 8480 C "C1'" . NAF I 4 .   ? 9.778   0.333   -37.639 1.00 60.19  ? 952  NAF B "C1'" 1 
HETATM 8481 O "O1'" . NAF I 4 .   ? 9.878   0.777   -39.004 1.00 58.64  ? 952  NAF B "O1'" 1 
HETATM 8482 C "C2'" . NAF I 4 .   ? 11.149  0.429   -36.969 1.00 61.30  ? 952  NAF B "C2'" 1 
HETATM 8483 F "F1'" . NAF I 4 .   ? 11.957  -0.350  -37.646 1.00 64.04  ? 952  NAF B "F1'" 1 
HETATM 8484 F "F2'" . NAF I 4 .   ? 11.045  0.152   -35.685 1.00 60.92  ? 952  NAF B "F2'" 1 
HETATM 8485 F "F3'" . NAF I 4 .   ? 11.637  1.647   -37.010 1.00 61.16  ? 952  NAF B "F3'" 1 
HETATM 8486 N N1    . NAF I 4 .   ? 5.508   -1.803  -38.352 1.00 60.22  ? 952  NAF B N1    1 
HETATM 8487 C CM1   . NAF I 4 .   ? 4.808   -3.094  -38.236 1.00 58.51  ? 952  NAF B CM1   1 
HETATM 8488 C CM2   . NAF I 4 .   ? 5.424   -1.348  -39.744 1.00 57.79  ? 952  NAF B CM2   1 
HETATM 8489 C CM3   . NAF I 4 .   ? 4.807   -0.779  -37.544 1.00 58.76  ? 952  NAF B CM3   1 
HETATM 8490 O O     . HOH J 7 .   ? 22.047  20.251  7.243   1.00 47.30  ? 952  HOH A O     1 
HETATM 8491 O O     . HOH J 7 .   ? 29.580  12.247  24.476  1.00 42.76  ? 953  HOH A O     1 
HETATM 8492 O O     . HOH J 7 .   ? 33.473  14.467  16.965  1.00 49.80  ? 954  HOH A O     1 
HETATM 8493 O O     . HOH J 7 .   ? 19.489  20.038  18.423  1.00 45.59  ? 955  HOH A O     1 
HETATM 8494 O O     . HOH J 7 .   ? 26.022  14.939  27.794  1.00 54.18  ? 956  HOH A O     1 
HETATM 8495 O O     . HOH J 7 .   ? 19.077  11.992  13.077  1.00 45.90  ? 957  HOH A O     1 
HETATM 8496 O O     . HOH J 7 .   ? 46.484  12.642  22.495  1.00 54.14  ? 958  HOH A O     1 
HETATM 8497 O O     . HOH J 7 .   ? 21.483  15.171  12.799  1.00 52.05  ? 959  HOH A O     1 
HETATM 8498 O O     . HOH J 7 .   ? 17.745  15.009  28.713  1.00 48.16  ? 960  HOH A O     1 
HETATM 8499 O O     . HOH J 7 .   ? 53.722  25.732  8.446   1.00 47.54  ? 961  HOH A O     1 
HETATM 8500 O O     . HOH J 7 .   ? 31.237  8.085   6.417   1.00 56.19  ? 962  HOH A O     1 
HETATM 8501 O O     . HOH J 7 .   ? 42.155  13.674  31.433  1.00 50.87  ? 963  HOH A O     1 
HETATM 8502 O O     . HOH J 7 .   ? 28.993  -0.229  29.320  1.00 44.06  ? 964  HOH A O     1 
HETATM 8503 O O     . HOH J 7 .   ? 41.404  16.630  21.559  1.00 48.55  ? 965  HOH A O     1 
HETATM 8504 O O     . HOH J 7 .   ? 29.226  17.971  19.647  1.00 44.12  ? 966  HOH A O     1 
HETATM 8505 O O     . HOH J 7 .   ? 11.747  1.036   10.481  1.00 51.59  ? 967  HOH A O     1 
HETATM 8506 O O     . HOH J 7 .   ? 32.190  16.822  29.606  1.00 49.79  ? 968  HOH A O     1 
HETATM 8507 O O     . HOH J 7 .   ? 43.845  15.340  24.950  1.00 57.57  ? 969  HOH A O     1 
HETATM 8508 O O     . HOH J 7 .   ? 46.756  10.606  10.775  1.00 55.19  ? 970  HOH A O     1 
HETATM 8509 O O     . HOH J 7 .   ? 9.978   -2.989  6.491   1.00 54.01  ? 971  HOH A O     1 
HETATM 8510 O O     . HOH J 7 .   ? 47.601  7.557   17.847  1.00 52.91  ? 972  HOH A O     1 
HETATM 8511 O O     . HOH J 7 .   ? 43.008  7.498   13.872  1.00 53.30  ? 973  HOH A O     1 
HETATM 8512 O O     . HOH J 7 .   ? 19.963  14.997  1.736   1.00 52.49  ? 974  HOH A O     1 
HETATM 8513 O O     . HOH J 7 .   ? 26.512  15.611  18.186  1.00 52.42  ? 975  HOH A O     1 
HETATM 8514 O O     . HOH J 7 .   ? 18.494  14.942  3.732   1.00 48.16  ? 976  HOH A O     1 
HETATM 8515 O O     . HOH J 7 .   ? 20.045  17.636  2.240   1.00 44.80  ? 977  HOH A O     1 
HETATM 8516 O O     . HOH J 7 .   ? 11.893  27.578  12.317  1.00 54.78  ? 978  HOH A O     1 
HETATM 8517 O O     . HOH J 7 .   ? 33.402  19.094  28.703  1.00 59.39  ? 979  HOH A O     1 
HETATM 8518 O O     . HOH J 7 .   ? 11.234  17.371  33.934  1.00 51.29  ? 980  HOH A O     1 
HETATM 8519 O O     . HOH J 7 .   ? 14.385  20.874  14.149  1.00 54.21  ? 981  HOH A O     1 
HETATM 8520 O O     . HOH J 7 .   ? 3.932   0.256   4.540   1.00 67.10  ? 982  HOH A O     1 
HETATM 8521 O O     . HOH J 7 .   ? 38.577  15.138  12.448  1.00 58.45  ? 983  HOH A O     1 
HETATM 8522 O O     . HOH J 7 .   ? 27.883  -1.272  37.256  1.00 54.05  ? 984  HOH A O     1 
HETATM 8523 O O     . HOH J 7 .   ? 33.726  11.539  -2.949  1.00 60.02  ? 985  HOH A O     1 
HETATM 8524 O O     . HOH J 7 .   ? 52.701  16.268  24.373  1.00 57.03  ? 986  HOH A O     1 
HETATM 8525 O O     . HOH J 7 .   ? 30.215  20.445  18.664  1.00 46.98  ? 987  HOH A O     1 
HETATM 8526 O O     . HOH J 7 .   ? 31.064  20.621  16.069  1.00 47.96  ? 988  HOH A O     1 
HETATM 8527 O O     . HOH J 7 .   ? 32.656  16.828  32.363  1.00 51.55  ? 989  HOH A O     1 
HETATM 8528 O O     . HOH J 7 .   ? 35.506  17.346  24.312  1.00 49.47  ? 990  HOH A O     1 
HETATM 8529 O O     . HOH J 7 .   ? 39.860  18.454  10.192  1.00 72.59  ? 991  HOH A O     1 
HETATM 8530 O O     . HOH J 7 .   ? 25.416  18.511  28.668  1.00 54.21  ? 992  HOH A O     1 
HETATM 8531 O O     . HOH J 7 .   ? 16.343  25.481  17.650  1.00 60.82  ? 993  HOH A O     1 
HETATM 8532 O O     . HOH J 7 .   ? 27.594  15.017  54.257  1.00 66.63  ? 994  HOH A O     1 
HETATM 8533 O O     . HOH J 7 .   ? 18.476  21.601  -12.065 1.00 67.26  ? 995  HOH A O     1 
HETATM 8534 O O     . HOH J 7 .   ? 34.843  23.322  18.468  1.00 50.29  ? 996  HOH A O     1 
HETATM 8535 O O     . HOH J 7 .   ? 2.095   8.670   16.442  1.00 66.57  ? 997  HOH A O     1 
HETATM 8536 O O     . HOH J 7 .   ? 42.522  0.599   44.946  1.00 55.71  ? 998  HOH A O     1 
HETATM 8537 O O     . HOH J 7 .   ? 5.664   11.439  13.687  1.00 52.76  ? 999  HOH A O     1 
HETATM 8538 O O     . HOH J 7 .   ? 27.075  8.794   7.337   1.00 55.09  ? 1000 HOH A O     1 
HETATM 8539 O O     . HOH J 7 .   ? 24.912  20.757  12.431  1.00 69.74  ? 1001 HOH A O     1 
HETATM 8540 O O     . HOH J 7 .   ? 44.047  18.622  16.165  1.00 56.35  ? 1002 HOH A O     1 
HETATM 8541 O O     . HOH J 7 .   ? 40.174  19.942  16.252  1.00 49.38  ? 1003 HOH A O     1 
HETATM 8542 O O     . HOH J 7 .   ? 37.229  12.619  6.712   1.00 51.74  ? 1004 HOH A O     1 
HETATM 8543 O O     . HOH J 7 .   ? 10.114  25.253  25.853  1.00 59.58  ? 1005 HOH A O     1 
HETATM 8544 O O     . HOH J 7 .   ? 37.145  -6.418  16.026  1.00 61.84  ? 1006 HOH A O     1 
HETATM 8545 O O     . HOH J 7 .   ? 43.876  0.557   5.943   1.00 50.21  ? 1007 HOH A O     1 
HETATM 8546 O O     . HOH J 7 .   ? 19.550  0.702   27.771  1.00 55.18  ? 1008 HOH A O     1 
HETATM 8547 O O     . HOH J 7 .   ? 38.278  8.410   47.420  1.00 65.33  ? 1009 HOH A O     1 
HETATM 8548 O O     . HOH J 7 .   ? 34.844  -2.627  33.259  1.00 58.51  ? 1010 HOH A O     1 
HETATM 8549 O O     . HOH J 7 .   ? 41.989  18.932  18.102  1.00 50.86  ? 1011 HOH A O     1 
HETATM 8550 O O     . HOH J 7 .   ? 24.330  23.661  23.117  1.00 54.20  ? 1012 HOH A O     1 
HETATM 8551 O O     . HOH J 7 .   ? 32.500  20.428  6.065   1.00 61.13  ? 1013 HOH A O     1 
HETATM 8552 O O     . HOH J 7 .   ? 40.908  12.233  33.422  1.00 55.58  ? 1014 HOH A O     1 
HETATM 8553 O O     . HOH J 7 .   ? 53.126  9.281   21.766  1.00 65.41  ? 1015 HOH A O     1 
HETATM 8554 O O     . HOH J 7 .   ? 39.719  27.826  26.772  1.00 62.28  ? 1016 HOH A O     1 
HETATM 8555 O O     . HOH J 7 .   ? 20.646  32.816  10.263  1.00 59.47  ? 1017 HOH A O     1 
HETATM 8556 O O     . HOH J 7 .   ? 43.532  9.417   11.203  1.00 51.46  ? 1018 HOH A O     1 
HETATM 8557 O O     . HOH J 7 .   ? 36.410  5.061   38.953  1.00 59.66  ? 1019 HOH A O     1 
HETATM 8558 O O     . HOH J 7 .   ? 34.782  6.514   -10.984 1.00 65.37  ? 1020 HOH A O     1 
HETATM 8559 O O     . HOH J 7 .   ? 29.867  25.668  15.275  1.00 47.09  ? 1021 HOH A O     1 
HETATM 8560 O O     . HOH J 7 .   ? 27.011  5.617   0.114   1.00 61.99  ? 1022 HOH A O     1 
HETATM 8561 O O     . HOH J 7 .   ? 17.008  -2.687  33.815  1.00 60.93  ? 1023 HOH A O     1 
HETATM 8562 O O     . HOH J 7 .   ? 29.167  17.835  55.593  1.00 75.12  ? 1024 HOH A O     1 
HETATM 8563 O O     . HOH J 7 .   ? 43.976  15.952  35.807  1.00 61.73  ? 1025 HOH A O     1 
HETATM 8564 O O     . HOH J 7 .   ? 8.464   11.505  27.550  1.00 56.30  ? 1026 HOH A O     1 
HETATM 8565 O O     . HOH J 7 .   ? 31.139  10.653  48.628  1.00 65.96  ? 1027 HOH A O     1 
HETATM 8566 O O     . HOH J 7 .   ? 9.371   -7.329  5.170   1.00 80.84  ? 1028 HOH A O     1 
HETATM 8567 O O     . HOH J 7 .   ? 37.052  -4.687  13.806  1.00 62.19  ? 1029 HOH A O     1 
HETATM 8568 O O     . HOH J 7 .   ? 40.601  -2.208  23.704  1.00 64.44  ? 1030 HOH A O     1 
HETATM 8569 O O     . HOH J 7 .   ? 28.217  25.070  13.343  1.00 55.12  ? 1031 HOH A O     1 
HETATM 8570 O O     . HOH J 7 .   ? 14.326  5.002   36.760  1.00 63.74  ? 1032 HOH A O     1 
HETATM 8571 O O     . HOH J 7 .   ? 45.862  8.224   29.437  1.00 57.42  ? 1033 HOH A O     1 
HETATM 8572 O O     . HOH J 7 .   ? 34.728  27.041  10.679  1.00 75.47  ? 1034 HOH A O     1 
HETATM 8573 O O     . HOH J 7 .   ? 15.159  8.234   -4.595  1.00 56.99  ? 1035 HOH A O     1 
HETATM 8574 O O     . HOH J 7 .   ? 39.051  15.815  0.709   1.00 63.51  ? 1036 HOH A O     1 
HETATM 8575 O O     . HOH J 7 .   ? 48.425  25.356  22.822  1.00 60.39  ? 1037 HOH A O     1 
HETATM 8576 O O     . HOH J 7 .   ? 50.994  3.247   7.336   1.00 67.97  ? 1038 HOH A O     1 
HETATM 8577 O O     . HOH J 7 .   ? 32.060  2.284   3.147   1.00 71.35  ? 1039 HOH A O     1 
HETATM 8578 O O     . HOH J 7 .   ? 44.441  11.266  9.263   1.00 56.82  ? 1040 HOH A O     1 
HETATM 8579 O O     . HOH J 7 .   ? 40.703  16.793  12.329  1.00 56.33  ? 1041 HOH A O     1 
HETATM 8580 O O     . HOH J 7 .   ? 12.702  22.762  -9.740  1.00 69.85  ? 1042 HOH A O     1 
HETATM 8581 O O     . HOH J 7 .   ? 15.703  -7.537  24.093  1.00 65.58  ? 1043 HOH A O     1 
HETATM 8582 O O     . HOH J 7 .   ? 14.292  21.521  0.147   1.00 59.14  ? 1044 HOH A O     1 
HETATM 8583 O O     . HOH J 7 .   ? 24.140  8.699   48.073  1.00 60.99  ? 1045 HOH A O     1 
HETATM 8584 O O     . HOH J 7 .   ? 10.327  10.556  3.161   1.00 59.43  ? 1046 HOH A O     1 
HETATM 8585 O O     . HOH J 7 .   ? 31.042  15.843  0.876   1.00 59.87  ? 1047 HOH A O     1 
HETATM 8586 O O     . HOH J 7 .   ? 17.483  2.809   -0.013  1.00 66.35  ? 1048 HOH A O     1 
HETATM 8587 O O     . HOH J 7 .   ? 36.551  1.466   36.777  1.00 59.58  ? 1049 HOH A O     1 
HETATM 8588 O O     . HOH J 7 .   ? 31.483  25.723  -12.767 1.00 64.33  ? 1050 HOH A O     1 
HETATM 8589 O O     . HOH J 7 .   ? 14.057  23.272  1.699   1.00 56.84  ? 1051 HOH A O     1 
HETATM 8590 O O     . HOH J 7 .   ? 15.871  31.469  3.691   1.00 63.77  ? 1052 HOH A O     1 
HETATM 8591 O O     . HOH J 7 .   ? 30.904  30.023  13.836  1.00 62.28  ? 1053 HOH A O     1 
HETATM 8592 O O     . HOH J 7 .   ? 31.443  23.475  15.551  1.00 47.73  ? 1054 HOH A O     1 
HETATM 8593 O O     . HOH J 7 .   ? 34.031  4.666   6.223   1.00 54.92  ? 1055 HOH A O     1 
HETATM 8594 O O     . HOH J 7 .   ? 46.570  14.636  24.206  1.00 60.89  ? 1056 HOH A O     1 
HETATM 8595 O O     . HOH J 7 .   ? 6.216   7.695   21.980  1.00 65.67  ? 1057 HOH A O     1 
HETATM 8596 O O     . HOH J 7 .   ? 29.463  2.412   45.673  1.00 55.64  ? 1058 HOH A O     1 
HETATM 8597 O O     . HOH J 7 .   ? 17.914  12.658  49.562  1.00 73.54  ? 1059 HOH A O     1 
HETATM 8598 O O     . HOH J 7 .   ? 25.484  22.429  29.780  1.00 59.76  ? 1060 HOH A O     1 
HETATM 8599 O O     . HOH J 7 .   ? 17.319  19.356  -0.980  1.00 52.47  ? 1061 HOH A O     1 
HETATM 8600 O O     . HOH J 7 .   ? 12.907  -8.872  4.450   1.00 70.57  ? 1062 HOH A O     1 
HETATM 8601 O O     . HOH J 7 .   ? 35.416  -3.483  30.993  1.00 72.42  ? 1063 HOH A O     1 
HETATM 8602 O O     . HOH J 7 .   ? 28.211  25.583  23.565  1.00 62.64  ? 1064 HOH A O     1 
HETATM 8603 O O     . HOH J 7 .   ? 35.194  15.639  -7.584  1.00 66.49  ? 1065 HOH A O     1 
HETATM 8604 O O     . HOH J 7 .   ? 29.908  7.269   -2.162  1.00 65.62  ? 1066 HOH A O     1 
HETATM 8605 O O     . HOH J 7 .   ? 5.029   18.272  11.471  1.00 69.92  ? 1067 HOH A O     1 
HETATM 8606 O O     . HOH J 7 .   ? 42.717  17.031  23.668  1.00 61.81  ? 1068 HOH A O     1 
HETATM 8607 O O     . HOH J 7 .   ? 33.146  24.590  16.821  1.00 52.47  ? 1069 HOH A O     1 
HETATM 8608 O O     . HOH J 7 .   ? 41.627  0.900   39.681  1.00 62.38  ? 1070 HOH A O     1 
HETATM 8609 O O     . HOH J 7 .   ? 41.449  26.403  19.272  1.00 58.48  ? 1071 HOH A O     1 
HETATM 8610 O O     . HOH J 7 .   ? 39.145  3.382   45.173  1.00 60.19  ? 1072 HOH A O     1 
HETATM 8611 O O     . HOH J 7 .   ? 36.117  19.318  4.303   1.00 62.85  ? 1073 HOH A O     1 
HETATM 8612 O O     . HOH J 7 .   ? 28.147  4.413   46.812  1.00 56.22  ? 1074 HOH A O     1 
HETATM 8613 O O     . HOH J 7 .   ? 25.962  29.296  -15.110 1.00 61.24  ? 1075 HOH A O     1 
HETATM 8614 O O     . HOH J 7 .   ? 36.928  1.691   34.194  1.00 66.00  ? 1076 HOH A O     1 
HETATM 8615 O O     . HOH J 7 .   ? 25.574  4.280   45.847  1.00 55.41  ? 1077 HOH A O     1 
HETATM 8616 O O     . HOH J 7 .   ? 34.119  -1.635  41.586  1.00 54.02  ? 1078 HOH A O     1 
HETATM 8617 O O     . HOH J 7 .   ? 14.983  -5.352  11.029  1.00 60.53  ? 1079 HOH A O     1 
HETATM 8618 O O     . HOH J 7 .   ? 18.444  25.265  18.349  1.00 62.30  ? 1080 HOH A O     1 
HETATM 8619 O O     . HOH J 7 .   ? 40.190  1.810   25.786  1.00 59.60  ? 1081 HOH A O     1 
HETATM 8620 O O     . HOH J 7 .   ? 41.404  6.891   2.907   1.00 60.81  ? 1082 HOH A O     1 
HETATM 8621 O O     . HOH J 7 .   ? 45.589  -2.920  7.930   1.00 60.68  ? 1083 HOH A O     1 
HETATM 8622 O O     . HOH J 7 .   ? 38.528  11.796  4.563   1.00 47.04  ? 1084 HOH A O     1 
HETATM 8623 O O     . HOH J 7 .   ? 3.342   15.441  18.379  1.00 66.84  ? 1085 HOH A O     1 
HETATM 8624 O O     . HOH J 7 .   ? 43.987  24.400  10.261  1.00 64.26  ? 1086 HOH A O     1 
HETATM 8625 O O     . HOH J 7 .   ? 17.943  23.707  0.553   1.00 59.36  ? 1087 HOH A O     1 
HETATM 8626 O O     . HOH J 7 .   ? 33.204  1.077   44.104  1.00 58.95  ? 1088 HOH A O     1 
HETATM 8627 O O     . HOH J 7 .   ? 19.826  23.442  38.301  1.00 66.55  ? 1089 HOH A O     1 
HETATM 8628 O O     . HOH J 7 .   ? 38.076  3.245   37.855  1.00 68.06  ? 1090 HOH A O     1 
HETATM 8629 O O     . HOH J 7 .   ? 35.905  9.430   0.585   1.00 56.69  ? 1091 HOH A O     1 
HETATM 8630 O O     . HOH J 7 .   ? 16.197  -3.207  29.542  1.00 60.15  ? 1092 HOH A O     1 
HETATM 8631 O O     . HOH J 7 .   ? 20.548  18.813  52.237  1.00 63.96  ? 1093 HOH A O     1 
HETATM 8632 O O     . HOH J 7 .   ? 24.679  18.435  49.486  1.00 74.33  ? 1094 HOH A O     1 
HETATM 8633 O O     . HOH J 7 .   ? 36.726  2.877   45.779  1.00 59.06  ? 1095 HOH A O     1 
HETATM 8634 O O     . HOH J 7 .   ? 40.202  3.562   39.527  1.00 63.11  ? 1096 HOH A O     1 
HETATM 8635 O O     . HOH J 7 .   ? 42.328  13.166  35.840  1.00 64.88  ? 1097 HOH A O     1 
HETATM 8636 O O     . HOH J 7 .   ? 50.786  17.250  25.946  1.00 63.96  ? 1098 HOH A O     1 
HETATM 8637 O O     . HOH J 7 .   ? 40.645  27.139  16.784  1.00 55.90  ? 1099 HOH A O     1 
HETATM 8638 O O     . HOH J 7 .   ? 46.279  21.269  27.560  1.00 59.70  ? 1100 HOH A O     1 
HETATM 8639 O O     . HOH J 7 .   ? 26.216  24.698  25.151  1.00 63.26  ? 1101 HOH A O     1 
HETATM 8640 O O     . HOH J 7 .   ? 47.898  -0.338  11.758  1.00 63.52  ? 1102 HOH A O     1 
HETATM 8641 O O     . HOH J 7 .   ? 32.313  0.494   41.498  1.00 52.93  ? 1103 HOH A O     1 
HETATM 8642 O O     . HOH J 7 .   ? 38.960  -5.426  17.164  1.00 67.74  ? 1104 HOH A O     1 
HETATM 8643 O O     . HOH J 7 .   ? 26.859  -5.583  21.757  1.00 65.74  ? 1105 HOH A O     1 
HETATM 8644 O O     . HOH J 7 .   ? 19.836  -5.743  28.038  1.00 62.48  ? 1106 HOH A O     1 
HETATM 8645 O O     . HOH J 7 .   ? 37.765  9.494   4.182   1.00 55.27  ? 1107 HOH A O     1 
HETATM 8646 O O     . HOH J 7 .   ? 36.953  2.560   4.602   1.00 72.47  ? 1108 HOH A O     1 
HETATM 8647 O O     . HOH J 7 .   ? 51.069  3.072   4.666   1.00 70.59  ? 1109 HOH A O     1 
HETATM 8648 O O     . HOH J 7 .   ? 57.138  24.710  18.308  1.00 77.24  ? 1110 HOH A O     1 
HETATM 8649 O O     . HOH J 7 .   ? 37.252  19.541  -5.001  1.00 63.14  ? 1111 HOH A O     1 
HETATM 8650 O O     . HOH J 7 .   ? 30.315  28.649  1.541   1.00 73.70  ? 1112 HOH A O     1 
HETATM 8651 O O     . HOH J 7 .   ? 30.036  27.102  -6.066  1.00 62.22  ? 1113 HOH A O     1 
HETATM 8652 O O     . HOH J 7 .   ? 30.736  19.387  -11.741 1.00 67.10  ? 1114 HOH A O     1 
HETATM 8653 O O     . HOH J 7 .   ? 34.914  23.449  -7.567  1.00 66.09  ? 1115 HOH A O     1 
HETATM 8654 O O     . HOH J 7 .   ? 15.735  26.464  -16.003 1.00 67.01  ? 1116 HOH A O     1 
HETATM 8655 O O     . HOH J 7 .   ? 27.814  7.957   -0.819  1.00 67.30  ? 1117 HOH A O     1 
HETATM 8656 O O     . HOH J 7 .   ? 15.640  -8.142  9.451   1.00 74.75  ? 1118 HOH A O     1 
HETATM 8657 O O     . HOH J 7 .   ? 15.496  -8.085  6.146   1.00 76.10  ? 1119 HOH A O     1 
HETATM 8658 O O     . HOH J 7 .   ? 8.172   -3.602  16.149  1.00 67.75  ? 1120 HOH A O     1 
HETATM 8659 O O     . HOH J 7 .   ? 8.946   29.211  19.438  1.00 67.82  ? 1121 HOH A O     1 
HETATM 8660 O O     . HOH J 7 .   ? 15.296  32.547  6.379   1.00 72.22  ? 1122 HOH A O     1 
HETATM 8661 O O     . HOH J 7 .   ? 7.741   20.675  31.102  1.00 69.94  ? 1123 HOH A O     1 
HETATM 8662 O O     . HOH J 7 .   ? 4.254   11.843  10.704  1.00 58.41  ? 1124 HOH A O     1 
HETATM 8663 O O     . HOH J 7 .   ? 0.842   10.468  17.974  1.00 68.55  ? 1125 HOH A O     1 
HETATM 8664 O O     . HOH J 7 .   ? 0.922   5.601   7.920   1.00 64.64  ? 1126 HOH A O     1 
HETATM 8665 O O     . HOH J 7 .   ? 9.810   6.888   0.868   1.00 58.45  ? 1127 HOH A O     1 
HETATM 8666 O O     . HOH J 7 .   ? 43.544  0.310   41.184  1.00 65.38  ? 1128 HOH A O     1 
HETATM 8667 O O     . HOH J 7 .   ? 47.200  8.113   26.839  1.00 67.81  ? 1129 HOH A O     1 
HETATM 8668 O O     . HOH J 7 .   ? 34.296  1.932   4.571   1.00 61.67  ? 1130 HOH A O     1 
HETATM 8669 O O     . HOH J 7 .   ? 28.190  3.136   2.459   1.00 65.19  ? 1131 HOH A O     1 
HETATM 8670 O O     . HOH J 7 .   ? 49.045  11.652  32.704  1.00 62.92  ? 1132 HOH A O     1 
HETATM 8671 O O     . HOH J 7 .   ? 44.481  19.917  34.317  1.00 69.81  ? 1133 HOH A O     1 
HETATM 8672 O O     . HOH J 7 .   ? 27.049  -6.306  32.143  1.00 62.91  ? 1134 HOH A O     1 
HETATM 8673 O O     . HOH J 7 .   ? 48.556  21.168  26.197  1.00 63.63  ? 1135 HOH A O     1 
HETATM 8674 O O     . HOH J 7 .   ? 50.370  0.270   15.814  1.00 70.83  ? 1136 HOH A O     1 
HETATM 8675 O O     . HOH J 7 .   ? 48.443  1.183   14.127  1.00 61.43  ? 1137 HOH A O     1 
HETATM 8676 O O     . HOH J 7 .   ? 17.437  17.079  0.665   1.00 69.06  ? 1138 HOH A O     1 
HETATM 8677 O O     . HOH J 7 .   ? 11.679  13.678  3.470   1.00 74.48  ? 1139 HOH A O     1 
HETATM 8678 O O     . HOH J 7 .   ? 6.787   20.428  11.786  1.00 67.53  ? 1140 HOH A O     1 
HETATM 8679 O O     . HOH J 7 .   ? 8.452   21.483  10.250  1.00 58.08  ? 1141 HOH A O     1 
HETATM 8680 O O     . HOH J 7 .   ? 15.919  32.385  10.951  1.00 67.53  ? 1142 HOH A O     1 
HETATM 8681 O O     . HOH J 7 .   ? 21.890  -5.988  36.311  1.00 70.61  ? 1143 HOH A O     1 
HETATM 8682 O O     . HOH J 7 .   ? 33.839  18.545  38.221  1.00 67.11  ? 1144 HOH A O     1 
HETATM 8683 O O     . HOH J 7 .   ? 37.107  16.588  38.118  1.00 64.15  ? 1145 HOH A O     1 
HETATM 8684 O O     . HOH J 7 .   ? 25.373  13.636  55.114  1.00 61.31  ? 1146 HOH A O     1 
HETATM 8685 O O     . HOH J 7 .   ? 22.717  28.968  -14.646 1.00 73.09  ? 1147 HOH A O     1 
HETATM 8686 O O     . HOH J 7 .   ? 40.312  5.682   46.285  1.00 63.40  ? 1148 HOH A O     1 
HETATM 8687 O O     . HOH J 7 .   ? 40.842  11.203  1.138   1.00 56.54  ? 1149 HOH A O     1 
HETATM 8688 O O     . HOH J 7 .   ? 41.834  0.427   4.302   1.00 65.56  ? 1150 HOH A O     1 
HETATM 8689 O O     . HOH J 7 .   ? 31.550  30.688  16.091  1.00 60.04  ? 1151 HOH A O     1 
HETATM 8690 O O     . HOH J 7 .   ? 18.504  1.626   -2.946  1.00 66.20  ? 1152 HOH A O     1 
HETATM 8691 O O     . HOH J 7 .   ? 14.736  -6.522  26.974  1.00 75.60  ? 1153 HOH A O     1 
HETATM 8692 O O     . HOH J 7 .   ? 18.334  -8.897  17.202  1.00 78.17  ? 1154 HOH A O     1 
HETATM 8693 O O     . HOH J 7 .   ? 35.088  24.010  -10.211 1.00 65.43  ? 1155 HOH A O     1 
HETATM 8694 O O     . HOH J 7 .   ? 22.957  3.632   47.306  1.00 64.12  ? 1156 HOH A O     1 
HETATM 8695 O O     . HOH J 7 .   ? 51.573  7.361   3.040   1.00 67.78  ? 1157 HOH A O     1 
HETATM 8696 O O     . HOH J 7 .   ? 24.348  32.762  -4.208  1.00 60.65  ? 1158 HOH A O     1 
HETATM 8697 O O     . HOH J 7 .   ? 30.942  34.316  -3.624  1.00 70.08  ? 1159 HOH A O     1 
HETATM 8698 O O     . HOH J 7 .   ? 14.087  39.549  26.131  1.00 81.26  ? 1160 HOH A O     1 
HETATM 8699 O O     . HOH J 7 .   ? 8.757   21.067  40.411  1.00 82.38  ? 1161 HOH A O     1 
HETATM 8700 O O     . HOH J 7 .   ? 16.921  23.284  32.504  1.00 68.19  ? 1162 HOH A O     1 
HETATM 8701 O O     . HOH J 7 .   ? 52.561  2.748   27.578  1.00 71.18  ? 1163 HOH A O     1 
HETATM 8702 O O     . HOH J 7 .   ? 49.642  8.527   31.669  1.00 77.74  ? 1164 HOH A O     1 
HETATM 8703 O O     . HOH J 7 .   ? 60.983  4.387   15.294  1.00 67.95  ? 1165 HOH A O     1 
HETATM 8704 O O     . HOH J 7 .   ? 22.001  -8.399  28.930  1.00 67.63  ? 1166 HOH A O     1 
HETATM 8705 O O     . HOH J 7 .   ? 42.951  27.370  14.835  1.00 65.92  ? 1167 HOH A O     1 
HETATM 8706 O O     . HOH J 7 .   ? 15.231  28.436  22.484  1.00 69.79  ? 1168 HOH A O     1 
HETATM 8707 O O     . HOH J 7 .   ? 47.433  17.779  0.946   1.00 67.43  ? 1169 HOH A O     1 
HETATM 8708 O O     . HOH J 7 .   ? 27.578  39.411  14.483  1.00 71.99  ? 1170 HOH A O     1 
HETATM 8709 O O     . HOH J 7 .   ? 34.104  -4.176  0.578   1.00 76.36  ? 1171 HOH A O     1 
HETATM 8710 O O     . HOH J 7 .   ? 12.105  38.617  29.314  1.00 77.97  ? 1172 HOH A O     1 
HETATM 8711 O O     . HOH J 7 .   ? 52.747  13.653  3.499   1.00 58.96  ? 1173 HOH A O     1 
HETATM 8712 O O     . HOH J 7 .   ? 19.011  36.413  -1.429  1.00 68.34  ? 1174 HOH A O     1 
HETATM 8713 O O     . HOH J 7 .   ? 58.405  4.568   9.462   1.00 77.22  ? 1175 HOH A O     1 
HETATM 8714 O O     . HOH J 7 .   ? 28.162  -8.356  27.983  1.00 68.13  ? 1176 HOH A O     1 
HETATM 8715 O O     . HOH J 7 .   ? 39.037  8.673   -5.699  1.00 62.80  ? 1177 HOH A O     1 
HETATM 8716 O O     . HOH J 7 .   ? 33.566  30.748  20.111  1.00 71.14  ? 1178 HOH A O     1 
HETATM 8717 O O     . HOH J 7 .   ? 28.824  1.445   -1.444  1.00 79.96  ? 1179 HOH A O     1 
HETATM 8718 O O     . HOH J 7 .   ? 6.130   5.536   0.873   1.00 69.41  ? 1180 HOH A O     1 
HETATM 8719 O O     . HOH J 7 .   ? 57.074  2.919   16.401  1.00 65.86  ? 1181 HOH A O     1 
HETATM 8720 O O     . HOH J 7 .   ? 56.926  2.604   13.636  1.00 70.03  ? 1182 HOH A O     1 
HETATM 8721 O O     . HOH J 7 .   ? 45.592  10.249  38.299  1.00 79.18  ? 1183 HOH A O     1 
HETATM 8722 O O     . HOH J 7 .   ? 39.216  29.418  16.657  1.00 60.86  ? 1184 HOH A O     1 
HETATM 8723 O O     . HOH J 7 .   ? 38.561  4.252   34.686  1.00 66.34  ? 1185 HOH A O     1 
HETATM 8724 O O     . HOH J 7 .   ? 37.802  17.464  43.907  1.00 71.54  ? 1186 HOH A O     1 
HETATM 8725 O O     . HOH J 7 .   ? 31.207  14.535  51.724  1.00 68.15  ? 1187 HOH A O     1 
HETATM 8726 O O     . HOH J 7 .   ? 31.063  32.981  -1.252  1.00 75.64  ? 1188 HOH A O     1 
HETATM 8727 O O     . HOH K 7 .   ? 3.974   4.105   -33.921 1.00 55.61  ? 953  HOH B O     1 
HETATM 8728 O O     . HOH K 7 .   ? 6.756   24.281  -24.963 1.00 51.33  ? 954  HOH B O     1 
HETATM 8729 O O     . HOH K 7 .   ? 17.699  -2.738  -55.994 1.00 61.37  ? 955  HOH B O     1 
HETATM 8730 O O     . HOH K 7 .   ? 16.928  -8.060  -48.767 1.00 53.00  ? 956  HOH B O     1 
HETATM 8731 O O     . HOH K 7 .   ? 3.250   7.692   -33.095 1.00 48.34  ? 957  HOH B O     1 
HETATM 8732 O O     . HOH K 7 .   ? 14.419  -7.205  -49.123 1.00 54.93  ? 958  HOH B O     1 
HETATM 8733 O O     . HOH K 7 .   ? 13.640  -7.670  -46.455 1.00 51.27  ? 959  HOH B O     1 
HETATM 8734 O O     . HOH K 7 .   ? 22.010  2.208   -47.735 1.00 55.16  ? 960  HOH B O     1 
HETATM 8735 O O     . HOH K 7 .   ? 4.478   4.733   -48.352 1.00 50.85  ? 961  HOH B O     1 
HETATM 8736 O O     . HOH K 7 .   ? 4.310   1.236   -69.187 1.00 48.14  ? 962  HOH B O     1 
HETATM 8737 O O     . HOH K 7 .   ? 5.546   -1.588  -29.026 1.00 54.44  ? 963  HOH B O     1 
HETATM 8738 O O     . HOH K 7 .   ? 23.579  -3.251  -34.922 1.00 58.89  ? 964  HOH B O     1 
HETATM 8739 O O     . HOH K 7 .   ? -3.494  1.235   -48.499 1.00 62.30  ? 965  HOH B O     1 
HETATM 8740 O O     . HOH K 7 .   ? 10.046  -5.687  -64.513 1.00 50.85  ? 966  HOH B O     1 
HETATM 8741 O O     . HOH K 7 .   ? 3.891   20.350  -28.422 1.00 46.28  ? 967  HOH B O     1 
HETATM 8742 O O     . HOH K 7 .   ? 16.579  -3.130  -42.872 1.00 61.02  ? 968  HOH B O     1 
HETATM 8743 O O     . HOH K 7 .   ? 10.602  0.102   -44.063 1.00 51.94  ? 969  HOH B O     1 
HETATM 8744 O O     . HOH K 7 .   ? -2.601  1.179   -36.659 1.00 59.17  ? 970  HOH B O     1 
HETATM 8745 O O     . HOH K 7 .   ? 9.056   1.548   -68.264 1.00 58.41  ? 971  HOH B O     1 
HETATM 8746 O O     . HOH K 7 .   ? 13.075  -4.295  -55.454 1.00 64.61  ? 972  HOH B O     1 
HETATM 8747 O O     . HOH K 7 .   ? 17.472  5.443   -34.960 1.00 57.85  ? 973  HOH B O     1 
HETATM 8748 O O     . HOH K 7 .   ? 8.980   -0.656  -60.800 1.00 51.83  ? 974  HOH B O     1 
HETATM 8749 O O     . HOH K 7 .   ? 25.468  -2.687  -46.895 1.00 57.27  ? 975  HOH B O     1 
HETATM 8750 O O     . HOH K 7 .   ? 6.360   16.872  -53.691 1.00 53.43  ? 976  HOH B O     1 
HETATM 8751 O O     . HOH K 7 .   ? 1.740   -2.464  -52.919 1.00 51.04  ? 977  HOH B O     1 
HETATM 8752 O O     . HOH K 7 .   ? -7.488  7.804   -44.862 1.00 55.36  ? 978  HOH B O     1 
HETATM 8753 O O     . HOH K 7 .   ? 22.991  0.796   -53.457 1.00 62.96  ? 979  HOH B O     1 
HETATM 8754 O O     . HOH K 7 .   ? -1.095  4.095   -48.641 1.00 54.31  ? 980  HOH B O     1 
HETATM 8755 O O     . HOH K 7 .   ? 7.191   -8.234  -44.826 1.00 59.13  ? 981  HOH B O     1 
HETATM 8756 O O     . HOH K 7 .   ? -1.162  26.805  -29.648 1.00 55.49  ? 982  HOH B O     1 
HETATM 8757 O O     . HOH K 7 .   ? 22.974  0.173   -28.258 1.00 69.00  ? 983  HOH B O     1 
HETATM 8758 O O     . HOH K 7 .   ? 1.561   0.195   -53.063 1.00 55.88  ? 984  HOH B O     1 
HETATM 8759 O O     . HOH K 7 .   ? 6.974   4.215   -24.679 1.00 60.25  ? 985  HOH B O     1 
HETATM 8760 O O     . HOH K 7 .   ? 8.563   25.013  -31.579 1.00 52.11  ? 986  HOH B O     1 
HETATM 8761 O O     . HOH K 7 .   ? -5.544  -2.358  -48.866 1.00 59.58  ? 987  HOH B O     1 
HETATM 8762 O O     . HOH K 7 .   ? 24.268  -2.467  -59.258 1.00 69.88  ? 988  HOH B O     1 
HETATM 8763 O O     . HOH K 7 .   ? 13.638  6.770   -33.466 1.00 50.38  ? 989  HOH B O     1 
HETATM 8764 O O     . HOH K 7 .   ? 0.371   19.637  -47.103 1.00 54.09  ? 990  HOH B O     1 
HETATM 8765 O O     . HOH K 7 .   ? 6.553   0.000   -64.742 1.00 63.41  ? 991  HOH B O     1 
HETATM 8766 O O     . HOH K 7 .   ? 1.841   19.515  -59.964 1.00 57.33  ? 992  HOH B O     1 
HETATM 8767 O O     . HOH K 7 .   ? 6.645   -2.263  -50.772 1.00 56.68  ? 993  HOH B O     1 
HETATM 8768 O O     . HOH K 7 .   ? -4.078  1.442   -30.301 1.00 69.07  ? 994  HOH B O     1 
HETATM 8769 O O     . HOH K 7 .   ? 12.891  15.055  -22.866 1.00 54.88  ? 995  HOH B O     1 
HETATM 8770 O O     . HOH K 7 .   ? 9.307   3.419   -24.084 1.00 58.86  ? 996  HOH B O     1 
HETATM 8771 O O     . HOH K 7 .   ? -8.416  7.286   -23.504 1.00 73.09  ? 997  HOH B O     1 
HETATM 8772 O O     . HOH K 7 .   ? -2.986  24.756  -23.689 1.00 61.89  ? 998  HOH B O     1 
HETATM 8773 O O     . HOH K 7 .   ? 4.415   -0.791  -43.449 1.00 54.82  ? 999  HOH B O     1 
HETATM 8774 O O     . HOH K 7 .   ? 11.835  3.949   -74.804 1.00 55.13  ? 1000 HOH B O     1 
HETATM 8775 O O     . HOH K 7 .   ? 17.294  1.325   -60.518 1.00 54.64  ? 1001 HOH B O     1 
HETATM 8776 O O     . HOH K 7 .   ? 23.014  10.152  -35.846 1.00 60.31  ? 1002 HOH B O     1 
HETATM 8777 O O     . HOH K 7 .   ? -3.784  21.273  -20.358 1.00 53.85  ? 1003 HOH B O     1 
HETATM 8778 O O     . HOH K 7 .   ? -3.257  -3.545  -42.699 1.00 64.12  ? 1004 HOH B O     1 
HETATM 8779 O O     . HOH K 7 .   ? -10.684 12.673  -59.731 1.00 83.99  ? 1005 HOH B O     1 
HETATM 8780 O O     . HOH K 7 .   ? -3.462  -5.132  -45.065 1.00 63.79  ? 1006 HOH B O     1 
HETATM 8781 O O     . HOH K 7 .   ? -3.357  27.665  -30.547 1.00 63.70  ? 1007 HOH B O     1 
HETATM 8782 O O     . HOH K 7 .   ? 19.695  -1.014  -37.707 1.00 55.11  ? 1008 HOH B O     1 
HETATM 8783 O O     . HOH K 7 .   ? 4.606   -3.630  -42.694 1.00 55.93  ? 1009 HOH B O     1 
HETATM 8784 O O     . HOH K 7 .   ? -0.291  -6.622  -57.545 1.00 61.68  ? 1010 HOH B O     1 
HETATM 8785 O O     . HOH K 7 .   ? 11.998  10.689  -16.880 1.00 57.38  ? 1011 HOH B O     1 
HETATM 8786 O O     . HOH K 7 .   ? 4.991   8.271   -64.265 1.00 60.83  ? 1012 HOH B O     1 
HETATM 8787 O O     . HOH K 7 .   ? 12.610  26.304  -28.274 1.00 57.07  ? 1013 HOH B O     1 
HETATM 8788 O O     . HOH K 7 .   ? -2.776  -0.354  -61.226 1.00 65.32  ? 1014 HOH B O     1 
HETATM 8789 O O     . HOH K 7 .   ? 24.280  -2.323  -44.437 1.00 60.35  ? 1015 HOH B O     1 
HETATM 8790 O O     . HOH K 7 .   ? 4.543   -9.239  -10.538 1.00 71.14  ? 1016 HOH B O     1 
HETATM 8791 O O     . HOH K 7 .   ? -8.334  2.262   -50.954 1.00 67.70  ? 1017 HOH B O     1 
HETATM 8792 O O     . HOH K 7 .   ? 11.384  16.885  -23.204 1.00 58.28  ? 1018 HOH B O     1 
HETATM 8793 O O     . HOH K 7 .   ? -6.473  13.738  -26.360 1.00 56.23  ? 1019 HOH B O     1 
HETATM 8794 O O     . HOH K 7 .   ? 7.638   1.175   -62.056 1.00 60.28  ? 1020 HOH B O     1 
HETATM 8795 O O     . HOH K 7 .   ? 2.071   23.772  -19.717 1.00 66.99  ? 1021 HOH B O     1 
HETATM 8796 O O     . HOH K 7 .   ? -9.101  18.345  -33.967 1.00 60.81  ? 1022 HOH B O     1 
HETATM 8797 O O     . HOH K 7 .   ? 7.920   -0.525  -67.178 1.00 56.72  ? 1023 HOH B O     1 
HETATM 8798 O O     . HOH K 7 .   ? 0.066   27.099  -32.289 1.00 52.50  ? 1024 HOH B O     1 
HETATM 8799 O O     . HOH K 7 .   ? 7.766   1.016   -23.945 1.00 57.89  ? 1025 HOH B O     1 
HETATM 8800 O O     . HOH K 7 .   ? 4.050   10.785  -65.247 1.00 67.22  ? 1026 HOH B O     1 
HETATM 8801 O O     . HOH K 7 .   ? 12.514  27.624  -25.701 1.00 66.53  ? 1027 HOH B O     1 
HETATM 8802 O O     . HOH K 7 .   ? 15.083  2.486   -62.017 1.00 57.64  ? 1028 HOH B O     1 
HETATM 8803 O O     . HOH K 7 .   ? -9.230  18.388  -27.094 1.00 70.99  ? 1029 HOH B O     1 
HETATM 8804 O O     . HOH K 7 .   ? 27.367  1.726   -37.908 1.00 58.81  ? 1030 HOH B O     1 
HETATM 8805 O O     . HOH K 7 .   ? 21.064  7.336   -37.073 1.00 53.39  ? 1031 HOH B O     1 
HETATM 8806 O O     . HOH K 7 .   ? 23.205  -5.625  -33.832 1.00 64.78  ? 1032 HOH B O     1 
HETATM 8807 O O     . HOH K 7 .   ? -3.660  24.451  -51.279 1.00 62.38  ? 1033 HOH B O     1 
HETATM 8808 O O     . HOH K 7 .   ? 1.663   21.445  -18.494 1.00 59.28  ? 1034 HOH B O     1 
HETATM 8809 O O     . HOH K 7 .   ? -6.039  2.903   -23.578 1.00 65.17  ? 1035 HOH B O     1 
HETATM 8810 O O     . HOH K 7 .   ? -3.990  -10.371 -23.053 1.00 74.77  ? 1036 HOH B O     1 
HETATM 8811 O O     . HOH K 7 .   ? -6.615  -2.800  -33.679 1.00 77.83  ? 1037 HOH B O     1 
HETATM 8812 O O     . HOH K 7 .   ? 0.432   0.402   -55.766 1.00 56.82  ? 1038 HOH B O     1 
HETATM 8813 O O     . HOH K 7 .   ? 4.588   2.102   -40.950 1.00 56.03  ? 1039 HOH B O     1 
HETATM 8814 O O     . HOH K 7 .   ? -1.427  -9.642  -20.870 1.00 75.02  ? 1040 HOH B O     1 
HETATM 8815 O O     . HOH K 7 .   ? -2.954  0.349   -22.398 1.00 65.73  ? 1041 HOH B O     1 
HETATM 8816 O O     . HOH K 7 .   ? 22.269  -1.375  -37.036 1.00 53.10  ? 1042 HOH B O     1 
HETATM 8817 O O     . HOH K 7 .   ? 28.480  5.485   -51.760 1.00 66.95  ? 1043 HOH B O     1 
HETATM 8818 O O     . HOH K 7 .   ? 32.683  -1.360  -19.818 1.00 83.94  ? 1044 HOH B O     1 
HETATM 8819 O O     . HOH K 7 .   ? 22.004  9.950   -33.357 1.00 62.91  ? 1045 HOH B O     1 
HETATM 8820 O O     . HOH K 7 .   ? 30.204  6.479   -26.900 1.00 78.95  ? 1046 HOH B O     1 
HETATM 8821 O O     . HOH K 7 .   ? 3.709   -13.528 -38.026 1.00 75.55  ? 1047 HOH B O     1 
HETATM 8822 O O     . HOH K 7 .   ? -18.111 12.773  -63.931 1.00 77.32  ? 1048 HOH B O     1 
HETATM 8823 O O     . HOH K 7 .   ? -0.763  7.536   -72.513 1.00 62.62  ? 1049 HOH B O     1 
HETATM 8824 O O     . HOH K 7 .   ? -14.851 3.007   -61.041 1.00 69.78  ? 1050 HOH B O     1 
HETATM 8825 O O     . HOH K 7 .   ? 2.798   9.561   -73.228 1.00 65.11  ? 1051 HOH B O     1 
HETATM 8826 O O     . HOH K 7 .   ? -0.737  7.144   -76.888 1.00 65.15  ? 1052 HOH B O     1 
HETATM 8827 O O     . HOH K 7 .   ? -1.601  -1.128  -65.110 1.00 70.08  ? 1053 HOH B O     1 
HETATM 8828 O O     . HOH K 7 .   ? 10.693  -14.350 -45.979 1.00 59.04  ? 1054 HOH B O     1 
HETATM 8829 O O     . HOH K 7 .   ? 10.394  -13.386 -48.654 1.00 66.64  ? 1055 HOH B O     1 
HETATM 8830 O O     . HOH K 7 .   ? 1.554   -13.578 -44.578 1.00 72.49  ? 1056 HOH B O     1 
HETATM 8831 O O     . HOH K 7 .   ? -1.405  -6.937  -44.978 1.00 61.93  ? 1057 HOH B O     1 
HETATM 8832 O O     . HOH K 7 .   ? 17.666  -5.376  -43.829 1.00 62.38  ? 1058 HOH B O     1 
HETATM 8833 O O     . HOH K 7 .   ? 8.527   -8.192  -38.838 1.00 72.06  ? 1059 HOH B O     1 
HETATM 8834 O O     . HOH K 7 .   ? -8.843  -0.185  -45.448 1.00 70.10  ? 1060 HOH B O     1 
HETATM 8835 O O     . HOH K 7 .   ? -5.434  -4.106  -40.977 1.00 65.39  ? 1061 HOH B O     1 
HETATM 8836 O O     . HOH K 7 .   ? 23.088  -0.249  -45.583 1.00 53.34  ? 1062 HOH B O     1 
HETATM 8837 O O     . HOH K 7 .   ? 23.001  7.236   -53.417 1.00 72.81  ? 1063 HOH B O     1 
HETATM 8838 O O     . HOH K 7 .   ? 15.854  10.082  -56.650 1.00 61.71  ? 1064 HOH B O     1 
HETATM 8839 O O     . HOH K 7 .   ? 2.840   25.522  -48.121 1.00 59.45  ? 1065 HOH B O     1 
HETATM 8840 O O     . HOH K 7 .   ? 22.242  17.299  -48.331 1.00 69.06  ? 1066 HOH B O     1 
HETATM 8841 O O     . HOH K 7 .   ? 11.448  21.689  -46.894 1.00 63.75  ? 1067 HOH B O     1 
HETATM 8842 O O     . HOH K 7 .   ? 22.914  1.325   -36.423 1.00 59.64  ? 1068 HOH B O     1 
HETATM 8843 O O     . HOH K 7 .   ? 25.672  0.522   -36.178 1.00 59.09  ? 1069 HOH B O     1 
HETATM 8844 O O     . HOH K 7 .   ? 32.819  4.290   -41.654 1.00 59.37  ? 1070 HOH B O     1 
HETATM 8845 O O     . HOH K 7 .   ? 32.727  6.496   -42.680 1.00 58.58  ? 1071 HOH B O     1 
HETATM 8846 O O     . HOH K 7 .   ? 34.380  -2.325  -43.603 1.00 72.00  ? 1072 HOH B O     1 
HETATM 8847 O O     . HOH K 7 .   ? 30.477  -3.924  -36.417 1.00 74.43  ? 1073 HOH B O     1 
HETATM 8848 O O     . HOH K 7 .   ? 32.645  -8.546  -43.650 1.00 69.10  ? 1074 HOH B O     1 
HETATM 8849 O O     . HOH K 7 .   ? 32.896  -8.584  -40.940 1.00 74.58  ? 1075 HOH B O     1 
HETATM 8850 O O     . HOH K 7 .   ? 2.015   8.025   -21.009 1.00 72.34  ? 1076 HOH B O     1 
HETATM 8851 O O     . HOH K 7 .   ? 6.955   0.070   -19.557 1.00 63.30  ? 1077 HOH B O     1 
HETATM 8852 O O     . HOH K 7 .   ? 23.897  -8.386  -27.358 1.00 69.94  ? 1078 HOH B O     1 
HETATM 8853 O O     . HOH K 7 .   ? 18.965  6.417   -27.368 1.00 62.17  ? 1079 HOH B O     1 
HETATM 8854 O O     . HOH K 7 .   ? 11.664  27.323  -32.621 1.00 56.73  ? 1080 HOH B O     1 
HETATM 8855 O O     . HOH K 7 .   ? 10.939  27.057  -30.221 1.00 60.08  ? 1081 HOH B O     1 
HETATM 8856 O O     . HOH K 7 .   ? 5.705   14.852  -18.727 1.00 58.41  ? 1082 HOH B O     1 
HETATM 8857 O O     . HOH K 7 .   ? -5.796  13.784  -23.072 1.00 60.71  ? 1083 HOH B O     1 
HETATM 8858 O O     . HOH K 7 .   ? -1.067  21.557  -17.416 1.00 66.39  ? 1084 HOH B O     1 
HETATM 8859 O O     . HOH K 7 .   ? 11.327  12.967  -16.123 1.00 62.25  ? 1085 HOH B O     1 
HETATM 8860 O O     . HOH K 7 .   ? 9.475   13.862  -17.986 1.00 63.69  ? 1086 HOH B O     1 
HETATM 8861 O O     . HOH K 7 .   ? 4.916   26.873  -26.820 1.00 67.14  ? 1087 HOH B O     1 
HETATM 8862 O O     . HOH K 7 .   ? 18.246  -14.532 -42.711 1.00 77.67  ? 1088 HOH B O     1 
HETATM 8863 O O     . HOH K 7 .   ? 3.561   0.113   -65.535 1.00 68.40  ? 1089 HOH B O     1 
HETATM 8864 O O     . HOH K 7 .   ? 12.139  -0.833  -68.396 1.00 62.37  ? 1090 HOH B O     1 
HETATM 8865 O O     . HOH K 7 .   ? -0.737  -9.025  -56.334 1.00 64.38  ? 1091 HOH B O     1 
HETATM 8866 O O     . HOH K 7 .   ? -2.680  22.752  -57.956 1.00 69.03  ? 1092 HOH B O     1 
HETATM 8867 O O     . HOH K 7 .   ? 16.081  15.373  -21.069 1.00 71.95  ? 1093 HOH B O     1 
HETATM 8868 O O     . HOH K 7 .   ? -4.786  12.792  -20.615 1.00 70.77  ? 1094 HOH B O     1 
HETATM 8869 O O     . HOH K 7 .   ? 2.575   -11.982 -46.913 1.00 69.29  ? 1095 HOH B O     1 
HETATM 8870 O O     . HOH K 7 .   ? 4.540   -5.363  -46.209 1.00 64.00  ? 1096 HOH B O     1 
HETATM 8871 O O     . HOH K 7 .   ? 2.884   -11.667 -51.200 1.00 62.88  ? 1097 HOH B O     1 
HETATM 8872 O O     . HOH K 7 .   ? 3.888   16.874  -17.091 1.00 64.35  ? 1098 HOH B O     1 
HETATM 8873 O O     . HOH K 7 .   ? 30.145  6.811   -42.720 1.00 65.16  ? 1099 HOH B O     1 
HETATM 8874 O O     . HOH K 7 .   ? 18.759  8.907   -27.694 1.00 60.37  ? 1100 HOH B O     1 
HETATM 8875 O O     . HOH K 7 .   ? 21.228  13.659  -51.998 1.00 68.22  ? 1101 HOH B O     1 
HETATM 8876 O O     . HOH K 7 .   ? 22.645  15.798  -46.026 1.00 65.01  ? 1102 HOH B O     1 
HETATM 8877 O O     . HOH K 7 .   ? -0.720  8.297   -18.985 1.00 70.59  ? 1103 HOH B O     1 
HETATM 8878 O O     . HOH K 7 .   ? 38.002  -2.952  -61.506 1.00 74.88  ? 1104 HOH B O     1 
HETATM 8879 O O     . HOH K 7 .   ? 4.778   27.382  -50.558 1.00 70.95  ? 1105 HOH B O     1 
HETATM 8880 O O     . HOH K 7 .   ? 37.174  -8.557  -54.327 1.00 84.71  ? 1106 HOH B O     1 
HETATM 8881 O O     . HOH K 7 .   ? 22.710  10.968  -28.033 1.00 66.56  ? 1107 HOH B O     1 
HETATM 8882 O O     . HOH K 7 .   ? 21.165  -6.319  -10.932 1.00 79.88  ? 1108 HOH B O     1 
HETATM 8883 O O     . HOH K 7 .   ? 33.252  2.384   -47.439 1.00 76.89  ? 1109 HOH B O     1 
HETATM 8884 O O     . HOH K 7 .   ? 11.062  -17.269 -25.501 1.00 74.48  ? 1110 HOH B O     1 
HETATM 8885 O O     . HOH K 7 .   ? 9.983   24.067  -49.766 1.00 66.90  ? 1111 HOH B O     1 
HETATM 8886 O O     . HOH K 7 .   ? -14.504 -7.731  -37.730 1.00 69.41  ? 1112 HOH B O     1 
HETATM 8887 O O     . HOH K 7 .   ? 31.573  -17.705 -50.378 1.00 68.10  ? 1113 HOH B O     1 
HETATM 8888 O O     . HOH K 7 .   ? -15.342 0.836   -53.157 1.00 67.61  ? 1114 HOH B O     1 
HETATM 8889 O O     . HOH K 7 .   ? 10.443  -7.274  -5.553  1.00 75.83  ? 1115 HOH B O     1 
HETATM 8890 O O     . HOH K 7 .   ? 26.901  14.556  -23.574 1.00 73.75  ? 1116 HOH B O     1 
HETATM 8891 O O     . HOH K 7 .   ? -0.160  27.394  -51.544 1.00 64.18  ? 1117 HOH B O     1 
HETATM 8892 O O     . HOH K 7 .   ? -17.878 12.931  -44.770 1.00 68.09  ? 1118 HOH B O     1 
HETATM 8893 O O     . HOH K 7 .   ? 27.307  -5.877  -17.685 1.00 78.92  ? 1119 HOH B O     1 
HETATM 8894 O O     . HOH K 7 .   ? 28.234  -3.312  -33.247 1.00 76.39  ? 1120 HOH B O     1 
HETATM 8895 O O     . HOH K 7 .   ? 8.827   27.618  -39.005 1.00 75.89  ? 1121 HOH B O     1 
HETATM 8896 O O     . HOH K 7 .   ? 21.438  19.220  -44.239 1.00 72.20  ? 1122 HOH B O     1 
HETATM 8897 O O     . HOH K 7 .   ? 6.175   17.447  -15.803 1.00 68.89  ? 1123 HOH B O     1 
HETATM 8898 O O     . HOH K 7 .   ? 22.627  15.831  -50.365 1.00 70.48  ? 1124 HOH B O     1 
HETATM 8899 O O     . HOH K 7 .   ? -2.650  -11.794 -28.461 1.00 76.78  ? 1125 HOH B O     1 
HETATM 8900 O O     . HOH K 7 .   ? -6.140  -13.323 -35.061 1.00 73.56  ? 1126 HOH B O     1 
HETATM 8901 O O     . HOH K 7 .   ? 5.275   -1.398  -22.013 1.00 64.76  ? 1127 HOH B O     1 
HETATM 8902 O O     . HOH K 7 .   ? 26.671  8.646   -53.736 1.00 66.69  ? 1128 HOH B O     1 
HETATM 8903 O O     . HOH K 7 .   ? 25.366  11.953  -56.576 1.00 76.83  ? 1129 HOH B O     1 
HETATM 8904 O O     . HOH K 7 .   ? 29.900  7.003   -49.874 1.00 70.55  ? 1130 HOH B O     1 
HETATM 8905 O O     . HOH K 7 .   ? -14.374 14.308  -33.462 1.00 70.58  ? 1131 HOH B O     1 
HETATM 8906 O O     . HOH K 7 .   ? -3.196  16.907  -67.165 1.00 71.50  ? 1132 HOH B O     1 
HETATM 8907 O O     . HOH K 7 .   ? 11.915  16.955  -64.260 1.00 79.30  ? 1133 HOH B O     1 
HETATM 8908 O O     . HOH K 7 .   ? 33.674  -18.959 -43.186 1.00 81.43  ? 1134 HOH B O     1 
HETATM 8909 O O     . HOH K 7 .   ? 5.067   -2.282  -13.937 1.00 70.65  ? 1135 HOH B O     1 
HETATM 8910 O O     . HOH K 7 .   ? 29.265  18.392  -19.823 1.00 92.51  ? 1136 HOH B O     1 
HETATM 8911 O O     . HOH K 7 .   ? -7.902  -3.513  -26.349 1.00 65.84  ? 1137 HOH B O     1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'FUC C 2 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 258 PRO PRO B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 NAG 1   701  701 NAG NAG A . 
E 4 NAF 1   951  951 NAF NAF A . 
F 5 P6G 1   901  901 P6G PEG A . 
G 6 PG4 1   902  902 PG4 PEA A . 
H 3 NAG 1   601  601 NAG NAG B . 
I 4 NAF 1   952  952 NAF NAF B . 
J 7 HOH 1   952  1   HOH HOH A . 
J 7 HOH 2   953  2   HOH HOH A . 
J 7 HOH 3   954  3   HOH HOH A . 
J 7 HOH 4   955  4   HOH HOH A . 
J 7 HOH 5   956  5   HOH HOH A . 
J 7 HOH 6   957  6   HOH HOH A . 
J 7 HOH 7   958  7   HOH HOH A . 
J 7 HOH 8   959  9   HOH HOH A . 
J 7 HOH 9   960  10  HOH HOH A . 
J 7 HOH 10  961  12  HOH HOH A . 
J 7 HOH 11  962  13  HOH HOH A . 
J 7 HOH 12  963  17  HOH HOH A . 
J 7 HOH 13  964  18  HOH HOH A . 
J 7 HOH 14  965  20  HOH HOH A . 
J 7 HOH 15  966  22  HOH HOH A . 
J 7 HOH 16  967  23  HOH HOH A . 
J 7 HOH 17  968  28  HOH HOH A . 
J 7 HOH 18  969  31  HOH HOH A . 
J 7 HOH 19  970  32  HOH HOH A . 
J 7 HOH 20  971  33  HOH HOH A . 
J 7 HOH 21  972  35  HOH HOH A . 
J 7 HOH 22  973  36  HOH HOH A . 
J 7 HOH 23  974  38  HOH HOH A . 
J 7 HOH 24  975  39  HOH HOH A . 
J 7 HOH 25  976  40  HOH HOH A . 
J 7 HOH 26  977  41  HOH HOH A . 
J 7 HOH 27  978  44  HOH HOH A . 
J 7 HOH 28  979  45  HOH HOH A . 
J 7 HOH 29  980  47  HOH HOH A . 
J 7 HOH 30  981  48  HOH HOH A . 
J 7 HOH 31  982  50  HOH HOH A . 
J 7 HOH 32  983  51  HOH HOH A . 
J 7 HOH 33  984  54  HOH HOH A . 
J 7 HOH 34  985  58  HOH HOH A . 
J 7 HOH 35  986  62  HOH HOH A . 
J 7 HOH 36  987  68  HOH HOH A . 
J 7 HOH 37  988  70  HOH HOH A . 
J 7 HOH 38  989  71  HOH HOH A . 
J 7 HOH 39  990  72  HOH HOH A . 
J 7 HOH 40  991  75  HOH HOH A . 
J 7 HOH 41  992  76  HOH HOH A . 
J 7 HOH 42  993  77  HOH HOH A . 
J 7 HOH 43  994  79  HOH HOH A . 
J 7 HOH 44  995  85  HOH HOH A . 
J 7 HOH 45  996  86  HOH HOH A . 
J 7 HOH 46  997  87  HOH HOH A . 
J 7 HOH 47  998  88  HOH HOH A . 
J 7 HOH 48  999  89  HOH HOH A . 
J 7 HOH 49  1000 90  HOH HOH A . 
J 7 HOH 50  1001 92  HOH HOH A . 
J 7 HOH 51  1002 93  HOH HOH A . 
J 7 HOH 52  1003 95  HOH HOH A . 
J 7 HOH 53  1004 96  HOH HOH A . 
J 7 HOH 54  1005 97  HOH HOH A . 
J 7 HOH 55  1006 98  HOH HOH A . 
J 7 HOH 56  1007 100 HOH HOH A . 
J 7 HOH 57  1008 101 HOH HOH A . 
J 7 HOH 58  1009 102 HOH HOH A . 
J 7 HOH 59  1010 103 HOH HOH A . 
J 7 HOH 60  1011 104 HOH HOH A . 
J 7 HOH 61  1012 105 HOH HOH A . 
J 7 HOH 62  1013 107 HOH HOH A . 
J 7 HOH 63  1014 110 HOH HOH A . 
J 7 HOH 64  1015 111 HOH HOH A . 
J 7 HOH 65  1016 113 HOH HOH A . 
J 7 HOH 66  1017 118 HOH HOH A . 
J 7 HOH 67  1018 119 HOH HOH A . 
J 7 HOH 68  1019 120 HOH HOH A . 
J 7 HOH 69  1020 121 HOH HOH A . 
J 7 HOH 70  1021 123 HOH HOH A . 
J 7 HOH 71  1022 126 HOH HOH A . 
J 7 HOH 72  1023 127 HOH HOH A . 
J 7 HOH 73  1024 128 HOH HOH A . 
J 7 HOH 74  1025 130 HOH HOH A . 
J 7 HOH 75  1026 133 HOH HOH A . 
J 7 HOH 76  1027 134 HOH HOH A . 
J 7 HOH 77  1028 135 HOH HOH A . 
J 7 HOH 78  1029 136 HOH HOH A . 
J 7 HOH 79  1030 137 HOH HOH A . 
J 7 HOH 80  1031 141 HOH HOH A . 
J 7 HOH 81  1032 142 HOH HOH A . 
J 7 HOH 82  1033 143 HOH HOH A . 
J 7 HOH 83  1034 144 HOH HOH A . 
J 7 HOH 84  1035 146 HOH HOH A . 
J 7 HOH 85  1036 147 HOH HOH A . 
J 7 HOH 86  1037 148 HOH HOH A . 
J 7 HOH 87  1038 150 HOH HOH A . 
J 7 HOH 88  1039 151 HOH HOH A . 
J 7 HOH 89  1040 153 HOH HOH A . 
J 7 HOH 90  1041 156 HOH HOH A . 
J 7 HOH 91  1042 157 HOH HOH A . 
J 7 HOH 92  1043 160 HOH HOH A . 
J 7 HOH 93  1044 161 HOH HOH A . 
J 7 HOH 94  1045 163 HOH HOH A . 
J 7 HOH 95  1046 166 HOH HOH A . 
J 7 HOH 96  1047 168 HOH HOH A . 
J 7 HOH 97  1048 170 HOH HOH A . 
J 7 HOH 98  1049 171 HOH HOH A . 
J 7 HOH 99  1050 172 HOH HOH A . 
J 7 HOH 100 1051 173 HOH HOH A . 
J 7 HOH 101 1052 174 HOH HOH A . 
J 7 HOH 102 1053 176 HOH HOH A . 
J 7 HOH 103 1054 177 HOH HOH A . 
J 7 HOH 104 1055 178 HOH HOH A . 
J 7 HOH 105 1056 179 HOH HOH A . 
J 7 HOH 106 1057 180 HOH HOH A . 
J 7 HOH 107 1058 182 HOH HOH A . 
J 7 HOH 108 1059 183 HOH HOH A . 
J 7 HOH 109 1060 185 HOH HOH A . 
J 7 HOH 110 1061 187 HOH HOH A . 
J 7 HOH 111 1062 188 HOH HOH A . 
J 7 HOH 112 1063 191 HOH HOH A . 
J 7 HOH 113 1064 192 HOH HOH A . 
J 7 HOH 114 1065 193 HOH HOH A . 
J 7 HOH 115 1066 194 HOH HOH A . 
J 7 HOH 116 1067 197 HOH HOH A . 
J 7 HOH 117 1068 198 HOH HOH A . 
J 7 HOH 118 1069 199 HOH HOH A . 
J 7 HOH 119 1070 201 HOH HOH A . 
J 7 HOH 120 1071 202 HOH HOH A . 
J 7 HOH 121 1072 203 HOH HOH A . 
J 7 HOH 122 1073 206 HOH HOH A . 
J 7 HOH 123 1074 207 HOH HOH A . 
J 7 HOH 124 1075 208 HOH HOH A . 
J 7 HOH 125 1076 211 HOH HOH A . 
J 7 HOH 126 1077 212 HOH HOH A . 
J 7 HOH 127 1078 213 HOH HOH A . 
J 7 HOH 128 1079 214 HOH HOH A . 
J 7 HOH 129 1080 219 HOH HOH A . 
J 7 HOH 130 1081 220 HOH HOH A . 
J 7 HOH 131 1082 221 HOH HOH A . 
J 7 HOH 132 1083 223 HOH HOH A . 
J 7 HOH 133 1084 225 HOH HOH A . 
J 7 HOH 134 1085 227 HOH HOH A . 
J 7 HOH 135 1086 233 HOH HOH A . 
J 7 HOH 136 1087 235 HOH HOH A . 
J 7 HOH 137 1088 237 HOH HOH A . 
J 7 HOH 138 1089 238 HOH HOH A . 
J 7 HOH 139 1090 239 HOH HOH A . 
J 7 HOH 140 1091 240 HOH HOH A . 
J 7 HOH 141 1092 242 HOH HOH A . 
J 7 HOH 142 1093 245 HOH HOH A . 
J 7 HOH 143 1094 246 HOH HOH A . 
J 7 HOH 144 1095 247 HOH HOH A . 
J 7 HOH 145 1096 248 HOH HOH A . 
J 7 HOH 146 1097 249 HOH HOH A . 
J 7 HOH 147 1098 250 HOH HOH A . 
J 7 HOH 148 1099 251 HOH HOH A . 
J 7 HOH 149 1100 252 HOH HOH A . 
J 7 HOH 150 1101 253 HOH HOH A . 
J 7 HOH 151 1102 254 HOH HOH A . 
J 7 HOH 152 1103 255 HOH HOH A . 
J 7 HOH 153 1104 256 HOH HOH A . 
J 7 HOH 154 1105 257 HOH HOH A . 
J 7 HOH 155 1106 258 HOH HOH A . 
J 7 HOH 156 1107 259 HOH HOH A . 
J 7 HOH 157 1108 260 HOH HOH A . 
J 7 HOH 158 1109 261 HOH HOH A . 
J 7 HOH 159 1110 262 HOH HOH A . 
J 7 HOH 160 1111 263 HOH HOH A . 
J 7 HOH 161 1112 264 HOH HOH A . 
J 7 HOH 162 1113 265 HOH HOH A . 
J 7 HOH 163 1114 266 HOH HOH A . 
J 7 HOH 164 1115 267 HOH HOH A . 
J 7 HOH 165 1116 268 HOH HOH A . 
J 7 HOH 166 1117 269 HOH HOH A . 
J 7 HOH 167 1118 270 HOH HOH A . 
J 7 HOH 168 1119 271 HOH HOH A . 
J 7 HOH 169 1120 272 HOH HOH A . 
J 7 HOH 170 1121 273 HOH HOH A . 
J 7 HOH 171 1122 274 HOH HOH A . 
J 7 HOH 172 1123 275 HOH HOH A . 
J 7 HOH 173 1124 276 HOH HOH A . 
J 7 HOH 174 1125 277 HOH HOH A . 
J 7 HOH 175 1126 278 HOH HOH A . 
J 7 HOH 176 1127 279 HOH HOH A . 
J 7 HOH 177 1128 285 HOH HOH A . 
J 7 HOH 178 1129 321 HOH HOH A . 
J 7 HOH 179 1130 323 HOH HOH A . 
J 7 HOH 180 1131 324 HOH HOH A . 
J 7 HOH 181 1132 326 HOH HOH A . 
J 7 HOH 182 1133 327 HOH HOH A . 
J 7 HOH 183 1134 328 HOH HOH A . 
J 7 HOH 184 1135 331 HOH HOH A . 
J 7 HOH 185 1136 332 HOH HOH A . 
J 7 HOH 186 1137 333 HOH HOH A . 
J 7 HOH 187 1138 334 HOH HOH A . 
J 7 HOH 188 1139 335 HOH HOH A . 
J 7 HOH 189 1140 336 HOH HOH A . 
J 7 HOH 190 1141 337 HOH HOH A . 
J 7 HOH 191 1142 338 HOH HOH A . 
J 7 HOH 192 1143 339 HOH HOH A . 
J 7 HOH 193 1144 341 HOH HOH A . 
J 7 HOH 194 1145 342 HOH HOH A . 
J 7 HOH 195 1146 343 HOH HOH A . 
J 7 HOH 196 1147 345 HOH HOH A . 
J 7 HOH 197 1148 346 HOH HOH A . 
J 7 HOH 198 1149 347 HOH HOH A . 
J 7 HOH 199 1150 349 HOH HOH A . 
J 7 HOH 200 1151 354 HOH HOH A . 
J 7 HOH 201 1152 355 HOH HOH A . 
J 7 HOH 202 1153 356 HOH HOH A . 
J 7 HOH 203 1154 357 HOH HOH A . 
J 7 HOH 204 1155 359 HOH HOH A . 
J 7 HOH 205 1156 361 HOH HOH A . 
J 7 HOH 206 1157 364 HOH HOH A . 
J 7 HOH 207 1158 365 HOH HOH A . 
J 7 HOH 208 1159 369 HOH HOH A . 
J 7 HOH 209 1160 370 HOH HOH A . 
J 7 HOH 210 1161 371 HOH HOH A . 
J 7 HOH 211 1162 373 HOH HOH A . 
J 7 HOH 212 1163 376 HOH HOH A . 
J 7 HOH 213 1164 378 HOH HOH A . 
J 7 HOH 214 1165 381 HOH HOH A . 
J 7 HOH 215 1166 382 HOH HOH A . 
J 7 HOH 216 1167 384 HOH HOH A . 
J 7 HOH 217 1168 385 HOH HOH A . 
J 7 HOH 218 1169 388 HOH HOH A . 
J 7 HOH 219 1170 389 HOH HOH A . 
J 7 HOH 220 1171 390 HOH HOH A . 
J 7 HOH 221 1172 393 HOH HOH A . 
J 7 HOH 222 1173 394 HOH HOH A . 
J 7 HOH 223 1174 395 HOH HOH A . 
J 7 HOH 224 1175 396 HOH HOH A . 
J 7 HOH 225 1176 397 HOH HOH A . 
J 7 HOH 226 1177 401 HOH HOH A . 
J 7 HOH 227 1178 406 HOH HOH A . 
J 7 HOH 228 1179 407 HOH HOH A . 
J 7 HOH 229 1180 410 HOH HOH A . 
J 7 HOH 230 1181 412 HOH HOH A . 
J 7 HOH 231 1182 414 HOH HOH A . 
J 7 HOH 232 1183 416 HOH HOH A . 
J 7 HOH 233 1184 417 HOH HOH A . 
J 7 HOH 234 1185 423 HOH HOH A . 
J 7 HOH 235 1186 424 HOH HOH A . 
J 7 HOH 236 1187 427 HOH HOH A . 
J 7 HOH 237 1188 432 HOH HOH A . 
K 7 HOH 1   953  8   HOH HOH B . 
K 7 HOH 2   954  11  HOH HOH B . 
K 7 HOH 3   955  14  HOH HOH B . 
K 7 HOH 4   956  15  HOH HOH B . 
K 7 HOH 5   957  16  HOH HOH B . 
K 7 HOH 6   958  19  HOH HOH B . 
K 7 HOH 7   959  21  HOH HOH B . 
K 7 HOH 8   960  24  HOH HOH B . 
K 7 HOH 9   961  25  HOH HOH B . 
K 7 HOH 10  962  26  HOH HOH B . 
K 7 HOH 11  963  27  HOH HOH B . 
K 7 HOH 12  964  29  HOH HOH B . 
K 7 HOH 13  965  30  HOH HOH B . 
K 7 HOH 14  966  34  HOH HOH B . 
K 7 HOH 15  967  37  HOH HOH B . 
K 7 HOH 16  968  42  HOH HOH B . 
K 7 HOH 17  969  43  HOH HOH B . 
K 7 HOH 18  970  46  HOH HOH B . 
K 7 HOH 19  971  49  HOH HOH B . 
K 7 HOH 20  972  52  HOH HOH B . 
K 7 HOH 21  973  53  HOH HOH B . 
K 7 HOH 22  974  55  HOH HOH B . 
K 7 HOH 23  975  57  HOH HOH B . 
K 7 HOH 24  976  59  HOH HOH B . 
K 7 HOH 25  977  60  HOH HOH B . 
K 7 HOH 26  978  61  HOH HOH B . 
K 7 HOH 27  979  63  HOH HOH B . 
K 7 HOH 28  980  64  HOH HOH B . 
K 7 HOH 29  981  65  HOH HOH B . 
K 7 HOH 30  982  66  HOH HOH B . 
K 7 HOH 31  983  67  HOH HOH B . 
K 7 HOH 32  984  69  HOH HOH B . 
K 7 HOH 33  985  73  HOH HOH B . 
K 7 HOH 34  986  74  HOH HOH B . 
K 7 HOH 35  987  78  HOH HOH B . 
K 7 HOH 36  988  80  HOH HOH B . 
K 7 HOH 37  989  81  HOH HOH B . 
K 7 HOH 38  990  82  HOH HOH B . 
K 7 HOH 39  991  83  HOH HOH B . 
K 7 HOH 40  992  84  HOH HOH B . 
K 7 HOH 41  993  91  HOH HOH B . 
K 7 HOH 42  994  94  HOH HOH B . 
K 7 HOH 43  995  99  HOH HOH B . 
K 7 HOH 44  996  106 HOH HOH B . 
K 7 HOH 45  997  108 HOH HOH B . 
K 7 HOH 46  998  109 HOH HOH B . 
K 7 HOH 47  999  112 HOH HOH B . 
K 7 HOH 48  1000 114 HOH HOH B . 
K 7 HOH 49  1001 115 HOH HOH B . 
K 7 HOH 50  1002 116 HOH HOH B . 
K 7 HOH 51  1003 117 HOH HOH B . 
K 7 HOH 52  1004 122 HOH HOH B . 
K 7 HOH 53  1005 124 HOH HOH B . 
K 7 HOH 54  1006 125 HOH HOH B . 
K 7 HOH 55  1007 129 HOH HOH B . 
K 7 HOH 56  1008 132 HOH HOH B . 
K 7 HOH 57  1009 138 HOH HOH B . 
K 7 HOH 58  1010 140 HOH HOH B . 
K 7 HOH 59  1011 145 HOH HOH B . 
K 7 HOH 60  1012 149 HOH HOH B . 
K 7 HOH 61  1013 152 HOH HOH B . 
K 7 HOH 62  1014 154 HOH HOH B . 
K 7 HOH 63  1015 155 HOH HOH B . 
K 7 HOH 64  1016 158 HOH HOH B . 
K 7 HOH 65  1017 159 HOH HOH B . 
K 7 HOH 66  1018 162 HOH HOH B . 
K 7 HOH 67  1019 164 HOH HOH B . 
K 7 HOH 68  1020 165 HOH HOH B . 
K 7 HOH 69  1021 167 HOH HOH B . 
K 7 HOH 70  1022 175 HOH HOH B . 
K 7 HOH 71  1023 181 HOH HOH B . 
K 7 HOH 72  1024 184 HOH HOH B . 
K 7 HOH 73  1025 186 HOH HOH B . 
K 7 HOH 74  1026 189 HOH HOH B . 
K 7 HOH 75  1027 195 HOH HOH B . 
K 7 HOH 76  1028 196 HOH HOH B . 
K 7 HOH 77  1029 200 HOH HOH B . 
K 7 HOH 78  1030 204 HOH HOH B . 
K 7 HOH 79  1031 205 HOH HOH B . 
K 7 HOH 80  1032 209 HOH HOH B . 
K 7 HOH 81  1033 210 HOH HOH B . 
K 7 HOH 82  1034 215 HOH HOH B . 
K 7 HOH 83  1035 216 HOH HOH B . 
K 7 HOH 84  1036 217 HOH HOH B . 
K 7 HOH 85  1037 218 HOH HOH B . 
K 7 HOH 86  1038 222 HOH HOH B . 
K 7 HOH 87  1039 224 HOH HOH B . 
K 7 HOH 88  1040 226 HOH HOH B . 
K 7 HOH 89  1041 228 HOH HOH B . 
K 7 HOH 90  1042 229 HOH HOH B . 
K 7 HOH 91  1043 230 HOH HOH B . 
K 7 HOH 92  1044 231 HOH HOH B . 
K 7 HOH 93  1045 232 HOH HOH B . 
K 7 HOH 94  1046 234 HOH HOH B . 
K 7 HOH 95  1047 241 HOH HOH B . 
K 7 HOH 96  1048 280 HOH HOH B . 
K 7 HOH 97  1049 281 HOH HOH B . 
K 7 HOH 98  1050 282 HOH HOH B . 
K 7 HOH 99  1051 283 HOH HOH B . 
K 7 HOH 100 1052 284 HOH HOH B . 
K 7 HOH 101 1053 286 HOH HOH B . 
K 7 HOH 102 1054 287 HOH HOH B . 
K 7 HOH 103 1055 288 HOH HOH B . 
K 7 HOH 104 1056 289 HOH HOH B . 
K 7 HOH 105 1057 290 HOH HOH B . 
K 7 HOH 106 1058 291 HOH HOH B . 
K 7 HOH 107 1059 292 HOH HOH B . 
K 7 HOH 108 1060 293 HOH HOH B . 
K 7 HOH 109 1061 294 HOH HOH B . 
K 7 HOH 110 1062 295 HOH HOH B . 
K 7 HOH 111 1063 296 HOH HOH B . 
K 7 HOH 112 1064 297 HOH HOH B . 
K 7 HOH 113 1065 298 HOH HOH B . 
K 7 HOH 114 1066 299 HOH HOH B . 
K 7 HOH 115 1067 300 HOH HOH B . 
K 7 HOH 116 1068 301 HOH HOH B . 
K 7 HOH 117 1069 302 HOH HOH B . 
K 7 HOH 118 1070 303 HOH HOH B . 
K 7 HOH 119 1071 304 HOH HOH B . 
K 7 HOH 120 1072 305 HOH HOH B . 
K 7 HOH 121 1073 306 HOH HOH B . 
K 7 HOH 122 1074 307 HOH HOH B . 
K 7 HOH 123 1075 308 HOH HOH B . 
K 7 HOH 124 1076 309 HOH HOH B . 
K 7 HOH 125 1077 311 HOH HOH B . 
K 7 HOH 126 1078 312 HOH HOH B . 
K 7 HOH 127 1079 313 HOH HOH B . 
K 7 HOH 128 1080 314 HOH HOH B . 
K 7 HOH 129 1081 315 HOH HOH B . 
K 7 HOH 130 1082 316 HOH HOH B . 
K 7 HOH 131 1083 317 HOH HOH B . 
K 7 HOH 132 1084 318 HOH HOH B . 
K 7 HOH 133 1085 319 HOH HOH B . 
K 7 HOH 134 1086 320 HOH HOH B . 
K 7 HOH 135 1087 322 HOH HOH B . 
K 7 HOH 136 1088 325 HOH HOH B . 
K 7 HOH 137 1089 329 HOH HOH B . 
K 7 HOH 138 1090 330 HOH HOH B . 
K 7 HOH 139 1091 340 HOH HOH B . 
K 7 HOH 140 1092 344 HOH HOH B . 
K 7 HOH 141 1093 348 HOH HOH B . 
K 7 HOH 142 1094 350 HOH HOH B . 
K 7 HOH 143 1095 351 HOH HOH B . 
K 7 HOH 144 1096 352 HOH HOH B . 
K 7 HOH 145 1097 353 HOH HOH B . 
K 7 HOH 146 1098 358 HOH HOH B . 
K 7 HOH 147 1099 360 HOH HOH B . 
K 7 HOH 148 1100 363 HOH HOH B . 
K 7 HOH 149 1101 366 HOH HOH B . 
K 7 HOH 150 1102 367 HOH HOH B . 
K 7 HOH 151 1103 368 HOH HOH B . 
K 7 HOH 152 1104 372 HOH HOH B . 
K 7 HOH 153 1105 374 HOH HOH B . 
K 7 HOH 154 1106 375 HOH HOH B . 
K 7 HOH 155 1107 377 HOH HOH B . 
K 7 HOH 156 1108 379 HOH HOH B . 
K 7 HOH 157 1109 380 HOH HOH B . 
K 7 HOH 158 1110 383 HOH HOH B . 
K 7 HOH 159 1111 386 HOH HOH B . 
K 7 HOH 160 1112 387 HOH HOH B . 
K 7 HOH 161 1113 391 HOH HOH B . 
K 7 HOH 162 1114 392 HOH HOH B . 
K 7 HOH 163 1115 398 HOH HOH B . 
K 7 HOH 164 1116 399 HOH HOH B . 
K 7 HOH 165 1117 400 HOH HOH B . 
K 7 HOH 166 1118 402 HOH HOH B . 
K 7 HOH 167 1119 403 HOH HOH B . 
K 7 HOH 168 1120 404 HOH HOH B . 
K 7 HOH 169 1121 405 HOH HOH B . 
K 7 HOH 170 1122 408 HOH HOH B . 
K 7 HOH 171 1123 409 HOH HOH B . 
K 7 HOH 172 1124 411 HOH HOH B . 
K 7 HOH 173 1125 413 HOH HOH B . 
K 7 HOH 174 1126 415 HOH HOH B . 
K 7 HOH 175 1127 418 HOH HOH B . 
K 7 HOH 176 1128 419 HOH HOH B . 
K 7 HOH 177 1129 420 HOH HOH B . 
K 7 HOH 178 1130 421 HOH HOH B . 
K 7 HOH 179 1131 422 HOH HOH B . 
K 7 HOH 180 1132 425 HOH HOH B . 
K 7 HOH 181 1133 426 HOH HOH B . 
K 7 HOH 182 1134 428 HOH HOH B . 
K 7 HOH 183 1135 429 HOH HOH B . 
K 7 HOH 184 1136 430 HOH HOH B . 
K 7 HOH 185 1137 431 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 350 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 350 B ASN 350 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-07-18 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Advisory                    
5 4 'Structure model' 'Atomic model'              
6 4 'Structure model' 'Data collection'           
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' database_PDB_caveat           
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' pdbx_validate_chiral          
15 4 'Structure model' struct_asym                   
16 4 'Structure model' struct_conn                   
17 4 'Structure model' struct_site                   
18 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.auth_asym_id'                
2  4 'Structure model' '_atom_site.auth_seq_id'                 
3  4 'Structure model' '_atom_site.label_asym_id'               
4  4 'Structure model' '_atom_site.label_entity_id'             
5  4 'Structure model' '_chem_comp.name'                        
6  4 'Structure model' '_chem_comp.type'                        
7  4 'Structure model' '_entity.formula_weight'                 
8  4 'Structure model' '_entity.pdbx_description'               
9  4 'Structure model' '_entity.pdbx_number_of_molecules'       
10 4 'Structure model' '_entity.type'                           
11 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
12 4 'Structure model' '_pdbx_validate_chiral.auth_asym_id'     
13 4 'Structure model' '_pdbx_validate_chiral.auth_seq_id'      
14 4 'Structure model' '_struct_conn.pdbx_dist_value'           
15 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
16 4 'Structure model' '_struct_conn.pdbx_role'                 
17 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
24 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
25 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
28 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'       
29 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 27.6871 11.9343 16.5122  -.3463 -.3992 -.2396 -.0007 .0111 .0570  1.1599 .7728  2.2231 -.3357 .2807 -.6472 -.1245 
.0581 .0070  .0331 -.0247 -.0402 .2681 .0063 .1492 'X-RAY DIFFRACTION' 
2 ? refined 7.8311  4.7736  -40.6145 -.3033 -.3095 -.2226 .0264  .0086 -.0699 .6821  1.1348 2.8081 -.0666 .2385 .7727  .1386  
.0940 -.0524 .0779 -.1612 .1681  .2544 .0561 .0226 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 3 A 3 A 542 A 542 ? 'X-RAY DIFFRACTION' ? 
2 2 B 4 B 4 B 543 B 543 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
ADSC      'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              246 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              246 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              246 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.06 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.24 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 67.76   -1.52   
2  1 ALA A 62  ? ? -107.24 48.75   
3  1 SER A 203 ? ? 63.48   -121.14 
4  1 ASP A 306 ? ? -140.58 -82.83  
5  1 ASP A 323 ? ? -100.99 47.25   
6  1 TYR A 341 ? ? -99.07  32.90   
7  1 VAL A 407 ? ? -130.25 -61.75  
8  1 ALA B 62  ? ? -114.63 50.19   
9  1 SER B 203 ? ? 66.82   -125.18 
10 1 ASP B 306 ? ? -123.65 -83.57  
11 1 ASP B 323 ? ? -98.63  43.81   
12 1 VAL B 407 ? ? -125.65 -63.90  
13 1 SER B 495 ? ? -80.51  -113.99 
14 1 SER B 497 ? ? -168.10 -77.40  
15 1 SER B 541 ? ? -91.08  48.62   
16 1 ALA B 542 ? ? 168.57  -63.58  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    496 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   SER 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    497 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -142.05 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    C 
_pdbx_validate_chiral.auth_comp_id    FUC 
_pdbx_validate_chiral.auth_seq_id     2 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 496 ? CG  ? A LYS 496 CG  
2  1 Y 1 A LYS 496 ? CD  ? A LYS 496 CD  
3  1 Y 1 A LYS 496 ? CE  ? A LYS 496 CE  
4  1 Y 1 A LYS 496 ? NZ  ? A LYS 496 NZ  
5  1 Y 1 B ARG 493 ? CG  ? B ARG 493 CG  
6  1 Y 1 B ARG 493 ? CD  ? B ARG 493 CD  
7  1 Y 1 B ARG 493 ? NE  ? B ARG 493 NE  
8  1 Y 1 B ARG 493 ? CZ  ? B ARG 493 CZ  
9  1 Y 1 B ARG 493 ? NH1 ? B ARG 493 NH1 
10 1 Y 1 B ARG 493 ? NH2 ? B ARG 493 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 259 ? A PRO 259 
2  1 Y 1 A GLY 260 ? A GLY 260 
3  1 Y 1 A GLY 261 ? A GLY 261 
4  1 Y 1 A ALA 262 ? A ALA 262 
5  1 Y 1 A GLY 263 ? A GLY 263 
6  1 Y 1 A GLY 264 ? A GLY 264 
7  1 Y 1 A THR 543 ? A THR 543 
8  1 Y 1 B GLU 1   ? B GLU 1   
9  1 Y 1 B GLY 2   ? B GLY 2   
10 1 Y 1 B ARG 3   ? B ARG 3   
11 1 Y 1 B PRO 259 ? B PRO 259 
12 1 Y 1 B GLY 260 ? B GLY 260 
13 1 Y 1 B GLY 261 ? B GLY 261 
14 1 Y 1 B ALA 262 ? B ALA 262 
15 1 Y 1 B GLY 263 ? B GLY 263 
16 1 Y 1 B GLY 264 ? B GLY 264 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 C NAG 501 n 
C 2 FUC 2 C FUC 2 C FUC 502 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 LFucpa1-6DGlcpNAcb1-                                                 'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-2/a6-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(6+1)][b-L-Fucp]{}}}'                      LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  FUC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O6 
_pdbx_entity_branch_link.leaving_atom_id_2          HO6 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 FUC 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose                               NAG 
4 'M-(N,N,N-TRIMETHYLAMMONIO)-2,2,2-TRIFLUORO-1,1-DIHYDROXYETHYLBENZENE' NAF 
5 'HEXAETHYLENE GLYCOL'                                                  P6G 
6 'TETRAETHYLENE GLYCOL'                                                 PG4 
7 water                                                                  HOH 
#