data_2HA0
# 
_entry.id   2HA0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.339 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HA0         
RCSB  RCSB038116   
WWPDB D_1000038116 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1J06 'apo mACHE' unspecified 
PDB 2H9Y .           unspecified 
PDB 2HA2 .           unspecified 
PDB 2HA3 .           unspecified 
PDB 2HA4 .           unspecified 
PDB 2HA5 .           unspecified 
PDB 2HA6 .           unspecified 
PDB 2HA7 .           unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HA0 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, Y.'       1 
'Radic, Z.'        2 
'Sulzenbacher, G.' 3 
'Kim, E.'          4 
'Taylor, P.'       5 
'Marchot, P.'      6 
# 
_citation.id                        primary 
_citation.title                     
;Substrate and product trafficking through the active center gorge of acetylcholinesterase analyzed by crystallography and equilibrium binding
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                29256 
_citation.page_last                 29267 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16837465 
_citation.pdbx_database_id_DOI      10.1074/jbc.M603018200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bourne, Y.'       1 ? 
primary 'Radic, Z.'        2 ? 
primary 'Sulzenbacher, G.' 3 ? 
primary 'Kim, E.'          4 ? 
primary 'Taylor, P.'       5 ? 
primary 'Marchot, P.'      6 ? 
# 
_cell.entry_id           2HA0 
_cell.length_a           79.228 
_cell.length_b           111.795 
_cell.length_c           226.940 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HA0 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                                  59764.488 2   3.1.1.7 ? 'catalytic domain' 
? 
2 branched    man 'alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose' 367.349   1   ?       ? ?                  
? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                              221.208   2   ?       ? ?                  
? 
4 non-polymer syn 'IODIDE ION'                                                          126.904   14  ?       ? ?                  
? 
5 non-polymer syn 4,4-DIHYDROXY-N,N,N-TRIMETHYLPENTAN-1-AMINIUM                         162.250   2   ?       ? ?                  
? 
6 non-polymer syn N,N,N-TRIMETHYL-4-OXOPENTAN-1-AMINIUM                                 144.235   2   ?       ? ?                  
? 
7 non-polymer syn 'HEXAETHYLENE GLYCOL'                                                 282.331   1   ?       ? ?                  
? 
8 water       nat water                                                                 18.015    632 ?       ? ?                  
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     Homo 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              'LAMBDA ZAP' 
_entity_src_gen.pdbx_host_org_cell_line            'HEK 293' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'HUMAN EMBRYONIC KIDNEY CELLS (HEK)' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           32 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HA0 A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 2HA0 B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                       ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                      ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                    ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'     133.103 
CHH non-polymer                   . N,N,N-TRIMETHYL-4-OXOPENTAN-1-AMINIUM         4-KETOAMYLTRIMETHYLAMMONIUM 'C8 H18 N O 1'   
144.235 
CYS 'L-peptide linking'           y CYSTEINE                                      ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                          
'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                     ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                       ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                     ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                         ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                    ? 'C6 H13 N O2'    131.173 
IOD non-polymer                   . 'IODIDE ION'                                  ? 'I -1'           126.904 
LEU 'L-peptide linking'           y LEUCINE                                       ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                        ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                    ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose      
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
NWA non-polymer                   . 4,4-DIHYDROXY-N,N,N-TRIMETHYLPENTAN-1-AMINIUM ? 'C8 H20 N O2 1'  162.250 
P6G non-polymer                   . 'HEXAETHYLENE GLYCOL'                         'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     
282.331 
PHE 'L-peptide linking'           y PHENYLALANINE                                 ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                       ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                        ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                     ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                      ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                        ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2HA0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.20 
_exptl_crystal.density_percent_sol   70.72 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
'25-32% PEG550 MME or PEG600, 60-100mM HEPES or Na acetate, pH 6.5-8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2003-04-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     2HA0 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             30 
_reflns.number_all                   ? 
_reflns.number_obs                   102641 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.065 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.9 
_reflns.B_iso_Wilson_estimate        41.1 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 2HA0 
_refine.ls_number_reflns_obs                     98944 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.00 
_refine.ls_R_factor_obs                          0.18319 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18249 
_refine.ls_R_factor_R_free                       0.21871 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  2015 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               .961 
_refine.correlation_coeff_Fo_to_Fc_free          .942 
_refine.B_iso_mean                               45.352 
_refine.aniso_B[1][1]                            3.00 
_refine.aniso_B[2][2]                            2.77 
_refine.aniso_B[3][3]                            -5.78 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             .80 
_refine.pdbx_solvent_shrinkage_radii             .80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1J06 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       .156 
_refine.pdbx_overall_ESU_R_Free                  .148 
_refine.overall_SU_ML                            .115 
_refine.overall_SU_B                             8.426 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8358 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         125 
_refine_hist.number_atoms_solvent             632 
_refine_hist.number_atoms_total               9115 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             .010   .022   ? 8785  'X-RAY DIFFRACTION' ? 
r_bond_other_d               .001   .020   ? 5988  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.280  1.969  ? 12001 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            .956   3.002  ? 14427 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.373  5.000  ? 1067  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.959 22.680 ? 403   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.972 15.000 ? 1282  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.240 15.000 ? 78    'X-RAY DIFFRACTION' ? 
r_chiral_restr               .097   .200   ? 1302  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         .004   .020   ? 9783  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           .001   .020   ? 1885  'X-RAY DIFFRACTION' ? 
r_nbd_refined                .200   .200   ? 1786  'X-RAY DIFFRACTION' ? 
r_nbd_other                  .193   .200   ? 6222  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              .178   .200   ? 4249  'X-RAY DIFFRACTION' ? 
r_nbtor_other                .086   .200   ? 4394  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        .169   .200   ? 477   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          .319   .200   ? 1     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       .084   .200   ? 8     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         .301   .200   ? 59    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     .153   .200   ? 25    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  .583   1.500  ? 5382  'X-RAY DIFFRACTION' ? 
r_mcbond_other               .107   1.500  ? 2146  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.018  2.000  ? 8647  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.491  3.000  ? 3781  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.481  4.500  ? 3354  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.257 
_refine_ls_shell.number_reflns_R_work             6318 
_refine_ls_shell.R_factor_R_work                  0.239 
_refine_ls_shell.percent_reflns_obs               99.32 
_refine_ls_shell.R_factor_R_free                  0.291 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             140 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HA0 
_struct.title                     'Crystal structure of mouse acetylcholinesterase complexed with 4-ketoamyltrimethylammonium' 
_struct.pdbx_descriptor           'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HA0 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'HYDROLASE FOLD, SERINE ESTERASE, ACETYLCHOLINESTERASE, HOMODIMER, GLYCOSYLATED PROTEIN, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 6 ? 
N N N 7 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
U N N 4 ? 
V N N 4 ? 
W N N 5 ? 
X N N 6 ? 
Y N N 8 ? 
Z N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 274 ? ASN A 265 ARG A 274 1 ? 10 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASN A 464 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P24 24 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 ARG A 534 ? THR A 543 ? ARG A 534 THR A 543 1 ? 10 
HELX_P HELX_P27 27 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P28 28 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SER B 203 ? LEU B 214 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 36 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P37 37 SER B 240 ? GLY B 256 ? SER B 240 GLY B 256 1 ? 17 
HELX_P HELX_P38 38 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 39 PRO B 277 ? HIS B 284 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P40 40 GLU B 285 ? LEU B 289 ? GLU B 285 LEU B 289 5 ? 5  
HELX_P HELX_P41 41 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 43 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 456 ? ASN B 464 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P50 50 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 ARG B 534 ? THR B 543 ? ARG B 534 THR B 543 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96   1_555 ? ? ? ? ? ? ? 2.058 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272  1_555 ? ? ? ? ? ? ? 2.106 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529  1_555 ? ? ? ? ? ? ? 2.065 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96   1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272  1_555 ? ? ? ? ? ? ? 2.077 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529  1_555 ? ? ? ? ? ? ? 2.062 ? ?               
covale1 covale one  ? A SER 203 OG  ? ? ? 1_555 L NWA .   C5 ? ? A SER 203 A NWA 709  1_555 ? ? ? ? ? ? ? 1.392 ? ?               
covale2 covale one  ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1    1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
covale3 covale one  ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 701  1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation 
covale4 covale one  ? B SER 203 OG  ? ? ? 1_555 W NWA .   C5 ? ? B SER 203 B NWA 1609 1_555 ? ? ? ? ? ? ? 1.443 ? ?               
covale5 covale one  ? B ASN 350 ND2 ? ? ? 1_555 O NAG .   C1 ? ? B ASN 350 B NAG 1601 1_555 ? ? ? ? ? ? ? 1.469 ? N-Glycosylation 
covale6 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 2    1_555 ? ? ? ? ? ? ? 1.447 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -5.86 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 -2.02 
3 CYS 257 B . ? CYS 257 B PRO 258 B ? PRO 258 B 1 -8.23 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 3  ? 
E ? 11 ? 
F ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? parallel      
E 5  6  ? parallel      
E 6  7  ? parallel      
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? parallel      
E 10 11 ? anti-parallel 
F 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
A 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
A 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
B 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
B 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
B 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
B 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
B 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
B 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
B 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
B 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
B 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
B 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
B 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
C 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
C 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
D 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
D 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
D 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
E 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
E 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
E 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
E 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
E 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
E 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
E 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
E 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
E 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
E 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
E 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
F 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
F 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 10  ? N VAL A 10  O LEU A 17  ? O LEU A 17  
A 2  3  N GLN A 16  ? N GLN A 16  O LEU A 60  ? O LEU A 60  
B 1  2  N LEU A 22  ? N LEU A 22  O VAL A 29  ? O VAL A 29  
B 2  3  N PHE A 32  ? N PHE A 32  O VAL A 101 ? O VAL A 101 
B 3  4  N ASN A 100 ? N ASN A 100 O SER A 148 ? O SER A 148 
B 4  5  O VAL A 147 ? O VAL A 147 N TRP A 117 ? N TRP A 117 
B 5  6  N VAL A 114 ? N VAL A 114 O SER A 196 ? O SER A 196 
B 6  7  N GLY A 201 ? N GLY A 201 O GLN A 228 ? O GLN A 228 
B 7  8  N LEU A 227 ? N LEU A 227 O LEU A 327 ? O LEU A 327 
B 8  9  N VAL A 328 ? N VAL A 328 O TYR A 426 ? O TYR A 426 
B 9  10 N ILE A 429 ? N ILE A 429 O LEU A 513 ? O LEU A 513 
B 10 11 N TYR A 510 ? N TYR A 510 O ARG A 521 ? O ARG A 521 
C 1  2  N VAL A 68  ? N VAL A 68  O SER A 93  ? O SER A 93  
D 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
D 2  3  N GLN B 16  ? N GLN B 16  O LEU B 60  ? O LEU B 60  
E 1  2  N ILE B 20  ? N ILE B 20  O ALA B 31  ? O ALA B 31  
E 2  3  N PHE B 32  ? N PHE B 32  O VAL B 101 ? O VAL B 101 
E 3  4  N ASN B 100 ? N ASN B 100 O SER B 148 ? O SER B 148 
E 4  5  O VAL B 147 ? O VAL B 147 N TRP B 117 ? N TRP B 117 
E 5  6  N ILE B 116 ? N ILE B 116 O THR B 198 ? O THR B 198 
E 6  7  N GLY B 201 ? N GLY B 201 O GLN B 228 ? O GLN B 228 
E 7  8  N LEU B 227 ? N LEU B 227 O LEU B 327 ? O LEU B 327 
E 8  9  N VAL B 330 ? N VAL B 330 O PHE B 430 ? O PHE B 430 
E 9  10 N ILE B 429 ? N ILE B 429 O LEU B 513 ? O LEU B 513 
E 10 11 N TYR B 510 ? N TYR B 510 O ARG B 521 ? O ARG B 521 
F 1  2  N VAL B 68  ? N VAL B 68  O SER B 93  ? O SER B 93  
# 
_database_PDB_matrix.entry_id          2HA0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HA0 
_atom_sites.fract_transf_matrix[1][1]   0.012622 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008945 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004406 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 3   ? 26.438  16.609  57.356  1.00 78.17  ? 3    ARG A N   1 
ATOM   2    C CA  . ARG A 1 3   ? 25.719  17.947  57.169  1.00 79.41  ? 3    ARG A CA  1 
ATOM   3    C C   . ARG A 1 3   ? 25.286  18.360  55.744  1.00 77.48  ? 3    ARG A C   1 
ATOM   4    O O   . ARG A 1 3   ? 24.657  19.404  55.573  1.00 78.08  ? 3    ARG A O   1 
ATOM   5    C CB  . ARG A 1 3   ? 26.537  19.106  57.771  1.00 80.76  ? 3    ARG A CB  1 
ATOM   6    C CG  . ARG A 1 3   ? 26.465  19.186  59.312  1.00 84.20  ? 3    ARG A CG  1 
ATOM   7    C CD  . ARG A 1 3   ? 26.117  20.585  59.801  1.00 86.08  ? 3    ARG A CD  1 
ATOM   8    N NE  . ARG A 1 3   ? 25.932  20.639  61.254  1.00 88.58  ? 3    ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 3   ? 24.843  20.233  61.917  1.00 89.82  ? 3    ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 3   ? 23.794  19.702  61.289  1.00 89.43  ? 3    ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 3   ? 24.809  20.353  63.238  1.00 91.80  ? 3    ARG A NH2 1 
ATOM   12   N N   . GLU A 1 4   ? 25.606  17.546  54.743  1.00 75.44  ? 4    GLU A N   1 
ATOM   13   C CA  . GLU A 1 4   ? 25.226  17.808  53.364  1.00 73.43  ? 4    GLU A CA  1 
ATOM   14   C C   . GLU A 1 4   ? 24.272  16.737  52.862  1.00 71.64  ? 4    GLU A C   1 
ATOM   15   O O   . GLU A 1 4   ? 24.076  15.729  53.524  1.00 72.04  ? 4    GLU A O   1 
ATOM   16   C CB  . GLU A 1 4   ? 26.460  17.860  52.473  1.00 72.75  ? 4    GLU A CB  1 
ATOM   17   C CG  . GLU A 1 4   ? 27.467  16.750  52.701  1.00 74.25  ? 4    GLU A CG  1 
ATOM   18   C CD  . GLU A 1 4   ? 28.574  16.792  51.675  1.00 75.34  ? 4    GLU A CD  1 
ATOM   19   O OE1 . GLU A 1 4   ? 28.263  16.653  50.470  1.00 76.16  ? 4    GLU A OE1 1 
ATOM   20   O OE2 . GLU A 1 4   ? 29.744  16.968  52.076  1.00 77.25  ? 4    GLU A OE2 1 
ATOM   21   N N   . ASP A 1 5   ? 23.688  16.967  51.685  1.00 69.39  ? 5    ASP A N   1 
ATOM   22   C CA  . ASP A 1 5   ? 22.616  16.123  51.147  1.00 67.87  ? 5    ASP A CA  1 
ATOM   23   C C   . ASP A 1 5   ? 23.095  14.684  51.007  1.00 66.83  ? 5    ASP A C   1 
ATOM   24   O O   . ASP A 1 5   ? 23.927  14.395  50.145  1.00 65.10  ? 5    ASP A O   1 
ATOM   25   C CB  . ASP A 1 5   ? 22.134  16.656  49.793  1.00 66.49  ? 5    ASP A CB  1 
ATOM   26   C CG  . ASP A 1 5   ? 20.910  15.911  49.255  1.00 65.94  ? 5    ASP A CG  1 
ATOM   27   O OD1 . ASP A 1 5   ? 20.609  14.799  49.723  1.00 65.45  ? 5    ASP A OD1 1 
ATOM   28   O OD2 . ASP A 1 5   ? 20.245  16.437  48.341  1.00 64.34  ? 5    ASP A OD2 1 
ATOM   29   N N   . PRO A 1 6   ? 22.548  13.766  51.839  1.00 67.32  ? 6    PRO A N   1 
ATOM   30   C CA  . PRO A 1 6   ? 23.029  12.375  51.860  1.00 66.70  ? 6    PRO A CA  1 
ATOM   31   C C   . PRO A 1 6   ? 22.742  11.631  50.559  1.00 65.00  ? 6    PRO A C   1 
ATOM   32   O O   . PRO A 1 6   ? 23.367  10.613  50.257  1.00 64.40  ? 6    PRO A O   1 
ATOM   33   C CB  . PRO A 1 6   ? 22.234  11.756  53.024  1.00 68.59  ? 6    PRO A CB  1 
ATOM   34   C CG  . PRO A 1 6   ? 20.984  12.573  53.099  1.00 68.93  ? 6    PRO A CG  1 
ATOM   35   C CD  . PRO A 1 6   ? 21.424  13.966  52.778  1.00 68.53  ? 6    PRO A CD  1 
ATOM   36   N N   . GLN A 1 7   ? 21.811  12.166  49.783  1.00 64.04  ? 7    GLN A N   1 
ATOM   37   C CA  . GLN A 1 7   ? 21.347  11.518  48.576  1.00 62.66  ? 7    GLN A CA  1 
ATOM   38   C C   . GLN A 1 7   ? 22.230  11.877  47.385  1.00 59.99  ? 7    GLN A C   1 
ATOM   39   O O   . GLN A 1 7   ? 21.965  11.420  46.294  1.00 59.47  ? 7    GLN A O   1 
ATOM   40   C CB  . GLN A 1 7   ? 19.863  11.866  48.342  1.00 63.89  ? 7    GLN A CB  1 
ATOM   41   C CG  . GLN A 1 7   ? 19.038  11.808  49.662  1.00 67.29  ? 7    GLN A CG  1 
ATOM   42   C CD  . GLN A 1 7   ? 17.548  11.497  49.496  1.00 71.61  ? 7    GLN A CD  1 
ATOM   43   O OE1 . GLN A 1 7   ? 16.758  12.355  49.072  1.00 73.42  ? 7    GLN A OE1 1 
ATOM   44   N NE2 . GLN A 1 7   ? 17.149  10.275  49.889  1.00 72.77  ? 7    GLN A NE2 1 
ATOM   45   N N   . LEU A 1 8   ? 23.300  12.650  47.606  1.00 58.24  ? 8    LEU A N   1 
ATOM   46   C CA  . LEU A 1 8   ? 24.215  13.064  46.539  1.00 56.11  ? 8    LEU A CA  1 
ATOM   47   C C   . LEU A 1 8   ? 25.635  12.514  46.680  1.00 55.24  ? 8    LEU A C   1 
ATOM   48   O O   . LEU A 1 8   ? 26.529  12.939  45.960  1.00 54.45  ? 8    LEU A O   1 
ATOM   49   C CB  . LEU A 1 8   ? 24.276  14.601  46.467  1.00 55.99  ? 8    LEU A CB  1 
ATOM   50   C CG  . LEU A 1 8   ? 23.003  15.272  45.946  1.00 55.59  ? 8    LEU A CG  1 
ATOM   51   C CD1 . LEU A 1 8   ? 23.083  16.791  46.075  1.00 54.78  ? 8    LEU A CD1 1 
ATOM   52   C CD2 . LEU A 1 8   ? 22.757  14.849  44.502  1.00 54.18  ? 8    LEU A CD2 1 
ATOM   53   N N   . LEU A 1 9   ? 25.836  11.563  47.587  1.00 55.51  ? 9    LEU A N   1 
ATOM   54   C CA  . LEU A 1 9   ? 27.164  11.020  47.887  1.00 55.17  ? 9    LEU A CA  1 
ATOM   55   C C   . LEU A 1 9   ? 27.217  9.570   47.418  1.00 54.44  ? 9    LEU A C   1 
ATOM   56   O O   . LEU A 1 9   ? 26.378  8.762   47.823  1.00 54.27  ? 9    LEU A O   1 
ATOM   57   C CB  . LEU A 1 9   ? 27.457  11.099  49.395  1.00 56.52  ? 9    LEU A CB  1 
ATOM   58   C CG  . LEU A 1 9   ? 27.396  12.487  50.059  1.00 58.20  ? 9    LEU A CG  1 
ATOM   59   C CD1 . LEU A 1 9   ? 27.497  12.409  51.609  1.00 58.93  ? 9    LEU A CD1 1 
ATOM   60   C CD2 . LEU A 1 9   ? 28.481  13.399  49.480  1.00 58.58  ? 9    LEU A CD2 1 
ATOM   61   N N   . VAL A 1 10  ? 28.199  9.262   46.571  1.00 53.14  ? 10   VAL A N   1 
ATOM   62   C CA  . VAL A 1 10  ? 28.297  7.981   45.884  1.00 53.21  ? 10   VAL A CA  1 
ATOM   63   C C   . VAL A 1 10  ? 29.785  7.584   45.728  1.00 52.79  ? 10   VAL A C   1 
ATOM   64   O O   . VAL A 1 10  ? 30.664  8.445   45.544  1.00 53.22  ? 10   VAL A O   1 
ATOM   65   C CB  . VAL A 1 10  ? 27.602  8.061   44.485  1.00 52.14  ? 10   VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 10  ? 28.016  6.934   43.586  1.00 53.64  ? 10   VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 10  ? 26.079  8.045   44.633  1.00 53.69  ? 10   VAL A CG2 1 
ATOM   68   N N   . ARG A 1 11  ? 30.063  6.289   45.816  1.00 52.12  ? 11   ARG A N   1 
ATOM   69   C CA  . ARG A 1 11  ? 31.406  5.770   45.623  1.00 51.24  ? 11   ARG A CA  1 
ATOM   70   C C   . ARG A 1 11  ? 31.462  4.993   44.316  1.00 50.42  ? 11   ARG A C   1 
ATOM   71   O O   . ARG A 1 11  ? 30.545  4.208   44.010  1.00 50.06  ? 11   ARG A O   1 
ATOM   72   C CB  . ARG A 1 11  ? 31.789  4.850   46.776  1.00 52.71  ? 11   ARG A CB  1 
ATOM   73   C CG  . ARG A 1 11  ? 33.144  4.177   46.603  1.00 52.96  ? 11   ARG A CG  1 
ATOM   74   C CD  . ARG A 1 11  ? 33.540  3.425   47.814  1.00 54.55  ? 11   ARG A CD  1 
ATOM   75   N NE  . ARG A 1 11  ? 34.022  4.282   48.902  1.00 55.56  ? 11   ARG A NE  1 
ATOM   76   C CZ  . ARG A 1 11  ? 35.264  4.748   49.023  1.00 56.98  ? 11   ARG A CZ  1 
ATOM   77   N NH1 . ARG A 1 11  ? 35.585  5.495   50.071  1.00 58.90  ? 11   ARG A NH1 1 
ATOM   78   N NH2 . ARG A 1 11  ? 36.184  4.491   48.109  1.00 56.43  ? 11   ARG A NH2 1 
ATOM   79   N N   . VAL A 1 12  ? 32.536  5.225   43.557  1.00 49.18  ? 12   VAL A N   1 
ATOM   80   C CA  . VAL A 1 12  ? 32.875  4.438   42.372  1.00 48.65  ? 12   VAL A CA  1 
ATOM   81   C C   . VAL A 1 12  ? 34.282  3.842   42.548  1.00 49.49  ? 12   VAL A C   1 
ATOM   82   O O   . VAL A 1 12  ? 34.953  4.095   43.566  1.00 49.88  ? 12   VAL A O   1 
ATOM   83   C CB  . VAL A 1 12  ? 32.771  5.291   41.088  1.00 47.32  ? 12   VAL A CB  1 
ATOM   84   C CG1 . VAL A 1 12  ? 31.324  5.776   40.895  1.00 46.59  ? 12   VAL A CG1 1 
ATOM   85   C CG2 . VAL A 1 12  ? 33.721  6.502   41.157  1.00 46.77  ? 12   VAL A CG2 1 
ATOM   86   N N   . ARG A 1 13  ? 34.726  3.044   41.576  1.00 49.51  ? 13   ARG A N   1 
ATOM   87   C CA  . ARG A 1 13  ? 36.023  2.348   41.666  1.00 50.71  ? 13   ARG A CA  1 
ATOM   88   C C   . ARG A 1 13  ? 37.163  3.263   42.090  1.00 51.06  ? 13   ARG A C   1 
ATOM   89   O O   . ARG A 1 13  ? 38.037  2.862   42.857  1.00 52.37  ? 13   ARG A O   1 
ATOM   90   C CB  . ARG A 1 13  ? 36.391  1.685   40.329  1.00 50.31  ? 13   ARG A CB  1 
ATOM   91   C CG  . ARG A 1 13  ? 37.723  0.883   40.352  1.00 51.92  ? 13   ARG A CG  1 
ATOM   92   C CD  . ARG A 1 13  ? 37.683  -0.292  41.326  1.00 53.42  ? 13   ARG A CD  1 
ATOM   93   N NE  . ARG A 1 13  ? 38.950  -1.036  41.438  1.00 55.27  ? 13   ARG A NE  1 
ATOM   94   C CZ  . ARG A 1 13  ? 40.032  -0.600  42.086  1.00 56.96  ? 13   ARG A CZ  1 
ATOM   95   N NH1 . ARG A 1 13  ? 40.046  0.596   42.667  1.00 58.42  ? 13   ARG A NH1 1 
ATOM   96   N NH2 . ARG A 1 13  ? 41.128  -1.348  42.144  1.00 57.50  ? 13   ARG A NH2 1 
ATOM   97   N N   . GLY A 1 14  ? 37.142  4.492   41.594  1.00 50.16  ? 14   GLY A N   1 
ATOM   98   C CA  . GLY A 1 14  ? 38.191  5.450   41.864  1.00 50.57  ? 14   GLY A CA  1 
ATOM   99   C C   . GLY A 1 14  ? 38.065  6.227   43.159  1.00 51.52  ? 14   GLY A C   1 
ATOM   100  O O   . GLY A 1 14  ? 39.014  6.924   43.556  1.00 52.31  ? 14   GLY A O   1 
ATOM   101  N N   . GLY A 1 15  ? 36.905  6.144   43.813  1.00 51.31  ? 15   GLY A N   1 
ATOM   102  C CA  . GLY A 1 15  ? 36.701  6.842   45.078  1.00 51.84  ? 15   GLY A CA  1 
ATOM   103  C C   . GLY A 1 15  ? 35.343  7.485   45.232  1.00 51.16  ? 15   GLY A C   1 
ATOM   104  O O   . GLY A 1 15  ? 34.412  7.173   44.496  1.00 50.30  ? 15   GLY A O   1 
ATOM   105  N N   . GLN A 1 16  ? 35.244  8.382   46.207  1.00 51.82  ? 16   GLN A N   1 
ATOM   106  C CA  . GLN A 1 16  ? 33.976  9.019   46.571  1.00 52.00  ? 16   GLN A CA  1 
ATOM   107  C C   . GLN A 1 16  ? 33.699  10.233  45.719  1.00 50.62  ? 16   GLN A C   1 
ATOM   108  O O   . GLN A 1 16  ? 34.627  10.955  45.378  1.00 50.37  ? 16   GLN A O   1 
ATOM   109  C CB  . GLN A 1 16  ? 33.995  9.436   48.030  1.00 53.38  ? 16   GLN A CB  1 
ATOM   110  C CG  . GLN A 1 16  ? 33.751  8.285   48.957  1.00 55.26  ? 16   GLN A CG  1 
ATOM   111  C CD  . GLN A 1 16  ? 33.832  8.670   50.419  1.00 58.46  ? 16   GLN A CD  1 
ATOM   112  O OE1 . GLN A 1 16  ? 32.842  8.553   51.147  1.00 60.46  ? 16   GLN A OE1 1 
ATOM   113  N NE2 . GLN A 1 16  ? 35.020  9.113   50.867  1.00 59.67  ? 16   GLN A NE2 1 
ATOM   114  N N   . LEU A 1 17  ? 32.426  10.431  45.370  1.00 49.96  ? 17   LEU A N   1 
ATOM   115  C CA  . LEU A 1 17  ? 31.968  11.579  44.569  1.00 49.69  ? 17   LEU A CA  1 
ATOM   116  C C   . LEU A 1 17  ? 30.878  12.338  45.309  1.00 50.26  ? 17   LEU A C   1 
ATOM   117  O O   . LEU A 1 17  ? 30.159  11.746  46.101  1.00 50.62  ? 17   LEU A O   1 
ATOM   118  C CB  . LEU A 1 17  ? 31.352  11.108  43.249  1.00 48.84  ? 17   LEU A CB  1 
ATOM   119  C CG  . LEU A 1 17  ? 32.207  10.309  42.282  1.00 48.24  ? 17   LEU A CG  1 
ATOM   120  C CD1 . LEU A 1 17  ? 31.335  9.691   41.215  1.00 45.62  ? 17   LEU A CD1 1 
ATOM   121  C CD2 . LEU A 1 17  ? 33.265  11.209  41.674  1.00 49.68  ? 17   LEU A CD2 1 
ATOM   122  N N   . ARG A 1 18  ? 30.766  13.638  45.046  1.00 50.45  ? 18   ARG A N   1 
ATOM   123  C CA  . ARG A 1 18  ? 29.631  14.446  45.495  1.00 51.78  ? 18   ARG A CA  1 
ATOM   124  C C   . ARG A 1 18  ? 29.003  15.093  44.267  1.00 50.28  ? 18   ARG A C   1 
ATOM   125  O O   . ARG A 1 18  ? 29.671  15.844  43.574  1.00 49.72  ? 18   ARG A O   1 
ATOM   126  C CB  . ARG A 1 18  ? 30.066  15.543  46.482  1.00 52.65  ? 18   ARG A CB  1 
ATOM   127  C CG  . ARG A 1 18  ? 28.912  16.486  46.969  1.00 54.54  ? 18   ARG A CG  1 
ATOM   128  C CD  . ARG A 1 18  ? 29.391  17.612  47.936  1.00 57.74  ? 18   ARG A CD  1 
ATOM   129  N NE  . ARG A 1 18  ? 30.767  18.022  47.631  1.00 61.92  ? 18   ARG A NE  1 
ATOM   130  C CZ  . ARG A 1 18  ? 31.830  17.865  48.421  1.00 63.18  ? 18   ARG A CZ  1 
ATOM   131  N NH1 . ARG A 1 18  ? 31.732  17.352  49.648  1.00 64.69  ? 18   ARG A NH1 1 
ATOM   132  N NH2 . ARG A 1 18  ? 33.022  18.247  47.967  1.00 65.03  ? 18   ARG A NH2 1 
ATOM   133  N N   . GLY A 1 19  ? 27.739  14.773  43.993  1.00 50.12  ? 19   GLY A N   1 
ATOM   134  C CA  . GLY A 1 19  ? 26.999  15.351  42.874  1.00 49.99  ? 19   GLY A CA  1 
ATOM   135  C C   . GLY A 1 19  ? 26.181  16.558  43.308  1.00 51.16  ? 19   GLY A C   1 
ATOM   136  O O   . GLY A 1 19  ? 26.356  17.061  44.418  1.00 52.19  ? 19   GLY A O   1 
ATOM   137  N N   . ILE A 1 20  ? 25.283  17.005  42.434  1.00 51.45  ? 20   ILE A N   1 
ATOM   138  C CA  . ILE A 1 20  ? 24.443  18.180  42.691  1.00 52.91  ? 20   ILE A CA  1 
ATOM   139  C C   . ILE A 1 20  ? 22.993  17.881  42.319  1.00 53.14  ? 20   ILE A C   1 
ATOM   140  O O   . ILE A 1 20  ? 22.720  17.168  41.353  1.00 52.79  ? 20   ILE A O   1 
ATOM   141  C CB  . ILE A 1 20  ? 24.956  19.422  41.889  1.00 52.74  ? 20   ILE A CB  1 
ATOM   142  C CG1 . ILE A 1 20  ? 24.217  20.706  42.274  1.00 55.01  ? 20   ILE A CG1 1 
ATOM   143  C CG2 . ILE A 1 20  ? 24.834  19.196  40.388  1.00 51.60  ? 20   ILE A CG2 1 
ATOM   144  C CD1 . ILE A 1 20  ? 24.862  21.969  41.692  1.00 55.30  ? 20   ILE A CD1 1 
ATOM   145  N N   . ARG A 1 21  ? 22.075  18.437  43.098  1.00 54.72  ? 21   ARG A N   1 
ATOM   146  C CA  . ARG A 1 21  ? 20.649  18.320  42.850  1.00 55.69  ? 21   ARG A CA  1 
ATOM   147  C C   . ARG A 1 21  ? 20.246  19.433  41.880  1.00 55.65  ? 21   ARG A C   1 
ATOM   148  O O   . ARG A 1 21  ? 20.352  20.617  42.214  1.00 55.98  ? 21   ARG A O   1 
ATOM   149  C CB  . ARG A 1 21  ? 19.892  18.435  44.179  1.00 57.37  ? 21   ARG A CB  1 
ATOM   150  C CG  . ARG A 1 21  ? 18.385  18.249  44.096  1.00 60.01  ? 21   ARG A CG  1 
ATOM   151  C CD  . ARG A 1 21  ? 17.696  18.542  45.438  1.00 64.74  ? 21   ARG A CD  1 
ATOM   152  N NE  . ARG A 1 21  ? 16.346  19.070  45.241  1.00 67.72  ? 21   ARG A NE  1 
ATOM   153  C CZ  . ARG A 1 21  ? 15.336  18.996  46.114  1.00 71.69  ? 21   ARG A CZ  1 
ATOM   154  N NH1 . ARG A 1 21  ? 15.478  18.405  47.299  1.00 73.40  ? 21   ARG A NH1 1 
ATOM   155  N NH2 . ARG A 1 21  ? 14.153  19.524  45.792  1.00 72.90  ? 21   ARG A NH2 1 
ATOM   156  N N   . LEU A 1 22  ? 19.805  19.048  40.680  1.00 55.08  ? 22   LEU A N   1 
ATOM   157  C CA  . LEU A 1 22  ? 19.394  20.003  39.648  1.00 55.14  ? 22   LEU A CA  1 
ATOM   158  C C   . LEU A 1 22  ? 17.883  20.031  39.537  1.00 56.83  ? 22   LEU A C   1 
ATOM   159  O O   . LEU A 1 22  ? 17.223  19.037  39.790  1.00 57.07  ? 22   LEU A O   1 
ATOM   160  C CB  . LEU A 1 22  ? 20.006  19.635  38.295  1.00 53.32  ? 22   LEU A CB  1 
ATOM   161  C CG  . LEU A 1 22  ? 21.540  19.677  38.237  1.00 52.12  ? 22   LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 22  ? 22.020  19.267  36.856  1.00 49.77  ? 22   LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 22  ? 22.072  21.055  38.610  1.00 50.53  ? 22   LEU A CD2 1 
ATOM   164  N N   . LYS A 1 23  ? 17.340  21.183  39.165  1.00 58.70  ? 23   LYS A N   1 
ATOM   165  C CA  . LYS A 1 23  ? 15.899  21.319  38.958  1.00 60.64  ? 23   LYS A CA  1 
ATOM   166  C C   . LYS A 1 23  ? 15.520  20.939  37.532  1.00 59.87  ? 23   LYS A C   1 
ATOM   167  O O   . LYS A 1 23  ? 16.044  21.501  36.578  1.00 58.57  ? 23   LYS A O   1 
ATOM   168  C CB  . LYS A 1 23  ? 15.452  22.756  39.242  1.00 62.39  ? 23   LYS A CB  1 
ATOM   169  C CG  . LYS A 1 23  ? 14.021  23.073  38.803  1.00 66.30  ? 23   LYS A CG  1 
ATOM   170  C CD  . LYS A 1 23  ? 13.584  24.459  39.272  1.00 71.16  ? 23   LYS A CD  1 
ATOM   171  C CE  . LYS A 1 23  ? 12.058  24.627  39.221  1.00 74.42  ? 23   LYS A CE  1 
ATOM   172  N NZ  . LYS A 1 23  ? 11.571  25.491  40.349  1.00 77.07  ? 23   LYS A NZ  1 
ATOM   173  N N   . ALA A 1 24  ? 14.623  19.966  37.397  1.00 60.50  ? 24   ALA A N   1 
ATOM   174  C CA  . ALA A 1 24  ? 13.936  19.733  36.136  1.00 60.51  ? 24   ALA A CA  1 
ATOM   175  C C   . ALA A 1 24  ? 12.488  20.178  36.337  1.00 62.18  ? 24   ALA A C   1 
ATOM   176  O O   . ALA A 1 24  ? 12.001  20.234  37.469  1.00 63.89  ? 24   ALA A O   1 
ATOM   177  C CB  . ALA A 1 24  ? 14.018  18.276  35.722  1.00 59.51  ? 24   ALA A CB  1 
ATOM   178  N N   . PRO A 1 25  ? 11.789  20.536  35.249  1.00 62.50  ? 25   PRO A N   1 
ATOM   179  C CA  . PRO A 1 25  ? 10.450  21.108  35.427  1.00 63.54  ? 25   PRO A CA  1 
ATOM   180  C C   . PRO A 1 25  ? 9.447   20.264  36.220  1.00 64.01  ? 25   PRO A C   1 
ATOM   181  O O   . PRO A 1 25  ? 8.610   20.823  36.918  1.00 65.96  ? 25   PRO A O   1 
ATOM   182  C CB  . PRO A 1 25  ? 9.979   21.306  33.990  1.00 63.74  ? 25   PRO A CB  1 
ATOM   183  C CG  . PRO A 1 25  ? 11.263  21.462  33.207  1.00 62.03  ? 25   PRO A CG  1 
ATOM   184  C CD  . PRO A 1 25  ? 12.185  20.499  33.830  1.00 61.59  ? 25   PRO A CD  1 
ATOM   185  N N   . GLY A 1 26  ? 9.512   18.944  36.110  1.00 62.63  ? 26   GLY A N   1 
ATOM   186  C CA  . GLY A 1 26  ? 8.613   18.064  36.877  1.00 63.17  ? 26   GLY A CA  1 
ATOM   187  C C   . GLY A 1 26  ? 9.161   17.609  38.227  1.00 63.01  ? 26   GLY A C   1 
ATOM   188  O O   . GLY A 1 26  ? 8.496   16.868  38.959  1.00 63.56  ? 26   GLY A O   1 
ATOM   189  N N   . GLY A 1 27  ? 10.382  18.033  38.558  1.00 61.70  ? 27   GLY A N   1 
ATOM   190  C CA  . GLY A 1 27  ? 11.009  17.658  39.830  1.00 61.34  ? 27   GLY A CA  1 
ATOM   191  C C   . GLY A 1 27  ? 12.519  17.662  39.774  1.00 59.11  ? 27   GLY A C   1 
ATOM   192  O O   . GLY A 1 27  ? 13.101  17.919  38.719  1.00 57.99  ? 27   GLY A O   1 
ATOM   193  N N   . PRO A 1 28  ? 13.171  17.363  40.913  1.00 58.58  ? 28   PRO A N   1 
ATOM   194  C CA  . PRO A 1 28  ? 14.640  17.323  40.956  1.00 56.78  ? 28   PRO A CA  1 
ATOM   195  C C   . PRO A 1 28  ? 15.245  16.100  40.266  1.00 54.94  ? 28   PRO A C   1 
ATOM   196  O O   . PRO A 1 28  ? 14.567  15.087  40.096  1.00 55.07  ? 28   PRO A O   1 
ATOM   197  C CB  . PRO A 1 28  ? 14.951  17.307  42.461  1.00 57.57  ? 28   PRO A CB  1 
ATOM   198  C CG  . PRO A 1 28  ? 13.746  16.691  43.092  1.00 59.41  ? 28   PRO A CG  1 
ATOM   199  C CD  . PRO A 1 28  ? 12.566  17.071  42.228  1.00 60.03  ? 28   PRO A CD  1 
ATOM   200  N N   . VAL A 1 29  ? 16.507  16.228  39.854  1.00 52.91  ? 29   VAL A N   1 
ATOM   201  C CA  . VAL A 1 29  ? 17.316  15.106  39.374  1.00 51.49  ? 29   VAL A CA  1 
ATOM   202  C C   . VAL A 1 29  ? 18.698  15.178  40.029  1.00 50.86  ? 29   VAL A C   1 
ATOM   203  O O   . VAL A 1 29  ? 19.093  16.234  40.542  1.00 50.64  ? 29   VAL A O   1 
ATOM   204  C CB  . VAL A 1 29  ? 17.476  15.083  37.820  1.00 50.43  ? 29   VAL A CB  1 
ATOM   205  C CG1 . VAL A 1 29  ? 16.113  15.074  37.127  1.00 50.74  ? 29   VAL A CG1 1 
ATOM   206  C CG2 . VAL A 1 29  ? 18.334  16.257  37.340  1.00 48.46  ? 29   VAL A CG2 1 
ATOM   207  N N   . SER A 1 30  ? 19.421  14.055  40.014  1.00 49.98  ? 30   SER A N   1 
ATOM   208  C CA  . SER A 1 30  ? 20.807  14.016  40.494  1.00 49.65  ? 30   SER A CA  1 
ATOM   209  C C   . SER A 1 30  ? 21.769  14.116  39.312  1.00 48.24  ? 30   SER A C   1 
ATOM   210  O O   . SER A 1 30  ? 21.589  13.448  38.307  1.00 48.34  ? 30   SER A O   1 
ATOM   211  C CB  . SER A 1 30  ? 21.129  12.722  41.262  1.00 50.15  ? 30   SER A CB  1 
ATOM   212  O OG  . SER A 1 30  ? 20.035  12.154  41.962  1.00 51.75  ? 30   SER A OG  1 
ATOM   213  N N   . ALA A 1 31  ? 22.822  14.911  39.456  1.00 47.78  ? 31   ALA A N   1 
ATOM   214  C CA  . ALA A 1 31  ? 23.810  15.068  38.408  1.00 46.32  ? 31   ALA A CA  1 
ATOM   215  C C   . ALA A 1 31  ? 25.194  14.840  38.999  1.00 46.24  ? 31   ALA A C   1 
ATOM   216  O O   . ALA A 1 31  ? 25.538  15.409  40.030  1.00 47.52  ? 31   ALA A O   1 
ATOM   217  C CB  . ALA A 1 31  ? 23.717  16.464  37.800  1.00 45.93  ? 31   ALA A CB  1 
ATOM   218  N N   . PHE A 1 32  ? 25.981  14.000  38.346  1.00 45.18  ? 32   PHE A N   1 
ATOM   219  C CA  . PHE A 1 32  ? 27.371  13.798  38.724  1.00 44.67  ? 32   PHE A CA  1 
ATOM   220  C C   . PHE A 1 32  ? 28.205  14.149  37.515  1.00 43.32  ? 32   PHE A C   1 
ATOM   221  O O   . PHE A 1 32  ? 28.309  13.360  36.598  1.00 43.04  ? 32   PHE A O   1 
ATOM   222  C CB  . PHE A 1 32  ? 27.580  12.358  39.165  1.00 44.53  ? 32   PHE A CB  1 
ATOM   223  C CG  . PHE A 1 32  ? 26.781  11.992  40.358  1.00 45.16  ? 32   PHE A CG  1 
ATOM   224  C CD1 . PHE A 1 32  ? 25.482  11.540  40.223  1.00 46.09  ? 32   PHE A CD1 1 
ATOM   225  C CD2 . PHE A 1 32  ? 27.325  12.094  41.627  1.00 46.38  ? 32   PHE A CD2 1 
ATOM   226  C CE1 . PHE A 1 32  ? 24.735  11.200  41.339  1.00 47.19  ? 32   PHE A CE1 1 
ATOM   227  C CE2 . PHE A 1 32  ? 26.599  11.744  42.739  1.00 47.71  ? 32   PHE A CE2 1 
ATOM   228  C CZ  . PHE A 1 32  ? 25.292  11.309  42.600  1.00 47.77  ? 32   PHE A CZ  1 
ATOM   229  N N   . LEU A 1 33  ? 28.763  15.358  37.520  1.00 43.15  ? 33   LEU A N   1 
ATOM   230  C CA  . LEU A 1 33  ? 29.366  15.976  36.341  1.00 42.07  ? 33   LEU A CA  1 
ATOM   231  C C   . LEU A 1 33  ? 30.863  16.114  36.537  1.00 41.98  ? 33   LEU A C   1 
ATOM   232  O O   . LEU A 1 33  ? 31.293  16.428  37.628  1.00 42.91  ? 33   LEU A O   1 
ATOM   233  C CB  . LEU A 1 33  ? 28.758  17.374  36.134  1.00 41.76  ? 33   LEU A CB  1 
ATOM   234  C CG  . LEU A 1 33  ? 27.232  17.459  35.996  1.00 41.57  ? 33   LEU A CG  1 
ATOM   235  C CD1 . LEU A 1 33  ? 26.792  18.931  35.874  1.00 40.74  ? 33   LEU A CD1 1 
ATOM   236  C CD2 . LEU A 1 33  ? 26.712  16.642  34.828  1.00 37.93  ? 33   LEU A CD2 1 
ATOM   237  N N   . GLY A 1 34  ? 31.651  15.865  35.499  1.00 41.89  ? 34   GLY A N   1 
ATOM   238  C CA  . GLY A 1 34  ? 33.112  15.969  35.598  1.00 42.49  ? 34   GLY A CA  1 
ATOM   239  C C   . GLY A 1 34  ? 33.828  14.832  36.300  1.00 43.54  ? 34   GLY A C   1 
ATOM   240  O O   . GLY A 1 34  ? 34.920  15.035  36.883  1.00 44.19  ? 34   GLY A O   1 
ATOM   241  N N   . ILE A 1 35  ? 33.280  13.621  36.200  1.00 43.40  ? 35   ILE A N   1 
ATOM   242  C CA  . ILE A 1 35  ? 33.931  12.432  36.779  1.00 43.63  ? 35   ILE A CA  1 
ATOM   243  C C   . ILE A 1 35  ? 35.062  11.942  35.872  1.00 44.53  ? 35   ILE A C   1 
ATOM   244  O O   . ILE A 1 35  ? 34.822  11.595  34.728  1.00 44.37  ? 35   ILE A O   1 
ATOM   245  C CB  . ILE A 1 35  ? 32.955  11.234  36.920  1.00 43.51  ? 35   ILE A CB  1 
ATOM   246  C CG1 . ILE A 1 35  ? 31.694  11.592  37.710  1.00 42.80  ? 35   ILE A CG1 1 
ATOM   247  C CG2 . ILE A 1 35  ? 33.661  10.041  37.586  1.00 42.40  ? 35   ILE A CG2 1 
ATOM   248  C CD1 . ILE A 1 35  ? 30.593  10.538  37.581  1.00 42.92  ? 35   ILE A CD1 1 
ATOM   249  N N   . PRO A 1 36  ? 36.300  11.869  36.384  1.00 46.13  ? 36   PRO A N   1 
ATOM   250  C CA  . PRO A 1 36  ? 37.380  11.433  35.511  1.00 46.60  ? 36   PRO A CA  1 
ATOM   251  C C   . PRO A 1 36  ? 37.353  9.943   35.296  1.00 47.15  ? 36   PRO A C   1 
ATOM   252  O O   . PRO A 1 36  ? 37.188  9.212   36.250  1.00 49.23  ? 36   PRO A O   1 
ATOM   253  C CB  . PRO A 1 36  ? 38.635  11.818  36.295  1.00 47.34  ? 36   PRO A CB  1 
ATOM   254  C CG  . PRO A 1 36  ? 38.204  11.804  37.711  1.00 48.43  ? 36   PRO A CG  1 
ATOM   255  C CD  . PRO A 1 36  ? 36.771  12.177  37.745  1.00 46.74  ? 36   PRO A CD  1 
ATOM   256  N N   . PHE A 1 37  ? 37.526  9.486   34.065  1.00 46.63  ? 37   PHE A N   1 
ATOM   257  C CA  . PHE A 1 37  ? 37.553  8.053   33.796  1.00 46.18  ? 37   PHE A CA  1 
ATOM   258  C C   . PHE A 1 37  ? 38.900  7.584   33.234  1.00 46.80  ? 37   PHE A C   1 
ATOM   259  O O   . PHE A 1 37  ? 39.080  6.394   33.019  1.00 47.84  ? 37   PHE A O   1 
ATOM   260  C CB  . PHE A 1 37  ? 36.379  7.638   32.886  1.00 45.39  ? 37   PHE A CB  1 
ATOM   261  C CG  . PHE A 1 37  ? 36.444  8.194   31.484  1.00 44.23  ? 37   PHE A CG  1 
ATOM   262  C CD1 . PHE A 1 37  ? 37.078  7.490   30.471  1.00 44.18  ? 37   PHE A CD1 1 
ATOM   263  C CD2 . PHE A 1 37  ? 35.870  9.403   31.176  1.00 43.60  ? 37   PHE A CD2 1 
ATOM   264  C CE1 . PHE A 1 37  ? 37.150  7.994   29.182  1.00 41.87  ? 37   PHE A CE1 1 
ATOM   265  C CE2 . PHE A 1 37  ? 35.938  9.913   29.880  1.00 43.10  ? 37   PHE A CE2 1 
ATOM   266  C CZ  . PHE A 1 37  ? 36.581  9.206   28.894  1.00 41.81  ? 37   PHE A CZ  1 
ATOM   267  N N   . ALA A 1 38  ? 39.840  8.499   33.025  1.00 46.78  ? 38   ALA A N   1 
ATOM   268  C CA  . ALA A 1 38  ? 41.168  8.156   32.524  1.00 48.26  ? 38   ALA A CA  1 
ATOM   269  C C   . ALA A 1 38  ? 42.219  9.082   33.123  1.00 49.25  ? 38   ALA A C   1 
ATOM   270  O O   . ALA A 1 38  ? 41.883  10.158  33.616  1.00 48.56  ? 38   ALA A O   1 
ATOM   271  C CB  . ALA A 1 38  ? 41.201  8.255   31.004  1.00 47.77  ? 38   ALA A CB  1 
ATOM   272  N N   . GLU A 1 39  ? 43.485  8.664   33.086  1.00 50.79  ? 39   GLU A N   1 
ATOM   273  C CA  . GLU A 1 39  ? 44.581  9.577   33.365  1.00 52.35  ? 39   GLU A CA  1 
ATOM   274  C C   . GLU A 1 39  ? 44.608  10.666  32.288  1.00 52.06  ? 39   GLU A C   1 
ATOM   275  O O   . GLU A 1 39  ? 44.400  10.376  31.100  1.00 51.90  ? 39   GLU A O   1 
ATOM   276  C CB  . GLU A 1 39  ? 45.927  8.845   33.384  1.00 54.16  ? 39   GLU A CB  1 
ATOM   277  C CG  . GLU A 1 39  ? 46.187  8.053   34.654  1.00 57.51  ? 39   GLU A CG  1 
ATOM   278  C CD  . GLU A 1 39  ? 46.137  8.922   35.891  1.00 59.44  ? 39   GLU A CD  1 
ATOM   279  O OE1 . GLU A 1 39  ? 46.940  9.872   35.984  1.00 64.19  ? 39   GLU A OE1 1 
ATOM   280  O OE2 . GLU A 1 39  ? 45.288  8.667   36.760  1.00 59.45  ? 39   GLU A OE2 1 
ATOM   281  N N   . PRO A 1 40  ? 44.839  11.927  32.692  1.00 52.13  ? 40   PRO A N   1 
ATOM   282  C CA  . PRO A 1 40  ? 44.965  13.004  31.723  1.00 51.22  ? 40   PRO A CA  1 
ATOM   283  C C   . PRO A 1 40  ? 45.887  12.637  30.557  1.00 50.94  ? 40   PRO A C   1 
ATOM   284  O O   . PRO A 1 40  ? 47.059  12.311  30.772  1.00 51.99  ? 40   PRO A O   1 
ATOM   285  C CB  . PRO A 1 40  ? 45.547  14.139  32.553  1.00 52.17  ? 40   PRO A CB  1 
ATOM   286  C CG  . PRO A 1 40  ? 45.005  13.897  33.919  1.00 52.68  ? 40   PRO A CG  1 
ATOM   287  C CD  . PRO A 1 40  ? 44.969  12.419  34.077  1.00 53.18  ? 40   PRO A CD  1 
ATOM   288  N N   . PRO A 1 41  ? 45.358  12.664  29.326  1.00 49.63  ? 41   PRO A N   1 
ATOM   289  C CA  . PRO A 1 41  ? 46.153  12.291  28.166  1.00 49.78  ? 41   PRO A CA  1 
ATOM   290  C C   . PRO A 1 41  ? 47.105  13.395  27.696  1.00 49.88  ? 41   PRO A C   1 
ATOM   291  O O   . PRO A 1 41  ? 47.100  13.753  26.522  1.00 49.49  ? 41   PRO A O   1 
ATOM   292  C CB  . PRO A 1 41  ? 45.102  11.973  27.114  1.00 48.98  ? 41   PRO A CB  1 
ATOM   293  C CG  . PRO A 1 41  ? 43.929  12.835  27.468  1.00 48.65  ? 41   PRO A CG  1 
ATOM   294  C CD  . PRO A 1 41  ? 43.966  13.007  28.965  1.00 48.94  ? 41   PRO A CD  1 
ATOM   295  N N   . VAL A 1 42  ? 47.944  13.880  28.608  1.00 49.87  ? 42   VAL A N   1 
ATOM   296  C CA  . VAL A 1 42  ? 48.741  15.065  28.375  1.00 50.16  ? 42   VAL A CA  1 
ATOM   297  C C   . VAL A 1 42  ? 50.209  14.694  28.314  1.00 51.87  ? 42   VAL A C   1 
ATOM   298  O O   . VAL A 1 42  ? 50.607  13.625  28.767  1.00 52.32  ? 42   VAL A O   1 
ATOM   299  C CB  . VAL A 1 42  ? 48.510  16.126  29.477  1.00 50.46  ? 42   VAL A CB  1 
ATOM   300  C CG1 . VAL A 1 42  ? 47.020  16.426  29.619  1.00 47.95  ? 42   VAL A CG1 1 
ATOM   301  C CG2 . VAL A 1 42  ? 49.097  15.686  30.817  1.00 50.18  ? 42   VAL A CG2 1 
ATOM   302  N N   . GLY A 1 43  ? 51.017  15.568  27.722  1.00 52.81  ? 43   GLY A N   1 
ATOM   303  C CA  . GLY A 1 43  ? 52.455  15.365  27.709  1.00 54.23  ? 43   GLY A CA  1 
ATOM   304  C C   . GLY A 1 43  ? 52.813  14.140  26.894  1.00 54.53  ? 43   GLY A C   1 
ATOM   305  O O   . GLY A 1 43  ? 52.415  14.020  25.731  1.00 53.19  ? 43   GLY A O   1 
ATOM   306  N N   . SER A 1 44  ? 53.540  13.220  27.521  1.00 55.96  ? 44   SER A N   1 
ATOM   307  C CA  . SER A 1 44  ? 53.998  12.006  26.864  1.00 56.96  ? 44   SER A CA  1 
ATOM   308  C C   . SER A 1 44  ? 52.839  11.080  26.506  1.00 56.08  ? 44   SER A C   1 
ATOM   309  O O   . SER A 1 44  ? 53.005  10.151  25.726  1.00 56.37  ? 44   SER A O   1 
ATOM   310  C CB  . SER A 1 44  ? 55.005  11.266  27.750  1.00 58.78  ? 44   SER A CB  1 
ATOM   311  O OG  . SER A 1 44  ? 54.426  10.841  28.976  1.00 58.85  ? 44   SER A OG  1 
ATOM   312  N N   . ARG A 1 45  ? 51.667  11.330  27.073  1.00 55.37  ? 45   ARG A N   1 
ATOM   313  C CA  . ARG A 1 45  ? 50.510  10.498  26.785  1.00 54.86  ? 45   ARG A CA  1 
ATOM   314  C C   . ARG A 1 45  ? 49.714  10.978  25.577  1.00 53.02  ? 45   ARG A C   1 
ATOM   315  O O   . ARG A 1 45  ? 48.814  10.272  25.124  1.00 51.79  ? 45   ARG A O   1 
ATOM   316  C CB  . ARG A 1 45  ? 49.622  10.392  28.016  1.00 55.24  ? 45   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 45  ? 50.213  9.544   29.153  1.00 58.94  ? 45   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 45  ? 49.505  9.915   30.453  1.00 65.61  ? 45   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 45  ? 49.378  8.848   31.458  1.00 68.94  ? 45   ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 45  ? 50.344  8.463   32.292  1.00 73.90  ? 45   ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 45  ? 50.095  7.494   33.175  1.00 75.37  ? 45   ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 45  ? 51.562  9.016   32.250  1.00 76.29  ? 45   ARG A NH2 1 
ATOM   323  N N   . ARG A 1 46  ? 50.060  12.152  25.039  1.00 52.55  ? 46   ARG A N   1 
ATOM   324  C CA  . ARG A 1 46  ? 49.406  12.654  23.819  1.00 51.27  ? 46   ARG A CA  1 
ATOM   325  C C   . ARG A 1 46  ? 49.527  11.635  22.687  1.00 50.82  ? 46   ARG A C   1 
ATOM   326  O O   . ARG A 1 46  ? 50.596  11.044  22.490  1.00 51.52  ? 46   ARG A O   1 
ATOM   327  C CB  . ARG A 1 46  ? 49.988  14.007  23.377  1.00 51.82  ? 46   ARG A CB  1 
ATOM   328  C CG  . ARG A 1 46  ? 49.178  14.686  22.256  1.00 49.77  ? 46   ARG A CG  1 
ATOM   329  C CD  . ARG A 1 46  ? 49.924  15.852  21.630  1.00 49.03  ? 46   ARG A CD  1 
ATOM   330  N NE  . ARG A 1 46  ? 49.782  17.071  22.410  1.00 48.96  ? 46   ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 46  ? 50.368  18.227  22.103  1.00 50.03  ? 46   ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 46  ? 51.162  18.320  21.048  1.00 51.61  ? 46   ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 46  ? 50.159  19.297  22.854  1.00 49.48  ? 46   ARG A NH2 1 
ATOM   334  N N   . PHE A 1 47  ? 48.414  11.436  21.972  1.00 48.97  ? 47   PHE A N   1 
ATOM   335  C CA  . PHE A 1 47  ? 48.259  10.425  20.902  1.00 48.92  ? 47   PHE A CA  1 
ATOM   336  C C   . PHE A 1 47  ? 48.235  8.964   21.353  1.00 50.56  ? 47   PHE A C   1 
ATOM   337  O O   . PHE A 1 47  ? 48.047  8.072   20.510  1.00 51.69  ? 47   PHE A O   1 
ATOM   338  C CB  . PHE A 1 47  ? 49.305  10.565  19.797  1.00 49.30  ? 47   PHE A CB  1 
ATOM   339  C CG  . PHE A 1 47  ? 49.579  11.985  19.374  1.00 48.59  ? 47   PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 47  ? 48.570  12.785  18.879  1.00 46.17  ? 47   PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 47  ? 50.863  12.507  19.460  1.00 48.10  ? 47   PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 47  ? 48.821  14.089  18.462  1.00 46.51  ? 47   PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 47  ? 51.121  13.804  19.066  1.00 48.27  ? 47   PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 47  ? 50.098  14.600  18.563  1.00 47.77  ? 47   PHE A CZ  1 
ATOM   345  N N   . MET A 1 48  ? 48.420  8.707   22.652  1.00 51.58  ? 48   MET A N   1 
ATOM   346  C CA  . MET A 1 48  ? 48.466  7.344   23.182  1.00 52.80  ? 48   MET A CA  1 
ATOM   347  C C   . MET A 1 48  ? 47.094  6.895   23.663  1.00 51.34  ? 48   MET A C   1 
ATOM   348  O O   . MET A 1 48  ? 46.249  7.723   24.027  1.00 50.18  ? 48   MET A O   1 
ATOM   349  C CB  . MET A 1 48  ? 49.454  7.254   24.344  1.00 53.93  ? 48   MET A CB  1 
ATOM   350  C CG  . MET A 1 48  ? 50.879  7.673   23.981  1.00 56.18  ? 48   MET A CG  1 
ATOM   351  S SD  . MET A 1 48  ? 52.141  6.693   24.800  1.00 61.30  ? 48   MET A SD  1 
ATOM   352  C CE  . MET A 1 48  ? 51.635  5.077   24.167  1.00 62.93  ? 48   MET A CE  1 
ATOM   353  N N   . PRO A 1 49  ? 46.855  5.579   23.664  1.00 51.54  ? 49   PRO A N   1 
ATOM   354  C CA  . PRO A 1 49  ? 45.611  5.075   24.237  1.00 50.55  ? 49   PRO A CA  1 
ATOM   355  C C   . PRO A 1 49  ? 45.413  5.574   25.675  1.00 50.68  ? 49   PRO A C   1 
ATOM   356  O O   . PRO A 1 49  ? 46.389  5.846   26.381  1.00 50.85  ? 49   PRO A O   1 
ATOM   357  C CB  . PRO A 1 49  ? 45.799  3.555   24.232  1.00 51.69  ? 49   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 49  ? 46.884  3.280   23.258  1.00 52.66  ? 49   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 49  ? 47.722  4.506   23.140  1.00 52.66  ? 49   PRO A CD  1 
ATOM   360  N N   . PRO A 1 50  ? 44.156  5.698   26.118  1.00 50.06  ? 50   PRO A N   1 
ATOM   361  C CA  . PRO A 1 50  ? 43.893  6.164   27.472  1.00 50.62  ? 50   PRO A CA  1 
ATOM   362  C C   . PRO A 1 50  ? 44.258  5.106   28.501  1.00 52.52  ? 50   PRO A C   1 
ATOM   363  O O   . PRO A 1 50  ? 44.124  3.903   28.243  1.00 52.93  ? 50   PRO A O   1 
ATOM   364  C CB  . PRO A 1 50  ? 42.383  6.401   27.473  1.00 49.18  ? 50   PRO A CB  1 
ATOM   365  C CG  . PRO A 1 50  ? 41.876  5.428   26.517  1.00 49.37  ? 50   PRO A CG  1 
ATOM   366  C CD  . PRO A 1 50  ? 42.920  5.361   25.415  1.00 49.40  ? 50   PRO A CD  1 
ATOM   367  N N   . GLU A 1 51  ? 44.746  5.547   29.651  1.00 54.52  ? 51   GLU A N   1 
ATOM   368  C CA  . GLU A 1 51  ? 44.981  4.636   30.779  1.00 56.45  ? 51   GLU A CA  1 
ATOM   369  C C   . GLU A 1 51  ? 43.888  4.890   31.801  1.00 55.28  ? 51   GLU A C   1 
ATOM   370  O O   . GLU A 1 51  ? 43.479  6.025   31.981  1.00 53.59  ? 51   GLU A O   1 
ATOM   371  C CB  . GLU A 1 51  ? 46.311  4.918   31.438  1.00 58.26  ? 51   GLU A CB  1 
ATOM   372  C CG  . GLU A 1 51  ? 47.513  4.670   30.564  1.00 63.32  ? 51   GLU A CG  1 
ATOM   373  C CD  . GLU A 1 51  ? 48.783  5.213   31.207  1.00 69.32  ? 51   GLU A CD  1 
ATOM   374  O OE1 . GLU A 1 51  ? 49.238  6.289   30.748  1.00 72.49  ? 51   GLU A OE1 1 
ATOM   375  O OE2 . GLU A 1 51  ? 49.299  4.590   32.182  1.00 72.76  ? 51   GLU A OE2 1 
ATOM   376  N N   . PRO A 1 52  ? 43.449  3.843   32.515  1.00 55.85  ? 52   PRO A N   1 
ATOM   377  C CA  . PRO A 1 52  ? 42.388  4.075   33.509  1.00 55.17  ? 52   PRO A CA  1 
ATOM   378  C C   . PRO A 1 52  ? 42.828  5.049   34.614  1.00 54.79  ? 52   PRO A C   1 
ATOM   379  O O   . PRO A 1 52  ? 43.999  5.143   34.936  1.00 54.66  ? 52   PRO A O   1 
ATOM   380  C CB  . PRO A 1 52  ? 42.117  2.681   34.069  1.00 56.33  ? 52   PRO A CB  1 
ATOM   381  C CG  . PRO A 1 52  ? 42.728  1.724   33.054  1.00 57.71  ? 52   PRO A CG  1 
ATOM   382  C CD  . PRO A 1 52  ? 43.895  2.442   32.486  1.00 56.66  ? 52   PRO A CD  1 
ATOM   383  N N   . LYS A 1 53  ? 41.873  5.793   35.143  1.00 54.16  ? 53   LYS A N   1 
ATOM   384  C CA  . LYS A 1 53  ? 42.130  6.804   36.148  1.00 54.67  ? 53   LYS A CA  1 
ATOM   385  C C   . LYS A 1 53  ? 42.634  6.156   37.423  1.00 56.19  ? 53   LYS A C   1 
ATOM   386  O O   . LYS A 1 53  ? 42.059  5.189   37.888  1.00 56.55  ? 53   LYS A O   1 
ATOM   387  C CB  . LYS A 1 53  ? 40.832  7.573   36.426  1.00 53.91  ? 53   LYS A CB  1 
ATOM   388  C CG  . LYS A 1 53  ? 40.902  8.582   37.544  1.00 54.37  ? 53   LYS A CG  1 
ATOM   389  C CD  . LYS A 1 53  ? 41.812  9.739   37.212  1.00 55.59  ? 53   LYS A CD  1 
ATOM   390  C CE  . LYS A 1 53  ? 41.801  10.767  38.341  1.00 56.20  ? 53   LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 53  ? 42.742  11.894  38.116  1.00 56.77  ? 53   LYS A NZ  1 
ATOM   392  N N   . ARG A 1 54  ? 43.720  6.685   37.976  1.00 57.35  ? 54   ARG A N   1 
ATOM   393  C CA  . ARG A 1 54  ? 44.207  6.250   39.267  1.00 59.18  ? 54   ARG A CA  1 
ATOM   394  C C   . ARG A 1 54  ? 43.254  6.773   40.352  1.00 58.34  ? 54   ARG A C   1 
ATOM   395  O O   . ARG A 1 54  ? 42.836  7.934   40.297  1.00 56.65  ? 54   ARG A O   1 
ATOM   396  C CB  . ARG A 1 54  ? 45.623  6.762   39.517  1.00 60.89  ? 54   ARG A CB  1 
ATOM   397  C CG  . ARG A 1 54  ? 46.690  6.199   38.562  1.00 65.28  ? 54   ARG A CG  1 
ATOM   398  C CD  . ARG A 1 54  ? 48.078  6.387   39.146  1.00 72.90  ? 54   ARG A CD  1 
ATOM   399  N NE  . ARG A 1 54  ? 49.144  6.455   38.137  1.00 77.56  ? 54   ARG A NE  1 
ATOM   400  C CZ  . ARG A 1 54  ? 49.525  7.566   37.496  1.00 80.40  ? 54   ARG A CZ  1 
ATOM   401  N NH1 . ARG A 1 54  ? 50.521  7.512   36.603  1.00 80.61  ? 54   ARG A NH1 1 
ATOM   402  N NH2 . ARG A 1 54  ? 48.915  8.736   37.732  1.00 81.45  ? 54   ARG A NH2 1 
ATOM   403  N N   . PRO A 1 55  ? 42.904  5.917   41.336  1.00 58.53  ? 55   PRO A N   1 
ATOM   404  C CA  . PRO A 1 55  ? 42.018  6.320   42.428  1.00 58.72  ? 55   PRO A CA  1 
ATOM   405  C C   . PRO A 1 55  ? 42.467  7.593   43.155  1.00 59.32  ? 55   PRO A C   1 
ATOM   406  O O   . PRO A 1 55  ? 43.658  7.864   43.285  1.00 59.60  ? 55   PRO A O   1 
ATOM   407  C CB  . PRO A 1 55  ? 42.059  5.114   43.371  1.00 60.16  ? 55   PRO A CB  1 
ATOM   408  C CG  . PRO A 1 55  ? 42.343  3.971   42.488  1.00 59.72  ? 55   PRO A CG  1 
ATOM   409  C CD  . PRO A 1 55  ? 43.294  4.502   41.461  1.00 59.43  ? 55   PRO A CD  1 
ATOM   410  N N   . TRP A 1 56  ? 41.497  8.373   43.610  1.00 59.65  ? 56   TRP A N   1 
ATOM   411  C CA  . TRP A 1 56  ? 41.772  9.629   44.310  1.00 60.51  ? 56   TRP A CA  1 
ATOM   412  C C   . TRP A 1 56  ? 41.394  9.505   45.773  1.00 61.89  ? 56   TRP A C   1 
ATOM   413  O O   . TRP A 1 56  ? 40.609  8.627   46.160  1.00 62.36  ? 56   TRP A O   1 
ATOM   414  C CB  . TRP A 1 56  ? 41.001  10.775  43.675  1.00 59.31  ? 56   TRP A CB  1 
ATOM   415  C CG  . TRP A 1 56  ? 39.536  10.552  43.652  1.00 58.48  ? 56   TRP A CG  1 
ATOM   416  C CD1 . TRP A 1 56  ? 38.646  10.835  44.648  1.00 58.81  ? 56   TRP A CD1 1 
ATOM   417  C CD2 . TRP A 1 56  ? 38.776  10.002  42.577  1.00 57.40  ? 56   TRP A CD2 1 
ATOM   418  N NE1 . TRP A 1 56  ? 37.378  10.500  44.254  1.00 58.02  ? 56   TRP A NE1 1 
ATOM   419  C CE2 . TRP A 1 56  ? 37.427  9.982   42.989  1.00 56.75  ? 56   TRP A CE2 1 
ATOM   420  C CE3 . TRP A 1 56  ? 39.104  9.524   41.303  1.00 56.36  ? 56   TRP A CE3 1 
ATOM   421  C CZ2 . TRP A 1 56  ? 36.406  9.499   42.177  1.00 56.26  ? 56   TRP A CZ2 1 
ATOM   422  C CZ3 . TRP A 1 56  ? 38.091  9.044   40.493  1.00 56.03  ? 56   TRP A CZ3 1 
ATOM   423  C CH2 . TRP A 1 56  ? 36.756  9.035   40.931  1.00 55.85  ? 56   TRP A CH2 1 
ATOM   424  N N   . SER A 1 57  ? 41.956  10.388  46.591  1.00 63.18  ? 57   SER A N   1 
ATOM   425  C CA  . SER A 1 57  ? 41.673  10.382  48.022  1.00 64.36  ? 57   SER A CA  1 
ATOM   426  C C   . SER A 1 57  ? 40.637  11.450  48.286  1.00 63.40  ? 57   SER A C   1 
ATOM   427  O O   . SER A 1 57  ? 40.620  12.480  47.621  1.00 62.86  ? 57   SER A O   1 
ATOM   428  C CB  . SER A 1 57  ? 42.941  10.651  48.840  1.00 66.21  ? 57   SER A CB  1 
ATOM   429  O OG  . SER A 1 57  ? 43.318  12.011  48.730  1.00 67.43  ? 57   SER A OG  1 
ATOM   430  N N   . GLY A 1 58  ? 39.766  11.187  49.249  1.00 63.54  ? 58   GLY A N   1 
ATOM   431  C CA  . GLY A 1 58  ? 38.737  12.138  49.630  1.00 63.03  ? 58   GLY A CA  1 
ATOM   432  C C   . GLY A 1 58  ? 37.593  12.141  48.649  1.00 61.11  ? 58   GLY A C   1 
ATOM   433  O O   . GLY A 1 58  ? 37.469  11.236  47.817  1.00 60.73  ? 58   GLY A O   1 
ATOM   434  N N   . VAL A 1 59  ? 36.757  13.166  48.766  1.00 60.31  ? 59   VAL A N   1 
ATOM   435  C CA  . VAL A 1 59  ? 35.527  13.284  47.996  1.00 58.70  ? 59   VAL A CA  1 
ATOM   436  C C   . VAL A 1 59  ? 35.774  14.224  46.823  1.00 57.70  ? 59   VAL A C   1 
ATOM   437  O O   . VAL A 1 59  ? 36.161  15.378  47.011  1.00 58.33  ? 59   VAL A O   1 
ATOM   438  C CB  . VAL A 1 59  ? 34.383  13.830  48.869  1.00 59.10  ? 59   VAL A CB  1 
ATOM   439  C CG1 . VAL A 1 59  ? 33.098  13.939  48.083  1.00 56.77  ? 59   VAL A CG1 1 
ATOM   440  C CG2 . VAL A 1 59  ? 34.202  12.953  50.104  1.00 59.87  ? 59   VAL A CG2 1 
ATOM   441  N N   . LEU A 1 60  ? 35.571  13.709  45.616  1.00 56.13  ? 60   LEU A N   1 
ATOM   442  C CA  . LEU A 1 60  ? 35.709  14.499  44.402  1.00 55.05  ? 60   LEU A CA  1 
ATOM   443  C C   . LEU A 1 60  ? 34.440  15.310  44.146  1.00 54.19  ? 60   LEU A C   1 
ATOM   444  O O   . LEU A 1 60  ? 33.333  14.776  44.163  1.00 53.30  ? 60   LEU A O   1 
ATOM   445  C CB  . LEU A 1 60  ? 36.030  13.569  43.223  1.00 54.29  ? 60   LEU A CB  1 
ATOM   446  C CG  . LEU A 1 60  ? 36.390  14.192  41.872  1.00 53.76  ? 60   LEU A CG  1 
ATOM   447  C CD1 . LEU A 1 60  ? 37.519  13.436  41.218  1.00 54.39  ? 60   LEU A CD1 1 
ATOM   448  C CD2 . LEU A 1 60  ? 35.181  14.197  40.962  1.00 55.16  ? 60   LEU A CD2 1 
ATOM   449  N N   . ASP A 1 61  ? 34.592  16.615  43.931  1.00 54.30  ? 61   ASP A N   1 
ATOM   450  C CA  . ASP A 1 61  ? 33.432  17.430  43.587  1.00 54.14  ? 61   ASP A CA  1 
ATOM   451  C C   . ASP A 1 61  ? 32.982  17.162  42.140  1.00 51.67  ? 61   ASP A C   1 
ATOM   452  O O   . ASP A 1 61  ? 33.727  17.410  41.205  1.00 51.68  ? 61   ASP A O   1 
ATOM   453  C CB  . ASP A 1 61  ? 33.715  18.916  43.765  1.00 55.34  ? 61   ASP A CB  1 
ATOM   454  C CG  . ASP A 1 61  ? 32.446  19.739  43.679  1.00 57.51  ? 61   ASP A CG  1 
ATOM   455  O OD1 . ASP A 1 61  ? 32.095  20.128  42.547  1.00 59.31  ? 61   ASP A OD1 1 
ATOM   456  O OD2 . ASP A 1 61  ? 31.769  19.932  44.731  1.00 62.49  ? 61   ASP A OD2 1 
ATOM   457  N N   . ALA A 1 62  ? 31.768  16.648  41.975  1.00 50.17  ? 62   ALA A N   1 
ATOM   458  C CA  . ALA A 1 62  ? 31.207  16.354  40.655  1.00 48.01  ? 62   ALA A CA  1 
ATOM   459  C C   . ALA A 1 62  ? 29.967  17.224  40.435  1.00 47.76  ? 62   ALA A C   1 
ATOM   460  O O   . ALA A 1 62  ? 28.890  16.737  40.055  1.00 45.71  ? 62   ALA A O   1 
ATOM   461  C CB  . ALA A 1 62  ? 30.874  14.862  40.542  1.00 47.51  ? 62   ALA A CB  1 
ATOM   462  N N   . THR A 1 63  ? 30.133  18.528  40.675  1.00 48.07  ? 63   THR A N   1 
ATOM   463  C CA  . THR A 1 63  ? 29.017  19.467  40.603  1.00 48.94  ? 63   THR A CA  1 
ATOM   464  C C   . THR A 1 63  ? 29.042  20.367  39.356  1.00 48.83  ? 63   THR A C   1 
ATOM   465  O O   . THR A 1 63  ? 28.039  21.020  39.058  1.00 49.18  ? 63   THR A O   1 
ATOM   466  C CB  . THR A 1 63  ? 28.940  20.339  41.869  1.00 50.12  ? 63   THR A CB  1 
ATOM   467  O OG1 . THR A 1 63  ? 30.072  21.220  41.918  1.00 51.55  ? 63   THR A OG1 1 
ATOM   468  C CG2 . THR A 1 63  ? 28.906  19.463  43.143  1.00 50.14  ? 63   THR A CG2 1 
ATOM   469  N N   . THR A 1 64  ? 30.170  20.395  38.640  1.00 48.45  ? 64   THR A N   1 
ATOM   470  C CA  . THR A 1 64  ? 30.309  21.195  37.435  1.00 48.03  ? 64   THR A CA  1 
ATOM   471  C C   . THR A 1 64  ? 30.945  20.389  36.299  1.00 47.43  ? 64   THR A C   1 
ATOM   472  O O   . THR A 1 64  ? 31.674  19.415  36.540  1.00 48.02  ? 64   THR A O   1 
ATOM   473  C CB  . THR A 1 64  ? 31.152  22.476  37.692  1.00 48.91  ? 64   THR A CB  1 
ATOM   474  O OG1 . THR A 1 64  ? 32.497  22.116  38.034  1.00 49.70  ? 64   THR A OG1 1 
ATOM   475  C CG2 . THR A 1 64  ? 30.574  23.321  38.817  1.00 48.89  ? 64   THR A CG2 1 
ATOM   476  N N   . PHE A 1 65  ? 30.632  20.777  35.061  1.00 46.66  ? 65   PHE A N   1 
ATOM   477  C CA  . PHE A 1 65  ? 31.232  20.177  33.871  1.00 45.75  ? 65   PHE A CA  1 
ATOM   478  C C   . PHE A 1 65  ? 32.726  20.459  33.838  1.00 46.27  ? 65   PHE A C   1 
ATOM   479  O O   . PHE A 1 65  ? 33.193  21.535  34.270  1.00 46.56  ? 65   PHE A O   1 
ATOM   480  C CB  . PHE A 1 65  ? 30.605  20.730  32.591  1.00 45.43  ? 65   PHE A CB  1 
ATOM   481  C CG  . PHE A 1 65  ? 29.175  20.306  32.356  1.00 44.31  ? 65   PHE A CG  1 
ATOM   482  C CD1 . PHE A 1 65  ? 28.874  18.989  32.062  1.00 43.89  ? 65   PHE A CD1 1 
ATOM   483  C CD2 . PHE A 1 65  ? 28.138  21.239  32.388  1.00 46.03  ? 65   PHE A CD2 1 
ATOM   484  C CE1 . PHE A 1 65  ? 27.587  18.596  31.815  1.00 42.29  ? 65   PHE A CE1 1 
ATOM   485  C CE2 . PHE A 1 65  ? 26.825  20.851  32.157  1.00 44.79  ? 65   PHE A CE2 1 
ATOM   486  C CZ  . PHE A 1 65  ? 26.559  19.512  31.879  1.00 44.97  ? 65   PHE A CZ  1 
ATOM   487  N N   . GLN A 1 66  ? 33.477  19.494  33.318  1.00 45.71  ? 66   GLN A N   1 
ATOM   488  C CA  . GLN A 1 66  ? 34.904  19.654  33.199  1.00 46.53  ? 66   GLN A CA  1 
ATOM   489  C C   . GLN A 1 66  ? 35.306  20.262  31.848  1.00 46.17  ? 66   GLN A C   1 
ATOM   490  O O   . GLN A 1 66  ? 34.457  20.669  31.050  1.00 46.52  ? 66   GLN A O   1 
ATOM   491  C CB  . GLN A 1 66  ? 35.604  18.328  33.497  1.00 46.89  ? 66   GLN A CB  1 
ATOM   492  C CG  . GLN A 1 66  ? 36.086  18.247  34.942  1.00 47.64  ? 66   GLN A CG  1 
ATOM   493  C CD  . GLN A 1 66  ? 37.397  18.973  35.142  1.00 50.03  ? 66   GLN A CD  1 
ATOM   494  O OE1 . GLN A 1 66  ? 37.923  19.599  34.216  1.00 50.54  ? 66   GLN A OE1 1 
ATOM   495  N NE2 . GLN A 1 66  ? 37.957  18.860  36.340  1.00 48.96  ? 66   GLN A NE2 1 
ATOM   496  N N   . ASN A 1 67  ? 36.606  20.388  31.631  1.00 46.30  ? 67   ASN A N   1 
ATOM   497  C CA  . ASN A 1 67  ? 37.134  20.966  30.396  1.00 45.74  ? 67   ASN A CA  1 
ATOM   498  C C   . ASN A 1 67  ? 36.646  20.218  29.152  1.00 44.37  ? 67   ASN A C   1 
ATOM   499  O O   . ASN A 1 67  ? 36.418  19.004  29.178  1.00 43.80  ? 67   ASN A O   1 
ATOM   500  C CB  . ASN A 1 67  ? 38.660  20.919  30.383  1.00 46.01  ? 67   ASN A CB  1 
ATOM   501  C CG  . ASN A 1 67  ? 39.296  21.623  31.563  1.00 47.19  ? 67   ASN A CG  1 
ATOM   502  O OD1 . ASN A 1 67  ? 38.895  22.712  31.965  1.00 48.26  ? 67   ASN A OD1 1 
ATOM   503  N ND2 . ASN A 1 67  ? 40.331  20.999  32.109  1.00 49.87  ? 67   ASN A ND2 1 
ATOM   504  N N   . VAL A 1 68  ? 36.542  20.965  28.062  1.00 43.95  ? 68   VAL A N   1 
ATOM   505  C CA  . VAL A 1 68  ? 36.272  20.435  26.734  1.00 43.21  ? 68   VAL A CA  1 
ATOM   506  C C   . VAL A 1 68  ? 37.584  20.018  26.068  1.00 43.86  ? 68   VAL A C   1 
ATOM   507  O O   . VAL A 1 68  ? 38.623  20.683  26.215  1.00 43.54  ? 68   VAL A O   1 
ATOM   508  C CB  . VAL A 1 68  ? 35.599  21.502  25.872  1.00 43.44  ? 68   VAL A CB  1 
ATOM   509  C CG1 . VAL A 1 68  ? 35.513  21.057  24.400  1.00 43.65  ? 68   VAL A CG1 1 
ATOM   510  C CG2 . VAL A 1 68  ? 34.218  21.850  26.443  1.00 43.58  ? 68   VAL A CG2 1 
ATOM   511  N N   . CYS A 1 69  ? 37.550  18.894  25.357  1.00 43.56  ? 69   CYS A N   1 
ATOM   512  C CA  . CYS A 1 69  ? 38.743  18.409  24.674  1.00 44.16  ? 69   CYS A CA  1 
ATOM   513  C C   . CYS A 1 69  ? 39.235  19.455  23.668  1.00 44.74  ? 69   CYS A C   1 
ATOM   514  O O   . CYS A 1 69  ? 38.431  20.123  23.027  1.00 43.21  ? 69   CYS A O   1 
ATOM   515  C CB  . CYS A 1 69  ? 38.458  17.067  24.027  1.00 43.74  ? 69   CYS A CB  1 
ATOM   516  S SG  . CYS A 1 69  ? 38.223  15.766  25.286  1.00 44.94  ? 69   CYS A SG  1 
ATOM   517  N N   . TYR A 1 70  ? 40.560  19.621  23.569  1.00 45.75  ? 70   TYR A N   1 
ATOM   518  C CA  . TYR A 1 70  ? 41.116  20.714  22.782  1.00 46.65  ? 70   TYR A CA  1 
ATOM   519  C C   . TYR A 1 70  ? 40.646  20.602  21.328  1.00 46.28  ? 70   TYR A C   1 
ATOM   520  O O   . TYR A 1 70  ? 40.760  19.538  20.718  1.00 46.14  ? 70   TYR A O   1 
ATOM   521  C CB  . TYR A 1 70  ? 42.659  20.779  22.879  1.00 48.08  ? 70   TYR A CB  1 
ATOM   522  C CG  . TYR A 1 70  ? 43.135  22.216  22.829  1.00 49.26  ? 70   TYR A CG  1 
ATOM   523  C CD1 . TYR A 1 70  ? 43.451  22.914  23.983  1.00 51.10  ? 70   TYR A CD1 1 
ATOM   524  C CD2 . TYR A 1 70  ? 43.203  22.893  21.625  1.00 50.23  ? 70   TYR A CD2 1 
ATOM   525  C CE1 . TYR A 1 70  ? 43.846  24.268  23.926  1.00 51.02  ? 70   TYR A CE1 1 
ATOM   526  C CE2 . TYR A 1 70  ? 43.599  24.225  21.557  1.00 49.43  ? 70   TYR A CE2 1 
ATOM   527  C CZ  . TYR A 1 70  ? 43.901  24.906  22.699  1.00 50.91  ? 70   TYR A CZ  1 
ATOM   528  O OH  . TYR A 1 70  ? 44.293  26.239  22.588  1.00 54.67  ? 70   TYR A OH  1 
ATOM   529  N N   . GLN A 1 71  ? 40.077  21.681  20.800  1.00 46.27  ? 71   GLN A N   1 
ATOM   530  C CA  . GLN A 1 71  ? 39.458  21.645  19.488  1.00 46.33  ? 71   GLN A CA  1 
ATOM   531  C C   . GLN A 1 71  ? 39.384  22.972  18.767  1.00 48.63  ? 71   GLN A C   1 
ATOM   532  O O   . GLN A 1 71  ? 39.465  24.034  19.371  1.00 48.40  ? 71   GLN A O   1 
ATOM   533  C CB  . GLN A 1 71  ? 38.038  21.089  19.577  1.00 45.48  ? 71   GLN A CB  1 
ATOM   534  C CG  . GLN A 1 71  ? 37.059  21.902  20.380  1.00 42.09  ? 71   GLN A CG  1 
ATOM   535  C CD  . GLN A 1 71  ? 35.807  21.099  20.690  1.00 41.80  ? 71   GLN A CD  1 
ATOM   536  O OE1 . GLN A 1 71  ? 34.727  21.413  20.190  1.00 38.39  ? 71   GLN A OE1 1 
ATOM   537  N NE2 . GLN A 1 71  ? 35.955  20.026  21.485  1.00 39.01  ? 71   GLN A NE2 1 
ATOM   538  N N   . TYR A 1 72  ? 39.209  22.858  17.449  1.00 51.05  ? 72   TYR A N   1 
ATOM   539  C CA  . TYR A 1 72  ? 38.881  23.967  16.571  1.00 53.00  ? 72   TYR A CA  1 
ATOM   540  C C   . TYR A 1 72  ? 37.574  24.611  17.017  1.00 53.81  ? 72   TYR A C   1 
ATOM   541  O O   . TYR A 1 72  ? 36.592  23.907  17.268  1.00 53.39  ? 72   TYR A O   1 
ATOM   542  C CB  . TYR A 1 72  ? 38.758  23.455  15.124  1.00 53.46  ? 72   TYR A CB  1 
ATOM   543  C CG  . TYR A 1 72  ? 38.281  24.504  14.144  1.00 54.41  ? 72   TYR A CG  1 
ATOM   544  C CD1 . TYR A 1 72  ? 36.934  24.596  13.797  1.00 54.62  ? 72   TYR A CD1 1 
ATOM   545  C CD2 . TYR A 1 72  ? 39.171  25.409  13.577  1.00 56.06  ? 72   TYR A CD2 1 
ATOM   546  C CE1 . TYR A 1 72  ? 36.485  25.556  12.917  1.00 55.59  ? 72   TYR A CE1 1 
ATOM   547  C CE2 . TYR A 1 72  ? 38.729  26.385  12.683  1.00 56.81  ? 72   TYR A CE2 1 
ATOM   548  C CZ  . TYR A 1 72  ? 37.375  26.445  12.362  1.00 56.46  ? 72   TYR A CZ  1 
ATOM   549  O OH  . TYR A 1 72  ? 36.905  27.400  11.486  1.00 57.78  ? 72   TYR A OH  1 
ATOM   550  N N   . VAL A 1 73  ? 37.571  25.941  17.125  1.00 55.92  ? 73   VAL A N   1 
ATOM   551  C CA  . VAL A 1 73  ? 36.360  26.713  17.448  1.00 57.12  ? 73   VAL A CA  1 
ATOM   552  C C   . VAL A 1 73  ? 35.829  27.437  16.204  1.00 58.60  ? 73   VAL A C   1 
ATOM   553  O O   . VAL A 1 73  ? 36.560  28.148  15.509  1.00 59.64  ? 73   VAL A O   1 
ATOM   554  C CB  . VAL A 1 73  ? 36.632  27.743  18.561  1.00 57.92  ? 73   VAL A CB  1 
ATOM   555  C CG1 . VAL A 1 73  ? 35.444  28.651  18.768  1.00 57.79  ? 73   VAL A CG1 1 
ATOM   556  C CG2 . VAL A 1 73  ? 36.989  27.037  19.850  1.00 57.60  ? 73   VAL A CG2 1 
ATOM   557  N N   . ASP A 1 74  ? 34.542  27.262  15.942  1.00 59.70  ? 74   ASP A N   1 
ATOM   558  C CA  . ASP A 1 74  ? 33.914  27.782  14.729  1.00 60.54  ? 74   ASP A CA  1 
ATOM   559  C C   . ASP A 1 74  ? 33.834  29.307  14.715  1.00 61.60  ? 74   ASP A C   1 
ATOM   560  O O   . ASP A 1 74  ? 33.388  29.925  15.681  1.00 62.20  ? 74   ASP A O   1 
ATOM   561  C CB  . ASP A 1 74  ? 32.517  27.185  14.561  1.00 60.05  ? 74   ASP A CB  1 
ATOM   562  C CG  . ASP A 1 74  ? 32.035  27.246  13.130  1.00 62.08  ? 74   ASP A CG  1 
ATOM   563  O OD1 . ASP A 1 74  ? 32.246  26.241  12.407  1.00 63.42  ? 74   ASP A OD1 1 
ATOM   564  O OD2 . ASP A 1 74  ? 31.477  28.300  12.725  1.00 63.73  ? 74   ASP A OD2 1 
ATOM   565  N N   . THR A 1 75  ? 34.260  29.893  13.596  1.00 62.44  ? 75   THR A N   1 
ATOM   566  C CA  . THR A 1 75  ? 34.317  31.349  13.425  1.00 63.45  ? 75   THR A CA  1 
ATOM   567  C C   . THR A 1 75  ? 33.472  31.853  12.244  1.00 63.73  ? 75   THR A C   1 
ATOM   568  O O   . THR A 1 75  ? 33.510  33.048  11.934  1.00 64.45  ? 75   THR A O   1 
ATOM   569  C CB  . THR A 1 75  ? 35.779  31.819  13.196  1.00 64.33  ? 75   THR A CB  1 
ATOM   570  O OG1 . THR A 1 75  ? 36.305  31.193  12.019  1.00 64.04  ? 75   THR A OG1 1 
ATOM   571  C CG2 . THR A 1 75  ? 36.661  31.475  14.385  1.00 63.56  ? 75   THR A CG2 1 
ATOM   572  N N   . LEU A 1 76  ? 32.711  30.956  11.602  1.00 63.12  ? 76   LEU A N   1 
ATOM   573  C CA  . LEU A 1 76  ? 31.929  31.302  10.408  1.00 63.31  ? 76   LEU A CA  1 
ATOM   574  C C   . LEU A 1 76  ? 31.040  32.509  10.661  1.00 64.27  ? 76   LEU A C   1 
ATOM   575  O O   . LEU A 1 76  ? 31.146  33.517  9.952   1.00 65.39  ? 76   LEU A O   1 
ATOM   576  C CB  . LEU A 1 76  ? 31.065  30.123  9.936   1.00 62.38  ? 76   LEU A CB  1 
ATOM   577  C CG  . LEU A 1 76  ? 30.230  30.343  8.656   1.00 62.81  ? 76   LEU A CG  1 
ATOM   578  C CD1 . LEU A 1 76  ? 31.067  30.872  7.489   1.00 62.55  ? 76   LEU A CD1 1 
ATOM   579  C CD2 . LEU A 1 76  ? 29.503  29.073  8.239   1.00 61.44  ? 76   LEU A CD2 1 
ATOM   580  N N   . TYR A 1 77  ? 30.171  32.404  11.667  1.00 64.08  ? 77   TYR A N   1 
ATOM   581  C CA  . TYR A 1 77  ? 29.217  33.477  11.998  1.00 64.71  ? 77   TYR A CA  1 
ATOM   582  C C   . TYR A 1 77  ? 29.339  33.856  13.470  1.00 65.24  ? 77   TYR A C   1 
ATOM   583  O O   . TYR A 1 77  ? 28.584  33.364  14.305  1.00 64.52  ? 77   TYR A O   1 
ATOM   584  C CB  . TYR A 1 77  ? 27.789  33.035  11.721  1.00 64.11  ? 77   TYR A CB  1 
ATOM   585  C CG  . TYR A 1 77  ? 27.485  32.741  10.282  1.00 63.75  ? 77   TYR A CG  1 
ATOM   586  C CD1 . TYR A 1 77  ? 27.449  33.761  9.334   1.00 64.88  ? 77   TYR A CD1 1 
ATOM   587  C CD2 . TYR A 1 77  ? 27.182  31.445  9.868   1.00 63.10  ? 77   TYR A CD2 1 
ATOM   588  C CE1 . TYR A 1 77  ? 27.141  33.500  8.002   1.00 64.79  ? 77   TYR A CE1 1 
ATOM   589  C CE2 . TYR A 1 77  ? 26.872  31.170  8.541   1.00 63.88  ? 77   TYR A CE2 1 
ATOM   590  C CZ  . TYR A 1 77  ? 26.851  32.202  7.607   1.00 64.55  ? 77   TYR A CZ  1 
ATOM   591  O OH  . TYR A 1 77  ? 26.541  31.928  6.288   1.00 64.11  ? 77   TYR A OH  1 
ATOM   592  N N   . PRO A 1 78  ? 30.298  34.730  13.796  1.00 66.64  ? 78   PRO A N   1 
ATOM   593  C CA  . PRO A 1 78  ? 30.503  35.119  15.195  1.00 67.13  ? 78   PRO A CA  1 
ATOM   594  C C   . PRO A 1 78  ? 29.262  35.751  15.830  1.00 67.33  ? 78   PRO A C   1 
ATOM   595  O O   . PRO A 1 78  ? 28.646  36.612  15.222  1.00 68.46  ? 78   PRO A O   1 
ATOM   596  C CB  . PRO A 1 78  ? 31.641  36.140  15.104  1.00 68.37  ? 78   PRO A CB  1 
ATOM   597  C CG  . PRO A 1 78  ? 32.357  35.789  13.826  1.00 68.39  ? 78   PRO A CG  1 
ATOM   598  C CD  . PRO A 1 78  ? 31.258  35.403  12.898  1.00 67.53  ? 78   PRO A CD  1 
ATOM   599  N N   . GLY A 1 79  ? 28.902  35.296  17.032  1.00 66.63  ? 79   GLY A N   1 
ATOM   600  C CA  . GLY A 1 79  ? 27.746  35.831  17.763  1.00 66.77  ? 79   GLY A CA  1 
ATOM   601  C C   . GLY A 1 79  ? 26.419  35.158  17.438  1.00 65.31  ? 79   GLY A C   1 
ATOM   602  O O   . GLY A 1 79  ? 25.425  35.377  18.134  1.00 65.71  ? 79   GLY A O   1 
ATOM   603  N N   . PHE A 1 80  ? 26.409  34.337  16.389  1.00 63.44  ? 80   PHE A N   1 
ATOM   604  C CA  . PHE A 1 80  ? 25.184  33.732  15.867  1.00 62.25  ? 80   PHE A CA  1 
ATOM   605  C C   . PHE A 1 80  ? 24.899  32.462  16.625  1.00 61.41  ? 80   PHE A C   1 
ATOM   606  O O   . PHE A 1 80  ? 25.750  31.571  16.678  1.00 60.77  ? 80   PHE A O   1 
ATOM   607  C CB  . PHE A 1 80  ? 25.352  33.426  14.372  1.00 61.31  ? 80   PHE A CB  1 
ATOM   608  C CG  . PHE A 1 80  ? 24.198  32.685  13.756  1.00 60.00  ? 80   PHE A CG  1 
ATOM   609  C CD1 . PHE A 1 80  ? 22.913  33.203  13.801  1.00 60.85  ? 80   PHE A CD1 1 
ATOM   610  C CD2 . PHE A 1 80  ? 24.402  31.479  13.106  1.00 58.51  ? 80   PHE A CD2 1 
ATOM   611  C CE1 . PHE A 1 80  ? 21.856  32.526  13.222  1.00 59.96  ? 80   PHE A CE1 1 
ATOM   612  C CE2 . PHE A 1 80  ? 23.349  30.798  12.521  1.00 57.46  ? 80   PHE A CE2 1 
ATOM   613  C CZ  . PHE A 1 80  ? 22.076  31.326  12.580  1.00 59.55  ? 80   PHE A CZ  1 
ATOM   614  N N   . GLU A 1 81  ? 23.697  32.358  17.179  1.00 61.81  ? 81   GLU A N   1 
ATOM   615  C CA  . GLU A 1 81  ? 23.351  31.224  18.027  1.00 61.76  ? 81   GLU A CA  1 
ATOM   616  C C   . GLU A 1 81  ? 23.390  29.856  17.322  1.00 59.68  ? 81   GLU A C   1 
ATOM   617  O O   . GLU A 1 81  ? 23.719  28.840  17.948  1.00 58.22  ? 81   GLU A O   1 
ATOM   618  C CB  . GLU A 1 81  ? 21.987  31.444  18.674  1.00 63.23  ? 81   GLU A CB  1 
ATOM   619  C CG  . GLU A 1 81  ? 21.613  30.342  19.671  1.00 66.41  ? 81   GLU A CG  1 
ATOM   620  C CD  . GLU A 1 81  ? 20.692  30.812  20.807  1.00 73.50  ? 81   GLU A CD  1 
ATOM   621  O OE1 . GLU A 1 81  ? 20.553  32.049  21.050  1.00 76.78  ? 81   GLU A OE1 1 
ATOM   622  O OE2 . GLU A 1 81  ? 20.114  29.919  21.474  1.00 76.78  ? 81   GLU A OE2 1 
ATOM   623  N N   . GLY A 1 82  ? 23.071  29.834  16.029  1.00 58.36  ? 82   GLY A N   1 
ATOM   624  C CA  . GLY A 1 82  ? 23.036  28.586  15.259  1.00 56.68  ? 82   GLY A CA  1 
ATOM   625  C C   . GLY A 1 82  ? 24.372  27.879  15.170  1.00 55.13  ? 82   GLY A C   1 
ATOM   626  O O   . GLY A 1 82  ? 24.434  26.643  15.054  1.00 54.03  ? 82   GLY A O   1 
ATOM   627  N N   . THR A 1 83  ? 25.450  28.656  15.198  1.00 54.45  ? 83   THR A N   1 
ATOM   628  C CA  . THR A 1 83  ? 26.780  28.078  15.248  1.00 53.67  ? 83   THR A CA  1 
ATOM   629  C C   . THR A 1 83  ? 27.268  27.994  16.698  1.00 53.87  ? 83   THR A C   1 
ATOM   630  O O   . THR A 1 83  ? 27.814  26.983  17.108  1.00 53.62  ? 83   THR A O   1 
ATOM   631  C CB  . THR A 1 83  ? 27.768  28.862  14.372  1.00 54.10  ? 83   THR A CB  1 
ATOM   632  O OG1 . THR A 1 83  ? 27.689  30.257  14.683  1.00 54.24  ? 83   THR A OG1 1 
ATOM   633  C CG2 . THR A 1 83  ? 27.456  28.625  12.884  1.00 52.09  ? 83   THR A CG2 1 
ATOM   634  N N   . GLU A 1 84  ? 27.022  29.035  17.484  1.00 54.71  ? 84   GLU A N   1 
ATOM   635  C CA  . GLU A 1 84  ? 27.620  29.134  18.808  1.00 54.88  ? 84   GLU A CA  1 
ATOM   636  C C   . GLU A 1 84  ? 27.089  28.074  19.753  1.00 53.22  ? 84   GLU A C   1 
ATOM   637  O O   . GLU A 1 84  ? 27.778  27.679  20.677  1.00 52.98  ? 84   GLU A O   1 
ATOM   638  C CB  . GLU A 1 84  ? 27.380  30.512  19.422  1.00 56.29  ? 84   GLU A CB  1 
ATOM   639  C CG  . GLU A 1 84  ? 28.050  31.658  18.681  1.00 60.90  ? 84   GLU A CG  1 
ATOM   640  C CD  . GLU A 1 84  ? 29.543  31.792  18.949  1.00 64.72  ? 84   GLU A CD  1 
ATOM   641  O OE1 . GLU A 1 84  ? 30.142  30.885  19.594  1.00 65.73  ? 84   GLU A OE1 1 
ATOM   642  O OE2 . GLU A 1 84  ? 30.109  32.822  18.496  1.00 67.85  ? 84   GLU A OE2 1 
ATOM   643  N N   . MET A 1 85  ? 25.870  27.603  19.536  1.00 51.95  ? 85   MET A N   1 
ATOM   644  C CA  . MET A 1 85  ? 25.332  26.584  20.417  1.00 51.28  ? 85   MET A CA  1 
ATOM   645  C C   . MET A 1 85  ? 26.125  25.268  20.388  1.00 49.14  ? 85   MET A C   1 
ATOM   646  O O   . MET A 1 85  ? 25.953  24.451  21.283  1.00 49.21  ? 85   MET A O   1 
ATOM   647  C CB  . MET A 1 85  ? 23.862  26.319  20.115  1.00 51.34  ? 85   MET A CB  1 
ATOM   648  C CG  . MET A 1 85  ? 23.569  25.612  18.813  1.00 50.72  ? 85   MET A CG  1 
ATOM   649  S SD  A MET A 1 85  ? 21.837  25.098  18.721  0.50 52.91  ? 85   MET A SD  1 
ATOM   650  S SD  B MET A 1 85  ? 21.820  25.190  18.687  0.50 53.04  ? 85   MET A SD  1 
ATOM   651  C CE  A MET A 1 85  ? 21.936  23.449  19.421  0.50 48.48  ? 85   MET A CE  1 
ATOM   652  C CE  B MET A 1 85  ? 21.264  26.479  17.582  0.50 50.46  ? 85   MET A CE  1 
ATOM   653  N N   . TRP A 1 86  ? 26.962  25.063  19.365  1.00 47.23  ? 86   TRP A N   1 
ATOM   654  C CA  . TRP A 1 86  ? 27.771  23.843  19.229  1.00 45.73  ? 86   TRP A CA  1 
ATOM   655  C C   . TRP A 1 86  ? 29.226  24.049  19.640  1.00 45.44  ? 86   TRP A C   1 
ATOM   656  O O   . TRP A 1 86  ? 30.001  23.093  19.725  1.00 44.37  ? 86   TRP A O   1 
ATOM   657  C CB  . TRP A 1 86  ? 27.729  23.347  17.780  1.00 44.87  ? 86   TRP A CB  1 
ATOM   658  C CG  . TRP A 1 86  ? 26.326  23.172  17.230  1.00 43.58  ? 86   TRP A CG  1 
ATOM   659  C CD1 . TRP A 1 86  ? 25.718  23.967  16.320  1.00 43.87  ? 86   TRP A CD1 1 
ATOM   660  C CD2 . TRP A 1 86  ? 25.386  22.146  17.555  1.00 42.11  ? 86   TRP A CD2 1 
ATOM   661  N NE1 . TRP A 1 86  ? 24.453  23.512  16.048  1.00 43.46  ? 86   TRP A NE1 1 
ATOM   662  C CE2 . TRP A 1 86  ? 24.222  22.390  16.794  1.00 42.85  ? 86   TRP A CE2 1 
ATOM   663  C CE3 . TRP A 1 86  ? 25.411  21.043  18.411  1.00 41.93  ? 86   TRP A CE3 1 
ATOM   664  C CZ2 . TRP A 1 86  ? 23.097  21.561  16.854  1.00 43.33  ? 86   TRP A CZ2 1 
ATOM   665  C CZ3 . TRP A 1 86  ? 24.301  20.228  18.481  1.00 43.05  ? 86   TRP A CZ3 1 
ATOM   666  C CH2 . TRP A 1 86  ? 23.146  20.495  17.714  1.00 43.56  ? 86   TRP A CH2 1 
ATOM   667  N N   . ASN A 1 87  ? 29.594  25.303  19.875  1.00 45.76  ? 87   ASN A N   1 
ATOM   668  C CA  . ASN A 1 87  ? 30.930  25.659  20.299  1.00 46.76  ? 87   ASN A CA  1 
ATOM   669  C C   . ASN A 1 87  ? 31.207  25.252  21.754  1.00 46.67  ? 87   ASN A C   1 
ATOM   670  O O   . ASN A 1 87  ? 30.289  25.113  22.559  1.00 46.70  ? 87   ASN A O   1 
ATOM   671  C CB  . ASN A 1 87  ? 31.135  27.188  20.155  1.00 47.83  ? 87   ASN A CB  1 
ATOM   672  C CG  . ASN A 1 87  ? 31.573  27.606  18.746  1.00 49.39  ? 87   ASN A CG  1 
ATOM   673  O OD1 . ASN A 1 87  ? 32.103  26.800  17.973  1.00 51.25  ? 87   ASN A OD1 1 
ATOM   674  N ND2 . ASN A 1 87  ? 31.377  28.891  18.422  1.00 51.01  ? 87   ASN A ND2 1 
ATOM   675  N N   . PRO A 1 88  ? 32.486  25.116  22.113  1.00 47.00  ? 88   PRO A N   1 
ATOM   676  C CA  . PRO A 1 88  ? 32.830  24.770  23.502  1.00 46.93  ? 88   PRO A CA  1 
ATOM   677  C C   . PRO A 1 88  ? 32.263  25.754  24.513  1.00 47.24  ? 88   PRO A C   1 
ATOM   678  O O   . PRO A 1 88  ? 32.334  26.952  24.295  1.00 47.24  ? 88   PRO A O   1 
ATOM   679  C CB  . PRO A 1 88  ? 34.354  24.853  23.523  1.00 47.30  ? 88   PRO A CB  1 
ATOM   680  C CG  . PRO A 1 88  ? 34.775  24.724  22.087  1.00 47.64  ? 88   PRO A CG  1 
ATOM   681  C CD  . PRO A 1 88  ? 33.682  25.312  21.272  1.00 47.41  ? 88   PRO A CD  1 
ATOM   682  N N   . ASN A 1 89  ? 31.711  25.238  25.611  1.00 47.25  ? 89   ASN A N   1 
ATOM   683  C CA  . ASN A 1 89  ? 31.155  26.075  26.677  1.00 47.58  ? 89   ASN A CA  1 
ATOM   684  C C   . ASN A 1 89  ? 31.898  25.923  28.002  1.00 47.73  ? 89   ASN A C   1 
ATOM   685  O O   . ASN A 1 89  ? 31.406  26.359  29.032  1.00 48.34  ? 89   ASN A O   1 
ATOM   686  C CB  . ASN A 1 89  ? 29.658  25.791  26.860  1.00 47.33  ? 89   ASN A CB  1 
ATOM   687  C CG  . ASN A 1 89  ? 29.371  24.383  27.338  1.00 47.27  ? 89   ASN A CG  1 
ATOM   688  O OD1 . ASN A 1 89  ? 30.223  23.502  27.258  1.00 45.37  ? 89   ASN A OD1 1 
ATOM   689  N ND2 . ASN A 1 89  ? 28.139  24.152  27.818  1.00 46.90  ? 89   ASN A ND2 1 
ATOM   690  N N   . ARG A 1 90  ? 33.064  25.277  27.966  1.00 47.33  ? 90   ARG A N   1 
ATOM   691  C CA  . ARG A 1 90  ? 33.998  25.263  29.075  1.00 48.67  ? 90   ARG A CA  1 
ATOM   692  C C   . ARG A 1 90  ? 35.408  25.434  28.501  1.00 49.12  ? 90   ARG A C   1 
ATOM   693  O O   . ARG A 1 90  ? 35.607  25.352  27.282  1.00 49.23  ? 90   ARG A O   1 
ATOM   694  C CB  A ARG A 1 90  ? 33.931  23.943  29.857  0.50 48.21  ? 90   ARG A CB  1 
ATOM   695  C CB  B ARG A 1 90  ? 33.897  23.962  29.881  0.50 48.50  ? 90   ARG A CB  1 
ATOM   696  C CG  A ARG A 1 90  ? 32.545  23.504  30.368  0.50 48.27  ? 90   ARG A CG  1 
ATOM   697  C CG  B ARG A 1 90  ? 32.671  23.848  30.797  0.50 49.89  ? 90   ARG A CG  1 
ATOM   698  C CD  A ARG A 1 90  ? 32.208  24.071  31.751  0.50 49.67  ? 90   ARG A CD  1 
ATOM   699  C CD  B ARG A 1 90  ? 32.540  25.053  31.721  0.50 53.23  ? 90   ARG A CD  1 
ATOM   700  N NE  A ARG A 1 90  ? 31.480  25.338  31.650  0.50 51.20  ? 90   ARG A NE  1 
ATOM   701  N NE  B ARG A 1 90  ? 32.021  24.736  33.049  0.50 54.77  ? 90   ARG A NE  1 
ATOM   702  C CZ  A ARG A 1 90  ? 30.205  25.543  31.985  0.50 51.96  ? 90   ARG A CZ  1 
ATOM   703  C CZ  B ARG A 1 90  ? 32.762  24.550  34.143  0.50 56.50  ? 90   ARG A CZ  1 
ATOM   704  N NH1 A ARG A 1 90  ? 29.692  26.744  31.819  0.50 53.72  ? 90   ARG A NH1 1 
ATOM   705  N NH1 B ARG A 1 90  ? 32.173  24.278  35.285  0.50 56.57  ? 90   ARG A NH1 1 
ATOM   706  N NH2 A ARG A 1 90  ? 29.435  24.590  32.493  0.50 52.48  ? 90   ARG A NH2 1 
ATOM   707  N NH2 B ARG A 1 90  ? 34.088  24.626  34.116  0.50 58.72  ? 90   ARG A NH2 1 
ATOM   708  N N   . GLU A 1 91  ? 36.380  25.654  29.375  1.00 49.71  ? 91   GLU A N   1 
ATOM   709  C CA  . GLU A 1 91  ? 37.775  25.799  28.958  1.00 50.81  ? 91   GLU A CA  1 
ATOM   710  C C   . GLU A 1 91  ? 38.243  24.627  28.110  1.00 49.37  ? 91   GLU A C   1 
ATOM   711  O O   . GLU A 1 91  ? 37.890  23.469  28.387  1.00 48.11  ? 91   GLU A O   1 
ATOM   712  C CB  . GLU A 1 91  ? 38.683  25.905  30.184  1.00 52.34  ? 91   GLU A CB  1 
ATOM   713  C CG  . GLU A 1 91  ? 40.177  25.791  29.880  1.00 55.01  ? 91   GLU A CG  1 
ATOM   714  C CD  . GLU A 1 91  ? 41.053  25.926  31.115  1.00 58.83  ? 91   GLU A CD  1 
ATOM   715  O OE1 . GLU A 1 91  ? 40.500  26.196  32.205  1.00 58.48  ? 91   GLU A OE1 1 
ATOM   716  O OE2 . GLU A 1 91  ? 42.296  25.751  30.992  1.00 62.17  ? 91   GLU A OE2 1 
ATOM   717  N N   . LEU A 1 92  ? 39.048  24.927  27.087  1.00 48.69  ? 92   LEU A N   1 
ATOM   718  C CA  . LEU A 1 92  ? 39.675  23.881  26.269  1.00 47.81  ? 92   LEU A CA  1 
ATOM   719  C C   . LEU A 1 92  ? 40.960  23.423  26.928  1.00 48.17  ? 92   LEU A C   1 
ATOM   720  O O   . LEU A 1 92  ? 41.791  24.236  27.299  1.00 48.66  ? 92   LEU A O   1 
ATOM   721  C CB  . LEU A 1 92  ? 40.014  24.389  24.880  1.00 48.29  ? 92   LEU A CB  1 
ATOM   722  C CG  . LEU A 1 92  ? 38.861  24.879  24.028  1.00 47.39  ? 92   LEU A CG  1 
ATOM   723  C CD1 . LEU A 1 92  ? 39.374  25.682  22.824  1.00 47.12  ? 92   LEU A CD1 1 
ATOM   724  C CD2 . LEU A 1 92  ? 38.067  23.664  23.603  1.00 48.50  ? 92   LEU A CD2 1 
ATOM   725  N N   . SER A 1 93  ? 41.109  22.113  27.065  1.00 47.20  ? 93   SER A N   1 
ATOM   726  C CA  . SER A 1 93  ? 42.312  21.513  27.603  1.00 47.26  ? 93   SER A CA  1 
ATOM   727  C C   . SER A 1 93  ? 42.440  20.112  27.040  1.00 46.60  ? 93   SER A C   1 
ATOM   728  O O   . SER A 1 93  ? 41.436  19.493  26.695  1.00 44.86  ? 93   SER A O   1 
ATOM   729  C CB  . SER A 1 93  ? 42.223  21.411  29.126  1.00 47.71  ? 93   SER A CB  1 
ATOM   730  O OG  . SER A 1 93  ? 43.364  20.725  29.645  1.00 47.96  ? 93   SER A OG  1 
ATOM   731  N N   . GLU A 1 94  ? 43.671  19.622  26.968  1.00 46.82  ? 94   GLU A N   1 
ATOM   732  C CA  . GLU A 1 94  ? 43.935  18.214  26.700  1.00 47.02  ? 94   GLU A CA  1 
ATOM   733  C C   . GLU A 1 94  ? 43.635  17.336  27.906  1.00 47.49  ? 94   GLU A C   1 
ATOM   734  O O   . GLU A 1 94  ? 43.521  16.112  27.762  1.00 47.80  ? 94   GLU A O   1 
ATOM   735  C CB  . GLU A 1 94  ? 45.394  18.001  26.320  1.00 47.93  ? 94   GLU A CB  1 
ATOM   736  C CG  . GLU A 1 94  ? 45.790  18.570  24.974  1.00 47.51  ? 94   GLU A CG  1 
ATOM   737  C CD  . GLU A 1 94  ? 47.246  18.320  24.687  1.00 48.51  ? 94   GLU A CD  1 
ATOM   738  O OE1 . GLU A 1 94  ? 47.591  17.186  24.265  1.00 45.29  ? 94   GLU A OE1 1 
ATOM   739  O OE2 . GLU A 1 94  ? 48.041  19.256  24.906  1.00 49.27  ? 94   GLU A OE2 1 
ATOM   740  N N   . ASP A 1 95  ? 43.540  17.954  29.086  1.00 48.19  ? 95   ASP A N   1 
ATOM   741  C CA  . ASP A 1 95  ? 43.002  17.304  30.280  1.00 48.72  ? 95   ASP A CA  1 
ATOM   742  C C   . ASP A 1 95  ? 41.495  17.430  30.241  1.00 47.32  ? 95   ASP A C   1 
ATOM   743  O O   . ASP A 1 95  ? 40.930  18.399  30.771  1.00 47.61  ? 95   ASP A O   1 
ATOM   744  C CB  . ASP A 1 95  ? 43.534  17.968  31.554  1.00 50.41  ? 95   ASP A CB  1 
ATOM   745  C CG  . ASP A 1 95  ? 43.083  17.254  32.828  1.00 52.10  ? 95   ASP A CG  1 
ATOM   746  O OD1 . ASP A 1 95  ? 42.283  16.284  32.770  1.00 51.31  ? 95   ASP A OD1 1 
ATOM   747  O OD2 . ASP A 1 95  ? 43.546  17.680  33.901  1.00 57.76  ? 95   ASP A OD2 1 
ATOM   748  N N   . CYS A 1 96  ? 40.858  16.445  29.612  1.00 45.95  ? 96   CYS A N   1 
ATOM   749  C CA  . CYS A 1 96  ? 39.457  16.535  29.226  1.00 44.25  ? 96   CYS A CA  1 
ATOM   750  C C   . CYS A 1 96  ? 38.629  15.229  29.326  1.00 43.23  ? 96   CYS A C   1 
ATOM   751  O O   . CYS A 1 96  ? 37.431  15.207  28.994  1.00 42.92  ? 96   CYS A O   1 
ATOM   752  C CB  . CYS A 1 96  ? 39.410  17.056  27.777  1.00 44.30  ? 96   CYS A CB  1 
ATOM   753  S SG  . CYS A 1 96  ? 39.909  15.867  26.462  1.00 44.46  ? 96   CYS A SG  1 
ATOM   754  N N   . LEU A 1 97  ? 39.238  14.165  29.823  1.00 43.35  ? 97   LEU A N   1 
ATOM   755  C CA  . LEU A 1 97  ? 38.627  12.836  29.806  1.00 42.92  ? 97   LEU A CA  1 
ATOM   756  C C   . LEU A 1 97  ? 37.774  12.611  31.052  1.00 42.95  ? 97   LEU A C   1 
ATOM   757  O O   . LEU A 1 97  ? 38.160  11.926  31.998  1.00 43.66  ? 97   LEU A O   1 
ATOM   758  C CB  . LEU A 1 97  ? 39.713  11.763  29.637  1.00 43.52  ? 97   LEU A CB  1 
ATOM   759  C CG  . LEU A 1 97  ? 40.357  11.667  28.248  1.00 43.16  ? 97   LEU A CG  1 
ATOM   760  C CD1 . LEU A 1 97  ? 41.266  10.412  28.167  1.00 40.33  ? 97   LEU A CD1 1 
ATOM   761  C CD2 . LEU A 1 97  ? 39.251  11.611  27.150  1.00 41.16  ? 97   LEU A CD2 1 
ATOM   762  N N   . TYR A 1 98  ? 36.581  13.202  31.003  1.00 42.52  ? 98   TYR A N   1 
ATOM   763  C CA  . TYR A 1 98  ? 35.636  13.203  32.093  1.00 42.12  ? 98   TYR A CA  1 
ATOM   764  C C   . TYR A 1 98  ? 34.285  12.740  31.555  1.00 41.67  ? 98   TYR A C   1 
ATOM   765  O O   . TYR A 1 98  ? 33.995  12.888  30.370  1.00 40.65  ? 98   TYR A O   1 
ATOM   766  C CB  . TYR A 1 98  ? 35.541  14.619  32.690  1.00 42.36  ? 98   TYR A CB  1 
ATOM   767  C CG  . TYR A 1 98  ? 36.853  15.088  33.255  1.00 42.14  ? 98   TYR A CG  1 
ATOM   768  C CD1 . TYR A 1 98  ? 37.218  14.791  34.568  1.00 44.01  ? 98   TYR A CD1 1 
ATOM   769  C CD2 . TYR A 1 98  ? 37.761  15.774  32.468  1.00 43.57  ? 98   TYR A CD2 1 
ATOM   770  C CE1 . TYR A 1 98  ? 38.439  15.193  35.088  1.00 43.53  ? 98   TYR A CE1 1 
ATOM   771  C CE2 . TYR A 1 98  ? 39.008  16.169  32.973  1.00 43.83  ? 98   TYR A CE2 1 
ATOM   772  C CZ  . TYR A 1 98  ? 39.338  15.867  34.289  1.00 44.74  ? 98   TYR A CZ  1 
ATOM   773  O OH  . TYR A 1 98  ? 40.568  16.248  34.809  1.00 44.47  ? 98   TYR A OH  1 
ATOM   774  N N   . LEU A 1 99  ? 33.469  12.166  32.426  1.00 41.39  ? 99   LEU A N   1 
ATOM   775  C CA  . LEU A 1 99  ? 32.132  11.775  32.048  1.00 41.50  ? 99   LEU A CA  1 
ATOM   776  C C   . LEU A 1 99  ? 31.105  12.323  33.041  1.00 41.68  ? 99   LEU A C   1 
ATOM   777  O O   . LEU A 1 99  ? 31.451  12.770  34.131  1.00 42.73  ? 99   LEU A O   1 
ATOM   778  C CB  . LEU A 1 99  ? 32.030  10.264  31.869  1.00 41.91  ? 99   LEU A CB  1 
ATOM   779  C CG  . LEU A 1 99  ? 32.306  9.272   33.010  1.00 42.38  ? 99   LEU A CG  1 
ATOM   780  C CD1 . LEU A 1 99  ? 31.094  9.152   33.947  1.00 41.03  ? 99   LEU A CD1 1 
ATOM   781  C CD2 . LEU A 1 99  ? 32.617  7.914   32.386  1.00 42.02  ? 99   LEU A CD2 1 
ATOM   782  N N   . ASN A 1 100 ? 29.856  12.346  32.604  1.00 41.14  ? 100  ASN A N   1 
ATOM   783  C CA  . ASN A 1 100 ? 28.763  12.939  33.352  1.00 41.04  ? 100  ASN A CA  1 
ATOM   784  C C   . ASN A 1 100 ? 27.665  11.902  33.488  1.00 40.46  ? 100  ASN A C   1 
ATOM   785  O O   . ASN A 1 100 ? 27.422  11.177  32.542  1.00 39.70  ? 100  ASN A O   1 
ATOM   786  C CB  . ASN A 1 100 ? 28.199  14.147  32.597  1.00 40.23  ? 100  ASN A CB  1 
ATOM   787  C CG  . ASN A 1 100 ? 29.276  15.067  32.044  1.00 41.56  ? 100  ASN A CG  1 
ATOM   788  O OD1 . ASN A 1 100 ? 29.457  15.174  30.808  1.00 44.04  ? 100  ASN A OD1 1 
ATOM   789  N ND2 . ASN A 1 100 ? 29.987  15.749  32.938  1.00 37.85  ? 100  ASN A ND2 1 
ATOM   790  N N   . VAL A 1 101 ? 26.999  11.865  34.646  1.00 41.15  ? 101  VAL A N   1 
ATOM   791  C CA  . VAL A 1 101 ? 25.871  10.978  34.911  1.00 41.05  ? 101  VAL A CA  1 
ATOM   792  C C   . VAL A 1 101 ? 24.674  11.782  35.455  1.00 42.16  ? 101  VAL A C   1 
ATOM   793  O O   . VAL A 1 101 ? 24.835  12.615  36.338  1.00 41.69  ? 101  VAL A O   1 
ATOM   794  C CB  . VAL A 1 101 ? 26.241  9.893   35.936  1.00 42.01  ? 101  VAL A CB  1 
ATOM   795  C CG1 . VAL A 1 101 ? 25.050  8.944   36.187  1.00 41.28  ? 101  VAL A CG1 1 
ATOM   796  C CG2 . VAL A 1 101 ? 27.473  9.103   35.476  1.00 40.42  ? 101  VAL A CG2 1 
ATOM   797  N N   . TRP A 1 102 ? 23.494  11.538  34.895  1.00 42.62  ? 102  TRP A N   1 
ATOM   798  C CA  . TRP A 1 102 ? 22.229  12.056  35.433  1.00 43.90  ? 102  TRP A CA  1 
ATOM   799  C C   . TRP A 1 102 ? 21.366  10.873  35.788  1.00 44.81  ? 102  TRP A C   1 
ATOM   800  O O   . TRP A 1 102 ? 21.315  9.892   35.048  1.00 43.76  ? 102  TRP A O   1 
ATOM   801  C CB  . TRP A 1 102 ? 21.448  12.854  34.416  1.00 44.07  ? 102  TRP A CB  1 
ATOM   802  C CG  . TRP A 1 102 ? 21.972  14.187  34.095  1.00 44.13  ? 102  TRP A CG  1 
ATOM   803  C CD1 . TRP A 1 102 ? 21.601  15.389  34.650  1.00 45.44  ? 102  TRP A CD1 1 
ATOM   804  C CD2 . TRP A 1 102 ? 22.895  14.485  33.072  1.00 42.26  ? 102  TRP A CD2 1 
ATOM   805  N NE1 . TRP A 1 102 ? 22.283  16.415  34.044  1.00 44.14  ? 102  TRP A NE1 1 
ATOM   806  C CE2 . TRP A 1 102 ? 23.089  15.882  33.073  1.00 43.72  ? 102  TRP A CE2 1 
ATOM   807  C CE3 . TRP A 1 102 ? 23.590  13.706  32.151  1.00 42.71  ? 102  TRP A CE3 1 
ATOM   808  C CZ2 . TRP A 1 102 ? 23.950  16.511  32.182  1.00 43.47  ? 102  TRP A CZ2 1 
ATOM   809  C CZ3 . TRP A 1 102 ? 24.458  14.332  31.277  1.00 42.50  ? 102  TRP A CZ3 1 
ATOM   810  C CH2 . TRP A 1 102 ? 24.628  15.718  31.299  1.00 43.30  ? 102  TRP A CH2 1 
ATOM   811  N N   . THR A 1 103 ? 20.671  10.989  36.910  1.00 46.64  ? 103  THR A N   1 
ATOM   812  C CA  . THR A 1 103 ? 19.806  9.929   37.401  1.00 48.35  ? 103  THR A CA  1 
ATOM   813  C C   . THR A 1 103 ? 18.635  10.628  38.103  1.00 49.87  ? 103  THR A C   1 
ATOM   814  O O   . THR A 1 103 ? 18.746  11.795  38.471  1.00 50.53  ? 103  THR A O   1 
ATOM   815  C CB  . THR A 1 103 ? 20.556  8.990   38.394  1.00 48.53  ? 103  THR A CB  1 
ATOM   816  O OG1 . THR A 1 103 ? 20.501  9.534   39.714  1.00 51.05  ? 103  THR A OG1 1 
ATOM   817  C CG2 . THR A 1 103 ? 21.999  8.844   38.038  1.00 48.27  ? 103  THR A CG2 1 
ATOM   818  N N   . PRO A 1 104 ? 17.508  9.929   38.276  1.00 51.48  ? 104  PRO A N   1 
ATOM   819  C CA  . PRO A 1 104 ? 16.442  10.413  39.145  1.00 53.27  ? 104  PRO A CA  1 
ATOM   820  C C   . PRO A 1 104 ? 16.913  10.835  40.547  1.00 54.21  ? 104  PRO A C   1 
ATOM   821  O O   . PRO A 1 104 ? 17.991  10.423  40.987  1.00 55.18  ? 104  PRO A O   1 
ATOM   822  C CB  . PRO A 1 104 ? 15.523  9.205   39.258  1.00 53.90  ? 104  PRO A CB  1 
ATOM   823  C CG  . PRO A 1 104 ? 15.724  8.480   37.995  1.00 53.30  ? 104  PRO A CG  1 
ATOM   824  C CD  . PRO A 1 104 ? 17.152  8.654   37.634  1.00 51.61  ? 104  PRO A CD  1 
ATOM   825  N N   . TYR A 1 105 ? 16.114  11.674  41.205  1.00 55.12  ? 105  TYR A N   1 
ATOM   826  C CA  . TYR A 1 105 ? 16.329  12.082  42.593  1.00 56.06  ? 105  TYR A CA  1 
ATOM   827  C C   . TYR A 1 105 ? 15.043  11.774  43.339  1.00 58.25  ? 105  TYR A C   1 
ATOM   828  O O   . TYR A 1 105 ? 13.993  12.303  42.980  1.00 58.61  ? 105  TYR A O   1 
ATOM   829  C CB  . TYR A 1 105 ? 16.633  13.576  42.694  1.00 55.02  ? 105  TYR A CB  1 
ATOM   830  C CG  . TYR A 1 105 ? 16.991  14.079  44.089  1.00 54.82  ? 105  TYR A CG  1 
ATOM   831  C CD1 . TYR A 1 105 ? 18.312  14.324  44.438  1.00 54.19  ? 105  TYR A CD1 1 
ATOM   832  C CD2 . TYR A 1 105 ? 16.012  14.347  45.041  1.00 55.97  ? 105  TYR A CD2 1 
ATOM   833  C CE1 . TYR A 1 105 ? 18.653  14.800  45.696  1.00 53.77  ? 105  TYR A CE1 1 
ATOM   834  C CE2 . TYR A 1 105 ? 16.347  14.830  46.305  1.00 57.20  ? 105  TYR A CE2 1 
ATOM   835  C CZ  . TYR A 1 105 ? 17.676  15.051  46.618  1.00 56.26  ? 105  TYR A CZ  1 
ATOM   836  O OH  . TYR A 1 105 ? 18.035  15.527  47.851  1.00 56.50  ? 105  TYR A OH  1 
ATOM   837  N N   . PRO A 1 106 ? 15.105  10.898  44.357  1.00 60.41  ? 106  PRO A N   1 
ATOM   838  C CA  . PRO A 1 106 ? 16.261  10.102  44.768  1.00 60.85  ? 106  PRO A CA  1 
ATOM   839  C C   . PRO A 1 106 ? 16.587  9.045   43.711  1.00 60.92  ? 106  PRO A C   1 
ATOM   840  O O   . PRO A 1 106 ? 15.767  8.796   42.824  1.00 60.69  ? 106  PRO A O   1 
ATOM   841  C CB  . PRO A 1 106 ? 15.806  9.457   46.078  1.00 62.59  ? 106  PRO A CB  1 
ATOM   842  C CG  . PRO A 1 106 ? 14.322  9.464   46.024  1.00 63.56  ? 106  PRO A CG  1 
ATOM   843  C CD  . PRO A 1 106 ? 13.930  10.656  45.210  1.00 62.30  ? 106  PRO A CD  1 
ATOM   844  N N   . ARG A 1 107 ? 17.780  8.454   43.792  1.00 61.48  ? 107  ARG A N   1 
ATOM   845  C CA  . ARG A 1 107 ? 18.234  7.484   42.788  1.00 61.54  ? 107  ARG A CA  1 
ATOM   846  C C   . ARG A 1 107 ? 17.302  6.287   42.793  1.00 63.10  ? 107  ARG A C   1 
ATOM   847  O O   . ARG A 1 107 ? 16.695  5.989   43.815  1.00 64.78  ? 107  ARG A O   1 
ATOM   848  C CB  . ARG A 1 107 ? 19.687  7.048   43.041  1.00 60.98  ? 107  ARG A CB  1 
ATOM   849  C CG  . ARG A 1 107 ? 20.672  8.213   42.924  1.00 60.97  ? 107  ARG A CG  1 
ATOM   850  C CD  . ARG A 1 107 ? 22.106  7.767   42.801  1.00 60.96  ? 107  ARG A CD  1 
ATOM   851  N NE  . ARG A 1 107 ? 22.550  7.029   43.981  1.00 62.40  ? 107  ARG A NE  1 
ATOM   852  C CZ  . ARG A 1 107 ? 22.906  7.594   45.128  1.00 63.01  ? 107  ARG A CZ  1 
ATOM   853  N NH1 . ARG A 1 107 ? 22.903  8.914   45.259  1.00 62.76  ? 107  ARG A NH1 1 
ATOM   854  N NH2 . ARG A 1 107 ? 23.282  6.828   46.149  1.00 64.63  ? 107  ARG A NH2 1 
ATOM   855  N N   . PRO A 1 108 ? 17.157  5.616   41.638  1.00 63.66  ? 108  PRO A N   1 
ATOM   856  C CA  . PRO A 1 108 ? 16.252  4.459   41.560  1.00 65.26  ? 108  PRO A CA  1 
ATOM   857  C C   . PRO A 1 108 ? 16.608  3.304   42.520  1.00 66.79  ? 108  PRO A C   1 
ATOM   858  O O   . PRO A 1 108 ? 17.781  2.990   42.722  1.00 66.42  ? 108  PRO A O   1 
ATOM   859  C CB  . PRO A 1 108 ? 16.361  4.010   40.097  1.00 64.24  ? 108  PRO A CB  1 
ATOM   860  C CG  . PRO A 1 108 ? 17.543  4.712   39.531  1.00 62.92  ? 108  PRO A CG  1 
ATOM   861  C CD  . PRO A 1 108 ? 17.789  5.927   40.343  1.00 62.26  ? 108  PRO A CD  1 
ATOM   862  N N   . ALA A 1 109 ? 15.583  2.681   43.089  1.00 68.90  ? 109  ALA A N   1 
ATOM   863  C CA  . ALA A 1 109 ? 15.777  1.559   44.009  1.00 70.58  ? 109  ALA A CA  1 
ATOM   864  C C   . ALA A 1 109 ? 16.055  0.245   43.265  1.00 70.80  ? 109  ALA A C   1 
ATOM   865  O O   . ALA A 1 109 ? 16.723  -0.635  43.791  1.00 71.85  ? 109  ALA A O   1 
ATOM   866  C CB  . ALA A 1 109 ? 14.566  1.411   44.904  1.00 72.24  ? 109  ALA A CB  1 
ATOM   867  N N   . SER A 1 110 ? 15.536  0.123   42.047  1.00 70.41  ? 110  SER A N   1 
ATOM   868  C CA  . SER A 1 110 ? 15.713  -1.074  41.224  1.00 70.16  ? 110  SER A CA  1 
ATOM   869  C C   . SER A 1 110 ? 16.608  -0.732  40.025  1.00 67.43  ? 110  SER A C   1 
ATOM   870  O O   . SER A 1 110 ? 16.582  0.404   39.561  1.00 66.58  ? 110  SER A O   1 
ATOM   871  C CB  . SER A 1 110 ? 14.356  -1.532  40.713  1.00 71.18  ? 110  SER A CB  1 
ATOM   872  O OG  . SER A 1 110 ? 13.957  -0.680  39.650  1.00 71.64  ? 110  SER A OG  1 
ATOM   873  N N   . PRO A 1 111 ? 17.372  -1.714  39.500  1.00 66.08  ? 111  PRO A N   1 
ATOM   874  C CA  . PRO A 1 111 ? 18.283  -1.402  38.388  1.00 63.60  ? 111  PRO A CA  1 
ATOM   875  C C   . PRO A 1 111 ? 17.560  -0.909  37.127  1.00 61.98  ? 111  PRO A C   1 
ATOM   876  O O   . PRO A 1 111 ? 16.633  -1.555  36.637  1.00 62.53  ? 111  PRO A O   1 
ATOM   877  C CB  . PRO A 1 111 ? 19.011  -2.727  38.120  1.00 64.28  ? 111  PRO A CB  1 
ATOM   878  C CG  . PRO A 1 111 ? 18.738  -3.593  39.326  1.00 66.31  ? 111  PRO A CG  1 
ATOM   879  C CD  . PRO A 1 111 ? 17.433  -3.136  39.890  1.00 67.33  ? 111  PRO A CD  1 
ATOM   880  N N   . THR A 1 112 ? 18.042  0.215   36.607  1.00 59.18  ? 112  THR A N   1 
ATOM   881  C CA  . THR A 1 112 ? 17.397  0.989   35.568  1.00 57.72  ? 112  THR A CA  1 
ATOM   882  C C   . THR A 1 112 ? 18.217  0.951   34.285  1.00 55.62  ? 112  THR A C   1 
ATOM   883  O O   . THR A 1 112 ? 19.440  1.103   34.333  1.00 55.17  ? 112  THR A O   1 
ATOM   884  C CB  . THR A 1 112 ? 17.320  2.463   36.024  1.00 57.25  ? 112  THR A CB  1 
ATOM   885  O OG1 . THR A 1 112 ? 16.787  2.513   37.352  1.00 58.71  ? 112  THR A OG1 1 
ATOM   886  C CG2 . THR A 1 112 ? 16.461  3.304   35.080  1.00 57.00  ? 112  THR A CG2 1 
ATOM   887  N N   . PRO A 1 113 ? 17.559  0.776   33.130  1.00 54.75  ? 113  PRO A N   1 
ATOM   888  C CA  . PRO A 1 113 ? 18.275  0.829   31.848  1.00 53.17  ? 113  PRO A CA  1 
ATOM   889  C C   . PRO A 1 113 ? 19.123  2.103   31.662  1.00 51.01  ? 113  PRO A C   1 
ATOM   890  O O   . PRO A 1 113 ? 18.690  3.197   32.022  1.00 50.50  ? 113  PRO A O   1 
ATOM   891  C CB  . PRO A 1 113 ? 17.150  0.785   30.813  1.00 53.16  ? 113  PRO A CB  1 
ATOM   892  C CG  . PRO A 1 113 ? 16.022  0.081   31.502  1.00 55.88  ? 113  PRO A CG  1 
ATOM   893  C CD  . PRO A 1 113 ? 16.115  0.524   32.939  1.00 56.32  ? 113  PRO A CD  1 
ATOM   894  N N   . VAL A 1 114 ? 20.310  1.942   31.087  1.00 49.56  ? 114  VAL A N   1 
ATOM   895  C CA  . VAL A 1 114 ? 21.273  3.033   30.937  1.00 47.99  ? 114  VAL A CA  1 
ATOM   896  C C   . VAL A 1 114 ? 21.339  3.472   29.471  1.00 47.07  ? 114  VAL A C   1 
ATOM   897  O O   . VAL A 1 114 ? 21.340  2.630   28.573  1.00 46.41  ? 114  VAL A O   1 
ATOM   898  C CB  . VAL A 1 114 ? 22.663  2.584   31.422  1.00 47.73  ? 114  VAL A CB  1 
ATOM   899  C CG1 . VAL A 1 114 ? 23.719  3.701   31.212  1.00 46.32  ? 114  VAL A CG1 1 
ATOM   900  C CG2 . VAL A 1 114 ? 22.595  2.147   32.882  1.00 47.61  ? 114  VAL A CG2 1 
ATOM   901  N N   . LEU A 1 115 ? 21.330  4.786   29.247  1.00 46.05  ? 115  LEU A N   1 
ATOM   902  C CA  . LEU A 1 115 ? 21.567  5.376   27.930  1.00 45.30  ? 115  LEU A CA  1 
ATOM   903  C C   . LEU A 1 115 ? 22.904  6.084   27.954  1.00 44.22  ? 115  LEU A C   1 
ATOM   904  O O   . LEU A 1 115 ? 23.146  6.895   28.825  1.00 44.63  ? 115  LEU A O   1 
ATOM   905  C CB  A LEU A 1 115 ? 20.471  6.377   27.579  0.50 45.13  ? 115  LEU A CB  1 
ATOM   906  C CB  B LEU A 1 115 ? 20.480  6.381   27.565  0.50 45.17  ? 115  LEU A CB  1 
ATOM   907  C CG  A LEU A 1 115 ? 19.183  5.801   26.980  0.50 46.40  ? 115  LEU A CG  1 
ATOM   908  C CG  B LEU A 1 115 ? 19.115  5.795   27.202  0.50 46.67  ? 115  LEU A CG  1 
ATOM   909  C CD1 A LEU A 1 115 ? 18.016  6.748   27.241  0.50 47.01  ? 115  LEU A CD1 1 
ATOM   910  C CD1 B LEU A 1 115 ? 18.442  5.257   28.438  0.50 47.56  ? 115  LEU A CD1 1 
ATOM   911  C CD2 A LEU A 1 115 ? 19.349  5.542   25.481  0.50 45.12  ? 115  LEU A CD2 1 
ATOM   912  C CD2 B LEU A 1 115 ? 18.239  6.851   26.522  0.50 46.63  ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 23.771  5.772   27.002  1.00 43.59  ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 25.056  6.449   26.893  1.00 42.13  ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 25.065  7.263   25.613  1.00 41.58  ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 24.861  6.711   24.518  1.00 40.28  ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 26.193  5.452   26.889  1.00 42.06  ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 26.106  4.562   28.134  1.00 42.46  ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.528  6.161   26.833  1.00 41.46  ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 27.193  3.528   28.231  1.00 40.17  ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.286  8.577   25.768  1.00 41.15  ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.348  9.510   24.663  1.00 40.40  ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 26.763  9.726   24.172  1.00 39.99  ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 27.641  10.107  24.948  1.00 40.14  ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 24.824  10.871  25.086  1.00 40.32  ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 24.954  11.921  24.026  1.00 40.19  ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 25.778  13.021  24.052  1.00 41.20  ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 24.211  12.006  22.799  1.00 41.11  ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 25.584  13.784  22.920  1.00 41.57  ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 24.631  13.176  22.135  1.00 41.40  ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.210  11.213  22.207  1.00 40.29  ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 24.105  13.559  20.899  1.00 40.77  ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 22.699  11.587  20.984  1.00 40.38  ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 23.148  12.753  20.340  1.00 40.12  ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 26.957  9.585   22.866  1.00 39.35  ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.223  9.939   22.247  1.00 38.90  ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 28.025  11.102  21.273  1.00 38.81  ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.389  10.939  20.249  1.00 38.21  ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 28.829  8.739   21.492  1.00 38.91  ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 28.841  7.494   22.408  1.00 38.63  ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.203  9.101   20.981  1.00 38.93  ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.510  6.257   21.801  1.00 38.36  ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 28.610  12.264  21.580  1.00 39.65  ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.436  13.464  20.744  1.00 39.54  ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 29.101  13.354  19.381  1.00 39.30  ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 30.029  12.552  19.194  1.00 39.49  ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 28.926  14.736  21.443  1.00 39.72  ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.372  14.768  21.883  1.00 40.62  ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.403  15.044  20.983  1.00 40.75  ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 30.708  14.592  23.225  1.00 41.13  ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 32.723  15.120  21.409  1.00 41.26  ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 32.001  14.657  23.654  1.00 41.76  ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 33.022  14.917  22.749  1.00 41.83  ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.333  14.946  23.177  1.00 40.91  ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.576  14.146  18.442  1.00 38.60  ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.160  14.360  17.120  1.00 38.71  ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 29.963  15.659  17.038  1.00 38.86  ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.229  16.294  18.055  1.00 39.03  ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.297  16.054  15.810  1.00 38.71  ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.213  17.158  15.513  1.00 38.59  ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.388  16.720  14.635  1.00 38.91  ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.508  17.240  14.753  1.00 39.55  ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 32.141  15.773  13.747  1.00 38.13  ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 33.093  15.427  12.706  1.00 37.97  ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.388  14.797  13.181  1.00 38.48  ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.353  14.773  12.424  1.00 38.48  ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.402  14.304  14.424  1.00 38.24  ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.599  13.811  15.084  1.00 38.68  ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 36.656  14.912  15.316  1.00 39.66  ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 37.797  14.594  15.705  1.00 39.91  ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 36.190  12.618  14.317  1.00 38.72  ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.321  11.373  14.307  1.00 37.79  ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 35.184  10.595  15.442  1.00 38.12  ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 34.688  10.950  13.130  1.00 40.12  ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.387  9.430   15.439  1.00 39.28  ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 33.890  9.785   13.102  1.00 39.86  ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 33.746  9.016   14.258  1.00 40.34  ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.285  16.185  15.092  1.00 39.58  ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.172  17.343  15.321  1.00 41.05  ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 36.611  18.287  16.411  1.00 40.57  ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.269  19.242  16.804  1.00 39.10  ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.420  18.160  14.006  1.00 42.74  ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.256  19.063  13.603  1.00 42.07  ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.125  20.354  14.105  1.00 44.54  ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.303  18.624  12.716  1.00 44.82  ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 35.036  21.164  13.756  1.00 43.43  ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.214  19.417  12.371  1.00 44.46  ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.093  20.686  12.887  1.00 43.82  ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 32.989  21.443  12.511  1.00 44.47  ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.397  18.022  16.898  1.00 39.72  ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 34.764  18.933  17.823  1.00 39.94  ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 33.695  18.256  18.662  1.00 39.69  ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.333  17.079  18.440  1.00 38.83  ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.160  20.117  17.047  1.00 40.03  ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.164  19.676  16.121  1.00 42.36  ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 33.169  19.021  19.609  1.00 40.10  ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 32.053  18.542  20.432  1.00 40.58  ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.433  18.457  21.899  1.00 40.55  ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 33.617  18.519  22.268  1.00 40.07  ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.405  18.322  22.722  1.00 40.05  ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 31.531  18.245  24.177  1.00 40.77  ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.257  17.643  24.725  1.00 40.93  ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.177  17.971  24.248  1.00 40.64  ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 31.712  19.623  24.771  1.00 40.41  ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.390  16.845  25.778  1.00 41.35  ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.241  16.322  26.490  1.00 41.87  ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 28.549  17.384  27.345  1.00 42.74  ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.456  17.134  27.854  1.00 42.97  ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 29.647  15.135  27.345  1.00 41.95  ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 29.162  18.562  27.496  1.00 42.94  ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 28.624  19.621  28.366  1.00 44.00  ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 27.702  20.614  27.669  1.00 45.01  ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 27.212  21.552  28.309  1.00 47.42  ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 29.774  20.396  29.009  1.00 44.57  ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 30.685  20.852  28.017  1.00 42.97  ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.482  20.459  26.363  1.00 45.00  ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 26.641  21.405  25.629  1.00 44.92  ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 25.213  21.297  26.134  1.00 45.57  ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 24.773  20.231  26.566  1.00 44.99  ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 26.660  21.120  24.124  1.00 44.43  ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 27.991  21.127  23.369  1.00 43.77  ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 27.725  20.876  21.912  1.00 40.33  ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 28.752  22.437  23.575  1.00 44.34  ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.488  22.406  26.061  1.00 46.57  ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 23.126  22.480  26.586  1.00 46.89  ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 22.165  21.489  25.943  1.00 46.31  ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 21.287  20.972  26.628  1.00 46.98  ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.563  23.886  26.419  1.00 47.92  ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 23.121  24.880  27.432  1.00 49.95  ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 23.849  24.516  28.374  1.00 50.56  ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 22.801  26.067  27.292  1.00 55.79  ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.315  21.226  24.646  1.00 45.10  ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.372  20.333  23.946  1.00 44.67  ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 21.545  18.872  24.343  1.00 43.85  ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 20.716  18.047  23.970  1.00 44.54  ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 21.441  20.440  22.381  1.00 44.44  ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 20.563  21.594  21.879  1.00 47.08  ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 22.882  20.560  21.898  1.00 41.61  ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 22.612  18.560  25.080  1.00 42.63  ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 22.881  17.195  25.558  1.00 42.38  ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 22.554  17.052  27.053  1.00 43.12  ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 23.028  16.134  27.723  1.00 42.68  ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.357  16.810  25.314  1.00 40.94  ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 24.881  16.998  23.911  1.00 39.60  ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 24.088  16.758  22.810  1.00 39.59  ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.209  17.372  23.683  1.00 40.60  ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 24.557  16.939  21.525  1.00 38.51  ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 26.699  17.511  22.395  1.00 40.17  ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 25.857  17.307  21.309  1.00 39.78  ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 26.301  17.448  19.998  1.00 38.56  ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 21.724  17.957  27.561  1.00 44.32  ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.363  18.015  28.973  1.00 45.15  ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 20.469  16.827  29.343  1.00 45.75  ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.310  16.761  28.933  1.00 46.74  ? 134  ASP A O   1 
ATOM   1055 C CB  A ASP A 1 134 ? 20.646  19.350  29.256  0.50 46.08  ? 134  ASP A CB  1 
ATOM   1056 C CB  B ASP A 1 134 ? 20.656  19.337  29.290  0.50 46.07  ? 134  ASP A CB  1 
ATOM   1057 C CG  A ASP A 1 134 ? 20.152  19.473  30.683  0.50 47.36  ? 134  ASP A CG  1 
ATOM   1058 C CG  B ASP A 1 134 ? 20.553  19.598  30.771  0.50 47.21  ? 134  ASP A CG  1 
ATOM   1059 O OD1 A ASP A 1 134 ? 20.473  18.596  31.517  0.50 48.95  ? 134  ASP A OD1 1 
ATOM   1060 O OD1 B ASP A 1 134 ? 20.308  18.638  31.536  0.50 48.78  ? 134  ASP A OD1 1 
ATOM   1061 O OD2 A ASP A 1 134 ? 19.435  20.459  30.966  0.50 47.78  ? 134  ASP A OD2 1 
ATOM   1062 O OD2 B ASP A 1 134 ? 20.729  20.764  31.169  0.50 47.09  ? 134  ASP A OD2 1 
ATOM   1063 N N   . GLY A 1 135 ? 21.007  15.912  30.148  1.00 45.73  ? 135  GLY A N   1 
ATOM   1064 C CA  . GLY A 1 135 ? 20.310  14.691  30.531  1.00 45.88  ? 135  GLY A CA  1 
ATOM   1065 C C   . GLY A 1 135 ? 19.221  14.796  31.591  1.00 46.79  ? 135  GLY A C   1 
ATOM   1066 O O   . GLY A 1 135 ? 18.656  13.778  31.967  1.00 46.10  ? 135  GLY A O   1 
ATOM   1067 N N   . ARG A 1 136 ? 18.899  16.006  32.061  1.00 47.43  ? 136  ARG A N   1 
ATOM   1068 C CA  . ARG A 1 136 ? 17.972  16.143  33.184  1.00 49.26  ? 136  ARG A CA  1 
ATOM   1069 C C   . ARG A 1 136 ? 16.532  15.759  32.866  1.00 50.13  ? 136  ARG A C   1 
ATOM   1070 O O   . ARG A 1 136 ? 15.810  15.298  33.760  1.00 50.55  ? 136  ARG A O   1 
ATOM   1071 C CB  . ARG A 1 136 ? 18.024  17.546  33.833  1.00 49.60  ? 136  ARG A CB  1 
ATOM   1072 C CG  . ARG A 1 136 ? 17.404  18.693  33.066  1.00 50.76  ? 136  ARG A CG  1 
ATOM   1073 C CD  . ARG A 1 136 ? 17.545  20.044  33.817  1.00 52.44  ? 136  ARG A CD  1 
ATOM   1074 N NE  . ARG A 1 136 ? 18.925  20.543  33.855  1.00 56.51  ? 136  ARG A NE  1 
ATOM   1075 C CZ  . ARG A 1 136 ? 19.371  21.565  34.609  1.00 58.74  ? 136  ARG A CZ  1 
ATOM   1076 N NH1 . ARG A 1 136 ? 18.571  22.234  35.451  1.00 60.65  ? 136  ARG A NH1 1 
ATOM   1077 N NH2 . ARG A 1 136 ? 20.650  21.922  34.533  1.00 58.03  ? 136  ARG A NH2 1 
ATOM   1078 N N   . PHE A 1 137 ? 16.112  15.929  31.613  1.00 50.11  ? 137  PHE A N   1 
ATOM   1079 C CA  . PHE A 1 137 ? 14.709  15.693  31.252  1.00 50.92  ? 137  PHE A CA  1 
ATOM   1080 C C   . PHE A 1 137 ? 14.478  14.206  31.051  1.00 50.57  ? 137  PHE A C   1 
ATOM   1081 O O   . PHE A 1 137 ? 13.499  13.664  31.539  1.00 52.01  ? 137  PHE A O   1 
ATOM   1082 C CB  . PHE A 1 137 ? 14.295  16.475  30.005  1.00 51.05  ? 137  PHE A CB  1 
ATOM   1083 C CG  . PHE A 1 137 ? 14.677  17.914  30.047  1.00 50.75  ? 137  PHE A CG  1 
ATOM   1084 C CD1 . PHE A 1 137 ? 13.866  18.838  30.673  1.00 53.69  ? 137  PHE A CD1 1 
ATOM   1085 C CD2 . PHE A 1 137 ? 15.860  18.346  29.467  1.00 50.61  ? 137  PHE A CD2 1 
ATOM   1086 C CE1 . PHE A 1 137 ? 14.231  20.184  30.729  1.00 54.16  ? 137  PHE A CE1 1 
ATOM   1087 C CE2 . PHE A 1 137 ? 16.220  19.672  29.510  1.00 50.69  ? 137  PHE A CE2 1 
ATOM   1088 C CZ  . PHE A 1 137 ? 15.408  20.595  30.148  1.00 51.78  ? 137  PHE A CZ  1 
ATOM   1089 N N   . LEU A 1 138 ? 15.383  13.537  30.354  1.00 49.47  ? 138  LEU A N   1 
ATOM   1090 C CA  . LEU A 1 138 ? 15.282  12.083  30.249  1.00 49.62  ? 138  LEU A CA  1 
ATOM   1091 C C   . LEU A 1 138 ? 15.309  11.430  31.640  1.00 50.44  ? 138  LEU A C   1 
ATOM   1092 O O   . LEU A 1 138 ? 14.480  10.572  31.932  1.00 51.09  ? 138  LEU A O   1 
ATOM   1093 C CB  . LEU A 1 138 ? 16.382  11.518  29.358  1.00 48.54  ? 138  LEU A CB  1 
ATOM   1094 C CG  . LEU A 1 138 ? 16.210  11.696  27.838  1.00 48.44  ? 138  LEU A CG  1 
ATOM   1095 C CD1 . LEU A 1 138 ? 17.548  11.523  27.103  1.00 45.58  ? 138  LEU A CD1 1 
ATOM   1096 C CD2 . LEU A 1 138 ? 15.168  10.690  27.313  1.00 48.68  ? 138  LEU A CD2 1 
ATOM   1097 N N   . ALA A 1 139 ? 16.252  11.844  32.490  1.00 50.13  ? 139  ALA A N   1 
ATOM   1098 C CA  . ALA A 1 139 ? 16.337  11.360  33.875  1.00 50.69  ? 139  ALA A CA  1 
ATOM   1099 C C   . ALA A 1 139 ? 15.033  11.579  34.652  1.00 52.10  ? 139  ALA A C   1 
ATOM   1100 O O   . ALA A 1 139 ? 14.478  10.637  35.224  1.00 52.58  ? 139  ALA A O   1 
ATOM   1101 C CB  . ALA A 1 139 ? 17.482  12.041  34.602  1.00 50.36  ? 139  ALA A CB  1 
ATOM   1102 N N   . GLN A 1 140 ? 14.550  12.820  34.670  1.00 52.26  ? 140  GLN A N   1 
ATOM   1103 C CA  . GLN A 1 140 ? 13.362  13.153  35.443  1.00 53.66  ? 140  GLN A CA  1 
ATOM   1104 C C   . GLN A 1 140 ? 12.123  12.483  34.870  1.00 54.75  ? 140  GLN A C   1 
ATOM   1105 O O   . GLN A 1 140 ? 11.389  11.814  35.605  1.00 56.37  ? 140  GLN A O   1 
ATOM   1106 C CB  . GLN A 1 140 ? 13.146  14.671  35.519  1.00 53.73  ? 140  GLN A CB  1 
ATOM   1107 C CG  . GLN A 1 140 ? 12.353  15.131  36.737  1.00 54.55  ? 140  GLN A CG  1 
ATOM   1108 C CD  . GLN A 1 140 ? 10.871  14.855  36.621  1.00 56.21  ? 140  GLN A CD  1 
ATOM   1109 O OE1 . GLN A 1 140 ? 10.290  14.986  35.541  1.00 57.31  ? 140  GLN A OE1 1 
ATOM   1110 N NE2 . GLN A 1 140 ? 10.244  14.485  37.736  1.00 55.66  ? 140  GLN A NE2 1 
ATOM   1111 N N   . VAL A 1 141 ? 11.874  12.661  33.575  1.00 54.43  ? 141  VAL A N   1 
ATOM   1112 C CA  . VAL A 1 141 ? 10.586  12.246  33.007  1.00 55.83  ? 141  VAL A CA  1 
ATOM   1113 C C   . VAL A 1 141 ? 10.526  10.745  32.716  1.00 55.93  ? 141  VAL A C   1 
ATOM   1114 O O   . VAL A 1 141 ? 9.510   10.105  32.984  1.00 56.91  ? 141  VAL A O   1 
ATOM   1115 C CB  . VAL A 1 141 ? 10.237  13.034  31.728  1.00 55.94  ? 141  VAL A CB  1 
ATOM   1116 C CG1 . VAL A 1 141 ? 8.982   12.469  31.085  1.00 55.87  ? 141  VAL A CG1 1 
ATOM   1117 C CG2 . VAL A 1 141 ? 10.067  14.530  32.049  1.00 56.59  ? 141  VAL A CG2 1 
ATOM   1118 N N   . GLU A 1 142 ? 11.601  10.183  32.172  1.00 54.75  ? 142  GLU A N   1 
ATOM   1119 C CA  . GLU A 1 142 ? 11.599  8.751   31.842  1.00 55.14  ? 142  GLU A CA  1 
ATOM   1120 C C   . GLU A 1 142 ? 12.224  7.856   32.918  1.00 55.42  ? 142  GLU A C   1 
ATOM   1121 O O   . GLU A 1 142 ? 12.103  6.627   32.852  1.00 55.80  ? 142  GLU A O   1 
ATOM   1122 C CB  . GLU A 1 142 ? 12.237  8.524   30.474  1.00 53.84  ? 142  GLU A CB  1 
ATOM   1123 C CG  . GLU A 1 142 ? 11.406  9.102   29.340  1.00 54.60  ? 142  GLU A CG  1 
ATOM   1124 C CD  . GLU A 1 142 ? 10.016  8.468   29.252  1.00 60.14  ? 142  GLU A CD  1 
ATOM   1125 O OE1 . GLU A 1 142 ? 9.869   7.253   29.557  1.00 61.12  ? 142  GLU A OE1 1 
ATOM   1126 O OE2 . GLU A 1 142 ? 9.061   9.198   28.895  1.00 63.98  ? 142  GLU A OE2 1 
ATOM   1127 N N   . GLY A 1 143 ? 12.846  8.470   33.924  1.00 55.07  ? 143  GLY A N   1 
ATOM   1128 C CA  . GLY A 1 143 ? 13.468  7.720   35.012  1.00 55.44  ? 143  GLY A CA  1 
ATOM   1129 C C   . GLY A 1 143 ? 14.787  7.108   34.580  1.00 54.27  ? 143  GLY A C   1 
ATOM   1130 O O   . GLY A 1 143 ? 15.270  6.167   35.206  1.00 55.32  ? 143  GLY A O   1 
ATOM   1131 N N   . ALA A 1 144 ? 15.380  7.645   33.516  1.00 52.63  ? 144  ALA A N   1 
ATOM   1132 C CA  . ALA A 1 144 ? 16.584  7.053   32.912  1.00 51.15  ? 144  ALA A CA  1 
ATOM   1133 C C   . ALA A 1 144 ? 17.870  7.397   33.658  1.00 50.17  ? 144  ALA A C   1 
ATOM   1134 O O   . ALA A 1 144 ? 17.971  8.443   34.295  1.00 49.30  ? 144  ALA A O   1 
ATOM   1135 C CB  . ALA A 1 144 ? 16.713  7.504   31.456  1.00 50.28  ? 144  ALA A CB  1 
ATOM   1136 N N   . VAL A 1 145 ? 18.856  6.506   33.554  1.00 49.48  ? 145  VAL A N   1 
ATOM   1137 C CA  . VAL A 1 145 ? 20.230  6.838   33.920  1.00 48.43  ? 145  VAL A CA  1 
ATOM   1138 C C   . VAL A 1 145 ? 20.940  7.227   32.624  1.00 47.57  ? 145  VAL A C   1 
ATOM   1139 O O   . VAL A 1 145 ? 21.057  6.416   31.732  1.00 47.21  ? 145  VAL A O   1 
ATOM   1140 C CB  . VAL A 1 145 ? 20.915  5.643   34.631  1.00 49.16  ? 145  VAL A CB  1 
ATOM   1141 C CG1 . VAL A 1 145 ? 22.403  5.899   34.838  1.00 47.80  ? 145  VAL A CG1 1 
ATOM   1142 C CG2 . VAL A 1 145 ? 20.196  5.347   35.970  1.00 48.82  ? 145  VAL A CG2 1 
ATOM   1143 N N   . LEU A 1 146 ? 21.354  8.489   32.495  1.00 47.25  ? 146  LEU A N   1 
ATOM   1144 C CA  . LEU A 1 146 ? 22.047  8.935   31.297  1.00 46.28  ? 146  LEU A CA  1 
ATOM   1145 C C   . LEU A 1 146 ? 23.511  9.246   31.563  1.00 45.30  ? 146  LEU A C   1 
ATOM   1146 O O   . LEU A 1 146 ? 23.846  9.951   32.514  1.00 45.76  ? 146  LEU A O   1 
ATOM   1147 C CB  . LEU A 1 146 ? 21.352  10.155  30.679  1.00 46.67  ? 146  LEU A CB  1 
ATOM   1148 C CG  . LEU A 1 146 ? 21.731  10.383  29.201  1.00 47.55  ? 146  LEU A CG  1 
ATOM   1149 C CD1 . LEU A 1 146 ? 20.488  10.612  28.352  1.00 48.65  ? 146  LEU A CD1 1 
ATOM   1150 C CD2 . LEU A 1 146 ? 22.766  11.508  29.040  1.00 47.07  ? 146  LEU A CD2 1 
ATOM   1151 N N   . VAL A 1 147 ? 24.376  8.727   30.700  1.00 44.34  ? 147  VAL A N   1 
ATOM   1152 C CA  . VAL A 1 147 ? 25.815  8.941   30.793  1.00 43.49  ? 147  VAL A CA  1 
ATOM   1153 C C   . VAL A 1 147 ? 26.314  9.574   29.498  1.00 42.93  ? 147  VAL A C   1 
ATOM   1154 O O   . VAL A 1 147 ? 25.906  9.171   28.421  1.00 42.81  ? 147  VAL A O   1 
ATOM   1155 C CB  . VAL A 1 147 ? 26.544  7.595   30.999  1.00 44.28  ? 147  VAL A CB  1 
ATOM   1156 C CG1 . VAL A 1 147 ? 28.065  7.818   31.190  1.00 42.79  ? 147  VAL A CG1 1 
ATOM   1157 C CG2 . VAL A 1 147 ? 25.932  6.836   32.176  1.00 42.26  ? 147  VAL A CG2 1 
ATOM   1158 N N   . SER A 1 148 ? 27.165  10.584  29.601  1.00 42.32  ? 148  SER A N   1 
ATOM   1159 C CA  . SER A 1 148 ? 27.794  11.175  28.424  1.00 41.82  ? 148  SER A CA  1 
ATOM   1160 C C   . SER A 1 148 ? 29.261  11.394  28.754  1.00 41.85  ? 148  SER A C   1 
ATOM   1161 O O   . SER A 1 148 ? 29.572  11.876  29.832  1.00 43.00  ? 148  SER A O   1 
ATOM   1162 C CB  . SER A 1 148 ? 27.105  12.511  28.064  1.00 41.49  ? 148  SER A CB  1 
ATOM   1163 O OG  . SER A 1 148 ? 27.432  13.508  28.999  1.00 39.85  ? 148  SER A OG  1 
ATOM   1164 N N   . MET A 1 149 ? 30.157  10.995  27.857  1.00 42.07  ? 149  MET A N   1 
ATOM   1165 C CA  . MET A 1 149 ? 31.591  11.184  28.053  1.00 41.72  ? 149  MET A CA  1 
ATOM   1166 C C   . MET A 1 149 ? 32.215  12.135  27.047  1.00 41.76  ? 149  MET A C   1 
ATOM   1167 O O   . MET A 1 149 ? 31.763  12.251  25.899  1.00 41.30  ? 149  MET A O   1 
ATOM   1168 C CB  . MET A 1 149 ? 32.315  9.828   27.973  1.00 42.47  ? 149  MET A CB  1 
ATOM   1169 C CG  . MET A 1 149 ? 32.802  9.419   26.583  1.00 42.17  ? 149  MET A CG  1 
ATOM   1170 S SD  . MET A 1 149 ? 31.499  8.970   25.417  1.00 43.01  ? 149  MET A SD  1 
ATOM   1171 C CE  . MET A 1 149 ? 30.988  7.343   25.940  1.00 37.33  ? 149  MET A CE  1 
ATOM   1172 N N   . ASN A 1 150 ? 33.283  12.803  27.488  1.00 42.34  ? 150  ASN A N   1 
ATOM   1173 C CA  . ASN A 1 150 ? 34.192  13.502  26.603  1.00 42.20  ? 150  ASN A CA  1 
ATOM   1174 C C   . ASN A 1 150 ? 35.142  12.472  26.000  1.00 42.57  ? 150  ASN A C   1 
ATOM   1175 O O   . ASN A 1 150 ? 35.552  11.531  26.670  1.00 42.49  ? 150  ASN A O   1 
ATOM   1176 C CB  . ASN A 1 150 ? 34.993  14.588  27.352  1.00 42.64  ? 150  ASN A CB  1 
ATOM   1177 C CG  . ASN A 1 150 ? 34.214  15.894  27.537  1.00 43.66  ? 150  ASN A CG  1 
ATOM   1178 O OD1 . ASN A 1 150 ? 33.048  16.002  27.150  1.00 46.34  ? 150  ASN A OD1 1 
ATOM   1179 N ND2 . ASN A 1 150 ? 34.852  16.886  28.165  1.00 43.86  ? 150  ASN A ND2 1 
ATOM   1180 N N   . TYR A 1 151 ? 35.472  12.657  24.725  1.00 42.03  ? 151  TYR A N   1 
ATOM   1181 C CA  . TYR A 1 151 ? 36.462  11.846  24.056  1.00 41.53  ? 151  TYR A CA  1 
ATOM   1182 C C   . TYR A 1 151 ? 37.319  12.772  23.227  1.00 41.24  ? 151  TYR A C   1 
ATOM   1183 O O   . TYR A 1 151 ? 36.854  13.806  22.779  1.00 40.55  ? 151  TYR A O   1 
ATOM   1184 C CB  . TYR A 1 151 ? 35.818  10.724  23.207  1.00 41.79  ? 151  TYR A CB  1 
ATOM   1185 C CG  . TYR A 1 151 ? 34.928  11.148  22.065  1.00 40.09  ? 151  TYR A CG  1 
ATOM   1186 C CD1 . TYR A 1 151 ? 33.558  11.299  22.238  1.00 41.75  ? 151  TYR A CD1 1 
ATOM   1187 C CD2 . TYR A 1 151 ? 35.443  11.342  20.801  1.00 41.04  ? 151  TYR A CD2 1 
ATOM   1188 C CE1 . TYR A 1 151 ? 32.737  11.703  21.186  1.00 41.00  ? 151  TYR A CE1 1 
ATOM   1189 C CE2 . TYR A 1 151 ? 34.631  11.738  19.738  1.00 39.54  ? 151  TYR A CE2 1 
ATOM   1190 C CZ  . TYR A 1 151 ? 33.285  11.917  19.937  1.00 41.45  ? 151  TYR A CZ  1 
ATOM   1191 O OH  . TYR A 1 151 ? 32.495  12.294  18.883  1.00 39.21  ? 151  TYR A OH  1 
ATOM   1192 N N   . ARG A 1 152 ? 38.581  12.402  23.037  1.00 41.50  ? 152  ARG A N   1 
ATOM   1193 C CA  . ARG A 1 152 ? 39.510  13.250  22.301  1.00 41.36  ? 152  ARG A CA  1 
ATOM   1194 C C   . ARG A 1 152 ? 39.147  13.315  20.817  1.00 40.90  ? 152  ARG A C   1 
ATOM   1195 O O   . ARG A 1 152 ? 38.772  12.303  20.193  1.00 40.10  ? 152  ARG A O   1 
ATOM   1196 C CB  . ARG A 1 152 ? 40.946  12.740  22.452  1.00 42.11  ? 152  ARG A CB  1 
ATOM   1197 C CG  . ARG A 1 152 ? 41.576  13.029  23.796  1.00 41.48  ? 152  ARG A CG  1 
ATOM   1198 C CD  . ARG A 1 152 ? 42.938  12.345  23.910  1.00 41.84  ? 152  ARG A CD  1 
ATOM   1199 N NE  . ARG A 1 152 ? 42.772  10.931  24.237  1.00 40.12  ? 152  ARG A NE  1 
ATOM   1200 C CZ  . ARG A 1 152 ? 43.758  10.045  24.279  1.00 41.28  ? 152  ARG A CZ  1 
ATOM   1201 N NH1 . ARG A 1 152 ? 45.013  10.397  24.014  1.00 40.33  ? 152  ARG A NH1 1 
ATOM   1202 N NH2 . ARG A 1 152 ? 43.480  8.789   24.609  1.00 43.14  ? 152  ARG A NH2 1 
ATOM   1203 N N   . VAL A 1 153 ? 39.285  14.519  20.268  1.00 40.25  ? 153  VAL A N   1 
ATOM   1204 C CA  . VAL A 1 153 ? 38.932  14.818  18.902  1.00 40.01  ? 153  VAL A CA  1 
ATOM   1205 C C   . VAL A 1 153 ? 40.107  15.457  18.191  1.00 41.48  ? 153  VAL A C   1 
ATOM   1206 O O   . VAL A 1 153 ? 41.105  15.840  18.825  1.00 42.29  ? 153  VAL A O   1 
ATOM   1207 C CB  . VAL A 1 153 ? 37.729  15.757  18.863  1.00 40.42  ? 153  VAL A CB  1 
ATOM   1208 C CG1 . VAL A 1 153 ? 36.516  15.059  19.486  1.00 38.64  ? 153  VAL A CG1 1 
ATOM   1209 C CG2 . VAL A 1 153 ? 38.037  17.096  19.579  1.00 38.67  ? 153  VAL A CG2 1 
ATOM   1210 N N   . GLY A 1 154 ? 40.001  15.551  16.865  1.00 41.50  ? 154  GLY A N   1 
ATOM   1211 C CA  . GLY A 1 154 ? 41.042  16.179  16.068  1.00 41.86  ? 154  GLY A CA  1 
ATOM   1212 C C   . GLY A 1 154 ? 42.295  15.349  16.090  1.00 42.83  ? 154  GLY A C   1 
ATOM   1213 O O   . GLY A 1 154 ? 42.228  14.121  16.237  1.00 43.90  ? 154  GLY A O   1 
ATOM   1214 N N   . THR A 1 155 ? 43.445  16.009  15.976  1.00 43.27  ? 155  THR A N   1 
ATOM   1215 C CA  . THR A 1 155 ? 44.722  15.315  16.028  1.00 44.09  ? 155  THR A CA  1 
ATOM   1216 C C   . THR A 1 155 ? 44.897  14.498  17.326  1.00 44.61  ? 155  THR A C   1 
ATOM   1217 O O   . THR A 1 155 ? 45.417  13.359  17.325  1.00 46.11  ? 155  THR A O   1 
ATOM   1218 C CB  . THR A 1 155 ? 45.888  16.316  15.887  1.00 45.26  ? 155  THR A CB  1 
ATOM   1219 O OG1 . THR A 1 155 ? 45.830  17.292  16.940  1.00 44.40  ? 155  THR A OG1 1 
ATOM   1220 C CG2 . THR A 1 155 ? 45.847  17.013  14.516  1.00 44.32  ? 155  THR A CG2 1 
ATOM   1221 N N   . PHE A 1 156 ? 44.461  15.086  18.430  1.00 43.92  ? 156  PHE A N   1 
ATOM   1222 C CA  . PHE A 1 156 ? 44.631  14.502  19.747  1.00 44.12  ? 156  PHE A CA  1 
ATOM   1223 C C   . PHE A 1 156 ? 43.908  13.159  19.830  1.00 43.85  ? 156  PHE A C   1 
ATOM   1224 O O   . PHE A 1 156 ? 44.371  12.248  20.474  1.00 44.74  ? 156  PHE A O   1 
ATOM   1225 C CB  . PHE A 1 156 ? 44.111  15.466  20.818  1.00 43.59  ? 156  PHE A CB  1 
ATOM   1226 C CG  . PHE A 1 156 ? 44.594  16.892  20.635  1.00 44.22  ? 156  PHE A CG  1 
ATOM   1227 C CD1 . PHE A 1 156 ? 45.893  17.239  20.946  1.00 43.97  ? 156  PHE A CD1 1 
ATOM   1228 C CD2 . PHE A 1 156 ? 43.760  17.856  20.106  1.00 43.98  ? 156  PHE A CD2 1 
ATOM   1229 C CE1 . PHE A 1 156 ? 46.351  18.532  20.749  1.00 46.89  ? 156  PHE A CE1 1 
ATOM   1230 C CE2 . PHE A 1 156 ? 44.201  19.160  19.920  1.00 44.42  ? 156  PHE A CE2 1 
ATOM   1231 C CZ  . PHE A 1 156 ? 45.509  19.490  20.233  1.00 46.29  ? 156  PHE A CZ  1 
ATOM   1232 N N   . GLY A 1 157 ? 42.761  13.055  19.182  1.00 43.76  ? 157  GLY A N   1 
ATOM   1233 C CA  . GLY A 1 157 ? 41.980  11.817  19.221  1.00 43.59  ? 157  GLY A CA  1 
ATOM   1234 C C   . GLY A 1 157 ? 42.319  10.858  18.106  1.00 43.99  ? 157  GLY A C   1 
ATOM   1235 O O   . GLY A 1 157 ? 42.211  9.638   18.282  1.00 44.52  ? 157  GLY A O   1 
ATOM   1236 N N   . PHE A 1 158 ? 42.722  11.389  16.947  1.00 44.15  ? 158  PHE A N   1 
ATOM   1237 C CA  . PHE A 1 158 ? 42.713  10.568  15.738  1.00 44.36  ? 158  PHE A CA  1 
ATOM   1238 C C   . PHE A 1 158 ? 43.936  10.595  14.832  1.00 45.78  ? 158  PHE A C   1 
ATOM   1239 O O   . PHE A 1 158 ? 43.950  9.892   13.820  1.00 46.94  ? 158  PHE A O   1 
ATOM   1240 C CB  . PHE A 1 158 ? 41.404  10.856  14.991  1.00 43.70  ? 158  PHE A CB  1 
ATOM   1241 C CG  . PHE A 1 158 ? 40.201  10.396  15.761  1.00 42.28  ? 158  PHE A CG  1 
ATOM   1242 C CD1 . PHE A 1 158 ? 39.881  9.051   15.813  1.00 44.02  ? 158  PHE A CD1 1 
ATOM   1243 C CD2 . PHE A 1 158 ? 39.435  11.292  16.486  1.00 43.17  ? 158  PHE A CD2 1 
ATOM   1244 C CE1 . PHE A 1 158 ? 38.791  8.598   16.577  1.00 42.60  ? 158  PHE A CE1 1 
ATOM   1245 C CE2 . PHE A 1 158 ? 38.339  10.864  17.228  1.00 42.59  ? 158  PHE A CE2 1 
ATOM   1246 C CZ  . PHE A 1 158 ? 38.036  9.510   17.289  1.00 41.68  ? 158  PHE A CZ  1 
ATOM   1247 N N   . LEU A 1 159 ? 44.968  11.358  15.194  1.00 45.93  ? 159  LEU A N   1 
ATOM   1248 C CA  . LEU A 1 159 ? 46.168  11.411  14.377  1.00 47.56  ? 159  LEU A CA  1 
ATOM   1249 C C   . LEU A 1 159 ? 46.864  10.091  14.567  1.00 49.08  ? 159  LEU A C   1 
ATOM   1250 O O   . LEU A 1 159 ? 47.050  9.652   15.701  1.00 49.70  ? 159  LEU A O   1 
ATOM   1251 C CB  . LEU A 1 159 ? 47.077  12.564  14.787  1.00 47.42  ? 159  LEU A CB  1 
ATOM   1252 C CG  . LEU A 1 159 ? 48.407  12.717  14.025  1.00 49.33  ? 159  LEU A CG  1 
ATOM   1253 C CD1 . LEU A 1 159 ? 48.848  14.186  13.939  1.00 46.80  ? 159  LEU A CD1 1 
ATOM   1254 C CD2 . LEU A 1 159 ? 49.500  11.847  14.661  1.00 47.79  ? 159  LEU A CD2 1 
ATOM   1255 N N   . ALA A 1 160 ? 47.235  9.461   13.461  1.00 50.34  ? 160  ALA A N   1 
ATOM   1256 C CA  . ALA A 1 160 ? 47.743  8.091   13.484  1.00 51.76  ? 160  ALA A CA  1 
ATOM   1257 C C   . ALA A 1 160 ? 48.933  7.919   12.554  1.00 53.46  ? 160  ALA A C   1 
ATOM   1258 O O   . ALA A 1 160 ? 48.940  8.424   11.436  1.00 53.79  ? 160  ALA A O   1 
ATOM   1259 C CB  . ALA A 1 160 ? 46.614  7.115   13.098  1.00 50.70  ? 160  ALA A CB  1 
ATOM   1260 N N   . LEU A 1 161 ? 49.966  7.246   13.049  1.00 55.71  ? 161  LEU A N   1 
ATOM   1261 C CA  . LEU A 1 161 ? 51.001  6.669   12.207  1.00 57.41  ? 161  LEU A CA  1 
ATOM   1262 C C   . LEU A 1 161 ? 50.830  5.161   12.368  1.00 58.14  ? 161  LEU A C   1 
ATOM   1263 O O   . LEU A 1 161 ? 51.336  4.584   13.315  1.00 58.74  ? 161  LEU A O   1 
ATOM   1264 C CB  . LEU A 1 161 ? 52.379  7.169   12.636  1.00 58.84  ? 161  LEU A CB  1 
ATOM   1265 C CG  . LEU A 1 161 ? 52.510  8.682   12.365  1.00 58.89  ? 161  LEU A CG  1 
ATOM   1266 C CD1 . LEU A 1 161 ? 53.651  9.263   13.139  1.00 61.56  ? 161  LEU A CD1 1 
ATOM   1267 C CD2 . LEU A 1 161 ? 52.699  8.952   10.891  1.00 58.54  ? 161  LEU A CD2 1 
ATOM   1268 N N   . PRO A 1 162 ? 50.032  4.535   11.485  1.00 58.51  ? 162  PRO A N   1 
ATOM   1269 C CA  . PRO A 1 162 ? 49.633  3.137   11.676  1.00 59.48  ? 162  PRO A CA  1 
ATOM   1270 C C   . PRO A 1 162 ? 50.782  2.155   11.749  1.00 61.83  ? 162  PRO A C   1 
ATOM   1271 O O   . PRO A 1 162 ? 51.716  2.239   10.961  1.00 63.33  ? 162  PRO A O   1 
ATOM   1272 C CB  . PRO A 1 162 ? 48.754  2.861   10.454  1.00 59.17  ? 162  PRO A CB  1 
ATOM   1273 C CG  . PRO A 1 162 ? 48.220  4.189   10.091  1.00 57.20  ? 162  PRO A CG  1 
ATOM   1274 C CD  . PRO A 1 162 ? 49.386  5.100   10.287  1.00 57.80  ? 162  PRO A CD  1 
ATOM   1275 N N   . GLY A 1 163 ? 50.712  1.230   12.704  1.00 62.90  ? 163  GLY A N   1 
ATOM   1276 C CA  . GLY A 1 163 ? 51.814  0.322   12.979  1.00 64.88  ? 163  GLY A CA  1 
ATOM   1277 C C   . GLY A 1 163 ? 52.746  0.819   14.075  1.00 65.71  ? 163  GLY A C   1 
ATOM   1278 O O   . GLY A 1 163 ? 53.496  0.031   14.645  1.00 66.99  ? 163  GLY A O   1 
ATOM   1279 N N   . SER A 1 164 ? 52.710  2.115   14.375  1.00 64.79  ? 164  SER A N   1 
ATOM   1280 C CA  . SER A 1 164 ? 53.531  2.672   15.447  1.00 65.29  ? 164  SER A CA  1 
ATOM   1281 C C   . SER A 1 164 ? 52.985  2.262   16.811  1.00 65.68  ? 164  SER A C   1 
ATOM   1282 O O   . SER A 1 164 ? 51.804  1.912   16.956  1.00 65.06  ? 164  SER A O   1 
ATOM   1283 C CB  . SER A 1 164 ? 53.595  4.205   15.357  1.00 64.39  ? 164  SER A CB  1 
ATOM   1284 O OG  . SER A 1 164 ? 52.341  4.802   15.669  1.00 60.16  ? 164  SER A OG  1 
ATOM   1285 N N   . ARG A 1 165 ? 53.860  2.306   17.806  1.00 67.43  ? 165  ARG A N   1 
ATOM   1286 C CA  . ARG A 1 165 ? 53.481  2.076   19.192  1.00 67.86  ? 165  ARG A CA  1 
ATOM   1287 C C   . ARG A 1 165 ? 52.967  3.388   19.790  1.00 65.31  ? 165  ARG A C   1 
ATOM   1288 O O   . ARG A 1 165 ? 52.030  3.405   20.598  1.00 64.58  ? 165  ARG A O   1 
ATOM   1289 C CB  . ARG A 1 165 ? 54.706  1.591   19.980  1.00 70.54  ? 165  ARG A CB  1 
ATOM   1290 C CG  . ARG A 1 165 ? 54.382  0.825   21.284  1.00 75.30  ? 165  ARG A CG  1 
ATOM   1291 C CD  . ARG A 1 165 ? 55.335  1.228   22.443  1.00 81.54  ? 165  ARG A CD  1 
ATOM   1292 N NE  . ARG A 1 165 ? 54.896  2.496   23.066  1.00 84.16  ? 165  ARG A NE  1 
ATOM   1293 C CZ  . ARG A 1 165 ? 55.695  3.400   23.644  1.00 85.51  ? 165  ARG A CZ  1 
ATOM   1294 N NH1 . ARG A 1 165 ? 55.165  4.503   24.162  1.00 84.21  ? 165  ARG A NH1 1 
ATOM   1295 N NH2 . ARG A 1 165 ? 57.015  3.225   23.698  1.00 87.91  ? 165  ARG A NH2 1 
ATOM   1296 N N   . GLU A 1 166 ? 53.572  4.489   19.360  1.00 64.14  ? 166  GLU A N   1 
ATOM   1297 C CA  . GLU A 1 166 ? 53.425  5.771   20.034  1.00 62.69  ? 166  GLU A CA  1 
ATOM   1298 C C   . GLU A 1 166 ? 52.190  6.568   19.563  1.00 59.41  ? 166  GLU A C   1 
ATOM   1299 O O   . GLU A 1 166 ? 51.690  7.421   20.298  1.00 58.13  ? 166  GLU A O   1 
ATOM   1300 C CB  . GLU A 1 166 ? 54.704  6.591   19.844  1.00 64.27  ? 166  GLU A CB  1 
ATOM   1301 C CG  . GLU A 1 166 ? 56.030  5.823   20.134  1.00 68.79  ? 166  GLU A CG  1 
ATOM   1302 C CD  . GLU A 1 166 ? 56.636  5.083   18.906  1.00 72.88  ? 166  GLU A CD  1 
ATOM   1303 O OE1 . GLU A 1 166 ? 57.872  4.937   18.862  1.00 78.29  ? 166  GLU A OE1 1 
ATOM   1304 O OE2 . GLU A 1 166 ? 55.906  4.625   17.999  1.00 74.74  ? 166  GLU A OE2 1 
ATOM   1305 N N   . ALA A 1 167 ? 51.724  6.302   18.344  1.00 57.57  ? 167  ALA A N   1 
ATOM   1306 C CA  . ALA A 1 167 ? 50.507  6.930   17.797  1.00 55.39  ? 167  ALA A CA  1 
ATOM   1307 C C   . ALA A 1 167 ? 49.756  5.944   16.911  1.00 54.46  ? 167  ALA A C   1 
ATOM   1308 O O   . ALA A 1 167 ? 49.805  6.044   15.688  1.00 54.00  ? 167  ALA A O   1 
ATOM   1309 C CB  . ALA A 1 167 ? 50.853  8.178   17.007  1.00 55.18  ? 167  ALA A CB  1 
ATOM   1310 N N   . PRO A 1 168 ? 49.062  4.980   17.530  1.00 54.11  ? 168  PRO A N   1 
ATOM   1311 C CA  . PRO A 1 168 ? 48.494  3.852   16.797  1.00 53.91  ? 168  PRO A CA  1 
ATOM   1312 C C   . PRO A 1 168 ? 47.157  4.146   16.131  1.00 52.07  ? 168  PRO A C   1 
ATOM   1313 O O   . PRO A 1 168 ? 46.691  3.338   15.314  1.00 53.19  ? 168  PRO A O   1 
ATOM   1314 C CB  . PRO A 1 168 ? 48.327  2.791   17.888  1.00 54.48  ? 168  PRO A CB  1 
ATOM   1315 C CG  . PRO A 1 168 ? 47.999  3.598   19.115  1.00 54.09  ? 168  PRO A CG  1 
ATOM   1316 C CD  . PRO A 1 168 ? 48.779  4.887   18.977  1.00 54.26  ? 168  PRO A CD  1 
ATOM   1317 N N   . GLY A 1 169 ? 46.540  5.279   16.461  1.00 49.40  ? 169  GLY A N   1 
ATOM   1318 C CA  . GLY A 1 169 ? 45.278  5.648   15.864  1.00 47.12  ? 169  GLY A CA  1 
ATOM   1319 C C   . GLY A 1 169 ? 44.081  5.222   16.682  1.00 45.87  ? 169  GLY A C   1 
ATOM   1320 O O   . GLY A 1 169 ? 44.193  4.392   17.570  1.00 44.40  ? 169  GLY A O   1 
ATOM   1321 N N   . ASN A 1 170 ? 42.931  5.848   16.412  1.00 44.25  ? 170  ASN A N   1 
ATOM   1322 C CA  . ASN A 1 170 ? 41.660  5.462   17.038  1.00 43.87  ? 170  ASN A CA  1 
ATOM   1323 C C   . ASN A 1 170 ? 41.560  5.655   18.560  1.00 43.49  ? 170  ASN A C   1 
ATOM   1324 O O   . ASN A 1 170 ? 40.601  5.162   19.178  1.00 43.90  ? 170  ASN A O   1 
ATOM   1325 C CB  . ASN A 1 170 ? 41.309  3.999   16.707  1.00 44.54  ? 170  ASN A CB  1 
ATOM   1326 C CG  . ASN A 1 170 ? 41.045  3.777   15.233  1.00 45.96  ? 170  ASN A CG  1 
ATOM   1327 O OD1 . ASN A 1 170 ? 40.483  4.645   14.558  1.00 45.54  ? 170  ASN A OD1 1 
ATOM   1328 N ND2 . ASN A 1 170 ? 41.416  2.586   14.730  1.00 45.62  ? 170  ASN A ND2 1 
ATOM   1329 N N   . VAL A 1 171 ? 42.486  6.399   19.158  1.00 42.78  ? 171  VAL A N   1 
ATOM   1330 C CA  . VAL A 1 171 ? 42.535  6.534   20.616  1.00 42.66  ? 171  VAL A CA  1 
ATOM   1331 C C   . VAL A 1 171 ? 41.295  7.299   21.157  1.00 42.31  ? 171  VAL A C   1 
ATOM   1332 O O   . VAL A 1 171 ? 40.852  7.043   22.266  1.00 43.02  ? 171  VAL A O   1 
ATOM   1333 C CB  . VAL A 1 171 ? 43.861  7.175   21.111  1.00 43.30  ? 171  VAL A CB  1 
ATOM   1334 C CG1 . VAL A 1 171 ? 45.061  6.380   20.581  1.00 41.90  ? 171  VAL A CG1 1 
ATOM   1335 C CG2 . VAL A 1 171 ? 43.949  8.653   20.711  1.00 42.18  ? 171  VAL A CG2 1 
ATOM   1336 N N   . GLY A 1 172 ? 40.714  8.185   20.361  1.00 41.26  ? 172  GLY A N   1 
ATOM   1337 C CA  . GLY A 1 172 ? 39.422  8.809   20.745  1.00 41.12  ? 172  GLY A CA  1 
ATOM   1338 C C   . GLY A 1 172 ? 38.293  7.777   20.905  1.00 40.85  ? 172  GLY A C   1 
ATOM   1339 O O   . GLY A 1 172 ? 37.407  7.916   21.753  1.00 41.58  ? 172  GLY A O   1 
ATOM   1340 N N   . LEU A 1 173 ? 38.317  6.745   20.077  1.00 41.55  ? 173  LEU A N   1 
ATOM   1341 C CA  . LEU A 1 173 ? 37.393  5.603   20.205  1.00 41.59  ? 173  LEU A CA  1 
ATOM   1342 C C   . LEU A 1 173 ? 37.683  4.740   21.436  1.00 42.77  ? 173  LEU A C   1 
ATOM   1343 O O   . LEU A 1 173 ? 36.777  4.182   22.076  1.00 43.19  ? 173  LEU A O   1 
ATOM   1344 C CB  . LEU A 1 173 ? 37.470  4.741   18.941  1.00 41.83  ? 173  LEU A CB  1 
ATOM   1345 C CG  . LEU A 1 173 ? 36.791  5.330   17.681  1.00 42.03  ? 173  LEU A CG  1 
ATOM   1346 C CD1 . LEU A 1 173 ? 37.147  4.496   16.439  1.00 40.06  ? 173  LEU A CD1 1 
ATOM   1347 C CD2 . LEU A 1 173 ? 35.298  5.363   17.879  1.00 39.87  ? 173  LEU A CD2 1 
ATOM   1348 N N   . LEU A 1 174 ? 38.964  4.590   21.739  1.00 44.20  ? 174  LEU A N   1 
ATOM   1349 C CA  . LEU A 1 174 ? 39.386  3.900   22.941  1.00 44.77  ? 174  LEU A CA  1 
ATOM   1350 C C   . LEU A 1 174 ? 38.936  4.707   24.166  1.00 44.69  ? 174  LEU A C   1 
ATOM   1351 O O   . LEU A 1 174 ? 38.508  4.119   25.160  1.00 45.35  ? 174  LEU A O   1 
ATOM   1352 C CB  . LEU A 1 174 ? 40.899  3.668   22.920  1.00 45.42  ? 174  LEU A CB  1 
ATOM   1353 C CG  . LEU A 1 174 ? 41.375  2.667   21.847  1.00 45.79  ? 174  LEU A CG  1 
ATOM   1354 C CD1 . LEU A 1 174 ? 42.898  2.501   21.818  1.00 46.38  ? 174  LEU A CD1 1 
ATOM   1355 C CD2 . LEU A 1 174 ? 40.723  1.309   22.038  1.00 46.69  ? 174  LEU A CD2 1 
ATOM   1356 N N   . ASP A 1 175 ? 38.985  6.042   24.090  1.00 43.22  ? 175  ASP A N   1 
ATOM   1357 C CA  . ASP A 1 175 ? 38.496  6.884   25.195  1.00 42.41  ? 175  ASP A CA  1 
ATOM   1358 C C   . ASP A 1 175 ? 37.025  6.530   25.449  1.00 41.47  ? 175  ASP A C   1 
ATOM   1359 O O   . ASP A 1 175 ? 36.596  6.310   26.585  1.00 41.50  ? 175  ASP A O   1 
ATOM   1360 C CB  . ASP A 1 175 ? 38.588  8.379   24.871  1.00 41.74  ? 175  ASP A CB  1 
ATOM   1361 C CG  . ASP A 1 175 ? 40.014  8.894   24.721  1.00 43.25  ? 175  ASP A CG  1 
ATOM   1362 O OD1 . ASP A 1 175 ? 40.993  8.255   25.194  1.00 45.07  ? 175  ASP A OD1 1 
ATOM   1363 O OD2 . ASP A 1 175 ? 40.152  9.988   24.133  1.00 42.14  ? 175  ASP A OD2 1 
ATOM   1364 N N   . GLN A 1 176 ? 36.249  6.479   24.378  1.00 40.54  ? 176  GLN A N   1 
ATOM   1365 C CA  . GLN A 1 176 ? 34.858  6.060   24.475  1.00 40.40  ? 176  GLN A CA  1 
ATOM   1366 C C   . GLN A 1 176 ? 34.753  4.665   25.065  1.00 40.94  ? 176  GLN A C   1 
ATOM   1367 O O   . GLN A 1 176 ? 33.955  4.436   25.963  1.00 41.26  ? 176  GLN A O   1 
ATOM   1368 C CB  . GLN A 1 176 ? 34.167  6.073   23.112  1.00 39.72  ? 176  GLN A CB  1 
ATOM   1369 C CG  . GLN A 1 176 ? 33.950  7.450   22.501  1.00 39.10  ? 176  GLN A CG  1 
ATOM   1370 C CD  . GLN A 1 176 ? 33.557  7.333   21.042  1.00 40.17  ? 176  GLN A CD  1 
ATOM   1371 O OE1 . GLN A 1 176 ? 33.148  6.254   20.602  1.00 40.82  ? 176  GLN A OE1 1 
ATOM   1372 N NE2 . GLN A 1 176 ? 33.721  8.418   20.273  1.00 39.54  ? 176  GLN A NE2 1 
ATOM   1373 N N   . ARG A 1 177 ? 35.548  3.730   24.564  1.00 41.61  ? 177  ARG A N   1 
ATOM   1374 C CA  . ARG A 1 177 ? 35.469  2.360   25.069  1.00 42.65  ? 177  ARG A CA  1 
ATOM   1375 C C   . ARG A 1 177 ? 35.712  2.300   26.577  1.00 43.02  ? 177  ARG A C   1 
ATOM   1376 O O   . ARG A 1 177 ? 34.986  1.603   27.268  1.00 43.46  ? 177  ARG A O   1 
ATOM   1377 C CB  . ARG A 1 177 ? 36.450  1.429   24.340  1.00 43.76  ? 177  ARG A CB  1 
ATOM   1378 C CG  . ARG A 1 177 ? 36.421  -0.020  24.862  1.00 45.31  ? 177  ARG A CG  1 
ATOM   1379 C CD  . ARG A 1 177 ? 37.398  -0.892  24.115  1.00 48.37  ? 177  ARG A CD  1 
ATOM   1380 N NE  . ARG A 1 177 ? 36.851  -1.269  22.817  1.00 49.99  ? 177  ARG A NE  1 
ATOM   1381 C CZ  . ARG A 1 177 ? 37.562  -1.816  21.828  1.00 51.90  ? 177  ARG A CZ  1 
ATOM   1382 N NH1 . ARG A 1 177 ? 38.863  -2.048  21.961  1.00 51.60  ? 177  ARG A NH1 1 
ATOM   1383 N NH2 . ARG A 1 177 ? 36.962  -2.136  20.695  1.00 52.18  ? 177  ARG A NH2 1 
ATOM   1384 N N   . LEU A 1 178 ? 36.697  3.050   27.076  1.00 43.32  ? 178  LEU A N   1 
ATOM   1385 C CA  . LEU A 1 178 ? 37.036  3.075   28.508  1.00 44.37  ? 178  LEU A CA  1 
ATOM   1386 C C   . LEU A 1 178 ? 35.860  3.570   29.338  1.00 44.81  ? 178  LEU A C   1 
ATOM   1387 O O   . LEU A 1 178 ? 35.598  3.048   30.415  1.00 45.39  ? 178  LEU A O   1 
ATOM   1388 C CB  . LEU A 1 178 ? 38.259  3.961   28.762  1.00 44.41  ? 178  LEU A CB  1 
ATOM   1389 C CG  . LEU A 1 178 ? 38.971  3.969   30.127  1.00 44.90  ? 178  LEU A CG  1 
ATOM   1390 C CD1 . LEU A 1 178 ? 39.276  2.540   30.681  1.00 44.90  ? 178  LEU A CD1 1 
ATOM   1391 C CD2 . LEU A 1 178 ? 40.239  4.769   30.025  1.00 41.35  ? 178  LEU A CD2 1 
ATOM   1392 N N   . ALA A 1 179 ? 35.162  4.588   28.830  1.00 44.54  ? 179  ALA A N   1 
ATOM   1393 C CA  . ALA A 1 179 ? 33.942  5.087   29.464  1.00 44.47  ? 179  ALA A CA  1 
ATOM   1394 C C   . ALA A 1 179 ? 32.874  4.004   29.527  1.00 45.15  ? 179  ALA A C   1 
ATOM   1395 O O   . ALA A 1 179 ? 32.162  3.922   30.525  1.00 46.47  ? 179  ALA A O   1 
ATOM   1396 C CB  . ALA A 1 179 ? 33.418  6.319   28.735  1.00 42.46  ? 179  ALA A CB  1 
ATOM   1397 N N   . LEU A 1 180 ? 32.764  3.169   28.485  1.00 45.35  ? 180  LEU A N   1 
ATOM   1398 C CA  . LEU A 1 180 ? 31.796  2.072   28.487  1.00 46.19  ? 180  LEU A CA  1 
ATOM   1399 C C   . LEU A 1 180 ? 32.168  1.010   29.518  1.00 47.60  ? 180  LEU A C   1 
ATOM   1400 O O   . LEU A 1 180 ? 31.287  0.382   30.126  1.00 47.70  ? 180  LEU A O   1 
ATOM   1401 C CB  . LEU A 1 180 ? 31.678  1.388   27.116  1.00 46.23  ? 180  LEU A CB  1 
ATOM   1402 C CG  . LEU A 1 180 ? 31.377  2.205   25.859  1.00 46.64  ? 180  LEU A CG  1 
ATOM   1403 C CD1 . LEU A 1 180 ? 31.119  1.253   24.673  1.00 45.21  ? 180  LEU A CD1 1 
ATOM   1404 C CD2 . LEU A 1 180 ? 30.234  3.178   26.056  1.00 45.94  ? 180  LEU A CD2 1 
ATOM   1405 N N   . GLN A 1 181 ? 33.475  0.780   29.655  1.00 48.20  ? 181  GLN A N   1 
ATOM   1406 C CA  . GLN A 1 181 ? 34.027  -0.124  30.661  1.00 50.00  ? 181  GLN A CA  1 
ATOM   1407 C C   . GLN A 1 181 ? 33.754  0.429   32.075  1.00 49.29  ? 181  GLN A C   1 
ATOM   1408 O O   . GLN A 1 181 ? 33.366  -0.320  32.981  1.00 50.15  ? 181  GLN A O   1 
ATOM   1409 C CB  . GLN A 1 181 ? 35.535  -0.319  30.430  1.00 50.66  ? 181  GLN A CB  1 
ATOM   1410 C CG  . GLN A 1 181 ? 35.892  -1.483  29.471  1.00 53.37  ? 181  GLN A CG  1 
ATOM   1411 C CD  . GLN A 1 181 ? 37.310  -1.371  28.814  1.00 54.13  ? 181  GLN A CD  1 
ATOM   1412 O OE1 . GLN A 1 181 ? 38.158  -0.570  29.221  1.00 55.71  ? 181  GLN A OE1 1 
ATOM   1413 N NE2 . GLN A 1 181 ? 37.539  -2.173  27.780  1.00 56.92  ? 181  GLN A NE2 1 
ATOM   1414 N N   . TRP A 1 182 ? 33.924  1.742   32.239  1.00 47.14  ? 182  TRP A N   1 
ATOM   1415 C CA  . TRP A 1 182 ? 33.598  2.426   33.483  1.00 46.70  ? 182  TRP A CA  1 
ATOM   1416 C C   . TRP A 1 182 ? 32.128  2.238   33.864  1.00 46.62  ? 182  TRP A C   1 
ATOM   1417 O O   . TRP A 1 182 ? 31.815  1.989   35.028  1.00 47.91  ? 182  TRP A O   1 
ATOM   1418 C CB  . TRP A 1 182 ? 33.900  3.925   33.352  1.00 45.47  ? 182  TRP A CB  1 
ATOM   1419 C CG  . TRP A 1 182 ? 33.754  4.702   34.612  1.00 45.07  ? 182  TRP A CG  1 
ATOM   1420 C CD1 . TRP A 1 182 ? 34.758  5.069   35.465  1.00 44.55  ? 182  TRP A CD1 1 
ATOM   1421 C CD2 . TRP A 1 182 ? 32.546  5.248   35.155  1.00 44.44  ? 182  TRP A CD2 1 
ATOM   1422 N NE1 . TRP A 1 182 ? 34.246  5.797   36.503  1.00 44.81  ? 182  TRP A NE1 1 
ATOM   1423 C CE2 . TRP A 1 182 ? 32.891  5.921   36.339  1.00 45.36  ? 182  TRP A CE2 1 
ATOM   1424 C CE3 . TRP A 1 182 ? 31.202  5.231   34.758  1.00 44.20  ? 182  TRP A CE3 1 
ATOM   1425 C CZ2 . TRP A 1 182 ? 31.939  6.558   37.141  1.00 45.23  ? 182  TRP A CZ2 1 
ATOM   1426 C CZ3 . TRP A 1 182 ? 30.268  5.870   35.542  1.00 44.01  ? 182  TRP A CZ3 1 
ATOM   1427 C CH2 . TRP A 1 182 ? 30.636  6.517   36.731  1.00 44.70  ? 182  TRP A CH2 1 
ATOM   1428 N N   . VAL A 1 183 ? 31.227  2.370   32.893  1.00 45.58  ? 183  VAL A N   1 
ATOM   1429 C CA  . VAL A 1 183 ? 29.805  2.130   33.150  1.00 45.15  ? 183  VAL A CA  1 
ATOM   1430 C C   . VAL A 1 183 ? 29.590  0.691   33.661  1.00 46.59  ? 183  VAL A C   1 
ATOM   1431 O O   . VAL A 1 183 ? 28.975  0.480   34.697  1.00 46.82  ? 183  VAL A O   1 
ATOM   1432 C CB  . VAL A 1 183 ? 28.947  2.459   31.907  1.00 44.60  ? 183  VAL A CB  1 
ATOM   1433 C CG1 . VAL A 1 183 ? 27.518  1.967   32.057  1.00 44.33  ? 183  VAL A CG1 1 
ATOM   1434 C CG2 . VAL A 1 183 ? 28.957  3.973   31.643  1.00 41.78  ? 183  VAL A CG2 1 
ATOM   1435 N N   . GLN A 1 184 ? 30.150  -0.294  32.970  1.00 47.38  ? 184  GLN A N   1 
ATOM   1436 C CA  . GLN A 1 184 ? 29.989  -1.684  33.384  1.00 48.67  ? 184  GLN A CA  1 
ATOM   1437 C C   . GLN A 1 184 ? 30.391  -1.862  34.842  1.00 49.16  ? 184  GLN A C   1 
ATOM   1438 O O   . GLN A 1 184 ? 29.659  -2.470  35.605  1.00 49.44  ? 184  GLN A O   1 
ATOM   1439 C CB  . GLN A 1 184 ? 30.809  -2.647  32.505  1.00 49.09  ? 184  GLN A CB  1 
ATOM   1440 C CG  . GLN A 1 184 ? 30.196  -2.949  31.144  1.00 49.30  ? 184  GLN A CG  1 
ATOM   1441 C CD  . GLN A 1 184 ? 28.760  -3.426  31.217  1.00 48.90  ? 184  GLN A CD  1 
ATOM   1442 O OE1 . GLN A 1 184 ? 27.834  -2.700  30.848  1.00 50.53  ? 184  GLN A OE1 1 
ATOM   1443 N NE2 . GLN A 1 184 ? 28.564  -4.628  31.700  1.00 47.73  ? 184  GLN A NE2 1 
ATOM   1444 N N   . GLU A 1 185 ? 31.537  -1.304  35.224  1.00 48.92  ? 185  GLU A N   1 
ATOM   1445 C CA  . GLU A 1 185 ? 32.011  -1.448  36.588  1.00 50.28  ? 185  GLU A CA  1 
ATOM   1446 C C   . GLU A 1 185 ? 31.275  -0.605  37.624  1.00 49.08  ? 185  GLU A C   1 
ATOM   1447 O O   . GLU A 1 185 ? 31.118  -1.042  38.747  1.00 49.24  ? 185  GLU A O   1 
ATOM   1448 C CB  . GLU A 1 185 ? 33.509  -1.171  36.713  1.00 50.85  ? 185  GLU A CB  1 
ATOM   1449 C CG  . GLU A 1 185 ? 33.938  -1.316  38.177  1.00 55.39  ? 185  GLU A CG  1 
ATOM   1450 C CD  . GLU A 1 185 ? 35.381  -1.683  38.387  1.00 59.66  ? 185  GLU A CD  1 
ATOM   1451 O OE1 . GLU A 1 185 ? 35.661  -2.371  39.400  1.00 61.53  ? 185  GLU A OE1 1 
ATOM   1452 O OE2 . GLU A 1 185 ? 36.224  -1.271  37.555  1.00 61.99  ? 185  GLU A OE2 1 
ATOM   1453 N N   . ASN A 1 186 ? 30.835  0.599   37.262  1.00 48.13  ? 186  ASN A N   1 
ATOM   1454 C CA  . ASN A 1 186 ? 30.407  1.578   38.268  1.00 47.67  ? 186  ASN A CA  1 
ATOM   1455 C C   . ASN A 1 186 ? 28.959  2.031   38.241  1.00 47.57  ? 186  ASN A C   1 
ATOM   1456 O O   . ASN A 1 186 ? 28.484  2.584   39.226  1.00 48.33  ? 186  ASN A O   1 
ATOM   1457 C CB  . ASN A 1 186 ? 31.298  2.813   38.189  1.00 46.77  ? 186  ASN A CB  1 
ATOM   1458 C CG  . ASN A 1 186 ? 32.748  2.503   38.453  1.00 47.50  ? 186  ASN A CG  1 
ATOM   1459 O OD1 . ASN A 1 186 ? 33.134  2.163   39.581  1.00 47.83  ? 186  ASN A OD1 1 
ATOM   1460 N ND2 . ASN A 1 186 ? 33.575  2.622   37.411  1.00 46.24  ? 186  ASN A ND2 1 
ATOM   1461 N N   . ILE A 1 187 ? 28.237  1.803   37.152  1.00 47.40  ? 187  ILE A N   1 
ATOM   1462 C CA  . ILE A 1 187 ? 26.914  2.405   37.012  1.00 47.00  ? 187  ILE A CA  1 
ATOM   1463 C C   . ILE A 1 187 ? 25.875  1.852   38.018  1.00 48.55  ? 187  ILE A C   1 
ATOM   1464 O O   . ILE A 1 187 ? 24.911  2.541   38.362  1.00 48.76  ? 187  ILE A O   1 
ATOM   1465 C CB  . ILE A 1 187 ? 26.383  2.312   35.560  1.00 46.34  ? 187  ILE A CB  1 
ATOM   1466 C CG1 . ILE A 1 187 ? 25.396  3.453   35.274  1.00 45.79  ? 187  ILE A CG1 1 
ATOM   1467 C CG2 . ILE A 1 187 ? 25.730  0.953   35.295  1.00 46.72  ? 187  ILE A CG2 1 
ATOM   1468 C CD1 . ILE A 1 187 ? 25.994  4.864   35.380  1.00 42.12  ? 187  ILE A CD1 1 
ATOM   1469 N N   . ALA A 1 188 ? 26.078  0.635   38.506  1.00 49.37  ? 188  ALA A N   1 
ATOM   1470 C CA  . ALA A 1 188 ? 25.197  0.074   39.539  1.00 50.98  ? 188  ALA A CA  1 
ATOM   1471 C C   . ALA A 1 188 ? 25.194  0.911   40.823  1.00 51.45  ? 188  ALA A C   1 
ATOM   1472 O O   . ALA A 1 188 ? 24.203  0.923   41.544  1.00 53.08  ? 188  ALA A O   1 
ATOM   1473 C CB  . ALA A 1 188 ? 25.564  -1.395  39.843  1.00 51.40  ? 188  ALA A CB  1 
ATOM   1474 N N   . ALA A 1 189 ? 26.281  1.625   41.094  1.00 51.23  ? 189  ALA A N   1 
ATOM   1475 C CA  . ALA A 1 189 ? 26.354  2.508   42.255  1.00 51.51  ? 189  ALA A CA  1 
ATOM   1476 C C   . ALA A 1 189 ? 25.355  3.675   42.163  1.00 51.62  ? 189  ALA A C   1 
ATOM   1477 O O   . ALA A 1 189 ? 24.947  4.239   43.182  1.00 52.84  ? 189  ALA A O   1 
ATOM   1478 C CB  . ALA A 1 189 ? 27.771  3.025   42.425  1.00 50.78  ? 189  ALA A CB  1 
ATOM   1479 N N   . PHE A 1 190 ? 24.953  4.025   40.945  1.00 51.09  ? 190  PHE A N   1 
ATOM   1480 C CA  . PHE A 1 190 ? 23.971  5.087   40.700  1.00 50.54  ? 190  PHE A CA  1 
ATOM   1481 C C   . PHE A 1 190 ? 22.568  4.531   40.478  1.00 51.39  ? 190  PHE A C   1 
ATOM   1482 O O   . PHE A 1 190 ? 21.626  5.291   40.263  1.00 51.78  ? 190  PHE A O   1 
ATOM   1483 C CB  . PHE A 1 190 ? 24.375  5.893   39.467  1.00 49.18  ? 190  PHE A CB  1 
ATOM   1484 C CG  . PHE A 1 190 ? 25.718  6.530   39.585  1.00 47.69  ? 190  PHE A CG  1 
ATOM   1485 C CD1 . PHE A 1 190 ? 26.857  5.828   39.253  1.00 48.89  ? 190  PHE A CD1 1 
ATOM   1486 C CD2 . PHE A 1 190 ? 25.847  7.825   40.046  1.00 47.80  ? 190  PHE A CD2 1 
ATOM   1487 C CE1 . PHE A 1 190 ? 28.110  6.411   39.359  1.00 47.64  ? 190  PHE A CE1 1 
ATOM   1488 C CE2 . PHE A 1 190 ? 27.078  8.410   40.148  1.00 47.60  ? 190  PHE A CE2 1 
ATOM   1489 C CZ  . PHE A 1 190 ? 28.223  7.690   39.815  1.00 47.70  ? 190  PHE A CZ  1 
ATOM   1490 N N   . GLY A 1 191 ? 22.428  3.210   40.531  1.00 52.11  ? 191  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 191 ? 21.140  2.572   40.315  1.00 52.52  ? 191  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 191 ? 20.912  2.165   38.872  1.00 51.95  ? 191  GLY A C   1 
ATOM   1493 O O   . GLY A 1 191 ? 19.809  1.768   38.523  1.00 52.45  ? 191  GLY A O   1 
ATOM   1494 N N   . GLY A 1 192 ? 21.948  2.249   38.037  1.00 50.50  ? 192  GLY A N   1 
ATOM   1495 C CA  . GLY A 1 192 ? 21.852  1.802   36.642  1.00 50.09  ? 192  GLY A CA  1 
ATOM   1496 C C   . GLY A 1 192 ? 22.063  0.296   36.481  1.00 50.93  ? 192  GLY A C   1 
ATOM   1497 O O   . GLY A 1 192 ? 22.756  -0.329  37.282  1.00 51.50  ? 192  GLY A O   1 
ATOM   1498 N N   . ASP A 1 193 ? 21.486  -0.272  35.426  1.00 50.87  ? 193  ASP A N   1 
ATOM   1499 C CA  . ASP A 1 193 ? 21.569  -1.707  35.132  1.00 51.99  ? 193  ASP A CA  1 
ATOM   1500 C C   . ASP A 1 193 ? 22.677  -1.970  34.116  1.00 51.58  ? 193  ASP A C   1 
ATOM   1501 O O   . ASP A 1 193 ? 22.492  -1.745  32.926  1.00 50.55  ? 193  ASP A O   1 
ATOM   1502 C CB  . ASP A 1 193 ? 20.229  -2.169  34.553  1.00 52.81  ? 193  ASP A CB  1 
ATOM   1503 C CG  . ASP A 1 193 ? 20.137  -3.677  34.363  1.00 54.78  ? 193  ASP A CG  1 
ATOM   1504 O OD1 . ASP A 1 193 ? 21.151  -4.386  34.523  1.00 55.74  ? 193  ASP A OD1 1 
ATOM   1505 O OD2 . ASP A 1 193 ? 19.009  -4.149  34.064  1.00 58.30  ? 193  ASP A OD2 1 
ATOM   1506 N N   . PRO A 1 194 ? 23.833  -2.479  34.566  1.00 52.58  ? 194  PRO A N   1 
ATOM   1507 C CA  . PRO A 1 194 ? 24.896  -2.689  33.565  1.00 52.51  ? 194  PRO A CA  1 
ATOM   1508 C C   . PRO A 1 194 ? 24.543  -3.761  32.502  1.00 53.53  ? 194  PRO A C   1 
ATOM   1509 O O   . PRO A 1 194 ? 25.204  -3.839  31.473  1.00 53.13  ? 194  PRO A O   1 
ATOM   1510 C CB  . PRO A 1 194 ? 26.101  -3.114  34.415  1.00 52.59  ? 194  PRO A CB  1 
ATOM   1511 C CG  . PRO A 1 194 ? 25.486  -3.730  35.650  1.00 54.03  ? 194  PRO A CG  1 
ATOM   1512 C CD  . PRO A 1 194 ? 24.239  -2.927  35.913  1.00 53.55  ? 194  PRO A CD  1 
ATOM   1513 N N   . MET A 1 195 ? 23.500  -4.553  32.739  1.00 55.18  ? 195  MET A N   1 
ATOM   1514 C CA  . MET A 1 195 ? 23.056  -5.552  31.767  1.00 56.63  ? 195  MET A CA  1 
ATOM   1515 C C   . MET A 1 195 ? 21.977  -4.998  30.817  1.00 55.59  ? 195  MET A C   1 
ATOM   1516 O O   . MET A 1 195 ? 21.382  -5.750  30.039  1.00 56.15  ? 195  MET A O   1 
ATOM   1517 C CB  . MET A 1 195 ? 22.554  -6.804  32.500  1.00 58.51  ? 195  MET A CB  1 
ATOM   1518 C CG  . MET A 1 195 ? 23.592  -7.447  33.435  1.00 60.19  ? 195  MET A CG  1 
ATOM   1519 S SD  . MET A 1 195 ? 23.082  -9.070  34.087  1.00 64.84  ? 195  MET A SD  1 
ATOM   1520 C CE  . MET A 1 195 ? 23.195  -10.000 32.550  1.00 68.84  ? 195  MET A CE  1 
ATOM   1521 N N   . SER A 1 196 ? 21.727  -3.686  30.878  1.00 53.70  ? 196  SER A N   1 
ATOM   1522 C CA  . SER A 1 196 ? 20.909  -2.997  29.887  1.00 52.35  ? 196  SER A CA  1 
ATOM   1523 C C   . SER A 1 196 ? 21.487  -1.605  29.585  1.00 51.17  ? 196  SER A C   1 
ATOM   1524 O O   . SER A 1 196 ? 21.074  -0.606  30.181  1.00 50.53  ? 196  SER A O   1 
ATOM   1525 C CB  . SER A 1 196 ? 19.468  -2.865  30.361  1.00 53.11  ? 196  SER A CB  1 
ATOM   1526 O OG  . SER A 1 196 ? 18.677  -2.161  29.410  1.00 51.61  ? 196  SER A OG  1 
ATOM   1527 N N   . VAL A 1 197 ? 22.429  -1.574  28.644  1.00 50.26  ? 197  VAL A N   1 
ATOM   1528 C CA  . VAL A 1 197 ? 23.122  -0.373  28.206  1.00 49.08  ? 197  VAL A CA  1 
ATOM   1529 C C   . VAL A 1 197 ? 22.847  -0.170  26.725  1.00 48.71  ? 197  VAL A C   1 
ATOM   1530 O O   . VAL A 1 197 ? 23.137  -1.040  25.901  1.00 49.58  ? 197  VAL A O   1 
ATOM   1531 C CB  . VAL A 1 197 ? 24.655  -0.490  28.395  1.00 48.96  ? 197  VAL A CB  1 
ATOM   1532 C CG1 . VAL A 1 197 ? 25.357  0.783   27.890  1.00 45.96  ? 197  VAL A CG1 1 
ATOM   1533 C CG2 . VAL A 1 197 ? 25.001  -0.759  29.851  1.00 49.55  ? 197  VAL A CG2 1 
ATOM   1534 N N   . THR A 1 198 ? 22.282  0.981   26.394  1.00 47.87  ? 198  THR A N   1 
ATOM   1535 C CA  . THR A 1 198 ? 21.994  1.364   25.007  1.00 47.19  ? 198  THR A CA  1 
ATOM   1536 C C   . THR A 1 198 ? 22.886  2.553   24.650  1.00 46.00  ? 198  THR A C   1 
ATOM   1537 O O   . THR A 1 198 ? 22.856  3.572   25.351  1.00 45.80  ? 198  THR A O   1 
ATOM   1538 C CB  . THR A 1 198 ? 20.512  1.771   24.858  1.00 47.36  ? 198  THR A CB  1 
ATOM   1539 O OG1 . THR A 1 198 ? 19.680  0.638   25.148  1.00 49.07  ? 198  THR A OG1 1 
ATOM   1540 C CG2 . THR A 1 198 ? 20.198  2.296   23.459  1.00 45.18  ? 198  THR A CG2 1 
ATOM   1541 N N   . LEU A 1 199 ? 23.682  2.426   23.585  1.00 45.66  ? 199  LEU A N   1 
ATOM   1542 C CA  . LEU A 1 199 ? 24.465  3.564   23.083  1.00 44.80  ? 199  LEU A CA  1 
ATOM   1543 C C   . LEU A 1 199 ? 23.599  4.391   22.135  1.00 44.86  ? 199  LEU A C   1 
ATOM   1544 O O   . LEU A 1 199 ? 22.817  3.826   21.358  1.00 46.20  ? 199  LEU A O   1 
ATOM   1545 C CB  . LEU A 1 199 ? 25.693  3.100   22.331  1.00 44.52  ? 199  LEU A CB  1 
ATOM   1546 C CG  . LEU A 1 199 ? 26.652  2.121   23.003  1.00 45.04  ? 199  LEU A CG  1 
ATOM   1547 C CD1 . LEU A 1 199 ? 27.857  1.942   22.091  1.00 44.51  ? 199  LEU A CD1 1 
ATOM   1548 C CD2 . LEU A 1 199 ? 27.085  2.579   24.389  1.00 42.83  ? 199  LEU A CD2 1 
ATOM   1549 N N   . PHE A 1 200 ? 23.704  5.714   22.212  1.00 43.58  ? 200  PHE A N   1 
ATOM   1550 C CA  . PHE A 1 200 ? 23.136  6.570   21.174  1.00 43.25  ? 200  PHE A CA  1 
ATOM   1551 C C   . PHE A 1 200 ? 24.034  7.753   20.878  1.00 42.35  ? 200  PHE A C   1 
ATOM   1552 O O   . PHE A 1 200 ? 24.798  8.177   21.730  1.00 42.66  ? 200  PHE A O   1 
ATOM   1553 C CB  . PHE A 1 200 ? 21.673  6.967   21.455  1.00 43.30  ? 200  PHE A CB  1 
ATOM   1554 C CG  . PHE A 1 200 ? 21.456  7.970   22.562  1.00 43.35  ? 200  PHE A CG  1 
ATOM   1555 C CD1 . PHE A 1 200 ? 21.974  7.784   23.826  1.00 43.87  ? 200  PHE A CD1 1 
ATOM   1556 C CD2 . PHE A 1 200 ? 20.586  9.041   22.365  1.00 43.47  ? 200  PHE A CD2 1 
ATOM   1557 C CE1 . PHE A 1 200 ? 21.724  8.691   24.849  1.00 44.39  ? 200  PHE A CE1 1 
ATOM   1558 C CE2 . PHE A 1 200 ? 20.323  9.939   23.392  1.00 44.90  ? 200  PHE A CE2 1 
ATOM   1559 C CZ  . PHE A 1 200 ? 20.907  9.764   24.640  1.00 42.91  ? 200  PHE A CZ  1 
ATOM   1560 N N   . GLY A 1 201 ? 23.974  8.252   19.648  1.00 41.95  ? 201  GLY A N   1 
ATOM   1561 C CA  . GLY A 1 201 ? 24.797  9.394   19.259  1.00 41.57  ? 201  GLY A CA  1 
ATOM   1562 C C   . GLY A 1 201 ? 24.395  9.903   17.900  1.00 41.29  ? 201  GLY A C   1 
ATOM   1563 O O   . GLY A 1 201 ? 23.664  9.220   17.181  1.00 41.34  ? 201  GLY A O   1 
ATOM   1564 N N   . GLU A 1 202 ? 24.900  11.088  17.557  1.00 40.38  ? 202  GLU A N   1 
ATOM   1565 C CA  . GLU A 1 202 ? 24.550  11.756  16.320  1.00 40.29  ? 202  GLU A CA  1 
ATOM   1566 C C   . GLU A 1 202 ? 25.778  12.142  15.530  1.00 40.05  ? 202  GLU A C   1 
ATOM   1567 O O   . GLU A 1 202 ? 26.807  12.520  16.097  1.00 39.22  ? 202  GLU A O   1 
ATOM   1568 C CB  . GLU A 1 202 ? 23.674  12.975  16.589  1.00 40.35  ? 202  GLU A CB  1 
ATOM   1569 C CG  . GLU A 1 202 ? 23.139  13.685  15.315  1.00 41.78  ? 202  GLU A CG  1 
ATOM   1570 C CD  . GLU A 1 202 ? 23.974  14.892  14.888  1.00 41.64  ? 202  GLU A CD  1 
ATOM   1571 O OE1 . GLU A 1 202 ? 24.907  15.264  15.614  1.00 44.59  ? 202  GLU A OE1 1 
ATOM   1572 O OE2 . GLU A 1 202 ? 23.686  15.485  13.830  1.00 41.78  ? 202  GLU A OE2 1 
ATOM   1573 N N   . SER A 1 203 ? 25.652  12.029  14.210  1.00 40.55  ? 203  SER A N   1 
ATOM   1574 C CA  . SER A 1 203 ? 26.700  12.411  13.277  1.00 40.69  ? 203  SER A CA  1 
ATOM   1575 C C   . SER A 1 203 ? 27.924  11.541  13.582  1.00 40.80  ? 203  SER A C   1 
ATOM   1576 O O   . SER A 1 203 ? 27.804  10.306  13.566  1.00 41.50  ? 203  SER A O   1 
ATOM   1577 C CB  . SER A 1 203 ? 26.941  13.930  13.356  1.00 40.90  ? 203  SER A CB  1 
ATOM   1578 O OG  . SER A 1 203 ? 27.779  14.395  12.299  1.00 41.32  ? 203  SER A OG  1 
ATOM   1579 N N   . ALA A 1 204 ? 29.063  12.137  13.905  1.00 40.01  ? 204  ALA A N   1 
ATOM   1580 C CA  . ALA A 1 204 ? 30.265  11.355  14.277  1.00 40.19  ? 204  ALA A CA  1 
ATOM   1581 C C   . ALA A 1 204 ? 30.021  10.448  15.503  1.00 40.87  ? 204  ALA A C   1 
ATOM   1582 O O   . ALA A 1 204 ? 30.630  9.366   15.646  1.00 40.00  ? 204  ALA A O   1 
ATOM   1583 C CB  . ALA A 1 204 ? 31.399  12.277  14.557  1.00 39.66  ? 204  ALA A CB  1 
ATOM   1584 N N   . GLY A 1 205 ? 29.142  10.907  16.401  1.00 40.59  ? 205  GLY A N   1 
ATOM   1585 C CA  . GLY A 1 205 ? 28.752  10.110  17.554  1.00 41.34  ? 205  GLY A CA  1 
ATOM   1586 C C   . GLY A 1 205 ? 28.083  8.822   17.109  1.00 41.72  ? 205  GLY A C   1 
ATOM   1587 O O   . GLY A 1 205 ? 28.362  7.766   17.651  1.00 42.49  ? 205  GLY A O   1 
ATOM   1588 N N   . ALA A 1 206 ? 27.202  8.928   16.111  1.00 41.53  ? 206  ALA A N   1 
ATOM   1589 C CA  . ALA A 1 206 ? 26.517  7.762   15.496  1.00 41.28  ? 206  ALA A CA  1 
ATOM   1590 C C   . ALA A 1 206 ? 27.523  6.854   14.790  1.00 41.18  ? 206  ALA A C   1 
ATOM   1591 O O   . ALA A 1 206 ? 27.454  5.618   14.875  1.00 39.85  ? 206  ALA A O   1 
ATOM   1592 C CB  . ALA A 1 206 ? 25.451  8.244   14.484  1.00 40.78  ? 206  ALA A CB  1 
ATOM   1593 N N   . ALA A 1 207 ? 28.453  7.460   14.054  1.00 40.50  ? 207  ALA A N   1 
ATOM   1594 C CA  . ALA A 1 207 ? 29.509  6.654   13.422  1.00 40.73  ? 207  ALA A CA  1 
ATOM   1595 C C   . ALA A 1 207 ? 30.253  5.852   14.484  1.00 41.32  ? 207  ALA A C   1 
ATOM   1596 O O   . ALA A 1 207 ? 30.578  4.673   14.284  1.00 42.39  ? 207  ALA A O   1 
ATOM   1597 C CB  . ALA A 1 207 ? 30.464  7.532   12.654  1.00 40.86  ? 207  ALA A CB  1 
ATOM   1598 N N   . SER A 1 208 ? 30.540  6.510   15.611  1.00 40.98  ? 208  SER A N   1 
ATOM   1599 C CA  . SER A 1 208 ? 31.225  5.898   16.759  1.00 41.37  ? 208  SER A CA  1 
ATOM   1600 C C   . SER A 1 208 ? 30.459  4.692   17.309  1.00 41.98  ? 208  SER A C   1 
ATOM   1601 O O   . SER A 1 208 ? 31.032  3.627   17.487  1.00 42.42  ? 208  SER A O   1 
ATOM   1602 C CB  . SER A 1 208 ? 31.417  6.939   17.869  1.00 40.86  ? 208  SER A CB  1 
ATOM   1603 O OG  . SER A 1 208 ? 32.254  8.015   17.434  1.00 40.93  ? 208  SER A OG  1 
ATOM   1604 N N   . VAL A 1 209 ? 29.155  4.858   17.545  1.00 41.46  ? 209  VAL A N   1 
ATOM   1605 C CA  . VAL A 1 209 ? 28.282  3.752   17.987  1.00 41.22  ? 209  VAL A CA  1 
ATOM   1606 C C   . VAL A 1 209 ? 28.417  2.572   17.038  1.00 42.93  ? 209  VAL A C   1 
ATOM   1607 O O   . VAL A 1 209 ? 28.567  1.412   17.477  1.00 43.89  ? 209  VAL A O   1 
ATOM   1608 C CB  . VAL A 1 209 ? 26.783  4.176   18.046  1.00 41.48  ? 209  VAL A CB  1 
ATOM   1609 C CG1 . VAL A 1 209 ? 25.855  2.947   18.265  1.00 40.53  ? 209  VAL A CG1 1 
ATOM   1610 C CG2 . VAL A 1 209 ? 26.573  5.249   19.111  1.00 38.61  ? 209  VAL A CG2 1 
ATOM   1611 N N   . GLY A 1 210 ? 28.388  2.861   15.735  1.00 43.30  ? 210  GLY A N   1 
ATOM   1612 C CA  . GLY A 1 210 ? 28.511  1.819   14.704  1.00 44.65  ? 210  GLY A CA  1 
ATOM   1613 C C   . GLY A 1 210 ? 29.837  1.086   14.756  1.00 45.57  ? 210  GLY A C   1 
ATOM   1614 O O   . GLY A 1 210 ? 29.904  -0.129  14.581  1.00 47.08  ? 210  GLY A O   1 
ATOM   1615 N N   . MET A 1 211 ? 30.906  1.816   15.003  1.00 45.25  ? 211  MET A N   1 
ATOM   1616 C CA  . MET A 1 211 ? 32.216  1.183   15.188  1.00 46.72  ? 211  MET A CA  1 
ATOM   1617 C C   . MET A 1 211 ? 32.325  0.326   16.450  1.00 46.52  ? 211  MET A C   1 
ATOM   1618 O O   . MET A 1 211 ? 33.035  -0.686  16.467  1.00 46.82  ? 211  MET A O   1 
ATOM   1619 C CB  . MET A 1 211 ? 33.296  2.248   15.131  1.00 46.13  ? 211  MET A CB  1 
ATOM   1620 C CG  . MET A 1 211 ? 33.471  2.762   13.690  1.00 47.43  ? 211  MET A CG  1 
ATOM   1621 S SD  . MET A 1 211 ? 34.471  4.205   13.707  1.00 49.44  ? 211  MET A SD  1 
ATOM   1622 C CE  . MET A 1 211 ? 33.998  5.000   12.142  1.00 47.53  ? 211  MET A CE  1 
ATOM   1623 N N   . HIS A 1 212 ? 31.594  0.685   17.500  1.00 46.06  ? 212  HIS A N   1 
ATOM   1624 C CA  . HIS A 1 212 ? 31.533  -0.212  18.666  1.00 46.20  ? 212  HIS A CA  1 
ATOM   1625 C C   . HIS A 1 212 ? 30.802  -1.501  18.343  1.00 47.22  ? 212  HIS A C   1 
ATOM   1626 O O   . HIS A 1 212 ? 31.201  -2.568  18.801  1.00 47.71  ? 212  HIS A O   1 
ATOM   1627 C CB  . HIS A 1 212 ? 30.944  0.492   19.875  1.00 45.36  ? 212  HIS A CB  1 
ATOM   1628 C CG  . HIS A 1 212 ? 31.838  1.558   20.405  1.00 44.66  ? 212  HIS A CG  1 
ATOM   1629 N ND1 . HIS A 1 212 ? 33.088  1.284   20.917  1.00 46.31  ? 212  HIS A ND1 1 
ATOM   1630 C CD2 . HIS A 1 212 ? 31.697  2.899   20.447  1.00 43.97  ? 212  HIS A CD2 1 
ATOM   1631 C CE1 . HIS A 1 212 ? 33.663  2.415   21.283  1.00 46.00  ? 212  HIS A CE1 1 
ATOM   1632 N NE2 . HIS A 1 212 ? 32.846  3.410   20.993  1.00 42.94  ? 212  HIS A NE2 1 
ATOM   1633 N N   . ILE A 1 213 ? 29.759  -1.408  17.526  1.00 47.41  ? 213  ILE A N   1 
ATOM   1634 C CA  . ILE A 1 213 ? 29.080  -2.596  17.015  1.00 48.68  ? 213  ILE A CA  1 
ATOM   1635 C C   . ILE A 1 213 ? 30.033  -3.482  16.217  1.00 49.83  ? 213  ILE A C   1 
ATOM   1636 O O   . ILE A 1 213 ? 29.951  -4.711  16.283  1.00 51.01  ? 213  ILE A O   1 
ATOM   1637 C CB  . ILE A 1 213 ? 27.866  -2.224  16.119  1.00 48.49  ? 213  ILE A CB  1 
ATOM   1638 C CG1 . ILE A 1 213 ? 26.793  -1.511  16.938  1.00 47.48  ? 213  ILE A CG1 1 
ATOM   1639 C CG2 . ILE A 1 213 ? 27.258  -3.482  15.457  1.00 49.37  ? 213  ILE A CG2 1 
ATOM   1640 C CD1 . ILE A 1 213 ? 25.641  -0.941  16.101  1.00 45.98  ? 213  ILE A CD1 1 
ATOM   1641 N N   . LEU A 1 214 ? 30.941  -2.866  15.469  1.00 49.33  ? 214  LEU A N   1 
ATOM   1642 C CA  . LEU A 1 214 ? 31.792  -3.610  14.556  1.00 50.40  ? 214  LEU A CA  1 
ATOM   1643 C C   . LEU A 1 214 ? 33.105  -4.052  15.185  1.00 51.30  ? 214  LEU A C   1 
ATOM   1644 O O   . LEU A 1 214 ? 33.873  -4.764  14.552  1.00 52.29  ? 214  LEU A O   1 
ATOM   1645 C CB  . LEU A 1 214 ? 32.038  -2.790  13.282  1.00 49.55  ? 214  LEU A CB  1 
ATOM   1646 C CG  . LEU A 1 214 ? 30.768  -2.473  12.487  1.00 50.04  ? 214  LEU A CG  1 
ATOM   1647 C CD1 . LEU A 1 214 ? 31.034  -1.434  11.385  1.00 48.84  ? 214  LEU A CD1 1 
ATOM   1648 C CD2 . LEU A 1 214 ? 30.132  -3.746  11.916  1.00 51.24  ? 214  LEU A CD2 1 
ATOM   1649 N N   . SER A 1 215 ? 33.358  -3.646  16.427  1.00 51.55  ? 215  SER A N   1 
ATOM   1650 C CA  . SER A 1 215 ? 34.601  -3.983  17.129  1.00 52.67  ? 215  SER A CA  1 
ATOM   1651 C C   . SER A 1 215 ? 34.318  -4.889  18.330  1.00 54.24  ? 215  SER A C   1 
ATOM   1652 O O   . SER A 1 215 ? 33.626  -4.499  19.255  1.00 53.11  ? 215  SER A O   1 
ATOM   1653 C CB  . SER A 1 215 ? 35.304  -2.710  17.583  1.00 51.41  ? 215  SER A CB  1 
ATOM   1654 O OG  . SER A 1 215 ? 36.644  -2.984  17.933  1.00 52.17  ? 215  SER A OG  1 
ATOM   1655 N N   . LEU A 1 216 ? 34.884  -6.091  18.316  1.00 56.85  ? 216  LEU A N   1 
ATOM   1656 C CA  . LEU A 1 216 ? 34.473  -7.157  19.234  1.00 58.84  ? 216  LEU A CA  1 
ATOM   1657 C C   . LEU A 1 216 ? 34.639  -6.830  20.727  1.00 58.28  ? 216  LEU A C   1 
ATOM   1658 O O   . LEU A 1 216 ? 33.711  -7.044  21.512  1.00 58.88  ? 216  LEU A O   1 
ATOM   1659 C CB  . LEU A 1 216 ? 35.189  -8.479  18.881  1.00 60.91  ? 216  LEU A CB  1 
ATOM   1660 C CG  . LEU A 1 216 ? 34.532  -9.741  19.452  1.00 64.78  ? 216  LEU A CG  1 
ATOM   1661 C CD1 . LEU A 1 216 ? 33.114  -9.964  18.859  1.00 67.03  ? 216  LEU A CD1 1 
ATOM   1662 C CD2 . LEU A 1 216 ? 35.417  -10.983 19.232  1.00 66.96  ? 216  LEU A CD2 1 
ATOM   1663 N N   . PRO A 1 217 ? 35.801  -6.295  21.130  1.00 57.52  ? 217  PRO A N   1 
ATOM   1664 C CA  . PRO A 1 217 ? 35.937  -5.912  22.538  1.00 57.15  ? 217  PRO A CA  1 
ATOM   1665 C C   . PRO A 1 217 ? 34.881  -4.933  23.064  1.00 55.87  ? 217  PRO A C   1 
ATOM   1666 O O   . PRO A 1 217 ? 34.610  -4.932  24.258  1.00 56.37  ? 217  PRO A O   1 
ATOM   1667 C CB  . PRO A 1 217 ? 37.326  -5.273  22.593  1.00 56.77  ? 217  PRO A CB  1 
ATOM   1668 C CG  . PRO A 1 217 ? 38.057  -5.879  21.452  1.00 57.91  ? 217  PRO A CG  1 
ATOM   1669 C CD  . PRO A 1 217 ? 37.035  -6.038  20.375  1.00 57.62  ? 217  PRO A CD  1 
ATOM   1670 N N   . SER A 1 218 ? 34.301  -4.102  22.204  1.00 55.10  ? 218  SER A N   1 
ATOM   1671 C CA  . SER A 1 218 ? 33.255  -3.166  22.629  1.00 54.28  ? 218  SER A CA  1 
ATOM   1672 C C   . SER A 1 218 ? 31.926  -3.859  22.794  1.00 55.34  ? 218  SER A C   1 
ATOM   1673 O O   . SER A 1 218 ? 31.081  -3.414  23.557  1.00 55.22  ? 218  SER A O   1 
ATOM   1674 C CB  . SER A 1 218 ? 33.078  -2.032  21.614  1.00 53.17  ? 218  SER A CB  1 
ATOM   1675 O OG  . SER A 1 218 ? 34.213  -1.189  21.575  1.00 52.42  ? 218  SER A OG  1 
ATOM   1676 N N   . ARG A 1 219 ? 31.742  -4.954  22.070  1.00 57.24  ? 219  ARG A N   1 
ATOM   1677 C CA  . ARG A 1 219 ? 30.418  -5.571  21.924  1.00 58.16  ? 219  ARG A CA  1 
ATOM   1678 C C   . ARG A 1 219 ? 29.931  -6.217  23.223  1.00 58.90  ? 219  ARG A C   1 
ATOM   1679 O O   . ARG A 1 219 ? 28.731  -6.365  23.434  1.00 59.85  ? 219  ARG A O   1 
ATOM   1680 C CB  A ARG A 1 219 ? 30.406  -6.589  20.763  0.50 59.28  ? 219  ARG A CB  1 
ATOM   1681 C CB  B ARG A 1 219 ? 30.437  -6.570  20.754  0.50 59.32  ? 219  ARG A CB  1 
ATOM   1682 C CG  A ARG A 1 219 ? 30.059  -5.979  19.388  0.50 58.22  ? 219  ARG A CG  1 
ATOM   1683 C CG  B ARG A 1 219 ? 29.066  -7.038  20.256  0.50 60.20  ? 219  ARG A CG  1 
ATOM   1684 C CD  A ARG A 1 219 ? 28.562  -6.112  19.030  0.50 59.26  ? 219  ARG A CD  1 
ATOM   1685 C CD  B ARG A 1 219 ? 28.192  -5.936  19.636  0.50 58.24  ? 219  ARG A CD  1 
ATOM   1686 N NE  A ARG A 1 219 ? 28.291  -7.123  17.996  0.50 61.49  ? 219  ARG A NE  1 
ATOM   1687 N NE  B ARG A 1 219 ? 26.786  -6.350  19.636  0.50 58.62  ? 219  ARG A NE  1 
ATOM   1688 C CZ  A ARG A 1 219 ? 27.113  -7.731  17.803  0.50 63.36  ? 219  ARG A CZ  1 
ATOM   1689 C CZ  B ARG A 1 219 ? 25.998  -6.375  20.716  0.50 58.92  ? 219  ARG A CZ  1 
ATOM   1690 N NH1 A ARG A 1 219 ? 26.067  -7.459  18.572  0.50 64.09  ? 219  ARG A NH1 1 
ATOM   1691 N NH1 B ARG A 1 219 ? 26.454  -5.985  21.899  0.50 56.95  ? 219  ARG A NH1 1 
ATOM   1692 N NH2 A ARG A 1 219 ? 26.975  -8.630  16.835  0.50 64.26  ? 219  ARG A NH2 1 
ATOM   1693 N NH2 B ARG A 1 219 ? 24.735  -6.788  20.618  0.50 59.78  ? 219  ARG A NH2 1 
ATOM   1694 N N   . SER A 1 220 ? 30.860  -6.569  24.108  1.00 58.95  ? 220  SER A N   1 
ATOM   1695 C CA  . SER A 1 220 ? 30.510  -7.056  25.425  1.00 59.14  ? 220  SER A CA  1 
ATOM   1696 C C   . SER A 1 220 ? 30.075  -5.947  26.392  1.00 57.15  ? 220  SER A C   1 
ATOM   1697 O O   . SER A 1 220 ? 29.706  -6.250  27.531  1.00 57.68  ? 220  SER A O   1 
ATOM   1698 C CB  . SER A 1 220 ? 31.697  -7.833  26.027  1.00 60.84  ? 220  SER A CB  1 
ATOM   1699 O OG  . SER A 1 220 ? 32.885  -7.045  26.076  1.00 61.92  ? 220  SER A OG  1 
ATOM   1700 N N   . LEU A 1 221 ? 30.099  -4.678  25.951  1.00 54.51  ? 221  LEU A N   1 
ATOM   1701 C CA  . LEU A 1 221 ? 29.921  -3.533  26.853  1.00 52.35  ? 221  LEU A CA  1 
ATOM   1702 C C   . LEU A 1 221 ? 28.603  -2.806  26.648  1.00 51.42  ? 221  LEU A C   1 
ATOM   1703 O O   . LEU A 1 221 ? 28.359  -1.781  27.303  1.00 50.45  ? 221  LEU A O   1 
ATOM   1704 C CB  . LEU A 1 221 ? 31.095  -2.549  26.721  1.00 50.98  ? 221  LEU A CB  1 
ATOM   1705 C CG  . LEU A 1 221 ? 32.509  -3.168  26.818  1.00 51.80  ? 221  LEU A CG  1 
ATOM   1706 C CD1 . LEU A 1 221 ? 33.593  -2.175  26.427  1.00 49.16  ? 221  LEU A CD1 1 
ATOM   1707 C CD2 . LEU A 1 221 ? 32.790  -3.767  28.216  1.00 50.04  ? 221  LEU A CD2 1 
ATOM   1708 N N   . PHE A 1 222 ? 27.754  -3.327  25.757  1.00 51.31  ? 222  PHE A N   1 
ATOM   1709 C CA  . PHE A 1 222 ? 26.399  -2.787  25.555  1.00 50.88  ? 222  PHE A CA  1 
ATOM   1710 C C   . PHE A 1 222 ? 25.522  -3.787  24.845  1.00 51.96  ? 222  PHE A C   1 
ATOM   1711 O O   . PHE A 1 222 ? 26.019  -4.757  24.315  1.00 52.85  ? 222  PHE A O   1 
ATOM   1712 C CB  . PHE A 1 222 ? 26.424  -1.502  24.723  1.00 49.44  ? 222  PHE A CB  1 
ATOM   1713 C CG  . PHE A 1 222 ? 26.856  -1.714  23.296  1.00 48.99  ? 222  PHE A CG  1 
ATOM   1714 C CD1 . PHE A 1 222 ? 28.204  -1.838  22.978  1.00 47.73  ? 222  PHE A CD1 1 
ATOM   1715 C CD2 . PHE A 1 222 ? 25.913  -1.795  22.268  1.00 48.42  ? 222  PHE A CD2 1 
ATOM   1716 C CE1 . PHE A 1 222 ? 28.606  -2.020  21.671  1.00 48.18  ? 222  PHE A CE1 1 
ATOM   1717 C CE2 . PHE A 1 222 ? 26.319  -1.990  20.947  1.00 47.83  ? 222  PHE A CE2 1 
ATOM   1718 C CZ  . PHE A 1 222 ? 27.657  -2.098  20.653  1.00 48.06  ? 222  PHE A CZ  1 
ATOM   1719 N N   . HIS A 1 223 ? 24.223  -3.512  24.787  1.00 52.32  ? 223  HIS A N   1 
ATOM   1720 C CA  . HIS A 1 223 ? 23.253  -4.482  24.282  1.00 54.36  ? 223  HIS A CA  1 
ATOM   1721 C C   . HIS A 1 223 ? 22.440  -4.001  23.070  1.00 54.18  ? 223  HIS A C   1 
ATOM   1722 O O   . HIS A 1 223 ? 22.013  -4.826  22.245  1.00 55.86  ? 223  HIS A O   1 
ATOM   1723 C CB  . HIS A 1 223 ? 22.357  -4.908  25.457  1.00 55.53  ? 223  HIS A CB  1 
ATOM   1724 C CG  . HIS A 1 223 ? 23.138  -5.114  26.722  1.00 56.98  ? 223  HIS A CG  1 
ATOM   1725 N ND1 . HIS A 1 223 ? 23.540  -6.360  27.161  1.00 58.70  ? 223  HIS A ND1 1 
ATOM   1726 C CD2 . HIS A 1 223 ? 23.696  -4.218  27.572  1.00 55.74  ? 223  HIS A CD2 1 
ATOM   1727 C CE1 . HIS A 1 223 ? 24.264  -6.220  28.258  1.00 58.59  ? 223  HIS A CE1 1 
ATOM   1728 N NE2 . HIS A 1 223 ? 24.376  -4.930  28.526  1.00 58.26  ? 223  HIS A NE2 1 
ATOM   1729 N N   . ARG A 1 224 ? 22.240  -2.686  22.959  1.00 52.34  ? 224  ARG A N   1 
ATOM   1730 C CA  . ARG A 1 224 ? 21.456  -2.082  21.883  1.00 51.88  ? 224  ARG A CA  1 
ATOM   1731 C C   . ARG A 1 224 ? 22.090  -0.737  21.471  1.00 49.62  ? 224  ARG A C   1 
ATOM   1732 O O   . ARG A 1 224 ? 22.863  -0.169  22.240  1.00 48.71  ? 224  ARG A O   1 
ATOM   1733 C CB  . ARG A 1 224 ? 20.030  -1.840  22.370  1.00 52.55  ? 224  ARG A CB  1 
ATOM   1734 C CG  . ARG A 1 224 ? 19.187  -3.080  22.396  1.00 56.90  ? 224  ARG A CG  1 
ATOM   1735 C CD  . ARG A 1 224 ? 17.897  -2.863  23.160  1.00 59.65  ? 224  ARG A CD  1 
ATOM   1736 N NE  . ARG A 1 224 ? 18.194  -2.707  24.572  1.00 61.87  ? 224  ARG A NE  1 
ATOM   1737 C CZ  . ARG A 1 224 ? 18.388  -3.701  25.438  1.00 64.11  ? 224  ARG A CZ  1 
ATOM   1738 N NH1 . ARG A 1 224 ? 18.308  -4.979  25.071  1.00 67.10  ? 224  ARG A NH1 1 
ATOM   1739 N NH2 . ARG A 1 224 ? 18.669  -3.400  26.697  1.00 64.54  ? 224  ARG A NH2 1 
ATOM   1740 N N   . ALA A 1 225 ? 21.748  -0.236  20.279  1.00 48.46  ? 225  ALA A N   1 
ATOM   1741 C CA  . ALA A 1 225 ? 22.383  0.977   19.719  1.00 46.58  ? 225  ALA A CA  1 
ATOM   1742 C C   . ALA A 1 225 ? 21.406  1.855   18.936  1.00 45.84  ? 225  ALA A C   1 
ATOM   1743 O O   . ALA A 1 225 ? 20.497  1.359   18.292  1.00 46.14  ? 225  ALA A O   1 
ATOM   1744 C CB  . ALA A 1 225 ? 23.540  0.593   18.835  1.00 46.16  ? 225  ALA A CB  1 
ATOM   1745 N N   . VAL A 1 226 ? 21.625  3.167   18.989  1.00 44.98  ? 226  VAL A N   1 
ATOM   1746 C CA  . VAL A 1 226 ? 20.866  4.121   18.190  1.00 44.18  ? 226  VAL A CA  1 
ATOM   1747 C C   . VAL A 1 226 ? 21.814  5.004   17.384  1.00 43.42  ? 226  VAL A C   1 
ATOM   1748 O O   . VAL A 1 226 ? 22.649  5.693   17.970  1.00 42.98  ? 226  VAL A O   1 
ATOM   1749 C CB  . VAL A 1 226 ? 20.001  5.028   19.072  1.00 44.24  ? 226  VAL A CB  1 
ATOM   1750 C CG1 . VAL A 1 226 ? 19.256  6.090   18.188  1.00 42.65  ? 226  VAL A CG1 1 
ATOM   1751 C CG2 . VAL A 1 226 ? 19.041  4.212   19.918  1.00 44.15  ? 226  VAL A CG2 1 
ATOM   1752 N N   . LEU A 1 227 ? 21.689  4.993   16.054  1.00 43.58  ? 227  LEU A N   1 
ATOM   1753 C CA  . LEU A 1 227 ? 22.533  5.835   15.179  1.00 43.01  ? 227  LEU A CA  1 
ATOM   1754 C C   . LEU A 1 227 ? 21.713  6.916   14.514  1.00 42.70  ? 227  LEU A C   1 
ATOM   1755 O O   . LEU A 1 227 ? 20.870  6.628   13.661  1.00 42.77  ? 227  LEU A O   1 
ATOM   1756 C CB  . LEU A 1 227 ? 23.213  5.000   14.096  1.00 43.85  ? 227  LEU A CB  1 
ATOM   1757 C CG  . LEU A 1 227 ? 24.274  3.977   14.540  1.00 44.16  ? 227  LEU A CG  1 
ATOM   1758 C CD1 . LEU A 1 227 ? 23.628  2.761   15.150  1.00 40.91  ? 227  LEU A CD1 1 
ATOM   1759 C CD2 . LEU A 1 227 ? 25.181  3.574   13.370  1.00 43.14  ? 227  LEU A CD2 1 
ATOM   1760 N N   . GLN A 1 228 ? 21.978  8.166   14.890  1.00 41.98  ? 228  GLN A N   1 
ATOM   1761 C CA  . GLN A 1 228 ? 21.212  9.312   14.408  1.00 41.30  ? 228  GLN A CA  1 
ATOM   1762 C C   . GLN A 1 228 ? 22.033  10.092  13.395  1.00 40.87  ? 228  GLN A C   1 
ATOM   1763 O O   . GLN A 1 228 ? 23.046  10.694  13.747  1.00 40.46  ? 228  GLN A O   1 
ATOM   1764 C CB  . GLN A 1 228 ? 20.868  10.241  15.572  1.00 41.35  ? 228  GLN A CB  1 
ATOM   1765 C CG  . GLN A 1 228 ? 20.049  9.600   16.674  1.00 42.19  ? 228  GLN A CG  1 
ATOM   1766 C CD  . GLN A 1 228 ? 19.861  10.481  17.885  1.00 42.84  ? 228  GLN A CD  1 
ATOM   1767 O OE1 . GLN A 1 228 ? 19.751  9.967   18.993  1.00 43.55  ? 228  GLN A OE1 1 
ATOM   1768 N NE2 . GLN A 1 228 ? 19.842  11.817  17.695  1.00 41.16  ? 228  GLN A NE2 1 
ATOM   1769 N N   . SER A 1 229 ? 21.610  10.088  12.135  1.00 40.95  ? 229  SER A N   1 
ATOM   1770 C CA  . SER A 1 229 ? 22.286  10.862  11.089  1.00 40.28  ? 229  SER A CA  1 
ATOM   1771 C C   . SER A 1 229 ? 23.779  10.581  11.007  1.00 39.83  ? 229  SER A C   1 
ATOM   1772 O O   . SER A 1 229 ? 24.574  11.499  10.824  1.00 39.90  ? 229  SER A O   1 
ATOM   1773 C CB  . SER A 1 229 ? 22.066  12.365  11.274  1.00 39.60  ? 229  SER A CB  1 
ATOM   1774 O OG  . SER A 1 229 ? 20.698  12.712  11.289  1.00 42.36  ? 229  SER A OG  1 
ATOM   1775 N N   . GLY A 1 230 ? 24.172  9.315   11.113  1.00 40.31  ? 230  GLY A N   1 
ATOM   1776 C CA  . GLY A 1 230 ? 25.580  8.956   10.929  1.00 40.01  ? 230  GLY A CA  1 
ATOM   1777 C C   . GLY A 1 230 ? 25.805  7.455   10.957  1.00 40.66  ? 230  GLY A C   1 
ATOM   1778 O O   . GLY A 1 230 ? 24.968  6.697   11.500  1.00 41.21  ? 230  GLY A O   1 
ATOM   1779 N N   . THR A 1 231 ? 26.933  7.025   10.387  1.00 40.77  ? 231  THR A N   1 
ATOM   1780 C CA  . THR A 1 231 ? 27.196  5.593   10.180  1.00 41.98  ? 231  THR A CA  1 
ATOM   1781 C C   . THR A 1 231 ? 28.702  5.307   10.120  1.00 42.37  ? 231  THR A C   1 
ATOM   1782 O O   . THR A 1 231 ? 29.484  6.191   9.780   1.00 41.75  ? 231  THR A O   1 
ATOM   1783 C CB  . THR A 1 231 ? 26.527  5.046   8.862   1.00 42.90  ? 231  THR A CB  1 
ATOM   1784 O OG1 . THR A 1 231 ? 27.095  5.688   7.722   1.00 43.51  ? 231  THR A OG1 1 
ATOM   1785 C CG2 . THR A 1 231 ? 25.003  5.264   8.830   1.00 43.48  ? 231  THR A CG2 1 
ATOM   1786 N N   . PRO A 1 232 ? 29.114  4.068   10.446  1.00 43.02  ? 232  PRO A N   1 
ATOM   1787 C CA  . PRO A 1 232 ? 30.545  3.744   10.379  1.00 43.70  ? 232  PRO A CA  1 
ATOM   1788 C C   . PRO A 1 232 ? 31.014  3.637   8.921   1.00 44.86  ? 232  PRO A C   1 
ATOM   1789 O O   . PRO A 1 232 ? 32.137  3.988   8.595   1.00 44.48  ? 232  PRO A O   1 
ATOM   1790 C CB  . PRO A 1 232 ? 30.631  2.392   11.103  1.00 44.07  ? 232  PRO A CB  1 
ATOM   1791 C CG  . PRO A 1 232 ? 29.264  1.782   10.973  1.00 44.49  ? 232  PRO A CG  1 
ATOM   1792 C CD  . PRO A 1 232 ? 28.297  2.934   10.926  1.00 43.68  ? 232  PRO A CD  1 
ATOM   1793 N N   . ASN A 1 233 ? 30.138  3.128   8.063   1.00 46.23  ? 233  ASN A N   1 
ATOM   1794 C CA  . ASN A 1 233 ? 30.371  3.106   6.623   1.00 47.39  ? 233  ASN A CA  1 
ATOM   1795 C C   . ASN A 1 233 ? 30.178  4.506   6.034   1.00 46.85  ? 233  ASN A C   1 
ATOM   1796 O O   . ASN A 1 233 ? 29.640  5.405   6.692   1.00 46.67  ? 233  ASN A O   1 
ATOM   1797 C CB  . ASN A 1 233 ? 29.430  2.108   5.941   1.00 48.09  ? 233  ASN A CB  1 
ATOM   1798 C CG  . ASN A 1 233 ? 27.987  2.336   6.309   1.00 49.04  ? 233  ASN A CG  1 
ATOM   1799 O OD1 . ASN A 1 233 ? 27.647  2.314   7.485   1.00 50.25  ? 233  ASN A OD1 1 
ATOM   1800 N ND2 . ASN A 1 233 ? 27.125  2.557   5.313   1.00 49.45  ? 233  ASN A ND2 1 
ATOM   1801 N N   . GLY A 1 234 ? 30.608  4.691   4.794   1.00 47.38  ? 234  GLY A N   1 
ATOM   1802 C CA  . GLY A 1 234 ? 30.459  5.971   4.132   1.00 46.94  ? 234  GLY A CA  1 
ATOM   1803 C C   . GLY A 1 234 ? 31.749  6.740   3.908   1.00 47.11  ? 234  GLY A C   1 
ATOM   1804 O O   . GLY A 1 234 ? 32.849  6.301   4.317   1.00 47.87  ? 234  GLY A O   1 
ATOM   1805 N N   . PRO A 1 235 ? 31.629  7.887   3.220   1.00 46.12  ? 235  PRO A N   1 
ATOM   1806 C CA  . PRO A 1 235 ? 32.785  8.578   2.683   1.00 45.91  ? 235  PRO A CA  1 
ATOM   1807 C C   . PRO A 1 235 ? 33.624  9.349   3.690   1.00 45.04  ? 235  PRO A C   1 
ATOM   1808 O O   . PRO A 1 235 ? 34.759  9.713   3.363   1.00 45.85  ? 235  PRO A O   1 
ATOM   1809 C CB  . PRO A 1 235 ? 32.172  9.531   1.657   1.00 46.29  ? 235  PRO A CB  1 
ATOM   1810 C CG  . PRO A 1 235 ? 30.786  9.814   2.177   1.00 45.38  ? 235  PRO A CG  1 
ATOM   1811 C CD  . PRO A 1 235 ? 30.355  8.548   2.865   1.00 46.00  ? 235  PRO A CD  1 
ATOM   1812 N N   . TRP A 1 236 ? 33.111  9.588   4.894   1.00 44.15  ? 236  TRP A N   1 
ATOM   1813 C CA  . TRP A 1 236 ? 33.771  10.536  5.827   1.00 43.28  ? 236  TRP A CA  1 
ATOM   1814 C C   . TRP A 1 236 ? 34.219  9.959   7.174   1.00 43.21  ? 236  TRP A C   1 
ATOM   1815 O O   . TRP A 1 236 ? 35.100  10.545  7.808   1.00 42.83  ? 236  TRP A O   1 
ATOM   1816 C CB  . TRP A 1 236 ? 32.873  11.762  6.076   1.00 42.67  ? 236  TRP A CB  1 
ATOM   1817 C CG  . TRP A 1 236 ? 31.518  11.449  6.644   1.00 42.05  ? 236  TRP A CG  1 
ATOM   1818 C CD1 . TRP A 1 236 ? 30.376  11.288  5.945   1.00 42.29  ? 236  TRP A CD1 1 
ATOM   1819 C CD2 . TRP A 1 236 ? 31.160  11.289  8.038   1.00 42.07  ? 236  TRP A CD2 1 
ATOM   1820 N NE1 . TRP A 1 236 ? 29.332  11.034  6.790   1.00 42.80  ? 236  TRP A NE1 1 
ATOM   1821 C CE2 . TRP A 1 236 ? 29.785  11.017  8.081   1.00 42.09  ? 236  TRP A CE2 1 
ATOM   1822 C CE3 . TRP A 1 236 ? 31.876  11.327  9.242   1.00 42.33  ? 236  TRP A CE3 1 
ATOM   1823 C CZ2 . TRP A 1 236 ? 29.098  10.776  9.280   1.00 41.47  ? 236  TRP A CZ2 1 
ATOM   1824 C CZ3 . TRP A 1 236 ? 31.190  11.097  10.435  1.00 41.06  ? 236  TRP A CZ3 1 
ATOM   1825 C CH2 . TRP A 1 236 ? 29.813  10.844  10.441  1.00 40.78  ? 236  TRP A CH2 1 
ATOM   1826 N N   . ALA A 1 237 ? 33.647  8.821   7.597   1.00 42.38  ? 237  ALA A N   1 
ATOM   1827 C CA  . ALA A 1 237 ? 33.829  8.328   8.973   1.00 41.67  ? 237  ALA A CA  1 
ATOM   1828 C C   . ALA A 1 237 ? 35.156  7.625   9.217   1.00 42.14  ? 237  ALA A C   1 
ATOM   1829 O O   . ALA A 1 237 ? 35.575  7.537   10.367  1.00 42.01  ? 237  ALA A O   1 
ATOM   1830 C CB  . ALA A 1 237 ? 32.649  7.400   9.415   1.00 40.77  ? 237  ALA A CB  1 
ATOM   1831 N N   . THR A 1 238 ? 35.769  7.065   8.173   1.00 42.72  ? 238  THR A N   1 
ATOM   1832 C CA  . THR A 1 238 ? 37.046  6.352   8.307   1.00 43.18  ? 238  THR A CA  1 
ATOM   1833 C C   . THR A 1 238 ? 38.009  6.765   7.209   1.00 44.27  ? 238  THR A C   1 
ATOM   1834 O O   . THR A 1 238 ? 37.594  7.306   6.181   1.00 44.49  ? 238  THR A O   1 
ATOM   1835 C CB  . THR A 1 238 ? 36.899  4.803   8.224   1.00 44.02  ? 238  THR A CB  1 
ATOM   1836 O OG1 . THR A 1 238 ? 36.267  4.440   6.995   1.00 42.86  ? 238  THR A OG1 1 
ATOM   1837 C CG2 . THR A 1 238 ? 36.092  4.251   9.377   1.00 44.97  ? 238  THR A CG2 1 
ATOM   1838 N N   . VAL A 1 239 ? 39.302  6.520   7.432   1.00 45.00  ? 239  VAL A N   1 
ATOM   1839 C CA  . VAL A 1 239 ? 40.298  6.641   6.379   1.00 46.03  ? 239  VAL A CA  1 
ATOM   1840 C C   . VAL A 1 239 ? 41.141  5.371   6.381   1.00 47.31  ? 239  VAL A C   1 
ATOM   1841 O O   . VAL A 1 239 ? 41.217  4.672   7.375   1.00 47.10  ? 239  VAL A O   1 
ATOM   1842 C CB  . VAL A 1 239 ? 41.240  7.894   6.525   1.00 46.43  ? 239  VAL A CB  1 
ATOM   1843 C CG1 . VAL A 1 239 ? 40.503  9.194   6.186   1.00 44.52  ? 239  VAL A CG1 1 
ATOM   1844 C CG2 . VAL A 1 239 ? 41.924  7.936   7.915   1.00 45.96  ? 239  VAL A CG2 1 
ATOM   1845 N N   . SER A 1 240 ? 41.753  5.071   5.251   1.00 48.56  ? 240  SER A N   1 
ATOM   1846 C CA  . SER A 1 240 ? 42.677  3.953   5.169   1.00 50.45  ? 240  SER A CA  1 
ATOM   1847 C C   . SER A 1 240 ? 43.906  4.234   6.014   1.00 50.91  ? 240  SER A C   1 
ATOM   1848 O O   . SER A 1 240 ? 44.203  5.384   6.347   1.00 51.03  ? 240  SER A O   1 
ATOM   1849 C CB  . SER A 1 240 ? 43.117  3.759   3.727   1.00 51.44  ? 240  SER A CB  1 
ATOM   1850 O OG  . SER A 1 240 ? 43.871  4.884   3.309   1.00 51.59  ? 240  SER A OG  1 
ATOM   1851 N N   . ALA A 1 241 ? 44.634  3.180   6.340   1.00 52.34  ? 241  ALA A N   1 
ATOM   1852 C CA  . ALA A 1 241 ? 45.898  3.312   7.031   1.00 53.18  ? 241  ALA A CA  1 
ATOM   1853 C C   . ALA A 1 241 ? 46.826  4.291   6.287   1.00 53.54  ? 241  ALA A C   1 
ATOM   1854 O O   . ALA A 1 241 ? 47.415  5.174   6.900   1.00 53.89  ? 241  ALA A O   1 
ATOM   1855 C CB  . ALA A 1 241 ? 46.559  1.922   7.195   1.00 54.75  ? 241  ALA A CB  1 
ATOM   1856 N N   . GLY A 1 242 ? 46.923  4.141   4.967   1.00 54.06  ? 242  GLY A N   1 
ATOM   1857 C CA  . GLY A 1 242 ? 47.835  4.936   4.150   1.00 54.27  ? 242  GLY A CA  1 
ATOM   1858 C C   . GLY A 1 242 ? 47.493  6.420   4.117   1.00 52.92  ? 242  GLY A C   1 
ATOM   1859 O O   . GLY A 1 242 ? 48.393  7.266   4.107   1.00 53.35  ? 242  GLY A O   1 
ATOM   1860 N N   . GLU A 1 243 ? 46.205  6.738   4.078   1.00 50.61  ? 243  GLU A N   1 
ATOM   1861 C CA  . GLU A 1 243 ? 45.764  8.127   4.072   1.00 49.72  ? 243  GLU A CA  1 
ATOM   1862 C C   . GLU A 1 243 ? 45.975  8.788   5.442   1.00 48.75  ? 243  GLU A C   1 
ATOM   1863 O O   . GLU A 1 243 ? 46.407  9.942   5.512   1.00 48.31  ? 243  GLU A O   1 
ATOM   1864 C CB  . GLU A 1 243 ? 44.296  8.225   3.632   1.00 48.83  ? 243  GLU A CB  1 
ATOM   1865 C CG  . GLU A 1 243 ? 43.702  9.636   3.625   1.00 49.04  ? 243  GLU A CG  1 
ATOM   1866 C CD  . GLU A 1 243 ? 44.387  10.602  2.655   1.00 51.53  ? 243  GLU A CD  1 
ATOM   1867 O OE1 . GLU A 1 243 ? 44.039  11.802  2.685   1.00 51.09  ? 243  GLU A OE1 1 
ATOM   1868 O OE2 . GLU A 1 243 ? 45.246  10.172  1.856   1.00 54.11  ? 243  GLU A OE2 1 
ATOM   1869 N N   . ALA A 1 244 ? 45.686  8.058   6.523   1.00 48.00  ? 244  ALA A N   1 
ATOM   1870 C CA  . ALA A 1 244 ? 45.954  8.556   7.879   1.00 47.12  ? 244  ALA A CA  1 
ATOM   1871 C C   . ALA A 1 244 ? 47.435  8.947   8.035   1.00 48.17  ? 244  ALA A C   1 
ATOM   1872 O O   . ALA A 1 244 ? 47.766  9.998   8.593   1.00 47.55  ? 244  ALA A O   1 
ATOM   1873 C CB  . ALA A 1 244 ? 45.561  7.524   8.929   1.00 45.98  ? 244  ALA A CB  1 
ATOM   1874 N N   . ARG A 1 245 ? 48.318  8.093   7.543   1.00 49.06  ? 245  ARG A N   1 
ATOM   1875 C CA  . ARG A 1 245 ? 49.758  8.342   7.630   1.00 50.61  ? 245  ARG A CA  1 
ATOM   1876 C C   . ARG A 1 245 ? 50.194  9.565   6.833   1.00 51.05  ? 245  ARG A C   1 
ATOM   1877 O O   . ARG A 1 245 ? 51.072  10.316  7.245   1.00 51.48  ? 245  ARG A O   1 
ATOM   1878 C CB  . ARG A 1 245 ? 50.534  7.144   7.097   1.00 51.56  ? 245  ARG A CB  1 
ATOM   1879 C CG  . ARG A 1 245 ? 52.048  7.382   7.035   1.00 54.14  ? 245  ARG A CG  1 
ATOM   1880 C CD  . ARG A 1 245 ? 52.793  6.096   6.767   1.00 55.52  ? 245  ARG A CD  1 
ATOM   1881 N NE  . ARG A 1 245 ? 52.689  5.207   7.918   1.00 56.70  ? 245  ARG A NE  1 
ATOM   1882 C CZ  . ARG A 1 245 ? 53.526  5.188   8.954   1.00 58.77  ? 245  ARG A CZ  1 
ATOM   1883 N NH1 . ARG A 1 245 ? 53.314  4.327   9.934   1.00 59.96  ? 245  ARG A NH1 1 
ATOM   1884 N NH2 . ARG A 1 245 ? 54.575  5.998   9.026   1.00 60.22  ? 245  ARG A NH2 1 
ATOM   1885 N N   . ARG A 1 246 ? 49.585  9.716   5.669   1.00 51.05  ? 246  ARG A N   1 
ATOM   1886 C CA  . ARG A 1 246 ? 49.856  10.816  4.763   1.00 51.74  ? 246  ARG A CA  1 
ATOM   1887 C C   . ARG A 1 246 ? 49.463  12.144  5.432   1.00 50.16  ? 246  ARG A C   1 
ATOM   1888 O O   . ARG A 1 246 ? 50.228  13.108  5.423   1.00 49.67  ? 246  ARG A O   1 
ATOM   1889 C CB  . ARG A 1 246 ? 49.025  10.570  3.509   1.00 52.23  ? 246  ARG A CB  1 
ATOM   1890 C CG  . ARG A 1 246 ? 49.435  11.304  2.255   1.00 55.39  ? 246  ARG A CG  1 
ATOM   1891 C CD  . ARG A 1 246 ? 48.179  11.848  1.562   1.00 57.13  ? 246  ARG A CD  1 
ATOM   1892 N NE  . ARG A 1 246 ? 48.246  13.290  1.655   1.00 58.84  ? 246  ARG A NE  1 
ATOM   1893 C CZ  . ARG A 1 246 ? 47.249  14.120  1.920   1.00 57.17  ? 246  ARG A CZ  1 
ATOM   1894 N NH1 . ARG A 1 246 ? 46.011  13.709  2.128   1.00 53.93  ? 246  ARG A NH1 1 
ATOM   1895 N NH2 . ARG A 1 246 ? 47.535  15.405  1.963   1.00 59.79  ? 246  ARG A NH2 1 
ATOM   1896 N N   . ARG A 1 247 ? 48.258  12.170  6.008   1.00 47.83  ? 247  ARG A N   1 
ATOM   1897 C CA  . ARG A 1 247 ? 47.756  13.329  6.755   1.00 46.84  ? 247  ARG A CA  1 
ATOM   1898 C C   . ARG A 1 247 ? 48.550  13.607  8.018   1.00 47.33  ? 247  ARG A C   1 
ATOM   1899 O O   . ARG A 1 247 ? 48.881  14.753  8.306   1.00 47.90  ? 247  ARG A O   1 
ATOM   1900 C CB  . ARG A 1 247 ? 46.291  13.114  7.146   1.00 45.39  ? 247  ARG A CB  1 
ATOM   1901 C CG  . ARG A 1 247 ? 45.379  13.154  5.967   1.00 44.90  ? 247  ARG A CG  1 
ATOM   1902 C CD  . ARG A 1 247 ? 43.937  12.953  6.371   1.00 45.95  ? 247  ARG A CD  1 
ATOM   1903 N NE  . ARG A 1 247 ? 43.131  12.723  5.189   1.00 44.82  ? 247  ARG A NE  1 
ATOM   1904 C CZ  . ARG A 1 247 ? 41.811  12.691  5.192   1.00 46.68  ? 247  ARG A CZ  1 
ATOM   1905 N NH1 . ARG A 1 247 ? 41.127  12.895  6.307   1.00 46.26  ? 247  ARG A NH1 1 
ATOM   1906 N NH2 . ARG A 1 247 ? 41.170  12.468  4.063   1.00 48.20  ? 247  ARG A NH2 1 
ATOM   1907 N N   . ALA A 1 248 ? 48.863  12.562  8.777   1.00 47.93  ? 248  ALA A N   1 
ATOM   1908 C CA  . ALA A 1 248 ? 49.679  12.725  9.971   1.00 48.36  ? 248  ALA A CA  1 
ATOM   1909 C C   . ALA A 1 248 ? 51.013  13.367  9.594   1.00 49.60  ? 248  ALA A C   1 
ATOM   1910 O O   . ALA A 1 248 ? 51.459  14.303  10.245  1.00 49.54  ? 248  ALA A O   1 
ATOM   1911 C CB  . ALA A 1 248 ? 49.891  11.399  10.673  1.00 48.39  ? 248  ALA A CB  1 
ATOM   1912 N N   . THR A 1 249 ? 51.612  12.888  8.509   1.00 51.32  ? 249  THR A N   1 
ATOM   1913 C CA  . THR A 1 249 ? 52.972  13.286  8.111   1.00 52.76  ? 249  THR A CA  1 
ATOM   1914 C C   . THR A 1 249 ? 53.039  14.718  7.573   1.00 53.06  ? 249  THR A C   1 
ATOM   1915 O O   . THR A 1 249 ? 54.003  15.427  7.817   1.00 55.21  ? 249  THR A O   1 
ATOM   1916 C CB  . THR A 1 249 ? 53.535  12.320  7.049   1.00 54.08  ? 249  THR A CB  1 
ATOM   1917 O OG1 . THR A 1 249 ? 53.498  10.982  7.564   1.00 56.33  ? 249  THR A OG1 1 
ATOM   1918 C CG2 . THR A 1 249 ? 54.999  12.677  6.690   1.00 53.34  ? 249  THR A CG2 1 
ATOM   1919 N N   . LEU A 1 250 ? 52.021  15.128  6.826   1.00 52.66  ? 250  LEU A N   1 
ATOM   1920 C CA  . LEU A 1 250 ? 51.921  16.491  6.310   1.00 52.54  ? 250  LEU A CA  1 
ATOM   1921 C C   . LEU A 1 250 ? 51.705  17.483  7.461   1.00 52.82  ? 250  LEU A C   1 
ATOM   1922 O O   . LEU A 1 250 ? 52.330  18.546  7.511   1.00 52.31  ? 250  LEU A O   1 
ATOM   1923 C CB  . LEU A 1 250 ? 50.771  16.583  5.293   1.00 51.45  ? 250  LEU A CB  1 
ATOM   1924 C CG  . LEU A 1 250 ? 50.488  17.944  4.640   1.00 50.89  ? 250  LEU A CG  1 
ATOM   1925 C CD1 . LEU A 1 250 ? 51.760  18.556  4.048   1.00 49.86  ? 250  LEU A CD1 1 
ATOM   1926 C CD2 . LEU A 1 250 ? 49.445  17.809  3.568   1.00 48.64  ? 250  LEU A CD2 1 
ATOM   1927 N N   . LEU A 1 251 ? 50.790  17.146  8.372   1.00 52.77  ? 251  LEU A N   1 
ATOM   1928 C CA  . LEU A 1 251 ? 50.575  17.985  9.549   1.00 52.97  ? 251  LEU A CA  1 
ATOM   1929 C C   . LEU A 1 251 ? 51.904  18.230  10.242  1.00 53.53  ? 251  LEU A C   1 
ATOM   1930 O O   . LEU A 1 251 ? 52.244  19.368  10.535  1.00 53.30  ? 251  LEU A O   1 
ATOM   1931 C CB  . LEU A 1 251 ? 49.634  17.334  10.540  1.00 51.94  ? 251  LEU A CB  1 
ATOM   1932 C CG  . LEU A 1 251 ? 49.369  18.193  11.790  1.00 54.04  ? 251  LEU A CG  1 
ATOM   1933 C CD1 . LEU A 1 251 ? 48.349  19.290  11.527  1.00 54.99  ? 251  LEU A CD1 1 
ATOM   1934 C CD2 . LEU A 1 251 ? 48.884  17.300  12.919  1.00 57.19  ? 251  LEU A CD2 1 
ATOM   1935 N N   . ALA A 1 252 ? 52.620  17.145  10.530  1.00 54.41  ? 252  ALA A N   1 
ATOM   1936 C CA  . ALA A 1 252 ? 53.947  17.228  11.140  1.00 56.08  ? 252  ALA A CA  1 
ATOM   1937 C C   . ALA A 1 252 ? 54.779  18.273  10.435  1.00 57.48  ? 252  ALA A C   1 
ATOM   1938 O O   . ALA A 1 252 ? 55.328  19.152  11.091  1.00 58.85  ? 252  ALA A O   1 
ATOM   1939 C CB  . ALA A 1 252 ? 54.651  15.880  11.117  1.00 56.79  ? 252  ALA A CB  1 
ATOM   1940 N N   . ARG A 1 253 ? 54.852  18.202  9.104   1.00 58.26  ? 253  ARG A N   1 
ATOM   1941 C CA  . ARG A 1 253 ? 55.635  19.181  8.325   1.00 60.57  ? 253  ARG A CA  1 
ATOM   1942 C C   . ARG A 1 253 ? 55.199  20.633  8.557   1.00 59.81  ? 253  ARG A C   1 
ATOM   1943 O O   . ARG A 1 253 ? 56.024  21.506  8.834   1.00 60.32  ? 253  ARG A O   1 
ATOM   1944 C CB  . ARG A 1 253 ? 55.585  18.862  6.829   1.00 61.30  ? 253  ARG A CB  1 
ATOM   1945 C CG  . ARG A 1 253 ? 56.565  17.789  6.421   1.00 65.20  ? 253  ARG A CG  1 
ATOM   1946 C CD  . ARG A 1 253 ? 56.623  17.632  4.909   1.00 70.47  ? 253  ARG A CD  1 
ATOM   1947 N NE  . ARG A 1 253 ? 57.103  16.294  4.532   1.00 74.10  ? 253  ARG A NE  1 
ATOM   1948 C CZ  . ARG A 1 253 ? 56.332  15.268  4.140   1.00 74.44  ? 253  ARG A CZ  1 
ATOM   1949 N NH1 . ARG A 1 253 ? 54.986  15.385  4.037   1.00 70.39  ? 253  ARG A NH1 1 
ATOM   1950 N NH2 . ARG A 1 253 ? 56.927  14.106  3.830   1.00 75.42  ? 253  ARG A NH2 1 
ATOM   1951 N N   . LEU A 1 254 ? 53.895  20.861  8.469   1.00 57.63  ? 254  LEU A N   1 
ATOM   1952 C CA  . LEU A 1 254 ? 53.303  22.191  8.611   1.00 57.40  ? 254  LEU A CA  1 
ATOM   1953 C C   . LEU A 1 254 ? 53.534  22.857  9.971   1.00 58.08  ? 254  LEU A C   1 
ATOM   1954 O O   . LEU A 1 254 ? 53.436  24.084  10.066  1.00 58.43  ? 254  LEU A O   1 
ATOM   1955 C CB  . LEU A 1 254 ? 51.788  22.115  8.345   1.00 54.99  ? 254  LEU A CB  1 
ATOM   1956 C CG  . LEU A 1 254 ? 51.403  21.835  6.888   1.00 54.47  ? 254  LEU A CG  1 
ATOM   1957 C CD1 . LEU A 1 254 ? 49.888  21.575  6.729   1.00 50.08  ? 254  LEU A CD1 1 
ATOM   1958 C CD2 . LEU A 1 254 ? 51.868  23.001  5.990   1.00 53.39  ? 254  LEU A CD2 1 
ATOM   1959 N N   . VAL A 1 255 ? 53.800  22.059  11.012  1.00 58.44  ? 255  VAL A N   1 
ATOM   1960 C CA  . VAL A 1 255 ? 54.150  22.593  12.336  1.00 59.37  ? 255  VAL A CA  1 
ATOM   1961 C C   . VAL A 1 255 ? 55.644  22.451  12.662  1.00 62.44  ? 255  VAL A C   1 
ATOM   1962 O O   . VAL A 1 255 ? 56.055  22.670  13.795  1.00 63.51  ? 255  VAL A O   1 
ATOM   1963 C CB  . VAL A 1 255 ? 53.313  21.959  13.467  1.00 57.71  ? 255  VAL A CB  1 
ATOM   1964 C CG1 . VAL A 1 255 ? 51.792  22.288  13.281  1.00 54.92  ? 255  VAL A CG1 1 
ATOM   1965 C CG2 . VAL A 1 255 ? 53.549  20.470  13.548  1.00 56.69  ? 255  VAL A CG2 1 
ATOM   1966 N N   . GLY A 1 256 ? 56.451  22.077  11.680  1.00 64.62  ? 256  GLY A N   1 
ATOM   1967 C CA  . GLY A 1 256 ? 57.902  22.083  11.850  1.00 67.63  ? 256  GLY A CA  1 
ATOM   1968 C C   . GLY A 1 256 ? 58.484  20.828  12.461  1.00 69.14  ? 256  GLY A C   1 
ATOM   1969 O O   . GLY A 1 256 ? 59.521  20.881  13.111  1.00 71.41  ? 256  GLY A O   1 
ATOM   1970 N N   . CYS A 1 257 ? 57.824  19.697  12.236  1.00 69.27  ? 257  CYS A N   1 
ATOM   1971 C CA  . CYS A 1 257 ? 58.301  18.394  12.678  1.00 70.52  ? 257  CYS A CA  1 
ATOM   1972 C C   . CYS A 1 257 ? 58.516  17.514  11.458  1.00 72.20  ? 257  CYS A C   1 
ATOM   1973 O O   . CYS A 1 257 ? 57.624  16.783  11.049  1.00 71.66  ? 257  CYS A O   1 
ATOM   1974 C CB  . CYS A 1 257 ? 57.286  17.743  13.621  1.00 68.29  ? 257  CYS A CB  1 
ATOM   1975 S SG  . CYS A 1 257 ? 57.247  18.470  15.263  1.00 67.37  ? 257  CYS A SG  1 
ATOM   1976 N N   . PRO A 1 258 ? 59.693  17.594  10.849  1.00 75.66  ? 258  PRO A N   1 
ATOM   1977 C CA  . PRO A 1 258 ? 59.928  16.739  9.682   1.00 77.10  ? 258  PRO A CA  1 
ATOM   1978 C C   . PRO A 1 258 ? 59.711  15.238  9.977   1.00 77.03  ? 258  PRO A C   1 
ATOM   1979 O O   . PRO A 1 258 ? 60.633  14.553  10.440  1.00 78.86  ? 258  PRO A O   1 
ATOM   1980 C CB  . PRO A 1 258 ? 61.406  17.027  9.334   1.00 79.59  ? 258  PRO A CB  1 
ATOM   1981 C CG  . PRO A 1 258 ? 61.991  17.596  10.626  1.00 80.08  ? 258  PRO A CG  1 
ATOM   1982 C CD  . PRO A 1 258 ? 60.873  18.421  11.165  1.00 78.04  ? 258  PRO A CD  1 
ATOM   1983 N N   . ASN A 1 265 ? 61.568  7.654   10.566  1.00 81.53  ? 265  ASN A N   1 
ATOM   1984 C CA  . ASN A 1 265 ? 61.459  7.153   11.942  1.00 81.10  ? 265  ASN A CA  1 
ATOM   1985 C C   . ASN A 1 265 ? 60.209  7.735   12.579  1.00 78.06  ? 265  ASN A C   1 
ATOM   1986 O O   . ASN A 1 265 ? 60.060  8.960   12.651  1.00 77.91  ? 265  ASN A O   1 
ATOM   1987 C CB  . ASN A 1 265 ? 62.714  7.540   12.748  1.00 83.08  ? 265  ASN A CB  1 
ATOM   1988 C CG  . ASN A 1 265 ? 62.843  6.778   14.069  1.00 83.75  ? 265  ASN A CG  1 
ATOM   1989 O OD1 . ASN A 1 265 ? 61.929  6.773   14.891  1.00 81.86  ? 265  ASN A OD1 1 
ATOM   1990 N ND2 . ASN A 1 265 ? 64.007  6.151   14.283  1.00 87.64  ? 265  ASN A ND2 1 
ATOM   1991 N N   . ASP A 1 266 ? 59.299  6.865   13.011  1.00 76.03  ? 266  ASP A N   1 
ATOM   1992 C CA  . ASP A 1 266 ? 58.026  7.314   13.582  1.00 72.88  ? 266  ASP A CA  1 
ATOM   1993 C C   . ASP A 1 266 ? 58.199  7.885   14.982  1.00 71.79  ? 266  ASP A C   1 
ATOM   1994 O O   . ASP A 1 266 ? 57.551  8.869   15.324  1.00 70.32  ? 266  ASP A O   1 
ATOM   1995 C CB  . ASP A 1 266 ? 57.004  6.171   13.626  1.00 72.13  ? 266  ASP A CB  1 
ATOM   1996 C CG  . ASP A 1 266 ? 56.272  5.974   12.302  1.00 71.58  ? 266  ASP A CG  1 
ATOM   1997 O OD1 . ASP A 1 266 ? 56.453  6.794   11.371  1.00 73.05  ? 266  ASP A OD1 1 
ATOM   1998 O OD2 . ASP A 1 266 ? 55.511  4.991   12.190  1.00 68.99  ? 266  ASP A OD2 1 
ATOM   1999 N N   . THR A 1 267 ? 59.066  7.260   15.783  1.00 71.90  ? 267  THR A N   1 
ATOM   2000 C CA  . THR A 1 267 ? 59.292  7.672   17.174  1.00 70.89  ? 267  THR A CA  1 
ATOM   2001 C C   . THR A 1 267 ? 59.716  9.130   17.245  1.00 70.40  ? 267  THR A C   1 
ATOM   2002 O O   . THR A 1 267 ? 59.215  9.874   18.081  1.00 69.72  ? 267  THR A O   1 
ATOM   2003 C CB  . THR A 1 267 ? 60.355  6.780   17.874  1.00 72.96  ? 267  THR A CB  1 
ATOM   2004 O OG1 . THR A 1 267 ? 60.006  5.403   17.712  1.00 71.96  ? 267  THR A OG1 1 
ATOM   2005 C CG2 . THR A 1 267 ? 60.454  7.094   19.365  1.00 72.59  ? 267  THR A CG2 1 
ATOM   2006 N N   . GLU A 1 268 ? 60.624  9.528   16.354  1.00 71.18  ? 268  GLU A N   1 
ATOM   2007 C CA  . GLU A 1 268 ? 61.096  10.913  16.245  1.00 71.04  ? 268  GLU A CA  1 
ATOM   2008 C C   . GLU A 1 268 ? 59.990  11.881  15.843  1.00 68.36  ? 268  GLU A C   1 
ATOM   2009 O O   . GLU A 1 268 ? 59.829  12.926  16.472  1.00 67.82  ? 268  GLU A O   1 
ATOM   2010 C CB  . GLU A 1 268 ? 62.210  11.029  15.206  1.00 73.42  ? 268  GLU A CB  1 
ATOM   2011 C CG  . GLU A 1 268 ? 63.574  10.468  15.646  1.00 77.42  ? 268  GLU A CG  1 
ATOM   2012 C CD  . GLU A 1 268 ? 64.738  11.047  14.832  1.00 82.72  ? 268  GLU A CD  1 
ATOM   2013 O OE1 . GLU A 1 268 ? 64.486  11.913  13.949  1.00 84.44  ? 268  GLU A OE1 1 
ATOM   2014 O OE2 . GLU A 1 268 ? 65.910  10.644  15.075  1.00 85.57  ? 268  GLU A OE2 1 
ATOM   2015 N N   . LEU A 1 269 ? 59.263  11.551  14.776  1.00 66.04  ? 269  LEU A N   1 
ATOM   2016 C CA  . LEU A 1 269 ? 58.205  12.425  14.285  1.00 63.99  ? 269  LEU A CA  1 
ATOM   2017 C C   . LEU A 1 269 ? 57.217  12.656  15.418  1.00 61.58  ? 269  LEU A C   1 
ATOM   2018 O O   . LEU A 1 269 ? 56.891  13.794  15.709  1.00 60.99  ? 269  LEU A O   1 
ATOM   2019 C CB  . LEU A 1 269 ? 57.495  11.846  13.045  1.00 63.16  ? 269  LEU A CB  1 
ATOM   2020 C CG  . LEU A 1 269 ? 56.321  12.651  12.455  1.00 61.75  ? 269  LEU A CG  1 
ATOM   2021 C CD1 . LEU A 1 269 ? 56.188  12.417  10.959  1.00 62.00  ? 269  LEU A CD1 1 
ATOM   2022 C CD2 . LEU A 1 269 ? 54.972  12.354  13.131  1.00 61.90  ? 269  LEU A CD2 1 
ATOM   2023 N N   . ILE A 1 270 ? 56.795  11.575  16.077  1.00 60.30  ? 270  ILE A N   1 
ATOM   2024 C CA  . ILE A 1 270 ? 55.779  11.649  17.122  1.00 58.53  ? 270  ILE A CA  1 
ATOM   2025 C C   . ILE A 1 270 ? 56.323  12.375  18.348  1.00 58.76  ? 270  ILE A C   1 
ATOM   2026 O O   . ILE A 1 270 ? 55.630  13.199  18.927  1.00 57.60  ? 270  ILE A O   1 
ATOM   2027 C CB  . ILE A 1 270 ? 55.223  10.248  17.498  1.00 58.32  ? 270  ILE A CB  1 
ATOM   2028 C CG1 . ILE A 1 270 ? 54.657  9.533   16.262  1.00 58.04  ? 270  ILE A CG1 1 
ATOM   2029 C CG2 . ILE A 1 270 ? 54.106  10.362  18.535  1.00 56.77  ? 270  ILE A CG2 1 
ATOM   2030 C CD1 . ILE A 1 270 ? 54.657  8.001   16.376  1.00 59.07  ? 270  ILE A CD1 1 
ATOM   2031 N N   . ALA A 1 271 ? 57.572  12.102  18.719  1.00 60.39  ? 271  ALA A N   1 
ATOM   2032 C CA  . ALA A 1 271 ? 58.217  12.820  19.824  1.00 61.44  ? 271  ALA A CA  1 
ATOM   2033 C C   . ALA A 1 271 ? 58.212  14.329  19.559  1.00 61.65  ? 271  ALA A C   1 
ATOM   2034 O O   . ALA A 1 271 ? 57.958  15.122  20.467  1.00 61.82  ? 271  ALA A O   1 
ATOM   2035 C CB  . ALA A 1 271 ? 59.666  12.305  20.067  1.00 63.21  ? 271  ALA A CB  1 
ATOM   2036 N N   . CYS A 1 272 ? 58.462  14.724  18.314  1.00 62.53  ? 272  CYS A N   1 
ATOM   2037 C CA  . CYS A 1 272 ? 58.422  16.134  17.947  1.00 62.45  ? 272  CYS A CA  1 
ATOM   2038 C C   . CYS A 1 272 ? 56.989  16.708  17.971  1.00 59.95  ? 272  CYS A C   1 
ATOM   2039 O O   . CYS A 1 272 ? 56.789  17.820  18.443  1.00 59.96  ? 272  CYS A O   1 
ATOM   2040 C CB  . CYS A 1 272 ? 59.071  16.352  16.584  1.00 64.05  ? 272  CYS A CB  1 
ATOM   2041 S SG  . CYS A 1 272 ? 59.156  18.098  16.072  1.00 65.99  ? 272  CYS A SG  1 
ATOM   2042 N N   . LEU A 1 273 ? 55.991  15.964  17.507  1.00 57.62  ? 273  LEU A N   1 
ATOM   2043 C CA  . LEU A 1 273 ? 54.612  16.467  17.589  1.00 55.85  ? 273  LEU A CA  1 
ATOM   2044 C C   . LEU A 1 273 ? 54.168  16.694  19.054  1.00 55.13  ? 273  LEU A C   1 
ATOM   2045 O O   . LEU A 1 273 ? 53.412  17.624  19.351  1.00 54.84  ? 273  LEU A O   1 
ATOM   2046 C CB  . LEU A 1 273 ? 53.620  15.523  16.892  1.00 54.51  ? 273  LEU A CB  1 
ATOM   2047 C CG  . LEU A 1 273 ? 53.503  15.497  15.360  1.00 54.59  ? 273  LEU A CG  1 
ATOM   2048 C CD1 . LEU A 1 273 ? 52.587  14.348  14.953  1.00 53.15  ? 273  LEU A CD1 1 
ATOM   2049 C CD2 . LEU A 1 273 ? 52.994  16.834  14.769  1.00 51.92  ? 273  LEU A CD2 1 
ATOM   2050 N N   . ARG A 1 274 ? 54.641  15.850  19.964  1.00 55.00  ? 274  ARG A N   1 
ATOM   2051 C CA  . ARG A 1 274 ? 54.287  15.974  21.366  1.00 54.05  ? 274  ARG A CA  1 
ATOM   2052 C C   . ARG A 1 274 ? 54.847  17.228  22.019  1.00 54.96  ? 274  ARG A C   1 
ATOM   2053 O O   . ARG A 1 274 ? 54.370  17.623  23.074  1.00 54.18  ? 274  ARG A O   1 
ATOM   2054 C CB  . ARG A 1 274 ? 54.706  14.727  22.146  1.00 54.35  ? 274  ARG A CB  1 
ATOM   2055 C CG  . ARG A 1 274 ? 53.768  13.536  21.899  1.00 53.24  ? 274  ARG A CG  1 
ATOM   2056 C CD  . ARG A 1 274 ? 54.006  12.410  22.895  1.00 54.51  ? 274  ARG A CD  1 
ATOM   2057 N NE  . ARG A 1 274 ? 55.436  12.157  23.080  1.00 55.98  ? 274  ARG A NE  1 
ATOM   2058 C CZ  . ARG A 1 274 ? 56.122  11.103  22.631  1.00 57.28  ? 274  ARG A CZ  1 
ATOM   2059 N NH1 . ARG A 1 274 ? 55.531  10.124  21.960  1.00 55.68  ? 274  ARG A NH1 1 
ATOM   2060 N NH2 . ARG A 1 274 ? 57.438  11.029  22.861  1.00 56.76  ? 274  ARG A NH2 1 
ATOM   2061 N N   . THR A 1 275 ? 55.837  17.868  21.397  1.00 56.28  ? 275  THR A N   1 
ATOM   2062 C CA  . THR A 1 275 ? 56.402  19.103  21.933  1.00 57.54  ? 275  THR A CA  1 
ATOM   2063 C C   . THR A 1 275 ? 55.655  20.362  21.476  1.00 57.70  ? 275  THR A C   1 
ATOM   2064 O O   . THR A 1 275 ? 55.939  21.444  21.968  1.00 59.09  ? 275  THR A O   1 
ATOM   2065 C CB  . THR A 1 275 ? 57.898  19.259  21.557  1.00 59.33  ? 275  THR A CB  1 
ATOM   2066 O OG1 . THR A 1 275 ? 58.021  19.467  20.143  1.00 58.68  ? 275  THR A OG1 1 
ATOM   2067 C CG2 . THR A 1 275 ? 58.701  18.031  21.973  1.00 58.43  ? 275  THR A CG2 1 
ATOM   2068 N N   . ARG A 1 276 ? 54.705  20.224  20.555  1.00 57.28  ? 276  ARG A N   1 
ATOM   2069 C CA  . ARG A 1 276 ? 54.042  21.366  19.945  1.00 57.37  ? 276  ARG A CA  1 
ATOM   2070 C C   . ARG A 1 276 ? 52.844  21.834  20.772  1.00 56.36  ? 276  ARG A C   1 
ATOM   2071 O O   . ARG A 1 276 ? 52.120  21.004  21.325  1.00 55.48  ? 276  ARG A O   1 
ATOM   2072 C CB  . ARG A 1 276 ? 53.588  20.997  18.525  1.00 57.24  ? 276  ARG A CB  1 
ATOM   2073 C CG  . ARG A 1 276 ? 54.756  20.684  17.575  1.00 61.51  ? 276  ARG A CG  1 
ATOM   2074 C CD  . ARG A 1 276 ? 55.424  21.963  17.104  1.00 66.62  ? 276  ARG A CD  1 
ATOM   2075 N NE  . ARG A 1 276 ? 56.794  21.763  16.645  1.00 71.88  ? 276  ARG A NE  1 
ATOM   2076 C CZ  . ARG A 1 276 ? 57.886  21.829  17.408  1.00 75.42  ? 276  ARG A CZ  1 
ATOM   2077 N NH1 . ARG A 1 276 ? 57.806  22.081  18.716  1.00 77.13  ? 276  ARG A NH1 1 
ATOM   2078 N NH2 . ARG A 1 276 ? 59.078  21.637  16.852  1.00 77.51  ? 276  ARG A NH2 1 
ATOM   2079 N N   . PRO A 1 277 ? 52.630  23.164  20.864  1.00 56.17  ? 277  PRO A N   1 
ATOM   2080 C CA  . PRO A 1 277 ? 51.432  23.670  21.520  1.00 55.00  ? 277  PRO A CA  1 
ATOM   2081 C C   . PRO A 1 277 ? 50.165  23.099  20.909  1.00 53.21  ? 277  PRO A C   1 
ATOM   2082 O O   . PRO A 1 277 ? 50.062  22.987  19.695  1.00 53.56  ? 277  PRO A O   1 
ATOM   2083 C CB  . PRO A 1 277 ? 51.508  25.176  21.271  1.00 55.59  ? 277  PRO A CB  1 
ATOM   2084 C CG  . PRO A 1 277 ? 52.981  25.457  21.101  1.00 57.53  ? 277  PRO A CG  1 
ATOM   2085 C CD  . PRO A 1 277 ? 53.505  24.256  20.396  1.00 57.70  ? 277  PRO A CD  1 
ATOM   2086 N N   . ALA A 1 278 ? 49.202  22.738  21.741  1.00 52.12  ? 278  ALA A N   1 
ATOM   2087 C CA  . ALA A 1 278 ? 47.941  22.177  21.244  1.00 50.38  ? 278  ALA A CA  1 
ATOM   2088 C C   . ALA A 1 278 ? 47.309  23.077  20.175  1.00 49.99  ? 278  ALA A C   1 
ATOM   2089 O O   . ALA A 1 278 ? 46.808  22.587  19.175  1.00 48.65  ? 278  ALA A O   1 
ATOM   2090 C CB  . ALA A 1 278 ? 46.978  21.919  22.384  1.00 49.30  ? 278  ALA A CB  1 
ATOM   2091 N N   . GLN A 1 279 ? 47.390  24.390  20.354  1.00 51.51  ? 279  GLN A N   1 
ATOM   2092 C CA  . GLN A 1 279 ? 46.768  25.326  19.406  1.00 51.86  ? 279  GLN A CA  1 
ATOM   2093 C C   . GLN A 1 279 ? 47.469  25.330  18.050  1.00 52.43  ? 279  GLN A C   1 
ATOM   2094 O O   . GLN A 1 279 ? 46.824  25.520  17.031  1.00 51.64  ? 279  GLN A O   1 
ATOM   2095 C CB  . GLN A 1 279 ? 46.719  26.752  19.971  1.00 52.94  ? 279  GLN A CB  1 
ATOM   2096 C CG  . GLN A 1 279 ? 45.825  27.722  19.183  1.00 52.44  ? 279  GLN A CG  1 
ATOM   2097 C CD  . GLN A 1 279 ? 44.365  27.379  19.302  1.00 52.20  ? 279  GLN A CD  1 
ATOM   2098 O OE1 . GLN A 1 279 ? 43.841  27.236  20.409  1.00 53.21  ? 279  GLN A OE1 1 
ATOM   2099 N NE2 . GLN A 1 279 ? 43.696  27.243  18.172  1.00 51.59  ? 279  GLN A NE2 1 
ATOM   2100 N N   . ASP A 1 280 ? 48.784  25.133  18.038  1.00 54.06  ? 280  ASP A N   1 
ATOM   2101 C CA  . ASP A 1 280 ? 49.518  24.993  16.778  1.00 54.72  ? 280  ASP A CA  1 
ATOM   2102 C C   . ASP A 1 280 ? 48.995  23.807  15.937  1.00 53.52  ? 280  ASP A C   1 
ATOM   2103 O O   . ASP A 1 280 ? 48.919  23.905  14.706  1.00 53.12  ? 280  ASP A O   1 
ATOM   2104 C CB  . ASP A 1 280 ? 51.012  24.836  17.038  1.00 56.70  ? 280  ASP A CB  1 
ATOM   2105 C CG  . ASP A 1 280 ? 51.698  26.157  17.415  1.00 60.76  ? 280  ASP A CG  1 
ATOM   2106 O OD1 . ASP A 1 280 ? 51.023  27.229  17.432  1.00 63.24  ? 280  ASP A OD1 1 
ATOM   2107 O OD2 . ASP A 1 280 ? 52.926  26.114  17.690  1.00 64.75  ? 280  ASP A OD2 1 
ATOM   2108 N N   . LEU A 1 281 ? 48.640  22.701  16.594  1.00 52.14  ? 281  LEU A N   1 
ATOM   2109 C CA  . LEU A 1 281 ? 48.054  21.557  15.890  1.00 51.39  ? 281  LEU A CA  1 
ATOM   2110 C C   . LEU A 1 281 ? 46.674  21.913  15.347  1.00 50.46  ? 281  LEU A C   1 
ATOM   2111 O O   . LEU A 1 281 ? 46.386  21.666  14.173  1.00 51.06  ? 281  LEU A O   1 
ATOM   2112 C CB  . LEU A 1 281 ? 47.991  20.306  16.779  1.00 50.74  ? 281  LEU A CB  1 
ATOM   2113 C CG  . LEU A 1 281 ? 49.323  19.788  17.366  1.00 51.96  ? 281  LEU A CG  1 
ATOM   2114 C CD1 . LEU A 1 281 ? 49.154  18.441  18.039  1.00 51.31  ? 281  LEU A CD1 1 
ATOM   2115 C CD2 . LEU A 1 281 ? 50.412  19.682  16.316  1.00 52.56  ? 281  LEU A CD2 1 
ATOM   2116 N N   . VAL A 1 282 ? 45.835  22.534  16.173  1.00 50.28  ? 282  VAL A N   1 
ATOM   2117 C CA  . VAL A 1 282 ? 44.489  22.922  15.736  1.00 48.90  ? 282  VAL A CA  1 
ATOM   2118 C C   . VAL A 1 282 ? 44.558  23.917  14.564  1.00 50.08  ? 282  VAL A C   1 
ATOM   2119 O O   . VAL A 1 282 ? 43.789  23.820  13.606  1.00 49.34  ? 282  VAL A O   1 
ATOM   2120 C CB  . VAL A 1 282 ? 43.633  23.520  16.897  1.00 48.56  ? 282  VAL A CB  1 
ATOM   2121 C CG1 . VAL A 1 282 ? 42.332  24.083  16.362  1.00 46.33  ? 282  VAL A CG1 1 
ATOM   2122 C CG2 . VAL A 1 282 ? 43.369  22.488  17.984  1.00 46.52  ? 282  VAL A CG2 1 
ATOM   2123 N N   . ASP A 1 283 ? 45.494  24.861  14.640  1.00 52.04  ? 283  ASP A N   1 
ATOM   2124 C CA  . ASP A 1 283 ? 45.653  25.901  13.613  1.00 53.15  ? 283  ASP A CA  1 
ATOM   2125 C C   . ASP A 1 283 ? 45.970  25.347  12.213  1.00 53.43  ? 283  ASP A C   1 
ATOM   2126 O O   . ASP A 1 283 ? 45.623  25.983  11.216  1.00 53.48  ? 283  ASP A O   1 
ATOM   2127 C CB  . ASP A 1 283 ? 46.737  26.922  14.019  1.00 54.49  ? 283  ASP A CB  1 
ATOM   2128 C CG  . ASP A 1 283 ? 46.268  27.900  15.110  1.00 55.48  ? 283  ASP A CG  1 
ATOM   2129 O OD1 . ASP A 1 283 ? 45.076  27.867  15.500  1.00 54.85  ? 283  ASP A OD1 1 
ATOM   2130 O OD2 . ASP A 1 283 ? 47.109  28.708  15.577  1.00 57.71  ? 283  ASP A OD2 1 
ATOM   2131 N N   . HIS A 1 284 ? 46.601  24.177  12.128  1.00 53.39  ? 284  HIS A N   1 
ATOM   2132 C CA  . HIS A 1 284 ? 46.932  23.596  10.822  1.00 53.77  ? 284  HIS A CA  1 
ATOM   2133 C C   . HIS A 1 284 ? 46.110  22.385  10.415  1.00 52.89  ? 284  HIS A C   1 
ATOM   2134 O O   . HIS A 1 284 ? 46.304  21.839  9.333   1.00 52.47  ? 284  HIS A O   1 
ATOM   2135 C CB  . HIS A 1 284 ? 48.407  23.245  10.790  1.00 55.50  ? 284  HIS A CB  1 
ATOM   2136 C CG  . HIS A 1 284 ? 49.286  24.431  10.968  1.00 57.12  ? 284  HIS A CG  1 
ATOM   2137 N ND1 . HIS A 1 284 ? 49.609  24.929  12.210  1.00 57.98  ? 284  HIS A ND1 1 
ATOM   2138 C CD2 . HIS A 1 284 ? 49.878  25.244  10.065  1.00 59.69  ? 284  HIS A CD2 1 
ATOM   2139 C CE1 . HIS A 1 284 ? 50.384  25.988  12.063  1.00 60.97  ? 284  HIS A CE1 1 
ATOM   2140 N NE2 . HIS A 1 284 ? 50.563  26.200  10.771  1.00 60.62  ? 284  HIS A NE2 1 
ATOM   2141 N N   . GLU A 1 285 ? 45.175  21.990  11.264  1.00 52.46  ? 285  GLU A N   1 
ATOM   2142 C CA  . GLU A 1 285 ? 44.482  20.725  11.112  1.00 52.64  ? 285  GLU A CA  1 
ATOM   2143 C C   . GLU A 1 285 ? 43.722  20.598  9.776   1.00 52.40  ? 285  GLU A C   1 
ATOM   2144 O O   . GLU A 1 285 ? 43.696  19.524  9.166   1.00 51.49  ? 285  GLU A O   1 
ATOM   2145 C CB  . GLU A 1 285 ? 43.581  20.500  12.340  1.00 52.40  ? 285  GLU A CB  1 
ATOM   2146 C CG  . GLU A 1 285 ? 42.273  19.831  12.080  1.00 54.65  ? 285  GLU A CG  1 
ATOM   2147 C CD  . GLU A 1 285 ? 41.471  19.540  13.346  1.00 57.47  ? 285  GLU A CD  1 
ATOM   2148 O OE1 . GLU A 1 285 ? 41.649  20.230  14.371  1.00 57.80  ? 285  GLU A OE1 1 
ATOM   2149 O OE2 . GLU A 1 285 ? 40.648  18.597  13.293  1.00 59.89  ? 285  GLU A OE2 1 
ATOM   2150 N N   . TRP A 1 286 ? 43.125  21.688  9.314   1.00 52.67  ? 286  TRP A N   1 
ATOM   2151 C CA  . TRP A 1 286 ? 42.324  21.657  8.093   1.00 53.30  ? 286  TRP A CA  1 
ATOM   2152 C C   . TRP A 1 286 ? 43.159  21.632  6.817   1.00 54.03  ? 286  TRP A C   1 
ATOM   2153 O O   . TRP A 1 286 ? 42.673  21.223  5.774   1.00 53.89  ? 286  TRP A O   1 
ATOM   2154 C CB  . TRP A 1 286 ? 41.354  22.839  8.057   1.00 54.05  ? 286  TRP A CB  1 
ATOM   2155 C CG  . TRP A 1 286 ? 40.342  22.759  9.138   1.00 54.46  ? 286  TRP A CG  1 
ATOM   2156 C CD1 . TRP A 1 286 ? 40.376  23.408  10.340  1.00 55.64  ? 286  TRP A CD1 1 
ATOM   2157 C CD2 . TRP A 1 286 ? 39.166  21.942  9.156   1.00 54.76  ? 286  TRP A CD2 1 
ATOM   2158 N NE1 . TRP A 1 286 ? 39.285  23.058  11.097  1.00 55.20  ? 286  TRP A NE1 1 
ATOM   2159 C CE2 . TRP A 1 286 ? 38.517  22.171  10.389  1.00 55.49  ? 286  TRP A CE2 1 
ATOM   2160 C CE3 . TRP A 1 286 ? 38.592  21.041  8.245   1.00 54.94  ? 286  TRP A CE3 1 
ATOM   2161 C CZ2 . TRP A 1 286 ? 37.310  21.546  10.734  1.00 53.18  ? 286  TRP A CZ2 1 
ATOM   2162 C CZ3 . TRP A 1 286 ? 37.394  20.419  8.585   1.00 53.75  ? 286  TRP A CZ3 1 
ATOM   2163 C CH2 . TRP A 1 286 ? 36.766  20.678  9.823   1.00 53.30  ? 286  TRP A CH2 1 
ATOM   2164 N N   . HIS A 1 287 ? 44.422  22.039  6.910   1.00 54.44  ? 287  HIS A N   1 
ATOM   2165 C CA  . HIS A 1 287 ? 45.302  22.111  5.753   1.00 55.50  ? 287  HIS A CA  1 
ATOM   2166 C C   . HIS A 1 287 ? 45.714  20.773  5.125   1.00 54.44  ? 287  HIS A C   1 
ATOM   2167 O O   . HIS A 1 287 ? 46.378  20.773  4.096   1.00 55.39  ? 287  HIS A O   1 
ATOM   2168 C CB  . HIS A 1 287 ? 46.602  22.834  6.140   1.00 57.64  ? 287  HIS A CB  1 
ATOM   2169 C CG  . HIS A 1 287 ? 46.398  24.230  6.622   1.00 60.26  ? 287  HIS A CG  1 
ATOM   2170 N ND1 . HIS A 1 287 ? 45.234  24.932  6.393   1.00 63.56  ? 287  HIS A ND1 1 
ATOM   2171 C CD2 . HIS A 1 287 ? 47.221  25.069  7.295   1.00 64.42  ? 287  HIS A CD2 1 
ATOM   2172 C CE1 . HIS A 1 287 ? 45.347  26.144  6.909   1.00 65.67  ? 287  HIS A CE1 1 
ATOM   2173 N NE2 . HIS A 1 287 ? 46.545  26.253  7.462   1.00 66.41  ? 287  HIS A NE2 1 
ATOM   2174 N N   . VAL A 1 288 ? 45.364  19.649  5.739   1.00 52.47  ? 288  VAL A N   1 
ATOM   2175 C CA  . VAL A 1 288 ? 45.863  18.344  5.290   1.00 51.64  ? 288  VAL A CA  1 
ATOM   2176 C C   . VAL A 1 288 ? 44.865  17.552  4.440   1.00 50.92  ? 288  VAL A C   1 
ATOM   2177 O O   . VAL A 1 288 ? 45.191  16.485  3.919   1.00 50.98  ? 288  VAL A O   1 
ATOM   2178 C CB  . VAL A 1 288 ? 46.316  17.481  6.495   1.00 51.54  ? 288  VAL A CB  1 
ATOM   2179 C CG1 . VAL A 1 288 ? 47.409  18.204  7.279   1.00 50.66  ? 288  VAL A CG1 1 
ATOM   2180 C CG2 . VAL A 1 288 ? 45.137  17.132  7.394   1.00 48.71  ? 288  VAL A CG2 1 
ATOM   2181 N N   . LEU A 1 289 ? 43.648  18.058  4.311   1.00 49.91  ? 289  LEU A N   1 
ATOM   2182 C CA  . LEU A 1 289 ? 42.656  17.425  3.442   1.00 49.50  ? 289  LEU A CA  1 
ATOM   2183 C C   . LEU A 1 289 ? 43.113  17.477  1.988   1.00 51.01  ? 289  LEU A C   1 
ATOM   2184 O O   . LEU A 1 289 ? 43.696  18.468  1.553   1.00 51.44  ? 289  LEU A O   1 
ATOM   2185 C CB  . LEU A 1 289 ? 41.299  18.110  3.577   1.00 48.31  ? 289  LEU A CB  1 
ATOM   2186 C CG  . LEU A 1 289 ? 40.509  17.778  4.845   1.00 46.36  ? 289  LEU A CG  1 
ATOM   2187 C CD1 . LEU A 1 289 ? 39.245  18.669  4.906   1.00 41.01  ? 289  LEU A CD1 1 
ATOM   2188 C CD2 . LEU A 1 289 ? 40.179  16.284  4.928   1.00 41.70  ? 289  LEU A CD2 1 
ATOM   2189 N N   . PRO A 1 290 ? 42.900  16.386  1.244   1.00 52.24  ? 290  PRO A N   1 
ATOM   2190 C CA  . PRO A 1 290 ? 43.416  16.313  -0.122  1.00 54.07  ? 290  PRO A CA  1 
ATOM   2191 C C   . PRO A 1 290 ? 42.720  17.199  -1.160  1.00 54.82  ? 290  PRO A C   1 
ATOM   2192 O O   . PRO A 1 290 ? 43.307  17.472  -2.194  1.00 55.61  ? 290  PRO A O   1 
ATOM   2193 C CB  . PRO A 1 290 ? 43.263  14.835  -0.472  1.00 54.53  ? 290  PRO A CB  1 
ATOM   2194 C CG  . PRO A 1 290 ? 42.208  14.325  0.417   1.00 53.34  ? 290  PRO A CG  1 
ATOM   2195 C CD  . PRO A 1 290 ? 42.239  15.142  1.660   1.00 51.88  ? 290  PRO A CD  1 
ATOM   2196 N N   . GLN A 1 291 ? 41.499  17.650  -0.869  1.00 54.98  ? 291  GLN A N   1 
ATOM   2197 C CA  . GLN A 1 291 ? 40.644  18.386  -1.809  1.00 55.72  ? 291  GLN A CA  1 
ATOM   2198 C C   . GLN A 1 291 ? 39.940  19.571  -1.129  1.00 54.70  ? 291  GLN A C   1 
ATOM   2199 O O   . GLN A 1 291 ? 39.764  19.589  0.085   1.00 53.39  ? 291  GLN A O   1 
ATOM   2200 C CB  . GLN A 1 291 ? 39.553  17.428  -2.303  1.00 56.16  ? 291  GLN A CB  1 
ATOM   2201 C CG  . GLN A 1 291 ? 39.700  16.943  -3.698  1.00 60.56  ? 291  GLN A CG  1 
ATOM   2202 C CD  . GLN A 1 291 ? 40.881  16.057  -3.901  1.00 64.67  ? 291  GLN A CD  1 
ATOM   2203 O OE1 . GLN A 1 291 ? 41.656  16.253  -4.844  1.00 68.92  ? 291  GLN A OE1 1 
ATOM   2204 N NE2 . GLN A 1 291 ? 41.037  15.062  -3.028  1.00 68.33  ? 291  GLN A NE2 1 
ATOM   2205 N N   . GLU A 1 292 ? 39.510  20.546  -1.914  1.00 55.36  ? 292  GLU A N   1 
ATOM   2206 C CA  . GLU A 1 292 ? 38.570  21.559  -1.431  1.00 55.70  ? 292  GLU A CA  1 
ATOM   2207 C C   . GLU A 1 292 ? 37.293  20.782  -1.203  1.00 53.36  ? 292  GLU A C   1 
ATOM   2208 O O   . GLU A 1 292 ? 36.826  20.112  -2.114  1.00 53.67  ? 292  GLU A O   1 
ATOM   2209 C CB  . GLU A 1 292 ? 38.361  22.658  -2.486  1.00 56.77  ? 292  GLU A CB  1 
ATOM   2210 C CG  . GLU A 1 292 ? 37.377  23.779  -2.092  1.00 58.42  ? 292  GLU A CG  1 
ATOM   2211 C CD  . GLU A 1 292 ? 37.262  24.885  -3.162  1.00 60.98  ? 292  GLU A CD  1 
ATOM   2212 O OE1 . GLU A 1 292 ? 37.632  24.642  -4.344  1.00 67.31  ? 292  GLU A OE1 1 
ATOM   2213 O OE2 . GLU A 1 292 ? 36.796  26.005  -2.822  1.00 66.59  ? 292  GLU A OE2 1 
ATOM   2214 N N   . SER A 1 293 ? 36.761  20.809  0.016   1.00 51.70  ? 293  SER A N   1 
ATOM   2215 C CA  . SER A 1 293 ? 35.610  19.965  0.357   1.00 50.25  ? 293  SER A CA  1 
ATOM   2216 C C   . SER A 1 293 ? 34.676  20.521  1.424   1.00 48.42  ? 293  SER A C   1 
ATOM   2217 O O   . SER A 1 293 ? 34.988  21.486  2.092   1.00 48.01  ? 293  SER A O   1 
ATOM   2218 C CB  . SER A 1 293 ? 36.114  18.595  0.826   1.00 50.61  ? 293  SER A CB  1 
ATOM   2219 O OG  . SER A 1 293 ? 37.014  18.716  1.911   1.00 50.79  ? 293  SER A OG  1 
ATOM   2220 N N   . ILE A 1 294 ? 33.508  19.893  1.546   1.00 46.97  ? 294  ILE A N   1 
ATOM   2221 C CA  . ILE A 1 294 ? 32.670  19.974  2.732   1.00 45.04  ? 294  ILE A CA  1 
ATOM   2222 C C   . ILE A 1 294 ? 32.310  18.544  3.177   1.00 43.99  ? 294  ILE A C   1 
ATOM   2223 O O   . ILE A 1 294 ? 32.454  17.574  2.397   1.00 43.13  ? 294  ILE A O   1 
ATOM   2224 C CB  . ILE A 1 294 ? 31.386  20.813  2.508   1.00 45.77  ? 294  ILE A CB  1 
ATOM   2225 C CG1 . ILE A 1 294 ? 30.486  20.192  1.426   1.00 46.23  ? 294  ILE A CG1 1 
ATOM   2226 C CG2 . ILE A 1 294 ? 31.738  22.237  2.152   1.00 44.73  ? 294  ILE A CG2 1 
ATOM   2227 C CD1 . ILE A 1 294 ? 29.160  20.895  1.275   1.00 45.48  ? 294  ILE A CD1 1 
ATOM   2228 N N   . PHE A 1 295 ? 31.879  18.430  4.439   1.00 42.44  ? 295  PHE A N   1 
ATOM   2229 C CA  . PHE A 1 295 ? 31.583  17.156  5.091   1.00 41.45  ? 295  PHE A CA  1 
ATOM   2230 C C   . PHE A 1 295 ? 32.802  16.220  5.008   1.00 41.40  ? 295  PHE A C   1 
ATOM   2231 O O   . PHE A 1 295 ? 32.659  15.020  4.798   1.00 41.61  ? 295  PHE A O   1 
ATOM   2232 C CB  . PHE A 1 295 ? 30.327  16.515  4.470   1.00 41.72  ? 295  PHE A CB  1 
ATOM   2233 C CG  . PHE A 1 295 ? 29.416  15.817  5.464   1.00 41.39  ? 295  PHE A CG  1 
ATOM   2234 C CD1 . PHE A 1 295 ? 29.917  14.944  6.418   1.00 41.34  ? 295  PHE A CD1 1 
ATOM   2235 C CD2 . PHE A 1 295 ? 28.029  15.992  5.390   1.00 43.14  ? 295  PHE A CD2 1 
ATOM   2236 C CE1 . PHE A 1 295 ? 29.073  14.290  7.300   1.00 41.14  ? 295  PHE A CE1 1 
ATOM   2237 C CE2 . PHE A 1 295 ? 27.162  15.338  6.282   1.00 41.30  ? 295  PHE A CE2 1 
ATOM   2238 C CZ  . PHE A 1 295 ? 27.677  14.503  7.236   1.00 41.65  ? 295  PHE A CZ  1 
ATOM   2239 N N   . ARG A 1 296 ? 34.011  16.775  5.170   1.00 40.57  ? 296  ARG A N   1 
ATOM   2240 C CA  . ARG A 1 296 ? 35.223  15.958  5.288   1.00 40.11  ? 296  ARG A CA  1 
ATOM   2241 C C   . ARG A 1 296 ? 36.076  16.494  6.407   1.00 39.56  ? 296  ARG A C   1 
ATOM   2242 O O   . ARG A 1 296 ? 36.217  17.721  6.542   1.00 38.91  ? 296  ARG A O   1 
ATOM   2243 C CB  . ARG A 1 296 ? 36.037  15.970  3.998   1.00 41.13  ? 296  ARG A CB  1 
ATOM   2244 C CG  . ARG A 1 296 ? 35.381  15.287  2.832   1.00 42.36  ? 296  ARG A CG  1 
ATOM   2245 C CD  . ARG A 1 296 ? 35.381  13.756  2.972   1.00 45.34  ? 296  ARG A CD  1 
ATOM   2246 N NE  . ARG A 1 296 ? 34.833  13.156  1.758   1.00 46.70  ? 296  ARG A NE  1 
ATOM   2247 C CZ  . ARG A 1 296 ? 33.538  13.018  1.484   1.00 46.46  ? 296  ARG A CZ  1 
ATOM   2248 N NH1 . ARG A 1 296 ? 32.606  13.404  2.333   1.00 46.86  ? 296  ARG A NH1 1 
ATOM   2249 N NH2 . ARG A 1 296 ? 33.167  12.479  0.336   1.00 47.24  ? 296  ARG A NH2 1 
ATOM   2250 N N   . PHE A 1 297 ? 36.674  15.579  7.188   1.00 38.55  ? 297  PHE A N   1 
ATOM   2251 C CA  . PHE A 1 297 ? 37.410  15.935  8.404   1.00 37.45  ? 297  PHE A CA  1 
ATOM   2252 C C   . PHE A 1 297 ? 38.775  15.241  8.409   1.00 38.45  ? 297  PHE A C   1 
ATOM   2253 O O   . PHE A 1 297 ? 38.890  14.080  7.971   1.00 37.83  ? 297  PHE A O   1 
ATOM   2254 C CB  . PHE A 1 297 ? 36.568  15.562  9.611   1.00 36.96  ? 297  PHE A CB  1 
ATOM   2255 C CG  . PHE A 1 297 ? 35.081  15.861  9.415   1.00 35.90  ? 297  PHE A CG  1 
ATOM   2256 C CD1 . PHE A 1 297 ? 34.626  17.167  9.432   1.00 35.70  ? 297  PHE A CD1 1 
ATOM   2257 C CD2 . PHE A 1 297 ? 34.175  14.842  9.128   1.00 36.11  ? 297  PHE A CD2 1 
ATOM   2258 C CE1 . PHE A 1 297 ? 33.259  17.475  9.201   1.00 34.68  ? 297  PHE A CE1 1 
ATOM   2259 C CE2 . PHE A 1 297 ? 32.792  15.132  8.913   1.00 35.22  ? 297  PHE A CE2 1 
ATOM   2260 C CZ  . PHE A 1 297 ? 32.354  16.438  8.942   1.00 36.32  ? 297  PHE A CZ  1 
ATOM   2261 N N   . SER A 1 298 ? 39.794  15.970  8.875   1.00 37.95  ? 298  SER A N   1 
ATOM   2262 C CA  . SER A 1 298 ? 41.177  15.585  8.679   1.00 39.62  ? 298  SER A CA  1 
ATOM   2263 C C   . SER A 1 298 ? 41.527  14.323  9.456   1.00 39.45  ? 298  SER A C   1 
ATOM   2264 O O   . SER A 1 298 ? 41.973  13.362  8.891   1.00 40.28  ? 298  SER A O   1 
ATOM   2265 C CB  . SER A 1 298 ? 42.112  16.733  9.065   1.00 40.22  ? 298  SER A CB  1 
ATOM   2266 O OG  . SER A 1 298 ? 41.991  17.788  8.111   1.00 41.62  ? 298  SER A OG  1 
ATOM   2267 N N   . PHE A 1 299 ? 41.246  14.327  10.746  1.00 39.85  ? 299  PHE A N   1 
ATOM   2268 C CA  . PHE A 1 299 ? 41.601  13.236  11.647  1.00 39.71  ? 299  PHE A CA  1 
ATOM   2269 C C   . PHE A 1 299 ? 40.363  12.474  12.184  1.00 39.50  ? 299  PHE A C   1 
ATOM   2270 O O   . PHE A 1 299 ? 39.627  12.973  13.035  1.00 39.23  ? 299  PHE A O   1 
ATOM   2271 C CB  . PHE A 1 299 ? 42.487  13.823  12.718  1.00 39.45  ? 299  PHE A CB  1 
ATOM   2272 C CG  . PHE A 1 299 ? 43.764  14.408  12.137  1.00 39.54  ? 299  PHE A CG  1 
ATOM   2273 C CD1 . PHE A 1 299 ? 44.825  13.586  11.832  1.00 40.05  ? 299  PHE A CD1 1 
ATOM   2274 C CD2 . PHE A 1 299 ? 43.849  15.741  11.813  1.00 40.25  ? 299  PHE A CD2 1 
ATOM   2275 C CE1 . PHE A 1 299 ? 45.999  14.087  11.258  1.00 41.15  ? 299  PHE A CE1 1 
ATOM   2276 C CE2 . PHE A 1 299 ? 45.011  16.271  11.224  1.00 40.28  ? 299  PHE A CE2 1 
ATOM   2277 C CZ  . PHE A 1 299 ? 46.101  15.424  10.958  1.00 41.25  ? 299  PHE A CZ  1 
ATOM   2278 N N   . VAL A 1 300 ? 40.181  11.254  11.661  1.00 39.89  ? 300  VAL A N   1 
ATOM   2279 C CA  . VAL A 1 300 ? 39.040  10.395  11.931  1.00 39.60  ? 300  VAL A CA  1 
ATOM   2280 C C   . VAL A 1 300 ? 39.518  8.940   12.147  1.00 40.57  ? 300  VAL A C   1 
ATOM   2281 O O   . VAL A 1 300 ? 40.703  8.617   11.944  1.00 41.60  ? 300  VAL A O   1 
ATOM   2282 C CB  . VAL A 1 300 ? 38.007  10.482  10.764  1.00 40.12  ? 300  VAL A CB  1 
ATOM   2283 C CG1 . VAL A 1 300 ? 37.422  11.912  10.618  1.00 38.27  ? 300  VAL A CG1 1 
ATOM   2284 C CG2 . VAL A 1 300 ? 38.627  10.025  9.450   1.00 41.09  ? 300  VAL A CG2 1 
ATOM   2285 N N   . PRO A 1 301 ? 38.615  8.042   12.585  1.00 40.25  ? 301  PRO A N   1 
ATOM   2286 C CA  . PRO A 1 301 ? 38.953  6.622   12.695  1.00 40.86  ? 301  PRO A CA  1 
ATOM   2287 C C   . PRO A 1 301 ? 39.663  6.048   11.492  1.00 42.46  ? 301  PRO A C   1 
ATOM   2288 O O   . PRO A 1 301 ? 39.355  6.385   10.351  1.00 42.20  ? 301  PRO A O   1 
ATOM   2289 C CB  . PRO A 1 301 ? 37.578  5.971   12.877  1.00 41.07  ? 301  PRO A CB  1 
ATOM   2290 C CG  . PRO A 1 301 ? 36.863  6.950   13.695  1.00 38.37  ? 301  PRO A CG  1 
ATOM   2291 C CD  . PRO A 1 301 ? 37.245  8.281   13.074  1.00 39.29  ? 301  PRO A CD  1 
ATOM   2292 N N   . VAL A 1 302 ? 40.653  5.203   11.766  1.00 44.77  ? 302  VAL A N   1 
ATOM   2293 C CA  . VAL A 1 302 ? 41.469  4.608   10.753  1.00 45.91  ? 302  VAL A CA  1 
ATOM   2294 C C   . VAL A 1 302 ? 41.174  3.100   10.733  1.00 47.86  ? 302  VAL A C   1 
ATOM   2295 O O   . VAL A 1 302 ? 40.923  2.490   11.775  1.00 48.04  ? 302  VAL A O   1 
ATOM   2296 C CB  . VAL A 1 302 ? 43.000  4.904   11.009  1.00 47.05  ? 302  VAL A CB  1 
ATOM   2297 C CG1 . VAL A 1 302 ? 43.493  4.362   12.364  1.00 45.85  ? 302  VAL A CG1 1 
ATOM   2298 C CG2 . VAL A 1 302 ? 43.851  4.359   9.885   1.00 46.30  ? 302  VAL A CG2 1 
ATOM   2299 N N   . VAL A 1 303 ? 41.175  2.508   9.543   1.00 49.14  ? 303  VAL A N   1 
ATOM   2300 C CA  . VAL A 1 303 ? 41.108  1.064   9.432   1.00 51.01  ? 303  VAL A CA  1 
ATOM   2301 C C   . VAL A 1 303 ? 42.508  0.546   9.735   1.00 52.61  ? 303  VAL A C   1 
ATOM   2302 O O   . VAL A 1 303 ? 43.380  0.546   8.871   1.00 53.45  ? 303  VAL A O   1 
ATOM   2303 C CB  . VAL A 1 303 ? 40.629  0.637   8.048   1.00 51.62  ? 303  VAL A CB  1 
ATOM   2304 C CG1 . VAL A 1 303 ? 40.600  -0.896  7.946   1.00 52.82  ? 303  VAL A CG1 1 
ATOM   2305 C CG2 . VAL A 1 303 ? 39.278  1.268   7.770   1.00 49.61  ? 303  VAL A CG2 1 
ATOM   2306 N N   . ASP A 1 304 ? 42.711  0.150   10.991  1.00 53.76  ? 304  ASP A N   1 
ATOM   2307 C CA  . ASP A 1 304 ? 44.033  -0.234  11.525  1.00 54.97  ? 304  ASP A CA  1 
ATOM   2308 C C   . ASP A 1 304 ? 44.298  -1.722  11.559  1.00 56.95  ? 304  ASP A C   1 
ATOM   2309 O O   . ASP A 1 304 ? 45.434  -2.133  11.816  1.00 57.77  ? 304  ASP A O   1 
ATOM   2310 C CB  . ASP A 1 304 ? 44.219  0.311   12.958  1.00 54.42  ? 304  ASP A CB  1 
ATOM   2311 C CG  . ASP A 1 304 ? 43.073  -0.072  13.918  1.00 54.43  ? 304  ASP A CG  1 
ATOM   2312 O OD1 . ASP A 1 304 ? 42.019  -0.588  13.477  1.00 55.36  ? 304  ASP A OD1 1 
ATOM   2313 O OD2 . ASP A 1 304 ? 43.211  0.185   15.131  1.00 55.03  ? 304  ASP A OD2 1 
ATOM   2314 N N   . GLY A 1 305 ? 43.270  -2.534  11.342  1.00 57.55  ? 305  GLY A N   1 
ATOM   2315 C CA  . GLY A 1 305 ? 43.419  -3.997  11.488  1.00 59.50  ? 305  GLY A CA  1 
ATOM   2316 C C   . GLY A 1 305 ? 43.347  -4.459  12.937  1.00 60.03  ? 305  GLY A C   1 
ATOM   2317 O O   . GLY A 1 305 ? 43.633  -5.617  13.241  1.00 61.73  ? 305  GLY A O   1 
ATOM   2318 N N   . ASP A 1 306 ? 42.941  -3.555  13.829  1.00 58.99  ? 306  ASP A N   1 
ATOM   2319 C CA  . ASP A 1 306 ? 42.925  -3.798  15.268  1.00 58.98  ? 306  ASP A CA  1 
ATOM   2320 C C   . ASP A 1 306 ? 41.544  -3.409  15.821  1.00 57.13  ? 306  ASP A C   1 
ATOM   2321 O O   . ASP A 1 306 ? 40.679  -4.270  15.927  1.00 57.63  ? 306  ASP A O   1 
ATOM   2322 C CB  . ASP A 1 306 ? 44.076  -3.036  15.942  1.00 59.30  ? 306  ASP A CB  1 
ATOM   2323 C CG  . ASP A 1 306 ? 44.163  -3.288  17.439  1.00 61.35  ? 306  ASP A CG  1 
ATOM   2324 O OD1 . ASP A 1 306 ? 43.621  -4.305  17.925  1.00 64.97  ? 306  ASP A OD1 1 
ATOM   2325 O OD2 . ASP A 1 306 ? 44.785  -2.461  18.140  1.00 63.89  ? 306  ASP A OD2 1 
ATOM   2326 N N   . PHE A 1 307 ? 41.315  -2.136  16.149  1.00 55.18  ? 307  PHE A N   1 
ATOM   2327 C CA  . PHE A 1 307 ? 39.956  -1.687  16.532  1.00 53.49  ? 307  PHE A CA  1 
ATOM   2328 C C   . PHE A 1 307 ? 38.993  -2.040  15.413  1.00 53.68  ? 307  PHE A C   1 
ATOM   2329 O O   . PHE A 1 307 ? 37.925  -2.602  15.640  1.00 54.23  ? 307  PHE A O   1 
ATOM   2330 C CB  . PHE A 1 307 ? 39.898  -0.177  16.799  1.00 51.49  ? 307  PHE A CB  1 
ATOM   2331 C CG  . PHE A 1 307 ? 38.652  0.255   17.541  1.00 50.53  ? 307  PHE A CG  1 
ATOM   2332 C CD1 . PHE A 1 307 ? 37.433  0.340   16.892  1.00 47.94  ? 307  PHE A CD1 1 
ATOM   2333 C CD2 . PHE A 1 307 ? 38.698  0.539   18.899  1.00 49.23  ? 307  PHE A CD2 1 
ATOM   2334 C CE1 . PHE A 1 307 ? 36.277  0.697   17.586  1.00 47.50  ? 307  PHE A CE1 1 
ATOM   2335 C CE2 . PHE A 1 307 ? 37.560  0.909   19.588  1.00 47.98  ? 307  PHE A CE2 1 
ATOM   2336 C CZ  . PHE A 1 307 ? 36.342  0.981   18.932  1.00 47.79  ? 307  PHE A CZ  1 
ATOM   2337 N N   . LEU A 1 308 ? 39.389  -1.681  14.198  1.00 53.96  ? 308  LEU A N   1 
ATOM   2338 C CA  . LEU A 1 308 ? 38.675  -2.041  12.992  1.00 54.28  ? 308  LEU A CA  1 
ATOM   2339 C C   . LEU A 1 308 ? 39.523  -3.059  12.262  1.00 56.39  ? 308  LEU A C   1 
ATOM   2340 O O   . LEU A 1 308 ? 40.569  -2.711  11.708  1.00 57.14  ? 308  LEU A O   1 
ATOM   2341 C CB  . LEU A 1 308 ? 38.467  -0.804  12.120  1.00 53.05  ? 308  LEU A CB  1 
ATOM   2342 C CG  . LEU A 1 308 ? 37.515  0.220   12.737  1.00 50.49  ? 308  LEU A CG  1 
ATOM   2343 C CD1 . LEU A 1 308 ? 37.441  1.451   11.820  1.00 48.43  ? 308  LEU A CD1 1 
ATOM   2344 C CD2 . LEU A 1 308 ? 36.133  -0.408  12.977  1.00 47.85  ? 308  LEU A CD2 1 
ATOM   2345 N N   . SER A 1 309 ? 39.085  -4.314  12.287  1.00 57.57  ? 309  SER A N   1 
ATOM   2346 C CA  . SER A 1 309 ? 39.863  -5.390  11.701  1.00 60.22  ? 309  SER A CA  1 
ATOM   2347 C C   . SER A 1 309 ? 39.775  -5.383  10.168  1.00 60.85  ? 309  SER A C   1 
ATOM   2348 O O   . SER A 1 309 ? 40.643  -5.915  9.485   1.00 62.46  ? 309  SER A O   1 
ATOM   2349 C CB  . SER A 1 309 ? 39.432  -6.746  12.289  1.00 61.19  ? 309  SER A CB  1 
ATOM   2350 O OG  . SER A 1 309 ? 38.102  -7.049  11.923  1.00 62.14  ? 309  SER A OG  1 
ATOM   2351 N N   . ASP A 1 310 ? 38.718  -4.789  9.639   1.00 60.36  ? 310  ASP A N   1 
ATOM   2352 C CA  . ASP A 1 310 ? 38.574  -4.582  8.206   1.00 61.08  ? 310  ASP A CA  1 
ATOM   2353 C C   . ASP A 1 310 ? 37.740  -3.305  8.009   1.00 59.56  ? 310  ASP A C   1 
ATOM   2354 O O   . ASP A 1 310 ? 37.341  -2.649  8.980   1.00 58.40  ? 310  ASP A O   1 
ATOM   2355 C CB  . ASP A 1 310 ? 37.878  -5.799  7.586   1.00 62.50  ? 310  ASP A CB  1 
ATOM   2356 C CG  . ASP A 1 310 ? 38.269  -6.045  6.117   1.00 65.40  ? 310  ASP A CG  1 
ATOM   2357 O OD1 . ASP A 1 310 ? 38.696  -5.103  5.395   1.00 64.80  ? 310  ASP A OD1 1 
ATOM   2358 O OD2 . ASP A 1 310 ? 38.133  -7.213  5.681   1.00 68.99  ? 310  ASP A OD2 1 
ATOM   2359 N N   . THR A 1 311 ? 37.468  -2.950  6.762   1.00 59.76  ? 311  THR A N   1 
ATOM   2360 C CA  . THR A 1 311 ? 36.693  -1.755  6.472   1.00 58.45  ? 311  THR A CA  1 
ATOM   2361 C C   . THR A 1 311 ? 35.286  -1.931  7.040   1.00 58.65  ? 311  THR A C   1 
ATOM   2362 O O   . THR A 1 311 ? 34.755  -3.035  7.026   1.00 59.31  ? 311  THR A O   1 
ATOM   2363 C CB  . THR A 1 311 ? 36.578  -1.541  4.964   1.00 59.15  ? 311  THR A CB  1 
ATOM   2364 O OG1 . THR A 1 311 ? 35.838  -2.626  4.397   1.00 58.56  ? 311  THR A OG1 1 
ATOM   2365 C CG2 . THR A 1 311 ? 37.963  -1.465  4.306   1.00 58.50  ? 311  THR A CG2 1 
ATOM   2366 N N   . PRO A 1 312 ? 34.668  -0.849  7.552   1.00 58.32  ? 312  PRO A N   1 
ATOM   2367 C CA  . PRO A 1 312 ? 33.266  -0.972  7.966   1.00 58.58  ? 312  PRO A CA  1 
ATOM   2368 C C   . PRO A 1 312 ? 32.390  -1.673  6.914   1.00 60.38  ? 312  PRO A C   1 
ATOM   2369 O O   . PRO A 1 312 ? 31.562  -2.497  7.269   1.00 60.67  ? 312  PRO A O   1 
ATOM   2370 C CB  . PRO A 1 312 ? 32.845  0.467   8.162   1.00 57.17  ? 312  PRO A CB  1 
ATOM   2371 C CG  . PRO A 1 312 ? 34.081  1.145   8.566   1.00 56.71  ? 312  PRO A CG  1 
ATOM   2372 C CD  . PRO A 1 312 ? 35.188  0.501   7.804   1.00 56.57  ? 312  PRO A CD  1 
ATOM   2373 N N   . GLU A 1 313 ? 32.615  -1.361  5.639   1.00 62.04  ? 313  GLU A N   1 
ATOM   2374 C CA  . GLU A 1 313 ? 31.944  -2.029  4.508   1.00 64.24  ? 313  GLU A CA  1 
ATOM   2375 C C   . GLU A 1 313 ? 32.067  -3.553  4.570   1.00 65.22  ? 313  GLU A C   1 
ATOM   2376 O O   . GLU A 1 313 ? 31.064  -4.265  4.513   1.00 65.69  ? 313  GLU A O   1 
ATOM   2377 C CB  . GLU A 1 313 ? 32.524  -1.520  3.174   1.00 65.35  ? 313  GLU A CB  1 
ATOM   2378 C CG  . GLU A 1 313 ? 31.750  -1.961  1.908   1.00 69.56  ? 313  GLU A CG  1 
ATOM   2379 C CD  . GLU A 1 313 ? 32.626  -2.031  0.644   1.00 74.06  ? 313  GLU A CD  1 
ATOM   2380 O OE1 . GLU A 1 313 ? 33.505  -2.935  0.574   1.00 78.18  ? 313  GLU A OE1 1 
ATOM   2381 O OE2 . GLU A 1 313 ? 32.408  -1.210  -0.282  1.00 74.78  ? 313  GLU A OE2 1 
ATOM   2382 N N   . ALA A 1 314 ? 33.291  -4.055  4.696   1.00 65.62  ? 314  ALA A N   1 
ATOM   2383 C CA  . ALA A 1 314 ? 33.502  -5.495  4.745   1.00 67.07  ? 314  ALA A CA  1 
ATOM   2384 C C   . ALA A 1 314 ? 32.837  -6.074  5.977   1.00 67.24  ? 314  ALA A C   1 
ATOM   2385 O O   . ALA A 1 314 ? 32.263  -7.152  5.920   1.00 68.69  ? 314  ALA A O   1 
ATOM   2386 C CB  . ALA A 1 314 ? 34.993  -5.838  4.737   1.00 67.88  ? 314  ALA A CB  1 
ATOM   2387 N N   . LEU A 1 315 ? 32.912  -5.358  7.095   1.00 66.22  ? 315  LEU A N   1 
ATOM   2388 C CA  . LEU A 1 315 ? 32.371  -5.855  8.359   1.00 66.31  ? 315  LEU A CA  1 
ATOM   2389 C C   . LEU A 1 315 ? 30.833  -5.866  8.400   1.00 66.76  ? 315  LEU A C   1 
ATOM   2390 O O   . LEU A 1 315 ? 30.263  -6.816  8.929   1.00 67.97  ? 315  LEU A O   1 
ATOM   2391 C CB  . LEU A 1 315 ? 32.962  -5.088  9.551   1.00 64.93  ? 315  LEU A CB  1 
ATOM   2392 C CG  . LEU A 1 315 ? 34.486  -5.179  9.723   1.00 63.89  ? 315  LEU A CG  1 
ATOM   2393 C CD1 . LEU A 1 315 ? 34.936  -4.221  10.805  1.00 60.67  ? 315  LEU A CD1 1 
ATOM   2394 C CD2 . LEU A 1 315 ? 34.964  -6.615  10.025  1.00 64.08  ? 315  LEU A CD2 1 
ATOM   2395 N N   . ILE A 1 316 ? 30.162  -4.856  7.838   1.00 66.80  ? 316  ILE A N   1 
ATOM   2396 C CA  . ILE A 1 316 ? 28.689  -4.897  7.738   1.00 67.50  ? 316  ILE A CA  1 
ATOM   2397 C C   . ILE A 1 316 ? 28.206  -5.996  6.764   1.00 70.87  ? 316  ILE A C   1 
ATOM   2398 O O   . ILE A 1 316 ? 27.135  -6.566  6.970   1.00 72.06  ? 316  ILE A O   1 
ATOM   2399 C CB  . ILE A 1 316 ? 27.995  -3.490  7.442   1.00 66.34  ? 316  ILE A CB  1 
ATOM   2400 C CG1 . ILE A 1 316 ? 28.352  -2.902  6.055   1.00 66.75  ? 316  ILE A CG1 1 
ATOM   2401 C CG2 . ILE A 1 316 ? 28.326  -2.484  8.550   1.00 65.04  ? 316  ILE A CG2 1 
ATOM   2402 C CD1 . ILE A 1 316 ? 27.549  -1.622  5.599   1.00 62.19  ? 316  ILE A CD1 1 
ATOM   2403 N N   . ASN A 1 317 ? 28.999  -6.324  5.740   1.00 73.12  ? 317  ASN A N   1 
ATOM   2404 C CA  . ASN A 1 317 ? 28.594  -7.340  4.744   1.00 75.85  ? 317  ASN A CA  1 
ATOM   2405 C C   . ASN A 1 317 ? 28.745  -8.784  5.224   1.00 77.89  ? 317  ASN A C   1 
ATOM   2406 O O   . ASN A 1 317 ? 28.006  -9.660  4.778   1.00 79.67  ? 317  ASN A O   1 
ATOM   2407 C CB  . ASN A 1 317 ? 29.374  -7.189  3.428   1.00 76.71  ? 317  ASN A CB  1 
ATOM   2408 C CG  . ASN A 1 317 ? 29.167  -5.830  2.759   1.00 77.01  ? 317  ASN A CG  1 
ATOM   2409 O OD1 . ASN A 1 317 ? 28.499  -4.938  3.302   1.00 79.17  ? 317  ASN A OD1 1 
ATOM   2410 N ND2 . ASN A 1 317 ? 29.765  -5.659  1.577   1.00 79.29  ? 317  ASN A ND2 1 
ATOM   2411 N N   . THR A 1 318 ? 29.702  -9.036  6.114   1.00 78.13  ? 318  THR A N   1 
ATOM   2412 C CA  . THR A 1 318 ? 30.013  -10.399 6.550   1.00 80.05  ? 318  THR A CA  1 
ATOM   2413 C C   . THR A 1 318 ? 29.731  -10.654 8.035   1.00 79.89  ? 318  THR A C   1 
ATOM   2414 O O   . THR A 1 318 ? 29.931  -11.766 8.513   1.00 81.09  ? 318  THR A O   1 
ATOM   2415 C CB  . THR A 1 318 ? 31.491  -10.725 6.284   1.00 80.84  ? 318  THR A CB  1 
ATOM   2416 O OG1 . THR A 1 318 ? 32.323  -9.810  7.010   1.00 79.62  ? 318  THR A OG1 1 
ATOM   2417 C CG2 . THR A 1 318 ? 31.801  -10.620 4.800   1.00 81.99  ? 318  THR A CG2 1 
ATOM   2418 N N   . GLY A 1 319 ? 29.271  -9.640  8.767   1.00 78.35  ? 319  GLY A N   1 
ATOM   2419 C CA  . GLY A 1 319 ? 29.004  -9.813  10.196  1.00 78.19  ? 319  GLY A CA  1 
ATOM   2420 C C   . GLY A 1 319 ? 27.751  -10.641 10.465  1.00 79.20  ? 319  GLY A C   1 
ATOM   2421 O O   . GLY A 1 319 ? 26.837  -10.674 9.640   1.00 79.89  ? 319  GLY A O   1 
ATOM   2422 N N   . ASP A 1 320 ? 27.721  -11.320 11.610  1.00 79.44  ? 320  ASP A N   1 
ATOM   2423 C CA  . ASP A 1 320 ? 26.511  -11.976 12.109  1.00 80.26  ? 320  ASP A CA  1 
ATOM   2424 C C   . ASP A 1 320 ? 25.937  -11.061 13.200  1.00 78.16  ? 320  ASP A C   1 
ATOM   2425 O O   . ASP A 1 320 ? 26.571  -10.863 14.239  1.00 77.55  ? 320  ASP A O   1 
ATOM   2426 C CB  . ASP A 1 320 ? 26.856  -13.374 12.656  1.00 82.31  ? 320  ASP A CB  1 
ATOM   2427 C CG  . ASP A 1 320 ? 25.651  -14.104 13.243  1.00 84.70  ? 320  ASP A CG  1 
ATOM   2428 O OD1 . ASP A 1 320 ? 24.730  -13.424 13.741  1.00 85.73  ? 320  ASP A OD1 1 
ATOM   2429 O OD2 . ASP A 1 320 ? 25.630  -15.361 13.222  1.00 86.81  ? 320  ASP A OD2 1 
ATOM   2430 N N   . PHE A 1 321 ? 24.756  -10.488 12.958  1.00 77.03  ? 321  PHE A N   1 
ATOM   2431 C CA  . PHE A 1 321 ? 24.153  -9.521  13.898  1.00 75.23  ? 321  PHE A CA  1 
ATOM   2432 C C   . PHE A 1 321 ? 22.802  -10.003 14.430  1.00 76.05  ? 321  PHE A C   1 
ATOM   2433 O O   . PHE A 1 321 ? 21.907  -9.198  14.706  1.00 75.13  ? 321  PHE A O   1 
ATOM   2434 C CB  . PHE A 1 321 ? 24.003  -8.147  13.228  1.00 73.58  ? 321  PHE A CB  1 
ATOM   2435 C CG  . PHE A 1 321 ? 25.283  -7.621  12.657  1.00 72.33  ? 321  PHE A CG  1 
ATOM   2436 C CD1 . PHE A 1 321 ? 26.252  -7.087  13.485  1.00 71.32  ? 321  PHE A CD1 1 
ATOM   2437 C CD2 . PHE A 1 321 ? 25.530  -7.683  11.299  1.00 72.90  ? 321  PHE A CD2 1 
ATOM   2438 C CE1 . PHE A 1 321 ? 27.441  -6.616  12.972  1.00 70.58  ? 321  PHE A CE1 1 
ATOM   2439 C CE2 . PHE A 1 321 ? 26.718  -7.212  10.775  1.00 71.94  ? 321  PHE A CE2 1 
ATOM   2440 C CZ  . PHE A 1 321 ? 27.677  -6.680  11.615  1.00 71.23  ? 321  PHE A CZ  1 
ATOM   2441 N N   . GLN A 1 322 ? 22.673  -11.321 14.587  1.00 77.47  ? 322  GLN A N   1 
ATOM   2442 C CA  . GLN A 1 322 ? 21.452  -11.938 15.082  1.00 78.48  ? 322  GLN A CA  1 
ATOM   2443 C C   . GLN A 1 322 ? 21.050  -11.394 16.446  1.00 77.11  ? 322  GLN A C   1 
ATOM   2444 O O   . GLN A 1 322 ? 19.870  -11.224 16.730  1.00 76.99  ? 322  GLN A O   1 
ATOM   2445 C CB  . GLN A 1 322 ? 21.616  -13.469 15.163  1.00 80.85  ? 322  GLN A CB  1 
ATOM   2446 C CG  . GLN A 1 322 ? 21.639  -14.175 13.802  1.00 83.20  ? 322  GLN A CG  1 
ATOM   2447 C CD  . GLN A 1 322 ? 21.877  -15.687 13.913  1.00 87.84  ? 322  GLN A CD  1 
ATOM   2448 O OE1 . GLN A 1 322 ? 21.298  -16.473 13.156  1.00 90.30  ? 322  GLN A OE1 1 
ATOM   2449 N NE2 . GLN A 1 322 ? 22.723  -16.098 14.863  1.00 88.66  ? 322  GLN A NE2 1 
ATOM   2450 N N   . ASP A 1 323 ? 22.028  -11.110 17.291  1.00 76.11  ? 323  ASP A N   1 
ATOM   2451 C CA  . ASP A 1 323 ? 21.731  -10.661 18.655  1.00 75.91  ? 323  ASP A CA  1 
ATOM   2452 C C   . ASP A 1 323 ? 21.672  -9.124  18.818  1.00 72.79  ? 323  ASP A C   1 
ATOM   2453 O O   . ASP A 1 323 ? 21.881  -8.606  19.918  1.00 72.28  ? 323  ASP A O   1 
ATOM   2454 C CB  . ASP A 1 323 ? 22.755  -11.272 19.631  1.00 77.01  ? 323  ASP A CB  1 
ATOM   2455 C CG  . ASP A 1 323 ? 24.193  -10.792 19.365  1.00 78.91  ? 323  ASP A CG  1 
ATOM   2456 O OD1 . ASP A 1 323 ? 24.451  -10.203 18.279  1.00 80.51  ? 323  ASP A OD1 1 
ATOM   2457 O OD2 . ASP A 1 323 ? 25.061  -11.018 20.251  1.00 83.06  ? 323  ASP A OD2 1 
ATOM   2458 N N   . LEU A 1 324 ? 21.378  -8.396  17.745  1.00 70.67  ? 324  LEU A N   1 
ATOM   2459 C CA  . LEU A 1 324 ? 21.465  -6.933  17.789  1.00 67.78  ? 324  LEU A CA  1 
ATOM   2460 C C   . LEU A 1 324 ? 20.125  -6.294  17.475  1.00 66.14  ? 324  LEU A C   1 
ATOM   2461 O O   . LEU A 1 324 ? 19.456  -6.688  16.521  1.00 66.49  ? 324  LEU A O   1 
ATOM   2462 C CB  . LEU A 1 324 ? 22.515  -6.434  16.796  1.00 67.15  ? 324  LEU A CB  1 
ATOM   2463 C CG  . LEU A 1 324 ? 22.856  -4.935  16.838  1.00 66.19  ? 324  LEU A CG  1 
ATOM   2464 C CD1 . LEU A 1 324 ? 23.654  -4.582  18.086  1.00 65.49  ? 324  LEU A CD1 1 
ATOM   2465 C CD2 . LEU A 1 324 ? 23.611  -4.532  15.582  1.00 65.71  ? 324  LEU A CD2 1 
ATOM   2466 N N   . GLN A 1 325 ? 19.735  -5.321  18.300  1.00 63.50  ? 325  GLN A N   1 
ATOM   2467 C CA  . GLN A 1 325 ? 18.636  -4.430  17.968  1.00 61.98  ? 325  GLN A CA  1 
ATOM   2468 C C   . GLN A 1 325 ? 19.189  -3.002  17.800  1.00 58.99  ? 325  GLN A C   1 
ATOM   2469 O O   . GLN A 1 325 ? 20.012  -2.559  18.594  1.00 56.53  ? 325  GLN A O   1 
ATOM   2470 C CB  . GLN A 1 325 ? 17.542  -4.469  19.029  1.00 62.67  ? 325  GLN A CB  1 
ATOM   2471 C CG  . GLN A 1 325 ? 17.015  -5.866  19.376  1.00 65.85  ? 325  GLN A CG  1 
ATOM   2472 C CD  . GLN A 1 325 ? 17.532  -6.375  20.715  1.00 68.69  ? 325  GLN A CD  1 
ATOM   2473 O OE1 . GLN A 1 325 ? 17.506  -5.665  21.722  1.00 68.59  ? 325  GLN A OE1 1 
ATOM   2474 N NE2 . GLN A 1 325 ? 18.012  -7.613  20.730  1.00 72.51  ? 325  GLN A NE2 1 
ATOM   2475 N N   . VAL A 1 326 ? 18.724  -2.309  16.757  1.00 57.52  ? 326  VAL A N   1 
ATOM   2476 C CA  . VAL A 1 326 ? 19.260  -1.005  16.358  1.00 55.86  ? 326  VAL A CA  1 
ATOM   2477 C C   . VAL A 1 326 ? 18.131  -0.070  15.933  1.00 54.99  ? 326  VAL A C   1 
ATOM   2478 O O   . VAL A 1 326 ? 17.158  -0.489  15.304  1.00 55.40  ? 326  VAL A O   1 
ATOM   2479 C CB  . VAL A 1 326 ? 20.261  -1.137  15.178  1.00 55.65  ? 326  VAL A CB  1 
ATOM   2480 C CG1 . VAL A 1 326 ? 20.772  0.199   14.758  1.00 54.83  ? 326  VAL A CG1 1 
ATOM   2481 C CG2 . VAL A 1 326 ? 21.427  -2.004  15.561  1.00 56.18  ? 326  VAL A CG2 1 
ATOM   2482 N N   . LEU A 1 327 ? 18.274  1.198   16.291  1.00 52.91  ? 327  LEU A N   1 
ATOM   2483 C CA  . LEU A 1 327 ? 17.381  2.232   15.839  1.00 52.20  ? 327  LEU A CA  1 
ATOM   2484 C C   . LEU A 1 327 ? 18.251  3.182   15.032  1.00 50.67  ? 327  LEU A C   1 
ATOM   2485 O O   . LEU A 1 327 ? 19.307  3.621   15.500  1.00 49.05  ? 327  LEU A O   1 
ATOM   2486 C CB  . LEU A 1 327 ? 16.716  2.915   17.040  1.00 52.29  ? 327  LEU A CB  1 
ATOM   2487 C CG  . LEU A 1 327 ? 15.770  4.106   16.819  1.00 53.89  ? 327  LEU A CG  1 
ATOM   2488 C CD1 . LEU A 1 327 ? 14.609  3.751   15.899  1.00 56.64  ? 327  LEU A CD1 1 
ATOM   2489 C CD2 . LEU A 1 327 ? 15.221  4.613   18.151  1.00 55.73  ? 327  LEU A CD2 1 
ATOM   2490 N N   . VAL A 1 328 ? 17.844  3.462   13.798  1.00 50.07  ? 328  VAL A N   1 
ATOM   2491 C CA  . VAL A 1 328 ? 18.645  4.311   12.920  1.00 49.09  ? 328  VAL A CA  1 
ATOM   2492 C C   . VAL A 1 328 ? 17.733  5.305   12.233  1.00 47.93  ? 328  VAL A C   1 
ATOM   2493 O O   . VAL A 1 328 ? 16.569  5.021   12.028  1.00 48.68  ? 328  VAL A O   1 
ATOM   2494 C CB  . VAL A 1 328 ? 19.419  3.468   11.849  1.00 49.83  ? 328  VAL A CB  1 
ATOM   2495 C CG1 . VAL A 1 328 ? 20.088  2.270   12.491  1.00 51.06  ? 328  VAL A CG1 1 
ATOM   2496 C CG2 . VAL A 1 328 ? 18.484  2.967   10.764  1.00 50.21  ? 328  VAL A CG2 1 
ATOM   2497 N N   . GLY A 1 329 ? 18.258  6.461   11.856  1.00 46.13  ? 329  GLY A N   1 
ATOM   2498 C CA  . GLY A 1 329 ? 17.462  7.405   11.074  1.00 45.93  ? 329  GLY A CA  1 
ATOM   2499 C C   . GLY A 1 329 ? 18.183  8.665   10.671  1.00 44.44  ? 329  GLY A C   1 
ATOM   2500 O O   . GLY A 1 329 ? 19.362  8.809   10.928  1.00 43.95  ? 329  GLY A O   1 
ATOM   2501 N N   . VAL A 1 330 ? 17.444  9.564   10.023  1.00 44.63  ? 330  VAL A N   1 
ATOM   2502 C CA  . VAL A 1 330 ? 17.975  10.771  9.404   1.00 43.95  ? 330  VAL A CA  1 
ATOM   2503 C C   . VAL A 1 330 ? 17.020  11.939  9.631   1.00 44.42  ? 330  VAL A C   1 
ATOM   2504 O O   . VAL A 1 330 ? 15.852  11.733  9.971   1.00 45.50  ? 330  VAL A O   1 
ATOM   2505 C CB  . VAL A 1 330 ? 18.134  10.589  7.857   1.00 44.73  ? 330  VAL A CB  1 
ATOM   2506 C CG1 . VAL A 1 330 ? 19.161  9.517   7.522   1.00 42.79  ? 330  VAL A CG1 1 
ATOM   2507 C CG2 . VAL A 1 330 ? 16.798  10.267  7.201   1.00 45.06  ? 330  VAL A CG2 1 
ATOM   2508 N N   . VAL A 1 331 ? 17.501  13.161  9.428   1.00 44.42  ? 331  VAL A N   1 
ATOM   2509 C CA  . VAL A 1 331 ? 16.605  14.345  9.387   1.00 45.56  ? 331  VAL A CA  1 
ATOM   2510 C C   . VAL A 1 331 ? 16.243  14.696  7.943   1.00 47.14  ? 331  VAL A C   1 
ATOM   2511 O O   . VAL A 1 331 ? 16.841  14.176  6.997   1.00 47.15  ? 331  VAL A O   1 
ATOM   2512 C CB  . VAL A 1 331 ? 17.201  15.586  10.097  1.00 44.53  ? 331  VAL A CB  1 
ATOM   2513 C CG1 . VAL A 1 331 ? 17.427  15.293  11.573  1.00 41.04  ? 331  VAL A CG1 1 
ATOM   2514 C CG2 . VAL A 1 331 ? 18.494  16.098  9.405   1.00 44.03  ? 331  VAL A CG2 1 
ATOM   2515 N N   . LYS A 1 332 ? 15.256  15.568  7.777   1.00 49.07  ? 332  LYS A N   1 
ATOM   2516 C CA  . LYS A 1 332 ? 14.736  15.891  6.451   1.00 50.37  ? 332  LYS A CA  1 
ATOM   2517 C C   . LYS A 1 332 ? 15.781  16.550  5.544   1.00 49.66  ? 332  LYS A C   1 
ATOM   2518 O O   . LYS A 1 332 ? 15.839  16.235  4.352   1.00 50.48  ? 332  LYS A O   1 
ATOM   2519 C CB  . LYS A 1 332 ? 13.492  16.779  6.569   1.00 52.06  ? 332  LYS A CB  1 
ATOM   2520 C CG  . LYS A 1 332 ? 12.689  16.973  5.284   1.00 54.26  ? 332  LYS A CG  1 
ATOM   2521 C CD  . LYS A 1 332 ? 11.471  17.845  5.576   1.00 59.64  ? 332  LYS A CD  1 
ATOM   2522 C CE  . LYS A 1 332 ? 10.552  17.980  4.358   1.00 63.76  ? 332  LYS A CE  1 
ATOM   2523 N NZ  . LYS A 1 332 ? 9.095   17.938  4.745   1.00 69.00  ? 332  LYS A NZ  1 
ATOM   2524 N N   . ASP A 1 333 ? 16.613  17.443  6.089   1.00 48.65  ? 333  ASP A N   1 
ATOM   2525 C CA  . ASP A 1 333 ? 17.587  18.185  5.267   1.00 47.23  ? 333  ASP A CA  1 
ATOM   2526 C C   . ASP A 1 333 ? 19.026  18.030  5.759   1.00 46.61  ? 333  ASP A C   1 
ATOM   2527 O O   . ASP A 1 333 ? 19.648  18.979  6.268   1.00 45.89  ? 333  ASP A O   1 
ATOM   2528 C CB  . ASP A 1 333 ? 17.195  19.663  5.145   1.00 47.57  ? 333  ASP A CB  1 
ATOM   2529 C CG  . ASP A 1 333 ? 15.758  19.855  4.642   1.00 47.80  ? 333  ASP A CG  1 
ATOM   2530 O OD1 . ASP A 1 333 ? 14.818  19.747  5.442   1.00 47.27  ? 333  ASP A OD1 1 
ATOM   2531 O OD2 . ASP A 1 333 ? 15.558  20.106  3.443   1.00 46.89  ? 333  ASP A OD2 1 
ATOM   2532 N N   . GLU A 1 334 ? 19.574  16.834  5.555   1.00 45.82  ? 334  GLU A N   1 
ATOM   2533 C CA  . GLU A 1 334 ? 20.906  16.512  6.067   1.00 45.04  ? 334  GLU A CA  1 
ATOM   2534 C C   . GLU A 1 334 ? 22.033  17.416  5.534   1.00 44.57  ? 334  GLU A C   1 
ATOM   2535 O O   . GLU A 1 334 ? 22.962  17.751  6.268   1.00 44.28  ? 334  GLU A O   1 
ATOM   2536 C CB  . GLU A 1 334 ? 21.224  15.048  5.791   1.00 45.31  ? 334  GLU A CB  1 
ATOM   2537 C CG  . GLU A 1 334 ? 20.390  14.057  6.593   1.00 45.83  ? 334  GLU A CG  1 
ATOM   2538 C CD  . GLU A 1 334 ? 20.809  13.963  8.063   1.00 47.10  ? 334  GLU A CD  1 
ATOM   2539 O OE1 . GLU A 1 334 ? 21.778  14.643  8.472   1.00 45.80  ? 334  GLU A OE1 1 
ATOM   2540 O OE2 . GLU A 1 334 ? 20.168  13.191  8.814   1.00 46.67  ? 334  GLU A OE2 1 
ATOM   2541 N N   . GLY A 1 335 ? 21.931  17.860  4.285   1.00 44.59  ? 335  GLY A N   1 
ATOM   2542 C CA  . GLY A 1 335 ? 23.024  18.580  3.655   1.00 44.44  ? 335  GLY A CA  1 
ATOM   2543 C C   . GLY A 1 335 ? 23.123  20.088  3.825   1.00 44.54  ? 335  GLY A C   1 
ATOM   2544 O O   . GLY A 1 335 ? 24.207  20.645  3.648   1.00 44.43  ? 335  GLY A O   1 
ATOM   2545 N N   . SER A 1 336 ? 22.025  20.753  4.173   1.00 44.98  ? 336  SER A N   1 
ATOM   2546 C CA  . SER A 1 336 ? 21.968  22.235  4.125   1.00 46.35  ? 336  SER A CA  1 
ATOM   2547 C C   . SER A 1 336 ? 22.975  22.943  5.047   1.00 46.44  ? 336  SER A C   1 
ATOM   2548 O O   . SER A 1 336 ? 23.624  23.912  4.631   1.00 46.28  ? 336  SER A O   1 
ATOM   2549 C CB  . SER A 1 336 ? 20.545  22.731  4.393   1.00 46.25  ? 336  SER A CB  1 
ATOM   2550 O OG  . SER A 1 336 ? 20.087  22.306  5.667   1.00 46.84  ? 336  SER A OG  1 
ATOM   2551 N N   . TYR A 1 337 ? 23.103  22.453  6.283   1.00 47.03  ? 337  TYR A N   1 
ATOM   2552 C CA  . TYR A 1 337 ? 24.091  22.967  7.266   1.00 48.03  ? 337  TYR A CA  1 
ATOM   2553 C C   . TYR A 1 337 ? 25.487  23.136  6.673   1.00 47.66  ? 337  TYR A C   1 
ATOM   2554 O O   . TYR A 1 337 ? 26.163  24.141  6.890   1.00 47.68  ? 337  TYR A O   1 
ATOM   2555 C CB  . TYR A 1 337 ? 24.184  22.019  8.482   1.00 48.59  ? 337  TYR A CB  1 
ATOM   2556 C CG  . TYR A 1 337 ? 25.132  22.478  9.562   1.00 49.80  ? 337  TYR A CG  1 
ATOM   2557 C CD1 . TYR A 1 337 ? 24.724  23.362  10.550  1.00 51.46  ? 337  TYR A CD1 1 
ATOM   2558 C CD2 . TYR A 1 337 ? 26.440  22.006  9.615   1.00 51.45  ? 337  TYR A CD2 1 
ATOM   2559 C CE1 . TYR A 1 337 ? 25.597  23.782  11.579  1.00 51.34  ? 337  TYR A CE1 1 
ATOM   2560 C CE2 . TYR A 1 337 ? 27.329  22.428  10.629  1.00 52.62  ? 337  TYR A CE2 1 
ATOM   2561 C CZ  . TYR A 1 337 ? 26.902  23.325  11.607  1.00 52.68  ? 337  TYR A CZ  1 
ATOM   2562 O OH  . TYR A 1 337 ? 27.789  23.752  12.620  1.00 53.96  ? 337  TYR A OH  1 
ATOM   2563 N N   . PHE A 1 338 ? 25.901  22.140  5.908   1.00 47.13  ? 338  PHE A N   1 
ATOM   2564 C CA  . PHE A 1 338 ? 27.268  22.079  5.408   1.00 47.06  ? 338  PHE A CA  1 
ATOM   2565 C C   . PHE A 1 338 ? 27.567  23.022  4.235   1.00 47.75  ? 338  PHE A C   1 
ATOM   2566 O O   . PHE A 1 338 ? 28.739  23.347  3.982   1.00 47.23  ? 338  PHE A O   1 
ATOM   2567 C CB  . PHE A 1 338 ? 27.566  20.636  5.022   1.00 46.76  ? 338  PHE A CB  1 
ATOM   2568 C CG  . PHE A 1 338 ? 27.539  19.709  6.193   1.00 46.50  ? 338  PHE A CG  1 
ATOM   2569 C CD1 . PHE A 1 338 ? 26.365  19.064  6.560   1.00 46.40  ? 338  PHE A CD1 1 
ATOM   2570 C CD2 . PHE A 1 338 ? 28.678  19.523  6.964   1.00 44.60  ? 338  PHE A CD2 1 
ATOM   2571 C CE1 . PHE A 1 338 ? 26.328  18.225  7.672   1.00 46.29  ? 338  PHE A CE1 1 
ATOM   2572 C CE2 . PHE A 1 338 ? 28.653  18.685  8.063   1.00 44.79  ? 338  PHE A CE2 1 
ATOM   2573 C CZ  . PHE A 1 338 ? 27.481  18.028  8.416   1.00 45.36  ? 338  PHE A CZ  1 
ATOM   2574 N N   . LEU A 1 339 ? 26.518  23.470  3.537   1.00 47.66  ? 339  LEU A N   1 
ATOM   2575 C CA  . LEU A 1 339 ? 26.692  24.280  2.327   1.00 48.74  ? 339  LEU A CA  1 
ATOM   2576 C C   . LEU A 1 339 ? 27.301  25.653  2.604   1.00 49.62  ? 339  LEU A C   1 
ATOM   2577 O O   . LEU A 1 339 ? 28.076  26.155  1.798   1.00 50.26  ? 339  LEU A O   1 
ATOM   2578 C CB  . LEU A 1 339 ? 25.362  24.446  1.581   1.00 48.79  ? 339  LEU A CB  1 
ATOM   2579 C CG  . LEU A 1 339 ? 24.671  23.141  1.171   1.00 48.57  ? 339  LEU A CG  1 
ATOM   2580 C CD1 . LEU A 1 339 ? 23.415  23.430  0.393   1.00 47.77  ? 339  LEU A CD1 1 
ATOM   2581 C CD2 . LEU A 1 339 ? 25.611  22.243  0.380   1.00 48.01  ? 339  LEU A CD2 1 
ATOM   2582 N N   . VAL A 1 340 ? 26.952  26.250  3.741   1.00 50.28  ? 340  VAL A N   1 
ATOM   2583 C CA  . VAL A 1 340 ? 27.454  27.576  4.109   1.00 51.67  ? 340  VAL A CA  1 
ATOM   2584 C C   . VAL A 1 340 ? 28.929  27.566  4.534   1.00 52.33  ? 340  VAL A C   1 
ATOM   2585 O O   . VAL A 1 340 ? 29.537  28.622  4.676   1.00 53.11  ? 340  VAL A O   1 
ATOM   2586 C CB  . VAL A 1 340 ? 26.563  28.233  5.205   1.00 51.98  ? 340  VAL A CB  1 
ATOM   2587 C CG1 . VAL A 1 340 ? 25.125  28.360  4.701   1.00 52.33  ? 340  VAL A CG1 1 
ATOM   2588 C CG2 . VAL A 1 340 ? 26.580  27.426  6.502   1.00 51.20  ? 340  VAL A CG2 1 
ATOM   2589 N N   . TYR A 1 341 ? 29.510  26.373  4.702   1.00 52.64  ? 341  TYR A N   1 
ATOM   2590 C CA  . TYR A 1 341 ? 30.910  26.231  5.117   1.00 53.03  ? 341  TYR A CA  1 
ATOM   2591 C C   . TYR A 1 341 ? 31.865  26.013  3.957   1.00 53.57  ? 341  TYR A C   1 
ATOM   2592 O O   . TYR A 1 341 ? 32.971  25.519  4.158   1.00 54.58  ? 341  TYR A O   1 
ATOM   2593 C CB  . TYR A 1 341 ? 31.064  25.066  6.121   1.00 52.94  ? 341  TYR A CB  1 
ATOM   2594 C CG  . TYR A 1 341 ? 30.587  25.434  7.495   1.00 53.30  ? 341  TYR A CG  1 
ATOM   2595 C CD1 . TYR A 1 341 ? 29.267  25.188  7.889   1.00 53.39  ? 341  TYR A CD1 1 
ATOM   2596 C CD2 . TYR A 1 341 ? 31.431  26.086  8.381   1.00 53.95  ? 341  TYR A CD2 1 
ATOM   2597 C CE1 . TYR A 1 341 ? 28.819  25.562  9.142   1.00 53.45  ? 341  TYR A CE1 1 
ATOM   2598 C CE2 . TYR A 1 341 ? 31.001  26.460  9.631   1.00 54.59  ? 341  TYR A CE2 1 
ATOM   2599 C CZ  . TYR A 1 341 ? 29.689  26.201  10.014  1.00 54.81  ? 341  TYR A CZ  1 
ATOM   2600 O OH  . TYR A 1 341 ? 29.265  26.575  11.275  1.00 54.77  ? 341  TYR A OH  1 
ATOM   2601 N N   . GLY A 1 342 ? 31.473  26.360  2.741   1.00 53.85  ? 342  GLY A N   1 
ATOM   2602 C CA  . GLY A 1 342 ? 32.404  26.196  1.626   1.00 53.64  ? 342  GLY A CA  1 
ATOM   2603 C C   . GLY A 1 342 ? 31.875  26.085  0.213   1.00 53.11  ? 342  GLY A C   1 
ATOM   2604 O O   . GLY A 1 342 ? 32.674  25.993  -0.705  1.00 53.58  ? 342  GLY A O   1 
ATOM   2605 N N   . VAL A 1 343 ? 30.559  26.073  0.001   1.00 52.26  ? 343  VAL A N   1 
ATOM   2606 C CA  . VAL A 1 343 ? 30.071  26.128  -1.372  1.00 52.03  ? 343  VAL A CA  1 
ATOM   2607 C C   . VAL A 1 343 ? 29.786  27.586  -1.744  1.00 52.95  ? 343  VAL A C   1 
ATOM   2608 O O   . VAL A 1 343 ? 28.860  28.209  -1.202  1.00 52.61  ? 343  VAL A O   1 
ATOM   2609 C CB  . VAL A 1 343 ? 28.857  25.239  -1.624  1.00 51.46  ? 343  VAL A CB  1 
ATOM   2610 C CG1 . VAL A 1 343 ? 28.562  25.197  -3.105  1.00 50.18  ? 343  VAL A CG1 1 
ATOM   2611 C CG2 . VAL A 1 343 ? 29.113  23.835  -1.114  1.00 51.28  ? 343  VAL A CG2 1 
ATOM   2612 N N   . PRO A 1 344 ? 30.572  28.141  -2.684  1.00 53.63  ? 344  PRO A N   1 
ATOM   2613 C CA  . PRO A 1 344 ? 30.274  29.513  -3.044  1.00 54.49  ? 344  PRO A CA  1 
ATOM   2614 C C   . PRO A 1 344 ? 28.818  29.660  -3.500  1.00 54.60  ? 344  PRO A C   1 
ATOM   2615 O O   . PRO A 1 344 ? 28.314  28.834  -4.269  1.00 54.35  ? 344  PRO A O   1 
ATOM   2616 C CB  . PRO A 1 344 ? 31.255  29.794  -4.189  1.00 55.51  ? 344  PRO A CB  1 
ATOM   2617 C CG  . PRO A 1 344 ? 32.384  28.836  -3.950  1.00 54.86  ? 344  PRO A CG  1 
ATOM   2618 C CD  . PRO A 1 344 ? 31.700  27.607  -3.466  1.00 53.93  ? 344  PRO A CD  1 
ATOM   2619 N N   . GLY A 1 345 ? 28.160  30.690  -2.984  1.00 54.71  ? 345  GLY A N   1 
ATOM   2620 C CA  . GLY A 1 345 ? 26.793  30.997  -3.322  1.00 55.20  ? 345  GLY A CA  1 
ATOM   2621 C C   . GLY A 1 345 ? 25.843  30.815  -2.166  1.00 54.63  ? 345  GLY A C   1 
ATOM   2622 O O   . GLY A 1 345 ? 24.737  31.347  -2.197  1.00 54.64  ? 345  GLY A O   1 
ATOM   2623 N N   . PHE A 1 346 ? 26.267  30.062  -1.149  1.00 53.67  ? 346  PHE A N   1 
ATOM   2624 C CA  . PHE A 1 346 ? 25.411  29.737  -0.013  1.00 53.35  ? 346  PHE A CA  1 
ATOM   2625 C C   . PHE A 1 346 ? 25.707  30.591  1.230   1.00 53.98  ? 346  PHE A C   1 
ATOM   2626 O O   . PHE A 1 346 ? 26.857  30.834  1.579   1.00 54.46  ? 346  PHE A O   1 
ATOM   2627 C CB  . PHE A 1 346 ? 25.513  28.242  0.296   1.00 52.31  ? 346  PHE A CB  1 
ATOM   2628 C CG  . PHE A 1 346 ? 24.941  27.354  -0.809  1.00 51.36  ? 346  PHE A CG  1 
ATOM   2629 C CD1 . PHE A 1 346 ? 25.687  27.049  -1.924  1.00 50.18  ? 346  PHE A CD1 1 
ATOM   2630 C CD2 . PHE A 1 346 ? 23.653  26.837  -0.711  1.00 50.67  ? 346  PHE A CD2 1 
ATOM   2631 C CE1 . PHE A 1 346 ? 25.160  26.252  -2.934  1.00 50.85  ? 346  PHE A CE1 1 
ATOM   2632 C CE2 . PHE A 1 346 ? 23.127  26.051  -1.711  1.00 50.66  ? 346  PHE A CE2 1 
ATOM   2633 C CZ  . PHE A 1 346 ? 23.884  25.757  -2.824  1.00 50.55  ? 346  PHE A CZ  1 
ATOM   2634 N N   . SER A 1 347 ? 24.643  31.062  1.874   1.00 54.70  ? 347  SER A N   1 
ATOM   2635 C CA  . SER A 1 347 ? 24.739  31.926  3.047   1.00 55.18  ? 347  SER A CA  1 
ATOM   2636 C C   . SER A 1 347 ? 23.520  31.783  3.925   1.00 55.23  ? 347  SER A C   1 
ATOM   2637 O O   . SER A 1 347 ? 22.411  31.524  3.437   1.00 55.48  ? 347  SER A O   1 
ATOM   2638 C CB  . SER A 1 347 ? 24.836  33.392  2.629   1.00 56.74  ? 347  SER A CB  1 
ATOM   2639 O OG  . SER A 1 347 ? 25.041  34.216  3.764   1.00 57.71  ? 347  SER A OG  1 
ATOM   2640 N N   . LYS A 1 348 ? 23.717  31.988  5.220   1.00 55.22  ? 348  LYS A N   1 
ATOM   2641 C CA  . LYS A 1 348 ? 22.602  32.033  6.152   1.00 55.90  ? 348  LYS A CA  1 
ATOM   2642 C C   . LYS A 1 348 ? 21.803  33.326  5.991   1.00 56.93  ? 348  LYS A C   1 
ATOM   2643 O O   . LYS A 1 348 ? 20.659  33.388  6.413   1.00 57.19  ? 348  LYS A O   1 
ATOM   2644 C CB  . LYS A 1 348 ? 23.084  31.896  7.605   1.00 55.75  ? 348  LYS A CB  1 
ATOM   2645 C CG  . LYS A 1 348 ? 23.534  33.202  8.234   1.00 58.22  ? 348  LYS A CG  1 
ATOM   2646 C CD  . LYS A 1 348 ? 23.906  33.042  9.689   1.00 59.70  ? 348  LYS A CD  1 
ATOM   2647 C CE  . LYS A 1 348 ? 24.045  34.408  10.363  1.00 61.99  ? 348  LYS A CE  1 
ATOM   2648 N NZ  . LYS A 1 348 ? 22.739  35.156  10.399  1.00 63.08  ? 348  LYS A NZ  1 
ATOM   2649 N N   . ASP A 1 349 ? 22.414  34.343  5.380   1.00 57.97  ? 349  ASP A N   1 
ATOM   2650 C CA  . ASP A 1 349 ? 21.881  35.713  5.371   1.00 59.80  ? 349  ASP A CA  1 
ATOM   2651 C C   . ASP A 1 349 ? 21.105  36.084  4.100   1.00 60.87  ? 349  ASP A C   1 
ATOM   2652 O O   . ASP A 1 349 ? 20.627  37.200  3.978   1.00 61.75  ? 349  ASP A O   1 
ATOM   2653 C CB  . ASP A 1 349 ? 23.024  36.712  5.604   1.00 60.44  ? 349  ASP A CB  1 
ATOM   2654 C CG  . ASP A 1 349 ? 23.639  36.580  6.992   1.00 61.44  ? 349  ASP A CG  1 
ATOM   2655 O OD1 . ASP A 1 349 ? 22.855  36.465  7.962   1.00 62.34  ? 349  ASP A OD1 1 
ATOM   2656 O OD2 . ASP A 1 349 ? 24.898  36.574  7.113   1.00 61.62  ? 349  ASP A OD2 1 
ATOM   2657 N N   . ASN A 1 350 ? 20.995  35.150  3.157   1.00 60.73  ? 350  ASN A N   1 
ATOM   2658 C CA  . ASN A 1 350 ? 20.078  35.293  2.027   1.00 62.01  ? 350  ASN A CA  1 
ATOM   2659 C C   . ASN A 1 350 ? 19.489  33.928  1.643   1.00 60.52  ? 350  ASN A C   1 
ATOM   2660 O O   . ASN A 1 350 ? 19.790  32.918  2.287   1.00 58.33  ? 350  ASN A O   1 
ATOM   2661 C CB  . ASN A 1 350 ? 20.759  36.016  0.836   1.00 63.12  ? 350  ASN A CB  1 
ATOM   2662 C CG  . ASN A 1 350 ? 21.947  35.258  0.270   1.00 65.38  ? 350  ASN A CG  1 
ATOM   2663 O OD1 . ASN A 1 350 ? 21.936  34.030  0.195   1.00 65.12  ? 350  ASN A OD1 1 
ATOM   2664 N ND2 . ASN A 1 350 ? 22.974  36.009  -0.172  1.00 73.20  ? 350  ASN A ND2 1 
ATOM   2665 N N   . GLU A 1 351 ? 18.650  33.908  0.604   1.00 60.68  ? 351  GLU A N   1 
ATOM   2666 C CA  . GLU A 1 351 ? 17.986  32.677  0.168   1.00 60.36  ? 351  GLU A CA  1 
ATOM   2667 C C   . GLU A 1 351 ? 18.901  31.714  -0.579  1.00 58.42  ? 351  GLU A C   1 
ATOM   2668 O O   . GLU A 1 351 ? 18.480  30.611  -0.889  1.00 57.61  ? 351  GLU A O   1 
ATOM   2669 C CB  . GLU A 1 351 ? 16.766  32.973  -0.715  1.00 62.40  ? 351  GLU A CB  1 
ATOM   2670 C CG  . GLU A 1 351 ? 15.785  34.005  -0.164  1.00 66.36  ? 351  GLU A CG  1 
ATOM   2671 C CD  . GLU A 1 351 ? 15.365  33.714  1.265   1.00 71.51  ? 351  GLU A CD  1 
ATOM   2672 O OE1 . GLU A 1 351 ? 15.215  32.511  1.643   1.00 71.63  ? 351  GLU A OE1 1 
ATOM   2673 O OE2 . GLU A 1 351 ? 15.183  34.710  2.011   1.00 76.87  ? 351  GLU A OE2 1 
ATOM   2674 N N   . SER A 1 352 ? 20.135  32.121  -0.879  1.00 57.20  ? 352  SER A N   1 
ATOM   2675 C CA  . SER A 1 352 ? 21.126  31.210  -1.459  1.00 55.63  ? 352  SER A CA  1 
ATOM   2676 C C   . SER A 1 352 ? 20.629  30.640  -2.777  1.00 55.48  ? 352  SER A C   1 
ATOM   2677 O O   . SER A 1 352 ? 20.849  29.477  -3.081  1.00 54.20  ? 352  SER A O   1 
ATOM   2678 C CB  . SER A 1 352 ? 21.463  30.072  -0.491  1.00 54.34  ? 352  SER A CB  1 
ATOM   2679 O OG  . SER A 1 352 ? 22.092  30.562  0.677   1.00 54.38  ? 352  SER A OG  1 
ATOM   2680 N N   . LEU A 1 353 ? 19.938  31.472  -3.557  1.00 55.64  ? 353  LEU A N   1 
ATOM   2681 C CA  . LEU A 1 353 ? 19.506  31.071  -4.880  1.00 55.82  ? 353  LEU A CA  1 
ATOM   2682 C C   . LEU A 1 353 ? 20.764  31.060  -5.733  1.00 55.51  ? 353  LEU A C   1 
ATOM   2683 O O   . LEU A 1 353 ? 21.402  32.096  -5.901  1.00 57.54  ? 353  LEU A O   1 
ATOM   2684 C CB  . LEU A 1 353 ? 18.497  32.066  -5.432  1.00 57.12  ? 353  LEU A CB  1 
ATOM   2685 C CG  . LEU A 1 353 ? 17.192  32.190  -4.656  1.00 57.09  ? 353  LEU A CG  1 
ATOM   2686 C CD1 . LEU A 1 353 ? 16.338  33.256  -5.315  1.00 58.91  ? 353  LEU A CD1 1 
ATOM   2687 C CD2 . LEU A 1 353 ? 16.437  30.872  -4.575  1.00 55.15  ? 353  LEU A CD2 1 
ATOM   2688 N N   . ILE A 1 354 ? 21.150  29.893  -6.231  1.00 53.46  ? 354  ILE A N   1 
ATOM   2689 C CA  . ILE A 1 354 ? 22.403  29.766  -6.969  1.00 52.26  ? 354  ILE A CA  1 
ATOM   2690 C C   . ILE A 1 354 ? 22.162  29.558  -8.451  1.00 52.75  ? 354  ILE A C   1 
ATOM   2691 O O   . ILE A 1 354 ? 21.055  29.223  -8.872  1.00 53.09  ? 354  ILE A O   1 
ATOM   2692 C CB  . ILE A 1 354 ? 23.299  28.609  -6.410  1.00 50.68  ? 354  ILE A CB  1 
ATOM   2693 C CG1 . ILE A 1 354 ? 22.500  27.308  -6.263  1.00 49.09  ? 354  ILE A CG1 1 
ATOM   2694 C CG2 . ILE A 1 354 ? 23.876  29.012  -5.073  1.00 49.18  ? 354  ILE A CG2 1 
ATOM   2695 C CD1 . ILE A 1 354 ? 23.314  26.043  -6.458  1.00 48.73  ? 354  ILE A CD1 1 
ATOM   2696 N N   . SER A 1 355 ? 23.216  29.764  -9.233  1.00 52.64  ? 355  SER A N   1 
ATOM   2697 C CA  . SER A 1 355 ? 23.199  29.483  -10.661 1.00 53.30  ? 355  SER A CA  1 
ATOM   2698 C C   . SER A 1 355 ? 23.577  28.034  -10.939 1.00 52.51  ? 355  SER A C   1 
ATOM   2699 O O   . SER A 1 355 ? 24.080  27.317  -10.068 1.00 51.59  ? 355  SER A O   1 
ATOM   2700 C CB  . SER A 1 355 ? 24.198  30.390  -11.384 1.00 54.17  ? 355  SER A CB  1 
ATOM   2701 O OG  . SER A 1 355 ? 25.532  30.062  -11.017 1.00 52.95  ? 355  SER A OG  1 
ATOM   2702 N N   . ARG A 1 356 ? 23.380  27.620  -12.181 1.00 53.43  ? 356  ARG A N   1 
ATOM   2703 C CA  . ARG A 1 356 ? 23.806  26.298  -12.621 1.00 53.51  ? 356  ARG A CA  1 
ATOM   2704 C C   . ARG A 1 356 ? 25.342  26.130  -12.550 1.00 52.59  ? 356  ARG A C   1 
ATOM   2705 O O   . ARG A 1 356 ? 25.842  25.081  -12.155 1.00 50.78  ? 356  ARG A O   1 
ATOM   2706 C CB  . ARG A 1 356 ? 23.289  26.023  -14.037 1.00 55.43  ? 356  ARG A CB  1 
ATOM   2707 C CG  . ARG A 1 356 ? 23.478  24.582  -14.438 1.00 57.69  ? 356  ARG A CG  1 
ATOM   2708 C CD  . ARG A 1 356 ? 22.536  24.101  -15.521 1.00 61.39  ? 356  ARG A CD  1 
ATOM   2709 N NE  . ARG A 1 356 ? 22.809  22.680  -15.743 1.00 62.81  ? 356  ARG A NE  1 
ATOM   2710 C CZ  . ARG A 1 356 ? 22.384  21.687  -14.961 1.00 62.30  ? 356  ARG A CZ  1 
ATOM   2711 N NH1 . ARG A 1 356 ? 21.600  21.934  -13.921 1.00 62.96  ? 356  ARG A NH1 1 
ATOM   2712 N NH2 . ARG A 1 356 ? 22.720  20.432  -15.245 1.00 61.70  ? 356  ARG A NH2 1 
ATOM   2713 N N   . ALA A 1 357 ? 26.082  27.179  -12.903 1.00 52.74  ? 357  ALA A N   1 
ATOM   2714 C CA  . ALA A 1 357 ? 27.545  27.150  -12.769 1.00 52.46  ? 357  ALA A CA  1 
ATOM   2715 C C   . ALA A 1 357 ? 27.952  26.887  -11.326 1.00 51.11  ? 357  ALA A C   1 
ATOM   2716 O O   . ALA A 1 357 ? 28.835  26.081  -11.065 1.00 50.00  ? 357  ALA A O   1 
ATOM   2717 C CB  . ALA A 1 357 ? 28.185  28.463  -13.289 1.00 53.48  ? 357  ALA A CB  1 
ATOM   2718 N N   . GLN A 1 358 ? 27.292  27.565  -10.394 1.00 51.14  ? 358  GLN A N   1 
ATOM   2719 C CA  . GLN A 1 358 ? 27.530  27.359  -8.969  1.00 50.43  ? 358  GLN A CA  1 
ATOM   2720 C C   . GLN A 1 358 ? 27.103  25.979  -8.451  1.00 49.75  ? 358  GLN A C   1 
ATOM   2721 O O   . GLN A 1 358 ? 27.699  25.463  -7.510  1.00 48.90  ? 358  GLN A O   1 
ATOM   2722 C CB  . GLN A 1 358 ? 26.846  28.457  -8.157  1.00 50.64  ? 358  GLN A CB  1 
ATOM   2723 C CG  . GLN A 1 358 ? 27.468  29.832  -8.341  1.00 52.37  ? 358  GLN A CG  1 
ATOM   2724 C CD  . GLN A 1 358 ? 26.689  30.926  -7.623  1.00 54.97  ? 358  GLN A CD  1 
ATOM   2725 O OE1 . GLN A 1 358 ? 25.455  30.961  -7.665  1.00 55.81  ? 358  GLN A OE1 1 
ATOM   2726 N NE2 . GLN A 1 358 ? 27.409  31.830  -6.964  1.00 54.79  ? 358  GLN A NE2 1 
ATOM   2727 N N   . PHE A 1 359 ? 26.082  25.383  -9.062  1.00 50.41  ? 359  PHE A N   1 
ATOM   2728 C CA  . PHE A 1 359 ? 25.721  23.990  -8.770  1.00 49.76  ? 359  PHE A CA  1 
ATOM   2729 C C   . PHE A 1 359 ? 26.817  23.014  -9.200  1.00 49.99  ? 359  PHE A C   1 
ATOM   2730 O O   . PHE A 1 359 ? 27.206  22.147  -8.431  1.00 48.73  ? 359  PHE A O   1 
ATOM   2731 C CB  . PHE A 1 359 ? 24.400  23.622  -9.446  1.00 50.10  ? 359  PHE A CB  1 
ATOM   2732 C CG  . PHE A 1 359 ? 23.978  22.191  -9.248  1.00 49.52  ? 359  PHE A CG  1 
ATOM   2733 C CD1 . PHE A 1 359 ? 23.868  21.326  -10.330 1.00 50.36  ? 359  PHE A CD1 1 
ATOM   2734 C CD2 . PHE A 1 359 ? 23.663  21.714  -7.998  1.00 49.77  ? 359  PHE A CD2 1 
ATOM   2735 C CE1 . PHE A 1 359 ? 23.456  19.996  -10.166 1.00 50.46  ? 359  PHE A CE1 1 
ATOM   2736 C CE2 . PHE A 1 359 ? 23.247  20.373  -7.824  1.00 50.86  ? 359  PHE A CE2 1 
ATOM   2737 C CZ  . PHE A 1 359 ? 23.152  19.519  -8.916  1.00 49.45  ? 359  PHE A CZ  1 
ATOM   2738 N N   . LEU A 1 360 ? 27.301  23.137  -10.428 1.00 51.98  ? 360  LEU A N   1 
ATOM   2739 C CA  . LEU A 1 360 ? 28.354  22.228  -10.892 1.00 53.18  ? 360  LEU A CA  1 
ATOM   2740 C C   . LEU A 1 360 ? 29.625  22.376  -10.049 1.00 52.57  ? 360  LEU A C   1 
ATOM   2741 O O   . LEU A 1 360 ? 30.261  21.383  -9.725  1.00 52.59  ? 360  LEU A O   1 
ATOM   2742 C CB  . LEU A 1 360 ? 28.672  22.423  -12.380 1.00 54.73  ? 360  LEU A CB  1 
ATOM   2743 C CG  . LEU A 1 360 ? 27.550  22.450  -13.435 1.00 57.74  ? 360  LEU A CG  1 
ATOM   2744 C CD1 . LEU A 1 360 ? 28.149  22.310  -14.862 1.00 60.48  ? 360  LEU A CD1 1 
ATOM   2745 C CD2 . LEU A 1 360 ? 26.462  21.416  -13.223 1.00 58.95  ? 360  LEU A CD2 1 
ATOM   2746 N N   . ALA A 1 361 ? 29.985  23.608  -9.681  1.00 52.85  ? 361  ALA A N   1 
ATOM   2747 C CA  . ALA A 1 361 ? 31.170  23.846  -8.829  1.00 52.44  ? 361  ALA A CA  1 
ATOM   2748 C C   . ALA A 1 361 ? 30.963  23.245  -7.441  1.00 51.55  ? 361  ALA A C   1 
ATOM   2749 O O   . ALA A 1 361 ? 31.895  22.693  -6.836  1.00 50.90  ? 361  ALA A O   1 
ATOM   2750 C CB  . ALA A 1 361 ? 31.475  25.350  -8.721  1.00 52.85  ? 361  ALA A CB  1 
ATOM   2751 N N   . GLY A 1 362 ? 29.721  23.338  -6.958  1.00 50.69  ? 362  GLY A N   1 
ATOM   2752 C CA  . GLY A 1 362 ? 29.349  22.826  -5.656  1.00 49.68  ? 362  GLY A CA  1 
ATOM   2753 C C   . GLY A 1 362 ? 29.363  21.315  -5.579  1.00 49.37  ? 362  GLY A C   1 
ATOM   2754 O O   . GLY A 1 362 ? 29.694  20.754  -4.533  1.00 48.94  ? 362  GLY A O   1 
ATOM   2755 N N   . VAL A 1 363 ? 29.007  20.650  -6.675  1.00 49.72  ? 363  VAL A N   1 
ATOM   2756 C CA  . VAL A 1 363 ? 29.062  19.195  -6.716  1.00 49.67  ? 363  VAL A CA  1 
ATOM   2757 C C   . VAL A 1 363 ? 30.476  18.684  -6.542  1.00 49.99  ? 363  VAL A C   1 
ATOM   2758 O O   . VAL A 1 363 ? 30.675  17.653  -5.893  1.00 49.60  ? 363  VAL A O   1 
ATOM   2759 C CB  . VAL A 1 363 ? 28.437  18.603  -8.016  1.00 51.09  ? 363  VAL A CB  1 
ATOM   2760 C CG1 . VAL A 1 363 ? 28.859  17.122  -8.223  1.00 49.02  ? 363  VAL A CG1 1 
ATOM   2761 C CG2 . VAL A 1 363 ? 26.909  18.731  -7.967  1.00 50.01  ? 363  VAL A CG2 1 
ATOM   2762 N N   . ARG A 1 364 ? 31.465  19.396  -7.092  1.00 50.95  ? 364  ARG A N   1 
ATOM   2763 C CA  . ARG A 1 364 ? 32.864  18.942  -6.972  1.00 51.26  ? 364  ARG A CA  1 
ATOM   2764 C C   . ARG A 1 364 ? 33.383  19.074  -5.538  1.00 49.98  ? 364  ARG A C   1 
ATOM   2765 O O   . ARG A 1 364 ? 34.214  18.274  -5.099  1.00 49.95  ? 364  ARG A O   1 
ATOM   2766 C CB  . ARG A 1 364 ? 33.790  19.702  -7.928  1.00 52.61  ? 364  ARG A CB  1 
ATOM   2767 C CG  . ARG A 1 364 ? 33.399  19.642  -9.413  1.00 56.06  ? 364  ARG A CG  1 
ATOM   2768 C CD  . ARG A 1 364 ? 32.964  18.232  -9.871  1.00 59.31  ? 364  ARG A CD  1 
ATOM   2769 N NE  . ARG A 1 364 ? 34.025  17.217  -9.768  1.00 61.46  ? 364  ARG A NE  1 
ATOM   2770 C CZ  . ARG A 1 364 ? 34.932  16.952  -10.718 1.00 64.20  ? 364  ARG A CZ  1 
ATOM   2771 N NH1 . ARG A 1 364 ? 34.930  17.615  -11.880 1.00 65.37  ? 364  ARG A NH1 1 
ATOM   2772 N NH2 . ARG A 1 364 ? 35.840  15.998  -10.511 1.00 63.76  ? 364  ARG A NH2 1 
ATOM   2773 N N   . ILE A 1 365 ? 32.886  20.087  -4.833  1.00 48.81  ? 365  ILE A N   1 
ATOM   2774 C CA  . ILE A 1 365 ? 33.229  20.371  -3.440  1.00 47.72  ? 365  ILE A CA  1 
ATOM   2775 C C   . ILE A 1 365 ? 32.482  19.405  -2.500  1.00 47.39  ? 365  ILE A C   1 
ATOM   2776 O O   . ILE A 1 365 ? 33.042  18.922  -1.523  1.00 47.44  ? 365  ILE A O   1 
ATOM   2777 C CB  . ILE A 1 365 ? 32.889  21.851  -3.099  1.00 47.62  ? 365  ILE A CB  1 
ATOM   2778 C CG1 . ILE A 1 365 ? 33.796  22.802  -3.885  1.00 48.26  ? 365  ILE A CG1 1 
ATOM   2779 C CG2 . ILE A 1 365 ? 32.976  22.141  -1.593  1.00 45.45  ? 365  ILE A CG2 1 
ATOM   2780 C CD1 . ILE A 1 365 ? 33.286  24.242  -3.909  1.00 50.29  ? 365  ILE A CD1 1 
ATOM   2781 N N   . GLY A 1 366 ? 31.227  19.114  -2.816  1.00 47.27  ? 366  GLY A N   1 
ATOM   2782 C CA  . GLY A 1 366 ? 30.416  18.204  -2.019  1.00 47.25  ? 366  GLY A CA  1 
ATOM   2783 C C   . GLY A 1 366 ? 30.636  16.711  -2.253  1.00 47.50  ? 366  GLY A C   1 
ATOM   2784 O O   . GLY A 1 366 ? 30.213  15.893  -1.438  1.00 47.62  ? 366  GLY A O   1 
ATOM   2785 N N   . VAL A 1 367 ? 31.261  16.356  -3.376  1.00 47.86  ? 367  VAL A N   1 
ATOM   2786 C CA  . VAL A 1 367 ? 31.607  14.975  -3.692  1.00 47.46  ? 367  VAL A CA  1 
ATOM   2787 C C   . VAL A 1 367 ? 33.066  15.024  -4.135  1.00 47.97  ? 367  VAL A C   1 
ATOM   2788 O O   . VAL A 1 367 ? 33.367  14.852  -5.302  1.00 48.74  ? 367  VAL A O   1 
ATOM   2789 C CB  . VAL A 1 367 ? 30.709  14.409  -4.821  1.00 48.36  ? 367  VAL A CB  1 
ATOM   2790 C CG1 . VAL A 1 367 ? 30.841  12.886  -4.912  1.00 48.69  ? 367  VAL A CG1 1 
ATOM   2791 C CG2 . VAL A 1 367 ? 29.253  14.800  -4.610  1.00 47.19  ? 367  VAL A CG2 1 
ATOM   2792 N N   . PRO A 1 368 ? 33.979  15.307  -3.199  1.00 47.74  ? 368  PRO A N   1 
ATOM   2793 C CA  . PRO A 1 368 ? 35.356  15.643  -3.565  1.00 49.02  ? 368  PRO A CA  1 
ATOM   2794 C C   . PRO A 1 368 ? 36.194  14.488  -4.096  1.00 50.49  ? 368  PRO A C   1 
ATOM   2795 O O   . PRO A 1 368 ? 37.182  14.728  -4.762  1.00 50.62  ? 368  PRO A O   1 
ATOM   2796 C CB  . PRO A 1 368 ? 35.941  16.210  -2.262  1.00 48.23  ? 368  PRO A CB  1 
ATOM   2797 C CG  . PRO A 1 368 ? 35.120  15.655  -1.190  1.00 47.36  ? 368  PRO A CG  1 
ATOM   2798 C CD  . PRO A 1 368 ? 33.765  15.363  -1.743  1.00 46.85  ? 368  PRO A CD  1 
ATOM   2799 N N   . GLN A 1 369 ? 35.785  13.252  -3.826  1.00 51.86  ? 369  GLN A N   1 
ATOM   2800 C CA  . GLN A 1 369 ? 36.481  12.072  -4.370  1.00 54.07  ? 369  GLN A CA  1 
ATOM   2801 C C   . GLN A 1 369 ? 36.006  11.688  -5.767  1.00 55.72  ? 369  GLN A C   1 
ATOM   2802 O O   . GLN A 1 369 ? 36.600  10.832  -6.401  1.00 56.89  ? 369  GLN A O   1 
ATOM   2803 C CB  . GLN A 1 369 ? 36.327  10.873  -3.425  1.00 54.01  ? 369  GLN A CB  1 
ATOM   2804 C CG  . GLN A 1 369 ? 37.387  10.844  -2.298  1.00 55.00  ? 369  GLN A CG  1 
ATOM   2805 C CD  . GLN A 1 369 ? 37.229  11.971  -1.274  1.00 54.09  ? 369  GLN A CD  1 
ATOM   2806 O OE1 . GLN A 1 369 ? 38.037  12.908  -1.241  1.00 55.78  ? 369  GLN A OE1 1 
ATOM   2807 N NE2 . GLN A 1 369 ? 36.188  11.880  -0.436  1.00 48.42  ? 369  GLN A NE2 1 
ATOM   2808 N N   . ALA A 1 370 ? 34.934  12.318  -6.248  1.00 56.67  ? 370  ALA A N   1 
ATOM   2809 C CA  . ALA A 1 370 ? 34.356  11.974  -7.553  1.00 57.75  ? 370  ALA A CA  1 
ATOM   2810 C C   . ALA A 1 370 ? 35.241  12.393  -8.719  1.00 59.27  ? 370  ALA A C   1 
ATOM   2811 O O   . ALA A 1 370 ? 35.645  13.551  -8.817  1.00 59.27  ? 370  ALA A O   1 
ATOM   2812 C CB  . ALA A 1 370 ? 32.970  12.617  -7.708  1.00 57.17  ? 370  ALA A CB  1 
ATOM   2813 N N   . SER A 1 371 ? 35.499  11.452  -9.622  1.00 60.73  ? 371  SER A N   1 
ATOM   2814 C CA  . SER A 1 371 ? 36.072  11.758  -10.924 1.00 62.31  ? 371  SER A CA  1 
ATOM   2815 C C   . SER A 1 371 ? 35.146  12.684  -11.712 1.00 62.55  ? 371  SER A C   1 
ATOM   2816 O O   . SER A 1 371 ? 34.019  12.954  -11.293 1.00 61.63  ? 371  SER A O   1 
ATOM   2817 C CB  . SER A 1 371 ? 36.285  10.462  -11.712 1.00 63.80  ? 371  SER A CB  1 
ATOM   2818 O OG  . SER A 1 371 ? 35.061  9.757   -11.903 1.00 64.96  ? 371  SER A OG  1 
ATOM   2819 N N   . ASP A 1 372 ? 35.616  13.164  -12.858 1.00 63.71  ? 372  ASP A N   1 
ATOM   2820 C CA  . ASP A 1 372 ? 34.786  14.005  -13.728 1.00 64.41  ? 372  ASP A CA  1 
ATOM   2821 C C   . ASP A 1 372 ? 33.516  13.283  -14.182 1.00 64.04  ? 372  ASP A C   1 
ATOM   2822 O O   . ASP A 1 372 ? 32.442  13.878  -14.195 1.00 63.69  ? 372  ASP A O   1 
ATOM   2823 C CB  . ASP A 1 372 ? 35.565  14.477  -14.968 1.00 66.25  ? 372  ASP A CB  1 
ATOM   2824 C CG  . ASP A 1 372 ? 36.612  15.540  -14.653 1.00 67.82  ? 372  ASP A CG  1 
ATOM   2825 O OD1 . ASP A 1 372 ? 36.860  15.829  -13.466 1.00 69.86  ? 372  ASP A OD1 1 
ATOM   2826 O OD2 . ASP A 1 372 ? 37.201  16.085  -15.611 1.00 72.21  ? 372  ASP A OD2 1 
ATOM   2827 N N   . LEU A 1 373 ? 33.644  12.011  -14.563 1.00 64.37  ? 373  LEU A N   1 
ATOM   2828 C CA  . LEU A 1 373 ? 32.486  11.228  -15.015 1.00 64.51  ? 373  LEU A CA  1 
ATOM   2829 C C   . LEU A 1 373 ? 31.461  11.015  -13.895 1.00 62.42  ? 373  LEU A C   1 
ATOM   2830 O O   . LEU A 1 373 ? 30.263  11.199  -14.107 1.00 62.65  ? 373  LEU A O   1 
ATOM   2831 C CB  . LEU A 1 373 ? 32.919  9.875   -15.602 1.00 65.88  ? 373  LEU A CB  1 
ATOM   2832 C CG  . LEU A 1 373 ? 31.815  9.035   -16.270 1.00 67.51  ? 373  LEU A CG  1 
ATOM   2833 C CD1 . LEU A 1 373 ? 31.119  9.822   -17.383 1.00 68.02  ? 373  LEU A CD1 1 
ATOM   2834 C CD2 . LEU A 1 373 ? 32.355  7.716   -16.823 1.00 69.00  ? 373  LEU A CD2 1 
ATOM   2835 N N   . ALA A 1 374 ? 31.924  10.624  -12.710 1.00 60.62  ? 374  ALA A N   1 
ATOM   2836 C CA  . ALA A 1 374 ? 31.028  10.434  -11.563 1.00 58.68  ? 374  ALA A CA  1 
ATOM   2837 C C   . ALA A 1 374 ? 30.324  11.741  -11.218 1.00 57.40  ? 374  ALA A C   1 
ATOM   2838 O O   . ALA A 1 374 ? 29.139  11.746  -10.911 1.00 56.28  ? 374  ALA A O   1 
ATOM   2839 C CB  . ALA A 1 374 ? 31.792  9.904   -10.350 1.00 57.76  ? 374  ALA A CB  1 
ATOM   2840 N N   . ALA A 1 375 ? 31.059  12.847  -11.282 1.00 57.07  ? 375  ALA A N   1 
ATOM   2841 C CA  . ALA A 1 375 ? 30.500  14.161  -10.976 1.00 56.66  ? 375  ALA A CA  1 
ATOM   2842 C C   . ALA A 1 375 ? 29.423  14.509  -12.000 1.00 57.83  ? 375  ALA A C   1 
ATOM   2843 O O   . ALA A 1 375 ? 28.373  15.013  -11.642 1.00 57.54  ? 375  ALA A O   1 
ATOM   2844 C CB  . ALA A 1 375 ? 31.599  15.229  -10.946 1.00 55.97  ? 375  ALA A CB  1 
ATOM   2845 N N   . GLU A 1 376 ? 29.685  14.219  -13.275 1.00 59.70  ? 376  GLU A N   1 
ATOM   2846 C CA  . GLU A 1 376 ? 28.682  14.397  -14.334 1.00 60.97  ? 376  GLU A CA  1 
ATOM   2847 C C   . GLU A 1 376 ? 27.442  13.536  -14.059 1.00 59.29  ? 376  GLU A C   1 
ATOM   2848 O O   . GLU A 1 376 ? 26.322  14.001  -14.200 1.00 59.17  ? 376  GLU A O   1 
ATOM   2849 C CB  . GLU A 1 376 ? 29.280  14.113  -15.740 1.00 62.72  ? 376  GLU A CB  1 
ATOM   2850 C CG  . GLU A 1 376 ? 30.064  15.319  -16.345 1.00 65.19  ? 376  GLU A CG  1 
ATOM   2851 C CD  . GLU A 1 376 ? 30.735  15.040  -17.723 1.00 67.84  ? 376  GLU A CD  1 
ATOM   2852 O OE1 . GLU A 1 376 ? 31.695  14.216  -17.822 1.00 72.71  ? 376  GLU A OE1 1 
ATOM   2853 O OE2 . GLU A 1 376 ? 30.322  15.685  -18.720 1.00 73.83  ? 376  GLU A OE2 1 
ATOM   2854 N N   . ALA A 1 377 ? 27.646  12.290  -13.650 1.00 58.05  ? 377  ALA A N   1 
ATOM   2855 C CA  . ALA A 1 377 ? 26.534  11.411  -13.302 1.00 57.21  ? 377  ALA A CA  1 
ATOM   2856 C C   . ALA A 1 377 ? 25.693  11.973  -12.150 1.00 55.54  ? 377  ALA A C   1 
ATOM   2857 O O   . ALA A 1 377 ? 24.455  11.875  -12.166 1.00 55.78  ? 377  ALA A O   1 
ATOM   2858 C CB  . ALA A 1 377 ? 27.036  10.028  -12.957 1.00 57.14  ? 377  ALA A CB  1 
ATOM   2859 N N   . VAL A 1 378 ? 26.353  12.563  -11.156 1.00 53.71  ? 378  VAL A N   1 
ATOM   2860 C CA  . VAL A 1 378 ? 25.649  13.177  -10.024 1.00 51.74  ? 378  VAL A CA  1 
ATOM   2861 C C   . VAL A 1 378 ? 24.802  14.355  -10.512 1.00 52.11  ? 378  VAL A C   1 
ATOM   2862 O O   . VAL A 1 378 ? 23.601  14.434  -10.204 1.00 51.00  ? 378  VAL A O   1 
ATOM   2863 C CB  . VAL A 1 378 ? 26.621  13.672  -8.924  1.00 50.86  ? 378  VAL A CB  1 
ATOM   2864 C CG1 . VAL A 1 378 ? 25.882  14.562  -7.928  1.00 47.22  ? 378  VAL A CG1 1 
ATOM   2865 C CG2 . VAL A 1 378 ? 27.293  12.483  -8.217  1.00 48.65  ? 378  VAL A CG2 1 
ATOM   2866 N N   . VAL A 1 379 ? 25.420  15.253  -11.284 1.00 52.45  ? 379  VAL A N   1 
ATOM   2867 C CA  . VAL A 1 379 ? 24.704  16.428  -11.828 1.00 53.23  ? 379  VAL A CA  1 
ATOM   2868 C C   . VAL A 1 379 ? 23.476  16.059  -12.689 1.00 54.72  ? 379  VAL A C   1 
ATOM   2869 O O   . VAL A 1 379 ? 22.410  16.669  -12.582 1.00 54.44  ? 379  VAL A O   1 
ATOM   2870 C CB  . VAL A 1 379 ? 25.652  17.359  -12.632 1.00 53.77  ? 379  VAL A CB  1 
ATOM   2871 C CG1 . VAL A 1 379 ? 24.858  18.359  -13.472 1.00 54.58  ? 379  VAL A CG1 1 
ATOM   2872 C CG2 . VAL A 1 379 ? 26.605  18.103  -11.689 1.00 52.12  ? 379  VAL A CG2 1 
ATOM   2873 N N   . LEU A 1 380 ? 23.614  15.045  -13.527 1.00 56.38  ? 380  LEU A N   1 
ATOM   2874 C CA  . LEU A 1 380 ? 22.520  14.659  -14.404 1.00 57.91  ? 380  LEU A CA  1 
ATOM   2875 C C   . LEU A 1 380 ? 21.379  14.001  -13.620 1.00 57.74  ? 380  LEU A C   1 
ATOM   2876 O O   . LEU A 1 380 ? 20.199  14.199  -13.926 1.00 58.24  ? 380  LEU A O   1 
ATOM   2877 C CB  . LEU A 1 380 ? 23.046  13.771  -15.540 1.00 59.84  ? 380  LEU A CB  1 
ATOM   2878 C CG  . LEU A 1 380 ? 24.135  14.421  -16.441 1.00 61.49  ? 380  LEU A CG  1 
ATOM   2879 C CD1 . LEU A 1 380 ? 24.541  13.513  -17.606 1.00 63.99  ? 380  LEU A CD1 1 
ATOM   2880 C CD2 . LEU A 1 380 ? 23.719  15.791  -16.987 1.00 63.49  ? 380  LEU A CD2 1 
ATOM   2881 N N   . HIS A 1 381 ? 21.735  13.256  -12.583 1.00 56.57  ? 381  HIS A N   1 
ATOM   2882 C CA  . HIS A 1 381 ? 20.764  12.609  -11.717 1.00 56.50  ? 381  HIS A CA  1 
ATOM   2883 C C   . HIS A 1 381 ? 19.979  13.604  -10.852 1.00 55.31  ? 381  HIS A C   1 
ATOM   2884 O O   . HIS A 1 381 ? 18.795  13.399  -10.577 1.00 55.11  ? 381  HIS A O   1 
ATOM   2885 C CB  . HIS A 1 381 ? 21.486  11.616  -10.807 1.00 56.37  ? 381  HIS A CB  1 
ATOM   2886 C CG  . HIS A 1 381 ? 20.569  10.717  -10.050 1.00 58.43  ? 381  HIS A CG  1 
ATOM   2887 N ND1 . HIS A 1 381 ? 20.096  9.528   -10.570 1.00 62.29  ? 381  HIS A ND1 1 
ATOM   2888 C CD2 . HIS A 1 381 ? 20.029  10.833  -8.812  1.00 59.32  ? 381  HIS A CD2 1 
ATOM   2889 C CE1 . HIS A 1 381 ? 19.307  8.949   -9.677  1.00 63.10  ? 381  HIS A CE1 1 
ATOM   2890 N NE2 . HIS A 1 381 ? 19.247  9.722   -8.605  1.00 61.36  ? 381  HIS A NE2 1 
ATOM   2891 N N   . TYR A 1 382 ? 20.640  14.671  -10.418 1.00 53.81  ? 382  TYR A N   1 
ATOM   2892 C CA  . TYR A 1 382 ? 20.008  15.653  -9.535  1.00 53.24  ? 382  TYR A CA  1 
ATOM   2893 C C   . TYR A 1 382 ? 19.443  16.873  -10.249 1.00 53.83  ? 382  TYR A C   1 
ATOM   2894 O O   . TYR A 1 382 ? 18.744  17.653  -9.627  1.00 53.85  ? 382  TYR A O   1 
ATOM   2895 C CB  . TYR A 1 382 ? 20.978  16.091  -8.443  1.00 51.74  ? 382  TYR A CB  1 
ATOM   2896 C CG  . TYR A 1 382 ? 21.069  15.097  -7.325  1.00 50.91  ? 382  TYR A CG  1 
ATOM   2897 C CD1 . TYR A 1 382 ? 21.960  14.038  -7.380  1.00 50.86  ? 382  TYR A CD1 1 
ATOM   2898 C CD2 . TYR A 1 382 ? 20.246  15.208  -6.210  1.00 50.90  ? 382  TYR A CD2 1 
ATOM   2899 C CE1 . TYR A 1 382 ? 22.030  13.110  -6.361  1.00 50.28  ? 382  TYR A CE1 1 
ATOM   2900 C CE2 . TYR A 1 382 ? 20.305  14.291  -5.184  1.00 50.25  ? 382  TYR A CE2 1 
ATOM   2901 C CZ  . TYR A 1 382 ? 21.213  13.249  -5.255  1.00 50.46  ? 382  TYR A CZ  1 
ATOM   2902 O OH  . TYR A 1 382 ? 21.286  12.338  -4.225  1.00 49.70  ? 382  TYR A OH  1 
ATOM   2903 N N   . THR A 1 383 ? 19.731  17.035  -11.539 1.00 54.71  ? 383  THR A N   1 
ATOM   2904 C CA  . THR A 1 383 ? 19.119  18.089  -12.334 1.00 55.59  ? 383  THR A CA  1 
ATOM   2905 C C   . THR A 1 383 ? 17.650  17.795  -12.557 1.00 57.12  ? 383  THR A C   1 
ATOM   2906 O O   . THR A 1 383 ? 17.270  16.649  -12.804 1.00 58.48  ? 383  THR A O   1 
ATOM   2907 C CB  . THR A 1 383 ? 19.817  18.255  -13.710 1.00 56.24  ? 383  THR A CB  1 
ATOM   2908 O OG1 . THR A 1 383 ? 21.143  18.745  -13.499 1.00 55.53  ? 383  THR A OG1 1 
ATOM   2909 C CG2 . THR A 1 383 ? 19.068  19.238  -14.622 1.00 56.13  ? 383  THR A CG2 1 
ATOM   2910 N N   . ASP A 1 384 ? 16.823  18.829  -12.452 1.00 57.74  ? 384  ASP A N   1 
ATOM   2911 C CA  . ASP A 1 384 ? 15.441  18.747  -12.893 1.00 59.46  ? 384  ASP A CA  1 
ATOM   2912 C C   . ASP A 1 384 ? 15.380  19.211  -14.335 1.00 60.45  ? 384  ASP A C   1 
ATOM   2913 O O   . ASP A 1 384 ? 15.451  20.410  -14.604 1.00 60.75  ? 384  ASP A O   1 
ATOM   2914 C CB  . ASP A 1 384 ? 14.541  19.629  -12.046 1.00 59.81  ? 384  ASP A CB  1 
ATOM   2915 C CG  . ASP A 1 384 ? 13.101  19.638  -12.546 1.00 63.47  ? 384  ASP A CG  1 
ATOM   2916 O OD1 . ASP A 1 384 ? 12.820  19.051  -13.621 1.00 66.18  ? 384  ASP A OD1 1 
ATOM   2917 O OD2 . ASP A 1 384 ? 12.252  20.245  -11.865 1.00 67.24  ? 384  ASP A OD2 1 
ATOM   2918 N N   . TRP A 1 385 ? 15.228  18.270  -15.263 1.00 61.20  ? 385  TRP A N   1 
ATOM   2919 C CA  . TRP A 1 385 ? 15.377  18.585  -16.684 1.00 62.14  ? 385  TRP A CA  1 
ATOM   2920 C C   . TRP A 1 385 ? 14.220  19.372  -17.292 1.00 63.91  ? 385  TRP A C   1 
ATOM   2921 O O   . TRP A 1 385 ? 14.276  19.742  -18.465 1.00 65.57  ? 385  TRP A O   1 
ATOM   2922 C CB  . TRP A 1 385 ? 15.709  17.320  -17.475 1.00 62.18  ? 385  TRP A CB  1 
ATOM   2923 C CG  . TRP A 1 385 ? 17.047  16.815  -17.083 1.00 60.05  ? 385  TRP A CG  1 
ATOM   2924 C CD1 . TRP A 1 385 ? 17.327  15.779  -16.243 1.00 59.10  ? 385  TRP A CD1 1 
ATOM   2925 C CD2 . TRP A 1 385 ? 18.296  17.368  -17.465 1.00 58.84  ? 385  TRP A CD2 1 
ATOM   2926 N NE1 . TRP A 1 385 ? 18.678  15.632  -16.107 1.00 57.51  ? 385  TRP A NE1 1 
ATOM   2927 C CE2 . TRP A 1 385 ? 19.299  16.602  -16.843 1.00 57.70  ? 385  TRP A CE2 1 
ATOM   2928 C CE3 . TRP A 1 385 ? 18.669  18.436  -18.285 1.00 60.31  ? 385  TRP A CE3 1 
ATOM   2929 C CZ2 . TRP A 1 385 ? 20.651  16.878  -16.999 1.00 58.03  ? 385  TRP A CZ2 1 
ATOM   2930 C CZ3 . TRP A 1 385 ? 20.022  18.709  -18.444 1.00 59.70  ? 385  TRP A CZ3 1 
ATOM   2931 C CH2 . TRP A 1 385 ? 20.994  17.924  -17.812 1.00 58.76  ? 385  TRP A CH2 1 
ATOM   2932 N N   . LEU A 1 386 ? 13.189  19.636  -16.493 1.00 64.57  ? 386  LEU A N   1 
ATOM   2933 C CA  . LEU A 1 386 ? 12.128  20.583  -16.865 1.00 66.48  ? 386  LEU A CA  1 
ATOM   2934 C C   . LEU A 1 386 ? 12.495  22.016  -16.524 1.00 66.40  ? 386  LEU A C   1 
ATOM   2935 O O   . LEU A 1 386 ? 12.107  22.940  -17.226 1.00 68.28  ? 386  LEU A O   1 
ATOM   2936 C CB  . LEU A 1 386 ? 10.807  20.242  -16.166 1.00 66.85  ? 386  LEU A CB  1 
ATOM   2937 C CG  . LEU A 1 386 ? 9.903   19.281  -16.932 1.00 68.83  ? 386  LEU A CG  1 
ATOM   2938 C CD1 . LEU A 1 386 ? 8.780   18.797  -16.018 1.00 68.52  ? 386  LEU A CD1 1 
ATOM   2939 C CD2 . LEU A 1 386 ? 9.362   19.956  -18.205 1.00 70.38  ? 386  LEU A CD2 1 
ATOM   2940 N N   . HIS A 1 387 ? 13.213  22.201  -15.425 1.00 65.41  ? 387  HIS A N   1 
ATOM   2941 C CA  . HIS A 1 387 ? 13.668  23.527  -15.017 1.00 65.17  ? 387  HIS A CA  1 
ATOM   2942 C C   . HIS A 1 387 ? 15.135  23.436  -14.638 1.00 63.11  ? 387  HIS A C   1 
ATOM   2943 O O   . HIS A 1 387 ? 15.472  23.595  -13.471 1.00 61.66  ? 387  HIS A O   1 
ATOM   2944 C CB  . HIS A 1 387 ? 12.851  24.020  -13.818 1.00 65.47  ? 387  HIS A CB  1 
ATOM   2945 C CG  . HIS A 1 387 ? 11.372  23.892  -13.999 1.00 68.01  ? 387  HIS A CG  1 
ATOM   2946 N ND1 . HIS A 1 387 ? 10.637  22.885  -13.409 1.00 69.25  ? 387  HIS A ND1 1 
ATOM   2947 C CD2 . HIS A 1 387 ? 10.492  24.642  -14.700 1.00 71.18  ? 387  HIS A CD2 1 
ATOM   2948 C CE1 . HIS A 1 387 ? 9.365   23.023  -13.739 1.00 71.51  ? 387  HIS A CE1 1 
ATOM   2949 N NE2 . HIS A 1 387 ? 9.249   24.081  -14.523 1.00 72.49  ? 387  HIS A NE2 1 
ATOM   2950 N N   . PRO A 1 388 ? 16.011  23.153  -15.622 1.00 63.04  ? 388  PRO A N   1 
ATOM   2951 C CA  . PRO A 1 388 ? 17.422  22.894  -15.328 1.00 61.69  ? 388  PRO A CA  1 
ATOM   2952 C C   . PRO A 1 388 ? 18.235  24.099  -14.820 1.00 60.63  ? 388  PRO A C   1 
ATOM   2953 O O   . PRO A 1 388 ? 19.318  23.897  -14.306 1.00 59.66  ? 388  PRO A O   1 
ATOM   2954 C CB  . PRO A 1 388 ? 17.974  22.384  -16.668 1.00 62.38  ? 388  PRO A CB  1 
ATOM   2955 C CG  . PRO A 1 388 ? 17.088  22.957  -17.686 1.00 64.27  ? 388  PRO A CG  1 
ATOM   2956 C CD  . PRO A 1 388 ? 15.727  23.045  -17.065 1.00 64.80  ? 388  PRO A CD  1 
ATOM   2957 N N   . GLU A 1 389 ? 17.719  25.319  -14.942 1.00 60.97  ? 389  GLU A N   1 
ATOM   2958 C CA  . GLU A 1 389 ? 18.431  26.498  -14.459 1.00 60.62  ? 389  GLU A CA  1 
ATOM   2959 C C   . GLU A 1 389 ? 17.682  27.249  -13.357 1.00 59.21  ? 389  GLU A C   1 
ATOM   2960 O O   . GLU A 1 389 ? 18.029  28.380  -13.040 1.00 58.31  ? 389  GLU A O   1 
ATOM   2961 C CB  . GLU A 1 389 ? 18.728  27.460  -15.622 1.00 62.89  ? 389  GLU A CB  1 
ATOM   2962 C CG  . GLU A 1 389 ? 19.372  26.792  -16.847 1.00 66.49  ? 389  GLU A CG  1 
ATOM   2963 C CD  . GLU A 1 389 ? 20.542  27.570  -17.398 1.00 71.12  ? 389  GLU A CD  1 
ATOM   2964 O OE1 . GLU A 1 389 ? 21.613  27.566  -16.746 1.00 73.40  ? 389  GLU A OE1 1 
ATOM   2965 O OE2 . GLU A 1 389 ? 20.395  28.183  -18.484 1.00 75.40  ? 389  GLU A OE2 1 
ATOM   2966 N N   . ASP A 1 390 ? 16.670  26.626  -12.759 1.00 58.29  ? 390  ASP A N   1 
ATOM   2967 C CA  . ASP A 1 390 ? 15.885  27.294  -11.719 1.00 57.61  ? 390  ASP A CA  1 
ATOM   2968 C C   . ASP A 1 390 ? 16.711  27.361  -10.427 1.00 55.64  ? 390  ASP A C   1 
ATOM   2969 O O   . ASP A 1 390 ? 17.058  26.327  -9.868  1.00 54.07  ? 390  ASP A O   1 
ATOM   2970 C CB  . ASP A 1 390 ? 14.565  26.571  -11.467 1.00 57.96  ? 390  ASP A CB  1 
ATOM   2971 C CG  . ASP A 1 390 ? 13.780  27.184  -10.335 1.00 57.89  ? 390  ASP A CG  1 
ATOM   2972 O OD1 . ASP A 1 390 ? 13.061  28.164  -10.546 1.00 60.25  ? 390  ASP A OD1 1 
ATOM   2973 O OD2 . ASP A 1 390 ? 13.891  26.696  -9.210  1.00 59.47  ? 390  ASP A OD2 1 
ATOM   2974 N N   . PRO A 1 391 ? 17.031  28.582  -9.953  1.00 55.38  ? 391  PRO A N   1 
ATOM   2975 C CA  . PRO A 1 391 ? 17.909  28.721  -8.794  1.00 54.24  ? 391  PRO A CA  1 
ATOM   2976 C C   . PRO A 1 391 ? 17.404  28.055  -7.510  1.00 53.26  ? 391  PRO A C   1 
ATOM   2977 O O   . PRO A 1 391 ? 18.216  27.607  -6.711  1.00 52.52  ? 391  PRO A O   1 
ATOM   2978 C CB  . PRO A 1 391 ? 18.002  30.247  -8.603  1.00 54.63  ? 391  PRO A CB  1 
ATOM   2979 C CG  . PRO A 1 391 ? 17.658  30.818  -9.861  1.00 56.36  ? 391  PRO A CG  1 
ATOM   2980 C CD  . PRO A 1 391 ? 16.626  29.906  -10.457 1.00 57.13  ? 391  PRO A CD  1 
ATOM   2981 N N   . THR A 1 392 ? 16.088  27.997  -7.314  1.00 53.92  ? 392  THR A N   1 
ATOM   2982 C CA  . THR A 1 392 ? 15.510  27.320  -6.148  1.00 53.41  ? 392  THR A CA  1 
ATOM   2983 C C   . THR A 1 392 ? 15.700  25.806  -6.237  1.00 52.64  ? 392  THR A C   1 
ATOM   2984 O O   . THR A 1 392 ? 16.110  25.187  -5.257  1.00 51.71  ? 392  THR A O   1 
ATOM   2985 C CB  . THR A 1 392 ? 13.994  27.643  -5.952  1.00 54.60  ? 392  THR A CB  1 
ATOM   2986 O OG1 . THR A 1 392 ? 13.811  29.055  -5.785  1.00 54.47  ? 392  THR A OG1 1 
ATOM   2987 C CG2 . THR A 1 392 ? 13.452  26.927  -4.717  1.00 54.25  ? 392  THR A CG2 1 
ATOM   2988 N N   . HIS A 1 393 ? 15.406  25.194  -7.391  1.00 53.49  ? 393  HIS A N   1 
ATOM   2989 C CA  . HIS A 1 393 ? 15.688  23.757  -7.521  1.00 53.06  ? 393  HIS A CA  1 
ATOM   2990 C C   . HIS A 1 393 ? 17.166  23.441  -7.348  1.00 51.34  ? 393  HIS A C   1 
ATOM   2991 O O   . HIS A 1 393 ? 17.495  22.387  -6.829  1.00 51.86  ? 393  HIS A O   1 
ATOM   2992 C CB  A HIS A 1 393 ? 15.209  23.096  -8.808  0.50 54.19  ? 393  HIS A CB  1 
ATOM   2993 C CB  B HIS A 1 393 ? 15.292  23.260  -8.920  0.50 54.29  ? 393  HIS A CB  1 
ATOM   2994 C CG  A HIS A 1 393 ? 15.449  21.613  -8.800  0.50 54.49  ? 393  HIS A CG  1 
ATOM   2995 C CG  B HIS A 1 393 ? 13.819  23.094  -9.138  0.50 56.58  ? 393  HIS A CG  1 
ATOM   2996 N ND1 A HIS A 1 393 ? 16.500  21.022  -9.471  0.50 54.94  ? 393  HIS A ND1 1 
ATOM   2997 N ND1 B HIS A 1 393 ? 12.927  24.143  -9.080  0.50 57.95  ? 393  HIS A ND1 1 
ATOM   2998 C CD2 A HIS A 1 393 ? 14.847  20.621  -8.098  0.50 54.72  ? 393  HIS A CD2 1 
ATOM   2999 C CD2 B HIS A 1 393 ? 13.092  22.002  -9.479  0.50 57.35  ? 393  HIS A CD2 1 
ATOM   3000 C CE1 A HIS A 1 393 ? 16.495  19.723  -9.233  0.50 54.81  ? 393  HIS A CE1 1 
ATOM   3001 C CE1 B HIS A 1 393 ? 11.713  23.699  -9.350  0.50 59.46  ? 393  HIS A CE1 1 
ATOM   3002 N NE2 A HIS A 1 393 ? 15.503  19.453  -8.401  0.50 54.75  ? 393  HIS A NE2 1 
ATOM   3003 N NE2 B HIS A 1 393 ? 11.786  22.404  -9.597  0.50 58.32  ? 393  HIS A NE2 1 
ATOM   3004 N N   . LEU A 1 394 ? 18.042  24.314  -7.839  1.00 50.55  ? 394  LEU A N   1 
ATOM   3005 C CA  . LEU A 1 394 ? 19.497  24.070  -7.809  1.00 49.44  ? 394  LEU A CA  1 
ATOM   3006 C C   . LEU A 1 394 ? 20.050  24.106  -6.387  1.00 48.50  ? 394  LEU A C   1 
ATOM   3007 O O   . LEU A 1 394 ? 20.785  23.218  -5.987  1.00 47.94  ? 394  LEU A O   1 
ATOM   3008 C CB  . LEU A 1 394 ? 20.234  25.071  -8.699  1.00 49.24  ? 394  LEU A CB  1 
ATOM   3009 C CG  . LEU A 1 394 ? 20.000  24.914  -10.208 1.00 50.67  ? 394  LEU A CG  1 
ATOM   3010 C CD1 . LEU A 1 394 ? 20.487  26.145  -10.978 1.00 50.27  ? 394  LEU A CD1 1 
ATOM   3011 C CD2 . LEU A 1 394 ? 20.650  23.637  -10.757 1.00 50.34  ? 394  LEU A CD2 1 
ATOM   3012 N N   . ARG A 1 395 ? 19.688  25.136  -5.628  1.00 48.72  ? 395  ARG A N   1 
ATOM   3013 C CA  . ARG A 1 395 ? 20.002  25.195  -4.198  1.00 47.80  ? 395  ARG A CA  1 
ATOM   3014 C C   . ARG A 1 395 ? 19.594  23.908  -3.455  1.00 47.60  ? 395  ARG A C   1 
ATOM   3015 O O   . ARG A 1 395 ? 20.409  23.266  -2.787  1.00 46.94  ? 395  ARG A O   1 
ATOM   3016 C CB  . ARG A 1 395 ? 19.265  26.383  -3.589  1.00 47.98  ? 395  ARG A CB  1 
ATOM   3017 C CG  . ARG A 1 395 ? 19.525  26.630  -2.110  1.00 46.81  ? 395  ARG A CG  1 
ATOM   3018 C CD  . ARG A 1 395 ? 18.561  27.670  -1.605  1.00 46.22  ? 395  ARG A CD  1 
ATOM   3019 N NE  . ARG A 1 395 ? 17.229  27.087  -1.509  1.00 45.07  ? 395  ARG A NE  1 
ATOM   3020 C CZ  . ARG A 1 395 ? 16.110  27.767  -1.358  1.00 47.25  ? 395  ARG A CZ  1 
ATOM   3021 N NH1 . ARG A 1 395 ? 16.125  29.086  -1.261  1.00 49.37  ? 395  ARG A NH1 1 
ATOM   3022 N NH2 . ARG A 1 395 ? 14.959  27.117  -1.288  1.00 48.45  ? 395  ARG A NH2 1 
ATOM   3023 N N   . ASP A 1 396 ? 18.324  23.547  -3.574  1.00 47.84  ? 396  ASP A N   1 
ATOM   3024 C CA  . ASP A 1 396 ? 17.802  22.380  -2.891  1.00 47.86  ? 396  ASP A CA  1 
ATOM   3025 C C   . ASP A 1 396 ? 18.449  21.075  -3.372  1.00 46.92  ? 396  ASP A C   1 
ATOM   3026 O O   . ASP A 1 396 ? 18.617  20.155  -2.584  1.00 45.62  ? 396  ASP A O   1 
ATOM   3027 C CB  . ASP A 1 396 ? 16.283  22.292  -3.058  1.00 49.04  ? 396  ASP A CB  1 
ATOM   3028 C CG  . ASP A 1 396 ? 15.536  23.497  -2.446  1.00 51.39  ? 396  ASP A CG  1 
ATOM   3029 O OD1 . ASP A 1 396 ? 16.099  24.248  -1.614  1.00 52.41  ? 396  ASP A OD1 1 
ATOM   3030 O OD2 . ASP A 1 396 ? 14.361  23.675  -2.787  1.00 56.58  ? 396  ASP A OD2 1 
ATOM   3031 N N   . ALA A 1 397 ? 18.785  20.987  -4.657  1.00 47.05  ? 397  ALA A N   1 
ATOM   3032 C CA  . ALA A 1 397 ? 19.511  19.814  -5.177  1.00 47.22  ? 397  ALA A CA  1 
ATOM   3033 C C   . ALA A 1 397 ? 20.939  19.756  -4.616  1.00 46.77  ? 397  ALA A C   1 
ATOM   3034 O O   . ALA A 1 397 ? 21.453  18.669  -4.339  1.00 46.58  ? 397  ALA A O   1 
ATOM   3035 C CB  . ALA A 1 397 ? 19.545  19.819  -6.710  1.00 47.53  ? 397  ALA A CB  1 
ATOM   3036 N N   . MET A 1 398 ? 21.579  20.912  -4.447  1.00 47.02  ? 398  MET A N   1 
ATOM   3037 C CA  . MET A 1 398 ? 22.915  20.944  -3.839  1.00 47.10  ? 398  MET A CA  1 
ATOM   3038 C C   . MET A 1 398 ? 22.856  20.344  -2.431  1.00 46.43  ? 398  MET A C   1 
ATOM   3039 O O   . MET A 1 398 ? 23.682  19.496  -2.048  1.00 45.28  ? 398  MET A O   1 
ATOM   3040 C CB  . MET A 1 398 ? 23.455  22.377  -3.797  1.00 47.28  ? 398  MET A CB  1 
ATOM   3041 C CG  . MET A 1 398 ? 24.970  22.467  -3.535  1.00 48.29  ? 398  MET A CG  1 
ATOM   3042 S SD  . MET A 1 398 ? 25.968  21.569  -4.719  1.00 50.29  ? 398  MET A SD  1 
ATOM   3043 C CE  . MET A 1 398 ? 26.403  20.094  -3.808  1.00 46.41  ? 398  MET A CE  1 
ATOM   3044 N N   . SER A 1 399 ? 21.849  20.774  -1.676  1.00 46.53  ? 399  SER A N   1 
ATOM   3045 C CA  . SER A 1 399 ? 21.590  20.244  -0.341  1.00 46.11  ? 399  SER A CA  1 
ATOM   3046 C C   . SER A 1 399 ? 21.406  18.726  -0.363  1.00 45.87  ? 399  SER A C   1 
ATOM   3047 O O   . SER A 1 399 ? 22.082  17.994  0.378   1.00 45.94  ? 399  SER A O   1 
ATOM   3048 C CB  . SER A 1 399 ? 20.333  20.907  0.236   1.00 46.82  ? 399  SER A CB  1 
ATOM   3049 O OG  . SER A 1 399 ? 20.065  20.456  1.545   1.00 47.36  ? 399  SER A OG  1 
ATOM   3050 N N   . ALA A 1 400 ? 20.482  18.256  -1.201  1.00 46.23  ? 400  ALA A N   1 
ATOM   3051 C CA  . ALA A 1 400 ? 20.189  16.815  -1.315  1.00 45.88  ? 400  ALA A CA  1 
ATOM   3052 C C   . ALA A 1 400 ? 21.431  15.990  -1.711  1.00 45.27  ? 400  ALA A C   1 
ATOM   3053 O O   . ALA A 1 400 ? 21.627  14.865  -1.225  1.00 45.78  ? 400  ALA A O   1 
ATOM   3054 C CB  . ALA A 1 400 ? 19.063  16.586  -2.298  1.00 46.59  ? 400  ALA A CB  1 
ATOM   3055 N N   . VAL A 1 401 ? 22.257  16.528  -2.602  1.00 44.50  ? 401  VAL A N   1 
ATOM   3056 C CA  . VAL A 1 401 ? 23.486  15.842  -3.007  1.00 44.17  ? 401  VAL A CA  1 
ATOM   3057 C C   . VAL A 1 401 ? 24.358  15.525  -1.781  1.00 43.93  ? 401  VAL A C   1 
ATOM   3058 O O   . VAL A 1 401 ? 24.734  14.371  -1.562  1.00 43.72  ? 401  VAL A O   1 
ATOM   3059 C CB  . VAL A 1 401 ? 24.287  16.667  -4.061  1.00 44.72  ? 401  VAL A CB  1 
ATOM   3060 C CG1 . VAL A 1 401 ? 25.743  16.158  -4.193  1.00 43.16  ? 401  VAL A CG1 1 
ATOM   3061 C CG2 . VAL A 1 401 ? 23.568  16.674  -5.428  1.00 42.41  ? 401  VAL A CG2 1 
ATOM   3062 N N   . VAL A 1 402 ? 24.651  16.558  -0.986  1.00 43.67  ? 402  VAL A N   1 
ATOM   3063 C CA  . VAL A 1 402 ? 25.549  16.461  0.161   1.00 43.09  ? 402  VAL A CA  1 
ATOM   3064 C C   . VAL A 1 402 ? 24.971  15.550  1.239   1.00 43.53  ? 402  VAL A C   1 
ATOM   3065 O O   . VAL A 1 402 ? 25.687  14.713  1.822   1.00 43.64  ? 402  VAL A O   1 
ATOM   3066 C CB  . VAL A 1 402 ? 25.841  17.855  0.740   1.00 43.53  ? 402  VAL A CB  1 
ATOM   3067 C CG1 . VAL A 1 402 ? 26.649  17.762  2.046   1.00 42.38  ? 402  VAL A CG1 1 
ATOM   3068 C CG2 . VAL A 1 402 ? 26.565  18.729  -0.310  1.00 41.97  ? 402  VAL A CG2 1 
ATOM   3069 N N   . GLY A 1 403 ? 23.666  15.684  1.468   1.00 43.13  ? 403  GLY A N   1 
ATOM   3070 C CA  . GLY A 1 403 ? 22.963  14.884  2.437   1.00 42.66  ? 403  GLY A CA  1 
ATOM   3071 C C   . GLY A 1 403 ? 22.807  13.426  2.050   1.00 43.82  ? 403  GLY A C   1 
ATOM   3072 O O   . GLY A 1 403 ? 22.974  12.549  2.912   1.00 44.32  ? 403  GLY A O   1 
ATOM   3073 N N   . ASP A 1 404 ? 22.468  13.144  0.785   1.00 44.03  ? 404  ASP A N   1 
ATOM   3074 C CA  . ASP A 1 404 ? 22.308  11.757  0.329   1.00 44.11  ? 404  ASP A CA  1 
ATOM   3075 C C   . ASP A 1 404 ? 23.655  11.026  0.314   1.00 44.37  ? 404  ASP A C   1 
ATOM   3076 O O   . ASP A 1 404 ? 23.754  9.873   0.757   1.00 45.08  ? 404  ASP A O   1 
ATOM   3077 C CB  . ASP A 1 404 ? 21.691  11.705  -1.071  1.00 45.18  ? 404  ASP A CB  1 
ATOM   3078 C CG  . ASP A 1 404 ? 20.252  12.211  -1.111  1.00 46.01  ? 404  ASP A CG  1 
ATOM   3079 O OD1 . ASP A 1 404 ? 19.636  12.411  -0.032  1.00 44.04  ? 404  ASP A OD1 1 
ATOM   3080 O OD2 . ASP A 1 404 ? 19.740  12.412  -2.237  1.00 46.82  ? 404  ASP A OD2 1 
ATOM   3081 N N   . HIS A 1 405 ? 24.683  11.691  -0.206  1.00 43.24  ? 405  HIS A N   1 
ATOM   3082 C CA  . HIS A 1 405 ? 26.024  11.116  -0.294  1.00 43.49  ? 405  HIS A CA  1 
ATOM   3083 C C   . HIS A 1 405 ? 26.594  10.737  1.090   1.00 43.33  ? 405  HIS A C   1 
ATOM   3084 O O   . HIS A 1 405 ? 27.104  9.629   1.294   1.00 43.96  ? 405  HIS A O   1 
ATOM   3085 C CB  . HIS A 1 405 ? 26.945  12.133  -0.975  1.00 43.24  ? 405  HIS A CB  1 
ATOM   3086 C CG  . HIS A 1 405 ? 28.380  11.704  -1.083  1.00 43.00  ? 405  HIS A CG  1 
ATOM   3087 N ND1 . HIS A 1 405 ? 28.758  10.437  -1.479  1.00 43.88  ? 405  HIS A ND1 1 
ATOM   3088 C CD2 . HIS A 1 405 ? 29.530  12.393  -0.883  1.00 42.34  ? 405  HIS A CD2 1 
ATOM   3089 C CE1 . HIS A 1 405 ? 30.079  10.363  -1.514  1.00 44.22  ? 405  HIS A CE1 1 
ATOM   3090 N NE2 . HIS A 1 405 ? 30.572  11.532  -1.150  1.00 43.56  ? 405  HIS A NE2 1 
ATOM   3091 N N   . ASN A 1 406 ? 26.512  11.679  2.025   1.00 42.73  ? 406  ASN A N   1 
ATOM   3092 C CA  . ASN A 1 406 ? 27.185  11.566  3.317   1.00 41.94  ? 406  ASN A CA  1 
ATOM   3093 C C   . ASN A 1 406 ? 26.395  10.919  4.437   1.00 41.83  ? 406  ASN A C   1 
ATOM   3094 O O   . ASN A 1 406 ? 27.006  10.334  5.346   1.00 41.19  ? 406  ASN A O   1 
ATOM   3095 C CB  . ASN A 1 406 ? 27.645  12.938  3.776   1.00 40.88  ? 406  ASN A CB  1 
ATOM   3096 C CG  . ASN A 1 406 ? 28.786  13.459  2.951   1.00 41.90  ? 406  ASN A CG  1 
ATOM   3097 O OD1 . ASN A 1 406 ? 29.878  12.852  2.902   1.00 39.66  ? 406  ASN A OD1 1 
ATOM   3098 N ND2 . ASN A 1 406 ? 28.550  14.576  2.272   1.00 38.19  ? 406  ASN A ND2 1 
ATOM   3099 N N   . VAL A 1 407 ? 25.064  10.992  4.374   1.00 42.31  ? 407  VAL A N   1 
ATOM   3100 C CA  . VAL A 1 407 ? 24.216  10.521  5.467   1.00 42.49  ? 407  VAL A CA  1 
ATOM   3101 C C   . VAL A 1 407 ? 23.123  9.563   5.009   1.00 44.06  ? 407  VAL A C   1 
ATOM   3102 O O   . VAL A 1 407 ? 23.114  8.396   5.433   1.00 44.33  ? 407  VAL A O   1 
ATOM   3103 C CB  . VAL A 1 407 ? 23.591  11.714  6.268   1.00 42.57  ? 407  VAL A CB  1 
ATOM   3104 C CG1 . VAL A 1 407 ? 22.677  11.216  7.411   1.00 41.72  ? 407  VAL A CG1 1 
ATOM   3105 C CG2 . VAL A 1 407 ? 24.693  12.627  6.840   1.00 41.02  ? 407  VAL A CG2 1 
ATOM   3106 N N   . VAL A 1 408 ? 22.204  10.025  4.155   1.00 44.85  ? 408  VAL A N   1 
ATOM   3107 C CA  . VAL A 1 408 ? 20.981  9.241   3.886   1.00 45.49  ? 408  VAL A CA  1 
ATOM   3108 C C   . VAL A 1 408 ? 21.295  7.863   3.292   1.00 47.03  ? 408  VAL A C   1 
ATOM   3109 O O   . VAL A 1 408 ? 20.759  6.846   3.764   1.00 47.87  ? 408  VAL A O   1 
ATOM   3110 C CB  . VAL A 1 408 ? 19.940  9.974   3.005   1.00 45.78  ? 408  VAL A CB  1 
ATOM   3111 C CG1 . VAL A 1 408 ? 18.695  9.091   2.792   1.00 45.79  ? 408  VAL A CG1 1 
ATOM   3112 C CG2 . VAL A 1 408 ? 19.518  11.272  3.647   1.00 43.74  ? 408  VAL A CG2 1 
ATOM   3113 N N   . CYS A 1 409 ? 22.172  7.817   2.290   1.00 47.38  ? 409  CYS A N   1 
ATOM   3114 C CA  . CYS A 1 409 ? 22.435  6.549   1.601   1.00 48.75  ? 409  CYS A CA  1 
ATOM   3115 C C   . CYS A 1 409 ? 23.352  5.596   2.373   1.00 48.19  ? 409  CYS A C   1 
ATOM   3116 O O   . CYS A 1 409 ? 23.150  4.383   2.324   1.00 49.11  ? 409  CYS A O   1 
ATOM   3117 C CB  . CYS A 1 409 ? 22.919  6.791   0.173   1.00 49.22  ? 409  CYS A CB  1 
ATOM   3118 S SG  . CYS A 1 409 ? 21.675  7.663   -0.826  1.00 50.31  ? 409  CYS A SG  1 
ATOM   3119 N N   . PRO A 1 410 ? 24.362  6.126   3.069   1.00 47.19  ? 410  PRO A N   1 
ATOM   3120 C CA  . PRO A 1 410 ? 25.037  5.306   4.071   1.00 47.30  ? 410  PRO A CA  1 
ATOM   3121 C C   . PRO A 1 410 ? 24.108  4.670   5.106   1.00 47.80  ? 410  PRO A C   1 
ATOM   3122 O O   . PRO A 1 410 ? 24.285  3.510   5.459   1.00 47.98  ? 410  PRO A O   1 
ATOM   3123 C CB  . PRO A 1 410 ? 25.997  6.289   4.718   1.00 46.42  ? 410  PRO A CB  1 
ATOM   3124 C CG  . PRO A 1 410 ? 26.345  7.220   3.586   1.00 46.31  ? 410  PRO A CG  1 
ATOM   3125 C CD  . PRO A 1 410 ? 25.039  7.422   2.886   1.00 46.62  ? 410  PRO A CD  1 
ATOM   3126 N N   . VAL A 1 411 ? 23.133  5.431   5.593   1.00 47.87  ? 411  VAL A N   1 
ATOM   3127 C CA  . VAL A 1 411 ? 22.178  4.910   6.550   1.00 47.92  ? 411  VAL A CA  1 
ATOM   3128 C C   . VAL A 1 411 ? 21.313  3.827   5.908   1.00 49.71  ? 411  VAL A C   1 
ATOM   3129 O O   . VAL A 1 411 ? 21.143  2.745   6.487   1.00 50.47  ? 411  VAL A O   1 
ATOM   3130 C CB  . VAL A 1 411 ? 21.322  6.033   7.164   1.00 47.86  ? 411  VAL A CB  1 
ATOM   3131 C CG1 . VAL A 1 411 ? 20.145  5.441   7.934   1.00 47.67  ? 411  VAL A CG1 1 
ATOM   3132 C CG2 . VAL A 1 411 ? 22.198  6.915   8.077   1.00 43.93  ? 411  VAL A CG2 1 
ATOM   3133 N N   . ALA A 1 412 ? 20.809  4.086   4.703   1.00 49.95  ? 412  ALA A N   1 
ATOM   3134 C CA  . ALA A 1 412 ? 20.069  3.064   3.954   1.00 51.36  ? 412  ALA A CA  1 
ATOM   3135 C C   . ALA A 1 412 ? 20.900  1.785   3.783   1.00 52.40  ? 412  ALA A C   1 
ATOM   3136 O O   . ALA A 1 412 ? 20.414  0.681   4.026   1.00 53.29  ? 412  ALA A O   1 
ATOM   3137 C CB  . ALA A 1 412 ? 19.641  3.604   2.594   1.00 51.39  ? 412  ALA A CB  1 
ATOM   3138 N N   . GLN A 1 413 ? 22.159  1.932   3.388   1.00 52.46  ? 413  GLN A N   1 
ATOM   3139 C CA  . GLN A 1 413 ? 23.023  0.765   3.224   1.00 53.82  ? 413  GLN A CA  1 
ATOM   3140 C C   . GLN A 1 413 ? 23.169  -0.005  4.533   1.00 53.06  ? 413  GLN A C   1 
ATOM   3141 O O   . GLN A 1 413 ? 22.987  -1.215  4.551   1.00 54.33  ? 413  GLN A O   1 
ATOM   3142 C CB  . GLN A 1 413 ? 24.410  1.157   2.725   1.00 53.95  ? 413  GLN A CB  1 
ATOM   3143 C CG  . GLN A 1 413 ? 25.297  -0.045  2.399   1.00 57.96  ? 413  GLN A CG  1 
ATOM   3144 C CD  . GLN A 1 413 ? 25.322  -0.366  0.923   1.00 64.56  ? 413  GLN A CD  1 
ATOM   3145 O OE1 . GLN A 1 413 ? 24.488  -1.146  0.389   1.00 68.56  ? 413  GLN A OE1 1 
ATOM   3146 N NE2 . GLN A 1 413 ? 26.298  0.242   0.228   1.00 67.50  ? 413  GLN A NE2 1 
ATOM   3147 N N   . LEU A 1 414 ? 23.501  0.703   5.615   1.00 51.58  ? 414  LEU A N   1 
ATOM   3148 C CA  . LEU A 1 414 ? 23.668  0.094   6.935   1.00 51.00  ? 414  LEU A CA  1 
ATOM   3149 C C   . LEU A 1 414 ? 22.426  -0.671  7.365   1.00 51.83  ? 414  LEU A C   1 
ATOM   3150 O O   . LEU A 1 414 ? 22.517  -1.848  7.729   1.00 52.53  ? 414  LEU A O   1 
ATOM   3151 C CB  . LEU A 1 414 ? 23.984  1.156   7.979   1.00 49.72  ? 414  LEU A CB  1 
ATOM   3152 C CG  . LEU A 1 414 ? 24.212  0.657   9.414   1.00 50.26  ? 414  LEU A CG  1 
ATOM   3153 C CD1 . LEU A 1 414 ? 25.415  -0.272  9.471   1.00 50.50  ? 414  LEU A CD1 1 
ATOM   3154 C CD2 . LEU A 1 414 ? 24.388  1.855   10.348  1.00 48.24  ? 414  LEU A CD2 1 
ATOM   3155 N N   . ALA A 1 415 ? 21.274  -0.007  7.300   1.00 51.60  ? 415  ALA A N   1 
ATOM   3156 C CA  . ALA A 1 415 ? 19.993  -0.606  7.693   1.00 53.24  ? 415  ALA A CA  1 
ATOM   3157 C C   . ALA A 1 415 ? 19.697  -1.925  6.958   1.00 55.43  ? 415  ALA A C   1 
ATOM   3158 O O   . ALA A 1 415 ? 19.248  -2.894  7.563   1.00 56.75  ? 415  ALA A O   1 
ATOM   3159 C CB  . ALA A 1 415 ? 18.854  0.392   7.462   1.00 52.64  ? 415  ALA A CB  1 
ATOM   3160 N N   . GLY A 1 416 ? 19.947  -1.952  5.653   1.00 56.69  ? 416  GLY A N   1 
ATOM   3161 C CA  . GLY A 1 416 ? 19.730  -3.160  4.848   1.00 59.06  ? 416  GLY A CA  1 
ATOM   3162 C C   . GLY A 1 416 ? 20.686  -4.295  5.152   1.00 60.11  ? 416  GLY A C   1 
ATOM   3163 O O   . GLY A 1 416 ? 20.282  -5.459  5.223   1.00 62.13  ? 416  GLY A O   1 
ATOM   3164 N N   . ARG A 1 417 ? 21.959  -3.971  5.319   1.00 59.94  ? 417  ARG A N   1 
ATOM   3165 C CA  . ARG A 1 417 ? 22.967  -4.994  5.590   1.00 61.48  ? 417  ARG A CA  1 
ATOM   3166 C C   . ARG A 1 417 ? 22.805  -5.584  6.993   1.00 61.41  ? 417  ARG A C   1 
ATOM   3167 O O   . ARG A 1 417 ? 23.021  -6.785  7.197   1.00 63.26  ? 417  ARG A O   1 
ATOM   3168 C CB  . ARG A 1 417 ? 24.378  -4.435  5.381   1.00 61.16  ? 417  ARG A CB  1 
ATOM   3169 C CG  . ARG A 1 417 ? 24.726  -4.192  3.903   1.00 64.85  ? 417  ARG A CG  1 
ATOM   3170 C CD  . ARG A 1 417 ? 25.443  -5.387  3.230   1.00 70.55  ? 417  ARG A CD  1 
ATOM   3171 N NE  . ARG A 1 417 ? 24.552  -6.414  2.672   1.00 75.51  ? 417  ARG A NE  1 
ATOM   3172 C CZ  . ARG A 1 417 ? 24.392  -7.666  3.135   1.00 79.20  ? 417  ARG A CZ  1 
ATOM   3173 N NH1 . ARG A 1 417 ? 25.041  -8.118  4.210   1.00 79.67  ? 417  ARG A NH1 1 
ATOM   3174 N NH2 . ARG A 1 417 ? 23.544  -8.491  2.516   1.00 81.79  ? 417  ARG A NH2 1 
ATOM   3175 N N   . LEU A 1 418 ? 22.403  -4.756  7.951   1.00 60.01  ? 418  LEU A N   1 
ATOM   3176 C CA  . LEU A 1 418 ? 22.125  -5.235  9.305   1.00 59.89  ? 418  LEU A CA  1 
ATOM   3177 C C   . LEU A 1 418 ? 20.883  -6.126  9.335   1.00 61.47  ? 418  LEU A C   1 
ATOM   3178 O O   . LEU A 1 418 ? 20.890  -7.157  9.993   1.00 62.75  ? 418  LEU A O   1 
ATOM   3179 C CB  . LEU A 1 418 ? 21.968  -4.064  10.289  1.00 58.46  ? 418  LEU A CB  1 
ATOM   3180 C CG  . LEU A 1 418 ? 23.199  -3.211  10.629  1.00 55.84  ? 418  LEU A CG  1 
ATOM   3181 C CD1 . LEU A 1 418 ? 22.852  -2.270  11.743  1.00 54.32  ? 418  LEU A CD1 1 
ATOM   3182 C CD2 . LEU A 1 418 ? 24.394  -4.028  11.027  1.00 56.14  ? 418  LEU A CD2 1 
ATOM   3183 N N   . ALA A 1 419 ? 19.835  -5.742  8.614   1.00 61.70  ? 419  ALA A N   1 
ATOM   3184 C CA  . ALA A 1 419 ? 18.591  -6.514  8.592   1.00 63.65  ? 419  ALA A CA  1 
ATOM   3185 C C   . ALA A 1 419 ? 18.775  -7.881  7.904   1.00 66.04  ? 419  ALA A C   1 
ATOM   3186 O O   . ALA A 1 419 ? 18.255  -8.894  8.362   1.00 67.36  ? 419  ALA A O   1 
ATOM   3187 C CB  . ALA A 1 419 ? 17.486  -5.713  7.905   1.00 63.34  ? 419  ALA A CB  1 
ATOM   3188 N N   . ALA A 1 420 ? 19.516  -7.889  6.798   1.00 66.89  ? 420  ALA A N   1 
ATOM   3189 C CA  . ALA A 1 420 ? 19.828  -9.123  6.075   1.00 69.09  ? 420  ALA A CA  1 
ATOM   3190 C C   . ALA A 1 420 ? 20.734  -10.067 6.881   1.00 70.09  ? 420  ALA A C   1 
ATOM   3191 O O   . ALA A 1 420 ? 20.653  -11.280 6.724   1.00 72.69  ? 420  ALA A O   1 
ATOM   3192 C CB  . ALA A 1 420 ? 20.467  -8.798  4.719   1.00 68.75  ? 420  ALA A CB  1 
ATOM   3193 N N   . GLN A 1 421 ? 21.584  -9.508  7.738   1.00 69.07  ? 421  GLN A N   1 
ATOM   3194 C CA  . GLN A 1 421 ? 22.504  -10.290 8.559   1.00 69.83  ? 421  GLN A CA  1 
ATOM   3195 C C   . GLN A 1 421 ? 21.927  -10.602 9.952   1.00 69.64  ? 421  GLN A C   1 
ATOM   3196 O O   . GLN A 1 421 ? 22.677  -10.978 10.857  1.00 69.86  ? 421  GLN A O   1 
ATOM   3197 C CB  . GLN A 1 421 ? 23.841  -9.546  8.708   1.00 68.89  ? 421  GLN A CB  1 
ATOM   3198 C CG  . GLN A 1 421 ? 24.644  -9.394  7.421   1.00 70.95  ? 421  GLN A CG  1 
ATOM   3199 C CD  . GLN A 1 421 ? 25.081  -10.726 6.833   1.00 75.97  ? 421  GLN A CD  1 
ATOM   3200 O OE1 . GLN A 1 421 ? 25.004  -10.931 5.617   1.00 80.34  ? 421  GLN A OE1 1 
ATOM   3201 N NE2 . GLN A 1 421 ? 25.543  -11.640 7.688   1.00 76.85  ? 421  GLN A NE2 1 
ATOM   3202 N N   . GLY A 1 422 ? 20.614  -10.426 10.129  1.00 69.40  ? 422  GLY A N   1 
ATOM   3203 C CA  . GLY A 1 422 ? 19.909  -10.901 11.325  1.00 69.48  ? 422  GLY A CA  1 
ATOM   3204 C C   . GLY A 1 422 ? 19.521  -9.895  12.399  1.00 67.57  ? 422  GLY A C   1 
ATOM   3205 O O   . GLY A 1 422 ? 18.838  -10.253 13.353  1.00 68.38  ? 422  GLY A O   1 
ATOM   3206 N N   . ALA A 1 423 ? 19.949  -8.643  12.273  1.00 65.22  ? 423  ALA A N   1 
ATOM   3207 C CA  . ALA A 1 423 ? 19.612  -7.626  13.267  1.00 63.00  ? 423  ALA A CA  1 
ATOM   3208 C C   . ALA A 1 423 ? 18.135  -7.264  13.212  1.00 62.70  ? 423  ALA A C   1 
ATOM   3209 O O   . ALA A 1 423 ? 17.510  -7.364  12.163  1.00 63.31  ? 423  ALA A O   1 
ATOM   3210 C CB  . ALA A 1 423 ? 20.458  -6.384  13.059  1.00 61.01  ? 423  ALA A CB  1 
ATOM   3211 N N   . ARG A 1 424 ? 17.587  -6.861  14.355  1.00 61.75  ? 424  ARG A N   1 
ATOM   3212 C CA  . ARG A 1 424 ? 16.286  -6.208  14.401  1.00 62.02  ? 424  ARG A CA  1 
ATOM   3213 C C   . ARG A 1 424 ? 16.494  -4.699  14.266  1.00 58.84  ? 424  ARG A C   1 
ATOM   3214 O O   . ARG A 1 424 ? 17.093  -4.087  15.147  1.00 57.47  ? 424  ARG A O   1 
ATOM   3215 C CB  . ARG A 1 424 ? 15.563  -6.521  15.711  1.00 63.19  ? 424  ARG A CB  1 
ATOM   3216 C CG  . ARG A 1 424 ? 14.079  -6.143  15.683  1.00 68.31  ? 424  ARG A CG  1 
ATOM   3217 C CD  . ARG A 1 424 ? 13.173  -7.161  16.415  1.00 76.70  ? 424  ARG A CD  1 
ATOM   3218 N NE  . ARG A 1 424 ? 12.655  -6.634  17.684  1.00 80.42  ? 424  ARG A NE  1 
ATOM   3219 C CZ  . ARG A 1 424 ? 13.121  -6.918  18.907  1.00 83.66  ? 424  ARG A CZ  1 
ATOM   3220 N NH1 . ARG A 1 424 ? 14.148  -7.756  19.095  1.00 85.40  ? 424  ARG A NH1 1 
ATOM   3221 N NH2 . ARG A 1 424 ? 12.539  -6.358  19.970  1.00 83.61  ? 424  ARG A NH2 1 
ATOM   3222 N N   . VAL A 1 425 ? 16.001  -4.108  13.174  1.00 57.69  ? 425  VAL A N   1 
ATOM   3223 C CA  . VAL A 1 425 ? 16.262  -2.678  12.852  1.00 55.17  ? 425  VAL A CA  1 
ATOM   3224 C C   . VAL A 1 425 ? 14.965  -1.866  12.816  1.00 54.82  ? 425  VAL A C   1 
ATOM   3225 O O   . VAL A 1 425 ? 13.950  -2.351  12.317  1.00 55.92  ? 425  VAL A O   1 
ATOM   3226 C CB  . VAL A 1 425 ? 16.962  -2.533  11.462  1.00 55.12  ? 425  VAL A CB  1 
ATOM   3227 C CG1 . VAL A 1 425 ? 17.324  -1.053  11.154  1.00 52.79  ? 425  VAL A CG1 1 
ATOM   3228 C CG2 . VAL A 1 425 ? 18.198  -3.433  11.365  1.00 54.09  ? 425  VAL A CG2 1 
ATOM   3229 N N   . TYR A 1 426 ? 15.009  -0.637  13.337  1.00 53.10  ? 426  TYR A N   1 
ATOM   3230 C CA  . TYR A 1 426 ? 13.905  0.327   13.227  1.00 52.49  ? 426  TYR A CA  1 
ATOM   3231 C C   . TYR A 1 426 ? 14.443  1.611   12.606  1.00 51.20  ? 426  TYR A C   1 
ATOM   3232 O O   . TYR A 1 426 ? 15.521  2.062   12.966  1.00 49.59  ? 426  TYR A O   1 
ATOM   3233 C CB  . TYR A 1 426 ? 13.282  0.631   14.600  1.00 52.32  ? 426  TYR A CB  1 
ATOM   3234 C CG  . TYR A 1 426 ? 12.559  -0.551  15.251  1.00 53.70  ? 426  TYR A CG  1 
ATOM   3235 C CD1 . TYR A 1 426 ? 13.233  -1.416  16.117  1.00 53.57  ? 426  TYR A CD1 1 
ATOM   3236 C CD2 . TYR A 1 426 ? 11.212  -0.786  15.013  1.00 54.26  ? 426  TYR A CD2 1 
ATOM   3237 C CE1 . TYR A 1 426 ? 12.583  -2.492  16.716  1.00 55.60  ? 426  TYR A CE1 1 
ATOM   3238 C CE2 . TYR A 1 426 ? 10.549  -1.861  15.603  1.00 56.26  ? 426  TYR A CE2 1 
ATOM   3239 C CZ  . TYR A 1 426 ? 11.240  -2.712  16.451  1.00 56.81  ? 426  TYR A CZ  1 
ATOM   3240 O OH  . TYR A 1 426 ? 10.602  -3.767  17.053  1.00 58.08  ? 426  TYR A OH  1 
ATOM   3241 N N   . ALA A 1 427 ? 13.692  2.203   11.678  1.00 51.30  ? 427  ALA A N   1 
ATOM   3242 C CA  . ALA A 1 427 ? 14.194  3.340   10.894  1.00 49.97  ? 427  ALA A CA  1 
ATOM   3243 C C   . ALA A 1 427 ? 13.237  4.513   10.939  1.00 49.56  ? 427  ALA A C   1 
ATOM   3244 O O   . ALA A 1 427 ? 12.029  4.306   10.944  1.00 50.38  ? 427  ALA A O   1 
ATOM   3245 C CB  . ALA A 1 427 ? 14.422  2.911   9.441   1.00 50.23  ? 427  ALA A CB  1 
ATOM   3246 N N   . TYR A 1 428 ? 13.769  5.738   10.955  1.00 48.48  ? 428  TYR A N   1 
ATOM   3247 C CA  . TYR A 1 428 ? 12.931  6.948   10.941  1.00 48.25  ? 428  TYR A CA  1 
ATOM   3248 C C   . TYR A 1 428 ? 13.492  8.024   10.023  1.00 47.88  ? 428  TYR A C   1 
ATOM   3249 O O   . TYR A 1 428 ? 14.684  8.010   9.689   1.00 47.05  ? 428  TYR A O   1 
ATOM   3250 C CB  . TYR A 1 428 ? 12.774  7.534   12.364  1.00 47.97  ? 428  TYR A CB  1 
ATOM   3251 C CG  . TYR A 1 428 ? 14.064  8.098   12.919  1.00 46.11  ? 428  TYR A CG  1 
ATOM   3252 C CD1 . TYR A 1 428 ? 14.488  9.393   12.598  1.00 45.44  ? 428  TYR A CD1 1 
ATOM   3253 C CD2 . TYR A 1 428 ? 14.884  7.322   13.725  1.00 45.85  ? 428  TYR A CD2 1 
ATOM   3254 C CE1 . TYR A 1 428 ? 15.722  9.902   13.082  1.00 43.59  ? 428  TYR A CE1 1 
ATOM   3255 C CE2 . TYR A 1 428 ? 16.099  7.812   14.206  1.00 44.05  ? 428  TYR A CE2 1 
ATOM   3256 C CZ  . TYR A 1 428 ? 16.507  9.096   13.899  1.00 43.83  ? 428  TYR A CZ  1 
ATOM   3257 O OH  . TYR A 1 428 ? 17.732  9.530   14.381  1.00 43.46  ? 428  TYR A OH  1 
ATOM   3258 N N   . ILE A 1 429 ? 12.618  8.952   9.625   1.00 48.55  ? 429  ILE A N   1 
ATOM   3259 C CA  . ILE A 1 429 ? 13.010  10.279  9.130   1.00 47.97  ? 429  ILE A CA  1 
ATOM   3260 C C   . ILE A 1 429 ? 12.360  11.325  10.036  1.00 48.19  ? 429  ILE A C   1 
ATOM   3261 O O   . ILE A 1 429 ? 11.152  11.250  10.311  1.00 48.91  ? 429  ILE A O   1 
ATOM   3262 C CB  . ILE A 1 429 ? 12.625  10.540  7.653   1.00 48.70  ? 429  ILE A CB  1 
ATOM   3263 C CG1 . ILE A 1 429 ? 13.001  11.974  7.246   1.00 49.18  ? 429  ILE A CG1 1 
ATOM   3264 C CG2 . ILE A 1 429 ? 11.150  10.332  7.431   1.00 52.17  ? 429  ILE A CG2 1 
ATOM   3265 C CD1 . ILE A 1 429 ? 13.064  12.208  5.740   1.00 51.36  ? 429  ILE A CD1 1 
ATOM   3266 N N   . PHE A 1 430 ? 13.166  12.275  10.521  1.00 47.20  ? 430  PHE A N   1 
ATOM   3267 C CA  . PHE A 1 430 ? 12.707  13.332  11.425  1.00 47.81  ? 430  PHE A CA  1 
ATOM   3268 C C   . PHE A 1 430 ? 12.430  14.591  10.618  1.00 48.55  ? 430  PHE A C   1 
ATOM   3269 O O   . PHE A 1 430 ? 13.331  15.125  9.974   1.00 47.58  ? 430  PHE A O   1 
ATOM   3270 C CB  . PHE A 1 430 ? 13.777  13.606  12.484  1.00 47.28  ? 430  PHE A CB  1 
ATOM   3271 C CG  . PHE A 1 430 ? 13.436  14.720  13.439  1.00 47.67  ? 430  PHE A CG  1 
ATOM   3272 C CD1 . PHE A 1 430 ? 13.858  16.020  13.194  1.00 46.45  ? 430  PHE A CD1 1 
ATOM   3273 C CD2 . PHE A 1 430 ? 12.746  14.460  14.610  1.00 48.78  ? 430  PHE A CD2 1 
ATOM   3274 C CE1 . PHE A 1 430 ? 13.558  17.041  14.077  1.00 46.90  ? 430  PHE A CE1 1 
ATOM   3275 C CE2 . PHE A 1 430 ? 12.432  15.490  15.498  1.00 48.38  ? 430  PHE A CE2 1 
ATOM   3276 C CZ  . PHE A 1 430 ? 12.843  16.778  15.227  1.00 48.12  ? 430  PHE A CZ  1 
ATOM   3277 N N   . GLU A 1 431 ? 11.194  15.093  10.690  1.00 50.61  ? 431  GLU A N   1 
ATOM   3278 C CA  . GLU A 1 431 ? 10.731  16.147  9.788   1.00 51.74  ? 431  GLU A CA  1 
ATOM   3279 C C   . GLU A 1 431 ? 10.196  17.418  10.437  1.00 52.33  ? 431  GLU A C   1 
ATOM   3280 O O   . GLU A 1 431 ? 9.621   18.262  9.741   1.00 52.61  ? 431  GLU A O   1 
ATOM   3281 C CB  . GLU A 1 431 ? 9.620   15.602  8.913   1.00 53.32  ? 431  GLU A CB  1 
ATOM   3282 C CG  . GLU A 1 431 ? 9.986   14.388  8.150   1.00 55.16  ? 431  GLU A CG  1 
ATOM   3283 C CD  . GLU A 1 431 ? 8.913   14.043  7.146   1.00 59.41  ? 431  GLU A CD  1 
ATOM   3284 O OE1 . GLU A 1 431 ? 7.740   13.864  7.560   1.00 60.04  ? 431  GLU A OE1 1 
ATOM   3285 O OE2 . GLU A 1 431 ? 9.251   13.979  5.941   1.00 62.72  ? 431  GLU A OE2 1 
ATOM   3286 N N   . HIS A 1 432 ? 10.371  17.586  11.743  1.00 51.99  ? 432  HIS A N   1 
ATOM   3287 C CA  . HIS A 1 432 ? 9.899   18.810  12.370  1.00 52.19  ? 432  HIS A CA  1 
ATOM   3288 C C   . HIS A 1 432 ? 11.006  19.872  12.530  1.00 51.30  ? 432  HIS A C   1 
ATOM   3289 O O   . HIS A 1 432 ? 12.076  19.616  13.088  1.00 49.88  ? 432  HIS A O   1 
ATOM   3290 C CB  . HIS A 1 432 ? 9.213   18.520  13.701  1.00 52.81  ? 432  HIS A CB  1 
ATOM   3291 C CG  . HIS A 1 432 ? 8.872   19.758  14.461  1.00 53.93  ? 432  HIS A CG  1 
ATOM   3292 N ND1 . HIS A 1 432 ? 7.834   20.589  14.095  1.00 53.30  ? 432  HIS A ND1 1 
ATOM   3293 C CD2 . HIS A 1 432 ? 9.468   20.342  15.528  1.00 53.52  ? 432  HIS A CD2 1 
ATOM   3294 C CE1 . HIS A 1 432 ? 7.786   21.614  14.925  1.00 55.25  ? 432  HIS A CE1 1 
ATOM   3295 N NE2 . HIS A 1 432 ? 8.766   21.490  15.803  1.00 54.56  ? 432  HIS A NE2 1 
ATOM   3296 N N   . ARG A 1 433 ? 10.716  21.072  12.025  1.00 51.95  ? 433  ARG A N   1 
ATOM   3297 C CA  . ARG A 1 433 ? 11.589  22.230  12.163  1.00 51.70  ? 433  ARG A CA  1 
ATOM   3298 C C   . ARG A 1 433 ? 11.239  22.997  13.443  1.00 52.58  ? 433  ARG A C   1 
ATOM   3299 O O   . ARG A 1 433 ? 10.124  23.537  13.567  1.00 53.85  ? 433  ARG A O   1 
ATOM   3300 C CB  . ARG A 1 433 ? 11.411  23.151  10.957  1.00 52.05  ? 433  ARG A CB  1 
ATOM   3301 C CG  . ARG A 1 433 ? 12.442  24.259  10.889  1.00 52.70  ? 433  ARG A CG  1 
ATOM   3302 C CD  . ARG A 1 433 ? 12.151  25.238  9.763   1.00 53.27  ? 433  ARG A CD  1 
ATOM   3303 N NE  . ARG A 1 433 ? 12.628  26.585  10.058  1.00 52.90  ? 433  ARG A NE  1 
ATOM   3304 C CZ  . ARG A 1 433 ? 13.825  27.068  9.727   1.00 54.59  ? 433  ARG A CZ  1 
ATOM   3305 N NH1 . ARG A 1 433 ? 14.721  26.342  9.052   1.00 52.61  ? 433  ARG A NH1 1 
ATOM   3306 N NH2 . ARG A 1 433 ? 14.126  28.316  10.059  1.00 55.06  ? 433  ARG A NH2 1 
ATOM   3307 N N   . ALA A 1 434 ? 12.187  23.069  14.381  1.00 51.99  ? 434  ALA A N   1 
ATOM   3308 C CA  . ALA A 1 434 ? 11.947  23.754  15.647  1.00 52.74  ? 434  ALA A CA  1 
ATOM   3309 C C   . ALA A 1 434 ? 11.504  25.170  15.359  1.00 54.06  ? 434  ALA A C   1 
ATOM   3310 O O   . ALA A 1 434 ? 12.138  25.857  14.559  1.00 53.80  ? 434  ALA A O   1 
ATOM   3311 C CB  . ALA A 1 434 ? 13.186  23.778  16.488  1.00 51.79  ? 434  ALA A CB  1 
ATOM   3312 N N   . SER A 1 435 ? 10.432  25.604  16.020  1.00 55.67  ? 435  SER A N   1 
ATOM   3313 C CA  . SER A 1 435 ? 9.961   26.987  15.921  1.00 57.42  ? 435  SER A CA  1 
ATOM   3314 C C   . SER A 1 435 ? 11.007  28.022  16.339  1.00 57.55  ? 435  SER A C   1 
ATOM   3315 O O   . SER A 1 435 ? 10.906  29.176  15.960  1.00 58.93  ? 435  SER A O   1 
ATOM   3316 C CB  . SER A 1 435 ? 8.718   27.185  16.785  1.00 58.72  ? 435  SER A CB  1 
ATOM   3317 O OG  . SER A 1 435 ? 9.009   26.965  18.155  1.00 58.69  ? 435  SER A OG  1 
ATOM   3318 N N   . THR A 1 436 ? 12.001  27.600  17.113  1.00 57.18  ? 436  THR A N   1 
ATOM   3319 C CA  . THR A 1 436 ? 13.018  28.489  17.673  1.00 57.37  ? 436  THR A CA  1 
ATOM   3320 C C   . THR A 1 436 ? 14.312  28.532  16.853  1.00 56.72  ? 436  THR A C   1 
ATOM   3321 O O   . THR A 1 436 ? 15.299  29.140  17.284  1.00 56.75  ? 436  THR A O   1 
ATOM   3322 C CB  . THR A 1 436 ? 13.379  28.008  19.098  1.00 57.23  ? 436  THR A CB  1 
ATOM   3323 O OG1 . THR A 1 436 ? 13.848  26.657  19.036  1.00 56.26  ? 436  THR A OG1 1 
ATOM   3324 C CG2 . THR A 1 436 ? 12.151  28.055  20.015  1.00 58.64  ? 436  THR A CG2 1 
ATOM   3325 N N   . LEU A 1 437 ? 14.315  27.889  15.682  1.00 56.49  ? 437  LEU A N   1 
ATOM   3326 C CA  . LEU A 1 437 ? 15.549  27.672  14.892  1.00 55.27  ? 437  LEU A CA  1 
ATOM   3327 C C   . LEU A 1 437 ? 16.011  29.014  14.343  1.00 55.64  ? 437  LEU A C   1 
ATOM   3328 O O   . LEU A 1 437 ? 15.194  29.765  13.857  1.00 55.85  ? 437  LEU A O   1 
ATOM   3329 C CB  . LEU A 1 437 ? 15.265  26.678  13.746  1.00 54.70  ? 437  LEU A CB  1 
ATOM   3330 C CG  . LEU A 1 437 ? 16.373  25.850  13.071  1.00 54.99  ? 437  LEU A CG  1 
ATOM   3331 C CD1 . LEU A 1 437 ? 17.525  25.613  13.966  1.00 53.80  ? 437  LEU A CD1 1 
ATOM   3332 C CD2 . LEU A 1 437 ? 15.841  24.503  12.603  1.00 55.25  ? 437  LEU A CD2 1 
ATOM   3333 N N   . THR A 1 438 ? 17.305  29.333  14.452  1.00 55.27  ? 438  THR A N   1 
ATOM   3334 C CA  . THR A 1 438 ? 17.808  30.648  14.017  1.00 55.87  ? 438  THR A CA  1 
ATOM   3335 C C   . THR A 1 438 ? 18.394  30.606  12.611  1.00 55.13  ? 438  THR A C   1 
ATOM   3336 O O   . THR A 1 438 ? 18.698  31.659  12.037  1.00 55.72  ? 438  THR A O   1 
ATOM   3337 C CB  . THR A 1 438 ? 18.876  31.222  14.993  1.00 56.21  ? 438  THR A CB  1 
ATOM   3338 O OG1 . THR A 1 438 ? 19.932  30.262  15.206  1.00 56.55  ? 438  THR A OG1 1 
ATOM   3339 C CG2 . THR A 1 438 ? 18.226  31.587  16.336  1.00 57.63  ? 438  THR A CG2 1 
ATOM   3340 N N   . TRP A 1 439 ? 18.564  29.399  12.060  1.00 53.71  ? 439  TRP A N   1 
ATOM   3341 C CA  . TRP A 1 439 ? 18.999  29.242  10.667  1.00 53.09  ? 439  TRP A CA  1 
ATOM   3342 C C   . TRP A 1 439 ? 17.837  29.639  9.768   1.00 54.04  ? 439  TRP A C   1 
ATOM   3343 O O   . TRP A 1 439 ? 16.677  29.569  10.187  1.00 55.04  ? 439  TRP A O   1 
ATOM   3344 C CB  . TRP A 1 439 ? 19.417  27.807  10.362  1.00 51.16  ? 439  TRP A CB  1 
ATOM   3345 C CG  . TRP A 1 439 ? 20.638  27.350  11.061  1.00 49.76  ? 439  TRP A CG  1 
ATOM   3346 C CD1 . TRP A 1 439 ? 20.686  26.578  12.162  1.00 48.84  ? 439  TRP A CD1 1 
ATOM   3347 C CD2 . TRP A 1 439 ? 22.006  27.627  10.701  1.00 47.55  ? 439  TRP A CD2 1 
ATOM   3348 N NE1 . TRP A 1 439 ? 21.989  26.362  12.531  1.00 48.08  ? 439  TRP A NE1 1 
ATOM   3349 C CE2 . TRP A 1 439 ? 22.818  26.993  11.647  1.00 48.13  ? 439  TRP A CE2 1 
ATOM   3350 C CE3 . TRP A 1 439 ? 22.611  28.351  9.673   1.00 49.07  ? 439  TRP A CE3 1 
ATOM   3351 C CZ2 . TRP A 1 439 ? 24.223  27.040  11.598  1.00 47.80  ? 439  TRP A CZ2 1 
ATOM   3352 C CZ3 . TRP A 1 439 ? 23.991  28.414  9.620   1.00 49.02  ? 439  TRP A CZ3 1 
ATOM   3353 C CH2 . TRP A 1 439 ? 24.788  27.753  10.579  1.00 48.79  ? 439  TRP A CH2 1 
ATOM   3354 N N   . PRO A 1 440 ? 18.130  30.085  8.534   1.00 54.12  ? 440  PRO A N   1 
ATOM   3355 C CA  . PRO A 1 440 ? 17.029  30.511  7.661   1.00 54.88  ? 440  PRO A CA  1 
ATOM   3356 C C   . PRO A 1 440 ? 16.175  29.346  7.168   1.00 54.46  ? 440  PRO A C   1 
ATOM   3357 O O   . PRO A 1 440 ? 16.597  28.177  7.264   1.00 53.27  ? 440  PRO A O   1 
ATOM   3358 C CB  . PRO A 1 440 ? 17.759  31.186  6.497   1.00 55.45  ? 440  PRO A CB  1 
ATOM   3359 C CG  . PRO A 1 440 ? 19.076  30.507  6.447   1.00 54.09  ? 440  PRO A CG  1 
ATOM   3360 C CD  . PRO A 1 440 ? 19.437  30.236  7.878   1.00 53.96  ? 440  PRO A CD  1 
ATOM   3361 N N   . LEU A 1 441 ? 14.996  29.677  6.643   1.00 54.91  ? 441  LEU A N   1 
ATOM   3362 C CA  . LEU A 1 441 ? 13.996  28.692  6.235   1.00 55.06  ? 441  LEU A CA  1 
ATOM   3363 C C   . LEU A 1 441 ? 14.456  27.734  5.159   1.00 53.94  ? 441  LEU A C   1 
ATOM   3364 O O   . LEU A 1 441 ? 14.099  26.559  5.192   1.00 53.22  ? 441  LEU A O   1 
ATOM   3365 C CB  . LEU A 1 441 ? 12.751  29.384  5.695   1.00 57.12  ? 441  LEU A CB  1 
ATOM   3366 C CG  . LEU A 1 441 ? 11.848  30.055  6.714   1.00 60.13  ? 441  LEU A CG  1 
ATOM   3367 C CD1 . LEU A 1 441 ? 10.899  31.021  5.989   1.00 63.41  ? 441  LEU A CD1 1 
ATOM   3368 C CD2 . LEU A 1 441 ? 11.080  28.996  7.521   1.00 62.83  ? 441  LEU A CD2 1 
ATOM   3369 N N   . TRP A 1 442 ? 15.225  28.237  4.194   1.00 53.26  ? 442  TRP A N   1 
ATOM   3370 C CA  . TRP A 1 442 ? 15.663  27.411  3.080   1.00 52.47  ? 442  TRP A CA  1 
ATOM   3371 C C   . TRP A 1 442 ? 16.470  26.187  3.556   1.00 50.96  ? 442  TRP A C   1 
ATOM   3372 O O   . TRP A 1 442 ? 16.535  25.191  2.853   1.00 50.05  ? 442  TRP A O   1 
ATOM   3373 C CB  . TRP A 1 442 ? 16.454  28.224  2.043   1.00 52.51  ? 442  TRP A CB  1 
ATOM   3374 C CG  . TRP A 1 442 ? 17.856  28.650  2.433   1.00 51.37  ? 442  TRP A CG  1 
ATOM   3375 C CD1 . TRP A 1 442 ? 18.244  29.894  2.847   1.00 52.04  ? 442  TRP A CD1 1 
ATOM   3376 C CD2 . TRP A 1 442 ? 19.057  27.859  2.378   1.00 50.61  ? 442  TRP A CD2 1 
ATOM   3377 N NE1 . TRP A 1 442 ? 19.599  29.918  3.091   1.00 50.65  ? 442  TRP A NE1 1 
ATOM   3378 C CE2 . TRP A 1 442 ? 20.123  28.687  2.807   1.00 49.48  ? 442  TRP A CE2 1 
ATOM   3379 C CE3 . TRP A 1 442 ? 19.337  26.533  2.016   1.00 49.96  ? 442  TRP A CE3 1 
ATOM   3380 C CZ2 . TRP A 1 442 ? 21.429  28.232  2.896   1.00 49.16  ? 442  TRP A CZ2 1 
ATOM   3381 C CZ3 . TRP A 1 442 ? 20.634  26.080  2.104   1.00 48.49  ? 442  TRP A CZ3 1 
ATOM   3382 C CH2 . TRP A 1 442 ? 21.671  26.932  2.541   1.00 49.59  ? 442  TRP A CH2 1 
ATOM   3383 N N   . MET A 1 443 ? 17.056  26.259  4.749   1.00 49.97  ? 443  MET A N   1 
ATOM   3384 C CA  . MET A 1 443 ? 17.854  25.150  5.275   1.00 49.25  ? 443  MET A CA  1 
ATOM   3385 C C   . MET A 1 443 ? 16.992  24.004  5.802   1.00 48.13  ? 443  MET A C   1 
ATOM   3386 O O   . MET A 1 443 ? 17.512  22.912  6.064   1.00 46.92  ? 443  MET A O   1 
ATOM   3387 C CB  . MET A 1 443 ? 18.842  25.646  6.333   1.00 48.40  ? 443  MET A CB  1 
ATOM   3388 C CG  . MET A 1 443 ? 19.847  26.622  5.759   1.00 49.10  ? 443  MET A CG  1 
ATOM   3389 S SD  . MET A 1 443 ? 21.277  27.011  6.817   1.00 51.51  ? 443  MET A SD  1 
ATOM   3390 C CE  . MET A 1 443 ? 21.670  25.439  7.496   1.00 46.94  ? 443  MET A CE  1 
ATOM   3391 N N   . GLY A 1 444 ? 15.681  24.234  5.921   1.00 48.12  ? 444  GLY A N   1 
ATOM   3392 C CA  . GLY A 1 444 ? 14.738  23.180  6.281   1.00 47.96  ? 444  GLY A CA  1 
ATOM   3393 C C   . GLY A 1 444 ? 14.911  22.658  7.701   1.00 47.07  ? 444  GLY A C   1 
ATOM   3394 O O   . GLY A 1 444 ? 14.897  23.436  8.645   1.00 47.16  ? 444  GLY A O   1 
ATOM   3395 N N   . VAL A 1 445 ? 15.045  21.339  7.844   1.00 45.82  ? 445  VAL A N   1 
ATOM   3396 C CA  . VAL A 1 445 ? 15.293  20.692  9.134   1.00 44.87  ? 445  VAL A CA  1 
ATOM   3397 C C   . VAL A 1 445 ? 16.728  20.199  9.073   1.00 44.07  ? 445  VAL A C   1 
ATOM   3398 O O   . VAL A 1 445 ? 16.970  19.079  8.563   1.00 43.93  ? 445  VAL A O   1 
ATOM   3399 C CB  . VAL A 1 445 ? 14.332  19.487  9.392   1.00 44.86  ? 445  VAL A CB  1 
ATOM   3400 C CG1 . VAL A 1 445 ? 14.596  18.881  10.756  1.00 43.33  ? 445  VAL A CG1 1 
ATOM   3401 C CG2 . VAL A 1 445 ? 12.849  19.924  9.274   1.00 46.73  ? 445  VAL A CG2 1 
ATOM   3402 N N   . PRO A 1 446 ? 17.696  21.033  9.534   1.00 42.82  ? 446  PRO A N   1 
ATOM   3403 C CA  . PRO A 1 446 ? 19.094  20.677  9.327   1.00 42.29  ? 446  PRO A CA  1 
ATOM   3404 C C   . PRO A 1 446 ? 19.673  19.607  10.258  1.00 42.02  ? 446  PRO A C   1 
ATOM   3405 O O   . PRO A 1 446 ? 19.170  19.338  11.351  1.00 41.39  ? 446  PRO A O   1 
ATOM   3406 C CB  . PRO A 1 446 ? 19.842  22.012  9.558   1.00 42.21  ? 446  PRO A CB  1 
ATOM   3407 C CG  . PRO A 1 446 ? 18.782  23.066  9.722   1.00 42.48  ? 446  PRO A CG  1 
ATOM   3408 C CD  . PRO A 1 446 ? 17.583  22.331  10.216  1.00 43.40  ? 446  PRO A CD  1 
ATOM   3409 N N   . HIS A 1 447 ? 20.766  19.023  9.797   1.00 42.31  ? 447  HIS A N   1 
ATOM   3410 C CA  . HIS A 1 447 ? 21.540  18.055  10.551  1.00 41.70  ? 447  HIS A CA  1 
ATOM   3411 C C   . HIS A 1 447 ? 21.718  18.591  11.990  1.00 41.85  ? 447  HIS A C   1 
ATOM   3412 O O   . HIS A 1 447 ? 22.164  19.750  12.193  1.00 41.60  ? 447  HIS A O   1 
ATOM   3413 C CB  . HIS A 1 447 ? 22.891  17.932  9.815   1.00 42.09  ? 447  HIS A CB  1 
ATOM   3414 C CG  . HIS A 1 447 ? 23.804  16.852  10.300  1.00 41.29  ? 447  HIS A CG  1 
ATOM   3415 N ND1 . HIS A 1 447 ? 23.555  15.516  10.078  1.00 44.57  ? 447  HIS A ND1 1 
ATOM   3416 C CD2 . HIS A 1 447 ? 25.034  16.916  10.867  1.00 42.11  ? 447  HIS A CD2 1 
ATOM   3417 C CE1 . HIS A 1 447 ? 24.573  14.798  10.533  1.00 43.74  ? 447  HIS A CE1 1 
ATOM   3418 N NE2 . HIS A 1 447 ? 25.482  15.624  11.020  1.00 41.13  ? 447  HIS A NE2 1 
ATOM   3419 N N   . GLY A 1 448 ? 21.373  17.759  12.976  1.00 41.10  ? 448  GLY A N   1 
ATOM   3420 C CA  . GLY A 1 448 ? 21.579  18.092  14.382  1.00 41.02  ? 448  GLY A CA  1 
ATOM   3421 C C   . GLY A 1 448 ? 20.367  18.627  15.135  1.00 41.73  ? 448  GLY A C   1 
ATOM   3422 O O   . GLY A 1 448 ? 20.399  18.672  16.382  1.00 41.05  ? 448  GLY A O   1 
ATOM   3423 N N   . TYR A 1 449 ? 19.292  19.008  14.423  1.00 42.00  ? 449  TYR A N   1 
ATOM   3424 C CA  . TYR A 1 449 ? 18.169  19.727  15.065  1.00 43.08  ? 449  TYR A CA  1 
ATOM   3425 C C   . TYR A 1 449 ? 17.012  18.822  15.511  1.00 43.75  ? 449  TYR A C   1 
ATOM   3426 O O   . TYR A 1 449 ? 15.897  19.285  15.844  1.00 44.51  ? 449  TYR A O   1 
ATOM   3427 C CB  . TYR A 1 449 ? 17.757  20.948  14.204  1.00 44.01  ? 449  TYR A CB  1 
ATOM   3428 C CG  . TYR A 1 449 ? 18.866  22.007  14.308  1.00 44.35  ? 449  TYR A CG  1 
ATOM   3429 C CD1 . TYR A 1 449 ? 19.963  21.991  13.463  1.00 44.06  ? 449  TYR A CD1 1 
ATOM   3430 C CD2 . TYR A 1 449 ? 18.858  22.949  15.337  1.00 45.51  ? 449  TYR A CD2 1 
ATOM   3431 C CE1 . TYR A 1 449 ? 21.008  22.937  13.604  1.00 43.49  ? 449  TYR A CE1 1 
ATOM   3432 C CE2 . TYR A 1 449 ? 19.876  23.880  15.484  1.00 44.78  ? 449  TYR A CE2 1 
ATOM   3433 C CZ  . TYR A 1 449 ? 20.947  23.863  14.629  1.00 44.37  ? 449  TYR A CZ  1 
ATOM   3434 O OH  . TYR A 1 449 ? 21.946  24.793  14.810  1.00 46.23  ? 449  TYR A OH  1 
ATOM   3435 N N   . GLU A 1 450 ? 17.301  17.524  15.548  1.00 43.23  ? 450  GLU A N   1 
ATOM   3436 C CA  . GLU A 1 450 ? 16.461  16.550  16.238  1.00 43.54  ? 450  GLU A CA  1 
ATOM   3437 C C   . GLU A 1 450 ? 16.896  16.347  17.694  1.00 43.18  ? 450  GLU A C   1 
ATOM   3438 O O   . GLU A 1 450 ? 16.089  16.035  18.543  1.00 44.05  ? 450  GLU A O   1 
ATOM   3439 C CB  . GLU A 1 450 ? 16.460  15.230  15.479  1.00 43.62  ? 450  GLU A CB  1 
ATOM   3440 C CG  . GLU A 1 450 ? 17.553  14.255  15.792  1.00 43.45  ? 450  GLU A CG  1 
ATOM   3441 C CD  . GLU A 1 450 ? 18.873  14.620  15.161  1.00 43.78  ? 450  GLU A CD  1 
ATOM   3442 O OE1 . GLU A 1 450 ? 19.105  15.814  14.861  1.00 43.99  ? 450  GLU A OE1 1 
ATOM   3443 O OE2 . GLU A 1 450 ? 19.684  13.695  14.964  1.00 44.41  ? 450  GLU A OE2 1 
ATOM   3444 N N   . ILE A 1 451 ? 18.171  16.578  17.980  1.00 42.88  ? 451  ILE A N   1 
ATOM   3445 C CA  . ILE A 1 451 ? 18.758  16.228  19.279  1.00 42.48  ? 451  ILE A CA  1 
ATOM   3446 C C   . ILE A 1 451 ? 17.998  16.922  20.408  1.00 43.39  ? 451  ILE A C   1 
ATOM   3447 O O   . ILE A 1 451 ? 17.582  16.273  21.391  1.00 42.88  ? 451  ILE A O   1 
ATOM   3448 C CB  . ILE A 1 451 ? 20.256  16.607  19.332  1.00 41.95  ? 451  ILE A CB  1 
ATOM   3449 C CG1 . ILE A 1 451 ? 21.027  15.873  18.229  1.00 39.45  ? 451  ILE A CG1 1 
ATOM   3450 C CG2 . ILE A 1 451 ? 20.841  16.295  20.704  1.00 42.23  ? 451  ILE A CG2 1 
ATOM   3451 C CD1 . ILE A 1 451 ? 22.486  16.271  18.115  1.00 39.49  ? 451  ILE A CD1 1 
ATOM   3452 N N   . GLU A 1 452 ? 17.777  18.230  20.255  1.00 43.79  ? 452  GLU A N   1 
ATOM   3453 C CA  . GLU A 1 452 ? 17.096  19.006  21.304  1.00 44.93  ? 452  GLU A CA  1 
ATOM   3454 C C   . GLU A 1 452 ? 15.751  18.408  21.680  1.00 45.46  ? 452  GLU A C   1 
ATOM   3455 O O   . GLU A 1 452 ? 15.325  18.549  22.819  1.00 46.85  ? 452  GLU A O   1 
ATOM   3456 C CB  . GLU A 1 452 ? 16.934  20.488  20.921  1.00 45.20  ? 452  GLU A CB  1 
ATOM   3457 C CG  . GLU A 1 452 ? 16.069  20.748  19.683  1.00 46.95  ? 452  GLU A CG  1 
ATOM   3458 C CD  . GLU A 1 452 ? 16.383  22.072  19.022  1.00 48.19  ? 452  GLU A CD  1 
ATOM   3459 O OE1 . GLU A 1 452 ? 15.499  22.947  18.966  1.00 52.11  ? 452  GLU A OE1 1 
ATOM   3460 O OE2 . GLU A 1 452 ? 17.518  22.254  18.561  1.00 47.73  ? 452  GLU A OE2 1 
ATOM   3461 N N   . PHE A 1 453 ? 15.086  17.735  20.743  1.00 45.86  ? 453  PHE A N   1 
ATOM   3462 C CA  . PHE A 1 453 ? 13.769  17.131  21.021  1.00 46.82  ? 453  PHE A CA  1 
ATOM   3463 C C   . PHE A 1 453 ? 13.860  15.786  21.737  1.00 47.05  ? 453  PHE A C   1 
ATOM   3464 O O   . PHE A 1 453 ? 13.028  15.458  22.598  1.00 48.16  ? 453  PHE A O   1 
ATOM   3465 C CB  . PHE A 1 453 ? 12.977  16.979  19.728  1.00 47.47  ? 453  PHE A CB  1 
ATOM   3466 C CG  . PHE A 1 453 ? 12.526  18.287  19.163  1.00 48.31  ? 453  PHE A CG  1 
ATOM   3467 C CD1 . PHE A 1 453 ? 11.342  18.860  19.589  1.00 47.13  ? 453  PHE A CD1 1 
ATOM   3468 C CD2 . PHE A 1 453 ? 13.307  18.966  18.241  1.00 45.08  ? 453  PHE A CD2 1 
ATOM   3469 C CE1 . PHE A 1 453 ? 10.956  20.083  19.112  1.00 48.10  ? 453  PHE A CE1 1 
ATOM   3470 C CE2 . PHE A 1 453 ? 12.909  20.170  17.748  1.00 47.11  ? 453  PHE A CE2 1 
ATOM   3471 C CZ  . PHE A 1 453 ? 11.726  20.740  18.198  1.00 47.83  ? 453  PHE A CZ  1 
ATOM   3472 N N   . ILE A 1 454 ? 14.861  14.999  21.372  1.00 46.13  ? 454  ILE A N   1 
ATOM   3473 C CA  . ILE A 1 454 ? 15.086  13.688  21.982  1.00 45.90  ? 454  ILE A CA  1 
ATOM   3474 C C   . ILE A 1 454 ? 15.531  13.886  23.426  1.00 45.46  ? 454  ILE A C   1 
ATOM   3475 O O   . ILE A 1 454 ? 15.106  13.159  24.301  1.00 46.45  ? 454  ILE A O   1 
ATOM   3476 C CB  . ILE A 1 454 ? 16.133  12.875  21.150  1.00 45.91  ? 454  ILE A CB  1 
ATOM   3477 C CG1 . ILE A 1 454 ? 15.693  12.851  19.674  1.00 46.58  ? 454  ILE A CG1 1 
ATOM   3478 C CG2 . ILE A 1 454 ? 16.421  11.494  21.752  1.00 44.77  ? 454  ILE A CG2 1 
ATOM   3479 C CD1 . ILE A 1 454 ? 15.672  11.556  19.048  1.00 49.41  ? 454  ILE A CD1 1 
ATOM   3480 N N   . PHE A 1 455 ? 16.371  14.883  23.681  1.00 44.33  ? 455  PHE A N   1 
ATOM   3481 C CA  . PHE A 1 455 ? 16.774  15.209  25.045  1.00 43.91  ? 455  PHE A CA  1 
ATOM   3482 C C   . PHE A 1 455 ? 15.697  15.942  25.875  1.00 45.44  ? 455  PHE A C   1 
ATOM   3483 O O   . PHE A 1 455 ? 15.868  16.127  27.083  1.00 45.86  ? 455  PHE A O   1 
ATOM   3484 C CB  . PHE A 1 455 ? 18.096  16.000  25.041  1.00 42.90  ? 455  PHE A CB  1 
ATOM   3485 C CG  . PHE A 1 455 ? 19.324  15.121  24.947  1.00 41.26  ? 455  PHE A CG  1 
ATOM   3486 C CD1 . PHE A 1 455 ? 19.755  14.636  23.733  1.00 41.09  ? 455  PHE A CD1 1 
ATOM   3487 C CD2 . PHE A 1 455 ? 20.038  14.777  26.079  1.00 41.32  ? 455  PHE A CD2 1 
ATOM   3488 C CE1 . PHE A 1 455 ? 20.889  13.815  23.654  1.00 39.68  ? 455  PHE A CE1 1 
ATOM   3489 C CE2 . PHE A 1 455 ? 21.160  13.962  26.000  1.00 40.43  ? 455  PHE A CE2 1 
ATOM   3490 C CZ  . PHE A 1 455 ? 21.581  13.494  24.794  1.00 40.37  ? 455  PHE A CZ  1 
ATOM   3491 N N   . GLY A 1 456 ? 14.614  16.383  25.236  1.00 46.33  ? 456  GLY A N   1 
ATOM   3492 C CA  . GLY A 1 456 ? 13.464  16.926  25.943  1.00 47.31  ? 456  GLY A CA  1 
ATOM   3493 C C   . GLY A 1 456 ? 13.572  18.394  26.312  1.00 48.04  ? 456  GLY A C   1 
ATOM   3494 O O   . GLY A 1 456 ? 12.887  18.868  27.216  1.00 48.82  ? 456  GLY A O   1 
ATOM   3495 N N   . LEU A 1 457 ? 14.396  19.146  25.598  1.00 48.50  ? 457  LEU A N   1 
ATOM   3496 C CA  . LEU A 1 457 ? 14.562  20.568  25.912  1.00 49.69  ? 457  LEU A CA  1 
ATOM   3497 C C   . LEU A 1 457 ? 13.268  21.394  25.837  1.00 51.38  ? 457  LEU A C   1 
ATOM   3498 O O   . LEU A 1 457 ? 13.110  22.313  26.625  1.00 52.96  ? 457  LEU A O   1 
ATOM   3499 C CB  . LEU A 1 457 ? 15.649  21.215  25.058  1.00 48.96  ? 457  LEU A CB  1 
ATOM   3500 C CG  . LEU A 1 457 ? 17.066  21.102  25.648  1.00 49.64  ? 457  LEU A CG  1 
ATOM   3501 C CD1 . LEU A 1 457 ? 17.533  19.633  25.708  1.00 46.96  ? 457  LEU A CD1 1 
ATOM   3502 C CD2 . LEU A 1 457 ? 18.045  21.979  24.853  1.00 49.28  ? 457  LEU A CD2 1 
ATOM   3503 N N   . PRO A 1 458 ? 12.363  21.108  24.882  1.00 52.24  ? 458  PRO A N   1 
ATOM   3504 C CA  . PRO A 1 458 ? 11.039  21.776  24.852  1.00 54.34  ? 458  PRO A CA  1 
ATOM   3505 C C   . PRO A 1 458 ? 10.240  21.771  26.157  1.00 55.93  ? 458  PRO A C   1 
ATOM   3506 O O   . PRO A 1 458 ? 9.397   22.656  26.352  1.00 57.22  ? 458  PRO A O   1 
ATOM   3507 C CB  . PRO A 1 458 ? 10.295  21.020  23.745  1.00 54.15  ? 458  PRO A CB  1 
ATOM   3508 C CG  . PRO A 1 458 ? 11.394  20.612  22.818  1.00 52.62  ? 458  PRO A CG  1 
ATOM   3509 C CD  . PRO A 1 458 ? 12.539  20.242  23.709  1.00 51.93  ? 458  PRO A CD  1 
ATOM   3510 N N   . LEU A 1 459 ? 10.514  20.799  27.033  1.00 56.65  ? 459  LEU A N   1 
ATOM   3511 C CA  . LEU A 1 459 ? 9.905   20.733  28.364  1.00 58.24  ? 459  LEU A CA  1 
ATOM   3512 C C   . LEU A 1 459 ? 10.288  21.893  29.282  1.00 59.07  ? 459  LEU A C   1 
ATOM   3513 O O   . LEU A 1 459 ? 9.601   22.134  30.272  1.00 60.51  ? 459  LEU A O   1 
ATOM   3514 C CB  . LEU A 1 459 ? 10.220  19.398  29.055  1.00 58.23  ? 459  LEU A CB  1 
ATOM   3515 C CG  . LEU A 1 459 ? 9.355   18.176  28.691  1.00 59.80  ? 459  LEU A CG  1 
ATOM   3516 C CD1 . LEU A 1 459 ? 9.094   18.063  27.207  1.00 61.61  ? 459  LEU A CD1 1 
ATOM   3517 C CD2 . LEU A 1 459 ? 10.009  16.907  29.185  1.00 59.47  ? 459  LEU A CD2 1 
ATOM   3518 N N   . ASP A 1 460 ? 11.370  22.601  28.965  1.00 58.87  ? 460  ASP A N   1 
ATOM   3519 C CA  . ASP A 1 460 ? 11.808  23.751  29.756  1.00 60.12  ? 460  ASP A CA  1 
ATOM   3520 C C   . ASP A 1 460 ? 11.086  25.008  29.280  1.00 61.76  ? 460  ASP A C   1 
ATOM   3521 O O   . ASP A 1 460 ? 11.355  25.488  28.177  1.00 61.38  ? 460  ASP A O   1 
ATOM   3522 C CB  . ASP A 1 460 ? 13.320  23.955  29.626  1.00 59.14  ? 460  ASP A CB  1 
ATOM   3523 C CG  . ASP A 1 460 ? 13.826  25.146  30.434  1.00 60.25  ? 460  ASP A CG  1 
ATOM   3524 O OD1 . ASP A 1 460 ? 12.998  25.907  30.997  1.00 62.31  ? 460  ASP A OD1 1 
ATOM   3525 O OD2 . ASP A 1 460 ? 15.056  25.319  30.505  1.00 59.67  ? 460  ASP A OD2 1 
ATOM   3526 N N   . PRO A 1 461 ? 10.198  25.572  30.117  1.00 63.98  ? 461  PRO A N   1 
ATOM   3527 C CA  . PRO A 1 461 ? 9.378   26.695  29.630  1.00 65.83  ? 461  PRO A CA  1 
ATOM   3528 C C   . PRO A 1 461 ? 10.181  27.964  29.308  1.00 65.96  ? 461  PRO A C   1 
ATOM   3529 O O   . PRO A 1 461 ? 9.766   28.741  28.452  1.00 66.94  ? 461  PRO A O   1 
ATOM   3530 C CB  . PRO A 1 461 ? 8.383   26.943  30.776  1.00 67.54  ? 461  PRO A CB  1 
ATOM   3531 C CG  . PRO A 1 461 ? 8.493   25.749  31.676  1.00 67.03  ? 461  PRO A CG  1 
ATOM   3532 C CD  . PRO A 1 461 ? 9.908   25.268  31.525  1.00 64.89  ? 461  PRO A CD  1 
ATOM   3533 N N   . SER A 1 462 ? 11.334  28.147  29.946  1.00 65.73  ? 462  SER A N   1 
ATOM   3534 C CA  . SER A 1 462 ? 12.204  29.281  29.632  1.00 65.92  ? 462  SER A CA  1 
ATOM   3535 C C   . SER A 1 462 ? 12.686  29.287  28.169  1.00 65.04  ? 462  SER A C   1 
ATOM   3536 O O   . SER A 1 462 ? 13.097  30.340  27.665  1.00 65.57  ? 462  SER A O   1 
ATOM   3537 C CB  . SER A 1 462 ? 13.404  29.344  30.587  1.00 65.32  ? 462  SER A CB  1 
ATOM   3538 O OG  . SER A 1 462 ? 14.382  28.354  30.287  1.00 63.92  ? 462  SER A OG  1 
ATOM   3539 N N   . LEU A 1 463 ? 12.614  28.140  27.484  1.00 63.92  ? 463  LEU A N   1 
ATOM   3540 C CA  . LEU A 1 463 ? 13.082  28.039  26.095  1.00 62.81  ? 463  LEU A CA  1 
ATOM   3541 C C   . LEU A 1 463 ? 12.059  28.429  25.001  1.00 63.40  ? 463  LEU A C   1 
ATOM   3542 O O   . LEU A 1 463 ? 12.408  28.489  23.827  1.00 63.26  ? 463  LEU A O   1 
ATOM   3543 C CB  . LEU A 1 463 ? 13.676  26.646  25.834  1.00 61.36  ? 463  LEU A CB  1 
ATOM   3544 C CG  . LEU A 1 463 ? 14.903  26.309  26.697  1.00 60.82  ? 463  LEU A CG  1 
ATOM   3545 C CD1 . LEU A 1 463 ? 15.477  24.945  26.321  1.00 58.57  ? 463  LEU A CD1 1 
ATOM   3546 C CD2 . LEU A 1 463 ? 15.995  27.395  26.605  1.00 59.58  ? 463  LEU A CD2 1 
ATOM   3547 N N   . ASN A 1 464 ? 10.814  28.710  25.356  1.00 64.73  ? 464  ASN A N   1 
ATOM   3548 C CA  . ASN A 1 464 ? 9.862   29.302  24.386  1.00 65.70  ? 464  ASN A CA  1 
ATOM   3549 C C   . ASN A 1 464 ? 9.454   28.411  23.191  1.00 63.57  ? 464  ASN A C   1 
ATOM   3550 O O   . ASN A 1 464 ? 8.987   28.932  22.167  1.00 63.28  ? 464  ASN A O   1 
ATOM   3551 C CB  . ASN A 1 464 ? 10.399  30.643  23.820  1.00 66.86  ? 464  ASN A CB  1 
ATOM   3552 C CG  . ASN A 1 464 ? 10.640  31.702  24.896  1.00 71.83  ? 464  ASN A CG  1 
ATOM   3553 O OD1 . ASN A 1 464 ? 10.063  31.647  25.991  1.00 73.39  ? 464  ASN A OD1 1 
ATOM   3554 N ND2 . ASN A 1 464 ? 11.503  32.684  24.575  1.00 79.42  ? 464  ASN A ND2 1 
ATOM   3555 N N   . TYR A 1 465 ? 9.624   27.091  23.309  1.00 60.73  ? 465  TYR A N   1 
ATOM   3556 C CA  . TYR A 1 465 ? 9.036   26.163  22.338  1.00 59.58  ? 465  TYR A CA  1 
ATOM   3557 C C   . TYR A 1 465 ? 7.511   26.197  22.484  1.00 60.48  ? 465  TYR A C   1 
ATOM   3558 O O   . TYR A 1 465 ? 7.004   26.621  23.508  1.00 61.38  ? 465  TYR A O   1 
ATOM   3559 C CB  . TYR A 1 465 ? 9.508   24.728  22.571  1.00 58.19  ? 465  TYR A CB  1 
ATOM   3560 C CG  . TYR A 1 465 ? 10.962  24.434  22.273  1.00 56.22  ? 465  TYR A CG  1 
ATOM   3561 C CD1 . TYR A 1 465 ? 11.345  23.965  21.035  1.00 55.33  ? 465  TYR A CD1 1 
ATOM   3562 C CD2 . TYR A 1 465 ? 11.950  24.578  23.251  1.00 56.48  ? 465  TYR A CD2 1 
ATOM   3563 C CE1 . TYR A 1 465 ? 12.669  23.660  20.757  1.00 53.52  ? 465  TYR A CE1 1 
ATOM   3564 C CE2 . TYR A 1 465 ? 13.290  24.261  22.984  1.00 54.85  ? 465  TYR A CE2 1 
ATOM   3565 C CZ  . TYR A 1 465 ? 13.634  23.811  21.730  1.00 53.57  ? 465  TYR A CZ  1 
ATOM   3566 O OH  . TYR A 1 465 ? 14.943  23.502  21.436  1.00 53.74  ? 465  TYR A OH  1 
ATOM   3567 N N   . THR A 1 466 ? 6.789   25.733  21.469  1.00 60.48  ? 466  THR A N   1 
ATOM   3568 C CA  . THR A 1 466 ? 5.322   25.676  21.517  1.00 61.58  ? 466  THR A CA  1 
ATOM   3569 C C   . THR A 1 466 ? 4.827   24.511  22.361  1.00 61.75  ? 466  THR A C   1 
ATOM   3570 O O   . THR A 1 466 ? 5.567   23.571  22.642  1.00 59.82  ? 466  THR A O   1 
ATOM   3571 C CB  . THR A 1 466 ? 4.697   25.486  20.117  1.00 62.10  ? 466  THR A CB  1 
ATOM   3572 O OG1 . THR A 1 466 ? 5.207   24.279  19.532  1.00 61.18  ? 466  THR A OG1 1 
ATOM   3573 C CG2 . THR A 1 466 ? 4.990   26.665  19.212  1.00 61.30  ? 466  THR A CG2 1 
ATOM   3574 N N   . THR A 1 467 ? 3.546   24.565  22.720  1.00 63.11  ? 467  THR A N   1 
ATOM   3575 C CA  . THR A 1 467 ? 2.893   23.501  23.479  1.00 64.27  ? 467  THR A CA  1 
ATOM   3576 C C   . THR A 1 467 ? 2.910   22.167  22.722  1.00 63.62  ? 467  THR A C   1 
ATOM   3577 O O   . THR A 1 467 ? 3.097   21.098  23.307  1.00 63.50  ? 467  THR A O   1 
ATOM   3578 C CB  . THR A 1 467 ? 1.432   23.917  23.850  1.00 66.67  ? 467  THR A CB  1 
ATOM   3579 O OG1 . THR A 1 467 ? 1.464   24.711  25.046  1.00 67.18  ? 467  THR A OG1 1 
ATOM   3580 C CG2 . THR A 1 467 ? 0.542   22.699  24.076  1.00 68.05  ? 467  THR A CG2 1 
ATOM   3581 N N   . GLU A 1 468 ? 2.744   22.254  21.412  1.00 63.67  ? 468  GLU A N   1 
ATOM   3582 C CA  . GLU A 1 468 ? 2.732   21.087  20.542  1.00 63.57  ? 468  GLU A CA  1 
ATOM   3583 C C   . GLU A 1 468 ? 4.130   20.454  20.491  1.00 61.12  ? 468  GLU A C   1 
ATOM   3584 O O   . GLU A 1 468 ? 4.254   19.238  20.421  1.00 60.02  ? 468  GLU A O   1 
ATOM   3585 C CB  . GLU A 1 468 ? 2.251   21.487  19.140  1.00 64.47  ? 468  GLU A CB  1 
ATOM   3586 C CG  . GLU A 1 468 ? 0.867   22.193  19.139  1.00 69.78  ? 468  GLU A CG  1 
ATOM   3587 C CD  . GLU A 1 468 ? 0.936   23.735  19.318  1.00 73.41  ? 468  GLU A CD  1 
ATOM   3588 O OE1 . GLU A 1 468 ? 0.838   24.227  20.472  1.00 74.23  ? 468  GLU A OE1 1 
ATOM   3589 O OE2 . GLU A 1 468 ? 1.094   24.450  18.295  1.00 76.47  ? 468  GLU A OE2 1 
ATOM   3590 N N   . GLU A 1 469 ? 5.164   21.292  20.552  1.00 59.71  ? 469  GLU A N   1 
ATOM   3591 C CA  . GLU A 1 469 ? 6.557   20.829  20.576  1.00 58.21  ? 469  GLU A CA  1 
ATOM   3592 C C   . GLU A 1 469 ? 6.953   20.100  21.874  1.00 57.90  ? 469  GLU A C   1 
ATOM   3593 O O   . GLU A 1 469 ? 7.749   19.158  21.852  1.00 56.90  ? 469  GLU A O   1 
ATOM   3594 C CB  . GLU A 1 469 ? 7.495   22.011  20.311  1.00 57.39  ? 469  GLU A CB  1 
ATOM   3595 C CG  . GLU A 1 469 ? 7.488   22.413  18.851  1.00 57.74  ? 469  GLU A CG  1 
ATOM   3596 C CD  . GLU A 1 469 ? 8.338   23.633  18.536  1.00 57.05  ? 469  GLU A CD  1 
ATOM   3597 O OE1 . GLU A 1 469 ? 8.302   24.635  19.280  1.00 54.28  ? 469  GLU A OE1 1 
ATOM   3598 O OE2 . GLU A 1 469 ? 9.038   23.579  17.512  1.00 58.53  ? 469  GLU A OE2 1 
ATOM   3599 N N   . ARG A 1 470 ? 6.396   20.547  22.995  1.00 59.31  ? 470  ARG A N   1 
ATOM   3600 C CA  . ARG A 1 470 ? 6.494   19.847  24.278  1.00 59.79  ? 470  ARG A CA  1 
ATOM   3601 C C   . ARG A 1 470 ? 5.926   18.414  24.174  1.00 59.29  ? 470  ARG A C   1 
ATOM   3602 O O   . ARG A 1 470 ? 6.576   17.461  24.590  1.00 58.19  ? 470  ARG A O   1 
ATOM   3603 C CB  A ARG A 1 470 ? 5.764   20.659  25.369  0.50 61.15  ? 470  ARG A CB  1 
ATOM   3604 C CB  B ARG A 1 470 ? 5.772   20.618  25.392  0.50 61.39  ? 470  ARG A CB  1 
ATOM   3605 C CG  A ARG A 1 470 ? 5.916   20.144  26.812  0.50 62.29  ? 470  ARG A CG  1 
ATOM   3606 C CG  B ARG A 1 470 ? 6.245   20.234  26.797  0.50 62.91  ? 470  ARG A CG  1 
ATOM   3607 C CD  A ARG A 1 470 ? 5.161   21.053  27.828  0.50 64.23  ? 470  ARG A CD  1 
ATOM   3608 C CD  B ARG A 1 470 ? 5.188   20.504  27.884  0.50 66.82  ? 470  ARG A CD  1 
ATOM   3609 N NE  A ARG A 1 470 ? 4.897   20.379  29.112  0.50 66.11  ? 470  ARG A NE  1 
ATOM   3610 N NE  B ARG A 1 470 ? 4.201   19.419  27.976  0.50 68.27  ? 470  ARG A NE  1 
ATOM   3611 C CZ  A ARG A 1 470 ? 5.696   20.394  30.185  0.50 65.96  ? 470  ARG A CZ  1 
ATOM   3612 C CZ  B ARG A 1 470 ? 2.930   19.490  27.588  0.50 69.87  ? 470  ARG A CZ  1 
ATOM   3613 N NH1 A ARG A 1 470 ? 5.331   19.732  31.276  0.50 66.81  ? 470  ARG A NH1 1 
ATOM   3614 N NH1 B ARG A 1 470 ? 2.154   18.419  27.719  0.50 71.13  ? 470  ARG A NH1 1 
ATOM   3615 N NH2 A ARG A 1 470 ? 6.849   21.061  30.192  0.50 64.92  ? 470  ARG A NH2 1 
ATOM   3616 N NH2 B ARG A 1 470 ? 2.420   20.612  27.081  0.50 71.32  ? 470  ARG A NH2 1 
ATOM   3617 N N   . ILE A 1 471 ? 4.727   18.262  23.619  1.00 59.65  ? 471  ILE A N   1 
ATOM   3618 C CA  . ILE A 1 471 ? 4.115   16.933  23.466  1.00 59.71  ? 471  ILE A CA  1 
ATOM   3619 C C   . ILE A 1 471 ? 4.915   16.040  22.495  1.00 57.97  ? 471  ILE A C   1 
ATOM   3620 O O   . ILE A 1 471 ? 5.106   14.846  22.741  1.00 57.35  ? 471  ILE A O   1 
ATOM   3621 C CB  . ILE A 1 471 ? 2.639   17.051  23.018  1.00 61.89  ? 471  ILE A CB  1 
ATOM   3622 C CG1 . ILE A 1 471 ? 1.797   17.687  24.136  1.00 63.97  ? 471  ILE A CG1 1 
ATOM   3623 C CG2 . ILE A 1 471 ? 2.047   15.677  22.666  1.00 62.86  ? 471  ILE A CG2 1 
ATOM   3624 C CD1 . ILE A 1 471 ? 0.507   18.330  23.649  1.00 66.95  ? 471  ILE A CD1 1 
ATOM   3625 N N   . PHE A 1 472 ? 5.387   16.629  21.400  1.00 56.69  ? 472  PHE A N   1 
ATOM   3626 C CA  . PHE A 1 472 ? 6.247   15.934  20.441  1.00 55.26  ? 472  PHE A CA  1 
ATOM   3627 C C   . PHE A 1 472 ? 7.536   15.440  21.122  1.00 53.96  ? 472  PHE A C   1 
ATOM   3628 O O   . PHE A 1 472 ? 7.917   14.275  20.958  1.00 53.72  ? 472  PHE A O   1 
ATOM   3629 C CB  . PHE A 1 472 ? 6.544   16.863  19.257  1.00 54.62  ? 472  PHE A CB  1 
ATOM   3630 C CG  . PHE A 1 472 ? 7.447   16.273  18.197  1.00 52.93  ? 472  PHE A CG  1 
ATOM   3631 C CD1 . PHE A 1 472 ? 7.203   15.019  17.660  1.00 52.04  ? 472  PHE A CD1 1 
ATOM   3632 C CD2 . PHE A 1 472 ? 8.532   17.001  17.719  1.00 52.00  ? 472  PHE A CD2 1 
ATOM   3633 C CE1 . PHE A 1 472 ? 8.019   14.490  16.678  1.00 51.20  ? 472  PHE A CE1 1 
ATOM   3634 C CE2 . PHE A 1 472 ? 9.370   16.473  16.738  1.00 50.76  ? 472  PHE A CE2 1 
ATOM   3635 C CZ  . PHE A 1 472 ? 9.114   15.224  16.214  1.00 51.61  ? 472  PHE A CZ  1 
ATOM   3636 N N   . ALA A 1 473 ? 8.178   16.300  21.914  1.00 53.27  ? 473  ALA A N   1 
ATOM   3637 C CA  . ALA A 1 473 ? 9.396   15.911  22.629  1.00 52.75  ? 473  ALA A CA  1 
ATOM   3638 C C   . ALA A 1 473 ? 9.143   14.706  23.541  1.00 53.32  ? 473  ALA A C   1 
ATOM   3639 O O   . ALA A 1 473 ? 9.928   13.760  23.566  1.00 52.23  ? 473  ALA A O   1 
ATOM   3640 C CB  . ALA A 1 473 ? 9.958   17.078  23.429  1.00 52.44  ? 473  ALA A CB  1 
ATOM   3641 N N   . GLN A 1 474 ? 8.033   14.740  24.260  1.00 54.67  ? 474  GLN A N   1 
ATOM   3642 C CA  . GLN A 1 474 ? 7.656   13.651  25.159  1.00 55.96  ? 474  GLN A CA  1 
ATOM   3643 C C   . GLN A 1 474 ? 7.440   12.330  24.433  1.00 55.91  ? 474  GLN A C   1 
ATOM   3644 O O   . GLN A 1 474 ? 7.845   11.285  24.926  1.00 56.00  ? 474  GLN A O   1 
ATOM   3645 C CB  . GLN A 1 474 ? 6.395   14.025  25.941  1.00 57.64  ? 474  GLN A CB  1 
ATOM   3646 C CG  . GLN A 1 474 ? 6.602   15.163  26.922  1.00 59.09  ? 474  GLN A CG  1 
ATOM   3647 C CD  . GLN A 1 474 ? 5.352   15.479  27.688  1.00 63.30  ? 474  GLN A CD  1 
ATOM   3648 O OE1 . GLN A 1 474 ? 4.453   16.164  27.194  1.00 65.55  ? 474  GLN A OE1 1 
ATOM   3649 N NE2 . GLN A 1 474 ? 5.277   14.973  28.905  1.00 66.05  ? 474  GLN A NE2 1 
ATOM   3650 N N   . ARG A 1 475 ? 6.786   12.368  23.275  1.00 56.59  ? 475  ARG A N   1 
ATOM   3651 C CA  . ARG A 1 475 ? 6.679   11.175  22.422  1.00 56.72  ? 475  ARG A CA  1 
ATOM   3652 C C   . ARG A 1 475 ? 8.048   10.597  22.043  1.00 54.64  ? 475  ARG A C   1 
ATOM   3653 O O   . ARG A 1 475 ? 8.272   9.390   22.143  1.00 54.18  ? 475  ARG A O   1 
ATOM   3654 C CB  . ARG A 1 475 ? 5.935   11.488  21.135  1.00 57.30  ? 475  ARG A CB  1 
ATOM   3655 C CG  . ARG A 1 475 ? 4.433   11.547  21.289  1.00 60.22  ? 475  ARG A CG  1 
ATOM   3656 C CD  . ARG A 1 475 ? 3.807   11.988  19.983  1.00 60.72  ? 475  ARG A CD  1 
ATOM   3657 N NE  . ARG A 1 475 ? 4.252   11.123  18.898  1.00 60.27  ? 475  ARG A NE  1 
ATOM   3658 C CZ  . ARG A 1 475 ? 4.330   11.474  17.619  1.00 59.21  ? 475  ARG A CZ  1 
ATOM   3659 N NH1 . ARG A 1 475 ? 3.962   12.682  17.217  1.00 59.68  ? 475  ARG A NH1 1 
ATOM   3660 N NH2 . ARG A 1 475 ? 4.772   10.592  16.731  1.00 58.83  ? 475  ARG A NH2 1 
ATOM   3661 N N   . LEU A 1 476 ? 8.939   11.455  21.563  1.00 53.43  ? 476  LEU A N   1 
ATOM   3662 C CA  . LEU A 1 476 ? 10.283  11.003  21.157  1.00 52.54  ? 476  LEU A CA  1 
ATOM   3663 C C   . LEU A 1 476 ? 11.032  10.374  22.311  1.00 52.23  ? 476  LEU A C   1 
ATOM   3664 O O   . LEU A 1 476 ? 11.640  9.317   22.147  1.00 52.23  ? 476  LEU A O   1 
ATOM   3665 C CB  . LEU A 1 476 ? 11.113  12.145  20.574  1.00 51.02  ? 476  LEU A CB  1 
ATOM   3666 C CG  . LEU A 1 476 ? 10.615  12.673  19.234  1.00 52.06  ? 476  LEU A CG  1 
ATOM   3667 C CD1 . LEU A 1 476 ? 11.432  13.865  18.788  1.00 50.36  ? 476  LEU A CD1 1 
ATOM   3668 C CD2 . LEU A 1 476 ? 10.655  11.573  18.194  1.00 53.35  ? 476  LEU A CD2 1 
ATOM   3669 N N   . MET A 1 477 ? 10.994  11.023  23.472  1.00 52.49  ? 477  MET A N   1 
ATOM   3670 C CA  . MET A 1 477 ? 11.685  10.497  24.653  1.00 52.73  ? 477  MET A CA  1 
ATOM   3671 C C   . MET A 1 477 ? 11.163  9.104   24.992  1.00 53.21  ? 477  MET A C   1 
ATOM   3672 O O   . MET A 1 477 ? 11.928  8.244   25.419  1.00 52.87  ? 477  MET A O   1 
ATOM   3673 C CB  . MET A 1 477 ? 11.514  11.424  25.856  1.00 52.70  ? 477  MET A CB  1 
ATOM   3674 C CG  . MET A 1 477 ? 12.103  12.823  25.686  1.00 52.43  ? 477  MET A CG  1 
ATOM   3675 S SD  . MET A 1 477 ? 11.525  13.953  26.990  1.00 55.76  ? 477  MET A SD  1 
ATOM   3676 C CE  . MET A 1 477 ? 12.741  13.498  28.213  1.00 52.12  ? 477  MET A CE  1 
ATOM   3677 N N   . LYS A 1 478 ? 9.867   8.875   24.792  1.00 54.26  ? 478  LYS A N   1 
ATOM   3678 C CA  . LYS A 1 478 ? 9.286   7.551   25.046  1.00 55.61  ? 478  LYS A CA  1 
ATOM   3679 C C   . LYS A 1 478 ? 9.765   6.479   24.063  1.00 54.44  ? 478  LYS A C   1 
ATOM   3680 O O   . LYS A 1 478 ? 10.079  5.363   24.479  1.00 53.76  ? 478  LYS A O   1 
ATOM   3681 C CB  . LYS A 1 478 ? 7.756   7.596   25.069  1.00 57.57  ? 478  LYS A CB  1 
ATOM   3682 C CG  . LYS A 1 478 ? 7.211   8.206   26.334  1.00 61.37  ? 478  LYS A CG  1 
ATOM   3683 C CD  . LYS A 1 478 ? 5.884   7.600   26.780  1.00 67.18  ? 478  LYS A CD  1 
ATOM   3684 C CE  . LYS A 1 478 ? 5.583   7.969   28.237  1.00 69.59  ? 478  LYS A CE  1 
ATOM   3685 N NZ  . LYS A 1 478 ? 6.732   7.614   29.160  1.00 71.45  ? 478  LYS A NZ  1 
ATOM   3686 N N   . TYR A 1 479 ? 9.833   6.817   22.773  1.00 53.42  ? 479  TYR A N   1 
ATOM   3687 C CA  . TYR A 1 479 ? 10.289  5.851   21.763  1.00 52.81  ? 479  TYR A CA  1 
ATOM   3688 C C   . TYR A 1 479 ? 11.712  5.416   22.081  1.00 51.61  ? 479  TYR A C   1 
ATOM   3689 O O   . TYR A 1 479 ? 12.023  4.227   22.038  1.00 52.01  ? 479  TYR A O   1 
ATOM   3690 C CB  . TYR A 1 479 ? 10.280  6.442   20.350  1.00 52.54  ? 479  TYR A CB  1 
ATOM   3691 C CG  . TYR A 1 479 ? 8.929   6.750   19.746  1.00 53.37  ? 479  TYR A CG  1 
ATOM   3692 C CD1 . TYR A 1 479 ? 7.884   5.842   19.812  1.00 53.89  ? 479  TYR A CD1 1 
ATOM   3693 C CD2 . TYR A 1 479 ? 8.719   7.942   19.066  1.00 52.93  ? 479  TYR A CD2 1 
ATOM   3694 C CE1 . TYR A 1 479 ? 6.672   6.117   19.236  1.00 55.77  ? 479  TYR A CE1 1 
ATOM   3695 C CE2 . TYR A 1 479 ? 7.493   8.231   18.493  1.00 53.68  ? 479  TYR A CE2 1 
ATOM   3696 C CZ  . TYR A 1 479 ? 6.480   7.317   18.574  1.00 55.70  ? 479  TYR A CZ  1 
ATOM   3697 O OH  . TYR A 1 479 ? 5.253   7.608   18.012  1.00 57.48  ? 479  TYR A OH  1 
ATOM   3698 N N   . TRP A 1 480 ? 12.556  6.393   22.403  1.00 49.57  ? 480  TRP A N   1 
ATOM   3699 C CA  . TRP A 1 480 ? 13.979  6.150   22.651  1.00 48.73  ? 480  TRP A CA  1 
ATOM   3700 C C   . TRP A 1 480 ? 14.217  5.314   23.909  1.00 49.13  ? 480  TRP A C   1 
ATOM   3701 O O   . TRP A 1 480 ? 15.078  4.421   23.924  1.00 48.45  ? 480  TRP A O   1 
ATOM   3702 C CB  . TRP A 1 480 ? 14.734  7.476   22.754  1.00 47.30  ? 480  TRP A CB  1 
ATOM   3703 C CG  . TRP A 1 480 ? 15.497  7.866   21.504  1.00 46.56  ? 480  TRP A CG  1 
ATOM   3704 C CD1 . TRP A 1 480 ? 16.839  8.044   21.401  1.00 45.10  ? 480  TRP A CD1 1 
ATOM   3705 C CD2 . TRP A 1 480 ? 14.956  8.135   20.200  1.00 46.44  ? 480  TRP A CD2 1 
ATOM   3706 N NE1 . TRP A 1 480 ? 17.174  8.411   20.113  1.00 44.92  ? 480  TRP A NE1 1 
ATOM   3707 C CE2 . TRP A 1 480 ? 16.035  8.465   19.358  1.00 43.65  ? 480  TRP A CE2 1 
ATOM   3708 C CE3 . TRP A 1 480 ? 13.662  8.125   19.663  1.00 47.25  ? 480  TRP A CE3 1 
ATOM   3709 C CZ2 . TRP A 1 480 ? 15.866  8.765   18.013  1.00 44.26  ? 480  TRP A CZ2 1 
ATOM   3710 C CZ3 . TRP A 1 480 ? 13.492  8.440   18.333  1.00 47.58  ? 480  TRP A CZ3 1 
ATOM   3711 C CH2 . TRP A 1 480 ? 14.592  8.770   17.518  1.00 46.09  ? 480  TRP A CH2 1 
ATOM   3712 N N   . THR A 1 481 ? 13.452  5.595   24.963  1.00 50.12  ? 481  THR A N   1 
ATOM   3713 C CA  . THR A 1 481 ? 13.626  4.882   26.230  1.00 50.42  ? 481  THR A CA  1 
ATOM   3714 C C   . THR A 1 481 ? 12.922  3.528   26.182  1.00 51.95  ? 481  THR A C   1 
ATOM   3715 O O   . THR A 1 481 ? 13.444  2.547   26.735  1.00 52.57  ? 481  THR A O   1 
ATOM   3716 C CB  . THR A 1 481 ? 13.204  5.734   27.437  1.00 50.70  ? 481  THR A CB  1 
ATOM   3717 O OG1 . THR A 1 481 ? 11.859  6.193   27.263  1.00 51.17  ? 481  THR A OG1 1 
ATOM   3718 C CG2 . THR A 1 481 ? 14.149  6.959   27.581  1.00 48.79  ? 481  THR A CG2 1 
ATOM   3719 N N   . ASN A 1 482 ? 11.782  3.439   25.498  1.00 52.65  ? 482  ASN A N   1 
ATOM   3720 C CA  . ASN A 1 482 ? 11.156  2.121   25.266  1.00 53.91  ? 482  ASN A CA  1 
ATOM   3721 C C   . ASN A 1 482 ? 12.124  1.189   24.549  1.00 53.77  ? 482  ASN A C   1 
ATOM   3722 O O   . ASN A 1 482 ? 12.248  0.014   24.905  1.00 54.81  ? 482  ASN A O   1 
ATOM   3723 C CB  . ASN A 1 482 ? 9.902   2.231   24.401  1.00 55.03  ? 482  ASN A CB  1 
ATOM   3724 C CG  . ASN A 1 482 ? 8.704   2.783   25.142  1.00 56.15  ? 482  ASN A CG  1 
ATOM   3725 O OD1 . ASN A 1 482 ? 8.644   2.786   26.368  1.00 57.52  ? 482  ASN A OD1 1 
ATOM   3726 N ND2 . ASN A 1 482 ? 7.726   3.236   24.384  1.00 58.56  ? 482  ASN A ND2 1 
ATOM   3727 N N   . PHE A 1 483 ? 12.773  1.719   23.510  1.00 52.47  ? 483  PHE A N   1 
ATOM   3728 C CA  . PHE A 1 483 ? 13.765  0.979   22.747  1.00 52.14  ? 483  PHE A CA  1 
ATOM   3729 C C   . PHE A 1 483 ? 14.944  0.526   23.620  1.00 51.87  ? 483  PHE A C   1 
ATOM   3730 O O   . PHE A 1 483 ? 15.360  -0.622  23.562  1.00 51.82  ? 483  PHE A O   1 
ATOM   3731 C CB  . PHE A 1 483 ? 14.312  1.806   21.571  1.00 50.23  ? 483  PHE A CB  1 
ATOM   3732 C CG  . PHE A 1 483 ? 15.413  1.094   20.835  1.00 49.00  ? 483  PHE A CG  1 
ATOM   3733 C CD1 . PHE A 1 483 ? 15.126  0.021   20.010  1.00 49.98  ? 483  PHE A CD1 1 
ATOM   3734 C CD2 . PHE A 1 483 ? 16.733  1.437   21.028  1.00 47.65  ? 483  PHE A CD2 1 
ATOM   3735 C CE1 . PHE A 1 483 ? 16.137  -0.670  19.381  1.00 49.81  ? 483  PHE A CE1 1 
ATOM   3736 C CE2 . PHE A 1 483 ? 17.740  0.754   20.394  1.00 46.58  ? 483  PHE A CE2 1 
ATOM   3737 C CZ  . PHE A 1 483 ? 17.445  -0.292  19.568  1.00 48.44  ? 483  PHE A CZ  1 
ATOM   3738 N N   . ALA A 1 484 ? 15.491  1.465   24.387  1.00 51.44  ? 484  ALA A N   1 
ATOM   3739 C CA  . ALA A 1 484 ? 16.496  1.171   25.405  1.00 51.86  ? 484  ALA A CA  1 
ATOM   3740 C C   . ALA A 1 484 ? 16.110  0.021   26.324  1.00 54.20  ? 484  ALA A C   1 
ATOM   3741 O O   . ALA A 1 484 ? 16.937  -0.848  26.623  1.00 54.45  ? 484  ALA A O   1 
ATOM   3742 C CB  . ALA A 1 484 ? 16.769  2.412   26.235  1.00 50.80  ? 484  ALA A CB  1 
ATOM   3743 N N   . ARG A 1 485 ? 14.854  0.026   26.773  1.00 55.77  ? 485  ARG A N   1 
ATOM   3744 C CA  . ARG A 1 485 ? 14.368  -0.932  27.767  1.00 58.18  ? 485  ARG A CA  1 
ATOM   3745 C C   . ARG A 1 485 ? 14.087  -2.312  27.192  1.00 58.80  ? 485  ARG A C   1 
ATOM   3746 O O   . ARG A 1 485 ? 14.378  -3.310  27.836  1.00 59.36  ? 485  ARG A O   1 
ATOM   3747 C CB  . ARG A 1 485 ? 13.087  -0.393  28.423  1.00 59.05  ? 485  ARG A CB  1 
ATOM   3748 C CG  . ARG A 1 485 ? 12.520  -1.236  29.620  1.00 62.62  ? 485  ARG A CG  1 
ATOM   3749 C CD  . ARG A 1 485 ? 11.160  -0.695  30.171  1.00 65.07  ? 485  ARG A CD  1 
ATOM   3750 N NE  . ARG A 1 485 ? 10.755  0.623   29.619  1.00 69.53  ? 485  ARG A NE  1 
ATOM   3751 C CZ  . ARG A 1 485 ? 11.375  1.795   29.843  1.00 70.69  ? 485  ARG A CZ  1 
ATOM   3752 N NH1 . ARG A 1 485 ? 10.899  2.906   29.283  1.00 70.92  ? 485  ARG A NH1 1 
ATOM   3753 N NH2 . ARG A 1 485 ? 12.479  1.880   30.596  1.00 71.26  ? 485  ARG A NH2 1 
ATOM   3754 N N   . THR A 1 486 ? 13.506  -2.354  25.995  1.00 58.85  ? 486  THR A N   1 
ATOM   3755 C CA  . THR A 1 486 ? 12.943  -3.590  25.432  1.00 60.42  ? 486  THR A CA  1 
ATOM   3756 C C   . THR A 1 486 ? 13.498  -3.960  24.057  1.00 60.67  ? 486  THR A C   1 
ATOM   3757 O O   . THR A 1 486 ? 13.258  -5.068  23.581  1.00 61.63  ? 486  THR A O   1 
ATOM   3758 C CB  . THR A 1 486 ? 11.404  -3.472  25.304  1.00 61.24  ? 486  THR A CB  1 
ATOM   3759 O OG1 . THR A 1 486 ? 11.071  -2.450  24.359  1.00 60.16  ? 486  THR A OG1 1 
ATOM   3760 C CG2 . THR A 1 486 ? 10.779  -3.112  26.632  1.00 60.48  ? 486  THR A CG2 1 
ATOM   3761 N N   . GLY A 1 487 ? 14.244  -3.044  23.432  1.00 59.68  ? 487  GLY A N   1 
ATOM   3762 C CA  . GLY A 1 487 ? 14.675  -3.203  22.044  1.00 60.02  ? 487  GLY A CA  1 
ATOM   3763 C C   . GLY A 1 487 ? 13.546  -3.002  21.045  1.00 61.06  ? 487  GLY A C   1 
ATOM   3764 O O   . GLY A 1 487 ? 13.651  -3.443  19.912  1.00 61.62  ? 487  GLY A O   1 
ATOM   3765 N N   . ASP A 1 488 ? 12.476  -2.330  21.475  1.00 61.77  ? 488  ASP A N   1 
ATOM   3766 C CA  . ASP A 1 488 ? 11.296  -2.070  20.653  1.00 62.86  ? 488  ASP A CA  1 
ATOM   3767 C C   . ASP A 1 488 ? 10.764  -0.684  21.028  1.00 62.55  ? 488  ASP A C   1 
ATOM   3768 O O   . ASP A 1 488 ? 10.412  -0.460  22.175  1.00 62.28  ? 488  ASP A O   1 
ATOM   3769 C CB  . ASP A 1 488 ? 10.233  -3.150  20.911  1.00 64.96  ? 488  ASP A CB  1 
ATOM   3770 C CG  . ASP A 1 488 ? 8.994   -3.004  20.031  1.00 65.77  ? 488  ASP A CG  1 
ATOM   3771 O OD1 . ASP A 1 488 ? 8.796   -1.958  19.391  1.00 65.56  ? 488  ASP A OD1 1 
ATOM   3772 O OD2 . ASP A 1 488 ? 8.195   -3.953  19.981  1.00 69.90  ? 488  ASP A OD2 1 
ATOM   3773 N N   . PRO A 1 489 ? 10.723  0.259   20.067  1.00 62.95  ? 489  PRO A N   1 
ATOM   3774 C CA  . PRO A 1 489 ? 10.282  1.615   20.404  1.00 63.21  ? 489  PRO A CA  1 
ATOM   3775 C C   . PRO A 1 489 ? 8.786   1.755   20.713  1.00 65.91  ? 489  PRO A C   1 
ATOM   3776 O O   . PRO A 1 489 ? 8.369   2.780   21.248  1.00 65.44  ? 489  PRO A O   1 
ATOM   3777 C CB  . PRO A 1 489 ? 10.657  2.418   19.152  1.00 62.02  ? 489  PRO A CB  1 
ATOM   3778 C CG  . PRO A 1 489 ? 10.584  1.440   18.056  1.00 62.34  ? 489  PRO A CG  1 
ATOM   3779 C CD  . PRO A 1 489 ? 11.097  0.156   18.644  1.00 62.67  ? 489  PRO A CD  1 
ATOM   3780 N N   . ASN A 1 490 ? 7.999   0.739   20.377  1.00 69.34  ? 490  ASN A N   1 
ATOM   3781 C CA  . ASN A 1 490 ? 6.561   0.750   20.613  1.00 72.83  ? 490  ASN A CA  1 
ATOM   3782 C C   . ASN A 1 490 ? 6.189   0.484   22.065  1.00 75.87  ? 490  ASN A C   1 
ATOM   3783 O O   . ASN A 1 490 ? 6.892   -0.238  22.774  1.00 75.97  ? 490  ASN A O   1 
ATOM   3784 C CB  . ASN A 1 490 ? 5.879   -0.308  19.732  1.00 74.12  ? 490  ASN A CB  1 
ATOM   3785 C CG  . ASN A 1 490 ? 5.985   0.009   18.258  1.00 72.47  ? 490  ASN A CG  1 
ATOM   3786 O OD1 . ASN A 1 490 ? 5.395   0.980   17.784  1.00 71.29  ? 490  ASN A OD1 1 
ATOM   3787 N ND2 . ASN A 1 490 ? 6.745   -0.798  17.528  1.00 68.68  ? 490  ASN A ND2 1 
ATOM   3788 N N   . ASP A 1 491 ? 5.072   1.064   22.498  1.00 79.56  ? 491  ASP A N   1 
ATOM   3789 C CA  . ASP A 1 491 ? 4.519   0.763   23.811  1.00 83.03  ? 491  ASP A CA  1 
ATOM   3790 C C   . ASP A 1 491 ? 3.632   -0.482  23.706  1.00 86.76  ? 491  ASP A C   1 
ATOM   3791 O O   . ASP A 1 491 ? 2.692   -0.511  22.904  1.00 87.63  ? 491  ASP A O   1 
ATOM   3792 C CB  . ASP A 1 491 ? 3.708   1.937   24.364  1.00 83.76  ? 491  ASP A CB  1 
ATOM   3793 C CG  . ASP A 1 491 ? 3.014   1.597   25.690  1.00 86.82  ? 491  ASP A CG  1 
ATOM   3794 O OD1 . ASP A 1 491 ? 3.716   1.343   26.702  1.00 87.62  ? 491  ASP A OD1 1 
ATOM   3795 O OD2 . ASP A 1 491 ? 1.760   1.573   25.710  1.00 90.92  ? 491  ASP A OD2 1 
ATOM   3796 N N   . PRO A 1 492 ? 3.934   -1.515  24.513  1.00 89.64  ? 492  PRO A N   1 
ATOM   3797 C CA  . PRO A 1 492 ? 3.163   -2.770  24.453  1.00 93.12  ? 492  PRO A CA  1 
ATOM   3798 C C   . PRO A 1 492 ? 1.679   -2.637  24.824  1.00 96.47  ? 492  PRO A C   1 
ATOM   3799 O O   . PRO A 1 492 ? 0.863   -3.440  24.360  1.00 98.55  ? 492  PRO A O   1 
ATOM   3800 C CB  . PRO A 1 492 ? 3.889   -3.692  25.447  1.00 93.23  ? 492  PRO A CB  1 
ATOM   3801 C CG  . PRO A 1 492 ? 4.709   -2.784  26.314  1.00 91.26  ? 492  PRO A CG  1 
ATOM   3802 C CD  . PRO A 1 492 ? 5.026   -1.569  25.506  1.00 88.56  ? 492  PRO A CD  1 
ATOM   3803 N N   . ARG A 1 493 ? 1.334   -1.641  25.640  1.00 97.70  ? 493  ARG A N   1 
ATOM   3804 C CA  . ARG A 1 493 ? -0.055  -1.454  26.085  1.00 100.78 ? 493  ARG A CA  1 
ATOM   3805 C C   . ARG A 1 493 ? -0.875  -0.718  25.019  1.00 101.61 ? 493  ARG A C   1 
ATOM   3806 O O   . ARG A 1 493 ? -1.937  -1.193  24.593  1.00 103.70 ? 493  ARG A O   1 
ATOM   3807 C CB  . ARG A 1 493 ? -0.105  -0.683  27.412  1.00 100.92 ? 493  ARG A CB  1 
ATOM   3808 C CG  . ARG A 1 493 ? 0.783   -1.271  28.533  1.00 102.01 ? 493  ARG A CG  1 
ATOM   3809 C CD  . ARG A 1 493 ? 1.093   -0.265  29.663  1.00 103.05 ? 493  ARG A CD  1 
ATOM   3810 N NE  . ARG A 1 493 ? 1.781   0.948   29.194  1.00 101.73 ? 493  ARG A NE  1 
ATOM   3811 C CZ  . ARG A 1 493 ? 2.548   1.740   29.950  1.00 101.85 ? 493  ARG A CZ  1 
ATOM   3812 N NH1 . ARG A 1 493 ? 2.767   1.470   31.238  1.00 102.58 ? 493  ARG A NH1 1 
ATOM   3813 N NH2 . ARG A 1 493 ? 3.116   2.816   29.408  1.00 100.17 ? 493  ARG A NH2 1 
ATOM   3814 N N   . ASP A 1 494 ? -0.361  0.439   24.597  1.00 100.15 ? 494  ASP A N   1 
ATOM   3815 C CA  . ASP A 1 494 ? -1.014  1.303   23.604  1.00 100.58 ? 494  ASP A CA  1 
ATOM   3816 C C   . ASP A 1 494 ? -1.177  0.597   22.244  1.00 101.14 ? 494  ASP A C   1 
ATOM   3817 O O   . ASP A 1 494 ? -0.239  0.531   21.439  1.00 99.71  ? 494  ASP A O   1 
ATOM   3818 C CB  . ASP A 1 494 ? -0.202  2.602   23.465  1.00 98.65  ? 494  ASP A CB  1 
ATOM   3819 C CG  . ASP A 1 494 ? -0.809  3.592   22.479  1.00 99.38  ? 494  ASP A CG  1 
ATOM   3820 O OD1 . ASP A 1 494 ? -2.006  3.460   22.126  1.00 101.04 ? 494  ASP A OD1 1 
ATOM   3821 O OD2 . ASP A 1 494 ? -0.064  4.514   22.064  1.00 98.06  ? 494  ASP A OD2 1 
ATOM   3822 N N   . SER A 1 495 ? -2.384  0.085   21.997  1.00 103.26 ? 495  SER A N   1 
ATOM   3823 C CA  . SER A 1 495 ? -2.664  -0.723  20.807  1.00 104.14 ? 495  SER A CA  1 
ATOM   3824 C C   . SER A 1 495 ? -3.033  0.116   19.573  1.00 103.66 ? 495  SER A C   1 
ATOM   3825 O O   . SER A 1 495 ? -2.364  0.023   18.536  1.00 102.89 ? 495  SER A O   1 
ATOM   3826 C CB  . SER A 1 495 ? -3.782  -1.742  21.105  1.00 106.99 ? 495  SER A CB  1 
ATOM   3827 O OG  . SER A 1 495 ? -5.054  -1.119  21.228  1.00 108.70 ? 495  SER A OG  1 
ATOM   3828 N N   . LYS A 1 496 ? -4.084  0.934   19.701  1.00 104.11 ? 496  LYS A N   1 
ATOM   3829 C CA  . LYS A 1 496 ? -4.715  1.618   18.551  1.00 104.01 ? 496  LYS A CA  1 
ATOM   3830 C C   . LYS A 1 496 ? -3.866  2.736   17.932  1.00 100.98 ? 496  LYS A C   1 
ATOM   3831 O O   . LYS A 1 496 ? -4.056  3.096   16.763  1.00 101.28 ? 496  LYS A O   1 
ATOM   3832 C CB  . LYS A 1 496 ? -6.096  2.164   18.942  1.00 106.14 ? 496  LYS A CB  1 
ATOM   3833 N N   . SER A 1 497 ? -2.944  3.290   18.715  1.00 97.92  ? 497  SER A N   1 
ATOM   3834 C CA  . SER A 1 497 ? -1.929  4.200   18.181  1.00 94.66  ? 497  SER A CA  1 
ATOM   3835 C C   . SER A 1 497 ? -1.109  3.468   17.101  1.00 92.59  ? 497  SER A C   1 
ATOM   3836 O O   . SER A 1 497 ? -0.925  2.241   17.186  1.00 93.25  ? 497  SER A O   1 
ATOM   3837 C CB  . SER A 1 497 ? -1.015  4.680   19.308  1.00 92.97  ? 497  SER A CB  1 
ATOM   3838 O OG  . SER A 1 497 ? -0.082  5.645   18.856  1.00 91.67  ? 497  SER A OG  1 
ATOM   3839 N N   . PRO A 1 498 ? -0.615  4.205   16.082  1.00 89.51  ? 498  PRO A N   1 
ATOM   3840 C CA  . PRO A 1 498 ? 0.083   3.499   15.006  1.00 87.38  ? 498  PRO A CA  1 
ATOM   3841 C C   . PRO A 1 498 ? 1.390   2.893   15.494  1.00 83.56  ? 498  PRO A C   1 
ATOM   3842 O O   . PRO A 1 498 ? 2.063   3.481   16.339  1.00 82.37  ? 498  PRO A O   1 
ATOM   3843 C CB  . PRO A 1 498 ? 0.343   4.597   13.956  1.00 86.75  ? 498  PRO A CB  1 
ATOM   3844 C CG  . PRO A 1 498 ? -0.515  5.758   14.360  1.00 88.16  ? 498  PRO A CG  1 
ATOM   3845 C CD  . PRO A 1 498 ? -0.634  5.661   15.849  1.00 88.83  ? 498  PRO A CD  1 
ATOM   3846 N N   . GLN A 1 499 ? 1.720   1.718   14.963  1.00 81.36  ? 499  GLN A N   1 
ATOM   3847 C CA  . GLN A 1 499 ? 2.911   0.973   15.354  1.00 77.98  ? 499  GLN A CA  1 
ATOM   3848 C C   . GLN A 1 499 ? 4.071   1.309   14.432  1.00 73.99  ? 499  GLN A C   1 
ATOM   3849 O O   . GLN A 1 499 ? 3.873   1.671   13.274  1.00 73.73  ? 499  GLN A O   1 
ATOM   3850 C CB  . GLN A 1 499 ? 2.642   -0.541  15.301  1.00 79.73  ? 499  GLN A CB  1 
ATOM   3851 C CG  . GLN A 1 499 ? 1.624   -1.036  16.324  1.00 82.14  ? 499  GLN A CG  1 
ATOM   3852 C CD  . GLN A 1 499 ? 2.119   -0.904  17.764  1.00 81.85  ? 499  GLN A CD  1 
ATOM   3853 O OE1 . GLN A 1 499 ? 3.046   -1.604  18.186  1.00 81.41  ? 499  GLN A OE1 1 
ATOM   3854 N NE2 . GLN A 1 499 ? 1.496   -0.004  18.522  1.00 81.90  ? 499  GLN A NE2 1 
ATOM   3855 N N   . TRP A 1 500 ? 5.279   1.168   14.971  1.00 69.67  ? 500  TRP A N   1 
ATOM   3856 C CA  . TRP A 1 500 ? 6.519   1.365   14.253  1.00 66.25  ? 500  TRP A CA  1 
ATOM   3857 C C   . TRP A 1 500 ? 7.063   -0.023  13.905  1.00 65.91  ? 500  TRP A C   1 
ATOM   3858 O O   . TRP A 1 500 ? 7.637   -0.690  14.762  1.00 65.14  ? 500  TRP A O   1 
ATOM   3859 C CB  . TRP A 1 500 ? 7.491   2.134   15.161  1.00 63.44  ? 500  TRP A CB  1 
ATOM   3860 C CG  . TRP A 1 500 ? 8.780   2.558   14.566  1.00 60.70  ? 500  TRP A CG  1 
ATOM   3861 C CD1 . TRP A 1 500 ? 9.398   2.052   13.455  1.00 59.79  ? 500  TRP A CD1 1 
ATOM   3862 C CD2 . TRP A 1 500 ? 9.666   3.559   15.095  1.00 58.18  ? 500  TRP A CD2 1 
ATOM   3863 N NE1 . TRP A 1 500 ? 10.591  2.707   13.240  1.00 57.82  ? 500  TRP A NE1 1 
ATOM   3864 C CE2 . TRP A 1 500 ? 10.783  3.625   14.239  1.00 56.15  ? 500  TRP A CE2 1 
ATOM   3865 C CE3 . TRP A 1 500 ? 9.608   4.417   16.199  1.00 56.84  ? 500  TRP A CE3 1 
ATOM   3866 C CZ2 . TRP A 1 500 ? 11.835  4.515   14.455  1.00 55.51  ? 500  TRP A CZ2 1 
ATOM   3867 C CZ3 . TRP A 1 500 ? 10.646  5.306   16.406  1.00 55.85  ? 500  TRP A CZ3 1 
ATOM   3868 C CH2 . TRP A 1 500 ? 11.748  5.344   15.543  1.00 55.16  ? 500  TRP A CH2 1 
ATOM   3869 N N   . PRO A 1 501 ? 6.895   -0.462  12.644  1.00 65.99  ? 501  PRO A N   1 
ATOM   3870 C CA  . PRO A 1 501 ? 7.318   -1.800  12.275  1.00 66.48  ? 501  PRO A CA  1 
ATOM   3871 C C   . PRO A 1 501 ? 8.809   -1.828  12.006  1.00 64.69  ? 501  PRO A C   1 
ATOM   3872 O O   . PRO A 1 501 ? 9.347   -0.811  11.578  1.00 63.40  ? 501  PRO A O   1 
ATOM   3873 C CB  . PRO A 1 501 ? 6.562   -2.046  10.971  1.00 67.90  ? 501  PRO A CB  1 
ATOM   3874 C CG  . PRO A 1 501 ? 6.500   -0.708  10.335  1.00 67.01  ? 501  PRO A CG  1 
ATOM   3875 C CD  . PRO A 1 501 ? 6.349   0.266   11.481  1.00 66.44  ? 501  PRO A CD  1 
ATOM   3876 N N   . PRO A 1 502 ? 9.471   -2.984  12.215  1.00 64.99  ? 502  PRO A N   1 
ATOM   3877 C CA  . PRO A 1 502 ? 10.886  -3.111  11.875  1.00 63.91  ? 502  PRO A CA  1 
ATOM   3878 C C   . PRO A 1 502 ? 11.193  -2.873  10.390  1.00 64.28  ? 502  PRO A C   1 
ATOM   3879 O O   . PRO A 1 502 ? 10.372  -3.178  9.526   1.00 65.16  ? 502  PRO A O   1 
ATOM   3880 C CB  . PRO A 1 502 ? 11.209  -4.568  12.240  1.00 65.19  ? 502  PRO A CB  1 
ATOM   3881 C CG  . PRO A 1 502 ? 10.162  -4.976  13.203  1.00 65.96  ? 502  PRO A CG  1 
ATOM   3882 C CD  . PRO A 1 502 ? 8.939   -4.235  12.786  1.00 66.54  ? 502  PRO A CD  1 
ATOM   3883 N N   . TYR A 1 503 ? 12.376  -2.325  10.111  1.00 63.62  ? 503  TYR A N   1 
ATOM   3884 C CA  . TYR A 1 503 ? 12.887  -2.219  8.747   1.00 63.76  ? 503  TYR A CA  1 
ATOM   3885 C C   . TYR A 1 503 ? 13.371  -3.589  8.263   1.00 65.00  ? 503  TYR A C   1 
ATOM   3886 O O   . TYR A 1 503 ? 14.093  -4.283  8.975   1.00 64.19  ? 503  TYR A O   1 
ATOM   3887 C CB  . TYR A 1 503 ? 14.035  -1.220  8.706   1.00 62.44  ? 503  TYR A CB  1 
ATOM   3888 C CG  . TYR A 1 503 ? 14.591  -0.963  7.331   1.00 62.70  ? 503  TYR A CG  1 
ATOM   3889 C CD1 . TYR A 1 503 ? 15.626  -1.745  6.823   1.00 63.64  ? 503  TYR A CD1 1 
ATOM   3890 C CD2 . TYR A 1 503 ? 14.098  0.071   6.545   1.00 62.89  ? 503  TYR A CD2 1 
ATOM   3891 C CE1 . TYR A 1 503 ? 16.152  -1.515  5.568   1.00 63.51  ? 503  TYR A CE1 1 
ATOM   3892 C CE2 . TYR A 1 503 ? 14.620  0.318   5.291   1.00 63.83  ? 503  TYR A CE2 1 
ATOM   3893 C CZ  . TYR A 1 503 ? 15.653  -0.477  4.809   1.00 64.21  ? 503  TYR A CZ  1 
ATOM   3894 O OH  . TYR A 1 503 ? 16.168  -0.248  3.552   1.00 64.59  ? 503  TYR A OH  1 
ATOM   3895 N N   . THR A 1 504 ? 12.953  -3.975  7.058   1.00 66.62  ? 504  THR A N   1 
ATOM   3896 C CA  . THR A 1 504 ? 13.407  -5.225  6.436   1.00 68.33  ? 504  THR A CA  1 
ATOM   3897 C C   . THR A 1 504 ? 13.826  -4.980  4.990   1.00 68.69  ? 504  THR A C   1 
ATOM   3898 O O   . THR A 1 504 ? 13.435  -3.980  4.374   1.00 68.04  ? 504  THR A O   1 
ATOM   3899 C CB  . THR A 1 504 ? 12.314  -6.302  6.434   1.00 70.39  ? 504  THR A CB  1 
ATOM   3900 O OG1 . THR A 1 504 ? 11.148  -5.777  5.799   1.00 71.12  ? 504  THR A OG1 1 
ATOM   3901 C CG2 . THR A 1 504 ? 11.968  -6.740  7.848   1.00 70.15  ? 504  THR A CG2 1 
ATOM   3902 N N   . THR A 1 505 ? 14.623  -5.897  4.449   1.00 69.59  ? 505  THR A N   1 
ATOM   3903 C CA  . THR A 1 505 ? 15.073  -5.776  3.060   1.00 69.96  ? 505  THR A CA  1 
ATOM   3904 C C   . THR A 1 505 ? 13.878  -5.848  2.103   1.00 71.13  ? 505  THR A C   1 
ATOM   3905 O O   . THR A 1 505 ? 13.820  -5.107  1.123   1.00 71.26  ? 505  THR A O   1 
ATOM   3906 C CB  . THR A 1 505 ? 16.133  -6.846  2.696   1.00 70.87  ? 505  THR A CB  1 
ATOM   3907 O OG1 . THR A 1 505 ? 15.668  -8.141  3.091   1.00 72.77  ? 505  THR A OG1 1 
ATOM   3908 C CG2 . THR A 1 505 ? 17.462  -6.545  3.402   1.00 68.92  ? 505  THR A CG2 1 
ATOM   3909 N N   . ALA A 1 506 ? 12.912  -6.700  2.421   1.00 72.24  ? 506  ALA A N   1 
ATOM   3910 C CA  . ALA A 1 506 ? 11.744  -6.894  1.566   1.00 74.07  ? 506  ALA A CA  1 
ATOM   3911 C C   . ALA A 1 506 ? 10.853  -5.668  1.534   1.00 73.09  ? 506  ALA A C   1 
ATOM   3912 O O   . ALA A 1 506 ? 10.504  -5.181  0.454   1.00 74.00  ? 506  ALA A O   1 
ATOM   3913 C CB  . ALA A 1 506 ? 10.926  -8.118  2.021   1.00 75.82  ? 506  ALA A CB  1 
ATOM   3914 N N   . ALA A 1 507 ? 10.478  -5.184  2.716   1.00 71.55  ? 507  ALA A N   1 
ATOM   3915 C CA  . ALA A 1 507 ? 9.450   -4.155  2.835   1.00 70.74  ? 507  ALA A CA  1 
ATOM   3916 C C   . ALA A 1 507 ? 10.012  -2.736  3.023   1.00 68.08  ? 507  ALA A C   1 
ATOM   3917 O O   . ALA A 1 507 ? 9.329   -1.770  2.701   1.00 68.27  ? 507  ALA A O   1 
ATOM   3918 C CB  . ALA A 1 507 ? 8.485   -4.514  3.956   1.00 71.46  ? 507  ALA A CB  1 
ATOM   3919 N N   . GLN A 1 508 ? 11.239  -2.611  3.528   1.00 65.58  ? 508  GLN A N   1 
ATOM   3920 C CA  . GLN A 1 508 ? 11.915  -1.310  3.657   1.00 63.45  ? 508  GLN A CA  1 
ATOM   3921 C C   . GLN A 1 508 ? 11.094  -0.244  4.410   1.00 62.06  ? 508  GLN A C   1 
ATOM   3922 O O   . GLN A 1 508 ? 11.112  0.939   4.053   1.00 60.32  ? 508  GLN A O   1 
ATOM   3923 C CB  . GLN A 1 508 ? 12.319  -0.775  2.270   1.00 63.46  ? 508  GLN A CB  1 
ATOM   3924 C CG  . GLN A 1 508 ? 13.252  -1.683  1.485   1.00 65.18  ? 508  GLN A CG  1 
ATOM   3925 C CD  . GLN A 1 508 ? 13.513  -1.179  0.077   1.00 66.43  ? 508  GLN A CD  1 
ATOM   3926 O OE1 . GLN A 1 508 ? 14.130  -0.133  -0.110  1.00 67.13  ? 508  GLN A OE1 1 
ATOM   3927 N NE2 . GLN A 1 508 ? 13.038  -1.924  -0.923  1.00 68.65  ? 508  GLN A NE2 1 
ATOM   3928 N N   . GLN A 1 509 ? 10.392  -0.665  5.457   1.00 61.99  ? 509  GLN A N   1 
ATOM   3929 C CA  . GLN A 1 509 ? 9.482   0.226   6.174   1.00 61.57  ? 509  GLN A CA  1 
ATOM   3930 C C   . GLN A 1 509 ? 10.191  1.126   7.187   1.00 59.09  ? 509  GLN A C   1 
ATOM   3931 O O   . GLN A 1 509 ? 11.135  0.708   7.849   1.00 57.91  ? 509  GLN A O   1 
ATOM   3932 C CB  . GLN A 1 509 ? 8.401   -0.579  6.893   1.00 63.28  ? 509  GLN A CB  1 
ATOM   3933 C CG  . GLN A 1 509 ? 7.393   -1.197  5.968   1.00 66.05  ? 509  GLN A CG  1 
ATOM   3934 C CD  . GLN A 1 509 ? 6.458   -2.121  6.698   1.00 68.96  ? 509  GLN A CD  1 
ATOM   3935 O OE1 . GLN A 1 509 ? 6.869   -3.173  7.172   1.00 70.24  ? 509  GLN A OE1 1 
ATOM   3936 N NE2 . GLN A 1 509 ? 5.191   -1.735  6.797   1.00 69.95  ? 509  GLN A NE2 1 
ATOM   3937 N N   . TYR A 1 510 ? 9.704   2.359   7.303   1.00 58.03  ? 510  TYR A N   1 
ATOM   3938 C CA  . TYR A 1 510 ? 10.237  3.332   8.252   1.00 56.08  ? 510  TYR A CA  1 
ATOM   3939 C C   . TYR A 1 510 ? 9.169   4.368   8.566   1.00 56.34  ? 510  TYR A C   1 
ATOM   3940 O O   . TYR A 1 510 ? 8.218   4.513   7.817   1.00 57.25  ? 510  TYR A O   1 
ATOM   3941 C CB  . TYR A 1 510 ? 11.483  3.998   7.689   1.00 54.40  ? 510  TYR A CB  1 
ATOM   3942 C CG  . TYR A 1 510 ? 11.242  4.948   6.536   1.00 54.32  ? 510  TYR A CG  1 
ATOM   3943 C CD1 . TYR A 1 510 ? 11.158  4.481   5.228   1.00 54.78  ? 510  TYR A CD1 1 
ATOM   3944 C CD2 . TYR A 1 510 ? 11.106  6.312   6.756   1.00 53.48  ? 510  TYR A CD2 1 
ATOM   3945 C CE1 . TYR A 1 510 ? 10.929  5.343   4.170   1.00 54.69  ? 510  TYR A CE1 1 
ATOM   3946 C CE2 . TYR A 1 510 ? 10.889  7.191   5.708   1.00 54.08  ? 510  TYR A CE2 1 
ATOM   3947 C CZ  . TYR A 1 510 ? 10.800  6.700   4.411   1.00 55.20  ? 510  TYR A CZ  1 
ATOM   3948 O OH  . TYR A 1 510 ? 10.588  7.575   3.359   1.00 54.79  ? 510  TYR A OH  1 
ATOM   3949 N N   . VAL A 1 511 ? 9.339   5.102   9.662   1.00 55.62  ? 511  VAL A N   1 
ATOM   3950 C CA  . VAL A 1 511 ? 8.306   6.025   10.132  1.00 55.66  ? 511  VAL A CA  1 
ATOM   3951 C C   . VAL A 1 511 ? 8.726   7.479   10.033  1.00 54.24  ? 511  VAL A C   1 
ATOM   3952 O O   . VAL A 1 511 ? 9.888   7.808   10.192  1.00 53.12  ? 511  VAL A O   1 
ATOM   3953 C CB  . VAL A 1 511 ? 7.917   5.755   11.612  1.00 56.30  ? 511  VAL A CB  1 
ATOM   3954 C CG1 . VAL A 1 511 ? 7.276   4.374   11.759  1.00 56.49  ? 511  VAL A CG1 1 
ATOM   3955 C CG2 . VAL A 1 511 ? 9.123   5.925   12.518  1.00 53.42  ? 511  VAL A CG2 1 
ATOM   3956 N N   . SER A 1 512 ? 7.758   8.345   9.772   1.00 54.84  ? 512  SER A N   1 
ATOM   3957 C CA  . SER A 1 512 ? 7.964   9.779   9.876   1.00 54.30  ? 512  SER A CA  1 
ATOM   3958 C C   . SER A 1 512 ? 7.770   10.242  11.326  1.00 53.92  ? 512  SER A C   1 
ATOM   3959 O O   . SER A 1 512 ? 6.748   9.934   11.969  1.00 54.43  ? 512  SER A O   1 
ATOM   3960 C CB  . SER A 1 512 ? 7.005   10.533  8.939   1.00 55.29  ? 512  SER A CB  1 
ATOM   3961 O OG  . SER A 1 512 ? 5.659   10.391  9.356   1.00 56.53  ? 512  SER A OG  1 
ATOM   3962 N N   . LEU A 1 513 ? 8.750   10.995  11.824  1.00 52.27  ? 513  LEU A N   1 
ATOM   3963 C CA  . LEU A 1 513 ? 8.660   11.618  13.137  1.00 52.05  ? 513  LEU A CA  1 
ATOM   3964 C C   . LEU A 1 513 ? 8.404   13.119  12.963  1.00 52.72  ? 513  LEU A C   1 
ATOM   3965 O O   . LEU A 1 513 ? 9.298   13.876  12.557  1.00 51.94  ? 513  LEU A O   1 
ATOM   3966 C CB  . LEU A 1 513 ? 9.939   11.377  13.938  1.00 50.82  ? 513  LEU A CB  1 
ATOM   3967 C CG  . LEU A 1 513 ? 10.321  9.937   14.283  1.00 49.42  ? 513  LEU A CG  1 
ATOM   3968 C CD1 . LEU A 1 513 ? 11.621  9.977   15.020  1.00 46.39  ? 513  LEU A CD1 1 
ATOM   3969 C CD2 . LEU A 1 513 ? 9.231   9.198   15.111  1.00 46.82  ? 513  LEU A CD2 1 
ATOM   3970 N N   . ASN A 1 514 ? 7.169   13.526  13.259  1.00 54.95  ? 514  ASN A N   1 
ATOM   3971 C CA  . ASN A 1 514 ? 6.737   14.923  13.238  1.00 55.62  ? 514  ASN A CA  1 
ATOM   3972 C C   . ASN A 1 514 ? 5.577   15.120  14.215  1.00 57.51  ? 514  ASN A C   1 
ATOM   3973 O O   . ASN A 1 514 ? 5.254   14.199  14.975  1.00 57.66  ? 514  ASN A O   1 
ATOM   3974 C CB  . ASN A 1 514 ? 6.371   15.366  11.803  1.00 56.56  ? 514  ASN A CB  1 
ATOM   3975 C CG  . ASN A 1 514 ? 5.397   14.411  11.091  1.00 58.58  ? 514  ASN A CG  1 
ATOM   3976 O OD1 . ASN A 1 514 ? 4.382   13.978  11.658  1.00 60.85  ? 514  ASN A OD1 1 
ATOM   3977 N ND2 . ASN A 1 514 ? 5.691   14.116  9.817   1.00 57.98  ? 514  ASN A ND2 1 
ATOM   3978 N N   . LEU A 1 515 ? 4.936   16.296  14.179  1.00 58.63  ? 515  LEU A N   1 
ATOM   3979 C CA  . LEU A 1 515 ? 3.834   16.627  15.101  1.00 60.12  ? 515  LEU A CA  1 
ATOM   3980 C C   . LEU A 1 515 ? 2.584   15.775  14.891  1.00 62.23  ? 515  LEU A C   1 
ATOM   3981 O O   . LEU A 1 515 ? 1.704   15.767  15.741  1.00 63.57  ? 515  LEU A O   1 
ATOM   3982 C CB  . LEU A 1 515 ? 3.436   18.106  14.984  1.00 60.38  ? 515  LEU A CB  1 
ATOM   3983 C CG  . LEU A 1 515 ? 4.527   19.171  15.160  1.00 58.81  ? 515  LEU A CG  1 
ATOM   3984 C CD1 . LEU A 1 515 ? 3.895   20.557  15.141  1.00 56.83  ? 515  LEU A CD1 1 
ATOM   3985 C CD2 . LEU A 1 515 ? 5.345   18.947  16.439  1.00 55.12  ? 515  LEU A CD2 1 
ATOM   3986 N N   . LYS A 1 516 ? 2.505   15.087  13.754  1.00 62.88  ? 516  LYS A N   1 
ATOM   3987 C CA  . LYS A 1 516 ? 1.422   14.156  13.463  1.00 64.56  ? 516  LYS A CA  1 
ATOM   3988 C C   . LYS A 1 516 ? 1.750   12.737  13.935  1.00 63.85  ? 516  LYS A C   1 
ATOM   3989 O O   . LYS A 1 516 ? 2.919   12.393  14.127  1.00 62.57  ? 516  LYS A O   1 
ATOM   3990 C CB  . LYS A 1 516 ? 1.149   14.154  11.961  1.00 65.75  ? 516  LYS A CB  1 
ATOM   3991 C CG  . LYS A 1 516 ? 0.392   15.398  11.484  1.00 68.99  ? 516  LYS A CG  1 
ATOM   3992 C CD  . LYS A 1 516 ? 0.821   15.853  10.082  1.00 72.32  ? 516  LYS A CD  1 
ATOM   3993 C CE  . LYS A 1 516 ? 0.736   14.747  9.021   1.00 74.97  ? 516  LYS A CE  1 
ATOM   3994 N NZ  . LYS A 1 516 ? 1.076   15.286  7.655   1.00 76.86  ? 516  LYS A NZ  1 
ATOM   3995 N N   . PRO A 1 517 ? 0.720   11.901  14.130  1.00 65.04  ? 517  PRO A N   1 
ATOM   3996 C CA  . PRO A 1 517 ? 0.949   10.517  14.552  1.00 64.81  ? 517  PRO A CA  1 
ATOM   3997 C C   . PRO A 1 517 ? 1.808   9.741   13.557  1.00 63.74  ? 517  PRO A C   1 
ATOM   3998 O O   . PRO A 1 517 ? 1.815   10.067  12.368  1.00 62.95  ? 517  PRO A O   1 
ATOM   3999 C CB  . PRO A 1 517 ? -0.471  9.923   14.602  1.00 67.27  ? 517  PRO A CB  1 
ATOM   4000 C CG  . PRO A 1 517 ? -1.388  11.089  14.715  1.00 68.32  ? 517  PRO A CG  1 
ATOM   4001 C CD  . PRO A 1 517 ? -0.716  12.197  13.959  1.00 67.30  ? 517  PRO A CD  1 
ATOM   4002 N N   . LEU A 1 518 ? 2.511   8.715   14.034  1.00 63.50  ? 518  LEU A N   1 
ATOM   4003 C CA  . LEU A 1 518 ? 3.443   7.960   13.181  1.00 63.17  ? 518  LEU A CA  1 
ATOM   4004 C C   . LEU A 1 518 ? 2.819   7.564   11.844  1.00 64.54  ? 518  LEU A C   1 
ATOM   4005 O O   . LEU A 1 518 ? 1.740   6.990   11.807  1.00 66.43  ? 518  LEU A O   1 
ATOM   4006 C CB  . LEU A 1 518 ? 3.933   6.679   13.867  1.00 62.94  ? 518  LEU A CB  1 
ATOM   4007 C CG  . LEU A 1 518 ? 4.951   6.727   14.994  1.00 61.24  ? 518  LEU A CG  1 
ATOM   4008 C CD1 . LEU A 1 518 ? 5.370   5.286   15.342  1.00 60.75  ? 518  LEU A CD1 1 
ATOM   4009 C CD2 . LEU A 1 518 ? 6.169   7.593   14.664  1.00 58.65  ? 518  LEU A CD2 1 
ATOM   4010 N N   . GLU A 1 519 ? 3.520   7.870   10.758  1.00 64.35  ? 519  GLU A N   1 
ATOM   4011 C CA  . GLU A 1 519 ? 3.122   7.438   9.432   1.00 65.80  ? 519  GLU A CA  1 
ATOM   4012 C C   . GLU A 1 519 ? 4.203   6.525   8.871   1.00 64.34  ? 519  GLU A C   1 
ATOM   4013 O O   . GLU A 1 519 ? 5.368   6.906   8.798   1.00 62.65  ? 519  GLU A O   1 
ATOM   4014 C CB  . GLU A 1 519 ? 2.882   8.651   8.531   1.00 66.51  ? 519  GLU A CB  1 
ATOM   4015 C CG  . GLU A 1 519 ? 2.944   8.372   7.029   1.00 69.74  ? 519  GLU A CG  1 
ATOM   4016 C CD  . GLU A 1 519 ? 2.582   9.595   6.194   1.00 73.81  ? 519  GLU A CD  1 
ATOM   4017 O OE1 . GLU A 1 519 ? 1.483   10.159  6.424   1.00 77.93  ? 519  GLU A OE1 1 
ATOM   4018 O OE2 . GLU A 1 519 ? 3.392   9.987   5.315   1.00 74.57  ? 519  GLU A OE2 1 
ATOM   4019 N N   . VAL A 1 520 ? 3.807   5.318   8.488   1.00 64.95  ? 520  VAL A N   1 
ATOM   4020 C CA  . VAL A 1 520 ? 4.717   4.325   7.940   1.00 64.62  ? 520  VAL A CA  1 
ATOM   4021 C C   . VAL A 1 520 ? 4.917   4.589   6.449   1.00 64.86  ? 520  VAL A C   1 
ATOM   4022 O O   . VAL A 1 520 ? 3.949   4.710   5.697   1.00 65.86  ? 520  VAL A O   1 
ATOM   4023 C CB  . VAL A 1 520 ? 4.170   2.891   8.152   1.00 66.19  ? 520  VAL A CB  1 
ATOM   4024 C CG1 . VAL A 1 520 ? 5.114   1.837   7.569   1.00 66.16  ? 520  VAL A CG1 1 
ATOM   4025 C CG2 . VAL A 1 520 ? 3.938   2.631   9.633   1.00 65.97  ? 520  VAL A CG2 1 
ATOM   4026 N N   . ARG A 1 521 ? 6.178   4.695   6.037   1.00 63.78  ? 521  ARG A N   1 
ATOM   4027 C CA  . ARG A 1 521 ? 6.545   4.890   4.632   1.00 64.25  ? 521  ARG A CA  1 
ATOM   4028 C C   . ARG A 1 521 ? 7.431   3.742   4.182   1.00 64.57  ? 521  ARG A C   1 
ATOM   4029 O O   . ARG A 1 521 ? 7.867   2.954   5.011   1.00 64.22  ? 521  ARG A O   1 
ATOM   4030 C CB  . ARG A 1 521 ? 7.266   6.221   4.460   1.00 63.17  ? 521  ARG A CB  1 
ATOM   4031 C CG  . ARG A 1 521 ? 6.362   7.404   4.737   1.00 63.40  ? 521  ARG A CG  1 
ATOM   4032 C CD  . ARG A 1 521 ? 7.135   8.688   4.713   1.00 61.81  ? 521  ARG A CD  1 
ATOM   4033 N NE  . ARG A 1 521 ? 6.346   9.807   5.219   1.00 62.54  ? 521  ARG A NE  1 
ATOM   4034 C CZ  . ARG A 1 521 ? 6.843   11.017  5.466   1.00 61.78  ? 521  ARG A CZ  1 
ATOM   4035 N NH1 . ARG A 1 521 ? 8.131   11.270  5.276   1.00 60.56  ? 521  ARG A NH1 1 
ATOM   4036 N NH2 . ARG A 1 521 ? 6.052   11.970  5.937   1.00 62.84  ? 521  ARG A NH2 1 
ATOM   4037 N N   . ARG A 1 522 ? 7.687   3.633   2.877   1.00 65.46  ? 522  ARG A N   1 
ATOM   4038 C CA  . ARG A 1 522 ? 8.447   2.495   2.348   1.00 66.37  ? 522  ARG A CA  1 
ATOM   4039 C C   . ARG A 1 522 ? 9.587   2.964   1.456   1.00 65.40  ? 522  ARG A C   1 
ATOM   4040 O O   . ARG A 1 522 ? 9.374   3.741   0.540   1.00 65.64  ? 522  ARG A O   1 
ATOM   4041 C CB  A ARG A 1 522 ? 7.539   1.538   1.550   0.50 68.50  ? 522  ARG A CB  1 
ATOM   4042 C CB  B ARG A 1 522 ? 7.545   1.523   1.585   0.50 68.50  ? 522  ARG A CB  1 
ATOM   4043 C CG  A ARG A 1 522 ? 6.016   1.718   1.736   0.50 70.49  ? 522  ARG A CG  1 
ATOM   4044 C CG  B ARG A 1 522 ? 6.818   0.528   2.474   0.50 70.19  ? 522  ARG A CG  1 
ATOM   4045 C CD  A ARG A 1 522 ? 5.447   0.874   2.866   0.50 71.72  ? 522  ARG A CD  1 
ATOM   4046 C CD  B ARG A 1 522 ? 6.041   -0.495  1.656   0.50 73.26  ? 522  ARG A CD  1 
ATOM   4047 N NE  A ARG A 1 522 ? 4.234   1.465   3.439   0.50 72.38  ? 522  ARG A NE  1 
ATOM   4048 N NE  B ARG A 1 522 ? 6.907   -1.498  1.023   0.50 74.47  ? 522  ARG A NE  1 
ATOM   4049 C CZ  A ARG A 1 522 ? 3.464   0.881   4.356   0.50 73.15  ? 522  ARG A CZ  1 
ATOM   4050 C CZ  B ARG A 1 522 ? 7.225   -1.551  -0.276  0.50 75.75  ? 522  ARG A CZ  1 
ATOM   4051 N NH1 A ARG A 1 522 ? 2.392   1.516   4.816   0.50 74.25  ? 522  ARG A NH1 1 
ATOM   4052 N NH1 B ARG A 1 522 ? 8.022   -2.524  -0.715  0.50 75.83  ? 522  ARG A NH1 1 
ATOM   4053 N NH2 A ARG A 1 522 ? 3.751   -0.334  4.812   0.50 72.66  ? 522  ARG A NH2 1 
ATOM   4054 N NH2 B ARG A 1 522 ? 6.760   -0.654  -1.149  0.50 76.18  ? 522  ARG A NH2 1 
ATOM   4055 N N   . GLY A 1 523 ? 10.791  2.472   1.725   1.00 65.00  ? 523  GLY A N   1 
ATOM   4056 C CA  . GLY A 1 523 ? 11.953  2.758   0.892   1.00 64.67  ? 523  GLY A CA  1 
ATOM   4057 C C   . GLY A 1 523 ? 12.611  4.075   1.229   1.00 63.72  ? 523  GLY A C   1 
ATOM   4058 O O   . GLY A 1 523 ? 12.037  5.145   1.017   1.00 63.72  ? 523  GLY A O   1 
ATOM   4059 N N   . LEU A 1 524 ? 13.835  4.008   1.739   1.00 63.26  ? 524  LEU A N   1 
ATOM   4060 C CA  . LEU A 1 524 ? 14.537  5.208   2.147   1.00 62.10  ? 524  LEU A CA  1 
ATOM   4061 C C   . LEU A 1 524 ? 15.362  5.764   0.972   1.00 61.42  ? 524  LEU A C   1 
ATOM   4062 O O   . LEU A 1 524 ? 16.523  5.380   0.756   1.00 61.09  ? 524  LEU A O   1 
ATOM   4063 C CB  . LEU A 1 524 ? 15.382  4.892   3.380   1.00 61.77  ? 524  LEU A CB  1 
ATOM   4064 C CG  . LEU A 1 524 ? 15.910  6.030   4.265   1.00 62.67  ? 524  LEU A CG  1 
ATOM   4065 C CD1 . LEU A 1 524 ? 15.057  7.314   4.223   1.00 64.43  ? 524  LEU A CD1 1 
ATOM   4066 C CD2 . LEU A 1 524 ? 16.032  5.484   5.694   1.00 64.88  ? 524  LEU A CD2 1 
ATOM   4067 N N   . ARG A 1 525 ? 14.744  6.672   0.215   1.00 61.00  ? 525  ARG A N   1 
ATOM   4068 C CA  . ARG A 1 525 ? 15.318  7.175   -1.034  1.00 61.00  ? 525  ARG A CA  1 
ATOM   4069 C C   . ARG A 1 525 ? 15.844  6.011   -1.869  1.00 60.64  ? 525  ARG A C   1 
ATOM   4070 O O   . ARG A 1 525 ? 16.987  6.032   -2.312  1.00 59.90  ? 525  ARG A O   1 
ATOM   4071 C CB  . ARG A 1 525 ? 16.445  8.175   -0.742  1.00 60.24  ? 525  ARG A CB  1 
ATOM   4072 C CG  . ARG A 1 525 ? 16.012  9.342   0.124   1.00 61.91  ? 525  ARG A CG  1 
ATOM   4073 C CD  . ARG A 1 525 ? 15.543  10.502  -0.681  1.00 65.68  ? 525  ARG A CD  1 
ATOM   4074 N NE  . ARG A 1 525 ? 16.424  11.657  -0.518  1.00 67.11  ? 525  ARG A NE  1 
ATOM   4075 C CZ  . ARG A 1 525 ? 16.356  12.528  0.490   1.00 67.58  ? 525  ARG A CZ  1 
ATOM   4076 N NH1 . ARG A 1 525 ? 15.471  12.370  1.469   1.00 69.59  ? 525  ARG A NH1 1 
ATOM   4077 N NH2 . ARG A 1 525 ? 17.190  13.565  0.529   1.00 67.19  ? 525  ARG A NH2 1 
ATOM   4078 N N   . ALA A 1 526 ? 15.001  4.998   -2.059  1.00 61.14  ? 526  ALA A N   1 
ATOM   4079 C CA  . ALA A 1 526 ? 15.398  3.758   -2.721  1.00 61.78  ? 526  ALA A CA  1 
ATOM   4080 C C   . ALA A 1 526 ? 16.085  3.987   -4.075  1.00 61.59  ? 526  ALA A C   1 
ATOM   4081 O O   . ALA A 1 526 ? 17.189  3.483   -4.279  1.00 61.06  ? 526  ALA A O   1 
ATOM   4082 C CB  . ALA A 1 526 ? 14.204  2.820   -2.868  1.00 63.09  ? 526  ALA A CB  1 
ATOM   4083 N N   . GLN A 1 527 ? 15.476  4.769   -4.971  1.00 61.71  ? 527  GLN A N   1 
ATOM   4084 C CA  . GLN A 1 527 ? 16.061  4.968   -6.313  1.00 62.50  ? 527  GLN A CA  1 
ATOM   4085 C C   . GLN A 1 527 ? 17.390  5.700   -6.264  1.00 60.76  ? 527  GLN A C   1 
ATOM   4086 O O   . GLN A 1 527 ? 18.354  5.270   -6.898  1.00 61.68  ? 527  GLN A O   1 
ATOM   4087 C CB  . GLN A 1 527 ? 15.124  5.721   -7.279  1.00 63.45  ? 527  GLN A CB  1 
ATOM   4088 C CG  . GLN A 1 527 ? 13.871  4.976   -7.717  1.00 66.62  ? 527  GLN A CG  1 
ATOM   4089 C CD  . GLN A 1 527 ? 14.128  3.582   -8.287  1.00 68.89  ? 527  GLN A CD  1 
ATOM   4090 O OE1 . GLN A 1 527 ? 13.675  2.585   -7.714  1.00 70.79  ? 527  GLN A OE1 1 
ATOM   4091 N NE2 . GLN A 1 527 ? 14.833  3.507   -9.421  1.00 68.36  ? 527  GLN A NE2 1 
ATOM   4092 N N   . THR A 1 528 ? 17.431  6.813   -5.533  1.00 58.93  ? 528  THR A N   1 
ATOM   4093 C CA  . THR A 1 528 ? 18.649  7.616   -5.407  1.00 57.37  ? 528  THR A CA  1 
ATOM   4094 C C   . THR A 1 528 ? 19.756  6.870   -4.675  1.00 55.86  ? 528  THR A C   1 
ATOM   4095 O O   . THR A 1 528 ? 20.916  6.961   -5.048  1.00 55.05  ? 528  THR A O   1 
ATOM   4096 C CB  . THR A 1 528 ? 18.359  8.959   -4.714  1.00 56.60  ? 528  THR A CB  1 
ATOM   4097 O OG1 . THR A 1 528 ? 17.619  9.793   -5.615  1.00 58.92  ? 528  THR A OG1 1 
ATOM   4098 C CG2 . THR A 1 528 ? 19.647  9.695   -4.325  1.00 56.79  ? 528  THR A CG2 1 
ATOM   4099 N N   . CYS A 1 529 ? 19.411  6.105   -3.648  1.00 55.35  ? 529  CYS A N   1 
ATOM   4100 C CA  . CYS A 1 529 ? 20.451  5.400   -2.913  1.00 54.57  ? 529  CYS A CA  1 
ATOM   4101 C C   . CYS A 1 529 ? 20.995  4.207   -3.687  1.00 55.66  ? 529  CYS A C   1 
ATOM   4102 O O   . CYS A 1 529 ? 22.129  3.794   -3.440  1.00 55.48  ? 529  CYS A O   1 
ATOM   4103 C CB  . CYS A 1 529 ? 20.015  5.086   -1.480  1.00 53.97  ? 529  CYS A CB  1 
ATOM   4104 S SG  . CYS A 1 529 ? 19.904  6.656   -0.486  1.00 52.61  ? 529  CYS A SG  1 
ATOM   4105 N N   . ALA A 1 530 ? 20.232  3.723   -4.675  1.00 56.85  ? 530  ALA A N   1 
ATOM   4106 C CA  . ALA A 1 530 ? 20.734  2.749   -5.648  1.00 58.29  ? 530  ALA A CA  1 
ATOM   4107 C C   . ALA A 1 530 ? 21.867  3.355   -6.467  1.00 58.25  ? 530  ALA A C   1 
ATOM   4108 O O   . ALA A 1 530 ? 22.890  2.710   -6.711  1.00 59.24  ? 530  ALA A O   1 
ATOM   4109 C CB  . ALA A 1 530 ? 19.613  2.265   -6.564  1.00 59.72  ? 530  ALA A CB  1 
ATOM   4110 N N   . PHE A 1 531 ? 21.699  4.602   -6.879  1.00 57.86  ? 531  PHE A N   1 
ATOM   4111 C CA  . PHE A 1 531 ? 22.771  5.330   -7.556  1.00 57.71  ? 531  PHE A CA  1 
ATOM   4112 C C   . PHE A 1 531 ? 24.070  5.405   -6.710  1.00 56.65  ? 531  PHE A C   1 
ATOM   4113 O O   . PHE A 1 531 ? 25.147  4.998   -7.152  1.00 56.96  ? 531  PHE A O   1 
ATOM   4114 C CB  . PHE A 1 531 ? 22.266  6.723   -7.928  1.00 57.39  ? 531  PHE A CB  1 
ATOM   4115 C CG  . PHE A 1 531 ? 23.329  7.642   -8.437  1.00 57.26  ? 531  PHE A CG  1 
ATOM   4116 C CD1 . PHE A 1 531 ? 23.755  7.564   -9.760  1.00 58.37  ? 531  PHE A CD1 1 
ATOM   4117 C CD2 . PHE A 1 531 ? 23.880  8.609   -7.605  1.00 56.09  ? 531  PHE A CD2 1 
ATOM   4118 C CE1 . PHE A 1 531 ? 24.726  8.425   -10.245 1.00 58.80  ? 531  PHE A CE1 1 
ATOM   4119 C CE2 . PHE A 1 531 ? 24.860  9.468   -8.074  1.00 56.42  ? 531  PHE A CE2 1 
ATOM   4120 C CZ  . PHE A 1 531 ? 25.292  9.374   -9.398  1.00 57.76  ? 531  PHE A CZ  1 
ATOM   4121 N N   . TRP A 1 532 ? 23.955  5.901   -5.489  1.00 55.41  ? 532  TRP A N   1 
ATOM   4122 C CA  . TRP A 1 532 ? 25.125  6.088   -4.631  1.00 54.73  ? 532  TRP A CA  1 
ATOM   4123 C C   . TRP A 1 532 ? 25.747  4.782   -4.168  1.00 56.28  ? 532  TRP A C   1 
ATOM   4124 O O   . TRP A 1 532 ? 26.972  4.684   -4.116  1.00 56.65  ? 532  TRP A O   1 
ATOM   4125 C CB  . TRP A 1 532 ? 24.785  6.944   -3.404  1.00 52.20  ? 532  TRP A CB  1 
ATOM   4126 C CG  . TRP A 1 532 ? 24.482  8.387   -3.728  1.00 50.55  ? 532  TRP A CG  1 
ATOM   4127 C CD1 . TRP A 1 532 ? 23.254  8.976   -3.783  1.00 49.80  ? 532  TRP A CD1 1 
ATOM   4128 C CD2 . TRP A 1 532 ? 25.426  9.412   -4.044  1.00 48.98  ? 532  TRP A CD2 1 
ATOM   4129 N NE1 . TRP A 1 532 ? 23.376  10.303  -4.106  1.00 49.09  ? 532  TRP A NE1 1 
ATOM   4130 C CE2 . TRP A 1 532 ? 24.700  10.594  -4.274  1.00 48.62  ? 532  TRP A CE2 1 
ATOM   4131 C CE3 . TRP A 1 532 ? 26.814  9.444   -4.161  1.00 49.15  ? 532  TRP A CE3 1 
ATOM   4132 C CZ2 . TRP A 1 532 ? 25.316  11.791  -4.609  1.00 49.38  ? 532  TRP A CZ2 1 
ATOM   4133 C CZ3 . TRP A 1 532 ? 27.422  10.638  -4.493  1.00 49.05  ? 532  TRP A CZ3 1 
ATOM   4134 C CH2 . TRP A 1 532 ? 26.674  11.791  -4.709  1.00 48.62  ? 532  TRP A CH2 1 
ATOM   4135 N N   . ASN A 1 533 ? 24.917  3.786   -3.843  1.00 58.25  ? 533  ASN A N   1 
ATOM   4136 C CA  . ASN A 1 533 ? 25.387  2.569   -3.161  1.00 59.55  ? 533  ASN A CA  1 
ATOM   4137 C C   . ASN A 1 533 ? 25.665  1.397   -4.080  1.00 62.44  ? 533  ASN A C   1 
ATOM   4138 O O   . ASN A 1 533 ? 26.359  0.473   -3.685  1.00 62.90  ? 533  ASN A O   1 
ATOM   4139 C CB  . ASN A 1 533 ? 24.380  2.115   -2.091  1.00 59.57  ? 533  ASN A CB  1 
ATOM   4140 C CG  . ASN A 1 533 ? 24.158  3.156   -1.003  1.00 57.65  ? 533  ASN A CG  1 
ATOM   4141 O OD1 . ASN A 1 533 ? 25.003  4.025   -0.790  1.00 58.66  ? 533  ASN A OD1 1 
ATOM   4142 N ND2 . ASN A 1 533 ? 23.022  3.068   -0.304  1.00 55.44  ? 533  ASN A ND2 1 
ATOM   4143 N N   . ARG A 1 534 ? 25.101  1.413   -5.284  1.00 64.96  ? 534  ARG A N   1 
ATOM   4144 C CA  . ARG A 1 534 ? 25.274  0.305   -6.223  1.00 67.78  ? 534  ARG A CA  1 
ATOM   4145 C C   . ARG A 1 534 ? 25.975  0.725   -7.504  1.00 69.19  ? 534  ARG A C   1 
ATOM   4146 O O   . ARG A 1 534 ? 26.849  0.008   -7.980  1.00 70.49  ? 534  ARG A O   1 
ATOM   4147 C CB  . ARG A 1 534 ? 23.932  -0.337  -6.574  1.00 69.19  ? 534  ARG A CB  1 
ATOM   4148 C CG  . ARG A 1 534 ? 23.248  -1.036  -5.414  1.00 69.94  ? 534  ARG A CG  1 
ATOM   4149 C CD  . ARG A 1 534 ? 21.817  -1.358  -5.749  1.00 71.97  ? 534  ARG A CD  1 
ATOM   4150 N NE  . ARG A 1 534 ? 21.063  -1.858  -4.598  1.00 73.41  ? 534  ARG A NE  1 
ATOM   4151 C CZ  . ARG A 1 534 ? 20.991  -3.140  -4.224  1.00 74.36  ? 534  ARG A CZ  1 
ATOM   4152 N NH1 . ARG A 1 534 ? 21.622  -4.101  -4.901  1.00 74.88  ? 534  ARG A NH1 1 
ATOM   4153 N NH2 . ARG A 1 534 ? 20.264  -3.460  -3.158  1.00 74.13  ? 534  ARG A NH2 1 
ATOM   4154 N N   . PHE A 1 535 ? 25.610  1.878   -8.067  1.00 69.73  ? 535  PHE A N   1 
ATOM   4155 C CA  . PHE A 1 535 ? 26.180  2.276   -9.352  1.00 70.81  ? 535  PHE A CA  1 
ATOM   4156 C C   . PHE A 1 535 ? 27.519  3.006   -9.257  1.00 71.09  ? 535  PHE A C   1 
ATOM   4157 O O   . PHE A 1 535 ? 28.469  2.599   -9.913  1.00 71.90  ? 535  PHE A O   1 
ATOM   4158 C CB  . PHE A 1 535 ? 25.210  3.096   -10.189 1.00 70.54  ? 535  PHE A CB  1 
ATOM   4159 C CG  . PHE A 1 535 ? 25.777  3.471   -11.521 1.00 71.27  ? 535  PHE A CG  1 
ATOM   4160 C CD1 . PHE A 1 535 ? 25.965  2.501   -12.500 1.00 72.07  ? 535  PHE A CD1 1 
ATOM   4161 C CD2 . PHE A 1 535 ? 26.189  4.770   -11.779 1.00 69.96  ? 535  PHE A CD2 1 
ATOM   4162 C CE1 . PHE A 1 535 ? 26.519  2.825   -13.714 1.00 72.83  ? 535  PHE A CE1 1 
ATOM   4163 C CE2 . PHE A 1 535 ? 26.743  5.098   -13.007 1.00 71.11  ? 535  PHE A CE2 1 
ATOM   4164 C CZ  . PHE A 1 535 ? 26.907  4.125   -13.971 1.00 72.26  ? 535  PHE A CZ  1 
ATOM   4165 N N   . LEU A 1 536 ? 27.605  4.087   -8.485  1.00 71.01  ? 536  LEU A N   1 
ATOM   4166 C CA  . LEU A 1 536 ? 28.878  4.833   -8.402  1.00 71.98  ? 536  LEU A CA  1 
ATOM   4167 C C   . LEU A 1 536 ? 30.103  3.953   -8.079  1.00 73.72  ? 536  LEU A C   1 
ATOM   4168 O O   . LEU A 1 536 ? 31.161  4.132   -8.682  1.00 74.44  ? 536  LEU A O   1 
ATOM   4169 C CB  . LEU A 1 536 ? 28.812  5.996   -7.407  1.00 70.17  ? 536  LEU A CB  1 
ATOM   4170 C CG  . LEU A 1 536 ? 28.267  7.341   -7.894  1.00 70.48  ? 536  LEU A CG  1 
ATOM   4171 C CD1 . LEU A 1 536 ? 28.787  8.458   -6.999  1.00 68.71  ? 536  LEU A CD1 1 
ATOM   4172 C CD2 . LEU A 1 536 ? 28.623  7.628   -9.362  1.00 71.37  ? 536  LEU A CD2 1 
ATOM   4173 N N   . PRO A 1 537 ? 29.972  3.019   -7.119  1.00 75.28  ? 537  PRO A N   1 
ATOM   4174 C CA  . PRO A 1 537 ? 31.076  2.086   -6.876  1.00 77.08  ? 537  PRO A CA  1 
ATOM   4175 C C   . PRO A 1 537 ? 31.512  1.299   -8.118  1.00 79.91  ? 537  PRO A C   1 
ATOM   4176 O O   . PRO A 1 537 ? 32.708  1.120   -8.335  1.00 80.98  ? 537  PRO A O   1 
ATOM   4177 C CB  . PRO A 1 537 ? 30.506  1.135   -5.810  1.00 76.93  ? 537  PRO A CB  1 
ATOM   4178 C CG  . PRO A 1 537 ? 29.465  1.927   -5.123  1.00 75.30  ? 537  PRO A CG  1 
ATOM   4179 C CD  . PRO A 1 537 ? 28.852  2.781   -6.193  1.00 74.66  ? 537  PRO A CD  1 
ATOM   4180 N N   . LYS A 1 538 ? 30.555  0.821   -8.912  1.00 82.16  ? 538  LYS A N   1 
ATOM   4181 C CA  . LYS A 1 538 ? 30.871  0.140   -10.175 1.00 84.73  ? 538  LYS A CA  1 
ATOM   4182 C C   . LYS A 1 538 ? 31.527  1.077   -11.194 1.00 85.70  ? 538  LYS A C   1 
ATOM   4183 O O   . LYS A 1 538 ? 32.358  0.648   -11.984 1.00 87.19  ? 538  LYS A O   1 
ATOM   4184 C CB  . LYS A 1 538 ? 29.624  -0.504  -10.776 1.00 85.85  ? 538  LYS A CB  1 
ATOM   4185 C CG  . LYS A 1 538 ? 29.298  -1.851  -10.160 1.00 87.24  ? 538  LYS A CG  1 
ATOM   4186 C CD  . LYS A 1 538 ? 27.929  -2.340  -10.572 1.00 89.31  ? 538  LYS A CD  1 
ATOM   4187 C CE  . LYS A 1 538 ? 27.626  -3.689  -9.932  1.00 91.37  ? 538  LYS A CE  1 
ATOM   4188 N NZ  . LYS A 1 538 ? 26.300  -4.231  -10.346 1.00 93.32  ? 538  LYS A NZ  1 
ATOM   4189 N N   . LEU A 1 539 ? 31.156  2.352   -11.168 1.00 85.71  ? 539  LEU A N   1 
ATOM   4190 C CA  . LEU A 1 539 ? 31.773  3.355   -12.030 1.00 86.70  ? 539  LEU A CA  1 
ATOM   4191 C C   . LEU A 1 539 ? 33.230  3.570   -11.625 1.00 87.80  ? 539  LEU A C   1 
ATOM   4192 O O   . LEU A 1 539 ? 34.107  3.694   -12.476 1.00 89.08  ? 539  LEU A O   1 
ATOM   4193 C CB  . LEU A 1 539 ? 30.985  4.666   -11.950 1.00 85.21  ? 539  LEU A CB  1 
ATOM   4194 C CG  . LEU A 1 539 ? 31.308  5.773   -12.948 1.00 84.55  ? 539  LEU A CG  1 
ATOM   4195 C CD1 . LEU A 1 539 ? 31.281  5.252   -14.367 1.00 85.49  ? 539  LEU A CD1 1 
ATOM   4196 C CD2 . LEU A 1 539 ? 30.324  6.914   -12.778 1.00 82.24  ? 539  LEU A CD2 1 
ATOM   4197 N N   . LEU A 1 540 ? 33.474  3.604   -10.317 1.00 88.29  ? 540  LEU A N   1 
ATOM   4198 C CA  . LEU A 1 540 ? 34.833  3.625   -9.749  1.00 89.27  ? 540  LEU A CA  1 
ATOM   4199 C C   . LEU A 1 540 ? 35.597  2.339   -10.083 1.00 91.56  ? 540  LEU A C   1 
ATOM   4200 O O   . LEU A 1 540 ? 36.713  2.381   -10.604 1.00 92.39  ? 540  LEU A O   1 
ATOM   4201 C CB  . LEU A 1 540 ? 34.743  3.808   -8.220  1.00 87.97  ? 540  LEU A CB  1 
ATOM   4202 C CG  . LEU A 1 540 ? 36.003  3.736   -7.350  1.00 87.97  ? 540  LEU A CG  1 
ATOM   4203 C CD1 . LEU A 1 540 ? 37.016  4.813   -7.747  1.00 88.20  ? 540  LEU A CD1 1 
ATOM   4204 C CD2 . LEU A 1 540 ? 35.610  3.857   -5.871  1.00 86.27  ? 540  LEU A CD2 1 
ATOM   4205 N N   . SER A 1 541 ? 34.971  1.207   -9.781  1.00 93.07  ? 541  SER A N   1 
ATOM   4206 C CA  . SER A 1 541 ? 35.563  -0.117  -9.985  1.00 95.64  ? 541  SER A CA  1 
ATOM   4207 C C   . SER A 1 541 ? 35.984  -0.368  -11.439 1.00 98.16  ? 541  SER A C   1 
ATOM   4208 O O   . SER A 1 541 ? 37.057  -0.920  -11.688 1.00 99.69  ? 541  SER A O   1 
ATOM   4209 C CB  . SER A 1 541 ? 34.576  -1.204  -9.520  1.00 96.06  ? 541  SER A CB  1 
ATOM   4210 O OG  . SER A 1 541 ? 34.963  -2.493  -9.961  1.00 98.14  ? 541  SER A OG  1 
ATOM   4211 N N   . ALA A 1 542 ? 35.134  0.029   -12.387 1.00 99.27  ? 542  ALA A N   1 
ATOM   4212 C CA  . ALA A 1 542 ? 35.431  -0.114  -13.816 1.00 101.44 ? 542  ALA A CA  1 
ATOM   4213 C C   . ALA A 1 542 ? 36.449  0.930   -14.300 1.00 101.83 ? 542  ALA A C   1 
ATOM   4214 O O   . ALA A 1 542 ? 37.208  0.664   -15.234 1.00 103.52 ? 542  ALA A O   1 
ATOM   4215 C CB  . ALA A 1 542 ? 34.145  -0.030  -14.639 1.00 101.79 ? 542  ALA A CB  1 
ATOM   4216 N N   . THR A 1 543 ? 36.463  2.106   -13.666 1.00 100.67 ? 543  THR A N   1 
ATOM   4217 C CA  . THR A 1 543 ? 37.390  3.185   -14.027 1.00 100.96 ? 543  THR A CA  1 
ATOM   4218 C C   . THR A 1 543 ? 38.291  3.555   -12.846 1.00 100.04 ? 543  THR A C   1 
ATOM   4219 O O   . THR A 1 543 ? 39.370  4.128   -13.022 1.00 100.54 ? 543  THR A O   1 
ATOM   4220 C CB  . THR A 1 543 ? 36.624  4.444   -14.489 1.00 100.25 ? 543  THR A CB  1 
ATOM   4221 O OG1 . THR A 1 543 ? 35.744  4.105   -15.573 1.00 101.77 ? 543  THR A OG1 1 
ATOM   4222 C CG2 . THR A 1 543 ? 37.593  5.542   -14.939 1.00 100.81 ? 543  THR A CG2 1 
ATOM   4223 N N   . GLU B 1 4   ? -16.998 4.939   -69.322 1.00 91.81  ? 4    GLU B N   1 
ATOM   4224 C CA  . GLU B 1 4   ? -15.747 5.671   -68.950 1.00 89.99  ? 4    GLU B CA  1 
ATOM   4225 C C   . GLU B 1 4   ? -16.099 6.946   -68.174 1.00 89.32  ? 4    GLU B C   1 
ATOM   4226 O O   . GLU B 1 4   ? -16.572 7.926   -68.753 1.00 90.67  ? 4    GLU B O   1 
ATOM   4227 C CB  . GLU B 1 4   ? -14.921 5.999   -70.206 1.00 90.22  ? 4    GLU B CB  1 
ATOM   4228 C CG  . GLU B 1 4   ? -13.600 6.764   -69.962 1.00 89.94  ? 4    GLU B CG  1 
ATOM   4229 C CD  . GLU B 1 4   ? -12.397 5.859   -69.642 1.00 90.50  ? 4    GLU B CD  1 
ATOM   4230 O OE1 . GLU B 1 4   ? -12.091 5.667   -68.433 1.00 91.23  ? 4    GLU B OE1 1 
ATOM   4231 O OE2 . GLU B 1 4   ? -11.742 5.372   -70.597 1.00 90.68  ? 4    GLU B OE2 1 
ATOM   4232 N N   . ASP B 1 5   ? -15.861 6.915   -66.861 1.00 87.21  ? 5    ASP B N   1 
ATOM   4233 C CA  . ASP B 1 5   ? -16.119 8.046   -65.965 1.00 86.10  ? 5    ASP B CA  1 
ATOM   4234 C C   . ASP B 1 5   ? -14.980 9.064   -66.105 1.00 84.36  ? 5    ASP B C   1 
ATOM   4235 O O   . ASP B 1 5   ? -13.843 8.753   -65.777 1.00 82.73  ? 5    ASP B O   1 
ATOM   4236 C CB  . ASP B 1 5   ? -16.214 7.524   -64.525 1.00 85.04  ? 5    ASP B CB  1 
ATOM   4237 C CG  . ASP B 1 5   ? -16.765 8.548   -63.543 1.00 84.40  ? 5    ASP B CG  1 
ATOM   4238 O OD1 . ASP B 1 5   ? -16.748 9.762   -63.838 1.00 83.64  ? 5    ASP B OD1 1 
ATOM   4239 O OD2 . ASP B 1 5   ? -17.198 8.118   -62.451 1.00 81.64  ? 5    ASP B OD2 1 
ATOM   4240 N N   . PRO B 1 6   ? -15.274 10.281  -66.604 1.00 84.79  ? 6    PRO B N   1 
ATOM   4241 C CA  . PRO B 1 6   ? -14.209 11.268  -66.862 1.00 83.30  ? 6    PRO B CA  1 
ATOM   4242 C C   . PRO B 1 6   ? -13.462 11.775  -65.631 1.00 80.91  ? 6    PRO B C   1 
ATOM   4243 O O   . PRO B 1 6   ? -12.372 12.331  -65.770 1.00 79.92  ? 6    PRO B O   1 
ATOM   4244 C CB  . PRO B 1 6   ? -14.951 12.424  -67.534 1.00 85.47  ? 6    PRO B CB  1 
ATOM   4245 C CG  . PRO B 1 6   ? -16.378 12.266  -67.126 1.00 87.34  ? 6    PRO B CG  1 
ATOM   4246 C CD  . PRO B 1 6   ? -16.604 10.798  -66.978 1.00 87.09  ? 6    PRO B CD  1 
ATOM   4247 N N   . GLN B 1 7   ? -14.047 11.602  -64.448 1.00 79.74  ? 7    GLN B N   1 
ATOM   4248 C CA  . GLN B 1 7   ? -13.352 11.879  -63.189 1.00 77.23  ? 7    GLN B CA  1 
ATOM   4249 C C   . GLN B 1 7   ? -12.223 10.890  -62.929 1.00 74.26  ? 7    GLN B C   1 
ATOM   4250 O O   . GLN B 1 7   ? -11.332 11.171  -62.136 1.00 72.26  ? 7    GLN B O   1 
ATOM   4251 C CB  . GLN B 1 7   ? -14.331 11.809  -62.015 1.00 77.90  ? 7    GLN B CB  1 
ATOM   4252 C CG  . GLN B 1 7   ? -15.380 12.918  -62.009 1.00 80.56  ? 7    GLN B CG  1 
ATOM   4253 C CD  . GLN B 1 7   ? -14.797 14.263  -61.623 1.00 81.06  ? 7    GLN B CD  1 
ATOM   4254 O OE1 . GLN B 1 7   ? -13.814 14.342  -60.882 1.00 79.33  ? 7    GLN B OE1 1 
ATOM   4255 N NE2 . GLN B 1 7   ? -15.402 15.331  -62.123 1.00 83.29  ? 7    GLN B NE2 1 
ATOM   4256 N N   . LEU B 1 8   ? -12.293 9.728   -63.577 1.00 73.28  ? 8    LEU B N   1 
ATOM   4257 C CA  . LEU B 1 8   ? -11.330 8.649   -63.377 1.00 71.06  ? 8    LEU B CA  1 
ATOM   4258 C C   . LEU B 1 8   ? -10.266 8.595   -64.474 1.00 70.13  ? 8    LEU B C   1 
ATOM   4259 O O   . LEU B 1 8   ? -9.449  7.681   -64.496 1.00 68.96  ? 8    LEU B O   1 
ATOM   4260 C CB  . LEU B 1 8   ? -12.058 7.299   -63.296 1.00 71.37  ? 8    LEU B CB  1 
ATOM   4261 C CG  . LEU B 1 8   ? -13.179 7.192   -62.254 1.00 71.35  ? 8    LEU B CG  1 
ATOM   4262 C CD1 . LEU B 1 8   ? -13.837 5.822   -62.332 1.00 71.30  ? 8    LEU B CD1 1 
ATOM   4263 C CD2 . LEU B 1 8   ? -12.670 7.466   -60.847 1.00 68.38  ? 8    LEU B CD2 1 
ATOM   4264 N N   . LEU B 1 9   ? -10.273 9.570   -65.377 1.00 70.48  ? 9    LEU B N   1 
ATOM   4265 C CA  . LEU B 1 9   ? -9.284  9.644   -66.447 1.00 70.11  ? 9    LEU B CA  1 
ATOM   4266 C C   . LEU B 1 9   ? -8.419  10.882  -66.214 1.00 68.93  ? 9    LEU B C   1 
ATOM   4267 O O   . LEU B 1 9   ? -8.919  12.008  -66.251 1.00 69.88  ? 9    LEU B O   1 
ATOM   4268 C CB  . LEU B 1 9   ? -9.987  9.722   -67.812 1.00 72.05  ? 9    LEU B CB  1 
ATOM   4269 C CG  . LEU B 1 9   ? -9.406  8.928   -68.987 1.00 73.34  ? 9    LEU B CG  1 
ATOM   4270 C CD1 . LEU B 1 9   ? -10.186 9.273   -70.271 1.00 75.98  ? 9    LEU B CD1 1 
ATOM   4271 C CD2 . LEU B 1 9   ? -7.907  9.170   -69.178 1.00 72.87  ? 9    LEU B CD2 1 
ATOM   4272 N N   . VAL B 1 10  ? -7.135  10.667  -65.954 1.00 66.74  ? 10   VAL B N   1 
ATOM   4273 C CA  . VAL B 1 10  ? -6.189  11.753  -65.726 1.00 65.89  ? 10   VAL B CA  1 
ATOM   4274 C C   . VAL B 1 10  ? -4.982  11.607  -66.647 1.00 65.41  ? 10   VAL B C   1 
ATOM   4275 O O   . VAL B 1 10  ? -4.502  10.490  -66.878 1.00 64.69  ? 10   VAL B O   1 
ATOM   4276 C CB  . VAL B 1 10  ? -5.679  11.764  -64.262 1.00 64.30  ? 10   VAL B CB  1 
ATOM   4277 C CG1 . VAL B 1 10  ? -4.701  12.911  -64.033 1.00 63.20  ? 10   VAL B CG1 1 
ATOM   4278 C CG2 . VAL B 1 10  ? -6.836  11.872  -63.309 1.00 64.72  ? 10   VAL B CG2 1 
ATOM   4279 N N   . ARG B 1 11  ? -4.504  12.738  -67.168 1.00 65.62  ? 11   ARG B N   1 
ATOM   4280 C CA  . ARG B 1 11  ? -3.243  12.786  -67.892 1.00 65.39  ? 11   ARG B CA  1 
ATOM   4281 C C   . ARG B 1 11  ? -2.151  13.313  -66.976 1.00 63.45  ? 11   ARG B C   1 
ATOM   4282 O O   . ARG B 1 11  ? -2.276  14.383  -66.394 1.00 63.37  ? 11   ARG B O   1 
ATOM   4283 C CB  . ARG B 1 11  ? -3.343  13.668  -69.141 1.00 67.49  ? 11   ARG B CB  1 
ATOM   4284 C CG  . ARG B 1 11  ? -2.043  13.713  -69.954 1.00 69.57  ? 11   ARG B CG  1 
ATOM   4285 C CD  . ARG B 1 11  ? -2.209  14.445  -71.279 1.00 73.65  ? 11   ARG B CD  1 
ATOM   4286 N NE  . ARG B 1 11  ? -2.891  13.631  -72.289 1.00 76.37  ? 11   ARG B NE  1 
ATOM   4287 C CZ  . ARG B 1 11  ? -2.346  12.603  -72.941 1.00 76.66  ? 11   ARG B CZ  1 
ATOM   4288 N NH1 . ARG B 1 11  ? -3.069  11.941  -73.841 1.00 77.42  ? 11   ARG B NH1 1 
ATOM   4289 N NH2 . ARG B 1 11  ? -1.092  12.217  -72.692 1.00 76.42  ? 11   ARG B NH2 1 
ATOM   4290 N N   . VAL B 1 12  ? -1.089  12.530  -66.846 1.00 61.83  ? 12   VAL B N   1 
ATOM   4291 C CA  . VAL B 1 12  ? 0.106   12.926  -66.133 1.00 60.21  ? 12   VAL B CA  1 
ATOM   4292 C C   . VAL B 1 12  ? 1.198   13.069  -67.186 1.00 60.81  ? 12   VAL B C   1 
ATOM   4293 O O   . VAL B 1 12  ? 0.949   12.812  -68.367 1.00 61.52  ? 12   VAL B O   1 
ATOM   4294 C CB  . VAL B 1 12  ? 0.479   11.891  -65.050 1.00 58.89  ? 12   VAL B CB  1 
ATOM   4295 C CG1 . VAL B 1 12  ? -0.524  11.958  -63.921 1.00 58.66  ? 12   VAL B CG1 1 
ATOM   4296 C CG2 . VAL B 1 12  ? 0.543   10.480  -65.617 1.00 57.16  ? 12   VAL B CG2 1 
ATOM   4297 N N   . ARG B 1 13  ? 2.391   13.494  -66.791 1.00 60.38  ? 13   ARG B N   1 
ATOM   4298 C CA  . ARG B 1 13  ? 3.444   13.740  -67.779 1.00 61.64  ? 13   ARG B CA  1 
ATOM   4299 C C   . ARG B 1 13  ? 3.770   12.485  -68.590 1.00 60.74  ? 13   ARG B C   1 
ATOM   4300 O O   . ARG B 1 13  ? 4.032   12.578  -69.778 1.00 62.02  ? 13   ARG B O   1 
ATOM   4301 C CB  . ARG B 1 13  ? 4.711   14.300  -67.130 1.00 61.62  ? 13   ARG B CB  1 
ATOM   4302 C CG  . ARG B 1 13  ? 4.583   15.757  -66.728 1.00 66.38  ? 13   ARG B CG  1 
ATOM   4303 C CD  . ARG B 1 13  ? 5.934   16.393  -66.410 1.00 72.55  ? 13   ARG B CD  1 
ATOM   4304 N NE  . ARG B 1 13  ? 5.750   17.697  -65.763 1.00 77.34  ? 13   ARG B NE  1 
ATOM   4305 C CZ  . ARG B 1 13  ? 6.725   18.439  -65.226 1.00 80.12  ? 13   ARG B CZ  1 
ATOM   4306 N NH1 . ARG B 1 13  ? 7.993   18.026  -65.248 1.00 81.77  ? 13   ARG B NH1 1 
ATOM   4307 N NH2 . ARG B 1 13  ? 6.429   19.607  -64.651 1.00 80.40  ? 13   ARG B NH2 1 
ATOM   4308 N N   . GLY B 1 14  ? 3.720   11.320  -67.954 1.00 58.69  ? 14   GLY B N   1 
ATOM   4309 C CA  . GLY B 1 14  ? 4.059   10.067  -68.618 1.00 58.15  ? 14   GLY B CA  1 
ATOM   4310 C C   . GLY B 1 14  ? 3.002   9.509   -69.552 1.00 58.28  ? 14   GLY B C   1 
ATOM   4311 O O   . GLY B 1 14  ? 3.304   8.636   -70.359 1.00 57.88  ? 14   GLY B O   1 
ATOM   4312 N N   . GLY B 1 15  ? 1.769   10.009  -69.444 1.00 58.38  ? 15   GLY B N   1 
ATOM   4313 C CA  . GLY B 1 15  ? 0.647   9.509   -70.241 1.00 59.27  ? 15   GLY B CA  1 
ATOM   4314 C C   . GLY B 1 15  ? -0.680  9.520   -69.497 1.00 59.59  ? 15   GLY B C   1 
ATOM   4315 O O   . GLY B 1 15  ? -0.813  10.171  -68.448 1.00 58.87  ? 15   GLY B O   1 
ATOM   4316 N N   . GLN B 1 16  ? -1.663  8.802   -70.047 1.00 60.34  ? 16   GLN B N   1 
ATOM   4317 C CA  . GLN B 1 16  ? -3.016  8.725   -69.469 1.00 60.96  ? 16   GLN B CA  1 
ATOM   4318 C C   . GLN B 1 16  ? -3.155  7.581   -68.470 1.00 59.65  ? 16   GLN B C   1 
ATOM   4319 O O   . GLN B 1 16  ? -2.547  6.519   -68.653 1.00 59.67  ? 16   GLN B O   1 
ATOM   4320 C CB  . GLN B 1 16  ? -4.061  8.501   -70.557 1.00 62.74  ? 16   GLN B CB  1 
ATOM   4321 C CG  . GLN B 1 16  ? -4.421  9.695   -71.411 1.00 65.83  ? 16   GLN B CG  1 
ATOM   4322 C CD  . GLN B 1 16  ? -5.399  9.293   -72.518 1.00 70.94  ? 16   GLN B CD  1 
ATOM   4323 O OE1 . GLN B 1 16  ? -6.596  9.615   -72.462 1.00 74.30  ? 16   GLN B OE1 1 
ATOM   4324 N NE2 . GLN B 1 16  ? -4.897  8.549   -73.514 1.00 72.08  ? 16   GLN B NE2 1 
ATOM   4325 N N   . LEU B 1 17  ? -3.973  7.798   -67.438 1.00 58.78  ? 17   LEU B N   1 
ATOM   4326 C CA  . LEU B 1 17  ? -4.260  6.800   -66.408 1.00 58.19  ? 17   LEU B CA  1 
ATOM   4327 C C   . LEU B 1 17  ? -5.749  6.605   -66.257 1.00 59.28  ? 17   LEU B C   1 
ATOM   4328 O O   . LEU B 1 17  ? -6.507  7.562   -66.403 1.00 60.30  ? 17   LEU B O   1 
ATOM   4329 C CB  . LEU B 1 17  ? -3.756  7.280   -65.045 1.00 57.17  ? 17   LEU B CB  1 
ATOM   4330 C CG  . LEU B 1 17  ? -2.273  7.545   -64.867 1.00 56.28  ? 17   LEU B CG  1 
ATOM   4331 C CD1 . LEU B 1 17  ? -2.081  8.349   -63.603 1.00 55.99  ? 17   LEU B CD1 1 
ATOM   4332 C CD2 . LEU B 1 17  ? -1.484  6.224   -64.847 1.00 55.03  ? 17   LEU B CD2 1 
ATOM   4333 N N   . ARG B 1 18  ? -6.175  5.388   -65.930 1.00 59.57  ? 18   ARG B N   1 
ATOM   4334 C CA  . ARG B 1 18  ? -7.563  5.169   -65.528 1.00 60.73  ? 18   ARG B CA  1 
ATOM   4335 C C   . ARG B 1 18  ? -7.611  4.744   -64.085 1.00 59.79  ? 18   ARG B C   1 
ATOM   4336 O O   . ARG B 1 18  ? -7.031  3.719   -63.713 1.00 58.87  ? 18   ARG B O   1 
ATOM   4337 C CB  . ARG B 1 18  ? -8.284  4.116   -66.371 1.00 62.05  ? 18   ARG B CB  1 
ATOM   4338 C CG  . ARG B 1 18  ? -9.803  4.152   -66.136 1.00 64.67  ? 18   ARG B CG  1 
ATOM   4339 C CD  . ARG B 1 18  ? -10.542 3.023   -66.812 1.00 68.14  ? 18   ARG B CD  1 
ATOM   4340 N NE  . ARG B 1 18  ? -10.549 3.147   -68.274 1.00 70.48  ? 18   ARG B NE  1 
ATOM   4341 C CZ  . ARG B 1 18  ? -9.701  2.538   -69.100 1.00 71.10  ? 18   ARG B CZ  1 
ATOM   4342 N NH1 . ARG B 1 18  ? -9.804  2.742   -70.409 1.00 71.46  ? 18   ARG B NH1 1 
ATOM   4343 N NH2 . ARG B 1 18  ? -8.749  1.729   -68.631 1.00 71.66  ? 18   ARG B NH2 1 
ATOM   4344 N N   . GLY B 1 19  ? -8.341  5.519   -63.290 1.00 60.12  ? 19   GLY B N   1 
ATOM   4345 C CA  . GLY B 1 19  ? -8.534  5.220   -61.882 1.00 59.66  ? 19   GLY B CA  1 
ATOM   4346 C C   . GLY B 1 19  ? -9.791  4.418   -61.651 1.00 60.88  ? 19   GLY B C   1 
ATOM   4347 O O   . GLY B 1 19  ? -10.432 3.964   -62.594 1.00 61.90  ? 19   GLY B O   1 
ATOM   4348 N N   . ILE B 1 20  ? -10.132 4.244   -60.381 1.00 60.86  ? 20   ILE B N   1 
ATOM   4349 C CA  . ILE B 1 20  ? -11.292 3.464   -59.986 1.00 62.25  ? 20   ILE B CA  1 
ATOM   4350 C C   . ILE B 1 20  ? -12.009 4.215   -58.879 1.00 62.91  ? 20   ILE B C   1 
ATOM   4351 O O   . ILE B 1 20  ? -11.380 4.830   -58.015 1.00 61.49  ? 20   ILE B O   1 
ATOM   4352 C CB  . ILE B 1 20  ? -10.893 2.039   -59.520 1.00 61.80  ? 20   ILE B CB  1 
ATOM   4353 C CG1 . ILE B 1 20  ? -12.136 1.183   -59.217 1.00 64.27  ? 20   ILE B CG1 1 
ATOM   4354 C CG2 . ILE B 1 20  ? -9.994  2.093   -58.314 1.00 59.88  ? 20   ILE B CG2 1 
ATOM   4355 C CD1 . ILE B 1 20  ? -11.810 -0.253  -58.768 1.00 64.58  ? 20   ILE B CD1 1 
ATOM   4356 N N   . ARG B 1 21  ? -13.332 4.166   -58.907 1.00 65.15  ? 21   ARG B N   1 
ATOM   4357 C CA  . ARG B 1 21  ? -14.134 4.858   -57.921 1.00 66.47  ? 21   ARG B CA  1 
ATOM   4358 C C   . ARG B 1 21  ? -14.365 3.923   -56.750 1.00 66.70  ? 21   ARG B C   1 
ATOM   4359 O O   . ARG B 1 21  ? -14.886 2.826   -56.925 1.00 67.52  ? 21   ARG B O   1 
ATOM   4360 C CB  . ARG B 1 21  ? -15.471 5.261   -58.521 1.00 68.90  ? 21   ARG B CB  1 
ATOM   4361 C CG  . ARG B 1 21  ? -16.000 6.574   -57.991 1.00 71.24  ? 21   ARG B CG  1 
ATOM   4362 C CD  . ARG B 1 21  ? -17.453 6.474   -57.638 1.00 76.00  ? 21   ARG B CD  1 
ATOM   4363 N NE  . ARG B 1 21  ? -18.225 5.797   -58.672 1.00 79.21  ? 21   ARG B NE  1 
ATOM   4364 C CZ  . ARG B 1 21  ? -19.485 5.411   -58.518 1.00 83.38  ? 21   ARG B CZ  1 
ATOM   4365 N NH1 . ARG B 1 21  ? -20.111 4.788   -59.519 1.00 84.91  ? 21   ARG B NH1 1 
ATOM   4366 N NH2 . ARG B 1 21  ? -20.125 5.649   -57.368 1.00 85.24  ? 21   ARG B NH2 1 
ATOM   4367 N N   . LEU B 1 22  ? -13.967 4.346   -55.559 1.00 66.29  ? 22   LEU B N   1 
ATOM   4368 C CA  . LEU B 1 22  ? -14.146 3.524   -54.369 1.00 67.06  ? 22   LEU B CA  1 
ATOM   4369 C C   . LEU B 1 22  ? -15.229 4.099   -53.466 1.00 68.80  ? 22   LEU B C   1 
ATOM   4370 O O   . LEU B 1 22  ? -15.480 5.309   -53.467 1.00 68.86  ? 22   LEU B O   1 
ATOM   4371 C CB  . LEU B 1 22  ? -12.832 3.396   -53.601 1.00 65.15  ? 22   LEU B CB  1 
ATOM   4372 C CG  . LEU B 1 22  ? -11.663 2.797   -54.381 1.00 64.16  ? 22   LEU B CG  1 
ATOM   4373 C CD1 . LEU B 1 22  ? -10.456 2.716   -53.478 1.00 63.40  ? 22   LEU B CD1 1 
ATOM   4374 C CD2 . LEU B 1 22  ? -12.008 1.428   -54.960 1.00 65.65  ? 22   LEU B CD2 1 
ATOM   4375 N N   . LYS B 1 23  ? -15.876 3.211   -52.714 1.00 70.56  ? 23   LYS B N   1 
ATOM   4376 C CA  . LYS B 1 23  ? -16.915 3.598   -51.773 1.00 72.52  ? 23   LYS B CA  1 
ATOM   4377 C C   . LYS B 1 23  ? -16.256 3.947   -50.461 1.00 71.19  ? 23   LYS B C   1 
ATOM   4378 O O   . LYS B 1 23  ? -15.506 3.147   -49.918 1.00 70.05  ? 23   LYS B O   1 
ATOM   4379 C CB  . LYS B 1 23  ? -17.917 2.458   -51.550 1.00 74.65  ? 23   LYS B CB  1 
ATOM   4380 C CG  . LYS B 1 23  ? -18.918 2.737   -50.426 1.00 78.44  ? 23   LYS B CG  1 
ATOM   4381 C CD  . LYS B 1 23  ? -20.094 1.735   -50.390 1.00 83.48  ? 23   LYS B CD  1 
ATOM   4382 C CE  . LYS B 1 23  ? -19.715 0.423   -49.662 1.00 84.86  ? 23   LYS B CE  1 
ATOM   4383 N NZ  . LYS B 1 23  ? -20.906 -0.458  -49.383 1.00 88.16  ? 23   LYS B NZ  1 
ATOM   4384 N N   . ALA B 1 24  ? -16.528 5.151   -49.969 1.00 71.39  ? 24   ALA B N   1 
ATOM   4385 C CA  . ALA B 1 24  ? -16.215 5.521   -48.600 1.00 70.68  ? 24   ALA B CA  1 
ATOM   4386 C C   . ALA B 1 24  ? -17.559 5.730   -47.894 1.00 72.69  ? 24   ALA B C   1 
ATOM   4387 O O   . ALA B 1 24  ? -18.509 6.210   -48.528 1.00 74.17  ? 24   ALA B O   1 
ATOM   4388 C CB  . ALA B 1 24  ? -15.369 6.779   -48.566 1.00 69.02  ? 24   ALA B CB  1 
ATOM   4389 N N   . PRO B 1 25  ? -17.668 5.333   -46.603 1.00 72.94  ? 25   PRO B N   1 
ATOM   4390 C CA  . PRO B 1 25  ? -18.894 5.558   -45.801 1.00 74.71  ? 25   PRO B CA  1 
ATOM   4391 C C   . PRO B 1 25  ? -19.663 6.870   -46.060 1.00 75.47  ? 25   PRO B C   1 
ATOM   4392 O O   . PRO B 1 25  ? -20.885 6.848   -46.111 1.00 77.85  ? 25   PRO B O   1 
ATOM   4393 C CB  . PRO B 1 25  ? -18.379 5.534   -44.354 1.00 73.80  ? 25   PRO B CB  1 
ATOM   4394 C CG  . PRO B 1 25  ? -17.032 4.859   -44.406 1.00 72.30  ? 25   PRO B CG  1 
ATOM   4395 C CD  . PRO B 1 25  ? -16.657 4.589   -45.833 1.00 71.42  ? 25   PRO B CD  1 
ATOM   4396 N N   . GLY B 1 26  ? -18.958 7.989   -46.220 1.00 74.10  ? 26   GLY B N   1 
ATOM   4397 C CA  . GLY B 1 26  ? -19.593 9.288   -46.484 1.00 74.75  ? 26   GLY B CA  1 
ATOM   4398 C C   . GLY B 1 26  ? -19.911 9.596   -47.944 1.00 75.32  ? 26   GLY B C   1 
ATOM   4399 O O   . GLY B 1 26  ? -20.697 10.498  -48.236 1.00 76.74  ? 26   GLY B O   1 
ATOM   4400 N N   . GLY B 1 27  ? -19.314 8.852   -48.869 1.00 74.21  ? 27   GLY B N   1 
ATOM   4401 C CA  . GLY B 1 27  ? -19.468 9.125   -50.300 1.00 74.46  ? 27   GLY B CA  1 
ATOM   4402 C C   . GLY B 1 27  ? -18.310 8.556   -51.098 1.00 72.49  ? 27   GLY B C   1 
ATOM   4403 O O   . GLY B 1 27  ? -17.414 7.952   -50.527 1.00 71.33  ? 27   GLY B O   1 
ATOM   4404 N N   . PRO B 1 28  ? -18.330 8.731   -52.431 1.00 72.62  ? 28   PRO B N   1 
ATOM   4405 C CA  . PRO B 1 28  ? -17.277 8.188   -53.294 1.00 70.92  ? 28   PRO B CA  1 
ATOM   4406 C C   . PRO B 1 28  ? -15.940 8.916   -53.213 1.00 68.76  ? 28   PRO B C   1 
ATOM   4407 O O   . PRO B 1 28  ? -15.882 10.075  -52.801 1.00 68.97  ? 28   PRO B O   1 
ATOM   4408 C CB  . PRO B 1 28  ? -17.866 8.342   -54.699 1.00 72.58  ? 28   PRO B CB  1 
ATOM   4409 C CG  . PRO B 1 28  ? -18.831 9.484   -54.586 1.00 73.91  ? 28   PRO B CG  1 
ATOM   4410 C CD  . PRO B 1 28  ? -19.390 9.409   -53.205 1.00 74.21  ? 28   PRO B CD  1 
ATOM   4411 N N   . VAL B 1 29  ? -14.878 8.212   -53.601 1.00 66.73  ? 29   VAL B N   1 
ATOM   4412 C CA  . VAL B 1 29  ? -13.551 8.803   -53.815 1.00 64.57  ? 29   VAL B CA  1 
ATOM   4413 C C   . VAL B 1 29  ? -12.957 8.239   -55.107 1.00 63.43  ? 29   VAL B C   1 
ATOM   4414 O O   . VAL B 1 29  ? -13.379 7.192   -55.572 1.00 63.65  ? 29   VAL B O   1 
ATOM   4415 C CB  . VAL B 1 29  ? -12.572 8.508   -52.641 1.00 63.11  ? 29   VAL B CB  1 
ATOM   4416 C CG1 . VAL B 1 29  ? -13.172 8.941   -51.312 1.00 63.88  ? 29   VAL B CG1 1 
ATOM   4417 C CG2 . VAL B 1 29  ? -12.197 7.039   -52.591 1.00 62.54  ? 29   VAL B CG2 1 
ATOM   4418 N N   . SER B 1 30  ? -11.988 8.948   -55.676 1.00 62.04  ? 30   SER B N   1 
ATOM   4419 C CA  . SER B 1 30  ? -11.251 8.496   -56.858 1.00 61.18  ? 30   SER B CA  1 
ATOM   4420 C C   . SER B 1 30  ? -9.900  7.954   -56.423 1.00 59.05  ? 30   SER B C   1 
ATOM   4421 O O   . SER B 1 30  ? -9.138  8.652   -55.767 1.00 58.75  ? 30   SER B O   1 
ATOM   4422 C CB  . SER B 1 30  ? -11.024 9.655   -57.831 1.00 61.42  ? 30   SER B CB  1 
ATOM   4423 O OG  . SER B 1 30  ? -12.231 10.327  -58.163 1.00 63.99  ? 30   SER B OG  1 
ATOM   4424 N N   . ALA B 1 31  ? -9.600  6.717   -56.799 1.00 58.14  ? 31   ALA B N   1 
ATOM   4425 C CA  . ALA B 1 31  ? -8.337  6.088   -56.482 1.00 56.15  ? 31   ALA B CA  1 
ATOM   4426 C C   . ALA B 1 31  ? -7.571  5.743   -57.755 1.00 55.65  ? 31   ALA B C   1 
ATOM   4427 O O   . ALA B 1 31  ? -8.127  5.171   -58.689 1.00 56.60  ? 31   ALA B O   1 
ATOM   4428 C CB  . ALA B 1 31  ? -8.573  4.837   -55.656 1.00 55.94  ? 31   ALA B CB  1 
ATOM   4429 N N   . PHE B 1 32  ? -6.293  6.102   -57.766 1.00 53.84  ? 32   PHE B N   1 
ATOM   4430 C CA  . PHE B 1 32  ? -5.370  5.791   -58.846 1.00 52.97  ? 32   PHE B CA  1 
ATOM   4431 C C   . PHE B 1 32  ? -4.213  5.009   -58.256 1.00 51.56  ? 32   PHE B C   1 
ATOM   4432 O O   . PHE B 1 32  ? -3.295  5.585   -57.694 1.00 50.88  ? 32   PHE B O   1 
ATOM   4433 C CB  . PHE B 1 32  ? -4.869  7.081   -59.486 1.00 53.09  ? 32   PHE B CB  1 
ATOM   4434 C CG  . PHE B 1 32  ? -5.975  7.954   -59.996 1.00 54.48  ? 32   PHE B CG  1 
ATOM   4435 C CD1 . PHE B 1 32  ? -6.608  8.852   -59.155 1.00 55.70  ? 32   PHE B CD1 1 
ATOM   4436 C CD2 . PHE B 1 32  ? -6.416  7.850   -61.308 1.00 56.99  ? 32   PHE B CD2 1 
ATOM   4437 C CE1 . PHE B 1 32  ? -7.656  9.638   -59.620 1.00 55.75  ? 32   PHE B CE1 1 
ATOM   4438 C CE2 . PHE B 1 32  ? -7.456  8.646   -61.772 1.00 57.17  ? 32   PHE B CE2 1 
ATOM   4439 C CZ  . PHE B 1 32  ? -8.068  9.532   -60.924 1.00 56.94  ? 32   PHE B CZ  1 
ATOM   4440 N N   . LEU B 1 33  ? -4.274  3.689   -58.396 1.00 51.44  ? 33   LEU B N   1 
ATOM   4441 C CA  . LEU B 1 33  ? -3.388  2.763   -57.708 1.00 50.50  ? 33   LEU B CA  1 
ATOM   4442 C C   . LEU B 1 33  ? -2.405  2.111   -58.673 1.00 50.59  ? 33   LEU B C   1 
ATOM   4443 O O   . LEU B 1 33  ? -2.778  1.749   -59.777 1.00 51.95  ? 33   LEU B O   1 
ATOM   4444 C CB  . LEU B 1 33  ? -4.231  1.667   -57.044 1.00 50.83  ? 33   LEU B CB  1 
ATOM   4445 C CG  . LEU B 1 33  ? -5.419  2.171   -56.221 1.00 50.25  ? 33   LEU B CG  1 
ATOM   4446 C CD1 . LEU B 1 33  ? -6.153  0.985   -55.655 1.00 49.28  ? 33   LEU B CD1 1 
ATOM   4447 C CD2 . LEU B 1 33  ? -4.952  3.145   -55.096 1.00 46.06  ? 33   LEU B CD2 1 
ATOM   4448 N N   . GLY B 1 34  ? -1.154  1.960   -58.252 1.00 49.73  ? 34   GLY B N   1 
ATOM   4449 C CA  . GLY B 1 34  ? -0.152  1.248   -59.050 1.00 49.76  ? 34   GLY B CA  1 
ATOM   4450 C C   . GLY B 1 34  ? 0.380   2.062   -60.212 1.00 49.49  ? 34   GLY B C   1 
ATOM   4451 O O   . GLY B 1 34  ? 0.599   1.532   -61.280 1.00 50.28  ? 34   GLY B O   1 
ATOM   4452 N N   . ILE B 1 35  ? 0.609   3.354   -59.985 1.00 48.64  ? 35   ILE B N   1 
ATOM   4453 C CA  . ILE B 1 35  ? 1.164   4.247   -60.998 1.00 47.94  ? 35   ILE B CA  1 
ATOM   4454 C C   . ILE B 1 35  ? 2.677   4.146   -60.958 1.00 47.05  ? 35   ILE B C   1 
ATOM   4455 O O   . ILE B 1 35  ? 3.266   4.387   -59.910 1.00 46.05  ? 35   ILE B O   1 
ATOM   4456 C CB  . ILE B 1 35  ? 0.820   5.719   -60.693 1.00 47.65  ? 35   ILE B CB  1 
ATOM   4457 C CG1 . ILE B 1 35  ? -0.700  5.957   -60.682 1.00 47.57  ? 35   ILE B CG1 1 
ATOM   4458 C CG2 . ILE B 1 35  ? 1.478   6.623   -61.710 1.00 48.83  ? 35   ILE B CG2 1 
ATOM   4459 C CD1 . ILE B 1 35  ? -1.097  7.264   -60.038 1.00 45.32  ? 35   ILE B CD1 1 
ATOM   4460 N N   . PRO B 1 36  ? 3.325   3.815   -62.093 1.00 47.21  ? 36   PRO B N   1 
ATOM   4461 C CA  . PRO B 1 36  ? 4.782   3.692   -62.069 1.00 46.74  ? 36   PRO B CA  1 
ATOM   4462 C C   . PRO B 1 36  ? 5.446   5.062   -62.009 1.00 46.61  ? 36   PRO B C   1 
ATOM   4463 O O   . PRO B 1 36  ? 5.105   5.921   -62.796 1.00 47.64  ? 36   PRO B O   1 
ATOM   4464 C CB  . PRO B 1 36  ? 5.087   3.018   -63.407 1.00 47.18  ? 36   PRO B CB  1 
ATOM   4465 C CG  . PRO B 1 36  ? 3.990   3.449   -64.295 1.00 47.91  ? 36   PRO B CG  1 
ATOM   4466 C CD  . PRO B 1 36  ? 2.779   3.560   -63.440 1.00 48.17  ? 36   PRO B CD  1 
ATOM   4467 N N   . PHE B 1 37  ? 6.352   5.271   -61.061 1.00 46.57  ? 37   PHE B N   1 
ATOM   4468 C CA  . PHE B 1 37  ? 7.154   6.504   -60.989 1.00 46.56  ? 37   PHE B CA  1 
ATOM   4469 C C   . PHE B 1 37  ? 8.632   6.280   -61.321 1.00 46.99  ? 37   PHE B C   1 
ATOM   4470 O O   . PHE B 1 37  ? 9.393   7.239   -61.376 1.00 47.40  ? 37   PHE B O   1 
ATOM   4471 C CB  . PHE B 1 37  ? 7.029   7.178   -59.613 1.00 46.24  ? 37   PHE B CB  1 
ATOM   4472 C CG  . PHE B 1 37  ? 7.599   6.384   -58.467 1.00 45.15  ? 37   PHE B CG  1 
ATOM   4473 C CD1 . PHE B 1 37  ? 8.897   6.590   -58.043 1.00 45.57  ? 37   PHE B CD1 1 
ATOM   4474 C CD2 . PHE B 1 37  ? 6.820   5.465   -57.783 1.00 45.62  ? 37   PHE B CD2 1 
ATOM   4475 C CE1 . PHE B 1 37  ? 9.423   5.870   -56.985 1.00 45.88  ? 37   PHE B CE1 1 
ATOM   4476 C CE2 . PHE B 1 37  ? 7.342   4.740   -56.717 1.00 44.77  ? 37   PHE B CE2 1 
ATOM   4477 C CZ  . PHE B 1 37  ? 8.636   4.945   -56.317 1.00 44.66  ? 37   PHE B CZ  1 
ATOM   4478 N N   . ALA B 1 38  ? 9.030   5.020   -61.532 1.00 47.20  ? 38   ALA B N   1 
ATOM   4479 C CA  . ALA B 1 38  ? 10.414  4.676   -61.880 1.00 47.68  ? 38   ALA B CA  1 
ATOM   4480 C C   . ALA B 1 38  ? 10.477  3.515   -62.873 1.00 48.62  ? 38   ALA B C   1 
ATOM   4481 O O   . ALA B 1 38  ? 9.531   2.743   -63.014 1.00 49.02  ? 38   ALA B O   1 
ATOM   4482 C CB  . ALA B 1 38  ? 11.195  4.326   -60.628 1.00 46.90  ? 38   ALA B CB  1 
ATOM   4483 N N   . GLU B 1 39  ? 11.609  3.392   -63.553 1.00 49.50  ? 39   GLU B N   1 
ATOM   4484 C CA  . GLU B 1 39  ? 11.902  2.199   -64.311 1.00 50.15  ? 39   GLU B CA  1 
ATOM   4485 C C   . GLU B 1 39  ? 12.099  1.036   -63.325 1.00 50.36  ? 39   GLU B C   1 
ATOM   4486 O O   . GLU B 1 39  ? 12.757  1.217   -62.292 1.00 49.58  ? 39   GLU B O   1 
ATOM   4487 C CB  . GLU B 1 39  ? 13.174  2.400   -65.134 1.00 51.06  ? 39   GLU B CB  1 
ATOM   4488 C CG  . GLU B 1 39  ? 13.014  3.339   -66.292 1.00 50.84  ? 39   GLU B CG  1 
ATOM   4489 C CD  . GLU B 1 39  ? 12.070  2.792   -67.333 1.00 52.15  ? 39   GLU B CD  1 
ATOM   4490 O OE1 . GLU B 1 39  ? 12.514  1.980   -68.191 1.00 54.37  ? 39   GLU B OE1 1 
ATOM   4491 O OE2 . GLU B 1 39  ? 10.883  3.179   -67.296 1.00 50.90  ? 39   GLU B OE2 1 
ATOM   4492 N N   . PRO B 1 40  ? 11.507  -0.150  -63.616 1.00 50.88  ? 40   PRO B N   1 
ATOM   4493 C CA  . PRO B 1 40  ? 11.724  -1.332  -62.771 1.00 50.74  ? 40   PRO B CA  1 
ATOM   4494 C C   . PRO B 1 40  ? 13.191  -1.572  -62.416 1.00 51.18  ? 40   PRO B C   1 
ATOM   4495 O O   . PRO B 1 40  ? 14.022  -1.757  -63.308 1.00 51.77  ? 40   PRO B O   1 
ATOM   4496 C CB  . PRO B 1 40  ? 11.164  -2.472  -63.620 1.00 51.79  ? 40   PRO B CB  1 
ATOM   4497 C CG  . PRO B 1 40  ? 10.073  -1.831  -64.408 1.00 51.66  ? 40   PRO B CG  1 
ATOM   4498 C CD  . PRO B 1 40  ? 10.539  -0.428  -64.697 1.00 51.59  ? 40   PRO B CD  1 
ATOM   4499 N N   . PRO B 1 41  ? 13.521  -1.552  -61.112 1.00 50.36  ? 41   PRO B N   1 
ATOM   4500 C CA  . PRO B 1 41  ? 14.920  -1.673  -60.703 1.00 50.67  ? 41   PRO B CA  1 
ATOM   4501 C C   . PRO B 1 41  ? 15.357  -3.128  -60.677 1.00 51.43  ? 41   PRO B C   1 
ATOM   4502 O O   . PRO B 1 41  ? 15.689  -3.667  -59.618 1.00 52.03  ? 41   PRO B O   1 
ATOM   4503 C CB  . PRO B 1 41  ? 14.916  -1.062  -59.309 1.00 49.72  ? 41   PRO B CB  1 
ATOM   4504 C CG  . PRO B 1 41  ? 13.542  -1.363  -58.791 1.00 49.30  ? 41   PRO B CG  1 
ATOM   4505 C CD  . PRO B 1 41  ? 12.619  -1.423  -59.955 1.00 49.17  ? 41   PRO B CD  1 
ATOM   4506 N N   . VAL B 1 42  ? 15.367  -3.746  -61.854 1.00 52.37  ? 42   VAL B N   1 
ATOM   4507 C CA  . VAL B 1 42  ? 15.599  -5.177  -61.992 1.00 53.02  ? 42   VAL B CA  1 
ATOM   4508 C C   . VAL B 1 42  ? 16.841  -5.472  -62.836 1.00 54.39  ? 42   VAL B C   1 
ATOM   4509 O O   . VAL B 1 42  ? 17.271  -4.659  -63.647 1.00 53.74  ? 42   VAL B O   1 
ATOM   4510 C CB  . VAL B 1 42  ? 14.363  -5.876  -62.614 1.00 53.53  ? 42   VAL B CB  1 
ATOM   4511 C CG1 . VAL B 1 42  ? 13.096  -5.570  -61.779 1.00 52.83  ? 42   VAL B CG1 1 
ATOM   4512 C CG2 . VAL B 1 42  ? 14.162  -5.460  -64.073 1.00 52.89  ? 42   VAL B CG2 1 
ATOM   4513 N N   . GLY B 1 43  ? 17.421  -6.651  -62.625 1.00 55.85  ? 43   GLY B N   1 
ATOM   4514 C CA  . GLY B 1 43  ? 18.602  -7.064  -63.367 1.00 57.44  ? 43   GLY B CA  1 
ATOM   4515 C C   . GLY B 1 43  ? 19.809  -6.224  -62.994 1.00 58.03  ? 43   GLY B C   1 
ATOM   4516 O O   . GLY B 1 43  ? 20.279  -6.264  -61.845 1.00 58.23  ? 43   GLY B O   1 
ATOM   4517 N N   . SER B 1 44  ? 20.308  -5.454  -63.958 1.00 58.78  ? 44   SER B N   1 
ATOM   4518 C CA  . SER B 1 44  ? 21.496  -4.620  -63.752 1.00 59.46  ? 44   SER B CA  1 
ATOM   4519 C C   . SER B 1 44  ? 21.190  -3.408  -62.898 1.00 58.48  ? 44   SER B C   1 
ATOM   4520 O O   . SER B 1 44  ? 22.103  -2.804  -62.348 1.00 59.01  ? 44   SER B O   1 
ATOM   4521 C CB  . SER B 1 44  ? 22.081  -4.156  -65.090 1.00 60.59  ? 44   SER B CB  1 
ATOM   4522 O OG  . SER B 1 44  ? 21.343  -3.076  -65.639 1.00 61.12  ? 44   SER B OG  1 
ATOM   4523 N N   . ARG B 1 45  ? 19.909  -3.042  -62.801 1.00 57.21  ? 45   ARG B N   1 
ATOM   4524 C CA  . ARG B 1 45  ? 19.494  -1.864  -62.031 1.00 56.13  ? 45   ARG B CA  1 
ATOM   4525 C C   . ARG B 1 45  ? 19.349  -2.162  -60.533 1.00 55.10  ? 45   ARG B C   1 
ATOM   4526 O O   . ARG B 1 45  ? 19.110  -1.250  -59.738 1.00 53.70  ? 45   ARG B O   1 
ATOM   4527 C CB  . ARG B 1 45  ? 18.180  -1.300  -62.582 1.00 55.75  ? 45   ARG B CB  1 
ATOM   4528 C CG  . ARG B 1 45  ? 18.159  -1.037  -64.104 1.00 58.08  ? 45   ARG B CG  1 
ATOM   4529 C CD  . ARG B 1 45  ? 16.979  -0.128  -64.514 1.00 62.07  ? 45   ARG B CD  1 
ATOM   4530 N NE  . ARG B 1 45  ? 16.718  -0.138  -65.970 1.00 65.12  ? 45   ARG B NE  1 
ATOM   4531 C CZ  . ARG B 1 45  ? 15.649  -0.675  -66.585 1.00 65.20  ? 45   ARG B CZ  1 
ATOM   4532 N NH1 . ARG B 1 45  ? 15.559  -0.612  -67.917 1.00 67.36  ? 45   ARG B NH1 1 
ATOM   4533 N NH2 . ARG B 1 45  ? 14.673  -1.273  -65.911 1.00 63.12  ? 45   ARG B NH2 1 
ATOM   4534 N N   . ARG B 1 46  ? 19.483  -3.433  -60.153 1.00 55.20  ? 46   ARG B N   1 
ATOM   4535 C CA  . ARG B 1 46  ? 19.494  -3.830  -58.746 1.00 54.90  ? 46   ARG B CA  1 
ATOM   4536 C C   . ARG B 1 46  ? 20.583  -3.079  -57.978 1.00 54.93  ? 46   ARG B C   1 
ATOM   4537 O O   . ARG B 1 46  ? 21.727  -2.993  -58.437 1.00 55.90  ? 46   ARG B O   1 
ATOM   4538 C CB  . ARG B 1 46  ? 19.727  -5.347  -58.611 1.00 55.71  ? 46   ARG B CB  1 
ATOM   4539 C CG  . ARG B 1 46  ? 19.575  -5.843  -57.181 1.00 55.63  ? 46   ARG B CG  1 
ATOM   4540 C CD  . ARG B 1 46  ? 19.926  -7.311  -57.043 1.00 56.22  ? 46   ARG B CD  1 
ATOM   4541 N NE  . ARG B 1 46  ? 18.795  -8.232  -57.167 1.00 56.04  ? 46   ARG B NE  1 
ATOM   4542 C CZ  . ARG B 1 46  ? 18.921  -9.557  -57.063 1.00 57.16  ? 46   ARG B CZ  1 
ATOM   4543 N NH1 . ARG B 1 46  ? 20.114  -10.094 -56.856 1.00 56.72  ? 46   ARG B NH1 1 
ATOM   4544 N NH2 . ARG B 1 46  ? 17.863  -10.350 -57.179 1.00 56.62  ? 46   ARG B NH2 1 
ATOM   4545 N N   . PHE B 1 47  ? 20.207  -2.539  -56.817 1.00 54.34  ? 47   PHE B N   1 
ATOM   4546 C CA  . PHE B 1 47  ? 21.090  -1.746  -55.948 1.00 53.94  ? 47   PHE B CA  1 
ATOM   4547 C C   . PHE B 1 47  ? 21.386  -0.352  -56.507 1.00 54.40  ? 47   PHE B C   1 
ATOM   4548 O O   . PHE B 1 47  ? 22.093  0.423   -55.866 1.00 54.92  ? 47   PHE B O   1 
ATOM   4549 C CB  . PHE B 1 47  ? 22.440  -2.428  -55.673 1.00 54.75  ? 47   PHE B CB  1 
ATOM   4550 C CG  . PHE B 1 47  ? 22.347  -3.867  -55.241 1.00 54.71  ? 47   PHE B CG  1 
ATOM   4551 C CD1 . PHE B 1 47  ? 21.565  -4.239  -54.161 1.00 53.11  ? 47   PHE B CD1 1 
ATOM   4552 C CD2 . PHE B 1 47  ? 23.102  -4.843  -55.887 1.00 55.89  ? 47   PHE B CD2 1 
ATOM   4553 C CE1 . PHE B 1 47  ? 21.487  -5.564  -53.747 1.00 53.97  ? 47   PHE B CE1 1 
ATOM   4554 C CE2 . PHE B 1 47  ? 23.028  -6.184  -55.488 1.00 56.36  ? 47   PHE B CE2 1 
ATOM   4555 C CZ  . PHE B 1 47  ? 22.226  -6.541  -54.404 1.00 55.54  ? 47   PHE B CZ  1 
ATOM   4556 N N   . MET B 1 48  ? 20.892  -0.030  -57.698 1.00 54.88  ? 48   MET B N   1 
ATOM   4557 C CA  . MET B 1 48  ? 21.206  1.259   -58.322 1.00 55.84  ? 48   MET B CA  1 
ATOM   4558 C C   . MET B 1 48  ? 20.106  2.277   -58.030 1.00 53.62  ? 48   MET B C   1 
ATOM   4559 O O   . MET B 1 48  ? 18.942  1.897   -57.830 1.00 51.61  ? 48   MET B O   1 
ATOM   4560 C CB  . MET B 1 48  ? 21.351  1.109   -59.838 1.00 56.64  ? 48   MET B CB  1 
ATOM   4561 C CG  . MET B 1 48  ? 22.476  0.189   -60.300 1.00 60.32  ? 48   MET B CG  1 
ATOM   4562 S SD  . MET B 1 48  ? 22.830  0.429   -62.058 1.00 63.71  ? 48   MET B SD  1 
ATOM   4563 C CE  . MET B 1 48  ? 23.868  1.903   -61.904 1.00 67.16  ? 48   MET B CE  1 
ATOM   4564 N N   . PRO B 1 49  ? 20.458  3.577   -58.041 1.00 53.22  ? 49   PRO B N   1 
ATOM   4565 C CA  . PRO B 1 49  ? 19.445  4.629   -57.919 1.00 52.33  ? 49   PRO B CA  1 
ATOM   4566 C C   . PRO B 1 49  ? 18.329  4.471   -58.947 1.00 51.99  ? 49   PRO B C   1 
ATOM   4567 O O   . PRO B 1 49  ? 18.578  3.998   -60.053 1.00 52.64  ? 49   PRO B O   1 
ATOM   4568 C CB  . PRO B 1 49  ? 20.227  5.913   -58.225 1.00 52.83  ? 49   PRO B CB  1 
ATOM   4569 C CG  . PRO B 1 49  ? 21.622  5.596   -57.931 1.00 53.73  ? 49   PRO B CG  1 
ATOM   4570 C CD  . PRO B 1 49  ? 21.812  4.138   -58.193 1.00 54.38  ? 49   PRO B CD  1 
ATOM   4571 N N   . PRO B 1 50  ? 17.113  4.918   -58.613 1.00 51.18  ? 50   PRO B N   1 
ATOM   4572 C CA  . PRO B 1 50  ? 16.020  4.757   -59.570 1.00 50.91  ? 50   PRO B CA  1 
ATOM   4573 C C   . PRO B 1 50  ? 16.101  5.773   -60.696 1.00 51.57  ? 50   PRO B C   1 
ATOM   4574 O O   . PRO B 1 50  ? 16.533  6.891   -60.477 1.00 51.92  ? 50   PRO B O   1 
ATOM   4575 C CB  . PRO B 1 50  ? 14.784  5.017   -58.715 1.00 49.84  ? 50   PRO B CB  1 
ATOM   4576 C CG  . PRO B 1 50  ? 15.258  5.984   -57.691 1.00 49.46  ? 50   PRO B CG  1 
ATOM   4577 C CD  . PRO B 1 50  ? 16.678  5.619   -57.392 1.00 50.04  ? 50   PRO B CD  1 
ATOM   4578 N N   . GLU B 1 51  ? 15.696  5.380   -61.898 1.00 52.58  ? 51   GLU B N   1 
ATOM   4579 C CA  . GLU B 1 51  ? 15.531  6.324   -62.992 1.00 53.48  ? 51   GLU B CA  1 
ATOM   4580 C C   . GLU B 1 51  ? 14.045  6.592   -63.231 1.00 52.38  ? 51   GLU B C   1 
ATOM   4581 O O   . GLU B 1 51  ? 13.212  5.735   -62.979 1.00 51.50  ? 51   GLU B O   1 
ATOM   4582 C CB  . GLU B 1 51  ? 16.189  5.785   -64.257 1.00 55.28  ? 51   GLU B CB  1 
ATOM   4583 C CG  . GLU B 1 51  ? 17.715  5.628   -64.138 1.00 59.36  ? 51   GLU B CG  1 
ATOM   4584 C CD  . GLU B 1 51  ? 18.463  6.974   -63.952 1.00 65.05  ? 51   GLU B CD  1 
ATOM   4585 O OE1 . GLU B 1 51  ? 19.447  7.015   -63.157 1.00 67.56  ? 51   GLU B OE1 1 
ATOM   4586 O OE2 . GLU B 1 51  ? 18.067  7.984   -64.599 1.00 68.27  ? 51   GLU B OE2 1 
ATOM   4587 N N   . PRO B 1 52  ? 13.709  7.783   -63.733 1.00 52.37  ? 52   PRO B N   1 
ATOM   4588 C CA  . PRO B 1 52  ? 12.318  8.109   -64.009 1.00 51.89  ? 52   PRO B CA  1 
ATOM   4589 C C   . PRO B 1 52  ? 11.645  7.184   -65.037 1.00 51.86  ? 52   PRO B C   1 
ATOM   4590 O O   . PRO B 1 52  ? 12.281  6.747   -65.992 1.00 52.36  ? 52   PRO B O   1 
ATOM   4591 C CB  . PRO B 1 52  ? 12.387  9.538   -64.566 1.00 52.70  ? 52   PRO B CB  1 
ATOM   4592 C CG  . PRO B 1 52  ? 13.709  10.075  -64.125 1.00 53.68  ? 52   PRO B CG  1 
ATOM   4593 C CD  . PRO B 1 52  ? 14.620  8.892   -64.075 1.00 53.61  ? 52   PRO B CD  1 
ATOM   4594 N N   . LYS B 1 53  ? 10.350  6.954   -64.837 1.00 50.98  ? 53   LYS B N   1 
ATOM   4595 C CA  . LYS B 1 53  ? 9.562   6.053   -65.657 1.00 51.40  ? 53   LYS B CA  1 
ATOM   4596 C C   . LYS B 1 53  ? 9.416   6.634   -67.053 1.00 52.43  ? 53   LYS B C   1 
ATOM   4597 O O   . LYS B 1 53  ? 9.066   7.811   -67.216 1.00 52.87  ? 53   LYS B O   1 
ATOM   4598 C CB  . LYS B 1 53  ? 8.197   5.808   -65.007 1.00 50.72  ? 53   LYS B CB  1 
ATOM   4599 C CG  . LYS B 1 53  ? 7.186   5.004   -65.817 1.00 51.62  ? 53   LYS B CG  1 
ATOM   4600 C CD  . LYS B 1 53  ? 7.658   3.575   -66.104 1.00 52.22  ? 53   LYS B CD  1 
ATOM   4601 C CE  . LYS B 1 53  ? 6.626   2.785   -66.931 1.00 52.35  ? 53   LYS B CE  1 
ATOM   4602 N NZ  . LYS B 1 53  ? 6.868   2.908   -68.389 1.00 53.46  ? 53   LYS B NZ  1 
ATOM   4603 N N   . ARG B 1 54  ? 9.733   5.814   -68.059 1.00 52.75  ? 54   ARG B N   1 
ATOM   4604 C CA  . ARG B 1 54  ? 9.561   6.206   -69.446 1.00 53.36  ? 54   ARG B CA  1 
ATOM   4605 C C   . ARG B 1 54  ? 8.056   6.390   -69.708 1.00 53.65  ? 54   ARG B C   1 
ATOM   4606 O O   . ARG B 1 54  ? 7.238   5.663   -69.160 1.00 52.29  ? 54   ARG B O   1 
ATOM   4607 C CB  . ARG B 1 54  ? 10.140  5.137   -70.380 1.00 53.79  ? 54   ARG B CB  1 
ATOM   4608 C CG  . ARG B 1 54  ? 11.638  4.958   -70.282 1.00 54.17  ? 54   ARG B CG  1 
ATOM   4609 C CD  . ARG B 1 54  ? 12.137  3.795   -71.126 1.00 55.56  ? 54   ARG B CD  1 
ATOM   4610 N NE  . ARG B 1 54  ? 11.467  2.538   -70.781 1.00 55.30  ? 54   ARG B NE  1 
ATOM   4611 C CZ  . ARG B 1 54  ? 10.753  1.786   -71.616 1.00 56.92  ? 54   ARG B CZ  1 
ATOM   4612 N NH1 . ARG B 1 54  ? 10.191  0.678   -71.166 1.00 57.93  ? 54   ARG B NH1 1 
ATOM   4613 N NH2 . ARG B 1 54  ? 10.589  2.108   -72.893 1.00 59.19  ? 54   ARG B NH2 1 
ATOM   4614 N N   . PRO B 1 55  ? 7.687   7.374   -70.539 1.00 55.26  ? 55   PRO B N   1 
ATOM   4615 C CA  . PRO B 1 55  ? 6.268   7.608   -70.830 1.00 56.00  ? 55   PRO B CA  1 
ATOM   4616 C C   . PRO B 1 55  ? 5.639   6.412   -71.546 1.00 56.64  ? 55   PRO B C   1 
ATOM   4617 O O   . PRO B 1 55  ? 6.350   5.610   -72.139 1.00 57.26  ? 55   PRO B O   1 
ATOM   4618 C CB  . PRO B 1 55  ? 6.295   8.840   -71.747 1.00 57.11  ? 55   PRO B CB  1 
ATOM   4619 C CG  . PRO B 1 55  ? 7.673   8.834   -72.356 1.00 58.21  ? 55   PRO B CG  1 
ATOM   4620 C CD  . PRO B 1 55  ? 8.563   8.313   -71.267 1.00 56.41  ? 55   PRO B CD  1 
ATOM   4621 N N   . TRP B 1 56  ? 4.319   6.289   -71.482 1.00 57.05  ? 56   TRP B N   1 
ATOM   4622 C CA  . TRP B 1 56  ? 3.630   5.108   -72.011 1.00 57.26  ? 56   TRP B CA  1 
ATOM   4623 C C   . TRP B 1 56  ? 2.501   5.499   -72.931 1.00 58.71  ? 56   TRP B C   1 
ATOM   4624 O O   . TRP B 1 56  ? 1.953   6.604   -72.835 1.00 59.43  ? 56   TRP B O   1 
ATOM   4625 C CB  . TRP B 1 56  ? 3.075   4.262   -70.864 1.00 56.14  ? 56   TRP B CB  1 
ATOM   4626 C CG  . TRP B 1 56  ? 2.168   5.024   -69.993 1.00 55.04  ? 56   TRP B CG  1 
ATOM   4627 C CD1 . TRP B 1 56  ? 0.832   5.222   -70.187 1.00 55.80  ? 56   TRP B CD1 1 
ATOM   4628 C CD2 . TRP B 1 56  ? 2.511   5.727   -68.789 1.00 54.08  ? 56   TRP B CD2 1 
ATOM   4629 N NE1 . TRP B 1 56  ? 0.319   6.001   -69.182 1.00 55.38  ? 56   TRP B NE1 1 
ATOM   4630 C CE2 . TRP B 1 56  ? 1.323   6.325   -68.306 1.00 53.91  ? 56   TRP B CE2 1 
ATOM   4631 C CE3 . TRP B 1 56  ? 3.702   5.906   -68.067 1.00 52.98  ? 56   TRP B CE3 1 
ATOM   4632 C CZ2 . TRP B 1 56  ? 1.288   7.093   -67.133 1.00 52.81  ? 56   TRP B CZ2 1 
ATOM   4633 C CZ3 . TRP B 1 56  ? 3.667   6.663   -66.901 1.00 52.88  ? 56   TRP B CZ3 1 
ATOM   4634 C CH2 . TRP B 1 56  ? 2.458   7.258   -66.450 1.00 52.49  ? 56   TRP B CH2 1 
ATOM   4635 N N   . SER B 1 57  ? 2.138   4.561   -73.802 1.00 59.84  ? 57   SER B N   1 
ATOM   4636 C CA  . SER B 1 57  ? 1.089   4.748   -74.789 1.00 60.97  ? 57   SER B CA  1 
ATOM   4637 C C   . SER B 1 57  ? -0.266  4.373   -74.215 1.00 60.85  ? 57   SER B C   1 
ATOM   4638 O O   . SER B 1 57  ? -0.351  3.604   -73.269 1.00 60.12  ? 57   SER B O   1 
ATOM   4639 C CB  . SER B 1 57  ? 1.369   3.848   -76.000 1.00 62.34  ? 57   SER B CB  1 
ATOM   4640 O OG  . SER B 1 57  ? 1.210   2.479   -75.647 1.00 62.20  ? 57   SER B OG  1 
ATOM   4641 N N   . GLY B 1 58  ? -1.331  4.898   -74.805 1.00 61.76  ? 58   GLY B N   1 
ATOM   4642 C CA  . GLY B 1 58  ? -2.677  4.514   -74.411 1.00 62.12  ? 58   GLY B CA  1 
ATOM   4643 C C   . GLY B 1 58  ? -3.011  4.939   -72.996 1.00 61.01  ? 58   GLY B C   1 
ATOM   4644 O O   . GLY B 1 58  ? -2.415  5.877   -72.474 1.00 59.99  ? 58   GLY B O   1 
ATOM   4645 N N   . VAL B 1 59  ? -3.961  4.229   -72.389 1.00 61.15  ? 59   VAL B N   1 
ATOM   4646 C CA  . VAL B 1 59  ? -4.419  4.496   -71.036 1.00 60.62  ? 59   VAL B CA  1 
ATOM   4647 C C   . VAL B 1 59  ? -3.926  3.373   -70.122 1.00 60.08  ? 59   VAL B C   1 
ATOM   4648 O O   . VAL B 1 59  ? -4.275  2.216   -70.323 1.00 60.16  ? 59   VAL B O   1 
ATOM   4649 C CB  . VAL B 1 59  ? -5.974  4.568   -70.974 1.00 61.93  ? 59   VAL B CB  1 
ATOM   4650 C CG1 . VAL B 1 59  ? -6.447  4.978   -69.570 1.00 60.45  ? 59   VAL B CG1 1 
ATOM   4651 C CG2 . VAL B 1 59  ? -6.507  5.528   -72.028 1.00 62.40  ? 59   VAL B CG2 1 
ATOM   4652 N N   . LEU B 1 60  ? -3.109  3.726   -69.128 1.00 59.40  ? 60   LEU B N   1 
ATOM   4653 C CA  . LEU B 1 60  ? -2.577  2.755   -68.165 1.00 58.80  ? 60   LEU B CA  1 
ATOM   4654 C C   . LEU B 1 60  ? -3.599  2.453   -67.080 1.00 58.84  ? 60   LEU B C   1 
ATOM   4655 O O   . LEU B 1 60  ? -4.186  3.357   -66.502 1.00 58.72  ? 60   LEU B O   1 
ATOM   4656 C CB  . LEU B 1 60  ? -1.290  3.282   -67.528 1.00 57.62  ? 60   LEU B CB  1 
ATOM   4657 C CG  . LEU B 1 60  ? -0.459  2.322   -66.665 1.00 57.18  ? 60   LEU B CG  1 
ATOM   4658 C CD1 . LEU B 1 60  ? -0.005  1.061   -67.424 1.00 56.90  ? 60   LEU B CD1 1 
ATOM   4659 C CD2 . LEU B 1 60  ? 0.731   3.067   -66.150 1.00 56.70  ? 60   LEU B CD2 1 
ATOM   4660 N N   . ASP B 1 61  ? -3.808  1.172   -66.820 1.00 59.80  ? 61   ASP B N   1 
ATOM   4661 C CA  . ASP B 1 61  ? -4.772  0.719   -65.827 1.00 60.70  ? 61   ASP B CA  1 
ATOM   4662 C C   . ASP B 1 61  ? -4.228  0.966   -64.419 1.00 58.98  ? 61   ASP B C   1 
ATOM   4663 O O   . ASP B 1 61  ? -3.273  0.297   -64.004 1.00 58.50  ? 61   ASP B O   1 
ATOM   4664 C CB  . ASP B 1 61  ? -5.046  -0.768  -66.048 1.00 62.21  ? 61   ASP B CB  1 
ATOM   4665 C CG  . ASP B 1 61  ? -5.933  -1.378  -64.981 1.00 65.92  ? 61   ASP B CG  1 
ATOM   4666 O OD1 . ASP B 1 61  ? -5.506  -2.385  -64.360 1.00 69.58  ? 61   ASP B OD1 1 
ATOM   4667 O OD2 . ASP B 1 61  ? -7.055  -0.860  -64.775 1.00 70.98  ? 61   ASP B OD2 1 
ATOM   4668 N N   . ALA B 1 62  ? -4.825  1.932   -63.709 1.00 57.81  ? 62   ALA B N   1 
ATOM   4669 C CA  . ALA B 1 62  ? -4.460  2.270   -62.317 1.00 55.91  ? 62   ALA B CA  1 
ATOM   4670 C C   . ALA B 1 62  ? -5.621  1.974   -61.349 1.00 55.86  ? 62   ALA B C   1 
ATOM   4671 O O   . ALA B 1 62  ? -5.970  2.799   -60.497 1.00 54.02  ? 62   ALA B O   1 
ATOM   4672 C CB  . ALA B 1 62  ? -4.057  3.744   -62.217 1.00 55.25  ? 62   ALA B CB  1 
ATOM   4673 N N   . THR B 1 63  ? -6.203  0.789   -61.485 1.00 56.12  ? 63   THR B N   1 
ATOM   4674 C CA  . THR B 1 63  ? -7.353  0.403   -60.693 1.00 57.16  ? 63   THR B CA  1 
ATOM   4675 C C   . THR B 1 63  ? -7.015  -0.585  -59.566 1.00 57.21  ? 63   THR B C   1 
ATOM   4676 O O   . THR B 1 63  ? -7.878  -0.879  -58.739 1.00 57.88  ? 63   THR B O   1 
ATOM   4677 C CB  . THR B 1 63  ? -8.466  -0.197  -61.592 1.00 58.86  ? 63   THR B CB  1 
ATOM   4678 O OG1 . THR B 1 63  ? -8.005  -1.416  -62.193 1.00 58.12  ? 63   THR B OG1 1 
ATOM   4679 C CG2 . THR B 1 63  ? -8.889  0.799   -62.697 1.00 58.64  ? 63   THR B CG2 1 
ATOM   4680 N N   . THR B 1 64  ? -5.780  -1.089  -59.522 1.00 56.60  ? 64   THR B N   1 
ATOM   4681 C CA  . THR B 1 64  ? -5.385  -2.083  -58.512 1.00 56.86  ? 64   THR B CA  1 
ATOM   4682 C C   . THR B 1 64  ? -3.968  -1.814  -57.984 1.00 55.70  ? 64   THR B C   1 
ATOM   4683 O O   . THR B 1 64  ? -3.157  -1.153  -58.644 1.00 55.49  ? 64   THR B O   1 
ATOM   4684 C CB  . THR B 1 64  ? -5.463  -3.542  -59.056 1.00 58.04  ? 64   THR B CB  1 
ATOM   4685 O OG1 . THR B 1 64  ? -4.596  -3.700  -60.180 1.00 58.74  ? 64   THR B OG1 1 
ATOM   4686 C CG2 . THR B 1 64  ? -6.877  -3.909  -59.514 1.00 60.67  ? 64   THR B CG2 1 
ATOM   4687 N N   . PHE B 1 65  ? -3.681  -2.307  -56.781 1.00 55.26  ? 65   PHE B N   1 
ATOM   4688 C CA  . PHE B 1 65  ? -2.353  -2.139  -56.195 1.00 54.27  ? 65   PHE B CA  1 
ATOM   4689 C C   . PHE B 1 65  ? -1.337  -2.965  -56.987 1.00 54.10  ? 65   PHE B C   1 
ATOM   4690 O O   . PHE B 1 65  ? -1.626  -4.065  -57.429 1.00 54.61  ? 65   PHE B O   1 
ATOM   4691 C CB  . PHE B 1 65  ? -2.328  -2.566  -54.712 1.00 54.03  ? 65   PHE B CB  1 
ATOM   4692 C CG  . PHE B 1 65  ? -2.935  -1.564  -53.766 1.00 53.27  ? 65   PHE B CG  1 
ATOM   4693 C CD1 . PHE B 1 65  ? -2.380  -0.305  -53.616 1.00 51.87  ? 65   PHE B CD1 1 
ATOM   4694 C CD2 . PHE B 1 65  ? -4.070  -1.887  -53.015 1.00 54.50  ? 65   PHE B CD2 1 
ATOM   4695 C CE1 . PHE B 1 65  ? -2.939  0.620   -52.750 1.00 50.24  ? 65   PHE B CE1 1 
ATOM   4696 C CE2 . PHE B 1 65  ? -4.623  -0.971  -52.140 1.00 52.93  ? 65   PHE B CE2 1 
ATOM   4697 C CZ  . PHE B 1 65  ? -4.057  0.286   -52.012 1.00 52.52  ? 65   PHE B CZ  1 
ATOM   4698 N N   . GLN B 1 66  ? -0.134  -2.430  -57.144 1.00 53.46  ? 66   GLN B N   1 
ATOM   4699 C CA  . GLN B 1 66  ? 0.954   -3.162  -57.785 1.00 53.32  ? 66   GLN B CA  1 
ATOM   4700 C C   . GLN B 1 66  ? 1.684   -4.085  -56.795 1.00 53.31  ? 66   GLN B C   1 
ATOM   4701 O O   . GLN B 1 66  ? 1.303   -4.174  -55.622 1.00 53.23  ? 66   GLN B O   1 
ATOM   4702 C CB  . GLN B 1 66  ? 1.906   -2.167  -58.448 1.00 53.00  ? 66   GLN B CB  1 
ATOM   4703 C CG  . GLN B 1 66  ? 1.610   -1.988  -59.910 1.00 54.12  ? 66   GLN B CG  1 
ATOM   4704 C CD  . GLN B 1 66  ? 2.122   -3.145  -60.741 1.00 56.33  ? 66   GLN B CD  1 
ATOM   4705 O OE1 . GLN B 1 66  ? 2.818   -4.042  -60.232 1.00 57.69  ? 66   GLN B OE1 1 
ATOM   4706 N NE2 . GLN B 1 66  ? 1.787   -3.137  -62.029 1.00 55.43  ? 66   GLN B NE2 1 
ATOM   4707 N N   . ASN B 1 67  ? 2.722   -4.783  -57.267 1.00 53.62  ? 67   ASN B N   1 
ATOM   4708 C CA  . ASN B 1 67  ? 3.463   -5.737  -56.439 1.00 53.58  ? 67   ASN B CA  1 
ATOM   4709 C C   . ASN B 1 67  ? 4.179   -5.114  -55.243 1.00 52.41  ? 67   ASN B C   1 
ATOM   4710 O O   . ASN B 1 67  ? 4.567   -3.954  -55.271 1.00 52.52  ? 67   ASN B O   1 
ATOM   4711 C CB  . ASN B 1 67  ? 4.488   -6.491  -57.278 1.00 54.18  ? 67   ASN B CB  1 
ATOM   4712 C CG  . ASN B 1 67  ? 3.847   -7.462  -58.255 1.00 56.58  ? 67   ASN B CG  1 
ATOM   4713 O OD1 . ASN B 1 67  ? 2.831   -8.079  -57.956 1.00 58.39  ? 67   ASN B OD1 1 
ATOM   4714 N ND2 . ASN B 1 67  ? 4.443   -7.600  -59.425 1.00 57.11  ? 67   ASN B ND2 1 
ATOM   4715 N N   . VAL B 1 68  ? 4.356   -5.914  -54.199 1.00 52.04  ? 68   VAL B N   1 
ATOM   4716 C CA  . VAL B 1 68  ? 5.091   -5.518  -53.010 1.00 51.39  ? 68   VAL B CA  1 
ATOM   4717 C C   . VAL B 1 68  ? 6.590   -5.714  -53.246 1.00 51.71  ? 68   VAL B C   1 
ATOM   4718 O O   . VAL B 1 68  ? 7.006   -6.738  -53.796 1.00 52.52  ? 68   VAL B O   1 
ATOM   4719 C CB  . VAL B 1 68  ? 4.608   -6.344  -51.780 1.00 51.56  ? 68   VAL B CB  1 
ATOM   4720 C CG1 . VAL B 1 68  ? 5.582   -6.242  -50.610 1.00 50.07  ? 68   VAL B CG1 1 
ATOM   4721 C CG2 . VAL B 1 68  ? 3.217   -5.885  -51.376 1.00 49.95  ? 68   VAL B CG2 1 
ATOM   4722 N N   . CYS B 1 69  ? 7.393   -4.737  -52.834 1.00 50.99  ? 69   CYS B N   1 
ATOM   4723 C CA  . CYS B 1 69  ? 8.848   -4.833  -52.971 1.00 51.74  ? 69   CYS B CA  1 
ATOM   4724 C C   . CYS B 1 69  ? 9.375   -6.086  -52.258 1.00 52.54  ? 69   CYS B C   1 
ATOM   4725 O O   . CYS B 1 69  ? 8.913   -6.432  -51.171 1.00 52.46  ? 69   CYS B O   1 
ATOM   4726 C CB  . CYS B 1 69  ? 9.539   -3.583  -52.422 1.00 50.90  ? 69   CYS B CB  1 
ATOM   4727 S SG  . CYS B 1 69  ? 9.369   -2.052  -53.442 1.00 52.53  ? 69   CYS B SG  1 
ATOM   4728 N N   . TYR B 1 70  ? 10.353  -6.751  -52.869 1.00 53.21  ? 70   TYR B N   1 
ATOM   4729 C CA  . TYR B 1 70  ? 10.804  -8.037  -52.365 1.00 53.86  ? 70   TYR B CA  1 
ATOM   4730 C C   . TYR B 1 70  ? 11.344  -7.919  -50.945 1.00 53.81  ? 70   TYR B C   1 
ATOM   4731 O O   . TYR B 1 70  ? 12.166  -7.057  -50.656 1.00 52.94  ? 70   TYR B O   1 
ATOM   4732 C CB  . TYR B 1 70  ? 11.827  -8.704  -53.295 1.00 54.37  ? 70   TYR B CB  1 
ATOM   4733 C CG  . TYR B 1 70  ? 11.724  -10.202 -53.195 1.00 55.10  ? 70   TYR B CG  1 
ATOM   4734 C CD1 . TYR B 1 70  ? 10.955  -10.928 -54.089 1.00 55.46  ? 70   TYR B CD1 1 
ATOM   4735 C CD2 . TYR B 1 70  ? 12.348  -10.885 -52.165 1.00 55.90  ? 70   TYR B CD2 1 
ATOM   4736 C CE1 . TYR B 1 70  ? 10.831  -12.312 -53.975 1.00 57.17  ? 70   TYR B CE1 1 
ATOM   4737 C CE2 . TYR B 1 70  ? 12.231  -12.255 -52.034 1.00 56.40  ? 70   TYR B CE2 1 
ATOM   4738 C CZ  . TYR B 1 70  ? 11.476  -12.967 -52.939 1.00 57.42  ? 70   TYR B CZ  1 
ATOM   4739 O OH  . TYR B 1 70  ? 11.361  -14.325 -52.800 1.00 58.69  ? 70   TYR B OH  1 
ATOM   4740 N N   . GLN B 1 71  ? 10.862  -8.790  -50.062 1.00 54.65  ? 71   GLN B N   1 
ATOM   4741 C CA  . GLN B 1 71  ? 11.123  -8.640  -48.635 1.00 54.82  ? 71   GLN B CA  1 
ATOM   4742 C C   . GLN B 1 71  ? 10.903  -9.933  -47.865 1.00 56.54  ? 71   GLN B C   1 
ATOM   4743 O O   . GLN B 1 71  ? 10.191  -10.828 -48.321 1.00 56.86  ? 71   GLN B O   1 
ATOM   4744 C CB  . GLN B 1 71  ? 10.228  -7.537  -48.040 1.00 53.37  ? 71   GLN B CB  1 
ATOM   4745 C CG  . GLN B 1 71  ? 8.749   -7.880  -47.943 1.00 53.15  ? 71   GLN B CG  1 
ATOM   4746 C CD  . GLN B 1 71  ? 7.890   -6.673  -47.595 1.00 52.11  ? 71   GLN B CD  1 
ATOM   4747 O OE1 . GLN B 1 71  ? 7.311   -6.593  -46.502 1.00 51.59  ? 71   GLN B OE1 1 
ATOM   4748 N NE2 . GLN B 1 71  ? 7.821   -5.712  -48.515 1.00 51.11  ? 71   GLN B NE2 1 
ATOM   4749 N N   . TYR B 1 72  ? 11.528  -9.997  -46.688 1.00 57.82  ? 72   TYR B N   1 
ATOM   4750 C CA  . TYR B 1 72  ? 11.260  -11.029 -45.690 1.00 59.43  ? 72   TYR B CA  1 
ATOM   4751 C C   . TYR B 1 72  ? 9.784   -11.027 -45.284 1.00 59.72  ? 72   TYR B C   1 
ATOM   4752 O O   . TYR B 1 72  ? 9.191   -9.968  -45.045 1.00 58.31  ? 72   TYR B O   1 
ATOM   4753 C CB  . TYR B 1 72  ? 12.143  -10.764 -44.465 1.00 60.22  ? 72   TYR B CB  1 
ATOM   4754 C CG  . TYR B 1 72  ? 11.896  -11.670 -43.276 1.00 61.82  ? 72   TYR B CG  1 
ATOM   4755 C CD1 . TYR B 1 72  ? 11.132  -11.230 -42.194 1.00 62.02  ? 72   TYR B CD1 1 
ATOM   4756 C CD2 . TYR B 1 72  ? 12.421  -12.963 -43.230 1.00 63.65  ? 72   TYR B CD2 1 
ATOM   4757 C CE1 . TYR B 1 72  ? 10.897  -12.044 -41.096 1.00 62.84  ? 72   TYR B CE1 1 
ATOM   4758 C CE2 . TYR B 1 72  ? 12.188  -13.790 -42.130 1.00 65.05  ? 72   TYR B CE2 1 
ATOM   4759 C CZ  . TYR B 1 72  ? 11.429  -13.317 -41.069 1.00 64.43  ? 72   TYR B CZ  1 
ATOM   4760 O OH  . TYR B 1 72  ? 11.185  -14.108 -39.977 1.00 66.30  ? 72   TYR B OH  1 
ATOM   4761 N N   . VAL B 1 73  ? 9.202   -12.220 -45.214 1.00 61.64  ? 73   VAL B N   1 
ATOM   4762 C CA  . VAL B 1 73  ? 7.835   -12.409 -44.739 1.00 62.70  ? 73   VAL B CA  1 
ATOM   4763 C C   . VAL B 1 73  ? 7.911   -12.947 -43.304 1.00 64.24  ? 73   VAL B C   1 
ATOM   4764 O O   . VAL B 1 73  ? 8.673   -13.868 -43.017 1.00 64.96  ? 73   VAL B O   1 
ATOM   4765 C CB  . VAL B 1 73  ? 7.042   -13.398 -45.644 1.00 63.82  ? 73   VAL B CB  1 
ATOM   4766 C CG1 . VAL B 1 73  ? 5.639   -13.609 -45.124 1.00 64.04  ? 73   VAL B CG1 1 
ATOM   4767 C CG2 . VAL B 1 73  ? 6.986   -12.887 -47.085 1.00 63.31  ? 73   VAL B CG2 1 
ATOM   4768 N N   . ASP B 1 74  ? 7.129   -12.359 -42.404 1.00 64.67  ? 74   ASP B N   1 
ATOM   4769 C CA  . ASP B 1 74  ? 7.148   -12.777 -41.007 1.00 66.05  ? 74   ASP B CA  1 
ATOM   4770 C C   . ASP B 1 74  ? 6.577   -14.179 -40.811 1.00 67.99  ? 74   ASP B C   1 
ATOM   4771 O O   . ASP B 1 74  ? 5.559   -14.538 -41.404 1.00 68.73  ? 74   ASP B O   1 
ATOM   4772 C CB  . ASP B 1 74  ? 6.374   -11.801 -40.131 1.00 65.40  ? 74   ASP B CB  1 
ATOM   4773 C CG  . ASP B 1 74  ? 6.783   -11.890 -38.683 1.00 66.58  ? 74   ASP B CG  1 
ATOM   4774 O OD1 . ASP B 1 74  ? 6.090   -12.582 -37.907 1.00 68.09  ? 74   ASP B OD1 1 
ATOM   4775 O OD2 . ASP B 1 74  ? 7.825   -11.291 -38.341 1.00 66.97  ? 74   ASP B OD2 1 
ATOM   4776 N N   . THR B 1 75  ? 7.249   -14.958 -39.966 1.00 69.51  ? 75   THR B N   1 
ATOM   4777 C CA  . THR B 1 75  ? 6.855   -16.327 -39.648 1.00 71.41  ? 75   THR B CA  1 
ATOM   4778 C C   . THR B 1 75  ? 6.781   -16.580 -38.130 1.00 72.13  ? 75   THR B C   1 
ATOM   4779 O O   . THR B 1 75  ? 6.660   -17.722 -37.707 1.00 73.69  ? 75   THR B O   1 
ATOM   4780 C CB  . THR B 1 75  ? 7.869   -17.319 -40.260 1.00 72.74  ? 75   THR B CB  1 
ATOM   4781 O OG1 . THR B 1 75  ? 9.183   -17.012 -39.776 1.00 73.04  ? 75   THR B OG1 1 
ATOM   4782 C CG2 . THR B 1 75  ? 7.858   -17.238 -41.785 1.00 72.29  ? 75   THR B CG2 1 
ATOM   4783 N N   . LEU B 1 76  ? 6.840   -15.528 -37.309 1.00 71.33  ? 76   LEU B N   1 
ATOM   4784 C CA  . LEU B 1 76  ? 6.887   -15.712 -35.851 1.00 71.83  ? 76   LEU B CA  1 
ATOM   4785 C C   . LEU B 1 76  ? 5.629   -16.427 -35.367 1.00 73.02  ? 76   LEU B C   1 
ATOM   4786 O O   . LEU B 1 76  ? 5.717   -17.408 -34.632 1.00 74.90  ? 76   LEU B O   1 
ATOM   4787 C CB  . LEU B 1 76  ? 7.064   -14.375 -35.122 1.00 70.33  ? 76   LEU B CB  1 
ATOM   4788 C CG  . LEU B 1 76  ? 7.211   -14.419 -33.586 1.00 70.87  ? 76   LEU B CG  1 
ATOM   4789 C CD1 . LEU B 1 76  ? 8.483   -15.161 -33.174 1.00 71.85  ? 76   LEU B CD1 1 
ATOM   4790 C CD2 . LEU B 1 76  ? 7.188   -13.013 -32.990 1.00 67.60  ? 76   LEU B CD2 1 
ATOM   4791 N N   . TYR B 1 77  ? 4.473   -15.938 -35.808 1.00 72.43  ? 77   TYR B N   1 
ATOM   4792 C CA  . TYR B 1 77  ? 3.172   -16.476 -35.425 1.00 73.48  ? 77   TYR B CA  1 
ATOM   4793 C C   . TYR B 1 77  ? 2.303   -16.711 -36.677 1.00 73.77  ? 77   TYR B C   1 
ATOM   4794 O O   . TYR B 1 77  ? 1.460   -15.875 -37.016 1.00 72.68  ? 77   TYR B O   1 
ATOM   4795 C CB  . TYR B 1 77  ? 2.461   -15.500 -34.481 1.00 72.58  ? 77   TYR B CB  1 
ATOM   4796 C CG  . TYR B 1 77  ? 3.145   -15.279 -33.150 1.00 72.48  ? 77   TYR B CG  1 
ATOM   4797 C CD1 . TYR B 1 77  ? 3.426   -16.346 -32.304 1.00 74.21  ? 77   TYR B CD1 1 
ATOM   4798 C CD2 . TYR B 1 77  ? 3.479   -13.996 -32.718 1.00 71.27  ? 77   TYR B CD2 1 
ATOM   4799 C CE1 . TYR B 1 77  ? 4.040   -16.152 -31.071 1.00 74.02  ? 77   TYR B CE1 1 
ATOM   4800 C CE2 . TYR B 1 77  ? 4.095   -13.785 -31.481 1.00 71.08  ? 77   TYR B CE2 1 
ATOM   4801 C CZ  . TYR B 1 77  ? 4.372   -14.868 -30.661 1.00 73.25  ? 77   TYR B CZ  1 
ATOM   4802 O OH  . TYR B 1 77  ? 4.983   -14.679 -29.437 1.00 72.91  ? 77   TYR B OH  1 
ATOM   4803 N N   . PRO B 1 78  ? 2.505   -17.843 -37.377 1.00 75.09  ? 78   PRO B N   1 
ATOM   4804 C CA  . PRO B 1 78  ? 1.733   -18.069 -38.609 1.00 75.31  ? 78   PRO B CA  1 
ATOM   4805 C C   . PRO B 1 78  ? 0.218   -18.120 -38.383 1.00 75.97  ? 78   PRO B C   1 
ATOM   4806 O O   . PRO B 1 78  ? -0.252  -18.812 -37.481 1.00 77.47  ? 78   PRO B O   1 
ATOM   4807 C CB  . PRO B 1 78  ? 2.264   -19.410 -39.135 1.00 76.91  ? 78   PRO B CB  1 
ATOM   4808 C CG  . PRO B 1 78  ? 2.958   -20.050 -37.977 1.00 78.17  ? 78   PRO B CG  1 
ATOM   4809 C CD  . PRO B 1 78  ? 3.443   -18.945 -37.094 1.00 76.59  ? 78   PRO B CD  1 
ATOM   4810 N N   . GLY B 1 79  ? -0.530  -17.371 -39.189 1.00 74.96  ? 79   GLY B N   1 
ATOM   4811 C CA  . GLY B 1 79  ? -1.985  -17.309 -39.063 1.00 75.60  ? 79   GLY B CA  1 
ATOM   4812 C C   . GLY B 1 79  ? -2.491  -16.244 -38.101 1.00 74.61  ? 79   GLY B C   1 
ATOM   4813 O O   . GLY B 1 79  ? -3.704  -16.061 -37.970 1.00 74.86  ? 79   GLY B O   1 
ATOM   4814 N N   . PHE B 1 80  ? -1.570  -15.533 -37.442 1.00 73.38  ? 80   PHE B N   1 
ATOM   4815 C CA  . PHE B 1 80  ? -1.917  -14.541 -36.413 1.00 72.48  ? 80   PHE B CA  1 
ATOM   4816 C C   . PHE B 1 80  ? -2.066  -13.145 -37.029 1.00 71.10  ? 80   PHE B C   1 
ATOM   4817 O O   . PHE B 1 80  ? -1.118  -12.579 -37.576 1.00 69.50  ? 80   PHE B O   1 
ATOM   4818 C CB  . PHE B 1 80  ? -0.866  -14.541 -35.288 1.00 71.98  ? 80   PHE B CB  1 
ATOM   4819 C CG  . PHE B 1 80  ? -1.098  -13.496 -34.230 1.00 70.70  ? 80   PHE B CG  1 
ATOM   4820 C CD1 . PHE B 1 80  ? -2.297  -13.446 -33.533 1.00 71.03  ? 80   PHE B CD1 1 
ATOM   4821 C CD2 . PHE B 1 80  ? -0.111  -12.564 -33.924 1.00 69.61  ? 80   PHE B CD2 1 
ATOM   4822 C CE1 . PHE B 1 80  ? -2.522  -12.483 -32.559 1.00 70.59  ? 80   PHE B CE1 1 
ATOM   4823 C CE2 . PHE B 1 80  ? -0.327  -11.594 -32.948 1.00 68.28  ? 80   PHE B CE2 1 
ATOM   4824 C CZ  . PHE B 1 80  ? -1.540  -11.555 -32.264 1.00 69.30  ? 80   PHE B CZ  1 
ATOM   4825 N N   . GLU B 1 81  ? -3.266  -12.593 -36.911 1.00 71.61  ? 81   GLU B N   1 
ATOM   4826 C CA  . GLU B 1 81  ? -3.604  -11.306 -37.513 1.00 70.73  ? 81   GLU B CA  1 
ATOM   4827 C C   . GLU B 1 81  ? -2.687  -10.158 -37.075 1.00 68.26  ? 81   GLU B C   1 
ATOM   4828 O O   . GLU B 1 81  ? -2.358  -9.292  -37.879 1.00 67.04  ? 81   GLU B O   1 
ATOM   4829 C CB  . GLU B 1 81  ? -5.064  -10.979 -37.189 1.00 72.27  ? 81   GLU B CB  1 
ATOM   4830 C CG  . GLU B 1 81  ? -5.614  -9.725  -37.840 1.00 74.45  ? 81   GLU B CG  1 
ATOM   4831 C CD  . GLU B 1 81  ? -7.119  -9.806  -38.068 1.00 80.89  ? 81   GLU B CD  1 
ATOM   4832 O OE1 . GLU B 1 81  ? -7.822  -10.492 -37.272 1.00 84.80  ? 81   GLU B OE1 1 
ATOM   4833 O OE2 . GLU B 1 81  ? -7.595  -9.191  -39.058 1.00 84.10  ? 81   GLU B OE2 1 
ATOM   4834 N N   . GLY B 1 82  ? -2.269  -10.160 -35.810 1.00 67.61  ? 82   GLY B N   1 
ATOM   4835 C CA  . GLY B 1 82  ? -1.407  -9.104  -35.264 1.00 65.39  ? 82   GLY B CA  1 
ATOM   4836 C C   . GLY B 1 82  ? -0.053  -8.961  -35.935 1.00 63.72  ? 82   GLY B C   1 
ATOM   4837 O O   . GLY B 1 82  ? 0.522   -7.866  -35.956 1.00 62.09  ? 82   GLY B O   1 
ATOM   4838 N N   . THR B 1 83  ? 0.472   -10.068 -36.457 1.00 63.79  ? 83   THR B N   1 
ATOM   4839 C CA  . THR B 1 83  ? 1.688   -10.043 -37.262 1.00 62.54  ? 83   THR B CA  1 
ATOM   4840 C C   . THR B 1 83  ? 1.347   -10.037 -38.748 1.00 62.36  ? 83   THR B C   1 
ATOM   4841 O O   . THR B 1 83  ? 1.950   -9.297  -39.527 1.00 60.82  ? 83   THR B O   1 
ATOM   4842 C CB  . THR B 1 83  ? 2.624   -11.242 -36.960 1.00 63.73  ? 83   THR B CB  1 
ATOM   4843 O OG1 . THR B 1 83  ? 1.874   -12.471 -36.944 1.00 64.74  ? 83   THR B OG1 1 
ATOM   4844 C CG2 . THR B 1 83  ? 3.341   -11.052 -35.638 1.00 62.56  ? 83   THR B CG2 1 
ATOM   4845 N N   . GLU B 1 84  ? 0.364   -10.847 -39.134 1.00 63.65  ? 84   GLU B N   1 
ATOM   4846 C CA  . GLU B 1 84  ? 0.049   -11.042 -40.549 1.00 63.92  ? 84   GLU B CA  1 
ATOM   4847 C C   . GLU B 1 84  ? -0.443  -9.771  -41.217 1.00 62.23  ? 84   GLU B C   1 
ATOM   4848 O O   . GLU B 1 84  ? -0.217  -9.599  -42.402 1.00 61.39  ? 84   GLU B O   1 
ATOM   4849 C CB  . GLU B 1 84  ? -0.985  -12.149 -40.741 1.00 65.95  ? 84   GLU B CB  1 
ATOM   4850 C CG  . GLU B 1 84  ? -0.514  -13.549 -40.326 1.00 70.05  ? 84   GLU B CG  1 
ATOM   4851 C CD  . GLU B 1 84  ? 0.242   -14.310 -41.406 1.00 74.06  ? 84   GLU B CD  1 
ATOM   4852 O OE1 . GLU B 1 84  ? 0.658   -13.687 -42.425 1.00 76.35  ? 84   GLU B OE1 1 
ATOM   4853 O OE2 . GLU B 1 84  ? 0.428   -15.539 -41.214 1.00 74.67  ? 84   GLU B OE2 1 
ATOM   4854 N N   . MET B 1 85  ? -1.100  -8.883  -40.467 1.00 61.45  ? 85   MET B N   1 
ATOM   4855 C CA  . MET B 1 85  ? -1.633  -7.629  -41.029 1.00 60.65  ? 85   MET B CA  1 
ATOM   4856 C C   . MET B 1 85  ? -0.549  -6.659  -41.546 1.00 58.39  ? 85   MET B C   1 
ATOM   4857 O O   . MET B 1 85  ? -0.857  -5.647  -42.201 1.00 57.85  ? 85   MET B O   1 
ATOM   4858 C CB  . MET B 1 85  ? -2.516  -6.905  -39.995 1.00 60.94  ? 85   MET B CB  1 
ATOM   4859 C CG  . MET B 1 85  ? -1.763  -6.299  -38.799 1.00 61.27  ? 85   MET B CG  1 
ATOM   4860 S SD  . MET B 1 85  ? -2.685  -5.047  -37.866 1.00 62.36  ? 85   MET B SD  1 
ATOM   4861 C CE  . MET B 1 85  ? -2.394  -3.595  -38.848 1.00 61.34  ? 85   MET B CE  1 
ATOM   4862 N N   . TRP B 1 86  ? 0.705   -6.942  -41.216 1.00 56.67  ? 86   TRP B N   1 
ATOM   4863 C CA  . TRP B 1 86  ? 1.823   -6.145  -41.681 1.00 54.72  ? 86   TRP B CA  1 
ATOM   4864 C C   . TRP B 1 86  ? 2.566   -6.821  -42.819 1.00 54.59  ? 86   TRP B C   1 
ATOM   4865 O O   . TRP B 1 86  ? 3.436   -6.200  -43.441 1.00 52.93  ? 86   TRP B O   1 
ATOM   4866 C CB  . TRP B 1 86  ? 2.786   -5.911  -40.539 1.00 53.83  ? 86   TRP B CB  1 
ATOM   4867 C CG  . TRP B 1 86  ? 2.164   -5.256  -39.396 1.00 53.34  ? 86   TRP B CG  1 
ATOM   4868 C CD1 . TRP B 1 86  ? 1.874   -5.822  -38.206 1.00 53.50  ? 86   TRP B CD1 1 
ATOM   4869 C CD2 . TRP B 1 86  ? 1.731   -3.887  -39.317 1.00 52.15  ? 86   TRP B CD2 1 
ATOM   4870 N NE1 . TRP B 1 86  ? 1.293   -4.897  -37.374 1.00 53.78  ? 86   TRP B NE1 1 
ATOM   4871 C CE2 . TRP B 1 86  ? 1.193   -3.699  -38.030 1.00 52.31  ? 86   TRP B CE2 1 
ATOM   4872 C CE3 . TRP B 1 86  ? 1.751   -2.807  -40.206 1.00 51.74  ? 86   TRP B CE3 1 
ATOM   4873 C CZ2 . TRP B 1 86  ? 0.686   -2.469  -37.598 1.00 51.79  ? 86   TRP B CZ2 1 
ATOM   4874 C CZ3 . TRP B 1 86  ? 1.244   -1.577  -39.784 1.00 51.06  ? 86   TRP B CZ3 1 
ATOM   4875 C CH2 . TRP B 1 86  ? 0.717   -1.420  -38.489 1.00 51.31  ? 86   TRP B CH2 1 
ATOM   4876 N N   . ASN B 1 87  ? 2.223   -8.086  -43.078 1.00 55.30  ? 87   ASN B N   1 
ATOM   4877 C CA  . ASN B 1 87  ? 2.881   -8.875  -44.106 1.00 55.93  ? 87   ASN B CA  1 
ATOM   4878 C C   . ASN B 1 87  ? 2.337   -8.482  -45.475 1.00 55.82  ? 87   ASN B C   1 
ATOM   4879 O O   . ASN B 1 87  ? 1.228   -7.947  -45.566 1.00 55.19  ? 87   ASN B O   1 
ATOM   4880 C CB  . ASN B 1 87  ? 2.677   -10.386 -43.876 1.00 57.36  ? 87   ASN B CB  1 
ATOM   4881 C CG  . ASN B 1 87  ? 3.781   -11.034 -43.029 1.00 58.67  ? 87   ASN B CG  1 
ATOM   4882 O OD1 . ASN B 1 87  ? 4.850   -10.452 -42.794 1.00 58.46  ? 87   ASN B OD1 1 
ATOM   4883 N ND2 . ASN B 1 87  ? 3.525   -12.269 -42.586 1.00 58.57  ? 87   ASN B ND2 1 
ATOM   4884 N N   . PRO B 1 88  ? 3.108   -8.764  -46.548 1.00 56.06  ? 88   PRO B N   1 
ATOM   4885 C CA  . PRO B 1 88  ? 2.681   -8.440  -47.904 1.00 56.00  ? 88   PRO B CA  1 
ATOM   4886 C C   . PRO B 1 88  ? 1.300   -9.002  -48.225 1.00 56.82  ? 88   PRO B C   1 
ATOM   4887 O O   . PRO B 1 88  ? 1.032   -10.182 -47.962 1.00 57.93  ? 88   PRO B O   1 
ATOM   4888 C CB  . PRO B 1 88  ? 3.738   -9.133  -48.774 1.00 56.48  ? 88   PRO B CB  1 
ATOM   4889 C CG  . PRO B 1 88  ? 4.941   -9.190  -47.923 1.00 56.05  ? 88   PRO B CG  1 
ATOM   4890 C CD  . PRO B 1 88  ? 4.419   -9.444  -46.546 1.00 56.56  ? 88   PRO B CD  1 
ATOM   4891 N N   . ASN B 1 89  ? 0.443   -8.153  -48.775 1.00 56.25  ? 89   ASN B N   1 
ATOM   4892 C CA  . ASN B 1 89  ? -0.883  -8.547  -49.199 1.00 57.42  ? 89   ASN B CA  1 
ATOM   4893 C C   . ASN B 1 89  ? -0.990  -8.555  -50.718 1.00 57.87  ? 89   ASN B C   1 
ATOM   4894 O O   . ASN B 1 89  ? -2.075  -8.683  -51.250 1.00 59.23  ? 89   ASN B O   1 
ATOM   4895 C CB  . ASN B 1 89  ? -1.947  -7.622  -48.589 1.00 57.26  ? 89   ASN B CB  1 
ATOM   4896 C CG  . ASN B 1 89  ? -1.778  -6.178  -49.016 1.00 56.17  ? 89   ASN B CG  1 
ATOM   4897 O OD1 . ASN B 1 89  ? -0.693  -5.770  -49.433 1.00 54.74  ? 89   ASN B OD1 1 
ATOM   4898 N ND2 . ASN B 1 89  ? -2.846  -5.404  -48.925 1.00 55.39  ? 89   ASN B ND2 1 
ATOM   4899 N N   . ARG B 1 90  ? 0.136   -8.408  -51.408 1.00 57.40  ? 90   ARG B N   1 
ATOM   4900 C CA  . ARG B 1 90  ? 0.223   -8.644  -52.850 1.00 57.87  ? 90   ARG B CA  1 
ATOM   4901 C C   . ARG B 1 90  ? 1.506   -9.436  -53.107 1.00 57.97  ? 90   ARG B C   1 
ATOM   4902 O O   . ARG B 1 90  ? 2.300   -9.634  -52.195 1.00 57.57  ? 90   ARG B O   1 
ATOM   4903 C CB  . ARG B 1 90  ? 0.240   -7.328  -53.640 1.00 57.02  ? 90   ARG B CB  1 
ATOM   4904 C CG  . ARG B 1 90  ? -1.042  -6.495  -53.568 1.00 58.58  ? 90   ARG B CG  1 
ATOM   4905 C CD  . ARG B 1 90  ? -2.215  -7.225  -54.187 1.00 62.27  ? 90   ARG B CD  1 
ATOM   4906 N NE  . ARG B 1 90  ? -3.443  -6.438  -54.212 1.00 64.93  ? 90   ARG B NE  1 
ATOM   4907 C CZ  . ARG B 1 90  ? -4.246  -6.226  -53.169 1.00 66.25  ? 90   ARG B CZ  1 
ATOM   4908 N NH1 . ARG B 1 90  ? -3.986  -6.750  -51.982 1.00 66.31  ? 90   ARG B NH1 1 
ATOM   4909 N NH2 . ARG B 1 90  ? -5.340  -5.484  -53.325 1.00 67.15  ? 90   ARG B NH2 1 
ATOM   4910 N N   . GLU B 1 91  ? 1.696   -9.891  -54.342 1.00 58.47  ? 91   GLU B N   1 
ATOM   4911 C CA  . GLU B 1 91  ? 2.879   -10.669 -54.718 1.00 58.68  ? 91   GLU B CA  1 
ATOM   4912 C C   . GLU B 1 91  ? 4.157   -9.882  -54.592 1.00 56.52  ? 91   GLU B C   1 
ATOM   4913 O O   . GLU B 1 91  ? 4.180   -8.680  -54.817 1.00 55.15  ? 91   GLU B O   1 
ATOM   4914 C CB  . GLU B 1 91  ? 2.767   -11.156 -56.161 1.00 60.26  ? 91   GLU B CB  1 
ATOM   4915 C CG  . GLU B 1 91  ? 1.728   -12.248 -56.360 1.00 64.97  ? 91   GLU B CG  1 
ATOM   4916 C CD  . GLU B 1 91  ? 2.257   -13.636 -56.061 1.00 69.58  ? 91   GLU B CD  1 
ATOM   4917 O OE1 . GLU B 1 91  ? 3.144   -13.792 -55.188 1.00 71.29  ? 91   GLU B OE1 1 
ATOM   4918 O OE2 . GLU B 1 91  ? 1.777   -14.581 -56.719 1.00 75.66  ? 91   GLU B OE2 1 
ATOM   4919 N N   . LEU B 1 92  ? 5.226   -10.585 -54.243 1.00 55.93  ? 92   LEU B N   1 
ATOM   4920 C CA  . LEU B 1 92  ? 6.527   -9.975  -54.074 1.00 54.48  ? 92   LEU B CA  1 
ATOM   4921 C C   . LEU B 1 92  ? 7.197   -9.837  -55.423 1.00 54.36  ? 92   LEU B C   1 
ATOM   4922 O O   . LEU B 1 92  ? 7.164   -10.761 -56.232 1.00 55.59  ? 92   LEU B O   1 
ATOM   4923 C CB  . LEU B 1 92  ? 7.403   -10.830 -53.173 1.00 54.88  ? 92   LEU B CB  1 
ATOM   4924 C CG  . LEU B 1 92  ? 7.017   -10.948 -51.707 1.00 53.58  ? 92   LEU B CG  1 
ATOM   4925 C CD1 . LEU B 1 92  ? 8.029   -11.844 -51.018 1.00 53.61  ? 92   LEU B CD1 1 
ATOM   4926 C CD2 . LEU B 1 92  ? 6.980   -9.583  -51.066 1.00 50.39  ? 92   LEU B CD2 1 
ATOM   4927 N N   . SER B 1 93  ? 7.796   -8.681  -55.675 1.00 52.84  ? 93   SER B N   1 
ATOM   4928 C CA  . SER B 1 93  ? 8.600   -8.502  -56.874 1.00 52.43  ? 93   SER B CA  1 
ATOM   4929 C C   . SER B 1 93  ? 9.622   -7.409  -56.652 1.00 51.19  ? 93   SER B C   1 
ATOM   4930 O O   . SER B 1 93  ? 9.396   -6.512  -55.858 1.00 50.28  ? 93   SER B O   1 
ATOM   4931 C CB  . SER B 1 93  ? 7.716   -8.142  -58.066 1.00 52.35  ? 93   SER B CB  1 
ATOM   4932 O OG  . SER B 1 93  ? 8.494   -8.040  -59.242 1.00 51.44  ? 93   SER B OG  1 
ATOM   4933 N N   . GLU B 1 94  ? 10.748  -7.496  -57.353 1.00 51.57  ? 94   GLU B N   1 
ATOM   4934 C CA  . GLU B 1 94  ? 11.695  -6.387  -57.403 1.00 50.78  ? 94   GLU B CA  1 
ATOM   4935 C C   . GLU B 1 94  ? 11.146  -5.288  -58.282 1.00 50.02  ? 94   GLU B C   1 
ATOM   4936 O O   . GLU B 1 94  ? 11.521  -4.120  -58.133 1.00 49.13  ? 94   GLU B O   1 
ATOM   4937 C CB  . GLU B 1 94  ? 13.060  -6.836  -57.907 1.00 51.88  ? 94   GLU B CB  1 
ATOM   4938 C CG  . GLU B 1 94  ? 13.833  -7.610  -56.872 1.00 52.68  ? 94   GLU B CG  1 
ATOM   4939 C CD  . GLU B 1 94  ? 15.178  -8.064  -57.378 1.00 54.72  ? 94   GLU B CD  1 
ATOM   4940 O OE1 . GLU B 1 94  ? 16.095  -7.213  -57.475 1.00 54.35  ? 94   GLU B OE1 1 
ATOM   4941 O OE2 . GLU B 1 94  ? 15.316  -9.274  -57.662 1.00 55.39  ? 94   GLU B OE2 1 
ATOM   4942 N N   . ASP B 1 95  ? 10.240  -5.668  -59.182 1.00 49.76  ? 95   ASP B N   1 
ATOM   4943 C CA  . ASP B 1 95  ? 9.467   -4.710  -59.956 1.00 49.40  ? 95   ASP B CA  1 
ATOM   4944 C C   . ASP B 1 95  ? 8.332   -4.172  -59.088 1.00 48.61  ? 95   ASP B C   1 
ATOM   4945 O O   . ASP B 1 95  ? 7.230   -4.694  -59.098 1.00 48.54  ? 95   ASP B O   1 
ATOM   4946 C CB  . ASP B 1 95  ? 8.928   -5.392  -61.207 1.00 50.15  ? 95   ASP B CB  1 
ATOM   4947 C CG  . ASP B 1 95  ? 8.230   -4.443  -62.145 1.00 50.11  ? 95   ASP B CG  1 
ATOM   4948 O OD1 . ASP B 1 95  ? 7.873   -3.319  -61.733 1.00 47.69  ? 95   ASP B OD1 1 
ATOM   4949 O OD2 . ASP B 1 95  ? 8.043   -4.848  -63.312 1.00 51.31  ? 95   ASP B OD2 1 
ATOM   4950 N N   . CYS B 1 96  ? 8.629   -3.125  -58.328 1.00 47.97  ? 96   CYS B N   1 
ATOM   4951 C CA  . CYS B 1 96  ? 7.720   -2.632  -57.292 1.00 47.47  ? 96   CYS B CA  1 
ATOM   4952 C C   . CYS B 1 96  ? 7.641   -1.099  -57.157 1.00 46.18  ? 96   CYS B C   1 
ATOM   4953 O O   . CYS B 1 96  ? 6.990   -0.592  -56.242 1.00 45.66  ? 96   CYS B O   1 
ATOM   4954 C CB  . CYS B 1 96  ? 8.162   -3.218  -55.945 1.00 47.23  ? 96   CYS B CB  1 
ATOM   4955 S SG  . CYS B 1 96  ? 9.787   -2.629  -55.355 1.00 49.66  ? 96   CYS B SG  1 
ATOM   4956 N N   . LEU B 1 97  ? 8.256   -0.350  -58.058 1.00 45.80  ? 97   LEU B N   1 
ATOM   4957 C CA  . LEU B 1 97  ? 8.327   1.092   -57.858 1.00 45.35  ? 97   LEU B CA  1 
ATOM   4958 C C   . LEU B 1 97  ? 7.105   1.808   -58.441 1.00 45.40  ? 97   LEU B C   1 
ATOM   4959 O O   . LEU B 1 97  ? 7.139   2.377   -59.542 1.00 44.92  ? 97   LEU B O   1 
ATOM   4960 C CB  . LEU B 1 97  ? 9.646   1.641   -58.389 1.00 45.59  ? 97   LEU B CB  1 
ATOM   4961 C CG  . LEU B 1 97  ? 10.890  1.209   -57.603 1.00 45.49  ? 97   LEU B CG  1 
ATOM   4962 C CD1 . LEU B 1 97  ? 12.101  1.981   -58.095 1.00 45.58  ? 97   LEU B CD1 1 
ATOM   4963 C CD2 . LEU B 1 97  ? 10.715  1.382   -56.073 1.00 45.41  ? 97   LEU B CD2 1 
ATOM   4964 N N   . TYR B 1 98  ? 6.032   1.770   -57.653 1.00 45.62  ? 98   TYR B N   1 
ATOM   4965 C CA  . TYR B 1 98  ? 4.727   2.344   -58.013 1.00 46.08  ? 98   TYR B CA  1 
ATOM   4966 C C   . TYR B 1 98  ? 4.186   3.165   -56.848 1.00 45.94  ? 98   TYR B C   1 
ATOM   4967 O O   . TYR B 1 98  ? 4.553   2.924   -55.696 1.00 45.85  ? 98   TYR B O   1 
ATOM   4968 C CB  . TYR B 1 98  ? 3.723   1.228   -58.372 1.00 46.93  ? 98   TYR B CB  1 
ATOM   4969 C CG  . TYR B 1 98  ? 4.200   0.316   -59.497 1.00 47.76  ? 98   TYR B CG  1 
ATOM   4970 C CD1 . TYR B 1 98  ? 3.905   0.592   -60.824 1.00 49.04  ? 98   TYR B CD1 1 
ATOM   4971 C CD2 . TYR B 1 98  ? 4.969   -0.796  -59.226 1.00 48.04  ? 98   TYR B CD2 1 
ATOM   4972 C CE1 . TYR B 1 98  ? 4.357   -0.235  -61.853 1.00 49.71  ? 98   TYR B CE1 1 
ATOM   4973 C CE2 . TYR B 1 98  ? 5.435   -1.632  -60.248 1.00 49.23  ? 98   TYR B CE2 1 
ATOM   4974 C CZ  . TYR B 1 98  ? 5.132   -1.342  -61.555 1.00 50.03  ? 98   TYR B CZ  1 
ATOM   4975 O OH  . TYR B 1 98  ? 5.599   -2.158  -62.564 1.00 50.32  ? 98   TYR B OH  1 
ATOM   4976 N N   . LEU B 1 99  ? 3.303   4.123   -57.148 1.00 46.61  ? 99   LEU B N   1 
ATOM   4977 C CA  . LEU B 1 99  ? 2.653   4.929   -56.126 1.00 46.24  ? 99   LEU B CA  1 
ATOM   4978 C C   . LEU B 1 99  ? 1.126   4.997   -56.309 1.00 47.19  ? 99   LEU B C   1 
ATOM   4979 O O   . LEU B 1 99  ? 0.600   4.651   -57.365 1.00 47.73  ? 99   LEU B O   1 
ATOM   4980 C CB  . LEU B 1 99  ? 3.263   6.335   -56.067 1.00 46.16  ? 99   LEU B CB  1 
ATOM   4981 C CG  . LEU B 1 99  ? 3.195   7.285   -57.280 1.00 46.98  ? 99   LEU B CG  1 
ATOM   4982 C CD1 . LEU B 1 99  ? 1.827   7.904   -57.494 1.00 44.95  ? 99   LEU B CD1 1 
ATOM   4983 C CD2 . LEU B 1 99  ? 4.251   8.401   -57.119 1.00 46.40  ? 99   LEU B CD2 1 
ATOM   4984 N N   . ASN B 1 100 ? 0.443   5.443   -55.250 1.00 46.79  ? 100  ASN B N   1 
ATOM   4985 C CA  . ASN B 1 100 ? -1.013  5.453   -55.160 1.00 47.52  ? 100  ASN B CA  1 
ATOM   4986 C C   . ASN B 1 100 ? -1.497  6.848   -54.772 1.00 47.60  ? 100  ASN B C   1 
ATOM   4987 O O   . ASN B 1 100 ? -0.929  7.469   -53.895 1.00 47.04  ? 100  ASN B O   1 
ATOM   4988 C CB  . ASN B 1 100 ? -1.470  4.436   -54.115 1.00 47.18  ? 100  ASN B CB  1 
ATOM   4989 C CG  . ASN B 1 100 ? -0.777  3.095   -54.274 1.00 47.86  ? 100  ASN B CG  1 
ATOM   4990 O OD1 . ASN B 1 100 ? -0.929  2.430   -55.291 1.00 50.59  ? 100  ASN B OD1 1 
ATOM   4991 N ND2 . ASN B 1 100 ? 0.009   2.706   -53.281 1.00 48.38  ? 100  ASN B ND2 1 
ATOM   4992 N N   . VAL B 1 101 ? -2.533  7.336   -55.446 1.00 48.99  ? 101  VAL B N   1 
ATOM   4993 C CA  . VAL B 1 101 ? -3.145  8.637   -55.152 1.00 49.12  ? 101  VAL B CA  1 
ATOM   4994 C C   . VAL B 1 101 ? -4.646  8.454   -54.881 1.00 50.35  ? 101  VAL B C   1 
ATOM   4995 O O   . VAL B 1 101 ? -5.326  7.819   -55.667 1.00 51.26  ? 101  VAL B O   1 
ATOM   4996 C CB  . VAL B 1 101 ? -2.993  9.568   -56.367 1.00 49.62  ? 101  VAL B CB  1 
ATOM   4997 C CG1 . VAL B 1 101 ? -3.703  10.902  -56.129 1.00 49.13  ? 101  VAL B CG1 1 
ATOM   4998 C CG2 . VAL B 1 101 ? -1.509  9.748   -56.738 1.00 47.42  ? 101  VAL B CG2 1 
ATOM   4999 N N   . TRP B 1 102 ? -5.160  8.983   -53.774 1.00 50.97  ? 102  TRP B N   1 
ATOM   5000 C CA  . TRP B 1 102 ? -6.618  9.091   -53.572 1.00 52.46  ? 102  TRP B CA  1 
ATOM   5001 C C   . TRP B 1 102 ? -7.017  10.555  -53.597 1.00 54.06  ? 102  TRP B C   1 
ATOM   5002 O O   . TRP B 1 102 ? -6.322  11.390  -53.015 1.00 53.02  ? 102  TRP B O   1 
ATOM   5003 C CB  . TRP B 1 102 ? -7.043  8.553   -52.220 1.00 51.88  ? 102  TRP B CB  1 
ATOM   5004 C CG  . TRP B 1 102 ? -6.967  7.095   -52.033 1.00 51.31  ? 102  TRP B CG  1 
ATOM   5005 C CD1 . TRP B 1 102 ? -7.997  6.195   -52.135 1.00 52.14  ? 102  TRP B CD1 1 
ATOM   5006 C CD2 . TRP B 1 102 ? -5.821  6.354   -51.646 1.00 49.20  ? 102  TRP B CD2 1 
ATOM   5007 N NE1 . TRP B 1 102 ? -7.544  4.931   -51.845 1.00 51.93  ? 102  TRP B NE1 1 
ATOM   5008 C CE2 . TRP B 1 102 ? -6.209  5.007   -51.541 1.00 49.51  ? 102  TRP B CE2 1 
ATOM   5009 C CE3 . TRP B 1 102 ? -4.487  6.696   -51.387 1.00 49.68  ? 102  TRP B CE3 1 
ATOM   5010 C CZ2 . TRP B 1 102 ? -5.323  4.011   -51.194 1.00 49.10  ? 102  TRP B CZ2 1 
ATOM   5011 C CZ3 . TRP B 1 102 ? -3.612  5.709   -51.041 1.00 48.20  ? 102  TRP B CZ3 1 
ATOM   5012 C CH2 . TRP B 1 102 ? -4.030  4.378   -50.942 1.00 49.31  ? 102  TRP B CH2 1 
ATOM   5013 N N   . THR B 1 103 ? -8.144  10.871  -54.237 1.00 56.85  ? 103  THR B N   1 
ATOM   5014 C CA  . THR B 1 103 ? -8.653  12.250  -54.251 1.00 58.82  ? 103  THR B CA  1 
ATOM   5015 C C   . THR B 1 103 ? -10.150 12.252  -54.052 1.00 60.85  ? 103  THR B C   1 
ATOM   5016 O O   . THR B 1 103 ? -10.793 11.233  -54.275 1.00 61.54  ? 103  THR B O   1 
ATOM   5017 C CB  . THR B 1 103 ? -8.344  12.988  -55.574 1.00 59.43  ? 103  THR B CB  1 
ATOM   5018 O OG1 . THR B 1 103 ? -9.001  12.329  -56.671 1.00 63.53  ? 103  THR B OG1 1 
ATOM   5019 C CG2 . THR B 1 103 ? -6.867  13.013  -55.840 1.00 58.83  ? 103  THR B CG2 1 
ATOM   5020 N N   . PRO B 1 104 ? -10.715 13.394  -53.611 1.00 62.49  ? 104  PRO B N   1 
ATOM   5021 C CA  . PRO B 1 104 ? -12.169 13.496  -53.525 1.00 64.77  ? 104  PRO B CA  1 
ATOM   5022 C C   . PRO B 1 104 ? -12.833 13.279  -54.874 1.00 66.77  ? 104  PRO B C   1 
ATOM   5023 O O   . PRO B 1 104 ? -12.260 13.622  -55.896 1.00 66.93  ? 104  PRO B O   1 
ATOM   5024 C CB  . PRO B 1 104 ? -12.393 14.935  -53.049 1.00 65.29  ? 104  PRO B CB  1 
ATOM   5025 C CG  . PRO B 1 104 ? -11.133 15.325  -52.392 1.00 63.60  ? 104  PRO B CG  1 
ATOM   5026 C CD  . PRO B 1 104 ? -10.048 14.619  -53.133 1.00 61.64  ? 104  PRO B CD  1 
ATOM   5027 N N   . TYR B 1 105 ? -14.020 12.686  -54.858 1.00 69.48  ? 105  TYR B N   1 
ATOM   5028 C CA  . TYR B 1 105 ? -14.865 12.549  -56.036 1.00 71.88  ? 105  TYR B CA  1 
ATOM   5029 C C   . TYR B 1 105 ? -16.054 13.460  -55.808 1.00 75.15  ? 105  TYR B C   1 
ATOM   5030 O O   . TYR B 1 105 ? -16.779 13.272  -54.828 1.00 76.76  ? 105  TYR B O   1 
ATOM   5031 C CB  . TYR B 1 105 ? -15.345 11.107  -56.161 1.00 71.95  ? 105  TYR B CB  1 
ATOM   5032 C CG  . TYR B 1 105 ? -16.087 10.796  -57.441 1.00 73.18  ? 105  TYR B CG  1 
ATOM   5033 C CD1 . TYR B 1 105 ? -15.504 10.012  -58.427 1.00 72.07  ? 105  TYR B CD1 1 
ATOM   5034 C CD2 . TYR B 1 105 ? -17.371 11.285  -57.669 1.00 75.35  ? 105  TYR B CD2 1 
ATOM   5035 C CE1 . TYR B 1 105 ? -16.162 9.725   -59.600 1.00 73.76  ? 105  TYR B CE1 1 
ATOM   5036 C CE2 . TYR B 1 105 ? -18.044 10.999  -58.847 1.00 76.99  ? 105  TYR B CE2 1 
ATOM   5037 C CZ  . TYR B 1 105 ? -17.433 10.214  -59.807 1.00 75.99  ? 105  TYR B CZ  1 
ATOM   5038 O OH  . TYR B 1 105 ? -18.084 9.917   -60.975 1.00 77.19  ? 105  TYR B OH  1 
ATOM   5039 N N   . PRO B 1 106 ? -16.275 14.460  -56.686 1.00 77.48  ? 106  PRO B N   1 
ATOM   5040 C CA  . PRO B 1 106 ? -15.492 14.847  -57.857 1.00 77.83  ? 106  PRO B CA  1 
ATOM   5041 C C   . PRO B 1 106 ? -14.149 15.472  -57.489 1.00 76.81  ? 106  PRO B C   1 
ATOM   5042 O O   . PRO B 1 106 ? -13.945 15.875  -56.345 1.00 76.34  ? 106  PRO B O   1 
ATOM   5043 C CB  . PRO B 1 106 ? -16.390 15.877  -58.554 1.00 79.79  ? 106  PRO B CB  1 
ATOM   5044 C CG  . PRO B 1 106 ? -17.222 16.446  -57.467 1.00 80.59  ? 106  PRO B CG  1 
ATOM   5045 C CD  . PRO B 1 106 ? -17.455 15.328  -56.505 1.00 79.38  ? 106  PRO B CD  1 
ATOM   5046 N N   . ARG B 1 107 ? -13.257 15.546  -58.474 1.00 77.09  ? 107  ARG B N   1 
ATOM   5047 C CA  . ARG B 1 107 ? -11.919 16.121  -58.316 1.00 76.40  ? 107  ARG B CA  1 
ATOM   5048 C C   . ARG B 1 107 ? -12.024 17.500  -57.674 1.00 76.79  ? 107  ARG B C   1 
ATOM   5049 O O   . ARG B 1 107 ? -12.869 18.285  -58.071 1.00 78.75  ? 107  ARG B O   1 
ATOM   5050 C CB  . ARG B 1 107 ? -11.247 16.230  -59.694 1.00 76.79  ? 107  ARG B CB  1 
ATOM   5051 C CG  . ARG B 1 107 ? -9.800  16.713  -59.675 1.00 77.18  ? 107  ARG B CG  1 
ATOM   5052 C CD  . ARG B 1 107 ? -9.054  16.392  -60.976 1.00 79.03  ? 107  ARG B CD  1 
ATOM   5053 N NE  . ARG B 1 107 ? -9.115  14.960  -61.307 1.00 79.57  ? 107  ARG B NE  1 
ATOM   5054 C CZ  . ARG B 1 107 ? -9.432  14.458  -62.503 1.00 81.27  ? 107  ARG B CZ  1 
ATOM   5055 N NH1 . ARG B 1 107 ? -9.482  13.145  -62.669 1.00 81.38  ? 107  ARG B NH1 1 
ATOM   5056 N NH2 . ARG B 1 107 ? -9.682  15.243  -63.544 1.00 83.28  ? 107  ARG B NH2 1 
ATOM   5057 N N   . PRO B 1 108 ? -11.182 17.796  -56.669 1.00 75.59  ? 108  PRO B N   1 
ATOM   5058 C CA  . PRO B 1 108 ? -11.329 19.078  -55.981 1.00 76.20  ? 108  PRO B CA  1 
ATOM   5059 C C   . PRO B 1 108 ? -11.233 20.291  -56.912 1.00 77.57  ? 108  PRO B C   1 
ATOM   5060 O O   . PRO B 1 108 ? -10.340 20.357  -57.764 1.00 76.97  ? 108  PRO B O   1 
ATOM   5061 C CB  . PRO B 1 108 ? -10.195 19.084  -54.949 1.00 74.61  ? 108  PRO B CB  1 
ATOM   5062 C CG  . PRO B 1 108 ? -9.372  17.882  -55.195 1.00 73.08  ? 108  PRO B CG  1 
ATOM   5063 C CD  . PRO B 1 108 ? -10.104 16.966  -56.109 1.00 73.65  ? 108  PRO B CD  1 
ATOM   5064 N N   . ALA B 1 109 ? -12.158 21.235  -56.722 1.00 79.01  ? 109  ALA B N   1 
ATOM   5065 C CA  . ALA B 1 109 ? -12.301 22.400  -57.593 1.00 80.75  ? 109  ALA B CA  1 
ATOM   5066 C C   . ALA B 1 109 ? -11.113 23.358  -57.504 1.00 79.97  ? 109  ALA B C   1 
ATOM   5067 O O   . ALA B 1 109 ? -10.704 23.931  -58.514 1.00 81.10  ? 109  ALA B O   1 
ATOM   5068 C CB  . ALA B 1 109 ? -13.610 23.148  -57.271 1.00 82.63  ? 109  ALA B CB  1 
ATOM   5069 N N   . SER B 1 110 ? -10.582 23.544  -56.296 1.00 78.36  ? 110  SER B N   1 
ATOM   5070 C CA  . SER B 1 110 ? -9.384  24.357  -56.087 1.00 76.96  ? 110  SER B CA  1 
ATOM   5071 C C   . SER B 1 110 ? -8.300  23.526  -55.400 1.00 73.78  ? 110  SER B C   1 
ATOM   5072 O O   . SER B 1 110 ? -8.623  22.576  -54.683 1.00 73.18  ? 110  SER B O   1 
ATOM   5073 C CB  . SER B 1 110 ? -9.726  25.583  -55.247 1.00 78.23  ? 110  SER B CB  1 
ATOM   5074 O OG  . SER B 1 110 ? -10.475 25.211  -54.111 1.00 78.81  ? 110  SER B OG  1 
ATOM   5075 N N   . PRO B 1 111 ? -7.014  23.880  -55.614 1.00 71.53  ? 111  PRO B N   1 
ATOM   5076 C CA  . PRO B 1 111 ? -5.848  23.127  -55.114 1.00 68.65  ? 111  PRO B CA  1 
ATOM   5077 C C   . PRO B 1 111 ? -5.906  22.754  -53.625 1.00 66.41  ? 111  PRO B C   1 
ATOM   5078 O O   . PRO B 1 111 ? -6.002  23.631  -52.779 1.00 66.36  ? 111  PRO B O   1 
ATOM   5079 C CB  . PRO B 1 111 ? -4.680  24.084  -55.361 1.00 68.71  ? 111  PRO B CB  1 
ATOM   5080 C CG  . PRO B 1 111 ? -5.117  24.960  -56.448 1.00 70.99  ? 111  PRO B CG  1 
ATOM   5081 C CD  . PRO B 1 111 ? -6.602  25.077  -56.371 1.00 72.54  ? 111  PRO B CD  1 
ATOM   5082 N N   . THR B 1 112 ? -5.822  21.459  -53.329 1.00 64.24  ? 112  THR B N   1 
ATOM   5083 C CA  . THR B 1 112 ? -5.969  20.937  -51.969 1.00 62.67  ? 112  THR B CA  1 
ATOM   5084 C C   . THR B 1 112 ? -4.611  20.525  -51.424 1.00 59.96  ? 112  THR B C   1 
ATOM   5085 O O   . THR B 1 112 ? -3.769  20.066  -52.182 1.00 59.62  ? 112  THR B O   1 
ATOM   5086 C CB  . THR B 1 112 ? -6.858  19.674  -51.941 1.00 62.58  ? 112  THR B CB  1 
ATOM   5087 O OG1 . THR B 1 112 ? -7.874  19.777  -52.939 1.00 66.18  ? 112  THR B OG1 1 
ATOM   5088 C CG2 . THR B 1 112 ? -7.514  19.511  -50.596 1.00 62.46  ? 112  THR B CG2 1 
ATOM   5089 N N   . PRO B 1 113 ? -4.391  20.678  -50.106 1.00 58.14  ? 113  PRO B N   1 
ATOM   5090 C CA  . PRO B 1 113 ? -3.167  20.162  -49.494 1.00 55.71  ? 113  PRO B CA  1 
ATOM   5091 C C   . PRO B 1 113 ? -2.948  18.692  -49.786 1.00 53.58  ? 113  PRO B C   1 
ATOM   5092 O O   . PRO B 1 113 ? -3.911  17.928  -49.803 1.00 53.39  ? 113  PRO B O   1 
ATOM   5093 C CB  . PRO B 1 113 ? -3.413  20.368  -48.005 1.00 55.52  ? 113  PRO B CB  1 
ATOM   5094 C CG  . PRO B 1 113 ? -4.331  21.556  -47.962 1.00 58.00  ? 113  PRO B CG  1 
ATOM   5095 C CD  . PRO B 1 113 ? -5.233  21.391  -49.127 1.00 58.91  ? 113  PRO B CD  1 
ATOM   5096 N N   . VAL B 1 114 ? -1.691  18.318  -50.022 1.00 51.62  ? 114  VAL B N   1 
ATOM   5097 C CA  . VAL B 1 114 ? -1.310  16.932  -50.279 1.00 49.81  ? 114  VAL B CA  1 
ATOM   5098 C C   . VAL B 1 114 ? -0.604  16.340  -49.071 1.00 48.88  ? 114  VAL B C   1 
ATOM   5099 O O   . VAL B 1 114 ? 0.295   16.948  -48.509 1.00 48.33  ? 114  VAL B O   1 
ATOM   5100 C CB  . VAL B 1 114 ? -0.377  16.827  -51.511 1.00 49.87  ? 114  VAL B CB  1 
ATOM   5101 C CG1 . VAL B 1 114 ? -0.057  15.355  -51.853 1.00 47.02  ? 114  VAL B CG1 1 
ATOM   5102 C CG2 . VAL B 1 114 ? -1.010  17.549  -52.711 1.00 50.01  ? 114  VAL B CG2 1 
ATOM   5103 N N   . LEU B 1 115 ? -1.017  15.137  -48.682 1.00 48.95  ? 115  LEU B N   1 
ATOM   5104 C CA  . LEU B 1 115 ? -0.338  14.349  -47.666 1.00 48.11  ? 115  LEU B CA  1 
ATOM   5105 C C   . LEU B 1 115 ? 0.334   13.144  -48.347 1.00 47.77  ? 115  LEU B C   1 
ATOM   5106 O O   . LEU B 1 115 ? -0.330  12.389  -49.071 1.00 47.97  ? 115  LEU B O   1 
ATOM   5107 C CB  . LEU B 1 115 ? -1.340  13.856  -46.622 1.00 48.65  ? 115  LEU B CB  1 
ATOM   5108 C CG  . LEU B 1 115 ? -1.894  14.756  -45.503 1.00 50.05  ? 115  LEU B CG  1 
ATOM   5109 C CD1 . LEU B 1 115 ? -2.991  14.032  -44.790 1.00 51.31  ? 115  LEU B CD1 1 
ATOM   5110 C CD2 . LEU B 1 115 ? -0.839  15.058  -44.489 1.00 51.60  ? 115  LEU B CD2 1 
ATOM   5111 N N   . ILE B 1 116 ? 1.640   12.973  -48.126 1.00 46.76  ? 116  ILE B N   1 
ATOM   5112 C CA  . ILE B 1 116 ? 2.369   11.853  -48.689 1.00 45.89  ? 116  ILE B CA  1 
ATOM   5113 C C   . ILE B 1 116 ? 2.786   10.923  -47.568 1.00 45.39  ? 116  ILE B C   1 
ATOM   5114 O O   . ILE B 1 116 ? 3.591   11.316  -46.708 1.00 44.79  ? 116  ILE B O   1 
ATOM   5115 C CB  . ILE B 1 116 ? 3.623   12.295  -49.449 1.00 45.96  ? 116  ILE B CB  1 
ATOM   5116 C CG1 . ILE B 1 116 ? 3.274   13.345  -50.501 1.00 46.57  ? 116  ILE B CG1 1 
ATOM   5117 C CG2 . ILE B 1 116 ? 4.303   11.074  -50.124 1.00 45.11  ? 116  ILE B CG2 1 
ATOM   5118 C CD1 . ILE B 1 116 ? 4.438   13.705  -51.415 1.00 46.29  ? 116  ILE B CD1 1 
ATOM   5119 N N   . TRP B 1 117 ? 2.222   9.709   -47.566 1.00 44.97  ? 117  TRP B N   1 
ATOM   5120 C CA  . TRP B 1 117 ? 2.587   8.652   -46.610 1.00 44.48  ? 117  TRP B CA  1 
ATOM   5121 C C   . TRP B 1 117 ? 3.804   7.835   -47.041 1.00 44.22  ? 117  TRP B C   1 
ATOM   5122 O O   . TRP B 1 117 ? 3.873   7.355   -48.169 1.00 43.93  ? 117  TRP B O   1 
ATOM   5123 C CB  . TRP B 1 117 ? 1.417   7.691   -46.424 1.00 45.33  ? 117  TRP B CB  1 
ATOM   5124 C CG  . TRP B 1 117 ? 1.684   6.556   -45.495 1.00 44.73  ? 117  TRP B CG  1 
ATOM   5125 C CD1 . TRP B 1 117 ? 1.850   5.250   -45.827 1.00 45.92  ? 117  TRP B CD1 1 
ATOM   5126 C CD2 . TRP B 1 117 ? 1.816   6.633   -44.076 1.00 45.04  ? 117  TRP B CD2 1 
ATOM   5127 N NE1 . TRP B 1 117 ? 2.073   4.494   -44.696 1.00 45.92  ? 117  TRP B NE1 1 
ATOM   5128 C CE2 . TRP B 1 117 ? 2.059   5.326   -43.606 1.00 45.89  ? 117  TRP B CE2 1 
ATOM   5129 C CE3 . TRP B 1 117 ? 1.756   7.687   -43.150 1.00 45.31  ? 117  TRP B CE3 1 
ATOM   5130 C CZ2 . TRP B 1 117 ? 2.236   5.043   -42.252 1.00 44.60  ? 117  TRP B CZ2 1 
ATOM   5131 C CZ3 . TRP B 1 117 ? 1.923   7.403   -41.813 1.00 44.76  ? 117  TRP B CZ3 1 
ATOM   5132 C CH2 . TRP B 1 117 ? 2.164   6.088   -41.377 1.00 44.88  ? 117  TRP B CH2 1 
ATOM   5133 N N   . ILE B 1 118 ? 4.739   7.659   -46.106 1.00 44.34  ? 118  ILE B N   1 
ATOM   5134 C CA  . ILE B 1 118 ? 5.908   6.792   -46.252 1.00 43.95  ? 118  ILE B CA  1 
ATOM   5135 C C   . ILE B 1 118 ? 5.822   5.690   -45.190 1.00 44.18  ? 118  ILE B C   1 
ATOM   5136 O O   . ILE B 1 118 ? 5.953   5.970   -43.993 1.00 44.21  ? 118  ILE B O   1 
ATOM   5137 C CB  . ILE B 1 118 ? 7.222   7.581   -46.034 1.00 43.38  ? 118  ILE B CB  1 
ATOM   5138 C CG1 . ILE B 1 118 ? 7.300   8.784   -46.974 1.00 43.51  ? 118  ILE B CG1 1 
ATOM   5139 C CG2 . ILE B 1 118 ? 8.412   6.687   -46.275 1.00 43.74  ? 118  ILE B CG2 1 
ATOM   5140 C CD1 . ILE B 1 118 ? 8.558   9.668   -46.760 1.00 41.03  ? 118  ILE B CD1 1 
ATOM   5141 N N   . TYR B 1 119 ? 5.589   4.445   -45.603 1.00 44.51  ? 119  TYR B N   1 
ATOM   5142 C CA  . TYR B 1 119 ? 5.475   3.327   -44.646 1.00 44.48  ? 119  TYR B CA  1 
ATOM   5143 C C   . TYR B 1 119 ? 6.743   2.978   -43.881 1.00 45.26  ? 119  TYR B C   1 
ATOM   5144 O O   . TYR B 1 119 ? 7.858   3.279   -44.323 1.00 45.56  ? 119  TYR B O   1 
ATOM   5145 C CB  . TYR B 1 119 ? 4.955   2.046   -45.321 1.00 45.10  ? 119  TYR B CB  1 
ATOM   5146 C CG  . TYR B 1 119 ? 5.783   1.483   -46.468 1.00 44.54  ? 119  TYR B CG  1 
ATOM   5147 C CD1 . TYR B 1 119 ? 6.967   0.814   -46.239 1.00 44.56  ? 119  TYR B CD1 1 
ATOM   5148 C CD2 . TYR B 1 119 ? 5.350   1.590   -47.771 1.00 44.99  ? 119  TYR B CD2 1 
ATOM   5149 C CE1 . TYR B 1 119 ? 7.711   0.281   -47.291 1.00 46.08  ? 119  TYR B CE1 1 
ATOM   5150 C CE2 . TYR B 1 119 ? 6.094   1.058   -48.835 1.00 44.87  ? 119  TYR B CE2 1 
ATOM   5151 C CZ  . TYR B 1 119 ? 7.266   0.404   -48.589 1.00 45.21  ? 119  TYR B CZ  1 
ATOM   5152 O OH  . TYR B 1 119 ? 8.009   -0.127  -49.636 1.00 45.16  ? 119  TYR B OH  1 
ATOM   5153 N N   . GLY B 1 120 ? 6.544   2.296   -42.747 1.00 45.70  ? 120  GLY B N   1 
ATOM   5154 C CA  . GLY B 1 120 ? 7.622   1.715   -41.939 1.00 45.46  ? 120  GLY B CA  1 
ATOM   5155 C C   . GLY B 1 120 ? 7.772   0.217   -42.141 1.00 45.84  ? 120  GLY B C   1 
ATOM   5156 O O   . GLY B 1 120 ? 7.137   -0.363  -43.021 1.00 46.59  ? 120  GLY B O   1 
ATOM   5157 N N   . GLY B 1 121 ? 8.609   -0.398  -41.307 1.00 45.92  ? 121  GLY B N   1 
ATOM   5158 C CA  . GLY B 1 121 ? 9.040   -1.806  -41.457 1.00 46.58  ? 121  GLY B CA  1 
ATOM   5159 C C   . GLY B 1 121 ? 10.543  -2.045  -41.339 1.00 46.92  ? 121  GLY B C   1 
ATOM   5160 O O   . GLY B 1 121 ? 11.099  -2.960  -41.968 1.00 48.00  ? 121  GLY B O   1 
ATOM   5161 N N   . GLY B 1 122 ? 11.204  -1.238  -40.518 1.00 47.10  ? 122  GLY B N   1 
ATOM   5162 C CA  . GLY B 1 122 ? 12.628  -1.352  -40.249 1.00 47.25  ? 122  GLY B CA  1 
ATOM   5163 C C   . GLY B 1 122 ? 13.534  -1.269  -41.457 1.00 47.17  ? 122  GLY B C   1 
ATOM   5164 O O   . GLY B 1 122 ? 14.647  -1.778  -41.416 1.00 48.43  ? 122  GLY B O   1 
ATOM   5165 N N   . PHE B 1 123 ? 13.068  -0.612  -42.519 1.00 46.29  ? 123  PHE B N   1 
ATOM   5166 C CA  . PHE B 1 123 ? 13.744  -0.593  -43.822 1.00 46.22  ? 123  PHE B CA  1 
ATOM   5167 C C   . PHE B 1 123 ? 13.950  -1.990  -44.440 1.00 46.62  ? 123  PHE B C   1 
ATOM   5168 O O   . PHE B 1 123 ? 14.627  -2.098  -45.452 1.00 46.73  ? 123  PHE B O   1 
ATOM   5169 C CB  . PHE B 1 123 ? 15.099  0.153   -43.770 1.00 46.31  ? 123  PHE B CB  1 
ATOM   5170 C CG  . PHE B 1 123 ? 14.992  1.608   -43.380 1.00 46.28  ? 123  PHE B CG  1 
ATOM   5171 C CD1 . PHE B 1 123 ? 14.527  2.557   -44.292 1.00 45.86  ? 123  PHE B CD1 1 
ATOM   5172 C CD2 . PHE B 1 123 ? 15.385  2.038   -42.115 1.00 46.46  ? 123  PHE B CD2 1 
ATOM   5173 C CE1 . PHE B 1 123 ? 14.415  3.893   -43.941 1.00 44.28  ? 123  PHE B CE1 1 
ATOM   5174 C CE2 . PHE B 1 123 ? 15.290  3.382   -41.758 1.00 46.36  ? 123  PHE B CE2 1 
ATOM   5175 C CZ  . PHE B 1 123 ? 14.788  4.309   -42.684 1.00 45.80  ? 123  PHE B CZ  1 
ATOM   5176 N N   . TYR B 1 124 ? 13.374  -3.045  -43.849 1.00 46.84  ? 124  TYR B N   1 
ATOM   5177 C CA  . TYR B 1 124 ? 13.455  -4.402  -44.406 1.00 47.46  ? 124  TYR B CA  1 
ATOM   5178 C C   . TYR B 1 124 ? 12.084  -4.910  -44.919 1.00 47.21  ? 124  TYR B C   1 
ATOM   5179 O O   . TYR B 1 124 ? 11.998  -6.006  -45.494 1.00 46.96  ? 124  TYR B O   1 
ATOM   5180 C CB  . TYR B 1 124 ? 14.055  -5.396  -43.368 1.00 48.88  ? 124  TYR B CB  1 
ATOM   5181 C CG  . TYR B 1 124 ? 13.091  -5.792  -42.272 1.00 49.34  ? 124  TYR B CG  1 
ATOM   5182 C CD1 . TYR B 1 124 ? 12.162  -6.803  -42.473 1.00 50.90  ? 124  TYR B CD1 1 
ATOM   5183 C CD2 . TYR B 1 124 ? 13.085  -5.136  -41.053 1.00 49.57  ? 124  TYR B CD2 1 
ATOM   5184 C CE1 . TYR B 1 124 ? 11.252  -7.159  -41.491 1.00 50.12  ? 124  TYR B CE1 1 
ATOM   5185 C CE2 . TYR B 1 124 ? 12.168  -5.474  -40.060 1.00 50.45  ? 124  TYR B CE2 1 
ATOM   5186 C CZ  . TYR B 1 124 ? 11.252  -6.500  -40.290 1.00 50.13  ? 124  TYR B CZ  1 
ATOM   5187 O OH  . TYR B 1 124 ? 10.336  -6.863  -39.315 1.00 49.68  ? 124  TYR B OH  1 
ATOM   5188 N N   . SER B 1 125 ? 11.024  -4.109  -44.738 1.00 45.97  ? 125  SER B N   1 
ATOM   5189 C CA  . SER B 1 125 ? 9.674   -4.555  -45.024 1.00 45.51  ? 125  SER B CA  1 
ATOM   5190 C C   . SER B 1 125 ? 8.702   -3.403  -45.198 1.00 44.78  ? 125  SER B C   1 
ATOM   5191 O O   . SER B 1 125 ? 9.042   -2.248  -44.970 1.00 43.89  ? 125  SER B O   1 
ATOM   5192 C CB  . SER B 1 125 ? 9.173   -5.442  -43.886 1.00 46.26  ? 125  SER B CB  1 
ATOM   5193 O OG  . SER B 1 125 ? 9.213   -4.739  -42.666 1.00 45.11  ? 125  SER B OG  1 
ATOM   5194 N N   . GLY B 1 126 ? 7.484   -3.741  -45.600 1.00 44.72  ? 126  GLY B N   1 
ATOM   5195 C CA  . GLY B 1 126 ? 6.398   -2.781  -45.701 1.00 44.63  ? 126  GLY B CA  1 
ATOM   5196 C C   . GLY B 1 126 ? 5.839   -2.708  -47.093 1.00 45.06  ? 126  GLY B C   1 
ATOM   5197 O O   . GLY B 1 126 ? 6.457   -3.201  -48.049 1.00 45.18  ? 126  GLY B O   1 
ATOM   5198 N N   . ALA B 1 127 ? 4.667   -2.080  -47.204 1.00 45.38  ? 127  ALA B N   1 
ATOM   5199 C CA  . ALA B 1 127 ? 4.030   -1.828  -48.489 1.00 46.12  ? 127  ALA B CA  1 
ATOM   5200 C C   . ALA B 1 127 ? 2.944   -0.774  -48.348 1.00 46.67  ? 127  ALA B C   1 
ATOM   5201 O O   . ALA B 1 127 ? 2.304   -0.717  -47.314 1.00 47.06  ? 127  ALA B O   1 
ATOM   5202 C CB  . ALA B 1 127 ? 3.439   -3.112  -49.018 1.00 47.00  ? 127  ALA B CB  1 
ATOM   5203 N N   . ALA B 1 128 ? 2.717   0.038   -49.384 1.00 47.22  ? 128  ALA B N   1 
ATOM   5204 C CA  . ALA B 1 128 ? 1.632   1.049   -49.372 1.00 47.70  ? 128  ALA B CA  1 
ATOM   5205 C C   . ALA B 1 128 ? 0.232   0.451   -49.547 1.00 49.16  ? 128  ALA B C   1 
ATOM   5206 O O   . ALA B 1 128 ? -0.765  1.160   -49.433 1.00 49.28  ? 128  ALA B O   1 
ATOM   5207 C CB  . ALA B 1 128 ? 1.884   2.132   -50.429 1.00 47.34  ? 128  ALA B CB  1 
ATOM   5208 N N   . SER B 1 129 ? 0.164   -0.853  -49.815 1.00 50.51  ? 129  SER B N   1 
ATOM   5209 C CA  . SER B 1 129 ? -1.090  -1.536  -50.108 1.00 52.00  ? 129  SER B CA  1 
ATOM   5210 C C   . SER B 1 129 ? -1.757  -2.149  -48.873 1.00 53.08  ? 129  SER B C   1 
ATOM   5211 O O   . SER B 1 129 ? -2.845  -2.696  -48.974 1.00 54.82  ? 129  SER B O   1 
ATOM   5212 C CB  . SER B 1 129 ? -0.870  -2.618  -51.179 1.00 52.57  ? 129  SER B CB  1 
ATOM   5213 O OG  . SER B 1 129 ? 0.192   -3.490  -50.849 1.00 52.42  ? 129  SER B OG  1 
ATOM   5214 N N   . LEU B 1 130 ? -1.122  -2.049  -47.711 1.00 53.47  ? 130  LEU B N   1 
ATOM   5215 C CA  . LEU B 1 130 ? -1.708  -2.592  -46.482 1.00 53.96  ? 130  LEU B CA  1 
ATOM   5216 C C   . LEU B 1 130 ? -3.003  -1.850  -46.164 1.00 54.52  ? 130  LEU B C   1 
ATOM   5217 O O   . LEU B 1 130 ? -3.134  -0.666  -46.470 1.00 53.63  ? 130  LEU B O   1 
ATOM   5218 C CB  . LEU B 1 130 ? -0.725  -2.490  -45.323 1.00 53.35  ? 130  LEU B CB  1 
ATOM   5219 C CG  . LEU B 1 130 ? 0.639   -3.174  -45.513 1.00 53.44  ? 130  LEU B CG  1 
ATOM   5220 C CD1 . LEU B 1 130 ? 1.470   -3.037  -44.252 1.00 51.37  ? 130  LEU B CD1 1 
ATOM   5221 C CD2 . LEU B 1 130 ? 0.487   -4.635  -45.921 1.00 54.41  ? 130  LEU B CD2 1 
ATOM   5222 N N   . ASP B 1 131 ? -3.968  -2.573  -45.598 1.00 56.05  ? 131  ASP B N   1 
ATOM   5223 C CA  . ASP B 1 131 ? -5.286  -2.026  -45.291 1.00 56.94  ? 131  ASP B CA  1 
ATOM   5224 C C   . ASP B 1 131 ? -5.214  -0.805  -44.371 1.00 56.14  ? 131  ASP B C   1 
ATOM   5225 O O   . ASP B 1 131 ? -6.019  0.112   -44.514 1.00 56.36  ? 131  ASP B O   1 
ATOM   5226 C CB  . ASP B 1 131 ? -6.165  -3.073  -44.611 1.00 58.64  ? 131  ASP B CB  1 
ATOM   5227 C CG  . ASP B 1 131 ? -6.638  -4.195  -45.555 1.00 61.37  ? 131  ASP B CG  1 
ATOM   5228 O OD1 . ASP B 1 131 ? -6.337  -4.200  -46.779 1.00 62.57  ? 131  ASP B OD1 1 
ATOM   5229 O OD2 . ASP B 1 131 ? -7.344  -5.089  -45.037 1.00 64.55  ? 131  ASP B OD2 1 
ATOM   5230 N N   . VAL B 1 132 ? -4.269  -0.791  -43.428 1.00 55.14  ? 132  VAL B N   1 
ATOM   5231 C CA  . VAL B 1 132 ? -4.139  0.350   -42.499 1.00 54.60  ? 132  VAL B CA  1 
ATOM   5232 C C   . VAL B 1 132 ? -3.706  1.672   -43.152 1.00 53.17  ? 132  VAL B C   1 
ATOM   5233 O O   . VAL B 1 132 ? -3.899  2.743   -42.554 1.00 53.27  ? 132  VAL B O   1 
ATOM   5234 C CB  . VAL B 1 132 ? -3.197  0.054   -41.289 1.00 54.31  ? 132  VAL B CB  1 
ATOM   5235 C CG1 . VAL B 1 132 ? -3.877  -0.881  -40.306 1.00 55.97  ? 132  VAL B CG1 1 
ATOM   5236 C CG2 . VAL B 1 132 ? -1.856  -0.504  -41.748 1.00 54.29  ? 132  VAL B CG2 1 
ATOM   5237 N N   . TYR B 1 133 ? -3.140  1.602   -44.360 1.00 52.21  ? 133  TYR B N   1 
ATOM   5238 C CA  . TYR B 1 133 ? -2.661  2.792   -45.078 1.00 51.06  ? 133  TYR B CA  1 
ATOM   5239 C C   . TYR B 1 133 ? -3.640  3.286   -46.143 1.00 51.83  ? 133  TYR B C   1 
ATOM   5240 O O   . TYR B 1 133 ? -3.265  4.052   -47.035 1.00 51.38  ? 133  TYR B O   1 
ATOM   5241 C CB  . TYR B 1 133 ? -1.326  2.510   -45.742 1.00 50.02  ? 133  TYR B CB  1 
ATOM   5242 C CG  . TYR B 1 133 ? -0.247  1.945   -44.839 1.00 48.36  ? 133  TYR B CG  1 
ATOM   5243 C CD1 . TYR B 1 133 ? -0.212  2.233   -43.476 1.00 49.01  ? 133  TYR B CD1 1 
ATOM   5244 C CD2 . TYR B 1 133 ? 0.744   1.143   -45.358 1.00 46.51  ? 133  TYR B CD2 1 
ATOM   5245 C CE1 . TYR B 1 133 ? 0.767   1.720   -42.663 1.00 46.77  ? 133  TYR B CE1 1 
ATOM   5246 C CE2 . TYR B 1 133 ? 1.748   0.629   -44.545 1.00 48.33  ? 133  TYR B CE2 1 
ATOM   5247 C CZ  . TYR B 1 133 ? 1.755   0.926   -43.204 1.00 47.57  ? 133  TYR B CZ  1 
ATOM   5248 O OH  . TYR B 1 133 ? 2.734   0.418   -42.407 1.00 46.12  ? 133  TYR B OH  1 
ATOM   5249 N N   . ASP B 1 134 ? -4.889  2.854   -46.026 1.00 52.73  ? 134  ASP B N   1 
ATOM   5250 C CA  . ASP B 1 134 ? -5.942  3.148   -46.990 1.00 53.82  ? 134  ASP B CA  1 
ATOM   5251 C C   . ASP B 1 134 ? -6.322  4.634   -46.915 1.00 53.85  ? 134  ASP B C   1 
ATOM   5252 O O   . ASP B 1 134 ? -6.819  5.104   -45.892 1.00 53.88  ? 134  ASP B O   1 
ATOM   5253 C CB  . ASP B 1 134 ? -7.138  2.241   -46.669 1.00 54.83  ? 134  ASP B CB  1 
ATOM   5254 C CG  . ASP B 1 134 ? -8.273  2.353   -47.667 1.00 56.96  ? 134  ASP B CG  1 
ATOM   5255 O OD1 . ASP B 1 134 ? -8.279  3.255   -48.530 1.00 58.36  ? 134  ASP B OD1 1 
ATOM   5256 O OD2 . ASP B 1 134 ? -9.186  1.516   -47.563 1.00 58.04  ? 134  ASP B OD2 1 
ATOM   5257 N N   . GLY B 1 135 ? -6.083  5.360   -48.007 1.00 53.74  ? 135  GLY B N   1 
ATOM   5258 C CA  . GLY B 1 135 ? -6.276  6.810   -48.056 1.00 53.63  ? 135  GLY B CA  1 
ATOM   5259 C C   . GLY B 1 135 ? -7.700  7.305   -48.305 1.00 55.10  ? 135  GLY B C   1 
ATOM   5260 O O   . GLY B 1 135 ? -7.920  8.512   -48.376 1.00 54.87  ? 135  GLY B O   1 
ATOM   5261 N N   . ARG B 1 136 ? -8.668  6.399   -48.433 1.00 56.43  ? 136  ARG B N   1 
ATOM   5262 C CA  . ARG B 1 136 ? -10.002 6.795   -48.870 1.00 58.45  ? 136  ARG B CA  1 
ATOM   5263 C C   . ARG B 1 136 ? -10.714 7.679   -47.850 1.00 58.97  ? 136  ARG B C   1 
ATOM   5264 O O   . ARG B 1 136 ? -11.467 8.579   -48.227 1.00 60.41  ? 136  ARG B O   1 
ATOM   5265 C CB  . ARG B 1 136 ? -10.857 5.580   -49.265 1.00 59.74  ? 136  ARG B CB  1 
ATOM   5266 C CG  . ARG B 1 136 ? -11.381 4.709   -48.136 1.00 61.83  ? 136  ARG B CG  1 
ATOM   5267 C CD  . ARG B 1 136 ? -12.268 3.571   -48.677 1.00 65.35  ? 136  ARG B CD  1 
ATOM   5268 N NE  . ARG B 1 136 ? -11.471 2.498   -49.265 1.00 67.12  ? 136  ARG B NE  1 
ATOM   5269 C CZ  . ARG B 1 136 ? -11.939 1.520   -50.055 1.00 69.51  ? 136  ARG B CZ  1 
ATOM   5270 N NH1 . ARG B 1 136 ? -13.228 1.450   -50.403 1.00 70.61  ? 136  ARG B NH1 1 
ATOM   5271 N NH2 . ARG B 1 136 ? -11.097 0.600   -50.517 1.00 68.16  ? 136  ARG B NH2 1 
ATOM   5272 N N   . PHE B 1 137 ? -10.455 7.446   -46.565 1.00 58.10  ? 137  PHE B N   1 
ATOM   5273 C CA  . PHE B 1 137 ? -11.187 8.139   -45.501 1.00 58.30  ? 137  PHE B CA  1 
ATOM   5274 C C   . PHE B 1 137 ? -10.732 9.592   -45.394 1.00 57.50  ? 137  PHE B C   1 
ATOM   5275 O O   . PHE B 1 137 ? -11.549 10.508  -45.310 1.00 58.21  ? 137  PHE B O   1 
ATOM   5276 C CB  . PHE B 1 137 ? -10.997 7.412   -44.163 1.00 57.86  ? 137  PHE B CB  1 
ATOM   5277 C CG  . PHE B 1 137 ? -11.463 5.988   -44.189 1.00 58.27  ? 137  PHE B CG  1 
ATOM   5278 C CD1 . PHE B 1 137 ? -12.815 5.687   -44.124 1.00 60.68  ? 137  PHE B CD1 1 
ATOM   5279 C CD2 . PHE B 1 137 ? -10.556 4.948   -44.299 1.00 57.73  ? 137  PHE B CD2 1 
ATOM   5280 C CE1 . PHE B 1 137 ? -13.255 4.354   -44.164 1.00 62.23  ? 137  PHE B CE1 1 
ATOM   5281 C CE2 . PHE B 1 137 ? -10.978 3.618   -44.333 1.00 59.13  ? 137  PHE B CE2 1 
ATOM   5282 C CZ  . PHE B 1 137 ? -12.324 3.317   -44.269 1.00 60.31  ? 137  PHE B CZ  1 
ATOM   5283 N N   . LEU B 1 138 ? -9.422  9.794   -45.400 1.00 55.58  ? 138  LEU B N   1 
ATOM   5284 C CA  . LEU B 1 138 ? -8.852  11.141  -45.381 1.00 55.04  ? 138  LEU B CA  1 
ATOM   5285 C C   . LEU B 1 138 ? -9.268  11.962  -46.599 1.00 55.70  ? 138  LEU B C   1 
ATOM   5286 O O   . LEU B 1 138 ? -9.544  13.157  -46.483 1.00 56.54  ? 138  LEU B O   1 
ATOM   5287 C CB  . LEU B 1 138 ? -7.321  11.066  -45.281 1.00 53.41  ? 138  LEU B CB  1 
ATOM   5288 C CG  . LEU B 1 138 ? -6.779  10.734  -43.890 1.00 51.62  ? 138  LEU B CG  1 
ATOM   5289 C CD1 . LEU B 1 138 ? -5.377  10.156  -43.977 1.00 49.12  ? 138  LEU B CD1 1 
ATOM   5290 C CD2 . LEU B 1 138 ? -6.795  11.975  -42.987 1.00 51.57  ? 138  LEU B CD2 1 
ATOM   5291 N N   . ALA B 1 139 ? -9.329  11.314  -47.759 1.00 55.88  ? 139  ALA B N   1 
ATOM   5292 C CA  . ALA B 1 139 ? -9.721  11.968  -49.012 1.00 56.71  ? 139  ALA B CA  1 
ATOM   5293 C C   . ALA B 1 139 ? -11.188 12.383  -48.959 1.00 58.68  ? 139  ALA B C   1 
ATOM   5294 O O   . ALA B 1 139 ? -11.528 13.540  -49.214 1.00 59.61  ? 139  ALA B O   1 
ATOM   5295 C CB  . ALA B 1 139 ? -9.474  11.033  -50.200 1.00 56.13  ? 139  ALA B CB  1 
ATOM   5296 N N   . GLN B 1 140 ? -12.051 11.439  -48.596 1.00 59.50  ? 140  GLN B N   1 
ATOM   5297 C CA  . GLN B 1 140 ? -13.498 11.686  -48.558 1.00 61.38  ? 140  GLN B CA  1 
ATOM   5298 C C   . GLN B 1 140 ? -13.900 12.697  -47.481 1.00 61.83  ? 140  GLN B C   1 
ATOM   5299 O O   . GLN B 1 140 ? -14.572 13.670  -47.774 1.00 63.46  ? 140  GLN B O   1 
ATOM   5300 C CB  . GLN B 1 140 ? -14.246 10.368  -48.347 1.00 61.94  ? 140  GLN B CB  1 
ATOM   5301 C CG  . GLN B 1 140 ? -15.648 10.372  -48.881 1.00 64.88  ? 140  GLN B CG  1 
ATOM   5302 C CD  . GLN B 1 140 ? -16.571 11.190  -48.029 1.00 66.37  ? 140  GLN B CD  1 
ATOM   5303 O OE1 . GLN B 1 140 ? -16.720 10.935  -46.832 1.00 66.38  ? 140  GLN B OE1 1 
ATOM   5304 N NE2 . GLN B 1 140 ? -17.194 12.189  -48.632 1.00 69.78  ? 140  GLN B NE2 1 
ATOM   5305 N N   . VAL B 1 141 ? -13.476 12.472  -46.244 1.00 61.26  ? 141  VAL B N   1 
ATOM   5306 C CA  . VAL B 1 141 ? -13.960 13.258  -45.105 1.00 61.95  ? 141  VAL B CA  1 
ATOM   5307 C C   . VAL B 1 141 ? -13.313 14.636  -45.006 1.00 61.92  ? 141  VAL B C   1 
ATOM   5308 O O   . VAL B 1 141 ? -14.012 15.638  -44.788 1.00 62.54  ? 141  VAL B O   1 
ATOM   5309 C CB  . VAL B 1 141 ? -13.737 12.511  -43.784 1.00 61.39  ? 141  VAL B CB  1 
ATOM   5310 C CG1 . VAL B 1 141 ? -14.302 13.319  -42.605 1.00 61.38  ? 141  VAL B CG1 1 
ATOM   5311 C CG2 . VAL B 1 141 ? -14.379 11.126  -43.858 1.00 61.68  ? 141  VAL B CG2 1 
ATOM   5312 N N   . GLU B 1 142 ? -11.990 14.674  -45.175 1.00 60.68  ? 142  GLU B N   1 
ATOM   5313 C CA  . GLU B 1 142 ? -11.199 15.903  -45.030 1.00 60.80  ? 142  GLU B CA  1 
ATOM   5314 C C   . GLU B 1 142 ? -10.862 16.599  -46.352 1.00 61.10  ? 142  GLU B C   1 
ATOM   5315 O O   . GLU B 1 142 ? -10.249 17.673  -46.353 1.00 60.68  ? 142  GLU B O   1 
ATOM   5316 C CB  . GLU B 1 142 ? -9.905  15.604  -44.262 1.00 59.30  ? 142  GLU B CB  1 
ATOM   5317 C CG  . GLU B 1 142 ? -10.135 15.260  -42.795 1.00 61.13  ? 142  GLU B CG  1 
ATOM   5318 C CD  . GLU B 1 142 ? -10.864 16.366  -42.037 1.00 66.08  ? 142  GLU B CD  1 
ATOM   5319 O OE1 . GLU B 1 142 ? -10.511 17.566  -42.206 1.00 68.23  ? 142  GLU B OE1 1 
ATOM   5320 O OE2 . GLU B 1 142 ? -11.801 16.033  -41.274 1.00 68.49  ? 142  GLU B OE2 1 
ATOM   5321 N N   . GLY B 1 143 ? -11.262 15.998  -47.469 1.00 61.87  ? 143  GLY B N   1 
ATOM   5322 C CA  . GLY B 1 143 ? -11.054 16.594  -48.787 1.00 62.35  ? 143  GLY B CA  1 
ATOM   5323 C C   . GLY B 1 143 ? -9.599  16.621  -49.230 1.00 61.26  ? 143  GLY B C   1 
ATOM   5324 O O   . GLY B 1 143 ? -9.235  17.407  -50.114 1.00 62.48  ? 143  GLY B O   1 
ATOM   5325 N N   . ALA B 1 144 ? -8.770  15.768  -48.629 1.00 59.26  ? 144  ALA B N   1 
ATOM   5326 C CA  . ALA B 1 144 ? -7.323  15.765  -48.877 1.00 57.34  ? 144  ALA B CA  1 
ATOM   5327 C C   . ALA B 1 144 ? -6.952  14.942  -50.104 1.00 56.30  ? 144  ALA B C   1 
ATOM   5328 O O   . ALA B 1 144 ? -7.675  14.024  -50.488 1.00 56.40  ? 144  ALA B O   1 
ATOM   5329 C CB  . ALA B 1 144 ? -6.577  15.222  -47.654 1.00 55.85  ? 144  ALA B CB  1 
ATOM   5330 N N   . VAL B 1 145 ? -5.818  15.283  -50.711 1.00 54.85  ? 145  VAL B N   1 
ATOM   5331 C CA  . VAL B 1 145 ? -5.211  14.436  -51.701 1.00 53.95  ? 145  VAL B CA  1 
ATOM   5332 C C   . VAL B 1 145 ? -4.126  13.644  -50.994 1.00 52.45  ? 145  VAL B C   1 
ATOM   5333 O O   . VAL B 1 145 ? -3.176  14.211  -50.451 1.00 51.40  ? 145  VAL B O   1 
ATOM   5334 C CB  . VAL B 1 145 ? -4.617  15.230  -52.872 1.00 54.28  ? 145  VAL B CB  1 
ATOM   5335 C CG1 . VAL B 1 145 ? -3.877  14.295  -53.811 1.00 52.95  ? 145  VAL B CG1 1 
ATOM   5336 C CG2 . VAL B 1 145 ? -5.715  15.976  -53.625 1.00 55.99  ? 145  VAL B CG2 1 
ATOM   5337 N N   . LEU B 1 146 ? -4.267  12.326  -51.000 1.00 52.23  ? 146  LEU B N   1 
ATOM   5338 C CA  . LEU B 1 146 ? -3.319  11.451  -50.313 1.00 51.20  ? 146  LEU B CA  1 
ATOM   5339 C C   . LEU B 1 146 ? -2.470  10.617  -51.272 1.00 50.27  ? 146  LEU B C   1 
ATOM   5340 O O   . LEU B 1 146 ? -2.999  9.994   -52.178 1.00 50.83  ? 146  LEU B O   1 
ATOM   5341 C CB  . LEU B 1 146 ? -4.080  10.548  -49.335 1.00 51.45  ? 146  LEU B CB  1 
ATOM   5342 C CG  . LEU B 1 146 ? -3.123  9.794   -48.404 1.00 53.30  ? 146  LEU B CG  1 
ATOM   5343 C CD1 . LEU B 1 146 ? -3.496  9.978   -46.941 1.00 52.35  ? 146  LEU B CD1 1 
ATOM   5344 C CD2 . LEU B 1 146 ? -3.001  8.295   -48.830 1.00 54.28  ? 146  LEU B CD2 1 
ATOM   5345 N N   . VAL B 1 147 ? -1.151  10.580  -51.047 1.00 49.42  ? 147  VAL B N   1 
ATOM   5346 C CA  . VAL B 1 147 ? -0.227  9.815   -51.902 1.00 48.06  ? 147  VAL B CA  1 
ATOM   5347 C C   . VAL B 1 147 ? 0.562   8.833   -51.038 1.00 47.69  ? 147  VAL B C   1 
ATOM   5348 O O   . VAL B 1 147 ? 0.904   9.152   -49.909 1.00 47.14  ? 147  VAL B O   1 
ATOM   5349 C CB  . VAL B 1 147 ? 0.730   10.770  -52.652 1.00 48.30  ? 147  VAL B CB  1 
ATOM   5350 C CG1 . VAL B 1 147 ? 1.702   10.018  -53.574 1.00 46.66  ? 147  VAL B CG1 1 
ATOM   5351 C CG2 . VAL B 1 147 ? -0.074  11.811  -53.423 1.00 48.11  ? 147  VAL B CG2 1 
ATOM   5352 N N   . SER B 1 148 ? 0.806   7.623   -51.549 1.00 47.49  ? 148  SER B N   1 
ATOM   5353 C CA  . SER B 1 148 ? 1.740   6.673   -50.922 1.00 46.57  ? 148  SER B CA  1 
ATOM   5354 C C   . SER B 1 148 ? 2.554   5.962   -52.000 1.00 46.90  ? 148  SER B C   1 
ATOM   5355 O O   . SER B 1 148 ? 2.042   5.649   -53.064 1.00 47.90  ? 148  SER B O   1 
ATOM   5356 C CB  . SER B 1 148 ? 0.998   5.646   -50.052 1.00 46.35  ? 148  SER B CB  1 
ATOM   5357 O OG  . SER B 1 148 ? 0.194   4.794   -50.840 1.00 45.37  ? 148  SER B OG  1 
ATOM   5358 N N   . MET B 1 149 ? 3.833   5.726   -51.736 1.00 47.26  ? 149  MET B N   1 
ATOM   5359 C CA  . MET B 1 149 ? 4.705   5.039   -52.693 1.00 47.29  ? 149  MET B CA  1 
ATOM   5360 C C   . MET B 1 149 ? 5.298   3.786   -52.089 1.00 47.05  ? 149  MET B C   1 
ATOM   5361 O O   . MET B 1 149 ? 5.472   3.688   -50.865 1.00 46.96  ? 149  MET B O   1 
ATOM   5362 C CB  . MET B 1 149 ? 5.827   5.981   -53.158 1.00 47.78  ? 149  MET B CB  1 
ATOM   5363 C CG  . MET B 1 149 ? 7.071   6.114   -52.249 1.00 47.51  ? 149  MET B CG  1 
ATOM   5364 S SD  . MET B 1 149 ? 6.861   6.855   -50.599 1.00 48.74  ? 149  MET B SD  1 
ATOM   5365 C CE  . MET B 1 149 ? 6.628   8.602   -50.981 1.00 47.81  ? 149  MET B CE  1 
ATOM   5366 N N   . ASN B 1 150 ? 5.614   2.824   -52.949 1.00 47.33  ? 150  ASN B N   1 
ATOM   5367 C CA  . ASN B 1 150 ? 6.501   1.721   -52.590 1.00 46.92  ? 150  ASN B CA  1 
ATOM   5368 C C   . ASN B 1 150 ? 7.937   2.193   -52.769 1.00 46.43  ? 150  ASN B C   1 
ATOM   5369 O O   . ASN B 1 150 ? 8.240   2.938   -53.699 1.00 47.29  ? 150  ASN B O   1 
ATOM   5370 C CB  . ASN B 1 150 ? 6.259   0.499   -53.473 1.00 48.03  ? 150  ASN B CB  1 
ATOM   5371 C CG  . ASN B 1 150 ? 5.031   -0.289  -53.076 1.00 50.27  ? 150  ASN B CG  1 
ATOM   5372 O OD1 . ASN B 1 150 ? 4.310   0.079   -52.142 1.00 53.39  ? 150  ASN B OD1 1 
ATOM   5373 N ND2 . ASN B 1 150 ? 4.780   -1.391  -53.794 1.00 51.89  ? 150  ASN B ND2 1 
ATOM   5374 N N   . TYR B 1 151 ? 8.813   1.777   -51.864 1.00 45.17  ? 151  TYR B N   1 
ATOM   5375 C CA  . TYR B 1 151 ? 10.228  2.025   -51.996 1.00 44.67  ? 151  TYR B CA  1 
ATOM   5376 C C   . TYR B 1 151 ? 10.968  0.746   -51.640 1.00 44.68  ? 151  TYR B C   1 
ATOM   5377 O O   . TYR B 1 151 ? 10.505  -0.052  -50.827 1.00 44.72  ? 151  TYR B O   1 
ATOM   5378 C CB  . TYR B 1 151 ? 10.670  3.192   -51.113 1.00 44.40  ? 151  TYR B CB  1 
ATOM   5379 C CG  . TYR B 1 151 ? 10.509  2.989   -49.617 1.00 43.62  ? 151  TYR B CG  1 
ATOM   5380 C CD1 . TYR B 1 151 ? 9.367   3.424   -48.955 1.00 43.55  ? 151  TYR B CD1 1 
ATOM   5381 C CD2 . TYR B 1 151 ? 11.512  2.392   -48.865 1.00 43.44  ? 151  TYR B CD2 1 
ATOM   5382 C CE1 . TYR B 1 151 ? 9.222   3.258   -47.586 1.00 42.94  ? 151  TYR B CE1 1 
ATOM   5383 C CE2 . TYR B 1 151 ? 11.379  2.219   -47.488 1.00 42.93  ? 151  TYR B CE2 1 
ATOM   5384 C CZ  . TYR B 1 151 ? 10.227  2.654   -46.855 1.00 43.38  ? 151  TYR B CZ  1 
ATOM   5385 O OH  . TYR B 1 151 ? 10.084  2.488   -45.489 1.00 43.46  ? 151  TYR B OH  1 
ATOM   5386 N N   . ARG B 1 152 ? 12.111  0.546   -52.269 1.00 45.17  ? 152  ARG B N   1 
ATOM   5387 C CA  . ARG B 1 152 ? 12.877  -0.680  -52.066 1.00 45.57  ? 152  ARG B CA  1 
ATOM   5388 C C   . ARG B 1 152 ? 13.349  -0.811  -50.619 1.00 44.84  ? 152  ARG B C   1 
ATOM   5389 O O   . ARG B 1 152 ? 13.735  0.168   -50.005 1.00 44.06  ? 152  ARG B O   1 
ATOM   5390 C CB  . ARG B 1 152 ? 14.058  -0.716  -53.017 1.00 46.35  ? 152  ARG B CB  1 
ATOM   5391 C CG  . ARG B 1 152 ? 13.722  -1.222  -54.367 1.00 46.63  ? 152  ARG B CG  1 
ATOM   5392 C CD  . ARG B 1 152 ? 14.879  -1.063  -55.286 1.00 46.94  ? 152  ARG B CD  1 
ATOM   5393 N NE  . ARG B 1 152 ? 15.092  0.343   -55.640 1.00 47.02  ? 152  ARG B NE  1 
ATOM   5394 C CZ  . ARG B 1 152 ? 16.149  0.782   -56.319 1.00 46.93  ? 152  ARG B CZ  1 
ATOM   5395 N NH1 . ARG B 1 152 ? 17.085  -0.066  -56.720 1.00 47.90  ? 152  ARG B NH1 1 
ATOM   5396 N NH2 . ARG B 1 152 ? 16.254  2.070   -56.615 1.00 46.74  ? 152  ARG B NH2 1 
ATOM   5397 N N   . VAL B 1 153 ? 13.270  -2.026  -50.084 1.00 44.57  ? 153  VAL B N   1 
ATOM   5398 C CA  . VAL B 1 153 ? 13.626  -2.313  -48.693 1.00 44.47  ? 153  VAL B CA  1 
ATOM   5399 C C   . VAL B 1 153 ? 14.678  -3.436  -48.697 1.00 46.00  ? 153  VAL B C   1 
ATOM   5400 O O   . VAL B 1 153 ? 14.968  -4.021  -49.752 1.00 46.81  ? 153  VAL B O   1 
ATOM   5401 C CB  . VAL B 1 153 ? 12.384  -2.714  -47.849 1.00 44.17  ? 153  VAL B CB  1 
ATOM   5402 C CG1 . VAL B 1 153 ? 11.372  -1.539  -47.759 1.00 42.34  ? 153  VAL B CG1 1 
ATOM   5403 C CG2 . VAL B 1 153 ? 11.701  -3.978  -48.431 1.00 44.02  ? 153  VAL B CG2 1 
ATOM   5404 N N   . GLY B 1 154 ? 15.270  -3.692  -47.537 1.00 46.27  ? 154  GLY B N   1 
ATOM   5405 C CA  . GLY B 1 154 ? 16.278  -4.750  -47.376 1.00 47.81  ? 154  GLY B CA  1 
ATOM   5406 C C   . GLY B 1 154 ? 17.529  -4.476  -48.175 1.00 48.19  ? 154  GLY B C   1 
ATOM   5407 O O   . GLY B 1 154 ? 17.867  -3.326  -48.425 1.00 47.83  ? 154  GLY B O   1 
ATOM   5408 N N   . THR B 1 155 ? 18.190  -5.543  -48.610 1.00 50.06  ? 155  THR B N   1 
ATOM   5409 C CA  . THR B 1 155 ? 19.376  -5.444  -49.471 1.00 50.73  ? 155  THR B CA  1 
ATOM   5410 C C   . THR B 1 155 ? 19.086  -4.640  -50.750 1.00 50.64  ? 155  THR B C   1 
ATOM   5411 O O   . THR B 1 155 ? 19.916  -3.847  -51.216 1.00 50.63  ? 155  THR B O   1 
ATOM   5412 C CB  . THR B 1 155 ? 19.838  -6.830  -49.897 1.00 51.93  ? 155  THR B CB  1 
ATOM   5413 O OG1 . THR B 1 155 ? 18.770  -7.481  -50.566 1.00 51.50  ? 155  THR B OG1 1 
ATOM   5414 C CG2 . THR B 1 155 ? 20.250  -7.676  -48.695 1.00 53.01  ? 155  THR B CG2 1 
ATOM   5415 N N   . PHE B 1 156 ? 17.890  -4.827  -51.297 1.00 49.87  ? 156  PHE B N   1 
ATOM   5416 C CA  . PHE B 1 156 ? 17.517  -4.205  -52.569 1.00 49.91  ? 156  PHE B CA  1 
ATOM   5417 C C   . PHE B 1 156 ? 17.450  -2.695  -52.470 1.00 49.23  ? 156  PHE B C   1 
ATOM   5418 O O   . PHE B 1 156 ? 17.780  -1.987  -53.422 1.00 49.84  ? 156  PHE B O   1 
ATOM   5419 C CB  . PHE B 1 156 ? 16.179  -4.751  -53.052 1.00 49.67  ? 156  PHE B CB  1 
ATOM   5420 C CG  . PHE B 1 156 ? 16.116  -6.238  -53.026 1.00 51.08  ? 156  PHE B CG  1 
ATOM   5421 C CD1 . PHE B 1 156 ? 16.685  -6.981  -54.042 1.00 50.98  ? 156  PHE B CD1 1 
ATOM   5422 C CD2 . PHE B 1 156 ? 15.537  -6.900  -51.957 1.00 51.44  ? 156  PHE B CD2 1 
ATOM   5423 C CE1 . PHE B 1 156 ? 16.649  -8.350  -54.005 1.00 52.52  ? 156  PHE B CE1 1 
ATOM   5424 C CE2 . PHE B 1 156 ? 15.504  -8.275  -51.920 1.00 51.62  ? 156  PHE B CE2 1 
ATOM   5425 C CZ  . PHE B 1 156 ? 16.064  -8.996  -52.948 1.00 52.77  ? 156  PHE B CZ  1 
ATOM   5426 N N   . GLY B 1 157 ? 17.035  -2.199  -51.315 1.00 48.84  ? 157  GLY B N   1 
ATOM   5427 C CA  . GLY B 1 157 ? 16.935  -0.746  -51.098 1.00 48.18  ? 157  GLY B CA  1 
ATOM   5428 C C   . GLY B 1 157 ? 18.137  -0.114  -50.418 1.00 47.94  ? 157  GLY B C   1 
ATOM   5429 O O   . GLY B 1 157 ? 18.406  1.075   -50.600 1.00 47.88  ? 157  GLY B O   1 
ATOM   5430 N N   . PHE B 1 158 ? 18.847  -0.893  -49.611 1.00 48.64  ? 158  PHE B N   1 
ATOM   5431 C CA  . PHE B 1 158 ? 19.871  -0.325  -48.727 1.00 48.93  ? 158  PHE B CA  1 
ATOM   5432 C C   . PHE B 1 158 ? 21.230  -1.019  -48.642 1.00 50.11  ? 158  PHE B C   1 
ATOM   5433 O O   . PHE B 1 158 ? 22.123  -0.514  -47.942 1.00 50.56  ? 158  PHE B O   1 
ATOM   5434 C CB  . PHE B 1 158 ? 19.251  -0.126  -47.337 1.00 48.36  ? 158  PHE B CB  1 
ATOM   5435 C CG  . PHE B 1 158 ? 18.095  0.840   -47.354 1.00 46.29  ? 158  PHE B CG  1 
ATOM   5436 C CD1 . PHE B 1 158 ? 18.329  2.207   -47.438 1.00 46.09  ? 158  PHE B CD1 1 
ATOM   5437 C CD2 . PHE B 1 158 ? 16.798  0.391   -47.377 1.00 45.04  ? 158  PHE B CD2 1 
ATOM   5438 C CE1 . PHE B 1 158 ? 17.286  3.101   -47.511 1.00 44.44  ? 158  PHE B CE1 1 
ATOM   5439 C CE2 . PHE B 1 158 ? 15.751  1.285   -47.458 1.00 45.02  ? 158  PHE B CE2 1 
ATOM   5440 C CZ  . PHE B 1 158 ? 16.005  2.647   -47.521 1.00 44.33  ? 158  PHE B CZ  1 
ATOM   5441 N N   . LEU B 1 159 ? 21.424  -2.130  -49.360 1.00 50.85  ? 159  LEU B N   1 
ATOM   5442 C CA  . LEU B 1 159 ? 22.777  -2.721  -49.469 1.00 52.05  ? 159  LEU B CA  1 
ATOM   5443 C C   . LEU B 1 159 ? 23.707  -1.716  -50.144 1.00 53.04  ? 159  LEU B C   1 
ATOM   5444 O O   . LEU B 1 159 ? 23.381  -1.139  -51.192 1.00 52.86  ? 159  LEU B O   1 
ATOM   5445 C CB  . LEU B 1 159 ? 22.795  -4.037  -50.242 1.00 52.58  ? 159  LEU B CB  1 
ATOM   5446 C CG  . LEU B 1 159 ? 24.160  -4.763  -50.317 1.00 53.62  ? 159  LEU B CG  1 
ATOM   5447 C CD1 . LEU B 1 159 ? 24.012  -6.287  -50.168 1.00 53.22  ? 159  LEU B CD1 1 
ATOM   5448 C CD2 . LEU B 1 159 ? 24.910  -4.430  -51.613 1.00 52.21  ? 159  LEU B CD2 1 
ATOM   5449 N N   . ALA B 1 160 ? 24.856  -1.485  -49.525 1.00 54.13  ? 160  ALA B N   1 
ATOM   5450 C CA  . ALA B 1 160 ? 25.735  -0.415  -49.960 1.00 54.93  ? 160  ALA B CA  1 
ATOM   5451 C C   . ALA B 1 160 ? 27.167  -0.872  -49.867 1.00 56.74  ? 160  ALA B C   1 
ATOM   5452 O O   . ALA B 1 160 ? 27.558  -1.500  -48.886 1.00 57.44  ? 160  ALA B O   1 
ATOM   5453 C CB  . ALA B 1 160 ? 25.521  0.840   -49.111 1.00 53.92  ? 160  ALA B CB  1 
ATOM   5454 N N   . LEU B 1 161 ? 27.918  -0.589  -50.924 1.00 58.07  ? 161  LEU B N   1 
ATOM   5455 C CA  . LEU B 1 161 ? 29.366  -0.609  -50.892 1.00 60.05  ? 161  LEU B CA  1 
ATOM   5456 C C   . LEU B 1 161 ? 29.792  0.850   -51.090 1.00 60.30  ? 161  LEU B C   1 
ATOM   5457 O O   . LEU B 1 161 ? 29.974  1.297   -52.216 1.00 60.21  ? 161  LEU B O   1 
ATOM   5458 C CB  . LEU B 1 161 ? 29.912  -1.510  -51.996 1.00 61.53  ? 161  LEU B CB  1 
ATOM   5459 C CG  . LEU B 1 161 ? 29.701  -3.009  -51.769 1.00 62.44  ? 161  LEU B CG  1 
ATOM   5460 C CD1 . LEU B 1 161 ? 30.250  -3.759  -52.945 1.00 66.35  ? 161  LEU B CD1 1 
ATOM   5461 C CD2 . LEU B 1 161 ? 30.384  -3.487  -50.516 1.00 62.92  ? 161  LEU B CD2 1 
ATOM   5462 N N   . PRO B 1 162 ? 29.903  1.613   -49.985 1.00 60.53  ? 162  PRO B N   1 
ATOM   5463 C CA  . PRO B 1 162 ? 30.079  3.068   -50.095 1.00 60.94  ? 162  PRO B CA  1 
ATOM   5464 C C   . PRO B 1 162 ? 31.274  3.478   -50.951 1.00 62.93  ? 162  PRO B C   1 
ATOM   5465 O O   . PRO B 1 162 ? 32.311  2.834   -50.907 1.00 63.88  ? 162  PRO B O   1 
ATOM   5466 C CB  . PRO B 1 162 ? 30.251  3.501   -48.640 1.00 60.93  ? 162  PRO B CB  1 
ATOM   5467 C CG  . PRO B 1 162 ? 29.472  2.469   -47.880 1.00 59.65  ? 162  PRO B CG  1 
ATOM   5468 C CD  . PRO B 1 162 ? 29.831  1.196   -48.575 1.00 59.98  ? 162  PRO B CD  1 
ATOM   5469 N N   . GLY B 1 163 ? 31.084  4.522   -51.754 1.00 63.45  ? 163  GLY B N   1 
ATOM   5470 C CA  . GLY B 1 163 ? 32.084  4.960   -52.721 1.00 65.48  ? 163  GLY B CA  1 
ATOM   5471 C C   . GLY B 1 163 ? 31.965  4.281   -54.070 1.00 66.48  ? 163  GLY B C   1 
ATOM   5472 O O   . GLY B 1 163 ? 32.614  4.707   -55.023 1.00 67.61  ? 163  GLY B O   1 
ATOM   5473 N N   . SER B 1 164 ? 31.146  3.227   -54.156 1.00 66.39  ? 164  SER B N   1 
ATOM   5474 C CA  . SER B 1 164 ? 30.938  2.496   -55.410 1.00 67.37  ? 164  SER B CA  1 
ATOM   5475 C C   . SER B 1 164 ? 29.921  3.207   -56.288 1.00 67.14  ? 164  SER B C   1 
ATOM   5476 O O   . SER B 1 164 ? 29.017  3.878   -55.788 1.00 66.09  ? 164  SER B O   1 
ATOM   5477 C CB  . SER B 1 164 ? 30.495  1.040   -55.158 1.00 67.04  ? 164  SER B CB  1 
ATOM   5478 O OG  . SER B 1 164 ? 29.150  0.948   -54.695 1.00 64.29  ? 164  SER B OG  1 
ATOM   5479 N N   . ARG B 1 165 ? 30.092  3.071   -57.600 1.00 68.97  ? 165  ARG B N   1 
ATOM   5480 C CA  . ARG B 1 165 ? 29.136  3.614   -58.564 1.00 69.33  ? 165  ARG B CA  1 
ATOM   5481 C C   . ARG B 1 165 ? 27.914  2.711   -58.592 1.00 67.17  ? 165  ARG B C   1 
ATOM   5482 O O   . ARG B 1 165 ? 26.789  3.178   -58.744 1.00 65.68  ? 165  ARG B O   1 
ATOM   5483 C CB  . ARG B 1 165 ? 29.746  3.668   -59.977 1.00 71.83  ? 165  ARG B CB  1 
ATOM   5484 C CG  . ARG B 1 165 ? 30.962  4.623   -60.156 1.00 77.40  ? 165  ARG B CG  1 
ATOM   5485 C CD  . ARG B 1 165 ? 30.800  5.570   -61.392 1.00 82.48  ? 165  ARG B CD  1 
ATOM   5486 N NE  . ARG B 1 165 ? 29.461  6.185   -61.433 1.00 83.91  ? 165  ARG B NE  1 
ATOM   5487 C CZ  . ARG B 1 165 ? 29.030  7.166   -60.629 1.00 84.47  ? 165  ARG B CZ  1 
ATOM   5488 N NH1 . ARG B 1 165 ? 29.825  7.695   -59.694 1.00 85.83  ? 165  ARG B NH1 1 
ATOM   5489 N NH2 . ARG B 1 165 ? 27.785  7.626   -60.762 1.00 82.82  ? 165  ARG B NH2 1 
ATOM   5490 N N   . GLU B 1 166 ? 28.166  1.411   -58.428 1.00 66.89  ? 166  GLU B N   1 
ATOM   5491 C CA  . GLU B 1 166 ? 27.170  0.374   -58.671 1.00 65.99  ? 166  GLU B CA  1 
ATOM   5492 C C   . GLU B 1 166 ? 26.186  0.140   -57.507 1.00 63.47  ? 166  GLU B C   1 
ATOM   5493 O O   . GLU B 1 166 ? 25.042  -0.212  -57.747 1.00 62.35  ? 166  GLU B O   1 
ATOM   5494 C CB  . GLU B 1 166 ? 27.876  -0.940  -59.048 1.00 67.63  ? 166  GLU B CB  1 
ATOM   5495 C CG  . GLU B 1 166 ? 28.769  -0.863  -60.308 1.00 70.22  ? 166  GLU B CG  1 
ATOM   5496 C CD  . GLU B 1 166 ? 30.267  -0.643  -60.017 1.00 73.93  ? 166  GLU B CD  1 
ATOM   5497 O OE1 . GLU B 1 166 ? 30.647  -0.270  -58.878 1.00 74.49  ? 166  GLU B OE1 1 
ATOM   5498 O OE2 . GLU B 1 166 ? 31.076  -0.852  -60.955 1.00 77.22  ? 166  GLU B OE2 1 
ATOM   5499 N N   . ALA B 1 167 ? 26.641  0.317   -56.265 1.00 62.80  ? 167  ALA B N   1 
ATOM   5500 C CA  . ALA B 1 167 ? 25.794  0.199   -55.061 1.00 61.07  ? 167  ALA B CA  1 
ATOM   5501 C C   . ALA B 1 167 ? 26.137  1.304   -54.053 1.00 60.60  ? 167  ALA B C   1 
ATOM   5502 O O   . ALA B 1 167 ? 26.719  1.033   -53.013 1.00 61.00  ? 167  ALA B O   1 
ATOM   5503 C CB  . ALA B 1 167 ? 25.966  -1.169  -54.418 1.00 60.97  ? 167  ALA B CB  1 
ATOM   5504 N N   . PRO B 1 168 ? 25.783  2.556   -54.369 1.00 60.10  ? 168  PRO B N   1 
ATOM   5505 C CA  . PRO B 1 168 ? 26.225  3.720   -53.589 1.00 59.99  ? 168  PRO B CA  1 
ATOM   5506 C C   . PRO B 1 168 ? 25.520  3.907   -52.230 1.00 58.56  ? 168  PRO B C   1 
ATOM   5507 O O   . PRO B 1 168 ? 25.999  4.677   -51.397 1.00 58.61  ? 168  PRO B O   1 
ATOM   5508 C CB  . PRO B 1 168 ? 25.899  4.894   -54.518 1.00 59.86  ? 168  PRO B CB  1 
ATOM   5509 C CG  . PRO B 1 168 ? 24.725  4.435   -55.289 1.00 59.55  ? 168  PRO B CG  1 
ATOM   5510 C CD  . PRO B 1 168 ? 24.929  2.952   -55.502 1.00 59.87  ? 168  PRO B CD  1 
ATOM   5511 N N   . GLY B 1 169 ? 24.396  3.216   -52.026 1.00 56.95  ? 169  GLY B N   1 
ATOM   5512 C CA  . GLY B 1 169 ? 23.643  3.287   -50.783 1.00 55.49  ? 169  GLY B CA  1 
ATOM   5513 C C   . GLY B 1 169 ? 22.438  4.205   -50.874 1.00 53.71  ? 169  GLY B C   1 
ATOM   5514 O O   . GLY B 1 169 ? 22.333  5.020   -51.794 1.00 54.29  ? 169  GLY B O   1 
ATOM   5515 N N   . ASN B 1 170 ? 21.517  4.046   -49.928 1.00 51.70  ? 170  ASN B N   1 
ATOM   5516 C CA  . ASN B 1 170 ? 20.348  4.914   -49.794 1.00 49.94  ? 170  ASN B CA  1 
ATOM   5517 C C   . ASN B 1 170 ? 19.395  4.971   -50.996 1.00 48.79  ? 170  ASN B C   1 
ATOM   5518 O O   . ASN B 1 170 ? 18.629  5.931   -51.125 1.00 47.57  ? 170  ASN B O   1 
ATOM   5519 C CB  . ASN B 1 170 ? 20.799  6.346   -49.453 1.00 50.16  ? 170  ASN B CB  1 
ATOM   5520 C CG  . ASN B 1 170 ? 21.530  6.432   -48.129 1.00 50.33  ? 170  ASN B CG  1 
ATOM   5521 O OD1 . ASN B 1 170 ? 21.194  5.730   -47.177 1.00 50.91  ? 170  ASN B OD1 1 
ATOM   5522 N ND2 . ASN B 1 170 ? 22.525  7.301   -48.058 1.00 50.54  ? 170  ASN B ND2 1 
ATOM   5523 N N   . VAL B 1 171 ? 19.414  3.952   -51.852 1.00 48.17  ? 171  VAL B N   1 
ATOM   5524 C CA  . VAL B 1 171 ? 18.629  3.997   -53.081 1.00 47.52  ? 171  VAL B CA  1 
ATOM   5525 C C   . VAL B 1 171 ? 17.117  3.963   -52.772 1.00 47.16  ? 171  VAL B C   1 
ATOM   5526 O O   . VAL B 1 171 ? 16.320  4.568   -53.490 1.00 47.01  ? 171  VAL B O   1 
ATOM   5527 C CB  . VAL B 1 171 ? 19.075  2.934   -54.150 1.00 48.20  ? 171  VAL B CB  1 
ATOM   5528 C CG1 . VAL B 1 171 ? 20.584  3.030   -54.410 1.00 48.05  ? 171  VAL B CG1 1 
ATOM   5529 C CG2 . VAL B 1 171 ? 18.708  1.523   -53.750 1.00 46.89  ? 171  VAL B CG2 1 
ATOM   5530 N N   . GLY B 1 172 ? 16.732  3.273   -51.698 1.00 46.90  ? 172  GLY B N   1 
ATOM   5531 C CA  . GLY B 1 172 ? 15.344  3.278   -51.241 1.00 46.06  ? 172  GLY B CA  1 
ATOM   5532 C C   . GLY B 1 172 ? 14.857  4.649   -50.806 1.00 45.71  ? 172  GLY B C   1 
ATOM   5533 O O   . GLY B 1 172 ? 13.671  4.957   -50.923 1.00 45.71  ? 172  GLY B O   1 
ATOM   5534 N N   . LEU B 1 173 ? 15.757  5.482   -50.285 1.00 46.08  ? 173  LEU B N   1 
ATOM   5535 C CA  . LEU B 1 173 ? 15.410  6.875   -49.980 1.00 45.46  ? 173  LEU B CA  1 
ATOM   5536 C C   . LEU B 1 173 ? 15.345  7.710   -51.261 1.00 45.99  ? 173  LEU B C   1 
ATOM   5537 O O   . LEU B 1 173 ? 14.527  8.620   -51.376 1.00 45.63  ? 173  LEU B O   1 
ATOM   5538 C CB  . LEU B 1 173 ? 16.415  7.508   -49.015 1.00 45.81  ? 173  LEU B CB  1 
ATOM   5539 C CG  . LEU B 1 173 ? 16.505  7.021   -47.561 1.00 44.64  ? 173  LEU B CG  1 
ATOM   5540 C CD1 . LEU B 1 173 ? 17.758  7.608   -46.902 1.00 45.50  ? 173  LEU B CD1 1 
ATOM   5541 C CD2 . LEU B 1 173 ? 15.284  7.424   -46.825 1.00 43.54  ? 173  LEU B CD2 1 
ATOM   5542 N N   . LEU B 1 174 ? 16.223  7.411   -52.216 1.00 46.24  ? 174  LEU B N   1 
ATOM   5543 C CA  . LEU B 1 174 ? 16.120  8.006   -53.540 1.00 46.70  ? 174  LEU B CA  1 
ATOM   5544 C C   . LEU B 1 174 ? 14.821  7.606   -54.262 1.00 46.70  ? 174  LEU B C   1 
ATOM   5545 O O   . LEU B 1 174 ? 14.268  8.417   -55.021 1.00 47.23  ? 174  LEU B O   1 
ATOM   5546 C CB  . LEU B 1 174 ? 17.344  7.682   -54.390 1.00 47.74  ? 174  LEU B CB  1 
ATOM   5547 C CG  . LEU B 1 174 ? 18.642  8.358   -53.903 1.00 48.30  ? 174  LEU B CG  1 
ATOM   5548 C CD1 . LEU B 1 174 ? 19.847  7.884   -54.705 1.00 46.70  ? 174  LEU B CD1 1 
ATOM   5549 C CD2 . LEU B 1 174 ? 18.515  9.877   -53.950 1.00 46.26  ? 174  LEU B CD2 1 
ATOM   5550 N N   . ASP B 1 175 ? 14.333  6.385   -54.029 1.00 45.67  ? 175  ASP B N   1 
ATOM   5551 C CA  . ASP B 1 175 ? 13.023  5.989   -54.546 1.00 45.51  ? 175  ASP B CA  1 
ATOM   5552 C C   . ASP B 1 175 ? 11.977  6.955   -54.004 1.00 44.87  ? 175  ASP B C   1 
ATOM   5553 O O   . ASP B 1 175 ? 11.173  7.485   -54.757 1.00 45.39  ? 175  ASP B O   1 
ATOM   5554 C CB  . ASP B 1 175 ? 12.613  4.564   -54.142 1.00 44.90  ? 175  ASP B CB  1 
ATOM   5555 C CG  . ASP B 1 175 ? 13.519  3.473   -54.729 1.00 46.04  ? 175  ASP B CG  1 
ATOM   5556 O OD1 . ASP B 1 175 ? 14.255  3.740   -55.690 1.00 45.48  ? 175  ASP B OD1 1 
ATOM   5557 O OD2 . ASP B 1 175 ? 13.471  2.320   -54.232 1.00 46.36  ? 175  ASP B OD2 1 
ATOM   5558 N N   . GLN B 1 176 ? 11.980  7.159   -52.693 1.00 44.36  ? 176  GLN B N   1 
ATOM   5559 C CA  . GLN B 1 176 ? 11.028  8.061   -52.049 1.00 44.17  ? 176  GLN B CA  1 
ATOM   5560 C C   . GLN B 1 176 ? 11.093  9.464   -52.639 1.00 44.46  ? 176  GLN B C   1 
ATOM   5561 O O   . GLN B 1 176 ? 10.070  10.050  -52.944 1.00 45.10  ? 176  GLN B O   1 
ATOM   5562 C CB  . GLN B 1 176 ? 11.277  8.143   -50.544 1.00 43.76  ? 176  GLN B CB  1 
ATOM   5563 C CG  . GLN B 1 176 ? 11.079  6.832   -49.782 1.00 44.52  ? 176  GLN B CG  1 
ATOM   5564 C CD  . GLN B 1 176 ? 11.553  6.938   -48.362 1.00 44.99  ? 176  GLN B CD  1 
ATOM   5565 O OE1 . GLN B 1 176 ? 11.783  8.039   -47.879 1.00 47.29  ? 176  GLN B OE1 1 
ATOM   5566 N NE2 . GLN B 1 176 ? 11.700  5.798   -47.677 1.00 44.56  ? 176  GLN B NE2 1 
ATOM   5567 N N   . ARG B 1 177 ? 12.302  9.994   -52.791 1.00 44.66  ? 177  ARG B N   1 
ATOM   5568 C CA  . ARG B 1 177 ? 12.499  11.329  -53.326 1.00 45.35  ? 177  ARG B CA  1 
ATOM   5569 C C   . ARG B 1 177 ? 11.957  11.436  -54.744 1.00 45.97  ? 177  ARG B C   1 
ATOM   5570 O O   . ARG B 1 177 ? 11.321  12.443  -55.094 1.00 45.46  ? 177  ARG B O   1 
ATOM   5571 C CB  . ARG B 1 177 ? 13.982  11.700  -53.317 1.00 45.54  ? 177  ARG B CB  1 
ATOM   5572 C CG  . ARG B 1 177 ? 14.274  13.033  -53.959 1.00 48.51  ? 177  ARG B CG  1 
ATOM   5573 C CD  . ARG B 1 177 ? 15.757  13.341  -53.966 1.00 49.93  ? 177  ARG B CD  1 
ATOM   5574 N NE  . ARG B 1 177 ? 16.199  13.745  -52.639 1.00 52.40  ? 177  ARG B NE  1 
ATOM   5575 C CZ  . ARG B 1 177 ? 17.474  13.750  -52.226 1.00 55.01  ? 177  ARG B CZ  1 
ATOM   5576 N NH1 . ARG B 1 177 ? 18.459  13.369  -53.036 1.00 55.52  ? 177  ARG B NH1 1 
ATOM   5577 N NH2 . ARG B 1 177 ? 17.775  14.145  -50.993 1.00 53.71  ? 177  ARG B NH2 1 
ATOM   5578 N N   . LEU B 1 178 ? 12.221  10.409  -55.556 1.00 45.62  ? 178  LEU B N   1 
ATOM   5579 C CA  . LEU B 1 178 ? 11.681  10.361  -56.910 1.00 46.49  ? 178  LEU B CA  1 
ATOM   5580 C C   . LEU B 1 178 ? 10.148  10.457  -56.901 1.00 46.01  ? 178  LEU B C   1 
ATOM   5581 O O   . LEU B 1 178 ? 9.576   11.167  -57.719 1.00 46.97  ? 178  LEU B O   1 
ATOM   5582 C CB  . LEU B 1 178 ? 12.145  9.101   -57.657 1.00 46.64  ? 178  LEU B CB  1 
ATOM   5583 C CG  . LEU B 1 178 ? 11.860  9.059   -59.173 1.00 47.55  ? 178  LEU B CG  1 
ATOM   5584 C CD1 . LEU B 1 178 ? 12.355  10.308  -59.931 1.00 46.56  ? 178  LEU B CD1 1 
ATOM   5585 C CD2 . LEU B 1 178 ? 12.464  7.794   -59.774 1.00 46.07  ? 178  LEU B CD2 1 
ATOM   5586 N N   . ALA B 1 179 ? 9.489   9.770   -55.973 1.00 45.58  ? 179  ALA B N   1 
ATOM   5587 C CA  . ALA B 1 179 ? 8.009   9.896   -55.823 1.00 45.69  ? 179  ALA B CA  1 
ATOM   5588 C C   . ALA B 1 179 ? 7.617   11.316  -55.412 1.00 45.82  ? 179  ALA B C   1 
ATOM   5589 O O   . ALA B 1 179 ? 6.562   11.831  -55.818 1.00 47.40  ? 179  ALA B O   1 
ATOM   5590 C CB  . ALA B 1 179 ? 7.478   8.887   -54.817 1.00 44.54  ? 179  ALA B CB  1 
ATOM   5591 N N   . LEU B 1 180 ? 8.449   11.953  -54.597 1.00 45.47  ? 180  LEU B N   1 
ATOM   5592 C CA  . LEU B 1 180 ? 8.194   13.333  -54.190 1.00 45.63  ? 180  LEU B CA  1 
ATOM   5593 C C   . LEU B 1 180 ? 8.267   14.279  -55.386 1.00 46.80  ? 180  LEU B C   1 
ATOM   5594 O O   . LEU B 1 180 ? 7.448   15.194  -55.500 1.00 46.48  ? 180  LEU B O   1 
ATOM   5595 C CB  . LEU B 1 180 ? 9.178   13.776  -53.102 1.00 45.39  ? 180  LEU B CB  1 
ATOM   5596 C CG  . LEU B 1 180 ? 8.835   13.537  -51.632 1.00 45.99  ? 180  LEU B CG  1 
ATOM   5597 C CD1 . LEU B 1 180 ? 8.293   12.138  -51.329 1.00 45.53  ? 180  LEU B CD1 1 
ATOM   5598 C CD2 . LEU B 1 180 ? 10.059  13.866  -50.769 1.00 43.74  ? 180  LEU B CD2 1 
ATOM   5599 N N   . GLN B 1 181 ? 9.273   14.080  -56.250 1.00 47.70  ? 181  GLN B N   1 
ATOM   5600 C CA  . GLN B 1 181 ? 9.444   14.903  -57.465 1.00 48.81  ? 181  GLN B CA  1 
ATOM   5601 C C   . GLN B 1 181 ? 8.258   14.699  -58.412 1.00 49.14  ? 181  GLN B C   1 
ATOM   5602 O O   . GLN B 1 181 ? 7.755   15.655  -59.001 1.00 50.37  ? 181  GLN B O   1 
ATOM   5603 C CB  A GLN B 1 181 ? 10.771  14.560  -58.166 0.50 49.11  ? 181  GLN B CB  1 
ATOM   5604 C CB  B GLN B 1 181 ? 10.772  14.581  -58.169 0.50 49.38  ? 181  GLN B CB  1 
ATOM   5605 C CG  A GLN B 1 181 ? 12.016  15.022  -57.391 0.50 48.96  ? 181  GLN B CG  1 
ATOM   5606 C CG  B GLN B 1 181 ? 11.076  15.418  -59.429 0.50 51.00  ? 181  GLN B CG  1 
ATOM   5607 C CD  A GLN B 1 181 ? 13.340  14.440  -57.911 0.50 48.26  ? 181  GLN B CD  1 
ATOM   5608 C CD  B GLN B 1 181 ? 11.024  16.930  -59.189 0.50 52.68  ? 181  GLN B CD  1 
ATOM   5609 O OE1 A GLN B 1 181 ? 13.372  13.397  -58.558 0.50 45.97  ? 181  GLN B OE1 1 
ATOM   5610 O OE1 B GLN B 1 181 ? 11.842  17.487  -58.451 0.50 54.01  ? 181  GLN B OE1 1 
ATOM   5611 N NE2 A GLN B 1 181 ? 14.438  15.116  -57.600 0.50 46.79  ? 181  GLN B NE2 1 
ATOM   5612 N NE2 B GLN B 1 181 ? 10.070  17.597  -59.828 0.50 52.08  ? 181  GLN B NE2 1 
ATOM   5613 N N   . TRP B 1 182 ? 7.803   13.455  -58.519 1.00 48.51  ? 182  TRP B N   1 
ATOM   5614 C CA  . TRP B 1 182 ? 6.610   13.099  -59.281 1.00 48.83  ? 182  TRP B CA  1 
ATOM   5615 C C   . TRP B 1 182 ? 5.391   13.869  -58.817 1.00 49.08  ? 182  TRP B C   1 
ATOM   5616 O O   . TRP B 1 182 ? 4.611   14.350  -59.632 1.00 50.06  ? 182  TRP B O   1 
ATOM   5617 C CB  . TRP B 1 182 ? 6.326   11.595  -59.153 1.00 48.45  ? 182  TRP B CB  1 
ATOM   5618 C CG  . TRP B 1 182 ? 5.270   11.085  -60.081 1.00 49.06  ? 182  TRP B CG  1 
ATOM   5619 C CD1 . TRP B 1 182 ? 5.466   10.494  -61.300 1.00 49.84  ? 182  TRP B CD1 1 
ATOM   5620 C CD2 . TRP B 1 182 ? 3.852   11.099  -59.867 1.00 49.83  ? 182  TRP B CD2 1 
ATOM   5621 N NE1 . TRP B 1 182 ? 4.255   10.162  -61.863 1.00 50.42  ? 182  TRP B NE1 1 
ATOM   5622 C CE2 . TRP B 1 182 ? 3.252   10.509  -61.001 1.00 49.86  ? 182  TRP B CE2 1 
ATOM   5623 C CE3 . TRP B 1 182 ? 3.030   11.558  -58.832 1.00 49.22  ? 182  TRP B CE3 1 
ATOM   5624 C CZ2 . TRP B 1 182 ? 1.876   10.373  -61.130 1.00 51.10  ? 182  TRP B CZ2 1 
ATOM   5625 C CZ3 . TRP B 1 182 ? 1.661   11.403  -58.957 1.00 49.55  ? 182  TRP B CZ3 1 
ATOM   5626 C CH2 . TRP B 1 182 ? 1.099   10.824  -60.099 1.00 49.86  ? 182  TRP B CH2 1 
ATOM   5627 N N   . VAL B 1 183 ? 5.217   13.972  -57.508 1.00 48.69  ? 183  VAL B N   1 
ATOM   5628 C CA  . VAL B 1 183 ? 4.111   14.740  -56.949 1.00 48.78  ? 183  VAL B CA  1 
ATOM   5629 C C   . VAL B 1 183 ? 4.238   16.228  -57.329 1.00 50.35  ? 183  VAL B C   1 
ATOM   5630 O O   . VAL B 1 183 ? 3.254   16.855  -57.698 1.00 50.80  ? 183  VAL B O   1 
ATOM   5631 C CB  . VAL B 1 183 ? 3.971   14.502  -55.407 1.00 47.87  ? 183  VAL B CB  1 
ATOM   5632 C CG1 . VAL B 1 183 ? 3.122   15.584  -54.726 1.00 46.30  ? 183  VAL B CG1 1 
ATOM   5633 C CG2 . VAL B 1 183 ? 3.380   13.108  -55.151 1.00 45.92  ? 183  VAL B CG2 1 
ATOM   5634 N N   . GLN B 1 184 ? 5.439   16.789  -57.278 1.00 51.20  ? 184  GLN B N   1 
ATOM   5635 C CA  . GLN B 1 184 ? 5.610   18.195  -57.674 1.00 52.99  ? 184  GLN B CA  1 
ATOM   5636 C C   . GLN B 1 184 ? 5.160   18.404  -59.117 1.00 54.69  ? 184  GLN B C   1 
ATOM   5637 O O   . GLN B 1 184 ? 4.432   19.362  -59.419 1.00 55.71  ? 184  GLN B O   1 
ATOM   5638 C CB  . GLN B 1 184 ? 7.061   18.647  -57.505 1.00 52.98  ? 184  GLN B CB  1 
ATOM   5639 C CG  . GLN B 1 184 ? 7.436   18.967  -56.075 1.00 52.95  ? 184  GLN B CG  1 
ATOM   5640 C CD  . GLN B 1 184 ? 6.533   20.032  -55.484 1.00 54.00  ? 184  GLN B CD  1 
ATOM   5641 O OE1 . GLN B 1 184 ? 6.540   21.174  -55.939 1.00 56.20  ? 184  GLN B OE1 1 
ATOM   5642 N NE2 . GLN B 1 184 ? 5.734   19.659  -54.488 1.00 50.73  ? 184  GLN B NE2 1 
ATOM   5643 N N   . GLU B 1 185 ? 5.552   17.476  -59.990 1.00 55.36  ? 185  GLU B N   1 
ATOM   5644 C CA  . GLU B 1 185 ? 5.268   17.580  -61.423 1.00 57.06  ? 185  GLU B CA  1 
ATOM   5645 C C   . GLU B 1 185 ? 3.842   17.234  -61.810 1.00 56.90  ? 185  GLU B C   1 
ATOM   5646 O O   . GLU B 1 185 ? 3.343   17.756  -62.810 1.00 57.99  ? 185  GLU B O   1 
ATOM   5647 C CB  . GLU B 1 185 ? 6.188   16.666  -62.230 1.00 57.74  ? 185  GLU B CB  1 
ATOM   5648 C CG  . GLU B 1 185 ? 7.667   17.007  -62.150 1.00 61.78  ? 185  GLU B CG  1 
ATOM   5649 C CD  . GLU B 1 185 ? 8.562   15.887  -62.716 1.00 67.18  ? 185  GLU B CD  1 
ATOM   5650 O OE1 . GLU B 1 185 ? 8.025   14.844  -63.183 1.00 71.68  ? 185  GLU B OE1 1 
ATOM   5651 O OE2 . GLU B 1 185 ? 9.804   16.044  -62.683 1.00 70.03  ? 185  GLU B OE2 1 
ATOM   5652 N N   . ASN B 1 186 ? 3.195   16.340  -61.061 1.00 55.45  ? 186  ASN B N   1 
ATOM   5653 C CA  . ASN B 1 186 ? 1.944   15.727  -61.531 1.00 55.19  ? 186  ASN B CA  1 
ATOM   5654 C C   . ASN B 1 186 ? 0.695   15.937  -60.681 1.00 54.09  ? 186  ASN B C   1 
ATOM   5655 O O   . ASN B 1 186 ? -0.420  15.748  -61.168 1.00 54.61  ? 186  ASN B O   1 
ATOM   5656 C CB  . ASN B 1 186 ? 2.161   14.221  -61.735 1.00 54.74  ? 186  ASN B CB  1 
ATOM   5657 C CG  . ASN B 1 186 ? 3.150   13.930  -62.831 1.00 55.87  ? 186  ASN B CG  1 
ATOM   5658 O OD1 . ASN B 1 186 ? 2.882   14.212  -63.998 1.00 58.34  ? 186  ASN B OD1 1 
ATOM   5659 N ND2 . ASN B 1 186 ? 4.311   13.386  -62.464 1.00 55.09  ? 186  ASN B ND2 1 
ATOM   5660 N N   . ILE B 1 187 ? 0.864   16.307  -59.423 1.00 52.52  ? 187  ILE B N   1 
ATOM   5661 C CA  . ILE B 1 187 ? -0.242  16.234  -58.491 1.00 51.76  ? 187  ILE B CA  1 
ATOM   5662 C C   . ILE B 1 187 ? -1.336  17.268  -58.782 1.00 52.73  ? 187  ILE B C   1 
ATOM   5663 O O   . ILE B 1 187 ? -2.511  17.011  -58.489 1.00 52.63  ? 187  ILE B O   1 
ATOM   5664 C CB  . ILE B 1 187 ? 0.242   16.311  -57.036 1.00 50.85  ? 187  ILE B CB  1 
ATOM   5665 C CG1 . ILE B 1 187 ? -0.736  15.560  -56.111 1.00 50.02  ? 187  ILE B CG1 1 
ATOM   5666 C CG2 . ILE B 1 187 ? 0.490   17.771  -56.609 1.00 51.41  ? 187  ILE B CG2 1 
ATOM   5667 C CD1 . ILE B 1 187 ? -0.818  14.046  -56.376 1.00 46.75  ? 187  ILE B CD1 1 
ATOM   5668 N N   . ALA B 1 188 ? -0.968  18.400  -59.391 1.00 53.34  ? 188  ALA B N   1 
ATOM   5669 C CA  . ALA B 1 188 ? -1.964  19.395  -59.833 1.00 55.04  ? 188  ALA B CA  1 
ATOM   5670 C C   . ALA B 1 188 ? -3.003  18.790  -60.769 1.00 56.03  ? 188  ALA B C   1 
ATOM   5671 O O   . ALA B 1 188 ? -4.144  19.234  -60.774 1.00 57.75  ? 188  ALA B O   1 
ATOM   5672 C CB  . ALA B 1 188 ? -1.296  20.604  -60.497 1.00 55.61  ? 188  ALA B CB  1 
ATOM   5673 N N   . ALA B 1 189 ? -2.629  17.780  -61.558 1.00 55.97  ? 189  ALA B N   1 
ATOM   5674 C CA  . ALA B 1 189 ? -3.606  17.095  -62.426 1.00 57.05  ? 189  ALA B CA  1 
ATOM   5675 C C   . ALA B 1 189 ? -4.728  16.403  -61.639 1.00 57.28  ? 189  ALA B C   1 
ATOM   5676 O O   . ALA B 1 189 ? -5.811  16.196  -62.169 1.00 58.22  ? 189  ALA B O   1 
ATOM   5677 C CB  . ALA B 1 189 ? -2.914  16.089  -63.340 1.00 56.56  ? 189  ALA B CB  1 
ATOM   5678 N N   . PHE B 1 190 ? -4.466  16.049  -60.380 1.00 56.64  ? 190  PHE B N   1 
ATOM   5679 C CA  . PHE B 1 190 ? -5.459  15.400  -59.526 1.00 56.95  ? 190  PHE B CA  1 
ATOM   5680 C C   . PHE B 1 190 ? -6.181  16.387  -58.609 1.00 58.16  ? 190  PHE B C   1 
ATOM   5681 O O   . PHE B 1 190 ? -7.024  15.979  -57.801 1.00 58.51  ? 190  PHE B O   1 
ATOM   5682 C CB  . PHE B 1 190 ? -4.790  14.342  -58.660 1.00 55.42  ? 190  PHE B CB  1 
ATOM   5683 C CG  . PHE B 1 190 ? -4.056  13.294  -59.441 1.00 54.45  ? 190  PHE B CG  1 
ATOM   5684 C CD1 . PHE B 1 190 ? -2.763  13.522  -59.890 1.00 53.76  ? 190  PHE B CD1 1 
ATOM   5685 C CD2 . PHE B 1 190 ? -4.642  12.067  -59.708 1.00 55.59  ? 190  PHE B CD2 1 
ATOM   5686 C CE1 . PHE B 1 190 ? -2.076  12.550  -60.604 1.00 52.83  ? 190  PHE B CE1 1 
ATOM   5687 C CE2 . PHE B 1 190 ? -3.949  11.084  -60.428 1.00 53.86  ? 190  PHE B CE2 1 
ATOM   5688 C CZ  . PHE B 1 190 ? -2.672  11.341  -60.877 1.00 52.91  ? 190  PHE B CZ  1 
ATOM   5689 N N   . GLY B 1 191 ? -5.837  17.670  -58.721 1.00 58.85  ? 191  GLY B N   1 
ATOM   5690 C CA  . GLY B 1 191 ? -6.369  18.704  -57.841 1.00 59.45  ? 191  GLY B CA  1 
ATOM   5691 C C   . GLY B 1 191 ? -5.526  18.980  -56.607 1.00 58.64  ? 191  GLY B C   1 
ATOM   5692 O O   . GLY B 1 191 ? -5.932  19.755  -55.744 1.00 58.68  ? 191  GLY B O   1 
ATOM   5693 N N   . GLY B 1 192 ? -4.354  18.352  -56.511 1.00 57.62  ? 192  GLY B N   1 
ATOM   5694 C CA  . GLY B 1 192 ? -3.445  18.589  -55.390 1.00 56.49  ? 192  GLY B CA  1 
ATOM   5695 C C   . GLY B 1 192 ? -2.706  19.899  -55.557 1.00 57.32  ? 192  GLY B C   1 
ATOM   5696 O O   . GLY B 1 192 ? -2.528  20.369  -56.680 1.00 58.30  ? 192  GLY B O   1 
ATOM   5697 N N   . ASP B 1 193 ? -2.289  20.489  -54.436 1.00 57.33  ? 193  ASP B N   1 
ATOM   5698 C CA  . ASP B 1 193 ? -1.474  21.708  -54.413 1.00 58.33  ? 193  ASP B CA  1 
ATOM   5699 C C   . ASP B 1 193 ? -0.014  21.344  -54.161 1.00 57.36  ? 193  ASP B C   1 
ATOM   5700 O O   . ASP B 1 193 ? 0.334   20.966  -53.043 1.00 56.75  ? 193  ASP B O   1 
ATOM   5701 C CB  . ASP B 1 193 ? -1.966  22.642  -53.297 1.00 59.44  ? 193  ASP B CB  1 
ATOM   5702 C CG  . ASP B 1 193 ? -1.276  24.010  -53.305 1.00 61.50  ? 193  ASP B CG  1 
ATOM   5703 O OD1 . ASP B 1 193 ? -0.389  24.238  -54.165 1.00 62.69  ? 193  ASP B OD1 1 
ATOM   5704 O OD2 . ASP B 1 193 ? -1.631  24.859  -52.444 1.00 62.97  ? 193  ASP B OD2 1 
ATOM   5705 N N   . PRO B 1 194 ? 0.854   21.455  -55.193 1.00 57.78  ? 194  PRO B N   1 
ATOM   5706 C CA  . PRO B 1 194 ? 2.252   21.069  -54.976 1.00 56.82  ? 194  PRO B CA  1 
ATOM   5707 C C   . PRO B 1 194 ? 3.008   22.071  -54.095 1.00 57.41  ? 194  PRO B C   1 
ATOM   5708 O O   . PRO B 1 194 ? 4.133   21.791  -53.659 1.00 56.61  ? 194  PRO B O   1 
ATOM   5709 C CB  . PRO B 1 194 ? 2.829   21.032  -56.393 1.00 57.19  ? 194  PRO B CB  1 
ATOM   5710 C CG  . PRO B 1 194 ? 2.003   22.040  -57.156 1.00 58.75  ? 194  PRO B CG  1 
ATOM   5711 C CD  . PRO B 1 194 ? 0.622   21.940  -56.573 1.00 58.74  ? 194  PRO B CD  1 
ATOM   5712 N N   . MET B 1 195 ? 2.402   23.231  -53.846 1.00 58.59  ? 195  MET B N   1 
ATOM   5713 C CA  . MET B 1 195 ? 2.955   24.215  -52.923 1.00 59.65  ? 195  MET B CA  1 
ATOM   5714 C C   . MET B 1 195 ? 2.518   23.982  -51.476 1.00 58.03  ? 195  MET B C   1 
ATOM   5715 O O   . MET B 1 195 ? 2.854   24.781  -50.597 1.00 58.61  ? 195  MET B O   1 
ATOM   5716 C CB  . MET B 1 195 ? 2.562   25.631  -53.355 1.00 61.21  ? 195  MET B CB  1 
ATOM   5717 C CG  . MET B 1 195 ? 3.127   26.011  -54.709 1.00 63.12  ? 195  MET B CG  1 
ATOM   5718 S SD  . MET B 1 195 ? 3.061   27.777  -54.984 1.00 68.04  ? 195  MET B SD  1 
ATOM   5719 C CE  . MET B 1 195 ? 1.286   28.037  -55.186 1.00 69.74  ? 195  MET B CE  1 
ATOM   5720 N N   . SER B 1 196 ? 1.777   22.902  -51.237 1.00 56.19  ? 196  SER B N   1 
ATOM   5721 C CA  . SER B 1 196 ? 1.421   22.479  -49.890 1.00 54.75  ? 196  SER B CA  1 
ATOM   5722 C C   . SER B 1 196 ? 1.501   20.961  -49.768 1.00 52.82  ? 196  SER B C   1 
ATOM   5723 O O   . SER B 1 196 ? 0.495   20.251  -49.885 1.00 53.06  ? 196  SER B O   1 
ATOM   5724 C CB  . SER B 1 196 ? 0.019   22.970  -49.532 1.00 55.82  ? 196  SER B CB  1 
ATOM   5725 O OG  . SER B 1 196 ? -0.282  22.639  -48.192 1.00 55.27  ? 196  SER B OG  1 
ATOM   5726 N N   . VAL B 1 197 ? 2.710   20.464  -49.548 1.00 50.77  ? 197  VAL B N   1 
ATOM   5727 C CA  . VAL B 1 197 ? 2.936   19.033  -49.406 1.00 48.76  ? 197  VAL B CA  1 
ATOM   5728 C C   . VAL B 1 197 ? 3.450   18.721  -48.008 1.00 47.99  ? 197  VAL B C   1 
ATOM   5729 O O   . VAL B 1 197 ? 4.407   19.341  -47.535 1.00 47.75  ? 197  VAL B O   1 
ATOM   5730 C CB  . VAL B 1 197 ? 3.937   18.513  -50.436 1.00 48.24  ? 197  VAL B CB  1 
ATOM   5731 C CG1 . VAL B 1 197 ? 4.307   17.066  -50.134 1.00 46.04  ? 197  VAL B CG1 1 
ATOM   5732 C CG2 . VAL B 1 197 ? 3.365   18.665  -51.843 1.00 47.93  ? 197  VAL B CG2 1 
ATOM   5733 N N   . THR B 1 198 ? 2.801   17.755  -47.361 1.00 46.87  ? 198  THR B N   1 
ATOM   5734 C CA  . THR B 1 198 ? 3.165   17.312  -46.036 1.00 45.49  ? 198  THR B CA  1 
ATOM   5735 C C   . THR B 1 198 ? 3.527   15.842  -46.087 1.00 45.29  ? 198  THR B C   1 
ATOM   5736 O O   . THR B 1 198 ? 2.708   14.995  -46.493 1.00 45.04  ? 198  THR B O   1 
ATOM   5737 C CB  . THR B 1 198 ? 2.003   17.499  -45.045 1.00 46.02  ? 198  THR B CB  1 
ATOM   5738 O OG1 . THR B 1 198 ? 1.508   18.844  -45.125 1.00 47.73  ? 198  THR B OG1 1 
ATOM   5739 C CG2 . THR B 1 198 ? 2.429   17.197  -43.627 1.00 42.76  ? 198  THR B CG2 1 
ATOM   5740 N N   . LEU B 1 199 ? 4.750   15.538  -45.669 1.00 44.69  ? 199  LEU B N   1 
ATOM   5741 C CA  . LEU B 1 199 ? 5.187   14.159  -45.551 1.00 44.65  ? 199  LEU B CA  1 
ATOM   5742 C C   . LEU B 1 199 ? 4.758   13.663  -44.194 1.00 44.69  ? 199  LEU B C   1 
ATOM   5743 O O   . LEU B 1 199 ? 4.906   14.351  -43.215 1.00 45.05  ? 199  LEU B O   1 
ATOM   5744 C CB  . LEU B 1 199 ? 6.710   14.053  -45.633 1.00 44.12  ? 199  LEU B CB  1 
ATOM   5745 C CG  . LEU B 1 199 ? 7.410   14.699  -46.826 1.00 44.72  ? 199  LEU B CG  1 
ATOM   5746 C CD1 . LEU B 1 199 ? 8.903   14.312  -46.798 1.00 43.02  ? 199  LEU B CD1 1 
ATOM   5747 C CD2 . LEU B 1 199 ? 6.741   14.298  -48.156 1.00 41.15  ? 199  LEU B CD2 1 
ATOM   5748 N N   . PHE B 1 200 ? 4.226   12.462  -44.135 1.00 45.09  ? 200  PHE B N   1 
ATOM   5749 C CA  . PHE B 1 200 ? 4.041   11.805  -42.858 1.00 44.95  ? 200  PHE B CA  1 
ATOM   5750 C C   . PHE B 1 200 ? 4.443   10.358  -43.016 1.00 44.68  ? 200  PHE B C   1 
ATOM   5751 O O   . PHE B 1 200 ? 4.317   9.792   -44.106 1.00 44.91  ? 200  PHE B O   1 
ATOM   5752 C CB  . PHE B 1 200 ? 2.634   12.039  -42.251 1.00 45.50  ? 200  PHE B CB  1 
ATOM   5753 C CG  . PHE B 1 200 ? 1.480   11.353  -42.949 1.00 45.75  ? 200  PHE B CG  1 
ATOM   5754 C CD1 . PHE B 1 200 ? 1.308   11.406  -44.321 1.00 45.98  ? 200  PHE B CD1 1 
ATOM   5755 C CD2 . PHE B 1 200 ? 0.484   10.748  -42.184 1.00 46.35  ? 200  PHE B CD2 1 
ATOM   5756 C CE1 . PHE B 1 200 ? 0.192   10.800  -44.931 1.00 46.66  ? 200  PHE B CE1 1 
ATOM   5757 C CE2 . PHE B 1 200 ? -0.599  10.157  -42.770 1.00 47.17  ? 200  PHE B CE2 1 
ATOM   5758 C CZ  . PHE B 1 200 ? -0.751  10.187  -44.155 1.00 47.48  ? 200  PHE B CZ  1 
ATOM   5759 N N   . GLY B 1 201 ? 5.018   9.792   -41.959 1.00 44.09  ? 201  GLY B N   1 
ATOM   5760 C CA  . GLY B 1 201 ? 5.269   8.352   -41.909 1.00 43.44  ? 201  GLY B CA  1 
ATOM   5761 C C   . GLY B 1 201 ? 5.473   7.852   -40.491 1.00 43.53  ? 201  GLY B C   1 
ATOM   5762 O O   . GLY B 1 201 ? 5.570   8.658   -39.568 1.00 43.05  ? 201  GLY B O   1 
ATOM   5763 N N   . GLU B 1 202 ? 5.573   6.524   -40.334 1.00 43.27  ? 202  GLU B N   1 
ATOM   5764 C CA  . GLU B 1 202 ? 5.718   5.877   -39.030 1.00 43.23  ? 202  GLU B CA  1 
ATOM   5765 C C   . GLU B 1 202 ? 6.892   4.888   -38.988 1.00 43.33  ? 202  GLU B C   1 
ATOM   5766 O O   . GLU B 1 202 ? 7.165   4.218   -39.969 1.00 42.49  ? 202  GLU B O   1 
ATOM   5767 C CB  . GLU B 1 202 ? 4.440   5.130   -38.686 1.00 43.29  ? 202  GLU B CB  1 
ATOM   5768 C CG  . GLU B 1 202 ? 4.399   4.549   -37.273 1.00 44.71  ? 202  GLU B CG  1 
ATOM   5769 C CD  . GLU B 1 202 ? 4.888   3.094   -37.140 1.00 46.45  ? 202  GLU B CD  1 
ATOM   5770 O OE1 . GLU B 1 202 ? 5.127   2.397   -38.142 1.00 45.23  ? 202  GLU B OE1 1 
ATOM   5771 O OE2 . GLU B 1 202 ? 5.034   2.641   -35.990 1.00 49.86  ? 202  GLU B OE2 1 
ATOM   5772 N N   . SER B 1 203 ? 7.549   4.802   -37.833 1.00 44.13  ? 203  SER B N   1 
ATOM   5773 C CA  . SER B 1 203 ? 8.715   3.930   -37.625 1.00 45.19  ? 203  SER B CA  1 
ATOM   5774 C C   . SER B 1 203 ? 9.775   4.296   -38.662 1.00 45.02  ? 203  SER B C   1 
ATOM   5775 O O   . SER B 1 203 ? 10.113  5.485   -38.755 1.00 45.97  ? 203  SER B O   1 
ATOM   5776 C CB  . SER B 1 203 ? 8.286   2.462   -37.650 1.00 45.84  ? 203  SER B CB  1 
ATOM   5777 O OG  . SER B 1 203 ? 9.298   1.608   -37.137 1.00 47.90  ? 203  SER B OG  1 
ATOM   5778 N N   . ALA B 1 204 ? 10.269  3.345   -39.461 1.00 44.80  ? 204  ALA B N   1 
ATOM   5779 C CA  . ALA B 1 204 ? 11.302  3.657   -40.473 1.00 44.81  ? 204  ALA B CA  1 
ATOM   5780 C C   . ALA B 1 204 ? 10.805  4.676   -41.502 1.00 44.40  ? 204  ALA B C   1 
ATOM   5781 O O   . ALA B 1 204 ? 11.596  5.349   -42.151 1.00 44.46  ? 204  ALA B O   1 
ATOM   5782 C CB  . ALA B 1 204 ? 11.799  2.400   -41.169 1.00 45.48  ? 204  ALA B CB  1 
ATOM   5783 N N   . GLY B 1 205 ? 9.493   4.815   -41.633 1.00 44.12  ? 205  GLY B N   1 
ATOM   5784 C CA  . GLY B 1 205 ? 8.942   5.858   -42.495 1.00 44.37  ? 205  GLY B CA  1 
ATOM   5785 C C   . GLY B 1 205 ? 9.137   7.253   -41.910 1.00 43.77  ? 205  GLY B C   1 
ATOM   5786 O O   . GLY B 1 205 ? 9.386   8.209   -42.636 1.00 44.68  ? 205  GLY B O   1 
ATOM   5787 N N   . ALA B 1 206 ? 8.980   7.369   -40.593 1.00 43.25  ? 206  ALA B N   1 
ATOM   5788 C CA  . ALA B 1 206 ? 9.219   8.616   -39.872 1.00 41.78  ? 206  ALA B CA  1 
ATOM   5789 C C   . ALA B 1 206 ? 10.692  8.963   -39.977 1.00 41.58  ? 206  ALA B C   1 
ATOM   5790 O O   . ALA B 1 206 ? 11.065  10.125  -40.221 1.00 41.97  ? 206  ALA B O   1 
ATOM   5791 C CB  . ALA B 1 206 ? 8.807   8.466   -38.417 1.00 41.41  ? 206  ALA B CB  1 
ATOM   5792 N N   . ALA B 1 207 ? 11.549  7.961   -39.805 1.00 41.00  ? 207  ALA B N   1 
ATOM   5793 C CA  . ALA B 1 207 ? 12.984  8.186   -39.977 1.00 40.76  ? 207  ALA B CA  1 
ATOM   5794 C C   . ALA B 1 207 ? 13.259  8.711   -41.380 1.00 41.25  ? 207  ALA B C   1 
ATOM   5795 O O   . ALA B 1 207 ? 14.054  9.647   -41.567 1.00 41.20  ? 207  ALA B O   1 
ATOM   5796 C CB  . ALA B 1 207 ? 13.772  6.895   -39.720 1.00 40.60  ? 207  ALA B CB  1 
ATOM   5797 N N   . SER B 1 208 ? 12.592  8.112   -42.371 1.00 41.27  ? 208  SER B N   1 
ATOM   5798 C CA  . SER B 1 208 ? 12.736  8.549   -43.757 1.00 41.86  ? 208  SER B CA  1 
ATOM   5799 C C   . SER B 1 208 ? 12.346  10.008  -43.929 1.00 42.41  ? 208  SER B C   1 
ATOM   5800 O O   . SER B 1 208 ? 13.112  10.789  -44.491 1.00 42.76  ? 208  SER B O   1 
ATOM   5801 C CB  . SER B 1 208 ? 11.922  7.672   -44.689 1.00 42.07  ? 208  SER B CB  1 
ATOM   5802 O OG  . SER B 1 208 ? 12.406  6.337   -44.702 1.00 42.75  ? 208  SER B OG  1 
ATOM   5803 N N   . VAL B 1 209 ? 11.168  10.382  -43.428 1.00 42.19  ? 209  VAL B N   1 
ATOM   5804 C CA  . VAL B 1 209 ? 10.739  11.794  -43.431 1.00 42.53  ? 209  VAL B CA  1 
ATOM   5805 C C   . VAL B 1 209 ? 11.816  12.707  -42.854 1.00 43.55  ? 209  VAL B C   1 
ATOM   5806 O O   . VAL B 1 209 ? 12.067  13.769  -43.407 1.00 44.50  ? 209  VAL B O   1 
ATOM   5807 C CB  . VAL B 1 209 ? 9.416   12.003  -42.640 1.00 41.97  ? 209  VAL B CB  1 
ATOM   5808 C CG1 . VAL B 1 209 ? 9.042   13.512  -42.506 1.00 41.93  ? 209  VAL B CG1 1 
ATOM   5809 C CG2 . VAL B 1 209 ? 8.290   11.232  -43.307 1.00 40.32  ? 209  VAL B CG2 1 
ATOM   5810 N N   . GLY B 1 210 ? 12.453  12.296  -41.753 1.00 44.10  ? 210  GLY B N   1 
ATOM   5811 C CA  . GLY B 1 210 ? 13.526  13.101  -41.137 1.00 44.99  ? 210  GLY B CA  1 
ATOM   5812 C C   . GLY B 1 210 ? 14.797  13.157  -41.973 1.00 45.98  ? 210  GLY B C   1 
ATOM   5813 O O   . GLY B 1 210 ? 15.490  14.176  -42.014 1.00 46.44  ? 210  GLY B O   1 
ATOM   5814 N N   . MET B 1 211 ? 15.105  12.063  -42.659 1.00 46.40  ? 211  MET B N   1 
ATOM   5815 C CA  . MET B 1 211 ? 16.179  12.082  -43.641 1.00 48.55  ? 211  MET B CA  1 
ATOM   5816 C C   . MET B 1 211 ? 15.914  13.076  -44.805 1.00 48.40  ? 211  MET B C   1 
ATOM   5817 O O   . MET B 1 211 ? 16.820  13.776  -45.225 1.00 49.22  ? 211  MET B O   1 
ATOM   5818 C CB  . MET B 1 211 ? 16.525  10.654  -44.066 1.00 48.46  ? 211  MET B CB  1 
ATOM   5819 C CG  . MET B 1 211 ? 17.375  9.980   -42.955 1.00 48.84  ? 211  MET B CG  1 
ATOM   5820 S SD  . MET B 1 211 ? 17.481  8.207   -43.085 1.00 54.45  ? 211  MET B SD  1 
ATOM   5821 C CE  . MET B 1 211 ? 17.810  7.756   -41.379 1.00 50.65  ? 211  MET B CE  1 
ATOM   5822 N N   . HIS B 1 212 ? 14.666  13.223  -45.239 1.00 47.74  ? 212  HIS B N   1 
ATOM   5823 C CA  . HIS B 1 212 ? 14.331  14.245  -46.227 1.00 48.02  ? 212  HIS B CA  1 
ATOM   5824 C C   . HIS B 1 212 ? 14.445  15.669  -45.683 1.00 48.79  ? 212  HIS B C   1 
ATOM   5825 O O   . HIS B 1 212 ? 14.855  16.571  -46.419 1.00 49.44  ? 212  HIS B O   1 
ATOM   5826 C CB  . HIS B 1 212 ? 12.945  13.995  -46.826 1.00 47.81  ? 212  HIS B CB  1 
ATOM   5827 C CG  . HIS B 1 212 ? 12.872  12.731  -47.630 1.00 47.90  ? 212  HIS B CG  1 
ATOM   5828 N ND1 . HIS B 1 212 ? 13.540  12.573  -48.825 1.00 47.26  ? 212  HIS B ND1 1 
ATOM   5829 C CD2 . HIS B 1 212 ? 12.235  11.562  -47.396 1.00 47.35  ? 212  HIS B CD2 1 
ATOM   5830 C CE1 . HIS B 1 212 ? 13.312  11.359  -49.292 1.00 48.50  ? 212  HIS B CE1 1 
ATOM   5831 N NE2 . HIS B 1 212 ? 12.525  10.725  -48.442 1.00 47.25  ? 212  HIS B NE2 1 
ATOM   5832 N N   . ILE B 1 213 ? 14.112  15.877  -44.408 1.00 48.41  ? 213  ILE B N   1 
ATOM   5833 C CA  . ILE B 1 213 ? 14.356  17.176  -43.758 1.00 48.89  ? 213  ILE B CA  1 
ATOM   5834 C C   . ILE B 1 213 ? 15.848  17.527  -43.750 1.00 49.75  ? 213  ILE B C   1 
ATOM   5835 O O   . ILE B 1 213 ? 16.232  18.687  -43.925 1.00 50.70  ? 213  ILE B O   1 
ATOM   5836 C CB  . ILE B 1 213 ? 13.812  17.206  -42.304 1.00 48.82  ? 213  ILE B CB  1 
ATOM   5837 C CG1 . ILE B 1 213 ? 12.275  17.175  -42.304 1.00 49.18  ? 213  ILE B CG1 1 
ATOM   5838 C CG2 . ILE B 1 213 ? 14.296  18.447  -41.546 1.00 48.74  ? 213  ILE B CG2 1 
ATOM   5839 C CD1 . ILE B 1 213 ? 11.630  16.716  -40.960 1.00 49.11  ? 213  ILE B CD1 1 
ATOM   5840 N N   . LEU B 1 214 ? 16.689  16.515  -43.560 1.00 49.99  ? 214  LEU B N   1 
ATOM   5841 C CA  . LEU B 1 214 ? 18.135  16.708  -43.406 1.00 50.98  ? 214  LEU B CA  1 
ATOM   5842 C C   . LEU B 1 214 ? 18.932  16.632  -44.715 1.00 52.07  ? 214  LEU B C   1 
ATOM   5843 O O   . LEU B 1 214 ? 20.165  16.793  -44.698 1.00 53.55  ? 214  LEU B O   1 
ATOM   5844 C CB  . LEU B 1 214 ? 18.698  15.687  -42.405 1.00 50.64  ? 214  LEU B CB  1 
ATOM   5845 C CG  . LEU B 1 214 ? 18.108  15.750  -40.985 1.00 50.73  ? 214  LEU B CG  1 
ATOM   5846 C CD1 . LEU B 1 214 ? 18.608  14.570  -40.160 1.00 50.26  ? 214  LEU B CD1 1 
ATOM   5847 C CD2 . LEU B 1 214 ? 18.416  17.077  -40.304 1.00 50.29  ? 214  LEU B CD2 1 
ATOM   5848 N N   . SER B 1 215 ? 18.251  16.407  -45.839 1.00 51.77  ? 215  SER B N   1 
ATOM   5849 C CA  . SER B 1 215 ? 18.902  16.345  -47.146 1.00 52.46  ? 215  SER B CA  1 
ATOM   5850 C C   . SER B 1 215 ? 18.338  17.422  -48.070 1.00 53.15  ? 215  SER B C   1 
ATOM   5851 O O   . SER B 1 215 ? 17.168  17.376  -48.452 1.00 52.73  ? 215  SER B O   1 
ATOM   5852 C CB  . SER B 1 215 ? 18.712  14.966  -47.770 1.00 52.10  ? 215  SER B CB  1 
ATOM   5853 O OG  . SER B 1 215 ? 19.511  14.831  -48.925 1.00 52.28  ? 215  SER B OG  1 
ATOM   5854 N N   . LEU B 1 216 ? 19.202  18.364  -48.442 1.00 54.67  ? 216  LEU B N   1 
ATOM   5855 C CA  . LEU B 1 216 ? 18.808  19.607  -49.117 1.00 55.65  ? 216  LEU B CA  1 
ATOM   5856 C C   . LEU B 1 216 ? 18.022  19.407  -50.406 1.00 55.23  ? 216  LEU B C   1 
ATOM   5857 O O   . LEU B 1 216 ? 17.021  20.091  -50.599 1.00 55.67  ? 216  LEU B O   1 
ATOM   5858 C CB  A LEU B 1 216 ? 20.050  20.490  -49.368 0.50 57.10  ? 216  LEU B CB  1 
ATOM   5859 C CB  B LEU B 1 216 ? 20.020  20.520  -49.379 0.50 57.17  ? 216  LEU B CB  1 
ATOM   5860 C CG  A LEU B 1 216 ? 19.860  21.853  -50.042 0.50 58.58  ? 216  LEU B CG  1 
ATOM   5861 C CG  B LEU B 1 216 ? 20.780  21.066  -48.166 0.50 58.18  ? 216  LEU B CG  1 
ATOM   5862 C CD1 A LEU B 1 216 ? 18.907  22.732  -49.237 0.50 58.94  ? 216  LEU B CD1 1 
ATOM   5863 C CD1 B LEU B 1 216 ? 21.693  22.210  -48.617 0.50 60.62  ? 216  LEU B CD1 1 
ATOM   5864 C CD2 A LEU B 1 216 ? 21.200  22.556  -50.240 0.50 59.59  ? 216  LEU B CD2 1 
ATOM   5865 C CD2 B LEU B 1 216 ? 19.857  21.530  -47.038 0.50 58.04  ? 216  LEU B CD2 1 
ATOM   5866 N N   . PRO B 1 217 ? 18.455  18.486  -51.292 1.00 55.20  ? 217  PRO B N   1 
ATOM   5867 C CA  . PRO B 1 217 ? 17.672  18.252  -52.512 1.00 54.98  ? 217  PRO B CA  1 
ATOM   5868 C C   . PRO B 1 217 ? 16.209  17.841  -52.288 1.00 54.17  ? 217  PRO B C   1 
ATOM   5869 O O   . PRO B 1 217 ? 15.371  18.094  -53.146 1.00 54.52  ? 217  PRO B O   1 
ATOM   5870 C CB  . PRO B 1 217 ? 18.456  17.142  -53.220 1.00 55.26  ? 217  PRO B CB  1 
ATOM   5871 C CG  . PRO B 1 217 ? 19.821  17.258  -52.705 1.00 55.74  ? 217  PRO B CG  1 
ATOM   5872 C CD  . PRO B 1 217 ? 19.672  17.658  -51.279 1.00 55.69  ? 217  PRO B CD  1 
ATOM   5873 N N   . SER B 1 218 ? 15.899  17.230  -51.143 1.00 53.75  ? 218  SER B N   1 
ATOM   5874 C CA  . SER B 1 218 ? 14.507  16.876  -50.804 1.00 52.61  ? 218  SER B CA  1 
ATOM   5875 C C   . SER B 1 218 ? 13.696  18.059  -50.291 1.00 53.54  ? 218  SER B C   1 
ATOM   5876 O O   . SER B 1 218 ? 12.471  18.022  -50.339 1.00 53.45  ? 218  SER B O   1 
ATOM   5877 C CB  . SER B 1 218 ? 14.458  15.792  -49.738 1.00 51.27  ? 218  SER B CB  1 
ATOM   5878 O OG  . SER B 1 218 ? 14.954  14.556  -50.204 1.00 50.22  ? 218  SER B OG  1 
ATOM   5879 N N   . ARG B 1 219 ? 14.367  19.094  -49.786 1.00 55.03  ? 219  ARG B N   1 
ATOM   5880 C CA  . ARG B 1 219 ? 13.685  20.184  -49.085 1.00 55.90  ? 219  ARG B CA  1 
ATOM   5881 C C   . ARG B 1 219 ? 12.856  21.061  -49.993 1.00 56.32  ? 219  ARG B C   1 
ATOM   5882 O O   . ARG B 1 219 ? 11.906  21.704  -49.541 1.00 57.06  ? 219  ARG B O   1 
ATOM   5883 C CB  . ARG B 1 219 ? 14.670  21.058  -48.291 1.00 56.93  ? 219  ARG B CB  1 
ATOM   5884 C CG  . ARG B 1 219 ? 15.169  20.422  -47.004 1.00 58.30  ? 219  ARG B CG  1 
ATOM   5885 C CD  . ARG B 1 219 ? 14.070  20.270  -45.939 1.00 60.55  ? 219  ARG B CD  1 
ATOM   5886 N NE  . ARG B 1 219 ? 13.651  21.532  -45.321 1.00 63.32  ? 219  ARG B NE  1 
ATOM   5887 C CZ  . ARG B 1 219 ? 14.368  22.206  -44.419 1.00 66.65  ? 219  ARG B CZ  1 
ATOM   5888 N NH1 . ARG B 1 219 ? 15.557  21.752  -44.004 1.00 67.72  ? 219  ARG B NH1 1 
ATOM   5889 N NH2 . ARG B 1 219 ? 13.901  23.351  -43.921 1.00 67.03  ? 219  ARG B NH2 1 
ATOM   5890 N N   . SER B 1 220 ? 13.186  21.093  -51.269 1.00 56.58  ? 220  SER B N   1 
ATOM   5891 C CA  . SER B 1 220 ? 12.371  21.849  -52.204 1.00 57.34  ? 220  SER B CA  1 
ATOM   5892 C C   . SER B 1 220 ? 11.127  21.065  -52.622 1.00 55.91  ? 220  SER B C   1 
ATOM   5893 O O   . SER B 1 220 ? 10.349  21.544  -53.448 1.00 56.64  ? 220  SER B O   1 
ATOM   5894 C CB  . SER B 1 220 ? 13.204  22.229  -53.429 1.00 58.62  ? 220  SER B CB  1 
ATOM   5895 O OG  . SER B 1 220 ? 13.560  21.069  -54.166 1.00 60.99  ? 220  SER B OG  1 
ATOM   5896 N N   . LEU B 1 221 ? 10.931  19.867  -52.059 1.00 53.58  ? 221  LEU B N   1 
ATOM   5897 C CA  . LEU B 1 221 ? 9.844   18.980  -52.492 1.00 52.29  ? 221  LEU B CA  1 
ATOM   5898 C C   . LEU B 1 221 ? 8.720   18.823  -51.459 1.00 51.42  ? 221  LEU B C   1 
ATOM   5899 O O   . LEU B 1 221 ? 7.748   18.119  -51.706 1.00 51.89  ? 221  LEU B O   1 
ATOM   5900 C CB  . LEU B 1 221 ? 10.403  17.603  -52.860 1.00 51.31  ? 221  LEU B CB  1 
ATOM   5901 C CG  . LEU B 1 221 ? 11.583  17.601  -53.838 1.00 50.93  ? 221  LEU B CG  1 
ATOM   5902 C CD1 . LEU B 1 221 ? 12.155  16.209  -54.010 1.00 47.94  ? 221  LEU B CD1 1 
ATOM   5903 C CD2 . LEU B 1 221 ? 11.148  18.193  -55.174 1.00 49.17  ? 221  LEU B CD2 1 
ATOM   5904 N N   . PHE B 1 222 ? 8.844   19.480  -50.313 1.00 51.10  ? 222  PHE B N   1 
ATOM   5905 C CA  . PHE B 1 222 ? 7.783   19.484  -49.315 1.00 50.28  ? 222  PHE B CA  1 
ATOM   5906 C C   . PHE B 1 222 ? 7.929   20.682  -48.396 1.00 51.02  ? 222  PHE B C   1 
ATOM   5907 O O   . PHE B 1 222 ? 8.978   21.337  -48.372 1.00 50.41  ? 222  PHE B O   1 
ATOM   5908 C CB  . PHE B 1 222 ? 7.772   18.189  -48.507 1.00 49.30  ? 222  PHE B CB  1 
ATOM   5909 C CG  . PHE B 1 222 ? 8.973   18.006  -47.626 1.00 48.56  ? 222  PHE B CG  1 
ATOM   5910 C CD1 . PHE B 1 222 ? 10.197  17.654  -48.175 1.00 47.51  ? 222  PHE B CD1 1 
ATOM   5911 C CD2 . PHE B 1 222 ? 8.872   18.170  -46.241 1.00 47.99  ? 222  PHE B CD2 1 
ATOM   5912 C CE1 . PHE B 1 222 ? 11.304  17.470  -47.371 1.00 48.36  ? 222  PHE B CE1 1 
ATOM   5913 C CE2 . PHE B 1 222 ? 9.977   18.000  -45.427 1.00 46.74  ? 222  PHE B CE2 1 
ATOM   5914 C CZ  . PHE B 1 222 ? 11.193  17.649  -45.987 1.00 48.38  ? 222  PHE B CZ  1 
ATOM   5915 N N   . HIS B 1 223 ? 6.860   20.952  -47.650 1.00 51.02  ? 223  HIS B N   1 
ATOM   5916 C CA  . HIS B 1 223 ? 6.767   22.123  -46.796 1.00 52.33  ? 223  HIS B CA  1 
ATOM   5917 C C   . HIS B 1 223 ? 6.647   21.801  -45.303 1.00 51.16  ? 223  HIS B C   1 
ATOM   5918 O O   . HIS B 1 223 ? 7.107   22.588  -44.478 1.00 51.90  ? 223  HIS B O   1 
ATOM   5919 C CB  . HIS B 1 223 ? 5.607   23.009  -47.267 1.00 53.82  ? 223  HIS B CB  1 
ATOM   5920 C CG  . HIS B 1 223 ? 5.619   23.232  -48.742 1.00 56.33  ? 223  HIS B CG  1 
ATOM   5921 N ND1 . HIS B 1 223 ? 5.088   22.320  -49.631 1.00 57.11  ? 223  HIS B ND1 1 
ATOM   5922 C CD2 . HIS B 1 223 ? 6.174   24.212  -49.492 1.00 59.08  ? 223  HIS B CD2 1 
ATOM   5923 C CE1 . HIS B 1 223 ? 5.291   22.745  -50.864 1.00 58.90  ? 223  HIS B CE1 1 
ATOM   5924 N NE2 . HIS B 1 223 ? 5.951   23.890  -50.808 1.00 59.77  ? 223  HIS B NE2 1 
ATOM   5925 N N   . ARG B 1 224 ? 6.055   20.658  -44.964 1.00 49.64  ? 224  ARG B N   1 
ATOM   5926 C CA  . ARG B 1 224 ? 5.874   20.238  -43.565 1.00 48.78  ? 224  ARG B CA  1 
ATOM   5927 C C   . ARG B 1 224 ? 6.086   18.720  -43.419 1.00 46.81  ? 224  ARG B C   1 
ATOM   5928 O O   . ARG B 1 224 ? 6.048   17.998  -44.415 1.00 45.92  ? 224  ARG B O   1 
ATOM   5929 C CB  . ARG B 1 224 ? 4.456   20.568  -43.106 1.00 49.82  ? 224  ARG B CB  1 
ATOM   5930 C CG  . ARG B 1 224 ? 4.178   22.024  -43.018 1.00 52.56  ? 224  ARG B CG  1 
ATOM   5931 C CD  . ARG B 1 224 ? 2.712   22.306  -42.779 1.00 55.44  ? 224  ARG B CD  1 
ATOM   5932 N NE  . ARG B 1 224 ? 2.004   22.484  -44.033 1.00 58.08  ? 224  ARG B NE  1 
ATOM   5933 C CZ  . ARG B 1 224 ? 2.147   23.535  -44.840 1.00 59.50  ? 224  ARG B CZ  1 
ATOM   5934 N NH1 . ARG B 1 224 ? 3.001   24.510  -44.560 1.00 60.46  ? 224  ARG B NH1 1 
ATOM   5935 N NH2 . ARG B 1 224 ? 1.458   23.586  -45.968 1.00 60.72  ? 224  ARG B NH2 1 
ATOM   5936 N N   . ALA B 1 225 ? 6.266   18.266  -42.169 1.00 45.55  ? 225  ALA B N   1 
ATOM   5937 C CA  . ALA B 1 225 ? 6.644   16.882  -41.845 1.00 44.32  ? 225  ALA B CA  1 
ATOM   5938 C C   . ALA B 1 225 ? 5.952   16.395  -40.580 1.00 43.64  ? 225  ALA B C   1 
ATOM   5939 O O   . ALA B 1 225 ? 5.741   17.169  -39.630 1.00 43.36  ? 225  ALA B O   1 
ATOM   5940 C CB  . ALA B 1 225 ? 8.174   16.775  -41.675 1.00 43.71  ? 225  ALA B CB  1 
ATOM   5941 N N   . VAL B 1 226 ? 5.597   15.113  -40.583 1.00 42.79  ? 226  VAL B N   1 
ATOM   5942 C CA  . VAL B 1 226 ? 5.088   14.412  -39.407 1.00 42.35  ? 226  VAL B CA  1 
ATOM   5943 C C   . VAL B 1 226 ? 5.890   13.143  -39.219 1.00 42.19  ? 226  VAL B C   1 
ATOM   5944 O O   . VAL B 1 226 ? 5.965   12.325  -40.140 1.00 41.83  ? 226  VAL B O   1 
ATOM   5945 C CB  . VAL B 1 226 ? 3.624   13.965  -39.575 1.00 42.67  ? 226  VAL B CB  1 
ATOM   5946 C CG1 . VAL B 1 226 ? 3.143   13.231  -38.315 1.00 40.87  ? 226  VAL B CG1 1 
ATOM   5947 C CG2 . VAL B 1 226 ? 2.712   15.162  -39.954 1.00 42.67  ? 226  VAL B CG2 1 
ATOM   5948 N N   . LEU B 1 227 ? 6.465   12.975  -38.030 1.00 42.54  ? 227  LEU B N   1 
ATOM   5949 C CA  . LEU B 1 227 ? 7.284   11.789  -37.693 1.00 42.74  ? 227  LEU B CA  1 
ATOM   5950 C C   . LEU B 1 227 ? 6.626   11.064  -36.547 1.00 42.74  ? 227  LEU B C   1 
ATOM   5951 O O   . LEU B 1 227 ? 6.689   11.535  -35.412 1.00 42.68  ? 227  LEU B O   1 
ATOM   5952 C CB  . LEU B 1 227 ? 8.714   12.165  -37.293 1.00 42.96  ? 227  LEU B CB  1 
ATOM   5953 C CG  . LEU B 1 227 ? 9.588   12.826  -38.375 1.00 43.59  ? 227  LEU B CG  1 
ATOM   5954 C CD1 . LEU B 1 227 ? 9.179   14.280  -38.605 1.00 43.05  ? 227  LEU B CD1 1 
ATOM   5955 C CD2 . LEU B 1 227 ? 11.085  12.742  -37.995 1.00 43.46  ? 227  LEU B CD2 1 
ATOM   5956 N N   . GLN B 1 228 ? 5.996   9.925   -36.863 1.00 41.84  ? 228  GLN B N   1 
ATOM   5957 C CA  . GLN B 1 228 ? 5.327   9.085   -35.888 1.00 41.98  ? 228  GLN B CA  1 
ATOM   5958 C C   . GLN B 1 228 ? 6.260   7.952   -35.467 1.00 42.17  ? 228  GLN B C   1 
ATOM   5959 O O   . GLN B 1 228 ? 6.592   7.098   -36.263 1.00 41.17  ? 228  GLN B O   1 
ATOM   5960 C CB  . GLN B 1 228 ? 4.046   8.497   -36.508 1.00 42.29  ? 228  GLN B CB  1 
ATOM   5961 C CG  . GLN B 1 228 ? 3.096   9.578   -37.043 1.00 42.44  ? 228  GLN B CG  1 
ATOM   5962 C CD  . GLN B 1 228 ? 1.927   9.041   -37.874 1.00 44.78  ? 228  GLN B CD  1 
ATOM   5963 O OE1 . GLN B 1 228 ? 1.455   9.736   -38.775 1.00 46.28  ? 228  GLN B OE1 1 
ATOM   5964 N NE2 . GLN B 1 228 ? 1.453   7.821   -37.574 1.00 39.23  ? 228  GLN B NE2 1 
ATOM   5965 N N   . SER B 1 229 ? 6.676   7.957   -34.206 1.00 42.75  ? 229  SER B N   1 
ATOM   5966 C CA  . SER B 1 229 ? 7.412   6.844   -33.620 1.00 42.96  ? 229  SER B CA  1 
ATOM   5967 C C   . SER B 1 229 ? 8.673   6.484   -34.401 1.00 43.09  ? 229  SER B C   1 
ATOM   5968 O O   . SER B 1 229 ? 8.941   5.317   -34.620 1.00 43.76  ? 229  SER B O   1 
ATOM   5969 C CB  . SER B 1 229 ? 6.493   5.609   -33.487 1.00 43.72  ? 229  SER B CB  1 
ATOM   5970 O OG  . SER B 1 229 ? 5.345   5.900   -32.705 1.00 43.04  ? 229  SER B OG  1 
ATOM   5971 N N   . GLY B 1 230 ? 9.457   7.484   -34.794 1.00 42.66  ? 230  GLY B N   1 
ATOM   5972 C CA  . GLY B 1 230 ? 10.669  7.241   -35.555 1.00 42.87  ? 230  GLY B CA  1 
ATOM   5973 C C   . GLY B 1 230 ? 11.421  8.511   -35.875 1.00 42.90  ? 230  GLY B C   1 
ATOM   5974 O O   . GLY B 1 230 ? 10.828  9.581   -35.977 1.00 42.84  ? 230  GLY B O   1 
ATOM   5975 N N   . THR B 1 231 ? 12.735  8.388   -36.032 1.00 43.66  ? 231  THR B N   1 
ATOM   5976 C CA  . THR B 1 231 ? 13.628  9.529   -36.135 1.00 43.83  ? 231  THR B CA  1 
ATOM   5977 C C   . THR B 1 231 ? 14.854  9.148   -36.954 1.00 44.72  ? 231  THR B C   1 
ATOM   5978 O O   . THR B 1 231 ? 15.265  7.987   -36.933 1.00 44.82  ? 231  THR B O   1 
ATOM   5979 C CB  . THR B 1 231 ? 14.118  9.972   -34.708 1.00 44.85  ? 231  THR B CB  1 
ATOM   5980 O OG1 . THR B 1 231 ? 14.734  8.855   -34.045 1.00 44.92  ? 231  THR B OG1 1 
ATOM   5981 C CG2 . THR B 1 231 ? 12.958  10.508  -33.846 1.00 43.91  ? 231  THR B CG2 1 
ATOM   5982 N N   . PRO B 1 232 ? 15.455  10.118  -37.669 1.00 45.11  ? 232  PRO B N   1 
ATOM   5983 C CA  . PRO B 1 232 ? 16.683  9.840   -38.413 1.00 45.99  ? 232  PRO B CA  1 
ATOM   5984 C C   . PRO B 1 232 ? 17.859  9.608   -37.480 1.00 47.06  ? 232  PRO B C   1 
ATOM   5985 O O   . PRO B 1 232 ? 18.713  8.793   -37.766 1.00 47.71  ? 232  PRO B O   1 
ATOM   5986 C CB  . PRO B 1 232 ? 16.906  11.118  -39.232 1.00 45.92  ? 232  PRO B CB  1 
ATOM   5987 C CG  . PRO B 1 232 ? 16.156  12.182  -38.507 1.00 45.97  ? 232  PRO B CG  1 
ATOM   5988 C CD  . PRO B 1 232 ? 15.006  11.514  -37.837 1.00 45.04  ? 232  PRO B CD  1 
ATOM   5989 N N   . ASN B 1 233 ? 17.901  10.367  -36.389 1.00 48.14  ? 233  ASN B N   1 
ATOM   5990 C CA  . ASN B 1 233 ? 18.864  10.167  -35.311 1.00 48.48  ? 233  ASN B CA  1 
ATOM   5991 C C   . ASN B 1 233 ? 18.507  8.904   -34.543 1.00 49.24  ? 233  ASN B C   1 
ATOM   5992 O O   . ASN B 1 233 ? 17.377  8.399   -34.647 1.00 49.24  ? 233  ASN B O   1 
ATOM   5993 C CB  . ASN B 1 233 ? 18.898  11.394  -34.371 1.00 48.65  ? 233  ASN B CB  1 
ATOM   5994 C CG  . ASN B 1 233 ? 17.507  11.805  -33.853 1.00 46.63  ? 233  ASN B CG  1 
ATOM   5995 O OD1 . ASN B 1 233 ? 16.633  12.152  -34.621 1.00 47.95  ? 233  ASN B OD1 1 
ATOM   5996 N ND2 . ASN B 1 233 ? 17.325  11.785  -32.546 1.00 46.49  ? 233  ASN B ND2 1 
ATOM   5997 N N   . GLY B 1 234 ? 19.455  8.383   -33.773 1.00 50.04  ? 234  GLY B N   1 
ATOM   5998 C CA  . GLY B 1 234 ? 19.167  7.231   -32.920 1.00 50.63  ? 234  GLY B CA  1 
ATOM   5999 C C   . GLY B 1 234 ? 19.829  5.939   -33.382 1.00 51.49  ? 234  GLY B C   1 
ATOM   6000 O O   . GLY B 1 234 ? 20.464  5.894   -34.432 1.00 51.66  ? 234  GLY B O   1 
ATOM   6001 N N   . PRO B 1 235 ? 19.663  4.871   -32.589 1.00 51.58  ? 235  PRO B N   1 
ATOM   6002 C CA  . PRO B 1 235 ? 20.519  3.685   -32.670 1.00 51.96  ? 235  PRO B CA  1 
ATOM   6003 C C   . PRO B 1 235 ? 20.333  2.751   -33.881 1.00 51.27  ? 235  PRO B C   1 
ATOM   6004 O O   . PRO B 1 235 ? 21.251  1.981   -34.187 1.00 52.22  ? 235  PRO B O   1 
ATOM   6005 C CB  . PRO B 1 235 ? 20.214  2.958   -31.352 1.00 52.37  ? 235  PRO B CB  1 
ATOM   6006 C CG  . PRO B 1 235 ? 18.826  3.368   -31.001 1.00 51.87  ? 235  PRO B CG  1 
ATOM   6007 C CD  . PRO B 1 235 ? 18.651  4.768   -31.521 1.00 50.97  ? 235  PRO B CD  1 
ATOM   6008 N N   . TRP B 1 236 ? 19.192  2.827   -34.568 1.00 49.55  ? 236  TRP B N   1 
ATOM   6009 C CA  . TRP B 1 236 ? 18.835  1.818   -35.582 1.00 48.51  ? 236  TRP B CA  1 
ATOM   6010 C C   . TRP B 1 236 ? 18.646  2.355   -37.009 1.00 47.46  ? 236  TRP B C   1 
ATOM   6011 O O   . TRP B 1 236 ? 18.662  1.580   -37.975 1.00 46.93  ? 236  TRP B O   1 
ATOM   6012 C CB  . TRP B 1 236 ? 17.571  1.077   -35.149 1.00 48.28  ? 236  TRP B CB  1 
ATOM   6013 C CG  . TRP B 1 236 ? 16.406  1.981   -34.927 1.00 47.87  ? 236  TRP B CG  1 
ATOM   6014 C CD1 . TRP B 1 236 ? 16.036  2.552   -33.749 1.00 47.86  ? 236  TRP B CD1 1 
ATOM   6015 C CD2 . TRP B 1 236 ? 15.470  2.444   -35.908 1.00 46.71  ? 236  TRP B CD2 1 
ATOM   6016 N NE1 . TRP B 1 236 ? 14.927  3.330   -33.926 1.00 47.47  ? 236  TRP B NE1 1 
ATOM   6017 C CE2 . TRP B 1 236 ? 14.552  3.284   -35.241 1.00 47.22  ? 236  TRP B CE2 1 
ATOM   6018 C CE3 . TRP B 1 236 ? 15.303  2.217   -37.281 1.00 47.72  ? 236  TRP B CE3 1 
ATOM   6019 C CZ2 . TRP B 1 236 ? 13.483  3.902   -35.897 1.00 45.52  ? 236  TRP B CZ2 1 
ATOM   6020 C CZ3 . TRP B 1 236 ? 14.235  2.832   -37.938 1.00 46.60  ? 236  TRP B CZ3 1 
ATOM   6021 C CH2 . TRP B 1 236 ? 13.349  3.674   -37.242 1.00 45.63  ? 236  TRP B CH2 1 
ATOM   6022 N N   . ALA B 1 237 ? 18.483  3.666   -37.159 1.00 46.40  ? 237  ALA B N   1 
ATOM   6023 C CA  . ALA B 1 237 ? 18.015  4.233   -38.431 1.00 45.62  ? 237  ALA B CA  1 
ATOM   6024 C C   . ALA B 1 237 ? 19.137  4.470   -39.430 1.00 46.01  ? 237  ALA B C   1 
ATOM   6025 O O   . ALA B 1 237 ? 18.865  4.628   -40.619 1.00 46.28  ? 237  ALA B O   1 
ATOM   6026 C CB  . ALA B 1 237 ? 17.224  5.555   -38.184 1.00 44.90  ? 237  ALA B CB  1 
ATOM   6027 N N   . THR B 1 238 ? 20.387  4.513   -38.968 1.00 46.54  ? 238  THR B N   1 
ATOM   6028 C CA  . THR B 1 238 ? 21.528  4.659   -39.862 1.00 47.04  ? 238  THR B CA  1 
ATOM   6029 C C   . THR B 1 238 ? 22.723  3.783   -39.456 1.00 48.52  ? 238  THR B C   1 
ATOM   6030 O O   . THR B 1 238 ? 22.818  3.315   -38.320 1.00 48.65  ? 238  THR B O   1 
ATOM   6031 C CB  . THR B 1 238 ? 22.030  6.116   -39.916 1.00 47.52  ? 238  THR B CB  1 
ATOM   6032 O OG1 . THR B 1 238 ? 22.482  6.510   -38.608 1.00 47.60  ? 238  THR B OG1 1 
ATOM   6033 C CG2 . THR B 1 238 ? 20.942  7.070   -40.426 1.00 45.07  ? 238  THR B CG2 1 
ATOM   6034 N N   . VAL B 1 239 ? 23.625  3.566   -40.414 1.00 49.38  ? 239  VAL B N   1 
ATOM   6035 C CA  . VAL B 1 239 ? 24.921  2.952   -40.154 1.00 51.15  ? 239  VAL B CA  1 
ATOM   6036 C C   . VAL B 1 239 ? 26.021  3.807   -40.786 1.00 52.49  ? 239  VAL B C   1 
ATOM   6037 O O   . VAL B 1 239 ? 25.771  4.594   -41.710 1.00 51.74  ? 239  VAL B O   1 
ATOM   6038 C CB  . VAL B 1 239 ? 24.990  1.464   -40.665 1.00 51.75  ? 239  VAL B CB  1 
ATOM   6039 C CG1 . VAL B 1 239 ? 24.042  0.602   -39.872 1.00 51.47  ? 239  VAL B CG1 1 
ATOM   6040 C CG2 . VAL B 1 239 ? 24.670  1.346   -42.159 1.00 50.58  ? 239  VAL B CG2 1 
ATOM   6041 N N   . SER B 1 240 ? 27.239  3.664   -40.274 1.00 54.61  ? 240  SER B N   1 
ATOM   6042 C CA  . SER B 1 240 ? 28.398  4.304   -40.884 1.00 56.21  ? 240  SER B CA  1 
ATOM   6043 C C   . SER B 1 240 ? 28.681  3.630   -42.220 1.00 57.24  ? 240  SER B C   1 
ATOM   6044 O O   . SER B 1 240 ? 28.147  2.559   -42.503 1.00 57.02  ? 240  SER B O   1 
ATOM   6045 C CB  . SER B 1 240 ? 29.608  4.148   -39.985 1.00 57.72  ? 240  SER B CB  1 
ATOM   6046 O OG  . SER B 1 240 ? 29.946  2.780   -39.915 1.00 59.03  ? 240  SER B OG  1 
ATOM   6047 N N   . ALA B 1 241 ? 29.528  4.257   -43.034 1.00 58.79  ? 241  ALA B N   1 
ATOM   6048 C CA  . ALA B 1 241 ? 29.962  3.675   -44.311 1.00 59.68  ? 241  ALA B CA  1 
ATOM   6049 C C   . ALA B 1 241 ? 30.723  2.373   -44.095 1.00 61.19  ? 241  ALA B C   1 
ATOM   6050 O O   . ALA B 1 241 ? 30.456  1.375   -44.769 1.00 61.79  ? 241  ALA B O   1 
ATOM   6051 C CB  . ALA B 1 241 ? 30.825  4.668   -45.080 1.00 60.46  ? 241  ALA B CB  1 
ATOM   6052 N N   . GLY B 1 242 ? 31.669  2.387   -43.155 1.00 62.24  ? 242  GLY B N   1 
ATOM   6053 C CA  . GLY B 1 242 ? 32.421  1.191   -42.781 1.00 63.29  ? 242  GLY B CA  1 
ATOM   6054 C C   . GLY B 1 242 ? 31.573  -0.020  -42.422 1.00 62.58  ? 242  GLY B C   1 
ATOM   6055 O O   . GLY B 1 242 ? 31.868  -1.134  -42.843 1.00 62.85  ? 242  GLY B O   1 
ATOM   6056 N N   . GLU B 1 243 ? 30.505  0.194   -41.657 1.00 61.22  ? 243  GLU B N   1 
ATOM   6057 C CA  . GLU B 1 243 ? 29.667  -0.912  -41.188 1.00 60.57  ? 243  GLU B CA  1 
ATOM   6058 C C   . GLU B 1 243 ? 28.753  -1.427  -42.298 1.00 59.64  ? 243  GLU B C   1 
ATOM   6059 O O   . GLU B 1 243 ? 28.469  -2.630  -42.370 1.00 60.06  ? 243  GLU B O   1 
ATOM   6060 C CB  . GLU B 1 243 ? 28.856  -0.484  -39.958 1.00 59.35  ? 243  GLU B CB  1 
ATOM   6061 C CG  . GLU B 1 243 ? 27.796  -1.487  -39.481 1.00 59.00  ? 243  GLU B CG  1 
ATOM   6062 C CD  . GLU B 1 243 ? 28.360  -2.764  -38.870 1.00 60.56  ? 243  GLU B CD  1 
ATOM   6063 O OE1 . GLU B 1 243 ? 27.532  -3.596  -38.439 1.00 60.08  ? 243  GLU B OE1 1 
ATOM   6064 O OE2 . GLU B 1 243 ? 29.604  -2.955  -38.813 1.00 60.26  ? 243  GLU B OE2 1 
ATOM   6065 N N   . ALA B 1 244 ? 28.287  -0.516  -43.153 1.00 58.46  ? 244  ALA B N   1 
ATOM   6066 C CA  . ALA B 1 244 ? 27.503  -0.884  -44.344 1.00 57.18  ? 244  ALA B CA  1 
ATOM   6067 C C   . ALA B 1 244 ? 28.313  -1.806  -45.261 1.00 58.26  ? 244  ALA B C   1 
ATOM   6068 O O   . ALA B 1 244 ? 27.812  -2.833  -45.718 1.00 57.69  ? 244  ALA B O   1 
ATOM   6069 C CB  . ALA B 1 244 ? 27.061  0.362   -45.100 1.00 55.57  ? 244  ALA B CB  1 
ATOM   6070 N N   . ARG B 1 245 ? 29.566  -1.424  -45.504 1.00 59.42  ? 245  ARG B N   1 
ATOM   6071 C CA  . ARG B 1 245 ? 30.496  -2.186  -46.337 1.00 61.17  ? 245  ARG B CA  1 
ATOM   6072 C C   . ARG B 1 245 ? 30.773  -3.581  -45.791 1.00 62.33  ? 245  ARG B C   1 
ATOM   6073 O O   . ARG B 1 245 ? 30.899  -4.558  -46.544 1.00 63.06  ? 245  ARG B O   1 
ATOM   6074 C CB  . ARG B 1 245 ? 31.826  -1.435  -46.446 1.00 62.34  ? 245  ARG B CB  1 
ATOM   6075 C CG  . ARG B 1 245 ? 32.898  -2.205  -47.210 1.00 65.36  ? 245  ARG B CG  1 
ATOM   6076 C CD  . ARG B 1 245 ? 34.072  -1.321  -47.587 1.00 67.68  ? 245  ARG B CD  1 
ATOM   6077 N NE  . ARG B 1 245 ? 33.687  -0.377  -48.633 1.00 67.46  ? 245  ARG B NE  1 
ATOM   6078 C CZ  . ARG B 1 245 ? 33.739  -0.630  -49.939 1.00 67.99  ? 245  ARG B CZ  1 
ATOM   6079 N NH1 . ARG B 1 245 ? 33.354  0.304   -50.794 1.00 66.94  ? 245  ARG B NH1 1 
ATOM   6080 N NH2 . ARG B 1 245 ? 34.163  -1.800  -50.395 1.00 67.91  ? 245  ARG B NH2 1 
ATOM   6081 N N   . ARG B 1 246 ? 30.919  -3.644  -44.475 1.00 62.72  ? 246  ARG B N   1 
ATOM   6082 C CA  . ARG B 1 246 ? 31.179  -4.883  -43.760 1.00 64.00  ? 246  ARG B CA  1 
ATOM   6083 C C   . ARG B 1 246 ? 29.979  -5.832  -43.894 1.00 62.71  ? 246  ARG B C   1 
ATOM   6084 O O   . ARG B 1 246 ? 30.132  -7.019  -44.189 1.00 62.87  ? 246  ARG B O   1 
ATOM   6085 C CB  . ARG B 1 246 ? 31.441  -4.536  -42.295 1.00 64.60  ? 246  ARG B CB  1 
ATOM   6086 C CG  . ARG B 1 246 ? 31.911  -5.678  -41.438 1.00 67.87  ? 246  ARG B CG  1 
ATOM   6087 C CD  . ARG B 1 246 ? 31.333  -5.593  -40.025 1.00 70.10  ? 246  ARG B CD  1 
ATOM   6088 N NE  . ARG B 1 246 ? 30.765  -6.891  -39.687 1.00 72.14  ? 246  ARG B NE  1 
ATOM   6089 C CZ  . ARG B 1 246 ? 29.510  -7.128  -39.316 1.00 71.72  ? 246  ARG B CZ  1 
ATOM   6090 N NH1 . ARG B 1 246 ? 28.644  -6.148  -39.122 1.00 69.94  ? 246  ARG B NH1 1 
ATOM   6091 N NH2 . ARG B 1 246 ? 29.145  -8.384  -39.078 1.00 74.62  ? 246  ARG B NH2 1 
ATOM   6092 N N   . ARG B 1 247 ? 28.778  -5.294  -43.701 1.00 60.75  ? 247  ARG B N   1 
ATOM   6093 C CA  . ARG B 1 247 ? 27.552  -6.097  -43.824 1.00 60.00  ? 247  ARG B CA  1 
ATOM   6094 C C   . ARG B 1 247 ? 27.274  -6.591  -45.252 1.00 59.89  ? 247  ARG B C   1 
ATOM   6095 O O   . ARG B 1 247 ? 26.828  -7.722  -45.445 1.00 60.51  ? 247  ARG B O   1 
ATOM   6096 C CB  . ARG B 1 247 ? 26.346  -5.332  -43.288 1.00 58.21  ? 247  ARG B CB  1 
ATOM   6097 C CG  . ARG B 1 247 ? 26.366  -5.127  -41.772 1.00 58.03  ? 247  ARG B CG  1 
ATOM   6098 C CD  . ARG B 1 247 ? 25.178  -4.311  -41.337 1.00 56.09  ? 247  ARG B CD  1 
ATOM   6099 N NE  . ARG B 1 247 ? 25.288  -3.862  -39.957 1.00 56.26  ? 247  ARG B NE  1 
ATOM   6100 C CZ  . ARG B 1 247 ? 24.302  -3.282  -39.269 1.00 55.89  ? 247  ARG B CZ  1 
ATOM   6101 N NH1 . ARG B 1 247 ? 23.096  -3.110  -39.796 1.00 54.29  ? 247  ARG B NH1 1 
ATOM   6102 N NH2 . ARG B 1 247 ? 24.514  -2.903  -38.017 1.00 56.79  ? 247  ARG B NH2 1 
ATOM   6103 N N   . ALA B 1 248 ? 27.540  -5.745  -46.241 1.00 59.42  ? 248  ALA B N   1 
ATOM   6104 C CA  . ALA B 1 248 ? 27.356  -6.104  -47.639 1.00 59.50  ? 248  ALA B CA  1 
ATOM   6105 C C   . ALA B 1 248 ? 28.371  -7.170  -48.063 1.00 61.81  ? 248  ALA B C   1 
ATOM   6106 O O   . ALA B 1 248 ? 28.028  -8.103  -48.809 1.00 62.52  ? 248  ALA B O   1 
ATOM   6107 C CB  . ALA B 1 248 ? 27.489  -4.875  -48.510 1.00 58.76  ? 248  ALA B CB  1 
ATOM   6108 N N   . THR B 1 249 ? 29.613  -7.025  -47.592 1.00 63.15  ? 249  THR B N   1 
ATOM   6109 C CA  . THR B 1 249 ? 30.682  -7.991  -47.869 1.00 65.33  ? 249  THR B CA  1 
ATOM   6110 C C   . THR B 1 249 ? 30.416  -9.358  -47.239 1.00 66.04  ? 249  THR B C   1 
ATOM   6111 O O   . THR B 1 249 ? 30.632  -10.393 -47.857 1.00 67.51  ? 249  THR B O   1 
ATOM   6112 C CB  . THR B 1 249 ? 32.032  -7.475  -47.362 1.00 66.69  ? 249  THR B CB  1 
ATOM   6113 O OG1 . THR B 1 249 ? 32.310  -6.205  -47.957 1.00 67.27  ? 249  THR B OG1 1 
ATOM   6114 C CG2 . THR B 1 249 ? 33.145  -8.443  -47.726 1.00 69.10  ? 249  THR B CG2 1 
ATOM   6115 N N   . LEU B 1 250 ? 29.949  -9.358  -46.001 1.00 65.62  ? 250  LEU B N   1 
ATOM   6116 C CA  . LEU B 1 250 ? 29.582  -10.598 -45.329 1.00 66.21  ? 250  LEU B CA  1 
ATOM   6117 C C   . LEU B 1 250 ? 28.419  -11.300 -46.052 1.00 65.98  ? 250  LEU B C   1 
ATOM   6118 O O   . LEU B 1 250 ? 28.485  -12.500 -46.303 1.00 66.66  ? 250  LEU B O   1 
ATOM   6119 C CB  . LEU B 1 250 ? 29.239  -10.314 -43.860 1.00 65.27  ? 250  LEU B CB  1 
ATOM   6120 C CG  . LEU B 1 250 ? 28.837  -11.499 -42.982 1.00 65.38  ? 250  LEU B CG  1 
ATOM   6121 C CD1 . LEU B 1 250 ? 29.866  -12.601 -43.071 1.00 65.43  ? 250  LEU B CD1 1 
ATOM   6122 C CD2 . LEU B 1 250 ? 28.648  -11.055 -41.547 1.00 62.32  ? 250  LEU B CD2 1 
ATOM   6123 N N   . LEU B 1 251 ? 27.363  -10.554 -46.388 1.00 64.78  ? 251  LEU B N   1 
ATOM   6124 C CA  . LEU B 1 251 ? 26.215  -11.137 -47.103 1.00 64.85  ? 251  LEU B CA  1 
ATOM   6125 C C   . LEU B 1 251 ? 26.664  -11.782 -48.405 1.00 66.37  ? 251  LEU B C   1 
ATOM   6126 O O   . LEU B 1 251 ? 26.257  -12.910 -48.715 1.00 67.44  ? 251  LEU B O   1 
ATOM   6127 C CB  . LEU B 1 251 ? 25.153  -10.093 -47.404 1.00 62.99  ? 251  LEU B CB  1 
ATOM   6128 C CG  . LEU B 1 251 ? 23.927  -10.573 -48.206 1.00 63.78  ? 251  LEU B CG  1 
ATOM   6129 C CD1 . LEU B 1 251 ? 23.041  -11.527 -47.400 1.00 63.81  ? 251  LEU B CD1 1 
ATOM   6130 C CD2 . LEU B 1 251 ? 23.129  -9.375  -48.649 1.00 62.54  ? 251  LEU B CD2 1 
ATOM   6131 N N   . ALA B 1 252 ? 27.505  -11.068 -49.156 1.00 66.84  ? 252  ALA B N   1 
ATOM   6132 C CA  . ALA B 1 252 ? 28.057  -11.587 -50.399 1.00 68.35  ? 252  ALA B CA  1 
ATOM   6133 C C   . ALA B 1 252 ? 28.784  -12.905 -50.141 1.00 70.92  ? 252  ALA B C   1 
ATOM   6134 O O   . ALA B 1 252 ? 28.555  -13.889 -50.838 1.00 71.93  ? 252  ALA B O   1 
ATOM   6135 C CB  . ALA B 1 252 ? 28.994  -10.579 -51.019 1.00 68.45  ? 252  ALA B CB  1 
ATOM   6136 N N   . ARG B 1 253 ? 29.642  -12.931 -49.125 1.00 72.45  ? 253  ARG B N   1 
ATOM   6137 C CA  . ARG B 1 253 ? 30.378  -14.161 -48.777 1.00 75.11  ? 253  ARG B CA  1 
ATOM   6138 C C   . ARG B 1 253 ? 29.383  -15.290 -48.482 1.00 75.25  ? 253  ARG B C   1 
ATOM   6139 O O   . ARG B 1 253 ? 29.566  -16.413 -48.928 1.00 76.59  ? 253  ARG B O   1 
ATOM   6140 C CB  A ARG B 1 253 ? 31.302  -13.904 -47.569 0.50 75.78  ? 253  ARG B CB  1 
ATOM   6141 C CB  B ARG B 1 253 ? 31.302  -13.968 -47.565 0.50 76.06  ? 253  ARG B CB  1 
ATOM   6142 C CG  A ARG B 1 253 ? 32.728  -14.421 -47.736 0.50 78.55  ? 253  ARG B CG  1 
ATOM   6143 C CG  B ARG B 1 253 ? 32.308  -15.123 -47.366 0.50 79.63  ? 253  ARG B CG  1 
ATOM   6144 C CD  A ARG B 1 253 ? 33.630  -14.062 -46.542 0.50 79.30  ? 253  ARG B CD  1 
ATOM   6145 C CD  B ARG B 1 253 ? 32.726  -15.326 -45.899 0.50 81.79  ? 253  ARG B CD  1 
ATOM   6146 N NE  A ARG B 1 253 ? 34.081  -12.659 -46.538 0.50 78.27  ? 253  ARG B NE  1 
ATOM   6147 N NE  B ARG B 1 253 ? 31.723  -16.060 -45.120 0.50 82.12  ? 253  ARG B NE  1 
ATOM   6148 C CZ  A ARG B 1 253 ? 33.716  -11.713 -45.664 0.50 75.99  ? 253  ARG B CZ  1 
ATOM   6149 C CZ  B ARG B 1 253 ? 31.793  -16.294 -43.809 0.50 82.91  ? 253  ARG B CZ  1 
ATOM   6150 N NH1 A ARG B 1 253 ? 32.862  -11.956 -44.673 0.50 74.43  ? 253  ARG B NH1 1 
ATOM   6151 N NH1 B ARG B 1 253 ? 32.823  -15.857 -43.090 0.50 83.79  ? 253  ARG B NH1 1 
ATOM   6152 N NH2 A ARG B 1 253 ? 34.220  -10.493 -45.786 0.50 75.67  ? 253  ARG B NH2 1 
ATOM   6153 N NH2 B ARG B 1 253 ? 30.819  -16.971 -43.208 0.50 82.54  ? 253  ARG B NH2 1 
ATOM   6154 N N   . LEU B 1 254 ? 28.320  -14.972 -47.746 1.00 74.20  ? 254  LEU B N   1 
ATOM   6155 C CA  . LEU B 1 254 ? 27.310  -15.966 -47.355 1.00 74.63  ? 254  LEU B CA  1 
ATOM   6156 C C   . LEU B 1 254 ? 26.527  -16.567 -48.525 1.00 75.11  ? 254  LEU B C   1 
ATOM   6157 O O   . LEU B 1 254 ? 26.099  -17.719 -48.451 1.00 75.79  ? 254  LEU B O   1 
ATOM   6158 C CB  . LEU B 1 254 ? 26.327  -15.362 -46.342 1.00 72.76  ? 254  LEU B CB  1 
ATOM   6159 C CG  . LEU B 1 254 ? 26.894  -15.115 -44.938 1.00 72.76  ? 254  LEU B CG  1 
ATOM   6160 C CD1 . LEU B 1 254 ? 25.868  -14.424 -44.073 1.00 68.53  ? 254  LEU B CD1 1 
ATOM   6161 C CD2 . LEU B 1 254 ? 27.357  -16.429 -44.302 1.00 73.77  ? 254  LEU B CD2 1 
ATOM   6162 N N   . VAL B 1 255 ? 26.325  -15.784 -49.585 1.00 74.83  ? 255  VAL B N   1 
ATOM   6163 C CA  . VAL B 1 255 ? 25.645  -16.270 -50.794 1.00 75.46  ? 255  VAL B CA  1 
ATOM   6164 C C   . VAL B 1 255 ? 26.636  -16.761 -51.865 1.00 78.00  ? 255  VAL B C   1 
ATOM   6165 O O   . VAL B 1 255 ? 26.226  -17.172 -52.944 1.00 78.60  ? 255  VAL B O   1 
ATOM   6166 C CB  . VAL B 1 255 ? 24.696  -15.199 -51.389 1.00 73.30  ? 255  VAL B CB  1 
ATOM   6167 C CG1 . VAL B 1 255 ? 23.616  -14.840 -50.379 1.00 71.69  ? 255  VAL B CG1 1 
ATOM   6168 C CG2 . VAL B 1 255 ? 25.462  -13.955 -51.816 1.00 72.35  ? 255  VAL B CG2 1 
ATOM   6169 N N   . GLY B 1 256 ? 27.933  -16.705 -51.566 1.00 80.03  ? 256  GLY B N   1 
ATOM   6170 C CA  . GLY B 1 256 ? 28.963  -17.282 -52.426 1.00 82.58  ? 256  GLY B CA  1 
ATOM   6171 C C   . GLY B 1 256 ? 29.640  -16.328 -53.396 1.00 83.08  ? 256  GLY B C   1 
ATOM   6172 O O   . GLY B 1 256 ? 30.100  -16.760 -54.446 1.00 84.36  ? 256  GLY B O   1 
ATOM   6173 N N   . CYS B 1 257 ? 29.741  -15.046 -53.047 1.00 82.64  ? 257  CYS B N   1 
ATOM   6174 C CA  . CYS B 1 257 ? 30.297  -14.043 -53.970 1.00 83.40  ? 257  CYS B CA  1 
ATOM   6175 C C   . CYS B 1 257 ? 31.696  -13.511 -53.596 1.00 85.46  ? 257  CYS B C   1 
ATOM   6176 O O   . CYS B 1 257 ? 32.044  -13.481 -52.408 1.00 86.07  ? 257  CYS B O   1 
ATOM   6177 C CB  . CYS B 1 257 ? 29.324  -12.875 -54.110 1.00 80.83  ? 257  CYS B CB  1 
ATOM   6178 S SG  . CYS B 1 257 ? 27.889  -13.287 -55.097 1.00 80.38  ? 257  CYS B SG  1 
ATOM   6179 N N   . PRO B 1 258 ? 32.507  -13.094 -54.615 1.00 86.82  ? 258  PRO B N   1 
ATOM   6180 C CA  . PRO B 1 258 ? 32.300  -13.228 -56.043 1.00 86.93  ? 258  PRO B CA  1 
ATOM   6181 C C   . PRO B 1 258 ? 33.068  -14.442 -56.577 1.00 89.82  ? 258  PRO B C   1 
ATOM   6182 O O   . PRO B 1 258 ? 32.483  -15.325 -57.212 1.00 90.61  ? 258  PRO B O   1 
ATOM   6183 C CB  . PRO B 1 258 ? 32.890  -11.923 -56.599 1.00 86.31  ? 258  PRO B CB  1 
ATOM   6184 C CG  . PRO B 1 258 ? 33.842  -11.435 -55.587 1.00 86.72  ? 258  PRO B CG  1 
ATOM   6185 C CD  . PRO B 1 258 ? 33.765  -12.366 -54.382 1.00 88.11  ? 258  PRO B CD  1 
ATOM   6186 N N   . GLY B 1 263 ? 37.566  -12.609 -51.907 1.00 98.62  ? 263  GLY B N   1 
ATOM   6187 C CA  . GLY B 1 263 ? 36.797  -11.567 -52.587 1.00 96.52  ? 263  GLY B CA  1 
ATOM   6188 C C   . GLY B 1 263 ? 37.603  -10.772 -53.608 1.00 97.28  ? 263  GLY B C   1 
ATOM   6189 O O   . GLY B 1 263 ? 38.476  -11.319 -54.295 1.00 99.60  ? 263  GLY B O   1 
ATOM   6190 N N   . GLY B 1 264 ? 37.300  -9.478  -53.707 1.00 95.36  ? 264  GLY B N   1 
ATOM   6191 C CA  . GLY B 1 264 ? 37.978  -8.564  -54.633 1.00 95.53  ? 264  GLY B CA  1 
ATOM   6192 C C   . GLY B 1 264 ? 37.047  -7.437  -55.063 1.00 92.73  ? 264  GLY B C   1 
ATOM   6193 O O   . GLY B 1 264 ? 35.913  -7.369  -54.595 1.00 90.90  ? 264  GLY B O   1 
ATOM   6194 N N   . ASN B 1 265 ? 37.564  -6.542  -55.913 1.00 92.36  ? 265  ASN B N   1 
ATOM   6195 C CA  . ASN B 1 265 ? 36.808  -5.504  -56.651 1.00 89.78  ? 265  ASN B CA  1 
ATOM   6196 C C   . ASN B 1 265 ? 35.319  -5.333  -56.288 1.00 85.90  ? 265  ASN B C   1 
ATOM   6197 O O   . ASN B 1 265 ? 34.561  -6.304  -56.306 1.00 85.13  ? 265  ASN B O   1 
ATOM   6198 C CB  . ASN B 1 265 ? 36.942  -5.814  -58.157 1.00 91.15  ? 265  ASN B CB  1 
ATOM   6199 C CG  . ASN B 1 265 ? 36.704  -4.596  -59.054 1.00 91.25  ? 265  ASN B CG  1 
ATOM   6200 O OD1 . ASN B 1 265 ? 35.674  -3.926  -58.952 1.00 89.89  ? 265  ASN B OD1 1 
ATOM   6201 N ND2 . ASN B 1 265 ? 37.653  -4.328  -59.962 1.00 93.76  ? 265  ASN B ND2 1 
ATOM   6202 N N   . ASP B 1 266 ? 34.901  -4.101  -55.983 1.00 82.88  ? 266  ASP B N   1 
ATOM   6203 C CA  . ASP B 1 266 ? 33.476  -3.808  -55.745 1.00 79.42  ? 266  ASP B CA  1 
ATOM   6204 C C   . ASP B 1 266 ? 32.608  -4.250  -56.919 1.00 78.06  ? 266  ASP B C   1 
ATOM   6205 O O   . ASP B 1 266 ? 31.605  -4.942  -56.733 1.00 76.67  ? 266  ASP B O   1 
ATOM   6206 C CB  . ASP B 1 266 ? 33.237  -2.307  -55.498 1.00 78.09  ? 266  ASP B CB  1 
ATOM   6207 C CG  . ASP B 1 266 ? 33.480  -1.888  -54.046 1.00 77.11  ? 266  ASP B CG  1 
ATOM   6208 O OD1 . ASP B 1 266 ? 33.556  -2.767  -53.163 1.00 75.93  ? 266  ASP B OD1 1 
ATOM   6209 O OD2 . ASP B 1 266 ? 33.589  -0.668  -53.795 1.00 74.99  ? 266  ASP B OD2 1 
ATOM   6210 N N   . THR B 1 267 ? 33.004  -3.836  -58.122 1.00 77.94  ? 267  THR B N   1 
ATOM   6211 C CA  . THR B 1 267 ? 32.284  -4.164  -59.358 1.00 76.98  ? 267  THR B CA  1 
ATOM   6212 C C   . THR B 1 267 ? 31.997  -5.657  -59.479 1.00 76.91  ? 267  THR B C   1 
ATOM   6213 O O   . THR B 1 267 ? 30.861  -6.058  -59.732 1.00 75.61  ? 267  THR B O   1 
ATOM   6214 C CB  . THR B 1 267 ? 33.073  -3.680  -60.591 1.00 78.34  ? 267  THR B CB  1 
ATOM   6215 O OG1 . THR B 1 267 ? 33.160  -2.250  -60.553 1.00 77.87  ? 267  THR B OG1 1 
ATOM   6216 C CG2 . THR B 1 267 ? 32.403  -4.107  -61.886 1.00 78.25  ? 267  THR B CG2 1 
ATOM   6217 N N   . GLU B 1 268 ? 33.027  -6.468  -59.259 1.00 78.17  ? 268  GLU B N   1 
ATOM   6218 C CA  . GLU B 1 268 ? 32.922  -7.922  -59.359 1.00 78.69  ? 268  GLU B CA  1 
ATOM   6219 C C   . GLU B 1 268 ? 32.001  -8.492  -58.271 1.00 76.43  ? 268  GLU B C   1 
ATOM   6220 O O   . GLU B 1 268 ? 31.173  -9.363  -58.540 1.00 75.86  ? 268  GLU B O   1 
ATOM   6221 C CB  . GLU B 1 268 ? 34.320  -8.555  -59.269 1.00 81.34  ? 268  GLU B CB  1 
ATOM   6222 C CG  . GLU B 1 268 ? 34.473  -9.884  -59.997 1.00 84.46  ? 268  GLU B CG  1 
ATOM   6223 C CD  . GLU B 1 268 ? 35.877  -10.484 -59.839 1.00 89.29  ? 268  GLU B CD  1 
ATOM   6224 O OE1 . GLU B 1 268 ? 36.497  -10.294 -58.757 1.00 91.26  ? 268  GLU B OE1 1 
ATOM   6225 O OE2 . GLU B 1 268 ? 36.359  -11.144 -60.796 1.00 91.29  ? 268  GLU B OE2 1 
ATOM   6226 N N   . LEU B 1 269 ? 32.147  -7.995  -57.047 1.00 74.95  ? 269  LEU B N   1 
ATOM   6227 C CA  . LEU B 1 269 ? 31.300  -8.429  -55.941 1.00 73.16  ? 269  LEU B CA  1 
ATOM   6228 C C   . LEU B 1 269 ? 29.841  -8.084  -56.231 1.00 70.94  ? 269  LEU B C   1 
ATOM   6229 O O   . LEU B 1 269 ? 28.965  -8.929  -56.080 1.00 70.22  ? 269  LEU B O   1 
ATOM   6230 C CB  . LEU B 1 269 ? 31.769  -7.805  -54.617 1.00 72.78  ? 269  LEU B CB  1 
ATOM   6231 C CG  . LEU B 1 269 ? 30.919  -8.083  -53.366 1.00 71.25  ? 269  LEU B CG  1 
ATOM   6232 C CD1 . LEU B 1 269 ? 31.757  -8.178  -52.117 1.00 71.97  ? 269  LEU B CD1 1 
ATOM   6233 C CD2 . LEU B 1 269 ? 29.873  -7.011  -53.188 1.00 70.54  ? 269  LEU B CD2 1 
ATOM   6234 N N   . ILE B 1 270 ? 29.593  -6.856  -56.673 1.00 69.82  ? 270  ILE B N   1 
ATOM   6235 C CA  . ILE B 1 270 ? 28.223  -6.392  -56.920 1.00 68.36  ? 270  ILE B CA  1 
ATOM   6236 C C   . ILE B 1 270 ? 27.604  -7.124  -58.111 1.00 68.58  ? 270  ILE B C   1 
ATOM   6237 O O   . ILE B 1 270 ? 26.424  -7.482  -58.076 1.00 67.68  ? 270  ILE B O   1 
ATOM   6238 C CB  . ILE B 1 270 ? 28.164  -4.859  -57.138 1.00 67.62  ? 270  ILE B CB  1 
ATOM   6239 C CG1 . ILE B 1 270 ? 28.635  -4.123  -55.877 1.00 68.07  ? 270  ILE B CG1 1 
ATOM   6240 C CG2 . ILE B 1 270 ? 26.751  -4.411  -57.464 1.00 65.60  ? 270  ILE B CG2 1 
ATOM   6241 C CD1 . ILE B 1 270 ? 29.068  -2.676  -56.125 1.00 68.55  ? 270  ILE B CD1 1 
ATOM   6242 N N   . ALA B 1 271 ? 28.409  -7.362  -59.149 1.00 70.13  ? 271  ALA B N   1 
ATOM   6243 C CA  . ALA B 1 271 ? 27.976  -8.138  -60.308 1.00 70.61  ? 271  ALA B CA  1 
ATOM   6244 C C   . ALA B 1 271 ? 27.525  -9.540  -59.910 1.00 71.05  ? 271  ALA B C   1 
ATOM   6245 O O   . ALA B 1 271 ? 26.504  -10.023 -60.391 1.00 70.83  ? 271  ALA B O   1 
ATOM   6246 C CB  . ALA B 1 271 ? 29.078  -8.210  -61.339 1.00 72.19  ? 271  ALA B CB  1 
ATOM   6247 N N   . CYS B 1 272 ? 28.273  -10.187 -59.022 1.00 72.31  ? 272  CYS B N   1 
ATOM   6248 C CA  . CYS B 1 272 ? 27.888  -11.513 -58.536 1.00 72.73  ? 272  CYS B CA  1 
ATOM   6249 C C   . CYS B 1 272 ? 26.605  -11.458 -57.704 1.00 70.47  ? 272  CYS B C   1 
ATOM   6250 O O   . CYS B 1 272 ? 25.777  -12.361 -57.784 1.00 70.70  ? 272  CYS B O   1 
ATOM   6251 C CB  . CYS B 1 272 ? 29.039  -12.169 -57.746 1.00 74.89  ? 272  CYS B CB  1 
ATOM   6252 S SG  . CYS B 1 272 ? 28.650  -13.784 -56.965 1.00 76.78  ? 272  CYS B SG  1 
ATOM   6253 N N   . LEU B 1 273 ? 26.427  -10.394 -56.922 1.00 68.37  ? 273  LEU B N   1 
ATOM   6254 C CA  . LEU B 1 273 ? 25.215  -10.248 -56.125 1.00 65.95  ? 273  LEU B CA  1 
ATOM   6255 C C   . LEU B 1 273 ? 23.988  -10.077 -57.023 1.00 64.46  ? 273  LEU B C   1 
ATOM   6256 O O   . LEU B 1 273 ? 22.893  -10.535 -56.688 1.00 63.51  ? 273  LEU B O   1 
ATOM   6257 C CB  . LEU B 1 273 ? 25.328  -9.066  -55.158 1.00 64.99  ? 273  LEU B CB  1 
ATOM   6258 C CG  . LEU B 1 273 ? 26.117  -9.262  -53.864 1.00 65.24  ? 273  LEU B CG  1 
ATOM   6259 C CD1 . LEU B 1 273 ? 26.186  -7.948  -53.105 1.00 63.68  ? 273  LEU B CD1 1 
ATOM   6260 C CD2 . LEU B 1 273 ? 25.489  -10.340 -53.003 1.00 64.43  ? 273  LEU B CD2 1 
ATOM   6261 N N   . ARG B 1 274 ? 24.173  -9.428  -58.166 1.00 63.81  ? 274  ARG B N   1 
ATOM   6262 C CA  . ARG B 1 274 ? 23.081  -9.261  -59.130 1.00 62.54  ? 274  ARG B CA  1 
ATOM   6263 C C   . ARG B 1 274 ? 22.628  -10.567 -59.789 1.00 62.67  ? 274  ARG B C   1 
ATOM   6264 O O   . ARG B 1 274 ? 21.513  -10.639 -60.284 1.00 61.77  ? 274  ARG B O   1 
ATOM   6265 C CB  . ARG B 1 274 ? 23.444  -8.209  -60.180 1.00 62.75  ? 274  ARG B CB  1 
ATOM   6266 C CG  . ARG B 1 274 ? 23.495  -6.788  -59.595 1.00 61.46  ? 274  ARG B CG  1 
ATOM   6267 C CD  . ARG B 1 274 ? 23.502  -5.725  -60.662 1.00 62.72  ? 274  ARG B CD  1 
ATOM   6268 N NE  . ARG B 1 274 ? 24.597  -5.923  -61.602 1.00 66.65  ? 274  ARG B NE  1 
ATOM   6269 C CZ  . ARG B 1 274 ? 25.681  -5.152  -61.705 1.00 68.92  ? 274  ARG B CZ  1 
ATOM   6270 N NH1 . ARG B 1 274 ? 25.842  -4.080  -60.929 1.00 68.98  ? 274  ARG B NH1 1 
ATOM   6271 N NH2 . ARG B 1 274 ? 26.613  -5.455  -62.604 1.00 69.48  ? 274  ARG B NH2 1 
ATOM   6272 N N   . THR B 1 275 ? 23.473  -11.598 -59.777 1.00 63.75  ? 275  THR B N   1 
ATOM   6273 C CA  . THR B 1 275 ? 23.093  -12.902 -60.331 1.00 64.46  ? 275  THR B CA  1 
ATOM   6274 C C   . THR B 1 275 ? 22.190  -13.718 -59.397 1.00 64.29  ? 275  THR B C   1 
ATOM   6275 O O   . THR B 1 275 ? 21.590  -14.704 -59.816 1.00 65.33  ? 275  THR B O   1 
ATOM   6276 C CB  . THR B 1 275 ? 24.338  -13.788 -60.694 1.00 66.57  ? 275  THR B CB  1 
ATOM   6277 O OG1 . THR B 1 275 ? 25.032  -14.187 -59.502 1.00 65.74  ? 275  THR B OG1 1 
ATOM   6278 C CG2 . THR B 1 275 ? 25.297  -13.055 -61.640 1.00 66.25  ? 275  THR B CG2 1 
ATOM   6279 N N   . ARG B 1 276 ? 22.096  -13.331 -58.134 1.00 63.51  ? 276  ARG B N   1 
ATOM   6280 C CA  . ARG B 1 276 ? 21.470  -14.193 -57.145 1.00 63.67  ? 276  ARG B CA  1 
ATOM   6281 C C   . ARG B 1 276 ? 19.960  -14.028 -57.131 1.00 62.26  ? 276  ARG B C   1 
ATOM   6282 O O   . ARG B 1 276 ? 19.476  -12.904 -57.077 1.00 60.54  ? 276  ARG B O   1 
ATOM   6283 C CB  . ARG B 1 276 ? 22.040  -13.896 -55.748 1.00 63.83  ? 276  ARG B CB  1 
ATOM   6284 C CG  . ARG B 1 276 ? 23.472  -14.375 -55.559 1.00 66.83  ? 276  ARG B CG  1 
ATOM   6285 C CD  . ARG B 1 276 ? 23.548  -15.901 -55.579 1.00 70.25  ? 276  ARG B CD  1 
ATOM   6286 N NE  . ARG B 1 276 ? 24.913  -16.363 -55.370 1.00 73.74  ? 276  ARG B NE  1 
ATOM   6287 C CZ  . ARG B 1 276 ? 25.759  -16.698 -56.339 1.00 75.21  ? 276  ARG B CZ  1 
ATOM   6288 N NH1 . ARG B 1 276 ? 25.406  -16.618 -57.617 1.00 76.51  ? 276  ARG B NH1 1 
ATOM   6289 N NH2 . ARG B 1 276 ? 26.984  -17.106 -56.024 1.00 77.30  ? 276  ARG B NH2 1 
ATOM   6290 N N   . PRO B 1 277 ? 19.214  -15.144 -57.146 1.00 62.49  ? 277  PRO B N   1 
ATOM   6291 C CA  . PRO B 1 277 ? 17.781  -15.067 -56.918 1.00 61.73  ? 277  PRO B CA  1 
ATOM   6292 C C   . PRO B 1 277 ? 17.457  -14.211 -55.692 1.00 60.19  ? 277  PRO B C   1 
ATOM   6293 O O   . PRO B 1 277 ? 18.204  -14.218 -54.717 1.00 60.34  ? 277  PRO B O   1 
ATOM   6294 C CB  . PRO B 1 277 ? 17.386  -16.526 -56.679 1.00 63.02  ? 277  PRO B CB  1 
ATOM   6295 C CG  . PRO B 1 277 ? 18.367  -17.308 -57.440 1.00 65.13  ? 277  PRO B CG  1 
ATOM   6296 C CD  . PRO B 1 277 ? 19.657  -16.531 -57.375 1.00 64.89  ? 277  PRO B CD  1 
ATOM   6297 N N   . ALA B 1 278 ? 16.358  -13.473 -55.751 1.00 59.16  ? 278  ALA B N   1 
ATOM   6298 C CA  . ALA B 1 278 ? 16.022  -12.504 -54.704 1.00 58.04  ? 278  ALA B CA  1 
ATOM   6299 C C   . ALA B 1 278 ? 15.872  -13.165 -53.329 1.00 58.65  ? 278  ALA B C   1 
ATOM   6300 O O   . ALA B 1 278 ? 16.313  -12.612 -52.314 1.00 58.58  ? 278  ALA B O   1 
ATOM   6301 C CB  . ALA B 1 278 ? 14.753  -11.740 -55.083 1.00 56.63  ? 278  ALA B CB  1 
ATOM   6302 N N   . GLN B 1 279 ? 15.264  -14.347 -53.289 1.00 59.97  ? 279  GLN B N   1 
ATOM   6303 C CA  . GLN B 1 279 ? 15.072  -15.060 -52.023 1.00 61.15  ? 279  GLN B CA  1 
ATOM   6304 C C   . GLN B 1 279 ? 16.384  -15.522 -51.391 1.00 62.59  ? 279  GLN B C   1 
ATOM   6305 O O   . GLN B 1 279 ? 16.448  -15.660 -50.171 1.00 62.63  ? 279  GLN B O   1 
ATOM   6306 C CB  . GLN B 1 279 ? 14.130  -16.261 -52.186 1.00 62.02  ? 279  GLN B CB  1 
ATOM   6307 C CG  . GLN B 1 279 ? 13.620  -16.845 -50.866 1.00 62.64  ? 279  GLN B CG  1 
ATOM   6308 C CD  . GLN B 1 279 ? 13.001  -15.804 -49.940 1.00 63.33  ? 279  GLN B CD  1 
ATOM   6309 O OE1 . GLN B 1 279 ? 12.248  -14.938 -50.375 1.00 63.11  ? 279  GLN B OE1 1 
ATOM   6310 N NE2 . GLN B 1 279 ? 13.317  -15.891 -48.657 1.00 63.83  ? 279  GLN B NE2 1 
ATOM   6311 N N   . ASP B 1 280 ? 17.413  -15.770 -52.205 1.00 64.35  ? 280  ASP B N   1 
ATOM   6312 C CA  . ASP B 1 280 ? 18.740  -16.139 -51.681 1.00 66.15  ? 280  ASP B CA  1 
ATOM   6313 C C   . ASP B 1 280 ? 19.301  -14.986 -50.843 1.00 65.34  ? 280  ASP B C   1 
ATOM   6314 O O   . ASP B 1 280 ? 19.942  -15.217 -49.825 1.00 66.87  ? 280  ASP B O   1 
ATOM   6315 C CB  . ASP B 1 280 ? 19.732  -16.481 -52.803 1.00 67.22  ? 280  ASP B CB  1 
ATOM   6316 C CG  . ASP B 1 280 ? 19.401  -17.786 -53.528 1.00 70.98  ? 280  ASP B CG  1 
ATOM   6317 O OD1 . ASP B 1 280 ? 18.265  -18.308 -53.364 1.00 74.03  ? 280  ASP B OD1 1 
ATOM   6318 O OD2 . ASP B 1 280 ? 20.286  -18.287 -54.278 1.00 70.54  ? 280  ASP B OD2 1 
ATOM   6319 N N   . LEU B 1 281 ? 19.051  -13.751 -51.271 1.00 64.08  ? 281  LEU B N   1 
ATOM   6320 C CA  . LEU B 1 281 ? 19.511  -12.555 -50.540 1.00 62.92  ? 281  LEU B CA  1 
ATOM   6321 C C   . LEU B 1 281 ? 18.748  -12.372 -49.222 1.00 62.22  ? 281  LEU B C   1 
ATOM   6322 O O   . LEU B 1 281 ? 19.344  -12.147 -48.162 1.00 62.06  ? 281  LEU B O   1 
ATOM   6323 C CB  . LEU B 1 281 ? 19.391  -11.311 -51.433 1.00 61.85  ? 281  LEU B CB  1 
ATOM   6324 C CG  . LEU B 1 281 ? 20.604  -10.921 -52.297 1.00 62.32  ? 281  LEU B CG  1 
ATOM   6325 C CD1 . LEU B 1 281 ? 21.201  -12.095 -52.981 1.00 64.09  ? 281  LEU B CD1 1 
ATOM   6326 C CD2 . LEU B 1 281 ? 20.250  -9.849  -53.318 1.00 60.51  ? 281  LEU B CD2 1 
ATOM   6327 N N   . VAL B 1 282 ? 17.428  -12.495 -49.295 1.00 61.73  ? 282  VAL B N   1 
ATOM   6328 C CA  . VAL B 1 282 ? 16.572  -12.452 -48.121 1.00 61.16  ? 282  VAL B CA  1 
ATOM   6329 C C   . VAL B 1 282 ? 16.898  -13.575 -47.106 1.00 63.13  ? 282  VAL B C   1 
ATOM   6330 O O   . VAL B 1 282 ? 16.843  -13.354 -45.892 1.00 62.74  ? 282  VAL B O   1 
ATOM   6331 C CB  . VAL B 1 282 ? 15.078  -12.524 -48.534 1.00 60.47  ? 282  VAL B CB  1 
ATOM   6332 C CG1 . VAL B 1 282 ? 14.178  -12.715 -47.323 1.00 60.26  ? 282  VAL B CG1 1 
ATOM   6333 C CG2 . VAL B 1 282 ? 14.674  -11.274 -49.317 1.00 57.61  ? 282  VAL B CG2 1 
ATOM   6334 N N   . ASP B 1 283 ? 17.235  -14.770 -47.585 1.00 65.23  ? 283  ASP B N   1 
ATOM   6335 C CA  . ASP B 1 283 ? 17.525  -15.884 -46.670 1.00 67.26  ? 283  ASP B CA  1 
ATOM   6336 C C   . ASP B 1 283 ? 18.681  -15.604 -45.694 1.00 67.88  ? 283  ASP B C   1 
ATOM   6337 O O   . ASP B 1 283 ? 18.677  -16.127 -44.577 1.00 68.81  ? 283  ASP B O   1 
ATOM   6338 C CB  . ASP B 1 283 ? 17.807  -17.176 -47.432 1.00 69.12  ? 283  ASP B CB  1 
ATOM   6339 C CG  . ASP B 1 283 ? 16.543  -17.835 -47.970 1.00 70.53  ? 283  ASP B CG  1 
ATOM   6340 O OD1 . ASP B 1 283 ? 15.422  -17.500 -47.522 1.00 71.48  ? 283  ASP B OD1 1 
ATOM   6341 O OD2 . ASP B 1 283 ? 16.677  -18.707 -48.848 1.00 72.82  ? 283  ASP B OD2 1 
ATOM   6342 N N   . HIS B 1 284 ? 19.652  -14.789 -46.106 1.00 67.56  ? 284  HIS B N   1 
ATOM   6343 C CA  . HIS B 1 284 ? 20.813  -14.490 -45.276 1.00 68.14  ? 284  HIS B CA  1 
ATOM   6344 C C   . HIS B 1 284 ? 20.838  -13.055 -44.743 1.00 66.78  ? 284  HIS B C   1 
ATOM   6345 O O   . HIS B 1 284 ? 21.804  -12.642 -44.109 1.00 67.00  ? 284  HIS B O   1 
ATOM   6346 C CB  . HIS B 1 284 ? 22.088  -14.793 -46.063 1.00 69.55  ? 284  HIS B CB  1 
ATOM   6347 C CG  . HIS B 1 284 ? 22.261  -16.244 -46.375 1.00 71.51  ? 284  HIS B CG  1 
ATOM   6348 N ND1 . HIS B 1 284 ? 22.722  -17.152 -45.447 1.00 73.87  ? 284  HIS B ND1 1 
ATOM   6349 C CD2 . HIS B 1 284 ? 22.023  -16.947 -47.506 1.00 72.90  ? 284  HIS B CD2 1 
ATOM   6350 C CE1 . HIS B 1 284 ? 22.766  -18.353 -45.995 1.00 75.37  ? 284  HIS B CE1 1 
ATOM   6351 N NE2 . HIS B 1 284 ? 22.348  -18.255 -47.245 1.00 74.66  ? 284  HIS B NE2 1 
ATOM   6352 N N   . GLU B 1 285 ? 19.756  -12.317 -44.964 1.00 65.59  ? 285  GLU B N   1 
ATOM   6353 C CA  . GLU B 1 285 ? 19.675  -10.909 -44.589 1.00 64.57  ? 285  GLU B CA  1 
ATOM   6354 C C   . GLU B 1 285 ? 19.967  -10.660 -43.100 1.00 65.39  ? 285  GLU B C   1 
ATOM   6355 O O   . GLU B 1 285 ? 20.643  -9.690  -42.734 1.00 64.77  ? 285  GLU B O   1 
ATOM   6356 C CB  . GLU B 1 285 ? 18.277  -10.383 -44.916 1.00 63.15  ? 285  GLU B CB  1 
ATOM   6357 C CG  . GLU B 1 285 ? 18.202  -8.902  -44.975 1.00 61.91  ? 285  GLU B CG  1 
ATOM   6358 C CD  . GLU B 1 285 ? 16.788  -8.391  -45.097 1.00 60.78  ? 285  GLU B CD  1 
ATOM   6359 O OE1 . GLU B 1 285 ? 15.964  -9.012  -45.802 1.00 58.42  ? 285  GLU B OE1 1 
ATOM   6360 O OE2 . GLU B 1 285 ? 16.511  -7.353  -44.464 1.00 61.56  ? 285  GLU B OE2 1 
ATOM   6361 N N   . TRP B 1 286 ? 19.441  -11.533 -42.247 1.00 66.99  ? 286  TRP B N   1 
ATOM   6362 C CA  . TRP B 1 286 ? 19.529  -11.355 -40.793 1.00 67.86  ? 286  TRP B CA  1 
ATOM   6363 C C   . TRP B 1 286 ? 20.867  -11.801 -40.186 1.00 69.28  ? 286  TRP B C   1 
ATOM   6364 O O   . TRP B 1 286 ? 21.212  -11.396 -39.072 1.00 69.65  ? 286  TRP B O   1 
ATOM   6365 C CB  . TRP B 1 286 ? 18.374  -12.089 -40.116 1.00 68.62  ? 286  TRP B CB  1 
ATOM   6366 C CG  . TRP B 1 286 ? 17.054  -11.478 -40.444 1.00 67.97  ? 286  TRP B CG  1 
ATOM   6367 C CD1 . TRP B 1 286 ? 16.108  -11.963 -41.305 1.00 68.15  ? 286  TRP B CD1 1 
ATOM   6368 C CD2 . TRP B 1 286 ? 16.543  -10.241 -39.940 1.00 67.27  ? 286  TRP B CD2 1 
ATOM   6369 N NE1 . TRP B 1 286 ? 15.033  -11.107 -41.355 1.00 67.30  ? 286  TRP B NE1 1 
ATOM   6370 C CE2 . TRP B 1 286 ? 15.274  -10.043 -40.526 1.00 66.40  ? 286  TRP B CE2 1 
ATOM   6371 C CE3 . TRP B 1 286 ? 17.034  -9.280  -39.041 1.00 66.85  ? 286  TRP B CE3 1 
ATOM   6372 C CZ2 . TRP B 1 286 ? 14.484  -8.929  -40.236 1.00 65.09  ? 286  TRP B CZ2 1 
ATOM   6373 C CZ3 . TRP B 1 286 ? 16.244  -8.171  -38.754 1.00 65.62  ? 286  TRP B CZ3 1 
ATOM   6374 C CH2 . TRP B 1 286 ? 14.985  -8.006  -39.353 1.00 64.39  ? 286  TRP B CH2 1 
ATOM   6375 N N   . HIS B 1 287 ? 21.635  -12.585 -40.930 1.00 70.20  ? 287  HIS B N   1 
ATOM   6376 C CA  . HIS B 1 287 ? 22.862  -13.173 -40.394 1.00 72.03  ? 287  HIS B CA  1 
ATOM   6377 C C   . HIS B 1 287 ? 24.068  -12.236 -40.354 1.00 71.26  ? 287  HIS B C   1 
ATOM   6378 O O   . HIS B 1 287 ? 25.145  -12.662 -39.944 1.00 73.07  ? 287  HIS B O   1 
ATOM   6379 C CB  . HIS B 1 287 ? 23.256  -14.424 -41.188 1.00 74.08  ? 287  HIS B CB  1 
ATOM   6380 C CG  . HIS B 1 287 ? 22.189  -15.469 -41.245 1.00 76.28  ? 287  HIS B CG  1 
ATOM   6381 N ND1 . HIS B 1 287 ? 22.168  -16.457 -42.210 1.00 79.29  ? 287  HIS B ND1 1 
ATOM   6382 C CD2 . HIS B 1 287 ? 21.096  -15.674 -40.471 1.00 77.77  ? 287  HIS B CD2 1 
ATOM   6383 C CE1 . HIS B 1 287 ? 21.115  -17.232 -42.021 1.00 79.96  ? 287  HIS B CE1 1 
ATOM   6384 N NE2 . HIS B 1 287 ? 20.447  -16.777 -40.973 1.00 80.41  ? 287  HIS B NE2 1 
ATOM   6385 N N   . VAL B 1 288 ? 23.907  -10.986 -40.782 1.00 69.01  ? 288  VAL B N   1 
ATOM   6386 C CA  . VAL B 1 288 ? 25.038  -10.055 -40.876 1.00 68.69  ? 288  VAL B CA  1 
ATOM   6387 C C   . VAL B 1 288 ? 25.110  -9.037  -39.722 1.00 67.80  ? 288  VAL B C   1 
ATOM   6388 O O   . VAL B 1 288 ? 26.062  -8.258  -39.651 1.00 68.19  ? 288  VAL B O   1 
ATOM   6389 C CB  . VAL B 1 288 ? 25.040  -9.292  -42.225 1.00 67.87  ? 288  VAL B CB  1 
ATOM   6390 C CG1 . VAL B 1 288 ? 25.155  -10.272 -43.383 1.00 67.81  ? 288  VAL B CG1 1 
ATOM   6391 C CG2 . VAL B 1 288 ? 23.789  -8.397  -42.358 1.00 65.41  ? 288  VAL B CG2 1 
ATOM   6392 N N   . LEU B 1 289 ? 24.119  -9.043  -38.831 1.00 66.56  ? 289  LEU B N   1 
ATOM   6393 C CA  . LEU B 1 289 ? 24.142  -8.173  -37.656 1.00 65.90  ? 289  LEU B CA  1 
ATOM   6394 C C   . LEU B 1 289 ? 25.243  -8.621  -36.691 1.00 67.87  ? 289  LEU B C   1 
ATOM   6395 O O   . LEU B 1 289 ? 25.406  -9.813  -36.450 1.00 69.22  ? 289  LEU B O   1 
ATOM   6396 C CB  . LEU B 1 289 ? 22.786  -8.187  -36.945 1.00 64.81  ? 289  LEU B CB  1 
ATOM   6397 C CG  . LEU B 1 289 ? 21.641  -7.418  -37.608 1.00 61.77  ? 289  LEU B CG  1 
ATOM   6398 C CD1 . LEU B 1 289 ? 20.305  -7.788  -36.957 1.00 59.55  ? 289  LEU B CD1 1 
ATOM   6399 C CD2 . LEU B 1 289 ? 21.893  -5.921  -37.550 1.00 59.58  ? 289  LEU B CD2 1 
ATOM   6400 N N   . PRO B 1 290 ? 26.014  -7.668  -36.143 1.00 68.26  ? 290  PRO B N   1 
ATOM   6401 C CA  . PRO B 1 290 ? 27.142  -8.021  -35.274 1.00 70.15  ? 290  PRO B CA  1 
ATOM   6402 C C   . PRO B 1 290 ? 26.785  -8.672  -33.928 1.00 71.00  ? 290  PRO B C   1 
ATOM   6403 O O   . PRO B 1 290 ? 27.640  -9.324  -33.331 1.00 72.79  ? 290  PRO B O   1 
ATOM   6404 C CB  . PRO B 1 290 ? 27.842  -6.676  -35.045 1.00 69.58  ? 290  PRO B CB  1 
ATOM   6405 C CG  . PRO B 1 290 ? 26.794  -5.659  -35.267 1.00 67.85  ? 290  PRO B CG  1 
ATOM   6406 C CD  . PRO B 1 290 ? 25.888  -6.211  -36.317 1.00 67.07  ? 290  PRO B CD  1 
ATOM   6407 N N   . GLN B 1 291 ? 25.549  -8.498  -33.465 1.00 70.26  ? 291  GLN B N   1 
ATOM   6408 C CA  . GLN B 1 291 ? 25.120  -8.985  -32.155 1.00 71.13  ? 291  GLN B CA  1 
ATOM   6409 C C   . GLN B 1 291 ? 23.734  -9.617  -32.191 1.00 70.53  ? 291  GLN B C   1 
ATOM   6410 O O   . GLN B 1 291 ? 22.928  -9.324  -33.074 1.00 69.25  ? 291  GLN B O   1 
ATOM   6411 C CB  . GLN B 1 291 ? 25.081  -7.822  -31.149 1.00 70.39  ? 291  GLN B CB  1 
ATOM   6412 C CG  . GLN B 1 291 ? 26.284  -7.741  -30.235 1.00 73.26  ? 291  GLN B CG  1 
ATOM   6413 C CD  . GLN B 1 291 ? 27.397  -6.845  -30.744 1.00 74.78  ? 291  GLN B CD  1 
ATOM   6414 O OE1 . GLN B 1 291 ? 28.574  -7.140  -30.523 1.00 76.27  ? 291  GLN B OE1 1 
ATOM   6415 N NE2 . GLN B 1 291 ? 27.036  -5.734  -31.402 1.00 73.21  ? 291  GLN B NE2 1 
ATOM   6416 N N   . GLU B 1 292 ? 23.467  -10.465 -31.201 1.00 71.46  ? 292  GLU B N   1 
ATOM   6417 C CA  . GLU B 1 292 ? 22.111  -10.917 -30.894 1.00 71.15  ? 292  GLU B CA  1 
ATOM   6418 C C   . GLU B 1 292 ? 21.322  -9.694  -30.416 1.00 68.69  ? 292  GLU B C   1 
ATOM   6419 O O   . GLU B 1 292 ? 21.670  -9.087  -29.405 1.00 68.97  ? 292  GLU B O   1 
ATOM   6420 C CB  . GLU B 1 292 ? 22.161  -11.988 -29.798 1.00 73.39  ? 292  GLU B CB  1 
ATOM   6421 C CG  . GLU B 1 292 ? 20.862  -12.768 -29.576 1.00 76.07  ? 292  GLU B CG  1 
ATOM   6422 C CD  . GLU B 1 292 ? 20.925  -13.676 -28.337 1.00 81.57  ? 292  GLU B CD  1 
ATOM   6423 O OE1 . GLU B 1 292 ? 22.003  -13.771 -27.694 1.00 85.03  ? 292  GLU B OE1 1 
ATOM   6424 O OE2 . GLU B 1 292 ? 19.888  -14.294 -27.998 1.00 84.23  ? 292  GLU B OE2 1 
ATOM   6425 N N   . SER B 1 293 ? 20.284  -9.308  -31.151 1.00 66.23  ? 293  SER B N   1 
ATOM   6426 C CA  . SER B 1 293 ? 19.604  -8.055  -30.871 1.00 63.66  ? 293  SER B CA  1 
ATOM   6427 C C   . SER B 1 293 ? 18.129  -8.064  -31.217 1.00 61.81  ? 293  SER B C   1 
ATOM   6428 O O   . SER B 1 293 ? 17.639  -8.991  -31.846 1.00 61.94  ? 293  SER B O   1 
ATOM   6429 C CB  . SER B 1 293 ? 20.306  -6.894  -31.603 1.00 63.25  ? 293  SER B CB  1 
ATOM   6430 O OG  . SER B 1 293 ? 20.554  -7.152  -32.982 1.00 63.68  ? 293  SER B OG  1 
ATOM   6431 N N   . ILE B 1 294 ? 17.426  -7.025  -30.765 1.00 59.49  ? 294  ILE B N   1 
ATOM   6432 C CA  . ILE B 1 294 ? 16.097  -6.685  -31.272 1.00 57.67  ? 294  ILE B CA  1 
ATOM   6433 C C   . ILE B 1 294 ? 16.086  -5.199  -31.621 1.00 55.75  ? 294  ILE B C   1 
ATOM   6434 O O   . ILE B 1 294 ? 16.931  -4.445  -31.154 1.00 55.23  ? 294  ILE B O   1 
ATOM   6435 C CB  . ILE B 1 294 ? 14.943  -6.987  -30.262 1.00 57.85  ? 294  ILE B CB  1 
ATOM   6436 C CG1 . ILE B 1 294 ? 15.187  -6.313  -28.902 1.00 57.88  ? 294  ILE B CG1 1 
ATOM   6437 C CG2 . ILE B 1 294 ? 14.757  -8.487  -30.084 1.00 59.02  ? 294  ILE B CG2 1 
ATOM   6438 C CD1 . ILE B 1 294 ? 13.932  -6.230  -28.014 1.00 56.88  ? 294  ILE B CD1 1 
ATOM   6439 N N   . PHE B 1 295 ? 15.120  -4.797  -32.443 1.00 54.14  ? 295  PHE B N   1 
ATOM   6440 C CA  . PHE B 1 295 ? 15.033  -3.437  -32.957 1.00 52.66  ? 295  PHE B CA  1 
ATOM   6441 C C   . PHE B 1 295 ? 16.339  -3.039  -33.643 1.00 52.52  ? 295  PHE B C   1 
ATOM   6442 O O   . PHE B 1 295 ? 16.799  -1.899  -33.512 1.00 51.83  ? 295  PHE B O   1 
ATOM   6443 C CB  . PHE B 1 295 ? 14.665  -2.468  -31.820 1.00 52.04  ? 295  PHE B CB  1 
ATOM   6444 C CG  . PHE B 1 295 ? 13.762  -1.325  -32.242 1.00 51.34  ? 295  PHE B CG  1 
ATOM   6445 C CD1 . PHE B 1 295 ? 14.019  -0.582  -33.387 1.00 50.31  ? 295  PHE B CD1 1 
ATOM   6446 C CD2 . PHE B 1 295 ? 12.659  -0.980  -31.469 1.00 51.41  ? 295  PHE B CD2 1 
ATOM   6447 C CE1 . PHE B 1 295 ? 13.200  0.454   -33.761 1.00 49.35  ? 295  PHE B CE1 1 
ATOM   6448 C CE2 . PHE B 1 295 ? 11.837  0.071   -31.842 1.00 50.81  ? 295  PHE B CE2 1 
ATOM   6449 C CZ  . PHE B 1 295 ? 12.112  0.786   -32.998 1.00 49.23  ? 295  PHE B CZ  1 
ATOM   6450 N N   . ARG B 1 296 ? 16.949  -3.999  -34.345 1.00 52.87  ? 296  ARG B N   1 
ATOM   6451 C CA  . ARG B 1 296 ? 18.083  -3.728  -35.209 1.00 52.91  ? 296  ARG B CA  1 
ATOM   6452 C C   . ARG B 1 296 ? 17.862  -4.389  -36.561 1.00 52.62  ? 296  ARG B C   1 
ATOM   6453 O O   . ARG B 1 296 ? 17.349  -5.508  -36.643 1.00 53.65  ? 296  ARG B O   1 
ATOM   6454 C CB  . ARG B 1 296 ? 19.369  -4.232  -34.581 1.00 54.52  ? 296  ARG B CB  1 
ATOM   6455 C CG  . ARG B 1 296 ? 19.781  -3.452  -33.357 1.00 55.31  ? 296  ARG B CG  1 
ATOM   6456 C CD  . ARG B 1 296 ? 20.226  -2.057  -33.687 1.00 54.70  ? 296  ARG B CD  1 
ATOM   6457 N NE  . ARG B 1 296 ? 20.813  -1.458  -32.510 1.00 54.96  ? 296  ARG B NE  1 
ATOM   6458 C CZ  . ARG B 1 296 ? 20.126  -0.887  -31.525 1.00 56.46  ? 296  ARG B CZ  1 
ATOM   6459 N NH1 . ARG B 1 296 ? 20.778  -0.394  -30.476 1.00 57.69  ? 296  ARG B NH1 1 
ATOM   6460 N NH2 . ARG B 1 296 ? 18.807  -0.765  -31.583 1.00 55.23  ? 296  ARG B NH2 1 
ATOM   6461 N N   . PHE B 1 297 ? 18.241  -3.684  -37.621 1.00 51.55  ? 297  PHE B N   1 
ATOM   6462 C CA  . PHE B 1 297 ? 17.927  -4.097  -38.996 1.00 50.81  ? 297  PHE B CA  1 
ATOM   6463 C C   . PHE B 1 297 ? 19.198  -3.978  -39.847 1.00 50.90  ? 297  PHE B C   1 
ATOM   6464 O O   . PHE B 1 297 ? 19.960  -3.006  -39.725 1.00 49.65  ? 297  PHE B O   1 
ATOM   6465 C CB  . PHE B 1 297 ? 16.783  -3.239  -39.543 1.00 49.73  ? 297  PHE B CB  1 
ATOM   6466 C CG  . PHE B 1 297 ? 15.716  -2.937  -38.518 1.00 49.26  ? 297  PHE B CG  1 
ATOM   6467 C CD1 . PHE B 1 297 ? 14.855  -3.935  -38.077 1.00 50.10  ? 297  PHE B CD1 1 
ATOM   6468 C CD2 . PHE B 1 297 ? 15.587  -1.668  -37.979 1.00 49.04  ? 297  PHE B CD2 1 
ATOM   6469 C CE1 . PHE B 1 297 ? 13.878  -3.667  -37.117 1.00 50.06  ? 297  PHE B CE1 1 
ATOM   6470 C CE2 . PHE B 1 297 ? 14.615  -1.389  -37.018 1.00 47.19  ? 297  PHE B CE2 1 
ATOM   6471 C CZ  . PHE B 1 297 ? 13.762  -2.387  -36.589 1.00 48.98  ? 297  PHE B CZ  1 
ATOM   6472 N N   . SER B 1 298 ? 19.433  -4.996  -40.671 1.00 51.47  ? 298  SER B N   1 
ATOM   6473 C CA  . SER B 1 298 ? 20.731  -5.216  -41.323 1.00 52.23  ? 298  SER B CA  1 
ATOM   6474 C C   . SER B 1 298 ? 21.060  -4.171  -42.374 1.00 51.61  ? 298  SER B C   1 
ATOM   6475 O O   . SER B 1 298 ? 22.191  -3.663  -42.421 1.00 52.50  ? 298  SER B O   1 
ATOM   6476 C CB  . SER B 1 298 ? 20.765  -6.596  -41.992 1.00 53.53  ? 298  SER B CB  1 
ATOM   6477 O OG  . SER B 1 298 ? 20.764  -7.649  -41.046 1.00 54.27  ? 298  SER B OG  1 
ATOM   6478 N N   . PHE B 1 299 ? 20.083  -3.859  -43.223 1.00 50.50  ? 299  PHE B N   1 
ATOM   6479 C CA  . PHE B 1 299 ? 20.295  -2.914  -44.326 1.00 49.86  ? 299  PHE B CA  1 
ATOM   6480 C C   . PHE B 1 299 ? 19.389  -1.698  -44.205 1.00 48.67  ? 299  PHE B C   1 
ATOM   6481 O O   . PHE B 1 299 ? 18.178  -1.791  -44.394 1.00 48.11  ? 299  PHE B O   1 
ATOM   6482 C CB  . PHE B 1 299 ? 20.165  -3.649  -45.660 1.00 49.73  ? 299  PHE B CB  1 
ATOM   6483 C CG  . PHE B 1 299 ? 21.205  -4.731  -45.815 1.00 50.78  ? 299  PHE B CG  1 
ATOM   6484 C CD1 . PHE B 1 299 ? 22.491  -4.407  -46.197 1.00 50.15  ? 299  PHE B CD1 1 
ATOM   6485 C CD2 . PHE B 1 299 ? 20.915  -6.045  -45.481 1.00 50.69  ? 299  PHE B CD2 1 
ATOM   6486 C CE1 . PHE B 1 299 ? 23.472  -5.371  -46.281 1.00 52.73  ? 299  PHE B CE1 1 
ATOM   6487 C CE2 . PHE B 1 299 ? 21.876  -7.015  -45.566 1.00 52.18  ? 299  PHE B CE2 1 
ATOM   6488 C CZ  . PHE B 1 299 ? 23.169  -6.679  -45.965 1.00 53.33  ? 299  PHE B CZ  1 
ATOM   6489 N N   . VAL B 1 300 ? 20.016  -0.571  -43.862 1.00 48.61  ? 300  VAL B N   1 
ATOM   6490 C CA  . VAL B 1 300 ? 19.353  0.682   -43.509 1.00 47.75  ? 300  VAL B CA  1 
ATOM   6491 C C   . VAL B 1 300 ? 20.165  1.836   -44.138 1.00 48.20  ? 300  VAL B C   1 
ATOM   6492 O O   . VAL B 1 300 ? 21.261  1.601   -44.656 1.00 48.99  ? 300  VAL B O   1 
ATOM   6493 C CB  . VAL B 1 300 ? 19.255  0.846   -41.952 1.00 47.81  ? 300  VAL B CB  1 
ATOM   6494 C CG1 . VAL B 1 300 ? 18.576  -0.378  -41.299 1.00 47.67  ? 300  VAL B CG1 1 
ATOM   6495 C CG2 . VAL B 1 300 ? 20.630  1.052   -41.338 1.00 48.56  ? 300  VAL B CG2 1 
ATOM   6496 N N   . PRO B 1 301 ? 19.613  3.071   -44.150 1.00 47.57  ? 301  PRO B N   1 
ATOM   6497 C CA  . PRO B 1 301 ? 20.296  4.240   -44.677 1.00 47.91  ? 301  PRO B CA  1 
ATOM   6498 C C   . PRO B 1 301 ? 21.687  4.389   -44.115 1.00 49.32  ? 301  PRO B C   1 
ATOM   6499 O O   . PRO B 1 301 ? 21.890  4.112   -42.937 1.00 49.94  ? 301  PRO B O   1 
ATOM   6500 C CB  . PRO B 1 301 ? 19.414  5.397   -44.198 1.00 46.76  ? 301  PRO B CB  1 
ATOM   6501 C CG  . PRO B 1 301 ? 18.079  4.828   -44.199 1.00 46.64  ? 301  PRO B CG  1 
ATOM   6502 C CD  . PRO B 1 301 ? 18.248  3.418   -43.711 1.00 46.85  ? 301  PRO B CD  1 
ATOM   6503 N N   . VAL B 1 302 ? 22.627  4.811   -44.959 1.00 50.28  ? 302  VAL B N   1 
ATOM   6504 C CA  . VAL B 1 302 ? 24.037  4.861   -44.608 1.00 51.40  ? 302  VAL B CA  1 
ATOM   6505 C C   . VAL B 1 302 ? 24.555  6.291   -44.686 1.00 52.07  ? 302  VAL B C   1 
ATOM   6506 O O   . VAL B 1 302 ? 24.204  7.028   -45.598 1.00 52.15  ? 302  VAL B O   1 
ATOM   6507 C CB  . VAL B 1 302 ? 24.894  3.950   -45.541 1.00 52.66  ? 302  VAL B CB  1 
ATOM   6508 C CG1 . VAL B 1 302 ? 24.668  4.294   -47.025 1.00 52.26  ? 302  VAL B CG1 1 
ATOM   6509 C CG2 . VAL B 1 302 ? 26.374  4.046   -45.183 1.00 52.72  ? 302  VAL B CG2 1 
ATOM   6510 N N   . VAL B 1 303 ? 25.392  6.681   -43.733 1.00 53.42  ? 303  VAL B N   1 
ATOM   6511 C CA  . VAL B 1 303 ? 26.005  8.012   -43.763 1.00 54.27  ? 303  VAL B CA  1 
ATOM   6512 C C   . VAL B 1 303 ? 27.091  8.020   -44.838 1.00 56.13  ? 303  VAL B C   1 
ATOM   6513 O O   . VAL B 1 303 ? 28.250  7.685   -44.596 1.00 57.57  ? 303  VAL B O   1 
ATOM   6514 C CB  . VAL B 1 303 ? 26.519  8.457   -42.375 1.00 54.55  ? 303  VAL B CB  1 
ATOM   6515 C CG1 . VAL B 1 303 ? 27.106  9.861   -42.436 1.00 54.58  ? 303  VAL B CG1 1 
ATOM   6516 C CG2 . VAL B 1 303 ? 25.374  8.425   -41.384 1.00 51.78  ? 303  VAL B CG2 1 
ATOM   6517 N N   . ASP B 1 304 ? 26.670  8.411   -46.039 1.00 56.82  ? 304  ASP B N   1 
ATOM   6518 C CA  . ASP B 1 304 ? 27.486  8.329   -47.271 1.00 58.27  ? 304  ASP B CA  1 
ATOM   6519 C C   . ASP B 1 304 ? 28.261  9.599   -47.612 1.00 59.59  ? 304  ASP B C   1 
ATOM   6520 O O   . ASP B 1 304 ? 29.117  9.572   -48.482 1.00 61.26  ? 304  ASP B O   1 
ATOM   6521 C CB  . ASP B 1 304 ? 26.585  7.970   -48.471 1.00 57.47  ? 304  ASP B CB  1 
ATOM   6522 C CG  . ASP B 1 304 ? 25.388  8.910   -48.632 1.00 56.91  ? 304  ASP B CG  1 
ATOM   6523 O OD1 . ASP B 1 304 ? 25.205  9.800   -47.777 1.00 57.12  ? 304  ASP B OD1 1 
ATOM   6524 O OD2 . ASP B 1 304 ? 24.615  8.754   -49.613 1.00 57.94  ? 304  ASP B OD2 1 
ATOM   6525 N N   . GLY B 1 305 ? 27.943  10.706  -46.948 1.00 60.00  ? 305  GLY B N   1 
ATOM   6526 C CA  . GLY B 1 305 ? 28.515  12.008  -47.283 1.00 61.47  ? 305  GLY B CA  1 
ATOM   6527 C C   . GLY B 1 305 ? 27.889  12.620  -48.525 1.00 61.82  ? 305  GLY B C   1 
ATOM   6528 O O   . GLY B 1 305 ? 28.449  13.542  -49.116 1.00 63.16  ? 305  GLY B O   1 
ATOM   6529 N N   . ASP B 1 306 ? 26.721  12.114  -48.912 1.00 61.05  ? 306  ASP B N   1 
ATOM   6530 C CA  . ASP B 1 306 ? 26.017  12.569  -50.113 1.00 61.29  ? 306  ASP B CA  1 
ATOM   6531 C C   . ASP B 1 306 ? 24.557  12.824  -49.764 1.00 59.40  ? 306  ASP B C   1 
ATOM   6532 O O   . ASP B 1 306 ? 24.190  13.969  -49.497 1.00 59.61  ? 306  ASP B O   1 
ATOM   6533 C CB  . ASP B 1 306 ? 26.162  11.547  -51.253 1.00 61.97  ? 306  ASP B CB  1 
ATOM   6534 C CG  . ASP B 1 306 ? 25.495  12.000  -52.549 1.00 64.12  ? 306  ASP B CG  1 
ATOM   6535 O OD1 . ASP B 1 306 ? 25.193  13.209  -52.689 1.00 67.43  ? 306  ASP B OD1 1 
ATOM   6536 O OD2 . ASP B 1 306 ? 25.294  11.141  -53.446 1.00 67.17  ? 306  ASP B OD2 1 
ATOM   6537 N N   . PHE B 1 307 ? 23.726  11.781  -49.755 1.00 58.01  ? 307  PHE B N   1 
ATOM   6538 C CA  . PHE B 1 307 ? 22.335  11.940  -49.337 1.00 56.33  ? 307  PHE B CA  1 
ATOM   6539 C C   . PHE B 1 307 ? 22.358  12.553  -47.945 1.00 56.16  ? 307  PHE B C   1 
ATOM   6540 O O   . PHE B 1 307 ? 21.705  13.568  -47.691 1.00 56.08  ? 307  PHE B O   1 
ATOM   6541 C CB  . PHE B 1 307 ? 21.559  10.606  -49.326 1.00 55.21  ? 307  PHE B CB  1 
ATOM   6542 C CG  . PHE B 1 307 ? 20.057  10.788  -49.235 1.00 53.33  ? 307  PHE B CG  1 
ATOM   6543 C CD1 . PHE B 1 307 ? 19.444  11.057  -48.019 1.00 52.75  ? 307  PHE B CD1 1 
ATOM   6544 C CD2 . PHE B 1 307 ? 19.264  10.725  -50.365 1.00 52.85  ? 307  PHE B CD2 1 
ATOM   6545 C CE1 . PHE B 1 307 ? 18.066  11.252  -47.932 1.00 50.65  ? 307  PHE B CE1 1 
ATOM   6546 C CE2 . PHE B 1 307 ? 17.883  10.917  -50.281 1.00 52.13  ? 307  PHE B CE2 1 
ATOM   6547 C CZ  . PHE B 1 307 ? 17.292  11.187  -49.062 1.00 51.05  ? 307  PHE B CZ  1 
ATOM   6548 N N   . LEU B 1 308 ? 23.141  11.926  -47.067 1.00 56.30  ? 308  LEU B N   1 
ATOM   6549 C CA  . LEU B 1 308 ? 23.412  12.437  -45.740 1.00 56.11  ? 308  LEU B CA  1 
ATOM   6550 C C   . LEU B 1 308 ? 24.826  12.952  -45.732 1.00 57.84  ? 308  LEU B C   1 
ATOM   6551 O O   . LEU B 1 308 ? 25.756  12.165  -45.763 1.00 58.22  ? 308  LEU B O   1 
ATOM   6552 C CB  . LEU B 1 308 ? 23.261  11.325  -44.696 1.00 55.49  ? 308  LEU B CB  1 
ATOM   6553 C CG  . LEU B 1 308 ? 21.857  10.734  -44.515 1.00 52.91  ? 308  LEU B CG  1 
ATOM   6554 C CD1 . LEU B 1 308 ? 21.919  9.581   -43.532 1.00 49.93  ? 308  LEU B CD1 1 
ATOM   6555 C CD2 . LEU B 1 308 ? 20.848  11.812  -44.060 1.00 51.01  ? 308  LEU B CD2 1 
ATOM   6556 N N   . SER B 1 309 ? 24.986  14.270  -45.686 1.00 58.75  ? 309  SER B N   1 
ATOM   6557 C CA  . SER B 1 309 ? 26.317  14.886  -45.748 1.00 60.89  ? 309  SER B CA  1 
ATOM   6558 C C   . SER B 1 309 ? 27.147  14.686  -44.475 1.00 61.85  ? 309  SER B C   1 
ATOM   6559 O O   . SER B 1 309 ? 28.367  14.737  -44.522 1.00 63.16  ? 309  SER B O   1 
ATOM   6560 C CB  . SER B 1 309 ? 26.202  16.377  -46.064 1.00 61.24  ? 309  SER B CB  1 
ATOM   6561 O OG  . SER B 1 309 ? 25.505  17.057  -45.038 1.00 61.90  ? 309  SER B OG  1 
ATOM   6562 N N   . ASP B 1 310 ? 26.473  14.466  -43.348 1.00 61.60  ? 310  ASP B N   1 
ATOM   6563 C CA  . ASP B 1 310 ? 27.113  14.109  -42.074 1.00 62.24  ? 310  ASP B CA  1 
ATOM   6564 C C   . ASP B 1 310 ? 26.125  13.195  -41.339 1.00 60.87  ? 310  ASP B C   1 
ATOM   6565 O O   . ASP B 1 310 ? 25.080  12.876  -41.881 1.00 59.19  ? 310  ASP B O   1 
ATOM   6566 C CB  . ASP B 1 310 ? 27.384  15.376  -41.264 1.00 63.21  ? 310  ASP B CB  1 
ATOM   6567 C CG  . ASP B 1 310 ? 28.608  15.271  -40.369 1.00 65.22  ? 310  ASP B CG  1 
ATOM   6568 O OD1 . ASP B 1 310 ? 28.829  14.222  -39.736 1.00 66.68  ? 310  ASP B OD1 1 
ATOM   6569 O OD2 . ASP B 1 310 ? 29.349  16.271  -40.286 1.00 68.24  ? 310  ASP B OD2 1 
ATOM   6570 N N   . THR B 1 311 ? 26.445  12.781  -40.115 1.00 61.48  ? 311  THR B N   1 
ATOM   6571 C CA  . THR B 1 311 ? 25.499  12.009  -39.293 1.00 60.75  ? 311  THR B CA  1 
ATOM   6572 C C   . THR B 1 311 ? 24.222  12.821  -38.992 1.00 60.33  ? 311  THR B C   1 
ATOM   6573 O O   . THR B 1 311 ? 24.281  14.039  -38.877 1.00 60.44  ? 311  THR B O   1 
ATOM   6574 C CB  . THR B 1 311 ? 26.121  11.600  -37.936 1.00 61.29  ? 311  THR B CB  1 
ATOM   6575 O OG1 . THR B 1 311 ? 26.418  12.772  -37.176 1.00 61.78  ? 311  THR B OG1 1 
ATOM   6576 C CG2 . THR B 1 311 ? 27.406  10.790  -38.118 1.00 62.09  ? 311  THR B CG2 1 
ATOM   6577 N N   . PRO B 1 312 ? 23.066  12.147  -38.833 1.00 60.21  ? 312  PRO B N   1 
ATOM   6578 C CA  . PRO B 1 312 ? 21.862  12.866  -38.409 1.00 60.16  ? 312  PRO B CA  1 
ATOM   6579 C C   . PRO B 1 312 ? 22.088  13.713  -37.158 1.00 61.74  ? 312  PRO B C   1 
ATOM   6580 O O   . PRO B 1 312 ? 21.526  14.806  -37.058 1.00 61.20  ? 312  PRO B O   1 
ATOM   6581 C CB  . PRO B 1 312 ? 20.866  11.744  -38.110 1.00 59.23  ? 312  PRO B CB  1 
ATOM   6582 C CG  . PRO B 1 312 ? 21.292  10.635  -38.991 1.00 59.31  ? 312  PRO B CG  1 
ATOM   6583 C CD  . PRO B 1 312 ? 22.800  10.713  -39.026 1.00 59.60  ? 312  PRO B CD  1 
ATOM   6584 N N   . GLU B 1 313 ? 22.911  13.213  -36.231 1.00 63.62  ? 313  GLU B N   1 
ATOM   6585 C CA  . GLU B 1 313 ? 23.241  13.951  -35.006 1.00 65.46  ? 313  GLU B CA  1 
ATOM   6586 C C   . GLU B 1 313 ? 23.891  15.281  -35.350 1.00 66.03  ? 313  GLU B C   1 
ATOM   6587 O O   . GLU B 1 313 ? 23.462  16.325  -34.871 1.00 66.23  ? 313  GLU B O   1 
ATOM   6588 C CB  . GLU B 1 313 ? 24.171  13.138  -34.093 1.00 66.83  ? 313  GLU B CB  1 
ATOM   6589 C CG  . GLU B 1 313 ? 24.493  13.832  -32.747 1.00 70.43  ? 313  GLU B CG  1 
ATOM   6590 C CD  . GLU B 1 313 ? 25.798  13.346  -32.098 1.00 76.11  ? 313  GLU B CD  1 
ATOM   6591 O OE1 . GLU B 1 313 ? 25.930  12.123  -31.834 1.00 78.30  ? 313  GLU B OE1 1 
ATOM   6592 O OE2 . GLU B 1 313 ? 26.688  14.199  -31.845 1.00 78.84  ? 313  GLU B OE2 1 
ATOM   6593 N N   . ALA B 1 314 ? 24.923  15.234  -36.184 1.00 67.02  ? 314  ALA B N   1 
ATOM   6594 C CA  . ALA B 1 314 ? 25.617  16.442  -36.623 1.00 68.22  ? 314  ALA B CA  1 
ATOM   6595 C C   . ALA B 1 314 ? 24.666  17.402  -37.341 1.00 67.84  ? 314  ALA B C   1 
ATOM   6596 O O   . ALA B 1 314 ? 24.698  18.607  -37.100 1.00 68.58  ? 314  ALA B O   1 
ATOM   6597 C CB  . ALA B 1 314 ? 26.795  16.083  -37.528 1.00 69.15  ? 314  ALA B CB  1 
ATOM   6598 N N   . LEU B 1 315 ? 23.814  16.856  -38.205 1.00 66.89  ? 315  LEU B N   1 
ATOM   6599 C CA  . LEU B 1 315 ? 22.896  17.651  -39.015 1.00 66.42  ? 315  LEU B CA  1 
ATOM   6600 C C   . LEU B 1 315 ? 21.742  18.274  -38.205 1.00 66.27  ? 315  LEU B C   1 
ATOM   6601 O O   . LEU B 1 315 ? 21.351  19.413  -38.492 1.00 66.35  ? 315  LEU B O   1 
ATOM   6602 C CB  . LEU B 1 315 ? 22.342  16.802  -40.169 1.00 65.30  ? 315  LEU B CB  1 
ATOM   6603 C CG  . LEU B 1 315 ? 23.374  16.237  -41.156 1.00 65.02  ? 315  LEU B CG  1 
ATOM   6604 C CD1 . LEU B 1 315 ? 22.733  15.224  -42.106 1.00 61.27  ? 315  LEU B CD1 1 
ATOM   6605 C CD2 . LEU B 1 315 ? 24.029  17.359  -41.928 1.00 64.94  ? 315  LEU B CD2 1 
ATOM   6606 N N   . ILE B 1 316 ? 21.200  17.551  -37.215 1.00 66.18  ? 316  ILE B N   1 
ATOM   6607 C CA  . ILE B 1 316 ? 20.163  18.130  -36.329 1.00 66.31  ? 316  ILE B CA  1 
ATOM   6608 C C   . ILE B 1 316 ? 20.768  19.210  -35.405 1.00 68.74  ? 316  ILE B C   1 
ATOM   6609 O O   . ILE B 1 316 ? 20.152  20.251  -35.176 1.00 69.37  ? 316  ILE B O   1 
ATOM   6610 C CB  . ILE B 1 316 ? 19.290  17.065  -35.530 1.00 65.47  ? 316  ILE B CB  1 
ATOM   6611 C CG1 . ILE B 1 316 ? 20.049  16.361  -34.380 1.00 65.89  ? 316  ILE B CG1 1 
ATOM   6612 C CG2 . ILE B 1 316 ? 18.674  16.021  -36.493 1.00 64.10  ? 316  ILE B CG2 1 
ATOM   6613 C CD1 . ILE B 1 316 ? 19.168  15.438  -33.433 1.00 62.48  ? 316  ILE B CD1 1 
ATOM   6614 N N   . ASN B 1 317 ? 21.986  18.990  -34.915 1.00 70.71  ? 317  ASN B N   1 
ATOM   6615 C CA  . ASN B 1 317 ? 22.632  19.966  -34.015 1.00 72.49  ? 317  ASN B CA  1 
ATOM   6616 C C   . ASN B 1 317 ? 23.035  21.282  -34.690 1.00 73.87  ? 317  ASN B C   1 
ATOM   6617 O O   . ASN B 1 317 ? 23.049  22.318  -34.037 1.00 75.25  ? 317  ASN B O   1 
ATOM   6618 C CB  . ASN B 1 317 ? 23.850  19.348  -33.316 1.00 73.31  ? 317  ASN B CB  1 
ATOM   6619 C CG  . ASN B 1 317 ? 23.471  18.213  -32.372 1.00 73.43  ? 317  ASN B CG  1 
ATOM   6620 O OD1 . ASN B 1 317 ? 22.299  17.829  -32.271 1.00 73.82  ? 317  ASN B OD1 1 
ATOM   6621 N ND2 . ASN B 1 317 ? 24.467  17.658  -31.687 1.00 74.31  ? 317  ASN B ND2 1 
ATOM   6622 N N   . THR B 1 318 ? 23.348  21.250  -35.982 1.00 74.46  ? 318  THR B N   1 
ATOM   6623 C CA  . THR B 1 318 ? 23.898  22.421  -36.670 1.00 76.04  ? 318  THR B CA  1 
ATOM   6624 C C   . THR B 1 318 ? 23.022  22.940  -37.805 1.00 75.75  ? 318  THR B C   1 
ATOM   6625 O O   . THR B 1 318 ? 23.469  23.766  -38.600 1.00 77.00  ? 318  THR B O   1 
ATOM   6626 C CB  . THR B 1 318 ? 25.294  22.108  -37.277 1.00 77.42  ? 318  THR B CB  1 
ATOM   6627 O OG1 . THR B 1 318 ? 25.153  21.209  -38.390 1.00 76.82  ? 318  THR B OG1 1 
ATOM   6628 C CG2 . THR B 1 318 ? 26.231  21.502  -36.222 1.00 78.23  ? 318  THR B CG2 1 
ATOM   6629 N N   . GLY B 1 319 ? 21.788  22.461  -37.900 1.00 74.51  ? 319  GLY B N   1 
ATOM   6630 C CA  . GLY B 1 319 ? 20.902  22.875  -38.986 1.00 74.18  ? 319  GLY B CA  1 
ATOM   6631 C C   . GLY B 1 319 ? 20.195  24.188  -38.703 1.00 74.62  ? 319  GLY B C   1 
ATOM   6632 O O   . GLY B 1 319 ? 20.158  24.646  -37.568 1.00 74.80  ? 319  GLY B O   1 
ATOM   6633 N N   . ASP B 1 320 ? 19.647  24.798  -39.752 1.00 74.93  ? 320  ASP B N   1 
ATOM   6634 C CA  . ASP B 1 320 ? 18.721  25.921  -39.610 1.00 75.31  ? 320  ASP B CA  1 
ATOM   6635 C C   . ASP B 1 320 ? 17.357  25.472  -40.129 1.00 73.33  ? 320  ASP B C   1 
ATOM   6636 O O   . ASP B 1 320 ? 17.214  25.100  -41.302 1.00 72.78  ? 320  ASP B O   1 
ATOM   6637 C CB  . ASP B 1 320 ? 19.207  27.149  -40.387 1.00 77.35  ? 320  ASP B CB  1 
ATOM   6638 C CG  . ASP B 1 320 ? 18.280  28.359  -40.226 1.00 79.53  ? 320  ASP B CG  1 
ATOM   6639 O OD1 . ASP B 1 320 ? 17.152  28.191  -39.713 1.00 80.55  ? 320  ASP B OD1 1 
ATOM   6640 O OD2 . ASP B 1 320 ? 18.687  29.482  -40.611 1.00 83.20  ? 320  ASP B OD2 1 
ATOM   6641 N N   . PHE B 1 321 ? 16.359  25.524  -39.246 1.00 71.87  ? 321  PHE B N   1 
ATOM   6642 C CA  . PHE B 1 321 ? 15.039  24.968  -39.532 1.00 69.99  ? 321  PHE B CA  1 
ATOM   6643 C C   . PHE B 1 321 ? 13.932  26.014  -39.382 1.00 70.42  ? 321  PHE B C   1 
ATOM   6644 O O   . PHE B 1 321 ? 12.798  25.671  -39.054 1.00 70.20  ? 321  PHE B O   1 
ATOM   6645 C CB  . PHE B 1 321 ? 14.785  23.772  -38.612 1.00 68.14  ? 321  PHE B CB  1 
ATOM   6646 C CG  . PHE B 1 321 ? 15.777  22.651  -38.777 1.00 66.39  ? 321  PHE B CG  1 
ATOM   6647 C CD1 . PHE B 1 321 ? 15.887  21.974  -39.984 1.00 65.57  ? 321  PHE B CD1 1 
ATOM   6648 C CD2 . PHE B 1 321 ? 16.585  22.257  -37.726 1.00 65.90  ? 321  PHE B CD2 1 
ATOM   6649 C CE1 . PHE B 1 321 ? 16.795  20.941  -40.144 1.00 64.64  ? 321  PHE B CE1 1 
ATOM   6650 C CE2 . PHE B 1 321 ? 17.491  21.217  -37.881 1.00 66.06  ? 321  PHE B CE2 1 
ATOM   6651 C CZ  . PHE B 1 321 ? 17.592  20.560  -39.094 1.00 65.30  ? 321  PHE B CZ  1 
ATOM   6652 N N   . GLN B 1 322 ? 14.251  27.275  -39.682 1.00 71.47  ? 322  GLN B N   1 
ATOM   6653 C CA  . GLN B 1 322 ? 13.367  28.403  -39.358 1.00 72.12  ? 322  GLN B CA  1 
ATOM   6654 C C   . GLN B 1 322 ? 12.004  28.407  -40.060 1.00 70.88  ? 322  GLN B C   1 
ATOM   6655 O O   . GLN B 1 322 ? 10.997  28.732  -39.423 1.00 71.57  ? 322  GLN B O   1 
ATOM   6656 C CB  . GLN B 1 322 ? 14.071  29.753  -39.565 1.00 74.04  ? 322  GLN B CB  1 
ATOM   6657 C CG  . GLN B 1 322 ? 15.123  30.065  -38.492 1.00 76.76  ? 322  GLN B CG  1 
ATOM   6658 C CD  . GLN B 1 322 ? 14.917  31.411  -37.789 1.00 80.89  ? 322  GLN B CD  1 
ATOM   6659 O OE1 . GLN B 1 322 ? 14.854  31.478  -36.549 1.00 81.89  ? 322  GLN B OE1 1 
ATOM   6660 N NE2 . GLN B 1 322 ? 14.822  32.488  -38.576 1.00 82.97  ? 322  GLN B NE2 1 
ATOM   6661 N N   . ASP B 1 323 ? 11.945  28.051  -41.340 1.00 69.27  ? 323  ASP B N   1 
ATOM   6662 C CA  . ASP B 1 323 ? 10.654  28.037  -42.045 1.00 68.29  ? 323  ASP B CA  1 
ATOM   6663 C C   . ASP B 1 323 ? 10.075  26.601  -42.169 1.00 65.07  ? 323  ASP B C   1 
ATOM   6664 O O   . ASP B 1 323 ? 9.432   26.269  -43.166 1.00 64.86  ? 323  ASP B O   1 
ATOM   6665 C CB  . ASP B 1 323 ? 10.761  28.734  -43.422 1.00 69.82  ? 323  ASP B CB  1 
ATOM   6666 C CG  . ASP B 1 323 ? 11.058  30.262  -43.321 1.00 73.57  ? 323  ASP B CG  1 
ATOM   6667 O OD1 . ASP B 1 323 ? 10.980  30.865  -42.219 1.00 76.13  ? 323  ASP B OD1 1 
ATOM   6668 O OD2 . ASP B 1 323 ? 11.372  30.870  -44.372 1.00 77.63  ? 323  ASP B OD2 1 
ATOM   6669 N N   . LEU B 1 324 ? 10.280  25.778  -41.133 1.00 61.92  ? 324  LEU B N   1 
ATOM   6670 C CA  . LEU B 1 324 ? 9.765   24.406  -41.084 1.00 58.78  ? 324  LEU B CA  1 
ATOM   6671 C C   . LEU B 1 324 ? 8.773   24.210  -39.935 1.00 56.28  ? 324  LEU B C   1 
ATOM   6672 O O   . LEU B 1 324 ? 8.945   24.757  -38.857 1.00 55.91  ? 324  LEU B O   1 
ATOM   6673 C CB  . LEU B 1 324 ? 10.925  23.422  -40.916 1.00 58.58  ? 324  LEU B CB  1 
ATOM   6674 C CG  . LEU B 1 324 ? 10.616  21.923  -41.017 1.00 57.76  ? 324  LEU B CG  1 
ATOM   6675 C CD1 . LEU B 1 324 ? 10.237  21.524  -42.452 1.00 56.82  ? 324  LEU B CD1 1 
ATOM   6676 C CD2 . LEU B 1 324 ? 11.792  21.108  -40.489 1.00 57.77  ? 324  LEU B CD2 1 
ATOM   6677 N N   . GLN B 1 325 ? 7.729   23.428  -40.188 1.00 53.78  ? 325  GLN B N   1 
ATOM   6678 C CA  . GLN B 1 325 ? 6.809   22.998  -39.156 1.00 51.94  ? 325  GLN B CA  1 
ATOM   6679 C C   . GLN B 1 325 ? 6.798   21.478  -39.103 1.00 49.71  ? 325  GLN B C   1 
ATOM   6680 O O   . GLN B 1 325 ? 6.759   20.830  -40.159 1.00 47.86  ? 325  GLN B O   1 
ATOM   6681 C CB  . GLN B 1 325 ? 5.405   23.510  -39.421 1.00 52.80  ? 325  GLN B CB  1 
ATOM   6682 C CG  . GLN B 1 325 ? 5.285   25.034  -39.584 1.00 54.03  ? 325  GLN B CG  1 
ATOM   6683 C CD  . GLN B 1 325 ? 5.211   25.459  -41.030 1.00 55.74  ? 325  GLN B CD  1 
ATOM   6684 O OE1 . GLN B 1 325 ? 4.469   24.893  -41.816 1.00 57.75  ? 325  GLN B OE1 1 
ATOM   6685 N NE2 . GLN B 1 325 ? 5.990   26.453  -41.390 1.00 60.35  ? 325  GLN B NE2 1 
ATOM   6686 N N   . VAL B 1 326 ? 6.829   20.931  -37.877 1.00 48.27  ? 326  VAL B N   1 
ATOM   6687 C CA  . VAL B 1 326 ? 6.934   19.480  -37.642 1.00 47.28  ? 326  VAL B CA  1 
ATOM   6688 C C   . VAL B 1 326 ? 5.960   19.019  -36.566 1.00 46.76  ? 326  VAL B C   1 
ATOM   6689 O O   . VAL B 1 326 ? 5.776   19.687  -35.568 1.00 46.97  ? 326  VAL B O   1 
ATOM   6690 C CB  . VAL B 1 326 ? 8.373   19.055  -37.198 1.00 47.27  ? 326  VAL B CB  1 
ATOM   6691 C CG1 . VAL B 1 326 ? 8.523   17.553  -37.216 1.00 47.13  ? 326  VAL B CG1 1 
ATOM   6692 C CG2 . VAL B 1 326 ? 9.445   19.662  -38.090 1.00 47.28  ? 326  VAL B CG2 1 
ATOM   6693 N N   . LEU B 1 327 ? 5.354   17.859  -36.773 1.00 46.23  ? 327  LEU B N   1 
ATOM   6694 C CA  . LEU B 1 327 ? 4.535   17.200  -35.763 1.00 46.25  ? 327  LEU B CA  1 
ATOM   6695 C C   . LEU B 1 327 ? 5.190   15.853  -35.456 1.00 45.74  ? 327  LEU B C   1 
ATOM   6696 O O   . LEU B 1 327 ? 5.389   15.049  -36.357 1.00 44.96  ? 327  LEU B O   1 
ATOM   6697 C CB  . LEU B 1 327 ? 3.107   17.022  -36.292 1.00 46.76  ? 327  LEU B CB  1 
ATOM   6698 C CG  . LEU B 1 327 ? 2.097   16.119  -35.570 1.00 47.28  ? 327  LEU B CG  1 
ATOM   6699 C CD1 . LEU B 1 327 ? 1.857   16.596  -34.139 1.00 48.57  ? 327  LEU B CD1 1 
ATOM   6700 C CD2 . LEU B 1 327 ? 0.793   16.107  -36.376 1.00 48.96  ? 327  LEU B CD2 1 
ATOM   6701 N N   . VAL B 1 328 ? 5.560   15.631  -34.199 1.00 45.68  ? 328  VAL B N   1 
ATOM   6702 C CA  . VAL B 1 328 ? 6.230   14.393  -33.797 1.00 45.87  ? 328  VAL B CA  1 
ATOM   6703 C C   . VAL B 1 328 ? 5.501   13.758  -32.620 1.00 45.69  ? 328  VAL B C   1 
ATOM   6704 O O   . VAL B 1 328 ? 4.891   14.452  -31.817 1.00 46.84  ? 328  VAL B O   1 
ATOM   6705 C CB  . VAL B 1 328 ? 7.728   14.626  -33.386 1.00 45.96  ? 328  VAL B CB  1 
ATOM   6706 C CG1 . VAL B 1 328 ? 8.530   15.126  -34.534 1.00 47.13  ? 328  VAL B CG1 1 
ATOM   6707 C CG2 . VAL B 1 328 ? 7.829   15.608  -32.250 1.00 46.94  ? 328  VAL B CG2 1 
ATOM   6708 N N   . GLY B 1 329 ? 5.569   12.444  -32.507 1.00 45.19  ? 329  GLY B N   1 
ATOM   6709 C CA  . GLY B 1 329 ? 5.101   11.806  -31.300 1.00 45.68  ? 329  GLY B CA  1 
ATOM   6710 C C   . GLY B 1 329 ? 5.407   10.340  -31.212 1.00 45.40  ? 329  GLY B C   1 
ATOM   6711 O O   . GLY B 1 329 ? 6.117   9.809   -32.052 1.00 46.21  ? 329  GLY B O   1 
ATOM   6712 N N   . VAL B 1 330 ? 4.848   9.703   -30.182 1.00 45.42  ? 330  VAL B N   1 
ATOM   6713 C CA  . VAL B 1 330 ? 5.126   8.321   -29.818 1.00 44.87  ? 330  VAL B CA  1 
ATOM   6714 C C   . VAL B 1 330 ? 3.850   7.654   -29.312 1.00 45.90  ? 330  VAL B C   1 
ATOM   6715 O O   . VAL B 1 330 ? 2.876   8.333   -28.997 1.00 46.23  ? 330  VAL B O   1 
ATOM   6716 C CB  . VAL B 1 330 ? 6.204   8.242   -28.704 1.00 45.47  ? 330  VAL B CB  1 
ATOM   6717 C CG1 . VAL B 1 330 ? 7.540   8.828   -29.191 1.00 43.31  ? 330  VAL B CG1 1 
ATOM   6718 C CG2 . VAL B 1 330 ? 5.734   8.962   -27.406 1.00 44.33  ? 330  VAL B CG2 1 
ATOM   6719 N N   . VAL B 1 331 ? 3.842   6.325   -29.273 1.00 46.33  ? 331  VAL B N   1 
ATOM   6720 C CA  . VAL B 1 331 ? 2.722   5.578   -28.700 1.00 47.32  ? 331  VAL B CA  1 
ATOM   6721 C C   . VAL B 1 331 ? 3.070   5.234   -27.269 1.00 48.17  ? 331  VAL B C   1 
ATOM   6722 O O   . VAL B 1 331 ? 4.217   5.368   -26.863 1.00 47.14  ? 331  VAL B O   1 
ATOM   6723 C CB  . VAL B 1 331 ? 2.410   4.287   -29.482 1.00 47.82  ? 331  VAL B CB  1 
ATOM   6724 C CG1 . VAL B 1 331 ? 1.839   4.627   -30.851 1.00 47.08  ? 331  VAL B CG1 1 
ATOM   6725 C CG2 . VAL B 1 331 ? 3.653   3.373   -29.591 1.00 47.52  ? 331  VAL B CG2 1 
ATOM   6726 N N   . LYS B 1 332 ? 2.087   4.769   -26.505 1.00 49.59  ? 332  LYS B N   1 
ATOM   6727 C CA  . LYS B 1 332 ? 2.281   4.613   -25.079 1.00 50.97  ? 332  LYS B CA  1 
ATOM   6728 C C   . LYS B 1 332 ? 3.282   3.506   -24.762 1.00 51.10  ? 332  LYS B C   1 
ATOM   6729 O O   . LYS B 1 332 ? 4.025   3.628   -23.802 1.00 51.72  ? 332  LYS B O   1 
ATOM   6730 C CB  . LYS B 1 332 ? 0.957   4.371   -24.356 1.00 52.42  ? 332  LYS B CB  1 
ATOM   6731 C CG  . LYS B 1 332 ? 1.025   4.578   -22.849 1.00 54.52  ? 332  LYS B CG  1 
ATOM   6732 C CD  . LYS B 1 332 ? -0.259  4.106   -22.161 1.00 58.70  ? 332  LYS B CD  1 
ATOM   6733 C CE  . LYS B 1 332 ? -0.071  4.024   -20.631 1.00 62.14  ? 332  LYS B CE  1 
ATOM   6734 N NZ  . LYS B 1 332 ? -0.510  2.695   -20.043 1.00 65.28  ? 332  LYS B NZ  1 
ATOM   6735 N N   . ASP B 1 333 ? 3.318   2.451   -25.569 1.00 51.06  ? 333  ASP B N   1 
ATOM   6736 C CA  . ASP B 1 333 ? 4.180   1.287   -25.286 1.00 51.64  ? 333  ASP B CA  1 
ATOM   6737 C C   . ASP B 1 333 ? 5.029   0.901   -26.493 1.00 50.81  ? 333  ASP B C   1 
ATOM   6738 O O   . ASP B 1 333 ? 4.852   -0.142  -27.082 1.00 50.87  ? 333  ASP B O   1 
ATOM   6739 C CB  . ASP B 1 333 ? 3.320   0.109   -24.830 1.00 53.01  ? 333  ASP B CB  1 
ATOM   6740 C CG  . ASP B 1 333 ? 2.529   0.427   -23.582 1.00 54.18  ? 333  ASP B CG  1 
ATOM   6741 O OD1 . ASP B 1 333 ? 1.364   0.872   -23.690 1.00 55.95  ? 333  ASP B OD1 1 
ATOM   6742 O OD2 . ASP B 1 333 ? 3.086   0.250   -22.488 1.00 56.27  ? 333  ASP B OD2 1 
ATOM   6743 N N   . GLU B 1 334 ? 5.969   1.766   -26.835 1.00 50.21  ? 334  GLU B N   1 
ATOM   6744 C CA  . GLU B 1 334 ? 6.814   1.603   -28.011 1.00 49.57  ? 334  GLU B CA  1 
ATOM   6745 C C   . GLU B 1 334 ? 7.602   0.292   -28.047 1.00 50.50  ? 334  GLU B C   1 
ATOM   6746 O O   . GLU B 1 334 ? 7.869   -0.236  -29.130 1.00 51.15  ? 334  GLU B O   1 
ATOM   6747 C CB  . GLU B 1 334 ? 7.813   2.765   -28.104 1.00 49.13  ? 334  GLU B CB  1 
ATOM   6748 C CG  . GLU B 1 334 ? 7.210   4.132   -28.466 1.00 49.05  ? 334  GLU B CG  1 
ATOM   6749 C CD  . GLU B 1 334 ? 6.768   4.215   -29.927 1.00 50.73  ? 334  GLU B CD  1 
ATOM   6750 O OE1 . GLU B 1 334 ? 7.018   3.249   -30.680 1.00 52.55  ? 334  GLU B OE1 1 
ATOM   6751 O OE2 . GLU B 1 334 ? 6.156   5.228   -30.324 1.00 48.56  ? 334  GLU B OE2 1 
ATOM   6752 N N   . GLY B 1 335 ? 7.985   -0.239  -26.894 1.00 51.30  ? 335  GLY B N   1 
ATOM   6753 C CA  . GLY B 1 335 ? 8.890   -1.395  -26.863 1.00 52.21  ? 335  GLY B CA  1 
ATOM   6754 C C   . GLY B 1 335 ? 8.274   -2.788  -26.885 1.00 52.93  ? 335  GLY B C   1 
ATOM   6755 O O   . GLY B 1 335 ? 8.954   -3.749  -27.216 1.00 53.18  ? 335  GLY B O   1 
ATOM   6756 N N   . SER B 1 336 ? 7.002   -2.914  -26.520 1.00 53.97  ? 336  SER B N   1 
ATOM   6757 C CA  . SER B 1 336 ? 6.402   -4.245  -26.297 1.00 55.62  ? 336  SER B CA  1 
ATOM   6758 C C   . SER B 1 336 ? 6.473   -5.168  -27.523 1.00 56.63  ? 336  SER B C   1 
ATOM   6759 O O   . SER B 1 336 ? 6.850   -6.353  -27.412 1.00 58.08  ? 336  SER B O   1 
ATOM   6760 C CB  . SER B 1 336 ? 4.959   -4.115  -25.799 1.00 56.10  ? 336  SER B CB  1 
ATOM   6761 O OG  . SER B 1 336 ? 4.139   -3.396  -26.706 1.00 55.44  ? 336  SER B OG  1 
ATOM   6762 N N   . TYR B 1 337 ? 6.132   -4.624  -28.688 1.00 56.19  ? 337  TYR B N   1 
ATOM   6763 C CA  . TYR B 1 337 ? 6.142   -5.374  -29.951 1.00 57.14  ? 337  TYR B CA  1 
ATOM   6764 C C   . TYR B 1 337 ? 7.424   -6.166  -30.197 1.00 57.60  ? 337  TYR B C   1 
ATOM   6765 O O   . TYR B 1 337 ? 7.369   -7.306  -30.658 1.00 57.91  ? 337  TYR B O   1 
ATOM   6766 C CB  . TYR B 1 337 ? 5.923   -4.412  -31.129 1.00 57.18  ? 337  TYR B CB  1 
ATOM   6767 C CG  . TYR B 1 337 ? 5.584   -5.066  -32.444 1.00 58.43  ? 337  TYR B CG  1 
ATOM   6768 C CD1 . TYR B 1 337 ? 4.263   -5.338  -32.767 1.00 60.93  ? 337  TYR B CD1 1 
ATOM   6769 C CD2 . TYR B 1 337 ? 6.566   -5.395  -33.373 1.00 59.60  ? 337  TYR B CD2 1 
ATOM   6770 C CE1 . TYR B 1 337 ? 3.917   -5.931  -33.973 1.00 60.78  ? 337  TYR B CE1 1 
ATOM   6771 C CE2 . TYR B 1 337 ? 6.226   -6.000  -34.601 1.00 59.44  ? 337  TYR B CE2 1 
ATOM   6772 C CZ  . TYR B 1 337 ? 4.892   -6.256  -34.884 1.00 59.98  ? 337  TYR B CZ  1 
ATOM   6773 O OH  . TYR B 1 337 ? 4.483   -6.844  -36.076 1.00 62.72  ? 337  TYR B OH  1 
ATOM   6774 N N   . PHE B 1 338 ? 8.570   -5.555  -29.904 1.00 56.87  ? 338  PHE B N   1 
ATOM   6775 C CA  . PHE B 1 338 ? 9.863   -6.102  -30.321 1.00 57.59  ? 338  PHE B CA  1 
ATOM   6776 C C   . PHE B 1 338 ? 10.395  -7.182  -29.391 1.00 58.57  ? 338  PHE B C   1 
ATOM   6777 O O   . PHE B 1 338 ? 11.293  -7.933  -29.763 1.00 59.01  ? 338  PHE B O   1 
ATOM   6778 C CB  . PHE B 1 338 ? 10.893  -4.973  -30.448 1.00 57.67  ? 338  PHE B CB  1 
ATOM   6779 C CG  . PHE B 1 338 ? 10.482  -3.910  -31.421 1.00 57.17  ? 338  PHE B CG  1 
ATOM   6780 C CD1 . PHE B 1 338 ? 9.731   -2.816  -30.999 1.00 57.74  ? 338  PHE B CD1 1 
ATOM   6781 C CD2 . PHE B 1 338 ? 10.797  -4.028  -32.764 1.00 57.75  ? 338  PHE B CD2 1 
ATOM   6782 C CE1 . PHE B 1 338 ? 9.316   -1.851  -31.907 1.00 57.32  ? 338  PHE B CE1 1 
ATOM   6783 C CE2 . PHE B 1 338 ? 10.397  -3.052  -33.680 1.00 56.32  ? 338  PHE B CE2 1 
ATOM   6784 C CZ  . PHE B 1 338 ? 9.658   -1.976  -33.252 1.00 56.22  ? 338  PHE B CZ  1 
ATOM   6785 N N   . LEU B 1 339 ? 9.832   -7.261  -28.189 1.00 58.93  ? 339  LEU B N   1 
ATOM   6786 C CA  . LEU B 1 339 ? 10.331  -8.166  -27.164 1.00 60.03  ? 339  LEU B CA  1 
ATOM   6787 C C   . LEU B 1 339 ? 10.062  -9.627  -27.532 1.00 61.72  ? 339  LEU B C   1 
ATOM   6788 O O   . LEU B 1 339 ? 10.875  -10.499 -27.237 1.00 62.44  ? 339  LEU B O   1 
ATOM   6789 C CB  . LEU B 1 339 ? 9.709   -7.825  -25.800 1.00 60.16  ? 339  LEU B CB  1 
ATOM   6790 C CG  . LEU B 1 339 ? 10.003  -6.444  -25.199 1.00 57.51  ? 339  LEU B CG  1 
ATOM   6791 C CD1 . LEU B 1 339 ? 9.397   -6.321  -23.819 1.00 56.09  ? 339  LEU B CD1 1 
ATOM   6792 C CD2 . LEU B 1 339 ? 11.500  -6.163  -25.148 1.00 55.76  ? 339  LEU B CD2 1 
ATOM   6793 N N   . VAL B 1 340 ? 8.932   -9.873  -28.197 1.00 62.27  ? 340  VAL B N   1 
ATOM   6794 C CA  . VAL B 1 340 ? 8.515   -11.236 -28.569 1.00 64.27  ? 340  VAL B CA  1 
ATOM   6795 C C   . VAL B 1 340 ? 9.353   -11.835 -29.711 1.00 65.17  ? 340  VAL B C   1 
ATOM   6796 O O   . VAL B 1 340 ? 9.251   -13.026 -30.002 1.00 66.52  ? 340  VAL B O   1 
ATOM   6797 C CB  . VAL B 1 340 ? 7.009   -11.271 -28.937 1.00 64.29  ? 340  VAL B CB  1 
ATOM   6798 C CG1 . VAL B 1 340 ? 6.163   -10.859 -27.723 1.00 63.74  ? 340  VAL B CG1 1 
ATOM   6799 C CG2 . VAL B 1 340 ? 6.715   -10.359 -30.144 1.00 62.23  ? 340  VAL B CG2 1 
ATOM   6800 N N   . TYR B 1 341 ? 10.201  -11.004 -30.319 1.00 64.97  ? 341  TYR B N   1 
ATOM   6801 C CA  . TYR B 1 341 ? 11.037  -11.387 -31.449 1.00 65.67  ? 341  TYR B CA  1 
ATOM   6802 C C   . TYR B 1 341 ? 12.473  -11.720 -31.058 1.00 67.01  ? 341  TYR B C   1 
ATOM   6803 O O   . TYR B 1 341 ? 13.341  -11.814 -31.918 1.00 67.90  ? 341  TYR B O   1 
ATOM   6804 C CB  . TYR B 1 341 ? 11.075  -10.240 -32.467 1.00 64.46  ? 341  TYR B CB  1 
ATOM   6805 C CG  . TYR B 1 341 ? 9.856   -10.145 -33.346 1.00 64.20  ? 341  TYR B CG  1 
ATOM   6806 C CD1 . TYR B 1 341 ? 8.820   -9.266  -33.052 1.00 63.43  ? 341  TYR B CD1 1 
ATOM   6807 C CD2 . TYR B 1 341 ? 9.745   -10.933 -34.481 1.00 65.39  ? 341  TYR B CD2 1 
ATOM   6808 C CE1 . TYR B 1 341 ? 7.700   -9.181  -33.870 1.00 63.40  ? 341  TYR B CE1 1 
ATOM   6809 C CE2 . TYR B 1 341 ? 8.640   -10.858 -35.300 1.00 65.15  ? 341  TYR B CE2 1 
ATOM   6810 C CZ  . TYR B 1 341 ? 7.621   -9.982  -34.996 1.00 64.34  ? 341  TYR B CZ  1 
ATOM   6811 O OH  . TYR B 1 341 ? 6.533   -9.923  -35.828 1.00 64.96  ? 341  TYR B OH  1 
ATOM   6812 N N   . GLY B 1 342 ? 12.761  -11.907 -29.782 1.00 68.30  ? 342  GLY B N   1 
ATOM   6813 C CA  . GLY B 1 342 ? 14.158  -12.157 -29.409 1.00 69.16  ? 342  GLY B CA  1 
ATOM   6814 C C   . GLY B 1 342 ? 14.508  -12.333 -27.948 1.00 69.73  ? 342  GLY B C   1 
ATOM   6815 O O   . GLY B 1 342 ? 15.461  -13.045 -27.635 1.00 71.89  ? 342  GLY B O   1 
ATOM   6816 N N   . VAL B 1 343 ? 13.766  -11.684 -27.057 1.00 68.68  ? 343  VAL B N   1 
ATOM   6817 C CA  . VAL B 1 343 ? 14.073  -11.736 -25.628 1.00 69.02  ? 343  VAL B CA  1 
ATOM   6818 C C   . VAL B 1 343 ? 13.386  -12.940 -24.980 1.00 70.27  ? 343  VAL B C   1 
ATOM   6819 O O   . VAL B 1 343 ? 12.157  -13.056 -25.027 1.00 69.93  ? 343  VAL B O   1 
ATOM   6820 C CB  . VAL B 1 343 ? 13.649  -10.447 -24.888 1.00 67.70  ? 343  VAL B CB  1 
ATOM   6821 C CG1 . VAL B 1 343 ? 14.233  -10.447 -23.490 1.00 68.00  ? 343  VAL B CG1 1 
ATOM   6822 C CG2 . VAL B 1 343 ? 14.103  -9.197  -25.655 1.00 65.74  ? 343  VAL B CG2 1 
ATOM   6823 N N   . PRO B 1 344 ? 14.173  -13.855 -24.398 1.00 71.61  ? 344  PRO B N   1 
ATOM   6824 C CA  . PRO B 1 344 ? 13.553  -14.996 -23.720 1.00 73.23  ? 344  PRO B CA  1 
ATOM   6825 C C   . PRO B 1 344 ? 12.604  -14.611 -22.578 1.00 72.92  ? 344  PRO B C   1 
ATOM   6826 O O   . PRO B 1 344 ? 12.881  -13.671 -21.817 1.00 72.09  ? 344  PRO B O   1 
ATOM   6827 C CB  . PRO B 1 344 ? 14.757  -15.792 -23.202 1.00 75.05  ? 344  PRO B CB  1 
ATOM   6828 C CG  . PRO B 1 344 ? 15.867  -15.417 -24.130 1.00 74.48  ? 344  PRO B CG  1 
ATOM   6829 C CD  . PRO B 1 344 ? 15.641  -13.951 -24.382 1.00 72.38  ? 344  PRO B CD  1 
ATOM   6830 N N   . GLY B 1 345 ? 11.485  -15.331 -22.497 1.00 73.19  ? 345  GLY B N   1 
ATOM   6831 C CA  . GLY B 1 345 ? 10.445  -15.084 -21.504 1.00 73.22  ? 345  GLY B CA  1 
ATOM   6832 C C   . GLY B 1 345 ? 9.239   -14.329 -22.038 1.00 71.61  ? 345  GLY B C   1 
ATOM   6833 O O   . GLY B 1 345 ? 8.213   -14.239 -21.361 1.00 71.85  ? 345  GLY B O   1 
ATOM   6834 N N   . PHE B 1 346 ? 9.351   -13.790 -23.252 1.00 70.16  ? 346  PHE B N   1 
ATOM   6835 C CA  . PHE B 1 346 ? 8.305   -12.939 -23.824 1.00 68.64  ? 346  PHE B CA  1 
ATOM   6836 C C   . PHE B 1 346 ? 7.538   -13.642 -24.932 1.00 69.31  ? 346  PHE B C   1 
ATOM   6837 O O   . PHE B 1 346 ? 8.140   -14.257 -25.813 1.00 69.82  ? 346  PHE B O   1 
ATOM   6838 C CB  . PHE B 1 346 ? 8.918   -11.639 -24.335 1.00 66.49  ? 346  PHE B CB  1 
ATOM   6839 C CG  . PHE B 1 346 ? 9.361   -10.719 -23.233 1.00 65.66  ? 346  PHE B CG  1 
ATOM   6840 C CD1 . PHE B 1 346 ? 10.637  -10.804 -22.712 1.00 65.66  ? 346  PHE B CD1 1 
ATOM   6841 C CD2 . PHE B 1 346 ? 8.484   -9.788  -22.694 1.00 64.92  ? 346  PHE B CD2 1 
ATOM   6842 C CE1 . PHE B 1 346 ? 11.038  -9.961  -21.687 1.00 65.61  ? 346  PHE B CE1 1 
ATOM   6843 C CE2 . PHE B 1 346 ? 8.880   -8.949  -21.665 1.00 64.06  ? 346  PHE B CE2 1 
ATOM   6844 C CZ  . PHE B 1 346 ? 10.159  -9.033  -21.167 1.00 64.48  ? 346  PHE B CZ  1 
ATOM   6845 N N   . SER B 1 347 ? 6.210   -13.540 -24.880 1.00 69.79  ? 347  SER B N   1 
ATOM   6846 C CA  . SER B 1 347 ? 5.329   -14.215 -25.829 1.00 70.59  ? 347  SER B CA  1 
ATOM   6847 C C   . SER B 1 347 ? 3.975   -13.527 -25.888 1.00 70.43  ? 347  SER B C   1 
ATOM   6848 O O   . SER B 1 347 ? 3.538   -12.922 -24.908 1.00 70.34  ? 347  SER B O   1 
ATOM   6849 C CB  . SER B 1 347 ? 5.142   -15.677 -25.418 1.00 72.90  ? 347  SER B CB  1 
ATOM   6850 O OG  . SER B 1 347 ? 4.200   -16.354 -26.248 1.00 74.34  ? 347  SER B OG  1 
ATOM   6851 N N   . LYS B 1 348 ? 3.310   -13.622 -27.039 1.00 70.66  ? 348  LYS B N   1 
ATOM   6852 C CA  . LYS B 1 348 ? 1.935   -13.147 -27.167 1.00 70.97  ? 348  LYS B CA  1 
ATOM   6853 C C   . LYS B 1 348 ? 0.999   -14.078 -26.405 1.00 73.49  ? 348  LYS B C   1 
ATOM   6854 O O   . LYS B 1 348 ? -0.103  -13.691 -26.029 1.00 73.90  ? 348  LYS B O   1 
ATOM   6855 C CB  . LYS B 1 348 ? 1.496   -13.076 -28.637 1.00 70.28  ? 348  LYS B CB  1 
ATOM   6856 C CG  . LYS B 1 348 ? 1.068   -14.427 -29.254 1.00 71.95  ? 348  LYS B CG  1 
ATOM   6857 C CD  . LYS B 1 348 ? 0.361   -14.237 -30.586 1.00 71.13  ? 348  LYS B CD  1 
ATOM   6858 C CE  . LYS B 1 348 ? -0.059  -15.567 -31.204 1.00 73.00  ? 348  LYS B CE  1 
ATOM   6859 N NZ  . LYS B 1 348 ? -1.189  -16.227 -30.482 1.00 73.77  ? 348  LYS B NZ  1 
ATOM   6860 N N   . ASP B 1 349 ? 1.446   -15.311 -26.190 1.00 75.70  ? 349  ASP B N   1 
ATOM   6861 C CA  . ASP B 1 349 ? 0.575   -16.369 -25.699 1.00 78.41  ? 349  ASP B CA  1 
ATOM   6862 C C   . ASP B 1 349 ? 0.531   -16.503 -24.180 1.00 80.23  ? 349  ASP B C   1 
ATOM   6863 O O   . ASP B 1 349 ? -0.267  -17.285 -23.660 1.00 82.02  ? 349  ASP B O   1 
ATOM   6864 C CB  . ASP B 1 349 ? 0.980   -17.695 -26.344 1.00 79.76  ? 349  ASP B CB  1 
ATOM   6865 C CG  . ASP B 1 349 ? 0.712   -17.709 -27.835 1.00 79.09  ? 349  ASP B CG  1 
ATOM   6866 O OD1 . ASP B 1 349 ? -0.366  -17.217 -28.232 1.00 78.58  ? 349  ASP B OD1 1 
ATOM   6867 O OD2 . ASP B 1 349 ? 1.572   -18.200 -28.605 1.00 79.03  ? 349  ASP B OD2 1 
ATOM   6868 N N   . ASN B 1 350 ? 1.372   -15.752 -23.467 1.00 79.76  ? 350  ASN B N   1 
ATOM   6869 C CA  . ASN B 1 350 ? 1.262   -15.676 -22.012 1.00 81.11  ? 350  ASN B CA  1 
ATOM   6870 C C   . ASN B 1 350 ? 1.489   -14.264 -21.485 1.00 78.88  ? 350  ASN B C   1 
ATOM   6871 O O   . ASN B 1 350 ? 1.752   -13.333 -22.253 1.00 77.32  ? 350  ASN B O   1 
ATOM   6872 C CB  . ASN B 1 350 ? 2.147   -16.737 -21.308 1.00 83.16  ? 350  ASN B CB  1 
ATOM   6873 C CG  . ASN B 1 350 ? 3.645   -16.608 -21.617 1.00 85.50  ? 350  ASN B CG  1 
ATOM   6874 O OD1 . ASN B 1 350 ? 4.180   -15.511 -21.816 1.00 84.27  ? 350  ASN B OD1 1 
ATOM   6875 N ND2 . ASN B 1 350 ? 4.341   -17.766 -21.586 1.00 93.08  ? 350  ASN B ND2 1 
ATOM   6876 N N   . GLU B 1 351 ? 1.362   -14.115 -20.173 1.00 78.77  ? 351  GLU B N   1 
ATOM   6877 C CA  . GLU B 1 351 ? 1.435   -12.826 -19.514 1.00 77.11  ? 351  GLU B CA  1 
ATOM   6878 C C   . GLU B 1 351 ? 2.877   -12.268 -19.464 1.00 74.90  ? 351  GLU B C   1 
ATOM   6879 O O   . GLU B 1 351 ? 3.086   -11.124 -19.087 1.00 72.93  ? 351  GLU B O   1 
ATOM   6880 C CB  . GLU B 1 351 ? 0.832   -12.957 -18.108 1.00 78.90  ? 351  GLU B CB  1 
ATOM   6881 C CG  . GLU B 1 351 ? -0.180  -11.872 -17.760 1.00 80.11  ? 351  GLU B CG  1 
ATOM   6882 C CD  . GLU B 1 351 ? -0.945  -12.174 -16.481 1.00 83.60  ? 351  GLU B CD  1 
ATOM   6883 O OE1 . GLU B 1 351 ? -1.694  -13.175 -16.457 1.00 85.49  ? 351  GLU B OE1 1 
ATOM   6884 O OE2 . GLU B 1 351 ? -0.801  -11.407 -15.501 1.00 84.57  ? 351  GLU B OE2 1 
ATOM   6885 N N   . SER B 1 352 ? 3.857   -13.087 -19.850 1.00 74.59  ? 352  SER B N   1 
ATOM   6886 C CA  . SER B 1 352 ? 5.259   -12.673 -19.996 1.00 73.02  ? 352  SER B CA  1 
ATOM   6887 C C   . SER B 1 352 ? 5.852   -12.103 -18.712 1.00 72.95  ? 352  SER B C   1 
ATOM   6888 O O   . SER B 1 352 ? 6.595   -11.117 -18.729 1.00 71.33  ? 352  SER B O   1 
ATOM   6889 C CB  . SER B 1 352 ? 5.420   -11.683 -21.149 1.00 71.00  ? 352  SER B CB  1 
ATOM   6890 O OG  . SER B 1 352 ? 5.078   -12.282 -22.380 1.00 70.63  ? 352  SER B OG  1 
ATOM   6891 N N   . LEU B 1 353 ? 5.533   -12.749 -17.597 1.00 74.32  ? 353  LEU B N   1 
ATOM   6892 C CA  . LEU B 1 353 ? 6.065   -12.351 -16.305 1.00 74.54  ? 353  LEU B CA  1 
ATOM   6893 C C   . LEU B 1 353 ? 7.446   -12.967 -16.198 1.00 75.24  ? 353  LEU B C   1 
ATOM   6894 O O   . LEU B 1 353 ? 7.584   -14.184 -16.223 1.00 77.22  ? 353  LEU B O   1 
ATOM   6895 C CB  . LEU B 1 353 ? 5.143   -12.829 -15.180 1.00 76.18  ? 353  LEU B CB  1 
ATOM   6896 C CG  . LEU B 1 353 ? 3.733   -12.220 -15.186 1.00 75.32  ? 353  LEU B CG  1 
ATOM   6897 C CD1 . LEU B 1 353 ? 2.877   -12.847 -14.087 1.00 76.32  ? 353  LEU B CD1 1 
ATOM   6898 C CD2 . LEU B 1 353 ? 3.774   -10.691 -15.045 1.00 71.38  ? 353  LEU B CD2 1 
ATOM   6899 N N   . ILE B 1 354 ? 8.469   -12.126 -16.099 1.00 74.10  ? 354  ILE B N   1 
ATOM   6900 C CA  . ILE B 1 354 ? 9.852   -12.585 -16.206 1.00 74.43  ? 354  ILE B CA  1 
ATOM   6901 C C   . ILE B 1 354 ? 10.638  -12.466 -14.904 1.00 75.25  ? 354  ILE B C   1 
ATOM   6902 O O   . ILE B 1 354 ? 10.298  -11.683 -14.020 1.00 74.65  ? 354  ILE B O   1 
ATOM   6903 C CB  . ILE B 1 354 ? 10.614  -11.830 -17.329 1.00 72.61  ? 354  ILE B CB  1 
ATOM   6904 C CG1 . ILE B 1 354 ? 10.522  -10.308 -17.143 1.00 70.61  ? 354  ILE B CG1 1 
ATOM   6905 C CG2 . ILE B 1 354 ? 10.064  -12.243 -18.694 1.00 72.62  ? 354  ILE B CG2 1 
ATOM   6906 C CD1 . ILE B 1 354 ? 11.672  -9.538  -17.766 1.00 68.61  ? 354  ILE B CD1 1 
ATOM   6907 N N   . SER B 1 355 ? 11.701  -13.258 -14.813 1.00 76.58  ? 355  SER B N   1 
ATOM   6908 C CA  . SER B 1 355 ? 12.628  -13.201 -13.690 1.00 77.78  ? 355  SER B CA  1 
ATOM   6909 C C   . SER B 1 355 ? 13.559  -12.011 -13.834 1.00 76.52  ? 355  SER B C   1 
ATOM   6910 O O   . SER B 1 355 ? 13.714  -11.457 -14.926 1.00 74.81  ? 355  SER B O   1 
ATOM   6911 C CB  . SER B 1 355 ? 13.492  -14.454 -13.661 1.00 79.65  ? 355  SER B CB  1 
ATOM   6912 O OG  . SER B 1 355 ? 14.427  -14.438 -14.733 1.00 79.03  ? 355  SER B OG  1 
ATOM   6913 N N   . ARG B 1 356 ? 14.219  -11.657 -12.736 1.00 77.35  ? 356  ARG B N   1 
ATOM   6914 C CA  . ARG B 1 356 ? 15.257  -10.642 -12.783 1.00 76.61  ? 356  ARG B CA  1 
ATOM   6915 C C   . ARG B 1 356 ? 16.397  -11.068 -13.705 1.00 76.58  ? 356  ARG B C   1 
ATOM   6916 O O   . ARG B 1 356 ? 16.952  -10.238 -14.434 1.00 75.34  ? 356  ARG B O   1 
ATOM   6917 C CB  . ARG B 1 356 ? 15.804  -10.345 -11.391 1.00 77.81  ? 356  ARG B CB  1 
ATOM   6918 C CG  . ARG B 1 356 ? 16.838  -9.233  -11.412 1.00 77.65  ? 356  ARG B CG  1 
ATOM   6919 C CD  . ARG B 1 356 ? 16.998  -8.578  -10.074 1.00 79.63  ? 356  ARG B CD  1 
ATOM   6920 N NE  . ARG B 1 356 ? 17.944  -7.475  -10.161 1.00 79.62  ? 356  ARG B NE  1 
ATOM   6921 C CZ  . ARG B 1 356 ? 17.647  -6.248  -10.583 1.00 78.58  ? 356  ARG B CZ  1 
ATOM   6922 N NH1 . ARG B 1 356 ? 16.413  -5.928  -10.964 1.00 76.64  ? 356  ARG B NH1 1 
ATOM   6923 N NH2 . ARG B 1 356 ? 18.602  -5.327  -10.618 1.00 79.41  ? 356  ARG B NH2 1 
ATOM   6924 N N   . ALA B 1 357 ? 16.733  -12.358 -13.671 1.00 77.83  ? 357  ALA B N   1 
ATOM   6925 C CA  . ALA B 1 357 ? 17.784  -12.916 -14.524 1.00 78.11  ? 357  ALA B CA  1 
ATOM   6926 C C   . ALA B 1 357 ? 17.467  -12.695 -15.994 1.00 76.13  ? 357  ALA B C   1 
ATOM   6927 O O   . ALA B 1 357 ? 18.348  -12.334 -16.779 1.00 75.44  ? 357  ALA B O   1 
ATOM   6928 C CB  . ALA B 1 357 ? 17.960  -14.402 -14.246 1.00 80.32  ? 357  ALA B CB  1 
ATOM   6929 N N   . GLN B 1 358 ? 16.201  -12.912 -16.348 1.00 75.19  ? 358  GLN B N   1 
ATOM   6930 C CA  . GLN B 1 358 ? 15.718  -12.715 -17.715 1.00 73.37  ? 358  GLN B CA  1 
ATOM   6931 C C   . GLN B 1 358 ? 15.714  -11.235 -18.108 1.00 70.99  ? 358  GLN B C   1 
ATOM   6932 O O   . GLN B 1 358 ? 15.876  -10.900 -19.289 1.00 69.58  ? 358  GLN B O   1 
ATOM   6933 C CB  . GLN B 1 358 ? 14.316  -13.320 -17.880 1.00 73.66  ? 358  GLN B CB  1 
ATOM   6934 C CG  . GLN B 1 358 ? 14.315  -14.841 -18.004 1.00 75.51  ? 358  GLN B CG  1 
ATOM   6935 C CD  . GLN B 1 358 ? 12.923  -15.450 -17.944 1.00 76.07  ? 358  GLN B CD  1 
ATOM   6936 O OE1 . GLN B 1 358 ? 12.077  -15.014 -17.163 1.00 77.11  ? 358  GLN B OE1 1 
ATOM   6937 N NE2 . GLN B 1 358 ? 12.689  -16.485 -18.748 1.00 75.74  ? 358  GLN B NE2 1 
ATOM   6938 N N   . PHE B 1 359 ? 15.537  -10.360 -17.116 1.00 70.15  ? 359  PHE B N   1 
ATOM   6939 C CA  . PHE B 1 359 ? 15.609  -8.925  -17.334 1.00 68.34  ? 359  PHE B CA  1 
ATOM   6940 C C   . PHE B 1 359 ? 17.043  -8.493  -17.671 1.00 68.19  ? 359  PHE B C   1 
ATOM   6941 O O   . PHE B 1 359 ? 17.264  -7.790  -18.656 1.00 66.62  ? 359  PHE B O   1 
ATOM   6942 C CB  . PHE B 1 359 ? 15.070  -8.162  -16.115 1.00 68.16  ? 359  PHE B CB  1 
ATOM   6943 C CG  . PHE B 1 359 ? 15.232  -6.682  -16.213 1.00 66.37  ? 359  PHE B CG  1 
ATOM   6944 C CD1 . PHE B 1 359 ? 16.051  -5.995  -15.321 1.00 67.04  ? 359  PHE B CD1 1 
ATOM   6945 C CD2 . PHE B 1 359 ? 14.586  -5.970  -17.210 1.00 64.79  ? 359  PHE B CD2 1 
ATOM   6946 C CE1 . PHE B 1 359 ? 16.212  -4.619  -15.415 1.00 64.88  ? 359  PHE B CE1 1 
ATOM   6947 C CE2 . PHE B 1 359 ? 14.745  -4.591  -17.320 1.00 64.20  ? 359  PHE B CE2 1 
ATOM   6948 C CZ  . PHE B 1 359 ? 15.561  -3.913  -16.416 1.00 63.82  ? 359  PHE B CZ  1 
ATOM   6949 N N   . LEU B 1 360 ? 18.015  -8.926  -16.875 1.00 69.84  ? 360  LEU B N   1 
ATOM   6950 C CA  . LEU B 1 360 ? 19.420  -8.603  -17.160 1.00 70.28  ? 360  LEU B CA  1 
ATOM   6951 C C   . LEU B 1 360 ? 19.843  -9.087  -18.549 1.00 69.79  ? 360  LEU B C   1 
ATOM   6952 O O   . LEU B 1 360 ? 20.530  -8.373  -19.282 1.00 68.57  ? 360  LEU B O   1 
ATOM   6953 C CB  . LEU B 1 360 ? 20.352  -9.211  -16.104 1.00 72.55  ? 360  LEU B CB  1 
ATOM   6954 C CG  . LEU B 1 360 ? 20.161  -8.841  -14.625 1.00 73.70  ? 360  LEU B CG  1 
ATOM   6955 C CD1 . LEU B 1 360 ? 21.497  -8.922  -13.893 1.00 76.25  ? 360  LEU B CD1 1 
ATOM   6956 C CD2 . LEU B 1 360 ? 19.559  -7.469  -14.418 1.00 71.30  ? 360  LEU B CD2 1 
ATOM   6957 N N   . ALA B 1 361 ? 19.421  -10.306 -18.894 1.00 70.64  ? 361  ALA B N   1 
ATOM   6958 C CA  . ALA B 1 361 ? 19.716  -10.919 -20.199 1.00 70.21  ? 361  ALA B CA  1 
ATOM   6959 C C   . ALA B 1 361 ? 19.065  -10.148 -21.332 1.00 67.79  ? 361  ALA B C   1 
ATOM   6960 O O   . ALA B 1 361 ? 19.692  -9.887  -22.364 1.00 67.51  ? 361  ALA B O   1 
ATOM   6961 C CB  . ALA B 1 361 ? 19.240  -12.369 -20.225 1.00 71.49  ? 361  ALA B CB  1 
ATOM   6962 N N   . GLY B 1 362 ? 17.797  -9.802  -21.139 1.00 66.24  ? 362  GLY B N   1 
ATOM   6963 C CA  . GLY B 1 362 ? 17.045  -9.034  -22.127 1.00 64.10  ? 362  GLY B CA  1 
ATOM   6964 C C   . GLY B 1 362 ? 17.643  -7.672  -22.437 1.00 62.29  ? 362  GLY B C   1 
ATOM   6965 O O   . GLY B 1 362 ? 17.585  -7.217  -23.568 1.00 60.75  ? 362  GLY B O   1 
ATOM   6966 N N   . VAL B 1 363 ? 18.218  -7.021  -21.427 1.00 62.51  ? 363  VAL B N   1 
ATOM   6967 C CA  . VAL B 1 363 ? 18.877  -5.718  -21.618 1.00 61.52  ? 363  VAL B CA  1 
ATOM   6968 C C   . VAL B 1 363 ? 20.091  -5.812  -22.564 1.00 61.87  ? 363  VAL B C   1 
ATOM   6969 O O   . VAL B 1 363 ? 20.338  -4.888  -23.327 1.00 60.40  ? 363  VAL B O   1 
ATOM   6970 C CB  . VAL B 1 363 ? 19.281  -5.072  -20.250 1.00 62.04  ? 363  VAL B CB  1 
ATOM   6971 C CG1 . VAL B 1 363 ? 20.248  -3.909  -20.439 1.00 61.34  ? 363  VAL B CG1 1 
ATOM   6972 C CG2 . VAL B 1 363 ? 18.042  -4.621  -19.497 1.00 60.79  ? 363  VAL B CG2 1 
ATOM   6973 N N   . ARG B 1 364 ? 20.840  -6.918  -22.523 1.00 63.51  ? 364  ARG B N   1 
ATOM   6974 C CA  . ARG B 1 364 ? 21.982  -7.072  -23.423 1.00 64.60  ? 364  ARG B CA  1 
ATOM   6975 C C   . ARG B 1 364 ? 21.507  -7.195  -24.875 1.00 63.73  ? 364  ARG B C   1 
ATOM   6976 O O   . ARG B 1 364 ? 22.207  -6.782  -25.795 1.00 63.49  ? 364  ARG B O   1 
ATOM   6977 C CB  . ARG B 1 364 ? 22.830  -8.299  -23.066 1.00 66.96  ? 364  ARG B CB  1 
ATOM   6978 C CG  . ARG B 1 364 ? 23.285  -8.395  -21.613 1.00 69.87  ? 364  ARG B CG  1 
ATOM   6979 C CD  . ARG B 1 364 ? 23.767  -7.062  -21.036 1.00 71.80  ? 364  ARG B CD  1 
ATOM   6980 N NE  . ARG B 1 364 ? 24.863  -6.467  -21.809 1.00 72.68  ? 364  ARG B NE  1 
ATOM   6981 C CZ  . ARG B 1 364 ? 26.160  -6.560  -21.504 1.00 74.59  ? 364  ARG B CZ  1 
ATOM   6982 N NH1 . ARG B 1 364 ? 26.581  -7.231  -20.432 1.00 76.63  ? 364  ARG B NH1 1 
ATOM   6983 N NH2 . ARG B 1 364 ? 27.050  -5.965  -22.285 1.00 74.25  ? 364  ARG B NH2 1 
ATOM   6984 N N   . ILE B 1 365 ? 20.313  -7.758  -25.061 1.00 63.21  ? 365  ILE B N   1 
ATOM   6985 C CA  . ILE B 1 365 ? 19.722  -7.972  -26.379 1.00 62.15  ? 365  ILE B CA  1 
ATOM   6986 C C   . ILE B 1 365 ? 18.995  -6.719  -26.854 1.00 60.41  ? 365  ILE B C   1 
ATOM   6987 O O   . ILE B 1 365 ? 19.023  -6.390  -28.045 1.00 59.73  ? 365  ILE B O   1 
ATOM   6988 C CB  . ILE B 1 365 ? 18.728  -9.176  -26.352 1.00 62.69  ? 365  ILE B CB  1 
ATOM   6989 C CG1 . ILE B 1 365 ? 19.470  -10.460 -25.937 1.00 64.31  ? 365  ILE B CG1 1 
ATOM   6990 C CG2 . ILE B 1 365 ? 18.027  -9.348  -27.717 1.00 61.06  ? 365  ILE B CG2 1 
ATOM   6991 C CD1 . ILE B 1 365 ? 18.592  -11.696 -25.876 1.00 64.92  ? 365  ILE B CD1 1 
ATOM   6992 N N   . GLY B 1 366 ? 18.330  -6.040  -25.920 1.00 59.62  ? 366  GLY B N   1 
ATOM   6993 C CA  . GLY B 1 366 ? 17.605  -4.814  -26.208 1.00 58.04  ? 366  GLY B CA  1 
ATOM   6994 C C   . GLY B 1 366 ? 18.492  -3.589  -26.379 1.00 57.56  ? 366  GLY B C   1 
ATOM   6995 O O   . GLY B 1 366 ? 18.082  -2.602  -26.996 1.00 57.02  ? 366  GLY B O   1 
ATOM   6996 N N   . VAL B 1 367 ? 19.695  -3.638  -25.819 1.00 58.31  ? 367  VAL B N   1 
ATOM   6997 C CA  . VAL B 1 367 ? 20.662  -2.548  -25.939 1.00 58.09  ? 367  VAL B CA  1 
ATOM   6998 C C   . VAL B 1 367 ? 22.006  -3.178  -26.348 1.00 59.46  ? 367  VAL B C   1 
ATOM   6999 O O   . VAL B 1 367 ? 22.958  -3.167  -25.591 1.00 59.71  ? 367  VAL B O   1 
ATOM   7000 C CB  . VAL B 1 367 ? 20.787  -1.751  -24.602 1.00 58.39  ? 367  VAL B CB  1 
ATOM   7001 C CG1 . VAL B 1 367 ? 21.573  -0.449  -24.802 1.00 57.17  ? 367  VAL B CG1 1 
ATOM   7002 C CG2 . VAL B 1 367 ? 19.401  -1.459  -24.001 1.00 57.09  ? 367  VAL B CG2 1 
ATOM   7003 N N   . PRO B 1 368 ? 22.068  -3.747  -27.569 1.00 60.20  ? 368  PRO B N   1 
ATOM   7004 C CA  . PRO B 1 368 ? 23.188  -4.600  -27.992 1.00 61.84  ? 368  PRO B CA  1 
ATOM   7005 C C   . PRO B 1 368 ? 24.545  -3.912  -28.144 1.00 62.89  ? 368  PRO B C   1 
ATOM   7006 O O   . PRO B 1 368 ? 25.563  -4.599  -28.202 1.00 64.28  ? 368  PRO B O   1 
ATOM   7007 C CB  . PRO B 1 368 ? 22.716  -5.148  -29.343 1.00 61.57  ? 368  PRO B CB  1 
ATOM   7008 C CG  . PRO B 1 368 ? 21.773  -4.135  -29.850 1.00 59.69  ? 368  PRO B CG  1 
ATOM   7009 C CD  . PRO B 1 368 ? 21.059  -3.616  -28.636 1.00 58.93  ? 368  PRO B CD  1 
ATOM   7010 N N   . GLN B 1 369 ? 24.572  -2.583  -28.209 1.00 62.46  ? 369  GLN B N   1 
ATOM   7011 C CA  . GLN B 1 369 ? 25.844  -1.862  -28.334 1.00 63.35  ? 369  GLN B CA  1 
ATOM   7012 C C   . GLN B 1 369 ? 26.392  -1.475  -26.969 1.00 64.32  ? 369  GLN B C   1 
ATOM   7013 O O   . GLN B 1 369 ? 27.501  -0.956  -26.876 1.00 65.26  ? 369  GLN B O   1 
ATOM   7014 C CB  . GLN B 1 369 ? 25.700  -0.631  -29.249 1.00 62.46  ? 369  GLN B CB  1 
ATOM   7015 C CG  . GLN B 1 369 ? 25.815  -0.948  -30.772 1.00 62.35  ? 369  GLN B CG  1 
ATOM   7016 C CD  . GLN B 1 369 ? 24.665  -1.805  -31.329 1.00 62.56  ? 369  GLN B CD  1 
ATOM   7017 O OE1 . GLN B 1 369 ? 23.567  -1.306  -31.572 1.00 60.14  ? 369  GLN B OE1 1 
ATOM   7018 N NE2 . GLN B 1 369 ? 24.937  -3.092  -31.566 1.00 63.18  ? 369  GLN B NE2 1 
ATOM   7019 N N   . ALA B 1 370 ? 25.632  -1.762  -25.909 1.00 64.26  ? 370  ALA B N   1 
ATOM   7020 C CA  . ALA B 1 370 ? 26.030  -1.412  -24.541 1.00 64.95  ? 370  ALA B CA  1 
ATOM   7021 C C   . ALA B 1 370 ? 27.174  -2.272  -24.024 1.00 66.90  ? 370  ALA B C   1 
ATOM   7022 O O   . ALA B 1 370 ? 27.190  -3.486  -24.219 1.00 67.28  ? 370  ALA B O   1 
ATOM   7023 C CB  . ALA B 1 370 ? 24.832  -1.518  -23.593 1.00 64.35  ? 370  ALA B CB  1 
ATOM   7024 N N   . SER B 1 371 ? 28.123  -1.624  -23.354 1.00 67.91  ? 371  SER B N   1 
ATOM   7025 C CA  . SER B 1 371 ? 29.182  -2.312  -22.629 1.00 69.96  ? 371  SER B CA  1 
ATOM   7026 C C   . SER B 1 371 ? 28.596  -2.937  -21.371 1.00 70.39  ? 371  SER B C   1 
ATOM   7027 O O   . SER B 1 371 ? 27.428  -2.738  -21.065 1.00 69.23  ? 371  SER B O   1 
ATOM   7028 C CB  . SER B 1 371 ? 30.294  -1.330  -22.253 1.00 70.79  ? 371  SER B CB  1 
ATOM   7029 O OG  . SER B 1 371 ? 29.788  -0.270  -21.463 1.00 70.57  ? 371  SER B OG  1 
ATOM   7030 N N   . ASP B 1 372 ? 29.401  -3.707  -20.651 1.00 72.43  ? 372  ASP B N   1 
ATOM   7031 C CA  . ASP B 1 372 ? 28.948  -4.298  -19.400 1.00 73.21  ? 372  ASP B CA  1 
ATOM   7032 C C   . ASP B 1 372 ? 28.512  -3.185  -18.445 1.00 72.19  ? 372  ASP B C   1 
ATOM   7033 O O   . ASP B 1 372 ? 27.460  -3.295  -17.813 1.00 71.77  ? 372  ASP B O   1 
ATOM   7034 C CB  . ASP B 1 372 ? 30.049  -5.143  -18.741 1.00 75.88  ? 372  ASP B CB  1 
ATOM   7035 C CG  . ASP B 1 372 ? 30.492  -6.336  -19.596 1.00 77.76  ? 372  ASP B CG  1 
ATOM   7036 O OD1 . ASP B 1 372 ? 29.914  -6.579  -20.677 1.00 78.02  ? 372  ASP B OD1 1 
ATOM   7037 O OD2 . ASP B 1 372 ? 31.439  -7.034  -19.173 1.00 81.75  ? 372  ASP B OD2 1 
ATOM   7038 N N   . LEU B 1 373 ? 29.311  -2.116  -18.367 1.00 71.80  ? 373  LEU B N   1 
ATOM   7039 C CA  . LEU B 1 373 ? 29.054  -1.005  -17.442 1.00 71.19  ? 373  LEU B CA  1 
ATOM   7040 C C   . LEU B 1 373 ? 27.823  -0.175  -17.800 1.00 68.81  ? 373  LEU B C   1 
ATOM   7041 O O   . LEU B 1 373 ? 27.107  0.281   -16.912 1.00 68.31  ? 373  LEU B O   1 
ATOM   7042 C CB  . LEU B 1 373 ? 30.276  -0.085  -17.361 1.00 72.19  ? 373  LEU B CB  1 
ATOM   7043 C CG  . LEU B 1 373 ? 30.194  1.151   -16.449 1.00 72.48  ? 373  LEU B CG  1 
ATOM   7044 C CD1 . LEU B 1 373 ? 29.665  0.808   -15.052 1.00 73.46  ? 373  LEU B CD1 1 
ATOM   7045 C CD2 . LEU B 1 373 ? 31.569  1.818   -16.349 1.00 73.11  ? 373  LEU B CD2 1 
ATOM   7046 N N   . ALA B 1 374 ? 27.603  0.041   -19.097 1.00 67.30  ? 374  ALA B N   1 
ATOM   7047 C CA  . ALA B 1 374 ? 26.443  0.783   -19.586 1.00 64.98  ? 374  ALA B CA  1 
ATOM   7048 C C   . ALA B 1 374 ? 25.164  -0.036  -19.398 1.00 64.18  ? 374  ALA B C   1 
ATOM   7049 O O   . ALA B 1 374 ? 24.111  0.517   -19.093 1.00 62.68  ? 374  ALA B O   1 
ATOM   7050 C CB  . ALA B 1 374 ? 26.630  1.157   -21.051 1.00 64.00  ? 374  ALA B CB  1 
ATOM   7051 N N   . ALA B 1 375 ? 25.264  -1.353  -19.585 1.00 64.98  ? 375  ALA B N   1 
ATOM   7052 C CA  . ALA B 1 375 ? 24.151  -2.270  -19.326 1.00 64.59  ? 375  ALA B CA  1 
ATOM   7053 C C   . ALA B 1 375 ? 23.817  -2.313  -17.839 1.00 65.33  ? 375  ALA B C   1 
ATOM   7054 O O   . ALA B 1 375 ? 22.648  -2.352  -17.470 1.00 64.51  ? 375  ALA B O   1 
ATOM   7055 C CB  . ALA B 1 375 ? 24.482  -3.677  -19.835 1.00 65.84  ? 375  ALA B CB  1 
ATOM   7056 N N   . GLU B 1 376 ? 24.839  -2.308  -16.983 1.00 67.11  ? 376  GLU B N   1 
ATOM   7057 C CA  . GLU B 1 376 ? 24.614  -2.208  -15.534 1.00 67.93  ? 376  GLU B CA  1 
ATOM   7058 C C   . GLU B 1 376 ? 23.872  -0.900  -15.221 1.00 65.79  ? 376  GLU B C   1 
ATOM   7059 O O   . GLU B 1 376 ? 22.901  -0.900  -14.476 1.00 65.66  ? 376  GLU B O   1 
ATOM   7060 C CB  . GLU B 1 376 ? 25.931  -2.299  -14.748 1.00 70.16  ? 376  GLU B CB  1 
ATOM   7061 C CG  . GLU B 1 376 ? 26.468  -3.741  -14.579 1.00 75.02  ? 376  GLU B CG  1 
ATOM   7062 C CD  . GLU B 1 376 ? 27.932  -3.816  -14.093 1.00 80.64  ? 376  GLU B CD  1 
ATOM   7063 O OE1 . GLU B 1 376 ? 28.428  -4.934  -13.804 1.00 85.12  ? 376  GLU B OE1 1 
ATOM   7064 O OE2 . GLU B 1 376 ? 28.601  -2.762  -14.000 1.00 83.01  ? 376  GLU B OE2 1 
ATOM   7065 N N   . ALA B 1 377 ? 24.312  0.207   -15.811 1.00 64.30  ? 377  ALA B N   1 
ATOM   7066 C CA  . ALA B 1 377 ? 23.636  1.492   -15.612 1.00 62.70  ? 377  ALA B CA  1 
ATOM   7067 C C   . ALA B 1 377 ? 22.170  1.450   -16.027 1.00 60.97  ? 377  ALA B C   1 
ATOM   7068 O O   . ALA B 1 377 ? 21.338  2.077   -15.378 1.00 60.15  ? 377  ALA B O   1 
ATOM   7069 C CB  . ALA B 1 377 ? 24.348  2.597   -16.360 1.00 62.25  ? 377  ALA B CB  1 
ATOM   7070 N N   . VAL B 1 378 ? 21.853  0.733   -17.111 1.00 60.27  ? 378  VAL B N   1 
ATOM   7071 C CA  . VAL B 1 378 ? 20.475  0.638   -17.588 1.00 58.90  ? 378  VAL B CA  1 
ATOM   7072 C C   . VAL B 1 378 ? 19.650  -0.203  -16.618 1.00 59.57  ? 378  VAL B C   1 
ATOM   7073 O O   . VAL B 1 378 ? 18.555  0.186   -16.229 1.00 58.60  ? 378  VAL B O   1 
ATOM   7074 C CB  . VAL B 1 378 ? 20.379  0.037   -19.023 1.00 58.57  ? 378  VAL B CB  1 
ATOM   7075 C CG1 . VAL B 1 378 ? 18.930  -0.206  -19.417 1.00 56.17  ? 378  VAL B CG1 1 
ATOM   7076 C CG2 . VAL B 1 378 ? 21.035  0.962   -20.034 1.00 58.07  ? 378  VAL B CG2 1 
ATOM   7077 N N   . VAL B 1 379 ? 20.184  -1.350  -16.213 1.00 61.35  ? 379  VAL B N   1 
ATOM   7078 C CA  . VAL B 1 379 ? 19.483  -2.206  -15.263 1.00 62.43  ? 379  VAL B CA  1 
ATOM   7079 C C   . VAL B 1 379 ? 19.229  -1.442  -13.956 1.00 63.49  ? 379  VAL B C   1 
ATOM   7080 O O   . VAL B 1 379 ? 18.128  -1.487  -13.406 1.00 63.61  ? 379  VAL B O   1 
ATOM   7081 C CB  . VAL B 1 379 ? 20.251  -3.518  -14.989 1.00 64.27  ? 379  VAL B CB  1 
ATOM   7082 C CG1 . VAL B 1 379 ? 19.739  -4.197  -13.716 1.00 64.76  ? 379  VAL B CG1 1 
ATOM   7083 C CG2 . VAL B 1 379 ? 20.147  -4.459  -16.188 1.00 62.65  ? 379  VAL B CG2 1 
ATOM   7084 N N   . LEU B 1 380 ? 20.224  -0.702  -13.485 1.00 64.27  ? 380  LEU B N   1 
ATOM   7085 C CA  . LEU B 1 380 ? 20.079  -0.023  -12.210 1.00 65.40  ? 380  LEU B CA  1 
ATOM   7086 C C   . LEU B 1 380 ? 19.093  1.151   -12.292 1.00 64.23  ? 380  LEU B C   1 
ATOM   7087 O O   . LEU B 1 380 ? 18.351  1.405   -11.348 1.00 64.74  ? 380  LEU B O   1 
ATOM   7088 C CB  . LEU B 1 380 ? 21.451  0.376   -11.634 1.00 66.89  ? 380  LEU B CB  1 
ATOM   7089 C CG  . LEU B 1 380 ? 22.389  -0.795  -11.208 1.00 69.34  ? 380  LEU B CG  1 
ATOM   7090 C CD1 . LEU B 1 380 ? 23.630  -0.307  -10.452 1.00 70.51  ? 380  LEU B CD1 1 
ATOM   7091 C CD2 . LEU B 1 380 ? 21.700  -1.871  -10.358 1.00 70.86  ? 380  LEU B CD2 1 
ATOM   7092 N N   . HIS B 1 381 ? 19.051  1.831   -13.431 1.00 63.17  ? 381  HIS B N   1 
ATOM   7093 C CA  . HIS B 1 381 ? 18.142  2.964   -13.640 1.00 62.04  ? 381  HIS B CA  1 
ATOM   7094 C C   . HIS B 1 381 ? 16.674  2.533   -13.838 1.00 61.06  ? 381  HIS B C   1 
ATOM   7095 O O   . HIS B 1 381 ? 15.756  3.249   -13.456 1.00 60.41  ? 381  HIS B O   1 
ATOM   7096 C CB  . HIS B 1 381 ? 18.630  3.777   -14.847 1.00 61.61  ? 381  HIS B CB  1 
ATOM   7097 C CG  . HIS B 1 381 ? 17.731  4.908   -15.225 1.00 61.97  ? 381  HIS B CG  1 
ATOM   7098 N ND1 . HIS B 1 381 ? 17.986  6.214   -14.857 1.00 63.61  ? 381  HIS B ND1 1 
ATOM   7099 C CD2 . HIS B 1 381 ? 16.581  4.931   -15.946 1.00 62.05  ? 381  HIS B CD2 1 
ATOM   7100 C CE1 . HIS B 1 381 ? 17.023  6.990   -15.328 1.00 64.12  ? 381  HIS B CE1 1 
ATOM   7101 N NE2 . HIS B 1 381 ? 16.161  6.238   -15.998 1.00 62.19  ? 381  HIS B NE2 1 
ATOM   7102 N N   . TYR B 1 382 ? 16.460  1.368   -14.440 1.00 60.81  ? 382  TYR B N   1 
ATOM   7103 C CA  . TYR B 1 382 ? 15.110  0.868   -14.727 1.00 60.54  ? 382  TYR B CA  1 
ATOM   7104 C C   . TYR B 1 382 ? 14.549  -0.102  -13.690 1.00 62.08  ? 382  TYR B C   1 
ATOM   7105 O O   . TYR B 1 382 ? 13.372  -0.471  -13.770 1.00 62.78  ? 382  TYR B O   1 
ATOM   7106 C CB  . TYR B 1 382 ? 15.068  0.207   -16.116 1.00 59.50  ? 382  TYR B CB  1 
ATOM   7107 C CG  . TYR B 1 382 ? 14.903  1.205   -17.232 1.00 57.32  ? 382  TYR B CG  1 
ATOM   7108 C CD1 . TYR B 1 382 ? 16.006  1.813   -17.810 1.00 56.55  ? 382  TYR B CD1 1 
ATOM   7109 C CD2 . TYR B 1 382 ? 13.645  1.551   -17.695 1.00 55.84  ? 382  TYR B CD2 1 
ATOM   7110 C CE1 . TYR B 1 382 ? 15.867  2.739   -18.826 1.00 56.05  ? 382  TYR B CE1 1 
ATOM   7111 C CE2 . TYR B 1 382 ? 13.490  2.470   -18.722 1.00 55.98  ? 382  TYR B CE2 1 
ATOM   7112 C CZ  . TYR B 1 382 ? 14.609  3.060   -19.287 1.00 55.56  ? 382  TYR B CZ  1 
ATOM   7113 O OH  . TYR B 1 382 ? 14.473  3.973   -20.302 1.00 54.81  ? 382  TYR B OH  1 
ATOM   7114 N N   . THR B 1 383 ? 15.377  -0.538  -12.745 1.00 63.51  ? 383  THR B N   1 
ATOM   7115 C CA  . THR B 1 383 ? 14.903  -1.347  -11.634 1.00 64.55  ? 383  THR B CA  1 
ATOM   7116 C C   . THR B 1 383 ? 14.080  -0.477  -10.685 1.00 65.33  ? 383  THR B C   1 
ATOM   7117 O O   . THR B 1 383 ? 14.440  0.671   -10.400 1.00 65.03  ? 383  THR B O   1 
ATOM   7118 C CB  . THR B 1 383 ? 16.069  -1.995  -10.878 1.00 65.84  ? 383  THR B CB  1 
ATOM   7119 O OG1 . THR B 1 383 ? 16.751  -2.896  -11.753 1.00 64.98  ? 383  THR B OG1 1 
ATOM   7120 C CG2 . THR B 1 383 ? 15.586  -2.755  -9.651  1.00 66.26  ? 383  THR B CG2 1 
ATOM   7121 N N   . ASP B 1 384 ? 12.948  -1.015  -10.236 1.00 66.61  ? 384  ASP B N   1 
ATOM   7122 C CA  . ASP B 1 384 ? 12.217  -0.445  -9.111  1.00 67.91  ? 384  ASP B CA  1 
ATOM   7123 C C   . ASP B 1 384 ? 12.818  -1.057  -7.860  1.00 69.34  ? 384  ASP B C   1 
ATOM   7124 O O   . ASP B 1 384 ? 12.623  -2.238  -7.587  1.00 70.15  ? 384  ASP B O   1 
ATOM   7125 C CB  . ASP B 1 384 ? 10.723  -0.763  -9.197  1.00 68.43  ? 384  ASP B CB  1 
ATOM   7126 C CG  . ASP B 1 384 ? 9.895   0.017   -8.180  1.00 70.82  ? 384  ASP B CG  1 
ATOM   7127 O OD1 . ASP B 1 384 ? 10.347  0.198   -7.029  1.00 72.33  ? 384  ASP B OD1 1 
ATOM   7128 O OD2 . ASP B 1 384 ? 8.776   0.447   -8.545  1.00 75.44  ? 384  ASP B OD2 1 
ATOM   7129 N N   . TRP B 1 385 ? 13.562  -0.254  -7.104  1.00 69.76  ? 385  TRP B N   1 
ATOM   7130 C CA  . TRP B 1 385 ? 14.295  -0.773  -5.952  1.00 71.58  ? 385  TRP B CA  1 
ATOM   7131 C C   . TRP B 1 385 ? 13.401  -1.088  -4.758  1.00 73.48  ? 385  TRP B C   1 
ATOM   7132 O O   . TRP B 1 385 ? 13.838  -1.723  -3.808  1.00 75.19  ? 385  TRP B O   1 
ATOM   7133 C CB  . TRP B 1 385 ? 15.456  0.159   -5.608  1.00 71.09  ? 385  TRP B CB  1 
ATOM   7134 C CG  . TRP B 1 385 ? 16.457  0.085   -6.682  1.00 69.57  ? 385  TRP B CG  1 
ATOM   7135 C CD1 . TRP B 1 385 ? 16.672  0.995   -7.669  1.00 67.91  ? 385  TRP B CD1 1 
ATOM   7136 C CD2 . TRP B 1 385 ? 17.326  -1.015  -6.949  1.00 69.71  ? 385  TRP B CD2 1 
ATOM   7137 N NE1 . TRP B 1 385 ? 17.649  0.547   -8.518  1.00 67.52  ? 385  TRP B NE1 1 
ATOM   7138 C CE2 . TRP B 1 385 ? 18.072  -0.686  -8.094  1.00 69.19  ? 385  TRP B CE2 1 
ATOM   7139 C CE3 . TRP B 1 385 ? 17.561  -2.243  -6.315  1.00 71.65  ? 385  TRP B CE3 1 
ATOM   7140 C CZ2 . TRP B 1 385 ? 19.036  -1.543  -8.633  1.00 70.48  ? 385  TRP B CZ2 1 
ATOM   7141 C CZ3 . TRP B 1 385 ? 18.520  -3.094  -6.845  1.00 72.69  ? 385  TRP B CZ3 1 
ATOM   7142 C CH2 . TRP B 1 385 ? 19.245  -2.738  -7.998  1.00 72.00  ? 385  TRP B CH2 1 
ATOM   7143 N N   . LEU B 1 386 ? 12.140  -0.676  -4.827  1.00 73.96  ? 386  LEU B N   1 
ATOM   7144 C CA  . LEU B 1 386 ? 11.130  -1.154  -3.882  1.00 76.17  ? 386  LEU B CA  1 
ATOM   7145 C C   . LEU B 1 386 ? 10.568  -2.535  -4.236  1.00 77.26  ? 386  LEU B C   1 
ATOM   7146 O O   . LEU B 1 386 ? 10.140  -3.260  -3.347  1.00 78.81  ? 386  LEU B O   1 
ATOM   7147 C CB  . LEU B 1 386 ? 9.992   -0.139  -3.764  1.00 75.72  ? 386  LEU B CB  1 
ATOM   7148 C CG  . LEU B 1 386 ? 10.220  0.847   -2.630  1.00 76.92  ? 386  LEU B CG  1 
ATOM   7149 C CD1 . LEU B 1 386 ? 9.328   2.080   -2.803  1.00 77.05  ? 386  LEU B CD1 1 
ATOM   7150 C CD2 . LEU B 1 386 ? 9.987   0.135   -1.294  1.00 78.47  ? 386  LEU B CD2 1 
ATOM   7151 N N   . HIS B 1 387 ? 10.567  -2.877  -5.530  1.00 76.96  ? 387  HIS B N   1 
ATOM   7152 C CA  . HIS B 1 387 ? 10.058  -4.165  -6.036  1.00 78.27  ? 387  HIS B CA  1 
ATOM   7153 C C   . HIS B 1 387 ? 11.027  -4.755  -7.077  1.00 77.69  ? 387  HIS B C   1 
ATOM   7154 O O   . HIS B 1 387 ? 10.643  -4.989  -8.224  1.00 76.74  ? 387  HIS B O   1 
ATOM   7155 C CB  . HIS B 1 387 ? 8.666   -3.984  -6.672  1.00 77.85  ? 387  HIS B CB  1 
ATOM   7156 C CG  . HIS B 1 387 ? 7.746   -3.100  -5.882  1.00 79.47  ? 387  HIS B CG  1 
ATOM   7157 N ND1 . HIS B 1 387 ? 7.022   -3.555  -4.799  1.00 82.54  ? 387  HIS B ND1 1 
ATOM   7158 C CD2 . HIS B 1 387 ? 7.442   -1.785  -6.016  1.00 78.96  ? 387  HIS B CD2 1 
ATOM   7159 C CE1 . HIS B 1 387 ? 6.313   -2.556  -4.298  1.00 82.52  ? 387  HIS B CE1 1 
ATOM   7160 N NE2 . HIS B 1 387 ? 6.549   -1.472  -5.020  1.00 80.69  ? 387  HIS B NE2 1 
ATOM   7161 N N   . PRO B 1 388 ? 12.292  -4.986  -6.677  1.00 78.44  ? 388  PRO B N   1 
ATOM   7162 C CA  . PRO B 1 388 ? 13.368  -5.336  -7.613  1.00 77.98  ? 388  PRO B CA  1 
ATOM   7163 C C   . PRO B 1 388 ? 13.253  -6.678  -8.331  1.00 78.37  ? 388  PRO B C   1 
ATOM   7164 O O   . PRO B 1 388 ? 13.873  -6.855  -9.373  1.00 77.71  ? 388  PRO B O   1 
ATOM   7165 C CB  . PRO B 1 388 ? 14.614  -5.331  -6.722  1.00 79.49  ? 388  PRO B CB  1 
ATOM   7166 C CG  . PRO B 1 388 ? 14.109  -5.585  -5.354  1.00 80.78  ? 388  PRO B CG  1 
ATOM   7167 C CD  . PRO B 1 388 ? 12.790  -4.894  -5.292  1.00 79.90  ? 388  PRO B CD  1 
ATOM   7168 N N   . GLU B 1 389 ? 12.494  -7.616  -7.777  1.00 79.56  ? 389  GLU B N   1 
ATOM   7169 C CA  . GLU B 1 389 ? 12.351  -8.935  -8.389  1.00 80.30  ? 389  GLU B CA  1 
ATOM   7170 C C   . GLU B 1 389 ? 10.909  -9.233  -8.797  1.00 79.37  ? 389  GLU B C   1 
ATOM   7171 O O   . GLU B 1 389 ? 10.584  -10.375 -9.134  1.00 80.46  ? 389  GLU B O   1 
ATOM   7172 C CB  . GLU B 1 389 ? 12.884  -10.020 -7.440  1.00 82.73  ? 389  GLU B CB  1 
ATOM   7173 C CG  . GLU B 1 389 ? 14.336  -9.787  -7.008  1.00 84.59  ? 389  GLU B CG  1 
ATOM   7174 C CD  . GLU B 1 389 ? 15.114  -11.078 -6.778  1.00 89.05  ? 389  GLU B CD  1 
ATOM   7175 O OE1 . GLU B 1 389 ? 15.426  -11.781 -7.770  1.00 89.33  ? 389  GLU B OE1 1 
ATOM   7176 O OE2 . GLU B 1 389 ? 15.425  -11.385 -5.601  1.00 92.99  ? 389  GLU B OE2 1 
ATOM   7177 N N   . ASP B 1 390 ? 10.053  -8.212  -8.782  1.00 77.45  ? 390  ASP B N   1 
ATOM   7178 C CA  . ASP B 1 390 ? 8.661   -8.379  -9.189  1.00 76.74  ? 390  ASP B CA  1 
ATOM   7179 C C   . ASP B 1 390 ? 8.555   -8.523  -10.708 1.00 74.79  ? 390  ASP B C   1 
ATOM   7180 O O   . ASP B 1 390 ? 8.924   -7.603  -11.440 1.00 72.83  ? 390  ASP B O   1 
ATOM   7181 C CB  . ASP B 1 390 ? 7.794   -7.208  -8.743  1.00 76.09  ? 390  ASP B CB  1 
ATOM   7182 C CG  . ASP B 1 390 ? 6.373   -7.340  -9.235  1.00 76.64  ? 390  ASP B CG  1 
ATOM   7183 O OD1 . ASP B 1 390 ? 5.730   -8.368  -8.919  1.00 80.14  ? 390  ASP B OD1 1 
ATOM   7184 O OD2 . ASP B 1 390 ? 5.908   -6.444  -9.962  1.00 75.28  ? 390  ASP B OD2 1 
ATOM   7185 N N   . PRO B 1 391 ? 8.037   -9.674  -11.184 1.00 75.02  ? 391  PRO B N   1 
ATOM   7186 C CA  . PRO B 1 391 ? 7.985   -9.969  -12.617 1.00 73.62  ? 391  PRO B CA  1 
ATOM   7187 C C   . PRO B 1 391 ? 7.183   -8.988  -13.489 1.00 71.46  ? 391  PRO B C   1 
ATOM   7188 O O   . PRO B 1 391 ? 7.542   -8.783  -14.652 1.00 69.74  ? 391  PRO B O   1 
ATOM   7189 C CB  . PRO B 1 391 ? 7.340   -11.357 -12.657 1.00 75.32  ? 391  PRO B CB  1 
ATOM   7190 C CG  . PRO B 1 391 ? 7.591   -11.942 -11.322 1.00 77.44  ? 391  PRO B CG  1 
ATOM   7191 C CD  . PRO B 1 391 ? 7.487   -10.791 -10.390 1.00 76.95  ? 391  PRO B CD  1 
ATOM   7192 N N   . THR B 1 392 ? 6.105   -8.418  -12.948 1.00 71.19  ? 392  THR B N   1 
ATOM   7193 C CA  . THR B 1 392 ? 5.281   -7.460  -13.696 1.00 69.59  ? 392  THR B CA  1 
ATOM   7194 C C   . THR B 1 392 ? 6.084   -6.187  -13.955 1.00 68.05  ? 392  THR B C   1 
ATOM   7195 O O   . THR B 1 392 ? 6.066   -5.638  -15.061 1.00 66.40  ? 392  THR B O   1 
ATOM   7196 C CB  . THR B 1 392 ? 3.965   -7.098  -12.946 1.00 70.17  ? 392  THR B CB  1 
ATOM   7197 O OG1 . THR B 1 392 ? 3.144   -8.268  -12.794 1.00 72.34  ? 392  THR B OG1 1 
ATOM   7198 C CG2 . THR B 1 392 ? 3.181   -6.045  -13.710 1.00 68.46  ? 392  THR B CG2 1 
ATOM   7199 N N   . HIS B 1 393 ? 6.789   -5.722  -12.926 1.00 68.47  ? 393  HIS B N   1 
ATOM   7200 C CA  . HIS B 1 393 ? 7.648   -4.542  -13.062 1.00 67.46  ? 393  HIS B CA  1 
ATOM   7201 C C   . HIS B 1 393 ? 8.787   -4.828  -14.021 1.00 66.01  ? 393  HIS B C   1 
ATOM   7202 O O   . HIS B 1 393 ? 9.109   -3.998  -14.843 1.00 64.40  ? 393  HIS B O   1 
ATOM   7203 C CB  . HIS B 1 393 ? 8.238   -4.108  -11.717 1.00 68.60  ? 393  HIS B CB  1 
ATOM   7204 C CG  . HIS B 1 393 ? 7.307   -3.311  -10.859 1.00 70.59  ? 393  HIS B CG  1 
ATOM   7205 N ND1 . HIS B 1 393 ? 6.300   -3.891  -10.110 1.00 73.23  ? 393  HIS B ND1 1 
ATOM   7206 C CD2 . HIS B 1 393 ? 7.269   -1.985  -10.580 1.00 70.83  ? 393  HIS B CD2 1 
ATOM   7207 C CE1 . HIS B 1 393 ? 5.673   -2.950  -9.422  1.00 74.14  ? 393  HIS B CE1 1 
ATOM   7208 N NE2 . HIS B 1 393 ? 6.244   -1.786  -9.685  1.00 72.21  ? 393  HIS B NE2 1 
ATOM   7209 N N   . LEU B 1 394 ? 9.393   -6.005  -13.906 1.00 66.95  ? 394  LEU B N   1 
ATOM   7210 C CA  . LEU B 1 394 ? 10.535  -6.357  -14.749 1.00 66.62  ? 394  LEU B CA  1 
ATOM   7211 C C   . LEU B 1 394 ? 10.148  -6.434  -16.223 1.00 65.26  ? 394  LEU B C   1 
ATOM   7212 O O   . LEU B 1 394 ? 10.875  -5.956  -17.078 1.00 64.57  ? 394  LEU B O   1 
ATOM   7213 C CB  . LEU B 1 394 ? 11.176  -7.662  -14.289 1.00 68.04  ? 394  LEU B CB  1 
ATOM   7214 C CG  . LEU B 1 394 ? 11.845  -7.582  -12.916 1.00 69.38  ? 394  LEU B CG  1 
ATOM   7215 C CD1 . LEU B 1 394 ? 12.078  -8.985  -12.351 1.00 69.86  ? 394  LEU B CD1 1 
ATOM   7216 C CD2 . LEU B 1 394 ? 13.147  -6.780  -12.976 1.00 67.86  ? 394  LEU B CD2 1 
ATOM   7217 N N   . ARG B 1 395 ? 8.989   -7.017  -16.500 1.00 65.37  ? 395  ARG B N   1 
ATOM   7218 C CA  . ARG B 1 395 ? 8.446   -7.099  -17.861 1.00 64.09  ? 395  ARG B CA  1 
ATOM   7219 C C   . ARG B 1 395 ? 8.204   -5.705  -18.450 1.00 62.18  ? 395  ARG B C   1 
ATOM   7220 O O   . ARG B 1 395 ? 8.671   -5.406  -19.546 1.00 61.14  ? 395  ARG B O   1 
ATOM   7221 C CB  . ARG B 1 395 ? 7.140   -7.910  -17.846 1.00 64.98  ? 395  ARG B CB  1 
ATOM   7222 C CG  . ARG B 1 395 ? 6.402   -8.019  -19.190 1.00 64.08  ? 395  ARG B CG  1 
ATOM   7223 C CD  . ARG B 1 395 ? 4.954   -8.386  -18.973 1.00 64.35  ? 395  ARG B CD  1 
ATOM   7224 N NE  . ARG B 1 395 ? 4.210   -7.283  -18.378 1.00 64.41  ? 395  ARG B NE  1 
ATOM   7225 C CZ  . ARG B 1 395 ? 2.987   -7.380  -17.860 1.00 65.96  ? 395  ARG B CZ  1 
ATOM   7226 N NH1 . ARG B 1 395 ? 2.351   -8.540  -17.843 1.00 67.16  ? 395  ARG B NH1 1 
ATOM   7227 N NH2 . ARG B 1 395 ? 2.389   -6.310  -17.351 1.00 65.35  ? 395  ARG B NH2 1 
ATOM   7228 N N   . ASP B 1 396 ? 7.484   -4.860  -17.718 1.00 61.59  ? 396  ASP B N   1 
ATOM   7229 C CA  . ASP B 1 396 ? 7.175   -3.511  -18.189 1.00 60.29  ? 396  ASP B CA  1 
ATOM   7230 C C   . ASP B 1 396 ? 8.419   -2.626  -18.315 1.00 58.91  ? 396  ASP B C   1 
ATOM   7231 O O   . ASP B 1 396 ? 8.490   -1.781  -19.205 1.00 57.46  ? 396  ASP B O   1 
ATOM   7232 C CB  . ASP B 1 396 ? 6.152   -2.842  -17.274 1.00 60.79  ? 396  ASP B CB  1 
ATOM   7233 C CG  . ASP B 1 396 ? 4.779   -3.508  -17.335 1.00 62.66  ? 396  ASP B CG  1 
ATOM   7234 O OD1 . ASP B 1 396 ? 4.449   -4.165  -18.346 1.00 64.30  ? 396  ASP B OD1 1 
ATOM   7235 O OD2 . ASP B 1 396 ? 4.016   -3.360  -16.361 1.00 66.67  ? 396  ASP B OD2 1 
ATOM   7236 N N   . ALA B 1 397 ? 9.394   -2.835  -17.431 1.00 58.95  ? 397  ALA B N   1 
ATOM   7237 C CA  . ALA B 1 397 ? 10.672  -2.126  -17.504 1.00 58.21  ? 397  ALA B CA  1 
ATOM   7238 C C   . ALA B 1 397 ? 11.454  -2.530  -18.752 1.00 57.40  ? 397  ALA B C   1 
ATOM   7239 O O   . ALA B 1 397 ? 12.084  -1.685  -19.382 1.00 56.10  ? 397  ALA B O   1 
ATOM   7240 C CB  . ALA B 1 397 ? 11.508  -2.370  -16.253 1.00 58.99  ? 397  ALA B CB  1 
ATOM   7241 N N   . MET B 1 398 ? 11.395  -3.815  -19.110 1.00 57.91  ? 398  MET B N   1 
ATOM   7242 C CA  . MET B 1 398 ? 12.042  -4.330  -20.330 1.00 57.48  ? 398  MET B CA  1 
ATOM   7243 C C   . MET B 1 398 ? 11.462  -3.653  -21.571 1.00 55.86  ? 398  MET B C   1 
ATOM   7244 O O   . MET B 1 398 ? 12.199  -3.204  -22.456 1.00 54.96  ? 398  MET B O   1 
ATOM   7245 C CB  . MET B 1 398 ? 11.846  -5.850  -20.422 1.00 58.88  ? 398  MET B CB  1 
ATOM   7246 C CG  . MET B 1 398 ? 12.719  -6.580  -21.455 1.00 59.60  ? 398  MET B CG  1 
ATOM   7247 S SD  . MET B 1 398 ? 14.498  -6.431  -21.201 1.00 61.62  ? 398  MET B SD  1 
ATOM   7248 C CE  . MET B 1 398 ? 14.898  -5.201  -22.448 1.00 60.63  ? 398  MET B CE  1 
ATOM   7249 N N   . SER B 1 399 ? 10.134  -3.582  -21.623 1.00 55.21  ? 399  SER B N   1 
ATOM   7250 C CA  . SER B 1 399 ? 9.450   -2.858  -22.665 1.00 54.03  ? 399  SER B CA  1 
ATOM   7251 C C   . SER B 1 399 ? 9.906   -1.416  -22.722 1.00 52.63  ? 399  SER B C   1 
ATOM   7252 O O   . SER B 1 399 ? 10.212  -0.921  -23.793 1.00 51.64  ? 399  SER B O   1 
ATOM   7253 C CB  . SER B 1 399 ? 7.944   -2.891  -22.457 1.00 54.43  ? 399  SER B CB  1 
ATOM   7254 O OG  . SER B 1 399 ? 7.316   -2.041  -23.393 1.00 54.42  ? 399  SER B OG  1 
ATOM   7255 N N   . ALA B 1 400 ? 9.963   -0.756  -21.562 1.00 52.76  ? 400  ALA B N   1 
ATOM   7256 C CA  . ALA B 1 400 ? 10.372  0.663   -21.467 1.00 51.39  ? 400  ALA B CA  1 
ATOM   7257 C C   . ALA B 1 400 ? 11.793  0.923   -21.944 1.00 51.01  ? 400  ALA B C   1 
ATOM   7258 O O   . ALA B 1 400 ? 12.050  1.934   -22.609 1.00 50.58  ? 400  ALA B O   1 
ATOM   7259 C CB  . ALA B 1 400 ? 10.219  1.172   -20.035 1.00 51.82  ? 400  ALA B CB  1 
ATOM   7260 N N   . VAL B 1 401 ? 12.720  0.046   -21.577 1.00 51.42  ? 401  VAL B N   1 
ATOM   7261 C CA  . VAL B 1 401 ? 14.104  0.173   -22.027 1.00 51.80  ? 401  VAL B CA  1 
ATOM   7262 C C   . VAL B 1 401 ? 14.173  0.231   -23.551 1.00 51.43  ? 401  VAL B C   1 
ATOM   7263 O O   . VAL B 1 401 ? 14.781  1.140   -24.128 1.00 50.66  ? 401  VAL B O   1 
ATOM   7264 C CB  . VAL B 1 401 ? 14.993  -1.024  -21.560 1.00 53.02  ? 401  VAL B CB  1 
ATOM   7265 C CG1 . VAL B 1 401 ? 16.324  -0.980  -22.264 1.00 52.03  ? 401  VAL B CG1 1 
ATOM   7266 C CG2 . VAL B 1 401 ? 15.179  -1.021  -20.020 1.00 52.91  ? 401  VAL B CG2 1 
ATOM   7267 N N   . VAL B 1 402 ? 13.559  -0.761  -24.186 1.00 51.93  ? 402  VAL B N   1 
ATOM   7268 C CA  . VAL B 1 402 ? 13.611  -0.915  -25.638 1.00 51.49  ? 402  VAL B CA  1 
ATOM   7269 C C   . VAL B 1 402 ? 12.907  0.274   -26.299 1.00 50.32  ? 402  VAL B C   1 
ATOM   7270 O O   . VAL B 1 402 ? 13.426  0.876   -27.238 1.00 49.98  ? 402  VAL B O   1 
ATOM   7271 C CB  . VAL B 1 402 ? 12.983  -2.281  -26.080 1.00 52.29  ? 402  VAL B CB  1 
ATOM   7272 C CG1 . VAL B 1 402 ? 12.851  -2.379  -27.602 1.00 52.10  ? 402  VAL B CG1 1 
ATOM   7273 C CG2 . VAL B 1 402 ? 13.803  -3.458  -25.547 1.00 52.48  ? 402  VAL B CG2 1 
ATOM   7274 N N   . GLY B 1 403 ? 11.736  0.631   -25.789 1.00 49.94  ? 403  GLY B N   1 
ATOM   7275 C CA  . GLY B 1 403 ? 10.995  1.757   -26.330 1.00 48.90  ? 403  GLY B CA  1 
ATOM   7276 C C   . GLY B 1 403 ? 11.682  3.110   -26.165 1.00 48.31  ? 403  GLY B C   1 
ATOM   7277 O O   . GLY B 1 403 ? 11.590  3.951   -27.058 1.00 47.89  ? 403  GLY B O   1 
ATOM   7278 N N   . ASP B 1 404 ? 12.354  3.333   -25.028 1.00 48.78  ? 404  ASP B N   1 
ATOM   7279 C CA  . ASP B 1 404 ? 13.003  4.624   -24.739 1.00 48.17  ? 404  ASP B CA  1 
ATOM   7280 C C   . ASP B 1 404 ? 14.299  4.787   -25.516 1.00 48.14  ? 404  ASP B C   1 
ATOM   7281 O O   . ASP B 1 404 ? 14.603  5.853   -26.058 1.00 47.58  ? 404  ASP B O   1 
ATOM   7282 C CB  . ASP B 1 404 ? 13.316  4.756   -23.243 1.00 49.25  ? 404  ASP B CB  1 
ATOM   7283 C CG  . ASP B 1 404 ? 12.067  4.883   -22.370 1.00 49.68  ? 404  ASP B CG  1 
ATOM   7284 O OD1 . ASP B 1 404 ? 10.968  5.111   -22.897 1.00 48.12  ? 404  ASP B OD1 1 
ATOM   7285 O OD2 . ASP B 1 404 ? 12.197  4.762   -21.135 1.00 51.05  ? 404  ASP B OD2 1 
ATOM   7286 N N   . HIS B 1 405 ? 15.101  3.729   -25.504 1.00 48.62  ? 405  HIS B N   1 
ATOM   7287 C CA  . HIS B 1 405 ? 16.353  3.688   -26.240 1.00 48.43  ? 405  HIS B CA  1 
ATOM   7288 C C   . HIS B 1 405 ? 16.113  3.962   -27.742 1.00 47.82  ? 405  HIS B C   1 
ATOM   7289 O O   . HIS B 1 405 ? 16.750  4.814   -28.343 1.00 46.72  ? 405  HIS B O   1 
ATOM   7290 C CB  . HIS B 1 405 ? 16.972  2.310   -26.025 1.00 49.33  ? 405  HIS B CB  1 
ATOM   7291 C CG  . HIS B 1 405 ? 18.237  2.072   -26.785 1.00 49.88  ? 405  HIS B CG  1 
ATOM   7292 N ND1 . HIS B 1 405 ? 19.244  3.010   -26.872 1.00 49.44  ? 405  HIS B ND1 1 
ATOM   7293 C CD2 . HIS B 1 405 ? 18.678  0.978   -27.456 1.00 49.63  ? 405  HIS B CD2 1 
ATOM   7294 C CE1 . HIS B 1 405 ? 20.249  2.503   -27.567 1.00 51.18  ? 405  HIS B CE1 1 
ATOM   7295 N NE2 . HIS B 1 405 ? 19.925  1.278   -27.944 1.00 50.27  ? 405  HIS B NE2 1 
ATOM   7296 N N   . ASN B 1 406 ? 15.145  3.263   -28.317 1.00 47.41  ? 406  ASN B N   1 
ATOM   7297 C CA  . ASN B 1 406 ? 14.950  3.270   -29.757 1.00 47.51  ? 406  ASN B CA  1 
ATOM   7298 C C   . ASN B 1 406 ? 13.991  4.344   -30.317 1.00 46.91  ? 406  ASN B C   1 
ATOM   7299 O O   . ASN B 1 406 ? 14.149  4.754   -31.469 1.00 46.91  ? 406  ASN B O   1 
ATOM   7300 C CB  . ASN B 1 406 ? 14.509  1.879   -30.206 1.00 47.16  ? 406  ASN B CB  1 
ATOM   7301 C CG  . ASN B 1 406 ? 15.609  0.841   -30.043 1.00 48.25  ? 406  ASN B CG  1 
ATOM   7302 O OD1 . ASN B 1 406 ? 16.667  0.965   -30.648 1.00 46.36  ? 406  ASN B OD1 1 
ATOM   7303 N ND2 . ASN B 1 406 ? 15.361  -0.182  -29.223 1.00 47.12  ? 406  ASN B ND2 1 
ATOM   7304 N N   . VAL B 1 407 ? 13.009  4.785   -29.539 1.00 46.86  ? 407  VAL B N   1 
ATOM   7305 C CA  . VAL B 1 407 ? 12.005  5.730   -30.060 1.00 46.46  ? 407  VAL B CA  1 
ATOM   7306 C C   . VAL B 1 407 ? 11.810  6.986   -29.201 1.00 46.92  ? 407  VAL B C   1 
ATOM   7307 O O   . VAL B 1 407 ? 12.067  8.112   -29.670 1.00 47.40  ? 407  VAL B O   1 
ATOM   7308 C CB  . VAL B 1 407 ? 10.641  5.039   -30.288 1.00 46.79  ? 407  VAL B CB  1 
ATOM   7309 C CG1 . VAL B 1 407 ? 9.608   6.042   -30.873 1.00 47.37  ? 407  VAL B CG1 1 
ATOM   7310 C CG2 . VAL B 1 407 ? 10.779  3.810   -31.210 1.00 45.84  ? 407  VAL B CG2 1 
ATOM   7311 N N   . VAL B 1 408 ? 11.393  6.821   -27.949 1.00 47.50  ? 408  VAL B N   1 
ATOM   7312 C CA  . VAL B 1 408 ? 10.975  7.984   -27.144 1.00 47.57  ? 408  VAL B CA  1 
ATOM   7313 C C   . VAL B 1 408 ? 12.101  8.994   -26.957 1.00 48.11  ? 408  VAL B C   1 
ATOM   7314 O O   . VAL B 1 408 ? 11.892  10.193  -27.133 1.00 47.83  ? 408  VAL B O   1 
ATOM   7315 C CB  . VAL B 1 408 ? 10.422  7.601   -25.749 1.00 48.43  ? 408  VAL B CB  1 
ATOM   7316 C CG1 . VAL B 1 408 ? 9.957   8.869   -25.010 1.00 47.68  ? 408  VAL B CG1 1 
ATOM   7317 C CG2 . VAL B 1 408 ? 9.291   6.564   -25.875 1.00 47.40  ? 408  VAL B CG2 1 
ATOM   7318 N N   . CYS B 1 409 ? 13.297  8.525   -26.620 1.00 48.45  ? 409  CYS B N   1 
ATOM   7319 C CA  . CYS B 1 409 ? 14.374  9.470   -26.346 1.00 49.13  ? 409  CYS B CA  1 
ATOM   7320 C C   . CYS B 1 409 ? 15.007  10.101  -27.593 1.00 48.94  ? 409  CYS B C   1 
ATOM   7321 O O   . CYS B 1 409 ? 15.325  11.302  -27.568 1.00 50.17  ? 409  CYS B O   1 
ATOM   7322 C CB  . CYS B 1 409 ? 15.395  8.864   -25.388 1.00 50.13  ? 409  CYS B CB  1 
ATOM   7323 S SG  . CYS B 1 409 ? 14.659  8.526   -23.740 1.00 50.96  ? 409  CYS B SG  1 
ATOM   7324 N N   . PRO B 1 410 ? 15.210  9.315   -28.678 1.00 48.55  ? 410  PRO B N   1 
ATOM   7325 C CA  . PRO B 1 410 ? 15.420  9.913   -29.997 1.00 47.72  ? 410  PRO B CA  1 
ATOM   7326 C C   . PRO B 1 410 ? 14.387  10.981  -30.412 1.00 46.81  ? 410  PRO B C   1 
ATOM   7327 O O   . PRO B 1 410 ? 14.779  12.024  -30.912 1.00 46.42  ? 410  PRO B O   1 
ATOM   7328 C CB  . PRO B 1 410 ? 15.373  8.703   -30.927 1.00 47.72  ? 410  PRO B CB  1 
ATOM   7329 C CG  . PRO B 1 410 ? 15.947  7.598   -30.102 1.00 48.23  ? 410  PRO B CG  1 
ATOM   7330 C CD  . PRO B 1 410 ? 15.366  7.843   -28.727 1.00 48.41  ? 410  PRO B CD  1 
ATOM   7331 N N   . VAL B 1 411 ? 13.097  10.738  -30.199 1.00 46.44  ? 411  VAL B N   1 
ATOM   7332 C CA  . VAL B 1 411 ? 12.059  11.740  -30.529 1.00 45.78  ? 411  VAL B CA  1 
ATOM   7333 C C   . VAL B 1 411 ? 12.231  13.037  -29.712 1.00 47.15  ? 411  VAL B C   1 
ATOM   7334 O O   . VAL B 1 411 ? 12.227  14.144  -30.276 1.00 47.18  ? 411  VAL B O   1 
ATOM   7335 C CB  . VAL B 1 411 ? 10.615  11.163  -30.400 1.00 45.80  ? 411  VAL B CB  1 
ATOM   7336 C CG1 . VAL B 1 411 ? 9.582   12.269  -30.366 1.00 44.56  ? 411  VAL B CG1 1 
ATOM   7337 C CG2 . VAL B 1 411 ? 10.315  10.187  -31.560 1.00 43.64  ? 411  VAL B CG2 1 
ATOM   7338 N N   . ALA B 1 412 ? 12.426  12.902  -28.401 1.00 47.94  ? 412  ALA B N   1 
ATOM   7339 C CA  . ALA B 1 412 ? 12.630  14.056  -27.524 1.00 48.45  ? 412  ALA B CA  1 
ATOM   7340 C C   . ALA B 1 412 ? 13.859  14.867  -27.937 1.00 49.18  ? 412  ALA B C   1 
ATOM   7341 O O   . ALA B 1 412 ? 13.802  16.092  -27.996 1.00 49.22  ? 412  ALA B O   1 
ATOM   7342 C CB  . ALA B 1 412 ? 12.734  13.614  -26.070 1.00 48.56  ? 412  ALA B CB  1 
ATOM   7343 N N   . GLN B 1 413 ? 14.951  14.179  -28.248 1.00 49.93  ? 413  GLN B N   1 
ATOM   7344 C CA  . GLN B 1 413 ? 16.157  14.819  -28.807 1.00 51.45  ? 413  GLN B CA  1 
ATOM   7345 C C   . GLN B 1 413 ? 15.883  15.670  -30.050 1.00 50.55  ? 413  GLN B C   1 
ATOM   7346 O O   . GLN B 1 413 ? 16.307  16.822  -30.132 1.00 50.75  ? 413  GLN B O   1 
ATOM   7347 C CB  . GLN B 1 413 ? 17.183  13.751  -29.203 1.00 52.10  ? 413  GLN B CB  1 
ATOM   7348 C CG  . GLN B 1 413 ? 18.385  13.699  -28.332 1.00 57.91  ? 413  GLN B CG  1 
ATOM   7349 C CD  . GLN B 1 413 ? 19.552  14.428  -28.921 1.00 62.22  ? 413  GLN B CD  1 
ATOM   7350 O OE1 . GLN B 1 413 ? 20.045  14.044  -29.976 1.00 66.83  ? 413  GLN B OE1 1 
ATOM   7351 N NE2 . GLN B 1 413 ? 20.026  15.472  -28.236 1.00 64.96  ? 413  GLN B NE2 1 
ATOM   7352 N N   . LEU B 1 414 ? 15.218  15.063  -31.030 1.00 49.12  ? 414  LEU B N   1 
ATOM   7353 C CA  . LEU B 1 414 ? 14.913  15.726  -32.288 1.00 48.95  ? 414  LEU B CA  1 
ATOM   7354 C C   . LEU B 1 414 ? 13.993  16.917  -32.067 1.00 49.24  ? 414  LEU B C   1 
ATOM   7355 O O   . LEU B 1 414 ? 14.251  18.026  -32.569 1.00 49.72  ? 414  LEU B O   1 
ATOM   7356 C CB  . LEU B 1 414 ? 14.263  14.731  -33.241 1.00 48.38  ? 414  LEU B CB  1 
ATOM   7357 C CG  . LEU B 1 414 ? 13.887  15.237  -34.636 1.00 48.07  ? 414  LEU B CG  1 
ATOM   7358 C CD1 . LEU B 1 414 ? 15.104  15.637  -35.464 1.00 45.62  ? 414  LEU B CD1 1 
ATOM   7359 C CD2 . LEU B 1 414 ? 13.111  14.170  -35.323 1.00 45.97  ? 414  LEU B CD2 1 
ATOM   7360 N N   . ALA B 1 415 ? 12.921  16.687  -31.314 1.00 49.08  ? 415  ALA B N   1 
ATOM   7361 C CA  . ALA B 1 415 ? 11.970  17.737  -30.989 1.00 49.75  ? 415  ALA B CA  1 
ATOM   7362 C C   . ALA B 1 415 ? 12.683  18.952  -30.405 1.00 50.81  ? 415  ALA B C   1 
ATOM   7363 O O   . ALA B 1 415 ? 12.443  20.080  -30.831 1.00 51.53  ? 415  ALA B O   1 
ATOM   7364 C CB  . ALA B 1 415 ? 10.907  17.215  -30.031 1.00 49.44  ? 415  ALA B CB  1 
ATOM   7365 N N   . GLY B 1 416 ? 13.596  18.719  -29.468 1.00 51.74  ? 416  GLY B N   1 
ATOM   7366 C CA  . GLY B 1 416 ? 14.313  19.805  -28.803 1.00 52.84  ? 416  GLY B CA  1 
ATOM   7367 C C   . GLY B 1 416 ? 15.270  20.577  -29.696 1.00 53.72  ? 416  GLY B C   1 
ATOM   7368 O O   . GLY B 1 416 ? 15.369  21.802  -29.591 1.00 55.44  ? 416  GLY B O   1 
ATOM   7369 N N   . ARG B 1 417 ? 15.996  19.873  -30.557 1.00 53.80  ? 417  ARG B N   1 
ATOM   7370 C CA  . ARG B 1 417 ? 16.920  20.515  -31.493 1.00 54.83  ? 417  ARG B CA  1 
ATOM   7371 C C   . ARG B 1 417 ? 16.174  21.297  -32.581 1.00 54.44  ? 417  ARG B C   1 
ATOM   7372 O O   . ARG B 1 417 ? 16.561  22.402  -32.931 1.00 54.57  ? 417  ARG B O   1 
ATOM   7373 C CB  . ARG B 1 417 ? 17.830  19.482  -32.170 1.00 55.23  ? 417  ARG B CB  1 
ATOM   7374 C CG  . ARG B 1 417 ? 18.719  18.637  -31.263 1.00 58.13  ? 417  ARG B CG  1 
ATOM   7375 C CD  . ARG B 1 417 ? 19.578  19.425  -30.294 1.00 64.14  ? 417  ARG B CD  1 
ATOM   7376 N NE  . ARG B 1 417 ? 20.444  20.400  -30.960 1.00 68.90  ? 417  ARG B NE  1 
ATOM   7377 C CZ  . ARG B 1 417 ? 21.583  20.886  -30.452 1.00 73.74  ? 417  ARG B CZ  1 
ATOM   7378 N NH1 . ARG B 1 417 ? 22.041  20.478  -29.261 1.00 75.70  ? 417  ARG B NH1 1 
ATOM   7379 N NH2 . ARG B 1 417 ? 22.292  21.773  -31.151 1.00 74.31  ? 417  ARG B NH2 1 
ATOM   7380 N N   . LEU B 1 418 ? 15.120  20.716  -33.143 1.00 53.78  ? 418  LEU B N   1 
ATOM   7381 C CA  . LEU B 1 418 ? 14.337  21.423  -34.160 1.00 54.22  ? 418  LEU B CA  1 
ATOM   7382 C C   . LEU B 1 418 ? 13.752  22.723  -33.583 1.00 55.12  ? 418  LEU B C   1 
ATOM   7383 O O   . LEU B 1 418 ? 13.842  23.786  -34.205 1.00 56.09  ? 418  LEU B O   1 
ATOM   7384 C CB  . LEU B 1 418 ? 13.229  20.531  -34.715 1.00 53.54  ? 418  LEU B CB  1 
ATOM   7385 C CG  . LEU B 1 418 ? 13.634  19.312  -35.551 1.00 53.28  ? 418  LEU B CG  1 
ATOM   7386 C CD1 . LEU B 1 418 ? 12.434  18.405  -35.761 1.00 52.95  ? 418  LEU B CD1 1 
ATOM   7387 C CD2 . LEU B 1 418 ? 14.234  19.710  -36.881 1.00 54.28  ? 418  LEU B CD2 1 
ATOM   7388 N N   . ALA B 1 419 ? 13.195  22.648  -32.378 1.00 54.98  ? 419  ALA B N   1 
ATOM   7389 C CA  . ALA B 1 419 ? 12.631  23.824  -31.730 1.00 56.18  ? 419  ALA B CA  1 
ATOM   7390 C C   . ALA B 1 419 ? 13.700  24.884  -31.471 1.00 57.94  ? 419  ALA B C   1 
ATOM   7391 O O   . ALA B 1 419 ? 13.479  26.067  -31.741 1.00 59.61  ? 419  ALA B O   1 
ATOM   7392 C CB  . ALA B 1 419 ? 11.934  23.440  -30.429 1.00 55.59  ? 419  ALA B CB  1 
ATOM   7393 N N   . ALA B 1 420 ? 14.858  24.468  -30.955 1.00 58.59  ? 420  ALA B N   1 
ATOM   7394 C CA  . ALA B 1 420 ? 15.949  25.412  -30.669 1.00 59.75  ? 420  ALA B CA  1 
ATOM   7395 C C   . ALA B 1 420 ? 16.519  26.037  -31.946 1.00 60.68  ? 420  ALA B C   1 
ATOM   7396 O O   . ALA B 1 420 ? 16.897  27.216  -31.950 1.00 62.33  ? 420  ALA B O   1 
ATOM   7397 C CB  . ALA B 1 420 ? 17.055  24.733  -29.877 1.00 59.74  ? 420  ALA B CB  1 
ATOM   7398 N N   . GLN B 1 421 ? 16.579  25.245  -33.013 1.00 59.99  ? 421  GLN B N   1 
ATOM   7399 C CA  . GLN B 1 421 ? 17.057  25.683  -34.323 1.00 60.97  ? 421  GLN B CA  1 
ATOM   7400 C C   . GLN B 1 421 ? 15.978  26.405  -35.170 1.00 60.85  ? 421  GLN B C   1 
ATOM   7401 O O   . GLN B 1 421 ? 16.134  26.551  -36.375 1.00 61.20  ? 421  GLN B O   1 
ATOM   7402 C CB  . GLN B 1 421 ? 17.601  24.478  -35.108 1.00 60.88  ? 421  GLN B CB  1 
ATOM   7403 C CG  . GLN B 1 421 ? 19.100  24.157  -34.948 1.00 63.38  ? 421  GLN B CG  1 
ATOM   7404 C CD  . GLN B 1 421 ? 19.558  24.055  -33.528 1.00 67.20  ? 421  GLN B CD  1 
ATOM   7405 O OE1 . GLN B 1 421 ? 19.886  25.071  -32.911 1.00 72.48  ? 421  GLN B OE1 1 
ATOM   7406 N NE2 . GLN B 1 421 ? 19.648  22.830  -33.004 1.00 67.55  ? 421  GLN B NE2 1 
ATOM   7407 N N   . GLY B 1 422 ? 14.893  26.859  -34.548 1.00 60.64  ? 422  GLY B N   1 
ATOM   7408 C CA  . GLY B 1 422 ? 13.939  27.757  -35.205 1.00 60.55  ? 422  GLY B CA  1 
ATOM   7409 C C   . GLY B 1 422 ? 12.699  27.107  -35.787 1.00 59.30  ? 422  GLY B C   1 
ATOM   7410 O O   . GLY B 1 422 ? 11.857  27.800  -36.354 1.00 60.06  ? 422  GLY B O   1 
ATOM   7411 N N   . ALA B 1 423 ? 12.569  25.790  -35.663 1.00 57.44  ? 423  ALA B N   1 
ATOM   7412 C CA  . ALA B 1 423 ? 11.401  25.100  -36.220 1.00 56.34  ? 423  ALA B CA  1 
ATOM   7413 C C   . ALA B 1 423 ? 10.175  25.263  -35.339 1.00 55.68  ? 423  ALA B C   1 
ATOM   7414 O O   . ALA B 1 423 ? 10.257  25.443  -34.130 1.00 56.15  ? 423  ALA B O   1 
ATOM   7415 C CB  . ALA B 1 423 ? 11.671  23.618  -36.442 1.00 54.77  ? 423  ALA B CB  1 
ATOM   7416 N N   . ARG B 1 424 ? 9.026   25.179  -35.977 1.00 54.80  ? 424  ARG B N   1 
ATOM   7417 C CA  . ARG B 1 424 ? 7.770   25.149  -35.281 1.00 54.33  ? 424  ARG B CA  1 
ATOM   7418 C C   . ARG B 1 424 ? 7.401   23.687  -35.052 1.00 51.09  ? 424  ARG B C   1 
ATOM   7419 O O   . ARG B 1 424 ? 7.170   22.956  -36.006 1.00 50.40  ? 424  ARG B O   1 
ATOM   7420 C CB  . ARG B 1 424 ? 6.757   25.839  -36.152 1.00 55.50  ? 424  ARG B CB  1 
ATOM   7421 C CG  . ARG B 1 424 ? 5.581   26.319  -35.442 1.00 60.43  ? 424  ARG B CG  1 
ATOM   7422 C CD  . ARG B 1 424 ? 5.330   27.750  -35.870 1.00 67.32  ? 424  ARG B CD  1 
ATOM   7423 N NE  . ARG B 1 424 ? 4.017   28.146  -35.419 1.00 70.44  ? 424  ARG B NE  1 
ATOM   7424 C CZ  . ARG B 1 424 ? 3.727   28.441  -34.166 1.00 71.80  ? 424  ARG B CZ  1 
ATOM   7425 N NH1 . ARG B 1 424 ? 4.652   28.441  -33.211 1.00 73.63  ? 424  ARG B NH1 1 
ATOM   7426 N NH2 . ARG B 1 424 ? 2.491   28.760  -33.881 1.00 73.59  ? 424  ARG B NH2 1 
ATOM   7427 N N   . VAL B 1 425 ? 7.363   23.259  -33.791 1.00 49.05  ? 425  VAL B N   1 
ATOM   7428 C CA  . VAL B 1 425 ? 7.209   21.832  -33.439 1.00 46.05  ? 425  VAL B CA  1 
ATOM   7429 C C   . VAL B 1 425 ? 5.983   21.576  -32.556 1.00 45.44  ? 425  VAL B C   1 
ATOM   7430 O O   . VAL B 1 425 ? 5.749   22.300  -31.605 1.00 45.96  ? 425  VAL B O   1 
ATOM   7431 C CB  . VAL B 1 425 ? 8.473   21.311  -32.685 1.00 46.05  ? 425  VAL B CB  1 
ATOM   7432 C CG1 . VAL B 1 425 ? 8.368   19.800  -32.375 1.00 43.28  ? 425  VAL B CG1 1 
ATOM   7433 C CG2 . VAL B 1 425 ? 9.765   21.631  -33.460 1.00 44.76  ? 425  VAL B CG2 1 
ATOM   7434 N N   . TYR B 1 426 ? 5.209   20.539  -32.872 1.00 44.41  ? 426  TYR B N   1 
ATOM   7435 C CA  . TYR B 1 426 ? 4.104   20.069  -32.034 1.00 44.09  ? 426  TYR B CA  1 
ATOM   7436 C C   . TYR B 1 426 ? 4.338   18.599  -31.693 1.00 43.73  ? 426  TYR B C   1 
ATOM   7437 O O   . TYR B 1 426 ? 4.686   17.816  -32.573 1.00 43.00  ? 426  TYR B O   1 
ATOM   7438 C CB  . TYR B 1 426 ? 2.770   20.211  -32.765 1.00 44.15  ? 426  TYR B CB  1 
ATOM   7439 C CG  . TYR B 1 426 ? 2.344   21.647  -33.052 1.00 44.92  ? 426  TYR B CG  1 
ATOM   7440 C CD1 . TYR B 1 426 ? 2.738   22.302  -34.225 1.00 44.92  ? 426  TYR B CD1 1 
ATOM   7441 C CD2 . TYR B 1 426 ? 1.538   22.335  -32.165 1.00 44.44  ? 426  TYR B CD2 1 
ATOM   7442 C CE1 . TYR B 1 426 ? 2.340   23.616  -34.485 1.00 46.17  ? 426  TYR B CE1 1 
ATOM   7443 C CE2 . TYR B 1 426 ? 1.132   23.640  -32.424 1.00 46.29  ? 426  TYR B CE2 1 
ATOM   7444 C CZ  . TYR B 1 426 ? 1.540   24.270  -33.582 1.00 46.51  ? 426  TYR B CZ  1 
ATOM   7445 O OH  . TYR B 1 426 ? 1.150   25.569  -33.804 1.00 49.08  ? 426  TYR B OH  1 
ATOM   7446 N N   . ALA B 1 427 ? 4.151   18.224  -30.428 1.00 44.14  ? 427  ALA B N   1 
ATOM   7447 C CA  . ALA B 1 427 ? 4.399   16.853  -29.981 1.00 44.20  ? 427  ALA B CA  1 
ATOM   7448 C C   . ALA B 1 427 ? 3.195   16.219  -29.292 1.00 44.79  ? 427  ALA B C   1 
ATOM   7449 O O   . ALA B 1 427 ? 2.334   16.903  -28.723 1.00 45.56  ? 427  ALA B O   1 
ATOM   7450 C CB  . ALA B 1 427 ? 5.616   16.791  -29.058 1.00 44.18  ? 427  ALA B CB  1 
ATOM   7451 N N   . TYR B 1 428 ? 3.166   14.894  -29.332 1.00 44.65  ? 428  TYR B N   1 
ATOM   7452 C CA  . TYR B 1 428 ? 2.049   14.119  -28.789 1.00 45.47  ? 428  TYR B CA  1 
ATOM   7453 C C   . TYR B 1 428 ? 2.529   12.780  -28.231 1.00 45.69  ? 428  TYR B C   1 
ATOM   7454 O O   . TYR B 1 428 ? 3.601   12.284  -28.595 1.00 44.99  ? 428  TYR B O   1 
ATOM   7455 C CB  . TYR B 1 428 ? 0.984   13.877  -29.867 1.00 45.08  ? 428  TYR B CB  1 
ATOM   7456 C CG  . TYR B 1 428 ? 1.397   12.887  -30.951 1.00 44.98  ? 428  TYR B CG  1 
ATOM   7457 C CD1 . TYR B 1 428 ? 1.304   11.507  -30.747 1.00 45.53  ? 428  TYR B CD1 1 
ATOM   7458 C CD2 . TYR B 1 428 ? 1.899   13.336  -32.169 1.00 43.63  ? 428  TYR B CD2 1 
ATOM   7459 C CE1 . TYR B 1 428 ? 1.712   10.594  -31.737 1.00 43.63  ? 428  TYR B CE1 1 
ATOM   7460 C CE2 . TYR B 1 428 ? 2.295   12.460  -33.145 1.00 43.35  ? 428  TYR B CE2 1 
ATOM   7461 C CZ  . TYR B 1 428 ? 2.199   11.081  -32.938 1.00 43.78  ? 428  TYR B CZ  1 
ATOM   7462 O OH  . TYR B 1 428 ? 2.618   10.224  -33.937 1.00 40.79  ? 428  TYR B OH  1 
ATOM   7463 N N   . ILE B 1 429 ? 1.734   12.224  -27.324 1.00 47.24  ? 429  ILE B N   1 
ATOM   7464 C CA  . ILE B 1 429 ? 1.809   10.802  -26.986 1.00 47.99  ? 429  ILE B CA  1 
ATOM   7465 C C   . ILE B 1 429 ? 0.448   10.169  -27.233 1.00 48.70  ? 429  ILE B C   1 
ATOM   7466 O O   . ILE B 1 429 ? -0.589  10.706  -26.822 1.00 50.16  ? 429  ILE B O   1 
ATOM   7467 C CB  . ILE B 1 429 ? 2.245   10.572  -25.542 1.00 48.93  ? 429  ILE B CB  1 
ATOM   7468 C CG1 . ILE B 1 429 ? 2.248   9.064   -25.238 1.00 48.87  ? 429  ILE B CG1 1 
ATOM   7469 C CG2 . ILE B 1 429 ? 1.345   11.361  -24.574 1.00 49.92  ? 429  ILE B CG2 1 
ATOM   7470 C CD1 . ILE B 1 429 ? 3.113   8.690   -24.054 1.00 50.01  ? 429  ILE B CD1 1 
ATOM   7471 N N   . PHE B 1 430 ? 0.443   9.049   -27.938 1.00 48.32  ? 430  PHE B N   1 
ATOM   7472 C CA  . PHE B 1 430 ? -0.802  8.388   -28.306 1.00 49.24  ? 430  PHE B CA  1 
ATOM   7473 C C   . PHE B 1 430 ? -1.106  7.235   -27.329 1.00 50.45  ? 430  PHE B C   1 
ATOM   7474 O O   . PHE B 1 430 ? -0.317  6.270   -27.216 1.00 50.03  ? 430  PHE B O   1 
ATOM   7475 C CB  . PHE B 1 430 ? -0.694  7.883   -29.737 1.00 48.60  ? 430  PHE B CB  1 
ATOM   7476 C CG  . PHE B 1 430 ? -1.940  7.285   -30.259 1.00 49.39  ? 430  PHE B CG  1 
ATOM   7477 C CD1 . PHE B 1 430 ? -2.178  5.916   -30.124 1.00 50.85  ? 430  PHE B CD1 1 
ATOM   7478 C CD2 . PHE B 1 430 ? -2.883  8.071   -30.902 1.00 49.58  ? 430  PHE B CD2 1 
ATOM   7479 C CE1 . PHE B 1 430 ? -3.351  5.344   -30.616 1.00 51.57  ? 430  PHE B CE1 1 
ATOM   7480 C CE2 . PHE B 1 430 ? -4.061  7.498   -31.399 1.00 52.49  ? 430  PHE B CE2 1 
ATOM   7481 C CZ  . PHE B 1 430 ? -4.292  6.135   -31.250 1.00 50.69  ? 430  PHE B CZ  1 
ATOM   7482 N N   . GLU B 1 431 ? -2.245  7.326   -26.637 1.00 51.42  ? 431  GLU B N   1 
ATOM   7483 C CA  . GLU B 1 431 ? -2.497  6.466   -25.484 1.00 53.34  ? 431  GLU B CA  1 
ATOM   7484 C C   . GLU B 1 431 ? -3.729  5.589   -25.574 1.00 54.78  ? 431  GLU B C   1 
ATOM   7485 O O   . GLU B 1 431 ? -4.078  4.937   -24.590 1.00 56.17  ? 431  GLU B O   1 
ATOM   7486 C CB  . GLU B 1 431 ? -2.624  7.303   -24.213 1.00 53.86  ? 431  GLU B CB  1 
ATOM   7487 C CG  . GLU B 1 431 ? -1.422  8.125   -23.871 1.00 54.33  ? 431  GLU B CG  1 
ATOM   7488 C CD  . GLU B 1 431 ? -1.552  8.774   -22.517 1.00 55.82  ? 431  GLU B CD  1 
ATOM   7489 O OE1 . GLU B 1 431 ? -2.670  9.240   -22.161 1.00 56.80  ? 431  GLU B OE1 1 
ATOM   7490 O OE2 . GLU B 1 431 ? -0.534  8.777   -21.801 1.00 56.08  ? 431  GLU B OE2 1 
ATOM   7491 N N   . HIS B 1 432 ? -4.394  5.566   -26.723 1.00 55.36  ? 432  HIS B N   1 
ATOM   7492 C CA  . HIS B 1 432 ? -5.563  4.723   -26.884 1.00 56.65  ? 432  HIS B CA  1 
ATOM   7493 C C   . HIS B 1 432 ? -5.218  3.354   -27.478 1.00 56.80  ? 432  HIS B C   1 
ATOM   7494 O O   . HIS B 1 432 ? -4.587  3.272   -28.532 1.00 55.90  ? 432  HIS B O   1 
ATOM   7495 C CB  . HIS B 1 432 ? -6.604  5.396   -27.764 1.00 57.04  ? 432  HIS B CB  1 
ATOM   7496 C CG  . HIS B 1 432 ? -7.772  4.515   -28.045 1.00 58.82  ? 432  HIS B CG  1 
ATOM   7497 N ND1 . HIS B 1 432 ? -8.649  4.118   -27.060 1.00 60.99  ? 432  HIS B ND1 1 
ATOM   7498 C CD2 . HIS B 1 432 ? -8.175  3.900   -29.181 1.00 59.87  ? 432  HIS B CD2 1 
ATOM   7499 C CE1 . HIS B 1 432 ? -9.566  3.325   -27.586 1.00 61.77  ? 432  HIS B CE1 1 
ATOM   7500 N NE2 . HIS B 1 432 ? -9.302  3.178   -28.872 1.00 60.21  ? 432  HIS B NE2 1 
ATOM   7501 N N   . ARG B 1 433 ? -5.658  2.287   -26.809 1.00 58.12  ? 433  ARG B N   1 
ATOM   7502 C CA  . ARG B 1 433 ? -5.456  0.920   -27.297 1.00 58.22  ? 433  ARG B CA  1 
ATOM   7503 C C   . ARG B 1 433 ? -6.715  0.495   -28.043 1.00 59.46  ? 433  ARG B C   1 
ATOM   7504 O O   . ARG B 1 433 ? -7.810  0.532   -27.489 1.00 60.50  ? 433  ARG B O   1 
ATOM   7505 C CB  . ARG B 1 433 ? -5.184  -0.041  -26.137 1.00 59.00  ? 433  ARG B CB  1 
ATOM   7506 C CG  . ARG B 1 433 ? -5.133  -1.524  -26.536 1.00 59.48  ? 433  ARG B CG  1 
ATOM   7507 C CD  . ARG B 1 433 ? -4.914  -2.423  -25.315 1.00 60.46  ? 433  ARG B CD  1 
ATOM   7508 N NE  . ARG B 1 433 ? -5.255  -3.823  -25.576 1.00 60.99  ? 433  ARG B NE  1 
ATOM   7509 C CZ  . ARG B 1 433 ? -4.386  -4.812  -25.792 1.00 61.69  ? 433  ARG B CZ  1 
ATOM   7510 N NH1 . ARG B 1 433 ? -3.066  -4.615  -25.769 1.00 59.77  ? 433  ARG B NH1 1 
ATOM   7511 N NH2 . ARG B 1 433 ? -4.856  -6.036  -26.026 1.00 63.00  ? 433  ARG B NH2 1 
ATOM   7512 N N   . ALA B 1 434 ? -6.542  0.101   -29.302 1.00 59.23  ? 434  ALA B N   1 
ATOM   7513 C CA  . ALA B 1 434 ? -7.640  -0.362  -30.150 1.00 60.18  ? 434  ALA B CA  1 
ATOM   7514 C C   . ALA B 1 434 ? -8.402  -1.498  -29.487 1.00 62.32  ? 434  ALA B C   1 
ATOM   7515 O O   . ALA B 1 434 ? -7.791  -2.442  -28.982 1.00 62.89  ? 434  ALA B O   1 
ATOM   7516 C CB  . ALA B 1 434 ? -7.107  -0.821  -31.487 1.00 58.87  ? 434  ALA B CB  1 
ATOM   7517 N N   . SER B 1 435 ? -9.733  -1.405  -29.512 1.00 63.63  ? 435  SER B N   1 
ATOM   7518 C CA  . SER B 1 435 ? -10.610 -2.415  -28.932 1.00 65.66  ? 435  SER B CA  1 
ATOM   7519 C C   . SER B 1 435 ? -10.514 -3.759  -29.656 1.00 66.48  ? 435  SER B C   1 
ATOM   7520 O O   . SER B 1 435 ? -10.800 -4.807  -29.080 1.00 67.60  ? 435  SER B O   1 
ATOM   7521 C CB  . SER B 1 435 ? -12.061 -1.920  -28.965 1.00 66.91  ? 435  SER B CB  1 
ATOM   7522 O OG  . SER B 1 435 ? -12.485 -1.668  -30.294 1.00 66.65  ? 435  SER B OG  1 
ATOM   7523 N N   . THR B 1 436 ? -10.089 -3.704  -30.916 1.00 66.09  ? 436  THR B N   1 
ATOM   7524 C CA  . THR B 1 436 ? -9.980  -4.867  -31.786 1.00 66.64  ? 436  THR B CA  1 
ATOM   7525 C C   . THR B 1 436 ? -8.561  -5.467  -31.850 1.00 65.42  ? 436  THR B C   1 
ATOM   7526 O O   . THR B 1 436 ? -8.315  -6.384  -32.619 1.00 65.49  ? 436  THR B O   1 
ATOM   7527 C CB  . THR B 1 436 ? -10.468 -4.483  -33.200 1.00 66.54  ? 436  THR B CB  1 
ATOM   7528 O OG1 . THR B 1 436 ? -9.734  -3.349  -33.676 1.00 66.43  ? 436  THR B OG1 1 
ATOM   7529 C CG2 . THR B 1 436 ? -11.939 -4.110  -33.160 1.00 68.46  ? 436  THR B CG2 1 
ATOM   7530 N N   . LEU B 1 437 ? -7.635  -4.961  -31.029 1.00 64.69  ? 437  LEU B N   1 
ATOM   7531 C CA  . LEU B 1 437 ? -6.248  -5.468  -30.982 1.00 63.57  ? 437  LEU B CA  1 
ATOM   7532 C C   . LEU B 1 437 ? -6.213  -6.967  -30.651 1.00 64.76  ? 437  LEU B C   1 
ATOM   7533 O O   . LEU B 1 437 ? -6.886  -7.409  -29.724 1.00 65.71  ? 437  LEU B O   1 
ATOM   7534 C CB  . LEU B 1 437 ? -5.447  -4.700  -29.928 1.00 62.90  ? 437  LEU B CB  1 
ATOM   7535 C CG  . LEU B 1 437 ? -3.974  -4.395  -30.215 1.00 62.28  ? 437  LEU B CG  1 
ATOM   7536 C CD1 . LEU B 1 437 ? -3.868  -3.509  -31.414 1.00 61.34  ? 437  LEU B CD1 1 
ATOM   7537 C CD2 . LEU B 1 437 ? -3.326  -3.729  -29.014 1.00 60.73  ? 437  LEU B CD2 1 
ATOM   7538 N N   . THR B 1 438 ? -5.430  -7.738  -31.407 1.00 64.45  ? 438  THR B N   1 
ATOM   7539 C CA  . THR B 1 438 ? -5.282  -9.179  -31.161 1.00 65.88  ? 438  THR B CA  1 
ATOM   7540 C C   . THR B 1 438 ? -4.077  -9.533  -30.282 1.00 65.54  ? 438  THR B C   1 
ATOM   7541 O O   . THR B 1 438 ? -3.985  -10.655 -29.781 1.00 66.96  ? 438  THR B O   1 
ATOM   7542 C CB  . THR B 1 438 ? -5.178  -9.965  -32.475 1.00 66.15  ? 438  THR B CB  1 
ATOM   7543 O OG1 . THR B 1 438 ? -4.124  -9.423  -33.285 1.00 64.70  ? 438  THR B OG1 1 
ATOM   7544 C CG2 . THR B 1 438 ? -6.505  -9.906  -33.225 1.00 67.33  ? 438  THR B CG2 1 
ATOM   7545 N N   . TRP B 1 439 ? -3.150  -8.590  -30.110 1.00 63.68  ? 439  TRP B N   1 
ATOM   7546 C CA  . TRP B 1 439 ? -2.050  -8.754  -29.152 1.00 63.13  ? 439  TRP B CA  1 
ATOM   7547 C C   . TRP B 1 439 ? -2.605  -8.721  -27.731 1.00 63.98  ? 439  TRP B C   1 
ATOM   7548 O O   . TRP B 1 439 ? -3.617  -8.073  -27.493 1.00 64.30  ? 439  TRP B O   1 
ATOM   7549 C CB  . TRP B 1 439 ? -1.031  -7.622  -29.307 1.00 61.15  ? 439  TRP B CB  1 
ATOM   7550 C CG  . TRP B 1 439 ? -0.301  -7.634  -30.595 1.00 59.61  ? 439  TRP B CG  1 
ATOM   7551 C CD1 . TRP B 1 439 ? -0.516  -6.819  -31.657 1.00 58.59  ? 439  TRP B CD1 1 
ATOM   7552 C CD2 . TRP B 1 439 ? 0.784   -8.498  -30.961 1.00 60.77  ? 439  TRP B CD2 1 
ATOM   7553 N NE1 . TRP B 1 439 ? 0.362   -7.117  -32.667 1.00 58.33  ? 439  TRP B NE1 1 
ATOM   7554 C CE2 . TRP B 1 439 ? 1.173   -8.143  -32.267 1.00 59.58  ? 439  TRP B CE2 1 
ATOM   7555 C CE3 . TRP B 1 439 ? 1.453   -9.550  -30.318 1.00 61.31  ? 439  TRP B CE3 1 
ATOM   7556 C CZ2 . TRP B 1 439 ? 2.206   -8.793  -32.941 1.00 59.60  ? 439  TRP B CZ2 1 
ATOM   7557 C CZ3 . TRP B 1 439 ? 2.484   -10.186 -30.981 1.00 60.56  ? 439  TRP B CZ3 1 
ATOM   7558 C CH2 . TRP B 1 439 ? 2.849   -9.810  -32.280 1.00 60.32  ? 439  TRP B CH2 1 
ATOM   7559 N N   . PRO B 1 440 ? -1.934  -9.393  -26.776 1.00 64.48  ? 440  PRO B N   1 
ATOM   7560 C CA  . PRO B 1 440 ? -2.411  -9.428  -25.395 1.00 65.61  ? 440  PRO B CA  1 
ATOM   7561 C C   . PRO B 1 440 ? -2.328  -8.090  -24.669 1.00 64.81  ? 440  PRO B C   1 
ATOM   7562 O O   . PRO B 1 440 ? -1.618  -7.188  -25.108 1.00 62.92  ? 440  PRO B O   1 
ATOM   7563 C CB  . PRO B 1 440 ? -1.472  -10.434 -24.730 1.00 66.61  ? 440  PRO B CB  1 
ATOM   7564 C CG  . PRO B 1 440 ? -0.243  -10.357 -25.512 1.00 65.16  ? 440  PRO B CG  1 
ATOM   7565 C CD  . PRO B 1 440 ? -0.681  -10.149 -26.929 1.00 64.42  ? 440  PRO B CD  1 
ATOM   7566 N N   . LEU B 1 441 ? -3.043  -7.994  -23.551 1.00 66.12  ? 441  LEU B N   1 
ATOM   7567 C CA  . LEU B 1 441 ? -3.146  -6.757  -22.783 1.00 66.18  ? 441  LEU B CA  1 
ATOM   7568 C C   . LEU B 1 441 ? -1.804  -6.229  -22.302 1.00 64.74  ? 441  LEU B C   1 
ATOM   7569 O O   . LEU B 1 441 ? -1.623  -5.015  -22.192 1.00 63.37  ? 441  LEU B O   1 
ATOM   7570 C CB  . LEU B 1 441 ? -4.061  -6.940  -21.563 1.00 68.29  ? 441  LEU B CB  1 
ATOM   7571 C CG  . LEU B 1 441 ? -5.575  -7.046  -21.795 1.00 71.37  ? 441  LEU B CG  1 
ATOM   7572 C CD1 . LEU B 1 441 ? -6.280  -7.337  -20.475 1.00 74.22  ? 441  LEU B CD1 1 
ATOM   7573 C CD2 . LEU B 1 441 ? -6.125  -5.754  -22.421 1.00 72.91  ? 441  LEU B CD2 1 
ATOM   7574 N N   . TRP B 1 442 ? -0.864  -7.126  -22.010 1.00 64.87  ? 442  TRP B N   1 
ATOM   7575 C CA  . TRP B 1 442 ? 0.401   -6.688  -21.412 1.00 64.03  ? 442  TRP B CA  1 
ATOM   7576 C C   . TRP B 1 442 ? 1.212   -5.791  -22.346 1.00 61.87  ? 442  TRP B C   1 
ATOM   7577 O O   . TRP B 1 442 ? 2.021   -4.997  -21.879 1.00 60.49  ? 442  TRP B O   1 
ATOM   7578 C CB  . TRP B 1 442 ? 1.240   -7.872  -20.890 1.00 65.14  ? 442  TRP B CB  1 
ATOM   7579 C CG  . TRP B 1 442 ? 1.905   -8.731  -21.910 1.00 64.77  ? 442  TRP B CG  1 
ATOM   7580 C CD1 . TRP B 1 442 ? 1.496   -9.963  -22.333 1.00 66.64  ? 442  TRP B CD1 1 
ATOM   7581 C CD2 . TRP B 1 442 ? 3.126   -8.453  -22.599 1.00 63.71  ? 442  TRP B CD2 1 
ATOM   7582 N NE1 . TRP B 1 442 ? 2.377   -10.462 -23.262 1.00 66.04  ? 442  TRP B NE1 1 
ATOM   7583 C CE2 . TRP B 1 442 ? 3.390   -9.555  -23.440 1.00 65.35  ? 442  TRP B CE2 1 
ATOM   7584 C CE3 . TRP B 1 442 ? 4.027   -7.374  -22.591 1.00 63.15  ? 442  TRP B CE3 1 
ATOM   7585 C CZ2 . TRP B 1 442 ? 4.509   -9.607  -24.275 1.00 64.06  ? 442  TRP B CZ2 1 
ATOM   7586 C CZ3 . TRP B 1 442 ? 5.128   -7.421  -23.422 1.00 62.47  ? 442  TRP B CZ3 1 
ATOM   7587 C CH2 . TRP B 1 442 ? 5.366   -8.537  -24.252 1.00 62.85  ? 442  TRP B CH2 1 
ATOM   7588 N N   . MET B 1 443 ? 0.987   -5.919  -23.653 1.00 60.82  ? 443  MET B N   1 
ATOM   7589 C CA  . MET B 1 443 ? 1.723   -5.137  -24.644 1.00 59.30  ? 443  MET B CA  1 
ATOM   7590 C C   . MET B 1 443 ? 1.198   -3.701  -24.757 1.00 57.90  ? 443  MET B C   1 
ATOM   7591 O O   . MET B 1 443 ? 1.858   -2.847  -25.357 1.00 57.21  ? 443  MET B O   1 
ATOM   7592 C CB  . MET B 1 443 ? 1.694   -5.844  -26.004 1.00 59.09  ? 443  MET B CB  1 
ATOM   7593 C CG  . MET B 1 443 ? 2.363   -7.217  -25.955 1.00 60.36  ? 443  MET B CG  1 
ATOM   7594 S SD  . MET B 1 443 ? 2.515   -8.041  -27.543 1.00 61.12  ? 443  MET B SD  1 
ATOM   7595 C CE  . MET B 1 443 ? 3.802   -7.119  -28.349 1.00 59.64  ? 443  MET B CE  1 
ATOM   7596 N N   . GLY B 1 444 ? 0.021   -3.448  -24.184 1.00 57.86  ? 444  GLY B N   1 
ATOM   7597 C CA  . GLY B 1 444 ? -0.546  -2.105  -24.084 1.00 56.80  ? 444  GLY B CA  1 
ATOM   7598 C C   . GLY B 1 444 ? -0.952  -1.483  -25.415 1.00 55.55  ? 444  GLY B C   1 
ATOM   7599 O O   . GLY B 1 444 ? -1.730  -2.065  -26.170 1.00 55.59  ? 444  GLY B O   1 
ATOM   7600 N N   . VAL B 1 445 ? -0.451  -0.273  -25.668 1.00 53.73  ? 445  VAL B N   1 
ATOM   7601 C CA  . VAL B 1 445 ? -0.618  0.411   -26.951 1.00 52.58  ? 445  VAL B CA  1 
ATOM   7602 C C   . VAL B 1 445 ? 0.678   0.239   -27.745 1.00 51.69  ? 445  VAL B C   1 
ATOM   7603 O O   . VAL B 1 445 ? 1.607   1.023   -27.573 1.00 50.73  ? 445  VAL B O   1 
ATOM   7604 C CB  . VAL B 1 445 ? -0.913  1.926   -26.761 1.00 52.13  ? 445  VAL B CB  1 
ATOM   7605 C CG1 . VAL B 1 445 ? -1.223  2.586   -28.112 1.00 50.33  ? 445  VAL B CG1 1 
ATOM   7606 C CG2 . VAL B 1 445 ? -2.051  2.140   -25.754 1.00 51.52  ? 445  VAL B CG2 1 
ATOM   7607 N N   . PRO B 1 446 ? 0.774   -0.824  -28.574 1.00 51.77  ? 446  PRO B N   1 
ATOM   7608 C CA  . PRO B 1 446 ? 2.051   -1.131  -29.205 1.00 51.41  ? 446  PRO B CA  1 
ATOM   7609 C C   . PRO B 1 446 ? 2.398   -0.251  -30.397 1.00 50.69  ? 446  PRO B C   1 
ATOM   7610 O O   . PRO B 1 446 ? 1.519   0.352   -31.012 1.00 50.80  ? 446  PRO B O   1 
ATOM   7611 C CB  . PRO B 1 446 ? 1.878   -2.593  -29.672 1.00 51.93  ? 446  PRO B CB  1 
ATOM   7612 C CG  . PRO B 1 446 ? 0.601   -3.053  -29.098 1.00 53.32  ? 446  PRO B CG  1 
ATOM   7613 C CD  . PRO B 1 446 ? -0.230  -1.827  -28.948 1.00 52.99  ? 446  PRO B CD  1 
ATOM   7614 N N   . HIS B 1 447 ? 3.686   -0.227  -30.707 1.00 50.36  ? 447  HIS B N   1 
ATOM   7615 C CA  . HIS B 1 447 ? 4.262   0.485   -31.844 1.00 49.96  ? 447  HIS B CA  1 
ATOM   7616 C C   . HIS B 1 447 ? 3.484   0.149   -33.116 1.00 49.99  ? 447  HIS B C   1 
ATOM   7617 O O   . HIS B 1 447 ? 3.319   -1.027  -33.460 1.00 50.78  ? 447  HIS B O   1 
ATOM   7618 C CB  . HIS B 1 447 ? 5.725   0.031   -31.950 1.00 50.14  ? 447  HIS B CB  1 
ATOM   7619 C CG  . HIS B 1 447 ? 6.525   0.698   -33.026 1.00 50.46  ? 447  HIS B CG  1 
ATOM   7620 N ND1 . HIS B 1 447 ? 7.086   1.947   -32.870 1.00 50.22  ? 447  HIS B ND1 1 
ATOM   7621 C CD2 . HIS B 1 447 ? 6.933   0.250   -34.239 1.00 51.06  ? 447  HIS B CD2 1 
ATOM   7622 C CE1 . HIS B 1 447 ? 7.768   2.258   -33.957 1.00 51.03  ? 447  HIS B CE1 1 
ATOM   7623 N NE2 . HIS B 1 447 ? 7.684   1.249   -34.807 1.00 50.63  ? 447  HIS B NE2 1 
ATOM   7624 N N   . GLY B 1 448 ? 2.979   1.173   -33.796 1.00 48.68  ? 448  GLY B N   1 
ATOM   7625 C CA  . GLY B 1 448 ? 2.237   0.978   -35.038 1.00 48.21  ? 448  GLY B CA  1 
ATOM   7626 C C   . GLY B 1 448 ? 0.726   1.064   -34.949 1.00 48.66  ? 448  GLY B C   1 
ATOM   7627 O O   . GLY B 1 448 ? 0.074   1.227   -35.977 1.00 49.15  ? 448  GLY B O   1 
ATOM   7628 N N   . TYR B 1 449 ? 0.146   0.988   -33.752 1.00 48.93  ? 449  TYR B N   1 
ATOM   7629 C CA  . TYR B 1 449 ? -1.325  0.885   -33.634 1.00 50.26  ? 449  TYR B CA  1 
ATOM   7630 C C   . TYR B 1 449 ? -2.097  2.209   -33.449 1.00 50.26  ? 449  TYR B C   1 
ATOM   7631 O O   . TYR B 1 449 ? -3.279  2.220   -33.092 1.00 51.25  ? 449  TYR B O   1 
ATOM   7632 C CB  . TYR B 1 449 ? -1.691  -0.174  -32.593 1.00 51.23  ? 449  TYR B CB  1 
ATOM   7633 C CG  . TYR B 1 449 ? -1.369  -1.539  -33.133 1.00 51.29  ? 449  TYR B CG  1 
ATOM   7634 C CD1 . TYR B 1 449 ? -0.124  -2.127  -32.908 1.00 50.07  ? 449  TYR B CD1 1 
ATOM   7635 C CD2 . TYR B 1 449 ? -2.278  -2.209  -33.942 1.00 51.98  ? 449  TYR B CD2 1 
ATOM   7636 C CE1 . TYR B 1 449 ? 0.184   -3.376  -33.449 1.00 51.69  ? 449  TYR B CE1 1 
ATOM   7637 C CE2 . TYR B 1 449 ? -1.981  -3.450  -34.485 1.00 51.87  ? 449  TYR B CE2 1 
ATOM   7638 C CZ  . TYR B 1 449 ? -0.751  -4.031  -34.242 1.00 51.80  ? 449  TYR B CZ  1 
ATOM   7639 O OH  . TYR B 1 449 ? -0.472  -5.271  -34.790 1.00 52.82  ? 449  TYR B OH  1 
ATOM   7640 N N   . GLU B 1 450 ? -1.427  3.311   -33.756 1.00 49.26  ? 450  GLU B N   1 
ATOM   7641 C CA  . GLU B 1 450 ? -2.084  4.600   -33.952 1.00 49.22  ? 450  GLU B CA  1 
ATOM   7642 C C   . GLU B 1 450 ? -2.484  4.840   -35.408 1.00 48.96  ? 450  GLU B C   1 
ATOM   7643 O O   . GLU B 1 450 ? -3.338  5.684   -35.692 1.00 48.98  ? 450  GLU B O   1 
ATOM   7644 C CB  . GLU B 1 450 ? -1.166  5.727   -33.475 1.00 48.58  ? 450  GLU B CB  1 
ATOM   7645 C CG  . GLU B 1 450 ? -0.081  6.190   -34.458 1.00 47.94  ? 450  GLU B CG  1 
ATOM   7646 C CD  . GLU B 1 450 ? 1.130   5.256   -34.590 1.00 48.94  ? 450  GLU B CD  1 
ATOM   7647 O OE1 . GLU B 1 450 ? 1.025   4.018   -34.365 1.00 49.43  ? 450  GLU B OE1 1 
ATOM   7648 O OE2 . GLU B 1 450 ? 2.201   5.775   -34.976 1.00 47.05  ? 450  GLU B OE2 1 
ATOM   7649 N N   . ILE B 1 451 ? -1.868  4.106   -36.329 1.00 48.86  ? 451  ILE B N   1 
ATOM   7650 C CA  . ILE B 1 451 ? -1.946  4.447   -37.740 1.00 49.09  ? 451  ILE B CA  1 
ATOM   7651 C C   . ILE B 1 451 ? -3.375  4.291   -38.233 1.00 50.77  ? 451  ILE B C   1 
ATOM   7652 O O   . ILE B 1 451 ? -3.889  5.153   -38.951 1.00 51.54  ? 451  ILE B O   1 
ATOM   7653 C CB  . ILE B 1 451 ? -1.014  3.577   -38.599 1.00 49.01  ? 451  ILE B CB  1 
ATOM   7654 C CG1 . ILE B 1 451 ? 0.454   3.773   -38.194 1.00 49.02  ? 451  ILE B CG1 1 
ATOM   7655 C CG2 . ILE B 1 451 ? -1.175  3.915   -40.074 1.00 47.59  ? 451  ILE B CG2 1 
ATOM   7656 C CD1 . ILE B 1 451 ? 1.363   2.663   -38.707 1.00 50.32  ? 451  ILE B CD1 1 
ATOM   7657 N N   . GLU B 1 452 ? -4.010  3.190   -37.845 1.00 51.54  ? 452  GLU B N   1 
ATOM   7658 C CA  . GLU B 1 452 ? -5.381  2.909   -38.238 1.00 53.04  ? 452  GLU B CA  1 
ATOM   7659 C C   . GLU B 1 452 ? -6.368  4.019   -37.821 1.00 53.36  ? 452  GLU B C   1 
ATOM   7660 O O   . GLU B 1 452 ? -7.354  4.239   -38.496 1.00 54.77  ? 452  GLU B O   1 
ATOM   7661 C CB  . GLU B 1 452 ? -5.825  1.554   -37.680 1.00 54.14  ? 452  GLU B CB  1 
ATOM   7662 C CG  . GLU B 1 452 ? -5.751  1.391   -36.147 1.00 56.04  ? 452  GLU B CG  1 
ATOM   7663 C CD  . GLU B 1 452 ? -5.714  -0.089  -35.725 1.00 59.30  ? 452  GLU B CD  1 
ATOM   7664 O OE1 . GLU B 1 452 ? -6.742  -0.579  -35.224 1.00 59.69  ? 452  GLU B OE1 1 
ATOM   7665 O OE2 . GLU B 1 452 ? -4.664  -0.759  -35.914 1.00 59.49  ? 452  GLU B OE2 1 
ATOM   7666 N N   . PHE B 1 453 ? -6.082  4.708   -36.716 1.00 52.76  ? 453  PHE B N   1 
ATOM   7667 C CA  . PHE B 1 453 ? -6.891  5.834   -36.242 1.00 52.64  ? 453  PHE B CA  1 
ATOM   7668 C C   . PHE B 1 453 ? -6.670  7.090   -37.061 1.00 51.76  ? 453  PHE B C   1 
ATOM   7669 O O   . PHE B 1 453 ? -7.616  7.756   -37.443 1.00 52.34  ? 453  PHE B O   1 
ATOM   7670 C CB  . PHE B 1 453 ? -6.644  6.074   -34.737 1.00 52.39  ? 453  PHE B CB  1 
ATOM   7671 C CG  . PHE B 1 453 ? -7.218  4.989   -33.893 1.00 52.82  ? 453  PHE B CG  1 
ATOM   7672 C CD1 . PHE B 1 453 ? -8.578  4.974   -33.606 1.00 54.73  ? 453  PHE B CD1 1 
ATOM   7673 C CD2 . PHE B 1 453 ? -6.438  3.920   -33.483 1.00 52.29  ? 453  PHE B CD2 1 
ATOM   7674 C CE1 . PHE B 1 453 ? -9.141  3.934   -32.873 1.00 54.99  ? 453  PHE B CE1 1 
ATOM   7675 C CE2 . PHE B 1 453 ? -6.990  2.870   -32.753 1.00 53.43  ? 453  PHE B CE2 1 
ATOM   7676 C CZ  . PHE B 1 453 ? -8.345  2.881   -32.447 1.00 54.64  ? 453  PHE B CZ  1 
ATOM   7677 N N   . ILE B 1 454 ? -5.419  7.386   -37.364 1.00 50.98  ? 454  ILE B N   1 
ATOM   7678 C CA  . ILE B 1 454 ? -5.068  8.568   -38.146 1.00 50.84  ? 454  ILE B CA  1 
ATOM   7679 C C   . ILE B 1 454 ? -5.575  8.451   -39.584 1.00 51.19  ? 454  ILE B C   1 
ATOM   7680 O O   . ILE B 1 454 ? -6.064  9.438   -40.148 1.00 51.85  ? 454  ILE B O   1 
ATOM   7681 C CB  . ILE B 1 454 ? -3.540  8.821   -38.127 1.00 49.76  ? 454  ILE B CB  1 
ATOM   7682 C CG1 . ILE B 1 454 ? -3.090  9.202   -36.712 1.00 50.17  ? 454  ILE B CG1 1 
ATOM   7683 C CG2 . ILE B 1 454 ? -3.165  9.923   -39.102 1.00 49.90  ? 454  ILE B CG2 1 
ATOM   7684 C CD1 . ILE B 1 454 ? -1.609  8.829   -36.415 1.00 51.14  ? 454  ILE B CD1 1 
ATOM   7685 N N   . PHE B 1 455 ? -5.478  7.253   -40.163 1.00 50.67  ? 455  PHE B N   1 
ATOM   7686 C CA  . PHE B 1 455 ? -6.033  7.001   -41.502 1.00 51.11  ? 455  PHE B CA  1 
ATOM   7687 C C   . PHE B 1 455 ? -7.577  6.895   -41.525 1.00 52.45  ? 455  PHE B C   1 
ATOM   7688 O O   . PHE B 1 455 ? -8.189  6.959   -42.587 1.00 52.34  ? 455  PHE B O   1 
ATOM   7689 C CB  . PHE B 1 455 ? -5.383  5.770   -42.148 1.00 50.24  ? 455  PHE B CB  1 
ATOM   7690 C CG  . PHE B 1 455 ? -4.091  6.077   -42.884 1.00 50.07  ? 455  PHE B CG  1 
ATOM   7691 C CD1 . PHE B 1 455 ? -2.864  6.016   -42.238 1.00 49.07  ? 455  PHE B CD1 1 
ATOM   7692 C CD2 . PHE B 1 455 ? -4.108  6.425   -44.222 1.00 49.89  ? 455  PHE B CD2 1 
ATOM   7693 C CE1 . PHE B 1 455 ? -1.680  6.283   -42.925 1.00 48.43  ? 455  PHE B CE1 1 
ATOM   7694 C CE2 . PHE B 1 455 ? -2.923  6.699   -44.908 1.00 49.28  ? 455  PHE B CE2 1 
ATOM   7695 C CZ  . PHE B 1 455 ? -1.720  6.624   -44.268 1.00 47.55  ? 455  PHE B CZ  1 
ATOM   7696 N N   . GLY B 1 456 ? -8.194  6.718   -40.360 1.00 53.39  ? 456  GLY B N   1 
ATOM   7697 C CA  . GLY B 1 456 ? -9.652  6.825   -40.235 1.00 55.14  ? 456  GLY B CA  1 
ATOM   7698 C C   . GLY B 1 456 ? -10.426 5.537   -40.422 1.00 56.35  ? 456  GLY B C   1 
ATOM   7699 O O   . GLY B 1 456 ? -11.616 5.576   -40.720 1.00 57.66  ? 456  GLY B O   1 
ATOM   7700 N N   . LEU B 1 457 ? -9.778  4.391   -40.221 1.00 56.49  ? 457  LEU B N   1 
ATOM   7701 C CA  . LEU B 1 457 ? -10.452 3.094   -40.431 1.00 57.95  ? 457  LEU B CA  1 
ATOM   7702 C C   . LEU B 1 457 ? -11.695 2.881   -39.554 1.00 59.90  ? 457  LEU B C   1 
ATOM   7703 O O   . LEU B 1 457 ? -12.662 2.263   -39.998 1.00 61.61  ? 457  LEU B O   1 
ATOM   7704 C CB  . LEU B 1 457 ? -9.481  1.932   -40.241 1.00 57.59  ? 457  LEU B CB  1 
ATOM   7705 C CG  . LEU B 1 457 ? -8.684  1.525   -41.486 1.00 57.08  ? 457  LEU B CG  1 
ATOM   7706 C CD1 . LEU B 1 457 ? -7.663  2.592   -41.891 1.00 54.57  ? 457  LEU B CD1 1 
ATOM   7707 C CD2 . LEU B 1 457 ? -8.017  0.196   -41.218 1.00 57.23  ? 457  LEU B CD2 1 
ATOM   7708 N N   . PRO B 1 458 ? -11.677 3.368   -38.302 1.00 60.47  ? 458  PRO B N   1 
ATOM   7709 C CA  . PRO B 1 458 ? -12.887 3.247   -37.486 1.00 62.79  ? 458  PRO B CA  1 
ATOM   7710 C C   . PRO B 1 458 ? -14.188 3.821   -38.080 1.00 64.77  ? 458  PRO B C   1 
ATOM   7711 O O   . PRO B 1 458 ? -15.254 3.532   -37.556 1.00 66.77  ? 458  PRO B O   1 
ATOM   7712 C CB  . PRO B 1 458 ? -12.500 3.981   -36.199 1.00 62.00  ? 458  PRO B CB  1 
ATOM   7713 C CG  . PRO B 1 458 ? -11.008 3.819   -36.126 1.00 60.22  ? 458  PRO B CG  1 
ATOM   7714 C CD  . PRO B 1 458 ? -10.556 3.945   -37.530 1.00 59.40  ? 458  PRO B CD  1 
ATOM   7715 N N   . LEU B 1 459 ? -14.105 4.612   -39.148 1.00 65.23  ? 459  LEU B N   1 
ATOM   7716 C CA  . LEU B 1 459 ? -15.293 5.156   -39.812 1.00 67.52  ? 459  LEU B CA  1 
ATOM   7717 C C   . LEU B 1 459 ? -16.007 4.113   -40.682 1.00 69.43  ? 459  LEU B C   1 
ATOM   7718 O O   . LEU B 1 459 ? -17.153 4.308   -41.087 1.00 71.06  ? 459  LEU B O   1 
ATOM   7719 C CB  . LEU B 1 459 ? -14.928 6.393   -40.647 1.00 66.89  ? 459  LEU B CB  1 
ATOM   7720 C CG  . LEU B 1 459 ? -14.736 7.723   -39.901 1.00 66.35  ? 459  LEU B CG  1 
ATOM   7721 C CD1 . LEU B 1 459 ? -13.564 7.698   -38.918 1.00 63.93  ? 459  LEU B CD1 1 
ATOM   7722 C CD2 . LEU B 1 459 ? -14.544 8.827   -40.919 1.00 66.33  ? 459  LEU B CD2 1 
ATOM   7723 N N   . ASP B 1 460 ? -15.320 3.011   -40.966 1.00 69.86  ? 460  ASP B N   1 
ATOM   7724 C CA  . ASP B 1 460 ? -15.913 1.870   -41.666 1.00 71.57  ? 460  ASP B CA  1 
ATOM   7725 C C   . ASP B 1 460 ? -16.549 0.934   -40.634 1.00 73.38  ? 460  ASP B C   1 
ATOM   7726 O O   . ASP B 1 460 ? -15.833 0.251   -39.889 1.00 72.31  ? 460  ASP B O   1 
ATOM   7727 C CB  . ASP B 1 460 ? -14.835 1.127   -42.461 1.00 70.39  ? 460  ASP B CB  1 
ATOM   7728 C CG  . ASP B 1 460 ? -15.386 -0.063  -43.246 1.00 72.73  ? 460  ASP B CG  1 
ATOM   7729 O OD1 . ASP B 1 460 ? -16.617 -0.299  -43.229 1.00 74.69  ? 460  ASP B OD1 1 
ATOM   7730 O OD2 . ASP B 1 460 ? -14.570 -0.766  -43.881 1.00 73.07  ? 460  ASP B OD2 1 
ATOM   7731 N N   . PRO B 1 461 ? -17.898 0.878   -40.603 1.00 75.98  ? 461  PRO B N   1 
ATOM   7732 C CA  . PRO B 1 461 ? -18.588 0.114   -39.554 1.00 77.70  ? 461  PRO B CA  1 
ATOM   7733 C C   . PRO B 1 461 ? -18.412 -1.410  -39.667 1.00 78.16  ? 461  PRO B C   1 
ATOM   7734 O O   . PRO B 1 461 ? -18.537 -2.121  -38.664 1.00 78.95  ? 461  PRO B O   1 
ATOM   7735 C CB  . PRO B 1 461 ? -20.061 0.521   -39.722 1.00 79.82  ? 461  PRO B CB  1 
ATOM   7736 C CG  . PRO B 1 461 ? -20.182 0.962   -41.128 1.00 79.93  ? 461  PRO B CG  1 
ATOM   7737 C CD  . PRO B 1 461 ? -18.844 1.496   -41.554 1.00 77.24  ? 461  PRO B CD  1 
ATOM   7738 N N   . SER B 1 462 ? -18.094 -1.904  -40.858 1.00 77.75  ? 462  SER B N   1 
ATOM   7739 C CA  . SER B 1 462 ? -17.813 -3.331  -41.029 1.00 78.33  ? 462  SER B CA  1 
ATOM   7740 C C   . SER B 1 462 ? -16.608 -3.823  -40.211 1.00 76.88  ? 462  SER B C   1 
ATOM   7741 O O   . SER B 1 462 ? -16.445 -5.032  -40.024 1.00 77.76  ? 462  SER B O   1 
ATOM   7742 C CB  . SER B 1 462 ? -17.585 -3.654  -42.508 1.00 78.12  ? 462  SER B CB  1 
ATOM   7743 O OG  . SER B 1 462 ? -16.425 -3.011  -42.997 1.00 76.47  ? 462  SER B OG  1 
ATOM   7744 N N   . LEU B 1 463 ? -15.776 -2.897  -39.731 1.00 74.78  ? 463  LEU B N   1 
ATOM   7745 C CA  . LEU B 1 463 ? -14.550 -3.240  -39.007 1.00 73.27  ? 463  LEU B CA  1 
ATOM   7746 C C   . LEU B 1 463 ? -14.732 -3.396  -37.496 1.00 73.79  ? 463  LEU B C   1 
ATOM   7747 O O   . LEU B 1 463 ? -13.808 -3.843  -36.815 1.00 73.65  ? 463  LEU B O   1 
ATOM   7748 C CB  . LEU B 1 463 ? -13.466 -2.190  -39.278 1.00 70.91  ? 463  LEU B CB  1 
ATOM   7749 C CG  . LEU B 1 463 ? -13.016 -2.009  -40.733 1.00 69.73  ? 463  LEU B CG  1 
ATOM   7750 C CD1 . LEU B 1 463 ? -11.865 -1.027  -40.791 1.00 67.06  ? 463  LEU B CD1 1 
ATOM   7751 C CD2 . LEU B 1 463 ? -12.610 -3.344  -41.368 1.00 69.47  ? 463  LEU B CD2 1 
ATOM   7752 N N   . ASN B 1 464 ? -15.886 -2.995  -36.972 1.00 74.72  ? 464  ASN B N   1 
ATOM   7753 C CA  . ASN B 1 464 ? -16.250 -3.254  -35.573 1.00 75.70  ? 464  ASN B CA  1 
ATOM   7754 C C   . ASN B 1 464 ? -15.505 -2.479  -34.494 1.00 74.02  ? 464  ASN B C   1 
ATOM   7755 O O   . ASN B 1 464 ? -15.376 -2.958  -33.360 1.00 74.85  ? 464  ASN B O   1 
ATOM   7756 C CB  . ASN B 1 464 ? -16.143 -4.753  -35.254 1.00 77.10  ? 464  ASN B CB  1 
ATOM   7757 C CG  . ASN B 1 464 ? -17.072 -5.587  -36.097 1.00 79.35  ? 464  ASN B CG  1 
ATOM   7758 O OD1 . ASN B 1 464 ? -18.233 -5.219  -36.305 1.00 81.31  ? 464  ASN B OD1 1 
ATOM   7759 N ND2 . ASN B 1 464 ? -16.572 -6.716  -36.592 1.00 80.43  ? 464  ASN B ND2 1 
ATOM   7760 N N   . TYR B 1 465 ? -15.034 -1.281  -34.823 1.00 71.67  ? 465  TYR B N   1 
ATOM   7761 C CA  . TYR B 1 465 ? -14.563 -0.358  -33.794 1.00 70.00  ? 465  TYR B CA  1 
ATOM   7762 C C   . TYR B 1 465 ? -15.783 0.212   -33.073 1.00 71.29  ? 465  TYR B C   1 
ATOM   7763 O O   . TYR B 1 465 ? -16.894 0.167   -33.599 1.00 72.56  ? 465  TYR B O   1 
ATOM   7764 C CB  . TYR B 1 465 ? -13.772 0.790   -34.412 1.00 67.90  ? 465  TYR B CB  1 
ATOM   7765 C CG  . TYR B 1 465 ? -12.439 0.423   -35.004 1.00 65.19  ? 465  TYR B CG  1 
ATOM   7766 C CD1 . TYR B 1 465 ? -11.280 0.465   -34.233 1.00 64.04  ? 465  TYR B CD1 1 
ATOM   7767 C CD2 . TYR B 1 465 ? -12.326 0.086   -36.339 1.00 64.64  ? 465  TYR B CD2 1 
ATOM   7768 C CE1 . TYR B 1 465 ? -10.046 0.152   -34.773 1.00 62.52  ? 465  TYR B CE1 1 
ATOM   7769 C CE2 . TYR B 1 465 ? -11.097 -0.227  -36.898 1.00 63.94  ? 465  TYR B CE2 1 
ATOM   7770 C CZ  . TYR B 1 465 ? -9.959  -0.187  -36.110 1.00 63.20  ? 465  TYR B CZ  1 
ATOM   7771 O OH  . TYR B 1 465 ? -8.747  -0.488  -36.664 1.00 61.30  ? 465  TYR B OH  1 
ATOM   7772 N N   . THR B 1 466 ? -15.571 0.764   -31.882 1.00 70.85  ? 466  THR B N   1 
ATOM   7773 C CA  . THR B 1 466 ? -16.653 1.373   -31.120 1.00 71.99  ? 466  THR B CA  1 
ATOM   7774 C C   . THR B 1 466 ? -17.004 2.759   -31.664 1.00 71.98  ? 466  THR B C   1 
ATOM   7775 O O   . THR B 1 466 ? -16.278 3.328   -32.484 1.00 70.51  ? 466  THR B O   1 
ATOM   7776 C CB  . THR B 1 466 ? -16.292 1.510   -29.621 1.00 72.06  ? 466  THR B CB  1 
ATOM   7777 O OG1 . THR B 1 466 ? -15.186 2.411   -29.466 1.00 69.19  ? 466  THR B OG1 1 
ATOM   7778 C CG2 . THR B 1 466 ? -15.947 0.154   -29.017 1.00 71.68  ? 466  THR B CG2 1 
ATOM   7779 N N   . THR B 1 467 ? -18.121 3.292   -31.181 1.00 73.42  ? 467  THR B N   1 
ATOM   7780 C CA  . THR B 1 467 ? -18.601 4.620   -31.548 1.00 73.66  ? 467  THR B CA  1 
ATOM   7781 C C   . THR B 1 467 ? -17.639 5.722   -31.120 1.00 72.13  ? 467  THR B C   1 
ATOM   7782 O O   . THR B 1 467 ? -17.426 6.685   -31.857 1.00 71.14  ? 467  THR B O   1 
ATOM   7783 C CB  . THR B 1 467 ? -19.969 4.892   -30.891 1.00 75.91  ? 467  THR B CB  1 
ATOM   7784 O OG1 . THR B 1 467 ? -20.931 3.969   -31.414 1.00 77.93  ? 467  THR B OG1 1 
ATOM   7785 C CG2 . THR B 1 467 ? -20.437 6.319   -31.146 1.00 75.97  ? 467  THR B CG2 1 
ATOM   7786 N N   . GLU B 1 468 ? -17.088 5.580   -29.917 1.00 71.84  ? 468  GLU B N   1 
ATOM   7787 C CA  . GLU B 1 468 ? -16.124 6.542   -29.377 1.00 70.76  ? 468  GLU B CA  1 
ATOM   7788 C C   . GLU B 1 468 ? -14.796 6.493   -30.150 1.00 68.06  ? 468  GLU B C   1 
ATOM   7789 O O   . GLU B 1 468 ? -14.120 7.515   -30.288 1.00 66.15  ? 468  GLU B O   1 
ATOM   7790 C CB  . GLU B 1 468 ? -15.899 6.354   -27.855 1.00 71.73  ? 468  GLU B CB  1 
ATOM   7791 C CG  . GLU B 1 468 ? -16.118 4.925   -27.280 1.00 75.10  ? 468  GLU B CG  1 
ATOM   7792 C CD  . GLU B 1 468 ? -17.594 4.626   -26.952 1.00 80.58  ? 468  GLU B CD  1 
ATOM   7793 O OE1 . GLU B 1 468 ? -18.187 5.414   -26.183 1.00 85.01  ? 468  GLU B OE1 1 
ATOM   7794 O OE2 . GLU B 1 468 ? -18.162 3.613   -27.447 1.00 82.17  ? 468  GLU B OE2 1 
ATOM   7795 N N   . GLU B 1 469 ? -14.449 5.313   -30.671 1.00 67.19  ? 469  GLU B N   1 
ATOM   7796 C CA  . GLU B 1 469 ? -13.257 5.151   -31.513 1.00 65.35  ? 469  GLU B CA  1 
ATOM   7797 C C   . GLU B 1 469 ? -13.391 5.854   -32.869 1.00 64.77  ? 469  GLU B C   1 
ATOM   7798 O O   . GLU B 1 469 ? -12.405 6.341   -33.427 1.00 63.94  ? 469  GLU B O   1 
ATOM   7799 C CB  . GLU B 1 469 ? -12.925 3.672   -31.698 1.00 65.15  ? 469  GLU B CB  1 
ATOM   7800 C CG  . GLU B 1 469 ? -12.169 3.107   -30.510 1.00 65.42  ? 469  GLU B CG  1 
ATOM   7801 C CD  . GLU B 1 469 ? -11.883 1.611   -30.607 1.00 66.17  ? 469  GLU B CD  1 
ATOM   7802 O OE1 . GLU B 1 469 ? -12.739 0.866   -31.130 1.00 66.44  ? 469  GLU B OE1 1 
ATOM   7803 O OE2 . GLU B 1 469 ? -10.798 1.184   -30.133 1.00 65.87  ? 469  GLU B OE2 1 
ATOM   7804 N N   . ARG B 1 470 ? -14.614 5.923   -33.369 1.00 65.83  ? 470  ARG B N   1 
ATOM   7805 C CA  . ARG B 1 470 ? -14.930 6.625   -34.601 1.00 65.81  ? 470  ARG B CA  1 
ATOM   7806 C C   . ARG B 1 470 ? -14.814 8.144   -34.393 1.00 64.74  ? 470  ARG B C   1 
ATOM   7807 O O   . ARG B 1 470 ? -14.186 8.840   -35.183 1.00 63.81  ? 470  ARG B O   1 
ATOM   7808 C CB  . ARG B 1 470 ? -16.339 6.212   -35.051 1.00 67.98  ? 470  ARG B CB  1 
ATOM   7809 C CG  . ARG B 1 470 ? -16.706 6.538   -36.482 1.00 70.95  ? 470  ARG B CG  1 
ATOM   7810 C CD  . ARG B 1 470 ? -17.681 7.714   -36.569 1.00 76.15  ? 470  ARG B CD  1 
ATOM   7811 N NE  . ARG B 1 470 ? -18.963 7.413   -35.920 1.00 81.02  ? 470  ARG B NE  1 
ATOM   7812 C CZ  . ARG B 1 470 ? -19.782 8.319   -35.374 1.00 83.67  ? 470  ARG B CZ  1 
ATOM   7813 N NH1 . ARG B 1 470 ? -19.481 9.617   -35.386 1.00 84.05  ? 470  ARG B NH1 1 
ATOM   7814 N NH2 . ARG B 1 470 ? -20.916 7.922   -34.802 1.00 86.07  ? 470  ARG B NH2 1 
ATOM   7815 N N   . ILE B 1 471 ? -15.392 8.650   -33.310 1.00 64.85  ? 471  ILE B N   1 
ATOM   7816 C CA  . ILE B 1 471 ? -15.302 10.083  -32.970 1.00 64.46  ? 471  ILE B CA  1 
ATOM   7817 C C   . ILE B 1 471 ? -13.847 10.523  -32.768 1.00 61.80  ? 471  ILE B C   1 
ATOM   7818 O O   . ILE B 1 471 ? -13.460 11.608  -33.184 1.00 61.25  ? 471  ILE B O   1 
ATOM   7819 C CB  . ILE B 1 471 ? -16.118 10.403  -31.686 1.00 66.02  ? 471  ILE B CB  1 
ATOM   7820 C CG1 . ILE B 1 471 ? -17.616 10.167  -31.926 1.00 68.49  ? 471  ILE B CG1 1 
ATOM   7821 C CG2 . ILE B 1 471 ? -15.853 11.841  -31.199 1.00 65.80  ? 471  ILE B CG2 1 
ATOM   7822 C CD1 . ILE B 1 471 ? -18.412 9.913   -30.630 1.00 71.10  ? 471  ILE B CD1 1 
ATOM   7823 N N   . PHE B 1 472 ? -13.065 9.657   -32.130 1.00 60.48  ? 472  PHE B N   1 
ATOM   7824 C CA  . PHE B 1 472 ? -11.624 9.844   -31.900 1.00 58.50  ? 472  PHE B CA  1 
ATOM   7825 C C   . PHE B 1 472 ? -10.828 9.890   -33.206 1.00 57.34  ? 472  PHE B C   1 
ATOM   7826 O O   . PHE B 1 472 ? -9.972  10.763  -33.388 1.00 55.91  ? 472  PHE B O   1 
ATOM   7827 C CB  . PHE B 1 472 ? -11.122 8.683   -31.020 1.00 58.06  ? 472  PHE B CB  1 
ATOM   7828 C CG  . PHE B 1 472 ? -9.647  8.727   -30.680 1.00 56.48  ? 472  PHE B CG  1 
ATOM   7829 C CD1 . PHE B 1 472 ? -9.064  9.872   -30.163 1.00 55.62  ? 472  PHE B CD1 1 
ATOM   7830 C CD2 . PHE B 1 472 ? -8.869  7.587   -30.813 1.00 55.18  ? 472  PHE B CD2 1 
ATOM   7831 C CE1 . PHE B 1 472 ? -7.707  9.900   -29.836 1.00 54.69  ? 472  PHE B CE1 1 
ATOM   7832 C CE2 . PHE B 1 472 ? -7.520  7.588   -30.476 1.00 53.88  ? 472  PHE B CE2 1 
ATOM   7833 C CZ  . PHE B 1 472 ? -6.936  8.746   -29.980 1.00 54.30  ? 472  PHE B CZ  1 
ATOM   7834 N N   . ALA B 1 473 ? -11.096 8.930   -34.095 1.00 57.23  ? 473  ALA B N   1 
ATOM   7835 C CA  . ALA B 1 473 ? -10.439 8.873   -35.400 1.00 56.55  ? 473  ALA B CA  1 
ATOM   7836 C C   . ALA B 1 473 ? -10.666 10.177  -36.150 1.00 57.06  ? 473  ALA B C   1 
ATOM   7837 O O   . ALA B 1 473 ? -9.727  10.762  -36.703 1.00 56.76  ? 473  ALA B O   1 
ATOM   7838 C CB  . ALA B 1 473 ? -10.950 7.679   -36.219 1.00 56.81  ? 473  ALA B CB  1 
ATOM   7839 N N   . GLN B 1 474 ? -11.909 10.647  -36.137 1.00 58.89  ? 474  GLN B N   1 
ATOM   7840 C CA  . GLN B 1 474 ? -12.275 11.898  -36.796 1.00 59.77  ? 474  GLN B CA  1 
ATOM   7841 C C   . GLN B 1 474 ? -11.525 13.112  -36.234 1.00 58.99  ? 474  GLN B C   1 
ATOM   7842 O O   . GLN B 1 474 ? -11.149 14.013  -36.985 1.00 58.53  ? 474  GLN B O   1 
ATOM   7843 C CB  . GLN B 1 474 ? -13.786 12.108  -36.701 1.00 61.72  ? 474  GLN B CB  1 
ATOM   7844 C CG  . GLN B 1 474 ? -14.563 11.137  -37.563 1.00 64.00  ? 474  GLN B CG  1 
ATOM   7845 C CD  . GLN B 1 474 ? -16.071 11.274  -37.408 1.00 67.00  ? 474  GLN B CD  1 
ATOM   7846 O OE1 . GLN B 1 474 ? -16.595 11.266  -36.303 1.00 69.69  ? 474  GLN B OE1 1 
ATOM   7847 N NE2 . GLN B 1 474 ? -16.770 11.388  -38.526 1.00 69.66  ? 474  GLN B NE2 1 
ATOM   7848 N N   . ARG B 1 475 ? -11.319 13.127  -34.919 1.00 59.06  ? 475  ARG B N   1 
ATOM   7849 C CA  . ARG B 1 475 ? -10.508 14.156  -34.275 1.00 58.78  ? 475  ARG B CA  1 
ATOM   7850 C C   . ARG B 1 475 ? -9.077  14.148  -34.797 1.00 56.91  ? 475  ARG B C   1 
ATOM   7851 O O   . ARG B 1 475 ? -8.532  15.201  -35.117 1.00 56.80  ? 475  ARG B O   1 
ATOM   7852 C CB  . ARG B 1 475 ? -10.483 13.987  -32.751 1.00 59.18  ? 475  ARG B CB  1 
ATOM   7853 C CG  . ARG B 1 475 ? -11.703 14.524  -32.019 1.00 62.65  ? 475  ARG B CG  1 
ATOM   7854 C CD  . ARG B 1 475 ? -11.617 14.274  -30.488 1.00 63.81  ? 475  ARG B CD  1 
ATOM   7855 N NE  . ARG B 1 475 ? -10.318 14.700  -29.967 1.00 62.46  ? 475  ARG B NE  1 
ATOM   7856 C CZ  . ARG B 1 475 ? -9.637  14.106  -28.988 1.00 61.12  ? 475  ARG B CZ  1 
ATOM   7857 N NH1 . ARG B 1 475 ? -10.108 13.029  -28.371 1.00 60.88  ? 475  ARG B NH1 1 
ATOM   7858 N NH2 . ARG B 1 475 ? -8.456  14.596  -28.635 1.00 59.46  ? 475  ARG B NH2 1 
ATOM   7859 N N   . LEU B 1 476 ? -8.478  12.966  -34.883 1.00 55.92  ? 476  LEU B N   1 
ATOM   7860 C CA  . LEU B 1 476 ? -7.078  12.835  -35.320 1.00 54.49  ? 476  LEU B CA  1 
ATOM   7861 C C   . LEU B 1 476 ? -6.877  13.203  -36.790 1.00 53.98  ? 476  LEU B C   1 
ATOM   7862 O O   . LEU B 1 476 ? -5.924  13.894  -37.141 1.00 53.17  ? 476  LEU B O   1 
ATOM   7863 C CB  . LEU B 1 476 ? -6.575  11.411  -35.082 1.00 54.15  ? 476  LEU B CB  1 
ATOM   7864 C CG  . LEU B 1 476 ? -6.578  10.953  -33.625 1.00 54.81  ? 476  LEU B CG  1 
ATOM   7865 C CD1 . LEU B 1 476 ? -6.130  9.513   -33.557 1.00 57.40  ? 476  LEU B CD1 1 
ATOM   7866 C CD2 . LEU B 1 476 ? -5.708  11.823  -32.770 1.00 55.91  ? 476  LEU B CD2 1 
ATOM   7867 N N   . MET B 1 477 ? -7.786  12.735  -37.639 1.00 54.48  ? 477  MET B N   1 
ATOM   7868 C CA  . MET B 1 477 ? -7.815  13.108  -39.040 1.00 54.44  ? 477  MET B CA  1 
ATOM   7869 C C   . MET B 1 477 ? -7.836  14.619  -39.194 1.00 54.41  ? 477  MET B C   1 
ATOM   7870 O O   . MET B 1 477 ? -7.256  15.152  -40.123 1.00 53.84  ? 477  MET B O   1 
ATOM   7871 C CB  . MET B 1 477 ? -9.050  12.503  -39.734 1.00 55.45  ? 477  MET B CB  1 
ATOM   7872 C CG  . MET B 1 477 ? -9.023  10.960  -39.950 1.00 55.72  ? 477  MET B CG  1 
ATOM   7873 S SD  . MET B 1 477 ? -10.626 10.338  -40.577 1.00 58.58  ? 477  MET B SD  1 
ATOM   7874 C CE  . MET B 1 477 ? -10.546 10.875  -42.268 1.00 54.44  ? 477  MET B CE  1 
ATOM   7875 N N   . LYS B 1 478 ? -8.522  15.314  -38.293 1.00 55.95  ? 478  LYS B N   1 
ATOM   7876 C CA  . LYS B 1 478 ? -8.568  16.784  -38.341 1.00 56.51  ? 478  LYS B CA  1 
ATOM   7877 C C   . LYS B 1 478 ? -7.272  17.427  -37.877 1.00 54.80  ? 478  LYS B C   1 
ATOM   7878 O O   . LYS B 1 478 ? -6.866  18.432  -38.450 1.00 54.80  ? 478  LYS B O   1 
ATOM   7879 C CB  . LYS B 1 478 ? -9.723  17.354  -37.514 1.00 58.33  ? 478  LYS B CB  1 
ATOM   7880 C CG  . LYS B 1 478 ? -10.994 17.579  -38.330 1.00 63.26  ? 478  LYS B CG  1 
ATOM   7881 C CD  . LYS B 1 478 ? -11.618 18.958  -38.087 1.00 67.62  ? 478  LYS B CD  1 
ATOM   7882 C CE  . LYS B 1 478 ? -12.649 19.292  -39.179 1.00 71.27  ? 478  LYS B CE  1 
ATOM   7883 N NZ  . LYS B 1 478 ? -12.096 19.194  -40.594 1.00 71.01  ? 478  LYS B NZ  1 
ATOM   7884 N N   . TYR B 1 479 ? -6.650  16.887  -36.829 1.00 53.21  ? 479  TYR B N   1 
ATOM   7885 C CA  . TYR B 1 479 ? -5.388  17.445  -36.342 1.00 51.88  ? 479  TYR B CA  1 
ATOM   7886 C C   . TYR B 1 479 ? -4.365  17.382  -37.471 1.00 50.72  ? 479  TYR B C   1 
ATOM   7887 O O   . TYR B 1 479 ? -3.769  18.394  -37.848 1.00 50.69  ? 479  TYR B O   1 
ATOM   7888 C CB  . TYR B 1 479 ? -4.854  16.683  -35.119 1.00 51.32  ? 479  TYR B CB  1 
ATOM   7889 C CG  . TYR B 1 479 ? -5.613  16.877  -33.821 1.00 51.61  ? 479  TYR B CG  1 
ATOM   7890 C CD1 . TYR B 1 479 ? -6.124  18.112  -33.447 1.00 53.49  ? 479  TYR B CD1 1 
ATOM   7891 C CD2 . TYR B 1 479 ? -5.788  15.815  -32.946 1.00 52.67  ? 479  TYR B CD2 1 
ATOM   7892 C CE1 . TYR B 1 479 ? -6.829  18.270  -32.247 1.00 53.83  ? 479  TYR B CE1 1 
ATOM   7893 C CE2 . TYR B 1 479 ? -6.488  15.961  -31.752 1.00 52.81  ? 479  TYR B CE2 1 
ATOM   7894 C CZ  . TYR B 1 479 ? -7.003  17.186  -31.412 1.00 53.68  ? 479  TYR B CZ  1 
ATOM   7895 O OH  . TYR B 1 479 ? -7.689  17.309  -30.230 1.00 54.57  ? 479  TYR B OH  1 
ATOM   7896 N N   . TRP B 1 480 ? -4.202  16.181  -38.026 1.00 49.68  ? 480  TRP B N   1 
ATOM   7897 C CA  . TRP B 1 480 ? -3.267  15.921  -39.124 1.00 48.02  ? 480  TRP B CA  1 
ATOM   7898 C C   . TRP B 1 480 ? -3.527  16.751  -40.379 1.00 48.23  ? 480  TRP B C   1 
ATOM   7899 O O   . TRP B 1 480 ? -2.584  17.298  -40.958 1.00 47.58  ? 480  TRP B O   1 
ATOM   7900 C CB  . TRP B 1 480 ? -3.265  14.429  -39.479 1.00 48.10  ? 480  TRP B CB  1 
ATOM   7901 C CG  . TRP B 1 480 ? -2.182  13.603  -38.814 1.00 47.03  ? 480  TRP B CG  1 
ATOM   7902 C CD1 . TRP B 1 480 ? -1.201  12.900  -39.444 1.00 47.15  ? 480  TRP B CD1 1 
ATOM   7903 C CD2 . TRP B 1 480 ? -1.989  13.382  -37.406 1.00 47.09  ? 480  TRP B CD2 1 
ATOM   7904 N NE1 . TRP B 1 480 ? -0.409  12.258  -38.525 1.00 46.57  ? 480  TRP B NE1 1 
ATOM   7905 C CE2 . TRP B 1 480 ? -0.873  12.533  -37.268 1.00 46.02  ? 480  TRP B CE2 1 
ATOM   7906 C CE3 . TRP B 1 480 ? -2.655  13.812  -36.252 1.00 48.03  ? 480  TRP B CE3 1 
ATOM   7907 C CZ2 . TRP B 1 480 ? -0.398  12.114  -36.028 1.00 45.50  ? 480  TRP B CZ2 1 
ATOM   7908 C CZ3 . TRP B 1 480 ? -2.176  13.399  -35.015 1.00 47.98  ? 480  TRP B CZ3 1 
ATOM   7909 C CH2 . TRP B 1 480 ? -1.063  12.548  -34.918 1.00 46.98  ? 480  TRP B CH2 1 
ATOM   7910 N N   . THR B 1 481 ? -4.786  16.863  -40.807 1.00 48.81  ? 481  THR B N   1 
ATOM   7911 C CA  . THR B 1 481 ? -5.085  17.650  -42.001 1.00 49.08  ? 481  THR B CA  1 
ATOM   7912 C C   . THR B 1 481 ? -5.023  19.151  -41.728 1.00 49.74  ? 481  THR B C   1 
ATOM   7913 O O   . THR B 1 481 ? -4.611  19.908  -42.593 1.00 49.68  ? 481  THR B O   1 
ATOM   7914 C CB  . THR B 1 481 ? -6.415  17.236  -42.667 1.00 50.15  ? 481  THR B CB  1 
ATOM   7915 O OG1 . THR B 1 481 ? -7.479  17.340  -41.720 1.00 52.66  ? 481  THR B OG1 1 
ATOM   7916 C CG2 . THR B 1 481 ? -6.333  15.779  -43.197 1.00 48.66  ? 481  THR B CG2 1 
ATOM   7917 N N   . ASN B 1 482 ? -5.418  19.589  -40.532 1.00 50.76  ? 482  ASN B N   1 
ATOM   7918 C CA  . ASN B 1 482 ? -5.198  20.995  -40.109 1.00 51.07  ? 482  ASN B CA  1 
ATOM   7919 C C   . ASN B 1 482 ? -3.723  21.326  -40.149 1.00 49.86  ? 482  ASN B C   1 
ATOM   7920 O O   . ASN B 1 482 ? -3.337  22.363  -40.670 1.00 50.43  ? 482  ASN B O   1 
ATOM   7921 C CB  . ASN B 1 482 ? -5.691  21.270  -38.690 1.00 51.61  ? 482  ASN B CB  1 
ATOM   7922 C CG  . ASN B 1 482 ? -7.197  21.507  -38.610 1.00 53.44  ? 482  ASN B CG  1 
ATOM   7923 O OD1 . ASN B 1 482 ? -7.849  21.865  -39.586 1.00 54.53  ? 482  ASN B OD1 1 
ATOM   7924 N ND2 . ASN B 1 482 ? -7.741  21.330  -37.419 1.00 55.15  ? 482  ASN B ND2 1 
ATOM   7925 N N   . PHE B 1 483 ? -2.901  20.448  -39.588 1.00 48.69  ? 483  PHE B N   1 
ATOM   7926 C CA  . PHE B 1 483 ? -1.448  20.639  -39.651 1.00 48.19  ? 483  PHE B CA  1 
ATOM   7927 C C   . PHE B 1 483 ? -0.979  20.713  -41.127 1.00 48.59  ? 483  PHE B C   1 
ATOM   7928 O O   . PHE B 1 483 ? -0.200  21.595  -41.498 1.00 47.98  ? 483  PHE B O   1 
ATOM   7929 C CB  . PHE B 1 483 ? -0.712  19.519  -38.900 1.00 47.14  ? 483  PHE B CB  1 
ATOM   7930 C CG  . PHE B 1 483 ? 0.790   19.600  -39.015 1.00 46.01  ? 483  PHE B CG  1 
ATOM   7931 C CD1 . PHE B 1 483 ? 1.512   20.522  -38.264 1.00 47.46  ? 483  PHE B CD1 1 
ATOM   7932 C CD2 . PHE B 1 483 ? 1.473   18.781  -39.886 1.00 46.70  ? 483  PHE B CD2 1 
ATOM   7933 C CE1 . PHE B 1 483 ? 2.884   20.615  -38.388 1.00 47.55  ? 483  PHE B CE1 1 
ATOM   7934 C CE2 . PHE B 1 483 ? 2.863   18.847  -40.003 1.00 46.14  ? 483  PHE B CE2 1 
ATOM   7935 C CZ  . PHE B 1 483 ? 3.566   19.759  -39.264 1.00 45.18  ? 483  PHE B CZ  1 
ATOM   7936 N N   . ALA B 1 484 ? -1.466  19.795  -41.963 1.00 49.22  ? 484  ALA B N   1 
ATOM   7937 C CA  . ALA B 1 484 ? -1.128  19.814  -43.389 1.00 50.13  ? 484  ALA B CA  1 
ATOM   7938 C C   . ALA B 1 484 ? -1.489  21.148  -44.047 1.00 52.09  ? 484  ALA B C   1 
ATOM   7939 O O   . ALA B 1 484 ? -0.672  21.718  -44.773 1.00 52.01  ? 484  ALA B O   1 
ATOM   7940 C CB  . ALA B 1 484 ? -1.778  18.617  -44.139 1.00 49.55  ? 484  ALA B CB  1 
ATOM   7941 N N   . ARG B 1 485 ? -2.693  21.649  -43.761 1.00 54.00  ? 485  ARG B N   1 
ATOM   7942 C CA  . ARG B 1 485 ? -3.192  22.910  -44.318 1.00 56.64  ? 485  ARG B CA  1 
ATOM   7943 C C   . ARG B 1 485 ? -2.393  24.134  -43.900 1.00 56.37  ? 485  ARG B C   1 
ATOM   7944 O O   . ARG B 1 485 ? -2.132  25.008  -44.724 1.00 56.09  ? 485  ARG B O   1 
ATOM   7945 C CB  . ARG B 1 485 ? -4.645  23.163  -43.884 1.00 57.92  ? 485  ARG B CB  1 
ATOM   7946 C CG  . ARG B 1 485 ? -5.716  22.422  -44.670 1.00 60.98  ? 485  ARG B CG  1 
ATOM   7947 C CD  . ARG B 1 485 ? -7.159  22.856  -44.248 1.00 63.64  ? 485  ARG B CD  1 
ATOM   7948 N NE  . ARG B 1 485 ? -7.666  22.027  -43.143 1.00 67.98  ? 485  ARG B NE  1 
ATOM   7949 C CZ  . ARG B 1 485 ? -8.190  20.800  -43.279 1.00 70.57  ? 485  ARG B CZ  1 
ATOM   7950 N NH1 . ARG B 1 485 ? -8.317  20.239  -44.487 1.00 71.43  ? 485  ARG B NH1 1 
ATOM   7951 N NH2 . ARG B 1 485 ? -8.607  20.125  -42.196 1.00 70.13  ? 485  ARG B NH2 1 
ATOM   7952 N N   . THR B 1 486 ? -2.044  24.207  -42.615 1.00 56.07  ? 486  THR B N   1 
ATOM   7953 C CA  . THR B 1 486 ? -1.566  25.454  -42.011 1.00 56.80  ? 486  THR B CA  1 
ATOM   7954 C C   . THR B 1 486 ? -0.269  25.358  -41.210 1.00 55.80  ? 486  THR B C   1 
ATOM   7955 O O   . THR B 1 486 ? 0.311   26.387  -40.867 1.00 56.92  ? 486  THR B O   1 
ATOM   7956 C CB  . THR B 1 486 ? -2.643  26.038  -41.075 1.00 57.89  ? 486  THR B CB  1 
ATOM   7957 O OG1 . THR B 1 486 ? -2.869  25.142  -39.975 1.00 57.63  ? 486  THR B OG1 1 
ATOM   7958 C CG2 . THR B 1 486 ? -3.951  26.244  -41.828 1.00 58.95  ? 486  THR B CG2 1 
ATOM   7959 N N   . GLY B 1 487 ? 0.183   24.144  -40.904 1.00 53.97  ? 487  GLY B N   1 
ATOM   7960 C CA  . GLY B 1 487 ? 1.357   23.940  -40.046 1.00 52.63  ? 487  GLY B CA  1 
ATOM   7961 C C   . GLY B 1 487 ? 1.048   24.023  -38.554 1.00 52.54  ? 487  GLY B C   1 
ATOM   7962 O O   . GLY B 1 487 ? 1.973   24.082  -37.733 1.00 51.50  ? 487  GLY B O   1 
ATOM   7963 N N   . ASP B 1 488 ? -0.251  24.006  -38.227 1.00 52.33  ? 488  ASP B N   1 
ATOM   7964 C CA  . ASP B 1 488 ? -0.766  24.120  -36.875 1.00 52.54  ? 488  ASP B CA  1 
ATOM   7965 C C   . ASP B 1 488 ? -1.927  23.141  -36.774 1.00 52.79  ? 488  ASP B C   1 
ATOM   7966 O O   . ASP B 1 488 ? -2.887  23.272  -37.513 1.00 53.30  ? 488  ASP B O   1 
ATOM   7967 C CB  . ASP B 1 488 ? -1.245  25.558  -36.655 1.00 53.64  ? 488  ASP B CB  1 
ATOM   7968 C CG  . ASP B 1 488 ? -1.716  25.835  -35.236 1.00 53.72  ? 488  ASP B CG  1 
ATOM   7969 O OD1 . ASP B 1 488 ? -2.034  24.901  -34.478 1.00 52.42  ? 488  ASP B OD1 1 
ATOM   7970 O OD2 . ASP B 1 488 ? -1.797  27.024  -34.883 1.00 55.21  ? 488  ASP B OD2 1 
ATOM   7971 N N   . PRO B 1 489 ? -1.861  22.160  -35.858 1.00 53.12  ? 489  PRO B N   1 
ATOM   7972 C CA  . PRO B 1 489 ? -2.953  21.178  -35.821 1.00 53.91  ? 489  PRO B CA  1 
ATOM   7973 C C   . PRO B 1 489 ? -4.241  21.706  -35.200 1.00 56.21  ? 489  PRO B C   1 
ATOM   7974 O O   . PRO B 1 489 ? -5.245  21.005  -35.223 1.00 56.47  ? 489  PRO B O   1 
ATOM   7975 C CB  . PRO B 1 489 ? -2.376  20.042  -34.959 1.00 52.75  ? 489  PRO B CB  1 
ATOM   7976 C CG  . PRO B 1 489 ? -1.482  20.732  -34.021 1.00 52.79  ? 489  PRO B CG  1 
ATOM   7977 C CD  . PRO B 1 489 ? -0.861  21.883  -34.816 1.00 52.44  ? 489  PRO B CD  1 
ATOM   7978 N N   . ASN B 1 490 ? -4.215  22.913  -34.644 1.00 58.56  ? 490  ASN B N   1 
ATOM   7979 C CA  . ASN B 1 490 ? -5.401  23.494  -34.024 1.00 61.44  ? 490  ASN B CA  1 
ATOM   7980 C C   . ASN B 1 490 ? -6.424  23.976  -35.054 1.00 64.95  ? 490  ASN B C   1 
ATOM   7981 O O   . ASN B 1 490 ? -6.062  24.527  -36.096 1.00 64.90  ? 490  ASN B O   1 
ATOM   7982 C CB  . ASN B 1 490 ? -5.018  24.646  -33.098 1.00 61.30  ? 490  ASN B CB  1 
ATOM   7983 C CG  . ASN B 1 490 ? -4.231  24.181  -31.894 1.00 59.15  ? 490  ASN B CG  1 
ATOM   7984 O OD1 . ASN B 1 490 ? -4.764  23.498  -31.022 1.00 58.33  ? 490  ASN B OD1 1 
ATOM   7985 N ND2 . ASN B 1 490 ? -2.956  24.539  -31.841 1.00 53.41  ? 490  ASN B ND2 1 
ATOM   7986 N N   . ASP B 1 491 ? -7.700  23.777  -34.736 1.00 68.92  ? 491  ASP B N   1 
ATOM   7987 C CA  . ASP B 1 491 ? -8.793  24.154  -35.627 1.00 72.84  ? 491  ASP B CA  1 
ATOM   7988 C C   . ASP B 1 491 ? -8.934  25.675  -35.633 1.00 75.52  ? 491  ASP B C   1 
ATOM   7989 O O   . ASP B 1 491 ? -9.178  26.264  -34.582 1.00 76.79  ? 491  ASP B O   1 
ATOM   7990 C CB  . ASP B 1 491 ? -10.105 23.481  -35.183 1.00 74.26  ? 491  ASP B CB  1 
ATOM   7991 C CG  . ASP B 1 491 ? -11.077 23.250  -36.347 1.00 77.89  ? 491  ASP B CG  1 
ATOM   7992 O OD1 . ASP B 1 491 ? -11.671 24.243  -36.845 1.00 81.19  ? 491  ASP B OD1 1 
ATOM   7993 O OD2 . ASP B 1 491 ? -11.244 22.069  -36.757 1.00 80.47  ? 491  ASP B OD2 1 
ATOM   7994 N N   . PRO B 1 492 ? -8.774  26.316  -36.813 1.00 77.79  ? 492  PRO B N   1 
ATOM   7995 C CA  . PRO B 1 492 ? -8.691  27.790  -36.894 1.00 80.06  ? 492  PRO B CA  1 
ATOM   7996 C C   . PRO B 1 492 ? -9.945  28.584  -36.519 1.00 83.23  ? 492  PRO B C   1 
ATOM   7997 O O   . PRO B 1 492 ? -9.842  29.790  -36.295 1.00 84.18  ? 492  PRO B O   1 
ATOM   7998 C CB  . PRO B 1 492 ? -8.318  28.054  -38.363 1.00 80.13  ? 492  PRO B CB  1 
ATOM   7999 C CG  . PRO B 1 492 ? -8.712  26.817  -39.110 1.00 79.04  ? 492  PRO B CG  1 
ATOM   8000 C CD  . PRO B 1 492 ? -8.642  25.675  -38.140 1.00 77.26  ? 492  PRO B CD  1 
ATOM   8001 N N   . ARG B 1 493 ? -11.109 27.940  -36.453 1.00 85.43  ? 493  ARG B N   1 
ATOM   8002 C CA  . ARG B 1 493 ? -12.346 28.653  -36.105 1.00 88.90  ? 493  ARG B CA  1 
ATOM   8003 C C   . ARG B 1 493 ? -13.030 28.114  -34.831 1.00 90.03  ? 493  ARG B C   1 
ATOM   8004 O O   . ARG B 1 493 ? -13.790 28.842  -34.187 1.00 91.86  ? 493  ARG B O   1 
ATOM   8005 C CB  . ARG B 1 493 ? -13.319 28.652  -37.295 1.00 90.43  ? 493  ARG B CB  1 
ATOM   8006 C CG  . ARG B 1 493 ? -12.683 29.016  -38.668 1.00 91.22  ? 493  ARG B CG  1 
ATOM   8007 C CD  . ARG B 1 493 ? -12.468 30.530  -38.871 1.00 93.55  ? 493  ARG B CD  1 
ATOM   8008 N NE  . ARG B 1 493 ? -13.724 31.272  -38.761 1.00 95.79  ? 493  ARG B NE  1 
ATOM   8009 C CZ  . ARG B 1 493 ? -13.930 32.351  -38.004 1.00 97.84  ? 493  ARG B CZ  1 
ATOM   8010 N NH1 . ARG B 1 493 ? -12.960 32.900  -37.277 1.00 97.69  ? 493  ARG B NH1 1 
ATOM   8011 N NH2 . ARG B 1 493 ? -15.132 32.905  -37.985 1.00 100.42 ? 493  ARG B NH2 1 
ATOM   8012 N N   . ASP B 1 494 ? -12.766 26.854  -34.472 1.00 89.63  ? 494  ASP B N   1 
ATOM   8013 C CA  . ASP B 1 494 ? -13.217 26.293  -33.182 1.00 90.46  ? 494  ASP B CA  1 
ATOM   8014 C C   . ASP B 1 494 ? -12.529 27.028  -32.031 1.00 90.63  ? 494  ASP B C   1 
ATOM   8015 O O   . ASP B 1 494 ? -11.324 26.885  -31.846 1.00 88.92  ? 494  ASP B O   1 
ATOM   8016 C CB  . ASP B 1 494 ? -12.901 24.783  -33.103 1.00 89.06  ? 494  ASP B CB  1 
ATOM   8017 C CG  . ASP B 1 494 ? -12.988 24.217  -31.680 1.00 89.58  ? 494  ASP B CG  1 
ATOM   8018 O OD1 . ASP B 1 494 ? -13.943 24.557  -30.942 1.00 91.61  ? 494  ASP B OD1 1 
ATOM   8019 O OD2 . ASP B 1 494 ? -12.095 23.419  -31.305 1.00 89.12  ? 494  ASP B OD2 1 
ATOM   8020 N N   . SER B 1 495 ? -13.295 27.803  -31.266 1.00 92.87  ? 495  SER B N   1 
ATOM   8021 C CA  . SER B 1 495 ? -12.752 28.526  -30.112 1.00 93.50  ? 495  SER B CA  1 
ATOM   8022 C C   . SER B 1 495 ? -11.734 27.674  -29.349 1.00 92.28  ? 495  SER B C   1 
ATOM   8023 O O   . SER B 1 495 ? -10.518 27.818  -29.553 1.00 91.53  ? 495  SER B O   1 
ATOM   8024 C CB  . SER B 1 495 ? -13.865 28.984  -29.170 1.00 95.52  ? 495  SER B CB  1 
ATOM   8025 O OG  . SER B 1 495 ? -13.341 29.321  -27.891 1.00 95.09  ? 495  SER B OG  1 
ATOM   8026 N N   . LYS B 1 496 ? -12.215 26.766  -28.498 1.00 92.31  ? 496  LYS B N   1 
ATOM   8027 C CA  . LYS B 1 496 ? -11.307 26.006  -27.638 1.00 90.67  ? 496  LYS B CA  1 
ATOM   8028 C C   . LYS B 1 496 ? -11.433 24.494  -27.805 1.00 89.26  ? 496  LYS B C   1 
ATOM   8029 O O   . LYS B 1 496 ? -12.394 23.989  -28.403 1.00 89.93  ? 496  LYS B O   1 
ATOM   8030 C CB  . LYS B 1 496 ? -11.533 26.392  -26.177 1.00 91.76  ? 496  LYS B CB  1 
ATOM   8031 C CG  . LYS B 1 496 ? -10.309 26.217  -25.295 1.00 90.79  ? 496  LYS B CG  1 
ATOM   8032 C CD  . LYS B 1 496 ? -10.456 27.013  -24.020 1.00 92.95  ? 496  LYS B CD  1 
ATOM   8033 C CE  . LYS B 1 496 ? -9.325  26.713  -23.065 1.00 92.26  ? 496  LYS B CE  1 
ATOM   8034 N NZ  . LYS B 1 496 ? -9.576  25.465  -22.299 1.00 92.76  ? 496  LYS B NZ  1 
ATOM   8035 N N   . SER B 1 497 ? -10.428 23.791  -27.284 1.00 86.73  ? 497  SER B N   1 
ATOM   8036 C CA  . SER B 1 497 ? -10.479 22.341  -27.136 1.00 85.01  ? 497  SER B CA  1 
ATOM   8037 C C   . SER B 1 497 ? -9.413  21.861  -26.138 1.00 82.27  ? 497  SER B C   1 
ATOM   8038 O O   . SER B 1 497 ? -8.973  20.711  -26.209 1.00 81.89  ? 497  SER B O   1 
ATOM   8039 C CB  . SER B 1 497 ? -10.203 21.706  -28.506 1.00 84.47  ? 497  SER B CB  1 
ATOM   8040 O OG  . SER B 1 497 ? -8.816  21.841  -28.879 1.00 83.93  ? 497  SER B OG  1 
ATOM   8041 N N   . PRO B 1 498 ? -9.109  22.664  -25.108 1.00 80.29  ? 498  PRO B N   1 
ATOM   8042 C CA  . PRO B 1 498 ? -7.804  23.241  -24.900 1.00 77.18  ? 498  PRO B CA  1 
ATOM   8043 C C   . PRO B 1 498 ? -6.901  23.160  -26.130 1.00 72.63  ? 498  PRO B C   1 
ATOM   8044 O O   . PRO B 1 498 ? -6.880  22.155  -26.829 1.00 72.05  ? 498  PRO B O   1 
ATOM   8045 C CB  . PRO B 1 498 ? -7.319  22.473  -23.672 1.00 77.04  ? 498  PRO B CB  1 
ATOM   8046 C CG  . PRO B 1 498 ? -8.689  22.391  -22.818 1.00 79.94  ? 498  PRO B CG  1 
ATOM   8047 C CD  . PRO B 1 498 ? -9.841  22.734  -23.836 1.00 81.94  ? 498  PRO B CD  1 
ATOM   8048 N N   . GLN B 1 499 ? -6.200  24.253  -26.407 1.00 68.70  ? 499  GLN B N   1 
ATOM   8049 C CA  . GLN B 1 499 ? -5.368  24.344  -27.599 1.00 64.50  ? 499  GLN B CA  1 
ATOM   8050 C C   . GLN B 1 499 ? -4.137  23.444  -27.439 1.00 60.07  ? 499  GLN B C   1 
ATOM   8051 O O   . GLN B 1 499 ? -3.663  23.214  -26.334 1.00 58.85  ? 499  GLN B O   1 
ATOM   8052 C CB  . GLN B 1 499 ? -4.967  25.806  -27.870 1.00 64.91  ? 499  GLN B CB  1 
ATOM   8053 C CG  . GLN B 1 499 ? -6.141  26.756  -28.145 1.00 65.56  ? 499  GLN B CG  1 
ATOM   8054 C CD  . GLN B 1 499 ? -6.807  26.533  -29.497 1.00 65.71  ? 499  GLN B CD  1 
ATOM   8055 O OE1 . GLN B 1 499 ? -6.238  26.834  -30.542 1.00 64.64  ? 499  GLN B OE1 1 
ATOM   8056 N NE2 . GLN B 1 499 ? -8.034  26.019  -29.478 1.00 67.43  ? 499  GLN B NE2 1 
ATOM   8057 N N   . TRP B 1 500 ? -3.660  22.908  -28.555 1.00 55.89  ? 500  TRP B N   1 
ATOM   8058 C CA  . TRP B 1 500 ? -2.398  22.165  -28.605 1.00 52.64  ? 500  TRP B CA  1 
ATOM   8059 C C   . TRP B 1 500 ? -1.238  23.169  -28.762 1.00 51.03  ? 500  TRP B C   1 
ATOM   8060 O O   . TRP B 1 500 ? -1.090  23.752  -29.823 1.00 50.22  ? 500  TRP B O   1 
ATOM   8061 C CB  . TRP B 1 500 ? -2.448  21.223  -29.818 1.00 51.37  ? 500  TRP B CB  1 
ATOM   8062 C CG  . TRP B 1 500 ? -1.340  20.241  -29.972 1.00 49.12  ? 500  TRP B CG  1 
ATOM   8063 C CD1 . TRP B 1 500 ? -0.074  20.318  -29.460 1.00 48.64  ? 500  TRP B CD1 1 
ATOM   8064 C CD2 . TRP B 1 500 ? -1.389  19.043  -30.735 1.00 48.05  ? 500  TRP B CD2 1 
ATOM   8065 N NE1 . TRP B 1 500 ? 0.660   19.228  -29.846 1.00 47.04  ? 500  TRP B NE1 1 
ATOM   8066 C CE2 . TRP B 1 500 ? -0.124  18.430  -30.636 1.00 46.79  ? 500  TRP B CE2 1 
ATOM   8067 C CE3 . TRP B 1 500 ? -2.386  18.418  -31.496 1.00 48.38  ? 500  TRP B CE3 1 
ATOM   8068 C CZ2 . TRP B 1 500 ? 0.171   17.230  -31.266 1.00 46.60  ? 500  TRP B CZ2 1 
ATOM   8069 C CZ3 . TRP B 1 500 ? -2.099  17.223  -32.111 1.00 47.50  ? 500  TRP B CZ3 1 
ATOM   8070 C CH2 . TRP B 1 500 ? -0.826  16.638  -31.997 1.00 46.99  ? 500  TRP B CH2 1 
ATOM   8071 N N   . PRO B 1 501 ? -0.404  23.355  -27.718 1.00 49.80  ? 501  PRO B N   1 
ATOM   8072 C CA  . PRO B 1 501 ? 0.658   24.357  -27.816 1.00 49.44  ? 501  PRO B CA  1 
ATOM   8073 C C   . PRO B 1 501 ? 1.904   23.831  -28.525 1.00 48.35  ? 501  PRO B C   1 
ATOM   8074 O O   . PRO B 1 501 ? 2.144   22.609  -28.523 1.00 47.61  ? 501  PRO B O   1 
ATOM   8075 C CB  . PRO B 1 501 ? 0.976   24.663  -26.350 1.00 49.61  ? 501  PRO B CB  1 
ATOM   8076 C CG  . PRO B 1 501 ? 0.689   23.397  -25.630 1.00 49.21  ? 501  PRO B CG  1 
ATOM   8077 C CD  . PRO B 1 501 ? -0.362  22.654  -26.420 1.00 49.69  ? 501  PRO B CD  1 
ATOM   8078 N N   . PRO B 1 502 ? 2.690   24.729  -29.143 1.00 48.70  ? 502  PRO B N   1 
ATOM   8079 C CA  . PRO B 1 502 ? 3.972   24.293  -29.694 1.00 48.54  ? 502  PRO B CA  1 
ATOM   8080 C C   . PRO B 1 502 ? 4.923   23.742  -28.620 1.00 48.83  ? 502  PRO B C   1 
ATOM   8081 O O   . PRO B 1 502 ? 4.928   24.225  -27.474 1.00 49.90  ? 502  PRO B O   1 
ATOM   8082 C CB  . PRO B 1 502 ? 4.555   25.571  -30.307 1.00 49.13  ? 502  PRO B CB  1 
ATOM   8083 C CG  . PRO B 1 502 ? 3.409   26.494  -30.480 1.00 49.90  ? 502  PRO B CG  1 
ATOM   8084 C CD  . PRO B 1 502 ? 2.463   26.167  -29.365 1.00 49.80  ? 502  PRO B CD  1 
ATOM   8085 N N   . TYR B 1 503 ? 5.699   22.726  -28.994 1.00 48.44  ? 503  TYR B N   1 
ATOM   8086 C CA  . TYR B 1 503 ? 6.777   22.202  -28.160 1.00 48.91  ? 503  TYR B CA  1 
ATOM   8087 C C   . TYR B 1 503 ? 7.941   23.168  -28.226 1.00 49.72  ? 503  TYR B C   1 
ATOM   8088 O O   . TYR B 1 503 ? 8.347   23.554  -29.317 1.00 49.62  ? 503  TYR B O   1 
ATOM   8089 C CB  . TYR B 1 503 ? 7.226   20.821  -28.660 1.00 48.49  ? 503  TYR B CB  1 
ATOM   8090 C CG  . TYR B 1 503 ? 8.288   20.157  -27.802 1.00 49.17  ? 503  TYR B CG  1 
ATOM   8091 C CD1 . TYR B 1 503 ? 9.639   20.409  -28.015 1.00 50.15  ? 503  TYR B CD1 1 
ATOM   8092 C CD2 . TYR B 1 503 ? 7.941   19.258  -26.784 1.00 50.37  ? 503  TYR B CD2 1 
ATOM   8093 C CE1 . TYR B 1 503 ? 10.611  19.818  -27.229 1.00 50.34  ? 503  TYR B CE1 1 
ATOM   8094 C CE2 . TYR B 1 503 ? 8.911   18.650  -26.001 1.00 49.45  ? 503  TYR B CE2 1 
ATOM   8095 C CZ  . TYR B 1 503 ? 10.242  18.940  -26.225 1.00 50.51  ? 503  TYR B CZ  1 
ATOM   8096 O OH  . TYR B 1 503 ? 11.222  18.351  -25.464 1.00 51.03  ? 503  TYR B OH  1 
ATOM   8097 N N   . THR B 1 504 ? 8.445   23.570  -27.057 1.00 51.10  ? 504  THR B N   1 
ATOM   8098 C CA  . THR B 1 504 ? 9.608   24.441  -26.934 1.00 52.53  ? 504  THR B CA  1 
ATOM   8099 C C   . THR B 1 504 ? 10.596  23.791  -25.974 1.00 53.23  ? 504  THR B C   1 
ATOM   8100 O O   . THR B 1 504 ? 10.242  22.900  -25.204 1.00 52.13  ? 504  THR B O   1 
ATOM   8101 C CB  . THR B 1 504 ? 9.252   25.838  -26.368 1.00 53.48  ? 504  THR B CB  1 
ATOM   8102 O OG1 . THR B 1 504 ? 8.680   25.683  -25.073 1.00 52.39  ? 504  THR B OG1 1 
ATOM   8103 C CG2 . THR B 1 504 ? 8.266   26.584  -27.274 1.00 54.38  ? 504  THR B CG2 1 
ATOM   8104 N N   . THR B 1 505 ? 11.834  24.267  -26.004 1.00 54.93  ? 505  THR B N   1 
ATOM   8105 C CA  . THR B 1 505 ? 12.870  23.707  -25.143 1.00 55.99  ? 505  THR B CA  1 
ATOM   8106 C C   . THR B 1 505 ? 12.690  24.165  -23.697 1.00 56.92  ? 505  THR B C   1 
ATOM   8107 O O   . THR B 1 505 ? 13.008  23.410  -22.782 1.00 57.10  ? 505  THR B O   1 
ATOM   8108 C CB  . THR B 1 505 ? 14.309  23.987  -25.671 1.00 56.80  ? 505  THR B CB  1 
ATOM   8109 O OG1 . THR B 1 505 ? 14.505  25.389  -25.860 1.00 59.77  ? 505  THR B OG1 1 
ATOM   8110 C CG2 . THR B 1 505 ? 14.539  23.276  -26.990 1.00 55.57  ? 505  THR B CG2 1 
ATOM   8111 N N   . ALA B 1 506 ? 12.140  25.365  -23.492 1.00 57.88  ? 506  ALA B N   1 
ATOM   8112 C CA  . ALA B 1 506 ? 11.837  25.841  -22.139 1.00 58.72  ? 506  ALA B CA  1 
ATOM   8113 C C   . ALA B 1 506 ? 10.699  25.042  -21.506 1.00 58.59  ? 506  ALA B C   1 
ATOM   8114 O O   . ALA B 1 506 ? 10.903  24.406  -20.457 1.00 59.79  ? 506  ALA B O   1 
ATOM   8115 C CB  . ALA B 1 506 ? 11.498  27.325  -22.143 1.00 59.78  ? 506  ALA B CB  1 
ATOM   8116 N N   . ALA B 1 507 ? 9.517   25.048  -22.136 1.00 57.29  ? 507  ALA B N   1 
ATOM   8117 C CA  . ALA B 1 507 ? 8.302   24.483  -21.511 1.00 56.15  ? 507  ALA B CA  1 
ATOM   8118 C C   . ALA B 1 507 ? 8.086   23.003  -21.803 1.00 54.40  ? 507  ALA B C   1 
ATOM   8119 O O   . ALA B 1 507 ? 7.429   22.319  -21.033 1.00 54.24  ? 507  ALA B O   1 
ATOM   8120 C CB  . ALA B 1 507 ? 7.067   25.284  -21.913 1.00 56.28  ? 507  ALA B CB  1 
ATOM   8121 N N   . GLN B 1 508 ? 8.592   22.520  -22.932 1.00 53.21  ? 508  GLN B N   1 
ATOM   8122 C CA  . GLN B 1 508 ? 8.525   21.096  -23.279 1.00 52.03  ? 508  GLN B CA  1 
ATOM   8123 C C   . GLN B 1 508 ? 7.087   20.551  -23.303 1.00 51.21  ? 508  GLN B C   1 
ATOM   8124 O O   . GLN B 1 508 ? 6.844   19.407  -22.941 1.00 50.27  ? 508  GLN B O   1 
ATOM   8125 C CB  . GLN B 1 508 ? 9.427   20.279  -22.340 1.00 52.29  ? 508  GLN B CB  1 
ATOM   8126 C CG  . GLN B 1 508 ? 10.886  20.737  -22.394 1.00 53.86  ? 508  GLN B CG  1 
ATOM   8127 C CD  . GLN B 1 508 ? 11.809  19.986  -21.453 1.00 55.86  ? 508  GLN B CD  1 
ATOM   8128 O OE1 . GLN B 1 508 ? 11.838  18.759  -21.431 1.00 55.08  ? 508  GLN B OE1 1 
ATOM   8129 N NE2 . GLN B 1 508 ? 12.583  20.730  -20.677 1.00 59.03  ? 508  GLN B NE2 1 
ATOM   8130 N N   . GLN B 1 509 ? 6.147   21.379  -23.763 1.00 51.10  ? 509  GLN B N   1 
ATOM   8131 C CA  . GLN B 1 509 ? 4.741   20.986  -23.789 1.00 50.70  ? 509  GLN B CA  1 
ATOM   8132 C C   . GLN B 1 509 ? 4.418   20.025  -24.933 1.00 49.40  ? 509  GLN B C   1 
ATOM   8133 O O   . GLN B 1 509 ? 4.872   20.201  -26.070 1.00 48.10  ? 509  GLN B O   1 
ATOM   8134 C CB  . GLN B 1 509 ? 3.826   22.206  -23.853 1.00 51.47  ? 509  GLN B CB  1 
ATOM   8135 C CG  . GLN B 1 509 ? 3.820   23.041  -22.585 1.00 52.75  ? 509  GLN B CG  1 
ATOM   8136 C CD  . GLN B 1 509 ? 3.269   24.424  -22.825 1.00 55.62  ? 509  GLN B CD  1 
ATOM   8137 O OE1 . GLN B 1 509 ? 3.770   25.148  -23.671 1.00 57.68  ? 509  GLN B OE1 1 
ATOM   8138 N NE2 . GLN B 1 509 ? 2.234   24.800  -22.086 1.00 55.76  ? 509  GLN B NE2 1 
ATOM   8139 N N   . TYR B 1 510 ? 3.658   18.988  -24.590 1.00 49.20  ? 510  TYR B N   1 
ATOM   8140 C CA  . TYR B 1 510 ? 3.132   18.027  -25.547 1.00 48.50  ? 510  TYR B CA  1 
ATOM   8141 C C   . TYR B 1 510 ? 1.732   17.625  -25.108 1.00 48.37  ? 510  TYR B C   1 
ATOM   8142 O O   . TYR B 1 510 ? 1.297   17.972  -24.016 1.00 49.27  ? 510  TYR B O   1 
ATOM   8143 C CB  . TYR B 1 510 ? 4.039   16.813  -25.667 1.00 48.47  ? 510  TYR B CB  1 
ATOM   8144 C CG  . TYR B 1 510 ? 4.098   15.947  -24.435 1.00 49.53  ? 510  TYR B CG  1 
ATOM   8145 C CD1 . TYR B 1 510 ? 4.876   16.317  -23.347 1.00 51.13  ? 510  TYR B CD1 1 
ATOM   8146 C CD2 . TYR B 1 510 ? 3.401   14.749  -24.367 1.00 50.25  ? 510  TYR B CD2 1 
ATOM   8147 C CE1 . TYR B 1 510 ? 4.947   15.524  -22.209 1.00 51.87  ? 510  TYR B CE1 1 
ATOM   8148 C CE2 . TYR B 1 510 ? 3.458   13.941  -23.217 1.00 50.88  ? 510  TYR B CE2 1 
ATOM   8149 C CZ  . TYR B 1 510 ? 4.239   14.339  -22.150 1.00 50.89  ? 510  TYR B CZ  1 
ATOM   8150 O OH  . TYR B 1 510 ? 4.307   13.579  -21.005 1.00 51.55  ? 510  TYR B OH  1 
ATOM   8151 N N   . VAL B 1 511 ? 1.005   16.916  -25.957 1.00 47.66  ? 511  VAL B N   1 
ATOM   8152 C CA  . VAL B 1 511 ? -0.376  16.549  -25.621 1.00 47.58  ? 511  VAL B CA  1 
ATOM   8153 C C   . VAL B 1 511 ? -0.606  15.050  -25.662 1.00 47.56  ? 511  VAL B C   1 
ATOM   8154 O O   . VAL B 1 511 ? 0.117   14.320  -26.343 1.00 46.41  ? 511  VAL B O   1 
ATOM   8155 C CB  . VAL B 1 511 ? -1.376  17.235  -26.561 1.00 48.23  ? 511  VAL B CB  1 
ATOM   8156 C CG1 . VAL B 1 511 ? -1.269  18.777  -26.460 1.00 46.90  ? 511  VAL B CG1 1 
ATOM   8157 C CG2 . VAL B 1 511 ? -1.181  16.739  -27.995 1.00 46.38  ? 511  VAL B CG2 1 
ATOM   8158 N N   . SER B 1 512 ? -1.613  14.601  -24.913 1.00 48.67  ? 512  SER B N   1 
ATOM   8159 C CA  . SER B 1 512 ? -2.067  13.216  -24.954 1.00 49.01  ? 512  SER B CA  1 
ATOM   8160 C C   . SER B 1 512 ? -3.240  13.080  -25.905 1.00 49.28  ? 512  SER B C   1 
ATOM   8161 O O   . SER B 1 512 ? -4.225  13.824  -25.818 1.00 49.29  ? 512  SER B O   1 
ATOM   8162 C CB  . SER B 1 512 ? -2.487  12.722  -23.570 1.00 49.65  ? 512  SER B CB  1 
ATOM   8163 O OG  . SER B 1 512 ? -3.486  13.560  -23.037 1.00 51.77  ? 512  SER B OG  1 
ATOM   8164 N N   . LEU B 1 513 ? -3.104  12.128  -26.822 1.00 48.77  ? 513  LEU B N   1 
ATOM   8165 C CA  . LEU B 1 513 ? -4.139  11.781  -27.767 1.00 49.29  ? 513  LEU B CA  1 
ATOM   8166 C C   . LEU B 1 513 ? -4.778  10.477  -27.282 1.00 50.39  ? 513  LEU B C   1 
ATOM   8167 O O   . LEU B 1 513 ? -4.178  9.398   -27.339 1.00 49.44  ? 513  LEU B O   1 
ATOM   8168 C CB  . LEU B 1 513 ? -3.556  11.628  -29.168 1.00 48.24  ? 513  LEU B CB  1 
ATOM   8169 C CG  . LEU B 1 513 ? -2.923  12.881  -29.776 1.00 47.63  ? 513  LEU B CG  1 
ATOM   8170 C CD1 . LEU B 1 513 ? -2.363  12.582  -31.160 1.00 46.57  ? 513  LEU B CD1 1 
ATOM   8171 C CD2 . LEU B 1 513 ? -3.928  14.054  -29.835 1.00 47.06  ? 513  LEU B CD2 1 
ATOM   8172 N N   . ASN B 1 514 ? -5.968  10.611  -26.725 1.00 52.12  ? 514  ASN B N   1 
ATOM   8173 C CA  . ASN B 1 514 ? -6.741  9.469   -26.269 1.00 53.95  ? 514  ASN B CA  1 
ATOM   8174 C C   . ASN B 1 514 ? -8.216  9.843   -26.368 1.00 55.46  ? 514  ASN B C   1 
ATOM   8175 O O   . ASN B 1 514 ? -8.540  10.839  -27.012 1.00 55.02  ? 514  ASN B O   1 
ATOM   8176 C CB  . ASN B 1 514 ? -6.307  9.025   -24.857 1.00 54.24  ? 514  ASN B CB  1 
ATOM   8177 C CG  . ASN B 1 514 ? -6.377  10.130  -23.839 1.00 55.41  ? 514  ASN B CG  1 
ATOM   8178 O OD1 . ASN B 1 514 ? -7.324  10.912  -23.815 1.00 57.41  ? 514  ASN B OD1 1 
ATOM   8179 N ND2 . ASN B 1 514 ? -5.363  10.202  -22.975 1.00 57.58  ? 514  ASN B ND2 1 
ATOM   8180 N N   . LEU B 1 515 ? -9.100  9.046   -25.768 1.00 57.42  ? 515  LEU B N   1 
ATOM   8181 C CA  . LEU B 1 515 ? -10.532 9.262   -25.922 1.00 59.29  ? 515  LEU B CA  1 
ATOM   8182 C C   . LEU B 1 515 ? -11.018 10.500  -25.185 1.00 60.72  ? 515  LEU B C   1 
ATOM   8183 O O   . LEU B 1 515 ? -12.094 11.011  -25.494 1.00 62.32  ? 515  LEU B O   1 
ATOM   8184 C CB  . LEU B 1 515 ? -11.329 8.027   -25.477 1.00 60.60  ? 515  LEU B CB  1 
ATOM   8185 C CG  . LEU B 1 515 ? -11.156 6.764   -26.325 1.00 59.87  ? 515  LEU B CG  1 
ATOM   8186 C CD1 . LEU B 1 515 ? -11.987 5.636   -25.740 1.00 60.50  ? 515  LEU B CD1 1 
ATOM   8187 C CD2 . LEU B 1 515 ? -11.534 7.000   -27.780 1.00 58.51  ? 515  LEU B CD2 1 
ATOM   8188 N N   . LYS B 1 516 ? -10.231 10.979  -24.221 1.00 60.94  ? 516  LYS B N   1 
ATOM   8189 C CA  . LYS B 1 516 ? -10.541 12.208  -23.495 1.00 62.15  ? 516  LYS B CA  1 
ATOM   8190 C C   . LYS B 1 516 ? -10.072 13.453  -24.279 1.00 61.16  ? 516  LYS B C   1 
ATOM   8191 O O   . LYS B 1 516 ? -9.231  13.341  -25.179 1.00 59.94  ? 516  LYS B O   1 
ATOM   8192 C CB  . LYS B 1 516 ? -9.869  12.184  -22.115 1.00 62.71  ? 516  LYS B CB  1 
ATOM   8193 C CG  . LYS B 1 516 ? -10.171 10.937  -21.277 1.00 65.66  ? 516  LYS B CG  1 
ATOM   8194 C CD  . LYS B 1 516 ? -9.475  10.980  -19.917 1.00 68.97  ? 516  LYS B CD  1 
ATOM   8195 C CE  . LYS B 1 516 ? -10.272 11.809  -18.889 1.00 72.90  ? 516  LYS B CE  1 
ATOM   8196 N NZ  . LYS B 1 516 ? -9.434  12.323  -17.741 1.00 74.48  ? 516  LYS B NZ  1 
ATOM   8197 N N   . PRO B 1 517 ? -10.621 14.645  -23.954 1.00 61.48  ? 517  PRO B N   1 
ATOM   8198 C CA  . PRO B 1 517 ? -10.130 15.915  -24.532 1.00 60.88  ? 517  PRO B CA  1 
ATOM   8199 C C   . PRO B 1 517 ? -8.621  16.135  -24.365 1.00 59.35  ? 517  PRO B C   1 
ATOM   8200 O O   . PRO B 1 517 ? -8.038  15.638  -23.398 1.00 59.06  ? 517  PRO B O   1 
ATOM   8201 C CB  . PRO B 1 517 ? -10.898 16.976  -23.740 1.00 62.58  ? 517  PRO B CB  1 
ATOM   8202 C CG  . PRO B 1 517 ? -12.154 16.291  -23.307 1.00 63.58  ? 517  PRO B CG  1 
ATOM   8203 C CD  . PRO B 1 517 ? -11.759 14.860  -23.047 1.00 63.16  ? 517  PRO B CD  1 
ATOM   8204 N N   . LEU B 1 518 ? -7.990  16.864  -25.292 1.00 58.43  ? 518  LEU B N   1 
ATOM   8205 C CA  . LEU B 1 518 ? -6.532  17.081  -25.223 1.00 57.29  ? 518  LEU B CA  1 
ATOM   8206 C C   . LEU B 1 518 ? -6.134  17.526  -23.824 1.00 57.72  ? 518  LEU B C   1 
ATOM   8207 O O   . LEU B 1 518 ? -6.760  18.405  -23.238 1.00 58.39  ? 518  LEU B O   1 
ATOM   8208 C CB  . LEU B 1 518 ? -6.041  18.177  -26.174 1.00 56.69  ? 518  LEU B CB  1 
ATOM   8209 C CG  . LEU B 1 518 ? -5.813  17.959  -27.653 1.00 55.77  ? 518  LEU B CG  1 
ATOM   8210 C CD1 . LEU B 1 518 ? -5.105  19.199  -28.189 1.00 56.37  ? 518  LEU B CD1 1 
ATOM   8211 C CD2 . LEU B 1 518 ? -5.005  16.713  -27.935 1.00 55.18  ? 518  LEU B CD2 1 
ATOM   8212 N N   . GLU B 1 519 ? -5.070  16.927  -23.320 1.00 56.95  ? 519  GLU B N   1 
ATOM   8213 C CA  . GLU B 1 519 ? -4.464  17.341  -22.077 1.00 57.44  ? 519  GLU B CA  1 
ATOM   8214 C C   . GLU B 1 519 ? -3.028  17.750  -22.411 1.00 55.49  ? 519  GLU B C   1 
ATOM   8215 O O   . GLU B 1 519 ? -2.362  17.064  -23.167 1.00 54.34  ? 519  GLU B O   1 
ATOM   8216 C CB  . GLU B 1 519 ? -4.513  16.171  -21.098 1.00 58.06  ? 519  GLU B CB  1 
ATOM   8217 C CG  . GLU B 1 519 ? -3.729  16.345  -19.821 1.00 61.16  ? 519  GLU B CG  1 
ATOM   8218 C CD  . GLU B 1 519 ? -3.888  15.147  -18.896 1.00 65.33  ? 519  GLU B CD  1 
ATOM   8219 O OE1 . GLU B 1 519 ? -5.048  14.871  -18.496 1.00 69.39  ? 519  GLU B OE1 1 
ATOM   8220 O OE2 . GLU B 1 519 ? -2.863  14.485  -18.587 1.00 65.72  ? 519  GLU B OE2 1 
ATOM   8221 N N   . VAL B 1 520 ? -2.577  18.873  -21.861 1.00 54.94  ? 520  VAL B N   1 
ATOM   8222 C CA  . VAL B 1 520 ? -1.219  19.353  -22.049 1.00 53.53  ? 520  VAL B CA  1 
ATOM   8223 C C   . VAL B 1 520 ? -0.303  18.861  -20.919 1.00 52.94  ? 520  VAL B C   1 
ATOM   8224 O O   . VAL B 1 520 ? -0.617  19.027  -19.739 1.00 53.29  ? 520  VAL B O   1 
ATOM   8225 C CB  . VAL B 1 520 ? -1.189  20.908  -22.082 1.00 54.40  ? 520  VAL B CB  1 
ATOM   8226 C CG1 . VAL B 1 520 ? 0.247   21.415  -22.213 1.00 53.44  ? 520  VAL B CG1 1 
ATOM   8227 C CG2 . VAL B 1 520 ? -2.066  21.441  -23.219 1.00 54.51  ? 520  VAL B CG2 1 
ATOM   8228 N N   . ARG B 1 521 ? 0.832   18.271  -21.283 1.00 51.72  ? 521  ARG B N   1 
ATOM   8229 C CA  . ARG B 1 521 ? 1.829   17.803  -20.316 1.00 51.63  ? 521  ARG B CA  1 
ATOM   8230 C C   . ARG B 1 521 ? 3.168   18.441  -20.625 1.00 51.41  ? 521  ARG B C   1 
ATOM   8231 O O   . ARG B 1 521 ? 3.389   18.926  -21.735 1.00 50.15  ? 521  ARG B O   1 
ATOM   8232 C CB  . ARG B 1 521 ? 1.965   16.282  -20.380 1.00 51.40  ? 521  ARG B CB  1 
ATOM   8233 C CG  . ARG B 1 521 ? 0.682   15.559  -20.018 1.00 52.38  ? 521  ARG B CG  1 
ATOM   8234 C CD  . ARG B 1 521 ? 0.813   14.051  -20.129 1.00 52.56  ? 521  ARG B CD  1 
ATOM   8235 N NE  . ARG B 1 521 ? -0.494  13.378  -20.014 1.00 53.70  ? 521  ARG B NE  1 
ATOM   8236 C CZ  . ARG B 1 521 ? -0.713  12.099  -20.345 1.00 54.35  ? 521  ARG B CZ  1 
ATOM   8237 N NH1 . ARG B 1 521 ? 0.271   11.346  -20.839 1.00 51.77  ? 521  ARG B NH1 1 
ATOM   8238 N NH2 . ARG B 1 521 ? -1.936  11.580  -20.220 1.00 53.98  ? 521  ARG B NH2 1 
ATOM   8239 N N   . ARG B 1 522 ? 4.067   18.426  -19.646 1.00 52.57  ? 522  ARG B N   1 
ATOM   8240 C CA  . ARG B 1 522 ? 5.391   19.023  -19.809 1.00 53.47  ? 522  ARG B CA  1 
ATOM   8241 C C   . ARG B 1 522 ? 6.471   17.969  -19.605 1.00 53.88  ? 522  ARG B C   1 
ATOM   8242 O O   . ARG B 1 522 ? 6.430   17.221  -18.641 1.00 54.75  ? 522  ARG B O   1 
ATOM   8243 C CB  . ARG B 1 522 ? 5.549   20.216  -18.866 1.00 54.34  ? 522  ARG B CB  1 
ATOM   8244 C CG  . ARG B 1 522 ? 4.610   21.366  -19.247 1.00 55.84  ? 522  ARG B CG  1 
ATOM   8245 C CD  . ARG B 1 522 ? 4.693   22.588  -18.318 1.00 58.28  ? 522  ARG B CD  1 
ATOM   8246 N NE  . ARG B 1 522 ? 6.015   23.211  -18.318 1.00 59.41  ? 522  ARG B NE  1 
ATOM   8247 C CZ  . ARG B 1 522 ? 6.314   24.368  -17.718 1.00 60.99  ? 522  ARG B CZ  1 
ATOM   8248 N NH1 . ARG B 1 522 ? 5.384   25.063  -17.074 1.00 61.70  ? 522  ARG B NH1 1 
ATOM   8249 N NH2 . ARG B 1 522 ? 7.554   24.839  -17.776 1.00 59.86  ? 522  ARG B NH2 1 
ATOM   8250 N N   . GLY B 1 523 ? 7.390   17.877  -20.560 1.00 54.25  ? 523  GLY B N   1 
ATOM   8251 C CA  . GLY B 1 523 ? 8.545   16.997  -20.463 1.00 55.07  ? 523  GLY B CA  1 
ATOM   8252 C C   . GLY B 1 523 ? 8.272   15.579  -20.903 1.00 55.20  ? 523  GLY B C   1 
ATOM   8253 O O   . GLY B 1 523 ? 7.625   14.843  -20.183 1.00 56.27  ? 523  GLY B O   1 
ATOM   8254 N N   . LEU B 1 524 ? 8.758   15.208  -22.085 1.00 55.59  ? 524  LEU B N   1 
ATOM   8255 C CA  . LEU B 1 524 ? 8.681   13.823  -22.576 1.00 56.34  ? 524  LEU B CA  1 
ATOM   8256 C C   . LEU B 1 524 ? 9.761   12.971  -21.929 1.00 56.89  ? 524  LEU B C   1 
ATOM   8257 O O   . LEU B 1 524 ? 10.907  12.986  -22.382 1.00 57.29  ? 524  LEU B O   1 
ATOM   8258 C CB  . LEU B 1 524 ? 8.908   13.763  -24.096 1.00 56.09  ? 524  LEU B CB  1 
ATOM   8259 C CG  . LEU B 1 524 ? 7.733   13.722  -25.065 1.00 57.53  ? 524  LEU B CG  1 
ATOM   8260 C CD1 . LEU B 1 524 ? 8.290   13.880  -26.493 1.00 57.86  ? 524  LEU B CD1 1 
ATOM   8261 C CD2 . LEU B 1 524 ? 6.937   12.422  -24.904 1.00 57.01  ? 524  LEU B CD2 1 
ATOM   8262 N N   . ARG B 1 525 ? 9.400   12.220  -20.892 1.00 57.60  ? 525  ARG B N   1 
ATOM   8263 C CA  . ARG B 1 525 ? 10.359  11.393  -20.169 1.00 57.75  ? 525  ARG B CA  1 
ATOM   8264 C C   . ARG B 1 525 ? 11.641  12.182  -19.906 1.00 57.00  ? 525  ARG B C   1 
ATOM   8265 O O   . ARG B 1 525 ? 12.733  11.719  -20.223 1.00 56.50  ? 525  ARG B O   1 
ATOM   8266 C CB  . ARG B 1 525 ? 10.712  10.172  -21.005 1.00 57.84  ? 525  ARG B CB  1 
ATOM   8267 C CG  . ARG B 1 525 ? 9.578   9.280   -21.362 1.00 60.79  ? 525  ARG B CG  1 
ATOM   8268 C CD  . ARG B 1 525 ? 9.266   8.335   -20.257 1.00 65.87  ? 525  ARG B CD  1 
ATOM   8269 N NE  . ARG B 1 525 ? 9.083   6.971   -20.742 1.00 68.64  ? 525  ARG B NE  1 
ATOM   8270 C CZ  . ARG B 1 525 ? 8.031   6.535   -21.436 1.00 69.59  ? 525  ARG B CZ  1 
ATOM   8271 N NH1 . ARG B 1 525 ? 7.047   7.359   -21.804 1.00 70.43  ? 525  ARG B NH1 1 
ATOM   8272 N NH2 . ARG B 1 525 ? 7.983   5.254   -21.784 1.00 68.45  ? 525  ARG B NH2 1 
ATOM   8273 N N   . ALA B 1 526 ? 11.516  13.377  -19.351 1.00 56.74  ? 526  ALA B N   1 
ATOM   8274 C CA  . ALA B 1 526 ? 12.670  14.279  -19.250 1.00 56.26  ? 526  ALA B CA  1 
ATOM   8275 C C   . ALA B 1 526 ? 13.860  13.639  -18.532 1.00 56.24  ? 526  ALA B C   1 
ATOM   8276 O O   . ALA B 1 526 ? 14.951  13.606  -19.079 1.00 56.08  ? 526  ALA B O   1 
ATOM   8277 C CB  . ALA B 1 526 ? 12.272  15.577  -18.596 1.00 56.71  ? 526  ALA B CB  1 
ATOM   8278 N N   . GLN B 1 527 ? 13.648  13.098  -17.336 1.00 56.84  ? 527  GLN B N   1 
ATOM   8279 C CA  . GLN B 1 527 ? 14.755  12.538  -16.535 1.00 57.80  ? 527  GLN B CA  1 
ATOM   8280 C C   . GLN B 1 527 ? 15.380  11.332  -17.214 1.00 56.98  ? 527  GLN B C   1 
ATOM   8281 O O   . GLN B 1 527 ? 16.596  11.232  -17.307 1.00 57.54  ? 527  GLN B O   1 
ATOM   8282 C CB  . GLN B 1 527 ? 14.297  12.103  -15.131 1.00 58.68  ? 527  GLN B CB  1 
ATOM   8283 C CG  . GLN B 1 527 ? 13.834  13.204  -14.236 1.00 60.46  ? 527  GLN B CG  1 
ATOM   8284 C CD  . GLN B 1 527 ? 14.839  14.331  -14.130 1.00 63.44  ? 527  GLN B CD  1 
ATOM   8285 O OE1 . GLN B 1 527 ? 14.581  15.446  -14.605 1.00 63.34  ? 527  GLN B OE1 1 
ATOM   8286 N NE2 . GLN B 1 527 ? 16.006  14.046  -13.523 1.00 64.69  ? 527  GLN B NE2 1 
ATOM   8287 N N   . THR B 1 528 ? 14.536  10.417  -17.670 1.00 56.08  ? 528  THR B N   1 
ATOM   8288 C CA  . THR B 1 528 ? 14.996  9.196   -18.309 1.00 55.57  ? 528  THR B CA  1 
ATOM   8289 C C   . THR B 1 528 ? 15.719  9.499   -19.613 1.00 54.65  ? 528  THR B C   1 
ATOM   8290 O O   . THR B 1 528 ? 16.735  8.868   -19.922 1.00 54.98  ? 528  THR B O   1 
ATOM   8291 C CB  . THR B 1 528 ? 13.817  8.212   -18.549 1.00 55.43  ? 528  THR B CB  1 
ATOM   8292 O OG1 . THR B 1 528 ? 13.391  7.675   -17.292 1.00 56.96  ? 528  THR B OG1 1 
ATOM   8293 C CG2 . THR B 1 528 ? 14.219  7.058   -19.479 1.00 55.16  ? 528  THR B CG2 1 
ATOM   8294 N N   . CYS B 1 529 ? 15.227  10.466  -20.377 1.00 53.30  ? 529  CYS B N   1 
ATOM   8295 C CA  . CYS B 1 529 ? 15.877  10.773  -21.646 1.00 52.84  ? 529  CYS B CA  1 
ATOM   8296 C C   . CYS B 1 529 ? 17.190  11.542  -21.461 1.00 53.15  ? 529  CYS B C   1 
ATOM   8297 O O   . CYS B 1 529 ? 18.031  11.504  -22.335 1.00 52.91  ? 529  CYS B O   1 
ATOM   8298 C CB  . CYS B 1 529 ? 14.910  11.436  -22.639 1.00 52.07  ? 529  CYS B CB  1 
ATOM   8299 S SG  . CYS B 1 529 ? 13.619  10.240  -23.260 1.00 53.07  ? 529  CYS B SG  1 
ATOM   8300 N N   . ALA B 1 530 ? 17.377  12.208  -20.321 1.00 53.51  ? 530  ALA B N   1 
ATOM   8301 C CA  . ALA B 1 530 ? 18.693  12.759  -19.963 1.00 54.49  ? 530  ALA B CA  1 
ATOM   8302 C C   . ALA B 1 530 ? 19.718  11.634  -19.775 1.00 54.90  ? 530  ALA B C   1 
ATOM   8303 O O   . ALA B 1 530 ? 20.871  11.766  -20.144 1.00 55.48  ? 530  ALA B O   1 
ATOM   8304 C CB  . ALA B 1 530 ? 18.604  13.595  -18.683 1.00 55.10  ? 530  ALA B CB  1 
ATOM   8305 N N   . PHE B 1 531 ? 19.283  10.531  -19.183 1.00 55.02  ? 531  PHE B N   1 
ATOM   8306 C CA  . PHE B 1 531 ? 20.112  9.334   -19.080 1.00 55.82  ? 531  PHE B CA  1 
ATOM   8307 C C   . PHE B 1 531 ? 20.590  8.859   -20.463 1.00 55.54  ? 531  PHE B C   1 
ATOM   8308 O O   . PHE B 1 531 ? 21.787  8.794   -20.730 1.00 56.19  ? 531  PHE B O   1 
ATOM   8309 C CB  . PHE B 1 531 ? 19.329  8.223   -18.364 1.00 55.62  ? 531  PHE B CB  1 
ATOM   8310 C CG  . PHE B 1 531 ? 20.023  6.912   -18.352 1.00 55.96  ? 531  PHE B CG  1 
ATOM   8311 C CD1 . PHE B 1 531 ? 21.140  6.719   -17.570 1.00 57.19  ? 531  PHE B CD1 1 
ATOM   8312 C CD2 . PHE B 1 531 ? 19.562  5.870   -19.122 1.00 55.74  ? 531  PHE B CD2 1 
ATOM   8313 C CE1 . PHE B 1 531 ? 21.785  5.501   -17.547 1.00 58.91  ? 531  PHE B CE1 1 
ATOM   8314 C CE2 . PHE B 1 531 ? 20.207  4.643   -19.109 1.00 57.38  ? 531  PHE B CE2 1 
ATOM   8315 C CZ  . PHE B 1 531 ? 21.321  4.463   -18.316 1.00 58.36  ? 531  PHE B CZ  1 
ATOM   8316 N N   . TRP B 1 532 ? 19.651  8.549   -21.338 1.00 55.10  ? 532  TRP B N   1 
ATOM   8317 C CA  . TRP B 1 532 ? 19.994  8.064   -22.675 1.00 55.32  ? 532  TRP B CA  1 
ATOM   8318 C C   . TRP B 1 532 ? 20.699  9.130   -23.520 1.00 56.42  ? 532  TRP B C   1 
ATOM   8319 O O   . TRP B 1 532 ? 21.701  8.832   -24.145 1.00 57.31  ? 532  TRP B O   1 
ATOM   8320 C CB  . TRP B 1 532 ? 18.760  7.568   -23.412 1.00 53.55  ? 532  TRP B CB  1 
ATOM   8321 C CG  . TRP B 1 532 ? 18.143  6.322   -22.846 1.00 53.12  ? 532  TRP B CG  1 
ATOM   8322 C CD1 . TRP B 1 532 ? 17.025  6.247   -22.087 1.00 53.01  ? 532  TRP B CD1 1 
ATOM   8323 C CD2 . TRP B 1 532 ? 18.604  4.974   -23.011 1.00 52.89  ? 532  TRP B CD2 1 
ATOM   8324 N NE1 . TRP B 1 532 ? 16.754  4.935   -21.761 1.00 53.57  ? 532  TRP B NE1 1 
ATOM   8325 C CE2 . TRP B 1 532 ? 17.712  4.136   -22.312 1.00 52.96  ? 532  TRP B CE2 1 
ATOM   8326 C CE3 . TRP B 1 532 ? 19.695  4.394   -23.665 1.00 54.16  ? 532  TRP B CE3 1 
ATOM   8327 C CZ2 . TRP B 1 532 ? 17.870  2.749   -22.253 1.00 53.71  ? 532  TRP B CZ2 1 
ATOM   8328 C CZ3 . TRP B 1 532 ? 19.849  3.015   -23.606 1.00 54.29  ? 532  TRP B CZ3 1 
ATOM   8329 C CH2 . TRP B 1 532 ? 18.937  2.212   -22.906 1.00 54.27  ? 532  TRP B CH2 1 
ATOM   8330 N N   . ASN B 1 533 ? 20.191  10.362  -23.530 1.00 56.96  ? 533  ASN B N   1 
ATOM   8331 C CA  . ASN B 1 533 ? 20.676  11.374  -24.475 1.00 57.89  ? 533  ASN B CA  1 
ATOM   8332 C C   . ASN B 1 533 ? 21.904  12.128  -24.012 1.00 59.88  ? 533  ASN B C   1 
ATOM   8333 O O   . ASN B 1 533 ? 22.631  12.656  -24.842 1.00 60.14  ? 533  ASN B O   1 
ATOM   8334 C CB  . ASN B 1 533 ? 19.573  12.385  -24.847 1.00 57.19  ? 533  ASN B CB  1 
ATOM   8335 C CG  . ASN B 1 533 ? 18.377  11.728  -25.519 1.00 56.47  ? 533  ASN B CG  1 
ATOM   8336 O OD1 . ASN B 1 533 ? 18.468  10.595  -25.986 1.00 57.18  ? 533  ASN B OD1 1 
ATOM   8337 N ND2 . ASN B 1 533 ? 17.250  12.431  -25.564 1.00 53.62  ? 533  ASN B ND2 1 
ATOM   8338 N N   . ARG B 1 534 ? 22.137  12.196  -22.704 1.00 61.92  ? 534  ARG B N   1 
ATOM   8339 C CA  . ARG B 1 534 ? 23.248  12.986  -22.177 1.00 64.27  ? 534  ARG B CA  1 
ATOM   8340 C C   . ARG B 1 534 ? 24.314  12.171  -21.449 1.00 66.02  ? 534  ARG B C   1 
ATOM   8341 O O   . ARG B 1 534 ? 25.502  12.402  -21.640 1.00 67.41  ? 534  ARG B O   1 
ATOM   8342 C CB  . ARG B 1 534 ? 22.737  14.076  -21.237 1.00 64.65  ? 534  ARG B CB  1 
ATOM   8343 C CG  . ARG B 1 534 ? 21.869  15.122  -21.902 1.00 65.52  ? 534  ARG B CG  1 
ATOM   8344 C CD  . ARG B 1 534 ? 21.234  16.022  -20.866 1.00 67.77  ? 534  ARG B CD  1 
ATOM   8345 N NE  . ARG B 1 534 ? 20.168  16.849  -21.437 1.00 67.98  ? 534  ARG B NE  1 
ATOM   8346 C CZ  . ARG B 1 534 ? 20.313  18.119  -21.825 1.00 69.78  ? 534  ARG B CZ  1 
ATOM   8347 N NH1 . ARG B 1 534 ? 21.478  18.770  -21.690 1.00 69.18  ? 534  ARG B NH1 1 
ATOM   8348 N NH2 . ARG B 1 534 ? 19.260  18.755  -22.334 1.00 69.97  ? 534  ARG B NH2 1 
ATOM   8349 N N   . PHE B 1 535 ? 23.905  11.243  -20.592 1.00 66.68  ? 535  PHE B N   1 
ATOM   8350 C CA  . PHE B 1 535 ? 24.881  10.547  -19.772 1.00 68.27  ? 535  PHE B CA  1 
ATOM   8351 C C   . PHE B 1 535 ? 25.528  9.377   -20.498 1.00 69.45  ? 535  PHE B C   1 
ATOM   8352 O O   . PHE B 1 535 ? 26.747  9.264   -20.509 1.00 70.71  ? 535  PHE B O   1 
ATOM   8353 C CB  . PHE B 1 535 ? 24.294  10.051  -18.451 1.00 67.82  ? 535  PHE B CB  1 
ATOM   8354 C CG  . PHE B 1 535 ? 25.290  9.292   -17.621 1.00 68.63  ? 535  PHE B CG  1 
ATOM   8355 C CD1 . PHE B 1 535 ? 26.382  9.943   -17.079 1.00 68.22  ? 535  PHE B CD1 1 
ATOM   8356 C CD2 . PHE B 1 535 ? 25.167  7.923   -17.434 1.00 68.33  ? 535  PHE B CD2 1 
ATOM   8357 C CE1 . PHE B 1 535 ? 27.310  9.256   -16.336 1.00 70.17  ? 535  PHE B CE1 1 
ATOM   8358 C CE2 . PHE B 1 535 ? 26.105  7.227   -16.693 1.00 69.60  ? 535  PHE B CE2 1 
ATOM   8359 C CZ  . PHE B 1 535 ? 27.172  7.897   -16.143 1.00 70.75  ? 535  PHE B CZ  1 
ATOM   8360 N N   . LEU B 1 536 ? 24.729  8.489   -21.069 1.00 69.75  ? 536  LEU B N   1 
ATOM   8361 C CA  . LEU B 1 536 ? 25.302  7.307   -21.719 1.00 71.69  ? 536  LEU B CA  1 
ATOM   8362 C C   . LEU B 1 536 ? 26.379  7.633   -22.778 1.00 73.56  ? 536  LEU B C   1 
ATOM   8363 O O   . LEU B 1 536 ? 27.402  6.954   -22.832 1.00 74.88  ? 536  LEU B O   1 
ATOM   8364 C CB  . LEU B 1 536 ? 24.210  6.389   -22.293 1.00 70.37  ? 536  LEU B CB  1 
ATOM   8365 C CG  . LEU B 1 536 ? 23.575  5.418   -21.287 1.00 70.80  ? 536  LEU B CG  1 
ATOM   8366 C CD1 . LEU B 1 536 ? 22.640  4.437   -21.978 1.00 69.17  ? 536  LEU B CD1 1 
ATOM   8367 C CD2 . LEU B 1 536 ? 24.644  4.647   -20.497 1.00 72.89  ? 536  LEU B CD2 1 
ATOM   8368 N N   . PRO B 1 537 ? 26.147  8.650   -23.632 1.00 74.74  ? 537  PRO B N   1 
ATOM   8369 C CA  . PRO B 1 537 ? 27.194  9.142   -24.535 1.00 76.58  ? 537  PRO B CA  1 
ATOM   8370 C C   . PRO B 1 537 ? 28.529  9.463   -23.856 1.00 79.62  ? 537  PRO B C   1 
ATOM   8371 O O   . PRO B 1 537 ? 29.581  9.123   -24.397 1.00 80.81  ? 537  PRO B O   1 
ATOM   8372 C CB  . PRO B 1 537 ? 26.571  10.413  -25.116 1.00 75.57  ? 537  PRO B CB  1 
ATOM   8373 C CG  . PRO B 1 537 ? 25.130  10.102  -25.154 1.00 73.66  ? 537  PRO B CG  1 
ATOM   8374 C CD  . PRO B 1 537 ? 24.873  9.349   -23.874 1.00 73.41  ? 537  PRO B CD  1 
ATOM   8375 N N   . LYS B 1 538 ? 28.483  10.121  -22.697 1.00 81.61  ? 538  LYS B N   1 
ATOM   8376 C CA  . LYS B 1 538 ? 29.691  10.417  -21.923 1.00 84.53  ? 538  LYS B CA  1 
ATOM   8377 C C   . LYS B 1 538 ? 30.327  9.138   -21.396 1.00 86.60  ? 538  LYS B C   1 
ATOM   8378 O O   . LYS B 1 538 ? 31.544  9.056   -21.272 1.00 88.47  ? 538  LYS B O   1 
ATOM   8379 C CB  . LYS B 1 538 ? 29.387  11.342  -20.745 1.00 84.87  ? 538  LYS B CB  1 
ATOM   8380 C CG  . LYS B 1 538 ? 28.980  12.759  -21.121 1.00 85.51  ? 538  LYS B CG  1 
ATOM   8381 C CD  . LYS B 1 538 ? 28.322  13.469  -19.926 1.00 87.38  ? 538  LYS B CD  1 
ATOM   8382 C CE  . LYS B 1 538 ? 27.814  14.873  -20.281 1.00 87.96  ? 538  LYS B CE  1 
ATOM   8383 N NZ  . LYS B 1 538 ? 27.211  15.578  -19.098 1.00 89.01  ? 538  LYS B NZ  1 
ATOM   8384 N N   . LEU B 1 539 ? 29.504  8.145   -21.078 1.00 87.09  ? 539  LEU B N   1 
ATOM   8385 C CA  . LEU B 1 539 ? 30.007  6.873   -20.578 1.00 89.31  ? 539  LEU B CA  1 
ATOM   8386 C C   . LEU B 1 539 ? 30.754  6.115   -21.673 1.00 91.13  ? 539  LEU B C   1 
ATOM   8387 O O   . LEU B 1 539 ? 31.658  5.335   -21.382 1.00 93.09  ? 539  LEU B O   1 
ATOM   8388 C CB  . LEU B 1 539 ? 28.858  6.031   -20.017 1.00 88.33  ? 539  LEU B CB  1 
ATOM   8389 C CG  . LEU B 1 539 ? 29.215  4.755   -19.262 1.00 89.07  ? 539  LEU B CG  1 
ATOM   8390 C CD1 . LEU B 1 539 ? 30.218  5.045   -18.165 1.00 91.33  ? 539  LEU B CD1 1 
ATOM   8391 C CD2 . LEU B 1 539 ? 27.966  4.131   -18.681 1.00 87.34  ? 539  LEU B CD2 1 
ATOM   8392 N N   . LEU B 1 540 ? 30.369  6.356   -22.927 1.00 91.46  ? 540  LEU B N   1 
ATOM   8393 C CA  . LEU B 1 540 ? 31.077  5.843   -24.111 1.00 92.86  ? 540  LEU B CA  1 
ATOM   8394 C C   . LEU B 1 540 ? 32.406  6.586   -24.329 1.00 95.17  ? 540  LEU B C   1 
ATOM   8395 O O   . LEU B 1 540 ? 33.465  5.964   -24.411 1.00 96.73  ? 540  LEU B O   1 
ATOM   8396 C CB  . LEU B 1 540 ? 30.159  5.975   -25.345 1.00 91.42  ? 540  LEU B CB  1 
ATOM   8397 C CG  . LEU B 1 540 ? 30.650  5.771   -26.790 1.00 91.80  ? 540  LEU B CG  1 
ATOM   8398 C CD1 . LEU B 1 540 ? 29.467  5.410   -27.676 1.00 89.86  ? 540  LEU B CD1 1 
ATOM   8399 C CD2 . LEU B 1 540 ? 31.372  7.007   -27.355 1.00 92.85  ? 540  LEU B CD2 1 
ATOM   8400 N N   . SER B 1 541 ? 32.339  7.915   -24.409 1.00 95.82  ? 541  SER B N   1 
ATOM   8401 C CA  . SER B 1 541 ? 33.521  8.761   -24.643 1.00 98.19  ? 541  SER B CA  1 
ATOM   8402 C C   . SER B 1 541 ? 34.603  8.627   -23.570 1.00 100.96 ? 541  SER B C   1 
ATOM   8403 O O   . SER B 1 541 ? 35.795  8.578   -23.887 1.00 102.83 ? 541  SER B O   1 
ATOM   8404 C CB  . SER B 1 541 ? 33.117  10.238  -24.749 1.00 97.60  ? 541  SER B CB  1 
ATOM   8405 O OG  . SER B 1 541 ? 32.483  10.508  -25.988 1.00 96.89  ? 541  SER B OG  1 
ATOM   8406 N N   . ALA B 1 542 ? 34.186  8.590   -22.307 1.00 101.69 ? 542  ALA B N   1 
ATOM   8407 C CA  . ALA B 1 542 ? 35.115  8.469   -21.180 1.00 104.22 ? 542  ALA B CA  1 
ATOM   8408 C C   . ALA B 1 542 ? 35.790  7.089   -21.118 1.00 105.99 ? 542  ALA B C   1 
ATOM   8409 O O   . ALA B 1 542 ? 36.973  6.990   -20.771 1.00 108.16 ? 542  ALA B O   1 
ATOM   8410 C CB  . ALA B 1 542 ? 34.394  8.771   -19.863 1.00 103.76 ? 542  ALA B CB  1 
ATOM   8411 N N   . THR B 1 543 ? 35.033  6.039   -21.445 1.00 105.45 ? 543  THR B N   1 
ATOM   8412 C CA  . THR B 1 543 ? 35.548  4.662   -21.467 1.00 106.99 ? 543  THR B CA  1 
ATOM   8413 C C   . THR B 1 543 ? 35.007  3.896   -22.676 1.00 106.04 ? 543  THR B C   1 
ATOM   8414 O O   . THR B 1 543 ? 35.762  3.446   -23.549 1.00 106.99 ? 543  THR B O   1 
ATOM   8415 C CB  . THR B 1 543 ? 35.157  3.885   -20.188 1.00 107.48 ? 543  THR B CB  1 
ATOM   8416 O OG1 . THR B 1 543 ? 33.739  3.970   -19.990 1.00 105.36 ? 543  THR B OG1 1 
ATOM   8417 C CG2 . THR B 1 543 ? 35.896  4.434   -18.951 1.00 109.20 ? 543  THR B CG2 1 
ATOM   8418 O OXT . THR B 1 543 ? 33.791  3.710   -22.796 1.00 104.45 ? 543  THR B OXT 1 
HETATM 8419 C C1  . NAG C 2 .   ? 24.163  35.302  -0.625  1.00 79.00  ? 1    NAG C C1  1 
HETATM 8420 C C2  . NAG C 2 .   ? 24.485  35.862  -2.023  1.00 83.65  ? 1    NAG C C2  1 
HETATM 8421 C C3  . NAG C 2 .   ? 25.852  35.350  -2.518  1.00 84.45  ? 1    NAG C C3  1 
HETATM 8422 C C4  . NAG C 2 .   ? 26.936  35.688  -1.502  1.00 84.79  ? 1    NAG C C4  1 
HETATM 8423 C C5  . NAG C 2 .   ? 26.524  35.097  -0.156  1.00 84.74  ? 1    NAG C C5  1 
HETATM 8424 C C6  . NAG C 2 .   ? 27.549  35.314  0.966   1.00 86.89  ? 1    NAG C C6  1 
HETATM 8425 C C7  . NAG C 2 .   ? 22.949  36.532  -3.809  1.00 86.80  ? 1    NAG C C7  1 
HETATM 8426 C C8  . NAG C 2 .   ? 22.626  36.080  -5.208  1.00 87.30  ? 1    NAG C C8  1 
HETATM 8427 N N2  . NAG C 2 .   ? 23.396  35.587  -2.965  1.00 84.79  ? 1    NAG C N2  1 
HETATM 8428 O O3  . NAG C 2 .   ? 26.232  35.894  -3.764  1.00 84.82  ? 1    NAG C O3  1 
HETATM 8429 O O4  . NAG C 2 .   ? 28.168  35.164  -1.946  1.00 85.23  ? 1    NAG C O4  1 
HETATM 8430 O O5  . NAG C 2 .   ? 25.255  35.608  0.230   1.00 81.37  ? 1    NAG C O5  1 
HETATM 8431 O O6  . NAG C 2 .   ? 28.155  36.595  0.973   1.00 90.27  ? 1    NAG C O6  1 
HETATM 8432 O O7  . NAG C 2 .   ? 22.783  37.721  -3.493  1.00 86.92  ? 1    NAG C O7  1 
HETATM 8433 C C1  . FUC C 2 .   ? 27.367  37.618  1.627   1.00 92.36  ? 2    FUC C C1  1 
HETATM 8434 C C2  . FUC C 2 .   ? 27.875  39.059  1.670   1.00 93.37  ? 2    FUC C C2  1 
HETATM 8435 C C3  . FUC C 2 .   ? 26.901  39.771  0.737   1.00 94.19  ? 2    FUC C C3  1 
HETATM 8436 C C4  . FUC C 2 .   ? 25.513  39.693  1.377   1.00 94.67  ? 2    FUC C C4  1 
HETATM 8437 C C5  . FUC C 2 .   ? 25.085  38.248  1.689   1.00 94.29  ? 2    FUC C C5  1 
HETATM 8438 C C6  . FUC C 2 .   ? 23.880  38.238  2.627   1.00 94.43  ? 2    FUC C C6  1 
HETATM 8439 O O2  . FUC C 2 .   ? 29.212  39.140  1.242   1.00 93.16  ? 2    FUC C O2  1 
HETATM 8440 O O3  . FUC C 2 .   ? 27.257  41.112  0.493   1.00 94.06  ? 2    FUC C O3  1 
HETATM 8441 O O4  . FUC C 2 .   ? 25.498  40.460  2.564   1.00 95.89  ? 2    FUC C O4  1 
HETATM 8442 O O5  . FUC C 2 .   ? 26.118  37.445  2.264   1.00 93.18  ? 2    FUC C O5  1 
HETATM 8443 C C1  . NAG D 3 .   ? 11.623  33.659  25.635  1.00 82.14  ? 701  NAG A C1  1 
HETATM 8444 C C2  . NAG D 3 .   ? 12.940  34.409  25.378  1.00 85.88  ? 701  NAG A C2  1 
HETATM 8445 C C3  . NAG D 3 .   ? 13.028  35.702  26.196  1.00 86.77  ? 701  NAG A C3  1 
HETATM 8446 C C4  . NAG D 3 .   ? 11.738  36.515  26.035  1.00 87.10  ? 701  NAG A C4  1 
HETATM 8447 C C5  . NAG D 3 .   ? 10.591  35.628  26.535  1.00 87.01  ? 701  NAG A C5  1 
HETATM 8448 C C6  . NAG D 3 .   ? 9.238   36.345  26.722  1.00 87.75  ? 701  NAG A C6  1 
HETATM 8449 C C7  . NAG D 3 .   ? 14.738  32.821  24.811  1.00 87.97  ? 701  NAG A C7  1 
HETATM 8450 C C8  . NAG D 3 .   ? 15.475  31.621  25.343  1.00 87.54  ? 701  NAG A C8  1 
HETATM 8451 N N2  . NAG D 3 .   ? 14.090  33.571  25.706  1.00 86.95  ? 701  NAG A N2  1 
HETATM 8452 O O3  . NAG D 3 .   ? 14.177  36.438  25.818  1.00 87.69  ? 701  NAG A O3  1 
HETATM 8453 O O4  . NAG D 3 .   ? 11.805  37.744  26.735  1.00 87.47  ? 701  NAG A O4  1 
HETATM 8454 O O5  . NAG D 3 .   ? 10.490  34.524  25.641  1.00 84.34  ? 701  NAG A O5  1 
HETATM 8455 O O6  . NAG D 3 .   ? 8.725   36.886  25.518  1.00 88.46  ? 701  NAG A O6  1 
HETATM 8456 O O7  . NAG D 3 .   ? 14.755  33.073  23.605  1.00 89.08  ? 701  NAG A O7  1 
HETATM 8457 I I   . IOD E 4 .   ? 38.772  15.851  0.952   0.60 49.03  ? 702  IOD A I   1 
HETATM 8458 I I   . IOD F 4 .   ? 50.665  2.759   6.723   0.50 55.28  ? 703  IOD A I   1 
HETATM 8459 I I   . IOD G 4 .   ? 28.245  3.466   2.160   0.30 52.28  ? 704  IOD A I   1 
HETATM 8460 I I   . IOD H 4 .   ? 32.330  21.083  6.396   0.30 55.59  ? 705  IOD A I   1 
HETATM 8461 I I   . IOD I 4 .   ? 12.780  20.915  41.836  0.50 70.80  ? 706  IOD A I   1 
HETATM 8462 I I   . IOD J 4 .   ? 19.101  35.238  -2.857  0.70 64.26  ? 707  IOD A I   1 
HETATM 8463 I I   . IOD K 4 .   ? 10.874  22.717  6.768   0.30 53.75  ? 708  IOD A I   1 
HETATM 8464 N N1  . NWA L 5 .   ? 26.828  19.282  14.848  1.00 47.50  ? 709  NWA A N1  1 
HETATM 8465 C C2  . NWA L 5 .   ? 27.584  18.677  13.726  1.00 46.99  ? 709  NWA A C2  1 
HETATM 8466 C C3  . NWA L 5 .   ? 27.642  17.144  13.663  1.00 47.33  ? 709  NWA A C3  1 
HETATM 8467 C C5  . NWA L 5 .   ? 28.862  15.269  12.319  1.00 46.89  ? 709  NWA A C5  1 
HETATM 8468 O O7  . NWA L 5 .   ? 29.567  14.907  13.499  1.00 43.38  ? 709  NWA A O7  1 
HETATM 8469 C C6  . NWA L 5 .   ? 29.754  14.989  11.103  1.00 42.82  ? 709  NWA A C6  1 
HETATM 8470 C C8  . NWA L 5 .   ? 26.934  20.749  14.694  1.00 48.25  ? 709  NWA A C8  1 
HETATM 8471 C C9  . NWA L 5 .   ? 27.414  18.947  16.136  1.00 45.11  ? 709  NWA A C9  1 
HETATM 8472 C C10 . NWA L 5 .   ? 25.403  18.886  14.824  1.00 47.66  ? 709  NWA A C10 1 
HETATM 8473 C C4  . NWA L 5 .   ? 28.385  16.740  12.383  1.00 46.24  ? 709  NWA A C4  1 
HETATM 8474 O O7  . CHH M 6 .   ? 31.747  21.419  8.936   0.80 71.87  ? 710  CHH A O7  1 
HETATM 8475 C C5  . CHH M 6 .   ? 32.312  22.354  9.493   0.80 72.58  ? 710  CHH A C5  1 
HETATM 8476 C C6  . CHH M 6 .   ? 31.489  23.303  10.302  0.80 72.21  ? 710  CHH A C6  1 
HETATM 8477 C C4  . CHH M 6 .   ? 33.832  22.520  9.370   0.80 72.80  ? 710  CHH A C4  1 
HETATM 8478 C C3  . CHH M 6 .   ? 34.296  23.944  9.078   0.80 73.38  ? 710  CHH A C3  1 
HETATM 8479 C C2  . CHH M 6 .   ? 35.825  23.997  8.982   0.80 73.71  ? 710  CHH A C2  1 
HETATM 8480 N N1  . CHH M 6 .   ? 36.347  25.158  8.228   0.80 74.36  ? 710  CHH A N1  1 
HETATM 8481 C C9  . CHH M 6 .   ? 35.647  26.380  8.636   0.80 75.44  ? 710  CHH A C9  1 
HETATM 8482 C C10 . CHH M 6 .   ? 36.185  24.947  6.786   0.80 74.24  ? 710  CHH A C10 1 
HETATM 8483 C C8  . CHH M 6 .   ? 37.778  25.354  8.509   0.80 73.99  ? 710  CHH A C8  1 
HETATM 8484 O O1  . P6G N 7 .   ? 15.770  5.719   -11.727 1.00 74.18  ? 711  P6G A O1  1 
HETATM 8485 C C2  . P6G N 7 .   ? 16.903  6.335   -11.078 1.00 73.78  ? 711  P6G A C2  1 
HETATM 8486 C C3  . P6G N 7 .   ? 18.423  6.059   -11.231 1.00 73.26  ? 711  P6G A C3  1 
HETATM 8487 O O4  . P6G N 7 .   ? 19.094  5.363   -10.001 1.00 71.95  ? 711  P6G A O4  1 
HETATM 8488 C C5  . P6G N 7 .   ? 19.177  3.928   -10.114 1.00 70.08  ? 711  P6G A C5  1 
HETATM 8489 C C6  . P6G N 7 .   ? 20.525  3.580   -10.490 1.00 66.89  ? 711  P6G A C6  1 
HETATM 8490 O O7  . P6G N 7 .   ? 21.303  4.644   -11.250 1.00 64.67  ? 711  P6G A O7  1 
HETATM 8491 C C8  . P6G N 7 .   ? 22.504  4.192   -11.879 1.00 61.13  ? 711  P6G A C8  1 
HETATM 8492 C C9  . P6G N 7 .   ? 22.575  4.720   -13.327 1.00 56.05  ? 711  P6G A C9  1 
HETATM 8493 O O10 . P6G N 7 .   ? 22.887  6.288   -13.486 1.00 53.34  ? 711  P6G A O10 1 
HETATM 8494 C C11 . P6G N 7 .   ? 23.952  6.734   -14.281 1.00 47.29  ? 711  P6G A C11 1 
HETATM 8495 C C12 . P6G N 7 .   ? 23.802  8.164   -14.181 1.00 54.78  ? 711  P6G A C12 1 
HETATM 8496 O O13 . P6G N 7 .   ? 22.385  8.819   -14.489 1.00 58.11  ? 711  P6G A O13 1 
HETATM 8497 C C14 . P6G N 7 .   ? 22.386  9.799   -15.593 1.00 60.00  ? 711  P6G A C14 1 
HETATM 8498 C C15 . P6G N 7 .   ? 21.408  10.869  -15.505 1.00 60.24  ? 711  P6G A C15 1 
HETATM 8499 O O16 . P6G N 7 .   ? 19.987  10.343  -15.127 1.00 66.05  ? 711  P6G A O16 1 
HETATM 8500 C C17 . P6G N 7 .   ? 18.907  11.272  -14.813 1.00 67.65  ? 711  P6G A C17 1 
HETATM 8501 C C18 . P6G N 7 .   ? 17.777  10.522  -14.366 1.00 68.47  ? 711  P6G A C18 1 
HETATM 8502 O O19 . P6G N 7 .   ? 17.394  10.582  -12.811 1.00 67.79  ? 711  P6G A O19 1 
HETATM 8503 C C1  . NAG O 3 .   ? 5.634   -17.807 -22.281 1.00 86.18  ? 1601 NAG B C1  1 
HETATM 8504 C C2  . NAG O 3 .   ? 6.621   -18.400 -21.261 1.00 90.11  ? 1601 NAG B C2  1 
HETATM 8505 C C3  . NAG O 3 .   ? 7.997   -18.601 -21.896 1.00 90.25  ? 1601 NAG B C3  1 
HETATM 8506 C C4  . NAG O 3 .   ? 7.864   -19.495 -23.125 1.00 90.53  ? 1601 NAG B C4  1 
HETATM 8507 C C5  . NAG O 3 .   ? 6.859   -18.925 -24.136 1.00 89.55  ? 1601 NAG B C5  1 
HETATM 8508 C C6  . NAG O 3 .   ? 6.587   -19.935 -25.273 1.00 89.22  ? 1601 NAG B C6  1 
HETATM 8509 C C7  . NAG O 3 .   ? 7.026   -17.968 -18.853 1.00 94.29  ? 1601 NAG B C7  1 
HETATM 8510 C C8  . NAG O 3 .   ? 8.325   -17.429 -18.312 1.00 94.52  ? 1601 NAG B C8  1 
HETATM 8511 N N2  . NAG O 3 .   ? 6.680   -17.542 -20.077 1.00 92.56  ? 1601 NAG B N2  1 
HETATM 8512 O O3  . NAG O 3 .   ? 8.902   -19.181 -20.975 1.00 90.42  ? 1601 NAG B O3  1 
HETATM 8513 O O4  . NAG O 3 .   ? 9.130   -19.711 -23.728 1.00 91.55  ? 1601 NAG B O4  1 
HETATM 8514 O O5  . NAG O 3 .   ? 5.631   -18.532 -23.515 1.00 88.06  ? 1601 NAG B O5  1 
HETATM 8515 O O6  . NAG O 3 .   ? 5.310   -20.550 -25.198 1.00 88.33  ? 1601 NAG B O6  1 
HETATM 8516 O O7  . NAG O 3 .   ? 6.339   -18.742 -18.174 1.00 94.94  ? 1601 NAG B O7  1 
HETATM 8517 I I   . IOD P 4 .   ? 23.089  -5.568  -33.690 0.60 54.52  ? 1602 IOD B I   1 
HETATM 8518 I I   . IOD Q 4 .   ? -3.184  -0.024  -22.341 0.30 57.88  ? 1603 IOD B I   1 
HETATM 8519 I I   . IOD R 4 .   ? -20.506 5.834   -52.735 0.50 88.09  ? 1604 IOD B I   1 
HETATM 8520 I I   . IOD S 4 .   ? 3.967   0.788   -68.731 0.50 47.63  ? 1605 IOD B I   1 
HETATM 8521 I I   . IOD T 4 .   ? 33.717  2.154   -46.570 0.60 71.71  ? 1606 IOD B I   1 
HETATM 8522 I I   . IOD U 4 .   ? 3.177   -15.795 -17.476 0.60 79.83  ? 1607 IOD B I   1 
HETATM 8523 I I   . IOD V 4 .   ? 13.292  -7.004  -34.129 0.30 72.75  ? 1608 IOD B I   1 
HETATM 8524 N N1  . NWA W 5 .   ? 5.450   -2.120  -38.175 1.00 53.94  ? 1609 NWA B N1  1 
HETATM 8525 C C2  . NWA W 5 .   ? 6.895   -2.118  -37.813 1.00 54.04  ? 1609 NWA B C2  1 
HETATM 8526 C C3  . NWA W 5 .   ? 7.568   -0.734  -37.782 1.00 52.50  ? 1609 NWA B C3  1 
HETATM 8527 C C5  . NWA W 5 .   ? 9.875   0.377   -37.620 1.00 50.68  ? 1609 NWA B C5  1 
HETATM 8528 O O7  . NWA W 5 .   ? 9.850   0.656   -39.016 1.00 45.88  ? 1609 NWA B O7  1 
HETATM 8529 C C6  . NWA W 5 .   ? 11.331  0.214   -37.180 1.00 47.96  ? 1609 NWA B C6  1 
HETATM 8530 C C8  . NWA W 5 .   ? 4.885   -3.428  -37.794 1.00 54.03  ? 1609 NWA B C8  1 
HETATM 8531 C C9  . NWA W 5 .   ? 5.265   -1.934  -39.614 1.00 52.47  ? 1609 NWA B C9  1 
HETATM 8532 C C10 . NWA W 5 .   ? 4.719   -1.051  -37.495 1.00 53.26  ? 1609 NWA B C10 1 
HETATM 8533 C C4  . NWA W 5 .   ? 9.019   -0.867  -37.291 1.00 51.49  ? 1609 NWA B C4  1 
HETATM 8534 O O7  . CHH X 6 .   ? 11.469  -6.783  -35.839 0.60 76.85  ? 1610 CHH B O7  1 
HETATM 8535 C C5  . CHH X 6 .   ? 11.300  -7.877  -36.357 0.60 76.74  ? 1610 CHH B C5  1 
HETATM 8536 C C6  . CHH X 6 .   ? 9.901   -8.326  -36.645 0.60 76.96  ? 1610 CHH B C6  1 
HETATM 8537 C C4  . CHH X 6 .   ? 12.498  -8.762  -36.708 0.60 76.82  ? 1610 CHH B C4  1 
HETATM 8538 C C3  . CHH X 6 .   ? 12.111  -10.088 -37.365 0.60 76.91  ? 1610 CHH B C3  1 
HETATM 8539 C C2  . CHH X 6 .   ? 13.338  -10.855 -37.869 0.60 77.18  ? 1610 CHH B C2  1 
HETATM 8540 N N1  . CHH X 6 .   ? 13.653  -12.071 -37.097 0.60 77.79  ? 1610 CHH B N1  1 
HETATM 8541 C C9  . CHH X 6 .   ? 12.490  -12.960 -37.026 0.60 77.96  ? 1610 CHH B C9  1 
HETATM 8542 C C10 . CHH X 6 .   ? 14.107  -11.696 -35.748 0.60 77.86  ? 1610 CHH B C10 1 
HETATM 8543 C C8  . CHH X 6 .   ? 14.723  -12.821 -37.769 0.60 77.58  ? 1610 CHH B C8  1 
HETATM 8544 O O   . HOH Y 8 .   ? 15.233  31.537  3.625   1.00 61.66  ? 801  HOH A O   1 
HETATM 8545 O O   . HOH Y 8 .   ? 40.181  16.551  12.314  1.00 52.09  ? 802  HOH A O   1 
HETATM 8546 O O   . HOH Y 8 .   ? 39.497  -0.232  27.306  1.00 62.88  ? 803  HOH A O   1 
HETATM 8547 O O   . HOH Y 8 .   ? 46.636  -1.487  16.937  1.00 61.67  ? 804  HOH A O   1 
HETATM 8548 O O   . HOH Y 8 .   ? 40.986  12.643  -3.279  1.00 46.34  ? 805  HOH A O   1 
HETATM 8549 O O   . HOH Y 8 .   ? 18.235  -9.530  17.357  1.00 67.83  ? 806  HOH A O   1 
HETATM 8550 O O   . HOH Y 8 .   ? 15.169  1.401   1.511   1.00 56.31  ? 807  HOH A O   1 
HETATM 8551 O O   . HOH Y 8 .   ? 32.895  23.689  13.517  1.00 52.68  ? 808  HOH A O   1 
HETATM 8552 O O   . HOH Y 8 .   ? 45.302  0.979   16.175  1.00 63.53  ? 809  HOH A O   1 
HETATM 8553 O O   . HOH Y 8 .   ? 26.627  5.274   0.616   1.00 54.43  ? 810  HOH A O   1 
HETATM 8554 O O   . HOH Y 8 .   ? 38.598  4.495   34.562  1.00 60.57  ? 811  HOH A O   1 
HETATM 8555 O O   . HOH Y 8 .   ? 28.694  18.148  19.818  1.00 37.55  ? 812  HOH A O   1 
HETATM 8556 O O   . HOH Y 8 .   ? 8.459   28.888  19.677  1.00 62.96  ? 813  HOH A O   1 
HETATM 8557 O O   . HOH Y 8 .   ? 14.557  28.818  22.565  1.00 78.26  ? 814  HOH A O   1 
HETATM 8558 O O   . HOH Y 8 .   ? 50.284  2.052   21.810  1.00 72.33  ? 815  HOH A O   1 
HETATM 8559 O O   . HOH Y 8 .   ? 30.532  16.010  1.061   1.00 50.20  ? 816  HOH A O   1 
HETATM 8560 O O   . HOH Y 8 .   ? 3.778   11.589  11.119  1.00 55.87  ? 817  HOH A O   1 
HETATM 8561 O O   . HOH Y 8 .   ? 13.980  4.842   36.922  1.00 60.30  ? 818  HOH A O   1 
HETATM 8562 O O   . HOH Y 8 .   ? 31.246  15.018  51.500  1.00 67.90  ? 819  HOH A O   1 
HETATM 8563 O O   . HOH Y 8 .   ? 8.122   -3.803  16.545  1.00 58.65  ? 820  HOH A O   1 
HETATM 8564 O O   . HOH Y 8 .   ? 16.568  -8.880  10.251  1.00 65.30  ? 821  HOH A O   1 
HETATM 8565 O O   . HOH Y 8 .   ? 26.855  -6.272  32.603  1.00 63.19  ? 822  HOH A O   1 
HETATM 8566 O O   . HOH Y 8 .   ? 17.544  20.752  1.725   1.00 57.06  ? 823  HOH A O   1 
HETATM 8567 O O   . HOH Y 8 .   ? 9.508   6.238   1.026   1.00 58.57  ? 824  HOH A O   1 
HETATM 8568 O O   . HOH Y 8 .   ? 29.383  27.295  -6.002  1.00 45.40  ? 825  HOH A O   1 
HETATM 8569 O O   . HOH Y 8 .   ? 49.858  0.398   16.274  1.00 78.05  ? 826  HOH A O   1 
HETATM 8570 O O   . HOH Y 8 .   ? 9.716   4.780   28.004  1.00 66.86  ? 827  HOH A O   1 
HETATM 8571 O O   . HOH Y 8 .   ? 39.609  20.189  16.316  1.00 40.80  ? 828  HOH A O   1 
HETATM 8572 O O   . HOH Y 8 .   ? 39.893  6.171   46.483  1.00 60.11  ? 829  HOH A O   1 
HETATM 8573 O O   . HOH Y 8 .   ? 16.876  -2.702  33.947  1.00 57.81  ? 830  HOH A O   1 
HETATM 8574 O O   . HOH Y 8 .   ? 19.058  -6.400  32.803  1.00 66.65  ? 831  HOH A O   1 
HETATM 8575 O O   . HOH Y 8 .   ? 33.795  4.927   6.428   1.00 46.97  ? 832  HOH A O   1 
HETATM 8576 O O   . HOH Y 8 .   ? 42.629  27.542  14.739  1.00 65.96  ? 833  HOH A O   1 
HETATM 8577 O O   . HOH Y 8 .   ? 46.877  17.750  1.096   1.00 52.61  ? 834  HOH A O   1 
HETATM 8578 O O   . HOH Y 8 .   ? 40.623  12.408  33.407  1.00 45.62  ? 835  HOH A O   1 
HETATM 8579 O O   . HOH Y 8 .   ? 38.807  3.678   45.190  1.00 60.03  ? 836  HOH A O   1 
HETATM 8580 O O   . HOH Y 8 .   ? 41.418  28.035  20.849  1.00 58.32  ? 837  HOH A O   1 
HETATM 8581 O O   . HOH Y 8 .   ? 3.213   6.033   18.263  1.00 57.32  ? 838  HOH A O   1 
HETATM 8582 O O   . HOH Y 8 .   ? 45.207  10.827  38.194  1.00 71.61  ? 839  HOH A O   1 
HETATM 8583 O O   . HOH Y 8 .   ? 48.453  4.397   27.015  1.00 63.47  ? 840  HOH A O   1 
HETATM 8584 O O   . HOH Y 8 .   ? 28.723  -0.376  29.464  1.00 49.46  ? 841  HOH A O   1 
HETATM 8585 O O   . HOH Y 8 .   ? 43.096  20.241  34.101  1.00 78.50  ? 842  HOH A O   1 
HETATM 8586 O O   . HOH Y 8 .   ? 17.482  14.903  28.791  1.00 43.76  ? 843  HOH A O   1 
HETATM 8587 O O   . HOH Y 8 .   ? 48.653  12.034  32.821  1.00 61.28  ? 844  HOH A O   1 
HETATM 8588 O O   . HOH Y 8 .   ? 19.553  -6.007  28.193  1.00 53.27  ? 845  HOH A O   1 
HETATM 8589 O O   . HOH Y 8 .   ? 44.871  17.528  36.152  1.00 79.60  ? 846  HOH A O   1 
HETATM 8590 O O   . HOH Y 8 .   ? 8.084   11.283  27.649  1.00 62.29  ? 847  HOH A O   1 
HETATM 8591 O O   . HOH Y 8 .   ? 12.156  14.067  40.188  1.00 59.62  ? 848  HOH A O   1 
HETATM 8592 O O   . HOH Y 8 .   ? 46.663  10.667  10.873  1.00 45.74  ? 849  HOH A O   1 
HETATM 8593 O O   . HOH Y 8 .   ? 26.013  15.561  18.199  1.00 45.50  ? 850  HOH A O   1 
HETATM 8594 O O   . HOH Y 8 .   ? 38.848  29.408  15.807  1.00 71.25  ? 851  HOH A O   1 
HETATM 8595 O O   . HOH Y 8 .   ? 11.429  2.630   -6.343  1.00 56.04  ? 852  HOH A O   1 
HETATM 8596 O O   . HOH Y 8 .   ? 36.288  3.191   45.822  1.00 45.45  ? 853  HOH A O   1 
HETATM 8597 O O   . HOH Y 8 .   ? 19.058  20.118  18.547  1.00 42.12  ? 854  HOH A O   1 
HETATM 8598 O O   . HOH Y 8 .   ? 30.820  20.859  16.356  1.00 48.31  ? 855  HOH A O   1 
HETATM 8599 O O   . HOH Y 8 .   ? 43.736  18.772  16.322  1.00 47.72  ? 856  HOH A O   1 
HETATM 8600 O O   . HOH Y 8 .   ? 25.045  22.580  29.711  1.00 47.45  ? 857  HOH A O   1 
HETATM 8601 O O   . HOH Y 8 .   ? 46.059  12.654  22.466  1.00 43.37  ? 858  HOH A O   1 
HETATM 8602 O O   . HOH Y 8 .   ? 18.789  11.630  13.174  1.00 46.69  ? 859  HOH A O   1 
HETATM 8603 O O   . HOH Y 8 .   ? 27.424  7.626   -0.403  1.00 52.96  ? 860  HOH A O   1 
HETATM 8604 O O   . HOH Y 8 .   ? 23.772  8.917   48.249  1.00 47.59  ? 861  HOH A O   1 
HETATM 8605 O O   . HOH Y 8 .   ? 48.051  21.591  26.151  1.00 50.11  ? 862  HOH A O   1 
HETATM 8606 O O   . HOH Y 8 .   ? 21.727  20.098  7.477   1.00 38.98  ? 863  HOH A O   1 
HETATM 8607 O O   . HOH Y 8 .   ? 40.748  26.348  19.170  1.00 54.45  ? 864  HOH A O   1 
HETATM 8608 O O   . HOH Y 8 .   ? 13.761  29.703  -8.359  1.00 52.54  ? 865  HOH A O   1 
HETATM 8609 O O   . HOH Y 8 .   ? 58.570  14.743  23.023  1.00 63.95  ? 866  HOH A O   1 
HETATM 8610 O O   . HOH Y 8 .   ? 37.991  15.076  12.480  1.00 40.75  ? 867  HOH A O   1 
HETATM 8611 O O   . HOH Y 8 .   ? 25.568  15.266  28.012  1.00 41.76  ? 868  HOH A O   1 
HETATM 8612 O O   . HOH Y 8 .   ? 18.017  14.744  4.003   1.00 45.30  ? 869  HOH A O   1 
HETATM 8613 O O   . HOH Y 8 .   ? 13.285  8.374   41.949  1.00 66.68  ? 870  HOH A O   1 
HETATM 8614 O O   . HOH Y 8 .   ? 32.297  0.657   41.617  1.00 45.70  ? 871  HOH A O   1 
HETATM 8615 O O   . HOH Y 8 .   ? 46.033  15.016  24.282  1.00 48.94  ? 872  HOH A O   1 
HETATM 8616 O O   . HOH Y 8 .   ? 34.188  23.394  18.317  1.00 47.93  ? 873  HOH A O   1 
HETATM 8617 O O   . HOH Y 8 .   ? 16.422  -3.551  29.803  1.00 58.78  ? 874  HOH A O   1 
HETATM 8618 O O   . HOH Y 8 .   ? 5.528   11.267  13.947  1.00 51.87  ? 875  HOH A O   1 
HETATM 8619 O O   . HOH Y 8 .   ? 17.437  23.585  0.906   1.00 58.84  ? 876  HOH A O   1 
HETATM 8620 O O   . HOH Y 8 .   ? 50.874  7.163   3.087   1.00 66.03  ? 877  HOH A O   1 
HETATM 8621 O O   . HOH Y 8 .   ? 36.486  23.897  33.153  1.00 72.90  ? 878  HOH A O   1 
HETATM 8622 O O   . HOH Y 8 .   ? 36.580  19.509  -4.792  1.00 55.56  ? 879  HOH A O   1 
HETATM 8623 O O   . HOH Y 8 .   ? 52.684  9.551   21.603  1.00 50.01  ? 880  HOH A O   1 
HETATM 8624 O O   . HOH Y 8 .   ? 17.051  2.770   0.363   1.00 48.97  ? 881  HOH A O   1 
HETATM 8625 O O   . HOH Y 8 .   ? 46.513  4.261   35.328  1.00 71.89  ? 882  HOH A O   1 
HETATM 8626 O O   . HOH Y 8 .   ? 34.416  23.437  -7.427  1.00 53.25  ? 883  HOH A O   1 
HETATM 8627 O O   . HOH Y 8 .   ? 14.675  -5.750  11.160  1.00 55.71  ? 884  HOH A O   1 
HETATM 8628 O O   . HOH Y 8 .   ? 29.276  12.220  24.583  1.00 38.69  ? 885  HOH A O   1 
HETATM 8629 O O   . HOH Y 8 .   ? 43.113  9.516   11.134  1.00 43.27  ? 886  HOH A O   1 
HETATM 8630 O O   . HOH Y 8 .   ? 27.829  25.818  23.416  1.00 54.58  ? 887  HOH A O   1 
HETATM 8631 O O   . HOH Y 8 .   ? 36.542  16.786  38.144  1.00 49.21  ? 888  HOH A O   1 
HETATM 8632 O O   . HOH Y 8 .   ? 11.368  0.703   10.619  1.00 49.00  ? 889  HOH A O   1 
HETATM 8633 O O   . HOH Y 8 .   ? 35.704  19.511  4.579   1.00 58.70  ? 890  HOH A O   1 
HETATM 8634 O O   . HOH Y 8 .   ? 48.157  1.334   14.239  1.00 58.55  ? 891  HOH A O   1 
HETATM 8635 O O   . HOH Y 8 .   ? 20.071  32.997  10.127  1.00 58.23  ? 892  HOH A O   1 
HETATM 8636 O O   . HOH Y 8 .   ? 45.353  8.185   29.613  1.00 48.59  ? 893  HOH A O   1 
HETATM 8637 O O   . HOH Y 8 .   ? 24.837  20.138  11.978  1.00 62.68  ? 894  HOH A O   1 
HETATM 8638 O O   . HOH Y 8 .   ? 42.154  25.608  12.387  1.00 65.05  ? 895  HOH A O   1 
HETATM 8639 O O   . HOH Y 8 .   ? 30.956  25.626  -12.696 1.00 53.28  ? 896  HOH A O   1 
HETATM 8640 O O   . HOH Y 8 .   ? 21.164  14.974  12.965  1.00 40.35  ? 897  HOH A O   1 
HETATM 8641 O O   . HOH Y 8 .   ? 52.252  16.407  24.447  1.00 49.95  ? 898  HOH A O   1 
HETATM 8642 O O   . HOH Y 8 .   ? 34.280  27.781  10.858  1.00 56.65  ? 899  HOH A O   1 
HETATM 8643 O O   . HOH Y 8 .   ? 44.362  1.899   18.660  1.00 58.32  ? 900  HOH A O   1 
HETATM 8644 O O   . HOH Y 8 .   ? 46.781  8.459   27.054  1.00 68.78  ? 901  HOH A O   1 
HETATM 8645 O O   . HOH Y 8 .   ? 43.622  0.657   6.110   1.00 47.89  ? 902  HOH A O   1 
HETATM 8646 O O   . HOH Y 8 .   ? 17.648  21.852  -11.803 1.00 57.24  ? 903  HOH A O   1 
HETATM 8647 O O   . HOH Y 8 .   ? 26.769  8.788   7.584   1.00 50.55  ? 904  HOH A O   1 
HETATM 8648 O O   . HOH Y 8 .   ? 17.012  25.002  22.402  1.00 68.10  ? 905  HOH A O   1 
HETATM 8649 O O   . HOH Y 8 .   ? 14.133  20.992  14.251  1.00 49.55  ? 906  HOH A O   1 
HETATM 8650 O O   . HOH Y 8 .   ? 15.948  25.336  17.711  1.00 58.37  ? 907  HOH A O   1 
HETATM 8651 O O   . HOH Y 8 .   ? 36.053  27.383  25.504  1.00 52.22  ? 908  HOH A O   1 
HETATM 8652 O O   . HOH Y 8 .   ? 35.540  9.487   0.749   1.00 51.61  ? 909  HOH A O   1 
HETATM 8653 O O   . HOH Y 8 .   ? 30.268  30.808  13.946  1.00 57.68  ? 910  HOH A O   1 
HETATM 8654 O O   . HOH Y 8 .   ? 29.678  20.580  18.685  1.00 38.82  ? 911  HOH A O   1 
HETATM 8655 O O   . HOH Y 8 .   ? 37.957  8.549   47.606  1.00 49.69  ? 912  HOH A O   1 
HETATM 8656 O O   . HOH Y 8 .   ? 16.932  19.284  -0.601  1.00 53.74  ? 913  HOH A O   1 
HETATM 8657 O O   . HOH Y 8 .   ? 32.410  16.939  32.429  1.00 44.16  ? 914  HOH A O   1 
HETATM 8658 O O   . HOH Y 8 .   ? 43.716  24.481  9.924   1.00 63.42  ? 915  HOH A O   1 
HETATM 8659 O O   . HOH Y 8 .   ? 37.047  17.847  44.085  1.00 63.70  ? 916  HOH A O   1 
HETATM 8660 O O   . HOH Y 8 .   ? 19.539  0.646   27.947  1.00 49.27  ? 917  HOH A O   1 
HETATM 8661 O O   . HOH Y 8 .   ? 49.537  6.391   28.013  1.00 71.53  ? 918  HOH A O   1 
HETATM 8662 O O   . HOH Y 8 .   ? 41.691  13.936  31.459  1.00 44.27  ? 919  HOH A O   1 
HETATM 8663 O O   . HOH Y 8 .   ? 29.740  25.740  15.582  1.00 48.04  ? 920  HOH A O   1 
HETATM 8664 O O   . HOH Y 8 .   ? 34.880  15.823  -7.398  1.00 55.60  ? 921  HOH A O   1 
HETATM 8665 O O   . HOH Y 8 .   ? 36.551  12.696  6.863   1.00 42.04  ? 922  HOH A O   1 
HETATM 8666 O O   . HOH Y 8 .   ? 19.385  27.854  16.442  1.00 52.26  ? 923  HOH A O   1 
HETATM 8667 O O   . HOH Y 8 .   ? 47.450  -0.271  12.125  1.00 64.44  ? 924  HOH A O   1 
HETATM 8668 O O   . HOH Y 8 .   ? 9.913   25.380  25.823  1.00 49.12  ? 925  HOH A O   1 
HETATM 8669 O O   . HOH Y 8 .   ? 7.751   13.969  35.111  1.00 61.05  ? 926  HOH A O   1 
HETATM 8670 O O   . HOH Y 8 .   ? 37.331  9.476   4.367   1.00 43.49  ? 927  HOH A O   1 
HETATM 8671 O O   . HOH Y 8 .   ? 34.646  -2.777  33.073  1.00 72.37  ? 928  HOH A O   1 
HETATM 8672 O O   . HOH Y 8 .   ? 12.318  10.354  37.771  1.00 57.75  ? 929  HOH A O   1 
HETATM 8673 O O   . HOH Y 8 .   ? 37.367  17.201  -6.004  1.00 63.30  ? 930  HOH A O   1 
HETATM 8674 O O   . HOH Y 8 .   ? 47.262  7.745   17.869  1.00 50.12  ? 931  HOH A O   1 
HETATM 8675 O O   . HOH Y 8 .   ? 41.554  19.068  18.097  1.00 46.57  ? 932  HOH A O   1 
HETATM 8676 O O   . HOH Y 8 .   ? 25.332  4.186   45.941  1.00 46.83  ? 933  HOH A O   1 
HETATM 8677 O O   . HOH Y 8 .   ? 18.248  1.301   -2.903  1.00 57.02  ? 934  HOH A O   1 
HETATM 8678 O O   . HOH Y 8 .   ? 9.991   -3.414  6.743   1.00 55.92  ? 935  HOH A O   1 
HETATM 8679 O O   . HOH Y 8 .   ? 22.344  29.192  -14.592 1.00 64.83  ? 936  HOH A O   1 
HETATM 8680 O O   . HOH Y 8 .   ? 24.698  13.584  55.207  1.00 56.65  ? 937  HOH A O   1 
HETATM 8681 O O   . HOH Y 8 .   ? 2.240   26.944  22.030  1.00 61.03  ? 938  HOH A O   1 
HETATM 8682 O O   . HOH Y 8 .   ? 40.746  -1.977  24.033  1.00 59.61  ? 939  HOH A O   1 
HETATM 8683 O O   . HOH Y 8 .   ? 17.125  13.091  -2.980  1.00 63.25  ? 940  HOH A O   1 
HETATM 8684 O O   . HOH Y 8 .   ? 52.244  13.595  3.533   1.00 51.98  ? 941  HOH A O   1 
HETATM 8685 O O   . HOH Y 8 .   ? 33.656  18.210  38.516  1.00 55.87  ? 942  HOH A O   1 
HETATM 8686 O O   . HOH Y 8 .   ? 20.765  19.127  47.728  1.00 54.80  ? 943  HOH A O   1 
HETATM 8687 O O   . HOH Y 8 .   ? 27.698  -1.442  37.332  1.00 48.98  ? 944  HOH A O   1 
HETATM 8688 O O   . HOH Y 8 .   ? 27.398  32.084  -11.637 1.00 62.48  ? 945  HOH A O   1 
HETATM 8689 O O   . HOH Y 8 .   ? 4.966   23.943  16.741  1.00 52.52  ? 946  HOH A O   1 
HETATM 8690 O O   . HOH Y 8 .   ? 42.545  7.456   14.051  1.00 50.37  ? 947  HOH A O   1 
HETATM 8691 O O   . HOH Y 8 .   ? 20.547  0.374   -2.949  1.00 66.99  ? 948  HOH A O   1 
HETATM 8692 O O   . HOH Y 8 .   ? 10.033  10.343  3.357   1.00 59.17  ? 949  HOH A O   1 
HETATM 8693 O O   . HOH Y 8 .   ? 58.807  21.347  8.365   1.00 57.36  ? 950  HOH A O   1 
HETATM 8694 O O   . HOH Y 8 .   ? 25.110  18.435  28.751  1.00 47.71  ? 951  HOH A O   1 
HETATM 8695 O O   . HOH Y 8 .   ? 23.541  33.102  -4.069  1.00 62.96  ? 952  HOH A O   1 
HETATM 8696 O O   . HOH Y 8 .   ? 42.664  -0.980  19.297  1.00 59.15  ? 953  HOH A O   1 
HETATM 8697 O O   . HOH Y 8 .   ? 46.402  7.981   0.471   1.00 61.55  ? 954  HOH A O   1 
HETATM 8698 O O   . HOH Y 8 .   ? 35.067  17.437  24.455  1.00 45.85  ? 955  HOH A O   1 
HETATM 8699 O O   . HOH Y 8 .   ? 31.840  16.902  29.566  1.00 41.22  ? 956  HOH A O   1 
HETATM 8700 O O   . HOH Y 8 .   ? 30.369  19.386  -11.753 1.00 62.46  ? 957  HOH A O   1 
HETATM 8701 O O   . HOH Y 8 .   ? 36.684  -4.924  14.119  1.00 53.20  ? 958  HOH A O   1 
HETATM 8702 O O   . HOH Y 8 .   ? 50.137  17.580  25.872  1.00 56.52  ? 959  HOH A O   1 
HETATM 8703 O O   . HOH Y 8 .   ? 41.805  13.396  35.879  1.00 56.78  ? 960  HOH A O   1 
HETATM 8704 O O   . HOH Y 8 .   ? 30.357  20.705  13.331  1.00 64.40  ? 961  HOH A O   1 
HETATM 8705 O O   . HOH Y 8 .   ? 40.661  19.990  34.964  1.00 60.37  ? 962  HOH A O   1 
HETATM 8706 O O   . HOH Y 8 .   ? 29.239  2.243   45.636  1.00 45.56  ? 963  HOH A O   1 
HETATM 8707 O O   . HOH Y 8 .   ? 11.261  27.568  12.432  1.00 65.98  ? 964  HOH A O   1 
HETATM 8708 O O   . HOH Y 8 .   ? 33.027  14.506  17.131  1.00 40.79  ? 965  HOH A O   1 
HETATM 8709 O O   . HOH Y 8 .   ? 22.271  4.142   44.224  1.00 60.13  ? 966  HOH A O   1 
HETATM 8710 O O   . HOH Y 8 .   ? 30.808  10.762  48.722  1.00 58.87  ? 967  HOH A O   1 
HETATM 8711 O O   . HOH Y 8 .   ? 32.995  19.283  28.996  1.00 45.53  ? 968  HOH A O   1 
HETATM 8712 O O   . HOH Y 8 .   ? 25.063  9.584   52.347  1.00 57.78  ? 969  HOH A O   1 
HETATM 8713 O O   . HOH Y 8 .   ? 25.710  33.787  -5.703  1.00 62.05  ? 970  HOH A O   1 
HETATM 8714 O O   . HOH Y 8 .   ? 53.745  8.033   28.899  1.00 68.81  ? 971  HOH A O   1 
HETATM 8715 O O   . HOH Y 8 .   ? 32.829  -7.334  13.731  1.00 70.33  ? 972  HOH A O   1 
HETATM 8716 O O   . HOH Y 8 .   ? 22.108  -6.110  36.641  1.00 67.82  ? 973  HOH A O   1 
HETATM 8717 O O   . HOH Y 8 .   ? 44.049  11.392  9.330   1.00 49.33  ? 974  HOH A O   1 
HETATM 8718 O O   . HOH Y 8 .   ? 19.646  14.647  1.809   1.00 57.07  ? 975  HOH A O   1 
HETATM 8719 O O   . HOH Y 8 .   ? 42.381  17.377  23.764  1.00 47.10  ? 976  HOH A O   1 
HETATM 8720 O O   . HOH Y 8 .   ? 43.438  15.502  24.929  1.00 45.39  ? 977  HOH A O   1 
HETATM 8721 O O   . HOH Y 8 .   ? 43.668  12.472  45.518  1.00 68.76  ? 978  HOH A O   1 
HETATM 8722 O O   . HOH Y 8 .   ? 32.111  21.797  21.388  1.00 46.68  ? 979  HOH A O   1 
HETATM 8723 O O   . HOH Y 8 .   ? 33.405  11.982  -2.517  1.00 42.79  ? 980  HOH A O   1 
HETATM 8724 O O   . HOH Y 8 .   ? 34.130  -1.519  41.732  1.00 58.11  ? 981  HOH A O   1 
HETATM 8725 O O   . HOH Y 8 .   ? 30.806  8.081   6.665   1.00 47.49  ? 982  HOH A O   1 
HETATM 8726 O O   . HOH Y 8 .   ? 25.386  29.321  -14.761 1.00 53.36  ? 983  HOH A O   1 
HETATM 8727 O O   . HOH Y 8 .   ? 37.378  2.342   5.287   1.00 58.45  ? 984  HOH A O   1 
HETATM 8728 O O   . HOH Y 8 .   ? 29.074  23.276  35.089  1.00 57.72  ? 985  HOH A O   1 
HETATM 8729 O O   . HOH Y 8 .   ? 48.603  22.272  2.910   1.00 62.80  ? 986  HOH A O   1 
HETATM 8730 O O   . HOH Y 8 .   ? 38.914  5.298   48.819  1.00 61.85  ? 987  HOH A O   1 
HETATM 8731 O O   . HOH Y 8 .   ? 37.718  -9.131  9.888   1.00 69.58  ? 988  HOH A O   1 
HETATM 8732 O O   . HOH Y 8 .   ? 40.912  16.755  21.660  1.00 43.38  ? 989  HOH A O   1 
HETATM 8733 O O   . HOH Y 8 .   ? 43.300  15.786  36.154  1.00 68.98  ? 990  HOH A O   1 
HETATM 8734 O O   . HOH Y 8 .   ? 13.219  -9.208  4.352   1.00 67.81  ? 991  HOH A O   1 
HETATM 8735 O O   . HOH Y 8 .   ? 44.876  11.269  -0.863  1.00 57.97  ? 992  HOH A O   1 
HETATM 8736 O O   . HOH Y 8 .   ? 41.779  27.147  26.783  1.00 59.95  ? 993  HOH A O   1 
HETATM 8737 O O   . HOH Y 8 .   ? 22.676  38.858  -0.904  1.00 73.97  ? 994  HOH A O   1 
HETATM 8738 O O   . HOH Y 8 .   ? 10.844  17.358  33.865  1.00 55.11  ? 995  HOH A O   1 
HETATM 8739 O O   . HOH Y 8 .   ? 38.979  16.287  47.059  1.00 64.39  ? 996  HOH A O   1 
HETATM 8740 O O   . HOH Y 8 .   ? 35.686  7.713   -13.957 1.00 74.73  ? 997  HOH A O   1 
HETATM 8741 O O   . HOH Y 8 .   ? 45.812  10.302  18.315  1.00 55.05  ? 998  HOH A O   1 
HETATM 8742 O O   . HOH Y 8 .   ? 23.736  23.833  23.158  1.00 45.92  ? 999  HOH A O   1 
HETATM 8743 O O   . HOH Y 8 .   ? 25.843  24.890  25.143  1.00 64.63  ? 1000 HOH A O   1 
HETATM 8744 O O   . HOH Y 8 .   ? 19.413  22.371  28.683  1.00 57.75  ? 1001 HOH A O   1 
HETATM 8745 O O   . HOH Y 8 .   ? 0.907   4.644   8.260   1.00 66.84  ? 1002 HOH A O   1 
HETATM 8746 O O   . HOH Y 8 .   ? 23.615  20.398  30.492  1.00 55.23  ? 1003 HOH A O   1 
HETATM 8747 O O   . HOH Y 8 .   ? 19.501  17.667  2.456   1.00 51.18  ? 1004 HOH A O   1 
HETATM 8748 O O   . HOH Y 8 .   ? 8.254   21.546  10.399  1.00 61.66  ? 1005 HOH A O   1 
HETATM 8749 O O   . HOH Y 8 .   ? 30.246  28.796  1.382   1.00 65.03  ? 1006 HOH A O   1 
HETATM 8750 O O   . HOH Y 8 .   ? 1.982   8.103   16.928  1.00 60.91  ? 1007 HOH A O   1 
HETATM 8751 O O   . HOH Y 8 .   ? 27.957  4.388   46.817  1.00 44.24  ? 1008 HOH A O   1 
HETATM 8752 O O   . HOH Y 8 .   ? 15.414  -8.254  6.144   1.00 62.59  ? 1009 HOH A O   1 
HETATM 8753 O O   . HOH Y 8 .   ? 46.315  1.679   3.344   1.00 56.22  ? 1010 HOH A O   1 
HETATM 8754 O O   . HOH Y 8 .   ? 32.841  -10.071 9.965   1.00 72.53  ? 1011 HOH A O   1 
HETATM 8755 O O   . HOH Y 8 .   ? 34.177  6.533   -10.271 1.00 74.22  ? 1012 HOH A O   1 
HETATM 8756 O O   . HOH Y 8 .   ? 30.415  31.660  -7.096  1.00 58.46  ? 1013 HOH A O   1 
HETATM 8757 O O   . HOH Y 8 .   ? 24.978  20.125  -17.222 1.00 60.57  ? 1014 HOH A O   1 
HETATM 8758 O O   . HOH Y 8 .   ? 37.002  -6.581  16.212  1.00 52.93  ? 1015 HOH A O   1 
HETATM 8759 O O   . HOH Y 8 .   ? 13.557  11.961  39.612  1.00 66.82  ? 1016 HOH A O   1 
HETATM 8760 O O   . HOH Y 8 .   ? 22.867  20.080  45.513  1.00 52.28  ? 1017 HOH A O   1 
HETATM 8761 O O   . HOH Y 8 .   ? 37.651  7.713   50.093  1.00 59.39  ? 1018 HOH A O   1 
HETATM 8762 O O   . HOH Y 8 .   ? 39.520  18.619  10.329  1.00 61.15  ? 1019 HOH A O   1 
HETATM 8763 O O   . HOH Y 8 .   ? 2.825   15.564  18.566  1.00 65.39  ? 1020 HOH A O   1 
HETATM 8764 O O   . HOH Y 8 .   ? 40.433  11.102  1.438   1.00 45.48  ? 1021 HOH A O   1 
HETATM 8765 O O   . HOH Y 8 .   ? 5.806   5.108   0.982   1.00 63.91  ? 1022 HOH A O   1 
HETATM 8766 O O   . HOH Y 8 .   ? 45.887  21.631  27.581  1.00 57.53  ? 1023 HOH A O   1 
HETATM 8767 O O   . HOH Y 8 .   ? 40.153  27.509  16.674  1.00 53.33  ? 1024 HOH A O   1 
HETATM 8768 O O   . HOH Y 8 .   ? 38.720  21.609  2.221   1.00 63.69  ? 1025 HOH A O   1 
HETATM 8769 O O   . HOH Y 8 .   ? 12.987  -5.580  -1.792  1.00 67.01  ? 1026 HOH A O   1 
HETATM 8770 O O   . HOH Y 8 .   ? 38.556  12.396  -13.320 1.00 68.21  ? 1027 HOH A O   1 
HETATM 8771 O O   . HOH Y 8 .   ? 39.302  27.975  26.642  1.00 53.90  ? 1028 HOH A O   1 
HETATM 8772 O O   . HOH Y 8 .   ? 41.134  6.847   2.791   1.00 42.63  ? 1029 HOH A O   1 
HETATM 8773 O O   . HOH Y 8 .   ? 50.876  14.883  1.280   1.00 59.35  ? 1030 HOH A O   1 
HETATM 8774 O O   . HOH Y 8 .   ? 36.309  10.597  -15.271 1.00 64.28  ? 1031 HOH A O   1 
HETATM 8775 O O   . HOH Y 8 .   ? 38.182  12.019  4.805   1.00 43.90  ? 1032 HOH A O   1 
HETATM 8776 O O   . HOH Y 8 .   ? 40.261  1.708   26.077  1.00 55.21  ? 1033 HOH A O   1 
HETATM 8777 O O   . HOH Y 8 .   ? 29.763  32.820  -1.361  1.00 65.24  ? 1034 HOH A O   1 
HETATM 8778 O O   . HOH Y 8 .   ? 55.498  8.573   7.452   1.00 69.64  ? 1035 HOH A O   1 
HETATM 8779 O O   . HOH Y 8 .   ? 14.583  32.783  6.632   1.00 67.05  ? 1036 HOH A O   1 
HETATM 8780 O O   . HOH Y 8 .   ? 49.918  22.866  24.803  1.00 45.63  ? 1037 HOH A O   1 
HETATM 8781 O O   . HOH Y 8 .   ? 21.502  34.619  17.147  1.00 59.28  ? 1038 HOH A O   1 
HETATM 8782 O O   . HOH Y 8 .   ? 12.867  6.466   -4.468  1.00 65.96  ? 1039 HOH A O   1 
HETATM 8783 O O   . HOH Y 8 .   ? 15.230  -7.411  24.336  1.00 75.79  ? 1040 HOH A O   1 
HETATM 8784 O O   . HOH Y 8 .   ? 37.340  15.114  51.182  1.00 69.50  ? 1041 HOH A O   1 
HETATM 8785 O O   . HOH Y 8 .   ? 11.854  27.589  -1.641  1.00 61.83  ? 1042 HOH A O   1 
HETATM 8786 O O   . HOH Y 8 .   ? 14.937  26.504  -15.896 1.00 60.73  ? 1043 HOH A O   1 
HETATM 8787 O O   . HOH Y 8 .   ? 13.885  13.490  48.260  1.00 64.99  ? 1044 HOH A O   1 
HETATM 8788 O O   . HOH Y 8 .   ? 38.590  12.763  2.157   1.00 59.18  ? 1045 HOH A O   1 
HETATM 8789 O O   . HOH Y 8 .   ? 46.751  17.546  33.592  1.00 64.95  ? 1046 HOH A O   1 
HETATM 8790 O O   . HOH Y 8 .   ? 38.957  24.532  34.638  1.00 73.99  ? 1047 HOH A O   1 
HETATM 8791 O O   . HOH Y 8 .   ? 32.062  2.034   3.631   1.00 61.29  ? 1048 HOH A O   1 
HETATM 8792 O O   . HOH Y 8 .   ? 42.724  6.538   47.536  1.00 72.87  ? 1049 HOH A O   1 
HETATM 8793 O O   . HOH Y 8 .   ? 22.078  24.401  36.154  1.00 71.40  ? 1050 HOH A O   1 
HETATM 8794 O O   . HOH Y 8 .   ? 10.833  26.858  -7.991  1.00 73.08  ? 1051 HOH A O   1 
HETATM 8795 O O   . HOH Y 8 .   ? 30.324  19.458  11.176  1.00 62.72  ? 1052 HOH A O   1 
HETATM 8796 O O   . HOH Y 8 .   ? 23.550  20.034  50.438  1.00 71.03  ? 1053 HOH A O   1 
HETATM 8797 O O   . HOH Y 8 .   ? 32.517  23.509  -11.858 1.00 64.06  ? 1054 HOH A O   1 
HETATM 8798 O O   . HOH Y 8 .   ? 16.852  16.889  0.607   1.00 70.87  ? 1055 HOH A O   1 
HETATM 8799 O O   . HOH Y 8 .   ? 43.260  1.750   25.819  1.00 64.41  ? 1056 HOH A O   1 
HETATM 8800 O O   . HOH Y 8 .   ? 29.765  7.235   -1.461  1.00 81.20  ? 1057 HOH A O   1 
HETATM 8801 O O   . HOH Y 8 .   ? 33.815  1.577   4.496   1.00 44.57  ? 1058 HOH A O   1 
HETATM 8802 O O   . HOH Y 8 .   ? 19.268  23.908  38.646  1.00 55.84  ? 1059 HOH A O   1 
HETATM 8803 O O   . HOH Y 8 .   ? 20.928  32.414  -10.015 1.00 62.15  ? 1060 HOH A O   1 
HETATM 8804 O O   . HOH Y 8 .   ? 7.781   17.874  32.763  1.00 48.15  ? 1061 HOH A O   1 
HETATM 8805 O O   . HOH Y 8 .   ? 41.150  13.781  40.489  1.00 71.10  ? 1062 HOH A O   1 
HETATM 8806 O O   . HOH Y 8 .   ? 24.506  36.732  12.876  1.00 72.07  ? 1063 HOH A O   1 
HETATM 8807 O O   . HOH Y 8 .   ? 36.642  22.076  -6.402  1.00 58.56  ? 1064 HOH A O   1 
HETATM 8808 O O   . HOH Y 8 .   ? 31.829  23.777  16.354  1.00 60.24  ? 1065 HOH A O   1 
HETATM 8809 O O   . HOH Y 8 .   ? 23.652  -4.238  -7.704  1.00 51.25  ? 1066 HOH A O   1 
HETATM 8810 O O   . HOH Y 8 .   ? 41.701  21.862  1.939   1.00 70.87  ? 1067 HOH A O   1 
HETATM 8811 O O   . HOH Y 8 .   ? 12.683  -0.229  33.406  1.00 65.60  ? 1068 HOH A O   1 
HETATM 8812 O O   . HOH Y 8 .   ? 31.810  5.600   0.537   1.00 56.83  ? 1069 HOH A O   1 
HETATM 8813 O O   . HOH Y 8 .   ? 25.575  18.347  48.923  1.00 67.43  ? 1070 HOH A O   1 
HETATM 8814 O O   . HOH Y 8 .   ? 29.222  1.749   -1.196  1.00 70.09  ? 1071 HOH A O   1 
HETATM 8815 O O   . HOH Y 8 .   ? 34.272  28.302  6.019   1.00 74.87  ? 1072 HOH A O   1 
HETATM 8816 O O   . HOH Y 8 .   ? 41.502  1.442   39.492  1.00 66.26  ? 1073 HOH A O   1 
HETATM 8817 O O   . HOH Y 8 .   ? 26.396  -8.111  25.603  1.00 66.82  ? 1074 HOH A O   1 
HETATM 8818 O O   . HOH Y 8 .   ? 33.006  1.111   44.189  1.00 49.98  ? 1075 HOH A O   1 
HETATM 8819 O O   . HOH Y 8 .   ? 14.359  8.357   -4.374  1.00 44.03  ? 1076 HOH A O   1 
HETATM 8820 O O   . HOH Y 8 .   ? 43.787  1.988   37.866  1.00 69.87  ? 1077 HOH A O   1 
HETATM 8821 O O   . HOH Y 8 .   ? 24.385  30.034  21.805  1.00 62.55  ? 1078 HOH A O   1 
HETATM 8822 O O   . HOH Y 8 .   ? 43.794  21.974  0.570   1.00 63.85  ? 1079 HOH A O   1 
HETATM 8823 O O   . HOH Y 8 .   ? 4.287   18.302  11.188  1.00 58.94  ? 1080 HOH A O   1 
HETATM 8824 O O   . HOH Y 8 .   ? 48.687  29.344  11.003  1.00 65.61  ? 1081 HOH A O   1 
HETATM 8825 O O   . HOH Y 8 .   ? 39.737  14.985  45.085  1.00 66.07  ? 1082 HOH A O   1 
HETATM 8826 O O   . HOH Y 8 .   ? 37.966  30.898  17.528  1.00 65.52  ? 1083 HOH A O   1 
HETATM 8827 O O   . HOH Y 8 .   ? 34.033  4.601   1.236   1.00 74.13  ? 1084 HOH A O   1 
HETATM 8828 O O   . HOH Y 8 .   ? 21.507  24.397  31.356  1.00 69.59  ? 1085 HOH A O   1 
HETATM 8829 O O   . HOH Y 8 .   ? 53.491  26.190  13.995  1.00 39.58  ? 1086 HOH A O   1 
HETATM 8830 O O   . HOH Y 8 .   ? 39.770  2.136   4.007   1.00 53.49  ? 1087 HOH A O   1 
HETATM 8831 O O   . HOH Y 8 .   ? 33.183  10.139  -3.467  1.00 65.60  ? 1088 HOH A O   1 
HETATM 8832 O O   . HOH Y 8 .   ? 46.062  -2.735  8.159   1.00 62.39  ? 1089 HOH A O   1 
HETATM 8833 O O   . HOH Y 8 .   ? 47.106  20.193  29.824  1.00 68.46  ? 1090 HOH A O   1 
HETATM 8834 O O   . HOH Y 8 .   ? 56.378  15.009  25.718  1.00 45.83  ? 1091 HOH A O   1 
HETATM 8835 O O   . HOH Y 8 .   ? 15.112  -6.966  27.006  1.00 65.69  ? 1092 HOH A O   1 
HETATM 8836 O O   . HOH Y 8 .   ? 46.471  13.207  -1.746  1.00 61.66  ? 1093 HOH A O   1 
HETATM 8837 O O   . HOH Y 8 .   ? 36.281  5.250   2.828   1.00 61.27  ? 1094 HOH A O   1 
HETATM 8838 O O   . HOH Y 8 .   ? 48.203  26.548  23.495  1.00 37.63  ? 1095 HOH A O   1 
HETATM 8839 O O   . HOH Y 8 .   ? 52.823  8.942   3.643   1.00 57.90  ? 1096 HOH A O   1 
HETATM 8840 O O   . HOH Y 8 .   ? 44.275  -3.514  7.625   1.00 57.41  ? 1097 HOH A O   1 
HETATM 8841 O O   . HOH Y 8 .   ? 53.343  21.010  25.109  1.00 64.01  ? 1098 HOH A O   1 
HETATM 8842 O O   . HOH Y 8 .   ? 6.095   25.036  15.160  1.00 65.81  ? 1099 HOH A O   1 
HETATM 8843 O O   . HOH Y 8 .   ? 34.695  29.204  8.453   1.00 58.26  ? 1100 HOH A O   1 
HETATM 8844 O O   . HOH Y 8 .   ? 46.072  0.701   20.468  1.00 60.23  ? 1101 HOH A O   1 
HETATM 8845 O O   . HOH Y 8 .   ? 29.937  0.507   2.574   1.00 68.87  ? 1102 HOH A O   1 
HETATM 8846 O O   . HOH Y 8 .   ? 12.802  23.618  1.923   1.00 61.03  ? 1103 HOH A O   1 
HETATM 8847 O O   . HOH Y 8 .   ? 0.295   10.077  18.170  1.00 62.70  ? 1104 HOH A O   1 
HETATM 8848 O O   . HOH Y 8 .   ? 33.347  -5.054  35.304  1.00 59.56  ? 1105 HOH A O   1 
HETATM 8849 O O   . HOH Y 8 .   ? 23.446  -5.363  -13.201 1.00 70.80  ? 1106 HOH A O   1 
HETATM 8850 O O   . HOH Y 8 .   ? 3.890   9.569   24.502  1.00 74.06  ? 1107 HOH A O   1 
HETATM 8851 O O   . HOH Y 8 .   ? 40.288  24.691  -0.827  1.00 73.71  ? 1108 HOH A O   1 
HETATM 8852 O O   . HOH Y 8 .   ? 24.920  -9.007  30.161  1.00 78.89  ? 1109 HOH A O   1 
HETATM 8853 O O   . HOH Y 8 .   ? 5.560   17.570  34.960  1.00 71.55  ? 1110 HOH A O   1 
HETATM 8854 O O   . HOH Y 8 .   ? 39.471  15.507  38.897  1.00 54.48  ? 1111 HOH A O   1 
HETATM 8855 O O   . HOH Y 8 .   ? 12.722  14.914  46.264  1.00 65.05  ? 1112 HOH A O   1 
HETATM 8856 O O   . HOH Y 8 .   ? 32.326  9.009   -5.024  1.00 57.43  ? 1113 HOH A O   1 
HETATM 8857 O O   . HOH Y 8 .   ? 31.165  28.772  -7.641  1.00 51.39  ? 1114 HOH A O   1 
HETATM 8858 O O   . HOH Y 8 .   ? 32.786  -6.107  30.717  1.00 70.09  ? 1115 HOH A O   1 
HETATM 8859 O O   . HOH Y 8 .   ? 29.976  25.680  -15.332 1.00 63.44  ? 1116 HOH A O   1 
HETATM 8860 O O   . HOH Y 8 .   ? 34.562  23.904  -10.185 1.00 61.83  ? 1117 HOH A O   1 
HETATM 8861 O O   . HOH Y 8 .   ? 40.054  25.734  5.816   1.00 66.07  ? 1118 HOH A O   1 
HETATM 8862 O O   . HOH Y 8 .   ? 21.540  25.425  23.048  1.00 52.76  ? 1119 HOH A O   1 
HETATM 8863 O O   . HOH Y 8 .   ? 53.182  11.334  2.563   1.00 58.78  ? 1120 HOH A O   1 
HETATM 8864 O O   . HOH Y 8 .   ? 27.229  -6.918  35.314  1.00 61.94  ? 1121 HOH A O   1 
HETATM 8865 O O   . HOH Y 8 .   ? 48.704  0.402   20.890  1.00 65.38  ? 1122 HOH A O   1 
HETATM 8866 O O   . HOH Y 8 .   ? 33.121  7.638   -6.546  1.00 66.32  ? 1123 HOH A O   1 
HETATM 8867 O O   . HOH Y 8 .   ? 52.590  24.209  25.298  1.00 61.93  ? 1124 HOH A O   1 
HETATM 8868 O O   . HOH Y 8 .   ? 5.977   7.348   0.840   1.00 64.33  ? 1125 HOH A O   1 
HETATM 8869 O O   . HOH Y 8 .   ? 41.517  0.191   4.509   1.00 51.89  ? 1126 HOH A O   1 
HETATM 8870 O O   . HOH Y 8 .   ? 12.735  -7.531  12.095  1.00 69.63  ? 1127 HOH A O   1 
HETATM 8871 O O   . HOH Y 8 .   ? 33.843  7.611   -0.991  1.00 68.47  ? 1128 HOH A O   1 
HETATM 8872 O O   . HOH Y 8 .   ? 24.961  -7.021  36.783  1.00 60.48  ? 1129 HOH A O   1 
HETATM 8873 O O   . HOH Y 8 .   ? 2.974   29.165  20.703  1.00 72.51  ? 1130 HOH A O   1 
HETATM 8874 O O   . HOH Y 8 .   ? 46.801  2.522   40.359  1.00 64.57  ? 1131 HOH A O   1 
HETATM 8875 O O   . HOH Y 8 .   ? 52.272  10.416  0.278   1.00 67.47  ? 1132 HOH A O   1 
HETATM 8876 O O   . HOH Y 8 .   ? 33.618  28.135  -7.856  1.00 63.40  ? 1133 HOH A O   1 
HETATM 8877 O O   . HOH Z 8 .   ? 15.187  12.659  -57.634 1.00 66.31  ? 1701 HOH B O   1 
HETATM 8878 O O   . HOH Z 8 .   ? 28.393  -3.922  -31.717 1.00 48.48  ? 1702 HOH B O   1 
HETATM 8879 O O   . HOH Z 8 .   ? 17.618  -5.440  -43.779 1.00 55.73  ? 1703 HOH B O   1 
HETATM 8880 O O   . HOH Z 8 .   ? -4.847  25.082  -38.095 1.00 62.72  ? 1704 HOH B O   1 
HETATM 8881 O O   . HOH Z 8 .   ? 18.436  8.965   -27.810 1.00 55.47  ? 1705 HOH B O   1 
HETATM 8882 O O   . HOH Z 8 .   ? -0.564  0.860   -21.681 1.00 64.13  ? 1706 HOH B O   1 
HETATM 8883 O O   . HOH Z 8 .   ? -3.406  -5.673  -56.832 1.00 64.78  ? 1707 HOH B O   1 
HETATM 8884 O O   . HOH Z 8 .   ? 30.816  -3.414  -14.887 1.00 70.66  ? 1708 HOH B O   1 
HETATM 8885 O O   . HOH Z 8 .   ? 4.937   -13.709 -53.478 1.00 53.27  ? 1709 HOH B O   1 
HETATM 8886 O O   . HOH Z 8 .   ? -0.614  7.582   -72.628 1.00 54.92  ? 1710 HOH B O   1 
HETATM 8887 O O   . HOH Z 8 .   ? 19.533  16.215  -25.907 1.00 60.84  ? 1711 HOH B O   1 
HETATM 8888 O O   . HOH Z 8 .   ? -15.674 0.527   -37.415 1.00 67.56  ? 1712 HOH B O   1 
HETATM 8889 O O   . HOH Z 8 .   ? -8.844  19.406  -29.529 1.00 55.47  ? 1713 HOH B O   1 
HETATM 8890 O O   . HOH Z 8 .   ? 17.100  -2.329  -29.273 1.00 60.07  ? 1714 HOH B O   1 
HETATM 8891 O O   . HOH Z 8 .   ? 9.740   -13.379 -38.065 1.00 69.45  ? 1715 HOH B O   1 
HETATM 8892 O O   . HOH Z 8 .   ? -5.353  -2.558  -48.961 1.00 52.53  ? 1716 HOH B O   1 
HETATM 8893 O O   . HOH Z 8 .   ? -3.961  27.840  -30.889 1.00 57.92  ? 1717 HOH B O   1 
HETATM 8894 O O   . HOH Z 8 .   ? 28.286  5.676   -51.709 1.00 56.59  ? 1718 HOH B O   1 
HETATM 8895 O O   . HOH Z 8 .   ? 9.065   -8.936  -39.982 1.00 55.52  ? 1719 HOH B O   1 
HETATM 8896 O O   . HOH Z 8 .   ? -14.056 9.304   -28.503 1.00 55.73  ? 1720 HOH B O   1 
HETATM 8897 O O   . HOH Z 8 .   ? 6.536   -0.270  -19.774 1.00 50.29  ? 1721 HOH B O   1 
HETATM 8898 O O   . HOH Z 8 .   ? 12.256  16.449  -14.244 1.00 50.04  ? 1722 HOH B O   1 
HETATM 8899 O O   . HOH Z 8 .   ? 8.756   -10.522 -59.834 1.00 65.39  ? 1723 HOH B O   1 
HETATM 8900 O O   . HOH Z 8 .   ? 2.900   -11.871 -51.089 1.00 64.25  ? 1724 HOH B O   1 
HETATM 8901 O O   . HOH Z 8 .   ? 20.294  4.244   -61.947 1.00 57.82  ? 1725 HOH B O   1 
HETATM 8902 O O   . HOH Z 8 .   ? 5.274   -5.468  -60.590 1.00 57.36  ? 1726 HOH B O   1 
HETATM 8903 O O   . HOH Z 8 .   ? 7.801   1.164   -61.959 1.00 44.89  ? 1727 HOH B O   1 
HETATM 8904 O O   . HOH Z 8 .   ? 5.125   -2.455  -34.600 1.00 62.59  ? 1728 HOH B O   1 
HETATM 8905 O O   . HOH Z 8 .   ? 8.932   9.426   -62.643 1.00 57.80  ? 1729 HOH B O   1 
HETATM 8906 O O   . HOH Z 8 .   ? 21.580  15.400  -31.529 1.00 82.08  ? 1730 HOH B O   1 
HETATM 8907 O O   . HOH Z 8 .   ? 14.789  2.587   -69.229 1.00 62.97  ? 1731 HOH B O   1 
HETATM 8908 O O   . HOH Z 8 .   ? -15.737 -8.315  -38.444 1.00 79.72  ? 1732 HOH B O   1 
HETATM 8909 O O   . HOH Z 8 .   ? 34.115  -2.300  -43.380 1.00 57.00  ? 1733 HOH B O   1 
HETATM 8910 O O   . HOH Z 8 .   ? -3.863  24.584  -51.158 1.00 55.64  ? 1734 HOH B O   1 
HETATM 8911 O O   . HOH Z 8 .   ? -0.173  -8.962  -16.093 1.00 66.26  ? 1735 HOH B O   1 
HETATM 8912 O O   . HOH Z 8 .   ? 4.512   -8.946  -39.740 1.00 54.58  ? 1736 HOH B O   1 
HETATM 8913 O O   . HOH Z 8 .   ? -7.558  7.547   -45.038 1.00 51.03  ? 1737 HOH B O   1 
HETATM 8914 O O   . HOH Z 8 .   ? -0.042  19.684  -47.036 1.00 49.08  ? 1738 HOH B O   1 
HETATM 8915 O O   . HOH Z 8 .   ? 20.637  7.141   -36.887 1.00 48.77  ? 1739 HOH B O   1 
HETATM 8916 O O   . HOH Z 8 .   ? 4.289   -3.973  -21.119 1.00 56.37  ? 1740 HOH B O   1 
HETATM 8917 O O   . HOH Z 8 .   ? 17.671  -2.875  -55.867 1.00 48.59  ? 1741 HOH B O   1 
HETATM 8918 O O   . HOH Z 8 .   ? 2.639   26.620  -37.019 1.00 66.39  ? 1742 HOH B O   1 
HETATM 8919 O O   . HOH Z 8 .   ? 3.828   -13.882 -37.938 1.00 62.68  ? 1743 HOH B O   1 
HETATM 8920 O O   . HOH Z 8 .   ? -6.992  22.144  -31.055 1.00 63.17  ? 1744 HOH B O   1 
HETATM 8921 O O   . HOH Z 8 .   ? 8.725   21.746  -57.255 1.00 69.85  ? 1745 HOH B O   1 
HETATM 8922 O O   . HOH Z 8 .   ? 21.885  2.080   -47.689 1.00 52.54  ? 1746 HOH B O   1 
HETATM 8923 O O   . HOH Z 8 .   ? -12.385 14.322  -39.378 1.00 60.02  ? 1747 HOH B O   1 
HETATM 8924 O O   . HOH Z 8 .   ? 8.676   27.554  -39.121 1.00 66.56  ? 1748 HOH B O   1 
HETATM 8925 O O   . HOH Z 8 .   ? 16.690  -3.973  -66.118 1.00 58.20  ? 1749 HOH B O   1 
HETATM 8926 O O   . HOH Z 8 .   ? -6.441  0.730   -70.091 1.00 67.13  ? 1750 HOH B O   1 
HETATM 8927 O O   . HOH Z 8 .   ? -1.292  -7.570  -44.880 1.00 62.77  ? 1751 HOH B O   1 
HETATM 8928 O O   . HOH Z 8 .   ? 6.658   12.782  -64.115 1.00 55.09  ? 1752 HOH B O   1 
HETATM 8929 O O   . HOH Z 8 .   ? 3.135   7.739   -33.196 1.00 43.07  ? 1753 HOH B O   1 
HETATM 8930 O O   . HOH Z 8 .   ? 14.347  7.109   -67.609 1.00 55.73  ? 1754 HOH B O   1 
HETATM 8931 O O   . HOH Z 8 .   ? 3.085   11.294  -20.448 1.00 55.22  ? 1755 HOH B O   1 
HETATM 8932 O O   . HOH Z 8 .   ? 13.579  -7.940  -46.384 1.00 47.09  ? 1756 HOH B O   1 
HETATM 8933 O O   . HOH Z 8 .   ? -15.043 17.193  -54.321 1.00 69.09  ? 1757 HOH B O   1 
HETATM 8934 O O   . HOH Z 8 .   ? 9.164   1.414   -68.287 1.00 42.11  ? 1758 HOH B O   1 
HETATM 8935 O O   . HOH Z 8 .   ? -1.178  3.745   -48.821 1.00 50.42  ? 1759 HOH B O   1 
HETATM 8936 O O   . HOH Z 8 .   ? 4.982   -1.686  -22.169 1.00 51.08  ? 1760 HOH B O   1 
HETATM 8937 O O   . HOH Z 8 .   ? 4.522   -1.196  -43.535 1.00 46.46  ? 1761 HOH B O   1 
HETATM 8938 O O   . HOH Z 8 .   ? 7.245   3.099   -71.016 1.00 57.26  ? 1762 HOH B O   1 
HETATM 8939 O O   . HOH Z 8 .   ? -6.178  13.734  -23.236 1.00 68.36  ? 1763 HOH B O   1 
HETATM 8940 O O   . HOH Z 8 .   ? -0.544  26.947  -32.273 1.00 49.54  ? 1764 HOH B O   1 
HETATM 8941 O O   . HOH Z 8 .   ? 14.670  -17.095 -14.678 1.00 66.59  ? 1765 HOH B O   1 
HETATM 8942 O O   . HOH Z 8 .   ? 11.046  16.881  -23.160 1.00 53.19  ? 1766 HOH B O   1 
HETATM 8943 O O   . HOH Z 8 .   ? 7.038   -8.472  -44.522 1.00 49.88  ? 1767 HOH B O   1 
HETATM 8944 O O   . HOH Z 8 .   ? -18.927 -7.754  -37.316 1.00 88.89  ? 1768 HOH B O   1 
HETATM 8945 O O   . HOH Z 8 .   ? 12.567  -0.696  -68.204 1.00 51.30  ? 1769 HOH B O   1 
HETATM 8946 O O   . HOH Z 8 .   ? 18.788  6.258   -27.368 1.00 55.84  ? 1770 HOH B O   1 
HETATM 8947 O O   . HOH Z 8 .   ? 11.422  21.904  -46.910 1.00 54.15  ? 1771 HOH B O   1 
HETATM 8948 O O   . HOH Z 8 .   ? -6.917  13.341  -26.540 1.00 47.77  ? 1772 HOH B O   1 
HETATM 8949 O O   . HOH Z 8 .   ? 23.330  -8.682  -27.324 1.00 67.08  ? 1773 HOH B O   1 
HETATM 8950 O O   . HOH Z 8 .   ? -1.763  24.955  -47.386 1.00 51.12  ? 1774 HOH B O   1 
HETATM 8951 O O   . HOH Z 8 .   ? 16.505  -3.236  -42.856 1.00 47.13  ? 1775 HOH B O   1 
HETATM 8952 O O   . HOH Z 8 .   ? 3.367   20.209  -28.474 1.00 41.60  ? 1776 HOH B O   1 
HETATM 8953 O O   . HOH Z 8 .   ? 5.294   14.563  -18.699 1.00 56.34  ? 1777 HOH B O   1 
HETATM 8954 O O   . HOH Z 8 .   ? 18.803  13.158  -55.702 1.00 61.30  ? 1778 HOH B O   1 
HETATM 8955 O O   . HOH Z 8 .   ? 2.240   1.834   -20.476 1.00 65.92  ? 1779 HOH B O   1 
HETATM 8956 O O   . HOH Z 8 .   ? 9.443   12.828  -62.088 1.00 60.52  ? 1780 HOH B O   1 
HETATM 8957 O O   . HOH Z 8 .   ? 4.655   1.812   -40.877 1.00 57.30  ? 1781 HOH B O   1 
HETATM 8958 O O   . HOH Z 8 .   ? 6.138   24.210  -25.058 1.00 44.82  ? 1782 HOH B O   1 
HETATM 8959 O O   . HOH Z 8 .   ? 24.332  -2.475  -59.042 1.00 58.21  ? 1783 HOH B O   1 
HETATM 8960 O O   . HOH Z 8 .   ? -14.584 -3.469  -30.827 1.00 69.16  ? 1784 HOH B O   1 
HETATM 8961 O O   . HOH Z 8 .   ? 16.978  -8.143  -48.654 1.00 47.86  ? 1785 HOH B O   1 
HETATM 8962 O O   . HOH Z 8 .   ? -7.063  -3.162  -34.054 1.00 63.47  ? 1786 HOH B O   1 
HETATM 8963 O O   . HOH Z 8 .   ? 3.885   3.946   -33.909 1.00 43.79  ? 1787 HOH B O   1 
HETATM 8964 O O   . HOH Z 8 .   ? 1.618   7.364   -20.969 1.00 66.77  ? 1788 HOH B O   1 
HETATM 8965 O O   . HOH Z 8 .   ? 13.441  6.554   -33.448 1.00 47.30  ? 1789 HOH B O   1 
HETATM 8966 O O   . HOH Z 8 .   ? 22.769  7.237   -26.054 1.00 64.00  ? 1790 HOH B O   1 
HETATM 8967 O O   . HOH Z 8 .   ? 23.112  0.697   -53.164 1.00 48.91  ? 1791 HOH B O   1 
HETATM 8968 O O   . HOH Z 8 .   ? 6.872   -5.011  -41.327 1.00 49.02  ? 1792 HOH B O   1 
HETATM 8969 O O   . HOH Z 8 .   ? 24.774  7.840   -38.032 1.00 54.75  ? 1793 HOH B O   1 
HETATM 8970 O O   . HOH Z 8 .   ? 19.709  -8.541  -60.482 1.00 57.46  ? 1794 HOH B O   1 
HETATM 8971 O O   . HOH Z 8 .   ? -2.701  0.785   -36.981 1.00 52.00  ? 1795 HOH B O   1 
HETATM 8972 O O   . HOH Z 8 .   ? 25.360  -2.582  -46.861 1.00 49.73  ? 1796 HOH B O   1 
HETATM 8973 O O   . HOH Z 8 .   ? 17.164  -7.105  -34.452 1.00 67.30  ? 1797 HOH B O   1 
HETATM 8974 O O   . HOH Z 8 .   ? -7.837  -4.070  -26.804 1.00 61.25  ? 1798 HOH B O   1 
HETATM 8975 O O   . HOH Z 8 .   ? 17.695  -13.280 -29.250 1.00 77.53  ? 1799 HOH B O   1 
HETATM 8976 O O   . HOH Z 8 .   ? -3.449  1.029   -48.576 1.00 53.71  ? 1800 HOH B O   1 
HETATM 8977 O O   . HOH Z 8 .   ? -17.625 11.694  -51.478 1.00 66.25  ? 1801 HOH B O   1 
HETATM 8978 O O   . HOH Z 8 .   ? 25.420  -9.932  -62.890 1.00 67.17  ? 1802 HOH B O   1 
HETATM 8979 O O   . HOH Z 8 .   ? 23.041  -0.386  -45.215 1.00 49.74  ? 1803 HOH B O   1 
HETATM 8980 O O   . HOH Z 8 .   ? 10.371  -13.766 -48.782 1.00 60.08  ? 1804 HOH B O   1 
HETATM 8981 O O   . HOH Z 8 .   ? -2.804  22.667  -58.122 1.00 66.10  ? 1805 HOH B O   1 
HETATM 8982 O O   . HOH Z 8 .   ? 4.370   4.678   -48.337 1.00 44.59  ? 1806 HOH B O   1 
HETATM 8983 O O   . HOH Z 8 .   ? 22.407  15.909  -50.217 1.00 68.26  ? 1807 HOH B O   1 
HETATM 8984 O O   . HOH Z 8 .   ? -8.681  -0.294  -45.567 1.00 62.52  ? 1808 HOH B O   1 
HETATM 8985 O O   . HOH Z 8 .   ? 19.533  -20.338 -55.939 1.00 70.95  ? 1809 HOH B O   1 
HETATM 8986 O O   . HOH Z 8 .   ? 2.405   25.772  -48.077 1.00 61.96  ? 1810 HOH B O   1 
HETATM 8987 O O   . HOH Z 8 .   ? 15.768  -4.498  -57.002 1.00 45.71  ? 1811 HOH B O   1 
HETATM 8988 O O   . HOH Z 8 .   ? 22.846  1.273   -36.483 1.00 47.58  ? 1812 HOH B O   1 
HETATM 8989 O O   . HOH Z 8 .   ? -16.428 8.612   -45.350 1.00 72.48  ? 1813 HOH B O   1 
HETATM 8990 O O   . HOH Z 8 .   ? 15.490  -13.132 -21.143 1.00 81.55  ? 1814 HOH B O   1 
HETATM 8991 O O   . HOH Z 8 .   ? 6.148   16.926  -53.599 1.00 47.37  ? 1815 HOH B O   1 
HETATM 8992 O O   . HOH Z 8 .   ? 15.483  15.525  -20.978 1.00 64.85  ? 1816 HOH B O   1 
HETATM 8993 O O   . HOH Z 8 .   ? 8.966   14.075  -17.905 1.00 53.13  ? 1817 HOH B O   1 
HETATM 8994 O O   . HOH Z 8 .   ? 15.209  2.447   -62.059 1.00 42.09  ? 1818 HOH B O   1 
HETATM 8995 O O   . HOH Z 8 .   ? 0.626   0.262   -55.981 1.00 52.44  ? 1819 HOH B O   1 
HETATM 8996 O O   . HOH Z 8 .   ? 24.788  -4.984  -24.616 1.00 62.76  ? 1820 HOH B O   1 
HETATM 8997 O O   . HOH Z 8 .   ? 8.054   25.066  -31.605 1.00 46.01  ? 1821 HOH B O   1 
HETATM 8998 O O   . HOH Z 8 .   ? 12.766  14.963  -22.892 1.00 47.22  ? 1822 HOH B O   1 
HETATM 8999 O O   . HOH Z 8 .   ? 21.584  -11.755 -23.110 1.00 65.47  ? 1823 HOH B O   1 
HETATM 9000 O O   . HOH Z 8 .   ? 13.575  -10.967 -58.984 1.00 51.96  ? 1824 HOH B O   1 
HETATM 9001 O O   . HOH Z 8 .   ? 19.429  -1.068  -37.758 1.00 48.35  ? 1825 HOH B O   1 
HETATM 9002 O O   . HOH Z 8 .   ? 23.340  1.381   -32.462 1.00 55.23  ? 1826 HOH B O   1 
HETATM 9003 O O   . HOH Z 8 .   ? 29.871  7.126   -42.410 1.00 56.57  ? 1827 HOH B O   1 
HETATM 9004 O O   . HOH Z 8 .   ? -4.082  -6.992  -34.634 1.00 58.59  ? 1828 HOH B O   1 
HETATM 9005 O O   . HOH Z 8 .   ? 10.392  -5.783  -64.473 1.00 51.57  ? 1829 HOH B O   1 
HETATM 9006 O O   . HOH Z 8 .   ? 3.867   11.427  -72.309 1.00 64.23  ? 1830 HOH B O   1 
HETATM 9007 O O   . HOH Z 8 .   ? -16.699 15.900  -44.071 1.00 69.95  ? 1831 HOH B O   1 
HETATM 9008 O O   . HOH Z 8 .   ? 8.218   -5.209  -38.539 1.00 63.96  ? 1832 HOH B O   1 
HETATM 9009 O O   . HOH Z 8 .   ? 14.812  -17.591 -20.200 1.00 70.85  ? 1833 HOH B O   1 
HETATM 9010 O O   . HOH Z 8 .   ? 6.762   -2.481  -50.738 1.00 43.49  ? 1834 HOH B O   1 
HETATM 9011 O O   . HOH Z 8 .   ? 22.582  15.964  -45.847 1.00 56.69  ? 1835 HOH B O   1 
HETATM 9012 O O   . HOH Z 8 .   ? -1.245  -1.491  -64.745 1.00 56.51  ? 1836 HOH B O   1 
HETATM 9013 O O   . HOH Z 8 .   ? 1.587   19.431  -59.912 1.00 50.05  ? 1837 HOH B O   1 
HETATM 9014 O O   . HOH Z 8 .   ? 8.996   -0.925  -60.791 1.00 48.96  ? 1838 HOH B O   1 
HETATM 9015 O O   . HOH Z 8 .   ? 1.858   -2.761  -52.988 1.00 58.98  ? 1839 HOH B O   1 
HETATM 9016 O O   . HOH Z 8 .   ? 4.944   8.385   -64.143 1.00 47.88  ? 1840 HOH B O   1 
HETATM 9017 O O   . HOH Z 8 .   ? 5.555   -1.835  -29.290 1.00 57.76  ? 1841 HOH B O   1 
HETATM 9018 O O   . HOH Z 8 .   ? -19.909 1.664   -29.727 1.00 65.87  ? 1842 HOH B O   1 
HETATM 9019 O O   . HOH Z 8 .   ? -0.986  6.650   -76.990 1.00 64.93  ? 1843 HOH B O   1 
HETATM 9020 O O   . HOH Z 8 .   ? 10.564  5.403   -18.922 1.00 64.95  ? 1844 HOH B O   1 
HETATM 9021 O O   . HOH Z 8 .   ? 2.348   -12.397 -46.804 1.00 56.10  ? 1845 HOH B O   1 
HETATM 9022 O O   . HOH Z 8 .   ? 19.361  -19.326 -49.492 1.00 75.95  ? 1846 HOH B O   1 
HETATM 9023 O O   . HOH Z 8 .   ? -1.843  -3.210  -60.629 1.00 63.95  ? 1847 HOH B O   1 
HETATM 9024 O O   . HOH Z 8 .   ? 12.795  -4.504  -51.718 1.00 47.65  ? 1848 HOH B O   1 
HETATM 9025 O O   . HOH Z 8 .   ? -4.189  1.268   -30.503 1.00 50.37  ? 1849 HOH B O   1 
HETATM 9026 O O   . HOH Z 8 .   ? 17.459  1.402   -60.315 1.00 59.81  ? 1850 HOH B O   1 
HETATM 9027 O O   . HOH Z 8 .   ? 16.861  -7.970  -60.103 1.00 55.30  ? 1851 HOH B O   1 
HETATM 9028 O O   . HOH Z 8 .   ? -13.552 2.233   -27.145 1.00 57.84  ? 1852 HOH B O   1 
HETATM 9029 O O   . HOH Z 8 .   ? -14.397 17.690  -41.328 1.00 80.76  ? 1853 HOH B O   1 
HETATM 9030 O O   . HOH Z 8 .   ? 10.498  -0.006  -43.995 1.00 41.82  ? 1854 HOH B O   1 
HETATM 9031 O O   . HOH Z 8 .   ? 32.069  -1.527  -38.873 1.00 71.01  ? 1855 HOH B O   1 
HETATM 9032 O O   . HOH Z 8 .   ? -10.225 12.884  -59.697 1.00 85.57  ? 1856 HOH B O   1 
HETATM 9033 O O   . HOH Z 8 .   ? 21.121  13.687  -52.055 1.00 63.79  ? 1857 HOH B O   1 
HETATM 9034 O O   . HOH Z 8 .   ? 22.931  7.566   -52.943 1.00 67.49  ? 1858 HOH B O   1 
HETATM 9035 O O   . HOH Z 8 .   ? 7.577   0.703   -24.143 1.00 54.03  ? 1859 HOH B O   1 
HETATM 9036 O O   . HOH Z 8 .   ? -2.434  -0.591  -61.417 1.00 67.09  ? 1860 HOH B O   1 
HETATM 9037 O O   . HOH Z 8 .   ? 4.004   10.814  -65.149 1.00 56.14  ? 1861 HOH B O   1 
HETATM 9038 O O   . HOH Z 8 .   ? -5.981  -3.831  -55.578 1.00 58.07  ? 1862 HOH B O   1 
HETATM 9039 O O   . HOH Z 8 .   ? 12.399  -5.271  -54.232 1.00 58.30  ? 1863 HOH B O   1 
HETATM 9040 O O   . HOH Z 8 .   ? 14.439  -7.419  -48.937 1.00 48.76  ? 1864 HOH B O   1 
HETATM 9041 O O   . HOH Z 8 .   ? 2.739   9.340   -73.252 1.00 62.47  ? 1865 HOH B O   1 
HETATM 9042 O O   . HOH Z 8 .   ? 13.388  -3.951  -55.941 1.00 50.09  ? 1866 HOH B O   1 
HETATM 9043 O O   . HOH Z 8 .   ? 4.863   -3.836  -42.575 1.00 45.26  ? 1867 HOH B O   1 
HETATM 9044 O O   . HOH Z 8 .   ? -5.140  -6.770  -47.395 1.00 62.02  ? 1868 HOH B O   1 
HETATM 9045 O O   . HOH Z 8 .   ? -9.438  17.745  -34.054 1.00 63.17  ? 1869 HOH B O   1 
HETATM 9046 O O   . HOH Z 8 .   ? -18.012 12.821  -45.040 1.00 64.09  ? 1870 HOH B O   1 
HETATM 9047 O O   . HOH Z 8 .   ? 22.556  10.390  -52.827 1.00 61.90  ? 1871 HOH B O   1 
HETATM 9048 O O   . HOH Z 8 .   ? 1.642   0.110   -53.301 1.00 50.54  ? 1872 HOH B O   1 
HETATM 9049 O O   . HOH Z 8 .   ? 4.604   -5.573  -46.179 1.00 51.97  ? 1873 HOH B O   1 
HETATM 9050 O O   . HOH Z 8 .   ? 22.518  -0.173  -28.148 1.00 55.63  ? 1874 HOH B O   1 
HETATM 9051 O O   . HOH Z 8 .   ? 32.423  -8.721  -43.586 1.00 55.64  ? 1875 HOH B O   1 
HETATM 9052 O O   . HOH Z 8 .   ? 22.047  15.897  -26.173 1.00 78.02  ? 1876 HOH B O   1 
HETATM 9053 O O   . HOH Z 8 .   ? 0.936   21.146  -18.458 1.00 50.62  ? 1877 HOH B O   1 
HETATM 9054 O O   . HOH Z 8 .   ? 21.904  9.984   -33.722 1.00 58.71  ? 1878 HOH B O   1 
HETATM 9055 O O   . HOH Z 8 .   ? 10.970  12.512  -16.309 1.00 62.66  ? 1879 HOH B O   1 
HETATM 9056 O O   . HOH Z 8 .   ? 26.273  16.023  -49.623 1.00 77.16  ? 1880 HOH B O   1 
HETATM 9057 O O   . HOH Z 8 .   ? 6.703   4.098   -24.902 1.00 53.32  ? 1881 HOH B O   1 
HETATM 9058 O O   . HOH Z 8 .   ? 12.018  3.927   -74.708 1.00 47.77  ? 1882 HOH B O   1 
HETATM 9059 O O   . HOH Z 8 .   ? 6.605   25.167  -53.390 1.00 74.13  ? 1883 HOH B O   1 
HETATM 9060 O O   . HOH Z 8 .   ? -6.882  2.537   -24.132 1.00 63.96  ? 1884 HOH B O   1 
HETATM 9061 O O   . HOH Z 8 .   ? -8.689  -6.517  -27.559 1.00 66.41  ? 1885 HOH B O   1 
HETATM 9062 O O   . HOH Z 8 .   ? 17.315  5.459   -34.945 1.00 50.63  ? 1886 HOH B O   1 
HETATM 9063 O O   . HOH Z 8 .   ? -4.217  20.878  -20.435 1.00 50.55  ? 1887 HOH B O   1 
HETATM 9064 O O   . HOH Z 8 .   ? 21.037  19.498  -43.878 1.00 65.07  ? 1888 HOH B O   1 
HETATM 9065 O O   . HOH Z 8 .   ? 32.760  4.675   -41.630 1.00 63.27  ? 1889 HOH B O   1 
HETATM 9066 O O   . HOH Z 8 .   ? 17.791  15.264  -22.216 1.00 62.68  ? 1890 HOH B O   1 
HETATM 9067 O O   . HOH Z 8 .   ? 4.967   8.958   -20.426 1.00 60.82  ? 1891 HOH B O   1 
HETATM 9068 O O   . HOH Z 8 .   ? -5.613  15.462  -66.789 1.00 70.18  ? 1892 HOH B O   1 
HETATM 9069 O O   . HOH Z 8 .   ? 5.802   17.629  -15.771 1.00 66.15  ? 1893 HOH B O   1 
HETATM 9070 O O   . HOH Z 8 .   ? 25.532  10.868  -29.167 1.00 71.93  ? 1894 HOH B O   1 
HETATM 9071 O O   . HOH Z 8 .   ? 4.642   27.106  -26.770 1.00 47.61  ? 1895 HOH B O   1 
HETATM 9072 O O   . HOH Z 8 .   ? 0.333   26.971  -22.829 1.00 64.16  ? 1896 HOH B O   1 
HETATM 9073 O O   . HOH Z 8 .   ? 1.574   23.301  -19.590 1.00 54.04  ? 1897 HOH B O   1 
HETATM 9074 O O   . HOH Z 8 .   ? 31.868  -4.507  -22.130 1.00 72.46  ? 1898 HOH B O   1 
HETATM 9075 O O   . HOH Z 8 .   ? -2.761  -0.779  -68.843 1.00 43.50  ? 1899 HOH B O   1 
HETATM 9076 O O   . HOH Z 8 .   ? -3.201  -3.861  -42.796 1.00 67.63  ? 1900 HOH B O   1 
HETATM 9077 O O   . HOH Z 8 .   ? 8.994   3.148   -24.035 1.00 52.22  ? 1901 HOH B O   1 
HETATM 9078 O O   . HOH Z 8 .   ? -12.735 11.564  -28.569 1.00 54.98  ? 1902 HOH B O   1 
HETATM 9079 O O   . HOH Z 8 .   ? 24.307  -2.363  -44.139 1.00 53.00  ? 1903 HOH B O   1 
HETATM 9080 O O   . HOH Z 8 .   ? 15.874  10.377  -56.708 1.00 45.02  ? 1904 HOH B O   1 
HETATM 9081 O O   . HOH Z 8 .   ? 11.302  23.965  -45.410 1.00 70.80  ? 1905 HOH B O   1 
HETATM 9082 O O   . HOH Z 8 .   ? -5.070  1.659   -73.628 1.00 60.32  ? 1906 HOH B O   1 
HETATM 9083 O O   . HOH Z 8 .   ? 6.828   11.699  -19.311 1.00 73.52  ? 1907 HOH B O   1 
HETATM 9084 O O   . HOH Z 8 .   ? 32.666  -8.942  -40.996 1.00 61.31  ? 1908 HOH B O   1 
HETATM 9085 O O   . HOH Z 8 .   ? -14.908 2.599   -61.053 1.00 63.16  ? 1909 HOH B O   1 
HETATM 9086 O O   . HOH Z 8 .   ? 12.210  -3.938  -10.950 1.00 58.97  ? 1910 HOH B O   1 
HETATM 9087 O O   . HOH Z 8 .   ? 22.064  -1.276  -37.041 1.00 52.60  ? 1911 HOH B O   1 
HETATM 9088 O O   . HOH Z 8 .   ? 1.289   -0.639  -63.799 1.00 61.06  ? 1912 HOH B O   1 
HETATM 9089 O O   . HOH Z 8 .   ? -3.245  -5.577  -45.268 1.00 67.78  ? 1913 HOH B O   1 
HETATM 9090 O O   . HOH Z 8 .   ? 17.623  15.469  -25.001 1.00 50.78  ? 1914 HOH B O   1 
HETATM 9091 O O   . HOH Z 8 .   ? -19.676 4.628   -54.458 1.00 50.78  ? 1915 HOH B O   1 
HETATM 9092 O O   . HOH Z 8 .   ? 26.051  -1.876  -35.502 1.00 65.05  ? 1916 HOH B O   1 
HETATM 9093 O O   . HOH Z 8 .   ? -5.285  12.437  -20.711 1.00 73.98  ? 1917 HOH B O   1 
HETATM 9094 O O   . HOH Z 8 .   ? 6.402   -7.898  -41.795 1.00 53.24  ? 1918 HOH B O   1 
HETATM 9095 O O   . HOH Z 8 .   ? 6.769   -0.003  -64.570 1.00 50.65  ? 1919 HOH B O   1 
HETATM 9096 O O   . HOH Z 8 .   ? -15.425 0.094   -53.072 1.00 59.63  ? 1920 HOH B O   1 
HETATM 9097 O O   . HOH Z 8 .   ? -1.781  26.847  -29.877 1.00 55.05  ? 1921 HOH B O   1 
HETATM 9098 O O   . HOH Z 8 .   ? 22.204  17.503  -47.886 1.00 57.52  ? 1922 HOH B O   1 
HETATM 9099 O O   . HOH Z 8 .   ? 12.105  27.766  -25.573 1.00 66.75  ? 1923 HOH B O   1 
HETATM 9100 O O   . HOH Z 8 .   ? 12.378  -14.473 -33.387 1.00 62.52  ? 1924 HOH B O   1 
HETATM 9101 O O   . HOH Z 8 .   ? 21.788  12.362  -32.057 1.00 62.75  ? 1925 HOH B O   1 
HETATM 9102 O O   . HOH Z 8 .   ? -14.909 33.864  -34.931 1.00 70.42  ? 1926 HOH B O   1 
HETATM 9103 O O   . HOH Z 8 .   ? -5.822  -13.379 -35.143 1.00 64.39  ? 1927 HOH B O   1 
HETATM 9104 O O   . HOH Z 8 .   ? -4.591  -10.743 -22.931 1.00 65.02  ? 1928 HOH B O   1 
HETATM 9105 O O   . HOH Z 8 .   ? 23.652  -3.291  -34.508 1.00 74.75  ? 1929 HOH B O   1 
HETATM 9106 O O   . HOH Z 8 .   ? 9.811   24.078  -50.108 1.00 75.70  ? 1930 HOH B O   1 
HETATM 9107 O O   . HOH Z 8 .   ? 27.535  1.955   -37.565 1.00 46.85  ? 1931 HOH B O   1 
HETATM 9108 O O   . HOH Z 8 .   ? 16.420  10.078  -61.056 1.00 64.54  ? 1932 HOH B O   1 
HETATM 9109 O O   . HOH Z 8 .   ? 11.005  -14.735 -46.229 1.00 55.93  ? 1933 HOH B O   1 
HETATM 9110 O O   . HOH Z 8 .   ? 3.113   16.946  -16.883 1.00 58.78  ? 1934 HOH B O   1 
HETATM 9111 O O   . HOH Z 8 .   ? -4.200  -4.280  -66.729 1.00 62.67  ? 1935 HOH B O   1 
HETATM 9112 O O   . HOH Z 8 .   ? -6.034  20.644  -63.090 1.00 66.79  ? 1936 HOH B O   1 
HETATM 9113 O O   . HOH Z 8 .   ? 10.981  -10.507 -58.764 1.00 52.55  ? 1937 HOH B O   1 
HETATM 9114 O O   . HOH Z 8 .   ? 12.373  26.643  -28.286 1.00 42.63  ? 1938 HOH B O   1 
HETATM 9115 O O   . HOH Z 8 .   ? -9.057  7.273   -22.889 1.00 54.51  ? 1939 HOH B O   1 
HETATM 9116 O O   . HOH Z 8 .   ? 23.163  9.905   -35.533 1.00 45.18  ? 1940 HOH B O   1 
HETATM 9117 O O   . HOH Z 8 .   ? -18.086 1.962   -46.803 1.00 62.85  ? 1941 HOH B O   1 
HETATM 9118 O O   . HOH Z 8 .   ? -1.370  -10.402 -55.752 1.00 63.76  ? 1942 HOH B O   1 
HETATM 9119 O O   . HOH Z 8 .   ? 11.165  10.221  -16.802 1.00 45.81  ? 1943 HOH B O   1 
HETATM 9120 O O   . HOH Z 8 .   ? 30.111  1.521   -36.728 1.00 77.56  ? 1944 HOH B O   1 
HETATM 9121 O O   . HOH Z 8 .   ? 13.251  13.460  -62.024 1.00 68.30  ? 1945 HOH B O   1 
HETATM 9122 O O   . HOH Z 8 .   ? 22.245  6.054   -30.591 1.00 58.96  ? 1946 HOH B O   1 
HETATM 9123 O O   . HOH Z 8 .   ? -1.683  -10.203 -20.592 1.00 54.83  ? 1947 HOH B O   1 
HETATM 9124 O O   . HOH Z 8 .   ? 19.581  10.174  -30.411 1.00 30.79  ? 1948 HOH B O   1 
HETATM 9125 O O   . HOH Z 8 .   ? 5.043   27.517  -50.503 1.00 73.44  ? 1949 HOH B O   1 
HETATM 9126 O O   . HOH Z 8 .   ? 24.642  17.775  -20.417 1.00 48.96  ? 1950 HOH B O   1 
HETATM 9127 O O   . HOH Z 8 .   ? -7.759  12.703  -69.577 1.00 72.70  ? 1951 HOH B O   1 
HETATM 9128 O O   . HOH Z 8 .   ? 10.022  -7.807  -5.167  1.00 48.29  ? 1952 HOH B O   1 
HETATM 9129 O O   . HOH Z 8 .   ? 27.317  -15.581 -40.058 1.00 71.11  ? 1953 HOH B O   1 
HETATM 9130 O O   . HOH Z 8 .   ? 6.090   -11.180 -59.729 1.00 71.46  ? 1954 HOH B O   1 
HETATM 9131 O O   . HOH Z 8 .   ? 34.420  -7.248  -44.037 1.00 65.77  ? 1955 HOH B O   1 
HETATM 9132 O O   . HOH Z 8 .   ? -9.580  -3.347  -48.350 1.00 68.17  ? 1956 HOH B O   1 
HETATM 9133 O O   . HOH Z 8 .   ? -14.195 3.767   -65.817 1.00 68.06  ? 1957 HOH B O   1 
HETATM 9134 O O   . HOH Z 8 .   ? 5.007   31.012  -37.572 1.00 70.37  ? 1958 HOH B O   1 
HETATM 9135 O O   . HOH Z 8 .   ? 28.801  -12.958 -61.466 1.00 62.81  ? 1959 HOH B O   1 
HETATM 9136 O O   . HOH Z 8 .   ? -4.351  -10.325 -41.736 1.00 55.03  ? 1960 HOH B O   1 
HETATM 9137 O O   . HOH Z 8 .   ? 7.657   11.951  -68.918 1.00 72.19  ? 1961 HOH B O   1 
HETATM 9138 O O   . HOH Z 8 .   ? -13.720 16.049  -34.927 1.00 68.16  ? 1962 HOH B O   1 
HETATM 9139 O O   . HOH Z 8 .   ? 0.238   -12.647 -50.723 1.00 78.09  ? 1963 HOH B O   1 
HETATM 9140 O O   . HOH Z 8 .   ? -5.917  0.232   -49.167 1.00 63.79  ? 1964 HOH B O   1 
HETATM 9141 O O   . HOH Z 8 .   ? 34.606  -4.799  -45.047 1.00 69.30  ? 1965 HOH B O   1 
HETATM 9142 O O   . HOH Z 8 .   ? 0.081   19.514  -64.077 1.00 71.94  ? 1966 HOH B O   1 
HETATM 9143 O O   . HOH Z 8 .   ? 27.512  7.068   -38.328 1.00 61.26  ? 1967 HOH B O   1 
HETATM 9144 O O   . HOH Z 8 .   ? -0.033  26.563  -48.200 1.00 66.65  ? 1968 HOH B O   1 
HETATM 9145 O O   . HOH Z 8 .   ? 35.574  -0.455  -43.970 1.00 67.25  ? 1969 HOH B O   1 
HETATM 9146 O O   . HOH Z 8 .   ? -1.009  24.318  -19.914 1.00 65.37  ? 1970 HOH B O   1 
HETATM 9147 O O   . HOH Z 8 .   ? -18.181 11.136  -43.174 1.00 76.08  ? 1971 HOH B O   1 
HETATM 9148 O O   . HOH Z 8 .   ? 22.581  9.829   -27.880 1.00 66.97  ? 1972 HOH B O   1 
HETATM 9149 O O   . HOH Z 8 .   ? -7.953  19.547  -61.857 1.00 73.56  ? 1973 HOH B O   1 
HETATM 9150 O O   . HOH Z 8 .   ? -5.183  -1.655  -69.870 1.00 57.20  ? 1974 HOH B O   1 
HETATM 9151 O O   . HOH Z 8 .   ? 18.872  9.308   -58.175 1.00 69.16  ? 1975 HOH B O   1 
HETATM 9152 O O   . HOH Z 8 .   ? 19.806  2.253   -63.532 1.00 59.56  ? 1976 HOH B O   1 
HETATM 9153 O O   . HOH Z 8 .   ? 8.119   -0.733  -67.030 1.00 51.26  ? 1977 HOH B O   1 
HETATM 9154 O O   . HOH Z 8 .   ? -17.798 8.967   -42.428 1.00 53.57  ? 1978 HOH B O   1 
HETATM 9155 O O   . HOH Z 8 .   ? 8.233   -15.212 -49.567 1.00 66.62  ? 1979 HOH B O   1 
HETATM 9156 O O   . HOH Z 8 .   ? 33.818  3.561   -47.139 1.00 45.66  ? 1980 HOH B O   1 
HETATM 9157 O O   . HOH Z 8 .   ? 10.807  -14.693 -35.655 1.00 72.12  ? 1981 HOH B O   1 
HETATM 9158 O O   . HOH Z 8 .   ? 24.090  2.050   -26.468 1.00 64.32  ? 1982 HOH B O   1 
HETATM 9159 O O   . HOH Z 8 .   ? -11.995 0.565   -26.196 1.00 71.04  ? 1983 HOH B O   1 
HETATM 9160 O O   . HOH Z 8 .   ? 25.808  0.721   -36.344 1.00 59.46  ? 1984 HOH B O   1 
HETATM 9161 O O   . HOH Z 8 .   ? 8.685   8.875   -17.023 1.00 75.27  ? 1985 HOH B O   1 
HETATM 9162 O O   . HOH Z 8 .   ? 3.565   -0.118  -65.674 1.00 43.72  ? 1986 HOH B O   1 
HETATM 9163 O O   . HOH Z 8 .   ? 10.718  12.535  -65.532 1.00 66.37  ? 1987 HOH B O   1 
HETATM 9164 O O   . HOH Z 8 .   ? -10.055 -1.866  -43.989 1.00 68.61  ? 1988 HOH B O   1 
HETATM 9165 O O   . HOH Z 8 .   ? 32.776  7.146   -42.753 1.00 67.66  ? 1989 HOH B O   1 
HETATM 9166 O O   . HOH Z 8 .   ? -5.297  -4.699  -41.175 1.00 64.38  ? 1990 HOH B O   1 
HETATM 9167 O O   . HOH Z 8 .   ? -2.741  -12.108 -21.979 1.00 73.77  ? 1991 HOH B O   1 
HETATM 9168 O O   . HOH Z 8 .   ? -5.882  -3.750  -68.567 1.00 59.43  ? 1992 HOH B O   1 
HETATM 9169 O O   . HOH Z 8 .   ? 15.141  5.394   -69.527 1.00 62.71  ? 1993 HOH B O   1 
HETATM 9170 O O   . HOH Z 8 .   ? -3.809  23.146  -20.706 1.00 63.04  ? 1994 HOH B O   1 
HETATM 9171 O O   . HOH Z 8 .   ? -8.036  -1.680  -53.193 1.00 68.50  ? 1995 HOH B O   1 
HETATM 9172 O O   . HOH Z 8 .   ? 29.308  7.886   -39.839 1.00 54.99  ? 1996 HOH B O   1 
HETATM 9173 O O   . HOH Z 8 .   ? 17.057  -15.690 -20.679 1.00 70.80  ? 1997 HOH B O   1 
HETATM 9174 O O   . HOH Z 8 .   ? 14.276  5.028   -74.255 1.00 57.08  ? 1998 HOH B O   1 
HETATM 9175 O O   . HOH Z 8 .   ? -3.771  0.827   -76.762 1.00 69.15  ? 1999 HOH B O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'FUC C 2 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   ?   ?   ?   A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 543 THR THR A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 258 PRO PRO B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 263 GLY GLY B . n 
B 1 264 GLY 264 264 264 GLY GLY B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 NAG 1   701  701  NAG NAG A . 
E 4 IOD 1   702  1101 IOD IDO A . 
F 4 IOD 1   703  1103 IOD IDO A . 
G 4 IOD 1   704  1104 IOD IDO A . 
H 4 IOD 1   705  1106 IOD IDO A . 
I 4 IOD 1   706  1108 IOD IDO A . 
J 4 IOD 1   707  1110 IOD IDO A . 
K 4 IOD 1   708  1111 IOD IDO A . 
L 5 NWA 1   709  601  NWA NWA A . 
M 6 CHH 1   710  1602 CHH CHH A . 
N 7 P6G 1   711  901  P6G P6G A . 
O 3 NAG 1   1601 1601 NAG NAG B . 
P 4 IOD 1   1602 1102 IOD IDO B . 
Q 4 IOD 1   1603 1105 IOD IDO B . 
R 4 IOD 1   1604 1107 IOD IDO B . 
S 4 IOD 1   1605 1109 IOD IDO B . 
T 4 IOD 1   1606 1112 IOD IDO B . 
U 4 IOD 1   1607 1113 IOD IDO B . 
V 4 IOD 1   1608 1114 IOD IDO B . 
W 5 NWA 1   1609 601  NWA NWA B . 
X 6 CHH 1   1610 2602 CHH CHH B . 
Y 8 HOH 1   801  352  HOH HOH A . 
Y 8 HOH 2   802  42   HOH HOH A . 
Y 8 HOH 3   803  259  HOH HOH A . 
Y 8 HOH 4   804  411  HOH HOH A . 
Y 8 HOH 5   805  377  HOH HOH A . 
Y 8 HOH 6   806  613  HOH HOH A . 
Y 8 HOH 7   807  206  HOH HOH A . 
Y 8 HOH 8   808  114  HOH HOH A . 
Y 8 HOH 9   809  332  HOH HOH A . 
Y 8 HOH 10  810  418  HOH HOH A . 
Y 8 HOH 11  811  387  HOH HOH A . 
Y 8 HOH 12  812  5    HOH HOH A . 
Y 8 HOH 13  813  289  HOH HOH A . 
Y 8 HOH 14  814  440  HOH HOH A . 
Y 8 HOH 15  815  591  HOH HOH A . 
Y 8 HOH 16  816  94   HOH HOH A . 
Y 8 HOH 17  817  321  HOH HOH A . 
Y 8 HOH 18  818  211  HOH HOH A . 
Y 8 HOH 19  819  382  HOH HOH A . 
Y 8 HOH 20  820  325  HOH HOH A . 
Y 8 HOH 21  821  616  HOH HOH A . 
Y 8 HOH 22  822  172  HOH HOH A . 
Y 8 HOH 23  823  152  HOH HOH A . 
Y 8 HOH 24  824  448  HOH HOH A . 
Y 8 HOH 25  825  72   HOH HOH A . 
Y 8 HOH 26  826  409  HOH HOH A . 
Y 8 HOH 27  827  408  HOH HOH A . 
Y 8 HOH 28  828  46   HOH HOH A . 
Y 8 HOH 29  829  383  HOH HOH A . 
Y 8 HOH 30  830  221  HOH HOH A . 
Y 8 HOH 31  831  414  HOH HOH A . 
Y 8 HOH 32  832  97   HOH HOH A . 
Y 8 HOH 33  833  292  HOH HOH A . 
Y 8 HOH 34  834  309  HOH HOH A . 
Y 8 HOH 35  835  84   HOH HOH A . 
Y 8 HOH 36  836  304  HOH HOH A . 
Y 8 HOH 37  837  562  HOH HOH A . 
Y 8 HOH 38  838  279  HOH HOH A . 
Y 8 HOH 39  839  389  HOH HOH A . 
Y 8 HOH 40  840  392  HOH HOH A . 
Y 8 HOH 41  841  121  HOH HOH A . 
Y 8 HOH 42  842  563  HOH HOH A . 
Y 8 HOH 43  843  17   HOH HOH A . 
Y 8 HOH 44  844  388  HOH HOH A . 
Y 8 HOH 45  845  190  HOH HOH A . 
Y 8 HOH 46  846  588  HOH HOH A . 
Y 8 HOH 47  847  270  HOH HOH A . 
Y 8 HOH 48  848  533  HOH HOH A . 
Y 8 HOH 49  849  21   HOH HOH A . 
Y 8 HOH 50  850  13   HOH HOH A . 
Y 8 HOH 51  851  606  HOH HOH A . 
Y 8 HOH 52  852  26   HOH HOH A . 
Y 8 HOH 53  853  280  HOH HOH A . 
Y 8 HOH 54  854  37   HOH HOH A . 
Y 8 HOH 55  855  111  HOH HOH A . 
Y 8 HOH 56  856  38   HOH HOH A . 
Y 8 HOH 57  857  113  HOH HOH A . 
Y 8 HOH 58  858  30   HOH HOH A . 
Y 8 HOH 59  859  12   HOH HOH A . 
Y 8 HOH 60  860  168  HOH HOH A . 
Y 8 HOH 61  861  51   HOH HOH A . 
Y 8 HOH 62  862  210  HOH HOH A . 
Y 8 HOH 63  863  7    HOH HOH A . 
Y 8 HOH 64  864  160  HOH HOH A . 
Y 8 HOH 65  865  70   HOH HOH A . 
Y 8 HOH 66  866  423  HOH HOH A . 
Y 8 HOH 67  867  4    HOH HOH A . 
Y 8 HOH 68  868  6    HOH HOH A . 
Y 8 HOH 69  869  93   HOH HOH A . 
Y 8 HOH 70  870  566  HOH HOH A . 
Y 8 HOH 71  871  167  HOH HOH A . 
Y 8 HOH 72  872  100  HOH HOH A . 
Y 8 HOH 73  873  120  HOH HOH A . 
Y 8 HOH 74  874  336  HOH HOH A . 
Y 8 HOH 75  875  443  HOH HOH A . 
Y 8 HOH 76  876  429  HOH HOH A . 
Y 8 HOH 77  877  421  HOH HOH A . 
Y 8 HOH 78  878  515  HOH HOH A . 
Y 8 HOH 79  879  425  HOH HOH A . 
Y 8 HOH 80  880  153  HOH HOH A . 
Y 8 HOH 81  881  203  HOH HOH A . 
Y 8 HOH 82  882  561  HOH HOH A . 
Y 8 HOH 83  883  181  HOH HOH A . 
Y 8 HOH 84  884  258  HOH HOH A . 
Y 8 HOH 85  885  23   HOH HOH A . 
Y 8 HOH 86  886  68   HOH HOH A . 
Y 8 HOH 87  887  165  HOH HOH A . 
Y 8 HOH 88  888  126  HOH HOH A . 
Y 8 HOH 89  889  56   HOH HOH A . 
Y 8 HOH 90  890  146  HOH HOH A . 
Y 8 HOH 91  891  233  HOH HOH A . 
Y 8 HOH 92  892  543  HOH HOH A . 
Y 8 HOH 93  893  118  HOH HOH A . 
Y 8 HOH 94  894  24   HOH HOH A . 
Y 8 HOH 95  895  242  HOH HOH A . 
Y 8 HOH 96  896  247  HOH HOH A . 
Y 8 HOH 97  897  3    HOH HOH A . 
Y 8 HOH 98  898  62   HOH HOH A . 
Y 8 HOH 99  899  69   HOH HOH A . 
Y 8 HOH 100 900  295  HOH HOH A . 
Y 8 HOH 101 901  253  HOH HOH A . 
Y 8 HOH 102 902  151  HOH HOH A . 
Y 8 HOH 103 903  574  HOH HOH A . 
Y 8 HOH 104 904  316  HOH HOH A . 
Y 8 HOH 105 905  644  HOH HOH A . 
Y 8 HOH 106 906  142  HOH HOH A . 
Y 8 HOH 107 907  511  HOH HOH A . 
Y 8 HOH 108 908  296  HOH HOH A . 
Y 8 HOH 109 909  169  HOH HOH A . 
Y 8 HOH 110 910  127  HOH HOH A . 
Y 8 HOH 111 911  41   HOH HOH A . 
Y 8 HOH 112 912  125  HOH HOH A . 
Y 8 HOH 113 913  227  HOH HOH A . 
Y 8 HOH 114 914  119  HOH HOH A . 
Y 8 HOH 115 915  166  HOH HOH A . 
Y 8 HOH 116 916  542  HOH HOH A . 
Y 8 HOH 117 917  83   HOH HOH A . 
Y 8 HOH 118 918  394  HOH HOH A . 
Y 8 HOH 119 919  8    HOH HOH A . 
Y 8 HOH 120 920  117  HOH HOH A . 
Y 8 HOH 121 921  139  HOH HOH A . 
Y 8 HOH 122 922  61   HOH HOH A . 
Y 8 HOH 123 923  175  HOH HOH A . 
Y 8 HOH 124 924  610  HOH HOH A . 
Y 8 HOH 125 925  171  HOH HOH A . 
Y 8 HOH 126 926  546  HOH HOH A . 
Y 8 HOH 127 927  88   HOH HOH A . 
Y 8 HOH 128 928  297  HOH HOH A . 
Y 8 HOH 129 929  183  HOH HOH A . 
Y 8 HOH 130 930  578  HOH HOH A . 
Y 8 HOH 131 931  73   HOH HOH A . 
Y 8 HOH 132 932  44   HOH HOH A . 
Y 8 HOH 133 933  261  HOH HOH A . 
Y 8 HOH 134 934  449  HOH HOH A . 
Y 8 HOH 135 935  161  HOH HOH A . 
Y 8 HOH 136 936  433  HOH HOH A . 
Y 8 HOH 137 937  381  HOH HOH A . 
Y 8 HOH 138 938  441  HOH HOH A . 
Y 8 HOH 139 939  209  HOH HOH A . 
Y 8 HOH 140 940  522  HOH HOH A . 
Y 8 HOH 141 941  178  HOH HOH A . 
Y 8 HOH 142 942  385  HOH HOH A . 
Y 8 HOH 143 943  263  HOH HOH A . 
Y 8 HOH 144 944  75   HOH HOH A . 
Y 8 HOH 145 945  549  HOH HOH A . 
Y 8 HOH 146 946  328  HOH HOH A . 
Y 8 HOH 147 947  50   HOH HOH A . 
Y 8 HOH 148 948  568  HOH HOH A . 
Y 8 HOH 149 949  583  HOH HOH A . 
Y 8 HOH 150 950  262  HOH HOH A . 
Y 8 HOH 151 951  45   HOH HOH A . 
Y 8 HOH 152 952  201  HOH HOH A . 
Y 8 HOH 153 953  410  HOH HOH A . 
Y 8 HOH 154 954  365  HOH HOH A . 
Y 8 HOH 155 955  28   HOH HOH A . 
Y 8 HOH 156 956  66   HOH HOH A . 
Y 8 HOH 157 957  192  HOH HOH A . 
Y 8 HOH 158 958  195  HOH HOH A . 
Y 8 HOH 159 959  205  HOH HOH A . 
Y 8 HOH 160 960  282  HOH HOH A . 
Y 8 HOH 161 961  504  HOH HOH A . 
Y 8 HOH 162 962  255  HOH HOH A . 
Y 8 HOH 163 963  116  HOH HOH A . 
Y 8 HOH 164 964  223  HOH HOH A . 
Y 8 HOH 165 965  29   HOH HOH A . 
Y 8 HOH 166 966  404  HOH HOH A . 
Y 8 HOH 167 967  260  HOH HOH A . 
Y 8 HOH 168 968  99   HOH HOH A . 
Y 8 HOH 169 969  380  HOH HOH A . 
Y 8 HOH 170 970  614  HOH HOH A . 
Y 8 HOH 171 971  391  HOH HOH A . 
Y 8 HOH 172 972  416  HOH HOH A . 
Y 8 HOH 173 973  413  HOH HOH A . 
Y 8 HOH 174 974  39   HOH HOH A . 
Y 8 HOH 175 975  134  HOH HOH A . 
Y 8 HOH 176 976  104  HOH HOH A . 
Y 8 HOH 177 977  55   HOH HOH A . 
Y 8 HOH 178 978  396  HOH HOH A . 
Y 8 HOH 179 979  334  HOH HOH A . 
Y 8 HOH 180 980  33   HOH HOH A . 
Y 8 HOH 181 981  180  HOH HOH A . 
Y 8 HOH 182 982  15   HOH HOH A . 
Y 8 HOH 183 983  184  HOH HOH A . 
Y 8 HOH 184 984  276  HOH HOH A . 
Y 8 HOH 185 985  250  HOH HOH A . 
Y 8 HOH 186 986  612  HOH HOH A . 
Y 8 HOH 187 987  456  HOH HOH A . 
Y 8 HOH 188 988  536  HOH HOH A . 
Y 8 HOH 189 989  32   HOH HOH A . 
Y 8 HOH 190 990  579  HOH HOH A . 
Y 8 HOH 191 991  361  HOH HOH A . 
Y 8 HOH 192 992  310  HOH HOH A . 
Y 8 HOH 193 993  403  HOH HOH A . 
Y 8 HOH 194 994  431  HOH HOH A . 
Y 8 HOH 195 995  378  HOH HOH A . 
Y 8 HOH 196 996  244  HOH HOH A . 
Y 8 HOH 197 997  535  HOH HOH A . 
Y 8 HOH 198 998  220  HOH HOH A . 
Y 8 HOH 199 999  155  HOH HOH A . 
Y 8 HOH 200 1000 532  HOH HOH A . 
Y 8 HOH 201 1001 407  HOH HOH A . 
Y 8 HOH 202 1002 576  HOH HOH A . 
Y 8 HOH 203 1003 106  HOH HOH A . 
Y 8 HOH 204 1004 86   HOH HOH A . 
Y 8 HOH 205 1005 596  HOH HOH A . 
Y 8 HOH 206 1006 518  HOH HOH A . 
Y 8 HOH 207 1007 299  HOH HOH A . 
Y 8 HOH 208 1008 87   HOH HOH A . 
Y 8 HOH 209 1009 266  HOH HOH A . 
Y 8 HOH 210 1010 212  HOH HOH A . 
Y 8 HOH 211 1011 427  HOH HOH A . 
Y 8 HOH 212 1012 437  HOH HOH A . 
Y 8 HOH 213 1013 303  HOH HOH A . 
Y 8 HOH 214 1014 434  HOH HOH A . 
Y 8 HOH 215 1015 314  HOH HOH A . 
Y 8 HOH 216 1016 609  HOH HOH A . 
Y 8 HOH 217 1017 147  HOH HOH A . 
Y 8 HOH 218 1018 514  HOH HOH A . 
Y 8 HOH 219 1019 91   HOH HOH A . 
Y 8 HOH 220 1020 445  HOH HOH A . 
Y 8 HOH 221 1021 162  HOH HOH A . 
Y 8 HOH 222 1022 268  HOH HOH A . 
Y 8 HOH 223 1023 397  HOH HOH A . 
Y 8 HOH 224 1024 154  HOH HOH A . 
Y 8 HOH 225 1025 369  HOH HOH A . 
Y 8 HOH 226 1026 447  HOH HOH A . 
Y 8 HOH 227 1027 438  HOH HOH A . 
Y 8 HOH 228 1028 164  HOH HOH A . 
Y 8 HOH 229 1029 11   HOH HOH A . 
Y 8 HOH 230 1030 312  HOH HOH A . 
Y 8 HOH 231 1031 193  HOH HOH A . 
Y 8 HOH 232 1032 79   HOH HOH A . 
Y 8 HOH 233 1033 185  HOH HOH A . 
Y 8 HOH 234 1034 345  HOH HOH A . 
Y 8 HOH 235 1035 611  HOH HOH A . 
Y 8 HOH 236 1036 131  HOH HOH A . 
Y 8 HOH 237 1037 52   HOH HOH A . 
Y 8 HOH 238 1038 401  HOH HOH A . 
Y 8 HOH 239 1039 508  HOH HOH A . 
Y 8 HOH 240 1040 619  HOH HOH A . 
Y 8 HOH 241 1041 605  HOH HOH A . 
Y 8 HOH 242 1042 439  HOH HOH A . 
Y 8 HOH 243 1043 273  HOH HOH A . 
Y 8 HOH 244 1044 607  HOH HOH A . 
Y 8 HOH 245 1045 506  HOH HOH A . 
Y 8 HOH 246 1046 505  HOH HOH A . 
Y 8 HOH 247 1047 322  HOH HOH A . 
Y 8 HOH 248 1048 426  HOH HOH A . 
Y 8 HOH 249 1049 604  HOH HOH A . 
Y 8 HOH 250 1050 291  HOH HOH A . 
Y 8 HOH 251 1051 554  HOH HOH A . 
Y 8 HOH 252 1052 406  HOH HOH A . 
Y 8 HOH 253 1053 601  HOH HOH A . 
Y 8 HOH 254 1054 435  HOH HOH A . 
Y 8 HOH 255 1055 556  HOH HOH A . 
Y 8 HOH 256 1056 395  HOH HOH A . 
Y 8 HOH 257 1057 581  HOH HOH A . 
Y 8 HOH 258 1058 376  HOH HOH A . 
Y 8 HOH 259 1059 81   HOH HOH A . 
Y 8 HOH 260 1060 432  HOH HOH A . 
Y 8 HOH 261 1061 77   HOH HOH A . 
Y 8 HOH 262 1062 521  HOH HOH A . 
Y 8 HOH 263 1063 248  HOH HOH A . 
Y 8 HOH 264 1064 305  HOH HOH A . 
Y 8 HOH 265 1065 398  HOH HOH A . 
Y 8 HOH 266 1066 620  HOH HOH A . 
Y 8 HOH 267 1067 351  HOH HOH A . 
Y 8 HOH 268 1068 405  HOH HOH A . 
Y 8 HOH 269 1069 419  HOH HOH A . 
Y 8 HOH 270 1070 600  HOH HOH A . 
Y 8 HOH 271 1071 451  HOH HOH A . 
Y 8 HOH 272 1072 400  HOH HOH A . 
Y 8 HOH 273 1073 311  HOH HOH A . 
Y 8 HOH 274 1074 571  HOH HOH A . 
Y 8 HOH 275 1075 213  HOH HOH A . 
Y 8 HOH 276 1076 450  HOH HOH A . 
Y 8 HOH 277 1077 393  HOH HOH A . 
Y 8 HOH 278 1078 170  HOH HOH A . 
Y 8 HOH 279 1079 338  HOH HOH A . 
Y 8 HOH 280 1080 346  HOH HOH A . 
Y 8 HOH 281 1081 517  HOH HOH A . 
Y 8 HOH 282 1082 245  HOH HOH A . 
Y 8 HOH 283 1083 531  HOH HOH A . 
Y 8 HOH 284 1084 373  HOH HOH A . 
Y 8 HOH 285 1085 358  HOH HOH A . 
Y 8 HOH 286 1086 2    HOH HOH A . 
Y 8 HOH 287 1087 202  HOH HOH A . 
Y 8 HOH 288 1088 370  HOH HOH A . 
Y 8 HOH 289 1089 643  HOH HOH A . 
Y 8 HOH 290 1090 390  HOH HOH A . 
Y 8 HOH 291 1091 341  HOH HOH A . 
Y 8 HOH 292 1092 446  HOH HOH A . 
Y 8 HOH 293 1093 422  HOH HOH A . 
Y 8 HOH 294 1094 372  HOH HOH A . 
Y 8 HOH 295 1095 379  HOH HOH A . 
Y 8 HOH 296 1096 243  HOH HOH A . 
Y 8 HOH 297 1097 340  HOH HOH A . 
Y 8 HOH 298 1098 231  HOH HOH A . 
Y 8 HOH 299 1099 331  HOH HOH A . 
Y 8 HOH 300 1100 399  HOH HOH A . 
Y 8 HOH 301 1101 353  HOH HOH A . 
Y 8 HOH 302 1102 417  HOH HOH A . 
Y 8 HOH 303 1103 428  HOH HOH A . 
Y 8 HOH 304 1104 444  HOH HOH A . 
Y 8 HOH 305 1105 520  HOH HOH A . 
Y 8 HOH 306 1106 350  HOH HOH A . 
Y 8 HOH 307 1107 442  HOH HOH A . 
Y 8 HOH 308 1108 529  HOH HOH A . 
Y 8 HOH 309 1109 415  HOH HOH A . 
Y 8 HOH 310 1110 594  HOH HOH A . 
Y 8 HOH 311 1111 386  HOH HOH A . 
Y 8 HOH 312 1112 307  HOH HOH A . 
Y 8 HOH 313 1113 343  HOH HOH A . 
Y 8 HOH 314 1114 234  HOH HOH A . 
Y 8 HOH 315 1115 329  HOH HOH A . 
Y 8 HOH 316 1116 534  HOH HOH A . 
Y 8 HOH 317 1117 436  HOH HOH A . 
Y 8 HOH 318 1118 424  HOH HOH A . 
Y 8 HOH 319 1119 281  HOH HOH A . 
Y 8 HOH 320 1120 249  HOH HOH A . 
Y 8 HOH 321 1121 320  HOH HOH A . 
Y 8 HOH 322 1122 519  HOH HOH A . 
Y 8 HOH 323 1123 371  HOH HOH A . 
Y 8 HOH 324 1124 230  HOH HOH A . 
Y 8 HOH 325 1125 362  HOH HOH A . 
Y 8 HOH 326 1126 191  HOH HOH A . 
Y 8 HOH 327 1127 565  HOH HOH A . 
Y 8 HOH 328 1128 420  HOH HOH A . 
Y 8 HOH 329 1129 412  HOH HOH A . 
Y 8 HOH 330 1130 645  HOH HOH A . 
Y 8 HOH 331 1131 569  HOH HOH A . 
Y 8 HOH 332 1132 642  HOH HOH A . 
Y 8 HOH 333 1133 430  HOH HOH A . 
Z 8 HOH 1   1701 524  HOH HOH B . 
Z 8 HOH 2   1702 27   HOH HOH B . 
Z 8 HOH 3   1703 271  HOH HOH B . 
Z 8 HOH 4   1704 516  HOH HOH B . 
Z 8 HOH 5   1705 222  HOH HOH B . 
Z 8 HOH 6   1706 560  HOH HOH B . 
Z 8 HOH 7   1707 463  HOH HOH B . 
Z 8 HOH 8   1708 272  HOH HOH B . 
Z 8 HOH 9   1709 174  HOH HOH B . 
Z 8 HOH 10  1710 287  HOH HOH B . 
Z 8 HOH 11  1711 539  HOH HOH B . 
Z 8 HOH 12  1712 638  HOH HOH B . 
Z 8 HOH 13  1713 110  HOH HOH B . 
Z 8 HOH 14  1714 294  HOH HOH B . 
Z 8 HOH 15  1715 208  HOH HOH B . 
Z 8 HOH 16  1716 130  HOH HOH B . 
Z 8 HOH 17  1717 402  HOH HOH B . 
Z 8 HOH 18  1718 135  HOH HOH B . 
Z 8 HOH 19  1719 241  HOH HOH B . 
Z 8 HOH 20  1720 364  HOH HOH B . 
Z 8 HOH 21  1721 490  HOH HOH B . 
Z 8 HOH 22  1722 67   HOH HOH B . 
Z 8 HOH 23  1723 603  HOH HOH B . 
Z 8 HOH 24  1724 469  HOH HOH B . 
Z 8 HOH 25  1725 148  HOH HOH B . 
Z 8 HOH 26  1726 176  HOH HOH B . 
Z 8 HOH 27  1727 140  HOH HOH B . 
Z 8 HOH 28  1728 54   HOH HOH B . 
Z 8 HOH 29  1729 457  HOH HOH B . 
Z 8 HOH 30  1730 246  HOH HOH B . 
Z 8 HOH 31  1731 267  HOH HOH B . 
Z 8 HOH 32  1732 368  HOH HOH B . 
Z 8 HOH 33  1733 177  HOH HOH B . 
Z 8 HOH 34  1734 470  HOH HOH B . 
Z 8 HOH 35  1735 487  HOH HOH B . 
Z 8 HOH 36  1736 143  HOH HOH B . 
Z 8 HOH 37  1737 34   HOH HOH B . 
Z 8 HOH 38  1738 35   HOH HOH B . 
Z 8 HOH 39  1739 226  HOH HOH B . 
Z 8 HOH 40  1740 528  HOH HOH B . 
Z 8 HOH 41  1741 71   HOH HOH B . 
Z 8 HOH 42  1742 636  HOH HOH B . 
Z 8 HOH 43  1743 188  HOH HOH B . 
Z 8 HOH 44  1744 339  HOH HOH B . 
Z 8 HOH 45  1745 627  HOH HOH B . 
Z 8 HOH 46  1746 89   HOH HOH B . 
Z 8 HOH 47  1747 585  HOH HOH B . 
Z 8 HOH 48  1748 484  HOH HOH B . 
Z 8 HOH 49  1749 236  HOH HOH B . 
Z 8 HOH 50  1750 558  HOH HOH B . 
Z 8 HOH 51  1751 622  HOH HOH B . 
Z 8 HOH 52  1752 82   HOH HOH B . 
Z 8 HOH 53  1753 48   HOH HOH B . 
Z 8 HOH 54  1754 458  HOH HOH B . 
Z 8 HOH 55  1755 537  HOH HOH B . 
Z 8 HOH 56  1756 95   HOH HOH B . 
Z 8 HOH 57  1757 623  HOH HOH B . 
Z 8 HOH 58  1758 18   HOH HOH B . 
Z 8 HOH 59  1759 10   HOH HOH B . 
Z 8 HOH 60  1760 145  HOH HOH B . 
Z 8 HOH 61  1761 31   HOH HOH B . 
Z 8 HOH 62  1762 196  HOH HOH B . 
Z 8 HOH 63  1763 499  HOH HOH B . 
Z 8 HOH 64  1764 59   HOH HOH B . 
Z 8 HOH 65  1765 237  HOH HOH B . 
Z 8 HOH 66  1766 103  HOH HOH B . 
Z 8 HOH 67  1767 96   HOH HOH B . 
Z 8 HOH 68  1768 550  HOH HOH B . 
Z 8 HOH 69  1769 123  HOH HOH B . 
Z 8 HOH 70  1770 492  HOH HOH B . 
Z 8 HOH 71  1771 476  HOH HOH B . 
Z 8 HOH 72  1772 239  HOH HOH B . 
Z 8 HOH 73  1773 483  HOH HOH B . 
Z 8 HOH 74  1774 471  HOH HOH B . 
Z 8 HOH 75  1775 9    HOH HOH B . 
Z 8 HOH 76  1776 105  HOH HOH B . 
Z 8 HOH 77  1777 275  HOH HOH B . 
Z 8 HOH 78  1778 251  HOH HOH B . 
Z 8 HOH 79  1779 115  HOH HOH B . 
Z 8 HOH 80  1780 133  HOH HOH B . 
Z 8 HOH 81  1781 274  HOH HOH B . 
Z 8 HOH 82  1782 14   HOH HOH B . 
Z 8 HOH 83  1783 137  HOH HOH B . 
Z 8 HOH 84  1784 639  HOH HOH B . 
Z 8 HOH 85  1785 98   HOH HOH B . 
Z 8 HOH 86  1786 288  HOH HOH B . 
Z 8 HOH 87  1787 22   HOH HOH B . 
Z 8 HOH 88  1788 485  HOH HOH B . 
Z 8 HOH 89  1789 80   HOH HOH B . 
Z 8 HOH 90  1790 507  HOH HOH B . 
Z 8 HOH 91  1791 74   HOH HOH B . 
Z 8 HOH 92  1792 285  HOH HOH B . 
Z 8 HOH 93  1793 215  HOH HOH B . 
Z 8 HOH 94  1794 179  HOH HOH B . 
Z 8 HOH 95  1795 92   HOH HOH B . 
Z 8 HOH 96  1796 47   HOH HOH B . 
Z 8 HOH 97  1797 144  HOH HOH B . 
Z 8 HOH 98  1798 495  HOH HOH B . 
Z 8 HOH 99  1799 633  HOH HOH B . 
Z 8 HOH 100 1800 60   HOH HOH B . 
Z 8 HOH 101 1801 621  HOH HOH B . 
Z 8 HOH 102 1802 319  HOH HOH B . 
Z 8 HOH 103 1803 324  HOH HOH B . 
Z 8 HOH 104 1804 254  HOH HOH B . 
Z 8 HOH 105 1805 300  HOH HOH B . 
Z 8 HOH 106 1806 63   HOH HOH B . 
Z 8 HOH 107 1807 318  HOH HOH B . 
Z 8 HOH 108 1808 286  HOH HOH B . 
Z 8 HOH 109 1809 278  HOH HOH B . 
Z 8 HOH 110 1810 552  HOH HOH B . 
Z 8 HOH 111 1811 150  HOH HOH B . 
Z 8 HOH 112 1812 157  HOH HOH B . 
Z 8 HOH 113 1813 264  HOH HOH B . 
Z 8 HOH 114 1814 323  HOH HOH B . 
Z 8 HOH 115 1815 43   HOH HOH B . 
Z 8 HOH 116 1816 356  HOH HOH B . 
Z 8 HOH 117 1817 225  HOH HOH B . 
Z 8 HOH 118 1818 173  HOH HOH B . 
Z 8 HOH 119 1819 455  HOH HOH B . 
Z 8 HOH 120 1820 488  HOH HOH B . 
Z 8 HOH 121 1821 136  HOH HOH B . 
Z 8 HOH 122 1822 107  HOH HOH B . 
Z 8 HOH 123 1823 290  HOH HOH B . 
Z 8 HOH 124 1824 308  HOH HOH B . 
Z 8 HOH 125 1825 102  HOH HOH B . 
Z 8 HOH 126 1826 197  HOH HOH B . 
Z 8 HOH 127 1827 480  HOH HOH B . 
Z 8 HOH 128 1828 76   HOH HOH B . 
Z 8 HOH 129 1829 58   HOH HOH B . 
Z 8 HOH 130 1830 584  HOH HOH B . 
Z 8 HOH 131 1831 624  HOH HOH B . 
Z 8 HOH 132 1832 333  HOH HOH B . 
Z 8 HOH 133 1833 367  HOH HOH B . 
Z 8 HOH 134 1834 85   HOH HOH B . 
Z 8 HOH 135 1835 283  HOH HOH B . 
Z 8 HOH 136 1836 317  HOH HOH B . 
Z 8 HOH 137 1837 112  HOH HOH B . 
Z 8 HOH 138 1838 158  HOH HOH B . 
Z 8 HOH 139 1839 252  HOH HOH B . 
Z 8 HOH 140 1840 129  HOH HOH B . 
Z 8 HOH 141 1841 65   HOH HOH B . 
Z 8 HOH 142 1842 497  HOH HOH B . 
Z 8 HOH 143 1843 293  HOH HOH B . 
Z 8 HOH 144 1844 491  HOH HOH B . 
Z 8 HOH 145 1845 468  HOH HOH B . 
Z 8 HOH 146 1846 547  HOH HOH B . 
Z 8 HOH 147 1847 49   HOH HOH B . 
Z 8 HOH 148 1848 101  HOH HOH B . 
Z 8 HOH 149 1849 128  HOH HOH B . 
Z 8 HOH 150 1850 586  HOH HOH B . 
Z 8 HOH 151 1851 355  HOH HOH B . 
Z 8 HOH 152 1852 229  HOH HOH B . 
Z 8 HOH 153 1853 625  HOH HOH B . 
Z 8 HOH 154 1854 20   HOH HOH B . 
Z 8 HOH 155 1855 629  HOH HOH B . 
Z 8 HOH 156 1856 344  HOH HOH B . 
Z 8 HOH 157 1857 477  HOH HOH B . 
Z 8 HOH 158 1858 626  HOH HOH B . 
Z 8 HOH 159 1859 204  HOH HOH B . 
Z 8 HOH 160 1860 553  HOH HOH B . 
Z 8 HOH 161 1861 240  HOH HOH B . 
Z 8 HOH 162 1862 199  HOH HOH B . 
Z 8 HOH 163 1863 327  HOH HOH B . 
Z 8 HOH 164 1864 108  HOH HOH B . 
Z 8 HOH 165 1865 462  HOH HOH B . 
Z 8 HOH 166 1866 132  HOH HOH B . 
Z 8 HOH 167 1867 25   HOH HOH B . 
Z 8 HOH 168 1868 224  HOH HOH B . 
Z 8 HOH 169 1869 363  HOH HOH B . 
Z 8 HOH 170 1870 454  HOH HOH B . 
Z 8 HOH 171 1871 525  HOH HOH B . 
Z 8 HOH 172 1872 64   HOH HOH B . 
Z 8 HOH 173 1873 326  HOH HOH B . 
Z 8 HOH 174 1874 163  HOH HOH B . 
Z 8 HOH 175 1875 257  HOH HOH B . 
Z 8 HOH 176 1876 540  HOH HOH B . 
Z 8 HOH 177 1877 189  HOH HOH B . 
Z 8 HOH 178 1878 567  HOH HOH B . 
Z 8 HOH 179 1879 500  HOH HOH B . 
Z 8 HOH 180 1880 634  HOH HOH B . 
Z 8 HOH 181 1881 141  HOH HOH B . 
Z 8 HOH 182 1882 159  HOH HOH B . 
Z 8 HOH 183 1883 475  HOH HOH B . 
Z 8 HOH 184 1884 494  HOH HOH B . 
Z 8 HOH 185 1885 496  HOH HOH B . 
Z 8 HOH 186 1886 19   HOH HOH B . 
Z 8 HOH 187 1887 156  HOH HOH B . 
Z 8 HOH 188 1888 530  HOH HOH B . 
Z 8 HOH 189 1889 302  HOH HOH B . 
Z 8 HOH 190 1890 493  HOH HOH B . 
Z 8 HOH 191 1891 200  HOH HOH B . 
Z 8 HOH 192 1892 646  HOH HOH B . 
Z 8 HOH 193 1893 538  HOH HOH B . 
Z 8 HOH 194 1894 503  HOH HOH B . 
Z 8 HOH 195 1895 198  HOH HOH B . 
Z 8 HOH 196 1896 349  HOH HOH B . 
Z 8 HOH 197 1897 122  HOH HOH B . 
Z 8 HOH 198 1898 256  HOH HOH B . 
Z 8 HOH 199 1899 109  HOH HOH B . 
Z 8 HOH 200 1900 587  HOH HOH B . 
Z 8 HOH 201 1901 124  HOH HOH B . 
Z 8 HOH 202 1902 277  HOH HOH B . 
Z 8 HOH 203 1903 138  HOH HOH B . 
Z 8 HOH 204 1904 90   HOH HOH B . 
Z 8 HOH 205 1905 575  HOH HOH B . 
Z 8 HOH 206 1906 548  HOH HOH B . 
Z 8 HOH 207 1907 337  HOH HOH B . 
Z 8 HOH 208 1908 360  HOH HOH B . 
Z 8 HOH 209 1909 238  HOH HOH B . 
Z 8 HOH 210 1910 489  HOH HOH B . 
Z 8 HOH 211 1911 219  HOH HOH B . 
Z 8 HOH 212 1912 384  HOH HOH B . 
Z 8 HOH 213 1913 599  HOH HOH B . 
Z 8 HOH 214 1914 228  HOH HOH B . 
Z 8 HOH 215 1915 573  HOH HOH B . 
Z 8 HOH 216 1916 479  HOH HOH B . 
Z 8 HOH 217 1917 640  HOH HOH B . 
Z 8 HOH 218 1918 235  HOH HOH B . 
Z 8 HOH 219 1919 53   HOH HOH B . 
Z 8 HOH 220 1920 269  HOH HOH B . 
Z 8 HOH 221 1921 182  HOH HOH B . 
Z 8 HOH 222 1922 149  HOH HOH B . 
Z 8 HOH 223 1923 335  HOH HOH B . 
Z 8 HOH 224 1924 194  HOH HOH B . 
Z 8 HOH 225 1925 186  HOH HOH B . 
Z 8 HOH 226 1926 512  HOH HOH B . 
Z 8 HOH 227 1927 466  HOH HOH B . 
Z 8 HOH 228 1928 207  HOH HOH B . 
Z 8 HOH 229 1929 348  HOH HOH B . 
Z 8 HOH 230 1930 478  HOH HOH B . 
Z 8 HOH 231 1931 36   HOH HOH B . 
Z 8 HOH 232 1932 523  HOH HOH B . 
Z 8 HOH 233 1933 465  HOH HOH B . 
Z 8 HOH 234 1934 306  HOH HOH B . 
Z 8 HOH 235 1935 513  HOH HOH B . 
Z 8 HOH 236 1936 628  HOH HOH B . 
Z 8 HOH 237 1937 572  HOH HOH B . 
Z 8 HOH 238 1938 16   HOH HOH B . 
Z 8 HOH 239 1939 357  HOH HOH B . 
Z 8 HOH 240 1940 375  HOH HOH B . 
Z 8 HOH 241 1941 1    HOH HOH B . 
Z 8 HOH 242 1942 218  HOH HOH B . 
Z 8 HOH 243 1943 40   HOH HOH B . 
Z 8 HOH 244 1944 630  HOH HOH B . 
Z 8 HOH 245 1945 557  HOH HOH B . 
Z 8 HOH 246 1946 187  HOH HOH B . 
Z 8 HOH 247 1947 342  HOH HOH B . 
Z 8 HOH 248 1948 374  HOH HOH B . 
Z 8 HOH 249 1949 551  HOH HOH B . 
Z 8 HOH 250 1950 216  HOH HOH B . 
Z 8 HOH 251 1951 354  HOH HOH B . 
Z 8 HOH 252 1952 330  HOH HOH B . 
Z 8 HOH 253 1953 482  HOH HOH B . 
Z 8 HOH 254 1954 526  HOH HOH B . 
Z 8 HOH 255 1955 544  HOH HOH B . 
Z 8 HOH 256 1956 472  HOH HOH B . 
Z 8 HOH 257 1957 541  HOH HOH B . 
Z 8 HOH 258 1958 366  HOH HOH B . 
Z 8 HOH 259 1959 608  HOH HOH B . 
Z 8 HOH 260 1960 347  HOH HOH B . 
Z 8 HOH 261 1961 452  HOH HOH B . 
Z 8 HOH 262 1962 577  HOH HOH B . 
Z 8 HOH 263 1963 570  HOH HOH B . 
Z 8 HOH 264 1964 359  HOH HOH B . 
Z 8 HOH 265 1965 631  HOH HOH B . 
Z 8 HOH 266 1966 473  HOH HOH B . 
Z 8 HOH 267 1967 217  HOH HOH B . 
Z 8 HOH 268 1968 509  HOH HOH B . 
Z 8 HOH 269 1969 593  HOH HOH B . 
Z 8 HOH 270 1970 498  HOH HOH B . 
Z 8 HOH 271 1971 545  HOH HOH B . 
Z 8 HOH 272 1972 502  HOH HOH B . 
Z 8 HOH 273 1973 474  HOH HOH B . 
Z 8 HOH 274 1974 214  HOH HOH B . 
Z 8 HOH 275 1975 461  HOH HOH B . 
Z 8 HOH 276 1976 460  HOH HOH B . 
Z 8 HOH 277 1977 78   HOH HOH B . 
Z 8 HOH 278 1978 265  HOH HOH B . 
Z 8 HOH 279 1979 313  HOH HOH B . 
Z 8 HOH 280 1980 564  HOH HOH B . 
Z 8 HOH 281 1981 598  HOH HOH B . 
Z 8 HOH 282 1982 284  HOH HOH B . 
Z 8 HOH 283 1983 315  HOH HOH B . 
Z 8 HOH 284 1984 510  HOH HOH B . 
Z 8 HOH 285 1985 501  HOH HOH B . 
Z 8 HOH 286 1986 57   HOH HOH B . 
Z 8 HOH 287 1987 555  HOH HOH B . 
Z 8 HOH 288 1988 527  HOH HOH B . 
Z 8 HOH 289 1989 597  HOH HOH B . 
Z 8 HOH 290 1990 467  HOH HOH B . 
Z 8 HOH 291 1991 647  HOH HOH B . 
Z 8 HOH 292 1992 559  HOH HOH B . 
Z 8 HOH 293 1993 459  HOH HOH B . 
Z 8 HOH 294 1994 641  HOH HOH B . 
Z 8 HOH 295 1995 464  HOH HOH B . 
Z 8 HOH 296 1996 232  HOH HOH B . 
Z 8 HOH 297 1997 486  HOH HOH B . 
Z 8 HOH 298 1998 301  HOH HOH B . 
Z 8 HOH 299 1999 580  HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 350 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 350 B ASN 350 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-07-18 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-10-05 
5 'Structure model' 2 0 2020-07-29 
6 'Structure model' 3 0 2021-03-10 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' Advisory                    
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' 'Derived calculations'      
5  5 'Structure model' Advisory                    
6  5 'Structure model' 'Atomic model'              
7  5 'Structure model' 'Data collection'           
8  5 'Structure model' 'Derived calculations'      
9  5 'Structure model' 'Structure summary'         
10 6 'Structure model' Advisory                    
11 6 'Structure model' 'Atomic model'              
12 6 'Structure model' 'Data collection'           
13 6 'Structure model' 'Derived calculations'      
14 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  5 'Structure model' atom_site                     
2  5 'Structure model' chem_comp                     
3  5 'Structure model' database_PDB_caveat           
4  5 'Structure model' entity                        
5  5 'Structure model' pdbx_branch_scheme            
6  5 'Structure model' pdbx_chem_comp_identifier     
7  5 'Structure model' pdbx_entity_branch            
8  5 'Structure model' pdbx_entity_branch_descriptor 
9  5 'Structure model' pdbx_entity_branch_link       
10 5 'Structure model' pdbx_entity_branch_list       
11 5 'Structure model' pdbx_entity_nonpoly           
12 5 'Structure model' pdbx_nonpoly_scheme           
13 5 'Structure model' pdbx_struct_assembly_gen      
14 5 'Structure model' pdbx_validate_chiral          
15 5 'Structure model' struct_asym                   
16 5 'Structure model' struct_conn                   
17 5 'Structure model' struct_site                   
18 5 'Structure model' struct_site_gen               
19 6 'Structure model' atom_site                     
20 6 'Structure model' chem_comp                     
21 6 'Structure model' pdbx_nonpoly_scheme           
22 6 'Structure model' pdbx_validate_close_contact   
23 6 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_atom_site.auth_asym_id'                    
2  5 'Structure model' '_atom_site.auth_seq_id'                     
3  5 'Structure model' '_atom_site.label_asym_id'                   
4  5 'Structure model' '_atom_site.label_entity_id'                 
5  5 'Structure model' '_chem_comp.name'                            
6  5 'Structure model' '_chem_comp.type'                            
7  5 'Structure model' '_entity.formula_weight'                     
8  5 'Structure model' '_entity.pdbx_description'                   
9  5 'Structure model' '_entity.pdbx_number_of_molecules'           
10 5 'Structure model' '_entity.type'                               
11 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'     
12 5 'Structure model' '_pdbx_validate_chiral.auth_asym_id'         
13 5 'Structure model' '_pdbx_validate_chiral.auth_seq_id'          
14 5 'Structure model' '_struct_conn.pdbx_dist_value'               
15 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'        
16 5 'Structure model' '_struct_conn.pdbx_role'                     
17 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'            
18 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'            
19 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'             
20 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'           
21 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'           
22 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'           
23 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'            
24 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'            
25 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'            
26 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'             
27 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'           
28 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'           
29 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'           
30 6 'Structure model' '_atom_site.B_iso_or_equiv'                  
31 6 'Structure model' '_atom_site.Cartn_x'                         
32 6 'Structure model' '_atom_site.Cartn_y'                         
33 6 'Structure model' '_atom_site.Cartn_z'                         
34 6 'Structure model' '_atom_site.auth_asym_id'                    
35 6 'Structure model' '_atom_site.auth_seq_id'                     
36 6 'Structure model' '_atom_site.label_asym_id'                   
37 6 'Structure model' '_chem_comp.pdbx_synonyms'                   
38 6 'Structure model' '_pdbx_nonpoly_scheme.asym_id'               
39 6 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num'          
40 6 'Structure model' '_pdbx_nonpoly_scheme.ndb_seq_num'           
41 6 'Structure model' '_pdbx_nonpoly_scheme.pdb_seq_num'           
42 6 'Structure model' '_pdbx_nonpoly_scheme.pdb_strand_id'         
43 6 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1' 
44 6 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 27.3484 11.9172 16.6084  -.1321 -.1579 -.0405 .0048  .0009  .0234  .9838 .8985  2.1706 -.0564 .0670 -.3403 -.0287 
.0223 -.0341 -.0090 .0057  -.0014 .1984 -.1082 .0230 'X-RAY DIFFRACTION' 
2 ? refined 7.7214  4.6687  -40.6292 -.1222 -.1451 -.0932 -.0161 -.0260 -.0659 .6540 1.0501 2.4895 -.0662 .0368 .4229  .0908  
.0626 -.0362 .0862  -.0987 .0425  .1815 .0071  .0079 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 3 A 3 A 543 A 543 ? 'X-RAY DIFFRACTION' ? 
2 2 B 4 B 4 B 543 B 543 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
ADSC      'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 I   B IOD 1606 ? ? O  B HOH 1980 ? ? 1.52 
2 1 O   A HOH 1048 ? ? O  A HOH 1058 ? ? 2.01 
3 1 O   A HOH 1089 ? ? O  A HOH 1097 ? ? 2.02 
4 1 O   A HOH 980  ? ? O  A HOH 1088 ? ? 2.09 
5 1 O   A HOH 1088 ? ? O  A HOH 1113 ? ? 2.11 
6 1 OE1 B GLN 181  ? A O  B HOH 1701 ? ? 2.17 
7 1 OG  B SER 203  ? ? O7 B NWA 1609 ? ? 2.18 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              246 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              246 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              246 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.04 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.26 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 69.59   -3.24   
2  1 ALA A 62  ? ? -117.08 50.36   
3  1 SER A 203 ? ? 60.98   -121.52 
4  1 ASP A 306 ? ? -130.02 -85.11  
5  1 VAL A 407 ? ? -128.62 -62.54  
6  1 ASP A 494 ? ? -61.79  99.57   
7  1 PHE B 47  ? ? 72.87   -3.01   
8  1 PHE B 123 ? ? 58.49   7.97    
9  1 SER B 203 ? ? 56.75   -125.19 
10 1 ASN B 265 ? ? 7.44    127.69  
11 1 ASP B 306 ? ? -132.34 -83.05  
12 1 VAL B 407 ? ? -128.07 -60.96  
13 1 SER B 495 ? ? -39.43  -80.73  
14 1 SER B 497 ? ? -162.43 33.36   
15 1 PRO B 498 ? ? 15.00   136.99  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   SER 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    497 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    498 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -117.21 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    C 
_pdbx_validate_chiral.auth_comp_id    FUC 
_pdbx_validate_chiral.auth_seq_id     2 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 496 ? CG ? A LYS 496 CG 
2 1 Y 1 A LYS 496 ? CD ? A LYS 496 CD 
3 1 Y 1 A LYS 496 ? CE ? A LYS 496 CE 
4 1 Y 1 A LYS 496 ? NZ ? A LYS 496 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 1   ? A GLU 1   
2  1 Y 1 A GLY 2   ? A GLY 2   
3  1 Y 1 A PRO 259 ? A PRO 259 
4  1 Y 1 A GLY 260 ? A GLY 260 
5  1 Y 1 A GLY 261 ? A GLY 261 
6  1 Y 1 A ALA 262 ? A ALA 262 
7  1 Y 1 A GLY 263 ? A GLY 263 
8  1 Y 1 A GLY 264 ? A GLY 264 
9  1 Y 1 B GLU 1   ? B GLU 1   
10 1 Y 1 B GLY 2   ? B GLY 2   
11 1 Y 1 B ARG 3   ? B ARG 3   
12 1 Y 1 B PRO 259 ? B PRO 259 
13 1 Y 1 B GLY 260 ? B GLY 260 
14 1 Y 1 B GLY 261 ? B GLY 261 
15 1 Y 1 B ALA 262 ? B ALA 262 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 C NAG 501 n 
C 2 FUC 2 C FUC 2 C FUC 502 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 LFucpa1-6DGlcpNAcb1-                                                 'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-2/a6-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(6+1)][a-L-Fucp]{}}}'                      LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  FUC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O6 
_pdbx_entity_branch_link.leaving_atom_id_2          HO6 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 FUC 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose      NAG 
4 'IODIDE ION'                                  IOD 
5 4,4-DIHYDROXY-N,N,N-TRIMETHYLPENTAN-1-AMINIUM NWA 
6 N,N,N-TRIMETHYL-4-OXOPENTAN-1-AMINIUM         CHH 
7 'HEXAETHYLENE GLYCOL'                         P6G 
8 water                                         HOH 
#