data_2HA2
# 
_entry.id   2HA2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2HA2         
RCSB  RCSB038118   
WWPDB D_1000038118 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1J06 'apo mACHE' unspecified 
PDB 2H9Y .           unspecified 
PDB 2HA0 .           unspecified 
PDB 2HA3 .           unspecified 
PDB 2HA4 .           unspecified 
PDB 2HA5 .           unspecified 
PDB 2HA6 .           unspecified 
PDB 2HA7 .           unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2HA2 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, Y.'       1 
'Radic, Z.'        2 
'Sulzenbacher, G.' 3 
'Kim, E.'          4 
'Taylor, P.'       5 
'Marchot, P.'      6 
# 
_citation.id                        primary 
_citation.title                     
;Substrate and product trafficking through the active center gorge of acetylcholinesterase analyzed by crystallography and equilibrium binding
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                29256 
_citation.page_last                 29267 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16837465 
_citation.pdbx_database_id_DOI      10.1074/jbc.M603018200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bourne, Y.'       1 ? 
primary 'Radic, Z.'        2 ? 
primary 'Sulzenbacher, G.' 3 ? 
primary 'Kim, E.'          4 ? 
primary 'Taylor, P.'       5 ? 
primary 'Marchot, P.'      6 ? 
# 
_cell.entry_id           2HA2 
_cell.length_a           78.935 
_cell.length_b           110.487 
_cell.length_c           227.809 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2HA2 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                                                      59764.488 2   3.1.1.7 
? 'catalytic domain' ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ?       
? ?                  ? 
3 non-polymer man alpha-L-fucopyranose                                                                      164.156   1   ?       
? ?                  ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208   2   ?       
? ?                  ? 
5 non-polymer syn "2,2'-[(1,4-DIOXOBUTANE-1,4-DIYL)BIS(OXY)]BIS(N,N,N-TRIMETHYLETHANAMINIUM)"               290.399   2   ?       
? ?                  ? 
6 non-polymer syn 'N,N,N-TRIMETHYL-2-[(4-OXOBUTANOYL)OXY]ETHANAMINIUM'                                      188.244   2   ?       
? ?                  ? 
7 non-polymer syn 'HEXAETHYLENE GLYCOL'                                                                     282.331   1   ?       
? ?                  ? 
8 water       nat water                                                                                     18.015    764 ?       
? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     Homo 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              'LAMBDA ZAP' 
_entity_src_gen.pdbx_host_org_cell_line            'HEK 293' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'HUMAN EMBRYONIC KIDNEY CELLS (HEK)' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           32 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2HA2 A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 2HA2 B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                                                     ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking'           y ARGININE                                                                    ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                                  ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                                             ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking'           y CYSTEINE                                                                    ? 'C3 H7 N O2 S' 
121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                                        ? 'C6 H12 O5' 
164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                                                   ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                                             ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'             y GLYCINE                                                                     ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking'           y HISTIDINE                                                                   ? 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer                   . WATER                                                                       ? 'H2 O' 18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                                  ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking'           y LEUCINE                                                                     ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking'           y LYSINE                                                                      ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking'           y METHIONINE                                                                  ? 'C5 H11 N O2 S' 
149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                                    ? 'C8 H15 N O6' 
221.208 
P6G non-polymer                   . 'HEXAETHYLENE GLYCOL'                                                       
'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'      282.331 
PHE 'L-peptide linking'           y PHENYLALANINE                                                               ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking'           y PROLINE                                                                     ? 'C5 H9 N O2' 
115.130 
SCK non-polymer                   . "2,2'-[(1,4-DIOXOBUTANE-1,4-DIYL)BIS(OXY)]BIS(N,N,N-TRIMETHYLETHANAMINIUM)" SUCCINYLDICHOLINE 
'C14 H30 N2 O4 2' 290.399 
SCU non-polymer                   . 'N,N,N-TRIMETHYL-2-[(4-OXOBUTANOYL)OXY]ETHANAMINIUM'                        
SUCCINYLMONOCHOLINE          'C9 H18 N O3 1'   188.244 
SER 'L-peptide linking'           y SERINE                                                                      ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking'           y THREONINE                                                                   ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                                  ? 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking'           y TYROSINE                                                                    ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking'           y VALINE                                                                      ? 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          2HA2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.15 
_exptl_crystal.density_percent_sol   70.38 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
'25-32% PEG550 MME or PEG600, 60-100mM HEPES or Na acetate, pH 6.5-8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2004-03-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.975 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.975 
# 
_reflns.entry_id                     2HA2 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.05 
_reflns.d_resolution_low             30 
_reflns.number_all                   ? 
_reflns.number_obs                   112415 
_reflns.percent_possible_obs         96.2 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.6 
_reflns.B_iso_Wilson_estimate        35.3 
_reflns.pdbx_redundancy              2.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.15 
_reflns_shell.percent_possible_all   55.1 
_reflns_shell.Rmerge_I_obs           0.385 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_redundancy        1.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2HA2 
_refine.ls_number_reflns_obs                     110041 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    89.87 
_refine.ls_R_factor_obs                          0.19227 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19168 
_refine.ls_R_factor_R_free                       0.22158 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  2255 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               .964 
_refine.correlation_coeff_Fo_to_Fc_free          .951 
_refine.B_iso_mean                               46.049 
_refine.aniso_B[1][1]                            2.25 
_refine.aniso_B[2][2]                            4.21 
_refine.aniso_B[3][3]                            -6.46 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             .80 
_refine.pdbx_solvent_shrinkage_radii             .80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1J06 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       .147 
_refine.pdbx_overall_ESU_R_Free                  .138 
_refine.overall_SU_ML                            .127 
_refine.overall_SU_B                             9.462 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8350 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         151 
_refine_hist.number_atoms_solvent             764 
_refine_hist.number_atoms_total               9265 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             .012   .022   ? 8813  'X-RAY DIFFRACTION' ? 
r_bond_other_d               .002   .020   ? 5984  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.410  1.973  ? 12043 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.045  3.002  ? 14422 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.508  5.000  ? 1078  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.057 22.775 ? 400   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.555 15.000 ? 1270  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.908 15.000 ? 75    'X-RAY DIFFRACTION' ? 
r_chiral_restr               .112   .200   ? 1299  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         .005   .020   ? 9843  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           .001   .020   ? 1882  'X-RAY DIFFRACTION' ? 
r_nbd_refined                .205   .200   ? 1929  'X-RAY DIFFRACTION' ? 
r_nbd_other                  .201   .200   ? 6471  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              .181   .200   ? 4352  'X-RAY DIFFRACTION' ? 
r_nbtor_other                .090   .200   ? 4468  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        .164   .200   ? 603   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          .021   .200   ? 1     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       .200   .200   ? 15    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         .300   .200   ? 50    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     .171   .200   ? 23    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  .734   1.500  ? 5717  'X-RAY DIFFRACTION' ? 
r_mcbond_other               .143   1.500  ? 2154  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.082  2.000  ? 8656  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.646  3.000  ? 3816  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.531  4.500  ? 3383  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.050 
_refine_ls_shell.d_res_low                        2.103 
_refine_ls_shell.number_reflns_R_work             4568 
_refine_ls_shell.R_factor_R_work                  0.315 
_refine_ls_shell.percent_reflns_obs               54.47 
_refine_ls_shell.R_factor_R_free                  0.319 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2HA2 
_struct.title                     'Crystal structure of mouse acetylcholinesterase complexed with succinylcholine' 
_struct.pdbx_descriptor           'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2HA2 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'HYDROLASE FOLD, SERINE ESTERASE, ACETYLCHOLINESTERASE, HOMODIMER, GLYCOSYLATED PROTEIN, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 8 ? 
M N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 274 ? ASN A 265 ARG A 274 1 ? 10 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASN A 464 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P24 24 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 525 ? SER A 541 ? ARG A 525 SER A 541 1 ? 17 
HELX_P HELX_P26 26 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P27 27 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P28 28 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P29 29 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P30 30 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P31 31 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P32 32 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P33 33 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P34 34 SER B 203 ? LEU B 214 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P35 35 SER B 215 ? PHE B 222 ? SER B 215 PHE B 222 5 ? 8  
HELX_P HELX_P36 36 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P37 37 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P38 38 PRO B 277 ? HIS B 284 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P39 39 GLU B 285 ? VAL B 288 ? GLU B 285 VAL B 288 5 ? 4  
HELX_P HELX_P40 40 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P41 41 GLY B 335 ? GLY B 342 ? GLY B 335 GLY B 342 5 ? 8  
HELX_P HELX_P42 42 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P43 43 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P44 44 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P45 45 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P46 46 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P47 47 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P48 48 GLY B 456 ? ASN B 464 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P49 49 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P50 50 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P51 51 ARG B 534 ? SER B 541 ? ARG B 534 SER B 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.129 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.063 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.061 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.098 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.071 ? ?               
covale1 covale none ? A SER 203 OG  ? ? ? 1_555 G SCU .   C5 B ? A SER 203 A SCU 902 1_555 ? ? ? ? ? ? ? 1.731 ? ?               
covale2 covale one  ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale3 covale one  ? A ASN 464 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 464 A NAG 701 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale4 covale none ? B SER 203 OG  ? ? ? 1_555 K SCU .   C5 B ? B SER 203 B SCU 952 1_555 ? ? ? ? ? ? ? 1.468 ? ?               
covale5 covale one  ? B ASN 350 ND2 ? ? ? 1_555 I NAG .   C1 ? ? B ASN 350 B NAG 601 1_555 ? ? ? ? ? ? ? 1.465 ? N-Glycosylation 
covale6 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -6.70 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 -2.07 
3 CYS 257 B . ? CYS 257 B PRO 258 B ? PRO 258 B 1 15.71 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 3  ? 
E ? 11 ? 
F ? 2  ? 
G ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? parallel      
E 5  6  ? parallel      
E 6  7  ? parallel      
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? parallel      
E 10 11 ? anti-parallel 
F 1  2  ? parallel      
G 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
A 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
A 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
B 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
B 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
B 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
B 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
B 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
B 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
B 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
B 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
B 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
B 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
B 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
C 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
C 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
D 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
D 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
D 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
E 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
E 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
E 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
E 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
E 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
E 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
E 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
E 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
E 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
E 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
E 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
F 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
F 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
G 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
G 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 10  ? N VAL A 10  O LEU A 17  ? O LEU A 17  
A 2  3  N GLN A 16  ? N GLN A 16  O LEU A 60  ? O LEU A 60  
B 1  2  N ILE A 20  ? N ILE A 20  O ALA A 31  ? O ALA A 31  
B 2  3  N PHE A 32  ? N PHE A 32  O VAL A 101 ? O VAL A 101 
B 3  4  N ASN A 100 ? N ASN A 100 O SER A 148 ? O SER A 148 
B 4  5  O VAL A 147 ? O VAL A 147 N TRP A 117 ? N TRP A 117 
B 5  6  N ILE A 116 ? N ILE A 116 O PHE A 200 ? O PHE A 200 
B 6  7  N GLY A 201 ? N GLY A 201 O GLN A 228 ? O GLN A 228 
B 7  8  N LEU A 227 ? N LEU A 227 O LEU A 327 ? O LEU A 327 
B 8  9  N VAL A 330 ? N VAL A 330 O PHE A 430 ? O PHE A 430 
B 9  10 N ILE A 429 ? N ILE A 429 O LEU A 513 ? O LEU A 513 
B 10 11 N TYR A 510 ? N TYR A 510 O ARG A 521 ? O ARG A 521 
C 1  2  N VAL A 68  ? N VAL A 68  O SER A 93  ? O SER A 93  
D 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
D 2  3  N GLN B 16  ? N GLN B 16  O LEU B 60  ? O LEU B 60  
E 1  2  N LEU B 22  ? N LEU B 22  O VAL B 29  ? O VAL B 29  
E 2  3  N PHE B 32  ? N PHE B 32  O VAL B 101 ? O VAL B 101 
E 3  4  N ASN B 100 ? N ASN B 100 O SER B 148 ? O SER B 148 
E 4  5  O VAL B 147 ? O VAL B 147 N LEU B 115 ? N LEU B 115 
E 5  6  N ILE B 116 ? N ILE B 116 O THR B 198 ? O THR B 198 
E 6  7  N GLY B 201 ? N GLY B 201 O GLN B 228 ? O GLN B 228 
E 7  8  N LEU B 227 ? N LEU B 227 O LEU B 327 ? O LEU B 327 
E 8  9  N VAL B 330 ? N VAL B 330 O PHE B 430 ? O PHE B 430 
E 9  10 N ILE B 429 ? N ILE B 429 O LEU B 513 ? O LEU B 513 
E 10 11 N TYR B 510 ? N TYR B 510 O ARG B 521 ? O ARG B 521 
F 1  2  N VAL B 68  ? N VAL B 68  O SER B 93  ? O SER B 93  
G 1  2  N VAL B 239 ? N VAL B 239 O VAL B 303 ? O VAL B 303 
# 
_database_PDB_matrix.entry_id          2HA2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2HA2 
_atom_sites.fract_transf_matrix[1][1]   0.012669 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009051 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004390 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 31.771  14.305  55.941  1.00 82.92  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.322  14.512  55.658  1.00 82.34  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.585  14.770  56.958  1.00 84.08  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 30.188  14.712  58.039  1.00 86.00  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 29.722  13.298  54.913  1.00 81.48  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 30.130  11.921  55.429  1.00 81.68  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.592  10.781  54.566  1.00 80.37  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 28.414  10.373  54.764  1.00 78.39  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 30.372  10.284  53.713  1.00 78.24  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.291  15.067  56.848  1.00 83.71  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 27.432  15.285  58.004  1.00 85.03  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.233  16.163  57.710  1.00 84.93  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.103  15.792  58.030  1.00 85.58  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 26.487  17.320  57.090  1.00 84.19  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 25.485  18.390  56.917  1.00 84.33  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 24.980  18.491  55.492  1.00 82.09  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.518  19.533  55.064  1.00 82.40  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 26.103  19.732  57.333  1.00 85.42  ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 26.372  19.851  58.822  1.00 88.70  ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 25.054  19.718  59.611  1.00 91.30  ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 25.204  19.965  61.045  1.00 93.82  ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 24.240  19.757  61.940  1.00 95.37  ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 23.050  19.291  61.556  1.00 94.90  ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 24.471  20.010  63.221  1.00 97.26  ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 24.994  17.373  54.791  1.00 79.97  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.012  17.368  53.356  1.00 77.89  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 23.996  16.362  52.837  1.00 75.71  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 23.714  15.390  53.507  1.00 75.95  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.417  16.964  52.976  1.00 77.11  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 26.813  17.170  51.576  1.00 77.07  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 28.220  16.674  51.326  1.00 77.00  ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 29.000  16.480  52.300  1.00 80.47  ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 28.525  16.456  50.141  1.00 79.99  ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 23.443  16.604  51.652  1.00 73.34  ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.346  15.783  51.122  1.00 71.94  ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 22.804  14.324  50.914  1.00 70.95  ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 23.621  14.051  50.042  1.00 68.93  ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 21.812  16.385  49.811  1.00 70.44  ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 20.612  15.627  49.253  1.00 69.67  ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.326  14.513  49.723  1.00 70.44  ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 19.941  16.141  48.335  1.00 67.84  ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.269  13.380  51.719  1.00 71.89  ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 22.696  11.971  51.649  1.00 71.29  ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.380  11.262  50.335  1.00 69.40  ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 22.886  10.169  50.078  1.00 68.71  ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 21.917  11.315  52.796  1.00 73.24  ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 20.735  12.190  53.007  1.00 74.27  ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.224  13.576  52.746  1.00 73.60  ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 21.550  11.872  49.505  1.00 68.22  ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.227  11.286  48.227  1.00 66.50  ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 22.266  11.592  47.157  1.00 63.41  ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 22.182  11.061  46.063  1.00 62.83  ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 19.864  11.788  47.779  1.00 67.36  ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.250  11.027  46.591  1.00 68.17  ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 18.970  9.574   46.912  1.00 70.08  ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 18.506  9.239   48.008  1.00 72.78  ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 19.254  8.703   45.961  1.00 68.54  ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.246  12.436  47.458  1.00 61.56  ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 24.212  12.866  46.448  1.00 58.87  ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 25.621  12.308  46.667  1.00 57.81  ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 26.558  12.716  45.987  1.00 57.12  ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.258  14.405  46.402  1.00 58.35  ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 22.945  15.077  46.013  1.00 56.68  ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 23.037  16.578  46.207  1.00 56.64  ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 22.575  14.725  44.586  1.00 52.83  ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 25.768  11.383  47.607  1.00 57.91  ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.067  10.815  47.929  1.00 57.45  ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.094  9.360   47.457  1.00 56.60  ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.281  8.553   47.885  1.00 56.53  ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.343  10.930  49.438  1.00 59.08  ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.265  12.358  50.032  1.00 60.92  ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 27.392  12.384  51.586  1.00 61.76  ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.310  13.286  49.394  1.00 59.47  ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.025  9.053   46.555  1.00 55.25  ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.111  7.749   45.901  1.00 54.77  ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 29.586  7.363   45.798  1.00 54.75  ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.458  8.225   45.608  1.00 55.05  ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.455  7.774   44.473  1.00 53.51  ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 27.728  6.495   43.709  1.00 53.58  ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 25.949  7.971   44.583  1.00 53.58  ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 29.867  6.075   45.925  1.00 54.55  ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.209  5.574   45.732  1.00 54.44  ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.287  4.768   44.438  1.00 53.00  ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.409  3.942   44.147  1.00 52.21  ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 31.633  4.713   46.911  1.00 56.02  ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.008  4.098   46.744  1.00 56.80  ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.409  3.285   47.935  1.00 58.79  ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 33.862  4.115   49.063  1.00 61.03  ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.108  4.541   49.269  1.00 61.02  ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 35.374  5.276   50.341  1.00 62.97  ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 36.087  4.248   48.430  1.00 61.60  ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.340  5.045   43.668  1.00 51.84  ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 32.713  4.243   42.507  1.00 51.46  ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.086  3.581   42.759  1.00 52.08  ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 34.689  3.789   43.814  1.00 52.40  ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 32.704  5.086   41.215  1.00 49.03  ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.288  5.537   40.898  1.00 48.59  ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 33.615  6.293   41.328  1.00 50.03  ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.574  2.794   41.803  1.00 52.21  ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 35.835  2.054   41.970  1.00 53.36  ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.036  2.924   42.349  1.00 53.98  ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 37.901  2.504   43.103  1.00 55.78  ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.157  1.293   40.681  1.00 53.24  ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.483  0.510   40.681  1.00 54.07  ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 37.455  -0.630  41.640  1.00 55.26  ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 38.716  -1.376  41.713  1.00 57.67  ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 39.827  -0.965  42.340  1.00 58.44  ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 39.897  0.227   42.929  1.00 58.90  ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 40.899  -1.746  42.367  1.00 58.53  ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.095  4.125   41.810  1.00 53.50  ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.180  5.043   42.106  1.00 54.20  ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.014  5.802   43.402  1.00 55.61  ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 38.955  6.453   43.852  1.00 57.18  ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 36.830  5.740   44.011  1.00 55.63  ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 36.596  6.438   45.273  1.00 56.12  ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.265  7.149   45.369  1.00 55.43  ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.351  6.870   44.603  1.00 54.26  ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.174  8.076   46.322  1.00 56.01  ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 33.906  8.716   46.702  1.00 55.87  ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.624  9.940   45.864  1.00 54.01  ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.536  10.686  45.558  1.00 53.44  ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 33.934  9.123   48.176  1.00 57.14  ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 33.626  7.986   49.120  1.00 59.40  ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 33.666  8.397   50.580  1.00 61.27  ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 34.623  9.029   51.032  1.00 65.24  ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 32.634  8.026   51.329  1.00 61.71  ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.353  10.135  45.513  1.00 53.48  ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 31.895  11.271  44.698  1.00 52.94  ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 30.794  12.044  45.412  1.00 54.35  ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.013  11.461  46.170  1.00 54.97  ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.278  10.778  43.381  1.00 51.79  ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.083  9.985   42.356  1.00 50.53  ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.160  9.537   41.278  1.00 49.01  ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.237  10.815  41.800  1.00 49.23  ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 30.707  13.344  45.136  1.00 54.97  ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.579  14.158  45.571  1.00 56.29  ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 28.922  14.775  44.344  1.00 54.47  ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.578  15.479  43.603  1.00 53.77  ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.040  15.274  46.507  1.00 57.54  ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 28.906  16.259  46.911  1.00 58.95  ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.374  17.311  47.907  1.00 62.89  ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 30.699  17.826  47.561  1.00 67.32  ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 31.819  17.616  48.257  1.00 68.94  ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 31.824  16.912  49.402  1.00 69.74  ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 32.958  18.128  47.788  1.00 69.22  ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 27.634  14.505  44.143  1.00 54.01  ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 26.887  15.028  43.001  1.00 53.17  ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.092  16.273  43.342  1.00 53.82  ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.257  16.839  44.419  1.00 54.97  ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.227  16.685  42.423  1.00 53.18  ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.425  17.886  42.590  1.00 54.69  ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 22.954  17.584  42.281  1.00 54.87  ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 22.634  16.806  41.386  1.00 53.22  ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 24.962  19.062  41.695  1.00 54.18  ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 24.289  20.384  42.051  1.00 56.46  ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 24.786  18.756  40.221  1.00 52.59  ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 24.996  21.632  41.467  1.00 55.56  ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.070  18.187  43.064  1.00 56.67  ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 20.643  18.098  42.832  1.00 58.00  ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.260  19.200  41.860  1.00 57.57  ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 20.379  20.385  42.188  1.00 58.60  ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 19.877  18.251  44.147  1.00 59.80  ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.405  17.960  44.032  1.00 60.99  ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 17.662  18.227  45.342  1.00 64.55  ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.353  18.801  45.068  1.00 68.40  ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.263  18.677  45.828  1.00 72.32  ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 15.271  17.962  46.956  1.00 74.43  ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.133  19.271  45.440  1.00 73.00  ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 19.815  18.807  40.668  1.00 56.79  ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.419  19.741  39.624  1.00 56.96  ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 17.909  19.718  39.476  1.00 58.15  ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.270  18.718  39.775  1.00 58.56  ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.079  19.381  38.289  1.00 55.20  ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.608  19.434  38.210  1.00 54.58  ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 22.098  18.900  36.875  1.00 50.74  ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.128  20.842  38.437  1.00 54.35  ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.351  20.841  39.042  1.00 59.35  ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 15.911  20.970  38.777  1.00 60.87  ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 15.592  20.646  37.332  1.00 59.27  ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.065  21.328  36.431  1.00 58.51  ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.442  22.404  39.052  1.00 62.42  ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 15.724  22.882  40.468  1.00 65.23  ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 15.161  24.295  40.742  1.00 67.46  ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 15.382  24.721  42.207  1.00 69.94  ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 14.287  25.648  42.687  1.00 74.68  ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 14.813  19.597  37.103  1.00 58.80  ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.130  19.427  35.828  1.00 58.10  ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 12.731  20.003  36.014  1.00 59.78  ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.276  20.150  37.147  1.00 61.31  ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.066  17.969  35.432  1.00 57.02  ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.037  20.352  34.914  1.00 59.96  ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.679  20.924  35.030  1.00 61.48  ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 9.718   20.114  35.905  1.00 61.97  ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 8.939   20.680  36.651  1.00 63.85  ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.183  20.935  33.584  1.00 61.16  ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.426  21.015  32.763  1.00 59.86  ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.478  20.256  33.509  1.00 58.95  ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 9.778   18.795  35.810  1.00 60.71  ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 8.856   17.934  36.549  1.00 61.61  ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.296   17.584  37.954  1.00 61.67  ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 8.529   16.993  38.709  1.00 62.56  ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.535  17.927  38.305  1.00 60.16  ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.078  17.594  39.614  1.00 60.29  ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 12.586  17.471  39.569  1.00 58.52  ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.189  17.679  38.520  1.00 56.95  ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.203  17.114  40.702  1.00 58.51  ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 14.659  17.107  40.793  1.00 57.23  ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.276  15.872  40.170  1.00 55.73  ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 14.610  14.833  40.068  1.00 55.48  ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 14.915  17.106  42.299  1.00 58.54  ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 13.739  16.368  42.880  1.00 59.95  ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 12.565  16.683  41.962  1.00 60.56  ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 16.531  16.006  39.734  1.00 54.48  ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.341  14.869  39.329  1.00 53.68  ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 18.716  14.966  40.008  1.00 53.51  ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.093  16.022  40.536  1.00 53.30  ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 17.486  14.751  37.772  1.00 52.66  ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.122  14.713  37.097  1.00 52.39  ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.338  15.877  37.204  1.00 52.97  ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.435  13.845  40.018  1.00 53.22  ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 20.798  13.776  40.540  1.00 53.35  ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 21.791  13.861  39.381  1.00 51.98  ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 21.619  13.205  38.367  1.00 51.40  ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.022  12.458  41.280  1.00 53.86  ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.072  12.233  42.310  1.00 57.53  ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 22.832  14.669  39.519  1.00 51.94  ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 23.855  14.723  38.490  1.00 50.86  ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.239  14.546  39.098  1.00 50.87  ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.569  15.162  40.116  1.00 53.01  ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 23.766  16.036  37.711  1.00 50.15  ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.040  13.697  38.467  1.00 49.55  ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.421  13.477  38.853  1.00 48.52  ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.210  13.830  37.627  1.00 47.31  ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.308  13.018  36.709  1.00 46.66  ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 27.611  12.035  39.286  1.00 48.47  ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 26.784  11.688  40.470  1.00 50.40  ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 25.462  11.307  40.316  1.00 49.77  ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 27.294  11.804  41.747  1.00 51.70  ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 24.685  11.033  41.405  1.00 50.70  ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 26.509  11.521  42.842  1.00 51.64  ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.202  11.140  42.663  1.00 51.45  ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 28.713  15.070  37.603  1.00 46.48  ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.325  15.682  36.433  1.00 45.56  ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 30.828  15.821  36.643  1.00 45.98  ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.263  16.156  37.731  1.00 47.33  ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 28.738  17.095  36.204  1.00 45.41  ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.220  17.261  36.077  1.00 43.85  ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 26.855  18.776  36.028  1.00 45.54  ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 26.647  16.516  34.892  1.00 41.46  ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 31.617  15.513  35.619  1.00 45.56  ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.076  15.656  35.686  1.00 45.72  ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 33.809  14.537  36.392  1.00 46.47  ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 34.831  14.788  37.035  1.00 47.60  ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.316  13.305  36.253  1.00 46.19  ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 33.936  12.144  36.864  1.00 46.83  ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.115  11.680  35.999  1.00 46.83  ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 34.925  11.283  34.863  1.00 46.32  ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 32.951  10.945  36.986  1.00 47.01  ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.672  11.330  37.733  1.00 46.96  ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.633  9.774   37.684  1.00 47.02  ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.585  10.247  37.716  1.00 47.21  ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.348  11.726  36.526  1.00 48.26  ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.475  11.298  35.694  1.00 48.13  ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.401  9.814   35.401  1.00 48.79  ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.219  9.051   36.324  1.00 50.12  ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.687  11.584  36.581  1.00 49.49  ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.160  11.578  37.962  1.00 49.82  ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.775  12.120  37.878  1.00 49.02  ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.504  9.404   34.138  1.00 48.43  ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.539  7.982   33.811  1.00 48.20  ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 38.896  7.496   33.302  1.00 49.15  ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.080  6.307   33.107  1.00 49.55  ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.402  7.576   32.847  1.00 47.21  ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.508  8.148   31.449  1.00 45.62  ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 37.180  7.460   30.452  1.00 46.47  ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 35.924  9.366   31.133  1.00 47.25  ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.296  7.975   29.184  1.00 44.18  ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 36.019  9.880   29.853  1.00 44.48  ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.704  9.187   28.878  1.00 43.14  ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 39.838  8.409   33.096  1.00 49.66  ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.183  8.056   32.634  1.00 50.69  ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.200  8.994   33.271  1.00 51.37  ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 41.839  10.057  33.770  1.00 51.18  ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.261  8.183   31.128  1.00 49.93  ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.463  8.591   33.256  1.00 52.48  ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.552  9.482   33.591  1.00 53.84  ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.630  10.584  32.535  1.00 53.28  ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.435  10.321  31.344  1.00 53.34  ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 45.875  8.712   33.638  1.00 55.47  ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.034  7.829   34.880  1.00 58.64  ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 45.973  8.635   36.172  1.00 60.80  ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 46.612  9.714   36.244  1.00 63.68  ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.266  8.208   37.104  1.00 59.93  ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 44.915  11.827  32.952  1.00 53.21  ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 44.952  12.888  31.952  1.00 52.13  ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 45.918  12.563  30.809  1.00 52.19  ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 47.098  12.278  31.047  1.00 53.75  ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.402  14.108  32.759  1.00 52.94  ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.002  13.791  34.155  1.00 53.42  ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.213  12.332  34.301  1.00 53.95  ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.428  12.576  29.566  1.00 51.55  ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.282  12.148  28.463  1.00 51.67  ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.187  13.285  27.969  1.00 51.60  ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 47.130  13.681  26.800  1.00 51.34  ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.267  11.719  27.416  1.00 50.56  ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.141  12.729  27.608  1.00 50.02  ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 44.091  12.994  29.090  1.00 50.59  ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 48.038  13.777  28.869  1.00 52.36  ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.874  14.945  28.614  1.00 52.39  ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.367  14.589  28.611  1.00 54.39  ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.777  13.531  29.109  1.00 54.24  ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.575  16.042  29.650  1.00 52.58  ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.061  16.310  29.713  1.00 51.02  ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.106  15.668  31.006  1.00 52.74  ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.185  15.464  28.035  1.00 55.15  ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.613  15.209  27.963  1.00 56.91  ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 52.918  13.952  27.169  1.00 57.24  ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.439  13.787  26.044  1.00 56.42  ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.693  13.052  27.766  1.00 58.69  ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.092  11.806  27.121  1.00 59.60  ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 52.918  10.934  26.733  1.00 58.45  ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.089  9.978   25.986  1.00 59.32  ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 54.997  10.999  28.048  1.00 61.34  ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.298  10.611  29.222  1.00 61.82  ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.742  11.259  27.263  1.00 57.57  ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.527  10.489  27.060  1.00 56.86  ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.755  10.909  25.811  1.00 54.53  ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.797  10.228  25.410  1.00 53.00  ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.612  10.687  28.259  1.00 57.42  ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.197  10.292  29.605  1.00 62.16  ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.805  8.866   29.993  1.00 69.10  ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 49.450  8.726   31.420  1.00 72.22  ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 50.306  8.466   32.420  1.00 76.78  ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 51.622  8.309   32.200  1.00 79.89  ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 49.840  8.349   33.668  1.00 77.13  ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 50.157  12.035  25.211  1.00 53.47  ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.503  12.542  24.004  1.00 51.20  ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.660  11.532  22.888  1.00 50.83  ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.745  10.947  22.709  1.00 51.17  ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 50.096  13.875  23.561  1.00 51.71  ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.297  14.560  22.473  1.00 50.06  ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 50.093  15.705  21.853  1.00 50.09  ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.921  16.933  22.608  1.00 49.45  ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.509  18.092  22.308  1.00 50.28  ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.328  18.185  21.279  1.00 50.10  ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.270  19.160  23.045  1.00 50.33  ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.561  11.331  22.166  1.00 48.47  ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.426  10.332  21.097  1.00 48.11  ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.338  8.882   21.543  1.00 49.43  ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 48.055  8.030   20.707  1.00 50.46  ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.518  10.460  20.034  1.00 48.00  ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.756  11.863  19.561  1.00 46.76  ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.723  12.611  19.027  1.00 44.55  ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 51.010  12.427  19.631  1.00 46.41  ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 48.935  13.896  18.551  1.00 45.28  ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.223  13.712  19.180  1.00 46.01  ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.177  14.453  18.649  1.00 46.09  ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.546  8.598   22.831  1.00 50.91  ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.561  7.234   23.340  1.00 52.02  ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 47.198  6.771   23.839  1.00 51.23  ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 46.358  7.592   24.261  1.00 50.41  ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.540  7.129   24.499  1.00 53.44  ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.954  7.532   24.154  1.00 55.87  ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 52.168  6.561   25.030  1.00 60.06  ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 51.874  4.956   24.254  1.00 60.74  ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.961  5.454   23.811  1.00 51.27  ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.746  4.895   24.398  1.00 51.31  ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.519  5.416   25.815  1.00 52.00  ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.480  5.742   26.517  1.00 52.76  ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 46.031  3.382   24.435  1.00 52.43  ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.928  3.156   23.297  1.00 52.39  ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.805  4.409   23.217  1.00 52.38  ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.257  5.527   26.231  1.00 51.88  ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 43.994  6.014   27.567  1.00 52.60  ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.334  4.978   28.637  1.00 54.64  ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 44.223  3.751   28.420  1.00 54.95  ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.501  6.318   27.542  1.00 51.12  ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.960  5.382   26.563  1.00 51.47  ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 43.021  5.246   25.502  1.00 51.61  ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.807  5.503   29.762  1.00 56.40  ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 45.106  4.723   30.959  1.00 58.34  ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 43.971  4.954   31.942  1.00 56.57  ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.582  6.093   32.179  1.00 55.25  ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.429  5.185   31.569  1.00 59.75  ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.636  4.445   31.014  1.00 63.53  ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 48.982  4.932   31.589  1.00 65.63  ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.247  6.165   31.542  1.00 68.77  ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.784  4.068   32.052  1.00 72.36  ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.434  3.879   32.531  1.00 56.72  ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.341  4.061   33.494  1.00 55.87  ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.741  4.940   34.673  1.00 55.97  ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 43.885  4.885   35.126  1.00 56.94  ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.060  2.652   33.997  1.00 56.99  ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.780  1.731   33.072  1.00 58.38  ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.844  2.476   32.381  1.00 57.57  ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.788  5.714   35.175  1.00 55.14  ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.029  6.648   36.254  1.00 56.07  ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.412  5.930   37.527  1.00 57.85  ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 41.722  5.014   37.952  1.00 57.93  ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.774  7.473   36.509  1.00 55.64  ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 40.863  8.456   37.661  1.00 56.64  ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 41.893  9.530   37.437  1.00 57.98  ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 41.794  10.549  38.557  1.00 59.79  ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 42.771  11.641  38.423  1.00 60.91  ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.521  6.348   38.126  1.00 59.16  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 43.947  5.817   39.401  1.00 61.25  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.067  6.373   40.516  1.00 60.42  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 42.694  7.532   40.473  1.00 59.47  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.406  6.165   39.652  1.00 63.03  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.356  5.440   38.714  1.00 67.26  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.767  5.473   39.241  1.00 74.41  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.239  6.851   39.337  1.00 76.75  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 48.964  7.484   38.412  1.00 79.49  ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 49.346  6.867   37.280  1.00 79.74  ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 49.319  8.758   38.630  1.00 79.61  ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 42.730  5.541   41.519  1.00 61.18  ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 41.880  5.974   42.624  1.00 61.21  ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.364  7.239   43.321  1.00 61.97  ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.563  7.474   43.418  1.00 62.79  ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 41.959  4.799   43.593  1.00 62.55  ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.192  3.640   42.735  1.00 62.41  ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.111  4.128   41.668  1.00 61.82  ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.417  8.027   43.815  1.00 62.13  ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 41.707  9.271   44.524  1.00 62.93  ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.322  9.136   45.980  1.00 64.47  ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 40.557  8.236   46.360  1.00 64.54  ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 40.933  10.433  43.904  1.00 61.94  ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.460  10.210  43.856  1.00 60.80  ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.562  10.498  44.829  1.00 61.55  ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 38.719  9.646   42.779  1.00 59.89  ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.302  10.151  44.429  1.00 60.74  ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.367  9.628   43.170  1.00 59.34  ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.065  9.161   41.516  1.00 59.29  ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.359  9.135   42.350  1.00 58.64  ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.065  8.666   40.700  1.00 58.30  ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 36.727  8.655   41.120  1.00 57.72  ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 41.854  10.032  46.804  1.00 65.90  ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.483  10.051  48.210  1.00 67.53  ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.447  11.146  48.433  1.00 66.86  ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.397  12.138  47.698  1.00 66.54  ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 42.710  10.224  49.118  1.00 69.49  ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.411  11.418  48.817  1.00 71.08  ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 39.588  10.931  49.422  1.00 67.16  ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 38.572  11.898  49.771  1.00 66.49  ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.403  11.835  48.827  1.00 64.55  ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.214  10.844  48.119  1.00 64.03  ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 36.620  12.905  48.830  1.00 63.41  ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.383  12.979  48.076  1.00 61.83  ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 35.638  13.917  46.906  1.00 60.42  ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 35.938  15.103  47.100  1.00 60.93  ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.222  13.498  48.958  1.00 62.46  ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 32.967  13.722  48.155  1.00 60.49  ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 33.951  12.521  50.079  1.00 63.81  ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.562  13.357  45.703  1.00 58.32  ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 35.706  14.116  44.481  1.00 57.00  ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.427  14.887  44.222  1.00 56.38  ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.329  14.324  44.238  1.00 56.32  ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.026  13.180  43.304  1.00 55.83  ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.382  13.783  41.933  1.00 54.46  ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.540  13.041  41.259  1.00 52.73  ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.184  13.761  41.019  1.00 53.75  ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 34.576  16.176  43.974  1.00 55.97  ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.445  17.019  43.670  1.00 55.93  ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 32.958  16.788  42.241  1.00 53.92  ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 33.666  17.089  41.287  1.00 54.12  ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 33.813  18.485  43.846  1.00 56.91  ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.637  19.381  43.611  1.00 58.64  ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 32.323  19.651  42.438  1.00 60.16  ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 31.991  19.761  44.612  1.00 64.19  ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 31.749  16.253  42.100  1.00 52.75  ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.170  15.965  40.797  1.00 50.53  ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 29.950  16.844  40.542  1.00 50.10  ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 28.910  16.358  40.110  1.00 48.03  ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 30.790  14.509  40.719  1.00 49.71  ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.099  18.146  40.787  1.00 51.37  ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 28.980  19.086  40.723  1.00 51.83  ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 28.994  19.980  39.471  1.00 51.62  ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.005  20.645  39.182  1.00 51.75  ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 28.912  19.967  41.997  1.00 53.65  ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.036  20.865  42.049  1.00 55.45  ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 28.866  19.106  43.264  1.00 53.19  ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.107  19.992  38.741  1.00 51.16  ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.233  20.783  37.540  1.00 50.71  ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 30.874  19.990  36.409  1.00 49.60  ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.663  19.069  36.635  1.00 50.13  ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.056  22.076  37.791  1.00 52.00  ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.382  21.752  38.204  1.00 52.75  ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 30.421  22.913  38.886  1.00 53.93  ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.501  20.355  35.186  1.00 48.66  ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.122  19.855  33.978  1.00 47.29  ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 32.606  20.165  33.982  1.00 48.40  ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.057  21.195  34.477  1.00 48.43  ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.494  20.496  32.740  1.00 46.11  ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.102  20.026  32.451  1.00 44.17  ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 28.863  18.708  32.167  1.00 43.58  ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.029  20.907  32.473  1.00 44.40  ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 27.604  18.255  31.892  1.00 41.50  ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 26.773  20.460  32.217  1.00 42.95  ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.556  19.115  31.929  1.00 44.09  ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.373  19.275  33.378  1.00 48.89  ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 34.812  19.426  33.386  1.00 50.23  ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.291  20.000  32.029  1.00 49.61  ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.480  20.467  31.210  1.00 50.02  ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.341  18.047  33.756  1.00 50.46  ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 36.743  17.890  34.211  1.00 53.56  ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.343  18.950  35.057  1.00 54.34  ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 37.960  19.865  34.526  1.00 59.70  ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 37.314  18.768  36.368  1.00 54.04  ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.601  20.041  31.797  1.00 50.38  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.135  20.708  30.596  1.00 49.97  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.714  20.005  29.305  1.00 48.62  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.473  18.792  29.292  1.00 46.22  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 38.643  20.769  30.596  1.00 50.60  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.202  21.516  31.766  1.00 53.07  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 38.856  22.681  32.035  1.00 53.61  ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.105  20.857  32.470  1.00 55.08  ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.644  20.798  28.235  1.00 47.70  ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.412  20.282  26.889  1.00 47.50  ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.734  19.899  26.230  1.00 46.90  ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.747  20.570  26.413  1.00 47.45  ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.653  21.300  26.044  1.00 47.62  ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.399  20.747  24.645  1.00 48.60  ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.335  21.628  26.730  1.00 48.53  ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.746  18.780  25.518  1.00 46.59  ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 38.952  18.337  24.814  1.00 47.18  ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.395  19.387  23.809  1.00 47.98  ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.558  20.028  23.193  1.00 47.70  ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.688  17.027  24.122  1.00 46.78  ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.333  15.759  25.343  1.00 47.38  ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.707  19.578  23.675  1.00 48.42  ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.222  20.650  22.847  1.00 49.30  ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.711  20.476  21.417  1.00 48.13  ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.778  19.382  20.859  1.00 47.96  ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.764  20.726  22.904  1.00 51.30  ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.250  22.153  22.919  1.00 53.16  ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.767  22.753  24.066  1.00 56.01  ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.155  22.912  21.781  1.00 54.24  ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.184  24.091  24.047  1.00 55.83  ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.552  24.210  21.751  1.00 56.69  ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.069  24.809  22.869  1.00 57.01  ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.443  26.149  22.724  1.00 58.91  ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.179  21.551  20.848  1.00 47.95  ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.577  21.515  19.537  1.00 47.52  ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.452  22.853  18.875  1.00 49.41  ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.429  23.876  19.535  1.00 48.59  ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.170  20.963  19.617  1.00 47.07  ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.230  21.719  20.513  1.00 45.50  ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 36.000  20.902  20.818  1.00 44.69  ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.939  21.166  20.262  1.00 38.47  ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 36.147  19.863  21.661  1.00 42.39  ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.342  22.785  17.548  1.00 51.20  ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 38.930  23.880  16.692  1.00 53.13  ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.599  24.448  17.159  1.00 53.58  ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.701  23.712  17.532  1.00 52.85  ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 38.796  23.352  15.254  1.00 53.34  ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.353  24.392  14.255  1.00 54.27  ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.001  24.569  13.954  1.00 55.17  ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.270  25.200  13.617  1.00 55.44  ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 36.585  25.545  13.041  1.00 54.34  ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 38.863  26.153  12.704  1.00 56.62  ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.511  26.304  12.414  1.00 56.00  ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.093  27.265  11.502  1.00 58.82  ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.484  25.763  17.148  1.00 55.72  ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.256  26.427  17.558  1.00 57.00  ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 35.739  27.207  16.363  1.00 58.60  ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.475  27.968  15.757  1.00 58.80  ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.507  27.354  18.747  1.00 58.07  ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.267  28.198  19.054  1.00 57.34  ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 36.949  26.515  19.959  1.00 57.15  ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.473  26.988  16.027  1.00 59.98  ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 33.885  27.546  14.823  1.00 61.89  ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 33.865  29.053  14.882  1.00 64.42  ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.375  29.636  15.849  1.00 64.92  ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.461  27.036  14.619  1.00 61.43  ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 31.974  27.247  13.203  1.00 63.26  ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 31.862  26.231  12.473  1.00 66.53  ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.753  28.419  12.814  1.00 61.85  ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.382  29.661  13.811  1.00 66.79  ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 34.481  31.112  13.662  1.00 69.47  ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.597  31.739  12.559  1.00 69.90  ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 33.525  32.956  12.469  1.00 70.56  ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 35.963  31.515  13.321  1.00 70.81  ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.537  30.525  12.447  1.00 71.13  ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 36.811  31.656  14.598  1.00 71.00  ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 32.954  30.916  11.727  1.00 69.47  ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.246  31.397  10.530  1.00 69.97  ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.295  32.560  10.826  1.00 71.20  ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.327  33.585  10.119  1.00 73.18  ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.470  30.251  9.855   1.00 68.89  ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 30.838  30.569  8.482   1.00 69.94  ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 31.897  31.038  7.481   1.00 72.23  ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 30.064  29.390  7.891   1.00 69.19  ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.477  32.414  11.879  1.00 70.64  ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.422  33.398  12.227  1.00 71.02  ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.404  33.765  13.710  1.00 71.05  ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.588  33.245  14.478  1.00 70.76  ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 28.049  32.842  11.860  1.00 69.80  ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.852  32.592  10.403  1.00 68.79  ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.804  33.647  9.504   1.00 69.34  ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.679  31.301  9.921   1.00 66.69  ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.606  33.433  8.151   1.00 69.93  ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.474  31.064  8.568   1.00 67.82  ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.438  32.134  7.679   1.00 69.07  ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 27.227  31.910  6.326   1.00 68.59  ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.280  34.682  14.120  1.00 71.87  ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.407  35.066  15.537  1.00 71.85  ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 29.158  35.667  16.182  1.00 72.25  ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.624  36.648  15.674  1.00 74.06  ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 31.514  36.128  15.515  1.00 73.57  ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 31.572  36.597  14.098  1.00 74.59  ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 31.223  35.417  13.261  1.00 72.94  ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 28.737  35.104  17.316  1.00 70.81  ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.598  35.626  18.099  1.00 71.03  ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.235  35.028  17.748  1.00 68.83  ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.192  35.508  18.228  1.00 69.81  ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.247  33.978  16.929  1.00 64.84  ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.058  33.481  16.254  1.00 62.90  ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 24.742  32.123  16.821  1.00 61.57  ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.584  31.241  16.752  1.00 59.88  ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.357  33.401  14.752  1.00 61.51  ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.392  32.567  13.955  1.00 58.66  ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 23.096  32.993  13.731  1.00 58.29  ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.802  31.374  13.382  1.00 56.78  ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 22.226  32.233  12.984  1.00 57.24  ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.929  30.612  12.637  1.00 55.03  ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.644  31.049  12.432  1.00 57.70  ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.545  31.959  17.381  1.00 62.65  ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.195  30.751  18.154  1.00 61.95  ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.309  29.485  17.306  1.00 59.62  ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 23.635  28.414  17.813  1.00 58.31  ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 21.792  30.894  18.789  1.00 63.69  ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.176  29.597  19.478  1.00 65.33  ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.751  29.237  20.889  1.00 72.06  ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 22.599  29.995  21.434  1.00 75.62  ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 21.342  28.172  21.450  1.00 75.27  ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.071  29.629  16.008  1.00 58.87  ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.137  28.516  15.094  1.00 56.87  ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.479  27.827  15.159  1.00 55.50  ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.548  26.591  15.083  1.00 53.00  ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.550  28.615  15.305  1.00 55.23  ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 26.894  28.016  15.410  1.00 54.57  ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.365  27.883  16.872  1.00 54.75  ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 27.922  26.850  17.278  1.00 53.23  ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 27.924  28.763  14.535  1.00 54.81  ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 27.996  30.143  14.909  1.00 54.44  ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.551  28.651  13.063  1.00 53.63  ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 27.081  28.893  17.680  1.00 55.48  ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.574  28.901  19.038  1.00 56.49  ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.008  27.772  19.876  1.00 55.55  ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 27.638  27.379  20.841  1.00 54.71  ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.276  30.217  19.742  1.00 58.66  ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 27.782  31.471  19.024  1.00 62.93  ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.277  31.722  19.173  1.00 68.47  ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 30.029  30.773  19.525  1.00 68.33  ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 29.686  32.896  18.923  1.00 72.31  ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 25.842  27.232  19.516  1.00 55.07  ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.249  26.187  20.333  1.00 54.53  ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.057  24.890  20.319  1.00 52.13  ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 25.858  24.056  21.178  1.00 52.01  ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 23.780  25.948  19.979  1.00 54.40  ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 23.456  25.196  18.713  1.00 55.63  ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 21.797  24.392  18.804  1.00 58.61  ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 22.294  22.793  19.394  1.00 58.31  ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 26.963  24.740  19.354  1.00 50.48  ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 27.824  23.555  19.247  1.00 49.08  ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.259  23.812  19.743  1.00 48.70  ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 30.076  22.891  19.881  1.00 47.13  ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 27.842  23.102  17.795  1.00 48.65  ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.499  23.005  17.207  1.00 48.09  ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 25.883  23.915  16.384  1.00 48.96  ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.569  21.951  17.413  1.00 47.15  ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.631  23.470  16.050  1.00 48.51  ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.408  22.267  16.675  1.00 45.71  ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.598  20.773  18.164  1.00 45.55  ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.291  21.441  16.653  1.00 47.58  ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.483  19.945  18.151  1.00 47.23  ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.335  20.289  17.389  1.00 48.34  ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.555  25.069  20.027  1.00 49.43  ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 30.869  25.457  20.477  1.00 50.36  ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.112  25.105  21.944  1.00 51.00  ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.151  25.018  22.728  1.00 51.48  ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.052  26.965  20.295  1.00 51.14  ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.406  27.341  18.868  1.00 51.98  ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 31.829  26.498  18.072  1.00 52.64  ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.250  28.618  18.542  1.00 47.83  ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.400  24.958  22.336  1.00 51.11  ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 32.710  24.540  23.711  1.00 51.15  ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.125  25.510  24.708  1.00 51.31  ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.159  26.714  24.482  1.00 53.01  ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.250  24.577  23.775  1.00 51.82  ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 34.725  24.530  22.329  1.00 51.10  ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.625  25.213  21.542  1.00 51.40  ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 31.566  24.978  25.791  1.00 50.65  ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 30.985  25.793  26.858  1.00 50.75  ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 31.790  25.693  28.142  1.00 51.33  ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.417  26.311  29.125  1.00 52.83  ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 29.516  25.412  27.129  1.00 50.16  ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.350  23.961  27.506  1.00 48.31  ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.293  23.198  27.418  1.00 44.76  ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.145  23.573  27.931  1.00 44.65  ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 32.883  24.929  28.129  1.00 50.58  ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 33.910  24.996  29.179  1.00 52.38  ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 35.285  25.282  28.562  1.00 52.23  ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 35.438  25.267  27.350  1.00 52.10  ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 33.971  23.679  29.940  1.00 52.34  ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 32.708  23.359  30.716  1.00 55.21  ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 32.753  24.024  32.078  1.00 62.08  ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 31.469  23.911  32.755  1.00 66.28  ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 30.376  24.621  32.443  1.00 70.32  ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 30.407  25.507  31.454  1.00 71.42  ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 29.231  24.434  33.113  1.00 70.58  ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 36.296  25.488  29.390  1.00 52.70  ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 37.621  25.771  28.875  1.00 52.98  ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.192  24.546  28.200  1.00 51.25  ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 37.802  23.422  28.515  1.00 50.17  ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 38.535  26.276  29.978  1.00 54.22  ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 38.313  27.795  30.281  1.00 57.01  ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 38.675  28.135  31.726  1.00 58.47  ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 39.720  28.777  31.966  1.00 58.90  ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 37.910  27.704  32.623  1.00 60.48  ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 39.065  24.783  27.222  1.00 50.66  ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 39.683  23.700  26.444  1.00 49.42  ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 40.938  23.269  27.127  1.00 49.81  ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 41.732  24.098  27.567  1.00 49.86  ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 40.073  24.172  25.042  1.00 50.01  ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 38.987  24.698  24.097  1.00 49.60  ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.622  25.214  22.798  1.00 48.05  ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 38.020  23.574  23.819  1.00 48.31  ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 41.136  21.962  27.186  1.00 48.99  ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.335  21.400  27.762  1.00 49.71  ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 42.505  19.978  27.248  1.00 48.99  ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 41.531  19.347  26.852  1.00 47.18  ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 42.229  21.422  29.294  1.00 50.85  ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 42.976  20.382  29.911  1.00 49.69  ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 43.745  19.496  27.228  1.00 49.86  ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 44.027  18.076  26.948  1.00 49.72  ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 43.685  17.184  28.129  1.00 49.89  ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.495  15.975  27.963  1.00 50.75  ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 45.486  17.861  26.582  1.00 50.75  ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 45.920  18.490  25.270  1.00 50.96  ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.322  18.060  24.897  1.00 51.66  ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 47.482  16.935  24.409  1.00 48.91  ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.260  18.838  25.124  1.00 51.75  ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 43.625  17.772  29.317  1.00 50.46  ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 43.053  17.122  30.485  1.00 50.61  ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 41.545  17.264  30.382  1.00 48.95  ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 40.973  18.277  30.794  1.00 48.47  ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 43.594  17.788  31.760  1.00 52.74  ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 43.103  17.119  33.040  1.00 54.20  ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.340  16.129  32.980  1.00 55.82  ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 43.486  17.618  34.111  1.00 58.46  ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 40.905  16.234  29.824  1.00 47.82  ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 39.498  16.307  29.433  1.00 46.25  ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 38.715  14.978  29.494  1.00 45.00  ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 37.554  14.949  29.120  1.00 44.85  ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.412  16.899  27.999  1.00 46.08  ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 39.938  15.765  26.629  1.00 47.33  ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.320  13.905  29.988  1.00 45.31  ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 38.710  12.584  29.934  1.00 44.35  ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 37.846  12.364  31.167  1.00 44.38  ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 38.243  11.691  32.111  1.00 45.16  ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 39.772  11.503  29.731  1.00 44.15  ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.482  11.561  28.362  1.00 42.88  ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.401  10.321  28.159  1.00 39.21  ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 39.492  11.694  27.198  1.00 39.54  ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 36.668  12.989  31.118  1.00 44.13  ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 35.664  12.978  32.185  1.00 44.25  ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.352  12.478  31.609  1.00 43.05  ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 34.140  12.559  30.408  1.00 42.76  ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 35.498  14.400  32.774  1.00 45.10  ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 36.792  14.869  33.385  1.00 44.39  ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 37.139  14.514  34.676  1.00 46.08  ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 37.709  15.564  32.636  1.00 43.56  ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 38.362  14.897  35.225  1.00 45.96  ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 38.944  15.951  33.172  1.00 45.94  ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.259  15.612  34.468  1.00 46.95  ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 40.475  15.991  35.013  1.00 49.11  ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 33.505  11.905  32.452  1.00 42.66  ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 32.166  11.514  32.031  1.00 41.61  ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 31.121  12.035  33.008  1.00 41.29  ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 31.413  12.406  34.135  1.00 41.93  ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 32.086  9.987   31.831  1.00 42.18  ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 32.342  9.104   33.027  1.00 43.32  ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 31.183  9.281   34.005  1.00 44.10  ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 32.526  7.614   32.625  1.00 42.99  ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 29.888  12.077  32.554  1.00 41.81  ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 28.804  12.669  33.309  1.00 42.81  ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 27.676  11.674  33.461  1.00 42.56  ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.412  10.915  32.541  1.00 41.63  ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 28.278  13.858  32.546  1.00 42.13  ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 29.376  14.764  32.055  1.00 46.28  ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 30.091  15.374  32.861  1.00 48.70  ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.486  14.916  30.719  1.00 46.34  ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 26.992  11.705  34.602  1.00 43.89  ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 25.867  10.794  34.874  1.00 44.94  ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 24.658  11.555  35.413  1.00 45.89  ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 24.805  12.396  36.290  1.00 46.42  ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 26.240  9.744   35.902  1.00 46.13  ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 25.098  8.751   36.105  1.00 46.45  ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.513  9.020   35.481  1.00 46.84  ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 23.471  11.237  34.903  1.00 45.93  ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 22.216  11.797  35.409  1.00 46.96  ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.321  10.644  35.803  1.00 48.13  ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 21.230  9.670   35.068  1.00 47.07  ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 21.490  12.561  34.325  1.00 46.78  ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 22.045  13.889  33.962  1.00 46.20  ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 21.701  15.108  34.491  1.00 47.46  ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 22.969  14.151  32.914  1.00 45.19  ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.392  16.112  33.849  1.00 46.31  ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 23.188  15.543  32.883  1.00 46.29  ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 23.652  13.339  32.005  1.00 45.16  ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 24.058  16.132  31.975  1.00 45.84  ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 24.523  13.934  31.118  1.00 44.95  ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 24.720  15.310  31.111  1.00 44.29  ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 20.652  10.771  36.946  1.00 49.65  ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 19.763  9.733   37.442  1.00 51.43  ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 18.556  10.394  38.080  1.00 52.25  ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 18.598  11.572  38.429  1.00 52.81  ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 20.471  8.810   38.481  1.00 52.30  ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 20.533  9.472   39.742  1.00 54.93  ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 21.890  8.504   38.066  1.00 51.33  ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 17.456  9.656   38.208  1.00 53.27  ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 16.373  10.164  39.026  1.00 55.11  ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 16.828  10.574  40.431  1.00 56.33  ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 17.874  10.107  40.903  1.00 57.38  ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 15.423  8.965   39.102  1.00 56.02  ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 15.651  8.252   37.819  1.00 54.76  ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 17.117  8.371   37.581  1.00 52.80  ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 16.043  11.436  41.073  1.00 57.58  ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.239  11.809  42.467  1.00 58.95  ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 14.963  11.501  43.222  1.00 61.86  ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 13.921  12.052  42.898  1.00 62.98  ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 16.546  13.292  42.582  1.00 57.58  ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 16.849  13.807  43.981  1.00 57.27  ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 18.157  14.061  44.380  1.00 55.96  ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 15.834  14.089  44.883  1.00 57.64  ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 18.436  14.554  45.648  1.00 56.07  ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 16.110  14.587  46.146  1.00 57.62  ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 17.406  14.822  46.519  1.00 57.99  ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 17.692  15.327  47.769  1.00 59.01  ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 15.029  10.618  44.229  1.00 64.54  ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.172  9.794   44.621  1.00 65.02  ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 16.462  8.717   43.589  1.00 65.27  ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 15.600  8.407   42.745  1.00 65.29  ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 15.719  9.168   45.939  1.00 66.65  ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.251  9.169   45.881  1.00 67.54  ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 13.875  10.402  45.119  1.00 66.63  ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 17.669  8.160   43.663  1.00 65.90  ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.130  7.158   42.706  1.00 66.08  ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.188  5.977   42.732  1.00 68.10  ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 16.620  5.656   43.776  1.00 69.90  ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 19.576  6.721   42.984  1.00 65.33  ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 20.572  7.856   42.776  1.00 64.63  ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 22.003  7.397   42.827  1.00 64.62  ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.308  6.729   44.091  1.00 66.92  ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 22.715  7.340   45.201  1.00 67.21  ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 22.884  8.653   45.220  1.00 67.77  ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 22.949  6.625   46.297  1.00 68.58  ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 16.994  5.343   41.567  1.00 68.86  ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 15.983  4.293   41.472  1.00 70.74  ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 16.255  3.103   42.401  1.00 72.50  ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 17.417  2.732   42.642  1.00 72.32  ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.027  3.874   39.994  1.00 69.82  ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 17.293  4.425   39.438  1.00 67.99  ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 17.688  5.588   40.287  1.00 67.34  ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 15.167  2.534   42.908  1.00 74.63  ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 15.214  1.397   43.818  1.00 76.31  ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 15.724  0.143   43.112  1.00 76.16  ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 16.580  -0.567  43.647  1.00 76.58  ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 13.828  1.141   44.387  1.00 78.50  ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 15.179  -0.132  41.922  1.00 75.29  ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 15.602  -1.293  41.131  1.00 74.43  ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.371  -0.853  39.870  1.00 71.68  ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.153  0.256   39.375  1.00 70.59  ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 14.395  -2.158  40.763  1.00 76.22  ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 13.751  -1.646  39.619  1.00 76.66  ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.273  -1.722  39.356  1.00 70.28  ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 18.188  -1.396  38.248  1.00 68.16  ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 17.499  -0.870  36.981  1.00 66.16  ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.581  -1.506  36.458  1.00 66.80  ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 18.871  -2.735  37.954  1.00 68.76  ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 18.758  -3.500  39.194  1.00 70.41  ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 17.467  -3.109  39.816  1.00 71.37  ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 17.964  0.271   36.493  1.00 63.23  ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.321  0.968   35.397  1.00 62.00  ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 18.171  0.879   34.132  1.00 59.63  ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.376  0.983   34.200  1.00 58.71  ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 17.157  2.460   35.750  1.00 61.63  ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 16.539  2.572   37.034  1.00 64.39  ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 16.299  3.178   34.725  1.00 61.77  ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 17.541  0.685   32.969  1.00 58.61  ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 18.236  0.777   31.695  1.00 56.46  ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 19.089  2.048   31.555  1.00 53.72  ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 18.628  3.135   31.916  1.00 53.56  ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 17.081  0.805   30.701  1.00 56.73  ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 16.069  -0.098  31.342  1.00 59.17  ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 16.123  0.320   32.779  1.00 60.22  ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 20.307  1.886   31.037  1.00 51.28  ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 21.272  2.971   30.890  1.00 49.64  ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 21.373  3.399   29.423  1.00 48.58  ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 21.424  2.556   28.536  1.00 48.39  ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 22.674  2.505   31.391  1.00 50.07  ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 23.737  3.576   31.154  1.00 44.84  ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 22.610  2.083   32.852  1.00 49.00  ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 21.382  4.703   29.169  1.00 47.57  ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 21.591  5.232   27.844  1.00 46.67  ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 22.943  5.955   27.855  1.00 45.73  ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 23.199  6.726   28.762  1.00 46.66  ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.485  6.237   27.474  1.00 47.54  ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 19.092  5.758   27.051  1.00 50.61  ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 18.161  6.946   26.797  1.00 51.87  ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 19.182  4.964   25.774  1.00 54.80  ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 23.819  5.669   26.889  1.00 44.27  ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 25.136  6.330   26.818  1.00 42.06  ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 25.213  7.146   25.551  1.00 40.08  ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 25.062  6.620   24.442  1.00 36.73  ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 26.301  5.334   26.861  1.00 42.34  ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 26.151  4.407   28.084  1.00 42.79  ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.609  6.078   26.876  1.00 41.28  ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 27.246  3.363   28.211  1.00 43.79  ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.419  8.459   25.724  1.00 40.15  ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.505  9.372   24.621  1.00 38.70  ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 26.943  9.610   24.160  1.00 40.41  ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 27.825  9.962   24.969  1.00 41.58  ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 24.920  10.725  25.026  1.00 38.66  ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 25.022  11.751  23.968  1.00 32.91  ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 25.805  12.918  24.013  1.00 37.29  ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 24.366  11.786  22.695  1.00 33.93  ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 25.632  13.642  22.872  1.00 33.73  ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 24.767  12.981  22.040  1.00 32.43  ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.476  10.959  22.039  1.00 34.05  ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 24.312  13.319  20.791  1.00 32.38  ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 23.015  11.324  20.791  1.00 34.31  ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 23.427  12.483  20.183  1.00 35.99  ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 27.175  9.451   22.849  1.00 40.16  ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.440  9.757   22.249  1.00 37.67  ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 28.275  10.887  21.254  1.00 38.31  ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.741  10.720  20.182  1.00 38.38  ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 28.995  8.610   21.465  1.00 38.23  ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 29.003  7.306   22.284  1.00 35.39  ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.333  8.958   21.029  1.00 34.11  ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.724  6.304   21.572  1.00 40.16  ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 28.747  12.051  21.610  1.00 39.32  ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.525  13.228  20.769  1.00 39.92  ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 29.226  13.185  19.420  1.00 40.41  ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 30.183  12.434  19.215  1.00 40.42  ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 28.946  14.471  21.526  1.00 40.86  ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.407  14.541  21.939  1.00 42.37  ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.396  14.955  21.042  1.00 43.20  ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 30.788  14.279  23.246  1.00 43.64  ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 32.740  15.056  21.423  1.00 43.25  ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 32.118  14.359  23.637  1.00 45.57  ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 33.105  14.762  22.729  1.00 45.06  ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.445  14.838  23.127  1.00 43.61  ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.768  14.058  18.518  1.00 41.79  ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.327  14.228  17.192  1.00 41.67  ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 30.111  15.507  17.083  1.00 42.40  ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.354  16.186  18.076  1.00 44.12  ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.432  15.874  15.850  1.00 42.51  ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.323  17.019  15.551  1.00 42.74  ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.539  16.633  14.722  1.00 42.38  ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.631  17.209  14.900  1.00 42.80  ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 32.352  15.672  13.816  1.00 41.70  ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 33.299  15.404  12.733  1.00 41.74  ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.531  14.635  13.138  1.00 41.61  ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.471  14.516  12.365  1.00 41.69  ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.523  14.177  14.382  1.00 41.51  ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.683  13.685  15.108  1.00 40.65  ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 36.720  14.768  15.389  1.00 40.76  ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 37.839  14.435  15.763  1.00 41.13  ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 36.322  12.528  14.378  1.00 41.88  ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.497  11.287  14.343  1.00 42.33  ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 35.399  10.485  15.459  1.00 42.53  ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 34.860  10.892  13.173  1.00 45.13  ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.673  9.294   15.421  1.00 44.32  ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 34.134  9.692   13.112  1.00 44.33  ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 34.045  8.897   14.241  1.00 44.65  ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.350  16.052  15.227  1.00 39.77  ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.279  17.178  15.448  1.00 40.48  ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 36.763  18.141  16.533  1.00 41.25  ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.452  19.114  16.905  1.00 40.41  ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.579  17.977  14.143  1.00 40.16  ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.443  18.910  13.700  1.00 39.50  ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.358  20.241  14.109  1.00 42.02  ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.478  18.442  12.862  1.00 39.86  ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 35.262  21.054  13.700  1.00 40.71  ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.414  19.206  12.463  1.00 37.68  ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.302  20.498  12.872  1.00 41.95  ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.173  21.146  12.390  1.00 40.89  ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.549  17.885  17.016  1.00 40.84  ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 34.870  18.802  17.916  1.00 41.23  ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 33.812  18.093  18.739  1.00 41.11  ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.460  16.894  18.505  1.00 40.80  ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.275  19.969  17.128  1.00 41.10  ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.196  19.559  16.277  1.00 41.14  ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 33.329  18.806  19.739  1.00 41.12  ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 32.213  18.306  20.530  1.00 41.76  ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.554  18.195  22.000  1.00 41.75  ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 33.744  18.180  22.387  1.00 44.33  ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.508  18.189  22.811  1.00 40.70  ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 31.601  18.017  24.256  1.00 40.79  ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.344  17.355  24.810  1.00 40.60  ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.213  17.591  24.307  1.00 40.13  ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 31.824  19.321  24.942  1.00 40.90  ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.526  16.583  25.884  1.00 39.38  ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.373  16.000  26.587  1.00 40.36  ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 28.609  17.052  27.414  1.00 41.77  ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.556  16.751  27.961  1.00 42.54  ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 29.799  14.863  27.460  1.00 40.24  ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 29.131  18.280  27.498  1.00 41.79  ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 28.597  19.290  28.387  1.00 43.34  ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 27.702  20.323  27.712  1.00 44.54  ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 27.237  21.258  28.391  1.00 45.86  ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 29.767  20.044  29.041  1.00 44.08  ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 30.587  20.659  28.047  1.00 44.92  ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.469  20.199  26.396  1.00 44.18  ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 26.614  21.172  25.694  1.00 44.52  ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 25.180  21.036  26.169  1.00 45.00  ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 24.723  19.938  26.504  1.00 44.30  ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 26.684  20.960  24.176  1.00 44.17  ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 28.041  20.888  23.462  1.00 43.92  ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 27.840  20.876  21.971  1.00 43.60  ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 28.941  22.041  23.842  1.00 42.30  ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.463  22.159  26.213  1.00 46.18  ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 23.072  22.179  26.665  1.00 46.34  ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 22.204  21.163  25.948  1.00 45.89  ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 21.362  20.516  26.559  1.00 46.97  ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.466  23.569  26.432  1.00 47.86  ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 23.052  24.634  27.351  1.00 48.60  ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 23.877  24.327  28.226  1.00 49.54  ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 22.634  25.801  27.233  1.00 59.11  ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.402  21.047  24.649  1.00 44.83  ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.643  20.140  23.806  1.00 45.06  ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 21.775  18.672  24.234  1.00 44.32  ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 20.915  17.855  23.897  1.00 44.80  ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 22.070  20.337  22.306  1.00 44.84  ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 23.580  20.282  22.149  1.00 42.81  ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 21.422  19.342  21.400  1.00 47.08  ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 22.827  18.333  24.979  1.00 44.44  ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 23.029  16.921  25.445  1.00 44.64  ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 22.683  16.760  26.946  1.00 45.39  ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 23.111  15.801  27.591  1.00 45.81  ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.454  16.411  25.181  1.00 44.02  ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 25.007  16.652  23.793  1.00 43.92  ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 24.217  16.487  22.665  1.00 45.32  ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.354  17.002  23.607  1.00 45.20  ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 24.727  16.749  21.379  1.00 46.13  ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 26.878  17.264  22.313  1.00 43.36  ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 26.053  17.146  21.215  1.00 42.87  ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 26.522  17.337  19.946  1.00 38.83  ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 21.891  17.693  27.475  1.00 45.78  ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.534  17.725  28.899  1.00 46.38  ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 20.583  16.579  29.251  1.00 46.15  ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.418  16.571  28.829  1.00 45.91  ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 20.897  19.067  29.211  1.00 47.50  ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.513  19.231  30.664  1.00 49.46  ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.460  18.250  31.447  1.00 52.32  ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 20.213  20.380  30.998  1.00 51.27  ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 21.098  15.622  30.026  1.00 45.37  ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.362  14.405  30.387  1.00 45.68  ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 19.281  14.520  31.431  1.00 46.18  ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 18.649  13.529  31.767  1.00 46.27  ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 19.030  15.720  31.950  1.00 46.95  ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 18.103  15.856  33.073  1.00 48.16  ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 16.656  15.497  32.728  1.00 49.38  ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 15.905  15.081  33.604  1.00 50.39  ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 18.194  17.252  33.722  1.00 48.63  ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.502  18.362  32.993  1.00 48.63  ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 17.642  19.697  33.729  1.00 50.37  ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 19.033  20.134  33.800  1.00 50.76  ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 19.505  21.123  34.567  1.00 52.34  ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 20.792  21.438  34.499  1.00 50.87  ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 18.720  21.805  35.401  1.00 54.45  ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 16.258  15.648  31.469  1.00 49.45  ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 14.840  15.513  31.126  1.00 50.54  ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 14.538  14.040  30.944  1.00 51.09  ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 13.531  13.551  31.427  1.00 52.49  ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.464  16.298  29.869  1.00 49.97  ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 14.862  17.740  29.912  1.00 50.13  ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 14.051  18.682  30.529  1.00 52.88  ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 16.037  18.168  29.317  1.00 49.99  ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.424  20.029  30.571  1.00 53.30  ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 16.407  19.510  29.355  1.00 49.34  ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 15.616  20.426  29.989  1.00 50.56  ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 15.416  13.332  30.247  1.00 50.64  ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 15.269  11.889  30.136  1.00 51.31  ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.263  11.223  31.512  1.00 51.82  ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 14.434  10.363  31.775  1.00 52.96  ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 16.356  11.285  29.228  1.00 50.30  ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 16.168  11.539  27.723  1.00 49.96  ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 17.504  11.341  26.958  1.00 46.81  ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 15.049  10.671  27.145  1.00 48.83  ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 16.174  11.636  32.386  1.00 51.93  ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 16.259  11.098  33.754  1.00 52.84  ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 14.970  11.365  34.528  1.00 54.39  ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 14.378  10.457  35.094  1.00 56.61  ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 17.439  11.710  34.491  1.00 51.87  ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 14.520  12.614  34.541  1.00 54.46  ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 13.313  12.959  35.281  1.00 55.64  ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 12.039  12.333  34.700  1.00 56.22  ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 11.274  11.714  35.430  1.00 57.72  ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 13.170  14.480  35.387  1.00 55.63  ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 12.383  14.930  36.586  1.00 56.81  ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 10.889  14.754  36.394  1.00 58.03  ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.384  14.892  35.279  1.00 58.90  ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 10.178  14.452  37.477  1.00 56.95  ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 11.816  12.485  33.398  1.00 55.38  ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 10.552  12.069  32.788  1.00 55.84  ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 10.499  10.563  32.559  1.00 56.01  ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.484   9.939   32.837  1.00 57.61  ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 10.298  12.808  31.457  1.00 55.53  ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 9.012   12.335  30.803  1.00 55.77  ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 10.263  14.328  31.682  1.00 56.21  ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 11.587  9.974   32.071  1.00 55.13  ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 11.604  8.551   31.739  1.00 55.30  ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 12.240  7.667   32.794  1.00 55.88  ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 12.148  6.447   32.701  1.00 56.37  ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 12.296  8.324   30.402  1.00 54.25  ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.649  9.067   29.241  1.00 54.94  ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 10.210  8.656   28.988  1.00 59.90  ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 9.809   7.517   29.324  1.00 60.10  ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 9.469   9.496   28.443  1.00 64.33  ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 12.872  8.268   33.798  1.00 55.89  ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 13.488  7.507   34.881  1.00 56.36  ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 14.783  6.855   34.441  1.00 55.44  ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.254  5.901   35.067  1.00 55.97  ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.374  7.387   33.374  1.00 54.33  ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 16.541  6.782   32.747  1.00 53.06  ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 17.806  7.150   33.500  1.00 52.70  ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 17.878  8.213   34.125  1.00 52.54  ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 16.656  7.241   31.311  1.00 52.09  ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 18.808  6.274   33.409  1.00 52.04  ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 20.171  6.639   33.769  1.00 51.18  ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 20.950  6.991   32.498  1.00 50.03  ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 21.107  6.160   31.624  1.00 50.09  ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 20.854  5.499   34.518  1.00 51.66  ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 22.292  5.886   34.844  1.00 51.69  ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 20.044  5.153   35.783  1.00 51.83  ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.419  8.230   32.389  1.00 49.73  ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 22.087  8.687   31.192  1.00 48.49  ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 23.538  8.999   31.492  1.00 48.22  ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 23.841  9.721   32.440  1.00 47.80  ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.376  9.928   30.604  1.00 48.76  ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 21.745  10.225  29.127  1.00 49.10  ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.534  10.519  28.295  1.00 49.03  ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 22.839  11.359  28.975  1.00 48.37  ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.433  8.441   30.677  1.00 47.61  ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 25.856  8.713   30.764  1.00 47.24  ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.334  9.410   29.499  1.00 46.33  ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 25.921  9.067   28.427  1.00 46.46  ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 26.676  7.402   30.900  1.00 47.54  ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 28.155  7.738   31.136  1.00 47.13  ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 26.114  6.496   32.013  1.00 46.94  ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 27.216  10.387  29.626  1.00 46.79  ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 27.895  10.981  28.472  1.00 45.98  ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.381  11.200  28.803  1.00 46.62  ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 29.692  11.723  29.868  1.00 47.81  ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 27.223  12.299  28.107  1.00 46.19  ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.479  13.300  29.064  1.00 45.18  ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 30.285  10.741  27.932  1.00 46.20  ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 31.720  10.926  28.102  1.00 45.36  ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.301  11.867  27.068  1.00 45.20  ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 31.863  11.895  25.908  1.00 44.94  ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.448  9.603   27.977  1.00 46.28  ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 32.852  9.200   26.556  1.00 45.85  ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 31.499  8.904   25.430  1.00 44.20  ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 31.049  7.238   25.917  1.00 38.91  ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.275  12.657  27.514  1.00 45.24  ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 34.225  13.328  26.640  1.00 44.61  ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 35.192  12.300  26.063  1.00 44.73  ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 35.593  11.364  26.744  1.00 44.99  ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 35.029  14.369  27.421  1.00 44.92  ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 34.279  15.685  27.591  1.00 45.96  ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 33.129  15.790  27.188  1.00 46.05  ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 34.923  16.682  28.242  1.00 44.45  ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 35.532  12.469  24.791  1.00 44.12  ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 36.589  11.684  24.171  1.00 43.76  ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.441  12.630  23.335  1.00 43.05  ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 36.956  13.640  22.856  1.00 43.30  ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 36.014  10.523  23.336  1.00 43.71  ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 35.146  10.920  22.159  1.00 43.84  ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 33.771  11.095  22.303  1.00 45.88  ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 35.696  11.132  20.900  1.00 44.63  ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 32.977  11.505  21.226  1.00 44.21  ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 34.898  11.515  19.818  1.00 43.64  ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.537  11.692  19.985  1.00 42.57  ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 32.757  12.065  18.896  1.00 40.02  ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 38.712  12.293  23.177  1.00 42.74  ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 39.657  13.108  22.430  1.00 42.13  ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 39.319  13.227  20.949  1.00 41.34  ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 38.978  12.245  20.283  1.00 39.53  ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 41.078  12.540  22.585  1.00 43.24  ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 41.733  12.825  23.916  1.00 42.76  ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 43.081  12.080  24.033  1.00 43.18  ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 42.869  10.670  24.316  1.00 41.82  ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 43.852  9.787   24.402  1.00 42.44  ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 45.111  10.168  24.215  1.00 41.33  ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.566  8.521   24.675  1.00 44.36  ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 39.385  14.460  20.440  1.00 39.96  ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 39.066  14.748  19.063  1.00 38.61  ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 40.299  15.347  18.356  1.00 40.46  ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 41.346  15.616  19.007  1.00 41.72  ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 37.833  15.673  18.960  1.00 39.57  ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.585  14.915  19.492  1.00 38.09  ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 38.031  16.983  19.708  1.00 32.78  ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 40.207  15.475  17.029  1.00 39.82  ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 41.266  16.057  16.225  1.00 40.90  ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.493  15.188  16.252  1.00 42.07  ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.368  13.968  16.418  1.00 42.25  ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.659  15.823  16.127  1.00 41.67  ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 44.952  15.157  16.191  1.00 43.91  ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 45.095  14.363  17.490  1.00 44.91  ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.628  13.232  17.509  1.00 47.48  ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 46.090  16.223  16.080  1.00 45.53  ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 45.826  17.309  16.988  1.00 45.27  ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 46.135  16.819  14.659  1.00 42.89  ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.585  14.937  18.574  1.00 44.48  ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 44.723  14.373  19.901  1.00 44.40  ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 44.017  13.042  20.025  1.00 43.89  ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.538  12.149  20.666  1.00 45.38  ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 44.205  15.347  20.943  1.00 43.82  ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 44.751  16.732  20.780  1.00 44.07  ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 46.021  17.022  21.166  1.00 44.48  ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 43.988  17.726  20.208  1.00 42.46  ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.536  18.287  20.992  1.00 46.92  ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.500  19.005  20.035  1.00 42.13  ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 45.770  19.279  20.432  1.00 46.44  ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 42.858  12.888  19.388  1.00 42.71  ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 42.158  11.582  19.375  1.00 41.77  ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.480  10.664  18.227  1.00 41.73  ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 42.480  9.425   18.394  1.00 43.20  ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 42.817  11.232  17.066  1.00 41.24  ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 42.848  10.443  15.833  1.00 41.57  ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 44.085  10.496  14.940  1.00 43.14  ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 44.110  9.838   13.904  1.00 43.79  ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.562  10.732  15.063  1.00 40.69  ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 40.337  10.285  15.816  1.00 39.11  ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 40.077  8.939   15.981  1.00 39.55  ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.563  11.196  16.484  1.00 37.90  ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 38.998  8.512   16.746  1.00 38.71  ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.494  10.807  17.241  1.00 37.17  ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 38.194  9.447   17.362  1.00 38.40  ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 45.113  11.254  15.329  1.00 44.36  ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 46.330  11.340  14.520  1.00 45.31  ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 47.024  10.033  14.738  1.00 46.88  ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 47.130  9.600   15.883  1.00 46.93  ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 47.233  12.494  14.960  1.00 45.36  ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.573  12.637  14.207  1.00 46.97  ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 49.072  14.083  14.196  1.00 45.43  ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.649  11.710  14.794  1.00 43.72  ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 47.503  9.425   13.650  1.00 48.75  ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 47.963  8.033   13.640  1.00 50.12  ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 49.186  7.864   12.761  1.00 52.10  ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 49.235  8.405   11.658  1.00 53.06  ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 46.849  7.130   13.119  1.00 49.17  ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 50.167  7.116   13.253  1.00 53.29  ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 51.249  6.605   12.434  1.00 54.70  ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 51.092  5.095   12.542  1.00 55.05  ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 51.617  4.474   13.453  1.00 55.89  ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 52.583  7.166   12.903  1.00 55.61  ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.620  8.647   12.474  1.00 56.74  ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 53.332  9.514   13.461  1.00 59.70  ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 53.193  8.836   11.062  1.00 55.41  ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 50.231  4.535   11.681  1.00 54.96  ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.786  3.162   11.813  1.00 55.65  ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 50.900  2.149   11.914  1.00 57.69  ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.807  2.137   11.101  1.00 58.64  ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.955  2.958   10.558  1.00 55.25  ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 48.339  4.297   10.340  1.00 53.74  ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 49.488  5.227   10.597  1.00 54.27  ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.829  1.307   12.926  1.00 58.85  ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 51.907  0.344   13.175  1.00 61.08  ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 52.863  0.874   14.221  1.00 62.09  ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 53.620  0.121   14.779  1.00 63.28  ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 52.820  2.174   14.511  1.00 61.96  ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 53.634  2.728   15.589  1.00 62.89  ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 53.094  2.321   16.945  1.00 63.60  ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 51.942  1.894   17.102  1.00 62.71  ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 53.690  4.251   15.537  1.00 61.89  ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 52.405  4.792   15.811  1.00 58.62  ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 53.960  2.475   17.928  1.00 65.67  ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 53.661  2.170   19.307  1.00 66.55  ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 53.138  3.446   19.982  1.00 63.82  ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 52.202  3.399   20.799  1.00 63.52  ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 54.968  1.689   19.920  1.00 68.89  ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 54.987  1.322   21.397  1.00 72.07  ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 56.380  0.707   21.727  1.00 75.72  ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 57.451  1.403   20.991  1.00 80.30  ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 58.700  0.968   20.850  1.00 84.29  ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 59.103  -0.176  21.413  1.00 87.58  ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 59.566  1.698   20.147  1.00 85.27  ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 53.707  4.587   19.595  1.00 61.96  ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.464  5.852   20.286  1.00 59.54  ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 52.242  6.610   19.772  1.00 56.81  ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 51.741  7.486   20.472  1.00 56.26  ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 54.709  6.754   20.204  1.00 61.26  ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 56.032  6.100   20.707  1.00 64.08  ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 56.857  5.373   19.607  1.00 67.62  ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 56.334  5.149   18.488  1.00 66.23  ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 58.046  5.010   19.876  1.00 71.88  ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 51.778  6.272   18.565  1.00 54.81  ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.615  6.907   17.924  1.00 52.62  ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 49.847  5.889   17.061  1.00 51.17  ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 49.839  5.961   15.821  1.00 49.05  ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 51.066  8.078   17.086  1.00 51.82  ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 49.225  4.902   17.719  1.00 51.11  ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.618  3.788   16.978  1.00 51.42  ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 47.329  4.113   16.265  1.00 49.63  ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 46.891  3.319   15.433  1.00 49.70  ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 48.359  2.735   18.066  1.00 51.85  ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 48.215  3.515   19.328  1.00 51.37  ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 49.095  4.735   19.179  1.00 51.27  ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 46.706  5.248   16.584  1.00 48.23  ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 45.456  5.613   15.944  1.00 46.40  ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 44.264  5.192   16.790  1.00 45.80  ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 44.389  4.389   17.708  1.00 46.21  ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 43.112  5.768   16.504  1.00 43.64  ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 41.857  5.396   17.161  1.00 43.52  ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 41.751  5.618   18.691  1.00 42.43  ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 40.835  5.107   19.340  1.00 42.11  ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 41.516  3.938   16.821  1.00 43.95  ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 41.251  3.724   15.344  1.00 45.22  ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.722  4.616   14.657  1.00 46.47  ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.609  2.534   14.839  1.00 45.25  ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.646  6.400   19.276  1.00 42.18  ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.680  6.484   20.726  1.00 41.89  ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 41.439  7.189   21.267  1.00 41.86  ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 41.015  6.887   22.368  1.00 41.63  ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 43.978  7.107   21.265  1.00 42.68  ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 45.202  6.286   20.760  1.00 42.30  ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 44.083  8.594   20.905  1.00 41.94  ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 40.838  8.093   20.488  1.00 40.62  ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.563  8.703   20.920  1.00 40.96  ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 38.418  7.700   21.070  1.00 40.89  ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 37.487  7.894   21.863  1.00 42.20  ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 38.445  6.673   20.248  1.00 41.75  ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 37.509  5.546   20.347  1.00 41.98  ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 37.856  4.663   21.521  1.00 42.98  ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 37.002  3.942   22.084  1.00 43.31  ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.577  4.696   19.079  1.00 42.22  ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 36.940  5.216   17.784  1.00 42.26  ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 37.347  4.320   16.600  1.00 40.33  ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 35.408  5.350   17.873  1.00 42.94  ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 39.140  4.644   21.864  1.00 44.40  ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.576  3.845   23.000  1.00 44.46  ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 39.088  4.566   24.271  1.00 44.26  ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 38.701  3.921   25.233  1.00 44.16  ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 41.089  3.615   22.967  1.00 45.21  ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 41.626  2.507   22.031  1.00 44.79  ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 43.167  2.427   22.112  1.00 42.72  ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 41.018  1.119   22.294  1.00 40.17  ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 39.086  5.899   24.247  1.00 42.63  ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.532  6.732   25.316  1.00 42.76  ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 37.059  6.400   25.530  1.00 42.71  ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 36.600  6.202   26.668  1.00 44.98  ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 38.609  8.242   24.972  1.00 41.57  ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 40.023  8.750   24.788  1.00 43.32  ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 40.958  8.066   25.209  1.00 44.65  ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 40.217  9.874   24.256  1.00 45.21  ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 36.305  6.340   24.436  1.00 42.06  ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 34.886  5.970   24.498  1.00 40.70  ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 34.710  4.602   25.091  1.00 42.18  ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 33.806  4.384   25.892  1.00 42.91  ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 34.260  5.988   23.120  1.00 40.44  ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 34.165  7.421   22.477  1.00 38.78  ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 33.807  7.319   21.013  1.00 38.39  ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 33.413  6.242   20.569  1.00 42.61  ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 33.883  8.431   20.270  1.00 41.63  ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 35.566  3.677   24.693  1.00 41.99  ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.481  2.296   25.212  1.00 43.35  ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 35.755  2.169   26.719  1.00 44.30  ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 35.068  1.411   27.417  1.00 45.55  ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 36.420  1.378   24.434  1.00 42.86  ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 36.470  -0.095  24.976  1.00 45.01  ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 37.481  -0.894  24.172  1.00 46.39  ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 36.901  -1.200  22.877  1.00 47.74  ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 37.535  -1.774  21.857  1.00 51.59  ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 38.820  -2.163  21.949  1.00 54.13  ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 36.861  -2.000  20.736  1.00 50.15  ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 36.775  2.869   27.202  1.00 45.33  ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 37.083  2.950   28.632  1.00 45.87  ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 35.901  3.468   29.425  1.00 45.55  ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 35.609  2.944   30.496  1.00 45.54  ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 38.304  3.850   28.888  1.00 46.29  ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 39.014  3.805   30.253  1.00 47.39  ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 39.551  2.379   30.630  1.00 49.07  ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 40.128  4.841   30.241  1.00 46.65  ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 35.228  4.506   28.913  1.00 44.45  ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 34.003  4.987   29.533  1.00 44.20  ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 32.981  3.871   29.556  1.00 45.32  ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 32.314  3.703   30.557  1.00 47.52  ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 33.446  6.210   28.810  1.00 41.85  ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 32.841  3.103   28.475  1.00 45.71  ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 31.853  2.016   28.475  1.00 47.12  ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 32.210  0.966   29.507  1.00 48.40  ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 31.321  0.342   30.091  1.00 49.59  ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 31.700  1.333   27.110  1.00 47.35  ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 31.466  2.138   25.822  1.00 46.54  ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 30.971  1.182   24.726  1.00 44.00  ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 30.534  3.329   25.989  1.00 43.39  ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 33.511  0.743   29.704  1.00 49.31  ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 33.991  -0.183  30.743  1.00 51.04  ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 33.695  0.377   32.150  1.00 50.17  ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 33.319  -0.360  33.089  1.00 50.23  ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 35.489  -0.439  30.577  1.00 51.94  ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 35.833  -1.192  29.269  1.00 55.41  ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 37.346  -1.440  29.003  1.00 55.52  ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 38.219  -0.705  29.472  1.00 59.55  ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 37.633  -2.464  28.194  1.00 60.67  ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 33.849  1.690   32.286  1.00 47.54  ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 33.582  2.365   33.536  1.00 47.17  ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 32.124  2.143   33.889  1.00 46.91  ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 31.798  1.789   35.016  1.00 48.52  ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 33.884  3.873   33.413  1.00 46.20  ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 33.701  4.619   34.690  1.00 46.24  ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 34.674  4.941   35.604  1.00 46.81  ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 32.478  5.102   35.224  1.00 47.33  ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 34.126  5.624   36.662  1.00 47.16  ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 32.777  5.735   36.453  1.00 47.95  ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 31.157  5.113   34.767  1.00 45.83  ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 31.797  6.333   37.235  1.00 47.13  ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 30.196  5.708   35.542  1.00 44.71  ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 30.515  6.306   36.763  1.00 46.33  ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 31.243  2.312   32.920  1.00 45.60  ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 29.825  2.156   33.177  1.00 45.94  ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 29.583  0.728   33.667  1.00 47.88  ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 28.860  0.501   34.631  1.00 49.27  ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 28.977  2.513   31.926  1.00 44.77  ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 27.571  1.941   32.017  1.00 46.07  ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 28.945  4.033   31.739  1.00 43.98  ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 30.240  -0.243  33.056  1.00 48.99  ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 30.012  -1.642  33.430  1.00 49.71  ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.370  -1.937  34.886  1.00 51.69  ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 29.671  -2.680  35.574  1.00 52.41  ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 30.847  -2.573  32.541  1.00 49.93  ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 30.279  -2.811  31.169  1.00 48.97  ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 28.883  -3.372  31.192  1.00 47.50  ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 28.674  -4.505  31.597  1.00 49.61  ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 27.916  -2.575  30.768  1.00 43.78  ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 31.504  -1.401  35.323  1.00 52.23  ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 32.022  -1.630  36.665  1.00 53.25  ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 31.227  -0.823  37.685  1.00 52.45  ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 30.968  -1.304  38.772  1.00 54.01  ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 33.514  -1.257  36.697  1.00 53.84  ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 34.199  -1.144  38.083  1.00 55.76  ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 34.814  -2.423  38.588  1.00 63.44  ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 34.713  -3.465  37.891  1.00 67.24  ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 35.390  -2.382  39.706  1.00 65.20  ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 30.806  0.380   37.308  1.00 50.97  ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 30.367  1.396   38.266  1.00 50.15  ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 28.906  1.835   38.241  1.00 49.47  ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 28.424  2.320   39.243  1.00 50.58  ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 31.235  2.634   38.120  1.00 48.69  ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 32.672  2.383   38.499  1.00 49.95  ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 32.969  2.003   39.640  1.00 50.63  ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 33.586  2.611   37.554  1.00 50.90  ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 28.196  1.656   37.136  1.00 48.63  ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 26.841  2.247   36.987  1.00 48.45  ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 25.801  1.727   37.999  1.00 50.08  ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 24.815  2.413   38.302  1.00 50.69  ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 26.266  2.093   35.540  1.00 46.69  ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 25.307  3.231   35.235  1.00 45.05  ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 25.569  0.735   35.354  1.00 46.72  ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 25.983  4.645   35.213  1.00 41.22  ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 26.015  0.534   38.527  1.00 51.34  ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 25.132  0.005   39.560  1.00 52.82  ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 25.158  0.862   40.831  1.00 53.20  ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 24.180  0.906   41.555  1.00 54.45  ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 25.497  -1.456  39.887  1.00 54.43  ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 26.262  1.559   41.098  1.00 52.90  ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 26.344  2.445   42.268  1.00 52.94  ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 25.298  3.555   42.166  1.00 52.46  ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 24.924  4.152   43.164  1.00 53.36  ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 27.741  3.047   42.392  1.00 52.10  ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 24.837  3.817   40.944  1.00 51.93  ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 23.860  4.860   40.649  1.00 51.12  ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 22.459  4.298   40.362  1.00 51.97  ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 21.541  5.057   40.032  1.00 52.57  ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 24.318  5.654   39.431  1.00 49.87  ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 25.649  6.329   39.605  1.00 48.28  ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 26.811  5.662   39.304  1.00 49.11  ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 25.728  7.624   40.071  1.00 47.78  ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 28.031  6.259   39.462  1.00 48.43  ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 26.954  8.240   40.228  1.00 47.80  ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 28.111  7.546   39.928  1.00 47.66  ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 22.287  2.983   40.469  1.00 52.63  ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 21.007  2.352   40.155  1.00 52.91  ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 20.799  1.971   38.699  1.00 52.51  ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 19.694  1.580   38.314  1.00 53.07  ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 21.843  2.098   37.879  1.00 51.24  ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 21.788  1.667   36.487  1.00 50.83  ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 22.028  0.177   36.334  1.00 52.34  ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 22.780  -0.421  37.101  1.00 52.86  ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 21.383  -0.419  35.339  1.00 52.63  ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 21.541  -1.828  35.047  1.00 53.44  ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 22.660  -2.029  34.034  1.00 52.09  ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 22.472  -1.770  32.856  1.00 51.79  ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 20.236  -2.377  34.475  1.00 54.85  ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 20.274  -3.858  34.259  1.00 56.84  ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 21.364  -4.441  34.448  1.00 59.68  ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 19.221  -4.441  33.906  1.00 60.33  ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 23.819  -2.550  34.470  1.00 51.95  ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 24.908  -2.692  33.513  1.00 50.63  ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 24.568  -3.708  32.404  1.00 51.44  ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 25.147  -3.640  31.332  1.00 50.39  ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 26.068  -3.201  34.392  1.00 51.81  ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 25.396  -3.954  35.469  1.00 52.89  ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 24.174  -3.133  35.779  1.00 53.35  ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.654  -4.640  32.674  1.00 52.05  ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 23.200  -5.608  31.679  1.00 53.52  ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 22.096  -5.087  30.741  1.00 52.54  ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.414  -5.878  30.060  1.00 53.91  ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.689  -6.892  32.380  1.00 55.25  ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 23.711  -7.551  33.291  1.00 56.05  ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 23.123  -9.173  33.839  1.00 63.21  ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 23.236  -10.021 32.255  1.00 67.56  ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 21.893  -3.774  30.699  1.00 49.80  ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 21.006  -3.190  29.728  1.00 48.82  ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 21.480  -1.774  29.405  1.00 47.00  ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 20.963  -0.815  29.964  1.00 46.44  ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 19.596  -3.116  30.252  1.00 49.63  ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 18.809  -2.330  29.366  1.00 52.15  ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 22.479  -1.690  28.533  1.00 45.91  ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 23.090  -0.425  28.098  1.00 44.23  ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 22.839  -0.258  26.605  1.00 43.26  ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 23.096  -1.160  25.814  1.00 44.02  ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 24.629  -0.433  28.338  1.00 43.80  ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 25.282  0.882   27.824  1.00 42.89  ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 24.930  -0.703  29.802  1.00 44.74  ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 22.381  0.927   26.213  1.00 41.63  ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 21.970  1.172   24.859  1.00 40.22  ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 22.821  2.430   24.552  1.00 37.98  ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 22.766  3.368   25.341  1.00 38.03  ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 20.422  1.417   24.812  1.00 40.27  ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 19.710  0.191   25.104  1.00 47.27  ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 19.960  1.874   23.463  1.00 42.96  ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 23.651  2.411   23.495  1.00 36.80  ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.461  3.639   23.095  1.00 35.24  ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 23.710  4.490   22.158  1.00 34.31  ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 22.989  3.968   21.320  1.00 32.27  ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 25.702  3.298   22.288  1.00 34.65  ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 26.559  2.135   22.825  1.00 36.98  ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 27.892  2.086   22.059  1.00 36.99  ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 26.791  2.297   24.310  1.00 37.16  ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 24.016  5.806   22.098  1.00 33.14  ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 23.379  6.493   21.058  1.00 32.94  ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 24.208  7.745   20.760  1.00 33.91  ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 24.899  8.234   21.639  1.00 33.52  ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 21.910  6.713   21.402  1.00 33.95  ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.617  7.718   22.513  1.00 37.16  ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 22.119  7.597   23.792  1.00 37.61  ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 20.688  8.750   22.286  1.00 37.98  ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 21.767  8.507   24.794  1.00 37.85  ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 20.382  9.628   23.273  1.00 38.58  ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 20.923  9.511   24.516  1.00 37.55  ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 24.226  8.147   19.511  1.00 33.75  ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 24.929  9.420   19.188  1.00 34.80  ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.540  9.936   17.855  1.00 34.54  ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 23.839  9.277   17.133  1.00 34.88  ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 25.049  11.114  17.481  1.00 35.90  ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 24.689  11.671  16.222  1.00 37.11  ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 25.957  12.057  15.424  1.00 39.08  ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 26.998  12.418  16.012  1.00 39.66  ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 23.705  12.796  16.484  1.00 38.14  ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 23.161  13.495  15.238  1.00 39.58  ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 24.037  14.648  14.779  1.00 44.53  ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 25.129  14.807  15.382  1.00 42.74  ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 23.619  15.351  13.816  1.00 40.56  ? 202  GLU A OE2 1 
ATOM   1569 N N   . SER A 1 203 ? 25.902  11.871  14.100  1.00 39.84  ? 203  SER A N   1 
ATOM   1570 C CA  . SER A 1 203 ? 27.012  12.183  13.212  1.00 40.59  ? 203  SER A CA  1 
ATOM   1571 C C   . SER A 1 203 ? 28.234  11.323  13.542  1.00 39.60  ? 203  SER A C   1 
ATOM   1572 O O   . SER A 1 203 ? 28.103  10.090  13.494  1.00 40.53  ? 203  SER A O   1 
ATOM   1573 C CB  . SER A 1 203 ? 27.264  13.690  13.256  1.00 40.89  ? 203  SER A CB  1 
ATOM   1574 O OG  . SER A 1 203 ? 28.117  14.137  12.202  1.00 49.31  ? 203  SER A OG  1 
ATOM   1575 N N   . ALA A 1 204 ? 29.375  11.917  13.908  1.00 38.99  ? 204  ALA A N   1 
ATOM   1576 C CA  . ALA A 1 204 ? 30.595  11.144  14.323  1.00 38.77  ? 204  ALA A CA  1 
ATOM   1577 C C   . ALA A 1 204 ? 30.326  10.228  15.535  1.00 39.25  ? 204  ALA A C   1 
ATOM   1578 O O   . ALA A 1 204 ? 30.923  9.130   15.706  1.00 38.80  ? 204  ALA A O   1 
ATOM   1579 C CB  . ALA A 1 204 ? 31.733  12.101  14.629  1.00 39.54  ? 204  ALA A CB  1 
ATOM   1580 N N   . GLY A 1 205 ? 29.411  10.680  16.380  1.00 38.52  ? 205  GLY A N   1 
ATOM   1581 C CA  . GLY A 1 205 ? 28.970  9.919   17.515  1.00 38.99  ? 205  GLY A CA  1 
ATOM   1582 C C   . GLY A 1 205 ? 28.332  8.634   17.065  1.00 39.40  ? 205  GLY A C   1 
ATOM   1583 O O   . GLY A 1 205 ? 28.561  7.624   17.652  1.00 41.48  ? 205  GLY A O   1 
ATOM   1584 N N   . ALA A 1 206 ? 27.558  8.683   15.987  1.00 41.24  ? 206  ALA A N   1 
ATOM   1585 C CA  . ALA A 1 206 ? 26.857  7.511   15.398  1.00 40.62  ? 206  ALA A CA  1 
ATOM   1586 C C   . ALA A 1 206 ? 27.830  6.607   14.667  1.00 41.55  ? 206  ALA A C   1 
ATOM   1587 O O   . ALA A 1 206 ? 27.752  5.378   14.786  1.00 41.56  ? 206  ALA A O   1 
ATOM   1588 C CB  . ALA A 1 206 ? 25.746  7.959   14.433  1.00 41.89  ? 206  ALA A CB  1 
ATOM   1589 N N   . ALA A 1 207 ? 28.741  7.204   13.903  1.00 40.65  ? 207  ALA A N   1 
ATOM   1590 C CA  . ALA A 1 207 ? 29.845  6.456   13.314  1.00 41.26  ? 207  ALA A CA  1 
ATOM   1591 C C   . ALA A 1 207 ? 30.547  5.696   14.422  1.00 41.65  ? 207  ALA A C   1 
ATOM   1592 O O   . ALA A 1 207 ? 30.786  4.468   14.318  1.00 44.46  ? 207  ALA A O   1 
ATOM   1593 C CB  . ALA A 1 207 ? 30.814  7.419   12.585  1.00 40.12  ? 207  ALA A CB  1 
ATOM   1594 N N   . SER A 1 208 ? 30.839  6.400   15.520  1.00 40.82  ? 208  SER A N   1 
ATOM   1595 C CA  . SER A 1 208 ? 31.466  5.801   16.713  1.00 40.99  ? 208  SER A CA  1 
ATOM   1596 C C   . SER A 1 208 ? 30.638  4.625   17.241  1.00 41.89  ? 208  SER A C   1 
ATOM   1597 O O   . SER A 1 208 ? 31.165  3.507   17.399  1.00 43.02  ? 208  SER A O   1 
ATOM   1598 C CB  . SER A 1 208 ? 31.680  6.878   17.796  1.00 41.17  ? 208  SER A CB  1 
ATOM   1599 O OG  . SER A 1 208 ? 32.640  7.853   17.369  1.00 41.55  ? 208  SER A OG  1 
ATOM   1600 N N   . VAL A 1 209 ? 29.328  4.818   17.465  1.00 40.76  ? 209  VAL A N   1 
ATOM   1601 C CA  . VAL A 1 209 ? 28.467  3.651   17.877  1.00 41.14  ? 209  VAL A CA  1 
ATOM   1602 C C   . VAL A 1 209 ? 28.649  2.477   16.944  1.00 42.76  ? 209  VAL A C   1 
ATOM   1603 O O   . VAL A 1 209 ? 28.789  1.314   17.398  1.00 46.18  ? 209  VAL A O   1 
ATOM   1604 C CB  . VAL A 1 209 ? 26.936  3.988   17.959  1.00 40.29  ? 209  VAL A CB  1 
ATOM   1605 C CG1 . VAL A 1 209 ? 26.044  2.686   18.119  1.00 40.90  ? 209  VAL A CG1 1 
ATOM   1606 C CG2 . VAL A 1 209 ? 26.706  4.967   19.073  1.00 39.84  ? 209  VAL A CG2 1 
ATOM   1607 N N   . GLY A 1 210 ? 28.636  2.739   15.637  1.00 43.03  ? 210  GLY A N   1 
ATOM   1608 C CA  . GLY A 1 210 ? 28.809  1.657   14.655  1.00 44.03  ? 210  GLY A CA  1 
ATOM   1609 C C   . GLY A 1 210 ? 30.154  0.968   14.705  1.00 44.71  ? 210  GLY A C   1 
ATOM   1610 O O   . GLY A 1 210 ? 30.262  -0.243  14.448  1.00 45.37  ? 210  GLY A O   1 
ATOM   1611 N N   . MET A 1 211 ? 31.204  1.730   14.977  1.00 44.37  ? 211  MET A N   1 
ATOM   1612 C CA  . MET A 1 211 ? 32.527  1.130   15.192  1.00 45.52  ? 211  MET A CA  1 
ATOM   1613 C C   . MET A 1 211 ? 32.593  0.205   16.427  1.00 46.31  ? 211  MET A C   1 
ATOM   1614 O O   . MET A 1 211 ? 33.296  -0.838  16.420  1.00 45.96  ? 211  MET A O   1 
ATOM   1615 C CB  . MET A 1 211 ? 33.591  2.212   15.174  1.00 45.22  ? 211  MET A CB  1 
ATOM   1616 C CG  . MET A 1 211 ? 33.783  2.736   13.727  1.00 45.07  ? 211  MET A CG  1 
ATOM   1617 S SD  . MET A 1 211 ? 34.741  4.207   13.660  1.00 48.62  ? 211  MET A SD  1 
ATOM   1618 C CE  . MET A 1 211 ? 34.344  4.792   12.016  1.00 45.56  ? 211  MET A CE  1 
ATOM   1619 N N   . HIS A 1 212 ? 31.789  0.510   17.444  1.00 45.32  ? 212  HIS A N   1 
ATOM   1620 C CA  . HIS A 1 212 ? 31.710  -0.362  18.624  1.00 45.65  ? 212  HIS A CA  1 
ATOM   1621 C C   . HIS A 1 212 ? 30.964  -1.656  18.339  1.00 46.48  ? 212  HIS A C   1 
ATOM   1622 O O   . HIS A 1 212 ? 31.344  -2.701  18.831  1.00 49.03  ? 212  HIS A O   1 
ATOM   1623 C CB  . HIS A 1 212 ? 31.085  0.404   19.788  1.00 45.62  ? 212  HIS A CB  1 
ATOM   1624 C CG  . HIS A 1 212 ? 32.030  1.364   20.423  1.00 43.94  ? 212  HIS A CG  1 
ATOM   1625 N ND1 . HIS A 1 212 ? 31.819  2.715   20.426  1.00 42.09  ? 212  HIS A ND1 1 
ATOM   1626 C CD2 . HIS A 1 212 ? 33.238  1.171   20.999  1.00 44.58  ? 212  HIS A CD2 1 
ATOM   1627 C CE1 . HIS A 1 212 ? 32.831  3.319   21.014  1.00 42.08  ? 212  HIS A CE1 1 
ATOM   1628 N NE2 . HIS A 1 212 ? 33.716  2.405   21.359  1.00 42.62  ? 212  HIS A NE2 1 
ATOM   1629 N N   . ILE A 1 213 ? 29.934  -1.579  17.506  1.00 46.27  ? 213  ILE A N   1 
ATOM   1630 C CA  . ILE A 1 213 ? 29.261  -2.757  16.963  1.00 47.75  ? 213  ILE A CA  1 
ATOM   1631 C C   . ILE A 1 213 ? 30.277  -3.584  16.183  1.00 49.70  ? 213  ILE A C   1 
ATOM   1632 O O   . ILE A 1 213 ? 30.324  -4.793  16.300  1.00 51.27  ? 213  ILE A O   1 
ATOM   1633 C CB  . ILE A 1 213 ? 28.103  -2.358  16.037  1.00 47.71  ? 213  ILE A CB  1 
ATOM   1634 C CG1 . ILE A 1 213 ? 27.071  -1.536  16.822  1.00 46.11  ? 213  ILE A CG1 1 
ATOM   1635 C CG2 . ILE A 1 213 ? 27.463  -3.614  15.366  1.00 47.12  ? 213  ILE A CG2 1 
ATOM   1636 C CD1 . ILE A 1 213 ? 25.913  -0.989  15.980  1.00 44.15  ? 213  ILE A CD1 1 
ATOM   1637 N N   . LEU A 1 214 ? 31.128  -2.915  15.420  1.00 49.63  ? 214  LEU A N   1 
ATOM   1638 C CA  . LEU A 1 214 ? 32.046  -3.612  14.513  1.00 51.02  ? 214  LEU A CA  1 
ATOM   1639 C C   . LEU A 1 214 ? 33.330  -4.068  15.179  1.00 52.28  ? 214  LEU A C   1 
ATOM   1640 O O   . LEU A 1 214 ? 34.067  -4.894  14.595  1.00 53.27  ? 214  LEU A O   1 
ATOM   1641 C CB  . LEU A 1 214 ? 32.341  -2.734  13.279  1.00 50.35  ? 214  LEU A CB  1 
ATOM   1642 C CG  . LEU A 1 214 ? 31.107  -2.467  12.395  1.00 49.59  ? 214  LEU A CG  1 
ATOM   1643 C CD1 . LEU A 1 214 ? 31.398  -1.437  11.309  1.00 46.81  ? 214  LEU A CD1 1 
ATOM   1644 C CD2 . LEU A 1 214 ? 30.574  -3.761  11.782  1.00 46.48  ? 214  LEU A CD2 1 
ATOM   1645 N N   . SER A 1 215 ? 33.591  -3.568  16.396  1.00 52.12  ? 215  SER A N   1 
ATOM   1646 C CA  . SER A 1 215 ? 34.802  -3.945  17.159  1.00 52.92  ? 215  SER A CA  1 
ATOM   1647 C C   . SER A 1 215 ? 34.559  -4.913  18.322  1.00 54.62  ? 215  SER A C   1 
ATOM   1648 O O   . SER A 1 215 ? 33.888  -4.588  19.280  1.00 53.79  ? 215  SER A O   1 
ATOM   1649 C CB  . SER A 1 215 ? 35.483  -2.684  17.679  1.00 52.23  ? 215  SER A CB  1 
ATOM   1650 O OG  . SER A 1 215 ? 36.797  -2.989  18.075  1.00 50.85  ? 215  SER A OG  1 
ATOM   1651 N N   . LEU A 1 216 ? 35.154  -6.098  18.250  1.00 56.78  ? 216  LEU A N   1 
ATOM   1652 C CA  . LEU A 1 216 ? 34.868  -7.169  19.207  1.00 58.65  ? 216  LEU A CA  1 
ATOM   1653 C C   . LEU A 1 216 ? 34.956  -6.766  20.683  1.00 57.83  ? 216  LEU A C   1 
ATOM   1654 O O   . LEU A 1 216 ? 33.990  -6.933  21.418  1.00 59.00  ? 216  LEU A O   1 
ATOM   1655 C CB  . LEU A 1 216 ? 35.754  -8.415  18.937  1.00 60.81  ? 216  LEU A CB  1 
ATOM   1656 C CG  . LEU A 1 216 ? 35.014  -9.560  18.245  1.00 64.46  ? 216  LEU A CG  1 
ATOM   1657 C CD1 . LEU A 1 216 ? 35.962  -10.683 17.717  1.00 68.25  ? 216  LEU A CD1 1 
ATOM   1658 C CD2 . LEU A 1 216 ? 33.970  -10.134 19.209  1.00 65.57  ? 216  LEU A CD2 1 
ATOM   1659 N N   . PRO A 1 217 ? 36.110  -6.267  21.138  1.00 57.19  ? 217  PRO A N   1 
ATOM   1660 C CA  . PRO A 1 217 ? 36.175  -5.917  22.556  1.00 56.69  ? 217  PRO A CA  1 
ATOM   1661 C C   . PRO A 1 217 ? 35.073  -4.994  23.101  1.00 55.33  ? 217  PRO A C   1 
ATOM   1662 O O   . PRO A 1 217 ? 34.773  -5.070  24.295  1.00 55.09  ? 217  PRO A O   1 
ATOM   1663 C CB  . PRO A 1 217 ? 37.566  -5.295  22.711  1.00 56.75  ? 217  PRO A CB  1 
ATOM   1664 C CG  . PRO A 1 217 ? 38.364  -5.818  21.583  1.00 57.44  ? 217  PRO A CG  1 
ATOM   1665 C CD  . PRO A 1 217 ? 37.407  -6.105  20.459  1.00 57.36  ? 217  PRO A CD  1 
ATOM   1666 N N   . SER A 1 218 ? 34.474  -4.145  22.261  1.00 54.37  ? 218  SER A N   1 
ATOM   1667 C CA  . SER A 1 218 ? 33.346  -3.301  22.680  1.00 53.58  ? 218  SER A CA  1 
ATOM   1668 C C   . SER A 1 218 ? 32.007  -3.996  22.834  1.00 55.26  ? 218  SER A C   1 
ATOM   1669 O O   . SER A 1 218 ? 31.119  -3.449  23.464  1.00 53.99  ? 218  SER A O   1 
ATOM   1670 C CB  . SER A 1 218 ? 33.124  -2.155  21.693  1.00 52.09  ? 218  SER A CB  1 
ATOM   1671 O OG  . SER A 1 218 ? 34.257  -1.330  21.632  1.00 50.74  ? 218  SER A OG  1 
ATOM   1672 N N   . ARG A 1 219 ? 31.849  -5.184  22.257  1.00 58.04  ? 219  ARG A N   1 
ATOM   1673 C CA  . ARG A 1 219 ? 30.526  -5.806  22.148  1.00 60.15  ? 219  ARG A CA  1 
ATOM   1674 C C   . ARG A 1 219 ? 29.979  -6.338  23.458  1.00 60.88  ? 219  ARG A C   1 
ATOM   1675 O O   . ARG A 1 219 ? 28.770  -6.488  23.620  1.00 62.29  ? 219  ARG A O   1 
ATOM   1676 C CB  . ARG A 1 219 ? 30.560  -6.971  21.128  1.00 62.64  ? 219  ARG A CB  1 
ATOM   1677 C CG  . ARG A 1 219 ? 30.608  -6.517  19.670  1.00 64.62  ? 219  ARG A CG  1 
ATOM   1678 C CD  . ARG A 1 219 ? 29.456  -5.549  19.334  1.00 67.58  ? 219  ARG A CD  1 
ATOM   1679 N NE  . ARG A 1 219 ? 28.122  -6.157  19.399  1.00 69.76  ? 219  ARG A NE  1 
ATOM   1680 C CZ  . ARG A 1 219 ? 27.551  -6.842  18.404  1.00 74.48  ? 219  ARG A CZ  1 
ATOM   1681 N NH1 . ARG A 1 219 ? 28.182  -7.041  17.245  1.00 77.24  ? 219  ARG A NH1 1 
ATOM   1682 N NH2 . ARG A 1 219 ? 26.337  -7.353  18.561  1.00 74.92  ? 219  ARG A NH2 1 
ATOM   1683 N N   . SER A 1 220 ? 30.871  -6.676  24.373  1.00 60.83  ? 220  SER A N   1 
ATOM   1684 C CA  . SER A 1 220 ? 30.478  -7.082  25.695  1.00 61.10  ? 220  SER A CA  1 
ATOM   1685 C C   . SER A 1 220 ? 30.059  -5.898  26.550  1.00 58.55  ? 220  SER A C   1 
ATOM   1686 O O   . SER A 1 220 ? 29.589  -6.103  27.650  1.00 60.39  ? 220  SER A O   1 
ATOM   1687 C CB  . SER A 1 220 ? 31.634  -7.835  26.372  1.00 62.46  ? 220  SER A CB  1 
ATOM   1688 O OG  . SER A 1 220 ? 32.893  -7.278  25.992  1.00 62.90  ? 220  SER A OG  1 
ATOM   1689 N N   . LEU A 1 221 ? 30.215  -4.666  26.065  1.00 55.78  ? 221  LEU A N   1 
ATOM   1690 C CA  . LEU A 1 221 ? 30.021  -3.481  26.903  1.00 52.65  ? 221  LEU A CA  1 
ATOM   1691 C C   . LEU A 1 221 ? 28.712  -2.776  26.656  1.00 51.59  ? 221  LEU A C   1 
ATOM   1692 O O   . LEU A 1 221 ? 28.489  -1.688  27.222  1.00 50.90  ? 221  LEU A O   1 
ATOM   1693 C CB  . LEU A 1 221 ? 31.179  -2.489  26.699  1.00 51.05  ? 221  LEU A CB  1 
ATOM   1694 C CG  . LEU A 1 221 ? 32.578  -3.108  26.826  1.00 51.00  ? 221  LEU A CG  1 
ATOM   1695 C CD1 . LEU A 1 221 ? 33.657  -2.136  26.456  1.00 45.77  ? 221  LEU A CD1 1 
ATOM   1696 C CD2 . LEU A 1 221 ? 32.839  -3.726  28.219  1.00 50.08  ? 221  LEU A CD2 1 
ATOM   1697 N N   . PHE A 1 222 ? 27.860  -3.354  25.808  1.00 51.27  ? 222  PHE A N   1 
ATOM   1698 C CA  . PHE A 1 222 ? 26.529  -2.789  25.518  1.00 50.69  ? 222  PHE A CA  1 
ATOM   1699 C C   . PHE A 1 222 ? 25.629  -3.802  24.846  1.00 51.53  ? 222  PHE A C   1 
ATOM   1700 O O   . PHE A 1 222 ? 26.096  -4.877  24.448  1.00 53.13  ? 222  PHE A O   1 
ATOM   1701 C CB  . PHE A 1 222 ? 26.612  -1.537  24.643  1.00 50.06  ? 222  PHE A CB  1 
ATOM   1702 C CG  . PHE A 1 222 ? 27.019  -1.816  23.220  1.00 50.25  ? 222  PHE A CG  1 
ATOM   1703 C CD1 . PHE A 1 222 ? 28.350  -2.093  22.915  1.00 47.19  ? 222  PHE A CD1 1 
ATOM   1704 C CD2 . PHE A 1 222 ? 26.071  -1.770  22.185  1.00 50.44  ? 222  PHE A CD2 1 
ATOM   1705 C CE1 . PHE A 1 222 ? 28.731  -2.333  21.622  1.00 50.82  ? 222  PHE A CE1 1 
ATOM   1706 C CE2 . PHE A 1 222 ? 26.439  -2.035  20.876  1.00 50.10  ? 222  PHE A CE2 1 
ATOM   1707 C CZ  . PHE A 1 222 ? 27.765  -2.304  20.588  1.00 52.42  ? 222  PHE A CZ  1 
ATOM   1708 N N   . HIS A 1 223 ? 24.334  -3.485  24.743  1.00 50.83  ? 223  HIS A N   1 
ATOM   1709 C CA  . HIS A 1 223 ? 23.353  -4.475  24.266  1.00 51.00  ? 223  HIS A CA  1 
ATOM   1710 C C   . HIS A 1 223 ? 22.489  -4.046  23.056  1.00 48.82  ? 223  HIS A C   1 
ATOM   1711 O O   . HIS A 1 223 ? 21.996  -4.903  22.281  1.00 47.82  ? 223  HIS A O   1 
ATOM   1712 C CB  . HIS A 1 223 ? 22.494  -4.951  25.450  1.00 54.29  ? 223  HIS A CB  1 
ATOM   1713 C CG  . HIS A 1 223 ? 23.310  -5.379  26.640  1.00 57.04  ? 223  HIS A CG  1 
ATOM   1714 N ND1 . HIS A 1 223 ? 23.897  -4.470  27.508  1.00 58.59  ? 223  HIS A ND1 1 
ATOM   1715 C CD2 . HIS A 1 223 ? 23.690  -6.610  27.068  1.00 61.06  ? 223  HIS A CD2 1 
ATOM   1716 C CE1 . HIS A 1 223 ? 24.592  -5.125  28.419  1.00 60.74  ? 223  HIS A CE1 1 
ATOM   1717 N NE2 . HIS A 1 223 ? 24.469  -6.425  28.186  1.00 62.30  ? 223  HIS A NE2 1 
ATOM   1718 N N   . ARG A 1 224 ? 22.334  -2.730  22.850  1.00 43.53  ? 224  ARG A N   1 
ATOM   1719 C CA  . ARG A 1 224 ? 21.491  -2.239  21.772  1.00 42.23  ? 224  ARG A CA  1 
ATOM   1720 C C   . ARG A 1 224 ? 22.108  -0.877  21.370  1.00 39.29  ? 224  ARG A C   1 
ATOM   1721 O O   . ARG A 1 224 ? 22.837  -0.332  22.162  1.00 36.34  ? 224  ARG A O   1 
ATOM   1722 C CB  . ARG A 1 224 ? 20.089  -1.978  22.289  1.00 43.49  ? 224  ARG A CB  1 
ATOM   1723 C CG  . ARG A 1 224 ? 19.228  -3.223  22.446  1.00 49.02  ? 224  ARG A CG  1 
ATOM   1724 C CD  . ARG A 1 224 ? 17.924  -2.817  23.063  1.00 53.43  ? 224  ARG A CD  1 
ATOM   1725 N NE  . ARG A 1 224 ? 18.117  -2.811  24.497  1.00 56.17  ? 224  ARG A NE  1 
ATOM   1726 C CZ  . ARG A 1 224 ? 17.993  -3.900  25.243  1.00 61.67  ? 224  ARG A CZ  1 
ATOM   1727 N NH1 . ARG A 1 224 ? 17.672  -5.047  24.677  1.00 62.62  ? 224  ARG A NH1 1 
ATOM   1728 N NH2 . ARG A 1 224 ? 18.204  -3.843  26.547  1.00 63.68  ? 224  ARG A NH2 1 
ATOM   1729 N N   . ALA A 1 225 ? 21.858  -0.416  20.159  1.00 38.35  ? 225  ALA A N   1 
ATOM   1730 C CA  . ALA A 1 225 ? 22.488  0.861   19.669  1.00 37.13  ? 225  ALA A CA  1 
ATOM   1731 C C   . ALA A 1 225 ? 21.544  1.698   18.883  1.00 37.51  ? 225  ALA A C   1 
ATOM   1732 O O   . ALA A 1 225 ? 20.667  1.184   18.212  1.00 38.14  ? 225  ALA A O   1 
ATOM   1733 C CB  . ALA A 1 225 ? 23.647  0.545   18.773  1.00 36.07  ? 225  ALA A CB  1 
ATOM   1734 N N   . VAL A 1 226 ? 21.849  3.003   18.810  1.00 37.50  ? 226  VAL A N   1 
ATOM   1735 C CA  . VAL A 1 226 ? 21.000  3.920   18.102  1.00 38.94  ? 226  VAL A CA  1 
ATOM   1736 C C   . VAL A 1 226 ? 21.952  4.851   17.352  1.00 38.37  ? 226  VAL A C   1 
ATOM   1737 O O   . VAL A 1 226 ? 22.800  5.433   17.967  1.00 36.50  ? 226  VAL A O   1 
ATOM   1738 C CB  . VAL A 1 226 ? 20.167  4.770   19.072  1.00 39.65  ? 226  VAL A CB  1 
ATOM   1739 C CG1 . VAL A 1 226 ? 19.488  5.927   18.282  1.00 40.24  ? 226  VAL A CG1 1 
ATOM   1740 C CG2 . VAL A 1 226 ? 19.150  3.907   19.787  1.00 41.99  ? 226  VAL A CG2 1 
ATOM   1741 N N   . LEU A 1 227 ? 21.870  4.860   16.027  1.00 39.24  ? 227  LEU A N   1 
ATOM   1742 C CA  . LEU A 1 227 ? 22.767  5.636   15.192  1.00 38.12  ? 227  LEU A CA  1 
ATOM   1743 C C   . LEU A 1 227 ? 21.949  6.700   14.502  1.00 37.68  ? 227  LEU A C   1 
ATOM   1744 O O   . LEU A 1 227 ? 21.193  6.384   13.606  1.00 36.73  ? 227  LEU A O   1 
ATOM   1745 C CB  . LEU A 1 227 ? 23.405  4.735   14.144  1.00 38.13  ? 227  LEU A CB  1 
ATOM   1746 C CG  . LEU A 1 227 ? 24.292  3.541   14.614  1.00 37.86  ? 227  LEU A CG  1 
ATOM   1747 C CD1 . LEU A 1 227 ? 23.478  2.293   15.011  1.00 35.23  ? 227  LEU A CD1 1 
ATOM   1748 C CD2 . LEU A 1 227 ? 25.279  3.238   13.487  1.00 38.21  ? 227  LEU A CD2 1 
ATOM   1749 N N   . GLN A 1 228 ? 22.149  7.966   14.875  1.00 39.40  ? 228  GLN A N   1 
ATOM   1750 C CA  . GLN A 1 228 ? 21.435  9.080   14.289  1.00 38.87  ? 228  GLN A CA  1 
ATOM   1751 C C   . GLN A 1 228 ? 22.321  9.874   13.292  1.00 39.50  ? 228  GLN A C   1 
ATOM   1752 O O   . GLN A 1 228 ? 23.368  10.406  13.684  1.00 38.19  ? 228  GLN A O   1 
ATOM   1753 C CB  . GLN A 1 228 ? 20.956  10.036  15.421  1.00 40.80  ? 228  GLN A CB  1 
ATOM   1754 C CG  . GLN A 1 228 ? 20.254  9.355   16.602  1.00 39.57  ? 228  GLN A CG  1 
ATOM   1755 C CD  . GLN A 1 228 ? 19.953  10.238  17.813  1.00 39.98  ? 228  GLN A CD  1 
ATOM   1756 O OE1 . GLN A 1 228 ? 19.666  9.700   18.913  1.00 38.57  ? 228  GLN A OE1 1 
ATOM   1757 N NE2 . GLN A 1 228 ? 19.952  11.575  17.635  1.00 38.76  ? 228  GLN A NE2 1 
ATOM   1758 N N   . SER A 1 229 ? 21.885  9.975   12.025  1.00 39.45  ? 229  SER A N   1 
ATOM   1759 C CA  . SER A 1 229 ? 22.541  10.766  11.002  1.00 38.51  ? 229  SER A CA  1 
ATOM   1760 C C   . SER A 1 229 ? 24.038  10.485  10.901  1.00 38.50  ? 229  SER A C   1 
ATOM   1761 O O   . SER A 1 229 ? 24.825  11.411  10.781  1.00 37.27  ? 229  SER A O   1 
ATOM   1762 C CB  . SER A 1 229 ? 22.331  12.263  11.257  1.00 38.59  ? 229  SER A CB  1 
ATOM   1763 O OG  . SER A 1 229 ? 20.953  12.615  11.176  1.00 38.92  ? 229  SER A OG  1 
ATOM   1764 N N   . GLY A 1 230 ? 24.425  9.213   10.982  1.00 38.36  ? 230  GLY A N   1 
ATOM   1765 C CA  . GLY A 1 230 ? 25.821  8.836   10.812  1.00 38.41  ? 230  GLY A CA  1 
ATOM   1766 C C   . GLY A 1 230 ? 26.007  7.337   10.830  1.00 39.90  ? 230  GLY A C   1 
ATOM   1767 O O   . GLY A 1 230 ? 25.182  6.629   11.374  1.00 40.38  ? 230  GLY A O   1 
ATOM   1768 N N   . THR A 1 231 ? 27.133  6.873   10.289  1.00 40.94  ? 231  THR A N   1 
ATOM   1769 C CA  . THR A 1 231 ? 27.380  5.449   10.081  1.00 41.80  ? 231  THR A CA  1 
ATOM   1770 C C   . THR A 1 231 ? 28.889  5.197   10.099  1.00 41.73  ? 231  THR A C   1 
ATOM   1771 O O   . THR A 1 231 ? 29.653  6.116   9.868   1.00 40.65  ? 231  THR A O   1 
ATOM   1772 C CB  . THR A 1 231 ? 26.831  4.999   8.696   1.00 42.80  ? 231  THR A CB  1 
ATOM   1773 O OG1 . THR A 1 231 ? 27.393  5.832   7.669   1.00 43.94  ? 231  THR A OG1 1 
ATOM   1774 C CG2 . THR A 1 231 ? 25.301  5.063   8.620   1.00 41.29  ? 231  THR A CG2 1 
ATOM   1775 N N   . PRO A 1 232 ? 29.339  3.952   10.393  1.00 42.72  ? 232  PRO A N   1 
ATOM   1776 C CA  . PRO A 1 232 ? 30.792  3.690   10.274  1.00 43.23  ? 232  PRO A CA  1 
ATOM   1777 C C   . PRO A 1 232 ? 31.303  3.515   8.825   1.00 44.44  ? 232  PRO A C   1 
ATOM   1778 O O   . PRO A 1 232 ? 32.435  3.902   8.518   1.00 43.84  ? 232  PRO A O   1 
ATOM   1779 C CB  . PRO A 1 232 ? 30.976  2.381   11.070  1.00 44.54  ? 232  PRO A CB  1 
ATOM   1780 C CG  . PRO A 1 232 ? 29.650  1.686   10.983  1.00 44.63  ? 232  PRO A CG  1 
ATOM   1781 C CD  . PRO A 1 232 ? 28.605  2.796   10.930  1.00 43.64  ? 232  PRO A CD  1 
ATOM   1782 N N   . ASN A 1 233 ? 30.507  2.847   7.984   1.00 44.95  ? 233  ASN A N   1 
ATOM   1783 C CA  . ASN A 1 233 ? 30.645  2.885   6.532   1.00 45.98  ? 233  ASN A CA  1 
ATOM   1784 C C   . ASN A 1 233 ? 30.425  4.317   5.997   1.00 46.21  ? 233  ASN A C   1 
ATOM   1785 O O   . ASN A 1 233 ? 30.037  5.206   6.744   1.00 46.69  ? 233  ASN A O   1 
ATOM   1786 C CB  . ASN A 1 233 ? 29.644  1.934   5.857   1.00 46.58  ? 233  ASN A CB  1 
ATOM   1787 C CG  . ASN A 1 233 ? 28.196  2.262   6.187   1.00 46.06  ? 233  ASN A CG  1 
ATOM   1788 O OD1 . ASN A 1 233 ? 27.805  2.194   7.341   1.00 48.70  ? 233  ASN A OD1 1 
ATOM   1789 N ND2 . ASN A 1 233 ? 27.390  2.590   5.175   1.00 44.80  ? 233  ASN A ND2 1 
ATOM   1790 N N   . GLY A 1 234 ? 30.722  4.537   4.716   1.00 47.04  ? 234  GLY A N   1 
ATOM   1791 C CA  . GLY A 1 234 ? 30.540  5.845   4.090   1.00 46.29  ? 234  GLY A CA  1 
ATOM   1792 C C   . GLY A 1 234 ? 31.852  6.570   3.846   1.00 46.32  ? 234  GLY A C   1 
ATOM   1793 O O   . GLY A 1 234 ? 32.915  6.077   4.219   1.00 47.73  ? 234  GLY A O   1 
ATOM   1794 N N   . PRO A 1 235 ? 31.795  7.749   3.206   1.00 45.09  ? 235  PRO A N   1 
ATOM   1795 C CA  . PRO A 1 235 ? 32.981  8.433   2.702   1.00 44.67  ? 235  PRO A CA  1 
ATOM   1796 C C   . PRO A 1 235 ? 33.880  9.234   3.667   1.00 44.50  ? 235  PRO A C   1 
ATOM   1797 O O   . PRO A 1 235 ? 35.016  9.598   3.289   1.00 45.12  ? 235  PRO A O   1 
ATOM   1798 C CB  . PRO A 1 235 ? 32.401  9.338   1.615   1.00 45.09  ? 235  PRO A CB  1 
ATOM   1799 C CG  . PRO A 1 235 ? 31.015  9.619   2.055   1.00 44.08  ? 235  PRO A CG  1 
ATOM   1800 C CD  . PRO A 1 235 ? 30.548  8.429   2.824   1.00 44.96  ? 235  PRO A CD  1 
ATOM   1801 N N   . TRP A 1 236 ? 33.434  9.490   4.893   1.00 44.20  ? 236  TRP A N   1 
ATOM   1802 C CA  . TRP A 1 236 ? 34.114  10.454  5.774   1.00 43.29  ? 236  TRP A CA  1 
ATOM   1803 C C   . TRP A 1 236 ? 34.503  9.929   7.138   1.00 42.62  ? 236  TRP A C   1 
ATOM   1804 O O   . TRP A 1 236 ? 35.221  10.630  7.840   1.00 41.25  ? 236  TRP A O   1 
ATOM   1805 C CB  . TRP A 1 236 ? 33.228  11.700  6.007   1.00 43.72  ? 236  TRP A CB  1 
ATOM   1806 C CG  . TRP A 1 236 ? 31.876  11.355  6.587   1.00 45.07  ? 236  TRP A CG  1 
ATOM   1807 C CD1 . TRP A 1 236 ? 30.746  11.127  5.874   1.00 45.85  ? 236  TRP A CD1 1 
ATOM   1808 C CD2 . TRP A 1 236 ? 31.515  11.150  7.977   1.00 46.64  ? 236  TRP A CD2 1 
ATOM   1809 N NE1 . TRP A 1 236 ? 29.722  10.809  6.698   1.00 46.95  ? 236  TRP A NE1 1 
ATOM   1810 C CE2 . TRP A 1 236 ? 30.149  10.813  7.997   1.00 46.94  ? 236  TRP A CE2 1 
ATOM   1811 C CE3 . TRP A 1 236 ? 32.204  11.228  9.194   1.00 46.54  ? 236  TRP A CE3 1 
ATOM   1812 C CZ2 . TRP A 1 236 ? 29.439  10.565  9.186   1.00 44.83  ? 236  TRP A CZ2 1 
ATOM   1813 C CZ3 . TRP A 1 236 ? 31.506  10.981  10.380  1.00 44.60  ? 236  TRP A CZ3 1 
ATOM   1814 C CH2 . TRP A 1 236 ? 30.123  10.665  10.362  1.00 45.17  ? 236  TRP A CH2 1 
ATOM   1815 N N   . ALA A 1 237 ? 34.060  8.731   7.531   1.00 42.29  ? 237  ALA A N   1 
ATOM   1816 C CA  . ALA A 1 237 ? 34.165  8.328   8.934   1.00 41.97  ? 237  ALA A CA  1 
ATOM   1817 C C   . ALA A 1 237 ? 35.441  7.559   9.240   1.00 43.21  ? 237  ALA A C   1 
ATOM   1818 O O   . ALA A 1 237 ? 35.805  7.429   10.401  1.00 43.55  ? 237  ALA A O   1 
ATOM   1819 C CB  . ALA A 1 237 ? 32.924  7.506   9.377   1.00 42.15  ? 237  ALA A CB  1 
ATOM   1820 N N   . THR A 1 238 ? 36.085  6.996   8.212   1.00 43.81  ? 238  THR A N   1 
ATOM   1821 C CA  . THR A 1 238 ? 37.367  6.362   8.368   1.00 43.67  ? 238  THR A CA  1 
ATOM   1822 C C   . THR A 1 238 ? 38.322  6.765   7.262   1.00 43.51  ? 238  THR A C   1 
ATOM   1823 O O   . THR A 1 238 ? 37.911  7.298   6.235   1.00 43.16  ? 238  THR A O   1 
ATOM   1824 C CB  . THR A 1 238 ? 37.248  4.826   8.328   1.00 44.58  ? 238  THR A CB  1 
ATOM   1825 O OG1 . THR A 1 238 ? 36.835  4.429   7.021   1.00 46.21  ? 238  THR A OG1 1 
ATOM   1826 C CG2 . THR A 1 238 ? 36.223  4.321   9.333   1.00 44.14  ? 238  THR A CG2 1 
ATOM   1827 N N   . VAL A 1 239 ? 39.597  6.428   7.458   1.00 43.51  ? 239  VAL A N   1 
ATOM   1828 C CA  . VAL A 1 239 ? 40.629  6.589   6.436   1.00 43.30  ? 239  VAL A CA  1 
ATOM   1829 C C   . VAL A 1 239 ? 41.505  5.332   6.472   1.00 44.87  ? 239  VAL A C   1 
ATOM   1830 O O   . VAL A 1 239 ? 41.563  4.656   7.477   1.00 44.24  ? 239  VAL A O   1 
ATOM   1831 C CB  . VAL A 1 239 ? 41.536  7.827   6.700   1.00 43.27  ? 239  VAL A CB  1 
ATOM   1832 C CG1 . VAL A 1 239 ? 40.820  9.164   6.400   1.00 41.77  ? 239  VAL A CG1 1 
ATOM   1833 C CG2 . VAL A 1 239 ? 42.090  7.781   8.125   1.00 41.27  ? 239  VAL A CG2 1 
ATOM   1834 N N   . SER A 1 240 ? 42.165  5.031   5.365   1.00 46.27  ? 240  SER A N   1 
ATOM   1835 C CA  . SER A 1 240 ? 43.098  3.915   5.285   1.00 48.40  ? 240  SER A CA  1 
ATOM   1836 C C   . SER A 1 240 ? 44.313  4.218   6.124   1.00 49.01  ? 240  SER A C   1 
ATOM   1837 O O   . SER A 1 240 ? 44.576  5.383   6.481   1.00 48.11  ? 240  SER A O   1 
ATOM   1838 C CB  . SER A 1 240 ? 43.540  3.725   3.845   1.00 49.52  ? 240  SER A CB  1 
ATOM   1839 O OG  . SER A 1 240 ? 44.102  4.928   3.358   1.00 50.37  ? 240  SER A OG  1 
ATOM   1840 N N   . ALA A 1 241 ? 45.083  3.175   6.412   1.00 50.73  ? 241  ALA A N   1 
ATOM   1841 C CA  . ALA A 1 241 ? 46.305  3.343   7.143   1.00 51.30  ? 241  ALA A CA  1 
ATOM   1842 C C   . ALA A 1 241 ? 47.193  4.321   6.381   1.00 52.05  ? 241  ALA A C   1 
ATOM   1843 O O   . ALA A 1 241 ? 47.749  5.235   6.973   1.00 52.75  ? 241  ALA A O   1 
ATOM   1844 C CB  . ALA A 1 241 ? 47.003  1.996   7.357   1.00 53.32  ? 241  ALA A CB  1 
ATOM   1845 N N   . GLY A 1 242 ? 47.291  4.157   5.065   1.00 52.56  ? 242  GLY A N   1 
ATOM   1846 C CA  . GLY A 1 242 ? 48.175  4.985   4.251   1.00 53.08  ? 242  GLY A CA  1 
ATOM   1847 C C   . GLY A 1 242 ? 47.826  6.464   4.246   1.00 51.99  ? 242  GLY A C   1 
ATOM   1848 O O   . GLY A 1 242 ? 48.723  7.319   4.278   1.00 51.92  ? 242  GLY A O   1 
ATOM   1849 N N   . GLU A 1 243 ? 46.527  6.759   4.195   1.00 50.48  ? 243  GLU A N   1 
ATOM   1850 C CA  . GLU A 1 243 ? 46.057  8.131   4.206   1.00 50.09  ? 243  GLU A CA  1 
ATOM   1851 C C   . GLU A 1 243 ? 46.223  8.757   5.583   1.00 49.66  ? 243  GLU A C   1 
ATOM   1852 O O   . GLU A 1 243 ? 46.528  9.946   5.693   1.00 50.55  ? 243  GLU A O   1 
ATOM   1853 C CB  . GLU A 1 243 ? 44.598  8.184   3.763   1.00 48.40  ? 243  GLU A CB  1 
ATOM   1854 C CG  . GLU A 1 243 ? 43.999  9.567   3.718   1.00 48.72  ? 243  GLU A CG  1 
ATOM   1855 C CD  . GLU A 1 243 ? 44.656  10.517  2.717   1.00 49.49  ? 243  GLU A CD  1 
ATOM   1856 O OE1 . GLU A 1 243 ? 45.525  10.111  1.906   1.00 52.21  ? 243  GLU A OE1 1 
ATOM   1857 O OE2 . GLU A 1 243 ? 44.285  11.705  2.740   1.00 47.68  ? 243  GLU A OE2 1 
ATOM   1858 N N   . ALA A 1 244 ? 46.030  7.963   6.637   1.00 49.18  ? 244  ALA A N   1 
ATOM   1859 C CA  . ALA A 1 244 ? 46.248  8.454   7.987   1.00 48.19  ? 244  ALA A CA  1 
ATOM   1860 C C   . ALA A 1 244 ? 47.739  8.852   8.161   1.00 49.74  ? 244  ALA A C   1 
ATOM   1861 O O   . ALA A 1 244 ? 48.069  9.943   8.644   1.00 49.28  ? 244  ALA A O   1 
ATOM   1862 C CB  . ALA A 1 244 ? 45.822  7.414   8.986   1.00 47.34  ? 244  ALA A CB  1 
ATOM   1863 N N   . ARG A 1 245 ? 48.626  7.976   7.719   1.00 50.53  ? 245  ARG A N   1 
ATOM   1864 C CA  . ARG A 1 245 ? 50.072  8.223   7.795   1.00 52.80  ? 245  ARG A CA  1 
ATOM   1865 C C   . ARG A 1 245 ? 50.510  9.465   7.034   1.00 53.65  ? 245  ARG A C   1 
ATOM   1866 O O   . ARG A 1 245 ? 51.397  10.199  7.469   1.00 54.95  ? 245  ARG A O   1 
ATOM   1867 C CB  . ARG A 1 245 ? 50.827  7.034   7.217   1.00 53.69  ? 245  ARG A CB  1 
ATOM   1868 C CG  . ARG A 1 245 ? 52.330  7.238   7.130   1.00 55.61  ? 245  ARG A CG  1 
ATOM   1869 C CD  . ARG A 1 245 ? 53.020  5.911   6.915   1.00 57.54  ? 245  ARG A CD  1 
ATOM   1870 N NE  . ARG A 1 245 ? 52.970  5.139   8.147   1.00 58.20  ? 245  ARG A NE  1 
ATOM   1871 C CZ  . ARG A 1 245 ? 53.834  5.274   9.149   1.00 59.73  ? 245  ARG A CZ  1 
ATOM   1872 N NH1 . ARG A 1 245 ? 54.823  6.160   9.088   1.00 61.10  ? 245  ARG A NH1 1 
ATOM   1873 N NH2 . ARG A 1 245 ? 53.693  4.530   10.235  1.00 59.22  ? 245  ARG A NH2 1 
ATOM   1874 N N   . ARG A 1 246 ? 49.920  9.644   5.865   1.00 53.70  ? 246  ARG A N   1 
ATOM   1875 C CA  . ARG A 1 246 ? 50.225  10.757  4.997   1.00 54.63  ? 246  ARG A CA  1 
ATOM   1876 C C   . ARG A 1 246 ? 49.773  12.075  5.633   1.00 53.04  ? 246  ARG A C   1 
ATOM   1877 O O   . ARG A 1 246 ? 50.469  13.092  5.573   1.00 52.68  ? 246  ARG A O   1 
ATOM   1878 C CB  . ARG A 1 246 ? 49.475  10.528  3.695   1.00 55.11  ? 246  ARG A CB  1 
ATOM   1879 C CG  . ARG A 1 246 ? 49.821  11.461  2.602   1.00 57.61  ? 246  ARG A CG  1 
ATOM   1880 C CD  . ARG A 1 246 ? 48.576  11.798  1.808   1.00 59.82  ? 246  ARG A CD  1 
ATOM   1881 N NE  . ARG A 1 246 ? 48.506  13.240  1.711   1.00 60.45  ? 246  ARG A NE  1 
ATOM   1882 C CZ  . ARG A 1 246 ? 47.457  13.980  2.017   1.00 58.65  ? 246  ARG A CZ  1 
ATOM   1883 N NH1 . ARG A 1 246 ? 46.299  13.452  2.358   1.00 56.96  ? 246  ARG A NH1 1 
ATOM   1884 N NH2 . ARG A 1 246 ? 47.566  15.280  1.894   1.00 61.47  ? 246  ARG A NH2 1 
ATOM   1885 N N   . ARG A 1 247 ? 48.584  12.059  6.221   1.00 51.07  ? 247  ARG A N   1 
ATOM   1886 C CA  . ARG A 1 247 ? 48.074  13.250  6.913   1.00 49.50  ? 247  ARG A CA  1 
ATOM   1887 C C   . ARG A 1 247 ? 48.871  13.604  8.178   1.00 49.88  ? 247  ARG A C   1 
ATOM   1888 O O   . ARG A 1 247 ? 49.164  14.765  8.408   1.00 49.73  ? 247  ARG A O   1 
ATOM   1889 C CB  . ARG A 1 247 ? 46.618  13.061  7.252   1.00 47.36  ? 247  ARG A CB  1 
ATOM   1890 C CG  . ARG A 1 247 ? 45.726  13.146  6.042   1.00 47.03  ? 247  ARG A CG  1 
ATOM   1891 C CD  . ARG A 1 247 ? 44.289  12.832  6.430   1.00 45.28  ? 247  ARG A CD  1 
ATOM   1892 N NE  . ARG A 1 247 ? 43.454  12.623  5.272   1.00 43.75  ? 247  ARG A NE  1 
ATOM   1893 C CZ  . ARG A 1 247 ? 42.131  12.516  5.312   1.00 42.99  ? 247  ARG A CZ  1 
ATOM   1894 N NH1 . ARG A 1 247 ? 41.477  12.593  6.448   1.00 42.01  ? 247  ARG A NH1 1 
ATOM   1895 N NH2 . ARG A 1 247 ? 41.463  12.327  4.197   1.00 45.49  ? 247  ARG A NH2 1 
ATOM   1896 N N   . ALA A 1 248 ? 49.236  12.594  8.978   1.00 50.40  ? 248  ALA A N   1 
ATOM   1897 C CA  . ALA A 1 248 ? 50.042  12.791  10.185  1.00 50.47  ? 248  ALA A CA  1 
ATOM   1898 C C   . ALA A 1 248 ? 51.402  13.345  9.853   1.00 52.14  ? 248  ALA A C   1 
ATOM   1899 O O   . ALA A 1 248 ? 51.956  14.159  10.590  1.00 52.80  ? 248  ALA A O   1 
ATOM   1900 C CB  . ALA A 1 248 ? 50.204  11.468  10.939  1.00 50.77  ? 248  ALA A CB  1 
ATOM   1901 N N   . THR A 1 249 ? 51.966  12.855  8.760   1.00 53.13  ? 249  THR A N   1 
ATOM   1902 C CA  . THR A 1 249 ? 53.314  13.227  8.344   1.00 54.25  ? 249  THR A CA  1 
ATOM   1903 C C   . THR A 1 249 ? 53.312  14.637  7.802   1.00 54.03  ? 249  THR A C   1 
ATOM   1904 O O   . THR A 1 249 ? 54.222  15.396  8.078   1.00 55.50  ? 249  THR A O   1 
ATOM   1905 C CB  . THR A 1 249 ? 53.841  12.259  7.273   1.00 55.67  ? 249  THR A CB  1 
ATOM   1906 O OG1 . THR A 1 249 ? 53.790  10.922  7.787   1.00 55.70  ? 249  THR A OG1 1 
ATOM   1907 C CG2 . THR A 1 249 ? 55.257  12.586  6.894   1.00 56.12  ? 249  THR A CG2 1 
ATOM   1908 N N   . LEU A 1 250 ? 52.280  14.985  7.037   1.00 53.13  ? 250  LEU A N   1 
ATOM   1909 C CA  . LEU A 1 250 ? 52.129  16.351  6.508   1.00 53.05  ? 250  LEU A CA  1 
ATOM   1910 C C   . LEU A 1 250 ? 51.967  17.344  7.662   1.00 53.05  ? 250  LEU A C   1 
ATOM   1911 O O   . LEU A 1 250 ? 52.601  18.389  7.673   1.00 53.55  ? 250  LEU A O   1 
ATOM   1912 C CB  . LEU A 1 250 ? 50.937  16.432  5.535   1.00 51.85  ? 250  LEU A CB  1 
ATOM   1913 C CG  . LEU A 1 250 ? 50.613  17.803  4.924   1.00 51.85  ? 250  LEU A CG  1 
ATOM   1914 C CD1 . LEU A 1 250 ? 51.865  18.468  4.385   1.00 51.20  ? 250  LEU A CD1 1 
ATOM   1915 C CD2 . LEU A 1 250 ? 49.556  17.665  3.839   1.00 50.25  ? 250  LEU A CD2 1 
ATOM   1916 N N   . LEU A 1 251 ? 51.116  17.005  8.632   1.00 52.91  ? 251  LEU A N   1 
ATOM   1917 C CA  . LEU A 1 251 ? 50.919  17.864  9.802   1.00 53.04  ? 251  LEU A CA  1 
ATOM   1918 C C   . LEU A 1 251 ? 52.208  18.084  10.562  1.00 54.20  ? 251  LEU A C   1 
ATOM   1919 O O   . LEU A 1 251 ? 52.514  19.206  10.932  1.00 54.54  ? 251  LEU A O   1 
ATOM   1920 C CB  . LEU A 1 251 ? 49.903  17.269  10.767  1.00 52.52  ? 251  LEU A CB  1 
ATOM   1921 C CG  . LEU A 1 251 ? 49.694  18.146  12.020  1.00 52.66  ? 251  LEU A CG  1 
ATOM   1922 C CD1 . LEU A 1 251 ? 48.407  18.909  11.939  1.00 51.98  ? 251  LEU A CD1 1 
ATOM   1923 C CD2 . LEU A 1 251 ? 49.764  17.337  13.284  1.00 53.47  ? 251  LEU A CD2 1 
ATOM   1924 N N   . ALA A 1 252 ? 52.932  16.998  10.828  1.00 54.67  ? 252  ALA A N   1 
ATOM   1925 C CA  . ALA A 1 252 ? 54.238  17.070  11.456  1.00 56.30  ? 252  ALA A CA  1 
ATOM   1926 C C   . ALA A 1 252 ? 55.132  18.100  10.740  1.00 57.80  ? 252  ALA A C   1 
ATOM   1927 O O   . ALA A 1 252 ? 55.677  18.986  11.377  1.00 58.85  ? 252  ALA A O   1 
ATOM   1928 C CB  . ALA A 1 252 ? 54.894  15.707  11.463  1.00 56.66  ? 252  ALA A CB  1 
ATOM   1929 N N   . ARG A 1 253 ? 55.283  17.978  9.425   1.00 58.59  ? 253  ARG A N   1 
ATOM   1930 C CA  . ARG A 1 253 ? 56.061  18.958  8.639   1.00 60.69  ? 253  ARG A CA  1 
ATOM   1931 C C   . ARG A 1 253 ? 55.572  20.390  8.870   1.00 60.04  ? 253  ARG A C   1 
ATOM   1932 O O   . ARG A 1 253 ? 56.364  21.299  9.090   1.00 60.24  ? 253  ARG A O   1 
ATOM   1933 C CB  . ARG A 1 253 ? 56.001  18.644  7.140   1.00 60.77  ? 253  ARG A CB  1 
ATOM   1934 C CG  . ARG A 1 253 ? 57.062  17.684  6.659   1.00 63.89  ? 253  ARG A CG  1 
ATOM   1935 C CD  . ARG A 1 253 ? 57.082  17.565  5.141   1.00 66.00  ? 253  ARG A CD  1 
ATOM   1936 N NE  . ARG A 1 253 ? 55.860  16.894  4.679   1.00 69.91  ? 253  ARG A NE  1 
ATOM   1937 C CZ  . ARG A 1 253 ? 55.734  15.584  4.414   1.00 70.29  ? 253  ARG A CZ  1 
ATOM   1938 N NH1 . ARG A 1 253 ? 54.546  15.114  4.025   1.00 64.92  ? 253  ARG A NH1 1 
ATOM   1939 N NH2 . ARG A 1 253 ? 56.787  14.740  4.514   1.00 72.83  ? 253  ARG A NH2 1 
ATOM   1940 N N   . LEU A 1 254 ? 54.256  20.573  8.824   1.00 58.34  ? 254  LEU A N   1 
ATOM   1941 C CA  . LEU A 1 254 ? 53.658  21.900  8.953   1.00 58.70  ? 254  LEU A CA  1 
ATOM   1942 C C   . LEU A 1 254 ? 53.922  22.565  10.293  1.00 59.98  ? 254  LEU A C   1 
ATOM   1943 O O   . LEU A 1 254 ? 53.961  23.788  10.361  1.00 60.41  ? 254  LEU A O   1 
ATOM   1944 C CB  . LEU A 1 254 ? 52.154  21.846  8.691   1.00 56.43  ? 254  LEU A CB  1 
ATOM   1945 C CG  . LEU A 1 254 ? 51.771  21.571  7.238   1.00 55.60  ? 254  LEU A CG  1 
ATOM   1946 C CD1 . LEU A 1 254 ? 50.276  21.513  7.119   1.00 52.47  ? 254  LEU A CD1 1 
ATOM   1947 C CD2 . LEU A 1 254 ? 52.351  22.630  6.307   1.00 55.13  ? 254  LEU A CD2 1 
ATOM   1948 N N   . VAL A 1 255 ? 54.101  21.762  11.346  1.00 61.01  ? 255  VAL A N   1 
ATOM   1949 C CA  . VAL A 1 255 ? 54.469  22.282  12.679  1.00 62.23  ? 255  VAL A CA  1 
ATOM   1950 C C   . VAL A 1 255 ? 55.959  22.128  13.005  1.00 65.58  ? 255  VAL A C   1 
ATOM   1951 O O   . VAL A 1 255 ? 56.377  22.294  14.160  1.00 66.75  ? 255  VAL A O   1 
ATOM   1952 C CB  . VAL A 1 255 ? 53.608  21.649  13.793  1.00 60.73  ? 255  VAL A CB  1 
ATOM   1953 C CG1 . VAL A 1 255 ? 52.145  22.049  13.611  1.00 58.34  ? 255  VAL A CG1 1 
ATOM   1954 C CG2 . VAL A 1 255 ? 53.746  20.144  13.811  1.00 59.12  ? 255  VAL A CG2 1 
ATOM   1955 N N   . GLY A 1 256 ? 56.767  21.837  11.990  1.00 67.90  ? 256  GLY A N   1 
ATOM   1956 C CA  . GLY A 1 256 ? 58.219  21.831  12.143  1.00 71.07  ? 256  GLY A CA  1 
ATOM   1957 C C   . GLY A 1 256 ? 58.786  20.574  12.780  1.00 72.49  ? 256  GLY A C   1 
ATOM   1958 O O   . GLY A 1 256 ? 59.724  20.652  13.562  1.00 74.74  ? 256  GLY A O   1 
ATOM   1959 N N   . CYS A 1 257 ? 58.228  19.421  12.420  1.00 72.42  ? 257  CYS A N   1 
ATOM   1960 C CA  . CYS A 1 257 ? 58.636  18.132  12.958  1.00 73.62  ? 257  CYS A CA  1 
ATOM   1961 C C   . CYS A 1 257 ? 58.935  17.146  11.827  1.00 75.26  ? 257  CYS A C   1 
ATOM   1962 O O   . CYS A 1 257 ? 58.018  16.687  11.154  1.00 74.38  ? 257  CYS A O   1 
ATOM   1963 C CB  . CYS A 1 257 ? 57.531  17.558  13.857  1.00 70.96  ? 257  CYS A CB  1 
ATOM   1964 S SG  . CYS A 1 257 ? 57.429  18.308  15.493  1.00 68.35  ? 257  CYS A SG  1 
ATOM   1965 N N   . PRO A 1 258 ? 60.221  16.812  11.619  1.00 79.14  ? 258  PRO A N   1 
ATOM   1966 C CA  . PRO A 1 258 ? 60.639  15.761  10.679  1.00 80.14  ? 258  PRO A CA  1 
ATOM   1967 C C   . PRO A 1 258 ? 59.666  14.578  10.555  1.00 79.85  ? 258  PRO A C   1 
ATOM   1968 O O   . PRO A 1 258 ? 59.494  14.025  9.454   1.00 81.00  ? 258  PRO A O   1 
ATOM   1969 C CB  . PRO A 1 258 ? 61.958  15.285  11.283  1.00 82.64  ? 258  PRO A CB  1 
ATOM   1970 C CG  . PRO A 1 258 ? 62.526  16.510  11.995  1.00 83.59  ? 258  PRO A CG  1 
ATOM   1971 C CD  . PRO A 1 258 ? 61.391  17.447  12.273  1.00 81.44  ? 258  PRO A CD  1 
ATOM   1972 N N   . ASN A 1 265 ? 61.863  7.619   10.866  1.00 78.61  ? 265  ASN A N   1 
ATOM   1973 C CA  . ASN A 1 265 ? 61.667  7.152   12.250  1.00 78.00  ? 265  ASN A CA  1 
ATOM   1974 C C   . ASN A 1 265 ? 60.402  7.754   12.883  1.00 75.29  ? 265  ASN A C   1 
ATOM   1975 O O   . ASN A 1 265 ? 60.311  8.977   13.021  1.00 75.13  ? 265  ASN A O   1 
ATOM   1976 C CB  . ASN A 1 265 ? 62.916  7.510   13.083  1.00 80.34  ? 265  ASN A CB  1 
ATOM   1977 C CG  . ASN A 1 265 ? 62.946  6.831   14.445  1.00 80.73  ? 265  ASN A CG  1 
ATOM   1978 O OD1 . ASN A 1 265 ? 62.059  7.037   15.268  1.00 78.72  ? 265  ASN A OD1 1 
ATOM   1979 N ND2 . ASN A 1 265 ? 63.989  6.036   14.695  1.00 84.01  ? 265  ASN A ND2 1 
ATOM   1980 N N   . ASP A 1 266 ? 59.442  6.907   13.274  1.00 73.32  ? 266  ASP A N   1 
ATOM   1981 C CA  . ASP A 1 266 ? 58.164  7.389   13.829  1.00 70.44  ? 266  ASP A CA  1 
ATOM   1982 C C   . ASP A 1 266 ? 58.294  7.899   15.250  1.00 69.31  ? 266  ASP A C   1 
ATOM   1983 O O   . ASP A 1 266 ? 57.601  8.835   15.637  1.00 67.81  ? 266  ASP A O   1 
ATOM   1984 C CB  . ASP A 1 266 ? 57.096  6.290   13.825  1.00 69.35  ? 266  ASP A CB  1 
ATOM   1985 C CG  . ASP A 1 266 ? 56.497  6.054   12.463  1.00 68.48  ? 266  ASP A CG  1 
ATOM   1986 O OD1 . ASP A 1 266 ? 56.679  6.903   11.560  1.00 69.21  ? 266  ASP A OD1 1 
ATOM   1987 O OD2 . ASP A 1 266 ? 55.850  5.005   12.297  1.00 65.67  ? 266  ASP A OD2 1 
ATOM   1988 N N   . THR A 1 267 ? 59.142  7.248   16.036  1.00 69.73  ? 267  THR A N   1 
ATOM   1989 C CA  . THR A 1 267 ? 59.366  7.632   17.426  1.00 69.24  ? 267  THR A CA  1 
ATOM   1990 C C   . THR A 1 267 ? 59.829  9.070   17.537  1.00 69.05  ? 267  THR A C   1 
ATOM   1991 O O   . THR A 1 267 ? 59.329  9.824   18.360  1.00 68.13  ? 267  THR A O   1 
ATOM   1992 C CB  . THR A 1 267 ? 60.441  6.732   18.080  1.00 71.09  ? 267  THR A CB  1 
ATOM   1993 O OG1 . THR A 1 267 ? 60.027  5.370   17.966  1.00 71.08  ? 267  THR A OG1 1 
ATOM   1994 C CG2 . THR A 1 267 ? 60.642  7.080   19.555  1.00 70.53  ? 267  THR A CG2 1 
ATOM   1995 N N   . GLU A 1 268 ? 60.820  9.416   16.727  1.00 70.73  ? 268  GLU A N   1 
ATOM   1996 C CA  . GLU A 1 268 ? 61.374  10.766  16.669  1.00 70.79  ? 268  GLU A CA  1 
ATOM   1997 C C   . GLU A 1 268 ? 60.315  11.782  16.193  1.00 68.13  ? 268  GLU A C   1 
ATOM   1998 O O   . GLU A 1 268 ? 60.226  12.879  16.740  1.00 68.07  ? 268  GLU A O   1 
ATOM   1999 C CB  . GLU A 1 268 ? 62.629  10.766  15.775  1.00 73.43  ? 268  GLU A CB  1 
ATOM   2000 C CG  . GLU A 1 268 ? 63.079  12.150  15.243  1.00 75.45  ? 268  GLU A CG  1 
ATOM   2001 C CD  . GLU A 1 268 ? 64.519  12.153  14.680  1.00 78.65  ? 268  GLU A CD  1 
ATOM   2002 O OE1 . GLU A 1 268 ? 65.444  11.657  15.378  1.00 84.45  ? 268  GLU A OE1 1 
ATOM   2003 O OE2 . GLU A 1 268 ? 64.721  12.664  13.545  1.00 81.57  ? 268  GLU A OE2 1 
ATOM   2004 N N   . LEU A 1 269 ? 59.499  11.405  15.209  1.00 65.50  ? 269  LEU A N   1 
ATOM   2005 C CA  . LEU A 1 269 ? 58.473  12.301  14.666  1.00 63.54  ? 269  LEU A CA  1 
ATOM   2006 C C   . LEU A 1 269 ? 57.399  12.584  15.715  1.00 60.23  ? 269  LEU A C   1 
ATOM   2007 O O   . LEU A 1 269 ? 57.089  13.741  16.004  1.00 59.51  ? 269  LEU A O   1 
ATOM   2008 C CB  . LEU A 1 269 ? 57.845  11.690  13.399  1.00 62.80  ? 269  LEU A CB  1 
ATOM   2009 C CG  . LEU A 1 269 ? 56.784  12.476  12.620  1.00 60.95  ? 269  LEU A CG  1 
ATOM   2010 C CD1 . LEU A 1 269 ? 56.800  12.067  11.169  1.00 61.37  ? 269  LEU A CD1 1 
ATOM   2011 C CD2 . LEU A 1 269 ? 55.387  12.267  13.181  1.00 60.31  ? 269  LEU A CD2 1 
ATOM   2012 N N   . ILE A 1 270 ? 56.871  11.507  16.297  1.00 58.27  ? 270  ILE A N   1 
ATOM   2013 C CA  . ILE A 1 270 ? 55.852  11.576  17.329  1.00 55.70  ? 270  ILE A CA  1 
ATOM   2014 C C   . ILE A 1 270 ? 56.386  12.282  18.569  1.00 56.55  ? 270  ILE A C   1 
ATOM   2015 O O   . ILE A 1 270 ? 55.690  13.082  19.161  1.00 55.36  ? 270  ILE A O   1 
ATOM   2016 C CB  . ILE A 1 270 ? 55.332  10.167  17.705  1.00 55.25  ? 270  ILE A CB  1 
ATOM   2017 C CG1 . ILE A 1 270 ? 54.713  9.478   16.483  1.00 54.49  ? 270  ILE A CG1 1 
ATOM   2018 C CG2 . ILE A 1 270 ? 54.314  10.250  18.832  1.00 52.39  ? 270  ILE A CG2 1 
ATOM   2019 C CD1 . ILE A 1 270 ? 54.728  7.948   16.525  1.00 54.15  ? 270  ILE A CD1 1 
ATOM   2020 N N   . ALA A 1 271 ? 57.631  12.003  18.951  1.00 58.66  ? 271  ALA A N   1 
ATOM   2021 C CA  . ALA A 1 271 ? 58.242  12.681  20.085  1.00 59.95  ? 271  ALA A CA  1 
ATOM   2022 C C   . ALA A 1 271 ? 58.250  14.191  19.876  1.00 60.58  ? 271  ALA A C   1 
ATOM   2023 O O   . ALA A 1 271 ? 57.981  14.955  20.797  1.00 60.60  ? 271  ALA A O   1 
ATOM   2024 C CB  . ALA A 1 271 ? 59.644  12.169  20.330  1.00 61.79  ? 271  ALA A CB  1 
ATOM   2025 N N   . CYS A 1 272 ? 58.561  14.618  18.660  1.00 62.37  ? 272  CYS A N   1 
ATOM   2026 C CA  . CYS A 1 272 ? 58.582  16.037  18.326  1.00 62.34  ? 272  CYS A CA  1 
ATOM   2027 C C   . CYS A 1 272 ? 57.165  16.600  18.311  1.00 59.46  ? 272  CYS A C   1 
ATOM   2028 O O   . CYS A 1 272 ? 56.951  17.722  18.762  1.00 59.04  ? 272  CYS A O   1 
ATOM   2029 C CB  . CYS A 1 272 ? 59.287  16.251  16.986  1.00 64.27  ? 272  CYS A CB  1 
ATOM   2030 S SG  . CYS A 1 272 ? 59.340  17.971  16.369  1.00 67.73  ? 272  CYS A SG  1 
ATOM   2031 N N   . LEU A 1 273 ? 56.184  15.827  17.839  1.00 57.08  ? 273  LEU A N   1 
ATOM   2032 C CA  . LEU A 1 273 ? 54.786  16.292  17.892  1.00 54.70  ? 273  LEU A CA  1 
ATOM   2033 C C   . LEU A 1 273 ? 54.326  16.553  19.342  1.00 54.39  ? 273  LEU A C   1 
ATOM   2034 O O   . LEU A 1 273 ? 53.576  17.493  19.600  1.00 53.37  ? 273  LEU A O   1 
ATOM   2035 C CB  . LEU A 1 273 ? 53.827  15.316  17.199  1.00 53.02  ? 273  LEU A CB  1 
ATOM   2036 C CG  . LEU A 1 273 ? 53.694  15.334  15.672  1.00 52.42  ? 273  LEU A CG  1 
ATOM   2037 C CD1 . LEU A 1 273 ? 52.786  14.184  15.225  1.00 48.60  ? 273  LEU A CD1 1 
ATOM   2038 C CD2 . LEU A 1 273 ? 53.187  16.676  15.093  1.00 49.48  ? 273  LEU A CD2 1 
ATOM   2039 N N   . ARG A 1 274 ? 54.807  15.749  20.290  1.00 55.09  ? 274  ARG A N   1 
ATOM   2040 C CA  . ARG A 1 274 ? 54.415  15.907  21.687  1.00 54.74  ? 274  ARG A CA  1 
ATOM   2041 C C   . ARG A 1 274 ? 55.008  17.154  22.328  1.00 55.91  ? 274  ARG A C   1 
ATOM   2042 O O   . ARG A 1 274 ? 54.554  17.576  23.394  1.00 55.78  ? 274  ARG A O   1 
ATOM   2043 C CB  . ARG A 1 274 ? 54.776  14.659  22.507  1.00 55.05  ? 274  ARG A CB  1 
ATOM   2044 C CG  . ARG A 1 274 ? 53.943  13.439  22.150  1.00 54.44  ? 274  ARG A CG  1 
ATOM   2045 C CD  . ARG A 1 274 ? 54.063  12.307  23.163  1.00 55.23  ? 274  ARG A CD  1 
ATOM   2046 N NE  . ARG A 1 274 ? 55.466  12.025  23.444  1.00 58.97  ? 274  ARG A NE  1 
ATOM   2047 C CZ  . ARG A 1 274 ? 56.185  11.009  22.968  1.00 59.43  ? 274  ARG A CZ  1 
ATOM   2048 N NH1 . ARG A 1 274 ? 55.645  10.081  22.184  1.00 58.62  ? 274  ARG A NH1 1 
ATOM   2049 N NH2 . ARG A 1 274 ? 57.477  10.930  23.293  1.00 60.01  ? 274  ARG A NH2 1 
ATOM   2050 N N   . THR A 1 275 ? 56.010  17.755  21.703  1.00 56.88  ? 275  THR A N   1 
ATOM   2051 C CA  . THR A 1 275 ? 56.571  18.983  22.235  1.00 58.44  ? 275  THR A CA  1 
ATOM   2052 C C   . THR A 1 275 ? 55.793  20.230  21.792  1.00 58.11  ? 275  THR A C   1 
ATOM   2053 O O   . THR A 1 275 ? 56.030  21.306  22.325  1.00 60.14  ? 275  THR A O   1 
ATOM   2054 C CB  . THR A 1 275 ? 58.044  19.173  21.811  1.00 60.28  ? 275  THR A CB  1 
ATOM   2055 O OG1 . THR A 1 275 ? 58.108  19.320  20.384  1.00 60.12  ? 275  THR A OG1 1 
ATOM   2056 C CG2 . THR A 1 275 ? 58.899  18.002  22.258  1.00 60.06  ? 275  THR A CG2 1 
ATOM   2057 N N   . ARG A 1 276 ? 54.902  20.100  20.818  1.00 56.96  ? 276  ARG A N   1 
ATOM   2058 C CA  . ARG A 1 276 ? 54.194  21.247  20.266  1.00 56.86  ? 276  ARG A CA  1 
ATOM   2059 C C   . ARG A 1 276 ? 53.001  21.664  21.125  1.00 55.88  ? 276  ARG A C   1 
ATOM   2060 O O   . ARG A 1 276 ? 52.295  20.805  21.673  1.00 54.03  ? 276  ARG A O   1 
ATOM   2061 C CB  . ARG A 1 276 ? 53.657  20.942  18.855  1.00 56.37  ? 276  ARG A CB  1 
ATOM   2062 C CG  . ARG A 1 276 ? 54.663  20.382  17.844  1.00 59.11  ? 276  ARG A CG  1 
ATOM   2063 C CD  . ARG A 1 276 ? 55.960  21.123  17.847  1.00 65.14  ? 276  ARG A CD  1 
ATOM   2064 N NE  . ARG A 1 276 ? 55.790  22.574  17.818  1.00 67.93  ? 276  ARG A NE  1 
ATOM   2065 C CZ  . ARG A 1 276 ? 56.715  23.448  18.248  1.00 72.74  ? 276  ARG A CZ  1 
ATOM   2066 N NH1 . ARG A 1 276 ? 57.875  23.011  18.759  1.00 74.68  ? 276  ARG A NH1 1 
ATOM   2067 N NH2 . ARG A 1 276 ? 56.479  24.767  18.195  1.00 72.83  ? 276  ARG A NH2 1 
ATOM   2068 N N   . PRO A 1 277 ? 52.753  22.986  21.233  1.00 56.27  ? 277  PRO A N   1 
ATOM   2069 C CA  . PRO A 1 277 ? 51.528  23.477  21.864  1.00 55.40  ? 277  PRO A CA  1 
ATOM   2070 C C   . PRO A 1 277 ? 50.268  22.877  21.252  1.00 53.48  ? 277  PRO A C   1 
ATOM   2071 O O   . PRO A 1 277 ? 50.198  22.731  20.046  1.00 53.25  ? 277  PRO A O   1 
ATOM   2072 C CB  . PRO A 1 277 ? 51.589  24.987  21.608  1.00 56.44  ? 277  PRO A CB  1 
ATOM   2073 C CG  . PRO A 1 277 ? 53.047  25.293  21.521  1.00 58.35  ? 277  PRO A CG  1 
ATOM   2074 C CD  . PRO A 1 277 ? 53.638  24.095  20.820  1.00 58.07  ? 277  PRO A CD  1 
ATOM   2075 N N   . ALA A 1 278 ? 49.287  22.518  22.072  1.00 52.84  ? 278  ALA A N   1 
ATOM   2076 C CA  . ALA A 1 278 ? 48.018  21.980  21.547  1.00 51.29  ? 278  ALA A CA  1 
ATOM   2077 C C   . ALA A 1 278 ? 47.458  22.884  20.456  1.00 51.04  ? 278  ALA A C   1 
ATOM   2078 O O   . ALA A 1 278 ? 47.008  22.413  19.423  1.00 50.58  ? 278  ALA A O   1 
ATOM   2079 C CB  . ALA A 1 278 ? 46.979  21.738  22.675  1.00 49.66  ? 278  ALA A CB  1 
ATOM   2080 N N   . GLN A 1 279 ? 47.528  24.189  20.659  1.00 52.77  ? 279  GLN A N   1 
ATOM   2081 C CA  . GLN A 1 279 ? 46.940  25.111  19.695  1.00 52.87  ? 279  GLN A CA  1 
ATOM   2082 C C   . GLN A 1 279 ? 47.643  25.046  18.331  1.00 53.22  ? 279  GLN A C   1 
ATOM   2083 O O   . GLN A 1 279 ? 46.968  25.040  17.315  1.00 52.41  ? 279  GLN A O   1 
ATOM   2084 C CB  . GLN A 1 279 ? 46.915  26.531  20.253  1.00 54.33  ? 279  GLN A CB  1 
ATOM   2085 C CG  . GLN A 1 279 ? 46.057  27.502  19.472  1.00 54.97  ? 279  GLN A CG  1 
ATOM   2086 C CD  . GLN A 1 279 ? 44.586  27.137  19.452  1.00 53.12  ? 279  GLN A CD  1 
ATOM   2087 O OE1 . GLN A 1 279 ? 43.972  26.904  20.494  1.00 55.08  ? 279  GLN A OE1 1 
ATOM   2088 N NE2 . GLN A 1 279 ? 44.001  27.138  18.264  1.00 54.08  ? 279  GLN A NE2 1 
ATOM   2089 N N   . ASP A 1 280 ? 48.975  24.963  18.300  1.00 54.31  ? 280  ASP A N   1 
ATOM   2090 C CA  . ASP A 1 280 ? 49.707  24.733  17.040  1.00 54.91  ? 280  ASP A CA  1 
ATOM   2091 C C   . ASP A 1 280 ? 49.116  23.564  16.269  1.00 52.18  ? 280  ASP A C   1 
ATOM   2092 O O   . ASP A 1 280 ? 49.042  23.602  15.057  1.00 52.35  ? 280  ASP A O   1 
ATOM   2093 C CB  . ASP A 1 280 ? 51.172  24.352  17.278  1.00 57.00  ? 280  ASP A CB  1 
ATOM   2094 C CG  . ASP A 1 280 ? 52.059  25.525  17.487  1.00 62.79  ? 280  ASP A CG  1 
ATOM   2095 O OD1 . ASP A 1 280 ? 51.534  26.617  17.846  1.00 67.69  ? 280  ASP A OD1 1 
ATOM   2096 O OD2 . ASP A 1 280 ? 53.297  25.333  17.320  1.00 69.78  ? 280  ASP A OD2 1 
ATOM   2097 N N   . LEU A 1 281 ? 48.774  22.490  16.960  1.00 50.47  ? 281  LEU A N   1 
ATOM   2098 C CA  . LEU A 1 281 ? 48.234  21.331  16.253  1.00 48.70  ? 281  LEU A CA  1 
ATOM   2099 C C   . LEU A 1 281 ? 46.902  21.732  15.648  1.00 47.03  ? 281  LEU A C   1 
ATOM   2100 O O   . LEU A 1 281 ? 46.668  21.514  14.458  1.00 47.84  ? 281  LEU A O   1 
ATOM   2101 C CB  . LEU A 1 281 ? 48.137  20.100  17.164  1.00 48.13  ? 281  LEU A CB  1 
ATOM   2102 C CG  . LEU A 1 281 ? 49.490  19.539  17.664  1.00 48.52  ? 281  LEU A CG  1 
ATOM   2103 C CD1 . LEU A 1 281 ? 49.247  18.339  18.515  1.00 48.38  ? 281  LEU A CD1 1 
ATOM   2104 C CD2 . LEU A 1 281 ? 50.440  19.179  16.541  1.00 47.27  ? 281  LEU A CD2 1 
ATOM   2105 N N   . VAL A 1 282 ? 46.061  22.388  16.436  1.00 46.20  ? 282  VAL A N   1 
ATOM   2106 C CA  . VAL A 1 282 ? 44.729  22.802  15.964  1.00 45.46  ? 282  VAL A CA  1 
ATOM   2107 C C   . VAL A 1 282 ? 44.834  23.794  14.815  1.00 47.13  ? 282  VAL A C   1 
ATOM   2108 O O   . VAL A 1 282 ? 44.114  23.683  13.839  1.00 47.54  ? 282  VAL A O   1 
ATOM   2109 C CB  . VAL A 1 282 ? 43.845  23.381  17.115  1.00 44.94  ? 282  VAL A CB  1 
ATOM   2110 C CG1 . VAL A 1 282 ? 42.535  23.946  16.556  1.00 42.81  ? 282  VAL A CG1 1 
ATOM   2111 C CG2 . VAL A 1 282 ? 43.558  22.307  18.175  1.00 41.77  ? 282  VAL A CG2 1 
ATOM   2112 N N   . ASP A 1 283 ? 45.754  24.748  14.922  1.00 49.20  ? 283  ASP A N   1 
ATOM   2113 C CA  . ASP A 1 283 ? 45.955  25.735  13.880  1.00 50.68  ? 283  ASP A CA  1 
ATOM   2114 C C   . ASP A 1 283 ? 46.314  25.161  12.505  1.00 51.52  ? 283  ASP A C   1 
ATOM   2115 O O   . ASP A 1 283 ? 46.176  25.868  11.514  1.00 52.45  ? 283  ASP A O   1 
ATOM   2116 C CB  . ASP A 1 283 ? 47.040  26.731  14.299  1.00 52.17  ? 283  ASP A CB  1 
ATOM   2117 C CG  . ASP A 1 283 ? 46.588  27.670  15.415  1.00 54.08  ? 283  ASP A CG  1 
ATOM   2118 O OD1 . ASP A 1 283 ? 45.393  27.612  15.811  1.00 50.36  ? 283  ASP A OD1 1 
ATOM   2119 O OD2 . ASP A 1 283 ? 47.436  28.491  15.871  1.00 56.09  ? 283  ASP A OD2 1 
ATOM   2120 N N   . HIS A 1 284 ? 46.791  23.916  12.426  1.00 52.01  ? 284  HIS A N   1 
ATOM   2121 C CA  . HIS A 1 284 ? 47.170  23.358  11.132  1.00 52.62  ? 284  HIS A CA  1 
ATOM   2122 C C   . HIS A 1 284 ? 46.379  22.171  10.692  1.00 52.55  ? 284  HIS A C   1 
ATOM   2123 O O   . HIS A 1 284 ? 46.618  21.672  9.591   1.00 52.23  ? 284  HIS A O   1 
ATOM   2124 C CB  . HIS A 1 284 ? 48.651  22.995  11.101  1.00 53.91  ? 284  HIS A CB  1 
ATOM   2125 C CG  . HIS A 1 284 ? 49.550  24.168  11.278  1.00 54.15  ? 284  HIS A CG  1 
ATOM   2126 N ND1 . HIS A 1 284 ? 50.006  24.562  12.515  1.00 55.96  ? 284  HIS A ND1 1 
ATOM   2127 C CD2 . HIS A 1 284 ? 50.053  25.047  10.387  1.00 53.89  ? 284  HIS A CD2 1 
ATOM   2128 C CE1 . HIS A 1 284 ? 50.774  25.629  12.373  1.00 58.20  ? 284  HIS A CE1 1 
ATOM   2129 N NE2 . HIS A 1 284 ? 50.814  25.945  11.092  1.00 57.15  ? 284  HIS A NE2 1 
ATOM   2130 N N   . GLU A 1 285 ? 45.424  21.724  11.503  1.00 53.09  ? 285  GLU A N   1 
ATOM   2131 C CA  . GLU A 1 285 ? 44.766  20.449  11.215  1.00 53.73  ? 285  GLU A CA  1 
ATOM   2132 C C   . GLU A 1 285 ? 43.925  20.471  9.930   1.00 53.33  ? 285  GLU A C   1 
ATOM   2133 O O   . GLU A 1 285 ? 43.762  19.423  9.288   1.00 51.81  ? 285  GLU A O   1 
ATOM   2134 C CB  . GLU A 1 285 ? 43.983  19.923  12.434  1.00 52.65  ? 285  GLU A CB  1 
ATOM   2135 C CG  . GLU A 1 285 ? 42.506  20.184  12.451  1.00 54.26  ? 285  GLU A CG  1 
ATOM   2136 C CD  . GLU A 1 285 ? 41.791  19.461  13.589  1.00 53.30  ? 285  GLU A CD  1 
ATOM   2137 O OE1 . GLU A 1 285 ? 41.860  19.986  14.708  1.00 55.00  ? 285  GLU A OE1 1 
ATOM   2138 O OE2 . GLU A 1 285 ? 41.135  18.388  13.363  1.00 60.15  ? 285  GLU A OE2 1 
ATOM   2139 N N   . TRP A 1 286 ? 43.425  21.647  9.530   1.00 54.19  ? 286  TRP A N   1 
ATOM   2140 C CA  . TRP A 1 286 ? 42.631  21.749  8.292   1.00 54.52  ? 286  TRP A CA  1 
ATOM   2141 C C   . TRP A 1 286 ? 43.478  21.763  7.034   1.00 55.79  ? 286  TRP A C   1 
ATOM   2142 O O   . TRP A 1 286 ? 42.949  21.595  5.945   1.00 56.90  ? 286  TRP A O   1 
ATOM   2143 C CB  . TRP A 1 286 ? 41.629  22.937  8.335   1.00 55.43  ? 286  TRP A CB  1 
ATOM   2144 C CG  . TRP A 1 286 ? 40.706  22.648  9.382   1.00 55.48  ? 286  TRP A CG  1 
ATOM   2145 C CD1 . TRP A 1 286 ? 40.667  23.190  10.638  1.00 56.68  ? 286  TRP A CD1 1 
ATOM   2146 C CD2 . TRP A 1 286 ? 39.785  21.571  9.375   1.00 55.07  ? 286  TRP A CD2 1 
ATOM   2147 N NE1 . TRP A 1 286 ? 39.727  22.528  11.402  1.00 55.62  ? 286  TRP A NE1 1 
ATOM   2148 C CE2 . TRP A 1 286 ? 39.180  21.526  10.646  1.00 55.96  ? 286  TRP A CE2 1 
ATOM   2149 C CE3 . TRP A 1 286 ? 39.412  20.629  8.406   1.00 55.20  ? 286  TRP A CE3 1 
ATOM   2150 C CZ2 . TRP A 1 286 ? 38.204  20.588  10.966  1.00 55.77  ? 286  TRP A CZ2 1 
ATOM   2151 C CZ3 . TRP A 1 286 ? 38.446  19.696  8.719   1.00 54.33  ? 286  TRP A CZ3 1 
ATOM   2152 C CH2 . TRP A 1 286 ? 37.850  19.679  9.989   1.00 55.00  ? 286  TRP A CH2 1 
ATOM   2153 N N   . HIS A 1 287 ? 44.789  21.910  7.176   1.00 56.40  ? 287  HIS A N   1 
ATOM   2154 C CA  . HIS A 1 287 ? 45.682  22.011  6.026   1.00 57.16  ? 287  HIS A CA  1 
ATOM   2155 C C   . HIS A 1 287 ? 46.125  20.652  5.433   1.00 56.33  ? 287  HIS A C   1 
ATOM   2156 O O   . HIS A 1 287 ? 46.989  20.627  4.572   1.00 57.66  ? 287  HIS A O   1 
ATOM   2157 C CB  . HIS A 1 287 ? 46.938  22.798  6.409   1.00 59.07  ? 287  HIS A CB  1 
ATOM   2158 C CG  . HIS A 1 287 ? 46.683  24.215  6.828   1.00 62.79  ? 287  HIS A CG  1 
ATOM   2159 N ND1 . HIS A 1 287 ? 45.717  25.008  6.245   1.00 65.98  ? 287  HIS A ND1 1 
ATOM   2160 C CD2 . HIS A 1 287 ? 47.337  25.012  7.711   1.00 66.31  ? 287  HIS A CD2 1 
ATOM   2161 C CE1 . HIS A 1 287 ? 45.757  26.218  6.781   1.00 67.09  ? 287  HIS A CE1 1 
ATOM   2162 N NE2 . HIS A 1 287 ? 46.735  26.248  7.671   1.00 66.79  ? 287  HIS A NE2 1 
ATOM   2163 N N   . VAL A 1 288 ? 45.551  19.537  5.859   1.00 54.40  ? 288  VAL A N   1 
ATOM   2164 C CA  . VAL A 1 288 ? 46.045  18.227  5.424   1.00 54.16  ? 288  VAL A CA  1 
ATOM   2165 C C   . VAL A 1 288 ? 45.071  17.386  4.591   1.00 53.06  ? 288  VAL A C   1 
ATOM   2166 O O   . VAL A 1 288 ? 45.416  16.294  4.161   1.00 53.32  ? 288  VAL A O   1 
ATOM   2167 C CB  . VAL A 1 288 ? 46.563  17.403  6.633   1.00 53.70  ? 288  VAL A CB  1 
ATOM   2168 C CG1 . VAL A 1 288 ? 47.559  18.235  7.448   1.00 53.98  ? 288  VAL A CG1 1 
ATOM   2169 C CG2 . VAL A 1 288 ? 45.411  16.901  7.507   1.00 50.97  ? 288  VAL A CG2 1 
ATOM   2170 N N   . LEU A 1 289 ? 43.865  17.874  4.358   1.00 52.07  ? 289  LEU A N   1 
ATOM   2171 C CA  . LEU A 1 289 ? 42.909  17.163  3.497   1.00 51.68  ? 289  LEU A CA  1 
ATOM   2172 C C   . LEU A 1 289 ? 43.405  17.173  2.054   1.00 53.06  ? 289  LEU A C   1 
ATOM   2173 O O   . LEU A 1 289 ? 43.987  18.165  1.618   1.00 52.86  ? 289  LEU A O   1 
ATOM   2174 C CB  . LEU A 1 289 ? 41.539  17.818  3.556   1.00 50.12  ? 289  LEU A CB  1 
ATOM   2175 C CG  . LEU A 1 289 ? 40.773  17.594  4.847   1.00 49.04  ? 289  LEU A CG  1 
ATOM   2176 C CD1 . LEU A 1 289 ? 39.546  18.569  4.931   1.00 46.35  ? 289  LEU A CD1 1 
ATOM   2177 C CD2 . LEU A 1 289 ? 40.360  16.176  4.910   1.00 42.58  ? 289  LEU A CD2 1 
ATOM   2178 N N   . PRO A 1 290 ? 43.190  16.063  1.315   1.00 53.59  ? 290  PRO A N   1 
ATOM   2179 C CA  . PRO A 1 290 ? 43.689  15.955  -0.054  1.00 55.32  ? 290  PRO A CA  1 
ATOM   2180 C C   . PRO A 1 290 ? 43.000  16.865  -1.097  1.00 55.84  ? 290  PRO A C   1 
ATOM   2181 O O   . PRO A 1 290 ? 43.604  17.184  -2.114  1.00 57.46  ? 290  PRO A O   1 
ATOM   2182 C CB  . PRO A 1 290 ? 43.477  14.484  -0.384  1.00 55.13  ? 290  PRO A CB  1 
ATOM   2183 C CG  . PRO A 1 290 ? 42.377  14.053  0.502   1.00 53.72  ? 290  PRO A CG  1 
ATOM   2184 C CD  . PRO A 1 290 ? 42.482  14.848  1.734   1.00 53.35  ? 290  PRO A CD  1 
ATOM   2185 N N   . GLN A 1 291 ? 41.767  17.288  -0.847  1.00 55.63  ? 291  GLN A N   1 
ATOM   2186 C CA  . GLN A 1 291 ? 41.033  18.126  -1.797  1.00 55.69  ? 291  GLN A CA  1 
ATOM   2187 C C   . GLN A 1 291 ? 40.419  19.308  -1.099  1.00 55.11  ? 291  GLN A C   1 
ATOM   2188 O O   . GLN A 1 291 ? 40.321  19.334  0.110   1.00 54.37  ? 291  GLN A O   1 
ATOM   2189 C CB  . GLN A 1 291 ? 39.887  17.329  -2.402  1.00 55.81  ? 291  GLN A CB  1 
ATOM   2190 C CG  . GLN A 1 291 ? 40.244  15.923  -2.819  1.00 57.81  ? 291  GLN A CG  1 
ATOM   2191 C CD  . GLN A 1 291 ? 41.228  15.909  -3.961  1.00 62.26  ? 291  GLN A CD  1 
ATOM   2192 O OE1 . GLN A 1 291 ? 41.345  16.888  -4.724  1.00 64.37  ? 291  GLN A OE1 1 
ATOM   2193 N NE2 . GLN A 1 291 ? 41.949  14.794  -4.101  1.00 65.63  ? 291  GLN A NE2 1 
ATOM   2194 N N   . GLU A 1 292 ? 39.974  20.284  -1.872  1.00 55.59  ? 292  GLU A N   1 
ATOM   2195 C CA  . GLU A 1 292 ? 39.036  21.269  -1.369  1.00 55.74  ? 292  GLU A CA  1 
ATOM   2196 C C   . GLU A 1 292 ? 37.726  20.530  -1.223  1.00 53.58  ? 292  GLU A C   1 
ATOM   2197 O O   . GLU A 1 292 ? 37.242  19.951  -2.185  1.00 54.14  ? 292  GLU A O   1 
ATOM   2198 C CB  . GLU A 1 292 ? 38.888  22.419  -2.354  1.00 56.79  ? 292  GLU A CB  1 
ATOM   2199 C CG  . GLU A 1 292 ? 37.895  23.446  -1.902  1.00 58.68  ? 292  GLU A CG  1 
ATOM   2200 C CD  . GLU A 1 292 ? 37.712  24.589  -2.884  1.00 60.98  ? 292  GLU A CD  1 
ATOM   2201 O OE1 . GLU A 1 292 ? 38.390  24.613  -3.949  1.00 66.72  ? 292  GLU A OE1 1 
ATOM   2202 O OE2 . GLU A 1 292 ? 36.874  25.473  -2.576  1.00 66.73  ? 292  GLU A OE2 1 
ATOM   2203 N N   . SER A 1 293 ? 37.157  20.534  -0.024  1.00 52.01  ? 293  SER A N   1 
ATOM   2204 C CA  . SER A 1 293 ? 36.013  19.667  0.275   1.00 50.09  ? 293  SER A CA  1 
ATOM   2205 C C   . SER A 1 293 ? 35.172  20.158  1.423   1.00 48.09  ? 293  SER A C   1 
ATOM   2206 O O   . SER A 1 293 ? 35.608  21.000  2.181   1.00 48.53  ? 293  SER A O   1 
ATOM   2207 C CB  . SER A 1 293 ? 36.528  18.293  0.658   1.00 50.09  ? 293  SER A CB  1 
ATOM   2208 O OG  . SER A 1 293 ? 37.345  18.378  1.814   1.00 51.47  ? 293  SER A OG  1 
ATOM   2209 N N   . ILE A 1 294 ? 33.969  19.594  1.556   1.00 45.47  ? 294  ILE A N   1 
ATOM   2210 C CA  . ILE A 1 294 ? 33.132  19.752  2.730   1.00 42.71  ? 294  ILE A CA  1 
ATOM   2211 C C   . ILE A 1 294 ? 32.661  18.343  3.173   1.00 42.04  ? 294  ILE A C   1 
ATOM   2212 O O   . ILE A 1 294 ? 32.670  17.409  2.348   1.00 40.76  ? 294  ILE A O   1 
ATOM   2213 C CB  . ILE A 1 294 ? 31.877  20.618  2.468   1.00 43.15  ? 294  ILE A CB  1 
ATOM   2214 C CG1 . ILE A 1 294 ? 30.981  19.983  1.380   1.00 44.14  ? 294  ILE A CG1 1 
ATOM   2215 C CG2 . ILE A 1 294 ? 32.256  22.041  2.108   1.00 43.63  ? 294  ILE A CG2 1 
ATOM   2216 C CD1 . ILE A 1 294 ? 29.654  20.665  1.194   1.00 41.83  ? 294  ILE A CD1 1 
ATOM   2217 N N   . PHE A 1 295 ? 32.267  18.234  4.455   1.00 40.23  ? 295  PHE A N   1 
ATOM   2218 C CA  . PHE A 1 295 ? 31.888  16.967  5.109   1.00 39.86  ? 295  PHE A CA  1 
ATOM   2219 C C   . PHE A 1 295 ? 33.081  16.008  5.019   1.00 39.60  ? 295  PHE A C   1 
ATOM   2220 O O   . PHE A 1 295 ? 32.900  14.787  4.877   1.00 39.30  ? 295  PHE A O   1 
ATOM   2221 C CB  . PHE A 1 295 ? 30.643  16.365  4.465   1.00 40.23  ? 295  PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 295 ? 29.680  15.674  5.442   1.00 40.70  ? 295  PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 295 ? 30.113  14.782  6.391   1.00 40.29  ? 295  PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 295 ? 28.313  15.920  5.365   1.00 41.51  ? 295  PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 295 ? 29.221  14.169  7.246   1.00 40.02  ? 295  PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 295 ? 27.421  15.305  6.226   1.00 40.57  ? 295  PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 295 ? 27.883  14.422  7.164   1.00 40.41  ? 295  PHE A CZ  1 
ATOM   2228 N N   . ARG A 1 296 ? 34.287  16.561  5.154   1.00 38.75  ? 296  ARG A N   1 
ATOM   2229 C CA  . ARG A 1 296 ? 35.512  15.756  5.248   1.00 39.93  ? 296  ARG A CA  1 
ATOM   2230 C C   . ARG A 1 296 ? 36.353  16.252  6.404   1.00 40.30  ? 296  ARG A C   1 
ATOM   2231 O O   . ARG A 1 296 ? 36.495  17.464  6.606   1.00 38.79  ? 296  ARG A O   1 
ATOM   2232 C CB  . ARG A 1 296 ? 36.333  15.834  3.972   1.00 40.97  ? 296  ARG A CB  1 
ATOM   2233 C CG  . ARG A 1 296 ? 35.676  15.154  2.798   1.00 43.12  ? 296  ARG A CG  1 
ATOM   2234 C CD  . ARG A 1 296 ? 35.692  13.643  2.887   1.00 44.99  ? 296  ARG A CD  1 
ATOM   2235 N NE  . ARG A 1 296 ? 35.095  13.048  1.690   1.00 46.71  ? 296  ARG A NE  1 
ATOM   2236 C CZ  . ARG A 1 296 ? 33.785  12.906  1.492   1.00 46.07  ? 296  ARG A CZ  1 
ATOM   2237 N NH1 . ARG A 1 296 ? 32.908  13.332  2.397   1.00 44.81  ? 296  ARG A NH1 1 
ATOM   2238 N NH2 . ARG A 1 296 ? 33.347  12.351  0.371   1.00 46.12  ? 296  ARG A NH2 1 
ATOM   2239 N N   . PHE A 1 297 ? 36.938  15.313  7.157   1.00 40.39  ? 297  PHE A N   1 
ATOM   2240 C CA  . PHE A 1 297 ? 37.584  15.673  8.408   1.00 40.05  ? 297  PHE A CA  1 
ATOM   2241 C C   . PHE A 1 297 ? 38.964  15.032  8.451   1.00 41.61  ? 297  PHE A C   1 
ATOM   2242 O O   . PHE A 1 297 ? 39.133  13.871  8.034   1.00 40.51  ? 297  PHE A O   1 
ATOM   2243 C CB  . PHE A 1 297 ? 36.658  15.259  9.562   1.00 39.68  ? 297  PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 297 ? 35.224  15.705  9.354   1.00 37.08  ? 297  PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 297 ? 34.909  17.045  9.369   1.00 39.64  ? 297  PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 297 ? 34.221  14.798  9.087   1.00 37.08  ? 297  PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 297 ? 33.586  17.475  9.145   1.00 36.68  ? 297  PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 297 ? 32.908  15.224  8.862   1.00 37.18  ? 297  PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 297 ? 32.606  16.548  8.898   1.00 36.16  ? 297  PHE A CZ  1 
ATOM   2250 N N   . SER A 1 298 ? 39.949  15.818  8.892   1.00 41.15  ? 298  SER A N   1 
ATOM   2251 C CA  . SER A 1 298 ? 41.350  15.468  8.766   1.00 42.19  ? 298  SER A CA  1 
ATOM   2252 C C   . SER A 1 298 ? 41.773  14.272  9.588   1.00 43.19  ? 298  SER A C   1 
ATOM   2253 O O   . SER A 1 298 ? 42.498  13.394  9.099   1.00 44.43  ? 298  SER A O   1 
ATOM   2254 C CB  . SER A 1 298 ? 42.205  16.668  9.166   1.00 42.87  ? 298  SER A CB  1 
ATOM   2255 O OG  . SER A 1 298 ? 42.033  17.691  8.218   1.00 42.55  ? 298  SER A OG  1 
ATOM   2256 N N   . PHE A 1 299 ? 41.326  14.212  10.839  1.00 43.06  ? 299  PHE A N   1 
ATOM   2257 C CA  . PHE A 1 299 ? 41.749  13.137  11.747  1.00 42.86  ? 299  PHE A CA  1 
ATOM   2258 C C   . PHE A 1 299 ? 40.535  12.383  12.252  1.00 42.03  ? 299  PHE A C   1 
ATOM   2259 O O   . PHE A 1 299 ? 39.765  12.896  13.049  1.00 41.28  ? 299  PHE A O   1 
ATOM   2260 C CB  . PHE A 1 299 ? 42.609  13.716  12.856  1.00 43.16  ? 299  PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 299 ? 43.869  14.319  12.326  1.00 42.56  ? 299  PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 299 ? 44.931  13.510  11.970  1.00 45.51  ? 299  PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 299 ? 43.951  15.651  12.065  1.00 45.81  ? 299  PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 299 ? 46.077  14.033  11.422  1.00 47.62  ? 299  PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 299 ? 45.125  16.190  11.512  1.00 46.22  ? 299  PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 299 ? 46.160  15.378  11.177  1.00 44.44  ? 299  PHE A CZ  1 
ATOM   2267 N N   . VAL A 1 300 ? 40.399  11.144  11.778  1.00 41.60  ? 300  VAL A N   1 
ATOM   2268 C CA  . VAL A 1 300 ? 39.180  10.347  11.984  1.00 40.37  ? 300  VAL A CA  1 
ATOM   2269 C C   . VAL A 1 300 ? 39.642  8.898   12.212  1.00 40.92  ? 300  VAL A C   1 
ATOM   2270 O O   . VAL A 1 300 ? 40.822  8.593   12.047  1.00 42.75  ? 300  VAL A O   1 
ATOM   2271 C CB  . VAL A 1 300 ? 38.241  10.463  10.750  1.00 40.18  ? 300  VAL A CB  1 
ATOM   2272 C CG1 . VAL A 1 300 ? 37.707  11.902  10.552  1.00 38.81  ? 300  VAL A CG1 1 
ATOM   2273 C CG2 . VAL A 1 300 ? 38.945  9.983   9.463   1.00 41.21  ? 300  VAL A CG2 1 
ATOM   2274 N N   . PRO A 1 301 ? 38.746  7.994   12.642  1.00 40.26  ? 301  PRO A N   1 
ATOM   2275 C CA  . PRO A 1 301 ? 39.183  6.602   12.770  1.00 40.56  ? 301  PRO A CA  1 
ATOM   2276 C C   . PRO A 1 301 ? 39.950  6.063   11.578  1.00 42.34  ? 301  PRO A C   1 
ATOM   2277 O O   . PRO A 1 301 ? 39.691  6.424   10.442  1.00 42.50  ? 301  PRO A O   1 
ATOM   2278 C CB  . PRO A 1 301 ? 37.871  5.834   12.969  1.00 39.86  ? 301  PRO A CB  1 
ATOM   2279 C CG  . PRO A 1 301 ? 36.975  6.825   13.656  1.00 40.32  ? 301  PRO A CG  1 
ATOM   2280 C CD  . PRO A 1 301 ? 37.375  8.184   13.119  1.00 37.92  ? 301  PRO A CD  1 
ATOM   2281 N N   . VAL A 1 302 ? 40.896  5.168   11.861  1.00 44.44  ? 302  VAL A N   1 
ATOM   2282 C CA  . VAL A 1 302 ? 41.756  4.595   10.862  1.00 45.67  ? 302  VAL A CA  1 
ATOM   2283 C C   . VAL A 1 302 ? 41.506  3.094   10.859  1.00 47.58  ? 302  VAL A C   1 
ATOM   2284 O O   . VAL A 1 302 ? 41.228  2.491   11.908  1.00 47.92  ? 302  VAL A O   1 
ATOM   2285 C CB  . VAL A 1 302 ? 43.262  4.910   11.123  1.00 45.93  ? 302  VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 302 ? 43.702  4.430   12.510  1.00 44.87  ? 302  VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 302 ? 44.150  4.322   10.019  1.00 46.69  ? 302  VAL A CG2 1 
ATOM   2288 N N   . VAL A 1 303 ? 41.578  2.501   9.671   1.00 48.88  ? 303  VAL A N   1 
ATOM   2289 C CA  . VAL A 1 303 ? 41.423  1.072   9.544   1.00 50.35  ? 303  VAL A CA  1 
ATOM   2290 C C   . VAL A 1 303 ? 42.798  0.504   9.827   1.00 51.89  ? 303  VAL A C   1 
ATOM   2291 O O   . VAL A 1 303 ? 43.653  0.478   8.950   1.00 52.87  ? 303  VAL A O   1 
ATOM   2292 C CB  . VAL A 1 303 ? 40.915  0.673   8.156   1.00 51.05  ? 303  VAL A CB  1 
ATOM   2293 C CG1 . VAL A 1 303 ? 40.795  -0.855  8.069   1.00 51.41  ? 303  VAL A CG1 1 
ATOM   2294 C CG2 . VAL A 1 303 ? 39.594  1.375   7.868   1.00 49.48  ? 303  VAL A CG2 1 
ATOM   2295 N N   . ASP A 1 304 ? 42.990  0.085   11.076  1.00 52.66  ? 304  ASP A N   1 
ATOM   2296 C CA  . ASP A 1 304 ? 44.291  -0.324  11.614  1.00 53.63  ? 304  ASP A CA  1 
ATOM   2297 C C   . ASP A 1 304 ? 44.515  -1.820  11.664  1.00 56.23  ? 304  ASP A C   1 
ATOM   2298 O O   . ASP A 1 304 ? 45.622  -2.263  11.989  1.00 57.10  ? 304  ASP A O   1 
ATOM   2299 C CB  . ASP A 1 304 ? 44.478  0.246   13.036  1.00 53.00  ? 304  ASP A CB  1 
ATOM   2300 C CG  . ASP A 1 304 ? 43.279  -0.042  13.979  1.00 53.31  ? 304  ASP A CG  1 
ATOM   2301 O OD1 . ASP A 1 304 ? 42.251  -0.610  13.520  1.00 52.28  ? 304  ASP A OD1 1 
ATOM   2302 O OD2 . ASP A 1 304 ? 43.372  0.291   15.190  1.00 50.99  ? 304  ASP A OD2 1 
ATOM   2303 N N   . GLY A 1 305 ? 43.493  -2.611  11.373  1.00 56.98  ? 305  GLY A N   1 
ATOM   2304 C CA  . GLY A 1 305 ? 43.594  -4.066  11.581  1.00 59.14  ? 305  GLY A CA  1 
ATOM   2305 C C   . GLY A 1 305 ? 43.681  -4.462  13.057  1.00 59.74  ? 305  GLY A C   1 
ATOM   2306 O O   . GLY A 1 305 ? 44.218  -5.506  13.381  1.00 62.13  ? 305  GLY A O   1 
ATOM   2307 N N   . ASP A 1 306 ? 43.157  -3.606  13.938  1.00 59.04  ? 306  ASP A N   1 
ATOM   2308 C CA  . ASP A 1 306 ? 43.147  -3.789  15.399  1.00 58.55  ? 306  ASP A CA  1 
ATOM   2309 C C   . ASP A 1 306 ? 41.762  -3.332  15.894  1.00 56.84  ? 306  ASP A C   1 
ATOM   2310 O O   . ASP A 1 306 ? 40.827  -4.123  15.897  1.00 57.59  ? 306  ASP A O   1 
ATOM   2311 C CB  . ASP A 1 306 ? 44.289  -2.988  16.045  1.00 58.73  ? 306  ASP A CB  1 
ATOM   2312 C CG  . ASP A 1 306 ? 44.427  -3.227  17.556  1.00 60.46  ? 306  ASP A CG  1 
ATOM   2313 O OD1 . ASP A 1 306 ? 43.807  -4.164  18.116  1.00 64.10  ? 306  ASP A OD1 1 
ATOM   2314 O OD2 . ASP A 1 306 ? 45.195  -2.472  18.193  1.00 63.26  ? 306  ASP A OD2 1 
ATOM   2315 N N   . PHE A 1 307 ? 41.573  -2.074  16.269  1.00 54.76  ? 307  PHE A N   1 
ATOM   2316 C CA  . PHE A 1 307 ? 40.202  -1.663  16.623  1.00 53.21  ? 307  PHE A CA  1 
ATOM   2317 C C   . PHE A 1 307 ? 39.238  -2.050  15.484  1.00 52.51  ? 307  PHE A C   1 
ATOM   2318 O O   . PHE A 1 307 ? 38.197  -2.685  15.695  1.00 51.85  ? 307  PHE A O   1 
ATOM   2319 C CB  . PHE A 1 307 ? 40.123  -0.190  16.934  1.00 52.07  ? 307  PHE A CB  1 
ATOM   2320 C CG  . PHE A 1 307 ? 38.861  0.204   17.623  1.00 52.06  ? 307  PHE A CG  1 
ATOM   2321 C CD1 . PHE A 1 307 ? 37.667  0.252   16.931  1.00 51.11  ? 307  PHE A CD1 1 
ATOM   2322 C CD2 . PHE A 1 307 ? 38.864  0.507   18.978  1.00 53.05  ? 307  PHE A CD2 1 
ATOM   2323 C CE1 . PHE A 1 307 ? 36.491  0.604   17.572  1.00 51.21  ? 307  PHE A CE1 1 
ATOM   2324 C CE2 . PHE A 1 307 ? 37.690  0.865   19.634  1.00 51.94  ? 307  PHE A CE2 1 
ATOM   2325 C CZ  . PHE A 1 307 ? 36.502  0.907   18.933  1.00 51.88  ? 307  PHE A CZ  1 
ATOM   2326 N N   . LEU A 1 308 ? 39.614  -1.686  14.268  1.00 52.04  ? 308  LEU A N   1 
ATOM   2327 C CA  . LEU A 1 308 ? 38.879  -2.100  13.086  1.00 52.04  ? 308  LEU A CA  1 
ATOM   2328 C C   . LEU A 1 308 ? 39.715  -3.128  12.360  1.00 53.34  ? 308  LEU A C   1 
ATOM   2329 O O   . LEU A 1 308 ? 40.752  -2.798  11.793  1.00 52.99  ? 308  LEU A O   1 
ATOM   2330 C CB  . LEU A 1 308 ? 38.639  -0.917  12.184  1.00 50.28  ? 308  LEU A CB  1 
ATOM   2331 C CG  . LEU A 1 308 ? 37.717  0.163   12.781  1.00 49.16  ? 308  LEU A CG  1 
ATOM   2332 C CD1 . LEU A 1 308 ? 37.765  1.348   11.885  1.00 44.31  ? 308  LEU A CD1 1 
ATOM   2333 C CD2 . LEU A 1 308 ? 36.292  -0.406  12.933  1.00 48.10  ? 308  LEU A CD2 1 
ATOM   2334 N N   . SER A 1 309 ? 39.252  -4.368  12.370  1.00 55.16  ? 309  SER A N   1 
ATOM   2335 C CA  . SER A 1 309 ? 40.027  -5.472  11.816  1.00 57.21  ? 309  SER A CA  1 
ATOM   2336 C C   . SER A 1 309 ? 39.990  -5.513  10.286  1.00 57.37  ? 309  SER A C   1 
ATOM   2337 O O   . SER A 1 309 ? 40.767  -6.234  9.650   1.00 58.95  ? 309  SER A O   1 
ATOM   2338 C CB  . SER A 1 309 ? 39.549  -6.804  12.404  1.00 59.15  ? 309  SER A CB  1 
ATOM   2339 O OG  . SER A 1 309 ? 38.294  -7.184  11.878  1.00 61.70  ? 309  SER A OG  1 
ATOM   2340 N N   . ASP A 1 310 ? 39.052  -4.780  9.709   1.00 55.81  ? 310  ASP A N   1 
ATOM   2341 C CA  . ASP A 1 310 ? 38.967  -4.570  8.273   1.00 55.95  ? 310  ASP A CA  1 
ATOM   2342 C C   . ASP A 1 310 ? 38.175  -3.274  8.066   1.00 53.51  ? 310  ASP A C   1 
ATOM   2343 O O   . ASP A 1 310 ? 37.860  -2.587  9.022   1.00 51.62  ? 310  ASP A O   1 
ATOM   2344 C CB  . ASP A 1 310 ? 38.269  -5.733  7.592   1.00 57.39  ? 310  ASP A CB  1 
ATOM   2345 C CG  . ASP A 1 310 ? 38.655  -5.872  6.127   1.00 60.32  ? 310  ASP A CG  1 
ATOM   2346 O OD1 . ASP A 1 310 ? 39.135  -4.887  5.515   1.00 62.23  ? 310  ASP A OD1 1 
ATOM   2347 O OD2 . ASP A 1 310 ? 38.481  -6.976  5.588   1.00 64.84  ? 310  ASP A OD2 1 
ATOM   2348 N N   . THR A 1 311 ? 37.851  -2.937  6.831   1.00 53.60  ? 311  THR A N   1 
ATOM   2349 C CA  . THR A 1 311 ? 37.086  -1.707  6.572   1.00 51.88  ? 311  THR A CA  1 
ATOM   2350 C C   . THR A 1 311 ? 35.664  -1.897  7.082   1.00 51.93  ? 311  THR A C   1 
ATOM   2351 O O   . THR A 1 311 ? 35.160  -3.019  7.097   1.00 51.93  ? 311  THR A O   1 
ATOM   2352 C CB  . THR A 1 311 ? 37.059  -1.396  5.070   1.00 52.46  ? 311  THR A CB  1 
ATOM   2353 O OG1 . THR A 1 311 ? 36.342  -2.427  4.381   1.00 52.22  ? 311  THR A OG1 1 
ATOM   2354 C CG2 . THR A 1 311 ? 38.498  -1.295  4.497   1.00 51.24  ? 311  THR A CG2 1 
ATOM   2355 N N   . PRO A 1 312 ? 35.001  -0.814  7.523   1.00 52.00  ? 312  PRO A N   1 
ATOM   2356 C CA  . PRO A 1 312 ? 33.591  -0.958  7.898   1.00 52.51  ? 312  PRO A CA  1 
ATOM   2357 C C   . PRO A 1 312 ? 32.754  -1.645  6.811   1.00 54.55  ? 312  PRO A C   1 
ATOM   2358 O O   . PRO A 1 312 ? 31.908  -2.456  7.120   1.00 54.72  ? 312  PRO A O   1 
ATOM   2359 C CB  . PRO A 1 312 ? 33.146  0.481   8.110   1.00 51.76  ? 312  PRO A CB  1 
ATOM   2360 C CG  . PRO A 1 312 ? 34.401  1.169   8.506   1.00 50.75  ? 312  PRO A CG  1 
ATOM   2361 C CD  . PRO A 1 312 ? 35.476  0.560   7.724   1.00 50.34  ? 312  PRO A CD  1 
ATOM   2362 N N   . GLU A 1 313 ? 33.018  -1.343  5.547   1.00 56.52  ? 313  GLU A N   1 
ATOM   2363 C CA  . GLU A 1 313 ? 32.264  -1.940  4.451   1.00 58.34  ? 313  GLU A CA  1 
ATOM   2364 C C   . GLU A 1 313 ? 32.403  -3.459  4.461   1.00 59.25  ? 313  GLU A C   1 
ATOM   2365 O O   . GLU A 1 313 ? 31.414  -4.172  4.376   1.00 59.46  ? 313  GLU A O   1 
ATOM   2366 C CB  . GLU A 1 313 ? 32.718  -1.354  3.107   1.00 58.85  ? 313  GLU A CB  1 
ATOM   2367 C CG  . GLU A 1 313 ? 32.119  -2.071  1.867   1.00 61.91  ? 313  GLU A CG  1 
ATOM   2368 C CD  . GLU A 1 313 ? 32.631  -1.494  0.544   1.00 63.86  ? 313  GLU A CD  1 
ATOM   2369 O OE1 . GLU A 1 313 ? 32.631  -0.250  0.409   1.00 68.40  ? 313  GLU A OE1 1 
ATOM   2370 O OE2 . GLU A 1 313 ? 33.030  -2.284  -0.350  1.00 69.71  ? 313  GLU A OE2 1 
ATOM   2371 N N   . ALA A 1 314 ? 33.632  -3.944  4.592   1.00 59.63  ? 314  ALA A N   1 
ATOM   2372 C CA  . ALA A 1 314 ? 33.884  -5.382  4.643   1.00 61.45  ? 314  ALA A CA  1 
ATOM   2373 C C   . ALA A 1 314 ? 33.229  -5.975  5.884   1.00 61.46  ? 314  ALA A C   1 
ATOM   2374 O O   . ALA A 1 314 ? 32.623  -7.037  5.817   1.00 63.30  ? 314  ALA A O   1 
ATOM   2375 C CB  . ALA A 1 314 ? 35.382  -5.677  4.633   1.00 61.85  ? 314  ALA A CB  1 
ATOM   2376 N N   . LEU A 1 315 ? 33.335  -5.280  7.013   1.00 59.95  ? 315  LEU A N   1 
ATOM   2377 C CA  . LEU A 1 315 ? 32.816  -5.803  8.276   1.00 60.04  ? 315  LEU A CA  1 
ATOM   2378 C C   . LEU A 1 315 ? 31.284  -5.873  8.289   1.00 60.93  ? 315  LEU A C   1 
ATOM   2379 O O   . LEU A 1 315 ? 30.733  -6.910  8.678   1.00 62.19  ? 315  LEU A O   1 
ATOM   2380 C CB  . LEU A 1 315 ? 33.368  -5.026  9.474   1.00 58.20  ? 315  LEU A CB  1 
ATOM   2381 C CG  . LEU A 1 315 ? 34.871  -5.193  9.751   1.00 56.75  ? 315  LEU A CG  1 
ATOM   2382 C CD1 . LEU A 1 315 ? 35.270  -4.281  10.879  1.00 51.59  ? 315  LEU A CD1 1 
ATOM   2383 C CD2 . LEU A 1 315 ? 35.256  -6.654  10.066  1.00 54.69  ? 315  LEU A CD2 1 
ATOM   2384 N N   . ILE A 1 316 ? 30.595  -4.833  7.807   1.00 60.24  ? 316  ILE A N   1 
ATOM   2385 C CA  . ILE A 1 316 ? 29.130  -4.907  7.707   1.00 61.94  ? 316  ILE A CA  1 
ATOM   2386 C C   . ILE A 1 316 ? 28.634  -5.947  6.669   1.00 64.55  ? 316  ILE A C   1 
ATOM   2387 O O   . ILE A 1 316 ? 27.524  -6.460  6.817   1.00 65.67  ? 316  ILE A O   1 
ATOM   2388 C CB  . ILE A 1 316 ? 28.412  -3.508  7.512   1.00 60.36  ? 316  ILE A CB  1 
ATOM   2389 C CG1 . ILE A 1 316 ? 28.526  -2.973  6.079   1.00 61.37  ? 316  ILE A CG1 1 
ATOM   2390 C CG2 . ILE A 1 316 ? 28.953  -2.443  8.494   1.00 57.38  ? 316  ILE A CG2 1 
ATOM   2391 C CD1 . ILE A 1 316 ? 27.501  -1.861  5.742   1.00 59.45  ? 316  ILE A CD1 1 
ATOM   2392 N N   . ASN A 1 317 ? 29.437  -6.284  5.651   1.00 66.32  ? 317  ASN A N   1 
ATOM   2393 C CA  . ASN A 1 317 ? 29.011  -7.282  4.637   1.00 68.71  ? 317  ASN A CA  1 
ATOM   2394 C C   . ASN A 1 317 ? 29.178  -8.734  5.079   1.00 71.26  ? 317  ASN A C   1 
ATOM   2395 O O   . ASN A 1 317 ? 28.430  -9.598  4.634   1.00 73.37  ? 317  ASN A O   1 
ATOM   2396 C CB  . ASN A 1 317 ? 29.738  -7.088  3.293   1.00 69.78  ? 317  ASN A CB  1 
ATOM   2397 C CG  . ASN A 1 317 ? 29.379  -5.764  2.602   1.00 69.65  ? 317  ASN A CG  1 
ATOM   2398 O OD1 . ASN A 1 317 ? 28.469  -5.055  3.027   1.00 73.16  ? 317  ASN A OD1 1 
ATOM   2399 N ND2 . ASN A 1 317 ? 30.113  -5.423  1.541   1.00 71.21  ? 317  ASN A ND2 1 
ATOM   2400 N N   . THR A 1 318 ? 30.156  -9.012  5.938   1.00 71.72  ? 318  THR A N   1 
ATOM   2401 C CA  . THR A 1 318 ? 30.442  -10.381 6.366   1.00 73.98  ? 318  THR A CA  1 
ATOM   2402 C C   . THR A 1 318 ? 30.002  -10.687 7.800   1.00 73.87  ? 318  THR A C   1 
ATOM   2403 O O   . THR A 1 318 ? 30.180  -11.806 8.277   1.00 75.56  ? 318  THR A O   1 
ATOM   2404 C CB  . THR A 1 318 ? 31.951  -10.684 6.255   1.00 74.80  ? 318  THR A CB  1 
ATOM   2405 O OG1 . THR A 1 318 ? 32.695  -9.742  7.044   1.00 73.21  ? 318  THR A OG1 1 
ATOM   2406 C CG2 . THR A 1 318 ? 32.406  -10.618 4.801   1.00 76.26  ? 318  THR A CG2 1 
ATOM   2407 N N   . GLY A 1 319 ? 29.434  -9.711  8.492   1.00 72.18  ? 319  GLY A N   1 
ATOM   2408 C CA  . GLY A 1 319 ? 29.121  -9.877  9.911   1.00 72.15  ? 319  GLY A CA  1 
ATOM   2409 C C   . GLY A 1 319 ? 27.845  -10.646 10.219  1.00 73.20  ? 319  GLY A C   1 
ATOM   2410 O O   . GLY A 1 319 ? 26.876  -10.591 9.448   1.00 74.11  ? 319  GLY A O   1 
ATOM   2411 N N   . ASP A 1 320 ? 27.852  -11.354 11.352  1.00 73.32  ? 320  ASP A N   1 
ATOM   2412 C CA  . ASP A 1 320 ? 26.656  -11.978 11.918  1.00 73.89  ? 320  ASP A CA  1 
ATOM   2413 C C   . ASP A 1 320 ? 26.073  -11.050 12.992  1.00 71.68  ? 320  ASP A C   1 
ATOM   2414 O O   . ASP A 1 320 ? 26.664  -10.896 14.068  1.00 70.98  ? 320  ASP A O   1 
ATOM   2415 C CB  . ASP A 1 320 ? 27.009  -13.345 12.531  1.00 76.42  ? 320  ASP A CB  1 
ATOM   2416 C CG  . ASP A 1 320 ? 25.859  -13.957 13.311  1.00 78.36  ? 320  ASP A CG  1 
ATOM   2417 O OD1 . ASP A 1 320 ? 24.932  -13.207 13.669  1.00 77.80  ? 320  ASP A OD1 1 
ATOM   2418 O OD2 . ASP A 1 320 ? 25.881  -15.184 13.575  1.00 81.67  ? 320  ASP A OD2 1 
ATOM   2419 N N   . PHE A 1 321 ? 24.918  -10.441 12.709  1.00 70.13  ? 321  PHE A N   1 
ATOM   2420 C CA  . PHE A 1 321 ? 24.298  -9.493  13.641  1.00 68.03  ? 321  PHE A CA  1 
ATOM   2421 C C   . PHE A 1 321 ? 22.998  -10.005 14.242  1.00 68.48  ? 321  PHE A C   1 
ATOM   2422 O O   . PHE A 1 321 ? 22.157  -9.213  14.640  1.00 67.26  ? 321  PHE A O   1 
ATOM   2423 C CB  . PHE A 1 321 ? 24.058  -8.140  12.948  1.00 66.61  ? 321  PHE A CB  1 
ATOM   2424 C CG  . PHE A 1 321 ? 25.293  -7.560  12.347  1.00 65.24  ? 321  PHE A CG  1 
ATOM   2425 C CD1 . PHE A 1 321 ? 26.305  -7.093  13.159  1.00 64.35  ? 321  PHE A CD1 1 
ATOM   2426 C CD2 . PHE A 1 321 ? 25.465  -7.529  10.975  1.00 65.74  ? 321  PHE A CD2 1 
ATOM   2427 C CE1 . PHE A 1 321 ? 27.465  -6.594  12.621  1.00 64.30  ? 321  PHE A CE1 1 
ATOM   2428 C CE2 . PHE A 1 321 ? 26.621  -7.025  10.425  1.00 65.67  ? 321  PHE A CE2 1 
ATOM   2429 C CZ  . PHE A 1 321 ? 27.626  -6.550  11.250  1.00 64.59  ? 321  PHE A CZ  1 
ATOM   2430 N N   . GLN A 1 322 ? 22.842  -11.327 14.345  1.00 69.78  ? 322  GLN A N   1 
ATOM   2431 C CA  . GLN A 1 322 ? 21.618  -11.907 14.889  1.00 70.74  ? 322  GLN A CA  1 
ATOM   2432 C C   . GLN A 1 322 ? 21.225  -11.323 16.252  1.00 69.03  ? 322  GLN A C   1 
ATOM   2433 O O   . GLN A 1 322 ? 20.045  -11.127 16.529  1.00 69.56  ? 322  GLN A O   1 
ATOM   2434 C CB  . GLN A 1 322 ? 21.747  -13.433 15.002  1.00 72.99  ? 322  GLN A CB  1 
ATOM   2435 C CG  . GLN A 1 322 ? 21.782  -14.147 13.654  1.00 74.84  ? 322  GLN A CG  1 
ATOM   2436 C CD  . GLN A 1 322 ? 21.798  -15.661 13.805  1.00 79.12  ? 322  GLN A CD  1 
ATOM   2437 O OE1 . GLN A 1 322 ? 22.278  -16.385 12.925  1.00 84.51  ? 322  GLN A OE1 1 
ATOM   2438 N NE2 . GLN A 1 322 ? 21.278  -16.151 14.933  1.00 79.67  ? 322  GLN A NE2 1 
ATOM   2439 N N   . ASP A 1 323 ? 22.208  -11.034 17.094  1.00 67.29  ? 323  ASP A N   1 
ATOM   2440 C CA  . ASP A 1 323 ? 21.941  -10.526 18.455  1.00 66.58  ? 323  ASP A CA  1 
ATOM   2441 C C   . ASP A 1 323 ? 21.779  -8.977  18.524  1.00 63.15  ? 323  ASP A C   1 
ATOM   2442 O O   . ASP A 1 323 ? 21.861  -8.376  19.591  1.00 61.72  ? 323  ASP A O   1 
ATOM   2443 C CB  . ASP A 1 323 ? 23.075  -10.978 19.396  1.00 67.38  ? 323  ASP A CB  1 
ATOM   2444 C CG  . ASP A 1 323 ? 24.488  -10.671 18.828  1.00 69.34  ? 323  ASP A CG  1 
ATOM   2445 O OD1 . ASP A 1 323 ? 24.807  -9.474  18.578  1.00 65.52  ? 323  ASP A OD1 1 
ATOM   2446 O OD2 . ASP A 1 323 ? 25.278  -11.641 18.625  1.00 73.56  ? 323  ASP A OD2 1 
ATOM   2447 N N   . LEU A 1 324 ? 21.534  -8.330  17.402  1.00 60.99  ? 324  LEU A N   1 
ATOM   2448 C CA  . LEU A 1 324 ? 21.671  -6.864  17.396  1.00 58.62  ? 324  LEU A CA  1 
ATOM   2449 C C   . LEU A 1 324 ? 20.323  -6.261  17.120  1.00 57.82  ? 324  LEU A C   1 
ATOM   2450 O O   . LEU A 1 324 ? 19.656  -6.610  16.147  1.00 58.63  ? 324  LEU A O   1 
ATOM   2451 C CB  . LEU A 1 324 ? 22.698  -6.434  16.372  1.00 57.62  ? 324  LEU A CB  1 
ATOM   2452 C CG  . LEU A 1 324 ? 23.038  -4.940  16.410  1.00 55.15  ? 324  LEU A CG  1 
ATOM   2453 C CD1 . LEU A 1 324 ? 23.833  -4.542  17.677  1.00 52.08  ? 324  LEU A CD1 1 
ATOM   2454 C CD2 . LEU A 1 324 ? 23.771  -4.612  15.136  1.00 56.10  ? 324  LEU A CD2 1 
ATOM   2455 N N   . GLN A 1 325 ? 19.898  -5.410  18.035  1.00 56.40  ? 325  GLN A N   1 
ATOM   2456 C CA  . GLN A 1 325 ? 18.739  -4.581  17.824  1.00 55.87  ? 325  GLN A CA  1 
ATOM   2457 C C   . GLN A 1 325 ? 19.285  -3.194  17.682  1.00 53.61  ? 325  GLN A C   1 
ATOM   2458 O O   . GLN A 1 325 ? 20.032  -2.763  18.559  1.00 52.96  ? 325  GLN A O   1 
ATOM   2459 C CB  . GLN A 1 325 ? 17.837  -4.666  19.020  1.00 56.06  ? 325  GLN A CB  1 
ATOM   2460 C CG  . GLN A 1 325 ? 17.213  -6.037  19.144  1.00 58.70  ? 325  GLN A CG  1 
ATOM   2461 C CD  . GLN A 1 325 ? 16.996  -6.451  20.551  1.00 59.73  ? 325  GLN A CD  1 
ATOM   2462 O OE1 . GLN A 1 325 ? 16.231  -7.388  20.806  1.00 65.04  ? 325  GLN A OE1 1 
ATOM   2463 N NE2 . GLN A 1 325 ? 17.677  -5.793  21.493  1.00 54.14  ? 325  GLN A NE2 1 
ATOM   2464 N N   . VAL A 1 326 ? 18.932  -2.511  16.586  1.00 53.60  ? 326  VAL A N   1 
ATOM   2465 C CA  . VAL A 1 326 ? 19.479  -1.173  16.253  1.00 51.94  ? 326  VAL A CA  1 
ATOM   2466 C C   . VAL A 1 326 ? 18.372  -0.198  15.798  1.00 52.55  ? 326  VAL A C   1 
ATOM   2467 O O   . VAL A 1 326 ? 17.412  -0.589  15.146  1.00 54.71  ? 326  VAL A O   1 
ATOM   2468 C CB  . VAL A 1 326 ? 20.533  -1.227  15.099  1.00 51.65  ? 326  VAL A CB  1 
ATOM   2469 C CG1 . VAL A 1 326 ? 21.408  0.008   15.108  1.00 47.79  ? 326  VAL A CG1 1 
ATOM   2470 C CG2 . VAL A 1 326 ? 21.450  -2.393  15.229  1.00 51.59  ? 326  VAL A CG2 1 
ATOM   2471 N N   . LEU A 1 327 ? 18.507  1.068   16.152  1.00 52.30  ? 327  LEU A N   1 
ATOM   2472 C CA  . LEU A 1 327 ? 17.604  2.098   15.667  1.00 52.14  ? 327  LEU A CA  1 
ATOM   2473 C C   . LEU A 1 327 ? 18.467  3.070   14.888  1.00 50.82  ? 327  LEU A C   1 
ATOM   2474 O O   . LEU A 1 327 ? 19.466  3.535   15.418  1.00 50.21  ? 327  LEU A O   1 
ATOM   2475 C CB  . LEU A 1 327 ? 16.910  2.772   16.854  1.00 52.39  ? 327  LEU A CB  1 
ATOM   2476 C CG  . LEU A 1 327 ? 15.902  3.916   16.648  1.00 52.57  ? 327  LEU A CG  1 
ATOM   2477 C CD1 . LEU A 1 327 ? 14.914  3.616   15.531  1.00 55.37  ? 327  LEU A CD1 1 
ATOM   2478 C CD2 . LEU A 1 327 ? 15.140  4.150   17.954  1.00 53.58  ? 327  LEU A CD2 1 
ATOM   2479 N N   . VAL A 1 328 ? 18.104  3.364   13.630  1.00 50.77  ? 328  VAL A N   1 
ATOM   2480 C CA  . VAL A 1 328 ? 18.923  4.245   12.756  1.00 49.49  ? 328  VAL A CA  1 
ATOM   2481 C C   . VAL A 1 328 ? 18.038  5.268   12.036  1.00 48.68  ? 328  VAL A C   1 
ATOM   2482 O O   . VAL A 1 328 ? 16.888  5.006   11.808  1.00 49.45  ? 328  VAL A O   1 
ATOM   2483 C CB  . VAL A 1 328 ? 19.724  3.411   11.698  1.00 49.91  ? 328  VAL A CB  1 
ATOM   2484 C CG1 . VAL A 1 328 ? 20.493  2.284   12.378  1.00 50.34  ? 328  VAL A CG1 1 
ATOM   2485 C CG2 . VAL A 1 328 ? 18.783  2.808   10.653  1.00 50.67  ? 328  VAL A CG2 1 
ATOM   2486 N N   . GLY A 1 329 ? 18.561  6.441   11.690  1.00 47.52  ? 329  GLY A N   1 
ATOM   2487 C CA  . GLY A 1 329 ? 17.778  7.371   10.879  1.00 46.73  ? 329  GLY A CA  1 
ATOM   2488 C C   . GLY A 1 329 ? 18.474  8.635   10.501  1.00 45.84  ? 329  GLY A C   1 
ATOM   2489 O O   . GLY A 1 329 ? 19.687  8.763   10.718  1.00 45.59  ? 329  GLY A O   1 
ATOM   2490 N N   . VAL A 1 330 ? 17.689  9.579   9.954   1.00 45.98  ? 330  VAL A N   1 
ATOM   2491 C CA  . VAL A 1 330 ? 18.206  10.757  9.268   1.00 45.54  ? 330  VAL A CA  1 
ATOM   2492 C C   . VAL A 1 330 ? 17.250  11.937  9.427   1.00 45.36  ? 330  VAL A C   1 
ATOM   2493 O O   . VAL A 1 330 ? 16.084  11.754  9.718   1.00 45.52  ? 330  VAL A O   1 
ATOM   2494 C CB  . VAL A 1 330 ? 18.473  10.455  7.730   1.00 46.47  ? 330  VAL A CB  1 
ATOM   2495 C CG1 . VAL A 1 330 ? 19.440  9.279   7.550   1.00 45.80  ? 330  VAL A CG1 1 
ATOM   2496 C CG2 . VAL A 1 330 ? 17.170  10.150  6.963   1.00 46.95  ? 330  VAL A CG2 1 
ATOM   2497 N N   . VAL A 1 331 ? 17.754  13.151  9.235   1.00 45.15  ? 331  VAL A N   1 
ATOM   2498 C CA  . VAL A 1 331 ? 16.884  14.339  9.219   1.00 46.37  ? 331  VAL A CA  1 
ATOM   2499 C C   . VAL A 1 331 ? 16.569  14.660  7.758   1.00 47.90  ? 331  VAL A C   1 
ATOM   2500 O O   . VAL A 1 331 ? 17.166  14.072  6.851   1.00 47.43  ? 331  VAL A O   1 
ATOM   2501 C CB  . VAL A 1 331 ? 17.492  15.530  9.999   1.00 45.32  ? 331  VAL A CB  1 
ATOM   2502 C CG1 . VAL A 1 331 ? 17.756  15.119  11.447  1.00 43.52  ? 331  VAL A CG1 1 
ATOM   2503 C CG2 . VAL A 1 331 ? 18.775  16.030  9.342   1.00 46.12  ? 331  VAL A CG2 1 
ATOM   2504 N N   . LYS A 1 332 ? 15.602  15.544  7.528   1.00 49.11  ? 332  LYS A N   1 
ATOM   2505 C CA  . LYS A 1 332 ? 15.102  15.795  6.192   1.00 51.08  ? 332  LYS A CA  1 
ATOM   2506 C C   . LYS A 1 332 ? 16.154  16.429  5.294   1.00 50.84  ? 332  LYS A C   1 
ATOM   2507 O O   . LYS A 1 332 ? 16.180  16.144  4.096   1.00 51.96  ? 332  LYS A O   1 
ATOM   2508 C CB  . LYS A 1 332 ? 13.853  16.689  6.246   1.00 52.49  ? 332  LYS A CB  1 
ATOM   2509 C CG  . LYS A 1 332 ? 13.099  16.840  4.922   1.00 53.89  ? 332  LYS A CG  1 
ATOM   2510 C CD  . LYS A 1 332 ? 11.696  17.409  5.164   1.00 56.25  ? 332  LYS A CD  1 
ATOM   2511 C CE  . LYS A 1 332 ? 10.950  17.751  3.865   1.00 60.28  ? 332  LYS A CE  1 
ATOM   2512 N NZ  . LYS A 1 332 ? 11.440  19.021  3.161   1.00 62.28  ? 332  LYS A NZ  1 
ATOM   2513 N N   . ASP A 1 333 ? 17.021  17.275  5.863   1.00 49.93  ? 333  ASP A N   1 
ATOM   2514 C CA  . ASP A 1 333 ? 17.983  18.035  5.076   1.00 49.44  ? 333  ASP A CA  1 
ATOM   2515 C C   . ASP A 1 333 ? 19.423  17.909  5.613   1.00 48.53  ? 333  ASP A C   1 
ATOM   2516 O O   . ASP A 1 333 ? 20.041  18.867  6.054   1.00 47.96  ? 333  ASP A O   1 
ATOM   2517 C CB  . ASP A 1 333 ? 17.505  19.495  4.943   1.00 49.88  ? 333  ASP A CB  1 
ATOM   2518 C CG  . ASP A 1 333 ? 16.082  19.590  4.379   1.00 50.99  ? 333  ASP A CG  1 
ATOM   2519 O OD1 . ASP A 1 333 ? 15.114  19.501  5.162   1.00 50.87  ? 333  ASP A OD1 1 
ATOM   2520 O OD2 . ASP A 1 333 ? 15.922  19.715  3.144   1.00 51.30  ? 333  ASP A OD2 1 
ATOM   2521 N N   . GLU A 1 334 ? 19.967  16.704  5.513   1.00 48.77  ? 334  GLU A N   1 
ATOM   2522 C CA  . GLU A 1 334 ? 21.285  16.406  6.064   1.00 48.41  ? 334  GLU A CA  1 
ATOM   2523 C C   . GLU A 1 334 ? 22.409  17.317  5.544   1.00 48.77  ? 334  GLU A C   1 
ATOM   2524 O O   . GLU A 1 334 ? 23.320  17.660  6.299   1.00 48.73  ? 334  GLU A O   1 
ATOM   2525 C CB  . GLU A 1 334 ? 21.638  14.954  5.790   1.00 48.46  ? 334  GLU A CB  1 
ATOM   2526 C CG  . GLU A 1 334 ? 20.792  13.954  6.565   1.00 48.98  ? 334  GLU A CG  1 
ATOM   2527 C CD  . GLU A 1 334 ? 21.201  13.836  8.030   1.00 48.78  ? 334  GLU A CD  1 
ATOM   2528 O OE1 . GLU A 1 334 ? 22.195  14.479  8.440   1.00 48.40  ? 334  GLU A OE1 1 
ATOM   2529 O OE2 . GLU A 1 334 ? 20.528  13.102  8.777   1.00 46.80  ? 334  GLU A OE2 1 
ATOM   2530 N N   . GLY A 1 335 ? 22.337  17.708  4.270   1.00 49.37  ? 335  GLY A N   1 
ATOM   2531 C CA  . GLY A 1 335 ? 23.424  18.434  3.617   1.00 49.52  ? 335  GLY A CA  1 
ATOM   2532 C C   . GLY A 1 335 ? 23.446  19.944  3.749   1.00 50.16  ? 335  GLY A C   1 
ATOM   2533 O O   . GLY A 1 335 ? 24.506  20.547  3.606   1.00 50.19  ? 335  GLY A O   1 
ATOM   2534 N N   . SER A 1 336 ? 22.305  20.573  4.012   1.00 51.20  ? 336  SER A N   1 
ATOM   2535 C CA  . SER A 1 336 ? 22.201  22.046  3.880   1.00 53.05  ? 336  SER A CA  1 
ATOM   2536 C C   . SER A 1 336 ? 23.237  22.808  4.691   1.00 53.16  ? 336  SER A C   1 
ATOM   2537 O O   . SER A 1 336 ? 23.829  23.752  4.209   1.00 53.64  ? 336  SER A O   1 
ATOM   2538 C CB  . SER A 1 336 ? 20.796  22.546  4.254   1.00 53.62  ? 336  SER A CB  1 
ATOM   2539 O OG  . SER A 1 336 ? 20.463  22.159  5.573   1.00 54.51  ? 336  SER A OG  1 
ATOM   2540 N N   . TYR A 1 337 ? 23.443  22.367  5.924   1.00 54.18  ? 337  TYR A N   1 
ATOM   2541 C CA  . TYR A 1 337 ? 24.351  22.995  6.900   1.00 55.24  ? 337  TYR A CA  1 
ATOM   2542 C C   . TYR A 1 337 ? 25.755  23.196  6.341   1.00 53.92  ? 337  TYR A C   1 
ATOM   2543 O O   . TYR A 1 337 ? 26.380  24.256  6.518   1.00 53.13  ? 337  TYR A O   1 
ATOM   2544 C CB  . TYR A 1 337 ? 24.420  22.078  8.143   1.00 57.28  ? 337  TYR A CB  1 
ATOM   2545 C CG  . TYR A 1 337 ? 24.926  22.707  9.406   1.00 59.94  ? 337  TYR A CG  1 
ATOM   2546 C CD1 . TYR A 1 337 ? 24.113  22.806  10.536  1.00 63.98  ? 337  TYR A CD1 1 
ATOM   2547 C CD2 . TYR A 1 337 ? 26.219  23.182  9.491   1.00 63.73  ? 337  TYR A CD2 1 
ATOM   2548 C CE1 . TYR A 1 337 ? 24.588  23.382  11.720  1.00 64.26  ? 337  TYR A CE1 1 
ATOM   2549 C CE2 . TYR A 1 337 ? 26.695  23.769  10.641  1.00 64.77  ? 337  TYR A CE2 1 
ATOM   2550 C CZ  . TYR A 1 337 ? 25.887  23.864  11.758  1.00 64.50  ? 337  TYR A CZ  1 
ATOM   2551 O OH  . TYR A 1 337 ? 26.420  24.444  12.901  1.00 64.92  ? 337  TYR A OH  1 
ATOM   2552 N N   . PHE A 1 338 ? 26.233  22.157  5.663   1.00 52.16  ? 338  PHE A N   1 
ATOM   2553 C CA  . PHE A 1 338 ? 27.614  22.078  5.224   1.00 51.60  ? 338  PHE A CA  1 
ATOM   2554 C C   . PHE A 1 338 ? 27.957  22.948  4.031   1.00 52.09  ? 338  PHE A C   1 
ATOM   2555 O O   . PHE A 1 338 ? 29.146  23.243  3.794   1.00 52.32  ? 338  PHE A O   1 
ATOM   2556 C CB  . PHE A 1 338 ? 27.968  20.612  4.927   1.00 50.84  ? 338  PHE A CB  1 
ATOM   2557 C CG  . PHE A 1 338 ? 27.899  19.745  6.139   1.00 50.16  ? 338  PHE A CG  1 
ATOM   2558 C CD1 . PHE A 1 338 ? 26.726  19.137  6.496   1.00 50.50  ? 338  PHE A CD1 1 
ATOM   2559 C CD2 . PHE A 1 338 ? 29.012  19.561  6.944   1.00 50.60  ? 338  PHE A CD2 1 
ATOM   2560 C CE1 . PHE A 1 338 ? 26.650  18.356  7.627   1.00 50.15  ? 338  PHE A CE1 1 
ATOM   2561 C CE2 . PHE A 1 338 ? 28.947  18.766  8.076   1.00 49.66  ? 338  PHE A CE2 1 
ATOM   2562 C CZ  . PHE A 1 338 ? 27.765  18.174  8.419   1.00 50.00  ? 338  PHE A CZ  1 
ATOM   2563 N N   . LEU A 1 339 ? 26.931  23.365  3.296   1.00 51.95  ? 339  LEU A N   1 
ATOM   2564 C CA  . LEU A 1 339 ? 27.127  24.132  2.083   1.00 52.57  ? 339  LEU A CA  1 
ATOM   2565 C C   . LEU A 1 339 ? 27.675  25.535  2.347   1.00 53.87  ? 339  LEU A C   1 
ATOM   2566 O O   . LEU A 1 339 ? 28.382  26.094  1.514   1.00 54.17  ? 339  LEU A O   1 
ATOM   2567 C CB  . LEU A 1 339 ? 25.809  24.202  1.304   1.00 52.68  ? 339  LEU A CB  1 
ATOM   2568 C CG  . LEU A 1 339 ? 25.188  22.861  0.884   1.00 51.09  ? 339  LEU A CG  1 
ATOM   2569 C CD1 . LEU A 1 339 ? 23.883  23.063  0.126   1.00 49.46  ? 339  LEU A CD1 1 
ATOM   2570 C CD2 . LEU A 1 339 ? 26.170  22.043  0.057   1.00 49.83  ? 339  LEU A CD2 1 
ATOM   2571 N N   . VAL A 1 340 ? 27.359  26.101  3.505   1.00 54.63  ? 340  VAL A N   1 
ATOM   2572 C CA  . VAL A 1 340 ? 27.811  27.453  3.860   1.00 56.30  ? 340  VAL A CA  1 
ATOM   2573 C C   . VAL A 1 340 ? 29.262  27.471  4.369   1.00 56.54  ? 340  VAL A C   1 
ATOM   2574 O O   . VAL A 1 340 ? 29.842  28.524  4.548   1.00 57.38  ? 340  VAL A O   1 
ATOM   2575 C CB  . VAL A 1 340 ? 26.841  28.109  4.874   1.00 56.27  ? 340  VAL A CB  1 
ATOM   2576 C CG1 . VAL A 1 340 ? 25.424  28.104  4.295   1.00 56.21  ? 340  VAL A CG1 1 
ATOM   2577 C CG2 . VAL A 1 340 ? 26.846  27.375  6.221   1.00 54.96  ? 340  VAL A CG2 1 
ATOM   2578 N N   . TYR A 1 341 ? 29.850  26.298  4.568   1.00 56.90  ? 341  TYR A N   1 
ATOM   2579 C CA  . TYR A 1 341 ? 31.253  26.178  4.996   1.00 57.62  ? 341  TYR A CA  1 
ATOM   2580 C C   . TYR A 1 341 ? 32.196  25.796  3.842   1.00 58.54  ? 341  TYR A C   1 
ATOM   2581 O O   . TYR A 1 341 ? 33.200  25.094  4.054   1.00 58.92  ? 341  TYR A O   1 
ATOM   2582 C CB  . TYR A 1 341 ? 31.380  25.126  6.116   1.00 57.45  ? 341  TYR A CB  1 
ATOM   2583 C CG  . TYR A 1 341 ? 30.835  25.593  7.449   1.00 58.64  ? 341  TYR A CG  1 
ATOM   2584 C CD1 . TYR A 1 341 ? 29.514  25.315  7.831   1.00 58.12  ? 341  TYR A CD1 1 
ATOM   2585 C CD2 . TYR A 1 341 ? 31.632  26.332  8.320   1.00 59.73  ? 341  TYR A CD2 1 
ATOM   2586 C CE1 . TYR A 1 341 ? 29.012  25.763  9.052   1.00 57.77  ? 341  TYR A CE1 1 
ATOM   2587 C CE2 . TYR A 1 341 ? 31.140  26.782  9.532   1.00 60.02  ? 341  TYR A CE2 1 
ATOM   2588 C CZ  . TYR A 1 341 ? 29.830  26.499  9.900   1.00 59.02  ? 341  TYR A CZ  1 
ATOM   2589 O OH  . TYR A 1 341 ? 29.361  26.941  11.124  1.00 59.00  ? 341  TYR A OH  1 
ATOM   2590 N N   . GLY A 1 342 ? 31.911  26.248  2.624   1.00 59.06  ? 342  GLY A N   1 
ATOM   2591 C CA  . GLY A 1 342 ? 32.796  25.888  1.518   1.00 59.05  ? 342  GLY A CA  1 
ATOM   2592 C C   . GLY A 1 342 ? 32.313  25.975  0.086   1.00 58.61  ? 342  GLY A C   1 
ATOM   2593 O O   . GLY A 1 342 ? 33.141  26.100  -0.809  1.00 59.58  ? 342  GLY A O   1 
ATOM   2594 N N   . VAL A 1 343 ? 31.007  25.870  -0.161  1.00 57.23  ? 343  VAL A N   1 
ATOM   2595 C CA  . VAL A 1 343 ? 30.528  25.926  -1.542  1.00 56.53  ? 343  VAL A CA  1 
ATOM   2596 C C   . VAL A 1 343 ? 30.292  27.378  -1.954  1.00 57.07  ? 343  VAL A C   1 
ATOM   2597 O O   . VAL A 1 343 ? 29.457  28.070  -1.369  1.00 57.46  ? 343  VAL A O   1 
ATOM   2598 C CB  . VAL A 1 343 ? 29.290  25.032  -1.757  1.00 55.95  ? 343  VAL A CB  1 
ATOM   2599 C CG1 . VAL A 1 343 ? 28.901  25.000  -3.225  1.00 55.62  ? 343  VAL A CG1 1 
ATOM   2600 C CG2 . VAL A 1 343 ? 29.590  23.633  -1.273  1.00 53.32  ? 343  VAL A CG2 1 
ATOM   2601 N N   . PRO A 1 344 ? 31.044  27.871  -2.955  1.00 57.35  ? 344  PRO A N   1 
ATOM   2602 C CA  . PRO A 1 344 ? 30.720  29.230  -3.374  1.00 57.72  ? 344  PRO A CA  1 
ATOM   2603 C C   . PRO A 1 344 ? 29.256  29.350  -3.840  1.00 57.86  ? 344  PRO A C   1 
ATOM   2604 O O   . PRO A 1 344 ? 28.720  28.423  -4.494  1.00 57.08  ? 344  PRO A O   1 
ATOM   2605 C CB  . PRO A 1 344 ? 31.696  29.485  -4.531  1.00 58.79  ? 344  PRO A CB  1 
ATOM   2606 C CG  . PRO A 1 344 ? 32.811  28.549  -4.307  1.00 58.06  ? 344  PRO A CG  1 
ATOM   2607 C CD  . PRO A 1 344 ? 32.152  27.317  -3.751  1.00 57.34  ? 344  PRO A CD  1 
ATOM   2608 N N   . GLY A 1 345 ? 28.635  30.475  -3.473  1.00 57.63  ? 345  GLY A N   1 
ATOM   2609 C CA  . GLY A 1 345 ? 27.239  30.745  -3.737  1.00 58.01  ? 345  GLY A CA  1 
ATOM   2610 C C   . GLY A 1 345 ? 26.327  30.652  -2.526  1.00 57.00  ? 345  GLY A C   1 
ATOM   2611 O O   . GLY A 1 345 ? 25.230  31.203  -2.535  1.00 56.95  ? 345  GLY A O   1 
ATOM   2612 N N   . PHE A 1 346 ? 26.779  29.948  -1.491  1.00 56.06  ? 346  PHE A N   1 
ATOM   2613 C CA  . PHE A 1 346 ? 25.957  29.641  -0.324  1.00 55.20  ? 346  PHE A CA  1 
ATOM   2614 C C   . PHE A 1 346 ? 26.265  30.538  0.892   1.00 56.53  ? 346  PHE A C   1 
ATOM   2615 O O   . PHE A 1 346 ? 27.407  30.924  1.139   1.00 57.18  ? 346  PHE A O   1 
ATOM   2616 C CB  . PHE A 1 346 ? 26.099  28.171  0.016   1.00 53.80  ? 346  PHE A CB  1 
ATOM   2617 C CG  . PHE A 1 346 ? 25.464  27.259  -1.008  1.00 51.57  ? 346  PHE A CG  1 
ATOM   2618 C CD1 . PHE A 1 346 ? 26.171  26.842  -2.106  1.00 50.50  ? 346  PHE A CD1 1 
ATOM   2619 C CD2 . PHE A 1 346 ? 24.145  26.840  -0.863  1.00 51.68  ? 346  PHE A CD2 1 
ATOM   2620 C CE1 . PHE A 1 346 ? 25.586  26.019  -3.060  1.00 50.79  ? 346  PHE A CE1 1 
ATOM   2621 C CE2 . PHE A 1 346 ? 23.552  26.029  -1.797  1.00 51.77  ? 346  PHE A CE2 1 
ATOM   2622 C CZ  . PHE A 1 346 ? 24.279  25.609  -2.906  1.00 52.50  ? 346  PHE A CZ  1 
ATOM   2623 N N   . SER A 1 347 ? 25.214  30.917  1.607   1.00 57.14  ? 347  SER A N   1 
ATOM   2624 C CA  . SER A 1 347 ? 25.325  31.784  2.768   1.00 57.51  ? 347  SER A CA  1 
ATOM   2625 C C   . SER A 1 347 ? 24.080  31.613  3.592   1.00 57.53  ? 347  SER A C   1 
ATOM   2626 O O   . SER A 1 347 ? 23.010  31.413  3.033   1.00 58.93  ? 347  SER A O   1 
ATOM   2627 C CB  . SER A 1 347 ? 25.427  33.240  2.349   1.00 58.87  ? 347  SER A CB  1 
ATOM   2628 O OG  . SER A 1 347 ? 25.495  34.075  3.489   1.00 58.95  ? 347  SER A OG  1 
ATOM   2629 N N   . LYS A 1 348 ? 24.214  31.718  4.912   1.00 57.30  ? 348  LYS A N   1 
ATOM   2630 C CA  . LYS A 1 348 ? 23.076  31.642  5.817   1.00 57.18  ? 348  LYS A CA  1 
ATOM   2631 C C   . LYS A 1 348 ? 22.231  32.912  5.751   1.00 58.23  ? 348  LYS A C   1 
ATOM   2632 O O   . LYS A 1 348 ? 21.107  32.915  6.230   1.00 58.77  ? 348  LYS A O   1 
ATOM   2633 C CB  . LYS A 1 348 ? 23.541  31.444  7.257   1.00 56.57  ? 348  LYS A CB  1 
ATOM   2634 C CG  . LYS A 1 348 ? 23.803  32.754  8.004   1.00 58.52  ? 348  LYS A CG  1 
ATOM   2635 C CD  . LYS A 1 348 ? 24.334  32.519  9.398   1.00 57.54  ? 348  LYS A CD  1 
ATOM   2636 C CE  . LYS A 1 348 ? 24.360  33.831  10.163  1.00 59.04  ? 348  LYS A CE  1 
ATOM   2637 N NZ  . LYS A 1 348 ? 23.018  34.465  10.206  1.00 59.91  ? 348  LYS A NZ  1 
ATOM   2638 N N   . ASP A 1 349 ? 22.792  33.986  5.199   1.00 59.31  ? 349  ASP A N   1 
ATOM   2639 C CA  . ASP A 1 349 ? 22.177  35.321  5.234   1.00 61.10  ? 349  ASP A CA  1 
ATOM   2640 C C   . ASP A 1 349 ? 21.492  35.740  3.936   1.00 62.08  ? 349  ASP A C   1 
ATOM   2641 O O   . ASP A 1 349 ? 21.015  36.878  3.827   1.00 63.70  ? 349  ASP A O   1 
ATOM   2642 C CB  . ASP A 1 349 ? 23.234  36.367  5.613   1.00 62.08  ? 349  ASP A CB  1 
ATOM   2643 C CG  . ASP A 1 349 ? 23.739  36.197  7.034   1.00 62.61  ? 349  ASP A CG  1 
ATOM   2644 O OD1 . ASP A 1 349 ? 22.908  35.905  7.927   1.00 63.21  ? 349  ASP A OD1 1 
ATOM   2645 O OD2 . ASP A 1 349 ? 24.966  36.341  7.262   1.00 63.87  ? 349  ASP A OD2 1 
ATOM   2646 N N   . ASN A 1 350 ? 21.443  34.841  2.956   1.00 60.98  ? 350  ASN A N   1 
ATOM   2647 C CA  . ASN A 1 350 ? 20.572  35.007  1.796   1.00 61.92  ? 350  ASN A CA  1 
ATOM   2648 C C   . ASN A 1 350 ? 20.018  33.650  1.375   1.00 60.07  ? 350  ASN A C   1 
ATOM   2649 O O   . ASN A 1 350 ? 20.298  32.647  2.019   1.00 58.02  ? 350  ASN A O   1 
ATOM   2650 C CB  . ASN A 1 350 ? 21.274  35.762  0.647   1.00 63.44  ? 350  ASN A CB  1 
ATOM   2651 C CG  . ASN A 1 350 ? 22.426  34.981  -0.006  1.00 65.80  ? 350  ASN A CG  1 
ATOM   2652 O OD1 . ASN A 1 350 ? 22.384  33.762  -0.144  1.00 65.11  ? 350  ASN A OD1 1 
ATOM   2653 N ND2 . ASN A 1 350 ? 23.444  35.720  -0.455  1.00 74.88  ? 350  ASN A ND2 1 
ATOM   2654 N N   . GLU A 1 351 ? 19.243  33.634  0.296   1.00 60.14  ? 351  GLU A N   1 
ATOM   2655 C CA  . GLU A 1 351 ? 18.517  32.448  -0.145  1.00 59.66  ? 351  GLU A CA  1 
ATOM   2656 C C   . GLU A 1 351 ? 19.366  31.426  -0.889  1.00 57.71  ? 351  GLU A C   1 
ATOM   2657 O O   . GLU A 1 351 ? 18.916  30.315  -1.149  1.00 56.30  ? 351  GLU A O   1 
ATOM   2658 C CB  . GLU A 1 351 ? 17.331  32.859  -1.009  1.00 61.90  ? 351  GLU A CB  1 
ATOM   2659 C CG  . GLU A 1 351 ? 16.316  33.709  -0.270  1.00 65.97  ? 351  GLU A CG  1 
ATOM   2660 C CD  . GLU A 1 351 ? 15.942  33.082  1.055   1.00 70.41  ? 351  GLU A CD  1 
ATOM   2661 O OE1 . GLU A 1 351 ? 15.535  31.894  1.049   1.00 72.72  ? 351  GLU A OE1 1 
ATOM   2662 O OE2 . GLU A 1 351 ? 16.085  33.761  2.105   1.00 75.23  ? 351  GLU A OE2 1 
ATOM   2663 N N   . SER A 1 352 ? 20.597  31.797  -1.226  1.00 56.87  ? 352  SER A N   1 
ATOM   2664 C CA  . SER A 1 352 ? 21.552  30.854  -1.789  1.00 55.20  ? 352  SER A CA  1 
ATOM   2665 C C   . SER A 1 352 ? 21.075  30.256  -3.113  1.00 54.89  ? 352  SER A C   1 
ATOM   2666 O O   . SER A 1 352 ? 21.332  29.101  -3.415  1.00 53.62  ? 352  SER A O   1 
ATOM   2667 C CB  . SER A 1 352 ? 21.874  29.776  -0.759  1.00 53.72  ? 352  SER A CB  1 
ATOM   2668 O OG  . SER A 1 352 ? 22.587  30.361  0.317   1.00 55.09  ? 352  SER A OG  1 
ATOM   2669 N N   . LEU A 1 353 ? 20.376  31.076  -3.897  1.00 55.62  ? 353  LEU A N   1 
ATOM   2670 C CA  . LEU A 1 353 ? 19.944  30.711  -5.230  1.00 55.62  ? 353  LEU A CA  1 
ATOM   2671 C C   . LEU A 1 353 ? 21.176  30.670  -6.143  1.00 55.53  ? 353  LEU A C   1 
ATOM   2672 O O   . LEU A 1 353 ? 21.704  31.692  -6.511  1.00 57.28  ? 353  LEU A O   1 
ATOM   2673 C CB  . LEU A 1 353 ? 18.927  31.740  -5.718  1.00 57.36  ? 353  LEU A CB  1 
ATOM   2674 C CG  . LEU A 1 353 ? 17.604  31.802  -4.939  1.00 56.06  ? 353  LEU A CG  1 
ATOM   2675 C CD1 . LEU A 1 353 ? 16.637  32.563  -5.743  1.00 57.03  ? 353  LEU A CD1 1 
ATOM   2676 C CD2 . LEU A 1 353 ? 17.051  30.443  -4.641  1.00 52.83  ? 353  LEU A CD2 1 
ATOM   2677 N N   . ILE A 1 354 ? 21.667  29.478  -6.464  1.00 53.79  ? 354  ILE A N   1 
ATOM   2678 C CA  . ILE A 1 354 ? 22.896  29.347  -7.240  1.00 52.73  ? 354  ILE A CA  1 
ATOM   2679 C C   . ILE A 1 354 ? 22.663  29.090  -8.736  1.00 53.82  ? 354  ILE A C   1 
ATOM   2680 O O   . ILE A 1 354 ? 21.564  28.770  -9.166  1.00 54.94  ? 354  ILE A O   1 
ATOM   2681 C CB  . ILE A 1 354 ? 23.809  28.253  -6.656  1.00 51.32  ? 354  ILE A CB  1 
ATOM   2682 C CG1 . ILE A 1 354 ? 23.069  26.916  -6.548  1.00 48.75  ? 354  ILE A CG1 1 
ATOM   2683 C CG2 . ILE A 1 354 ? 24.343  28.720  -5.306  1.00 50.26  ? 354  ILE A CG2 1 
ATOM   2684 C CD1 . ILE A 1 354 ? 23.985  25.698  -6.576  1.00 48.71  ? 354  ILE A CD1 1 
ATOM   2685 N N   . SER A 1 355 ? 23.733  29.225  -9.508  1.00 53.74  ? 355  SER A N   1 
ATOM   2686 C CA  . SER A 1 355 ? 23.732  28.963  -10.923 1.00 54.05  ? 355  SER A CA  1 
ATOM   2687 C C   . SER A 1 355 ? 24.105  27.525  -11.198 1.00 53.48  ? 355  SER A C   1 
ATOM   2688 O O   . SER A 1 355 ? 24.525  26.787  -10.314 1.00 50.81  ? 355  SER A O   1 
ATOM   2689 C CB  . SER A 1 355 ? 24.737  29.887  -11.620 1.00 55.46  ? 355  SER A CB  1 
ATOM   2690 O OG  . SER A 1 355 ? 26.076  29.509  -11.342 1.00 52.27  ? 355  SER A OG  1 
ATOM   2691 N N   . ARG A 1 356 ? 23.970  27.132  -12.453 1.00 55.07  ? 356  ARG A N   1 
ATOM   2692 C CA  . ARG A 1 356 ? 24.321  25.787  -12.835 1.00 55.27  ? 356  ARG A CA  1 
ATOM   2693 C C   . ARG A 1 356 ? 25.827  25.568  -12.760 1.00 54.33  ? 356  ARG A C   1 
ATOM   2694 O O   . ARG A 1 356 ? 26.270  24.499  -12.350 1.00 52.92  ? 356  ARG A O   1 
ATOM   2695 C CB  . ARG A 1 356 ? 23.800  25.489  -14.227 1.00 57.51  ? 356  ARG A CB  1 
ATOM   2696 C CG  . ARG A 1 356 ? 24.130  24.095  -14.661 1.00 59.61  ? 356  ARG A CG  1 
ATOM   2697 C CD  . ARG A 1 356 ? 23.182  23.594  -15.730 1.00 64.35  ? 356  ARG A CD  1 
ATOM   2698 N NE  . ARG A 1 356 ? 23.432  22.170  -15.930 1.00 65.32  ? 356  ARG A NE  1 
ATOM   2699 C CZ  . ARG A 1 356 ? 22.897  21.189  -15.207 1.00 65.69  ? 356  ARG A CZ  1 
ATOM   2700 N NH1 . ARG A 1 356 ? 22.033  21.446  -14.228 1.00 66.17  ? 356  ARG A NH1 1 
ATOM   2701 N NH2 . ARG A 1 356 ? 23.215  19.929  -15.493 1.00 65.80  ? 356  ARG A NH2 1 
ATOM   2702 N N   . ALA A 1 357 ? 26.595  26.589  -13.141 1.00 54.93  ? 357  ALA A N   1 
ATOM   2703 C CA  . ALA A 1 357 ? 28.059  26.596  -12.987 1.00 54.51  ? 357  ALA A CA  1 
ATOM   2704 C C   . ALA A 1 357 ? 28.454  26.444  -11.527 1.00 53.20  ? 357  ALA A C   1 
ATOM   2705 O O   . ALA A 1 357 ? 29.369  25.699  -11.204 1.00 53.12  ? 357  ALA A O   1 
ATOM   2706 C CB  . ALA A 1 357 ? 28.668  27.894  -13.594 1.00 55.36  ? 357  ALA A CB  1 
ATOM   2707 N N   . GLN A 1 358 ? 27.743  27.121  -10.632 1.00 53.04  ? 358  GLN A N   1 
ATOM   2708 C CA  . GLN A 1 358 ? 27.988  26.961  -9.198  1.00 52.14  ? 358  GLN A CA  1 
ATOM   2709 C C   . GLN A 1 358 ? 27.597  25.579  -8.678  1.00 51.15  ? 358  GLN A C   1 
ATOM   2710 O O   . GLN A 1 358 ? 28.221  25.050  -7.742  1.00 50.34  ? 358  GLN A O   1 
ATOM   2711 C CB  . GLN A 1 358 ? 27.252  28.049  -8.426  1.00 52.26  ? 358  GLN A CB  1 
ATOM   2712 C CG  . GLN A 1 358 ? 27.957  29.391  -8.523  1.00 54.30  ? 358  GLN A CG  1 
ATOM   2713 C CD  . GLN A 1 358 ? 27.150  30.547  -7.974  1.00 54.89  ? 358  GLN A CD  1 
ATOM   2714 O OE1 . GLN A 1 358 ? 25.926  30.538  -8.023  1.00 56.34  ? 358  GLN A OE1 1 
ATOM   2715 N NE2 . GLN A 1 358 ? 27.843  31.569  -7.468  1.00 56.22  ? 358  GLN A NE2 1 
ATOM   2716 N N   . PHE A 1 359 ? 26.574  24.982  -9.281  1.00 51.54  ? 359  PHE A N   1 
ATOM   2717 C CA  . PHE A 1 359 ? 26.189  23.599  -8.936  1.00 50.98  ? 359  PHE A CA  1 
ATOM   2718 C C   . PHE A 1 359 ? 27.287  22.627  -9.326  1.00 50.71  ? 359  PHE A C   1 
ATOM   2719 O O   . PHE A 1 359 ? 27.693  21.820  -8.518  1.00 49.99  ? 359  PHE A O   1 
ATOM   2720 C CB  . PHE A 1 359 ? 24.852  23.255  -9.600  1.00 51.29  ? 359  PHE A CB  1 
ATOM   2721 C CG  . PHE A 1 359 ? 24.383  21.840  -9.364  1.00 51.68  ? 359  PHE A CG  1 
ATOM   2722 C CD1 . PHE A 1 359 ? 24.143  20.983  -10.433 1.00 52.59  ? 359  PHE A CD1 1 
ATOM   2723 C CD2 . PHE A 1 359 ? 24.155  21.373  -8.097  1.00 50.52  ? 359  PHE A CD2 1 
ATOM   2724 C CE1 . PHE A 1 359 ? 23.704  19.677  -10.232 1.00 50.96  ? 359  PHE A CE1 1 
ATOM   2725 C CE2 . PHE A 1 359 ? 23.711  20.057  -7.894  1.00 51.54  ? 359  PHE A CE2 1 
ATOM   2726 C CZ  . PHE A 1 359 ? 23.490  19.222  -8.967  1.00 50.14  ? 359  PHE A CZ  1 
ATOM   2727 N N   . LEU A 1 360 ? 27.799  22.721  -10.552 1.00 53.19  ? 360  LEU A N   1 
ATOM   2728 C CA  . LEU A 1 360 ? 28.871  21.818  -10.998 1.00 54.28  ? 360  LEU A CA  1 
ATOM   2729 C C   . LEU A 1 360 ? 30.122  21.952  -10.118 1.00 53.64  ? 360  LEU A C   1 
ATOM   2730 O O   . LEU A 1 360 ? 30.681  20.948  -9.691  1.00 53.95  ? 360  LEU A O   1 
ATOM   2731 C CB  . LEU A 1 360 ? 29.236  22.043  -12.473 1.00 55.97  ? 360  LEU A CB  1 
ATOM   2732 C CG  . LEU A 1 360 ? 28.161  22.076  -13.582 1.00 59.70  ? 360  LEU A CG  1 
ATOM   2733 C CD1 . LEU A 1 360 ? 28.824  22.083  -14.990 1.00 62.91  ? 360  LEU A CD1 1 
ATOM   2734 C CD2 . LEU A 1 360 ? 27.130  20.972  -13.514 1.00 59.27  ? 360  LEU A CD2 1 
ATOM   2735 N N   . ALA A 1 361 ? 30.541  23.195  -9.857  1.00 54.08  ? 361  ALA A N   1 
ATOM   2736 C CA  . ALA A 1 361 ? 31.642  23.542  -8.920  1.00 53.26  ? 361  ALA A CA  1 
ATOM   2737 C C   . ALA A 1 361 ? 31.468  22.957  -7.529  1.00 52.39  ? 361  ALA A C   1 
ATOM   2738 O O   . ALA A 1 361 ? 32.397  22.362  -6.967  1.00 51.55  ? 361  ALA A O   1 
ATOM   2739 C CB  . ALA A 1 361 ? 31.761  25.062  -8.804  1.00 53.54  ? 361  ALA A CB  1 
ATOM   2740 N N   . GLY A 1 362 ? 30.270  23.146  -6.975  1.00 52.20  ? 362  GLY A N   1 
ATOM   2741 C CA  . GLY A 1 362 ? 29.898  22.593  -5.685  1.00 51.20  ? 362  GLY A CA  1 
ATOM   2742 C C   . GLY A 1 362 ? 29.951  21.077  -5.594  1.00 50.75  ? 362  GLY A C   1 
ATOM   2743 O O   . GLY A 1 362 ? 30.345  20.540  -4.564  1.00 49.57  ? 362  GLY A O   1 
ATOM   2744 N N   . VAL A 1 363 ? 29.547  20.385  -6.657  1.00 51.57  ? 363  VAL A N   1 
ATOM   2745 C CA  . VAL A 1 363 ? 29.605  18.912  -6.696  1.00 51.39  ? 363  VAL A CA  1 
ATOM   2746 C C   . VAL A 1 363 ? 31.051  18.411  -6.626  1.00 52.10  ? 363  VAL A C   1 
ATOM   2747 O O   . VAL A 1 363 ? 31.320  17.349  -6.074  1.00 51.40  ? 363  VAL A O   1 
ATOM   2748 C CB  . VAL A 1 363 ? 28.906  18.348  -7.967  1.00 52.33  ? 363  VAL A CB  1 
ATOM   2749 C CG1 . VAL A 1 363 ? 29.169  16.850  -8.137  1.00 52.03  ? 363  VAL A CG1 1 
ATOM   2750 C CG2 . VAL A 1 363 ? 27.398  18.626  -7.923  1.00 51.55  ? 363  VAL A CG2 1 
ATOM   2751 N N   . ARG A 1 364 ? 31.991  19.171  -7.187  1.00 53.26  ? 364  ARG A N   1 
ATOM   2752 C CA  . ARG A 1 364 ? 33.397  18.792  -7.072  1.00 53.81  ? 364  ARG A CA  1 
ATOM   2753 C C   . ARG A 1 364 ? 33.832  18.868  -5.619  1.00 52.49  ? 364  ARG A C   1 
ATOM   2754 O O   . ARG A 1 364 ? 34.576  18.014  -5.155  1.00 51.68  ? 364  ARG A O   1 
ATOM   2755 C CB  . ARG A 1 364 ? 34.302  19.654  -7.946  1.00 55.18  ? 364  ARG A CB  1 
ATOM   2756 C CG  . ARG A 1 364 ? 34.117  19.478  -9.458  1.00 59.00  ? 364  ARG A CG  1 
ATOM   2757 C CD  . ARG A 1 364 ? 33.565  18.097  -9.908  1.00 62.91  ? 364  ARG A CD  1 
ATOM   2758 N NE  . ARG A 1 364 ? 34.531  16.992  -9.809  1.00 64.79  ? 364  ARG A NE  1 
ATOM   2759 C CZ  . ARG A 1 364 ? 35.510  16.747  -10.697 1.00 67.18  ? 364  ARG A CZ  1 
ATOM   2760 N NH1 . ARG A 1 364 ? 35.680  17.530  -11.766 1.00 67.88  ? 364  ARG A NH1 1 
ATOM   2761 N NH2 . ARG A 1 364 ? 36.326  15.709  -10.512 1.00 66.31  ? 364  ARG A NH2 1 
ATOM   2762 N N   . ILE A 1 365 ? 33.325  19.874  -4.909  1.00 51.37  ? 365  ILE A N   1 
ATOM   2763 C CA  . ILE A 1 365 ? 33.614  20.063  -3.488  1.00 50.32  ? 365  ILE A CA  1 
ATOM   2764 C C   . ILE A 1 365 ? 32.822  19.113  -2.569  1.00 49.26  ? 365  ILE A C   1 
ATOM   2765 O O   . ILE A 1 365 ? 33.321  18.672  -1.546  1.00 48.80  ? 365  ILE A O   1 
ATOM   2766 C CB  . ILE A 1 365 ? 33.362  21.526  -3.089  1.00 50.12  ? 365  ILE A CB  1 
ATOM   2767 C CG1 . ILE A 1 365 ? 34.295  22.435  -3.881  1.00 50.57  ? 365  ILE A CG1 1 
ATOM   2768 C CG2 . ILE A 1 365 ? 33.561  21.716  -1.579  1.00 48.44  ? 365  ILE A CG2 1 
ATOM   2769 C CD1 . ILE A 1 365 ? 33.881  23.874  -3.899  1.00 51.93  ? 365  ILE A CD1 1 
ATOM   2770 N N   . GLY A 1 366 ? 31.589  18.817  -2.934  1.00 49.71  ? 366  GLY A N   1 
ATOM   2771 C CA  . GLY A 1 366 ? 30.731  17.941  -2.158  1.00 49.59  ? 366  GLY A CA  1 
ATOM   2772 C C   . GLY A 1 366 ? 30.984  16.462  -2.355  1.00 50.67  ? 366  GLY A C   1 
ATOM   2773 O O   . GLY A 1 366 ? 30.562  15.635  -1.499  1.00 51.28  ? 366  GLY A O   1 
ATOM   2774 N N   . VAL A 1 367 ? 31.626  16.114  -3.473  1.00 50.85  ? 367  VAL A N   1 
ATOM   2775 C CA  . VAL A 1 367 ? 31.960  14.725  -3.790  1.00 51.65  ? 367  VAL A CA  1 
ATOM   2776 C C   . VAL A 1 367 ? 33.433  14.745  -4.189  1.00 52.14  ? 367  VAL A C   1 
ATOM   2777 O O   . VAL A 1 367 ? 33.787  14.540  -5.338  1.00 53.40  ? 367  VAL A O   1 
ATOM   2778 C CB  . VAL A 1 367 ? 31.039  14.153  -4.910  1.00 52.53  ? 367  VAL A CB  1 
ATOM   2779 C CG1 . VAL A 1 367 ? 31.147  12.650  -4.977  1.00 52.56  ? 367  VAL A CG1 1 
ATOM   2780 C CG2 . VAL A 1 367 ? 29.575  14.549  -4.664  1.00 51.08  ? 367  VAL A CG2 1 
ATOM   2781 N N   . PRO A 1 368 ? 34.310  15.022  -3.223  1.00 52.03  ? 368  PRO A N   1 
ATOM   2782 C CA  . PRO A 1 368 ? 35.689  15.413  -3.518  1.00 52.92  ? 368  PRO A CA  1 
ATOM   2783 C C   . PRO A 1 368 ? 36.531  14.320  -4.105  1.00 53.81  ? 368  PRO A C   1 
ATOM   2784 O O   . PRO A 1 368 ? 37.511  14.604  -4.789  1.00 54.28  ? 368  PRO A O   1 
ATOM   2785 C CB  . PRO A 1 368 ? 36.260  15.789  -2.146  1.00 52.48  ? 368  PRO A CB  1 
ATOM   2786 C CG  . PRO A 1 368 ? 35.154  15.788  -1.217  1.00 50.87  ? 368  PRO A CG  1 
ATOM   2787 C CD  . PRO A 1 368 ? 34.069  14.949  -1.777  1.00 51.51  ? 368  PRO A CD  1 
ATOM   2788 N N   . GLN A 1 369 ? 36.167  13.076  -3.809  1.00 54.59  ? 369  GLN A N   1 
ATOM   2789 C CA  . GLN A 1 369 ? 36.910  11.911  -4.290  1.00 56.16  ? 369  GLN A CA  1 
ATOM   2790 C C   . GLN A 1 369 ? 36.454  11.422  -5.667  1.00 57.55  ? 369  GLN A C   1 
ATOM   2791 O O   . GLN A 1 369 ? 37.022  10.474  -6.182  1.00 58.95  ? 369  GLN A O   1 
ATOM   2792 C CB  . GLN A 1 369 ? 36.832  10.771  -3.259  1.00 55.83  ? 369  GLN A CB  1 
ATOM   2793 C CG  . GLN A 1 369 ? 37.874  10.886  -2.112  1.00 55.87  ? 369  GLN A CG  1 
ATOM   2794 C CD  . GLN A 1 369 ? 37.557  11.979  -1.074  1.00 54.48  ? 369  GLN A CD  1 
ATOM   2795 O OE1 . GLN A 1 369 ? 36.619  11.848  -0.272  1.00 51.54  ? 369  GLN A OE1 1 
ATOM   2796 N NE2 . GLN A 1 369 ? 38.363  13.044  -1.070  1.00 54.52  ? 369  GLN A NE2 1 
ATOM   2797 N N   . ALA A 1 370 ? 35.470  12.098  -6.268  1.00 58.05  ? 370  ALA A N   1 
ATOM   2798 C CA  . ALA A 1 370 ? 34.882  11.715  -7.561  1.00 58.87  ? 370  ALA A CA  1 
ATOM   2799 C C   . ALA A 1 370 ? 35.743  12.117  -8.735  1.00 60.29  ? 370  ALA A C   1 
ATOM   2800 O O   . ALA A 1 370 ? 36.231  13.236  -8.786  1.00 60.14  ? 370  ALA A O   1 
ATOM   2801 C CB  . ALA A 1 370 ? 33.511  12.370  -7.730  1.00 58.52  ? 370  ALA A CB  1 
ATOM   2802 N N   . SER A 1 371 ? 35.902  11.196  -9.690  1.00 61.94  ? 371  SER A N   1 
ATOM   2803 C CA  . SER A 1 371 ? 36.488  11.503  -10.991 1.00 63.22  ? 371  SER A CA  1 
ATOM   2804 C C   . SER A 1 371 ? 35.631  12.518  -11.726 1.00 63.18  ? 371  SER A C   1 
ATOM   2805 O O   . SER A 1 371 ? 34.581  12.896  -11.248 1.00 61.93  ? 371  SER A O   1 
ATOM   2806 C CB  . SER A 1 371 ? 36.574  10.236  -11.820 1.00 64.78  ? 371  SER A CB  1 
ATOM   2807 O OG  . SER A 1 371 ? 35.313  9.586   -11.908 1.00 65.62  ? 371  SER A OG  1 
ATOM   2808 N N   . ASP A 1 372 ? 36.084  12.965  -12.885 1.00 64.53  ? 372  ASP A N   1 
ATOM   2809 C CA  . ASP A 1 372 ? 35.298  13.880  -13.699 1.00 65.39  ? 372  ASP A CA  1 
ATOM   2810 C C   . ASP A 1 372 ? 34.029  13.165  -14.204 1.00 65.24  ? 372  ASP A C   1 
ATOM   2811 O O   . ASP A 1 372 ? 32.951  13.763  -14.261 1.00 65.08  ? 372  ASP A O   1 
ATOM   2812 C CB  . ASP A 1 372 ? 36.105  14.412  -14.900 1.00 67.23  ? 372  ASP A CB  1 
ATOM   2813 C CG  . ASP A 1 372 ? 37.227  15.382  -14.504 1.00 69.79  ? 372  ASP A CG  1 
ATOM   2814 O OD1 . ASP A 1 372 ? 37.454  15.622  -13.298 1.00 72.06  ? 372  ASP A OD1 1 
ATOM   2815 O OD2 . ASP A 1 372 ? 37.906  15.907  -15.419 1.00 73.72  ? 372  ASP A OD2 1 
ATOM   2816 N N   . LEU A 1 373 ? 34.157  11.888  -14.564 1.00 65.31  ? 373  LEU A N   1 
ATOM   2817 C CA  . LEU A 1 373 ? 33.008  11.133  -15.080 1.00 65.26  ? 373  LEU A CA  1 
ATOM   2818 C C   . LEU A 1 373 ? 31.963  10.906  -13.981 1.00 63.22  ? 373  LEU A C   1 
ATOM   2819 O O   . LEU A 1 373 ? 30.769  11.094  -14.206 1.00 63.02  ? 373  LEU A O   1 
ATOM   2820 C CB  . LEU A 1 373 ? 33.458  9.795   -15.681 1.00 66.62  ? 373  LEU A CB  1 
ATOM   2821 C CG  . LEU A 1 373 ? 32.375  8.907   -16.313 1.00 67.89  ? 373  LEU A CG  1 
ATOM   2822 C CD1 . LEU A 1 373 ? 31.670  9.655   -17.438 1.00 68.76  ? 373  LEU A CD1 1 
ATOM   2823 C CD2 . LEU A 1 373 ? 32.963  7.586   -16.808 1.00 68.61  ? 373  LEU A CD2 1 
ATOM   2824 N N   . ALA A 1 374 ? 32.429  10.500  -12.802 1.00 61.33  ? 374  ALA A N   1 
ATOM   2825 C CA  . ALA A 1 374 ? 31.568  10.326  -11.634 1.00 59.21  ? 374  ALA A CA  1 
ATOM   2826 C C   . ALA A 1 374 ? 30.868  11.624  -11.241 1.00 57.79  ? 374  ALA A C   1 
ATOM   2827 O O   . ALA A 1 374 ? 29.693  11.606  -10.934 1.00 56.76  ? 374  ALA A O   1 
ATOM   2828 C CB  . ALA A 1 374 ? 32.363  9.785   -10.469 1.00 58.36  ? 374  ALA A CB  1 
ATOM   2829 N N   . ALA A 1 375 ? 31.589  12.736  -11.250 1.00 57.21  ? 375  ALA A N   1 
ATOM   2830 C CA  . ALA A 1 375 ? 31.003  14.039  -10.923 1.00 57.08  ? 375  ALA A CA  1 
ATOM   2831 C C   . ALA A 1 375 ? 29.912  14.401  -11.907 1.00 57.87  ? 375  ALA A C   1 
ATOM   2832 O O   . ALA A 1 375 ? 28.908  14.977  -11.519 1.00 58.43  ? 375  ALA A O   1 
ATOM   2833 C CB  . ALA A 1 375 ? 32.074  15.147  -10.889 1.00 56.30  ? 375  ALA A CB  1 
ATOM   2834 N N   . GLU A 1 376 ? 30.100  14.069  -13.182 1.00 59.86  ? 376  GLU A N   1 
ATOM   2835 C CA  . GLU A 1 376 ? 29.104  14.418  -14.197 1.00 60.32  ? 376  GLU A CA  1 
ATOM   2836 C C   . GLU A 1 376 ? 27.892  13.492  -14.097 1.00 59.03  ? 376  GLU A C   1 
ATOM   2837 O O   . GLU A 1 376 ? 26.762  13.928  -14.273 1.00 58.82  ? 376  GLU A O   1 
ATOM   2838 C CB  . GLU A 1 376 ? 29.732  14.440  -15.598 1.00 62.71  ? 376  GLU A CB  1 
ATOM   2839 C CG  . GLU A 1 376 ? 28.858  15.094  -16.706 1.00 65.59  ? 376  GLU A CG  1 
ATOM   2840 C CD  . GLU A 1 376 ? 28.376  16.544  -16.413 1.00 71.39  ? 376  GLU A CD  1 
ATOM   2841 O OE1 . GLU A 1 376 ? 29.190  17.403  -15.976 1.00 73.89  ? 376  GLU A OE1 1 
ATOM   2842 O OE2 . GLU A 1 376 ? 27.174  16.830  -16.664 1.00 74.00  ? 376  GLU A OE2 1 
ATOM   2843 N N   . ALA A 1 377 ? 28.121  12.229  -13.752 1.00 57.46  ? 377  ALA A N   1 
ATOM   2844 C CA  . ALA A 1 377 ? 27.025  11.335  -13.399 1.00 56.43  ? 377  ALA A CA  1 
ATOM   2845 C C   . ALA A 1 377 ? 26.170  11.917  -12.276 1.00 54.69  ? 377  ALA A C   1 
ATOM   2846 O O   . ALA A 1 377 ? 24.936  11.835  -12.333 1.00 55.10  ? 377  ALA A O   1 
ATOM   2847 C CB  . ALA A 1 377 ? 27.549  9.971   -13.011 1.00 56.05  ? 377  ALA A CB  1 
ATOM   2848 N N   . VAL A 1 378 ? 26.810  12.521  -11.272 1.00 52.69  ? 378  VAL A N   1 
ATOM   2849 C CA  . VAL A 1 378 ? 26.079  13.097  -10.142 1.00 50.74  ? 378  VAL A CA  1 
ATOM   2850 C C   . VAL A 1 378 ? 25.241  14.273  -10.604 1.00 51.29  ? 378  VAL A C   1 
ATOM   2851 O O   . VAL A 1 378 ? 24.049  14.354  -10.283 1.00 51.12  ? 378  VAL A O   1 
ATOM   2852 C CB  . VAL A 1 378 ? 27.018  13.528  -8.981  1.00 49.94  ? 378  VAL A CB  1 
ATOM   2853 C CG1 . VAL A 1 378 ? 26.289  14.461  -7.989  1.00 46.23  ? 378  VAL A CG1 1 
ATOM   2854 C CG2 . VAL A 1 378 ? 27.556  12.306  -8.265  1.00 46.70  ? 378  VAL A CG2 1 
ATOM   2855 N N   . VAL A 1 379 ? 25.860  15.174  -11.365 1.00 51.65  ? 379  VAL A N   1 
ATOM   2856 C CA  . VAL A 1 379 ? 25.167  16.356  -11.894 1.00 52.49  ? 379  VAL A CA  1 
ATOM   2857 C C   . VAL A 1 379 ? 23.990  15.975  -12.784 1.00 53.70  ? 379  VAL A C   1 
ATOM   2858 O O   . VAL A 1 379 ? 22.929  16.604  -12.743 1.00 54.10  ? 379  VAL A O   1 
ATOM   2859 C CB  . VAL A 1 379 ? 26.138  17.270  -12.682 1.00 52.87  ? 379  VAL A CB  1 
ATOM   2860 C CG1 . VAL A 1 379 ? 25.375  18.284  -13.540 1.00 54.97  ? 379  VAL A CG1 1 
ATOM   2861 C CG2 . VAL A 1 379 ? 27.097  17.989  -11.722 1.00 51.17  ? 379  VAL A CG2 1 
ATOM   2862 N N   . LEU A 1 380 ? 24.174  14.935  -13.582 1.00 54.54  ? 380  LEU A N   1 
ATOM   2863 C CA  . LEU A 1 380 ? 23.132  14.505  -14.494 1.00 55.89  ? 380  LEU A CA  1 
ATOM   2864 C C   . LEU A 1 380 ? 21.979  13.853  -13.744 1.00 55.38  ? 380  LEU A C   1 
ATOM   2865 O O   . LEU A 1 380 ? 20.821  14.072  -14.073 1.00 56.53  ? 380  LEU A O   1 
ATOM   2866 C CB  . LEU A 1 380 ? 23.713  13.575  -15.568 1.00 57.42  ? 380  LEU A CB  1 
ATOM   2867 C CG  . LEU A 1 380 ? 24.616  14.279  -16.601 1.00 59.34  ? 380  LEU A CG  1 
ATOM   2868 C CD1 . LEU A 1 380 ? 25.157  13.310  -17.656 1.00 61.39  ? 380  LEU A CD1 1 
ATOM   2869 C CD2 . LEU A 1 380 ? 23.896  15.432  -17.286 1.00 61.26  ? 380  LEU A CD2 1 
ATOM   2870 N N   . HIS A 1 381 ? 22.298  13.065  -12.724 1.00 53.94  ? 381  HIS A N   1 
ATOM   2871 C CA  . HIS A 1 381 ? 21.291  12.435  -11.892 1.00 53.28  ? 381  HIS A CA  1 
ATOM   2872 C C   . HIS A 1 381 ? 20.474  13.450  -11.104 1.00 52.36  ? 381  HIS A C   1 
ATOM   2873 O O   . HIS A 1 381 ? 19.286  13.276  -10.911 1.00 52.30  ? 381  HIS A O   1 
ATOM   2874 C CB  . HIS A 1 381 ? 21.956  11.486  -10.910 1.00 52.64  ? 381  HIS A CB  1 
ATOM   2875 C CG  . HIS A 1 381 ? 20.993  10.686  -10.092 1.00 52.59  ? 381  HIS A CG  1 
ATOM   2876 N ND1 . HIS A 1 381 ? 20.448  9.499   -10.532 1.00 54.95  ? 381  HIS A ND1 1 
ATOM   2877 C CD2 . HIS A 1 381 ? 20.486  10.899  -8.858  1.00 51.23  ? 381  HIS A CD2 1 
ATOM   2878 C CE1 . HIS A 1 381 ? 19.635  9.025   -9.604  1.00 54.44  ? 381  HIS A CE1 1 
ATOM   2879 N NE2 . HIS A 1 381 ? 19.636  9.859   -8.581  1.00 52.90  ? 381  HIS A NE2 1 
ATOM   2880 N N   . TYR A 1 382 ? 21.123  14.496  -10.620 1.00 51.21  ? 382  TYR A N   1 
ATOM   2881 C CA  . TYR A 1 382 ? 20.473  15.417  -9.698  1.00 50.88  ? 382  TYR A CA  1 
ATOM   2882 C C   . TYR A 1 382 ? 19.850  16.602  -10.395 1.00 51.36  ? 382  TYR A C   1 
ATOM   2883 O O   . TYR A 1 382 ? 19.136  17.339  -9.757  1.00 51.80  ? 382  TYR A O   1 
ATOM   2884 C CB  . TYR A 1 382 ? 21.452  15.875  -8.606  1.00 49.95  ? 382  TYR A CB  1 
ATOM   2885 C CG  . TYR A 1 382 ? 21.520  14.912  -7.444  1.00 49.37  ? 382  TYR A CG  1 
ATOM   2886 C CD1 . TYR A 1 382 ? 22.423  13.852  -7.443  1.00 49.33  ? 382  TYR A CD1 1 
ATOM   2887 C CD2 . TYR A 1 382 ? 20.673  15.049  -6.355  1.00 48.75  ? 382  TYR A CD2 1 
ATOM   2888 C CE1 . TYR A 1 382 ? 22.484  12.970  -6.394  1.00 49.48  ? 382  TYR A CE1 1 
ATOM   2889 C CE2 . TYR A 1 382 ? 20.735  14.163  -5.287  1.00 47.95  ? 382  TYR A CE2 1 
ATOM   2890 C CZ  . TYR A 1 382 ? 21.633  13.133  -5.316  1.00 48.51  ? 382  TYR A CZ  1 
ATOM   2891 O OH  . TYR A 1 382 ? 21.700  12.256  -4.264  1.00 48.30  ? 382  TYR A OH  1 
ATOM   2892 N N   . THR A 1 383 ? 20.090  16.761  -11.699 1.00 52.14  ? 383  THR A N   1 
ATOM   2893 C CA  . THR A 1 383 ? 19.462  17.811  -12.494 1.00 53.31  ? 383  THR A CA  1 
ATOM   2894 C C   . THR A 1 383 ? 17.988  17.505  -12.696 1.00 54.88  ? 383  THR A C   1 
ATOM   2895 O O   . THR A 1 383 ? 17.600  16.356  -12.900 1.00 55.67  ? 383  THR A O   1 
ATOM   2896 C CB  . THR A 1 383 ? 20.172  18.007  -13.882 1.00 54.05  ? 383  THR A CB  1 
ATOM   2897 O OG1 . THR A 1 383 ? 21.538  18.353  -13.662 1.00 53.56  ? 383  THR A OG1 1 
ATOM   2898 C CG2 . THR A 1 383 ? 19.530  19.099  -14.726 1.00 53.70  ? 383  THR A CG2 1 
ATOM   2899 N N   . ASP A 1 384 ? 17.172  18.546  -12.582 1.00 55.86  ? 384  ASP A N   1 
ATOM   2900 C CA  . ASP A 1 384 ? 15.789  18.494  -13.004 1.00 57.87  ? 384  ASP A CA  1 
ATOM   2901 C C   . ASP A 1 384 ? 15.762  18.916  -14.454 1.00 59.01  ? 384  ASP A C   1 
ATOM   2902 O O   . ASP A 1 384 ? 15.855  20.113  -14.757 1.00 59.93  ? 384  ASP A O   1 
ATOM   2903 C CB  . ASP A 1 384 ? 14.928  19.436  -12.168 1.00 58.11  ? 384  ASP A CB  1 
ATOM   2904 C CG  . ASP A 1 384 ? 13.463  19.351  -12.538 1.00 61.69  ? 384  ASP A CG  1 
ATOM   2905 O OD1 . ASP A 1 384 ? 13.142  18.768  -13.594 1.00 64.47  ? 384  ASP A OD1 1 
ATOM   2906 O OD2 . ASP A 1 384 ? 12.630  19.868  -11.780 1.00 64.85  ? 384  ASP A OD2 1 
ATOM   2907 N N   . TRP A 1 385 ? 15.633  17.948  -15.361 1.00 59.55  ? 385  TRP A N   1 
ATOM   2908 C CA  . TRP A 1 385 ? 15.770  18.250  -16.788 1.00 60.22  ? 385  TRP A CA  1 
ATOM   2909 C C   . TRP A 1 385 ? 14.587  19.023  -17.363 1.00 61.88  ? 385  TRP A C   1 
ATOM   2910 O O   . TRP A 1 385 ? 14.650  19.483  -18.488 1.00 62.99  ? 385  TRP A O   1 
ATOM   2911 C CB  . TRP A 1 385 ? 16.140  16.997  -17.589 1.00 60.12  ? 385  TRP A CB  1 
ATOM   2912 C CG  . TRP A 1 385 ? 17.518  16.549  -17.227 1.00 57.64  ? 385  TRP A CG  1 
ATOM   2913 C CD1 . TRP A 1 385 ? 17.854  15.559  -16.370 1.00 56.22  ? 385  TRP A CD1 1 
ATOM   2914 C CD2 . TRP A 1 385 ? 18.742  17.140  -17.656 1.00 55.98  ? 385  TRP A CD2 1 
ATOM   2915 N NE1 . TRP A 1 385 ? 19.216  15.468  -16.259 1.00 55.32  ? 385  TRP A NE1 1 
ATOM   2916 C CE2 . TRP A 1 385 ? 19.785  16.433  -17.036 1.00 54.64  ? 385  TRP A CE2 1 
ATOM   2917 C CE3 . TRP A 1 385 ? 19.060  18.197  -18.514 1.00 57.92  ? 385  TRP A CE3 1 
ATOM   2918 C CZ2 . TRP A 1 385 ? 21.120  16.751  -17.227 1.00 55.93  ? 385  TRP A CZ2 1 
ATOM   2919 C CZ3 . TRP A 1 385 ? 20.384  18.512  -18.717 1.00 57.36  ? 385  TRP A CZ3 1 
ATOM   2920 C CH2 . TRP A 1 385 ? 21.405  17.788  -18.080 1.00 56.95  ? 385  TRP A CH2 1 
ATOM   2921 N N   . LEU A 1 386 ? 13.543  19.206  -16.565 1.00 62.44  ? 386  LEU A N   1 
ATOM   2922 C CA  . LEU A 1 386 ? 12.472  20.145  -16.895 1.00 64.62  ? 386  LEU A CA  1 
ATOM   2923 C C   . LEU A 1 386 ? 12.818  21.590  -16.537 1.00 64.71  ? 386  LEU A C   1 
ATOM   2924 O O   . LEU A 1 386 ? 12.223  22.534  -17.071 1.00 66.33  ? 386  LEU A O   1 
ATOM   2925 C CB  . LEU A 1 386 ? 11.178  19.755  -16.180 1.00 65.18  ? 386  LEU A CB  1 
ATOM   2926 C CG  . LEU A 1 386 ? 10.157  19.034  -17.043 1.00 68.23  ? 386  LEU A CG  1 
ATOM   2927 C CD1 . LEU A 1 386 ? 9.008   18.568  -16.175 1.00 70.15  ? 386  LEU A CD1 1 
ATOM   2928 C CD2 . LEU A 1 386 ? 9.685   19.962  -18.185 1.00 71.37  ? 386  LEU A CD2 1 
ATOM   2929 N N   . HIS A 1 387 ? 13.749  21.757  -15.603 1.00 63.73  ? 387  HIS A N   1 
ATOM   2930 C CA  . HIS A 1 387 ? 14.145  23.088  -15.114 1.00 63.55  ? 387  HIS A CA  1 
ATOM   2931 C C   . HIS A 1 387 ? 15.637  23.095  -14.773 1.00 61.44  ? 387  HIS A C   1 
ATOM   2932 O O   . HIS A 1 387 ? 15.998  23.312  -13.626 1.00 60.36  ? 387  HIS A O   1 
ATOM   2933 C CB  . HIS A 1 387 ? 13.332  23.458  -13.865 1.00 63.48  ? 387  HIS A CB  1 
ATOM   2934 C CG  . HIS A 1 387 ? 11.849  23.418  -14.070 1.00 65.49  ? 387  HIS A CG  1 
ATOM   2935 N ND1 . HIS A 1 387 ? 11.054  22.408  -13.571 1.00 65.99  ? 387  HIS A ND1 1 
ATOM   2936 C CD2 . HIS A 1 387 ? 11.021  24.262  -14.719 1.00 68.15  ? 387  HIS A CD2 1 
ATOM   2937 C CE1 . HIS A 1 387 ? 9.795   22.634  -13.906 1.00 68.32  ? 387  HIS A CE1 1 
ATOM   2938 N NE2 . HIS A 1 387 ? 9.747   23.751  -14.608 1.00 69.66  ? 387  HIS A NE2 1 
ATOM   2939 N N   . PRO A 1 388 ? 16.508  22.900  -15.775 1.00 61.39  ? 388  PRO A N   1 
ATOM   2940 C CA  . PRO A 1 388 ? 17.914  22.634  -15.473 1.00 60.49  ? 388  PRO A CA  1 
ATOM   2941 C C   . PRO A 1 388 ? 18.733  23.858  -15.025 1.00 59.96  ? 388  PRO A C   1 
ATOM   2942 O O   . PRO A 1 388 ? 19.884  23.707  -14.613 1.00 59.54  ? 388  PRO A O   1 
ATOM   2943 C CB  . PRO A 1 388 ? 18.455  22.053  -16.788 1.00 61.03  ? 388  PRO A CB  1 
ATOM   2944 C CG  . PRO A 1 388 ? 17.456  22.366  -17.827 1.00 62.54  ? 388  PRO A CG  1 
ATOM   2945 C CD  . PRO A 1 388 ? 16.258  22.988  -17.222 1.00 63.12  ? 388  PRO A CD  1 
ATOM   2946 N N   . GLU A 1 389 ? 18.133  25.036  -15.115 1.00 61.10  ? 389  GLU A N   1 
ATOM   2947 C CA  . GLU A 1 389 ? 18.778  26.293  -14.796 1.00 61.52  ? 389  GLU A CA  1 
ATOM   2948 C C   . GLU A 1 389 ? 18.078  27.003  -13.642 1.00 60.39  ? 389  GLU A C   1 
ATOM   2949 O O   . GLU A 1 389 ? 18.355  28.172  -13.381 1.00 60.77  ? 389  GLU A O   1 
ATOM   2950 C CB  . GLU A 1 389 ? 18.683  27.233  -16.000 1.00 63.90  ? 389  GLU A CB  1 
ATOM   2951 C CG  . GLU A 1 389 ? 18.977  26.615  -17.355 1.00 67.49  ? 389  GLU A CG  1 
ATOM   2952 C CD  . GLU A 1 389 ? 20.371  26.927  -17.817 1.00 71.23  ? 389  GLU A CD  1 
ATOM   2953 O OE1 . GLU A 1 389 ? 21.335  26.442  -17.185 1.00 71.89  ? 389  GLU A OE1 1 
ATOM   2954 O OE2 . GLU A 1 389 ? 20.487  27.682  -18.810 1.00 75.98  ? 389  GLU A OE2 1 
ATOM   2955 N N   . ASP A 1 390 ? 17.145  26.331  -12.983 1.00 58.84  ? 390  ASP A N   1 
ATOM   2956 C CA  . ASP A 1 390 ? 16.368  26.972  -11.940 1.00 58.10  ? 390  ASP A CA  1 
ATOM   2957 C C   . ASP A 1 390 ? 17.196  26.987  -10.674 1.00 55.87  ? 390  ASP A C   1 
ATOM   2958 O O   . ASP A 1 390 ? 17.557  25.932  -10.169 1.00 54.21  ? 390  ASP A O   1 
ATOM   2959 C CB  . ASP A 1 390 ? 15.054  26.243  -11.681 1.00 57.99  ? 390  ASP A CB  1 
ATOM   2960 C CG  . ASP A 1 390 ? 14.191  26.980  -10.715 1.00 58.55  ? 390  ASP A CG  1 
ATOM   2961 O OD1 . ASP A 1 390 ? 13.590  27.978  -11.124 1.00 64.22  ? 390  ASP A OD1 1 
ATOM   2962 O OD2 . ASP A 1 390 ? 14.136  26.611  -9.543  1.00 58.18  ? 390  ASP A OD2 1 
ATOM   2963 N N   . PRO A 1 391 ? 17.527  28.185  -10.179 1.00 56.11  ? 391  PRO A N   1 
ATOM   2964 C CA  . PRO A 1 391 ? 18.445  28.297  -9.063  1.00 55.02  ? 391  PRO A CA  1 
ATOM   2965 C C   . PRO A 1 391 ? 17.927  27.743  -7.744  1.00 54.13  ? 391  PRO A C   1 
ATOM   2966 O O   . PRO A 1 391 ? 18.733  27.316  -6.924  1.00 53.51  ? 391  PRO A O   1 
ATOM   2967 C CB  . PRO A 1 391 ? 18.718  29.799  -8.981  1.00 55.78  ? 391  PRO A CB  1 
ATOM   2968 C CG  . PRO A 1 391 ? 17.597  30.440  -9.607  1.00 57.70  ? 391  PRO A CG  1 
ATOM   2969 C CD  . PRO A 1 391 ? 17.117  29.510  -10.673 1.00 57.93  ? 391  PRO A CD  1 
ATOM   2970 N N   . THR A 1 392 ? 16.608  27.712  -7.554  1.00 54.77  ? 392  THR A N   1 
ATOM   2971 C CA  . THR A 1 392 ? 16.020  27.080  -6.369  1.00 53.80  ? 392  THR A CA  1 
ATOM   2972 C C   . THR A 1 392 ? 16.208  25.566  -6.409  1.00 52.31  ? 392  THR A C   1 
ATOM   2973 O O   . THR A 1 392 ? 16.610  24.995  -5.417  1.00 51.09  ? 392  THR A O   1 
ATOM   2974 C CB  . THR A 1 392 ? 14.501  27.406  -6.210  1.00 55.11  ? 392  THR A CB  1 
ATOM   2975 O OG1 . THR A 1 392 ? 14.326  28.810  -5.979  1.00 57.47  ? 392  THR A OG1 1 
ATOM   2976 C CG2 . THR A 1 392 ? 13.894  26.645  -5.039  1.00 54.67  ? 392  THR A CG2 1 
ATOM   2977 N N   A HIS A 1 393 ? 15.912  24.900  -7.526  0.50 53.05  ? 393  HIS A N   1 
ATOM   2978 N N   B HIS A 1 393 ? 15.907  24.946  -7.553  0.50 53.06  ? 393  HIS A N   1 
ATOM   2979 C CA  A HIS A 1 393 ? 16.172  23.455  -7.562  0.50 52.18  ? 393  HIS A CA  1 
ATOM   2980 C CA  B HIS A 1 393 ? 16.119  23.503  -7.753  0.50 52.38  ? 393  HIS A CA  1 
ATOM   2981 C C   A HIS A 1 393 ? 17.662  23.181  -7.463  0.50 50.68  ? 393  HIS A C   1 
ATOM   2982 C C   B HIS A 1 393 ? 17.598  23.124  -7.635  0.50 50.83  ? 393  HIS A C   1 
ATOM   2983 O O   A HIS A 1 393 ? 18.071  22.247  -6.791  0.50 50.52  ? 393  HIS A O   1 
ATOM   2984 O O   B HIS A 1 393 ? 17.926  22.050  -7.156  0.50 50.62  ? 393  HIS A O   1 
ATOM   2985 C CB  A HIS A 1 393 ? 15.631  22.736  -8.795  0.50 53.06  ? 393  HIS A CB  1 
ATOM   2986 C CB  B HIS A 1 393 ? 15.611  23.055  -9.131  0.50 53.72  ? 393  HIS A CB  1 
ATOM   2987 C CG  A HIS A 1 393 ? 15.960  21.272  -8.797  0.50 52.90  ? 393  HIS A CG  1 
ATOM   2988 C CG  B HIS A 1 393 ? 14.117  22.983  -9.248  0.50 56.28  ? 393  HIS A CG  1 
ATOM   2989 N ND1 A HIS A 1 393 ? 17.085  20.760  -9.412  0.50 53.80  ? 393  HIS A ND1 1 
ATOM   2990 N ND1 B HIS A 1 393 ? 13.471  21.953  -9.899  0.50 57.66  ? 393  HIS A ND1 1 
ATOM   2991 C CD2 A HIS A 1 393 ? 15.362  20.224  -8.181  0.50 52.60  ? 393  HIS A CD2 1 
ATOM   2992 C CD2 B HIS A 1 393 ? 13.144  23.815  -8.809  0.50 58.27  ? 393  HIS A CD2 1 
ATOM   2993 C CE1 A HIS A 1 393 ? 17.137  19.457  -9.214  0.50 52.85  ? 393  HIS A CE1 1 
ATOM   2994 C CE1 B HIS A 1 393 ? 12.168  22.152  -9.852  0.50 58.28  ? 393  HIS A CE1 1 
ATOM   2995 N NE2 A HIS A 1 393 ? 16.102  19.105  -8.473  0.50 52.17  ? 393  HIS A NE2 1 
ATOM   2996 N NE2 B HIS A 1 393 ? 11.943  23.277  -9.199  0.50 59.43  ? 393  HIS A NE2 1 
ATOM   2997 N N   . LEU A 1 394 ? 18.481  23.987  -8.120  1.00 50.94  ? 394  LEU A N   1 
ATOM   2998 C CA  . LEU A 1 394 ? 19.943  23.742  -8.081  1.00 49.49  ? 394  LEU A CA  1 
ATOM   2999 C C   . LEU A 1 394 ? 20.502  23.795  -6.648  1.00 47.99  ? 394  LEU A C   1 
ATOM   3000 O O   . LEU A 1 394 ? 21.334  22.963  -6.250  1.00 47.93  ? 394  LEU A O   1 
ATOM   3001 C CB  . LEU A 1 394 ? 20.662  24.746  -8.999  1.00 49.28  ? 394  LEU A CB  1 
ATOM   3002 C CG  . LEU A 1 394 ? 20.454  24.533  -10.511 1.00 50.22  ? 394  LEU A CG  1 
ATOM   3003 C CD1 . LEU A 1 394 ? 20.930  25.698  -11.349 1.00 46.82  ? 394  LEU A CD1 1 
ATOM   3004 C CD2 . LEU A 1 394 ? 21.164  23.255  -10.967 1.00 49.80  ? 394  LEU A CD2 1 
ATOM   3005 N N   . ARG A 1 395 ? 20.038  24.771  -5.873  1.00 47.99  ? 395  ARG A N   1 
ATOM   3006 C CA  . ARG A 1 395 ? 20.429  24.897  -4.471  1.00 46.81  ? 395  ARG A CA  1 
ATOM   3007 C C   . ARG A 1 395 ? 20.053  23.658  -3.697  1.00 46.66  ? 395  ARG A C   1 
ATOM   3008 O O   . ARG A 1 395 ? 20.865  23.118  -2.938  1.00 45.59  ? 395  ARG A O   1 
ATOM   3009 C CB  . ARG A 1 395 ? 19.735  26.097  -3.848  1.00 47.44  ? 395  ARG A CB  1 
ATOM   3010 C CG  . ARG A 1 395 ? 20.060  26.372  -2.366  1.00 46.42  ? 395  ARG A CG  1 
ATOM   3011 C CD  . ARG A 1 395 ? 19.038  27.387  -1.819  1.00 46.65  ? 395  ARG A CD  1 
ATOM   3012 N NE  . ARG A 1 395 ? 17.745  26.750  -1.683  1.00 43.41  ? 395  ARG A NE  1 
ATOM   3013 C CZ  . ARG A 1 395 ? 16.586  27.367  -1.522  1.00 46.09  ? 395  ARG A CZ  1 
ATOM   3014 N NH1 . ARG A 1 395 ? 16.507  28.689  -1.492  1.00 45.56  ? 395  ARG A NH1 1 
ATOM   3015 N NH2 . ARG A 1 395 ? 15.482  26.644  -1.425  1.00 45.51  ? 395  ARG A NH2 1 
ATOM   3016 N N   . ASP A 1 396 ? 18.821  23.201  -3.899  1.00 47.99  ? 396  ASP A N   1 
ATOM   3017 C CA  . ASP A 1 396 ? 18.288  22.084  -3.140  1.00 47.96  ? 396  ASP A CA  1 
ATOM   3018 C C   . ASP A 1 396 ? 18.862  20.755  -3.593  1.00 47.72  ? 396  ASP A C   1 
ATOM   3019 O O   . ASP A 1 396 ? 18.950  19.824  -2.791  1.00 47.51  ? 396  ASP A O   1 
ATOM   3020 C CB  . ASP A 1 396 ? 16.772  22.028  -3.252  1.00 49.36  ? 396  ASP A CB  1 
ATOM   3021 C CG  . ASP A 1 396 ? 16.075  23.255  -2.649  1.00 50.38  ? 396  ASP A CG  1 
ATOM   3022 O OD1 . ASP A 1 396 ? 16.654  23.947  -1.789  1.00 50.35  ? 396  ASP A OD1 1 
ATOM   3023 O OD2 . ASP A 1 396 ? 14.907  23.479  -3.004  1.00 54.58  ? 396  ASP A OD2 1 
ATOM   3024 N N   . ALA A 1 397 ? 19.230  20.645  -4.865  1.00 48.76  ? 397  ALA A N   1 
ATOM   3025 C CA  . ALA A 1 397 ? 19.979  19.448  -5.357  1.00 48.69  ? 397  ALA A CA  1 
ATOM   3026 C C   . ALA A 1 397 ? 21.407  19.386  -4.798  1.00 47.92  ? 397  ALA A C   1 
ATOM   3027 O O   . ALA A 1 397 ? 21.981  18.300  -4.554  1.00 48.76  ? 397  ALA A O   1 
ATOM   3028 C CB  . ALA A 1 397 ? 20.020  19.441  -6.895  1.00 49.35  ? 397  ALA A CB  1 
ATOM   3029 N N   . MET A 1 398 ? 22.003  20.552  -4.617  1.00 48.26  ? 398  MET A N   1 
ATOM   3030 C CA  . MET A 1 398 ? 23.334  20.635  -4.025  1.00 47.62  ? 398  MET A CA  1 
ATOM   3031 C C   . MET A 1 398 ? 23.257  20.150  -2.599  1.00 46.65  ? 398  MET A C   1 
ATOM   3032 O O   . MET A 1 398 ? 24.070  19.378  -2.178  1.00 45.68  ? 398  MET A O   1 
ATOM   3033 C CB  . MET A 1 398 ? 23.836  22.087  -4.069  1.00 48.14  ? 398  MET A CB  1 
ATOM   3034 C CG  . MET A 1 398 ? 25.289  22.272  -3.679  1.00 47.48  ? 398  MET A CG  1 
ATOM   3035 S SD  . MET A 1 398 ? 26.387  21.401  -4.778  1.00 47.41  ? 398  MET A SD  1 
ATOM   3036 C CE  . MET A 1 398 ? 26.908  20.025  -3.773  1.00 45.48  ? 398  MET A CE  1 
ATOM   3037 N N   . SER A 1 399 ? 22.260  20.617  -1.851  1.00 47.41  ? 399  SER A N   1 
ATOM   3038 C CA  . SER A 1 399 ? 22.019  20.109  -0.495  1.00 46.59  ? 399  SER A CA  1 
ATOM   3039 C C   . SER A 1 399 ? 21.819  18.592  -0.499  1.00 46.32  ? 399  SER A C   1 
ATOM   3040 O O   . SER A 1 399 ? 22.454  17.875  0.275   1.00 46.82  ? 399  SER A O   1 
ATOM   3041 C CB  . SER A 1 399 ? 20.791  20.811  0.101   1.00 47.27  ? 399  SER A CB  1 
ATOM   3042 O OG  . SER A 1 399 ? 20.467  20.301  1.374   1.00 45.71  ? 399  SER A OG  1 
ATOM   3043 N N   . ALA A 1 400 ? 20.962  18.105  -1.392  1.00 47.08  ? 400  ALA A N   1 
ATOM   3044 C CA  . ALA A 1 400 ? 20.642  16.670  -1.486  1.00 46.73  ? 400  ALA A CA  1 
ATOM   3045 C C   . ALA A 1 400 ? 21.855  15.794  -1.828  1.00 46.50  ? 400  ALA A C   1 
ATOM   3046 O O   . ALA A 1 400 ? 21.987  14.673  -1.314  1.00 46.61  ? 400  ALA A O   1 
ATOM   3047 C CB  . ALA A 1 400 ? 19.538  16.445  -2.501  1.00 47.49  ? 400  ALA A CB  1 
ATOM   3048 N N   . VAL A 1 401 ? 22.726  16.286  -2.699  1.00 46.73  ? 401  VAL A N   1 
ATOM   3049 C CA  . VAL A 1 401 ? 23.955  15.555  -3.090  1.00 46.89  ? 401  VAL A CA  1 
ATOM   3050 C C   . VAL A 1 401 ? 24.794  15.256  -1.847  1.00 46.09  ? 401  VAL A C   1 
ATOM   3051 O O   . VAL A 1 401 ? 25.157  14.126  -1.567  1.00 46.60  ? 401  VAL A O   1 
ATOM   3052 C CB  . VAL A 1 401 ? 24.820  16.404  -4.102  1.00 46.74  ? 401  VAL A CB  1 
ATOM   3053 C CG1 . VAL A 1 401 ? 26.256  15.919  -4.183  1.00 45.25  ? 401  VAL A CG1 1 
ATOM   3054 C CG2 . VAL A 1 401 ? 24.175  16.437  -5.498  1.00 46.77  ? 401  VAL A CG2 1 
ATOM   3055 N N   . VAL A 1 402 ? 25.103  16.322  -1.120  1.00 46.45  ? 402  VAL A N   1 
ATOM   3056 C CA  . VAL A 1 402 ? 25.929  16.266  0.074   1.00 45.16  ? 402  VAL A CA  1 
ATOM   3057 C C   . VAL A 1 402 ? 25.302  15.385  1.165   1.00 44.52  ? 402  VAL A C   1 
ATOM   3058 O O   . VAL A 1 402 ? 25.975  14.519  1.760   1.00 43.68  ? 402  VAL A O   1 
ATOM   3059 C CB  . VAL A 1 402 ? 26.167  17.682  0.616   1.00 45.22  ? 402  VAL A CB  1 
ATOM   3060 C CG1 . VAL A 1 402 ? 26.780  17.625  2.010   1.00 44.47  ? 402  VAL A CG1 1 
ATOM   3061 C CG2 . VAL A 1 402 ? 27.038  18.467  -0.338  1.00 44.17  ? 402  VAL A CG2 1 
ATOM   3062 N N   . GLY A 1 403 ? 24.025  15.599  1.427   1.00 44.59  ? 403  GLY A N   1 
ATOM   3063 C CA  . GLY A 1 403 ? 23.297  14.778  2.397   1.00 44.44  ? 403  GLY A CA  1 
ATOM   3064 C C   . GLY A 1 403 ? 23.205  13.314  2.031   1.00 45.18  ? 403  GLY A C   1 
ATOM   3065 O O   . GLY A 1 403 ? 23.354  12.434  2.906   1.00 46.06  ? 403  GLY A O   1 
ATOM   3066 N N   . ASP A 1 404 ? 22.921  13.024  0.760   1.00 45.71  ? 404  ASP A N   1 
ATOM   3067 C CA  . ASP A 1 404 ? 22.676  11.632  0.322   1.00 45.56  ? 404  ASP A CA  1 
ATOM   3068 C C   . ASP A 1 404 ? 23.972  10.833  0.323   1.00 45.25  ? 404  ASP A C   1 
ATOM   3069 O O   . ASP A 1 404 ? 24.031  9.687   0.754   1.00 45.76  ? 404  ASP A O   1 
ATOM   3070 C CB  . ASP A 1 404 ? 22.097  11.604  -1.094  1.00 46.29  ? 404  ASP A CB  1 
ATOM   3071 C CG  . ASP A 1 404 ? 20.684  12.145  -1.173  1.00 47.57  ? 404  ASP A CG  1 
ATOM   3072 O OD1 . ASP A 1 404 ? 20.058  12.345  -0.120  1.00 47.42  ? 404  ASP A OD1 1 
ATOM   3073 O OD2 . ASP A 1 404 ? 20.202  12.398  -2.296  1.00 48.69  ? 404  ASP A OD2 1 
ATOM   3074 N N   . HIS A 1 405 ? 25.015  11.451  -0.206  1.00 44.48  ? 405  HIS A N   1 
ATOM   3075 C CA  . HIS A 1 405 ? 26.342  10.819  -0.304  1.00 44.17  ? 405  HIS A CA  1 
ATOM   3076 C C   . HIS A 1 405 ? 26.965  10.534  1.064   1.00 43.51  ? 405  HIS A C   1 
ATOM   3077 O O   . HIS A 1 405 ? 27.558  9.485   1.294   1.00 42.92  ? 405  HIS A O   1 
ATOM   3078 C CB  . HIS A 1 405 ? 27.212  11.786  -1.119  1.00 44.11  ? 405  HIS A CB  1 
ATOM   3079 C CG  . HIS A 1 405 ? 28.656  11.454  -1.174  1.00 43.66  ? 405  HIS A CG  1 
ATOM   3080 N ND1 . HIS A 1 405 ? 29.140  10.222  -1.566  1.00 43.36  ? 405  HIS A ND1 1 
ATOM   3081 C CD2 . HIS A 1 405 ? 29.734  12.228  -0.952  1.00 40.74  ? 405  HIS A CD2 1 
ATOM   3082 C CE1 . HIS A 1 405 ? 30.459  10.253  -1.561  1.00 41.95  ? 405  HIS A CE1 1 
ATOM   3083 N NE2 . HIS A 1 405 ? 30.843  11.455  -1.176  1.00 41.59  ? 405  HIS A NE2 1 
ATOM   3084 N N   . ASN A 1 406 ? 26.852  11.502  1.967   1.00 43.71  ? 406  ASN A N   1 
ATOM   3085 C CA  . ASN A 1 406 ? 27.554  11.439  3.250   1.00 42.97  ? 406  ASN A CA  1 
ATOM   3086 C C   . ASN A 1 406 ? 26.736  10.826  4.382   1.00 42.54  ? 406  ASN A C   1 
ATOM   3087 O O   . ASN A 1 406 ? 27.334  10.308  5.324   1.00 41.87  ? 406  ASN A O   1 
ATOM   3088 C CB  . ASN A 1 406 ? 28.024  12.814  3.682   1.00 41.78  ? 406  ASN A CB  1 
ATOM   3089 C CG  . ASN A 1 406 ? 29.148  13.350  2.838   1.00 42.47  ? 406  ASN A CG  1 
ATOM   3090 O OD1 . ASN A 1 406 ? 30.270  12.803  2.812   1.00 38.84  ? 406  ASN A OD1 1 
ATOM   3091 N ND2 . ASN A 1 406 ? 28.885  14.459  2.180   1.00 38.51  ? 406  ASN A ND2 1 
ATOM   3092 N N   . VAL A 1 407 ? 25.394  10.870  4.307   1.00 42.79  ? 407  VAL A N   1 
ATOM   3093 C CA  . VAL A 1 407 ? 24.545  10.345  5.386   1.00 42.56  ? 407  VAL A CA  1 
ATOM   3094 C C   . VAL A 1 407 ? 23.439  9.383   4.917   1.00 43.53  ? 407  VAL A C   1 
ATOM   3095 O O   . VAL A 1 407 ? 23.425  8.187   5.291   1.00 43.44  ? 407  VAL A O   1 
ATOM   3096 C CB  . VAL A 1 407 ? 23.897  11.517  6.216   1.00 42.89  ? 407  VAL A CB  1 
ATOM   3097 C CG1 . VAL A 1 407 ? 23.075  10.974  7.365   1.00 40.64  ? 407  VAL A CG1 1 
ATOM   3098 C CG2 . VAL A 1 407 ? 24.967  12.502  6.748   1.00 41.14  ? 407  VAL A CG2 1 
ATOM   3099 N N   . VAL A 1 408 ? 22.526  9.862   4.076   1.00 43.79  ? 408  VAL A N   1 
ATOM   3100 C CA  . VAL A 1 408 ? 21.299  9.084   3.799   1.00 44.06  ? 408  VAL A CA  1 
ATOM   3101 C C   . VAL A 1 408 ? 21.618  7.757   3.156   1.00 45.86  ? 408  VAL A C   1 
ATOM   3102 O O   . VAL A 1 408 ? 21.076  6.736   3.557   1.00 46.76  ? 408  VAL A O   1 
ATOM   3103 C CB  . VAL A 1 408 ? 20.293  9.812   2.911   1.00 44.54  ? 408  VAL A CB  1 
ATOM   3104 C CG1 . VAL A 1 408 ? 19.017  8.923   2.721   1.00 43.57  ? 408  VAL A CG1 1 
ATOM   3105 C CG2 . VAL A 1 408 ? 19.949  11.174  3.498   1.00 40.65  ? 408  VAL A CG2 1 
ATOM   3106 N N   . CYS A 1 409 ? 22.501  7.747   2.162   1.00 46.45  ? 409  CYS A N   1 
ATOM   3107 C CA  . CYS A 1 409 ? 22.760  6.472   1.471   1.00 47.48  ? 409  CYS A CA  1 
ATOM   3108 C C   . CYS A 1 409 ? 23.661  5.497   2.227   1.00 47.04  ? 409  CYS A C   1 
ATOM   3109 O O   . CYS A 1 409 ? 23.476  4.274   2.119   1.00 48.16  ? 409  CYS A O   1 
ATOM   3110 C CB  . CYS A 1 409 ? 23.240  6.718   0.049   1.00 47.85  ? 409  CYS A CB  1 
ATOM   3111 S SG  . CYS A 1 409 ? 21.959  7.504   -0.960  1.00 48.76  ? 409  CYS A SG  1 
ATOM   3112 N N   . PRO A 1 410 ? 24.660  6.008   2.950   1.00 45.96  ? 410  PRO A N   1 
ATOM   3113 C CA  . PRO A 1 410 ? 25.312  5.137   3.931   1.00 45.29  ? 410  PRO A CA  1 
ATOM   3114 C C   . PRO A 1 410 ? 24.388  4.507   4.977   1.00 45.90  ? 410  PRO A C   1 
ATOM   3115 O O   . PRO A 1 410 ? 24.567  3.344   5.335   1.00 44.31  ? 410  PRO A O   1 
ATOM   3116 C CB  . PRO A 1 410 ? 26.303  6.060   4.590   1.00 44.39  ? 410  PRO A CB  1 
ATOM   3117 C CG  . PRO A 1 410 ? 26.732  6.979   3.458   1.00 44.06  ? 410  PRO A CG  1 
ATOM   3118 C CD  . PRO A 1 410 ? 25.382  7.299   2.819   1.00 44.97  ? 410  PRO A CD  1 
ATOM   3119 N N   . VAL A 1 411 ? 23.418  5.268   5.471   1.00 45.04  ? 411  VAL A N   1 
ATOM   3120 C CA  . VAL A 1 411 ? 22.472  4.729   6.433   1.00 45.86  ? 411  VAL A CA  1 
ATOM   3121 C C   . VAL A 1 411 ? 21.609  3.636   5.792   1.00 47.71  ? 411  VAL A C   1 
ATOM   3122 O O   . VAL A 1 411 ? 21.482  2.555   6.357   1.00 49.27  ? 411  VAL A O   1 
ATOM   3123 C CB  . VAL A 1 411 ? 21.587  5.841   7.026   1.00 44.99  ? 411  VAL A CB  1 
ATOM   3124 C CG1 . VAL A 1 411 ? 20.438  5.220   7.799   1.00 46.68  ? 411  VAL A CG1 1 
ATOM   3125 C CG2 . VAL A 1 411 ? 22.414  6.712   7.920   1.00 39.63  ? 411  VAL A CG2 1 
ATOM   3126 N N   . ALA A 1 412 ? 21.059  3.929   4.605   1.00 48.48  ? 412  ALA A N   1 
ATOM   3127 C CA  . ALA A 1 412 ? 20.258  2.987   3.823   1.00 49.94  ? 412  ALA A CA  1 
ATOM   3128 C C   . ALA A 1 412 ? 21.046  1.713   3.630   1.00 51.02  ? 412  ALA A C   1 
ATOM   3129 O O   . ALA A 1 412 ? 20.609  0.609   3.947   1.00 52.97  ? 412  ALA A O   1 
ATOM   3130 C CB  . ALA A 1 412 ? 19.905  3.609   2.464   1.00 50.37  ? 412  ALA A CB  1 
ATOM   3131 N N   . GLN A 1 413 ? 22.241  1.878   3.113   1.00 50.90  ? 413  GLN A N   1 
ATOM   3132 C CA  . GLN A 1 413 ? 23.221  0.821   3.176   1.00 51.43  ? 413  GLN A CA  1 
ATOM   3133 C C   . GLN A 1 413 ? 23.451  -0.027  4.426   1.00 51.44  ? 413  GLN A C   1 
ATOM   3134 O O   . GLN A 1 413 ? 23.343  -1.266  4.390   1.00 51.27  ? 413  GLN A O   1 
ATOM   3135 C CB  . GLN A 1 413 ? 24.319  0.905   2.121   1.00 52.12  ? 413  GLN A CB  1 
ATOM   3136 C CG  . GLN A 1 413 ? 25.585  0.221   2.442   1.00 54.64  ? 413  GLN A CG  1 
ATOM   3137 C CD  . GLN A 1 413 ? 26.315  -0.144  1.192   1.00 60.58  ? 413  GLN A CD  1 
ATOM   3138 O OE1 . GLN A 1 413 ? 26.051  -1.203  0.601   1.00 65.97  ? 413  GLN A OE1 1 
ATOM   3139 N NE2 . GLN A 1 413 ? 27.234  0.733   0.751   1.00 63.34  ? 413  GLN A NE2 1 
ATOM   3140 N N   . LEU A 1 414 ? 23.758  0.655   5.531   1.00 49.86  ? 414  LEU A N   1 
ATOM   3141 C CA  . LEU A 1 414 ? 23.916  0.004   6.825   1.00 50.02  ? 414  LEU A CA  1 
ATOM   3142 C C   . LEU A 1 414 ? 22.650  -0.758  7.211   1.00 51.08  ? 414  LEU A C   1 
ATOM   3143 O O   . LEU A 1 414 ? 22.711  -1.944  7.541   1.00 53.22  ? 414  LEU A O   1 
ATOM   3144 C CB  . LEU A 1 414 ? 24.272  1.055   7.889   1.00 49.15  ? 414  LEU A CB  1 
ATOM   3145 C CG  . LEU A 1 414 ? 24.600  0.564   9.308   1.00 48.67  ? 414  LEU A CG  1 
ATOM   3146 C CD1 . LEU A 1 414 ? 25.795  -0.325  9.267   1.00 48.30  ? 414  LEU A CD1 1 
ATOM   3147 C CD2 . LEU A 1 414 ? 24.845  1.750   10.246  1.00 46.05  ? 414  LEU A CD2 1 
ATOM   3148 N N   . ALA A 1 415 ? 21.498  -0.094  7.129   1.00 50.92  ? 415  ALA A N   1 
ATOM   3149 C CA  . ALA A 1 415 ? 20.221  -0.686  7.550   1.00 51.69  ? 415  ALA A CA  1 
ATOM   3150 C C   . ALA A 1 415 ? 19.937  -1.968  6.792   1.00 54.15  ? 415  ALA A C   1 
ATOM   3151 O O   . ALA A 1 415 ? 19.447  -2.950  7.361   1.00 55.27  ? 415  ALA A O   1 
ATOM   3152 C CB  . ALA A 1 415 ? 19.093  0.295   7.347   1.00 51.50  ? 415  ALA A CB  1 
ATOM   3153 N N   . GLY A 1 416 ? 20.239  -1.963  5.497   1.00 54.93  ? 416  GLY A N   1 
ATOM   3154 C CA  . GLY A 1 416 ? 20.030  -3.150  4.659   1.00 56.85  ? 416  GLY A CA  1 
ATOM   3155 C C   . GLY A 1 416 ? 20.984  -4.278  4.982   1.00 57.84  ? 416  GLY A C   1 
ATOM   3156 O O   . GLY A 1 416 ? 20.569  -5.429  5.079   1.00 59.52  ? 416  GLY A O   1 
ATOM   3157 N N   . ARG A 1 417 ? 22.272  -3.980  5.120   1.00 57.19  ? 417  ARG A N   1 
ATOM   3158 C CA  . ARG A 1 417 ? 23.222  -5.036  5.483   1.00 59.11  ? 417  ARG A CA  1 
ATOM   3159 C C   . ARG A 1 417 ? 22.877  -5.646  6.848   1.00 59.21  ? 417  ARG A C   1 
ATOM   3160 O O   . ARG A 1 417 ? 22.886  -6.866  7.002   1.00 61.42  ? 417  ARG A O   1 
ATOM   3161 C CB  . ARG A 1 417 ? 24.681  -4.545  5.468   1.00 58.54  ? 417  ARG A CB  1 
ATOM   3162 C CG  . ARG A 1 417 ? 25.236  -4.078  4.107   1.00 60.92  ? 417  ARG A CG  1 
ATOM   3163 C CD  . ARG A 1 417 ? 24.987  -5.022  2.935   1.00 66.94  ? 417  ARG A CD  1 
ATOM   3164 N NE  . ARG A 1 417 ? 25.651  -6.315  3.091   1.00 71.10  ? 417  ARG A NE  1 
ATOM   3165 C CZ  . ARG A 1 417 ? 25.943  -7.153  2.089   1.00 75.05  ? 417  ARG A CZ  1 
ATOM   3166 N NH1 . ARG A 1 417 ? 25.639  -6.846  0.826   1.00 76.39  ? 417  ARG A NH1 1 
ATOM   3167 N NH2 . ARG A 1 417 ? 26.558  -8.309  2.342   1.00 76.07  ? 417  ARG A NH2 1 
ATOM   3168 N N   . LEU A 1 418 ? 22.554  -4.804  7.823   1.00 57.72  ? 418  LEU A N   1 
ATOM   3169 C CA  . LEU A 1 418 ? 22.214  -5.279  9.168   1.00 57.83  ? 418  LEU A CA  1 
ATOM   3170 C C   . LEU A 1 418 ? 20.960  -6.126  9.152   1.00 59.49  ? 418  LEU A C   1 
ATOM   3171 O O   . LEU A 1 418 ? 20.957  -7.203  9.701   1.00 60.85  ? 418  LEU A O   1 
ATOM   3172 C CB  . LEU A 1 418 ? 22.029  -4.109  10.145  1.00 55.93  ? 418  LEU A CB  1 
ATOM   3173 C CG  . LEU A 1 418 ? 23.249  -3.236  10.476  1.00 53.90  ? 418  LEU A CG  1 
ATOM   3174 C CD1 . LEU A 1 418 ? 22.798  -2.059  11.316  1.00 51.11  ? 418  LEU A CD1 1 
ATOM   3175 C CD2 . LEU A 1 418 ? 24.367  -3.975  11.172  1.00 53.93  ? 418  LEU A CD2 1 
ATOM   3176 N N   . ALA A 1 419 ? 19.902  -5.632  8.516   1.00 59.50  ? 419  ALA A N   1 
ATOM   3177 C CA  . ALA A 1 419 ? 18.675  -6.393  8.371   1.00 61.66  ? 419  ALA A CA  1 
ATOM   3178 C C   . ALA A 1 419 ? 18.918  -7.728  7.641   1.00 63.88  ? 419  ALA A C   1 
ATOM   3179 O O   . ALA A 1 419 ? 18.416  -8.769  8.048   1.00 66.01  ? 419  ALA A O   1 
ATOM   3180 C CB  . ALA A 1 419 ? 17.633  -5.562  7.640   1.00 61.34  ? 419  ALA A CB  1 
ATOM   3181 N N   . ALA A 1 420 ? 19.707  -7.698  6.572   1.00 64.41  ? 420  ALA A N   1 
ATOM   3182 C CA  . ALA A 1 420 ? 19.987  -8.903  5.786   1.00 66.77  ? 420  ALA A CA  1 
ATOM   3183 C C   . ALA A 1 420 ? 20.723  -9.957  6.601   1.00 67.99  ? 420  ALA A C   1 
ATOM   3184 O O   . ALA A 1 420 ? 20.618  -11.147 6.325   1.00 70.47  ? 420  ALA A O   1 
ATOM   3185 C CB  . ALA A 1 420 ? 20.805  -8.546  4.541   1.00 66.28  ? 420  ALA A CB  1 
ATOM   3186 N N   . GLN A 1 421 ? 21.468  -9.508  7.605   1.00 67.01  ? 421  GLN A N   1 
ATOM   3187 C CA  . GLN A 1 421 ? 22.339  -10.376 8.382   1.00 67.96  ? 421  GLN A CA  1 
ATOM   3188 C C   . GLN A 1 421 ? 21.901  -10.576 9.841   1.00 67.29  ? 421  GLN A C   1 
ATOM   3189 O O   . GLN A 1 421 ? 22.742  -10.812 10.720  1.00 67.39  ? 421  GLN A O   1 
ATOM   3190 C CB  . GLN A 1 421 ? 23.766  -9.832  8.285   1.00 66.83  ? 421  GLN A CB  1 
ATOM   3191 C CG  . GLN A 1 421 ? 24.406  -10.205 6.940   1.00 70.24  ? 421  GLN A CG  1 
ATOM   3192 C CD  . GLN A 1 421 ? 25.210  -9.086  6.342   1.00 70.77  ? 421  GLN A CD  1 
ATOM   3193 O OE1 . GLN A 1 421 ? 25.837  -8.321  7.068   1.00 71.62  ? 421  GLN A OE1 1 
ATOM   3194 N NE2 . GLN A 1 421 ? 25.190  -8.969  5.007   1.00 72.67  ? 421  GLN A NE2 1 
ATOM   3195 N N   . GLY A 1 422 ? 20.591  -10.493 10.087  1.00 66.72  ? 422  GLY A N   1 
ATOM   3196 C CA  . GLY A 1 422 ? 19.999  -10.919 11.361  1.00 66.32  ? 422  GLY A CA  1 
ATOM   3197 C C   . GLY A 1 422 ? 19.571  -9.827  12.328  1.00 63.77  ? 422  GLY A C   1 
ATOM   3198 O O   . GLY A 1 422 ? 18.771  -10.076 13.226  1.00 64.07  ? 422  GLY A O   1 
ATOM   3199 N N   . ALA A 1 423 ? 20.097  -8.617  12.172  1.00 60.53  ? 423  ALA A N   1 
ATOM   3200 C CA  . ALA A 1 423 ? 19.745  -7.535  13.088  1.00 58.47  ? 423  ALA A CA  1 
ATOM   3201 C C   . ALA A 1 423 ? 18.256  -7.218  13.033  1.00 58.28  ? 423  ALA A C   1 
ATOM   3202 O O   . ALA A 1 423 ? 17.634  -7.349  11.985  1.00 59.71  ? 423  ALA A O   1 
ATOM   3203 C CB  . ALA A 1 423 ? 20.559  -6.270  12.782  1.00 56.07  ? 423  ALA A CB  1 
ATOM   3204 N N   . ARG A 1 424 ? 17.683  -6.859  14.180  1.00 57.47  ? 424  ARG A N   1 
ATOM   3205 C CA  A ARG A 1 424 ? 16.361  -6.244  14.216  0.50 57.21  ? 424  ARG A CA  1 
ATOM   3206 C CA  B ARG A 1 424 ? 16.362  -6.254  14.227  0.50 57.19  ? 424  ARG A CA  1 
ATOM   3207 C C   . ARG A 1 424 ? 16.581  -4.756  14.089  1.00 54.63  ? 424  ARG A C   1 
ATOM   3208 O O   . ARG A 1 424 ? 17.125  -4.153  14.985  1.00 53.62  ? 424  ARG A O   1 
ATOM   3209 C CB  A ARG A 1 424 ? 15.624  -6.527  15.523  0.50 57.73  ? 424  ARG A CB  1 
ATOM   3210 C CB  B ARG A 1 424 ? 15.670  -6.593  15.549  0.50 58.04  ? 424  ARG A CB  1 
ATOM   3211 C CG  A ARG A 1 424 ? 14.339  -5.688  15.673  0.50 58.13  ? 424  ARG A CG  1 
ATOM   3212 C CG  B ARG A 1 424 ? 14.331  -5.889  15.787  0.50 59.26  ? 424  ARG A CG  1 
ATOM   3213 C CD  A ARG A 1 424 ? 13.223  -6.403  16.443  0.50 60.93  ? 424  ARG A CD  1 
ATOM   3214 C CD  B ARG A 1 424 ? 13.225  -6.871  16.262  0.50 64.74  ? 424  ARG A CD  1 
ATOM   3215 N NE  A ARG A 1 424 ? 12.745  -7.605  15.749  0.50 63.63  ? 424  ARG A NE  1 
ATOM   3216 N NE  B ARG A 1 424 ? 13.635  -7.777  17.348  0.50 66.16  ? 424  ARG A NE  1 
ATOM   3217 C CZ  A ARG A 1 424 ? 11.568  -8.196  15.949  0.50 65.25  ? 424  ARG A CZ  1 
ATOM   3218 C CZ  B ARG A 1 424 ? 13.620  -7.479  18.651  0.50 66.68  ? 424  ARG A CZ  1 
ATOM   3219 N NH1 A ARG A 1 424 ? 10.686  -7.705  16.819  0.50 65.42  ? 424  ARG A NH1 1 
ATOM   3220 N NH1 B ARG A 1 424 ? 13.223  -6.283  19.089  0.50 64.23  ? 424  ARG A NH1 1 
ATOM   3221 N NH2 A ARG A 1 424 ? 11.269  -9.282  15.251  0.50 66.43  ? 424  ARG A NH2 1 
ATOM   3222 N NH2 B ARG A 1 424 ? 14.013  -8.396  19.529  0.50 67.56  ? 424  ARG A NH2 1 
ATOM   3223 N N   . VAL A 1 425 ? 16.146  -4.173  12.970  1.00 53.86  ? 425  VAL A N   1 
ATOM   3224 C CA  . VAL A 1 425 ? 16.433  -2.755  12.650  1.00 51.03  ? 425  VAL A CA  1 
ATOM   3225 C C   . VAL A 1 425 ? 15.147  -1.924  12.621  1.00 51.03  ? 425  VAL A C   1 
ATOM   3226 O O   . VAL A 1 425 ? 14.115  -2.417  12.182  1.00 52.46  ? 425  VAL A O   1 
ATOM   3227 C CB  . VAL A 1 425 ? 17.137  -2.637  11.262  1.00 51.12  ? 425  VAL A CB  1 
ATOM   3228 C CG1 . VAL A 1 425 ? 17.705  -1.209  11.007  1.00 46.79  ? 425  VAL A CG1 1 
ATOM   3229 C CG2 . VAL A 1 425 ? 18.252  -3.667  11.123  1.00 51.72  ? 425  VAL A CG2 1 
ATOM   3230 N N   . TYR A 1 426 ? 15.229  -0.672  13.080  1.00 49.05  ? 426  TYR A N   1 
ATOM   3231 C CA  . TYR A 1 426 ? 14.128  0.308   13.034  1.00 48.15  ? 426  TYR A CA  1 
ATOM   3232 C C   . TYR A 1 426 ? 14.690  1.561   12.420  1.00 46.96  ? 426  TYR A C   1 
ATOM   3233 O O   . TYR A 1 426 ? 15.730  1.994   12.837  1.00 45.30  ? 426  TYR A O   1 
ATOM   3234 C CB  . TYR A 1 426 ? 13.601  0.642   14.437  1.00 47.49  ? 426  TYR A CB  1 
ATOM   3235 C CG  . TYR A 1 426 ? 12.790  -0.496  15.070  1.00 47.11  ? 426  TYR A CG  1 
ATOM   3236 C CD1 . TYR A 1 426 ? 13.385  -1.399  15.943  1.00 47.51  ? 426  TYR A CD1 1 
ATOM   3237 C CD2 . TYR A 1 426 ? 11.451  -0.659  14.774  1.00 48.36  ? 426  TYR A CD2 1 
ATOM   3238 C CE1 . TYR A 1 426 ? 12.639  -2.471  16.518  1.00 49.07  ? 426  TYR A CE1 1 
ATOM   3239 C CE2 . TYR A 1 426 ? 10.699  -1.707  15.324  1.00 48.68  ? 426  TYR A CE2 1 
ATOM   3240 C CZ  . TYR A 1 426 ? 11.303  -2.607  16.204  1.00 51.03  ? 426  TYR A CZ  1 
ATOM   3241 O OH  . TYR A 1 426 ? 10.559  -3.654  16.759  1.00 54.08  ? 426  TYR A OH  1 
ATOM   3242 N N   . ALA A 1 427 ? 14.019  2.128   11.418  1.00 47.45  ? 427  ALA A N   1 
ATOM   3243 C CA  . ALA A 1 427 ? 14.568  3.287   10.684  1.00 46.32  ? 427  ALA A CA  1 
ATOM   3244 C C   . ALA A 1 427 ? 13.579  4.437   10.724  1.00 46.33  ? 427  ALA A C   1 
ATOM   3245 O O   . ALA A 1 427 ? 12.384  4.202   10.731  1.00 46.21  ? 427  ALA A O   1 
ATOM   3246 C CB  . ALA A 1 427 ? 14.888  2.892   9.217   1.00 46.16  ? 427  ALA A CB  1 
ATOM   3247 N N   . TYR A 1 428 ? 14.071  5.673   10.743  1.00 45.78  ? 428  TYR A N   1 
ATOM   3248 C CA  . TYR A 1 428 ? 13.193  6.843   10.706  1.00 46.62  ? 428  TYR A CA  1 
ATOM   3249 C C   . TYR A 1 428 ? 13.738  7.885   9.767   1.00 47.13  ? 428  TYR A C   1 
ATOM   3250 O O   . TYR A 1 428 ? 14.920  7.839   9.380   1.00 46.66  ? 428  TYR A O   1 
ATOM   3251 C CB  . TYR A 1 428 ? 13.047  7.492   12.113  1.00 46.23  ? 428  TYR A CB  1 
ATOM   3252 C CG  . TYR A 1 428 ? 14.344  8.039   12.705  1.00 44.07  ? 428  TYR A CG  1 
ATOM   3253 C CD1 . TYR A 1 428 ? 14.772  9.310   12.430  1.00 43.93  ? 428  TYR A CD1 1 
ATOM   3254 C CD2 . TYR A 1 428 ? 15.154  7.247   13.515  1.00 44.94  ? 428  TYR A CD2 1 
ATOM   3255 C CE1 . TYR A 1 428 ? 15.957  9.793   12.932  1.00 42.42  ? 428  TYR A CE1 1 
ATOM   3256 C CE2 . TYR A 1 428 ? 16.335  7.724   14.046  1.00 39.62  ? 428  TYR A CE2 1 
ATOM   3257 C CZ  . TYR A 1 428 ? 16.748  8.990   13.735  1.00 41.97  ? 428  TYR A CZ  1 
ATOM   3258 O OH  . TYR A 1 428 ? 17.938  9.477   14.251  1.00 39.44  ? 428  TYR A OH  1 
ATOM   3259 N N   . ILE A 1 429 ? 12.876  8.843   9.434   1.00 48.49  ? 429  ILE A N   1 
ATOM   3260 C CA  . ILE A 1 429 ? 13.300  10.146  8.944   1.00 48.86  ? 429  ILE A CA  1 
ATOM   3261 C C   . ILE A 1 429 ? 12.643  11.218  9.807   1.00 49.19  ? 429  ILE A C   1 
ATOM   3262 O O   . ILE A 1 429 ? 11.445  11.174  10.033  1.00 50.21  ? 429  ILE A O   1 
ATOM   3263 C CB  . ILE A 1 429 ? 12.916  10.368  7.474   1.00 49.91  ? 429  ILE A CB  1 
ATOM   3264 C CG1 . ILE A 1 429 ? 13.450  11.716  6.992   1.00 48.65  ? 429  ILE A CG1 1 
ATOM   3265 C CG2 . ILE A 1 429 ? 11.409  10.332  7.282   1.00 51.33  ? 429  ILE A CG2 1 
ATOM   3266 C CD1 . ILE A 1 429 ? 13.450  11.853  5.497   1.00 50.07  ? 429  ILE A CD1 1 
ATOM   3267 N N   . PHE A 1 430 ? 13.436  12.182  10.274  1.00 48.50  ? 430  PHE A N   1 
ATOM   3268 C CA  . PHE A 1 430 ? 12.964  13.221  11.182  1.00 48.33  ? 430  PHE A CA  1 
ATOM   3269 C C   . PHE A 1 430 ? 12.687  14.456  10.364  1.00 49.03  ? 430  PHE A C   1 
ATOM   3270 O O   . PHE A 1 430 ? 13.571  14.959  9.683   1.00 48.14  ? 430  PHE A O   1 
ATOM   3271 C CB  . PHE A 1 430 ? 14.025  13.477  12.248  1.00 47.15  ? 430  PHE A CB  1 
ATOM   3272 C CG  . PHE A 1 430 ? 13.676  14.551  13.224  1.00 47.69  ? 430  PHE A CG  1 
ATOM   3273 C CD1 . PHE A 1 430 ? 14.094  15.860  13.011  1.00 47.01  ? 430  PHE A CD1 1 
ATOM   3274 C CD2 . PHE A 1 430 ? 12.965  14.264  14.377  1.00 48.54  ? 430  PHE A CD2 1 
ATOM   3275 C CE1 . PHE A 1 430 ? 13.775  16.868  13.912  1.00 46.09  ? 430  PHE A CE1 1 
ATOM   3276 C CE2 . PHE A 1 430 ? 12.667  15.273  15.289  1.00 48.30  ? 430  PHE A CE2 1 
ATOM   3277 C CZ  . PHE A 1 430 ? 13.061  16.578  15.038  1.00 47.53  ? 430  PHE A CZ  1 
ATOM   3278 N N   . GLU A 1 431 ? 11.459  14.961  10.418  1.00 50.36  ? 431  GLU A N   1 
ATOM   3279 C CA  . GLU A 1 431 ? 11.078  16.033  9.504   1.00 51.62  ? 431  GLU A CA  1 
ATOM   3280 C C   . GLU A 1 431 ? 10.473  17.255  10.167  1.00 52.32  ? 431  GLU A C   1 
ATOM   3281 O O   . GLU A 1 431 ? 9.821   18.056  9.485   1.00 53.43  ? 431  GLU A O   1 
ATOM   3282 C CB  . GLU A 1 431 ? 10.073  15.523  8.494   1.00 52.69  ? 431  GLU A CB  1 
ATOM   3283 C CG  . GLU A 1 431 ? 10.464  14.284  7.749   1.00 53.97  ? 431  GLU A CG  1 
ATOM   3284 C CD  . GLU A 1 431 ? 9.408   13.897  6.729   1.00 56.28  ? 431  GLU A CD  1 
ATOM   3285 O OE1 . GLU A 1 431 ? 8.210   13.798  7.117   1.00 60.97  ? 431  GLU A OE1 1 
ATOM   3286 O OE2 . GLU A 1 431 ? 9.774   13.715  5.538   1.00 59.83  ? 431  GLU A OE2 1 
ATOM   3287 N N   . HIS A 1 432 ? 10.668  17.429  11.470  1.00 51.94  ? 432  HIS A N   1 
ATOM   3288 C CA  . HIS A 1 432 ? 10.176  18.637  12.110  1.00 52.39  ? 432  HIS A CA  1 
ATOM   3289 C C   . HIS A 1 432 ? 11.283  19.681  12.255  1.00 51.70  ? 432  HIS A C   1 
ATOM   3290 O O   . HIS A 1 432 ? 12.338  19.397  12.852  1.00 50.28  ? 432  HIS A O   1 
ATOM   3291 C CB  . HIS A 1 432 ? 9.564   18.345  13.466  1.00 52.97  ? 432  HIS A CB  1 
ATOM   3292 C CG  . HIS A 1 432 ? 9.165   19.583  14.196  1.00 54.11  ? 432  HIS A CG  1 
ATOM   3293 N ND1 . HIS A 1 432 ? 8.148   20.408  13.762  1.00 55.91  ? 432  HIS A ND1 1 
ATOM   3294 C CD2 . HIS A 1 432 ? 9.691   20.180  15.291  1.00 54.57  ? 432  HIS A CD2 1 
ATOM   3295 C CE1 . HIS A 1 432 ? 8.049   21.443  14.576  1.00 56.52  ? 432  HIS A CE1 1 
ATOM   3296 N NE2 . HIS A 1 432 ? 8.969   21.326  15.515  1.00 54.03  ? 432  HIS A NE2 1 
ATOM   3297 N N   . ARG A 1 433 ? 11.036  20.875  11.716  1.00 52.06  ? 433  ARG A N   1 
ATOM   3298 C CA  . ARG A 1 433 ? 11.964  22.000  11.871  1.00 52.49  ? 433  ARG A CA  1 
ATOM   3299 C C   . ARG A 1 433 ? 11.635  22.722  13.173  1.00 53.26  ? 433  ARG A C   1 
ATOM   3300 O O   . ARG A 1 433 ? 10.520  23.230  13.343  1.00 53.67  ? 433  ARG A O   1 
ATOM   3301 C CB  . ARG A 1 433 ? 11.888  22.974  10.679  1.00 52.66  ? 433  ARG A CB  1 
ATOM   3302 C CG  . ARG A 1 433 ? 12.412  24.368  11.008  1.00 55.39  ? 433  ARG A CG  1 
ATOM   3303 C CD  . ARG A 1 433 ? 12.333  25.413  9.872   1.00 55.56  ? 433  ARG A CD  1 
ATOM   3304 N NE  . ARG A 1 433 ? 13.640  25.501  9.274   1.00 58.52  ? 433  ARG A NE  1 
ATOM   3305 C CZ  . ARG A 1 433 ? 14.496  26.515  9.371   1.00 58.12  ? 433  ARG A CZ  1 
ATOM   3306 N NH1 . ARG A 1 433 ? 14.192  27.657  9.975   1.00 56.80  ? 433  ARG A NH1 1 
ATOM   3307 N NH2 . ARG A 1 433 ? 15.679  26.372  8.781   1.00 57.35  ? 433  ARG A NH2 1 
ATOM   3308 N N   . ALA A 1 434 ? 12.589  22.741  14.107  1.00 52.44  ? 434  ALA A N   1 
ATOM   3309 C CA  . ALA A 1 434 ? 12.367  23.409  15.392  1.00 53.13  ? 434  ALA A CA  1 
ATOM   3310 C C   . ALA A 1 434 ? 11.917  24.812  15.120  1.00 53.91  ? 434  ALA A C   1 
ATOM   3311 O O   . ALA A 1 434 ? 12.466  25.479  14.256  1.00 53.55  ? 434  ALA A O   1 
ATOM   3312 C CB  . ALA A 1 434 ? 13.636  23.413  16.237  1.00 52.37  ? 434  ALA A CB  1 
ATOM   3313 N N   . SER A 1 435 ? 10.910  25.256  15.868  1.00 55.56  ? 435  SER A N   1 
ATOM   3314 C CA  . SER A 1 435 ? 10.349  26.586  15.721  1.00 56.65  ? 435  SER A CA  1 
ATOM   3315 C C   . SER A 1 435 ? 11.303  27.700  16.162  1.00 57.46  ? 435  SER A C   1 
ATOM   3316 O O   . SER A 1 435 ? 11.097  28.878  15.834  1.00 58.41  ? 435  SER A O   1 
ATOM   3317 C CB  . SER A 1 435 ? 9.037   26.690  16.514  1.00 58.07  ? 435  SER A CB  1 
ATOM   3318 O OG  . SER A 1 435 ? 9.243   26.527  17.904  1.00 56.22  ? 435  SER A OG  1 
ATOM   3319 N N   . THR A 1 436 ? 12.326  27.324  16.918  1.00 56.75  ? 436  THR A N   1 
ATOM   3320 C CA  . THR A 1 436 ? 13.299  28.246  17.484  1.00 57.27  ? 436  THR A CA  1 
ATOM   3321 C C   . THR A 1 436 ? 14.601  28.279  16.668  1.00 56.60  ? 436  THR A C   1 
ATOM   3322 O O   . THR A 1 436 ? 15.583  28.868  17.111  1.00 57.02  ? 436  THR A O   1 
ATOM   3323 C CB  . THR A 1 436 ? 13.683  27.775  18.900  1.00 57.02  ? 436  THR A CB  1 
ATOM   3324 O OG1 . THR A 1 436 ? 14.161  26.436  18.807  1.00 54.55  ? 436  THR A OG1 1 
ATOM   3325 C CG2 . THR A 1 436 ? 12.483  27.812  19.847  1.00 57.77  ? 436  THR A CG2 1 
ATOM   3326 N N   . LEU A 1 437 ? 14.618  27.659  15.489  1.00 55.95  ? 437  LEU A N   1 
ATOM   3327 C CA  . LEU A 1 437 ? 15.849  27.528  14.701  1.00 54.55  ? 437  LEU A CA  1 
ATOM   3328 C C   . LEU A 1 437 ? 16.247  28.890  14.161  1.00 54.67  ? 437  LEU A C   1 
ATOM   3329 O O   . LEU A 1 437 ? 15.391  29.655  13.760  1.00 56.14  ? 437  LEU A O   1 
ATOM   3330 C CB  . LEU A 1 437 ? 15.636  26.543  13.555  1.00 54.12  ? 437  LEU A CB  1 
ATOM   3331 C CG  . LEU A 1 437 ? 16.789  25.670  13.019  1.00 52.78  ? 437  LEU A CG  1 
ATOM   3332 C CD1 . LEU A 1 437 ? 17.914  25.544  13.968  1.00 52.49  ? 437  LEU A CD1 1 
ATOM   3333 C CD2 . LEU A 1 437 ? 16.254  24.330  12.658  1.00 51.40  ? 437  LEU A CD2 1 
ATOM   3334 N N   . THR A 1 438 ? 17.538  29.199  14.187  1.00 53.81  ? 438  THR A N   1 
ATOM   3335 C CA  . THR A 1 438 ? 18.050  30.507  13.741  1.00 54.37  ? 438  THR A CA  1 
ATOM   3336 C C   . THR A 1 438 ? 18.691  30.436  12.361  1.00 53.89  ? 438  THR A C   1 
ATOM   3337 O O   . THR A 1 438 ? 19.004  31.463  11.775  1.00 55.20  ? 438  THR A O   1 
ATOM   3338 C CB  . THR A 1 438 ? 19.100  31.076  14.717  1.00 53.82  ? 438  THR A CB  1 
ATOM   3339 O OG1 . THR A 1 438 ? 20.041  30.055  15.091  1.00 53.80  ? 438  THR A OG1 1 
ATOM   3340 C CG2 . THR A 1 438 ? 18.440  31.594  15.950  1.00 55.57  ? 438  THR A CG2 1 
ATOM   3341 N N   . TRP A 1 439 ? 18.904  29.232  11.842  1.00 52.92  ? 439  TRP A N   1 
ATOM   3342 C CA  . TRP A 1 439 ? 19.308  29.082  10.451  1.00 52.78  ? 439  TRP A CA  1 
ATOM   3343 C C   . TRP A 1 439 ? 18.139  29.408  9.526   1.00 53.55  ? 439  TRP A C   1 
ATOM   3344 O O   . TRP A 1 439 ? 16.974  29.255  9.919   1.00 54.48  ? 439  TRP A O   1 
ATOM   3345 C CB  . TRP A 1 439 ? 19.736  27.669  10.177  1.00 51.94  ? 439  TRP A CB  1 
ATOM   3346 C CG  . TRP A 1 439 ? 20.919  27.242  10.884  1.00 50.55  ? 439  TRP A CG  1 
ATOM   3347 C CD1 . TRP A 1 439 ? 20.952  26.452  11.962  1.00 51.08  ? 439  TRP A CD1 1 
ATOM   3348 C CD2 . TRP A 1 439 ? 22.278  27.536  10.546  1.00 51.63  ? 439  TRP A CD2 1 
ATOM   3349 N NE1 . TRP A 1 439 ? 22.248  26.221  12.338  1.00 51.29  ? 439  TRP A NE1 1 
ATOM   3350 C CE2 . TRP A 1 439 ? 23.085  26.878  11.483  1.00 50.45  ? 439  TRP A CE2 1 
ATOM   3351 C CE3 . TRP A 1 439 ? 22.891  28.305  9.549   1.00 51.57  ? 439  TRP A CE3 1 
ATOM   3352 C CZ2 . TRP A 1 439 ? 24.483  26.943  11.454  1.00 50.30  ? 439  TRP A CZ2 1 
ATOM   3353 C CZ3 . TRP A 1 439 ? 24.282  28.368  9.519   1.00 51.39  ? 439  TRP A CZ3 1 
ATOM   3354 C CH2 . TRP A 1 439 ? 25.058  27.693  10.469  1.00 50.46  ? 439  TRP A CH2 1 
ATOM   3355 N N   . PRO A 1 440 ? 18.441  29.829  8.281   1.00 53.33  ? 440  PRO A N   1 
ATOM   3356 C CA  . PRO A 1 440 ? 17.383  30.308  7.407   1.00 53.90  ? 440  PRO A CA  1 
ATOM   3357 C C   . PRO A 1 440 ? 16.513  29.155  6.965   1.00 53.21  ? 440  PRO A C   1 
ATOM   3358 O O   . PRO A 1 440 ? 16.944  27.999  7.033   1.00 50.32  ? 440  PRO A O   1 
ATOM   3359 C CB  . PRO A 1 440 ? 18.151  30.886  6.212   1.00 54.37  ? 440  PRO A CB  1 
ATOM   3360 C CG  . PRO A 1 440 ? 19.399  30.117  6.182   1.00 52.81  ? 440  PRO A CG  1 
ATOM   3361 C CD  . PRO A 1 440 ? 19.753  29.896  7.617   1.00 52.53  ? 440  PRO A CD  1 
ATOM   3362 N N   . LEU A 1 441 ? 15.312  29.484  6.502   1.00 53.31  ? 441  LEU A N   1 
ATOM   3363 C CA  . LEU A 1 441 ? 14.328  28.484  6.118   1.00 53.56  ? 441  LEU A CA  1 
ATOM   3364 C C   . LEU A 1 441 ? 14.817  27.559  5.015   1.00 52.93  ? 441  LEU A C   1 
ATOM   3365 O O   . LEU A 1 441 ? 14.459  26.388  5.014   1.00 52.59  ? 441  LEU A O   1 
ATOM   3366 C CB  . LEU A 1 441 ? 13.029  29.163  5.669   1.00 54.80  ? 441  LEU A CB  1 
ATOM   3367 C CG  . LEU A 1 441 ? 12.281  29.882  6.791   1.00 55.54  ? 441  LEU A CG  1 
ATOM   3368 C CD1 . LEU A 1 441 ? 11.223  30.896  6.249   1.00 55.14  ? 441  LEU A CD1 1 
ATOM   3369 C CD2 . LEU A 1 441 ? 11.628  28.869  7.706   1.00 55.62  ? 441  LEU A CD2 1 
ATOM   3370 N N   . TRP A 1 442 ? 15.622  28.078  4.079   1.00 52.89  ? 442  TRP A N   1 
ATOM   3371 C CA  . TRP A 1 442 ? 16.031  27.286  2.932   1.00 52.48  ? 442  TRP A CA  1 
ATOM   3372 C C   . TRP A 1 442 ? 16.771  26.040  3.381   1.00 51.42  ? 442  TRP A C   1 
ATOM   3373 O O   . TRP A 1 442 ? 16.785  25.058  2.651   1.00 51.57  ? 442  TRP A O   1 
ATOM   3374 C CB  . TRP A 1 442 ? 16.851  28.089  1.899   1.00 52.69  ? 442  TRP A CB  1 
ATOM   3375 C CG  . TRP A 1 442 ? 18.295  28.467  2.248   1.00 51.45  ? 442  TRP A CG  1 
ATOM   3376 C CD1 . TRP A 1 442 ? 18.763  29.712  2.626   1.00 51.77  ? 442  TRP A CD1 1 
ATOM   3377 C CD2 . TRP A 1 442 ? 19.450  27.611  2.190   1.00 50.14  ? 442  TRP A CD2 1 
ATOM   3378 N NE1 . TRP A 1 442 ? 20.129  29.658  2.830   1.00 52.24  ? 442  TRP A NE1 1 
ATOM   3379 C CE2 . TRP A 1 442 ? 20.568  28.385  2.582   1.00 48.12  ? 442  TRP A CE2 1 
ATOM   3380 C CE3 . TRP A 1 442 ? 19.640  26.262  1.859   1.00 48.81  ? 442  TRP A CE3 1 
ATOM   3381 C CZ2 . TRP A 1 442 ? 21.835  27.862  2.656   1.00 49.64  ? 442  TRP A CZ2 1 
ATOM   3382 C CZ3 . TRP A 1 442 ? 20.900  25.735  1.926   1.00 47.90  ? 442  TRP A CZ3 1 
ATOM   3383 C CH2 . TRP A 1 442 ? 21.996  26.539  2.323   1.00 48.88  ? 442  TRP A CH2 1 
ATOM   3384 N N   . MET A 1 443 ? 17.362  26.067  4.580   1.00 51.06  ? 443  MET A N   1 
ATOM   3385 C CA  . MET A 1 443 ? 18.146  24.920  5.083   1.00 49.89  ? 443  MET A CA  1 
ATOM   3386 C C   . MET A 1 443 ? 17.299  23.780  5.605   1.00 49.18  ? 443  MET A C   1 
ATOM   3387 O O   . MET A 1 443 ? 17.829  22.718  5.918   1.00 47.88  ? 443  MET A O   1 
ATOM   3388 C CB  . MET A 1 443 ? 19.127  25.336  6.169   1.00 49.72  ? 443  MET A CB  1 
ATOM   3389 C CG  . MET A 1 443 ? 20.237  26.235  5.687   1.00 49.50  ? 443  MET A CG  1 
ATOM   3390 S SD  . MET A 1 443 ? 21.630  26.319  6.831   1.00 50.62  ? 443  MET A SD  1 
ATOM   3391 C CE  . MET A 1 443 ? 22.349  27.823  6.238   1.00 51.79  ? 443  MET A CE  1 
ATOM   3392 N N   . GLY A 1 444 ? 15.995  23.997  5.720   1.00 49.78  ? 444  GLY A N   1 
ATOM   3393 C CA  . GLY A 1 444 ? 15.085  22.928  6.104   1.00 49.65  ? 444  GLY A CA  1 
ATOM   3394 C C   . GLY A 1 444 ? 15.270  22.443  7.526   1.00 48.85  ? 444  GLY A C   1 
ATOM   3395 O O   . GLY A 1 444 ? 15.255  23.242  8.468   1.00 48.41  ? 444  GLY A O   1 
ATOM   3396 N N   . VAL A 1 445 ? 15.411  21.122  7.667   1.00 48.18  ? 445  VAL A N   1 
ATOM   3397 C CA  . VAL A 1 445 ? 15.603  20.460  8.959   1.00 47.55  ? 445  VAL A CA  1 
ATOM   3398 C C   . VAL A 1 445 ? 17.021  19.942  8.909   1.00 46.87  ? 445  VAL A C   1 
ATOM   3399 O O   . VAL A 1 445 ? 17.249  18.819  8.417   1.00 46.92  ? 445  VAL A O   1 
ATOM   3400 C CB  . VAL A 1 445 ? 14.566  19.288  9.200   1.00 47.66  ? 445  VAL A CB  1 
ATOM   3401 C CG1 . VAL A 1 445 ? 14.739  18.677  10.599  1.00 45.46  ? 445  VAL A CG1 1 
ATOM   3402 C CG2 . VAL A 1 445 ? 13.133  19.789  9.001   1.00 49.06  ? 445  VAL A CG2 1 
ATOM   3403 N N   . PRO A 1 446 ? 17.991  20.769  9.365   1.00 46.35  ? 446  PRO A N   1 
ATOM   3404 C CA  . PRO A 1 446 ? 19.388  20.464  9.162   1.00 45.58  ? 446  PRO A CA  1 
ATOM   3405 C C   . PRO A 1 446 ? 19.952  19.460  10.123  1.00 45.22  ? 446  PRO A C   1 
ATOM   3406 O O   . PRO A 1 446 ? 19.361  19.156  11.140  1.00 44.88  ? 446  PRO A O   1 
ATOM   3407 C CB  . PRO A 1 446 ? 20.101  21.818  9.376   1.00 45.73  ? 446  PRO A CB  1 
ATOM   3408 C CG  . PRO A 1 446 ? 19.044  22.811  9.649   1.00 46.96  ? 446  PRO A CG  1 
ATOM   3409 C CD  . PRO A 1 446 ? 17.844  22.038  10.085  1.00 47.11  ? 446  PRO A CD  1 
ATOM   3410 N N   . HIS A 1 447 ? 21.127  18.965  9.749   1.00 45.26  ? 447  HIS A N   1 
ATOM   3411 C CA  . HIS A 1 447 ? 21.904  17.999  10.493  1.00 44.55  ? 447  HIS A CA  1 
ATOM   3412 C C   . HIS A 1 447 ? 22.045  18.443  11.946  1.00 44.60  ? 447  HIS A C   1 
ATOM   3413 O O   . HIS A 1 447 ? 22.429  19.603  12.220  1.00 43.65  ? 447  HIS A O   1 
ATOM   3414 C CB  . HIS A 1 447 ? 23.282  17.972  9.833   1.00 44.75  ? 447  HIS A CB  1 
ATOM   3415 C CG  . HIS A 1 447 ? 24.165  16.851  10.270  1.00 44.18  ? 447  HIS A CG  1 
ATOM   3416 N ND1 . HIS A 1 447 ? 23.919  15.539  9.944   1.00 47.52  ? 447  HIS A ND1 1 
ATOM   3417 C CD2 . HIS A 1 447 ? 25.358  16.863  10.902  1.00 46.32  ? 447  HIS A CD2 1 
ATOM   3418 C CE1 . HIS A 1 447 ? 24.888  14.780  10.420  1.00 46.13  ? 447  HIS A CE1 1 
ATOM   3419 N NE2 . HIS A 1 447 ? 25.778  15.562  11.002  1.00 46.01  ? 447  HIS A NE2 1 
ATOM   3420 N N   . GLY A 1 448 ? 21.737  17.527  12.870  1.00 43.66  ? 448  GLY A N   1 
ATOM   3421 C CA  . GLY A 1 448 ? 21.825  17.818  14.315  1.00 43.62  ? 448  GLY A CA  1 
ATOM   3422 C C   . GLY A 1 448 ? 20.607  18.428  15.010  1.00 43.20  ? 448  GLY A C   1 
ATOM   3423 O O   . GLY A 1 448 ? 20.584  18.541  16.237  1.00 43.62  ? 448  GLY A O   1 
ATOM   3424 N N   . TYR A 1 449 ? 19.563  18.765  14.268  1.00 42.85  ? 449  TYR A N   1 
ATOM   3425 C CA  . TYR A 1 449 ? 18.427  19.481  14.871  1.00 42.89  ? 449  TYR A CA  1 
ATOM   3426 C C   . TYR A 1 449 ? 17.241  18.610  15.304  1.00 43.95  ? 449  TYR A C   1 
ATOM   3427 O O   . TYR A 1 449 ? 16.131  19.094  15.581  1.00 42.74  ? 449  TYR A O   1 
ATOM   3428 C CB  . TYR A 1 449 ? 18.069  20.631  13.968  1.00 44.38  ? 449  TYR A CB  1 
ATOM   3429 C CG  . TYR A 1 449 ? 19.120  21.708  14.143  1.00 43.84  ? 449  TYR A CG  1 
ATOM   3430 C CD1 . TYR A 1 449 ? 20.257  21.742  13.357  1.00 44.93  ? 449  TYR A CD1 1 
ATOM   3431 C CD2 . TYR A 1 449 ? 18.996  22.662  15.139  1.00 45.66  ? 449  TYR A CD2 1 
ATOM   3432 C CE1 . TYR A 1 449 ? 21.255  22.725  13.554  1.00 44.12  ? 449  TYR A CE1 1 
ATOM   3433 C CE2 . TYR A 1 449 ? 19.979  23.650  15.333  1.00 45.51  ? 449  TYR A CE2 1 
ATOM   3434 C CZ  . TYR A 1 449 ? 21.104  23.664  14.548  1.00 44.35  ? 449  TYR A CZ  1 
ATOM   3435 O OH  . TYR A 1 449 ? 22.080  24.642  14.781  1.00 47.78  ? 449  TYR A OH  1 
ATOM   3436 N N   . GLU A 1 450 ? 17.498  17.306  15.383  1.00 42.40  ? 450  GLU A N   1 
ATOM   3437 C CA  . GLU A 1 450 ? 16.609  16.375  16.061  1.00 43.44  ? 450  GLU A CA  1 
ATOM   3438 C C   . GLU A 1 450 ? 17.067  16.128  17.492  1.00 43.22  ? 450  GLU A C   1 
ATOM   3439 O O   . GLU A 1 450 ? 16.302  15.702  18.316  1.00 43.38  ? 450  GLU A O   1 
ATOM   3440 C CB  . GLU A 1 450 ? 16.579  15.043  15.323  1.00 44.08  ? 450  GLU A CB  1 
ATOM   3441 C CG  . GLU A 1 450 ? 17.674  14.092  15.660  1.00 42.87  ? 450  GLU A CG  1 
ATOM   3442 C CD  . GLU A 1 450 ? 19.040  14.461  15.108  1.00 44.28  ? 450  GLU A CD  1 
ATOM   3443 O OE1 . GLU A 1 450 ? 19.312  15.644  14.790  1.00 45.58  ? 450  GLU A OE1 1 
ATOM   3444 O OE2 . GLU A 1 450 ? 19.878  13.533  14.971  1.00 39.84  ? 450  GLU A OE2 1 
ATOM   3445 N N   . ILE A 1 451 ? 18.321  16.428  17.795  1.00 43.74  ? 451  ILE A N   1 
ATOM   3446 C CA  . ILE A 1 451 ? 18.917  15.984  19.052  1.00 44.14  ? 451  ILE A CA  1 
ATOM   3447 C C   . ILE A 1 451 ? 18.177  16.608  20.229  1.00 44.63  ? 451  ILE A C   1 
ATOM   3448 O O   . ILE A 1 451 ? 17.798  15.924  21.207  1.00 43.89  ? 451  ILE A O   1 
ATOM   3449 C CB  . ILE A 1 451 ? 20.402  16.378  19.159  1.00 43.52  ? 451  ILE A CB  1 
ATOM   3450 C CG1 . ILE A 1 451 ? 21.245  15.678  18.079  1.00 43.24  ? 451  ILE A CG1 1 
ATOM   3451 C CG2 . ILE A 1 451 ? 20.913  16.041  20.572  1.00 41.65  ? 451  ILE A CG2 1 
ATOM   3452 C CD1 . ILE A 1 451 ? 22.667  16.244  17.961  1.00 41.98  ? 451  ILE A CD1 1 
ATOM   3453 N N   . GLU A 1 452 ? 17.965  17.907  20.122  1.00 45.04  ? 452  GLU A N   1 
ATOM   3454 C CA  . GLU A 1 452 ? 17.279  18.662  21.171  1.00 46.11  ? 452  GLU A CA  1 
ATOM   3455 C C   . GLU A 1 452 ? 15.886  18.158  21.502  1.00 46.53  ? 452  GLU A C   1 
ATOM   3456 O O   . GLU A 1 452 ? 15.390  18.429  22.589  1.00 48.02  ? 452  GLU A O   1 
ATOM   3457 C CB  . GLU A 1 452 ? 17.196  20.156  20.809  1.00 46.73  ? 452  GLU A CB  1 
ATOM   3458 C CG  . GLU A 1 452 ? 16.388  20.479  19.549  1.00 48.62  ? 452  GLU A CG  1 
ATOM   3459 C CD  . GLU A 1 452 ? 16.806  21.796  18.925  1.00 49.85  ? 452  GLU A CD  1 
ATOM   3460 O OE1 . GLU A 1 452 ? 15.963  22.677  18.782  1.00 51.79  ? 452  GLU A OE1 1 
ATOM   3461 O OE2 . GLU A 1 452 ? 17.997  21.962  18.597  1.00 54.67  ? 452  GLU A OE2 1 
ATOM   3462 N N   . PHE A 1 453 ? 15.228  17.482  20.563  1.00 46.13  ? 453  PHE A N   1 
ATOM   3463 C CA  . PHE A 1 453 ? 13.908  16.854  20.835  1.00 46.24  ? 453  PHE A CA  1 
ATOM   3464 C C   . PHE A 1 453 ? 14.030  15.528  21.564  1.00 46.26  ? 453  PHE A C   1 
ATOM   3465 O O   . PHE A 1 453 ? 13.231  15.194  22.433  1.00 47.61  ? 453  PHE A O   1 
ATOM   3466 C CB  . PHE A 1 453 ? 13.154  16.677  19.519  1.00 46.21  ? 453  PHE A CB  1 
ATOM   3467 C CG  . PHE A 1 453 ? 12.721  17.980  18.934  1.00 46.21  ? 453  PHE A CG  1 
ATOM   3468 C CD1 . PHE A 1 453 ? 11.539  18.555  19.324  1.00 46.67  ? 453  PHE A CD1 1 
ATOM   3469 C CD2 . PHE A 1 453 ? 13.545  18.675  18.066  1.00 45.09  ? 453  PHE A CD2 1 
ATOM   3470 C CE1 . PHE A 1 453 ? 11.166  19.784  18.828  1.00 48.12  ? 453  PHE A CE1 1 
ATOM   3471 C CE2 . PHE A 1 453 ? 13.169  19.914  17.574  1.00 46.62  ? 453  PHE A CE2 1 
ATOM   3472 C CZ  . PHE A 1 453 ? 11.997  20.464  17.955  1.00 46.74  ? 453  PHE A CZ  1 
ATOM   3473 N N   . ILE A 1 454 ? 15.038  14.750  21.204  1.00 44.55  ? 454  ILE A N   1 
ATOM   3474 C CA  . ILE A 1 454 ? 15.230  13.438  21.824  1.00 44.23  ? 454  ILE A CA  1 
ATOM   3475 C C   . ILE A 1 454 ? 15.628  13.615  23.290  1.00 44.19  ? 454  ILE A C   1 
ATOM   3476 O O   . ILE A 1 454 ? 15.245  12.833  24.129  1.00 45.11  ? 454  ILE A O   1 
ATOM   3477 C CB  . ILE A 1 454 ? 16.386  12.644  21.127  1.00 43.04  ? 454  ILE A CB  1 
ATOM   3478 C CG1 . ILE A 1 454 ? 16.204  12.617  19.594  1.00 43.33  ? 454  ILE A CG1 1 
ATOM   3479 C CG2 . ILE A 1 454 ? 16.529  11.245  21.750  1.00 43.00  ? 454  ILE A CG2 1 
ATOM   3480 C CD1 . ILE A 1 454 ? 15.444  11.468  19.085  1.00 46.19  ? 454  ILE A CD1 1 
ATOM   3481 N N   . PHE A 1 455 ? 16.479  14.594  23.573  1.00 43.90  ? 455  PHE A N   1 
ATOM   3482 C CA  . PHE A 1 455 ? 16.909  14.895  24.933  1.00 44.00  ? 455  PHE A CA  1 
ATOM   3483 C C   . PHE A 1 455 ? 15.872  15.662  25.753  1.00 45.67  ? 455  PHE A C   1 
ATOM   3484 O O   . PHE A 1 455 ? 16.013  15.804  26.970  1.00 46.41  ? 455  PHE A O   1 
ATOM   3485 C CB  . PHE A 1 455 ? 18.217  15.696  24.893  1.00 43.80  ? 455  PHE A CB  1 
ATOM   3486 C CG  . PHE A 1 455 ? 19.437  14.837  24.827  1.00 42.13  ? 455  PHE A CG  1 
ATOM   3487 C CD1 . PHE A 1 455 ? 19.936  14.399  23.612  1.00 42.55  ? 455  PHE A CD1 1 
ATOM   3488 C CD2 . PHE A 1 455 ? 20.077  14.450  25.973  1.00 43.87  ? 455  PHE A CD2 1 
ATOM   3489 C CE1 . PHE A 1 455 ? 21.039  13.595  23.556  1.00 42.51  ? 455  PHE A CE1 1 
ATOM   3490 C CE2 . PHE A 1 455 ? 21.202  13.637  25.919  1.00 41.55  ? 455  PHE A CE2 1 
ATOM   3491 C CZ  . PHE A 1 455 ? 21.673  13.215  24.707  1.00 42.45  ? 455  PHE A CZ  1 
ATOM   3492 N N   . GLY A 1 456 ? 14.868  16.211  25.085  1.00 46.65  ? 456  GLY A N   1 
ATOM   3493 C CA  . GLY A 1 456 ? 13.713  16.791  25.768  1.00 48.06  ? 456  GLY A CA  1 
ATOM   3494 C C   . GLY A 1 456 ? 13.785  18.257  26.121  1.00 49.02  ? 456  GLY A C   1 
ATOM   3495 O O   . GLY A 1 456 ? 13.010  18.739  26.954  1.00 49.81  ? 456  GLY A O   1 
ATOM   3496 N N   . LEU A 1 457 ? 14.673  19.002  25.476  1.00 49.10  ? 457  LEU A N   1 
ATOM   3497 C CA  . LEU A 1 457 ? 14.787  20.434  25.766  1.00 49.89  ? 457  LEU A CA  1 
ATOM   3498 C C   . LEU A 1 457 ? 13.487  21.225  25.682  1.00 51.34  ? 457  LEU A C   1 
ATOM   3499 O O   . LEU A 1 457 ? 13.352  22.188  26.412  1.00 52.29  ? 457  LEU A O   1 
ATOM   3500 C CB  . LEU A 1 457 ? 15.831  21.122  24.879  1.00 49.02  ? 457  LEU A CB  1 
ATOM   3501 C CG  . LEU A 1 457 ? 17.258  21.103  25.445  1.00 48.44  ? 457  LEU A CG  1 
ATOM   3502 C CD1 . LEU A 1 457 ? 17.736  19.691  25.556  1.00 42.86  ? 457  LEU A CD1 1 
ATOM   3503 C CD2 . LEU A 1 457 ? 18.214  21.980  24.620  1.00 46.90  ? 457  LEU A CD2 1 
ATOM   3504 N N   . PRO A 1 458 ? 12.574  20.891  24.755  1.00 52.12  ? 458  PRO A N   1 
ATOM   3505 C CA  . PRO A 1 458 ? 11.292  21.641  24.708  1.00 54.29  ? 458  PRO A CA  1 
ATOM   3506 C C   . PRO A 1 458 ? 10.459  21.642  25.982  1.00 56.30  ? 458  PRO A C   1 
ATOM   3507 O O   . PRO A 1 458 ? 9.617   22.540  26.167  1.00 58.47  ? 458  PRO A O   1 
ATOM   3508 C CB  . PRO A 1 458 ? 10.530  20.967  23.559  1.00 54.20  ? 458  PRO A CB  1 
ATOM   3509 C CG  . PRO A 1 458 ? 11.616  20.438  22.681  1.00 52.43  ? 458  PRO A CG  1 
ATOM   3510 C CD  . PRO A 1 458 ? 12.661  19.940  23.638  1.00 51.45  ? 458  PRO A CD  1 
ATOM   3511 N N   . LEU A 1 459 ? 10.696  20.660  26.853  1.00 56.92  ? 459  LEU A N   1 
ATOM   3512 C CA  . LEU A 1 459 ? 10.012  20.582  28.149  1.00 58.89  ? 459  LEU A CA  1 
ATOM   3513 C C   . LEU A 1 459 ? 10.355  21.762  29.073  1.00 59.69  ? 459  LEU A C   1 
ATOM   3514 O O   . LEU A 1 459 ? 9.605   22.056  29.986  1.00 61.00  ? 459  LEU A O   1 
ATOM   3515 C CB  . LEU A 1 459 ? 10.329  19.246  28.839  1.00 58.35  ? 459  LEU A CB  1 
ATOM   3516 C CG  . LEU A 1 459 ? 9.551   18.003  28.358  1.00 58.63  ? 459  LEU A CG  1 
ATOM   3517 C CD1 . LEU A 1 459 ? 9.550   17.857  26.849  1.00 57.83  ? 459  LEU A CD1 1 
ATOM   3518 C CD2 . LEU A 1 459 ? 10.103  16.761  28.988  1.00 57.83  ? 459  LEU A CD2 1 
ATOM   3519 N N   . ASP A 1 460 ? 11.490  22.418  28.831  1.00 59.55  ? 460  ASP A N   1 
ATOM   3520 C CA  . ASP A 1 460 ? 11.946  23.563  29.626  1.00 60.73  ? 460  ASP A CA  1 
ATOM   3521 C C   . ASP A 1 460 ? 11.206  24.791  29.139  1.00 62.67  ? 460  ASP A C   1 
ATOM   3522 O O   . ASP A 1 460 ? 11.459  25.274  28.035  1.00 61.62  ? 460  ASP A O   1 
ATOM   3523 C CB  . ASP A 1 460 ? 13.459  23.762  29.456  1.00 60.04  ? 460  ASP A CB  1 
ATOM   3524 C CG  . ASP A 1 460 ? 14.025  24.875  30.337  1.00 62.19  ? 460  ASP A CG  1 
ATOM   3525 O OD1 . ASP A 1 460 ? 13.259  25.530  31.051  1.00 66.32  ? 460  ASP A OD1 1 
ATOM   3526 O OD2 . ASP A 1 460 ? 15.257  25.094  30.309  1.00 64.79  ? 460  ASP A OD2 1 
ATOM   3527 N N   . PRO A 1 461 ? 10.280  25.311  29.952  1.00 65.44  ? 461  PRO A N   1 
ATOM   3528 C CA  . PRO A 1 461 ? 9.467   26.390  29.398  1.00 67.43  ? 461  PRO A CA  1 
ATOM   3529 C C   . PRO A 1 461 ? 10.288  27.644  29.068  1.00 67.62  ? 461  PRO A C   1 
ATOM   3530 O O   . PRO A 1 461 ? 9.939   28.368  28.144  1.00 69.04  ? 461  PRO A O   1 
ATOM   3531 C CB  . PRO A 1 461 ? 8.427   26.642  30.496  1.00 69.59  ? 461  PRO A CB  1 
ATOM   3532 C CG  . PRO A 1 461 ? 8.458   25.375  31.341  1.00 68.96  ? 461  PRO A CG  1 
ATOM   3533 C CD  . PRO A 1 461 ? 9.903   25.015  31.341  1.00 66.57  ? 461  PRO A CD  1 
ATOM   3534 N N   . SER A 1 462 ? 11.397  27.854  29.769  1.00 67.21  ? 462  SER A N   1 
ATOM   3535 C CA  . SER A 1 462 ? 12.277  28.987  29.504  1.00 67.31  ? 462  SER A CA  1 
ATOM   3536 C C   . SER A 1 462 ? 12.841  29.035  28.080  1.00 66.17  ? 462  SER A C   1 
ATOM   3537 O O   . SER A 1 462 ? 13.379  30.069  27.673  1.00 67.09  ? 462  SER A O   1 
ATOM   3538 C CB  . SER A 1 462 ? 13.441  29.005  30.504  1.00 66.72  ? 462  SER A CB  1 
ATOM   3539 O OG  . SER A 1 462 ? 14.431  28.048  30.163  1.00 65.54  ? 462  SER A OG  1 
ATOM   3540 N N   . LEU A 1 463 ? 12.720  27.936  27.328  1.00 64.82  ? 463  LEU A N   1 
ATOM   3541 C CA  . LEU A 1 463 ? 13.293  27.839  25.986  1.00 63.13  ? 463  LEU A CA  1 
ATOM   3542 C C   . LEU A 1 463 ? 12.384  28.247  24.832  1.00 63.74  ? 463  LEU A C   1 
ATOM   3543 O O   . LEU A 1 463 ? 12.849  28.302  23.695  1.00 63.31  ? 463  LEU A O   1 
ATOM   3544 C CB  . LEU A 1 463 ? 13.837  26.427  25.733  1.00 61.34  ? 463  LEU A CB  1 
ATOM   3545 C CG  . LEU A 1 463 ? 15.008  26.026  26.625  1.00 59.92  ? 463  LEU A CG  1 
ATOM   3546 C CD1 . LEU A 1 463 ? 15.545  24.645  26.212  1.00 53.81  ? 463  LEU A CD1 1 
ATOM   3547 C CD2 . LEU A 1 463 ? 16.095  27.114  26.604  1.00 57.66  ? 463  LEU A CD2 1 
ATOM   3548 N N   . ASN A 1 464 ? 11.113  28.524  25.104  1.00 65.10  ? 464  ASN A N   1 
ATOM   3549 C CA  . ASN A 1 464 ? 10.208  29.097  24.100  1.00 66.15  ? 464  ASN A CA  1 
ATOM   3550 C C   . ASN A 1 464 ? 9.787   28.181  22.932  1.00 63.88  ? 464  ASN A C   1 
ATOM   3551 O O   . ASN A 1 464 ? 9.354   28.674  21.886  1.00 63.61  ? 464  ASN A O   1 
ATOM   3552 C CB  . ASN A 1 464 ? 10.785  30.416  23.525  1.00 67.59  ? 464  ASN A CB  1 
ATOM   3553 C CG  . ASN A 1 464 ? 10.949  31.510  24.579  1.00 72.49  ? 464  ASN A CG  1 
ATOM   3554 O OD1 . ASN A 1 464 ? 10.269  31.516  25.612  1.00 73.05  ? 464  ASN A OD1 1 
ATOM   3555 N ND2 . ASN A 1 464 ? 11.858  32.455  24.301  1.00 81.73  ? 464  ASN A ND2 1 
ATOM   3556 N N   . TYR A 1 465 ? 9.879   26.864  23.100  1.00 61.01  ? 465  TYR A N   1 
ATOM   3557 C CA  . TYR A 1 465 ? 9.258   25.966  22.135  1.00 59.64  ? 465  TYR A CA  1 
ATOM   3558 C C   . TYR A 1 465 ? 7.741   26.010  22.255  1.00 61.00  ? 465  TYR A C   1 
ATOM   3559 O O   . TYR A 1 465 ? 7.212   26.408  23.280  1.00 62.10  ? 465  TYR A O   1 
ATOM   3560 C CB  . TYR A 1 465 ? 9.698   24.538  22.339  1.00 57.98  ? 465  TYR A CB  1 
ATOM   3561 C CG  . TYR A 1 465 ? 11.152  24.245  22.051  1.00 55.10  ? 465  TYR A CG  1 
ATOM   3562 C CD1 . TYR A 1 465 ? 11.547  23.733  20.831  1.00 54.16  ? 465  TYR A CD1 1 
ATOM   3563 C CD2 . TYR A 1 465 ? 12.125  24.456  23.015  1.00 54.74  ? 465  TYR A CD2 1 
ATOM   3564 C CE1 . TYR A 1 465 ? 12.891  23.438  20.577  1.00 53.34  ? 465  TYR A CE1 1 
ATOM   3565 C CE2 . TYR A 1 465 ? 13.461  24.160  22.780  1.00 52.72  ? 465  TYR A CE2 1 
ATOM   3566 C CZ  . TYR A 1 465 ? 13.840  23.654  21.564  1.00 52.55  ? 465  TYR A CZ  1 
ATOM   3567 O OH  . TYR A 1 465 ? 15.173  23.342  21.342  1.00 51.96  ? 465  TYR A OH  1 
ATOM   3568 N N   . THR A 1 466 ? 7.044   25.572  21.212  1.00 60.99  ? 466  THR A N   1 
ATOM   3569 C CA  . THR A 1 466 ? 5.584   25.483  21.245  1.00 62.62  ? 466  THR A CA  1 
ATOM   3570 C C   . THR A 1 466 ? 5.129   24.288  22.085  1.00 63.01  ? 466  THR A C   1 
ATOM   3571 O O   . THR A 1 466 ? 5.907   23.377  22.380  1.00 60.84  ? 466  THR A O   1 
ATOM   3572 C CB  . THR A 1 466 ? 4.980   25.336  19.831  1.00 62.97  ? 466  THR A CB  1 
ATOM   3573 O OG1 . THR A 1 466 ? 5.352   24.061  19.291  1.00 61.54  ? 466  THR A OG1 1 
ATOM   3574 C CG2 . THR A 1 466 ? 5.460   26.443  18.912  1.00 61.81  ? 466  THR A CG2 1 
ATOM   3575 N N   . THR A 1 467 ? 3.854   24.307  22.457  1.00 65.20  ? 467  THR A N   1 
ATOM   3576 C CA  . THR A 1 467 ? 3.222   23.223  23.210  1.00 66.55  ? 467  THR A CA  1 
ATOM   3577 C C   . THR A 1 467 ? 3.260   21.916  22.432  1.00 66.07  ? 467  THR A C   1 
ATOM   3578 O O   . THR A 1 467 ? 3.560   20.846  22.986  1.00 65.45  ? 467  THR A O   1 
ATOM   3579 C CB  . THR A 1 467 ? 1.749   23.573  23.526  1.00 69.26  ? 467  THR A CB  1 
ATOM   3580 O OG1 . THR A 1 467 ? 1.712   24.708  24.401  1.00 70.23  ? 467  THR A OG1 1 
ATOM   3581 C CG2 . THR A 1 467 ? 1.035   22.393  24.191  1.00 70.87  ? 467  THR A CG2 1 
ATOM   3582 N N   . GLU A 1 468 ? 2.967   22.033  21.139  1.00 66.52  ? 468  GLU A N   1 
ATOM   3583 C CA  . GLU A 1 468 ? 2.961   20.915  20.207  1.00 66.46  ? 468  GLU A CA  1 
ATOM   3584 C C   . GLU A 1 468 ? 4.344   20.277  20.199  1.00 63.53  ? 468  GLU A C   1 
ATOM   3585 O O   . GLU A 1 468 ? 4.465   19.066  20.227  1.00 62.37  ? 468  GLU A O   1 
ATOM   3586 C CB  . GLU A 1 468 ? 2.595   21.391  18.793  1.00 67.46  ? 468  GLU A CB  1 
ATOM   3587 C CG  . GLU A 1 468 ? 1.223   22.061  18.648  1.00 73.81  ? 468  GLU A CG  1 
ATOM   3588 C CD  . GLU A 1 468 ? 1.159   23.537  19.146  1.00 79.87  ? 468  GLU A CD  1 
ATOM   3589 O OE1 . GLU A 1 468 ? 0.877   23.766  20.349  1.00 83.34  ? 468  GLU A OE1 1 
ATOM   3590 O OE2 . GLU A 1 468 ? 1.351   24.471  18.325  1.00 83.54  ? 468  GLU A OE2 1 
ATOM   3591 N N   . GLU A 1 469 ? 5.373   21.121  20.182  1.00 62.12  ? 469  GLU A N   1 
ATOM   3592 C CA  . GLU A 1 469 ? 6.767   20.676  20.216  1.00 60.09  ? 469  GLU A CA  1 
ATOM   3593 C C   . GLU A 1 469 ? 7.134   19.948  21.510  1.00 59.66  ? 469  GLU A C   1 
ATOM   3594 O O   . GLU A 1 469 ? 7.890   18.994  21.484  1.00 58.85  ? 469  GLU A O   1 
ATOM   3595 C CB  . GLU A 1 469 ? 7.703   21.867  19.983  1.00 59.27  ? 469  GLU A CB  1 
ATOM   3596 C CG  . GLU A 1 469 ? 7.800   22.272  18.525  1.00 58.95  ? 469  GLU A CG  1 
ATOM   3597 C CD  . GLU A 1 469 ? 8.696   23.483  18.276  1.00 58.51  ? 469  GLU A CD  1 
ATOM   3598 O OE1 . GLU A 1 469 ? 8.723   24.409  19.105  1.00 59.99  ? 469  GLU A OE1 1 
ATOM   3599 O OE2 . GLU A 1 469 ? 9.376   23.519  17.231  1.00 57.38  ? 469  GLU A OE2 1 
ATOM   3600 N N   . ARG A 1 470 ? 6.594   20.400  22.634  1.00 61.33  ? 470  ARG A N   1 
ATOM   3601 C CA  . ARG A 1 470 ? 6.696   19.675  23.913  1.00 61.14  ? 470  ARG A CA  1 
ATOM   3602 C C   . ARG A 1 470 ? 6.090   18.256  23.849  1.00 61.12  ? 470  ARG A C   1 
ATOM   3603 O O   . ARG A 1 470 ? 6.723   17.296  24.287  1.00 59.97  ? 470  ARG A O   1 
ATOM   3604 C CB  . ARG A 1 470 ? 6.041   20.494  25.038  1.00 63.38  ? 470  ARG A CB  1 
ATOM   3605 C CG  . ARG A 1 470 ? 6.483   20.118  26.468  1.00 65.19  ? 470  ARG A CG  1 
ATOM   3606 C CD  . ARG A 1 470 ? 5.387   19.423  27.304  1.00 72.14  ? 470  ARG A CD  1 
ATOM   3607 N NE  . ARG A 1 470 ? 4.168   20.234  27.385  1.00 77.08  ? 470  ARG A NE  1 
ATOM   3608 C CZ  . ARG A 1 470 ? 2.936   19.756  27.580  1.00 80.48  ? 470  ARG A CZ  1 
ATOM   3609 N NH1 . ARG A 1 470 ? 2.722   18.443  27.728  1.00 81.46  ? 470  ARG A NH1 1 
ATOM   3610 N NH2 . ARG A 1 470 ? 1.903   20.603  27.622  1.00 81.81  ? 470  ARG A NH2 1 
ATOM   3611 N N   . ILE A 1 471 ? 4.880   18.122  23.303  1.00 62.02  ? 471  ILE A N   1 
ATOM   3612 C CA  . ILE A 1 471 ? 4.228   16.806  23.136  1.00 62.53  ? 471  ILE A CA  1 
ATOM   3613 C C   . ILE A 1 471 ? 5.081   15.891  22.254  1.00 60.44  ? 471  ILE A C   1 
ATOM   3614 O O   . ILE A 1 471 ? 5.287   14.714  22.556  1.00 59.93  ? 471  ILE A O   1 
ATOM   3615 C CB  . ILE A 1 471 ? 2.814   16.950  22.500  1.00 64.65  ? 471  ILE A CB  1 
ATOM   3616 C CG1 . ILE A 1 471 ? 1.911   17.853  23.342  1.00 67.12  ? 471  ILE A CG1 1 
ATOM   3617 C CG2 . ILE A 1 471 ? 2.118   15.593  22.302  1.00 65.56  ? 471  ILE A CG2 1 
ATOM   3618 C CD1 . ILE A 1 471 ? 1.947   17.590  24.809  1.00 69.50  ? 471  ILE A CD1 1 
ATOM   3619 N N   . PHE A 1 472 ? 5.579   16.461  21.164  1.00 59.11  ? 472  PHE A N   1 
ATOM   3620 C CA  . PHE A 1 472 ? 6.393   15.751  20.188  1.00 57.33  ? 472  PHE A CA  1 
ATOM   3621 C C   . PHE A 1 472 ? 7.692   15.291  20.832  1.00 55.87  ? 472  PHE A C   1 
ATOM   3622 O O   . PHE A 1 472 ? 8.100   14.148  20.644  1.00 55.88  ? 472  PHE A O   1 
ATOM   3623 C CB  . PHE A 1 472 ? 6.622   16.677  18.980  1.00 57.28  ? 472  PHE A CB  1 
ATOM   3624 C CG  . PHE A 1 472 ? 7.574   16.146  17.939  1.00 55.05  ? 472  PHE A CG  1 
ATOM   3625 C CD1 . PHE A 1 472 ? 7.334   14.947  17.297  1.00 55.78  ? 472  PHE A CD1 1 
ATOM   3626 C CD2 . PHE A 1 472 ? 8.692   16.885  17.569  1.00 55.35  ? 472  PHE A CD2 1 
ATOM   3627 C CE1 . PHE A 1 472 ? 8.211   14.481  16.329  1.00 55.14  ? 472  PHE A CE1 1 
ATOM   3628 C CE2 . PHE A 1 472 ? 9.573   16.423  16.598  1.00 53.17  ? 472  PHE A CE2 1 
ATOM   3629 C CZ  . PHE A 1 472 ? 9.336   15.229  15.981  1.00 54.18  ? 472  PHE A CZ  1 
ATOM   3630 N N   . ALA A 1 473 ? 8.316   16.150  21.632  1.00 54.86  ? 473  ALA A N   1 
ATOM   3631 C CA  . ALA A 1 473 ? 9.516   15.751  22.359  1.00 54.03  ? 473  ALA A CA  1 
ATOM   3632 C C   . ALA A 1 473 ? 9.239   14.552  23.276  1.00 54.62  ? 473  ALA A C   1 
ATOM   3633 O O   . ALA A 1 473 ? 10.008  13.608  23.308  1.00 53.07  ? 473  ALA A O   1 
ATOM   3634 C CB  . ALA A 1 473 ? 10.077  16.916  23.146  1.00 53.35  ? 473  ALA A CB  1 
ATOM   3635 N N   . GLN A 1 474 ? 8.126   14.585  23.993  1.00 56.35  ? 474  GLN A N   1 
ATOM   3636 C CA  . GLN A 1 474 ? 7.753   13.494  24.889  1.00 58.02  ? 474  GLN A CA  1 
ATOM   3637 C C   . GLN A 1 474 ? 7.535   12.165  24.167  1.00 57.98  ? 474  GLN A C   1 
ATOM   3638 O O   . GLN A 1 474 ? 7.922   11.120  24.683  1.00 58.22  ? 474  GLN A O   1 
ATOM   3639 C CB  . GLN A 1 474 ? 6.523   13.884  25.725  1.00 60.05  ? 474  GLN A CB  1 
ATOM   3640 C CG  . GLN A 1 474 ? 6.873   14.932  26.778  1.00 61.12  ? 474  GLN A CG  1 
ATOM   3641 C CD  . GLN A 1 474 ? 5.702   15.421  27.579  1.00 63.30  ? 474  GLN A CD  1 
ATOM   3642 O OE1 . GLN A 1 474 ? 4.684   15.835  27.031  1.00 66.53  ? 474  GLN A OE1 1 
ATOM   3643 N NE2 . GLN A 1 474 ? 5.854   15.408  28.903  1.00 67.89  ? 474  GLN A NE2 1 
ATOM   3644 N N   . ARG A 1 475 ? 6.944   12.210  22.973  1.00 58.54  ? 475  ARG A N   1 
ATOM   3645 C CA  . ARG A 1 475 ? 6.824   11.023  22.105  1.00 58.55  ? 475  ARG A CA  1 
ATOM   3646 C C   . ARG A 1 475 ? 8.184   10.435  21.752  1.00 56.38  ? 475  ARG A C   1 
ATOM   3647 O O   . ARG A 1 475 ? 8.368   9.236   21.851  1.00 55.62  ? 475  ARG A O   1 
ATOM   3648 C CB  . ARG A 1 475 ? 6.116   11.365  20.793  1.00 59.07  ? 475  ARG A CB  1 
ATOM   3649 C CG  . ARG A 1 475 ? 4.628   11.244  20.817  1.00 62.14  ? 475  ARG A CG  1 
ATOM   3650 C CD  . ARG A 1 475 ? 4.031   11.746  19.499  1.00 63.22  ? 475  ARG A CD  1 
ATOM   3651 N NE  . ARG A 1 475 ? 4.469   10.879  18.418  1.00 64.34  ? 475  ARG A NE  1 
ATOM   3652 C CZ  . ARG A 1 475 ? 4.647   11.242  17.153  1.00 62.95  ? 475  ARG A CZ  1 
ATOM   3653 N NH1 . ARG A 1 475 ? 4.405   12.481  16.734  1.00 61.27  ? 475  ARG A NH1 1 
ATOM   3654 N NH2 . ARG A 1 475 ? 5.079   10.330  16.296  1.00 63.54  ? 475  ARG A NH2 1 
ATOM   3655 N N   . LEU A 1 476 ? 9.119   11.287  21.321  1.00 54.69  ? 476  LEU A N   1 
ATOM   3656 C CA  . LEU A 1 476 ? 10.445  10.821  20.898  1.00 53.63  ? 476  LEU A CA  1 
ATOM   3657 C C   . LEU A 1 476 ? 11.220  10.222  22.054  1.00 53.10  ? 476  LEU A C   1 
ATOM   3658 O O   . LEU A 1 476 ? 11.835  9.169   21.909  1.00 53.62  ? 476  LEU A O   1 
ATOM   3659 C CB  . LEU A 1 476 ? 11.266  11.952  20.260  1.00 52.50  ? 476  LEU A CB  1 
ATOM   3660 C CG  . LEU A 1 476 ? 10.715  12.563  18.960  1.00 52.28  ? 476  LEU A CG  1 
ATOM   3661 C CD1 . LEU A 1 476 ? 11.654  13.627  18.428  1.00 50.38  ? 476  LEU A CD1 1 
ATOM   3662 C CD2 . LEU A 1 476 ? 10.490  11.523  17.900  1.00 52.03  ? 476  LEU A CD2 1 
ATOM   3663 N N   . MET A 1 477 ? 11.183  10.888  23.202  1.00 53.31  ? 477  MET A N   1 
ATOM   3664 C CA  . MET A 1 477 ? 11.835  10.377  24.406  1.00 53.02  ? 477  MET A CA  1 
ATOM   3665 C C   . MET A 1 477 ? 11.279  9.018   24.777  1.00 53.81  ? 477  MET A C   1 
ATOM   3666 O O   . MET A 1 477 ? 12.029  8.156   25.246  1.00 53.41  ? 477  MET A O   1 
ATOM   3667 C CB  . MET A 1 477 ? 11.667  11.335  25.583  1.00 53.36  ? 477  MET A CB  1 
ATOM   3668 C CG  . MET A 1 477 ? 12.242  12.720  25.381  1.00 52.13  ? 477  MET A CG  1 
ATOM   3669 S SD  . MET A 1 477 ? 11.553  13.848  26.608  1.00 55.38  ? 477  MET A SD  1 
ATOM   3670 C CE  . MET A 1 477 ? 12.619  13.382  27.950  1.00 54.50  ? 477  MET A CE  1 
ATOM   3671 N N   . LYS A 1 478 ? 9.978   8.817   24.572  1.00 54.68  ? 478  LYS A N   1 
ATOM   3672 C CA  . LYS A 1 478 ? 9.377   7.498   24.805  1.00 56.60  ? 478  LYS A CA  1 
ATOM   3673 C C   . LYS A 1 478 ? 9.825   6.426   23.813  1.00 55.08  ? 478  LYS A C   1 
ATOM   3674 O O   . LYS A 1 478 ? 10.107  5.299   24.224  1.00 54.98  ? 478  LYS A O   1 
ATOM   3675 C CB  . LYS A 1 478 ? 7.843   7.560   24.853  1.00 58.52  ? 478  LYS A CB  1 
ATOM   3676 C CG  . LYS A 1 478 ? 7.338   7.971   26.212  1.00 61.13  ? 478  LYS A CG  1 
ATOM   3677 C CD  . LYS A 1 478 ? 5.931   7.480   26.523  1.00 64.17  ? 478  LYS A CD  1 
ATOM   3678 C CE  . LYS A 1 478 ? 5.712   7.317   28.054  1.00 67.70  ? 478  LYS A CE  1 
ATOM   3679 N NZ  . LYS A 1 478 ? 6.760   8.004   28.923  1.00 69.88  ? 478  LYS A NZ  1 
ATOM   3680 N N   . TYR A 1 479 ? 9.890   6.764   22.523  1.00 53.69  ? 479  TYR A N   1 
ATOM   3681 C CA  . TYR A 1 479 ? 10.369  5.810   21.506  1.00 52.56  ? 479  TYR A CA  1 
ATOM   3682 C C   . TYR A 1 479 ? 11.796  5.372   21.831  1.00 51.32  ? 479  TYR A C   1 
ATOM   3683 O O   . TYR A 1 479 ? 12.117  4.172   21.811  1.00 50.58  ? 479  TYR A O   1 
ATOM   3684 C CB  . TYR A 1 479 ? 10.371  6.433   20.101  1.00 51.68  ? 479  TYR A CB  1 
ATOM   3685 C CG  . TYR A 1 479 ? 9.022   6.724   19.479  1.00 51.67  ? 479  TYR A CG  1 
ATOM   3686 C CD1 . TYR A 1 479 ? 7.961   5.832   19.593  1.00 52.60  ? 479  TYR A CD1 1 
ATOM   3687 C CD2 . TYR A 1 479 ? 8.837   7.866   18.728  1.00 50.50  ? 479  TYR A CD2 1 
ATOM   3688 C CE1 . TYR A 1 479 ? 6.742   6.105   19.002  1.00 54.37  ? 479  TYR A CE1 1 
ATOM   3689 C CE2 . TYR A 1 479 ? 7.632   8.144   18.137  1.00 51.12  ? 479  TYR A CE2 1 
ATOM   3690 C CZ  . TYR A 1 479 ? 6.589   7.266   18.270  1.00 53.62  ? 479  TYR A CZ  1 
ATOM   3691 O OH  . TYR A 1 479 ? 5.391   7.577   17.670  1.00 54.71  ? 479  TYR A OH  1 
ATOM   3692 N N   . TRP A 1 480 ? 12.643  6.355   22.136  1.00 49.60  ? 480  TRP A N   1 
ATOM   3693 C CA  . TRP A 1 480 ? 14.054  6.091   22.421  1.00 49.10  ? 480  TRP A CA  1 
ATOM   3694 C C   . TRP A 1 480 ? 14.269  5.232   23.672  1.00 50.28  ? 480  TRP A C   1 
ATOM   3695 O O   . TRP A 1 480 ? 15.093  4.304   23.662  1.00 50.57  ? 480  TRP A O   1 
ATOM   3696 C CB  . TRP A 1 480 ? 14.837  7.409   22.531  1.00 47.64  ? 480  TRP A CB  1 
ATOM   3697 C CG  . TRP A 1 480 ? 15.652  7.763   21.289  1.00 46.37  ? 480  TRP A CG  1 
ATOM   3698 C CD1 . TRP A 1 480 ? 17.019  7.880   21.215  1.00 45.19  ? 480  TRP A CD1 1 
ATOM   3699 C CD2 . TRP A 1 480 ? 15.161  8.071   19.975  1.00 45.77  ? 480  TRP A CD2 1 
ATOM   3700 N NE1 . TRP A 1 480 ? 17.396  8.215   19.948  1.00 43.17  ? 480  TRP A NE1 1 
ATOM   3701 C CE2 . TRP A 1 480 ? 16.282  8.348   19.167  1.00 43.27  ? 480  TRP A CE2 1 
ATOM   3702 C CE3 . TRP A 1 480 ? 13.886  8.123   19.401  1.00 48.30  ? 480  TRP A CE3 1 
ATOM   3703 C CZ2 . TRP A 1 480 ? 16.173  8.666   17.825  1.00 43.52  ? 480  TRP A CZ2 1 
ATOM   3704 C CZ3 . TRP A 1 480 ? 13.775  8.459   18.065  1.00 47.43  ? 480  TRP A CZ3 1 
ATOM   3705 C CH2 . TRP A 1 480 ? 14.918  8.727   17.289  1.00 46.17  ? 480  TRP A CH2 1 
ATOM   3706 N N   . THR A 1 481 ? 13.503  5.517   24.730  1.00 51.61  ? 481  THR A N   1 
ATOM   3707 C CA  . THR A 1 481 ? 13.631  4.799   25.997  1.00 52.25  ? 481  THR A CA  1 
ATOM   3708 C C   . THR A 1 481 ? 12.925  3.478   25.971  1.00 53.61  ? 481  THR A C   1 
ATOM   3709 O O   . THR A 1 481 ? 13.395  2.535   26.590  1.00 54.29  ? 481  THR A O   1 
ATOM   3710 C CB  . THR A 1 481 ? 13.162  5.633   27.187  1.00 52.74  ? 481  THR A CB  1 
ATOM   3711 O OG1 . THR A 1 481 ? 11.826  6.081   26.963  1.00 54.90  ? 481  THR A OG1 1 
ATOM   3712 C CG2 . THR A 1 481 ? 14.084  6.839   27.362  1.00 50.90  ? 481  THR A CG2 1 
ATOM   3713 N N   . ASN A 1 482 ? 11.810  3.385   25.250  1.00 54.41  ? 482  ASN A N   1 
ATOM   3714 C CA  . ASN A 1 482 ? 11.217  2.078   24.991  1.00 56.06  ? 482  ASN A CA  1 
ATOM   3715 C C   . ASN A 1 482 ? 12.179  1.153   24.260  1.00 55.93  ? 482  ASN A C   1 
ATOM   3716 O O   . ASN A 1 482 ? 12.257  -0.047  24.572  1.00 57.23  ? 482  ASN A O   1 
ATOM   3717 C CB  . ASN A 1 482 ? 9.929   2.210   24.183  1.00 56.73  ? 482  ASN A CB  1 
ATOM   3718 C CG  . ASN A 1 482 ? 8.797   2.793   24.990  1.00 57.95  ? 482  ASN A CG  1 
ATOM   3719 O OD1 . ASN A 1 482 ? 8.778   2.709   26.221  1.00 56.41  ? 482  ASN A OD1 1 
ATOM   3720 N ND2 . ASN A 1 482 ? 7.840   3.391   24.299  1.00 60.81  ? 482  ASN A ND2 1 
ATOM   3721 N N   . PHE A 1 483 ? 12.877  1.700   23.265  1.00 54.80  ? 483  PHE A N   1 
ATOM   3722 C CA  . PHE A 1 483 ? 13.876  0.924   22.521  1.00 54.41  ? 483  PHE A CA  1 
ATOM   3723 C C   . PHE A 1 483 ? 15.015  0.434   23.440  1.00 53.98  ? 483  PHE A C   1 
ATOM   3724 O O   . PHE A 1 483 ? 15.368  -0.757  23.449  1.00 54.19  ? 483  PHE A O   1 
ATOM   3725 C CB  . PHE A 1 483 ? 14.453  1.728   21.338  1.00 52.31  ? 483  PHE A CB  1 
ATOM   3726 C CG  . PHE A 1 483 ? 15.527  0.993   20.603  1.00 50.75  ? 483  PHE A CG  1 
ATOM   3727 C CD1 . PHE A 1 483 ? 15.212  -0.057  19.759  1.00 54.04  ? 483  PHE A CD1 1 
ATOM   3728 C CD2 . PHE A 1 483 ? 16.861  1.301   20.803  1.00 52.18  ? 483  PHE A CD2 1 
ATOM   3729 C CE1 . PHE A 1 483 ? 16.204  -0.775  19.116  1.00 53.24  ? 483  PHE A CE1 1 
ATOM   3730 C CE2 . PHE A 1 483 ? 17.852  0.605   20.152  1.00 51.14  ? 483  PHE A CE2 1 
ATOM   3731 C CZ  . PHE A 1 483 ? 17.526  -0.438  19.314  1.00 52.71  ? 483  PHE A CZ  1 
ATOM   3732 N N   . ALA A 1 484 ? 15.589  1.378   24.172  1.00 53.24  ? 484  ALA A N   1 
ATOM   3733 C CA  . ALA A 1 484 ? 16.565  1.101   25.224  1.00 53.85  ? 484  ALA A CA  1 
ATOM   3734 C C   . ALA A 1 484 ? 16.132  -0.019  26.144  1.00 55.84  ? 484  ALA A C   1 
ATOM   3735 O O   . ALA A 1 484 ? 16.914  -0.928  26.429  1.00 57.15  ? 484  ALA A O   1 
ATOM   3736 C CB  . ALA A 1 484 ? 16.798  2.352   26.040  1.00 52.28  ? 484  ALA A CB  1 
ATOM   3737 N N   . ARG A 1 485 ? 14.898  0.074   26.622  1.00 57.54  ? 485  ARG A N   1 
ATOM   3738 C CA  . ARG A 1 485 ? 14.334  -0.876  27.577  1.00 60.31  ? 485  ARG A CA  1 
ATOM   3739 C C   . ARG A 1 485 ? 14.103  -2.246  26.990  1.00 60.75  ? 485  ARG A C   1 
ATOM   3740 O O   . ARG A 1 485 ? 14.378  -3.249  27.645  1.00 61.34  ? 485  ARG A O   1 
ATOM   3741 C CB  . ARG A 1 485 ? 12.966  -0.398  28.095  1.00 61.35  ? 485  ARG A CB  1 
ATOM   3742 C CG  . ARG A 1 485 ? 12.982  0.447   29.363  1.00 64.14  ? 485  ARG A CG  1 
ATOM   3743 C CD  . ARG A 1 485 ? 11.548  0.662   29.944  1.00 67.25  ? 485  ARG A CD  1 
ATOM   3744 N NE  . ARG A 1 485 ? 10.870  1.805   29.308  1.00 70.53  ? 485  ARG A NE  1 
ATOM   3745 C CZ  . ARG A 1 485 ? 11.139  3.087   29.570  1.00 71.06  ? 485  ARG A CZ  1 
ATOM   3746 N NH1 . ARG A 1 485 ? 12.048  3.404   30.498  1.00 70.84  ? 485  ARG A NH1 1 
ATOM   3747 N NH2 . ARG A 1 485 ? 10.476  4.060   28.907  1.00 70.37  ? 485  ARG A NH2 1 
ATOM   3748 N N   . THR A 1 486 ? 13.525  -2.288  25.786  1.00 60.13  ? 486  THR A N   1 
ATOM   3749 C CA  . THR A 1 486 ? 12.943  -3.540  25.262  1.00 60.75  ? 486  THR A CA  1 
ATOM   3750 C C   . THR A 1 486 ? 13.476  -3.978  23.892  1.00 60.18  ? 486  THR A C   1 
ATOM   3751 O O   . THR A 1 486 ? 13.246  -5.104  23.461  1.00 61.36  ? 486  THR A O   1 
ATOM   3752 C CB  . THR A 1 486 ? 11.413  -3.414  25.154  1.00 61.89  ? 486  THR A CB  1 
ATOM   3753 O OG1 . THR A 1 486 ? 11.078  -2.451  24.146  1.00 60.92  ? 486  THR A OG1 1 
ATOM   3754 C CG2 . THR A 1 486 ? 10.801  -2.986  26.486  1.00 61.43  ? 486  THR A CG2 1 
ATOM   3755 N N   . GLY A 1 487 ? 14.182  -3.092  23.209  1.00 58.07  ? 487  GLY A N   1 
ATOM   3756 C CA  . GLY A 1 487 ? 14.611  -3.334  21.835  1.00 57.75  ? 487  GLY A CA  1 
ATOM   3757 C C   . GLY A 1 487 ? 13.525  -3.079  20.812  1.00 58.04  ? 487  GLY A C   1 
ATOM   3758 O O   . GLY A 1 487 ? 13.644  -3.511  19.671  1.00 58.15  ? 487  GLY A O   1 
ATOM   3759 N N   . ASP A 1 488 ? 12.475  -2.369  21.223  1.00 58.44  ? 488  ASP A N   1 
ATOM   3760 C CA  . ASP A 1 488 ? 11.306  -2.106  20.388  1.00 59.61  ? 488  ASP A CA  1 
ATOM   3761 C C   . ASP A 1 488 ? 10.769  -0.738  20.797  1.00 59.91  ? 488  ASP A C   1 
ATOM   3762 O O   . ASP A 1 488 ? 10.401  -0.542  21.953  1.00 60.33  ? 488  ASP A O   1 
ATOM   3763 C CB  . ASP A 1 488 ? 10.251  -3.211  20.613  1.00 61.44  ? 488  ASP A CB  1 
ATOM   3764 C CG  . ASP A 1 488 ? 8.951   -2.978  19.841  1.00 61.27  ? 488  ASP A CG  1 
ATOM   3765 O OD1 . ASP A 1 488 ? 8.721   -1.871  19.345  1.00 56.63  ? 488  ASP A OD1 1 
ATOM   3766 O OD2 . ASP A 1 488 ? 8.123   -3.917  19.738  1.00 62.62  ? 488  ASP A OD2 1 
ATOM   3767 N N   . PRO A 1 489 ? 10.715  0.220   19.860  1.00 60.58  ? 489  PRO A N   1 
ATOM   3768 C CA  . PRO A 1 489 ? 10.314  1.565   20.283  1.00 61.00  ? 489  PRO A CA  1 
ATOM   3769 C C   . PRO A 1 489 ? 8.803   1.738   20.520  1.00 63.52  ? 489  PRO A C   1 
ATOM   3770 O O   . PRO A 1 489 ? 8.369   2.785   20.986  1.00 62.95  ? 489  PRO A O   1 
ATOM   3771 C CB  . PRO A 1 489 ? 10.809  2.455   19.131  1.00 59.45  ? 489  PRO A CB  1 
ATOM   3772 C CG  . PRO A 1 489 ? 10.813  1.575   17.933  1.00 59.81  ? 489  PRO A CG  1 
ATOM   3773 C CD  . PRO A 1 489 ? 10.994  0.150   18.413  1.00 60.54  ? 489  PRO A CD  1 
ATOM   3774 N N   . ASN A 1 490 ? 8.013   0.725   20.196  1.00 67.69  ? 490  ASN A N   1 
ATOM   3775 C CA  . ASN A 1 490 ? 6.567   0.776   20.414  1.00 71.16  ? 490  ASN A CA  1 
ATOM   3776 C C   . ASN A 1 490 ? 6.201   0.496   21.868  1.00 74.83  ? 490  ASN A C   1 
ATOM   3777 O O   . ASN A 1 490 ? 6.907   -0.230  22.572  1.00 74.62  ? 490  ASN A O   1 
ATOM   3778 C CB  . ASN A 1 490 ? 5.847   -0.227  19.495  1.00 72.45  ? 490  ASN A CB  1 
ATOM   3779 C CG  . ASN A 1 490 ? 6.056   0.073   18.025  1.00 69.95  ? 490  ASN A CG  1 
ATOM   3780 O OD1 . ASN A 1 490 ? 5.501   1.032   17.503  1.00 67.61  ? 490  ASN A OD1 1 
ATOM   3781 N ND2 . ASN A 1 490 ? 6.876   -0.733  17.358  1.00 66.32  ? 490  ASN A ND2 1 
ATOM   3782 N N   . ASP A 1 491 ? 5.088   1.071   22.305  1.00 79.31  ? 491  ASP A N   1 
ATOM   3783 C CA  . ASP A 1 491 ? 4.521   0.778   23.617  1.00 83.76  ? 491  ASP A CA  1 
ATOM   3784 C C   . ASP A 1 491 ? 3.593   -0.442  23.495  1.00 87.16  ? 491  ASP A C   1 
ATOM   3785 O O   . ASP A 1 491 ? 2.705   -0.461  22.633  1.00 88.25  ? 491  ASP A O   1 
ATOM   3786 C CB  . ASP A 1 491 ? 3.749   1.992   24.144  1.00 84.15  ? 491  ASP A CB  1 
ATOM   3787 C CG  . ASP A 1 491 ? 3.362   1.854   25.618  1.00 87.52  ? 491  ASP A CG  1 
ATOM   3788 O OD1 . ASP A 1 491 ? 4.184   1.338   26.424  1.00 88.63  ? 491  ASP A OD1 1 
ATOM   3789 O OD2 . ASP A 1 491 ? 2.229   2.273   25.965  1.00 91.06  ? 491  ASP A OD2 1 
ATOM   3790 N N   . PRO A 1 492 ? 3.804   -1.468  24.343  1.00 90.01  ? 492  PRO A N   1 
ATOM   3791 C CA  . PRO A 1 492 ? 2.987   -2.692  24.249  1.00 93.30  ? 492  PRO A CA  1 
ATOM   3792 C C   . PRO A 1 492 ? 1.509   -2.495  24.595  1.00 97.49  ? 492  PRO A C   1 
ATOM   3793 O O   . PRO A 1 492 ? 0.635   -3.112  23.968  1.00 99.82  ? 492  PRO A O   1 
ATOM   3794 C CB  . PRO A 1 492 ? 3.639   -3.644  25.270  1.00 93.92  ? 492  PRO A CB  1 
ATOM   3795 C CG  . PRO A 1 492 ? 4.981   -3.042  25.583  1.00 91.19  ? 492  PRO A CG  1 
ATOM   3796 C CD  . PRO A 1 492 ? 4.818   -1.567  25.410  1.00 89.19  ? 492  PRO A CD  1 
ATOM   3797 N N   . ARG A 1 493 ? 1.239   -1.658  25.594  1.00 99.19  ? 493  ARG A N   1 
ATOM   3798 C CA  . ARG A 1 493 ? -0.138  -1.445  26.069  1.00 102.93 ? 493  ARG A CA  1 
ATOM   3799 C C   . ARG A 1 493 ? -0.937  -0.556  25.110  1.00 103.28 ? 493  ARG A C   1 
ATOM   3800 O O   . ARG A 1 493 ? -2.092  -0.864  24.785  1.00 105.56 ? 493  ARG A O   1 
ATOM   3801 C CB  . ARG A 1 493 ? -0.164  -0.884  27.505  1.00 103.08 ? 493  ARG A CB  1 
ATOM   3802 C CG  . ARG A 1 493 ? 0.710   0.352   27.748  1.00 102.17 ? 493  ARG A CG  1 
ATOM   3803 C CD  . ARG A 1 493 ? 0.749   0.741   29.228  1.00 103.08 ? 493  ARG A CD  1 
ATOM   3804 N NE  . ARG A 1 493 ? 1.980   1.460   29.572  1.00 103.04 ? 493  ARG A NE  1 
ATOM   3805 C CZ  . ARG A 1 493 ? 2.160   2.194   30.676  1.00 104.13 ? 493  ARG A CZ  1 
ATOM   3806 N NH1 . ARG A 1 493 ? 1.184   2.339   31.577  1.00 106.98 ? 493  ARG A NH1 1 
ATOM   3807 N NH2 . ARG A 1 493 ? 3.330   2.800   30.878  1.00 102.05 ? 493  ARG A NH2 1 
ATOM   3808 N N   . ASP A 1 494 ? -0.309  0.525   24.649  1.00 101.41 ? 494  ASP A N   1 
ATOM   3809 C CA  . ASP A 1 494 ? -0.917  1.435   23.671  1.00 101.53 ? 494  ASP A CA  1 
ATOM   3810 C C   . ASP A 1 494 ? -0.979  0.802   22.266  1.00 101.76 ? 494  ASP A C   1 
ATOM   3811 O O   . ASP A 1 494 ? -0.007  0.849   21.507  1.00 100.16 ? 494  ASP A O   1 
ATOM   3812 C CB  . ASP A 1 494 ? -0.130  2.758   23.644  1.00 99.36  ? 494  ASP A CB  1 
ATOM   3813 C CG  . ASP A 1 494 ? -0.655  3.748   22.609  1.00 99.64  ? 494  ASP A CG  1 
ATOM   3814 O OD1 . ASP A 1 494 ? -1.884  3.806   22.367  1.00 101.30 ? 494  ASP A OD1 1 
ATOM   3815 O OD2 . ASP A 1 494 ? 0.186   4.480   22.044  1.00 97.77  ? 494  ASP A OD2 1 
ATOM   3816 N N   . SER A 1 495 ? -2.125  0.210   21.931  1.00 103.91 ? 495  SER A N   1 
ATOM   3817 C CA  . SER A 1 495 ? -2.338  -0.373  20.600  1.00 104.32 ? 495  SER A CA  1 
ATOM   3818 C C   . SER A 1 495 ? -2.985  0.621   19.614  1.00 104.36 ? 495  SER A C   1 
ATOM   3819 O O   . SER A 1 495 ? -2.833  0.470   18.393  1.00 104.40 ? 495  SER A O   1 
ATOM   3820 C CB  . SER A 1 495 ? -3.179  -1.658  20.694  1.00 107.21 ? 495  SER A CB  1 
ATOM   3821 O OG  . SER A 1 495 ? -4.488  -1.401  21.170  1.00 109.53 ? 495  SER A OG  1 
ATOM   3822 N N   . LYS A 1 496 ? -3.692  1.627   20.144  1.00 104.16 ? 496  LYS A N   1 
ATOM   3823 C CA  . LYS A 1 496 ? -4.372  2.651   19.323  1.00 103.82 ? 496  LYS A CA  1 
ATOM   3824 C C   . LYS A 1 496 ? -3.416  3.478   18.436  1.00 100.19 ? 496  LYS A C   1 
ATOM   3825 O O   . LYS A 1 496 ? -3.722  3.745   17.266  1.00 100.52 ? 496  LYS A O   1 
ATOM   3826 C CB  . LYS A 1 496 ? -5.195  3.590   20.217  1.00 104.74 ? 496  LYS A CB  1 
ATOM   3827 N N   . SER A 1 497 ? -2.269  3.879   18.985  1.00 96.32  ? 497  SER A N   1 
ATOM   3828 C CA  . SER A 1 497 ? -1.280  4.621   18.203  1.00 92.80  ? 497  SER A CA  1 
ATOM   3829 C C   . SER A 1 497 ? -0.763  3.765   17.055  1.00 90.90  ? 497  SER A C   1 
ATOM   3830 O O   . SER A 1 497 ? -0.667  2.537   17.185  1.00 91.80  ? 497  SER A O   1 
ATOM   3831 C CB  . SER A 1 497 ? -0.088  5.049   19.059  1.00 90.85  ? 497  SER A CB  1 
ATOM   3832 O OG  . SER A 1 497 ? -0.448  6.056   19.985  1.00 91.60  ? 497  SER A OG  1 
ATOM   3833 N N   . PRO A 1 498 ? -0.422  4.406   15.925  1.00 87.71  ? 498  PRO A N   1 
ATOM   3834 C CA  . PRO A 1 498 ? 0.178   3.652   14.829  1.00 85.64  ? 498  PRO A CA  1 
ATOM   3835 C C   . PRO A 1 498 ? 1.547   3.077   15.228  1.00 81.79  ? 498  PRO A C   1 
ATOM   3836 O O   . PRO A 1 498 ? 2.285   3.698   16.000  1.00 79.48  ? 498  PRO A O   1 
ATOM   3837 C CB  . PRO A 1 498 ? 0.306   4.691   13.706  1.00 85.06  ? 498  PRO A CB  1 
ATOM   3838 C CG  . PRO A 1 498 ? 0.261   6.014   14.393  1.00 85.21  ? 498  PRO A CG  1 
ATOM   3839 C CD  . PRO A 1 498 ? -0.575  5.837   15.608  1.00 87.06  ? 498  PRO A CD  1 
ATOM   3840 N N   . GLN A 1 499 ? 1.840   1.886   14.707  1.00 79.74  ? 499  GLN A N   1 
ATOM   3841 C CA  . GLN A 1 499 ? 3.021   1.112   15.064  1.00 76.45  ? 499  GLN A CA  1 
ATOM   3842 C C   . GLN A 1 499 ? 4.175   1.379   14.116  1.00 72.20  ? 499  GLN A C   1 
ATOM   3843 O O   . GLN A 1 499 ? 3.975   1.589   12.927  1.00 72.44  ? 499  GLN A O   1 
ATOM   3844 C CB  . GLN A 1 499 ? 2.695   -0.375  15.015  1.00 78.43  ? 499  GLN A CB  1 
ATOM   3845 C CG  . GLN A 1 499 ? 1.697   -0.799  16.068  1.00 81.76  ? 499  GLN A CG  1 
ATOM   3846 C CD  . GLN A 1 499 ? 2.334   -0.969  17.439  1.00 82.89  ? 499  GLN A CD  1 
ATOM   3847 O OE1 . GLN A 1 499 ? 3.316   -1.710  17.595  1.00 83.57  ? 499  GLN A OE1 1 
ATOM   3848 N NE2 . GLN A 1 499 ? 1.772   -0.294  18.442  1.00 83.39  ? 499  GLN A NE2 1 
ATOM   3849 N N   . TRP A 1 500 ? 5.380   1.345   14.672  1.00 67.40  ? 500  TRP A N   1 
ATOM   3850 C CA  . TRP A 1 500 ? 6.623   1.456   13.940  1.00 63.75  ? 500  TRP A CA  1 
ATOM   3851 C C   . TRP A 1 500 ? 7.120   0.040   13.620  1.00 63.68  ? 500  TRP A C   1 
ATOM   3852 O O   . TRP A 1 500 ? 7.539   -0.687  14.520  1.00 63.54  ? 500  TRP A O   1 
ATOM   3853 C CB  . TRP A 1 500 ? 7.617   2.189   14.836  1.00 60.27  ? 500  TRP A CB  1 
ATOM   3854 C CG  . TRP A 1 500 ? 8.912   2.593   14.257  1.00 57.91  ? 500  TRP A CG  1 
ATOM   3855 C CD1 . TRP A 1 500 ? 9.548   2.082   13.155  1.00 56.79  ? 500  TRP A CD1 1 
ATOM   3856 C CD2 . TRP A 1 500 ? 9.787   3.583   14.801  1.00 53.57  ? 500  TRP A CD2 1 
ATOM   3857 N NE1 . TRP A 1 500 ? 10.753  2.717   12.973  1.00 53.46  ? 500  TRP A NE1 1 
ATOM   3858 C CE2 . TRP A 1 500 ? 10.927  3.634   13.977  1.00 53.12  ? 500  TRP A CE2 1 
ATOM   3859 C CE3 . TRP A 1 500 ? 9.717   4.424   15.917  1.00 53.20  ? 500  TRP A CE3 1 
ATOM   3860 C CZ2 . TRP A 1 500 ? 11.991  4.506   14.228  1.00 49.89  ? 500  TRP A CZ2 1 
ATOM   3861 C CZ3 . TRP A 1 500 ? 10.761  5.286   16.161  1.00 52.47  ? 500  TRP A CZ3 1 
ATOM   3862 C CH2 . TRP A 1 500 ? 11.884  5.322   15.321  1.00 51.08  ? 500  TRP A CH2 1 
ATOM   3863 N N   . PRO A 1 501 ? 7.092   -0.351  12.334  1.00 63.57  ? 501  PRO A N   1 
ATOM   3864 C CA  . PRO A 1 501 ? 7.495   -1.695  11.965  1.00 64.10  ? 501  PRO A CA  1 
ATOM   3865 C C   . PRO A 1 501 ? 8.999   -1.771  11.718  1.00 62.02  ? 501  PRO A C   1 
ATOM   3866 O O   . PRO A 1 501 ? 9.589   -0.782  11.288  1.00 60.83  ? 501  PRO A O   1 
ATOM   3867 C CB  . PRO A 1 501 ? 6.731   -1.924  10.659  1.00 65.47  ? 501  PRO A CB  1 
ATOM   3868 C CG  . PRO A 1 501 ? 6.616   -0.572  10.042  1.00 64.55  ? 501  PRO A CG  1 
ATOM   3869 C CD  . PRO A 1 501 ? 6.726   0.447   11.146  1.00 63.57  ? 501  PRO A CD  1 
ATOM   3870 N N   . PRO A 1 502 ? 9.621   -2.942  11.949  1.00 62.03  ? 502  PRO A N   1 
ATOM   3871 C CA  . PRO A 1 502 ? 11.049  -3.046  11.667  1.00 60.46  ? 502  PRO A CA  1 
ATOM   3872 C C   . PRO A 1 502 ? 11.379  -2.875  10.174  1.00 60.36  ? 502  PRO A C   1 
ATOM   3873 O O   . PRO A 1 502 ? 10.581  -3.245  9.307   1.00 61.51  ? 502  PRO A O   1 
ATOM   3874 C CB  . PRO A 1 502 ? 11.412  -4.470  12.113  1.00 62.03  ? 502  PRO A CB  1 
ATOM   3875 C CG  . PRO A 1 502 ? 10.261  -4.975  12.874  1.00 63.13  ? 502  PRO A CG  1 
ATOM   3876 C CD  . PRO A 1 502 ? 9.062   -4.213  12.421  1.00 63.65  ? 502  PRO A CD  1 
ATOM   3877 N N   . TYR A 1 503 ? 12.549  -2.307  9.899   1.00 58.57  ? 503  TYR A N   1 
ATOM   3878 C CA  . TYR A 1 503 ? 13.090  -2.237  8.546   1.00 58.19  ? 503  TYR A CA  1 
ATOM   3879 C C   . TYR A 1 503 ? 13.554  -3.610  8.094   1.00 58.85  ? 503  TYR A C   1 
ATOM   3880 O O   . TYR A 1 503 ? 14.339  -4.258  8.779   1.00 57.55  ? 503  TYR A O   1 
ATOM   3881 C CB  . TYR A 1 503 ? 14.274  -1.288  8.516   1.00 56.63  ? 503  TYR A CB  1 
ATOM   3882 C CG  . TYR A 1 503 ? 14.867  -1.079  7.144   1.00 57.99  ? 503  TYR A CG  1 
ATOM   3883 C CD1 . TYR A 1 503 ? 15.865  -1.926  6.665   1.00 59.22  ? 503  TYR A CD1 1 
ATOM   3884 C CD2 . TYR A 1 503 ? 14.440  -0.032  6.322   1.00 57.16  ? 503  TYR A CD2 1 
ATOM   3885 C CE1 . TYR A 1 503 ? 16.423  -1.739  5.405   1.00 58.37  ? 503  TYR A CE1 1 
ATOM   3886 C CE2 . TYR A 1 503 ? 14.994  0.158   5.066   1.00 57.35  ? 503  TYR A CE2 1 
ATOM   3887 C CZ  . TYR A 1 503 ? 15.986  -0.702  4.616   1.00 57.28  ? 503  TYR A CZ  1 
ATOM   3888 O OH  . TYR A 1 503 ? 16.542  -0.551  3.369   1.00 57.87  ? 503  TYR A OH  1 
ATOM   3889 N N   . THR A 1 504 ? 13.066  -4.039  6.934   1.00 59.96  ? 504  THR A N   1 
ATOM   3890 C CA  . THR A 1 504 ? 13.520  -5.264  6.304   1.00 61.35  ? 504  THR A CA  1 
ATOM   3891 C C   . THR A 1 504 ? 13.957  -4.983  4.874   1.00 61.51  ? 504  THR A C   1 
ATOM   3892 O O   . THR A 1 504 ? 13.528  -4.009  4.279   1.00 60.83  ? 504  THR A O   1 
ATOM   3893 C CB  . THR A 1 504 ? 12.379  -6.257  6.236   1.00 63.45  ? 504  THR A CB  1 
ATOM   3894 O OG1 . THR A 1 504 ? 11.292  -5.640  5.535   1.00 63.09  ? 504  THR A OG1 1 
ATOM   3895 C CG2 . THR A 1 504 ? 11.926  -6.658  7.645   1.00 63.35  ? 504  THR A CG2 1 
ATOM   3896 N N   . THR A 1 505 ? 14.781  -5.859  4.307   1.00 63.12  ? 505  THR A N   1 
ATOM   3897 C CA  . THR A 1 505 ? 15.124  -5.755  2.887   1.00 63.79  ? 505  THR A CA  1 
ATOM   3898 C C   . THR A 1 505 ? 13.873  -5.972  2.014   1.00 65.61  ? 505  THR A C   1 
ATOM   3899 O O   . THR A 1 505 ? 13.682  -5.286  1.018   1.00 65.83  ? 505  THR A O   1 
ATOM   3900 C CB  . THR A 1 505 ? 16.254  -6.745  2.474   1.00 64.62  ? 505  THR A CB  1 
ATOM   3901 O OG1 . THR A 1 505 ? 15.785  -8.092  2.574   1.00 66.39  ? 505  THR A OG1 1 
ATOM   3902 C CG2 . THR A 1 505 ? 17.491  -6.569  3.353   1.00 63.60  ? 505  THR A CG2 1 
ATOM   3903 N N   . ALA A 1 506 ? 12.998  -6.889  2.400   1.00 67.61  ? 506  ALA A N   1 
ATOM   3904 C CA  . ALA A 1 506 ? 11.811  -7.147  1.590   1.00 69.62  ? 506  ALA A CA  1 
ATOM   3905 C C   . ALA A 1 506 ? 10.934  -5.908  1.468   1.00 68.73  ? 506  ALA A C   1 
ATOM   3906 O O   . ALA A 1 506 ? 10.610  -5.493  0.360   1.00 69.76  ? 506  ALA A O   1 
ATOM   3907 C CB  . ALA A 1 506 ? 10.998  -8.328  2.139   1.00 72.24  ? 506  ALA A CB  1 
ATOM   3908 N N   . ALA A 1 507 ? 10.574  -5.305  2.597   1.00 67.47  ? 507  ALA A N   1 
ATOM   3909 C CA  . ALA A 1 507 ? 9.589   -4.216  2.611   1.00 66.35  ? 507  ALA A CA  1 
ATOM   3910 C C   . ALA A 1 507 ? 10.202  -2.828  2.769   1.00 63.55  ? 507  ALA A C   1 
ATOM   3911 O O   . ALA A 1 507 ? 9.575   -1.853  2.410   1.00 63.81  ? 507  ALA A O   1 
ATOM   3912 C CB  . ALA A 1 507 ? 8.537   -4.468  3.695   1.00 66.74  ? 507  ALA A CB  1 
ATOM   3913 N N   . GLN A 1 508 ? 11.406  -2.726  3.320   1.00 61.85  ? 508  GLN A N   1 
ATOM   3914 C CA  . GLN A 1 508 ? 12.127  -1.443  3.407   1.00 59.43  ? 508  GLN A CA  1 
ATOM   3915 C C   . GLN A 1 508 ? 11.383  -0.306  4.124   1.00 58.63  ? 508  GLN A C   1 
ATOM   3916 O O   . GLN A 1 508 ? 11.577  0.879   3.809   1.00 57.59  ? 508  GLN A O   1 
ATOM   3917 C CB  . GLN A 1 508 ? 12.559  -0.985  2.016   1.00 59.23  ? 508  GLN A CB  1 
ATOM   3918 C CG  . GLN A 1 508 ? 13.445  -1.983  1.286   1.00 59.49  ? 508  GLN A CG  1 
ATOM   3919 C CD  . GLN A 1 508 ? 13.881  -1.481  -0.076  1.00 59.20  ? 508  GLN A CD  1 
ATOM   3920 O OE1 . GLN A 1 508 ? 14.453  -0.394  -0.202  1.00 56.85  ? 508  GLN A OE1 1 
ATOM   3921 N NE2 . GLN A 1 508 ? 13.623  -2.277  -1.103  1.00 56.83  ? 508  GLN A NE2 1 
ATOM   3922 N N   . GLN A 1 509 ? 10.603  -0.669  5.136   1.00 59.27  ? 509  GLN A N   1 
ATOM   3923 C CA  . GLN A 1 509 ? 9.761   0.278   5.862   1.00 59.18  ? 509  GLN A CA  1 
ATOM   3924 C C   . GLN A 1 509 ? 10.475  1.141   6.899   1.00 57.10  ? 509  GLN A C   1 
ATOM   3925 O O   . GLN A 1 509 ? 11.397  0.698   7.583   1.00 56.26  ? 509  GLN A O   1 
ATOM   3926 C CB  . GLN A 1 509 ? 8.652   -0.457  6.579   1.00 61.08  ? 509  GLN A CB  1 
ATOM   3927 C CG  . GLN A 1 509 ? 7.667   -1.096  5.664   1.00 63.75  ? 509  GLN A CG  1 
ATOM   3928 C CD  . GLN A 1 509 ? 6.762   -2.035  6.398   1.00 67.65  ? 509  GLN A CD  1 
ATOM   3929 O OE1 . GLN A 1 509 ? 7.219   -3.030  6.950   1.00 70.40  ? 509  GLN A OE1 1 
ATOM   3930 N NE2 . GLN A 1 509 ? 5.464   -1.741  6.404   1.00 69.73  ? 509  GLN A NE2 1 
ATOM   3931 N N   . TYR A 1 510 ? 9.987   2.369   7.028   1.00 56.37  ? 510  TYR A N   1 
ATOM   3932 C CA  . TYR A 1 510 ? 10.503  3.325   7.982   1.00 54.98  ? 510  TYR A CA  1 
ATOM   3933 C C   . TYR A 1 510 ? 9.430   4.354   8.290   1.00 54.93  ? 510  TYR A C   1 
ATOM   3934 O O   . TYR A 1 510 ? 8.454   4.463   7.559   1.00 56.23  ? 510  TYR A O   1 
ATOM   3935 C CB  . TYR A 1 510 ? 11.746  3.995   7.420   1.00 53.78  ? 510  TYR A CB  1 
ATOM   3936 C CG  . TYR A 1 510 ? 11.509  4.922   6.247   1.00 54.66  ? 510  TYR A CG  1 
ATOM   3937 C CD1 . TYR A 1 510 ? 11.332  4.423   4.960   1.00 56.17  ? 510  TYR A CD1 1 
ATOM   3938 C CD2 . TYR A 1 510 ? 11.497  6.312   6.422   1.00 54.65  ? 510  TYR A CD2 1 
ATOM   3939 C CE1 . TYR A 1 510 ? 11.124  5.275   3.881   1.00 56.99  ? 510  TYR A CE1 1 
ATOM   3940 C CE2 . TYR A 1 510 ? 11.288  7.172   5.357   1.00 54.79  ? 510  TYR A CE2 1 
ATOM   3941 C CZ  . TYR A 1 510 ? 11.106  6.652   4.080   1.00 56.31  ? 510  TYR A CZ  1 
ATOM   3942 O OH  . TYR A 1 510 ? 10.899  7.506   3.006   1.00 55.97  ? 510  TYR A OH  1 
ATOM   3943 N N   . VAL A 1 511 ? 9.601   5.109   9.369   1.00 53.22  ? 511  VAL A N   1 
ATOM   3944 C CA  . VAL A 1 511 ? 8.542   6.015   9.814   1.00 53.03  ? 511  VAL A CA  1 
ATOM   3945 C C   . VAL A 1 511 ? 8.980   7.456   9.695   1.00 52.06  ? 511  VAL A C   1 
ATOM   3946 O O   . VAL A 1 511 ? 10.171  7.768   9.830   1.00 50.31  ? 511  VAL A O   1 
ATOM   3947 C CB  . VAL A 1 511 ? 8.092   5.732   11.271  1.00 53.13  ? 511  VAL A CB  1 
ATOM   3948 C CG1 . VAL A 1 511 ? 7.396   4.349   11.369  1.00 53.29  ? 511  VAL A CG1 1 
ATOM   3949 C CG2 . VAL A 1 511 ? 9.260   5.862   12.251  1.00 50.86  ? 511  VAL A CG2 1 
ATOM   3950 N N   . SER A 1 512 ? 8.028   8.343   9.433   1.00 52.83  ? 512  SER A N   1 
ATOM   3951 C CA  . SER A 1 512 ? 8.314   9.775   9.534   1.00 52.40  ? 512  SER A CA  1 
ATOM   3952 C C   . SER A 1 512 ? 8.155   10.246  10.985  1.00 52.13  ? 512  SER A C   1 
ATOM   3953 O O   . SER A 1 512 ? 7.136   9.977   11.626  1.00 53.61  ? 512  SER A O   1 
ATOM   3954 C CB  . SER A 1 512 ? 7.378   10.566  8.630   1.00 53.37  ? 512  SER A CB  1 
ATOM   3955 O OG  . SER A 1 512 ? 6.046   10.143  8.840   1.00 55.47  ? 512  SER A OG  1 
ATOM   3956 N N   . LEU A 1 513 ? 9.157   10.955  11.503  1.00 50.65  ? 513  LEU A N   1 
ATOM   3957 C CA  . LEU A 1 513 ? 9.014   11.595  12.809  1.00 50.76  ? 513  LEU A CA  1 
ATOM   3958 C C   . LEU A 1 513 ? 8.685   13.072  12.620  1.00 50.90  ? 513  LEU A C   1 
ATOM   3959 O O   . LEU A 1 513 ? 9.516   13.841  12.186  1.00 49.57  ? 513  LEU A O   1 
ATOM   3960 C CB  . LEU A 1 513 ? 10.272  11.406  13.662  1.00 49.26  ? 513  LEU A CB  1 
ATOM   3961 C CG  . LEU A 1 513 ? 10.638  9.957   13.990  1.00 48.46  ? 513  LEU A CG  1 
ATOM   3962 C CD1 . LEU A 1 513 ? 11.897  9.952   14.820  1.00 44.30  ? 513  LEU A CD1 1 
ATOM   3963 C CD2 . LEU A 1 513 ? 9.485   9.257   14.720  1.00 47.50  ? 513  LEU A CD2 1 
ATOM   3964 N N   . ASN A 1 514 ? 7.448   13.448  12.918  1.00 53.35  ? 514  ASN A N   1 
ATOM   3965 C CA  . ASN A 1 514 ? 7.011   14.861  12.867  1.00 54.72  ? 514  ASN A CA  1 
ATOM   3966 C C   . ASN A 1 514 ? 5.844   15.094  13.822  1.00 56.66  ? 514  ASN A C   1 
ATOM   3967 O O   . ASN A 1 514 ? 5.475   14.180  14.570  1.00 57.13  ? 514  ASN A O   1 
ATOM   3968 C CB  . ASN A 1 514 ? 6.695   15.333  11.423  1.00 55.01  ? 514  ASN A CB  1 
ATOM   3969 C CG  . ASN A 1 514 ? 5.772   14.380  10.647  1.00 57.80  ? 514  ASN A CG  1 
ATOM   3970 O OD1 . ASN A 1 514 ? 4.720   13.917  11.151  1.00 59.97  ? 514  ASN A OD1 1 
ATOM   3971 N ND2 . ASN A 1 514 ? 6.142   14.118  9.385   1.00 56.35  ? 514  ASN A ND2 1 
ATOM   3972 N N   . LEU A 1 515 ? 5.270   16.303  13.803  1.00 58.14  ? 515  LEU A N   1 
ATOM   3973 C CA  . LEU A 1 515 ? 4.153   16.663  14.700  1.00 59.70  ? 515  LEU A CA  1 
ATOM   3974 C C   . LEU A 1 515 ? 2.911   15.803  14.524  1.00 62.38  ? 515  LEU A C   1 
ATOM   3975 O O   . LEU A 1 515 ? 2.030   15.823  15.384  1.00 64.48  ? 515  LEU A O   1 
ATOM   3976 C CB  . LEU A 1 515 ? 3.750   18.135  14.505  1.00 60.19  ? 515  LEU A CB  1 
ATOM   3977 C CG  . LEU A 1 515 ? 4.813   19.183  14.835  1.00 58.46  ? 515  LEU A CG  1 
ATOM   3978 C CD1 . LEU A 1 515 ? 4.210   20.596  14.837  1.00 56.77  ? 515  LEU A CD1 1 
ATOM   3979 C CD2 . LEU A 1 515 ? 5.461   18.862  16.160  1.00 54.42  ? 515  LEU A CD2 1 
ATOM   3980 N N   . LYS A 1 516 ? 2.825   15.080  13.407  1.00 63.44  ? 516  LYS A N   1 
ATOM   3981 C CA  . LYS A 1 516 ? 1.680   14.218  13.111  1.00 65.75  ? 516  LYS A CA  1 
ATOM   3982 C C   . LYS A 1 516 ? 1.969   12.798  13.581  1.00 65.15  ? 516  LYS A C   1 
ATOM   3983 O O   . LYS A 1 516 ? 3.126   12.417  13.750  1.00 63.17  ? 516  LYS A O   1 
ATOM   3984 C CB  . LYS A 1 516 ? 1.397   14.190  11.609  1.00 66.45  ? 516  LYS A CB  1 
ATOM   3985 C CG  . LYS A 1 516 ? 1.456   15.545  10.912  1.00 67.79  ? 516  LYS A CG  1 
ATOM   3986 C CD  . LYS A 1 516 ? 1.480   15.404  9.385   1.00 68.89  ? 516  LYS A CD  1 
ATOM   3987 C CE  . LYS A 1 516 ? 0.120   14.940  8.860   1.00 74.26  ? 516  LYS A CE  1 
ATOM   3988 N NZ  . LYS A 1 516 ? -0.025  15.192  7.389   1.00 78.14  ? 516  LYS A NZ  1 
ATOM   3989 N N   . PRO A 1 517 ? 0.917   11.996  13.795  1.00 66.76  ? 517  PRO A N   1 
ATOM   3990 C CA  . PRO A 1 517 ? 1.171   10.607  14.178  1.00 66.65  ? 517  PRO A CA  1 
ATOM   3991 C C   . PRO A 1 517 ? 2.045   9.864   13.160  1.00 65.52  ? 517  PRO A C   1 
ATOM   3992 O O   . PRO A 1 517 ? 2.060   10.224  11.980  1.00 65.09  ? 517  PRO A O   1 
ATOM   3993 C CB  . PRO A 1 517 ? -0.239  9.999   14.242  1.00 69.12  ? 517  PRO A CB  1 
ATOM   3994 C CG  . PRO A 1 517 ? -1.163  11.161  14.445  1.00 70.22  ? 517  PRO A CG  1 
ATOM   3995 C CD  . PRO A 1 517 ? -0.525  12.307  13.723  1.00 69.12  ? 517  PRO A CD  1 
ATOM   3996 N N   . LEU A 1 518 ? 2.756   8.834   13.619  1.00 65.11  ? 518  LEU A N   1 
ATOM   3997 C CA  . LEU A 1 518 ? 3.664   8.050   12.761  1.00 64.34  ? 518  LEU A CA  1 
ATOM   3998 C C   . LEU A 1 518 ? 3.029   7.622   11.454  1.00 65.62  ? 518  LEU A C   1 
ATOM   3999 O O   . LEU A 1 518 ? 1.943   7.049   11.444  1.00 67.50  ? 518  LEU A O   1 
ATOM   4000 C CB  . LEU A 1 518 ? 4.134   6.770   13.455  1.00 64.21  ? 518  LEU A CB  1 
ATOM   4001 C CG  . LEU A 1 518 ? 5.246   6.800   14.486  1.00 63.26  ? 518  LEU A CG  1 
ATOM   4002 C CD1 . LEU A 1 518 ? 5.630   5.361   14.833  1.00 63.88  ? 518  LEU A CD1 1 
ATOM   4003 C CD2 . LEU A 1 518 ? 6.464   7.599   14.019  1.00 61.83  ? 518  LEU A CD2 1 
ATOM   4004 N N   . GLU A 1 519 ? 3.735   7.894   10.366  1.00 64.96  ? 519  GLU A N   1 
ATOM   4005 C CA  . GLU A 1 519 ? 3.378   7.423   9.036   1.00 66.73  ? 519  GLU A CA  1 
ATOM   4006 C C   . GLU A 1 519 ? 4.480   6.481   8.547   1.00 64.85  ? 519  GLU A C   1 
ATOM   4007 O O   . GLU A 1 519 ? 5.664   6.845   8.533   1.00 62.46  ? 519  GLU A O   1 
ATOM   4008 C CB  . GLU A 1 519 ? 3.211   8.626   8.092   1.00 66.84  ? 519  GLU A CB  1 
ATOM   4009 C CG  . GLU A 1 519 ? 3.241   8.310   6.599   1.00 69.36  ? 519  GLU A CG  1 
ATOM   4010 C CD  . GLU A 1 519 ? 3.042   9.559   5.723   1.00 70.16  ? 519  GLU A CD  1 
ATOM   4011 O OE1 . GLU A 1 519 ? 1.950   10.177  5.813   1.00 77.02  ? 519  GLU A OE1 1 
ATOM   4012 O OE2 . GLU A 1 519 ? 3.957   9.910   4.940   1.00 70.53  ? 519  GLU A OE2 1 
ATOM   4013 N N   . VAL A 1 520 ? 4.095   5.268   8.163   1.00 65.16  ? 520  VAL A N   1 
ATOM   4014 C CA  . VAL A 1 520 ? 5.023   4.292   7.608   1.00 64.54  ? 520  VAL A CA  1 
ATOM   4015 C C   . VAL A 1 520 ? 5.238   4.636   6.136   1.00 64.61  ? 520  VAL A C   1 
ATOM   4016 O O   . VAL A 1 520 ? 4.281   4.916   5.416   1.00 66.01  ? 520  VAL A O   1 
ATOM   4017 C CB  . VAL A 1 520 ? 4.478   2.841   7.731   1.00 66.60  ? 520  VAL A CB  1 
ATOM   4018 C CG1 . VAL A 1 520 ? 5.426   1.845   7.090   1.00 66.13  ? 520  VAL A CG1 1 
ATOM   4019 C CG2 . VAL A 1 520 ? 4.230   2.477   9.191   1.00 66.32  ? 520  VAL A CG2 1 
ATOM   4020 N N   . ARG A 1 521 ? 6.497   4.631   5.708   1.00 63.18  ? 521  ARG A N   1 
ATOM   4021 C CA  . ARG A 1 521 ? 6.873   4.835   4.308   1.00 63.28  ? 521  ARG A CA  1 
ATOM   4022 C C   . ARG A 1 521 ? 7.742   3.687   3.865   1.00 63.77  ? 521  ARG A C   1 
ATOM   4023 O O   . ARG A 1 521 ? 8.260   2.964   4.698   1.00 62.99  ? 521  ARG A O   1 
ATOM   4024 C CB  . ARG A 1 521 ? 7.649   6.140   4.149   1.00 61.29  ? 521  ARG A CB  1 
ATOM   4025 C CG  . ARG A 1 521 ? 6.789   7.333   4.357   1.00 60.95  ? 521  ARG A CG  1 
ATOM   4026 C CD  . ARG A 1 521 ? 7.583   8.586   4.317   1.00 59.18  ? 521  ARG A CD  1 
ATOM   4027 N NE  . ARG A 1 521 ? 6.803   9.715   4.790   1.00 58.39  ? 521  ARG A NE  1 
ATOM   4028 C CZ  . ARG A 1 521 ? 7.305   10.927  5.007   1.00 59.11  ? 521  ARG A CZ  1 
ATOM   4029 N NH1 . ARG A 1 521 ? 8.605   11.172  4.821   1.00 57.38  ? 521  ARG A NH1 1 
ATOM   4030 N NH2 . ARG A 1 521 ? 6.508   11.889  5.452   1.00 59.59  ? 521  ARG A NH2 1 
ATOM   4031 N N   . ARG A 1 522 ? 7.921   3.540   2.558   1.00 65.32  ? 522  ARG A N   1 
ATOM   4032 C CA  . ARG A 1 522 ? 8.695   2.434   2.013   1.00 67.10  ? 522  ARG A CA  1 
ATOM   4033 C C   . ARG A 1 522 ? 9.843   2.916   1.132   1.00 66.21  ? 522  ARG A C   1 
ATOM   4034 O O   . ARG A 1 522 ? 9.651   3.755   0.253   1.00 66.60  ? 522  ARG A O   1 
ATOM   4035 C CB  . ARG A 1 522 ? 7.778   1.484   1.253   1.00 68.97  ? 522  ARG A CB  1 
ATOM   4036 C CG  . ARG A 1 522 ? 6.911   0.654   2.184   1.00 71.69  ? 522  ARG A CG  1 
ATOM   4037 C CD  . ARG A 1 522 ? 6.145   -0.436  1.448   1.00 76.28  ? 522  ARG A CD  1 
ATOM   4038 N NE  . ARG A 1 522 ? 7.059   -1.320  0.702   1.00 81.12  ? 522  ARG A NE  1 
ATOM   4039 C CZ  . ARG A 1 522 ? 6.718   -2.128  -0.311  1.00 84.21  ? 522  ARG A CZ  1 
ATOM   4040 N NH1 . ARG A 1 522 ? 5.460   -2.191  -0.750  1.00 87.33  ? 522  ARG A NH1 1 
ATOM   4041 N NH2 . ARG A 1 522 ? 7.658   -2.870  -0.909  1.00 84.04  ? 522  ARG A NH2 1 
ATOM   4042 N N   . GLY A 1 523 ? 11.039  2.393   1.392   1.00 65.75  ? 523  GLY A N   1 
ATOM   4043 C CA  . GLY A 1 523 ? 12.216  2.700   0.596   1.00 65.33  ? 523  GLY A CA  1 
ATOM   4044 C C   . GLY A 1 523 ? 12.823  4.020   1.007   1.00 64.22  ? 523  GLY A C   1 
ATOM   4045 O O   . GLY A 1 523 ? 12.265  5.078   0.727   1.00 64.66  ? 523  GLY A O   1 
ATOM   4046 N N   . LEU A 1 524 ? 13.961  3.967   1.690   1.00 63.75  ? 524  LEU A N   1 
ATOM   4047 C CA  . LEU A 1 524 ? 14.649  5.180   2.101   1.00 62.43  ? 524  LEU A CA  1 
ATOM   4048 C C   . LEU A 1 524 ? 15.521  5.633   0.938   1.00 61.40  ? 524  LEU A C   1 
ATOM   4049 O O   . LEU A 1 524 ? 16.671  5.247   0.792   1.00 61.48  ? 524  LEU A O   1 
ATOM   4050 C CB  . LEU A 1 524 ? 15.445  4.946   3.386   1.00 61.56  ? 524  LEU A CB  1 
ATOM   4051 C CG  . LEU A 1 524 ? 16.235  6.148   3.930   1.00 61.19  ? 524  LEU A CG  1 
ATOM   4052 C CD1 . LEU A 1 524 ? 15.379  7.435   4.071   1.00 62.87  ? 524  LEU A CD1 1 
ATOM   4053 C CD2 . LEU A 1 524 ? 16.878  5.754   5.268   1.00 61.02  ? 524  LEU A CD2 1 
ATOM   4054 N N   . ARG A 1 525 ? 14.909  6.407   0.065   1.00 61.37  ? 525  ARG A N   1 
ATOM   4055 C CA  . ARG A 1 525 ? 15.576  7.029   -1.055  1.00 60.92  ? 525  ARG A CA  1 
ATOM   4056 C C   . ARG A 1 525 ? 16.174  5.977   -1.994  1.00 60.29  ? 525  ARG A C   1 
ATOM   4057 O O   . ARG A 1 525 ? 17.290  6.118   -2.482  1.00 58.72  ? 525  ARG A O   1 
ATOM   4058 C CB  . ARG A 1 525 ? 16.620  8.030   -0.560  1.00 60.01  ? 525  ARG A CB  1 
ATOM   4059 C CG  . ARG A 1 525 ? 16.890  9.072   -1.611  1.00 63.43  ? 525  ARG A CG  1 
ATOM   4060 C CD  . ARG A 1 525 ? 17.325  10.396  -1.082  1.00 66.43  ? 525  ARG A CD  1 
ATOM   4061 N NE  . ARG A 1 525 ? 16.410  10.946  -0.091  1.00 67.95  ? 525  ARG A NE  1 
ATOM   4062 C CZ  . ARG A 1 525 ? 16.565  12.148  0.456   1.00 67.93  ? 525  ARG A CZ  1 
ATOM   4063 N NH1 . ARG A 1 525 ? 17.563  12.937  0.090   1.00 67.27  ? 525  ARG A NH1 1 
ATOM   4064 N NH2 . ARG A 1 525 ? 15.707  12.572  1.365   1.00 70.69  ? 525  ARG A NH2 1 
ATOM   4065 N N   . ALA A 1 526 ? 15.366  4.952   -2.264  1.00 60.19  ? 526  ALA A N   1 
ATOM   4066 C CA  . ALA A 1 526 ? 15.797  3.735   -2.929  1.00 60.86  ? 526  ALA A CA  1 
ATOM   4067 C C   . ALA A 1 526 ? 16.485  3.938   -4.280  1.00 60.65  ? 526  ALA A C   1 
ATOM   4068 O O   . ALA A 1 526 ? 17.530  3.346   -4.496  1.00 60.68  ? 526  ALA A O   1 
ATOM   4069 C CB  . ALA A 1 526 ? 14.612  2.750   -3.067  1.00 61.77  ? 526  ALA A CB  1 
ATOM   4070 N N   . GLN A 1 527 ? 15.944  4.771   -5.172  1.00 60.66  ? 527  GLN A N   1 
ATOM   4071 C CA  . GLN A 1 527 ? 16.539  4.901   -6.513  1.00 60.78  ? 527  GLN A CA  1 
ATOM   4072 C C   . GLN A 1 527 ? 17.874  5.617   -6.458  1.00 58.99  ? 527  GLN A C   1 
ATOM   4073 O O   . GLN A 1 527 ? 18.876  5.107   -6.963  1.00 59.03  ? 527  GLN A O   1 
ATOM   4074 C CB  . GLN A 1 527 ? 15.610  5.619   -7.501  1.00 62.13  ? 527  GLN A CB  1 
ATOM   4075 C CG  . GLN A 1 527 ? 14.348  4.849   -7.906  1.00 64.15  ? 527  GLN A CG  1 
ATOM   4076 C CD  . GLN A 1 527 ? 14.597  3.451   -8.458  1.00 66.52  ? 527  GLN A CD  1 
ATOM   4077 O OE1 . GLN A 1 527 ? 14.097  2.463   -7.902  1.00 67.77  ? 527  GLN A OE1 1 
ATOM   4078 N NE2 . GLN A 1 527 ? 15.347  3.357   -9.563  1.00 66.48  ? 527  GLN A NE2 1 
ATOM   4079 N N   . THR A 1 528 ? 17.878  6.799   -5.845  1.00 57.23  ? 528  THR A N   1 
ATOM   4080 C CA  . THR A 1 528 ? 19.093  7.579   -5.675  1.00 55.62  ? 528  THR A CA  1 
ATOM   4081 C C   . THR A 1 528 ? 20.173  6.821   -4.912  1.00 54.26  ? 528  THR A C   1 
ATOM   4082 O O   . THR A 1 528 ? 21.330  6.922   -5.250  1.00 54.57  ? 528  THR A O   1 
ATOM   4083 C CB  . THR A 1 528 ? 18.812  8.900   -4.966  1.00 54.49  ? 528  THR A CB  1 
ATOM   4084 O OG1 . THR A 1 528 ? 18.054  9.754   -5.836  1.00 56.44  ? 528  THR A OG1 1 
ATOM   4085 C CG2 . THR A 1 528 ? 20.109  9.600   -4.585  1.00 53.79  ? 528  THR A CG2 1 
ATOM   4086 N N   . CYS A 1 529 ? 19.822  6.051   -3.901  1.00 53.74  ? 529  CYS A N   1 
ATOM   4087 C CA  . CYS A 1 529 ? 20.856  5.333   -3.157  1.00 53.36  ? 529  CYS A CA  1 
ATOM   4088 C C   . CYS A 1 529 ? 21.389  4.134   -3.929  1.00 53.98  ? 529  CYS A C   1 
ATOM   4089 O O   . CYS A 1 529 ? 22.509  3.693   -3.692  1.00 53.67  ? 529  CYS A O   1 
ATOM   4090 C CB  . CYS A 1 529 ? 20.377  4.958   -1.750  1.00 52.96  ? 529  CYS A CB  1 
ATOM   4091 S SG  . CYS A 1 529 ? 20.235  6.414   -0.648  1.00 54.00  ? 529  CYS A SG  1 
ATOM   4092 N N   . ALA A 1 530 ? 20.608  3.630   -4.873  1.00 54.89  ? 530  ALA A N   1 
ATOM   4093 C CA  . ALA A 1 530 ? 21.108  2.649   -5.831  1.00 55.86  ? 530  ALA A CA  1 
ATOM   4094 C C   . ALA A 1 530 ? 22.200  3.294   -6.684  1.00 55.05  ? 530  ALA A C   1 
ATOM   4095 O O   . ALA A 1 530 ? 23.205  2.657   -7.009  1.00 55.38  ? 530  ALA A O   1 
ATOM   4096 C CB  . ALA A 1 530 ? 19.989  2.139   -6.715  1.00 57.46  ? 530  ALA A CB  1 
ATOM   4097 N N   . PHE A 1 531 ? 22.001  4.555   -7.043  1.00 53.28  ? 531  PHE A N   1 
ATOM   4098 C CA  . PHE A 1 531 ? 23.013  5.290   -7.761  1.00 52.75  ? 531  PHE A CA  1 
ATOM   4099 C C   . PHE A 1 531 ? 24.311  5.321   -6.943  1.00 51.83  ? 531  PHE A C   1 
ATOM   4100 O O   . PHE A 1 531 ? 25.339  4.842   -7.404  1.00 52.37  ? 531  PHE A O   1 
ATOM   4101 C CB  . PHE A 1 531 ? 22.510  6.694   -8.074  1.00 51.48  ? 531  PHE A CB  1 
ATOM   4102 C CG  . PHE A 1 531 ? 23.556  7.607   -8.642  1.00 50.82  ? 531  PHE A CG  1 
ATOM   4103 C CD1 . PHE A 1 531 ? 23.955  7.487   -9.969  1.00 50.22  ? 531  PHE A CD1 1 
ATOM   4104 C CD2 . PHE A 1 531 ? 24.109  8.614   -7.865  1.00 48.55  ? 531  PHE A CD2 1 
ATOM   4105 C CE1 . PHE A 1 531 ? 24.897  8.324   -10.498 1.00 49.46  ? 531  PHE A CE1 1 
ATOM   4106 C CE2 . PHE A 1 531 ? 25.071  9.456   -8.390  1.00 48.00  ? 531  PHE A CE2 1 
ATOM   4107 C CZ  . PHE A 1 531 ? 25.459  9.303   -9.719  1.00 49.10  ? 531  PHE A CZ  1 
ATOM   4108 N N   . TRP A 1 532 ? 24.254  5.859   -5.730  1.00 50.89  ? 532  TRP A N   1 
ATOM   4109 C CA  . TRP A 1 532 ? 25.459  6.000   -4.883  1.00 50.55  ? 532  TRP A CA  1 
ATOM   4110 C C   . TRP A 1 532 ? 26.070  4.657   -4.469  1.00 51.89  ? 532  TRP A C   1 
ATOM   4111 O O   . TRP A 1 532 ? 27.271  4.480   -4.531  1.00 52.22  ? 532  TRP A O   1 
ATOM   4112 C CB  . TRP A 1 532 ? 25.156  6.829   -3.621  1.00 48.38  ? 532  TRP A CB  1 
ATOM   4113 C CG  . TRP A 1 532 ? 24.852  8.251   -3.888  1.00 46.91  ? 532  TRP A CG  1 
ATOM   4114 C CD1 . TRP A 1 532 ? 23.623  8.840   -3.914  1.00 47.54  ? 532  TRP A CD1 1 
ATOM   4115 C CD2 . TRP A 1 532 ? 25.794  9.287   -4.160  1.00 45.60  ? 532  TRP A CD2 1 
ATOM   4116 N NE1 . TRP A 1 532 ? 23.741  10.180  -4.178  1.00 46.68  ? 532  TRP A NE1 1 
ATOM   4117 C CE2 . TRP A 1 532 ? 25.069  10.479  -4.332  1.00 45.70  ? 532  TRP A CE2 1 
ATOM   4118 C CE3 . TRP A 1 532 ? 27.182  9.323   -4.280  1.00 46.46  ? 532  TRP A CE3 1 
ATOM   4119 C CZ2 . TRP A 1 532 ? 25.685  11.682  -4.638  1.00 45.15  ? 532  TRP A CZ2 1 
ATOM   4120 C CZ3 . TRP A 1 532 ? 27.790  10.533  -4.568  1.00 46.43  ? 532  TRP A CZ3 1 
ATOM   4121 C CH2 . TRP A 1 532 ? 27.037  11.690  -4.742  1.00 45.55  ? 532  TRP A CH2 1 
ATOM   4122 N N   . ASN A 1 533 ? 25.237  3.708   -4.071  1.00 54.05  ? 533  ASN A N   1 
ATOM   4123 C CA  . ASN A 1 533 ? 25.711  2.446   -3.472  1.00 55.04  ? 533  ASN A CA  1 
ATOM   4124 C C   . ASN A 1 533 ? 25.968  1.310   -4.429  1.00 58.04  ? 533  ASN A C   1 
ATOM   4125 O O   . ASN A 1 533 ? 26.642  0.342   -4.062  1.00 59.10  ? 533  ASN A O   1 
ATOM   4126 C CB  . ASN A 1 533 ? 24.705  1.947   -2.443  1.00 54.48  ? 533  ASN A CB  1 
ATOM   4127 C CG  . ASN A 1 533 ? 24.517  2.917   -1.295  1.00 52.69  ? 533  ASN A CG  1 
ATOM   4128 O OD1 . ASN A 1 533 ? 25.374  3.747   -1.043  1.00 50.86  ? 533  ASN A OD1 1 
ATOM   4129 N ND2 . ASN A 1 533 ? 23.409  2.788   -0.571  1.00 52.09  ? 533  ASN A ND2 1 
ATOM   4130 N N   . ARG A 1 534 ? 25.385  1.372   -5.623  1.00 60.22  ? 534  ARG A N   1 
ATOM   4131 C CA  . ARG A 1 534 ? 25.536  0.291   -6.602  1.00 62.56  ? 534  ARG A CA  1 
ATOM   4132 C C   . ARG A 1 534 ? 26.202  0.761   -7.876  1.00 63.42  ? 534  ARG A C   1 
ATOM   4133 O O   . ARG A 1 534 ? 27.063  0.071   -8.395  1.00 64.57  ? 534  ARG A O   1 
ATOM   4134 C CB  . ARG A 1 534 ? 24.194  -0.351  -6.938  1.00 63.91  ? 534  ARG A CB  1 
ATOM   4135 C CG  . ARG A 1 534 ? 23.593  -1.150  -5.805  1.00 65.23  ? 534  ARG A CG  1 
ATOM   4136 C CD  . ARG A 1 534 ? 22.104  -1.297  -6.009  1.00 68.08  ? 534  ARG A CD  1 
ATOM   4137 N NE  . ARG A 1 534 ? 21.403  -1.907  -4.886  1.00 69.06  ? 534  ARG A NE  1 
ATOM   4138 C CZ  . ARG A 1 534 ? 21.426  -3.210  -4.603  1.00 70.20  ? 534  ARG A CZ  1 
ATOM   4139 N NH1 . ARG A 1 534 ? 22.117  -4.069  -5.340  1.00 71.30  ? 534  ARG A NH1 1 
ATOM   4140 N NH2 . ARG A 1 534 ? 20.740  -3.650  -3.566  1.00 71.15  ? 534  ARG A NH2 1 
ATOM   4141 N N   . PHE A 1 535 ? 25.817  1.926   -8.391  1.00 63.46  ? 535  PHE A N   1 
ATOM   4142 C CA  . PHE A 1 535 ? 26.372  2.348   -9.661  1.00 64.21  ? 535  PHE A CA  1 
ATOM   4143 C C   . PHE A 1 535 ? 27.783  2.888   -9.518  1.00 64.16  ? 535  PHE A C   1 
ATOM   4144 O O   . PHE A 1 535 ? 28.704  2.343   -10.120 1.00 65.52  ? 535  PHE A O   1 
ATOM   4145 C CB  . PHE A 1 535 ? 25.514  3.361   -10.429 1.00 63.38  ? 535  PHE A CB  1 
ATOM   4146 C CG  . PHE A 1 535 ? 26.150  3.757   -11.713 1.00 63.19  ? 535  PHE A CG  1 
ATOM   4147 C CD1 . PHE A 1 535 ? 26.377  2.797   -12.692 1.00 64.41  ? 535  PHE A CD1 1 
ATOM   4148 C CD2 . PHE A 1 535 ? 26.628  5.037   -11.909 1.00 61.47  ? 535  PHE A CD2 1 
ATOM   4149 C CE1 . PHE A 1 535 ? 27.024  3.125   -13.858 1.00 65.26  ? 535  PHE A CE1 1 
ATOM   4150 C CE2 . PHE A 1 535 ? 27.269  5.376   -13.085 1.00 61.64  ? 535  PHE A CE2 1 
ATOM   4151 C CZ  . PHE A 1 535 ? 27.472  4.424   -14.057 1.00 64.08  ? 535  PHE A CZ  1 
ATOM   4152 N N   . LEU A 1 536 ? 27.962  3.957   -8.753  1.00 63.49  ? 536  LEU A N   1 
ATOM   4153 C CA  . LEU A 1 536 ? 29.296  4.575   -8.652  1.00 63.77  ? 536  LEU A CA  1 
ATOM   4154 C C   . LEU A 1 536 ? 30.416  3.591   -8.259  1.00 65.70  ? 536  LEU A C   1 
ATOM   4155 O O   . LEU A 1 536 ? 31.470  3.563   -8.895  1.00 66.80  ? 536  LEU A O   1 
ATOM   4156 C CB  . LEU A 1 536 ? 29.271  5.774   -7.719  1.00 61.73  ? 536  LEU A CB  1 
ATOM   4157 C CG  . LEU A 1 536 ? 28.471  6.967   -8.214  1.00 60.08  ? 536  LEU A CG  1 
ATOM   4158 C CD1 . LEU A 1 536 ? 28.571  8.087   -7.209  1.00 56.11  ? 536  LEU A CD1 1 
ATOM   4159 C CD2 . LEU A 1 536 ? 28.967  7.433   -9.576  1.00 61.07  ? 536  LEU A CD2 1 
ATOM   4160 N N   . PRO A 1 537 ? 30.194  2.755   -7.235  1.00 67.27  ? 537  PRO A N   1 
ATOM   4161 C CA  . PRO A 1 537 ? 31.182  1.699   -6.966  1.00 69.36  ? 537  PRO A CA  1 
ATOM   4162 C C   . PRO A 1 537 ? 31.580  0.843   -8.188  1.00 72.01  ? 537  PRO A C   1 
ATOM   4163 O O   . PRO A 1 537 ? 32.760  0.531   -8.355  1.00 73.05  ? 537  PRO A O   1 
ATOM   4164 C CB  . PRO A 1 537 ? 30.482  0.828   -5.920  1.00 69.03  ? 537  PRO A CB  1 
ATOM   4165 C CG  . PRO A 1 537 ? 29.545  1.743   -5.240  1.00 67.15  ? 537  PRO A CG  1 
ATOM   4166 C CD  . PRO A 1 537 ? 29.083  2.718   -6.271  1.00 66.68  ? 537  PRO A CD  1 
ATOM   4167 N N   . LYS A 1 538 ? 30.609  0.452   -9.016  1.00 73.92  ? 538  LYS A N   1 
ATOM   4168 C CA  . LYS A 1 538 ? 30.898  -0.317  -10.230 1.00 76.21  ? 538  LYS A CA  1 
ATOM   4169 C C   . LYS A 1 538 ? 31.606  0.516   -11.302 1.00 77.00  ? 538  LYS A C   1 
ATOM   4170 O O   . LYS A 1 538 ? 32.364  -0.033  -12.102 1.00 78.77  ? 538  LYS A O   1 
ATOM   4171 C CB  . LYS A 1 538 ? 29.626  -0.962  -10.799 1.00 77.70  ? 538  LYS A CB  1 
ATOM   4172 C CG  . LYS A 1 538 ? 29.180  -2.209  -10.037 1.00 78.79  ? 538  LYS A CG  1 
ATOM   4173 C CD  . LYS A 1 538 ? 28.414  -3.179  -10.925 1.00 81.16  ? 538  LYS A CD  1 
ATOM   4174 C CE  . LYS A 1 538 ? 28.555  -4.654  -10.457 1.00 83.85  ? 538  LYS A CE  1 
ATOM   4175 N NZ  . LYS A 1 538 ? 28.343  -5.655  -11.582 1.00 86.38  ? 538  LYS A NZ  1 
ATOM   4176 N N   . LEU A 1 539 ? 31.351  1.824   -11.316 1.00 76.47  ? 539  LEU A N   1 
ATOM   4177 C CA  . LEU A 1 539 ? 32.060  2.770   -12.189 1.00 77.13  ? 539  LEU A CA  1 
ATOM   4178 C C   . LEU A 1 539 ? 33.513  2.891   -11.765 1.00 78.15  ? 539  LEU A C   1 
ATOM   4179 O O   . LEU A 1 539 ? 34.412  2.875   -12.604 1.00 79.51  ? 539  LEU A O   1 
ATOM   4180 C CB  . LEU A 1 539 ? 31.395  4.160   -12.137 1.00 75.73  ? 539  LEU A CB  1 
ATOM   4181 C CG  . LEU A 1 539 ? 31.925  5.315   -13.000 1.00 75.25  ? 539  LEU A CG  1 
ATOM   4182 C CD1 . LEU A 1 539 ? 32.004  4.921   -14.464 1.00 75.66  ? 539  LEU A CD1 1 
ATOM   4183 C CD2 . LEU A 1 539 ? 31.054  6.569   -12.841 1.00 73.76  ? 539  LEU A CD2 1 
ATOM   4184 N N   . LEU A 1 540 ? 33.722  3.001   -10.453 1.00 78.39  ? 540  LEU A N   1 
ATOM   4185 C CA  . LEU A 1 540 ? 35.058  3.092   -9.835  1.00 79.18  ? 540  LEU A CA  1 
ATOM   4186 C C   . LEU A 1 540 ? 36.024  1.974   -10.278 1.00 81.23  ? 540  LEU A C   1 
ATOM   4187 O O   . LEU A 1 540 ? 37.153  2.257   -10.667 1.00 81.65  ? 540  LEU A O   1 
ATOM   4188 C CB  . LEU A 1 540 ? 34.922  3.108   -8.298  1.00 77.84  ? 540  LEU A CB  1 
ATOM   4189 C CG  . LEU A 1 540 ? 36.136  3.513   -7.456  1.00 76.73  ? 540  LEU A CG  1 
ATOM   4190 C CD1 . LEU A 1 540 ? 36.699  4.881   -7.871  1.00 75.94  ? 540  LEU A CD1 1 
ATOM   4191 C CD2 . LEU A 1 540 ? 35.724  3.503   -5.994  1.00 75.73  ? 540  LEU A CD2 1 
ATOM   4192 N N   . SER A 1 541 ? 35.571  0.722   -10.230 1.00 82.92  ? 541  SER A N   1 
ATOM   4193 C CA  . SER A 1 541 ? 36.304  -0.406  -10.835 1.00 85.71  ? 541  SER A CA  1 
ATOM   4194 C C   . SER A 1 541 ? 36.381  -0.311  -12.393 1.00 87.93  ? 541  SER A C   1 
ATOM   4195 O O   . SER A 1 541 ? 35.795  -1.136  -13.116 1.00 89.58  ? 541  SER A O   1 
ATOM   4196 C CB  . SER A 1 541 ? 35.656  -1.740  -10.416 1.00 86.70  ? 541  SER A CB  1 
ATOM   4197 O OG  . SER A 1 541 ? 35.068  -1.638  -9.130  1.00 85.24  ? 541  SER A OG  1 
ATOM   4198 N N   . ALA A 1 542 ? 37.117  0.693   -12.891 1.00 88.26  ? 542  ALA A N   1 
ATOM   4199 C CA  . ALA A 1 542 ? 37.250  0.969   -14.335 1.00 89.24  ? 542  ALA A CA  1 
ATOM   4200 C C   . ALA A 1 542 ? 37.582  2.455   -14.576 1.00 88.41  ? 542  ALA A C   1 
ATOM   4201 O O   . ALA A 1 542 ? 36.864  3.358   -14.128 1.00 86.61  ? 542  ALA A O   1 
ATOM   4202 C CB  . ALA A 1 542 ? 35.972  0.574   -15.089 1.00 90.14  ? 542  ALA A CB  1 
ATOM   4203 N N   . GLU B 1 4   ? -16.889 5.443   -69.614 1.00 94.44  ? 4    GLU B N   1 
ATOM   4204 C CA  . GLU B 1 4   ? -15.660 6.210   -69.254 1.00 92.26  ? 4    GLU B CA  1 
ATOM   4205 C C   . GLU B 1 4   ? -16.024 7.458   -68.426 1.00 91.65  ? 4    GLU B C   1 
ATOM   4206 O O   . GLU B 1 4   ? -16.558 8.437   -68.955 1.00 93.06  ? 4    GLU B O   1 
ATOM   4207 C CB  . GLU B 1 4   ? -14.890 6.601   -70.528 1.00 92.56  ? 4    GLU B CB  1 
ATOM   4208 C CG  . GLU B 1 4   ? -13.468 7.200   -70.307 1.00 91.18  ? 4    GLU B CG  1 
ATOM   4209 C CD  . GLU B 1 4   ? -12.354 6.145   -70.197 1.00 91.99  ? 4    GLU B CD  1 
ATOM   4210 O OE1 . GLU B 1 4   ? -11.605 5.944   -71.187 1.00 92.77  ? 4    GLU B OE1 1 
ATOM   4211 O OE2 . GLU B 1 4   ? -12.220 5.525   -69.116 1.00 92.23  ? 4    GLU B OE2 1 
ATOM   4212 N N   . ASP B 1 5   ? -15.724 7.406   -67.127 1.00 89.41  ? 5    ASP B N   1 
ATOM   4213 C CA  . ASP B 1 5   ? -15.988 8.505   -66.196 1.00 88.20  ? 5    ASP B CA  1 
ATOM   4214 C C   . ASP B 1 5   ? -14.831 9.513   -66.245 1.00 86.52  ? 5    ASP B C   1 
ATOM   4215 O O   . ASP B 1 5   ? -13.714 9.184   -65.859 1.00 84.61  ? 5    ASP B O   1 
ATOM   4216 C CB  . ASP B 1 5   ? -16.152 7.934   -64.780 1.00 87.34  ? 5    ASP B CB  1 
ATOM   4217 C CG  . ASP B 1 5   ? -16.536 8.980   -63.749 1.00 86.12  ? 5    ASP B CG  1 
ATOM   4218 O OD1 . ASP B 1 5   ? -16.407 10.192  -64.017 1.00 84.73  ? 5    ASP B OD1 1 
ATOM   4219 O OD2 . ASP B 1 5   ? -16.950 8.570   -62.647 1.00 84.42  ? 5    ASP B OD2 1 
ATOM   4220 N N   . PRO B 1 6   ? -15.092 10.745  -66.715 1.00 87.01  ? 6    PRO B N   1 
ATOM   4221 C CA  . PRO B 1 6   ? -14.013 11.727  -66.893 1.00 85.71  ? 6    PRO B CA  1 
ATOM   4222 C C   . PRO B 1 6   ? -13.269 12.150  -65.630 1.00 83.19  ? 6    PRO B C   1 
ATOM   4223 O O   . PRO B 1 6   ? -12.190 12.719  -65.745 1.00 82.32  ? 6    PRO B O   1 
ATOM   4224 C CB  . PRO B 1 6   ? -14.728 12.944  -67.498 1.00 87.77  ? 6    PRO B CB  1 
ATOM   4225 C CG  . PRO B 1 6   ? -16.173 12.769  -67.173 1.00 89.79  ? 6    PRO B CG  1 
ATOM   4226 C CD  . PRO B 1 6   ? -16.401 11.285  -67.125 1.00 89.54  ? 6    PRO B CD  1 
ATOM   4227 N N   . GLN B 1 7   ? -13.841 11.909  -64.450 1.00 82.04  ? 7    GLN B N   1 
ATOM   4228 C CA  . GLN B 1 7   ? -13.137 12.148  -63.191 1.00 79.59  ? 7    GLN B CA  1 
ATOM   4229 C C   . GLN B 1 7   ? -12.012 11.147  -62.991 1.00 76.64  ? 7    GLN B C   1 
ATOM   4230 O O   . GLN B 1 7   ? -11.049 11.438  -62.291 1.00 74.73  ? 7    GLN B O   1 
ATOM   4231 C CB  . GLN B 1 7   ? -14.086 12.053  -61.993 1.00 80.30  ? 7    GLN B CB  1 
ATOM   4232 C CG  . GLN B 1 7   ? -15.077 13.194  -61.890 1.00 83.00  ? 7    GLN B CG  1 
ATOM   4233 C CD  . GLN B 1 7   ? -14.424 14.511  -61.516 1.00 83.69  ? 7    GLN B CD  1 
ATOM   4234 O OE1 . GLN B 1 7   ? -13.595 14.567  -60.609 1.00 82.98  ? 7    GLN B OE1 1 
ATOM   4235 N NE2 . GLN B 1 7   ? -14.802 15.581  -62.210 1.00 85.16  ? 7    GLN B NE2 1 
ATOM   4236 N N   . LEU B 1 8   ? -12.154 9.968   -63.595 1.00 75.65  ? 8    LEU B N   1 
ATOM   4237 C CA  . LEU B 1 8   ? -11.195 8.893   -63.438 1.00 73.49  ? 8    LEU B CA  1 
ATOM   4238 C C   . LEU B 1 8   ? -10.123 8.868   -64.527 1.00 72.82  ? 8    LEU B C   1 
ATOM   4239 O O   . LEU B 1 8   ? -9.263  8.005   -64.520 1.00 71.75  ? 8    LEU B O   1 
ATOM   4240 C CB  . LEU B 1 8   ? -11.925 7.552   -63.390 1.00 73.87  ? 8    LEU B CB  1 
ATOM   4241 C CG  . LEU B 1 8   ? -13.016 7.461   -62.322 1.00 73.44  ? 8    LEU B CG  1 
ATOM   4242 C CD1 . LEU B 1 8   ? -13.752 6.135   -62.439 1.00 73.14  ? 8    LEU B CD1 1 
ATOM   4243 C CD2 . LEU B 1 8   ? -12.435 7.651   -60.918 1.00 71.26  ? 8    LEU B CD2 1 
ATOM   4244 N N   . LEU B 1 9   ? -10.156 9.829   -65.440 1.00 73.74  ? 9    LEU B N   1 
ATOM   4245 C CA  . LEU B 1 9   ? -9.179  9.913   -66.523 1.00 73.38  ? 9    LEU B CA  1 
ATOM   4246 C C   . LEU B 1 9   ? -8.258  11.116  -66.289 1.00 72.45  ? 9    LEU B C   1 
ATOM   4247 O O   . LEU B 1 9   ? -8.716  12.257  -66.319 1.00 73.89  ? 9    LEU B O   1 
ATOM   4248 C CB  . LEU B 1 9   ? -9.926  10.038  -67.863 1.00 75.19  ? 9    LEU B CB  1 
ATOM   4249 C CG  . LEU B 1 9   ? -9.164  9.830   -69.176 1.00 75.72  ? 9    LEU B CG  1 
ATOM   4250 C CD1 . LEU B 1 9   ? -8.410  8.488   -69.215 1.00 74.21  ? 9    LEU B CD1 1 
ATOM   4251 C CD2 . LEU B 1 9   ? -10.138 9.937   -70.341 1.00 77.68  ? 9    LEU B CD2 1 
ATOM   4252 N N   . VAL B 1 10  ? -6.976  10.863  -66.031 1.00 70.60  ? 10   VAL B N   1 
ATOM   4253 C CA  . VAL B 1 10  ? -6.000  11.930  -65.792 1.00 69.89  ? 10   VAL B CA  1 
ATOM   4254 C C   . VAL B 1 10  ? -4.810  11.810  -66.737 1.00 69.66  ? 10   VAL B C   1 
ATOM   4255 O O   . VAL B 1 10  ? -4.355  10.702  -67.031 1.00 69.49  ? 10   VAL B O   1 
ATOM   4256 C CB  . VAL B 1 10  ? -5.448  11.877  -64.351 1.00 68.32  ? 10   VAL B CB  1 
ATOM   4257 C CG1 . VAL B 1 10  ? -4.605  13.099  -64.033 1.00 67.05  ? 10   VAL B CG1 1 
ATOM   4258 C CG2 . VAL B 1 10  ? -6.571  11.773  -63.376 1.00 69.64  ? 10   VAL B CG2 1 
ATOM   4259 N N   . ARG B 1 11  ? -4.309  12.952  -67.204 1.00 70.02  ? 11   ARG B N   1 
ATOM   4260 C CA  . ARG B 1 11  ? -3.084  13.006  -67.985 1.00 69.84  ? 11   ARG B CA  1 
ATOM   4261 C C   . ARG B 1 11  ? -1.930  13.531  -67.120 1.00 68.07  ? 11   ARG B C   1 
ATOM   4262 O O   . ARG B 1 11  ? -1.978  14.641  -66.601 1.00 67.71  ? 11   ARG B O   1 
ATOM   4263 C CB  . ARG B 1 11  ? -3.287  13.856  -69.250 1.00 71.24  ? 11   ARG B CB  1 
ATOM   4264 C CG  . ARG B 1 11  ? -2.019  14.088  -70.089 1.00 71.91  ? 11   ARG B CG  1 
ATOM   4265 C CD  . ARG B 1 11  ? -2.321  14.212  -71.595 1.00 75.48  ? 11   ARG B CD  1 
ATOM   4266 N NE  . ARG B 1 11  ? -2.079  12.950  -72.319 1.00 78.66  ? 11   ARG B NE  1 
ATOM   4267 C CZ  . ARG B 1 11  ? -2.586  12.629  -73.508 1.00 81.06  ? 11   ARG B CZ  1 
ATOM   4268 N NH1 . ARG B 1 11  ? -3.397  13.462  -74.156 1.00 84.54  ? 11   ARG B NH1 1 
ATOM   4269 N NH2 . ARG B 1 11  ? -2.287  11.452  -74.053 1.00 81.54  ? 11   ARG B NH2 1 
ATOM   4270 N N   . VAL B 1 12  ? -0.906  12.698  -66.962 1.00 66.55  ? 12   VAL B N   1 
ATOM   4271 C CA  . VAL B 1 12  ? 0.324   13.068  -66.282 1.00 65.14  ? 12   VAL B CA  1 
ATOM   4272 C C   . VAL B 1 12  ? 1.422   13.186  -67.343 1.00 65.80  ? 12   VAL B C   1 
ATOM   4273 O O   . VAL B 1 12  ? 1.179   12.877  -68.507 1.00 67.07  ? 12   VAL B O   1 
ATOM   4274 C CB  . VAL B 1 12  ? 0.687   12.039  -65.185 1.00 63.82  ? 12   VAL B CB  1 
ATOM   4275 C CG1 . VAL B 1 12  ? -0.389  12.030  -64.097 1.00 62.50  ? 12   VAL B CG1 1 
ATOM   4276 C CG2 . VAL B 1 12  ? 0.876   10.639  -65.768 1.00 62.52  ? 12   VAL B CG2 1 
ATOM   4277 N N   . ARG B 1 13  ? 2.616   13.629  -66.965 1.00 65.18  ? 13   ARG B N   1 
ATOM   4278 C CA  . ARG B 1 13  ? 3.673   13.866  -67.949 1.00 66.69  ? 13   ARG B CA  1 
ATOM   4279 C C   . ARG B 1 13  ? 3.997   12.658  -68.818 1.00 65.44  ? 13   ARG B C   1 
ATOM   4280 O O   . ARG B 1 13  ? 4.316   12.819  -69.988 1.00 67.01  ? 13   ARG B O   1 
ATOM   4281 C CB  . ARG B 1 13  ? 4.954   14.369  -67.292 1.00 65.94  ? 13   ARG B CB  1 
ATOM   4282 C CG  . ARG B 1 13  ? 4.876   15.835  -66.934 1.00 69.51  ? 13   ARG B CG  1 
ATOM   4283 C CD  . ARG B 1 13  ? 6.211   16.386  -66.414 1.00 71.45  ? 13   ARG B CD  1 
ATOM   4284 N NE  . ARG B 1 13  ? 6.019   17.729  -65.844 1.00 76.83  ? 13   ARG B NE  1 
ATOM   4285 C CZ  . ARG B 1 13  ? 6.995   18.506  -65.359 1.00 79.94  ? 13   ARG B CZ  1 
ATOM   4286 N NH1 . ARG B 1 13  ? 8.264   18.088  -65.369 1.00 82.28  ? 13   ARG B NH1 1 
ATOM   4287 N NH2 . ARG B 1 13  ? 6.705   19.712  -64.856 1.00 79.86  ? 13   ARG B NH2 1 
ATOM   4288 N N   . GLY B 1 14  ? 3.916   11.462  -68.254 1.00 63.26  ? 14   GLY B N   1 
ATOM   4289 C CA  . GLY B 1 14  ? 4.256   10.251  -68.986 1.00 62.33  ? 14   GLY B CA  1 
ATOM   4290 C C   . GLY B 1 14  ? 3.140   9.681   -69.831 1.00 62.25  ? 14   GLY B C   1 
ATOM   4291 O O   . GLY B 1 14  ? 3.367   8.747   -70.595 1.00 62.30  ? 14   GLY B O   1 
ATOM   4292 N N   . GLY B 1 15  ? 1.931   10.215  -69.685 1.00 61.80  ? 15   GLY B N   1 
ATOM   4293 C CA  . GLY B 1 15  ? 0.792   9.750   -70.449 1.00 62.32  ? 15   GLY B CA  1 
ATOM   4294 C C   . GLY B 1 15  ? -0.498  9.743   -69.660 1.00 62.52  ? 15   GLY B C   1 
ATOM   4295 O O   . GLY B 1 15  ? -0.619  10.407  -68.629 1.00 61.25  ? 15   GLY B O   1 
ATOM   4296 N N   . GLN B 1 16  ? -1.465  8.976   -70.159 1.00 63.36  ? 16   GLN B N   1 
ATOM   4297 C CA  . GLN B 1 16  ? -2.812  8.928   -69.602 1.00 64.07  ? 16   GLN B CA  1 
ATOM   4298 C C   . GLN B 1 16  ? -3.022  7.765   -68.635 1.00 62.64  ? 16   GLN B C   1 
ATOM   4299 O O   . GLN B 1 16  ? -2.497  6.672   -68.836 1.00 61.80  ? 16   GLN B O   1 
ATOM   4300 C CB  . GLN B 1 16  ? -3.836  8.817   -70.723 1.00 65.65  ? 16   GLN B CB  1 
ATOM   4301 C CG  . GLN B 1 16  ? -4.244  10.130  -71.353 1.00 68.18  ? 16   GLN B CG  1 
ATOM   4302 C CD  . GLN B 1 16  ? -5.376  9.943   -72.367 1.00 70.83  ? 16   GLN B CD  1 
ATOM   4303 O OE1 . GLN B 1 16  ? -5.343  9.011   -73.196 1.00 75.11  ? 16   GLN B OE1 1 
ATOM   4304 N NE2 . GLN B 1 16  ? -6.390  10.821  -72.303 1.00 73.97  ? 16   GLN B NE2 1 
ATOM   4305 N N   . LEU B 1 17  ? -3.827  8.016   -67.604 1.00 62.22  ? 17   LEU B N   1 
ATOM   4306 C CA  . LEU B 1 17  ? -4.134  7.037   -66.569 1.00 61.75  ? 17   LEU B CA  1 
ATOM   4307 C C   . LEU B 1 17  ? -5.631  6.907   -66.431 1.00 63.16  ? 17   LEU B C   1 
ATOM   4308 O O   . LEU B 1 17  ? -6.358  7.876   -66.660 1.00 63.63  ? 17   LEU B O   1 
ATOM   4309 C CB  . LEU B 1 17  ? -3.616  7.509   -65.210 1.00 60.82  ? 17   LEU B CB  1 
ATOM   4310 C CG  . LEU B 1 17  ? -2.144  7.846   -65.060 1.00 59.48  ? 17   LEU B CG  1 
ATOM   4311 C CD1 . LEU B 1 17  ? -1.983  8.669   -63.816 1.00 57.68  ? 17   LEU B CD1 1 
ATOM   4312 C CD2 . LEU B 1 17  ? -1.305  6.543   -65.035 1.00 58.51  ? 17   LEU B CD2 1 
ATOM   4313 N N   . ARG B 1 18  ? -6.087  5.720   -66.042 1.00 63.59  ? 18   ARG B N   1 
ATOM   4314 C CA  . ARG B 1 18  ? -7.473  5.521   -65.660 1.00 65.34  ? 18   ARG B CA  1 
ATOM   4315 C C   . ARG B 1 18  ? -7.505  4.997   -64.251 1.00 64.03  ? 18   ARG B C   1 
ATOM   4316 O O   . ARG B 1 18  ? -6.934  3.947   -63.966 1.00 63.36  ? 18   ARG B O   1 
ATOM   4317 C CB  . ARG B 1 18  ? -8.188  4.525   -66.571 1.00 66.80  ? 18   ARG B CB  1 
ATOM   4318 C CG  . ARG B 1 18  ? -9.690  4.446   -66.291 1.00 69.60  ? 18   ARG B CG  1 
ATOM   4319 C CD  . ARG B 1 18  ? -10.399 3.371   -67.075 1.00 72.11  ? 18   ARG B CD  1 
ATOM   4320 N NE  . ARG B 1 18  ? -10.188 3.501   -68.521 1.00 76.36  ? 18   ARG B NE  1 
ATOM   4321 C CZ  . ARG B 1 18  ? -9.286  2.815   -69.227 1.00 76.45  ? 18   ARG B CZ  1 
ATOM   4322 N NH1 . ARG B 1 18  ? -8.456  1.941   -68.641 1.00 75.94  ? 18   ARG B NH1 1 
ATOM   4323 N NH2 . ARG B 1 18  ? -9.193  3.036   -70.533 1.00 76.90  ? 18   ARG B NH2 1 
ATOM   4324 N N   . GLY B 1 19  ? -8.201  5.714   -63.385 1.00 64.17  ? 19   GLY B N   1 
ATOM   4325 C CA  . GLY B 1 19  ? -8.351  5.324   -62.000 1.00 64.05  ? 19   GLY B CA  1 
ATOM   4326 C C   . GLY B 1 19  ? -9.672  4.634   -61.752 1.00 65.67  ? 19   GLY B C   1 
ATOM   4327 O O   . GLY B 1 19  ? -10.422 4.355   -62.683 1.00 67.30  ? 19   GLY B O   1 
ATOM   4328 N N   . ILE B 1 20  ? -9.952  4.380   -60.480 1.00 65.73  ? 20   ILE B N   1 
ATOM   4329 C CA  . ILE B 1 20  ? -11.128 3.633   -60.071 1.00 67.46  ? 20   ILE B CA  1 
ATOM   4330 C C   . ILE B 1 20  ? -11.842 4.389   -58.956 1.00 68.52  ? 20   ILE B C   1 
ATOM   4331 O O   . ILE B 1 20  ? -11.215 4.963   -58.057 1.00 67.21  ? 20   ILE B O   1 
ATOM   4332 C CB  . ILE B 1 20  ? -10.759 2.185   -59.639 1.00 66.97  ? 20   ILE B CB  1 
ATOM   4333 C CG1 . ILE B 1 20  ? -11.996 1.404   -59.185 1.00 68.66  ? 20   ILE B CG1 1 
ATOM   4334 C CG2 . ILE B 1 20  ? -9.707  2.194   -58.557 1.00 64.97  ? 20   ILE B CG2 1 
ATOM   4335 C CD1 . ILE B 1 20  ? -11.694 -0.034  -58.791 1.00 69.01  ? 20   ILE B CD1 1 
ATOM   4336 N N   . ARG B 1 21  ? -13.163 4.397   -59.033 1.00 70.97  ? 21   ARG B N   1 
ATOM   4337 C CA  . ARG B 1 21  ? -13.989 5.075   -58.062 1.00 72.83  ? 21   ARG B CA  1 
ATOM   4338 C C   . ARG B 1 21  ? -14.224 4.135   -56.898 1.00 72.37  ? 21   ARG B C   1 
ATOM   4339 O O   . ARG B 1 21  ? -14.787 3.059   -57.067 1.00 73.37  ? 21   ARG B O   1 
ATOM   4340 C CB  . ARG B 1 21  ? -15.305 5.459   -58.714 1.00 74.91  ? 21   ARG B CB  1 
ATOM   4341 C CG  . ARG B 1 21  ? -16.240 6.267   -57.867 1.00 77.56  ? 21   ARG B CG  1 
ATOM   4342 C CD  . ARG B 1 21  ? -17.400 6.713   -58.731 1.00 81.99  ? 21   ARG B CD  1 
ATOM   4343 N NE  . ARG B 1 21  ? -18.638 6.851   -57.973 1.00 88.27  ? 21   ARG B NE  1 
ATOM   4344 C CZ  . ARG B 1 21  ? -19.365 5.830   -57.523 1.00 91.26  ? 21   ARG B CZ  1 
ATOM   4345 N NH1 . ARG B 1 21  ? -18.980 4.567   -57.740 1.00 92.20  ? 21   ARG B NH1 1 
ATOM   4346 N NH2 . ARG B 1 21  ? -20.483 6.077   -56.840 1.00 92.51  ? 21   ARG B NH2 1 
ATOM   4347 N N   . LEU B 1 22  ? -13.777 4.541   -55.717 1.00 71.48  ? 22   LEU B N   1 
ATOM   4348 C CA  . LEU B 1 22  ? -13.900 3.710   -54.527 1.00 71.82  ? 22   LEU B CA  1 
ATOM   4349 C C   . LEU B 1 22  ? -14.946 4.262   -53.586 1.00 73.10  ? 22   LEU B C   1 
ATOM   4350 O O   . LEU B 1 22  ? -15.233 5.453   -53.597 1.00 73.31  ? 22   LEU B O   1 
ATOM   4351 C CB  . LEU B 1 22  ? -12.560 3.606   -53.805 1.00 69.78  ? 22   LEU B CB  1 
ATOM   4352 C CG  . LEU B 1 22  ? -11.427 2.908   -54.561 1.00 68.58  ? 22   LEU B CG  1 
ATOM   4353 C CD1 . LEU B 1 22  ? -10.179 2.911   -53.717 1.00 66.63  ? 22   LEU B CD1 1 
ATOM   4354 C CD2 . LEU B 1 22  ? -11.813 1.498   -54.949 1.00 70.10  ? 22   LEU B CD2 1 
ATOM   4355 N N   . LYS B 1 23  ? -15.512 3.378   -52.773 1.00 74.86  ? 23   LYS B N   1 
ATOM   4356 C CA  . LYS B 1 23  ? -16.537 3.752   -51.800 1.00 76.30  ? 23   LYS B CA  1 
ATOM   4357 C C   . LYS B 1 23  ? -15.895 4.038   -50.447 1.00 74.94  ? 23   LYS B C   1 
ATOM   4358 O O   . LYS B 1 23  ? -15.268 3.162   -49.846 1.00 74.03  ? 23   LYS B O   1 
ATOM   4359 C CB  . LYS B 1 23  ? -17.567 2.632   -51.649 1.00 78.71  ? 23   LYS B CB  1 
ATOM   4360 C CG  . LYS B 1 23  ? -18.735 2.966   -50.721 1.00 80.97  ? 23   LYS B CG  1 
ATOM   4361 C CD  . LYS B 1 23  ? -19.733 3.935   -51.380 1.00 84.83  ? 23   LYS B CD  1 
ATOM   4362 C CE  . LYS B 1 23  ? -20.960 4.179   -50.486 1.00 86.96  ? 23   LYS B CE  1 
ATOM   4363 N NZ  . LYS B 1 23  ? -20.595 4.822   -49.185 1.00 86.96  ? 23   LYS B NZ  1 
ATOM   4364 N N   . ALA B 1 24  ? -16.036 5.273   -49.981 1.00 74.41  ? 24   ALA B N   1 
ATOM   4365 C CA  . ALA B 1 24  ? -15.705 5.608   -48.611 1.00 73.37  ? 24   ALA B CA  1 
ATOM   4366 C C   . ALA B 1 24  ? -17.034 5.696   -47.868 1.00 74.76  ? 24   ALA B C   1 
ATOM   4367 O O   . ALA B 1 24  ? -18.075 5.899   -48.487 1.00 76.34  ? 24   ALA B O   1 
ATOM   4368 C CB  . ALA B 1 24  ? -14.938 6.915   -48.544 1.00 72.00  ? 24   ALA B CB  1 
ATOM   4369 N N   . PRO B 1 25  ? -17.007 5.547   -46.538 1.00 74.37  ? 25   PRO B N   1 
ATOM   4370 C CA  . PRO B 1 25  ? -18.243 5.542   -45.765 1.00 76.02  ? 25   PRO B CA  1 
ATOM   4371 C C   . PRO B 1 25  ? -19.186 6.715   -46.071 1.00 76.91  ? 25   PRO B C   1 
ATOM   4372 O O   . PRO B 1 25  ? -20.383 6.515   -46.169 1.00 78.80  ? 25   PRO B O   1 
ATOM   4373 C CB  . PRO B 1 25  ? -17.740 5.613   -44.316 1.00 75.21  ? 25   PRO B CB  1 
ATOM   4374 C CG  . PRO B 1 25  ? -16.412 4.998   -44.355 1.00 73.62  ? 25   PRO B CG  1 
ATOM   4375 C CD  . PRO B 1 25  ? -15.823 5.386   -45.674 1.00 72.74  ? 25   PRO B CD  1 
ATOM   4376 N N   . GLY B 1 26  ? -18.649 7.919   -46.236 1.00 75.58  ? 26   GLY B N   1 
ATOM   4377 C CA  . GLY B 1 26  ? -19.488 9.108   -46.397 1.00 76.86  ? 26   GLY B CA  1 
ATOM   4378 C C   . GLY B 1 26  ? -19.619 9.611   -47.819 1.00 76.93  ? 26   GLY B C   1 
ATOM   4379 O O   . GLY B 1 26  ? -20.207 10.664  -48.047 1.00 77.77  ? 26   GLY B O   1 
ATOM   4380 N N   . GLY B 1 27  ? -19.064 8.866   -48.771 1.00 75.96  ? 27   GLY B N   1 
ATOM   4381 C CA  . GLY B 1 27  ? -19.064 9.268   -50.177 1.00 76.18  ? 27   GLY B CA  1 
ATOM   4382 C C   . GLY B 1 27  ? -17.956 8.602   -50.980 1.00 74.48  ? 27   GLY B C   1 
ATOM   4383 O O   . GLY B 1 27  ? -17.108 7.914   -50.419 1.00 72.79  ? 27   GLY B O   1 
ATOM   4384 N N   . PRO B 1 28  ? -17.965 8.792   -52.311 1.00 74.71  ? 28   PRO B N   1 
ATOM   4385 C CA  . PRO B 1 28  ? -16.925 8.229   -53.183 1.00 73.15  ? 28   PRO B CA  1 
ATOM   4386 C C   . PRO B 1 28  ? -15.618 9.008   -53.196 1.00 70.97  ? 28   PRO B C   1 
ATOM   4387 O O   . PRO B 1 28  ? -15.597 10.193  -52.901 1.00 70.99  ? 28   PRO B O   1 
ATOM   4388 C CB  . PRO B 1 28  ? -17.559 8.316   -54.566 1.00 74.76  ? 28   PRO B CB  1 
ATOM   4389 C CG  . PRO B 1 28  ? -18.457 9.536   -54.470 1.00 76.11  ? 28   PRO B CG  1 
ATOM   4390 C CD  . PRO B 1 28  ? -18.989 9.530   -53.074 1.00 76.42  ? 28   PRO B CD  1 
ATOM   4391 N N   . VAL B 1 29  ? -14.541 8.320   -53.561 1.00 69.55  ? 29   VAL B N   1 
ATOM   4392 C CA  . VAL B 1 29  ? -13.225 8.927   -53.772 1.00 67.66  ? 29   VAL B CA  1 
ATOM   4393 C C   . VAL B 1 29  ? -12.642 8.366   -55.073 1.00 66.95  ? 29   VAL B C   1 
ATOM   4394 O O   . VAL B 1 29  ? -13.003 7.268   -55.491 1.00 67.16  ? 29   VAL B O   1 
ATOM   4395 C CB  . VAL B 1 29  ? -12.253 8.635   -52.592 1.00 66.16  ? 29   VAL B CB  1 
ATOM   4396 C CG1 . VAL B 1 29  ? -12.852 9.120   -51.290 1.00 66.17  ? 29   VAL B CG1 1 
ATOM   4397 C CG2 . VAL B 1 29  ? -11.947 7.161   -52.496 1.00 65.61  ? 29   VAL B CG2 1 
ATOM   4398 N N   . SER B 1 30  ? -11.778 9.138   -55.723 1.00 65.98  ? 30   SER B N   1 
ATOM   4399 C CA  . SER B 1 30  ? -11.072 8.672   -56.919 1.00 65.50  ? 30   SER B CA  1 
ATOM   4400 C C   . SER B 1 30  ? -9.720  8.145   -56.477 1.00 63.25  ? 30   SER B C   1 
ATOM   4401 O O   . SER B 1 30  ? -9.001  8.824   -55.738 1.00 63.16  ? 30   SER B O   1 
ATOM   4402 C CB  . SER B 1 30  ? -10.858 9.797   -57.944 1.00 65.96  ? 30   SER B CB  1 
ATOM   4403 O OG  . SER B 1 30  ? -12.033 10.554  -58.193 1.00 68.08  ? 30   SER B OG  1 
ATOM   4404 N N   . ALA B 1 31  ? -9.377  6.942   -56.925 1.00 62.09  ? 31   ALA B N   1 
ATOM   4405 C CA  . ALA B 1 31  ? -8.103  6.334   -56.604 1.00 60.00  ? 31   ALA B CA  1 
ATOM   4406 C C   . ALA B 1 31  ? -7.346  5.963   -57.878 1.00 59.28  ? 31   ALA B C   1 
ATOM   4407 O O   . ALA B 1 31  ? -7.898  5.369   -58.796 1.00 60.02  ? 31   ALA B O   1 
ATOM   4408 C CB  . ALA B 1 31  ? -8.304  5.110   -55.736 1.00 59.86  ? 31   ALA B CB  1 
ATOM   4409 N N   . PHE B 1 32  ? -6.068  6.323   -57.905 1.00 58.02  ? 32   PHE B N   1 
ATOM   4410 C CA  . PHE B 1 32  ? -5.154  5.990   -58.987 1.00 57.04  ? 32   PHE B CA  1 
ATOM   4411 C C   . PHE B 1 32  ? -4.010  5.196   -58.403 1.00 55.60  ? 32   PHE B C   1 
ATOM   4412 O O   . PHE B 1 32  ? -3.109  5.753   -57.774 1.00 54.85  ? 32   PHE B O   1 
ATOM   4413 C CB  . PHE B 1 32  ? -4.663  7.279   -59.622 1.00 57.36  ? 32   PHE B CB  1 
ATOM   4414 C CG  . PHE B 1 32  ? -5.772  8.137   -60.115 1.00 58.44  ? 32   PHE B CG  1 
ATOM   4415 C CD1 . PHE B 1 32  ? -6.430  8.998   -59.250 1.00 60.14  ? 32   PHE B CD1 1 
ATOM   4416 C CD2 . PHE B 1 32  ? -6.199  8.049   -61.422 1.00 60.08  ? 32   PHE B CD2 1 
ATOM   4417 C CE1 . PHE B 1 32  ? -7.476  9.754   -59.689 1.00 60.08  ? 32   PHE B CE1 1 
ATOM   4418 C CE2 . PHE B 1 32  ? -7.242  8.814   -61.866 1.00 60.74  ? 32   PHE B CE2 1 
ATOM   4419 C CZ  . PHE B 1 32  ? -7.881  9.662   -60.993 1.00 61.16  ? 32   PHE B CZ  1 
ATOM   4420 N N   . LEU B 1 33  ? -4.062  3.881   -58.595 1.00 55.53  ? 33   LEU B N   1 
ATOM   4421 C CA  . LEU B 1 33  ? -3.190  2.955   -57.905 1.00 54.31  ? 33   LEU B CA  1 
ATOM   4422 C C   . LEU B 1 33  ? -2.198  2.292   -58.860 1.00 54.41  ? 33   LEU B C   1 
ATOM   4423 O O   . LEU B 1 33  ? -2.550  1.934   -59.973 1.00 56.29  ? 33   LEU B O   1 
ATOM   4424 C CB  . LEU B 1 33  ? -4.054  1.883   -57.238 1.00 54.80  ? 33   LEU B CB  1 
ATOM   4425 C CG  . LEU B 1 33  ? -5.209  2.349   -56.345 1.00 54.25  ? 33   LEU B CG  1 
ATOM   4426 C CD1 . LEU B 1 33  ? -5.936  1.125   -55.788 1.00 54.23  ? 33   LEU B CD1 1 
ATOM   4427 C CD2 . LEU B 1 33  ? -4.750  3.269   -55.212 1.00 51.56  ? 33   LEU B CD2 1 
ATOM   4428 N N   . GLY B 1 34  ? -0.962  2.097   -58.425 1.00 53.38  ? 34   GLY B N   1 
ATOM   4429 C CA  . GLY B 1 34  ? 0.018   1.397   -59.257 1.00 53.13  ? 34   GLY B CA  1 
ATOM   4430 C C   . GLY B 1 34  ? 0.533   2.232   -60.407 1.00 52.67  ? 34   GLY B C   1 
ATOM   4431 O O   . GLY B 1 34  ? 0.792   1.706   -61.481 1.00 52.71  ? 34   GLY B O   1 
ATOM   4432 N N   . ILE B 1 35  ? 0.688   3.537   -60.181 1.00 51.97  ? 35   ILE B N   1 
ATOM   4433 C CA  . ILE B 1 35  ? 1.255   4.435   -61.175 1.00 51.77  ? 35   ILE B CA  1 
ATOM   4434 C C   . ILE B 1 35  ? 2.772   4.306   -61.141 1.00 51.91  ? 35   ILE B C   1 
ATOM   4435 O O   . ILE B 1 35  ? 3.366   4.551   -60.107 1.00 51.80  ? 35   ILE B O   1 
ATOM   4436 C CB  . ILE B 1 35  ? 0.900   5.915   -60.867 1.00 51.89  ? 35   ILE B CB  1 
ATOM   4437 C CG1 . ILE B 1 35  ? -0.623  6.133   -60.851 1.00 51.41  ? 35   ILE B CG1 1 
ATOM   4438 C CG2 . ILE B 1 35  ? 1.567   6.849   -61.886 1.00 51.01  ? 35   ILE B CG2 1 
ATOM   4439 C CD1 . ILE B 1 35  ? -1.043  7.534   -60.363 1.00 51.65  ? 35   ILE B CD1 1 
ATOM   4440 N N   . PRO B 1 36  ? 3.416   3.952   -62.271 1.00 52.72  ? 36   PRO B N   1 
ATOM   4441 C CA  . PRO B 1 36  ? 4.867   3.786   -62.260 1.00 52.17  ? 36   PRO B CA  1 
ATOM   4442 C C   . PRO B 1 36  ? 5.564   5.137   -62.234 1.00 52.12  ? 36   PRO B C   1 
ATOM   4443 O O   . PRO B 1 36  ? 5.171   6.041   -62.982 1.00 53.70  ? 36   PRO B O   1 
ATOM   4444 C CB  . PRO B 1 36  ? 5.134   3.084   -63.575 1.00 53.19  ? 36   PRO B CB  1 
ATOM   4445 C CG  . PRO B 1 36  ? 4.043   3.561   -64.462 1.00 54.30  ? 36   PRO B CG  1 
ATOM   4446 C CD  . PRO B 1 36  ? 2.849   3.728   -63.612 1.00 53.62  ? 36   PRO B CD  1 
ATOM   4447 N N   . PHE B 1 37  ? 6.547   5.295   -61.352 1.00 51.08  ? 37   PHE B N   1 
ATOM   4448 C CA  . PHE B 1 37  ? 7.336   6.547   -61.256 1.00 50.31  ? 37   PHE B CA  1 
ATOM   4449 C C   . PHE B 1 37  ? 8.816   6.351   -61.598 1.00 50.21  ? 37   PHE B C   1 
ATOM   4450 O O   . PHE B 1 37  ? 9.578   7.310   -61.695 1.00 49.84  ? 37   PHE B O   1 
ATOM   4451 C CB  . PHE B 1 37  ? 7.173   7.202   -59.871 1.00 49.41  ? 37   PHE B CB  1 
ATOM   4452 C CG  . PHE B 1 37  ? 7.792   6.436   -58.717 1.00 48.01  ? 37   PHE B CG  1 
ATOM   4453 C CD1 . PHE B 1 37  ? 9.134   6.599   -58.388 1.00 48.34  ? 37   PHE B CD1 1 
ATOM   4454 C CD2 . PHE B 1 37  ? 7.023   5.620   -57.922 1.00 47.88  ? 37   PHE B CD2 1 
ATOM   4455 C CE1 . PHE B 1 37  ? 9.695   5.942   -57.335 1.00 47.98  ? 37   PHE B CE1 1 
ATOM   4456 C CE2 . PHE B 1 37  ? 7.586   4.937   -56.852 1.00 47.58  ? 37   PHE B CE2 1 
ATOM   4457 C CZ  . PHE B 1 37  ? 8.920   5.099   -56.555 1.00 47.98  ? 37   PHE B CZ  1 
ATOM   4458 N N   . ALA B 1 38  ? 9.211   5.106   -61.810 1.00 50.31  ? 38   ALA B N   1 
ATOM   4459 C CA  . ALA B 1 38  ? 10.574  4.793   -62.160 1.00 50.55  ? 38   ALA B CA  1 
ATOM   4460 C C   . ALA B 1 38  ? 10.600  3.634   -63.167 1.00 51.82  ? 38   ALA B C   1 
ATOM   4461 O O   . ALA B 1 38  ? 9.623   2.894   -63.308 1.00 52.64  ? 38   ALA B O   1 
ATOM   4462 C CB  . ALA B 1 38  ? 11.348  4.445   -60.910 1.00 49.69  ? 38   ALA B CB  1 
ATOM   4463 N N   . GLU B 1 39  ? 11.709  3.512   -63.884 1.00 52.36  ? 39   GLU B N   1 
ATOM   4464 C CA  . GLU B 1 39  ? 11.991  2.319   -64.660 1.00 53.36  ? 39   GLU B CA  1 
ATOM   4465 C C   . GLU B 1 39  ? 12.178  1.164   -63.692 1.00 53.19  ? 39   GLU B C   1 
ATOM   4466 O O   . GLU B 1 39  ? 12.803  1.338   -62.649 1.00 52.93  ? 39   GLU B O   1 
ATOM   4467 C CB  . GLU B 1 39  ? 13.266  2.509   -65.480 1.00 53.89  ? 39   GLU B CB  1 
ATOM   4468 C CG  . GLU B 1 39  ? 13.112  3.474   -66.612 1.00 53.61  ? 39   GLU B CG  1 
ATOM   4469 C CD  . GLU B 1 39  ? 12.134  2.978   -67.641 1.00 55.30  ? 39   GLU B CD  1 
ATOM   4470 O OE1 . GLU B 1 39  ? 12.540  2.162   -68.498 1.00 54.57  ? 39   GLU B OE1 1 
ATOM   4471 O OE2 . GLU B 1 39  ? 10.955  3.407   -67.598 1.00 54.24  ? 39   GLU B OE2 1 
ATOM   4472 N N   . PRO B 1 40  ? 11.643  -0.021  -64.014 1.00 53.91  ? 40   PRO B N   1 
ATOM   4473 C CA  . PRO B 1 40  ? 11.823  -1.108  -63.055 1.00 54.16  ? 40   PRO B CA  1 
ATOM   4474 C C   . PRO B 1 40  ? 13.298  -1.356  -62.726 1.00 54.96  ? 40   PRO B C   1 
ATOM   4475 O O   . PRO B 1 40  ? 14.094  -1.476  -63.624 1.00 55.72  ? 40   PRO B O   1 
ATOM   4476 C CB  . PRO B 1 40  ? 11.182  -2.290  -63.769 1.00 54.86  ? 40   PRO B CB  1 
ATOM   4477 C CG  . PRO B 1 40  ? 10.147  -1.635  -64.652 1.00 54.75  ? 40   PRO B CG  1 
ATOM   4478 C CD  . PRO B 1 40  ? 10.846  -0.446  -65.168 1.00 54.37  ? 40   PRO B CD  1 
ATOM   4479 N N   . PRO B 1 41  ? 13.669  -1.377  -61.435 1.00 55.36  ? 41   PRO B N   1 
ATOM   4480 C CA  . PRO B 1 41  ? 15.060  -1.502  -61.049 1.00 55.68  ? 41   PRO B CA  1 
ATOM   4481 C C   . PRO B 1 41  ? 15.508  -2.960  -61.029 1.00 56.93  ? 41   PRO B C   1 
ATOM   4482 O O   . PRO B 1 41  ? 15.866  -3.501  -59.976 1.00 57.51  ? 41   PRO B O   1 
ATOM   4483 C CB  . PRO B 1 41  ? 15.060  -0.923  -59.655 1.00 55.08  ? 41   PRO B CB  1 
ATOM   4484 C CG  . PRO B 1 41  ? 13.738  -1.319  -59.112 1.00 54.35  ? 41   PRO B CG  1 
ATOM   4485 C CD  . PRO B 1 41  ? 12.792  -1.260  -60.256 1.00 54.83  ? 41   PRO B CD  1 
ATOM   4486 N N   . VAL B 1 42  ? 15.500  -3.571  -62.201 1.00 57.64  ? 42   VAL B N   1 
ATOM   4487 C CA  . VAL B 1 42  ? 15.743  -5.000  -62.351 1.00 58.60  ? 42   VAL B CA  1 
ATOM   4488 C C   . VAL B 1 42  ? 16.977  -5.246  -63.199 1.00 59.88  ? 42   VAL B C   1 
ATOM   4489 O O   . VAL B 1 42  ? 17.426  -4.367  -63.925 1.00 59.45  ? 42   VAL B O   1 
ATOM   4490 C CB  . VAL B 1 42  ? 14.527  -5.700  -62.998 1.00 59.15  ? 42   VAL B CB  1 
ATOM   4491 C CG1 . VAL B 1 42  ? 13.308  -5.566  -62.101 1.00 58.05  ? 42   VAL B CG1 1 
ATOM   4492 C CG2 . VAL B 1 42  ? 14.238  -5.124  -64.378 1.00 58.81  ? 42   VAL B CG2 1 
ATOM   4493 N N   . GLY B 1 43  ? 17.522  -6.456  -63.103 1.00 61.59  ? 43   GLY B N   1 
ATOM   4494 C CA  . GLY B 1 43  ? 18.761  -6.797  -63.797 1.00 63.42  ? 43   GLY B CA  1 
ATOM   4495 C C   . GLY B 1 43  ? 19.932  -5.919  -63.381 1.00 63.82  ? 43   GLY B C   1 
ATOM   4496 O O   . GLY B 1 43  ? 20.325  -5.920  -62.212 1.00 63.22  ? 43   GLY B O   1 
ATOM   4497 N N   . SER B 1 44  ? 20.474  -5.161  -64.338 1.00 64.83  ? 44   SER B N   1 
ATOM   4498 C CA  . SER B 1 44  ? 21.662  -4.327  -64.114 1.00 65.78  ? 44   SER B CA  1 
ATOM   4499 C C   . SER B 1 44  ? 21.335  -3.146  -63.242 1.00 64.60  ? 44   SER B C   1 
ATOM   4500 O O   . SER B 1 44  ? 22.224  -2.514  -62.687 1.00 65.67  ? 44   SER B O   1 
ATOM   4501 C CB  . SER B 1 44  ? 22.218  -3.796  -65.440 1.00 67.02  ? 44   SER B CB  1 
ATOM   4502 O OG  . SER B 1 44  ? 21.493  -2.640  -65.883 1.00 67.85  ? 44   SER B OG  1 
ATOM   4503 N N   . ARG B 1 45  ? 20.057  -2.830  -63.129 1.00 63.52  ? 45   ARG B N   1 
ATOM   4504 C CA  . ARG B 1 45  ? 19.636  -1.669  -62.355 1.00 62.51  ? 45   ARG B CA  1 
ATOM   4505 C C   . ARG B 1 45  ? 19.468  -1.983  -60.862 1.00 60.62  ? 45   ARG B C   1 
ATOM   4506 O O   . ARG B 1 45  ? 19.201  -1.084  -60.071 1.00 60.26  ? 45   ARG B O   1 
ATOM   4507 C CB  . ARG B 1 45  ? 18.335  -1.121  -62.918 1.00 61.72  ? 45   ARG B CB  1 
ATOM   4508 C CG  . ARG B 1 45  ? 18.343  -0.765  -64.394 1.00 64.00  ? 45   ARG B CG  1 
ATOM   4509 C CD  . ARG B 1 45  ? 16.984  -0.137  -64.768 1.00 65.52  ? 45   ARG B CD  1 
ATOM   4510 N NE  . ARG B 1 45  ? 16.761  -0.026  -66.220 1.00 69.12  ? 45   ARG B NE  1 
ATOM   4511 C CZ  . ARG B 1 45  ? 15.730  -0.549  -66.898 1.00 70.79  ? 45   ARG B CZ  1 
ATOM   4512 N NH1 . ARG B 1 45  ? 14.768  -1.261  -66.300 1.00 69.37  ? 45   ARG B NH1 1 
ATOM   4513 N NH2 . ARG B 1 45  ? 15.661  -0.359  -68.220 1.00 73.81  ? 45   ARG B NH2 1 
ATOM   4514 N N   . ARG B 1 46  ? 19.612  -3.243  -60.470 1.00 60.27  ? 46   ARG B N   1 
ATOM   4515 C CA  . ARG B 1 46  ? 19.619  -3.594  -59.050 1.00 58.84  ? 46   ARG B CA  1 
ATOM   4516 C C   . ARG B 1 46  ? 20.778  -2.919  -58.320 1.00 58.64  ? 46   ARG B C   1 
ATOM   4517 O O   . ARG B 1 46  ? 21.898  -2.905  -58.830 1.00 59.87  ? 46   ARG B O   1 
ATOM   4518 C CB  . ARG B 1 46  ? 19.744  -5.106  -58.864 1.00 59.70  ? 46   ARG B CB  1 
ATOM   4519 C CG  . ARG B 1 46  ? 19.594  -5.561  -57.422 1.00 58.40  ? 46   ARG B CG  1 
ATOM   4520 C CD  . ARG B 1 46  ? 20.022  -7.000  -57.257 1.00 58.59  ? 46   ARG B CD  1 
ATOM   4521 N NE  . ARG B 1 46  ? 18.954  -7.964  -57.512 1.00 56.98  ? 46   ARG B NE  1 
ATOM   4522 C CZ  . ARG B 1 46  ? 19.144  -9.287  -57.503 1.00 59.50  ? 46   ARG B CZ  1 
ATOM   4523 N NH1 . ARG B 1 46  ? 20.356  -9.777  -57.282 1.00 59.15  ? 46   ARG B NH1 1 
ATOM   4524 N NH2 . ARG B 1 46  ? 18.136  -10.120 -57.734 1.00 58.45  ? 46   ARG B NH2 1 
ATOM   4525 N N   . PHE B 1 47  ? 20.483  -2.406  -57.121 1.00 57.39  ? 47   PHE B N   1 
ATOM   4526 C CA  . PHE B 1 47  ? 21.395  -1.619  -56.279 1.00 57.06  ? 47   PHE B CA  1 
ATOM   4527 C C   . PHE B 1 47  ? 21.707  -0.221  -56.841 1.00 56.87  ? 47   PHE B C   1 
ATOM   4528 O O   . PHE B 1 47  ? 22.445  0.537   -56.213 1.00 56.45  ? 47   PHE B O   1 
ATOM   4529 C CB  . PHE B 1 47  ? 22.740  -2.335  -56.003 1.00 58.15  ? 47   PHE B CB  1 
ATOM   4530 C CG  . PHE B 1 47  ? 22.624  -3.800  -55.647 1.00 58.00  ? 47   PHE B CG  1 
ATOM   4531 C CD1 . PHE B 1 47  ? 21.850  -4.214  -54.572 1.00 56.97  ? 47   PHE B CD1 1 
ATOM   4532 C CD2 . PHE B 1 47  ? 23.337  -4.749  -56.358 1.00 58.63  ? 47   PHE B CD2 1 
ATOM   4533 C CE1 . PHE B 1 47  ? 21.746  -5.556  -54.235 1.00 57.05  ? 47   PHE B CE1 1 
ATOM   4534 C CE2 . PHE B 1 47  ? 23.249  -6.105  -56.028 1.00 59.77  ? 47   PHE B CE2 1 
ATOM   4535 C CZ  . PHE B 1 47  ? 22.446  -6.509  -54.959 1.00 59.11  ? 47   PHE B CZ  1 
ATOM   4536 N N   . MET B 1 48  ? 21.201  0.112   -58.026 1.00 57.18  ? 48   MET B N   1 
ATOM   4537 C CA  . MET B 1 48  ? 21.522  1.403   -58.652 1.00 58.05  ? 48   MET B CA  1 
ATOM   4538 C C   . MET B 1 48  ? 20.429  2.409   -58.367 1.00 55.92  ? 48   MET B C   1 
ATOM   4539 O O   . MET B 1 48  ? 19.297  2.017   -58.138 1.00 54.59  ? 48   MET B O   1 
ATOM   4540 C CB  . MET B 1 48  ? 21.670  1.248   -60.163 1.00 59.08  ? 48   MET B CB  1 
ATOM   4541 C CG  . MET B 1 48  ? 22.680  0.188   -60.603 1.00 62.19  ? 48   MET B CG  1 
ATOM   4542 S SD  . MET B 1 48  ? 23.384  0.573   -62.212 1.00 64.99  ? 48   MET B SD  1 
ATOM   4543 C CE  . MET B 1 48  ? 24.364  2.005   -61.705 1.00 65.59  ? 48   MET B CE  1 
ATOM   4544 N N   . PRO B 1 49  ? 20.751  3.716   -58.393 1.00 56.09  ? 49   PRO B N   1 
ATOM   4545 C CA  . PRO B 1 49  ? 19.694  4.724   -58.286 1.00 55.30  ? 49   PRO B CA  1 
ATOM   4546 C C   . PRO B 1 49  ? 18.557  4.551   -59.295 1.00 55.44  ? 49   PRO B C   1 
ATOM   4547 O O   . PRO B 1 49  ? 18.795  4.115   -60.409 1.00 56.66  ? 49   PRO B O   1 
ATOM   4548 C CB  . PRO B 1 49  ? 20.433  6.038   -58.572 1.00 55.85  ? 49   PRO B CB  1 
ATOM   4549 C CG  . PRO B 1 49  ? 21.814  5.786   -58.164 1.00 56.81  ? 49   PRO B CG  1 
ATOM   4550 C CD  . PRO B 1 49  ? 22.076  4.342   -58.509 1.00 57.11  ? 49   PRO B CD  1 
ATOM   4551 N N   . PRO B 1 50  ? 17.325  4.938   -58.922 1.00 55.11  ? 50   PRO B N   1 
ATOM   4552 C CA  . PRO B 1 50  ? 16.195  4.794   -59.838 1.00 55.08  ? 50   PRO B CA  1 
ATOM   4553 C C   . PRO B 1 50  ? 16.304  5.738   -61.038 1.00 56.36  ? 50   PRO B C   1 
ATOM   4554 O O   . PRO B 1 50  ? 16.802  6.837   -60.884 1.00 56.26  ? 50   PRO B O   1 
ATOM   4555 C CB  . PRO B 1 50  ? 14.994  5.183   -58.966 1.00 54.06  ? 50   PRO B CB  1 
ATOM   4556 C CG  . PRO B 1 50  ? 15.545  6.045   -57.927 1.00 53.45  ? 50   PRO B CG  1 
ATOM   4557 C CD  . PRO B 1 50  ? 16.928  5.563   -57.648 1.00 53.80  ? 50   PRO B CD  1 
ATOM   4558 N N   . GLU B 1 51  ? 15.857  5.313   -62.221 1.00 57.47  ? 51   GLU B N   1 
ATOM   4559 C CA  . GLU B 1 51  ? 15.772  6.221   -63.367 1.00 59.17  ? 51   GLU B CA  1 
ATOM   4560 C C   . GLU B 1 51  ? 14.312  6.596   -63.557 1.00 57.27  ? 51   GLU B C   1 
ATOM   4561 O O   . GLU B 1 51  ? 13.430  5.814   -63.244 1.00 56.11  ? 51   GLU B O   1 
ATOM   4562 C CB  . GLU B 1 51  ? 16.308  5.573   -64.643 1.00 60.56  ? 51   GLU B CB  1 
ATOM   4563 C CG  . GLU B 1 51  ? 17.690  4.921   -64.512 1.00 64.19  ? 51   GLU B CG  1 
ATOM   4564 C CD  . GLU B 1 51  ? 17.998  3.963   -65.678 1.00 66.62  ? 51   GLU B CD  1 
ATOM   4565 O OE1 . GLU B 1 51  ? 17.933  4.396   -66.868 1.00 74.32  ? 51   GLU B OE1 1 
ATOM   4566 O OE2 . GLU B 1 51  ? 18.303  2.764   -65.413 1.00 74.10  ? 51   GLU B OE2 1 
ATOM   4567 N N   . PRO B 1 52  ? 14.043  7.800   -64.067 1.00 57.22  ? 52   PRO B N   1 
ATOM   4568 C CA  . PRO B 1 52  ? 12.636  8.167   -64.323 1.00 56.44  ? 52   PRO B CA  1 
ATOM   4569 C C   . PRO B 1 52  ? 11.920  7.267   -65.350 1.00 56.22  ? 52   PRO B C   1 
ATOM   4570 O O   . PRO B 1 52  ? 12.530  6.818   -66.322 1.00 57.16  ? 52   PRO B O   1 
ATOM   4571 C CB  . PRO B 1 52  ? 12.713  9.615   -64.828 1.00 57.44  ? 52   PRO B CB  1 
ATOM   4572 C CG  . PRO B 1 52  ? 14.124  10.068  -64.636 1.00 58.10  ? 52   PRO B CG  1 
ATOM   4573 C CD  . PRO B 1 52  ? 14.993  8.869   -64.422 1.00 58.12  ? 52   PRO B CD  1 
ATOM   4574 N N   . LYS B 1 53  ? 10.641  7.011   -65.101 1.00 55.15  ? 53   LYS B N   1 
ATOM   4575 C CA  . LYS B 1 53  ? 9.801   6.171   -65.950 1.00 55.61  ? 53   LYS B CA  1 
ATOM   4576 C C   . LYS B 1 53  ? 9.622   6.754   -67.332 1.00 56.62  ? 53   LYS B C   1 
ATOM   4577 O O   . LYS B 1 53  ? 9.216   7.910   -67.478 1.00 57.05  ? 53   LYS B O   1 
ATOM   4578 C CB  . LYS B 1 53  ? 8.420   5.981   -65.319 1.00 54.72  ? 53   LYS B CB  1 
ATOM   4579 C CG  . LYS B 1 53  ? 7.405   5.185   -66.136 1.00 55.70  ? 53   LYS B CG  1 
ATOM   4580 C CD  . LYS B 1 53  ? 7.857   3.740   -66.437 1.00 56.67  ? 53   LYS B CD  1 
ATOM   4581 C CE  . LYS B 1 53  ? 6.799   2.940   -67.240 1.00 56.39  ? 53   LYS B CE  1 
ATOM   4582 N NZ  . LYS B 1 53  ? 6.879   3.146   -68.717 1.00 57.33  ? 53   LYS B NZ  1 
ATOM   4583 N N   . ARG B 1 54  ? 9.905   5.934   -68.344 1.00 57.01  ? 54   ARG B N   1 
ATOM   4584 C CA  . ARG B 1 54  ? 9.673   6.320   -69.719 1.00 57.86  ? 54   ARG B CA  1 
ATOM   4585 C C   . ARG B 1 54  ? 8.180   6.538   -69.966 1.00 57.95  ? 54   ARG B C   1 
ATOM   4586 O O   . ARG B 1 54  ? 7.341   5.856   -69.393 1.00 57.10  ? 54   ARG B O   1 
ATOM   4587 C CB  . ARG B 1 54  ? 10.197  5.254   -70.668 1.00 58.87  ? 54   ARG B CB  1 
ATOM   4588 C CG  . ARG B 1 54  ? 11.710  5.076   -70.645 1.00 58.91  ? 54   ARG B CG  1 
ATOM   4589 C CD  . ARG B 1 54  ? 12.132  3.922   -71.523 1.00 59.62  ? 54   ARG B CD  1 
ATOM   4590 N NE  . ARG B 1 54  ? 11.443  2.683   -71.161 1.00 58.86  ? 54   ARG B NE  1 
ATOM   4591 C CZ  . ARG B 1 54  ? 10.718  1.930   -71.984 1.00 60.05  ? 54   ARG B CZ  1 
ATOM   4592 N NH1 . ARG B 1 54  ? 10.150  0.839   -71.506 1.00 59.44  ? 54   ARG B NH1 1 
ATOM   4593 N NH2 . ARG B 1 54  ? 10.547  2.243   -73.268 1.00 60.11  ? 54   ARG B NH2 1 
ATOM   4594 N N   . PRO B 1 55  ? 7.839   7.509   -70.812 1.00 59.13  ? 55   PRO B N   1 
ATOM   4595 C CA  . PRO B 1 55  ? 6.420   7.753   -71.123 1.00 59.32  ? 55   PRO B CA  1 
ATOM   4596 C C   . PRO B 1 55  ? 5.796   6.576   -71.848 1.00 59.54  ? 55   PRO B C   1 
ATOM   4597 O O   . PRO B 1 55  ? 6.509   5.790   -72.460 1.00 60.50  ? 55   PRO B O   1 
ATOM   4598 C CB  . PRO B 1 55  ? 6.461   8.979   -72.034 1.00 60.46  ? 55   PRO B CB  1 
ATOM   4599 C CG  . PRO B 1 55  ? 7.818   9.592   -71.799 1.00 60.97  ? 55   PRO B CG  1 
ATOM   4600 C CD  . PRO B 1 55  ? 8.730   8.455   -71.503 1.00 60.03  ? 55   PRO B CD  1 
ATOM   4601 N N   . TRP B 1 56  ? 4.475   6.468   -71.784 1.00 59.31  ? 56   TRP B N   1 
ATOM   4602 C CA  . TRP B 1 56  ? 3.761   5.278   -72.250 1.00 59.19  ? 56   TRP B CA  1 
ATOM   4603 C C   . TRP B 1 56  ? 2.621   5.658   -73.158 1.00 60.25  ? 56   TRP B C   1 
ATOM   4604 O O   . TRP B 1 56  ? 2.115   6.780   -73.089 1.00 60.48  ? 56   TRP B O   1 
ATOM   4605 C CB  . TRP B 1 56  ? 3.216   4.484   -71.060 1.00 58.22  ? 56   TRP B CB  1 
ATOM   4606 C CG  . TRP B 1 56  ? 2.313   5.272   -70.201 1.00 57.17  ? 56   TRP B CG  1 
ATOM   4607 C CD1 . TRP B 1 56  ? 0.973   5.490   -70.396 1.00 57.71  ? 56   TRP B CD1 1 
ATOM   4608 C CD2 . TRP B 1 56  ? 2.663   5.969   -68.998 1.00 56.18  ? 56   TRP B CD2 1 
ATOM   4609 N NE1 . TRP B 1 56  ? 0.475   6.282   -69.396 1.00 57.32  ? 56   TRP B NE1 1 
ATOM   4610 C CE2 . TRP B 1 56  ? 1.491   6.597   -68.527 1.00 56.38  ? 56   TRP B CE2 1 
ATOM   4611 C CE3 . TRP B 1 56  ? 3.855   6.131   -68.275 1.00 55.01  ? 56   TRP B CE3 1 
ATOM   4612 C CZ2 . TRP B 1 56  ? 1.477   7.370   -67.357 1.00 55.32  ? 56   TRP B CZ2 1 
ATOM   4613 C CZ3 . TRP B 1 56  ? 3.843   6.905   -67.137 1.00 54.49  ? 56   TRP B CZ3 1 
ATOM   4614 C CH2 . TRP B 1 56  ? 2.659   7.516   -66.684 1.00 54.18  ? 56   TRP B CH2 1 
ATOM   4615 N N   . SER B 1 57  ? 2.212   4.701   -73.991 1.00 60.91  ? 57   SER B N   1 
ATOM   4616 C CA  . SER B 1 57  ? 1.156   4.894   -74.977 1.00 62.15  ? 57   SER B CA  1 
ATOM   4617 C C   . SER B 1 57  ? -0.210  4.655   -74.376 1.00 62.07  ? 57   SER B C   1 
ATOM   4618 O O   . SER B 1 57  ? -0.340  3.967   -73.382 1.00 61.11  ? 57   SER B O   1 
ATOM   4619 C CB  . SER B 1 57  ? 1.339   3.913   -76.142 1.00 63.79  ? 57   SER B CB  1 
ATOM   4620 O OG  . SER B 1 57  ? 1.079   2.571   -75.734 1.00 63.53  ? 57   SER B OG  1 
ATOM   4621 N N   . GLY B 1 58  ? -1.239  5.214   -74.998 1.00 63.39  ? 58   GLY B N   1 
ATOM   4622 C CA  . GLY B 1 58  ? -2.600  4.883   -74.634 1.00 63.82  ? 58   GLY B CA  1 
ATOM   4623 C C   . GLY B 1 58  ? -2.909  5.235   -73.203 1.00 62.84  ? 58   GLY B C   1 
ATOM   4624 O O   . GLY B 1 58  ? -2.325  6.168   -72.655 1.00 62.27  ? 58   GLY B O   1 
ATOM   4625 N N   . VAL B 1 59  ? -3.826  4.478   -72.605 1.00 63.42  ? 59   VAL B N   1 
ATOM   4626 C CA  . VAL B 1 59  ? -4.335  4.754   -71.267 1.00 63.30  ? 59   VAL B CA  1 
ATOM   4627 C C   . VAL B 1 59  ? -3.868  3.657   -70.327 1.00 63.04  ? 59   VAL B C   1 
ATOM   4628 O O   . VAL B 1 59  ? -4.271  2.508   -70.475 1.00 64.06  ? 59   VAL B O   1 
ATOM   4629 C CB  . VAL B 1 59  ? -5.886  4.803   -71.274 1.00 64.47  ? 59   VAL B CB  1 
ATOM   4630 C CG1 . VAL B 1 59  ? -6.429  4.952   -69.865 1.00 63.63  ? 59   VAL B CG1 1 
ATOM   4631 C CG2 . VAL B 1 59  ? -6.376  5.942   -72.154 1.00 64.76  ? 59   VAL B CG2 1 
ATOM   4632 N N   . LEU B 1 60  ? -3.009  4.004   -69.374 1.00 62.77  ? 60   LEU B N   1 
ATOM   4633 C CA  . LEU B 1 60  ? -2.492  3.031   -68.407 1.00 62.20  ? 60   LEU B CA  1 
ATOM   4634 C C   . LEU B 1 60  ? -3.519  2.755   -67.319 1.00 62.51  ? 60   LEU B C   1 
ATOM   4635 O O   . LEU B 1 60  ? -4.087  3.676   -66.744 1.00 62.18  ? 60   LEU B O   1 
ATOM   4636 C CB  . LEU B 1 60  ? -1.185  3.528   -67.780 1.00 61.04  ? 60   LEU B CB  1 
ATOM   4637 C CG  . LEU B 1 60  ? -0.392  2.544   -66.905 1.00 60.10  ? 60   LEU B CG  1 
ATOM   4638 C CD1 . LEU B 1 60  ? -0.006  1.263   -67.665 1.00 63.20  ? 60   LEU B CD1 1 
ATOM   4639 C CD2 . LEU B 1 60  ? 0.834   3.210   -66.401 1.00 58.97  ? 60   LEU B CD2 1 
ATOM   4640 N N   . ASP B 1 61  ? -3.747  1.481   -67.042 1.00 63.56  ? 61   ASP B N   1 
ATOM   4641 C CA  . ASP B 1 61  ? -4.697  1.055   -66.023 1.00 64.87  ? 61   ASP B CA  1 
ATOM   4642 C C   . ASP B 1 61  ? -4.145  1.229   -64.603 1.00 63.58  ? 61   ASP B C   1 
ATOM   4643 O O   . ASP B 1 61  ? -3.229  0.499   -64.200 1.00 63.29  ? 61   ASP B O   1 
ATOM   4644 C CB  . ASP B 1 61  ? -5.051  -0.410  -66.249 1.00 66.79  ? 61   ASP B CB  1 
ATOM   4645 C CG  . ASP B 1 61  ? -6.060  -0.929  -65.246 1.00 70.62  ? 61   ASP B CG  1 
ATOM   4646 O OD1 . ASP B 1 61  ? -7.182  -0.373  -65.212 1.00 76.08  ? 61   ASP B OD1 1 
ATOM   4647 O OD2 . ASP B 1 61  ? -5.734  -1.902  -64.521 1.00 75.57  ? 61   ASP B OD2 1 
ATOM   4648 N N   . ALA B 1 62  ? -4.699  2.194   -63.860 1.00 62.81  ? 62   ALA B N   1 
ATOM   4649 C CA  . ALA B 1 62  ? -4.280  2.507   -62.492 1.00 61.29  ? 62   ALA B CA  1 
ATOM   4650 C C   . ALA B 1 62  ? -5.442  2.258   -61.517 1.00 61.47  ? 62   ALA B C   1 
ATOM   4651 O O   . ALA B 1 62  ? -5.792  3.120   -60.713 1.00 60.38  ? 62   ALA B O   1 
ATOM   4652 C CB  . ALA B 1 62  ? -3.794  3.982   -62.398 1.00 59.91  ? 62   ALA B CB  1 
ATOM   4653 N N   . THR B 1 63  ? -6.040  1.075   -61.598 1.00 62.29  ? 63   THR B N   1 
ATOM   4654 C CA  . THR B 1 63  ? -7.220  0.749   -60.803 1.00 63.45  ? 63   THR B CA  1 
ATOM   4655 C C   . THR B 1 63  ? -6.911  -0.270  -59.712 1.00 63.19  ? 63   THR B C   1 
ATOM   4656 O O   . THR B 1 63  ? -7.795  -0.663  -58.933 1.00 63.66  ? 63   THR B O   1 
ATOM   4657 C CB  . THR B 1 63  ? -8.347  0.165   -61.703 1.00 65.43  ? 63   THR B CB  1 
ATOM   4658 O OG1 . THR B 1 63  ? -7.893  -1.062  -62.313 1.00 66.05  ? 63   THR B OG1 1 
ATOM   4659 C CG2 . THR B 1 63  ? -8.773  1.175   -62.787 1.00 65.07  ? 63   THR B CG2 1 
ATOM   4660 N N   . THR B 1 64  ? -5.653  -0.690  -59.656 1.00 62.26  ? 64   THR B N   1 
ATOM   4661 C CA  . THR B 1 64  ? -5.256  -1.796  -58.818 1.00 62.32  ? 64   THR B CA  1 
ATOM   4662 C C   . THR B 1 64  ? -3.842  -1.559  -58.248 1.00 60.35  ? 64   THR B C   1 
ATOM   4663 O O   . THR B 1 64  ? -3.022  -0.864  -58.854 1.00 59.24  ? 64   THR B O   1 
ATOM   4664 C CB  . THR B 1 64  ? -5.382  -3.124  -59.620 1.00 63.94  ? 64   THR B CB  1 
ATOM   4665 O OG1 . THR B 1 64  ? -5.280  -4.227  -58.722 1.00 67.42  ? 64   THR B OG1 1 
ATOM   4666 C CG2 . THR B 1 64  ? -4.320  -3.244  -60.703 1.00 63.41  ? 64   THR B CG2 1 
ATOM   4667 N N   . PHE B 1 65  ? -3.589  -2.087  -57.052 1.00 59.67  ? 65   PHE B N   1 
ATOM   4668 C CA  . PHE B 1 65  ? -2.275  -1.962  -56.422 1.00 58.32  ? 65   PHE B CA  1 
ATOM   4669 C C   . PHE B 1 65  ? -1.258  -2.798  -57.170 1.00 58.21  ? 65   PHE B C   1 
ATOM   4670 O O   . PHE B 1 65  ? -1.552  -3.903  -57.615 1.00 59.63  ? 65   PHE B O   1 
ATOM   4671 C CB  . PHE B 1 65  ? -2.288  -2.425  -54.948 1.00 58.06  ? 65   PHE B CB  1 
ATOM   4672 C CG  . PHE B 1 65  ? -2.823  -1.403  -53.975 1.00 57.28  ? 65   PHE B CG  1 
ATOM   4673 C CD1 . PHE B 1 65  ? -2.281  -0.130  -53.910 1.00 56.86  ? 65   PHE B CD1 1 
ATOM   4674 C CD2 . PHE B 1 65  ? -3.859  -1.725  -53.110 1.00 58.09  ? 65   PHE B CD2 1 
ATOM   4675 C CE1 . PHE B 1 65  ? -2.763  0.802   -53.021 1.00 54.92  ? 65   PHE B CE1 1 
ATOM   4676 C CE2 . PHE B 1 65  ? -4.342  -0.801  -52.220 1.00 56.98  ? 65   PHE B CE2 1 
ATOM   4677 C CZ  . PHE B 1 65  ? -3.796  0.465   -52.180 1.00 57.21  ? 65   PHE B CZ  1 
ATOM   4678 N N   . GLN B 1 66  ? -0.037  -2.291  -57.250 1.00 57.18  ? 66   GLN B N   1 
ATOM   4679 C CA  . GLN B 1 66  ? 1.045   -3.015  -57.908 1.00 56.95  ? 66   GLN B CA  1 
ATOM   4680 C C   . GLN B 1 66  ? 1.802   -3.917  -56.921 1.00 56.80  ? 66   GLN B C   1 
ATOM   4681 O O   . GLN B 1 66  ? 1.458   -4.009  -55.740 1.00 56.55  ? 66   GLN B O   1 
ATOM   4682 C CB  . GLN B 1 66  ? 1.968   -2.022  -58.616 1.00 56.49  ? 66   GLN B CB  1 
ATOM   4683 C CG  . GLN B 1 66  ? 1.592   -1.799  -60.073 1.00 57.12  ? 66   GLN B CG  1 
ATOM   4684 C CD  . GLN B 1 66  ? 1.997   -2.976  -60.949 1.00 59.08  ? 66   GLN B CD  1 
ATOM   4685 O OE1 . GLN B 1 66  ? 2.622   -3.934  -60.479 1.00 62.57  ? 66   GLN B OE1 1 
ATOM   4686 N NE2 . GLN B 1 66  ? 1.654   -2.910  -62.215 1.00 57.75  ? 66   GLN B NE2 1 
ATOM   4687 N N   . ASN B 1 67  ? 2.819   -4.607  -57.414 1.00 57.23  ? 67   ASN B N   1 
ATOM   4688 C CA  . ASN B 1 67  ? 3.575   -5.533  -56.594 1.00 57.42  ? 67   ASN B CA  1 
ATOM   4689 C C   . ASN B 1 67  ? 4.317   -4.893  -55.419 1.00 55.83  ? 67   ASN B C   1 
ATOM   4690 O O   . ASN B 1 67  ? 4.694   -3.720  -55.444 1.00 55.17  ? 67   ASN B O   1 
ATOM   4691 C CB  . ASN B 1 67  ? 4.566   -6.293  -57.460 1.00 58.64  ? 67   ASN B CB  1 
ATOM   4692 C CG  . ASN B 1 67  ? 3.883   -7.229  -58.465 1.00 61.54  ? 67   ASN B CG  1 
ATOM   4693 O OD1 . ASN B 1 67  ? 4.507   -7.668  -59.425 1.00 63.86  ? 67   ASN B OD1 1 
ATOM   4694 N ND2 . ASN B 1 67  ? 2.602   -7.530  -58.242 1.00 64.14  ? 67   ASN B ND2 1 
ATOM   4695 N N   . VAL B 1 68  ? 4.537   -5.693  -54.385 1.00 55.56  ? 68   VAL B N   1 
ATOM   4696 C CA  . VAL B 1 68  ? 5.302   -5.266  -53.213 1.00 54.12  ? 68   VAL B CA  1 
ATOM   4697 C C   . VAL B 1 68  ? 6.797   -5.455  -53.481 1.00 54.01  ? 68   VAL B C   1 
ATOM   4698 O O   . VAL B 1 68  ? 7.199   -6.467  -54.059 1.00 54.95  ? 68   VAL B O   1 
ATOM   4699 C CB  . VAL B 1 68  ? 4.845   -6.080  -51.984 1.00 54.64  ? 68   VAL B CB  1 
ATOM   4700 C CG1 . VAL B 1 68  ? 5.822   -5.938  -50.806 1.00 53.00  ? 68   VAL B CG1 1 
ATOM   4701 C CG2 . VAL B 1 68  ? 3.430   -5.668  -51.607 1.00 54.46  ? 68   VAL B CG2 1 
ATOM   4702 N N   . CYS B 1 69  ? 7.627   -4.499  -53.073 1.00 53.04  ? 69   CYS B N   1 
ATOM   4703 C CA  . CYS B 1 69  ? 9.068   -4.630  -53.266 1.00 53.31  ? 69   CYS B CA  1 
ATOM   4704 C C   . CYS B 1 69  ? 9.560   -5.903  -52.601 1.00 53.87  ? 69   CYS B C   1 
ATOM   4705 O O   . CYS B 1 69  ? 9.047   -6.287  -51.561 1.00 53.66  ? 69   CYS B O   1 
ATOM   4706 C CB  . CYS B 1 69  ? 9.809   -3.412  -52.739 1.00 52.48  ? 69   CYS B CB  1 
ATOM   4707 S SG  . CYS B 1 69  ? 9.526   -1.923  -53.754 1.00 53.66  ? 69   CYS B SG  1 
ATOM   4708 N N   . TYR B 1 70  ? 10.550  -6.554  -53.210 1.00 54.69  ? 70   TYR B N   1 
ATOM   4709 C CA  . TYR B 1 70  ? 10.990  -7.860  -52.722 1.00 55.94  ? 70   TYR B CA  1 
ATOM   4710 C C   . TYR B 1 70  ? 11.512  -7.735  -51.291 1.00 56.25  ? 70   TYR B C   1 
ATOM   4711 O O   . TYR B 1 70  ? 12.344  -6.879  -50.990 1.00 55.03  ? 70   TYR B O   1 
ATOM   4712 C CB  . TYR B 1 70  ? 12.019  -8.541  -53.650 1.00 56.35  ? 70   TYR B CB  1 
ATOM   4713 C CG  . TYR B 1 70  ? 11.925  -10.051 -53.515 1.00 57.80  ? 70   TYR B CG  1 
ATOM   4714 C CD1 . TYR B 1 70  ? 11.116  -10.796 -54.353 1.00 57.83  ? 70   TYR B CD1 1 
ATOM   4715 C CD2 . TYR B 1 70  ? 12.583  -10.713 -52.495 1.00 58.02  ? 70   TYR B CD2 1 
ATOM   4716 C CE1 . TYR B 1 70  ? 10.996  -12.172 -54.201 1.00 60.01  ? 70   TYR B CE1 1 
ATOM   4717 C CE2 . TYR B 1 70  ? 12.465  -12.071 -52.331 1.00 58.74  ? 70   TYR B CE2 1 
ATOM   4718 C CZ  . TYR B 1 70  ? 11.672  -12.794 -53.185 1.00 59.59  ? 70   TYR B CZ  1 
ATOM   4719 O OH  . TYR B 1 70  ? 11.558  -14.137 -53.005 1.00 61.55  ? 70   TYR B OH  1 
ATOM   4720 N N   . GLN B 1 71  ? 11.001  -8.583  -50.403 1.00 57.59  ? 71   GLN B N   1 
ATOM   4721 C CA  . GLN B 1 71  ? 11.294  -8.432  -48.994 1.00 58.06  ? 71   GLN B CA  1 
ATOM   4722 C C   . GLN B 1 71  ? 11.085  -9.720  -48.230 1.00 60.20  ? 71   GLN B C   1 
ATOM   4723 O O   . GLN B 1 71  ? 10.436  -10.645 -48.715 1.00 61.51  ? 71   GLN B O   1 
ATOM   4724 C CB  . GLN B 1 71  ? 10.437  -7.307  -48.374 1.00 56.78  ? 71   GLN B CB  1 
ATOM   4725 C CG  . GLN B 1 71  ? 8.951   -7.595  -48.303 1.00 55.58  ? 71   GLN B CG  1 
ATOM   4726 C CD  . GLN B 1 71  ? 8.149   -6.383  -47.905 1.00 55.83  ? 71   GLN B CD  1 
ATOM   4727 O OE1 . GLN B 1 71  ? 7.482   -6.381  -46.858 1.00 56.75  ? 71   GLN B OE1 1 
ATOM   4728 N NE2 . GLN B 1 71  ? 8.214   -5.326  -48.725 1.00 51.79  ? 71   GLN B NE2 1 
ATOM   4729 N N   . TYR B 1 72  ? 11.683  -9.756  -47.039 1.00 61.57  ? 72   TYR B N   1 
ATOM   4730 C CA  . TYR B 1 72  ? 11.463  -10.809 -46.057 1.00 63.36  ? 72   TYR B CA  1 
ATOM   4731 C C   . TYR B 1 72  ? 10.029  -10.720 -45.559 1.00 63.29  ? 72   TYR B C   1 
ATOM   4732 O O   . TYR B 1 72  ? 9.485   -9.626  -45.357 1.00 61.49  ? 72   TYR B O   1 
ATOM   4733 C CB  . TYR B 1 72  ? 12.462  -10.653 -44.896 1.00 64.13  ? 72   TYR B CB  1 
ATOM   4734 C CG  . TYR B 1 72  ? 12.201  -11.502 -43.662 1.00 65.53  ? 72   TYR B CG  1 
ATOM   4735 C CD1 . TYR B 1 72  ? 11.403  -11.017 -42.627 1.00 66.17  ? 72   TYR B CD1 1 
ATOM   4736 C CD2 . TYR B 1 72  ? 12.769  -12.767 -43.515 1.00 67.90  ? 72   TYR B CD2 1 
ATOM   4737 C CE1 . TYR B 1 72  ? 11.163  -11.763 -41.482 1.00 66.95  ? 72   TYR B CE1 1 
ATOM   4738 C CE2 . TYR B 1 72  ? 12.531  -13.532 -42.367 1.00 69.39  ? 72   TYR B CE2 1 
ATOM   4739 C CZ  . TYR B 1 72  ? 11.727  -13.011 -41.351 1.00 68.31  ? 72   TYR B CZ  1 
ATOM   4740 O OH  . TYR B 1 72  ? 11.464  -13.726 -40.202 1.00 70.02  ? 72   TYR B OH  1 
ATOM   4741 N N   . VAL B 1 73  ? 9.433   -11.890 -45.379 1.00 65.12  ? 73   VAL B N   1 
ATOM   4742 C CA  . VAL B 1 73  ? 8.064   -12.032 -44.919 1.00 66.20  ? 73   VAL B CA  1 
ATOM   4743 C C   . VAL B 1 73  ? 8.078   -12.745 -43.568 1.00 67.81  ? 73   VAL B C   1 
ATOM   4744 O O   . VAL B 1 73  ? 8.687   -13.817 -43.427 1.00 68.36  ? 73   VAL B O   1 
ATOM   4745 C CB  . VAL B 1 73  ? 7.233   -12.884 -45.913 1.00 67.42  ? 73   VAL B CB  1 
ATOM   4746 C CG1 . VAL B 1 73  ? 5.825   -13.049 -45.414 1.00 68.01  ? 73   VAL B CG1 1 
ATOM   4747 C CG2 . VAL B 1 73  ? 7.227   -12.244 -47.288 1.00 67.10  ? 73   VAL B CG2 1 
ATOM   4748 N N   . ASP B 1 74  ? 7.385   -12.157 -42.597 1.00 68.47  ? 74   ASP B N   1 
ATOM   4749 C CA  . ASP B 1 74  ? 7.388   -12.650 -41.224 1.00 70.83  ? 74   ASP B CA  1 
ATOM   4750 C C   . ASP B 1 74  ? 6.625   -13.964 -41.100 1.00 73.52  ? 74   ASP B C   1 
ATOM   4751 O O   . ASP B 1 74  ? 5.510   -14.077 -41.597 1.00 73.97  ? 74   ASP B O   1 
ATOM   4752 C CB  . ASP B 1 74  ? 6.765   -11.627 -40.275 1.00 70.03  ? 74   ASP B CB  1 
ATOM   4753 C CG  . ASP B 1 74  ? 7.238   -11.797 -38.840 1.00 71.86  ? 74   ASP B CG  1 
ATOM   4754 O OD1 . ASP B 1 74  ? 6.528   -12.447 -38.039 1.00 73.37  ? 74   ASP B OD1 1 
ATOM   4755 O OD2 . ASP B 1 74  ? 8.338   -11.279 -38.526 1.00 74.55  ? 74   ASP B OD2 1 
ATOM   4756 N N   . THR B 1 75  ? 7.228   -14.932 -40.414 1.00 76.00  ? 75   THR B N   1 
ATOM   4757 C CA  . THR B 1 75  ? 6.613   -16.238 -40.189 1.00 79.00  ? 75   THR B CA  1 
ATOM   4758 C C   . THR B 1 75  ? 6.645   -16.678 -38.715 1.00 80.22  ? 75   THR B C   1 
ATOM   4759 O O   . THR B 1 75  ? 6.462   -17.853 -38.415 1.00 82.31  ? 75   THR B O   1 
ATOM   4760 C CB  . THR B 1 75  ? 7.315   -17.316 -41.068 1.00 80.60  ? 75   THR B CB  1 
ATOM   4761 O OG1 . THR B 1 75  ? 8.741   -17.217 -40.900 1.00 80.91  ? 75   THR B OG1 1 
ATOM   4762 C CG2 . THR B 1 75  ? 6.941   -17.138 -42.552 1.00 79.77  ? 75   THR B CG2 1 
ATOM   4763 N N   . LEU B 1 76  ? 6.849   -15.741 -37.791 1.00 79.79  ? 76   LEU B N   1 
ATOM   4764 C CA  . LEU B 1 76  ? 6.909   -16.078 -36.360 1.00 80.71  ? 76   LEU B CA  1 
ATOM   4765 C C   . LEU B 1 76  ? 5.599   -16.691 -35.856 1.00 82.51  ? 76   LEU B C   1 
ATOM   4766 O O   . LEU B 1 76  ? 5.613   -17.578 -34.996 1.00 84.56  ? 76   LEU B O   1 
ATOM   4767 C CB  . LEU B 1 76  ? 7.249   -14.841 -35.517 1.00 79.31  ? 76   LEU B CB  1 
ATOM   4768 C CG  . LEU B 1 76  ? 7.447   -15.051 -34.005 1.00 80.06  ? 76   LEU B CG  1 
ATOM   4769 C CD1 . LEU B 1 76  ? 8.685   -15.918 -33.704 1.00 81.81  ? 76   LEU B CD1 1 
ATOM   4770 C CD2 . LEU B 1 76  ? 7.530   -13.713 -33.277 1.00 78.16  ? 76   LEU B CD2 1 
ATOM   4771 N N   . TYR B 1 77  ? 4.480   -16.202 -36.391 1.00 82.09  ? 77   TYR B N   1 
ATOM   4772 C CA  . TYR B 1 77  ? 3.149   -16.605 -35.956 1.00 82.87  ? 77   TYR B CA  1 
ATOM   4773 C C   . TYR B 1 77  ? 2.234   -16.713 -37.172 1.00 82.56  ? 77   TYR B C   1 
ATOM   4774 O O   . TYR B 1 77  ? 1.438   -15.817 -37.432 1.00 81.36  ? 77   TYR B O   1 
ATOM   4775 C CB  . TYR B 1 77  ? 2.575   -15.570 -34.981 1.00 82.12  ? 77   TYR B CB  1 
ATOM   4776 C CG  . TYR B 1 77  ? 3.288   -15.436 -33.650 1.00 82.39  ? 77   TYR B CG  1 
ATOM   4777 C CD1 . TYR B 1 77  ? 3.434   -16.526 -32.795 1.00 84.55  ? 77   TYR B CD1 1 
ATOM   4778 C CD2 . TYR B 1 77  ? 3.775   -14.200 -33.222 1.00 81.58  ? 77   TYR B CD2 1 
ATOM   4779 C CE1 . TYR B 1 77  ? 4.073   -16.398 -31.555 1.00 84.32  ? 77   TYR B CE1 1 
ATOM   4780 C CE2 . TYR B 1 77  ? 4.410   -14.058 -31.981 1.00 81.65  ? 77   TYR B CE2 1 
ATOM   4781 C CZ  . TYR B 1 77  ? 4.552   -15.162 -31.152 1.00 83.21  ? 77   TYR B CZ  1 
ATOM   4782 O OH  . TYR B 1 77  ? 5.182   -15.024 -29.927 1.00 83.02  ? 77   TYR B OH  1 
ATOM   4783 N N   . PRO B 1 78  ? 2.348   -17.806 -37.934 1.00 83.45  ? 78   PRO B N   1 
ATOM   4784 C CA  . PRO B 1 78  ? 1.520   -17.988 -39.141 1.00 83.25  ? 78   PRO B CA  1 
ATOM   4785 C C   . PRO B 1 78  ? 0.020   -17.792 -38.892 1.00 83.48  ? 78   PRO B C   1 
ATOM   4786 O O   . PRO B 1 78  ? -0.503  -18.291 -37.905 1.00 84.97  ? 78   PRO B O   1 
ATOM   4787 C CB  . PRO B 1 78  ? 1.811   -19.432 -39.550 1.00 85.43  ? 78   PRO B CB  1 
ATOM   4788 C CG  . PRO B 1 78  ? 3.175   -19.724 -38.977 1.00 85.87  ? 78   PRO B CG  1 
ATOM   4789 C CD  . PRO B 1 78  ? 3.283   -18.924 -37.712 1.00 84.97  ? 78   PRO B CD  1 
ATOM   4790 N N   . GLY B 1 79  ? -0.657  -17.047 -39.761 1.00 82.23  ? 79   GLY B N   1 
ATOM   4791 C CA  . GLY B 1 79  ? -2.113  -16.837 -39.644 1.00 82.79  ? 79   GLY B CA  1 
ATOM   4792 C C   . GLY B 1 79  ? -2.579  -15.747 -38.675 1.00 81.34  ? 79   GLY B C   1 
ATOM   4793 O O   . GLY B 1 79  ? -3.745  -15.342 -38.697 1.00 81.41  ? 79   GLY B O   1 
ATOM   4794 N N   . PHE B 1 80  ? -1.671  -15.263 -37.831 1.00 79.72  ? 80   PHE B N   1 
ATOM   4795 C CA  . PHE B 1 80  ? -2.012  -14.340 -36.759 1.00 78.62  ? 80   PHE B CA  1 
ATOM   4796 C C   . PHE B 1 80  ? -2.149  -12.929 -37.322 1.00 76.94  ? 80   PHE B C   1 
ATOM   4797 O O   . PHE B 1 80  ? -1.205  -12.410 -37.902 1.00 75.81  ? 80   PHE B O   1 
ATOM   4798 C CB  . PHE B 1 80  ? -0.917  -14.424 -35.685 1.00 77.89  ? 80   PHE B CB  1 
ATOM   4799 C CG  . PHE B 1 80  ? -1.053  -13.424 -34.582 1.00 76.11  ? 80   PHE B CG  1 
ATOM   4800 C CD1 . PHE B 1 80  ? -2.193  -13.379 -33.806 1.00 76.54  ? 80   PHE B CD1 1 
ATOM   4801 C CD2 . PHE B 1 80  ? -0.026  -12.540 -34.309 1.00 73.51  ? 80   PHE B CD2 1 
ATOM   4802 C CE1 . PHE B 1 80  ? -2.315  -12.448 -32.788 1.00 75.98  ? 80   PHE B CE1 1 
ATOM   4803 C CE2 . PHE B 1 80  ? -0.139  -11.615 -33.291 1.00 73.29  ? 80   PHE B CE2 1 
ATOM   4804 C CZ  . PHE B 1 80  ? -1.287  -11.565 -32.531 1.00 74.64  ? 80   PHE B CZ  1 
ATOM   4805 N N   . GLU B 1 81  ? -3.319  -12.311 -37.151 1.00 77.52  ? 81   GLU B N   1 
ATOM   4806 C CA  . GLU B 1 81  ? -3.575  -10.944 -37.658 1.00 75.81  ? 81   GLU B CA  1 
ATOM   4807 C C   . GLU B 1 81  ? -2.534  -9.918  -37.216 1.00 73.49  ? 81   GLU B C   1 
ATOM   4808 O O   . GLU B 1 81  ? -2.208  -9.005  -37.966 1.00 72.79  ? 81   GLU B O   1 
ATOM   4809 C CB  . GLU B 1 81  ? -4.976  -10.461 -37.238 1.00 76.98  ? 81   GLU B CB  1 
ATOM   4810 C CG  . GLU B 1 81  ? -5.398  -9.055  -37.744 1.00 77.22  ? 81   GLU B CG  1 
ATOM   4811 C CD  . GLU B 1 81  ? -5.635  -8.966  -39.277 1.00 81.97  ? 81   GLU B CD  1 
ATOM   4812 O OE1 . GLU B 1 81  ? -6.097  -9.962  -39.888 1.00 84.66  ? 81   GLU B OE1 1 
ATOM   4813 O OE2 . GLU B 1 81  ? -5.379  -7.879  -39.873 1.00 83.74  ? 81   GLU B OE2 1 
ATOM   4814 N N   . GLY B 1 82  ? -2.024  -10.052 -35.995 1.00 72.73  ? 82   GLY B N   1 
ATOM   4815 C CA  . GLY B 1 82  ? -1.102  -9.077  -35.435 1.00 69.96  ? 82   GLY B CA  1 
ATOM   4816 C C   . GLY B 1 82  ? 0.189   -8.952  -36.218 1.00 68.23  ? 82   GLY B C   1 
ATOM   4817 O O   . GLY B 1 82  ? 0.786   -7.860  -36.267 1.00 65.72  ? 82   GLY B O   1 
ATOM   4818 N N   . THR B 1 83  ? 0.625   -10.070 -36.807 1.00 68.08  ? 83   THR B N   1 
ATOM   4819 C CA  . THR B 1 83  ? 1.796   -10.087 -37.678 1.00 67.01  ? 83   THR B CA  1 
ATOM   4820 C C   . THR B 1 83  ? 1.411   -9.971  -39.156 1.00 66.60  ? 83   THR B C   1 
ATOM   4821 O O   . THR B 1 83  ? 2.067   -9.269  -39.924 1.00 64.74  ? 83   THR B O   1 
ATOM   4822 C CB  . THR B 1 83  ? 2.658   -11.368 -37.478 1.00 67.97  ? 83   THR B CB  1 
ATOM   4823 O OG1 . THR B 1 83  ? 1.841   -12.539 -37.587 1.00 69.21  ? 83   THR B OG1 1 
ATOM   4824 C CG2 . THR B 1 83  ? 3.367   -11.343 -36.130 1.00 67.21  ? 83   THR B CG2 1 
ATOM   4825 N N   . GLU B 1 84  ? 0.348   -10.664 -39.550 1.00 67.96  ? 84   GLU B N   1 
ATOM   4826 C CA  . GLU B 1 84  ? -0.029  -10.722 -40.955 1.00 68.26  ? 84   GLU B CA  1 
ATOM   4827 C C   . GLU B 1 84  ? -0.546  -9.393  -41.480 1.00 66.46  ? 84   GLU B C   1 
ATOM   4828 O O   . GLU B 1 84  ? -0.545  -9.196  -42.683 1.00 66.28  ? 84   GLU B O   1 
ATOM   4829 C CB  . GLU B 1 84  ? -1.085  -11.807 -41.216 1.00 70.39  ? 84   GLU B CB  1 
ATOM   4830 C CG  . GLU B 1 84  ? -0.672  -13.248 -40.868 1.00 74.57  ? 84   GLU B CG  1 
ATOM   4831 C CD  . GLU B 1 84  ? 0.400   -13.838 -41.776 1.00 77.76  ? 84   GLU B CD  1 
ATOM   4832 O OE1 . GLU B 1 84  ? 0.877   -13.122 -42.692 1.00 79.15  ? 84   GLU B OE1 1 
ATOM   4833 O OE2 . GLU B 1 84  ? 0.772   -15.024 -41.562 1.00 79.51  ? 84   GLU B OE2 1 
ATOM   4834 N N   . MET B 1 85  ? -0.973  -8.467  -40.614 1.00 65.65  ? 85   MET B N   1 
ATOM   4835 C CA  A MET B 1 85  ? -1.472  -7.174  -41.092 0.50 64.45  ? 85   MET B CA  1 
ATOM   4836 C CA  B MET B 1 85  ? -1.474  -7.168  -41.090 0.50 64.46  ? 85   MET B CA  1 
ATOM   4837 C C   . MET B 1 85  ? -0.336  -6.307  -41.655 1.00 62.36  ? 85   MET B C   1 
ATOM   4838 O O   . MET B 1 85  ? -0.587  -5.289  -42.309 1.00 61.48  ? 85   MET B O   1 
ATOM   4839 C CB  A MET B 1 85  ? -2.262  -6.426  -39.999 0.50 64.57  ? 85   MET B CB  1 
ATOM   4840 C CB  B MET B 1 85  ? -2.257  -6.407  -39.995 0.50 64.59  ? 85   MET B CB  1 
ATOM   4841 C CG  A MET B 1 85  ? -1.470  -5.909  -38.800 0.50 63.78  ? 85   MET B CG  1 
ATOM   4842 C CG  B MET B 1 85  ? -1.488  -5.334  -39.213 0.50 63.52  ? 85   MET B CG  1 
ATOM   4843 S SD  A MET B 1 85  ? -2.423  -4.708  -37.827 0.50 64.48  ? 85   MET B SD  1 
ATOM   4844 S SD  B MET B 1 85  ? -2.582  -4.286  -38.213 0.50 64.15  ? 85   MET B SD  1 
ATOM   4845 C CE  A MET B 1 85  ? -1.969  -3.165  -38.625 0.50 60.65  ? 85   MET B CE  1 
ATOM   4846 C CE  B MET B 1 85  ? -3.089  -5.476  -36.965 0.50 64.92  ? 85   MET B CE  1 
ATOM   4847 N N   . TRP B 1 86  ? 0.907   -6.718  -41.408 1.00 60.79  ? 86   TRP B N   1 
ATOM   4848 C CA  . TRP B 1 86  ? 2.082   -5.992  -41.889 1.00 58.33  ? 86   TRP B CA  1 
ATOM   4849 C C   . TRP B 1 86  ? 2.826   -6.701  -43.026 1.00 58.03  ? 86   TRP B C   1 
ATOM   4850 O O   . TRP B 1 86  ? 3.770   -6.142  -43.593 1.00 56.36  ? 86   TRP B O   1 
ATOM   4851 C CB  . TRP B 1 86  ? 3.059   -5.785  -40.743 1.00 57.28  ? 86   TRP B CB  1 
ATOM   4852 C CG  . TRP B 1 86  ? 2.459   -5.194  -39.539 1.00 56.27  ? 86   TRP B CG  1 
ATOM   4853 C CD1 . TRP B 1 86  ? 2.205   -5.828  -38.372 1.00 56.31  ? 86   TRP B CD1 1 
ATOM   4854 C CD2 . TRP B 1 86  ? 2.044   -3.837  -39.365 1.00 54.38  ? 86   TRP B CD2 1 
ATOM   4855 N NE1 . TRP B 1 86  ? 1.649   -4.955  -37.477 1.00 56.37  ? 86   TRP B NE1 1 
ATOM   4856 C CE2 . TRP B 1 86  ? 1.532   -3.724  -38.062 1.00 54.91  ? 86   TRP B CE2 1 
ATOM   4857 C CE3 . TRP B 1 86  ? 2.040   -2.710  -40.190 1.00 53.93  ? 86   TRP B CE3 1 
ATOM   4858 C CZ2 . TRP B 1 86  ? 1.043   -2.514  -37.545 1.00 54.40  ? 86   TRP B CZ2 1 
ATOM   4859 C CZ3 . TRP B 1 86  ? 1.534   -1.511  -39.682 1.00 53.64  ? 86   TRP B CZ3 1 
ATOM   4860 C CH2 . TRP B 1 86  ? 1.036   -1.433  -38.377 1.00 53.20  ? 86   TRP B CH2 1 
ATOM   4861 N N   . ASN B 1 87  ? 2.420   -7.936  -43.321 1.00 58.73  ? 87   ASN B N   1 
ATOM   4862 C CA  . ASN B 1 87  ? 3.030   -8.731  -44.373 1.00 59.16  ? 87   ASN B CA  1 
ATOM   4863 C C   . ASN B 1 87  ? 2.493   -8.303  -45.742 1.00 58.85  ? 87   ASN B C   1 
ATOM   4864 O O   . ASN B 1 87  ? 1.404   -7.708  -45.832 1.00 58.12  ? 87   ASN B O   1 
ATOM   4865 C CB  . ASN B 1 87  ? 2.756   -10.238 -44.172 1.00 60.83  ? 87   ASN B CB  1 
ATOM   4866 C CG  . ASN B 1 87  ? 3.781   -10.931 -43.267 1.00 61.94  ? 87   ASN B CG  1 
ATOM   4867 O OD1 . ASN B 1 87  ? 4.888   -10.431 -43.035 1.00 61.21  ? 87   ASN B OD1 1 
ATOM   4868 N ND2 . ASN B 1 87  ? 3.414   -12.111 -42.773 1.00 61.92  ? 87   ASN B ND2 1 
ATOM   4869 N N   . PRO B 1 88  ? 3.253   -8.611  -46.818 1.00 58.91  ? 88   PRO B N   1 
ATOM   4870 C CA  . PRO B 1 88  ? 2.829   -8.198  -48.153 1.00 58.79  ? 88   PRO B CA  1 
ATOM   4871 C C   . PRO B 1 88  ? 1.461   -8.763  -48.510 1.00 59.60  ? 88   PRO B C   1 
ATOM   4872 O O   . PRO B 1 88  ? 1.179   -9.929  -48.224 1.00 60.63  ? 88   PRO B O   1 
ATOM   4873 C CB  . PRO B 1 88  ? 3.920   -8.770  -49.067 1.00 59.38  ? 88   PRO B CB  1 
ATOM   4874 C CG  . PRO B 1 88  ? 5.105   -8.983  -48.183 1.00 58.71  ? 88   PRO B CG  1 
ATOM   4875 C CD  . PRO B 1 88  ? 4.532   -9.351  -46.856 1.00 59.32  ? 88   PRO B CD  1 
ATOM   4876 N N   . ASN B 1 89  ? 0.616   -7.921  -49.096 1.00 59.34  ? 89   ASN B N   1 
ATOM   4877 C CA  . ASN B 1 89  ? -0.702  -8.342  -49.539 1.00 60.63  ? 89   ASN B CA  1 
ATOM   4878 C C   . ASN B 1 89  ? -0.838  -8.378  -51.064 1.00 61.20  ? 89   ASN B C   1 
ATOM   4879 O O   . ASN B 1 89  ? -1.910  -8.677  -51.582 1.00 62.80  ? 89   ASN B O   1 
ATOM   4880 C CB  . ASN B 1 89  ? -1.790  -7.479  -48.893 1.00 60.44  ? 89   ASN B CB  1 
ATOM   4881 C CG  . ASN B 1 89  ? -1.710  -6.034  -49.292 1.00 59.23  ? 89   ASN B CG  1 
ATOM   4882 O OD1 . ASN B 1 89  ? -0.677  -5.561  -49.759 1.00 59.88  ? 89   ASN B OD1 1 
ATOM   4883 N ND2 . ASN B 1 89  ? -2.805  -5.313  -49.107 1.00 59.93  ? 89   ASN B ND2 1 
ATOM   4884 N N   . ARG B 1 90  ? 0.244   -8.079  -51.780 1.00 60.80  ? 90   ARG B N   1 
ATOM   4885 C CA  . ARG B 1 90  ? 0.334   -8.291  -53.226 1.00 61.16  ? 90   ARG B CA  1 
ATOM   4886 C C   . ARG B 1 90  ? 1.575   -9.117  -53.495 1.00 61.34  ? 90   ARG B C   1 
ATOM   4887 O O   . ARG B 1 90  ? 2.402   -9.285  -52.597 1.00 60.82  ? 90   ARG B O   1 
ATOM   4888 C CB  . ARG B 1 90  ? 0.403   -6.956  -53.972 1.00 60.47  ? 90   ARG B CB  1 
ATOM   4889 C CG  . ARG B 1 90  ? -0.890  -6.139  -53.944 1.00 61.62  ? 90   ARG B CG  1 
ATOM   4890 C CD  . ARG B 1 90  ? -2.044  -6.930  -54.556 1.00 65.91  ? 90   ARG B CD  1 
ATOM   4891 N NE  . ARG B 1 90  ? -3.333  -6.252  -54.509 1.00 67.36  ? 90   ARG B NE  1 
ATOM   4892 C CZ  . ARG B 1 90  ? -4.042  -6.052  -53.400 1.00 68.66  ? 90   ARG B CZ  1 
ATOM   4893 N NH1 . ARG B 1 90  ? -3.617  -6.477  -52.220 1.00 68.22  ? 90   ARG B NH1 1 
ATOM   4894 N NH2 . ARG B 1 90  ? -5.208  -5.423  -53.474 1.00 69.74  ? 90   ARG B NH2 1 
ATOM   4895 N N   . GLU B 1 91  ? 1.695   -9.656  -54.712 1.00 61.83  ? 91   GLU B N   1 
ATOM   4896 C CA  . GLU B 1 91  ? 2.850   -10.483 -55.070 1.00 62.32  ? 91   GLU B CA  1 
ATOM   4897 C C   . GLU B 1 91  ? 4.143   -9.704  -54.916 1.00 59.82  ? 91   GLU B C   1 
ATOM   4898 O O   . GLU B 1 91  ? 4.172   -8.506  -55.153 1.00 58.64  ? 91   GLU B O   1 
ATOM   4899 C CB  . GLU B 1 91  ? 2.752   -10.999 -56.503 1.00 63.76  ? 91   GLU B CB  1 
ATOM   4900 C CG  . GLU B 1 91  ? 1.708   -12.076 -56.706 1.00 68.67  ? 91   GLU B CG  1 
ATOM   4901 C CD  . GLU B 1 91  ? 2.073   -13.410 -56.054 1.00 73.20  ? 91   GLU B CD  1 
ATOM   4902 O OE1 . GLU B 1 91  ? 3.285   -13.736 -55.958 1.00 73.80  ? 91   GLU B OE1 1 
ATOM   4903 O OE2 . GLU B 1 91  ? 1.131   -14.139 -55.655 1.00 77.45  ? 91   GLU B OE2 1 
ATOM   4904 N N   . LEU B 1 92  ? 5.200   -10.405 -54.510 1.00 58.80  ? 92   LEU B N   1 
ATOM   4905 C CA  . LEU B 1 92  ? 6.518   -9.809  -54.354 1.00 57.19  ? 92   LEU B CA  1 
ATOM   4906 C C   . LEU B 1 92  ? 7.229   -9.662  -55.706 1.00 57.09  ? 92   LEU B C   1 
ATOM   4907 O O   . LEU B 1 92  ? 7.153   -10.546 -56.555 1.00 57.92  ? 92   LEU B O   1 
ATOM   4908 C CB  . LEU B 1 92  ? 7.376   -10.660 -53.423 1.00 57.38  ? 92   LEU B CB  1 
ATOM   4909 C CG  . LEU B 1 92  ? 7.087   -10.718 -51.930 1.00 56.01  ? 92   LEU B CG  1 
ATOM   4910 C CD1 . LEU B 1 92  ? 8.068   -11.702 -51.281 1.00 54.46  ? 92   LEU B CD1 1 
ATOM   4911 C CD2 . LEU B 1 92  ? 7.231   -9.342  -51.293 1.00 54.20  ? 92   LEU B CD2 1 
ATOM   4912 N N   . SER B 1 93  ? 7.937   -8.555  -55.902 1.00 55.40  ? 93   SER B N   1 
ATOM   4913 C CA  . SER B 1 93  ? 8.711   -8.380  -57.124 1.00 55.70  ? 93   SER B CA  1 
ATOM   4914 C C   . SER B 1 93  ? 9.740   -7.282  -56.952 1.00 54.83  ? 93   SER B C   1 
ATOM   4915 O O   . SER B 1 93  ? 9.507   -6.346  -56.201 1.00 54.53  ? 93   SER B O   1 
ATOM   4916 C CB  . SER B 1 93  ? 7.794   -8.033  -58.295 1.00 55.70  ? 93   SER B CB  1 
ATOM   4917 O OG  . SER B 1 93  ? 8.522   -7.898  -59.503 1.00 55.72  ? 93   SER B OG  1 
ATOM   4918 N N   . GLU B 1 94  ? 10.868  -7.394  -57.655 1.00 55.28  ? 94   GLU B N   1 
ATOM   4919 C CA  . GLU B 1 94  ? 11.816  -6.277  -57.761 1.00 54.84  ? 94   GLU B CA  1 
ATOM   4920 C C   . GLU B 1 94  ? 11.263  -5.168  -58.645 1.00 54.07  ? 94   GLU B C   1 
ATOM   4921 O O   . GLU B 1 94  ? 11.697  -4.015  -58.560 1.00 54.01  ? 94   GLU B O   1 
ATOM   4922 C CB  . GLU B 1 94  ? 13.159  -6.740  -58.301 1.00 55.54  ? 94   GLU B CB  1 
ATOM   4923 C CG  . GLU B 1 94  ? 13.929  -7.578  -57.318 1.00 56.63  ? 94   GLU B CG  1 
ATOM   4924 C CD  . GLU B 1 94  ? 15.337  -7.845  -57.780 1.00 57.34  ? 94   GLU B CD  1 
ATOM   4925 O OE1 . GLU B 1 94  ? 16.154  -6.903  -57.773 1.00 56.88  ? 94   GLU B OE1 1 
ATOM   4926 O OE2 . GLU B 1 94  ? 15.616  -9.001  -58.145 1.00 58.89  ? 94   GLU B OE2 1 
ATOM   4927 N N   . ASP B 1 95  ? 10.297  -5.521  -59.486 1.00 54.43  ? 95   ASP B N   1 
ATOM   4928 C CA  . ASP B 1 95  ? 9.559   -4.536  -60.251 1.00 53.67  ? 95   ASP B CA  1 
ATOM   4929 C C   . ASP B 1 95  ? 8.435   -4.002  -59.380 1.00 52.97  ? 95   ASP B C   1 
ATOM   4930 O O   . ASP B 1 95  ? 7.305   -4.490  -59.417 1.00 53.18  ? 95   ASP B O   1 
ATOM   4931 C CB  . ASP B 1 95  ? 9.019   -5.167  -61.529 1.00 54.82  ? 95   ASP B CB  1 
ATOM   4932 C CG  . ASP B 1 95  ? 8.275   -4.197  -62.394 1.00 54.01  ? 95   ASP B CG  1 
ATOM   4933 O OD1 . ASP B 1 95  ? 8.055   -3.033  -62.008 1.00 55.33  ? 95   ASP B OD1 1 
ATOM   4934 O OD2 . ASP B 1 95  ? 7.897   -4.615  -63.480 1.00 56.31  ? 95   ASP B OD2 1 
ATOM   4935 N N   . CYS B 1 96  ? 8.749   -2.983  -58.593 1.00 51.49  ? 96   CYS B N   1 
ATOM   4936 C CA  . CYS B 1 96  ? 7.839   -2.549  -57.552 1.00 50.70  ? 96   CYS B CA  1 
ATOM   4937 C C   . CYS B 1 96  ? 7.747   -1.024  -57.373 1.00 49.09  ? 96   CYS B C   1 
ATOM   4938 O O   . CYS B 1 96  ? 7.137   -0.551  -56.437 1.00 48.96  ? 96   CYS B O   1 
ATOM   4939 C CB  . CYS B 1 96  ? 8.314   -3.187  -56.249 1.00 50.53  ? 96   CYS B CB  1 
ATOM   4940 S SG  . CYS B 1 96  ? 9.924   -2.544  -55.679 1.00 51.96  ? 96   CYS B SG  1 
ATOM   4941 N N   . LEU B 1 97  ? 8.316   -0.257  -58.282 1.00 48.66  ? 97   LEU B N   1 
ATOM   4942 C CA  . LEU B 1 97  ? 8.406   1.183   -58.094 1.00 47.43  ? 97   LEU B CA  1 
ATOM   4943 C C   . LEU B 1 97  ? 7.191   1.890   -58.702 1.00 47.78  ? 97   LEU B C   1 
ATOM   4944 O O   . LEU B 1 97  ? 7.221   2.434   -59.817 1.00 47.96  ? 97   LEU B O   1 
ATOM   4945 C CB  . LEU B 1 97  ? 9.729   1.689   -58.656 1.00 47.13  ? 97   LEU B CB  1 
ATOM   4946 C CG  . LEU B 1 97  ? 10.970  1.216   -57.878 1.00 45.86  ? 97   LEU B CG  1 
ATOM   4947 C CD1 . LEU B 1 97  ? 12.167  2.038   -58.323 1.00 43.41  ? 97   LEU B CD1 1 
ATOM   4948 C CD2 . LEU B 1 97  ? 10.807  1.285   -56.338 1.00 45.05  ? 97   LEU B CD2 1 
ATOM   4949 N N   . TYR B 1 98  ? 6.117   1.857   -57.918 1.00 48.16  ? 98   TYR B N   1 
ATOM   4950 C CA  . TYR B 1 98  ? 4.830   2.445   -58.269 1.00 47.91  ? 98   TYR B CA  1 
ATOM   4951 C C   . TYR B 1 98  ? 4.305   3.228   -57.079 1.00 47.95  ? 98   TYR B C   1 
ATOM   4952 O O   . TYR B 1 98  ? 4.673   2.950   -55.934 1.00 47.09  ? 98   TYR B O   1 
ATOM   4953 C CB  . TYR B 1 98  ? 3.838   1.342   -58.647 1.00 48.57  ? 98   TYR B CB  1 
ATOM   4954 C CG  . TYR B 1 98  ? 4.343   0.447   -59.780 1.00 48.72  ? 98   TYR B CG  1 
ATOM   4955 C CD1 . TYR B 1 98  ? 4.013   0.707   -61.102 1.00 48.61  ? 98   TYR B CD1 1 
ATOM   4956 C CD2 . TYR B 1 98  ? 5.160   -0.636  -59.522 1.00 49.67  ? 98   TYR B CD2 1 
ATOM   4957 C CE1 . TYR B 1 98  ? 4.478   -0.087  -62.127 1.00 50.65  ? 98   TYR B CE1 1 
ATOM   4958 C CE2 . TYR B 1 98  ? 5.645   -1.443  -60.557 1.00 50.11  ? 98   TYR B CE2 1 
ATOM   4959 C CZ  . TYR B 1 98  ? 5.293   -1.157  -61.857 1.00 49.86  ? 98   TYR B CZ  1 
ATOM   4960 O OH  . TYR B 1 98  ? 5.747   -1.928  -62.906 1.00 52.21  ? 98   TYR B OH  1 
ATOM   4961 N N   . LEU B 1 99  ? 3.429   4.195   -57.356 1.00 48.43  ? 99   LEU B N   1 
ATOM   4962 C CA  . LEU B 1 99  ? 2.775   4.974   -56.326 1.00 48.39  ? 99   LEU B CA  1 
ATOM   4963 C C   . LEU B 1 99  ? 1.264   5.047   -56.497 1.00 49.68  ? 99   LEU B C   1 
ATOM   4964 O O   . LEU B 1 99  ? 0.728   4.738   -57.562 1.00 50.95  ? 99   LEU B O   1 
ATOM   4965 C CB  . LEU B 1 99  ? 3.369   6.387   -56.256 1.00 48.41  ? 99   LEU B CB  1 
ATOM   4966 C CG  . LEU B 1 99  ? 3.414   7.295   -57.484 1.00 48.95  ? 99   LEU B CG  1 
ATOM   4967 C CD1 . LEU B 1 99  ? 2.103   7.997   -57.701 1.00 47.90  ? 99   LEU B CD1 1 
ATOM   4968 C CD2 . LEU B 1 99  ? 4.553   8.342   -57.304 1.00 47.93  ? 99   LEU B CD2 1 
ATOM   4969 N N   . ASN B 1 100 ? 0.594   5.457   -55.418 1.00 49.39  ? 100  ASN B N   1 
ATOM   4970 C CA  . ASN B 1 100 ? -0.864  5.498   -55.333 1.00 49.85  ? 100  ASN B CA  1 
ATOM   4971 C C   . ASN B 1 100 ? -1.345  6.878   -54.934 1.00 49.59  ? 100  ASN B C   1 
ATOM   4972 O O   . ASN B 1 100 ? -0.745  7.506   -54.093 1.00 48.79  ? 100  ASN B O   1 
ATOM   4973 C CB  . ASN B 1 100 ? -1.336  4.511   -54.288 1.00 49.63  ? 100  ASN B CB  1 
ATOM   4974 C CG  . ASN B 1 100 ? -0.637  3.181   -54.407 1.00 48.93  ? 100  ASN B CG  1 
ATOM   4975 O OD1 . ASN B 1 100 ? -0.679  2.553   -55.449 1.00 50.27  ? 100  ASN B OD1 1 
ATOM   4976 N ND2 . ASN B 1 100 ? 0.016   2.753   -53.344 1.00 48.47  ? 100  ASN B ND2 1 
ATOM   4977 N N   . VAL B 1 101 ? -2.440  7.326   -55.534 1.00 51.17  ? 101  VAL B N   1 
ATOM   4978 C CA  . VAL B 1 101 ? -3.028  8.627   -55.240 1.00 51.49  ? 101  VAL B CA  1 
ATOM   4979 C C   . VAL B 1 101 ? -4.518  8.472   -54.984 1.00 53.17  ? 101  VAL B C   1 
ATOM   4980 O O   . VAL B 1 101 ? -5.230  7.899   -55.801 1.00 54.05  ? 101  VAL B O   1 
ATOM   4981 C CB  . VAL B 1 101 ? -2.851  9.595   -56.407 1.00 51.92  ? 101  VAL B CB  1 
ATOM   4982 C CG1 . VAL B 1 101 ? -3.493  10.926  -56.086 1.00 52.03  ? 101  VAL B CG1 1 
ATOM   4983 C CG2 . VAL B 1 101 ? -1.381  9.749   -56.765 1.00 50.97  ? 101  VAL B CG2 1 
ATOM   4984 N N   . TRP B 1 102 ? -4.974  8.951   -53.832 1.00 54.10  ? 102  TRP B N   1 
ATOM   4985 C CA  . TRP B 1 102 ? -6.397  9.151   -53.576 1.00 55.58  ? 102  TRP B CA  1 
ATOM   4986 C C   . TRP B 1 102 ? -6.733  10.631  -53.581 1.00 57.15  ? 102  TRP B C   1 
ATOM   4987 O O   . TRP B 1 102 ? -6.006  11.451  -53.026 1.00 56.65  ? 102  TRP B O   1 
ATOM   4988 C CB  . TRP B 1 102 ? -6.816  8.601   -52.233 1.00 54.97  ? 102  TRP B CB  1 
ATOM   4989 C CG  . TRP B 1 102 ? -6.686  7.161   -52.075 1.00 54.08  ? 102  TRP B CG  1 
ATOM   4990 C CD1 . TRP B 1 102 ? -7.669  6.237   -52.171 1.00 55.70  ? 102  TRP B CD1 1 
ATOM   4991 C CD2 . TRP B 1 102 ? -5.503  6.464   -51.730 1.00 52.62  ? 102  TRP B CD2 1 
ATOM   4992 N NE1 . TRP B 1 102 ? -7.167  4.983   -51.915 1.00 55.64  ? 102  TRP B NE1 1 
ATOM   4993 C CE2 . TRP B 1 102 ? -5.831  5.101   -51.639 1.00 52.39  ? 102  TRP B CE2 1 
ATOM   4994 C CE3 . TRP B 1 102 ? -4.191  6.862   -51.471 1.00 52.17  ? 102  TRP B CE3 1 
ATOM   4995 C CZ2 . TRP B 1 102 ? -4.906  4.139   -51.300 1.00 52.41  ? 102  TRP B CZ2 1 
ATOM   4996 C CZ3 . TRP B 1 102 ? -3.264  5.898   -51.147 1.00 51.64  ? 102  TRP B CZ3 1 
ATOM   4997 C CH2 . TRP B 1 102 ? -3.629  4.550   -51.066 1.00 51.83  ? 102  TRP B CH2 1 
ATOM   4998 N N   . THR B 1 103 ? -7.877  10.937  -54.169 1.00 59.87  ? 103  THR B N   1 
ATOM   4999 C CA  . THR B 1 103 ? -8.351  12.287  -54.336 1.00 61.93  ? 103  THR B CA  1 
ATOM   5000 C C   . THR B 1 103 ? -9.863  12.241  -54.039 1.00 63.94  ? 103  THR B C   1 
ATOM   5001 O O   . THR B 1 103 ? -10.475 11.176  -54.161 1.00 64.31  ? 103  THR B O   1 
ATOM   5002 C CB  . THR B 1 103 ? -8.069  12.741  -55.793 1.00 62.47  ? 103  THR B CB  1 
ATOM   5003 O OG1 . THR B 1 103 ? -7.887  14.151  -55.851 1.00 64.86  ? 103  THR B OG1 1 
ATOM   5004 C CG2 . THR B 1 103 ? -9.209  12.379  -56.709 1.00 64.29  ? 103  THR B CG2 1 
ATOM   5005 N N   . PRO B 1 104 ? -10.459 13.367  -53.589 1.00 65.45  ? 104  PRO B N   1 
ATOM   5006 C CA  . PRO B 1 104 ? -11.913 13.489  -53.524 1.00 67.52  ? 104  PRO B CA  1 
ATOM   5007 C C   . PRO B 1 104 ? -12.591 13.298  -54.872 1.00 69.56  ? 104  PRO B C   1 
ATOM   5008 O O   . PRO B 1 104 ? -11.992 13.563  -55.898 1.00 69.49  ? 104  PRO B O   1 
ATOM   5009 C CB  . PRO B 1 104 ? -12.127 14.933  -53.044 1.00 68.17  ? 104  PRO B CB  1 
ATOM   5010 C CG  . PRO B 1 104 ? -10.903 15.266  -52.322 1.00 66.26  ? 104  PRO B CG  1 
ATOM   5011 C CD  . PRO B 1 104 ? -9.798  14.562  -53.038 1.00 65.20  ? 104  PRO B CD  1 
ATOM   5012 N N   . TYR B 1 105 ? -13.838 12.838  -54.836 1.00 72.13  ? 105  TYR B N   1 
ATOM   5013 C CA  . TYR B 1 105 ? -14.693 12.711  -56.006 1.00 74.36  ? 105  TYR B CA  1 
ATOM   5014 C C   . TYR B 1 105 ? -15.899 13.612  -55.769 1.00 77.37  ? 105  TYR B C   1 
ATOM   5015 O O   . TYR B 1 105 ? -16.614 13.424  -54.781 1.00 78.14  ? 105  TYR B O   1 
ATOM   5016 C CB  . TYR B 1 105 ? -15.147 11.263  -56.143 1.00 74.65  ? 105  TYR B CB  1 
ATOM   5017 C CG  . TYR B 1 105 ? -15.930 10.959  -57.400 1.00 76.18  ? 105  TYR B CG  1 
ATOM   5018 C CD1 . TYR B 1 105 ? -15.338 10.288  -58.466 1.00 75.74  ? 105  TYR B CD1 1 
ATOM   5019 C CD2 . TYR B 1 105 ? -17.270 11.336  -57.524 1.00 78.46  ? 105  TYR B CD2 1 
ATOM   5020 C CE1 . TYR B 1 105 ? -16.054 9.997   -59.628 1.00 77.17  ? 105  TYR B CE1 1 
ATOM   5021 C CE2 . TYR B 1 105 ? -17.996 11.051  -58.677 1.00 79.83  ? 105  TYR B CE2 1 
ATOM   5022 C CZ  . TYR B 1 105 ? -17.384 10.377  -59.724 1.00 79.59  ? 105  TYR B CZ  1 
ATOM   5023 O OH  . TYR B 1 105 ? -18.099 10.088  -60.869 1.00 81.55  ? 105  TYR B OH  1 
ATOM   5024 N N   . PRO B 1 106 ? -16.125 14.616  -56.640 1.00 79.71  ? 106  PRO B N   1 
ATOM   5025 C CA  . PRO B 1 106 ? -15.328 15.001  -57.797 1.00 80.18  ? 106  PRO B CA  1 
ATOM   5026 C C   . PRO B 1 106 ? -14.009 15.616  -57.355 1.00 79.52  ? 106  PRO B C   1 
ATOM   5027 O O   . PRO B 1 106 ? -13.859 15.990  -56.189 1.00 79.26  ? 106  PRO B O   1 
ATOM   5028 C CB  . PRO B 1 106 ? -16.204 16.044  -58.493 1.00 82.18  ? 106  PRO B CB  1 
ATOM   5029 C CG  . PRO B 1 106 ? -16.980 16.641  -57.404 1.00 82.83  ? 106  PRO B CG  1 
ATOM   5030 C CD  . PRO B 1 106 ? -17.276 15.517  -56.465 1.00 81.86  ? 106  PRO B CD  1 
ATOM   5031 N N   . ARG B 1 107 ? -13.059 15.716  -58.279 1.00 79.76  ? 107  ARG B N   1 
ATOM   5032 C CA  A ARG B 1 107 ? -11.747 16.200  -57.889 0.50 78.67  ? 107  ARG B CA  1 
ATOM   5033 C CA  B ARG B 1 107 ? -11.726 16.265  -58.016 0.50 78.63  ? 107  ARG B CA  1 
ATOM   5034 C C   . ARG B 1 107 ? -11.831 17.619  -57.332 1.00 79.30  ? 107  ARG B C   1 
ATOM   5035 O O   . ARG B 1 107 ? -12.750 18.378  -57.641 1.00 81.49  ? 107  ARG B O   1 
ATOM   5036 C CB  A ARG B 1 107 ? -10.694 16.037  -58.998 0.50 78.01  ? 107  ARG B CB  1 
ATOM   5037 C CB  B ARG B 1 107 ? -10.972 16.441  -59.342 0.50 78.62  ? 107  ARG B CB  1 
ATOM   5038 C CG  A ARG B 1 107 ? -10.796 16.936  -60.226 0.50 79.70  ? 107  ARG B CG  1 
ATOM   5039 C CG  B ARG B 1 107 ? -9.518  16.072  -59.265 0.50 76.93  ? 107  ARG B CG  1 
ATOM   5040 C CD  A ARG B 1 107 ? -9.551  16.733  -61.102 0.50 79.05  ? 107  ARG B CD  1 
ATOM   5041 C CD  B ARG B 1 107 ? -8.783  16.359  -60.563 0.50 77.34  ? 107  ARG B CD  1 
ATOM   5042 N NE  A ARG B 1 107 ? -9.347  15.314  -61.438 0.50 79.16  ? 107  ARG B NE  1 
ATOM   5043 N NE  B ARG B 1 107 ? -9.286  15.631  -61.729 0.50 79.14  ? 107  ARG B NE  1 
ATOM   5044 C CZ  A ARG B 1 107 ? -9.201  14.809  -62.668 0.50 79.40  ? 107  ARG B CZ  1 
ATOM   5045 C CZ  B ARG B 1 107 ? -9.252  14.307  -61.893 0.50 78.50  ? 107  ARG B CZ  1 
ATOM   5046 N NH1 A ARG B 1 107 ? -9.046  13.498  -62.813 0.50 78.99  ? 107  ARG B NH1 1 
ATOM   5047 N NH1 B ARG B 1 107 ? -9.730  13.783  -63.020 0.50 79.42  ? 107  ARG B NH1 1 
ATOM   5048 N NH2 A ARG B 1 107 ? -9.180  15.580  -63.751 0.50 80.51  ? 107  ARG B NH2 1 
ATOM   5049 N NH2 B ARG B 1 107 ? -8.765  13.500  -60.948 0.50 77.13  ? 107  ARG B NH2 1 
ATOM   5050 N N   . PRO B 1 108 ? -10.898 17.950  -56.432 1.00 78.25  ? 108  PRO B N   1 
ATOM   5051 C CA  . PRO B 1 108 ? -10.986 19.255  -55.798 1.00 79.12  ? 108  PRO B CA  1 
ATOM   5052 C C   . PRO B 1 108 ? -11.105 20.417  -56.784 1.00 80.89  ? 108  PRO B C   1 
ATOM   5053 O O   . PRO B 1 108 ? -10.389 20.458  -57.794 1.00 80.78  ? 108  PRO B O   1 
ATOM   5054 C CB  . PRO B 1 108 ? -9.673  19.346  -55.023 1.00 77.41  ? 108  PRO B CB  1 
ATOM   5055 C CG  . PRO B 1 108 ? -9.332  17.956  -54.720 1.00 75.76  ? 108  PRO B CG  1 
ATOM   5056 C CD  . PRO B 1 108 ? -9.755  17.176  -55.913 1.00 76.29  ? 108  PRO B CD  1 
ATOM   5057 N N   . ALA B 1 109 ? -12.023 21.336  -56.474 1.00 82.60  ? 109  ALA B N   1 
ATOM   5058 C CA  . ALA B 1 109 ? -12.228 22.556  -57.252 1.00 84.35  ? 109  ALA B CA  1 
ATOM   5059 C C   . ALA B 1 109 ? -10.954 23.403  -57.262 1.00 83.58  ? 109  ALA B C   1 
ATOM   5060 O O   . ALA B 1 109 ? -10.412 23.713  -58.328 1.00 83.96  ? 109  ALA B O   1 
ATOM   5061 C CB  . ALA B 1 109 ? -13.394 23.367  -56.661 1.00 86.16  ? 109  ALA B CB  1 
ATOM   5062 N N   . SER B 1 110 ? -10.485 23.763  -56.066 1.00 82.43  ? 110  SER B N   1 
ATOM   5063 C CA  . SER B 1 110 ? -9.244  24.515  -55.905 1.00 81.26  ? 110  SER B CA  1 
ATOM   5064 C C   . SER B 1 110 ? -8.134  23.606  -55.373 1.00 78.52  ? 110  SER B C   1 
ATOM   5065 O O   . SER B 1 110 ? -8.425  22.556  -54.803 1.00 77.80  ? 110  SER B O   1 
ATOM   5066 C CB  . SER B 1 110 ? -9.475  25.683  -54.956 1.00 82.58  ? 110  SER B CB  1 
ATOM   5067 O OG  . SER B 1 110 ? -9.995  25.218  -53.729 1.00 83.48  ? 110  SER B OG  1 
ATOM   5068 N N   . PRO B 1 111 ? -6.857  23.996  -55.569 1.00 76.95  ? 111  PRO B N   1 
ATOM   5069 C CA  . PRO B 1 111 ? -5.712  23.183  -55.131 1.00 74.62  ? 111  PRO B CA  1 
ATOM   5070 C C   . PRO B 1 111 ? -5.710  22.785  -53.643 1.00 72.54  ? 111  PRO B C   1 
ATOM   5071 O O   . PRO B 1 111 ? -5.904  23.630  -52.774 1.00 73.11  ? 111  PRO B O   1 
ATOM   5072 C CB  . PRO B 1 111 ? -4.511  24.080  -55.449 1.00 74.68  ? 111  PRO B CB  1 
ATOM   5073 C CG  . PRO B 1 111 ? -4.973  24.948  -56.546 1.00 76.22  ? 111  PRO B CG  1 
ATOM   5074 C CD  . PRO B 1 111 ? -6.406  25.223  -56.249 1.00 78.07  ? 111  PRO B CD  1 
ATOM   5075 N N   . THR B 1 112 ? -5.467  21.504  -53.375 1.00 70.08  ? 112  THR B N   1 
ATOM   5076 C CA  . THR B 1 112 ? -5.603  20.930  -52.041 1.00 68.66  ? 112  THR B CA  1 
ATOM   5077 C C   . THR B 1 112 ? -4.256  20.522  -51.452 1.00 66.32  ? 112  THR B C   1 
ATOM   5078 O O   . THR B 1 112 ? -3.381  20.063  -52.169 1.00 65.67  ? 112  THR B O   1 
ATOM   5079 C CB  . THR B 1 112 ? -6.477  19.669  -52.077 1.00 68.46  ? 112  THR B CB  1 
ATOM   5080 O OG1 . THR B 1 112 ? -7.698  19.966  -52.747 1.00 71.19  ? 112  THR B OG1 1 
ATOM   5081 C CG2 . THR B 1 112 ? -6.804  19.197  -50.674 1.00 68.42  ? 112  THR B CG2 1 
ATOM   5082 N N   . PRO B 1 113 ? -4.080  20.686  -50.136 1.00 64.67  ? 113  PRO B N   1 
ATOM   5083 C CA  . PRO B 1 113 ? -2.877  20.123  -49.530 1.00 62.31  ? 113  PRO B CA  1 
ATOM   5084 C C   . PRO B 1 113 ? -2.689  18.635  -49.788 1.00 59.72  ? 113  PRO B C   1 
ATOM   5085 O O   . PRO B 1 113 ? -3.666  17.884  -49.798 1.00 59.66  ? 113  PRO B O   1 
ATOM   5086 C CB  . PRO B 1 113 ? -3.081  20.421  -48.046 1.00 62.32  ? 113  PRO B CB  1 
ATOM   5087 C CG  . PRO B 1 113 ? -3.864  21.719  -48.076 1.00 64.82  ? 113  PRO B CG  1 
ATOM   5088 C CD  . PRO B 1 113 ? -4.870  21.448  -49.155 1.00 65.90  ? 113  PRO B CD  1 
ATOM   5089 N N   . VAL B 1 114 ? -1.424  18.253  -50.001 1.00 57.28  ? 114  VAL B N   1 
ATOM   5090 C CA  . VAL B 1 114 ? -1.010  16.890  -50.308 1.00 54.94  ? 114  VAL B CA  1 
ATOM   5091 C C   . VAL B 1 114 ? -0.289  16.290  -49.108 1.00 53.42  ? 114  VAL B C   1 
ATOM   5092 O O   . VAL B 1 114 ? 0.585   16.908  -48.522 1.00 52.47  ? 114  VAL B O   1 
ATOM   5093 C CB  . VAL B 1 114 ? -0.049  16.835  -51.538 1.00 54.67  ? 114  VAL B CB  1 
ATOM   5094 C CG1 . VAL B 1 114 ? 0.358   15.410  -51.853 1.00 51.84  ? 114  VAL B CG1 1 
ATOM   5095 C CG2 . VAL B 1 114 ? -0.702  17.453  -52.766 1.00 55.04  ? 114  VAL B CG2 1 
ATOM   5096 N N   . LEU B 1 115 ? -0.669  15.078  -48.745 1.00 52.69  ? 115  LEU B N   1 
ATOM   5097 C CA  . LEU B 1 115 ? 0.025   14.308  -47.732 1.00 51.66  ? 115  LEU B CA  1 
ATOM   5098 C C   . LEU B 1 115 ? 0.658   13.130  -48.440 1.00 50.93  ? 115  LEU B C   1 
ATOM   5099 O O   . LEU B 1 115 ? -0.034  12.416  -49.170 1.00 52.09  ? 115  LEU B O   1 
ATOM   5100 C CB  . LEU B 1 115 ? -0.960  13.804  -46.669 1.00 52.47  ? 115  LEU B CB  1 
ATOM   5101 C CG  . LEU B 1 115 ? -1.421  14.721  -45.525 1.00 52.80  ? 115  LEU B CG  1 
ATOM   5102 C CD1 . LEU B 1 115 ? -2.655  14.191  -44.858 1.00 54.08  ? 115  LEU B CD1 1 
ATOM   5103 C CD2 . LEU B 1 115 ? -0.312  14.846  -44.504 1.00 53.53  ? 115  LEU B CD2 1 
ATOM   5104 N N   . ILE B 1 116 ? 1.962   12.926  -48.228 1.00 49.54  ? 116  ILE B N   1 
ATOM   5105 C CA  . ILE B 1 116 ? 2.690   11.807  -48.811 1.00 48.38  ? 116  ILE B CA  1 
ATOM   5106 C C   . ILE B 1 116 ? 3.154   10.892  -47.682 1.00 47.48  ? 116  ILE B C   1 
ATOM   5107 O O   . ILE B 1 116 ? 3.983   11.281  -46.844 1.00 47.33  ? 116  ILE B O   1 
ATOM   5108 C CB  . ILE B 1 116 ? 3.931   12.259  -49.645 1.00 48.71  ? 116  ILE B CB  1 
ATOM   5109 C CG1 . ILE B 1 116 ? 3.545   13.345  -50.657 1.00 49.40  ? 116  ILE B CG1 1 
ATOM   5110 C CG2 . ILE B 1 116 ? 4.583   11.054  -50.362 1.00 47.84  ? 116  ILE B CG2 1 
ATOM   5111 C CD1 . ILE B 1 116 ? 4.674   13.798  -51.601 1.00 48.63  ? 116  ILE B CD1 1 
ATOM   5112 N N   . TRP B 1 117 ? 2.600   9.683   -47.675 1.00 46.73  ? 117  TRP B N   1 
ATOM   5113 C CA  . TRP B 1 117 ? 2.904   8.657   -46.703 1.00 46.04  ? 117  TRP B CA  1 
ATOM   5114 C C   . TRP B 1 117 ? 4.114   7.844   -47.128 1.00 45.89  ? 117  TRP B C   1 
ATOM   5115 O O   . TRP B 1 117 ? 4.126   7.301   -48.242 1.00 45.93  ? 117  TRP B O   1 
ATOM   5116 C CB  . TRP B 1 117 ? 1.713   7.703   -46.588 1.00 46.48  ? 117  TRP B CB  1 
ATOM   5117 C CG  . TRP B 1 117 ? 1.970   6.548   -45.685 1.00 45.84  ? 117  TRP B CG  1 
ATOM   5118 C CD1 . TRP B 1 117 ? 2.119   5.264   -46.043 1.00 45.73  ? 117  TRP B CD1 1 
ATOM   5119 C CD2 . TRP B 1 117 ? 2.113   6.599   -44.271 1.00 45.24  ? 117  TRP B CD2 1 
ATOM   5120 N NE1 . TRP B 1 117 ? 2.360   4.488   -44.933 1.00 46.19  ? 117  TRP B NE1 1 
ATOM   5121 C CE2 . TRP B 1 117 ? 2.340   5.290   -43.828 1.00 45.40  ? 117  TRP B CE2 1 
ATOM   5122 C CE3 . TRP B 1 117 ? 2.068   7.633   -43.330 1.00 45.48  ? 117  TRP B CE3 1 
ATOM   5123 C CZ2 . TRP B 1 117 ? 2.523   4.981   -42.484 1.00 45.44  ? 117  TRP B CZ2 1 
ATOM   5124 C CZ3 . TRP B 1 117 ? 2.239   7.333   -42.010 1.00 44.72  ? 117  TRP B CZ3 1 
ATOM   5125 C CH2 . TRP B 1 117 ? 2.472   6.016   -41.592 1.00 45.76  ? 117  TRP B CH2 1 
ATOM   5126 N N   . ILE B 1 118 ? 5.114   7.749   -46.238 1.00 45.88  ? 118  ILE B N   1 
ATOM   5127 C CA  . ILE B 1 118 ? 6.261   6.825   -46.405 1.00 44.71  ? 118  ILE B CA  1 
ATOM   5128 C C   . ILE B 1 118 ? 6.205   5.686   -45.367 1.00 45.40  ? 118  ILE B C   1 
ATOM   5129 O O   . ILE B 1 118 ? 6.394   5.898   -44.192 1.00 45.39  ? 118  ILE B O   1 
ATOM   5130 C CB  . ILE B 1 118 ? 7.603   7.558   -46.230 1.00 44.27  ? 118  ILE B CB  1 
ATOM   5131 C CG1 . ILE B 1 118 ? 7.639   8.833   -47.053 1.00 43.21  ? 118  ILE B CG1 1 
ATOM   5132 C CG2 . ILE B 1 118 ? 8.754   6.671   -46.626 1.00 41.73  ? 118  ILE B CG2 1 
ATOM   5133 C CD1 . ILE B 1 118 ? 8.941   9.609   -46.925 1.00 43.00  ? 118  ILE B CD1 1 
ATOM   5134 N N   . TYR B 1 119 ? 5.962   4.463   -45.795 1.00 46.97  ? 119  TYR B N   1 
ATOM   5135 C CA  . TYR B 1 119 ? 5.781   3.385   -44.834 1.00 47.76  ? 119  TYR B CA  1 
ATOM   5136 C C   . TYR B 1 119 ? 7.067   3.048   -44.067 1.00 48.34  ? 119  TYR B C   1 
ATOM   5137 O O   . TYR B 1 119 ? 8.180   3.384   -44.496 1.00 48.13  ? 119  TYR B O   1 
ATOM   5138 C CB  . TYR B 1 119 ? 5.208   2.119   -45.508 1.00 48.60  ? 119  TYR B CB  1 
ATOM   5139 C CG  . TYR B 1 119 ? 6.012   1.566   -46.675 1.00 48.92  ? 119  TYR B CG  1 
ATOM   5140 C CD1 . TYR B 1 119 ? 7.173   0.850   -46.468 1.00 50.05  ? 119  TYR B CD1 1 
ATOM   5141 C CD2 . TYR B 1 119 ? 5.592   1.747   -47.979 1.00 49.30  ? 119  TYR B CD2 1 
ATOM   5142 C CE1 . TYR B 1 119 ? 7.908   0.334   -47.537 1.00 50.33  ? 119  TYR B CE1 1 
ATOM   5143 C CE2 . TYR B 1 119 ? 6.313   1.223   -49.056 1.00 49.94  ? 119  TYR B CE2 1 
ATOM   5144 C CZ  . TYR B 1 119 ? 7.473   0.527   -48.834 1.00 48.34  ? 119  TYR B CZ  1 
ATOM   5145 O OH  . TYR B 1 119 ? 8.197   -0.002  -49.897 1.00 49.22  ? 119  TYR B OH  1 
ATOM   5146 N N   . GLY B 1 120 ? 6.877   2.416   -42.906 1.00 48.83  ? 120  GLY B N   1 
ATOM   5147 C CA  . GLY B 1 120 ? 7.959   1.825   -42.132 1.00 48.92  ? 120  GLY B CA  1 
ATOM   5148 C C   . GLY B 1 120 ? 8.018   0.331   -42.324 1.00 49.44  ? 120  GLY B C   1 
ATOM   5149 O O   . GLY B 1 120 ? 7.320   -0.225  -43.168 1.00 50.55  ? 120  GLY B O   1 
ATOM   5150 N N   . GLY B 1 121 ? 8.848   -0.315  -41.513 1.00 49.84  ? 121  GLY B N   1 
ATOM   5151 C CA  . GLY B 1 121 ? 9.175   -1.721  -41.671 1.00 50.17  ? 121  GLY B CA  1 
ATOM   5152 C C   . GLY B 1 121 ? 10.654  -2.027  -41.578 1.00 50.52  ? 121  GLY B C   1 
ATOM   5153 O O   . GLY B 1 121 ? 11.118  -3.007  -42.151 1.00 50.35  ? 121  GLY B O   1 
ATOM   5154 N N   . GLY B 1 122 ? 11.399  -1.195  -40.861 1.00 50.43  ? 122  GLY B N   1 
ATOM   5155 C CA  . GLY B 1 122 ? 12.822  -1.448  -40.591 1.00 51.08  ? 122  GLY B CA  1 
ATOM   5156 C C   . GLY B 1 122 ? 13.765  -1.237  -41.761 1.00 51.02  ? 122  GLY B C   1 
ATOM   5157 O O   . GLY B 1 122 ? 14.926  -1.632  -41.693 1.00 52.00  ? 122  GLY B O   1 
ATOM   5158 N N   . PHE B 1 123 ? 13.281  -0.576  -42.814 1.00 50.41  ? 123  PHE B N   1 
ATOM   5159 C CA  . PHE B 1 123 ? 13.971  -0.547  -44.108 1.00 50.14  ? 123  PHE B CA  1 
ATOM   5160 C C   . PHE B 1 123 ? 14.213  -1.940  -44.729 1.00 50.85  ? 123  PHE B C   1 
ATOM   5161 O O   . PHE B 1 123 ? 15.001  -2.046  -45.661 1.00 51.20  ? 123  PHE B O   1 
ATOM   5162 C CB  . PHE B 1 123 ? 15.328  0.146   -43.996 1.00 50.17  ? 123  PHE B CB  1 
ATOM   5163 C CG  . PHE B 1 123 ? 15.249  1.558   -43.575 1.00 48.60  ? 123  PHE B CG  1 
ATOM   5164 C CD1 . PHE B 1 123 ? 14.846  2.529   -44.471 1.00 48.06  ? 123  PHE B CD1 1 
ATOM   5165 C CD2 . PHE B 1 123 ? 15.629  1.939   -42.299 1.00 49.00  ? 123  PHE B CD2 1 
ATOM   5166 C CE1 . PHE B 1 123 ? 14.774  3.852   -44.091 1.00 48.12  ? 123  PHE B CE1 1 
ATOM   5167 C CE2 . PHE B 1 123 ? 15.577  3.280   -41.917 1.00 48.06  ? 123  PHE B CE2 1 
ATOM   5168 C CZ  . PHE B 1 123 ? 15.138  4.227   -42.815 1.00 48.09  ? 123  PHE B CZ  1 
ATOM   5169 N N   . TYR B 1 124 ? 13.559  -2.991  -44.226 1.00 50.83  ? 124  TYR B N   1 
ATOM   5170 C CA  . TYR B 1 124 ? 13.670  -4.326  -44.810 1.00 51.30  ? 124  TYR B CA  1 
ATOM   5171 C C   . TYR B 1 124 ? 12.310  -4.875  -45.314 1.00 51.37  ? 124  TYR B C   1 
ATOM   5172 O O   . TYR B 1 124 ? 12.256  -5.958  -45.922 1.00 51.00  ? 124  TYR B O   1 
ATOM   5173 C CB  . TYR B 1 124 ? 14.308  -5.309  -43.798 1.00 53.04  ? 124  TYR B CB  1 
ATOM   5174 C CG  . TYR B 1 124 ? 13.372  -5.712  -42.674 1.00 54.15  ? 124  TYR B CG  1 
ATOM   5175 C CD1 . TYR B 1 124 ? 12.497  -6.791  -42.816 1.00 54.50  ? 124  TYR B CD1 1 
ATOM   5176 C CD2 . TYR B 1 124 ? 13.342  -4.999  -41.485 1.00 53.58  ? 124  TYR B CD2 1 
ATOM   5177 C CE1 . TYR B 1 124 ? 11.625  -7.136  -41.804 1.00 54.75  ? 124  TYR B CE1 1 
ATOM   5178 C CE2 . TYR B 1 124 ? 12.481  -5.345  -40.463 1.00 54.31  ? 124  TYR B CE2 1 
ATOM   5179 C CZ  . TYR B 1 124 ? 11.614  -6.408  -40.631 1.00 54.76  ? 124  TYR B CZ  1 
ATOM   5180 O OH  . TYR B 1 124 ? 10.743  -6.728  -39.603 1.00 55.90  ? 124  TYR B OH  1 
ATOM   5181 N N   . SER B 1 125 ? 11.224  -4.128  -45.072 1.00 49.86  ? 125  SER B N   1 
ATOM   5182 C CA  . SER B 1 125 ? 9.874   -4.585  -45.360 1.00 49.44  ? 125  SER B CA  1 
ATOM   5183 C C   . SER B 1 125 ? 8.938   -3.409  -45.495 1.00 48.01  ? 125  SER B C   1 
ATOM   5184 O O   . SER B 1 125 ? 9.344   -2.258  -45.328 1.00 46.29  ? 125  SER B O   1 
ATOM   5185 C CB  . SER B 1 125 ? 9.374   -5.485  -44.238 1.00 50.21  ? 125  SER B CB  1 
ATOM   5186 O OG  . SER B 1 125 ? 9.307   -4.761  -43.037 1.00 49.38  ? 125  SER B OG  1 
ATOM   5187 N N   . GLY B 1 126 ? 7.680   -3.714  -45.791 1.00 48.18  ? 126  GLY B N   1 
ATOM   5188 C CA  . GLY B 1 126 ? 6.634   -2.707  -45.963 1.00 47.66  ? 126  GLY B CA  1 
ATOM   5189 C C   . GLY B 1 126 ? 6.086   -2.637  -47.370 1.00 48.19  ? 126  GLY B C   1 
ATOM   5190 O O   . GLY B 1 126 ? 6.673   -3.170  -48.321 1.00 48.68  ? 126  GLY B O   1 
ATOM   5191 N N   . ALA B 1 127 ? 4.936   -1.980  -47.496 1.00 47.95  ? 127  ALA B N   1 
ATOM   5192 C CA  . ALA B 1 127 ? 4.272   -1.798  -48.780 1.00 48.83  ? 127  ALA B CA  1 
ATOM   5193 C C   . ALA B 1 127 ? 3.208   -0.710  -48.630 1.00 48.64  ? 127  ALA B C   1 
ATOM   5194 O O   . ALA B 1 127 ? 2.687   -0.539  -47.557 1.00 49.23  ? 127  ALA B O   1 
ATOM   5195 C CB  . ALA B 1 127 ? 3.653   -3.064  -49.221 1.00 48.81  ? 127  ALA B CB  1 
ATOM   5196 N N   . ALA B 1 128 ? 2.900   0.019   -49.696 1.00 49.12  ? 128  ALA B N   1 
ATOM   5197 C CA  . ALA B 1 128 ? 1.892   1.085   -49.642 1.00 49.67  ? 128  ALA B CA  1 
ATOM   5198 C C   . ALA B 1 128 ? 0.492   0.533   -49.827 1.00 51.25  ? 128  ALA B C   1 
ATOM   5199 O O   . ALA B 1 128 ? -0.489  1.275   -49.694 1.00 51.43  ? 128  ALA B O   1 
ATOM   5200 C CB  . ALA B 1 128 ? 2.175   2.145   -50.687 1.00 49.73  ? 128  ALA B CB  1 
ATOM   5201 N N   . SER B 1 129 ? 0.401   -0.762  -50.142 1.00 52.07  ? 129  SER B N   1 
ATOM   5202 C CA  . SER B 1 129 ? -0.864  -1.431  -50.355 1.00 53.75  ? 129  SER B CA  1 
ATOM   5203 C C   . SER B 1 129 ? -1.488  -2.017  -49.087 1.00 54.57  ? 129  SER B C   1 
ATOM   5204 O O   . SER B 1 129 ? -2.583  -2.577  -49.150 1.00 56.80  ? 129  SER B O   1 
ATOM   5205 C CB  . SER B 1 129 ? -0.685  -2.547  -51.393 1.00 54.75  ? 129  SER B CB  1 
ATOM   5206 O OG  . SER B 1 129 ? 0.404   -3.398  -51.058 1.00 54.95  ? 129  SER B OG  1 
ATOM   5207 N N   . LEU B 1 130 ? -0.814  -1.925  -47.948 1.00 53.99  ? 130  LEU B N   1 
ATOM   5208 C CA  . LEU B 1 130 ? -1.350  -2.513  -46.726 1.00 54.73  ? 130  LEU B CA  1 
ATOM   5209 C C   . LEU B 1 130 ? -2.641  -1.776  -46.355 1.00 55.69  ? 130  LEU B C   1 
ATOM   5210 O O   . LEU B 1 130 ? -2.760  -0.584  -46.590 1.00 55.18  ? 130  LEU B O   1 
ATOM   5211 C CB  . LEU B 1 130 ? -0.347  -2.434  -45.578 1.00 53.66  ? 130  LEU B CB  1 
ATOM   5212 C CG  . LEU B 1 130 ? 1.046   -3.059  -45.738 1.00 53.19  ? 130  LEU B CG  1 
ATOM   5213 C CD1 . LEU B 1 130 ? 1.786   -2.959  -44.435 1.00 49.28  ? 130  LEU B CD1 1 
ATOM   5214 C CD2 . LEU B 1 130 ? 0.953   -4.502  -46.219 1.00 51.51  ? 130  LEU B CD2 1 
ATOM   5215 N N   . ASP B 1 131 ? -3.611  -2.491  -45.794 1.00 57.54  ? 131  ASP B N   1 
ATOM   5216 C CA  . ASP B 1 131 ? -4.938  -1.899  -45.553 1.00 58.61  ? 131  ASP B CA  1 
ATOM   5217 C C   . ASP B 1 131 ? -4.894  -0.724  -44.572 1.00 57.67  ? 131  ASP B C   1 
ATOM   5218 O O   . ASP B 1 131 ? -5.724  0.170   -44.676 1.00 57.93  ? 131  ASP B O   1 
ATOM   5219 C CB  . ASP B 1 131 ? -5.940  -2.927  -45.024 1.00 60.41  ? 131  ASP B CB  1 
ATOM   5220 C CG  . ASP B 1 131 ? -6.254  -4.039  -46.023 1.00 63.07  ? 131  ASP B CG  1 
ATOM   5221 O OD1 . ASP B 1 131 ? -6.161  -3.843  -47.263 1.00 63.98  ? 131  ASP B OD1 1 
ATOM   5222 O OD2 . ASP B 1 131 ? -6.612  -5.135  -45.539 1.00 67.45  ? 131  ASP B OD2 1 
ATOM   5223 N N   . VAL B 1 132 ? -3.946  -0.728  -43.627 1.00 56.84  ? 132  VAL B N   1 
ATOM   5224 C CA  . VAL B 1 132 ? -3.824  0.374   -42.663 1.00 56.01  ? 132  VAL B CA  1 
ATOM   5225 C C   . VAL B 1 132 ? -3.383  1.685   -43.291 1.00 54.47  ? 132  VAL B C   1 
ATOM   5226 O O   . VAL B 1 132 ? -3.510  2.738   -42.648 1.00 54.34  ? 132  VAL B O   1 
ATOM   5227 C CB  . VAL B 1 132 ? -2.870  0.059   -41.461 1.00 55.98  ? 132  VAL B CB  1 
ATOM   5228 C CG1 . VAL B 1 132 ? -3.600  -0.781  -40.404 1.00 57.36  ? 132  VAL B CG1 1 
ATOM   5229 C CG2 . VAL B 1 132 ? -1.562  -0.600  -41.933 1.00 55.29  ? 132  VAL B CG2 1 
ATOM   5230 N N   . TYR B 1 133 ? -2.882  1.633   -44.530 1.00 53.33  ? 133  TYR B N   1 
ATOM   5231 C CA  . TYR B 1 133 ? -2.388  2.827   -45.237 1.00 52.44  ? 133  TYR B CA  1 
ATOM   5232 C C   . TYR B 1 133 ? -3.373  3.324   -46.303 1.00 53.31  ? 133  TYR B C   1 
ATOM   5233 O O   . TYR B 1 133 ? -3.016  4.081   -47.193 1.00 52.97  ? 133  TYR B O   1 
ATOM   5234 C CB  . TYR B 1 133 ? -1.022  2.571   -45.882 1.00 51.42  ? 133  TYR B CB  1 
ATOM   5235 C CG  . TYR B 1 133 ? 0.040   1.991   -44.976 1.00 50.24  ? 133  TYR B CG  1 
ATOM   5236 C CD1 . TYR B 1 133 ? 0.181   2.408   -43.661 1.00 51.24  ? 133  TYR B CD1 1 
ATOM   5237 C CD2 . TYR B 1 133 ? 0.950   1.071   -45.460 1.00 49.25  ? 133  TYR B CD2 1 
ATOM   5238 C CE1 . TYR B 1 133 ? 1.172   1.882   -42.847 1.00 49.36  ? 133  TYR B CE1 1 
ATOM   5239 C CE2 . TYR B 1 133 ? 1.931   0.528   -44.649 1.00 49.26  ? 133  TYR B CE2 1 
ATOM   5240 C CZ  . TYR B 1 133 ? 2.039   0.930   -43.349 1.00 49.86  ? 133  TYR B CZ  1 
ATOM   5241 O OH  . TYR B 1 133 ? 3.032   0.397   -42.553 1.00 49.22  ? 133  TYR B OH  1 
ATOM   5242 N N   . ASP B 1 134 ? -4.631  2.940   -46.152 1.00 54.57  ? 134  ASP B N   1 
ATOM   5243 C CA  . ASP B 1 134 ? -5.690  3.268   -47.089 1.00 55.58  ? 134  ASP B CA  1 
ATOM   5244 C C   . ASP B 1 134 ? -6.069  4.766   -47.018 1.00 55.49  ? 134  ASP B C   1 
ATOM   5245 O O   . ASP B 1 134 ? -6.627  5.224   -46.023 1.00 56.05  ? 134  ASP B O   1 
ATOM   5246 C CB  . ASP B 1 134 ? -6.881  2.369   -46.749 1.00 56.58  ? 134  ASP B CB  1 
ATOM   5247 C CG  . ASP B 1 134 ? -8.003  2.450   -47.753 1.00 58.45  ? 134  ASP B CG  1 
ATOM   5248 O OD1 . ASP B 1 134 ? -8.059  3.402   -48.559 1.00 59.29  ? 134  ASP B OD1 1 
ATOM   5249 O OD2 . ASP B 1 134 ? -8.853  1.538   -47.719 1.00 58.75  ? 134  ASP B OD2 1 
ATOM   5250 N N   . GLY B 1 135 ? -5.778  5.509   -48.087 1.00 55.34  ? 135  GLY B N   1 
ATOM   5251 C CA  . GLY B 1 135 ? -6.003  6.969   -48.140 1.00 55.54  ? 135  GLY B CA  1 
ATOM   5252 C C   . GLY B 1 135 ? -7.426  7.462   -48.391 1.00 56.71  ? 135  GLY B C   1 
ATOM   5253 O O   . GLY B 1 135 ? -7.668  8.677   -48.456 1.00 56.81  ? 135  GLY B O   1 
ATOM   5254 N N   . ARG B 1 136 ? -8.374  6.543   -48.520 1.00 57.48  ? 136  ARG B N   1 
ATOM   5255 C CA  . ARG B 1 136 ? -9.712  6.927   -48.918 1.00 59.39  ? 136  ARG B CA  1 
ATOM   5256 C C   . ARG B 1 136 ? -10.431 7.750   -47.863 1.00 59.72  ? 136  ARG B C   1 
ATOM   5257 O O   . ARG B 1 136 ? -11.174 8.665   -48.203 1.00 61.10  ? 136  ARG B O   1 
ATOM   5258 C CB  . ARG B 1 136 ? -10.545 5.704   -49.315 1.00 60.71  ? 136  ARG B CB  1 
ATOM   5259 C CG  . ARG B 1 136 ? -11.037 4.863   -48.155 1.00 62.89  ? 136  ARG B CG  1 
ATOM   5260 C CD  . ARG B 1 136 ? -11.012 3.384   -48.489 1.00 64.89  ? 136  ARG B CD  1 
ATOM   5261 N NE  . ARG B 1 136 ? -12.113 2.947   -49.302 1.00 67.12  ? 136  ARG B NE  1 
ATOM   5262 C CZ  . ARG B 1 136 ? -12.087 1.884   -50.117 1.00 68.40  ? 136  ARG B CZ  1 
ATOM   5263 N NH1 . ARG B 1 136 ? -10.993 1.137   -50.283 1.00 66.45  ? 136  ARG B NH1 1 
ATOM   5264 N NH2 . ARG B 1 136 ? -13.176 1.568   -50.802 1.00 70.47  ? 136  ARG B NH2 1 
ATOM   5265 N N   . PHE B 1 137 ? -10.202 7.433   -46.590 1.00 59.11  ? 137  PHE B N   1 
ATOM   5266 C CA  . PHE B 1 137 ? -10.923 8.076   -45.495 1.00 59.53  ? 137  PHE B CA  1 
ATOM   5267 C C   . PHE B 1 137 ? -10.480 9.530   -45.374 1.00 59.02  ? 137  PHE B C   1 
ATOM   5268 O O   . PHE B 1 137 ? -11.314 10.437  -45.257 1.00 60.70  ? 137  PHE B O   1 
ATOM   5269 C CB  . PHE B 1 137 ? -10.706 7.331   -44.173 1.00 58.75  ? 137  PHE B CB  1 
ATOM   5270 C CG  . PHE B 1 137 ? -11.021 5.866   -44.248 1.00 58.89  ? 137  PHE B CG  1 
ATOM   5271 C CD1 . PHE B 1 137 ? -12.331 5.418   -44.170 1.00 60.58  ? 137  PHE B CD1 1 
ATOM   5272 C CD2 . PHE B 1 137 ? -10.010 4.933   -44.423 1.00 57.77  ? 137  PHE B CD2 1 
ATOM   5273 C CE1 . PHE B 1 137 ? -12.623 4.042   -44.263 1.00 62.10  ? 137  PHE B CE1 1 
ATOM   5274 C CE2 . PHE B 1 137 ? -10.291 3.564   -44.508 1.00 58.32  ? 137  PHE B CE2 1 
ATOM   5275 C CZ  . PHE B 1 137 ? -11.598 3.120   -44.426 1.00 60.32  ? 137  PHE B CZ  1 
ATOM   5276 N N   . LEU B 1 138 ? -9.176  9.749   -45.428 1.00 57.25  ? 138  LEU B N   1 
ATOM   5277 C CA  . LEU B 1 138 ? -8.618  11.103  -45.380 1.00 56.80  ? 138  LEU B CA  1 
ATOM   5278 C C   . LEU B 1 138 ? -9.050  11.909  -46.605 1.00 57.90  ? 138  LEU B C   1 
ATOM   5279 O O   . LEU B 1 138 ? -9.458  13.062  -46.486 1.00 58.43  ? 138  LEU B O   1 
ATOM   5280 C CB  . LEU B 1 138 ? -7.094  11.051  -45.289 1.00 55.05  ? 138  LEU B CB  1 
ATOM   5281 C CG  . LEU B 1 138 ? -6.485  10.720  -43.928 1.00 53.74  ? 138  LEU B CG  1 
ATOM   5282 C CD1 . LEU B 1 138 ? -5.008  10.359  -44.084 1.00 52.90  ? 138  LEU B CD1 1 
ATOM   5283 C CD2 . LEU B 1 138 ? -6.650  11.875  -42.954 1.00 52.66  ? 138  LEU B CD2 1 
ATOM   5284 N N   . ALA B 1 139 ? -9.000  11.280  -47.778 1.00 58.11  ? 139  ALA B N   1 
ATOM   5285 C CA  . ALA B 1 139 ? -9.493  11.892  -49.009 1.00 59.21  ? 139  ALA B CA  1 
ATOM   5286 C C   . ALA B 1 139 ? -10.931 12.382  -48.847 1.00 61.21  ? 139  ALA B C   1 
ATOM   5287 O O   . ALA B 1 139 ? -11.231 13.563  -49.045 1.00 61.92  ? 139  ALA B O   1 
ATOM   5288 C CB  . ALA B 1 139 ? -9.404  10.898  -50.178 1.00 58.98  ? 139  ALA B CB  1 
ATOM   5289 N N   . GLN B 1 140 ? -11.813 11.461  -48.477 1.00 62.22  ? 140  GLN B N   1 
ATOM   5290 C CA  . GLN B 1 140 ? -13.239 11.729  -48.457 1.00 64.12  ? 140  GLN B CA  1 
ATOM   5291 C C   . GLN B 1 140 ? -13.614 12.726  -47.382 1.00 64.81  ? 140  GLN B C   1 
ATOM   5292 O O   . GLN B 1 140 ? -14.352 13.676  -47.654 1.00 66.41  ? 140  GLN B O   1 
ATOM   5293 C CB  . GLN B 1 140 ? -14.025 10.430  -48.238 1.00 65.11  ? 140  GLN B CB  1 
ATOM   5294 C CG  . GLN B 1 140 ? -15.432 10.456  -48.793 1.00 66.74  ? 140  GLN B CG  1 
ATOM   5295 C CD  . GLN B 1 140 ? -16.405 11.220  -47.930 1.00 68.20  ? 140  GLN B CD  1 
ATOM   5296 O OE1 . GLN B 1 140 ? -16.332 11.186  -46.707 1.00 67.75  ? 140  GLN B OE1 1 
ATOM   5297 N NE2 . GLN B 1 140 ? -17.346 11.890  -48.566 1.00 70.83  ? 140  GLN B NE2 1 
ATOM   5298 N N   . VAL B 1 141 ? -13.126 12.494  -46.163 1.00 63.95  ? 141  VAL B N   1 
ATOM   5299 C CA  . VAL B 1 141 ? -13.580 13.246  -44.995 1.00 64.31  ? 141  VAL B CA  1 
ATOM   5300 C C   . VAL B 1 141 ? -12.904 14.607  -44.948 1.00 64.49  ? 141  VAL B C   1 
ATOM   5301 O O   . VAL B 1 141 ? -13.574 15.609  -44.767 1.00 65.35  ? 141  VAL B O   1 
ATOM   5302 C CB  . VAL B 1 141 ? -13.315 12.469  -43.693 1.00 63.57  ? 141  VAL B CB  1 
ATOM   5303 C CG1 . VAL B 1 141 ? -13.615 13.330  -42.468 1.00 63.22  ? 141  VAL B CG1 1 
ATOM   5304 C CG2 . VAL B 1 141 ? -14.137 11.182  -43.672 1.00 63.47  ? 141  VAL B CG2 1 
ATOM   5305 N N   . GLU B 1 142 ? -11.585 14.642  -45.152 1.00 63.42  ? 142  GLU B N   1 
ATOM   5306 C CA  . GLU B 1 142 ? -10.825 15.890  -45.048 1.00 63.74  ? 142  GLU B CA  1 
ATOM   5307 C C   . GLU B 1 142 ? -10.547 16.607  -46.369 1.00 64.08  ? 142  GLU B C   1 
ATOM   5308 O O   . GLU B 1 142 ? -9.970  17.696  -46.368 1.00 63.86  ? 142  GLU B O   1 
ATOM   5309 C CB  . GLU B 1 142 ? -9.509  15.633  -44.325 1.00 62.28  ? 142  GLU B CB  1 
ATOM   5310 C CG  . GLU B 1 142 ? -9.691  15.097  -42.919 1.00 63.85  ? 142  GLU B CG  1 
ATOM   5311 C CD  . GLU B 1 142 ? -10.430 16.058  -42.008 1.00 67.94  ? 142  GLU B CD  1 
ATOM   5312 O OE1 . GLU B 1 142 ? -10.426 17.293  -42.256 1.00 70.18  ? 142  GLU B OE1 1 
ATOM   5313 O OE2 . GLU B 1 142 ? -11.022 15.566  -41.023 1.00 71.66  ? 142  GLU B OE2 1 
ATOM   5314 N N   . GLY B 1 143 ? -10.952 16.011  -47.487 1.00 64.51  ? 143  GLY B N   1 
ATOM   5315 C CA  . GLY B 1 143 ? -10.731 16.623  -48.797 1.00 65.31  ? 143  GLY B CA  1 
ATOM   5316 C C   . GLY B 1 143 ? -9.268  16.638  -49.223 1.00 64.03  ? 143  GLY B C   1 
ATOM   5317 O O   . GLY B 1 143 ? -8.889  17.368  -50.139 1.00 65.25  ? 143  GLY B O   1 
ATOM   5318 N N   . ALA B 1 144 ? -8.452  15.823  -48.565 1.00 62.29  ? 144  ALA B N   1 
ATOM   5319 C CA  . ALA B 1 144 ? -7.018  15.769  -48.811 1.00 60.45  ? 144  ALA B CA  1 
ATOM   5320 C C   . ALA B 1 144 ? -6.710  14.996  -50.079 1.00 59.71  ? 144  ALA B C   1 
ATOM   5321 O O   . ALA B 1 144 ? -7.463  14.113  -50.466 1.00 60.52  ? 144  ALA B O   1 
ATOM   5322 C CB  . ALA B 1 144 ? -6.330  15.096  -47.642 1.00 59.02  ? 144  ALA B CB  1 
ATOM   5323 N N   . VAL B 1 145 ? -5.591  15.334  -50.713 1.00 58.63  ? 145  VAL B N   1 
ATOM   5324 C CA  . VAL B 1 145 ? -4.985  14.488  -51.732 1.00 57.70  ? 145  VAL B CA  1 
ATOM   5325 C C   . VAL B 1 145 ? -3.898  13.674  -51.040 1.00 56.43  ? 145  VAL B C   1 
ATOM   5326 O O   . VAL B 1 145 ? -2.977  14.232  -50.468 1.00 55.68  ? 145  VAL B O   1 
ATOM   5327 C CB  . VAL B 1 145 ? -4.379  15.322  -52.899 1.00 57.81  ? 145  VAL B CB  1 
ATOM   5328 C CG1 . VAL B 1 145 ? -3.504  14.439  -53.786 1.00 55.11  ? 145  VAL B CG1 1 
ATOM   5329 C CG2 . VAL B 1 145 ? -5.488  15.970  -53.708 1.00 58.49  ? 145  VAL B CG2 1 
ATOM   5330 N N   . LEU B 1 146 ? -4.011  12.353  -51.071 1.00 56.49  ? 146  LEU B N   1 
ATOM   5331 C CA  . LEU B 1 146 ? -3.066  11.491  -50.371 1.00 55.27  ? 146  LEU B CA  1 
ATOM   5332 C C   . LEU B 1 146 ? -2.287  10.638  -51.347 1.00 54.21  ? 146  LEU B C   1 
ATOM   5333 O O   . LEU B 1 146 ? -2.880  9.980   -52.219 1.00 54.42  ? 146  LEU B O   1 
ATOM   5334 C CB  . LEU B 1 146 ? -3.808  10.606  -49.356 1.00 55.66  ? 146  LEU B CB  1 
ATOM   5335 C CG  . LEU B 1 146 ? -3.040  9.994   -48.159 1.00 55.92  ? 146  LEU B CG  1 
ATOM   5336 C CD1 . LEU B 1 146 ? -2.038  10.914  -47.509 1.00 56.28  ? 146  LEU B CD1 1 
ATOM   5337 C CD2 . LEU B 1 146 ? -4.022  9.576   -47.085 1.00 56.79  ? 146  LEU B CD2 1 
ATOM   5338 N N   . VAL B 1 147 ? -0.959  10.630  -51.183 1.00 52.73  ? 147  VAL B N   1 
ATOM   5339 C CA  . VAL B 1 147 ? -0.059  9.886   -52.067 1.00 51.78  ? 147  VAL B CA  1 
ATOM   5340 C C   . VAL B 1 147 ? 0.765   8.890   -51.250 1.00 50.91  ? 147  VAL B C   1 
ATOM   5341 O O   . VAL B 1 147 ? 1.144   9.172   -50.126 1.00 50.91  ? 147  VAL B O   1 
ATOM   5342 C CB  . VAL B 1 147 ? 0.902   10.846  -52.819 1.00 51.77  ? 147  VAL B CB  1 
ATOM   5343 C CG1 . VAL B 1 147 ? 1.774   10.087  -53.813 1.00 49.93  ? 147  VAL B CG1 1 
ATOM   5344 C CG2 . VAL B 1 147 ? 0.121   11.964  -53.517 1.00 51.68  ? 147  VAL B CG2 1 
ATOM   5345 N N   . SER B 1 148 ? 1.035   7.718   -51.808 1.00 51.32  ? 148  SER B N   1 
ATOM   5346 C CA  . SER B 1 148 ? 1.966   6.771   -51.179 1.00 50.21  ? 148  SER B CA  1 
ATOM   5347 C C   . SER B 1 148 ? 2.786   6.020   -52.239 1.00 50.23  ? 148  SER B C   1 
ATOM   5348 O O   . SER B 1 148 ? 2.306   5.738   -53.326 1.00 51.02  ? 148  SER B O   1 
ATOM   5349 C CB  . SER B 1 148 ? 1.211   5.815   -50.251 1.00 50.71  ? 148  SER B CB  1 
ATOM   5350 O OG  . SER B 1 148 ? 0.440   4.846   -50.942 1.00 50.74  ? 148  SER B OG  1 
ATOM   5351 N N   . MET B 1 149 ? 4.039   5.727   -51.929 1.00 49.83  ? 149  MET B N   1 
ATOM   5352 C CA  . MET B 1 149 ? 4.933   5.092   -52.881 1.00 50.21  ? 149  MET B CA  1 
ATOM   5353 C C   . MET B 1 149 ? 5.567   3.857   -52.287 1.00 49.88  ? 149  MET B C   1 
ATOM   5354 O O   . MET B 1 149 ? 5.776   3.797   -51.078 1.00 49.59  ? 149  MET B O   1 
ATOM   5355 C CB  . MET B 1 149 ? 6.008   6.086   -53.325 1.00 50.51  ? 149  MET B CB  1 
ATOM   5356 C CG  . MET B 1 149 ? 7.279   6.187   -52.448 1.00 50.60  ? 149  MET B CG  1 
ATOM   5357 S SD  . MET B 1 149 ? 7.107   6.860   -50.776 1.00 48.55  ? 149  MET B SD  1 
ATOM   5358 C CE  . MET B 1 149 ? 6.716   8.575   -51.096 1.00 46.90  ? 149  MET B CE  1 
ATOM   5359 N N   . ASN B 1 150 ? 5.821   2.852   -53.131 1.00 50.40  ? 150  ASN B N   1 
ATOM   5360 C CA  . ASN B 1 150 ? 6.753   1.791   -52.786 1.00 50.26  ? 150  ASN B CA  1 
ATOM   5361 C C   . ASN B 1 150 ? 8.160   2.310   -52.983 1.00 49.78  ? 150  ASN B C   1 
ATOM   5362 O O   . ASN B 1 150 ? 8.425   3.065   -53.922 1.00 49.82  ? 150  ASN B O   1 
ATOM   5363 C CB  . ASN B 1 150 ? 6.565   0.555   -53.649 1.00 50.89  ? 150  ASN B CB  1 
ATOM   5364 C CG  . ASN B 1 150 ? 5.346   -0.220  -53.281 1.00 52.54  ? 150  ASN B CG  1 
ATOM   5365 O OD1 . ASN B 1 150 ? 4.687   0.103   -52.302 1.00 54.90  ? 150  ASN B OD1 1 
ATOM   5366 N ND2 . ASN B 1 150 ? 5.015   -1.246  -54.072 1.00 52.57  ? 150  ASN B ND2 1 
ATOM   5367 N N   . TYR B 1 151 ? 9.044   1.919   -52.071 1.00 48.99  ? 151  TYR B N   1 
ATOM   5368 C CA  . TYR B 1 151 ? 10.463  2.146   -52.201 1.00 48.09  ? 151  TYR B CA  1 
ATOM   5369 C C   . TYR B 1 151 ? 11.166  0.827   -51.882 1.00 48.37  ? 151  TYR B C   1 
ATOM   5370 O O   . TYR B 1 151 ? 10.625  -0.032  -51.158 1.00 48.61  ? 151  TYR B O   1 
ATOM   5371 C CB  . TYR B 1 151 ? 10.936  3.299   -51.302 1.00 48.04  ? 151  TYR B CB  1 
ATOM   5372 C CG  . TYR B 1 151 ? 10.756  3.108   -49.805 1.00 47.44  ? 151  TYR B CG  1 
ATOM   5373 C CD1 . TYR B 1 151 ? 9.581   3.502   -49.167 1.00 47.76  ? 151  TYR B CD1 1 
ATOM   5374 C CD2 . TYR B 1 151 ? 11.753  2.536   -49.029 1.00 46.82  ? 151  TYR B CD2 1 
ATOM   5375 C CE1 . TYR B 1 151 ? 9.413   3.327   -47.784 1.00 47.05  ? 151  TYR B CE1 1 
ATOM   5376 C CE2 . TYR B 1 151 ? 11.591  2.352   -47.659 1.00 47.01  ? 151  TYR B CE2 1 
ATOM   5377 C CZ  . TYR B 1 151 ? 10.430  2.757   -47.036 1.00 46.31  ? 151  TYR B CZ  1 
ATOM   5378 O OH  . TYR B 1 151 ? 10.268  2.576   -45.674 1.00 45.27  ? 151  TYR B OH  1 
ATOM   5379 N N   . ARG B 1 152 ? 12.356  0.658   -52.446 1.00 48.03  ? 152  ARG B N   1 
ATOM   5380 C CA  . ARG B 1 152 ? 13.115  -0.574  -52.279 1.00 48.58  ? 152  ARG B CA  1 
ATOM   5381 C C   . ARG B 1 152 ? 13.632  -0.754  -50.847 1.00 47.57  ? 152  ARG B C   1 
ATOM   5382 O O   . ARG B 1 152 ? 14.083  0.192   -50.208 1.00 47.23  ? 152  ARG B O   1 
ATOM   5383 C CB  . ARG B 1 152 ? 14.268  -0.620  -53.279 1.00 49.18  ? 152  ARG B CB  1 
ATOM   5384 C CG  . ARG B 1 152 ? 13.867  -0.974  -54.676 1.00 49.66  ? 152  ARG B CG  1 
ATOM   5385 C CD  . ARG B 1 152 ? 15.056  -0.890  -55.614 1.00 50.54  ? 152  ARG B CD  1 
ATOM   5386 N NE  . ARG B 1 152 ? 15.325  0.498   -56.005 1.00 50.12  ? 152  ARG B NE  1 
ATOM   5387 C CZ  . ARG B 1 152 ? 16.394  0.875   -56.696 1.00 51.90  ? 152  ARG B CZ  1 
ATOM   5388 N NH1 . ARG B 1 152 ? 17.305  -0.016  -57.070 1.00 53.73  ? 152  ARG B NH1 1 
ATOM   5389 N NH2 . ARG B 1 152 ? 16.549  2.150   -57.013 1.00 52.01  ? 152  ARG B NH2 1 
ATOM   5390 N N   . VAL B 1 153 ? 13.550  -1.988  -50.359 1.00 47.45  ? 153  VAL B N   1 
ATOM   5391 C CA  . VAL B 1 153 ? 13.890  -2.317  -48.993 1.00 47.09  ? 153  VAL B CA  1 
ATOM   5392 C C   . VAL B 1 153 ? 14.913  -3.449  -48.986 1.00 48.60  ? 153  VAL B C   1 
ATOM   5393 O O   . VAL B 1 153 ? 15.127  -4.115  -50.003 1.00 49.85  ? 153  VAL B O   1 
ATOM   5394 C CB  . VAL B 1 153 ? 12.639  -2.718  -48.169 1.00 46.99  ? 153  VAL B CB  1 
ATOM   5395 C CG1 . VAL B 1 153 ? 11.668  -1.533  -48.049 1.00 45.28  ? 153  VAL B CG1 1 
ATOM   5396 C CG2 . VAL B 1 153 ? 11.949  -3.937  -48.768 1.00 46.47  ? 153  VAL B CG2 1 
ATOM   5397 N N   . GLY B 1 154 ? 15.581  -3.637  -47.856 1.00 48.94  ? 154  GLY B N   1 
ATOM   5398 C CA  . GLY B 1 154 ? 16.543  -4.744  -47.721 1.00 50.29  ? 154  GLY B CA  1 
ATOM   5399 C C   . GLY B 1 154 ? 17.774  -4.499  -48.551 1.00 50.84  ? 154  GLY B C   1 
ATOM   5400 O O   . GLY B 1 154 ? 18.137  -3.350  -48.798 1.00 49.84  ? 154  GLY B O   1 
ATOM   5401 N N   . THR B 1 155 ? 18.422  -5.582  -48.982 1.00 52.86  ? 155  THR B N   1 
ATOM   5402 C CA  . THR B 1 155 ? 19.587  -5.477  -49.868 1.00 53.66  ? 155  THR B CA  1 
ATOM   5403 C C   . THR B 1 155 ? 19.279  -4.639  -51.113 1.00 53.49  ? 155  THR B C   1 
ATOM   5404 O O   . THR B 1 155 ? 20.104  -3.850  -51.559 1.00 53.68  ? 155  THR B O   1 
ATOM   5405 C CB  . THR B 1 155 ? 20.065  -6.849  -50.315 1.00 55.45  ? 155  THR B CB  1 
ATOM   5406 O OG1 . THR B 1 155 ? 18.966  -7.571  -50.876 1.00 54.66  ? 155  THR B OG1 1 
ATOM   5407 C CG2 . THR B 1 155 ? 20.641  -7.621  -49.126 1.00 56.30  ? 155  THR B CG2 1 
ATOM   5408 N N   . PHE B 1 156 ? 18.068  -4.775  -51.637 1.00 52.86  ? 156  PHE B N   1 
ATOM   5409 C CA  . PHE B 1 156 ? 17.705  -4.136  -52.897 1.00 52.71  ? 156  PHE B CA  1 
ATOM   5410 C C   . PHE B 1 156 ? 17.686  -2.624  -52.809 1.00 51.63  ? 156  PHE B C   1 
ATOM   5411 O O   . PHE B 1 156 ? 18.051  -1.942  -53.760 1.00 52.16  ? 156  PHE B O   1 
ATOM   5412 C CB  . PHE B 1 156 ? 16.358  -4.662  -53.387 1.00 52.66  ? 156  PHE B CB  1 
ATOM   5413 C CG  . PHE B 1 156 ? 16.289  -6.145  -53.394 1.00 54.08  ? 156  PHE B CG  1 
ATOM   5414 C CD1 . PHE B 1 156 ? 16.848  -6.863  -54.428 1.00 54.63  ? 156  PHE B CD1 1 
ATOM   5415 C CD2 . PHE B 1 156 ? 15.734  -6.825  -52.326 1.00 54.51  ? 156  PHE B CD2 1 
ATOM   5416 C CE1 . PHE B 1 156 ? 16.816  -8.242  -54.422 1.00 56.48  ? 156  PHE B CE1 1 
ATOM   5417 C CE2 . PHE B 1 156 ? 15.699  -8.203  -52.314 1.00 54.79  ? 156  PHE B CE2 1 
ATOM   5418 C CZ  . PHE B 1 156 ? 16.246  -8.913  -53.364 1.00 56.42  ? 156  PHE B CZ  1 
ATOM   5419 N N   . GLY B 1 157 ? 17.283  -2.112  -51.662 1.00 50.91  ? 157  GLY B N   1 
ATOM   5420 C CA  . GLY B 1 157 ? 17.199  -0.675  -51.433 1.00 49.70  ? 157  GLY B CA  1 
ATOM   5421 C C   . GLY B 1 157 ? 18.397  -0.089  -50.709 1.00 49.24  ? 157  GLY B C   1 
ATOM   5422 O O   . GLY B 1 157 ? 18.674  1.086   -50.857 1.00 49.07  ? 157  GLY B O   1 
ATOM   5423 N N   . PHE B 1 158 ? 19.119  -0.899  -49.937 1.00 49.46  ? 158  PHE B N   1 
ATOM   5424 C CA  . PHE B 1 158 ? 20.106  -0.351  -49.015 1.00 49.79  ? 158  PHE B CA  1 
ATOM   5425 C C   . PHE B 1 158 ? 21.470  -1.034  -48.921 1.00 51.48  ? 158  PHE B C   1 
ATOM   5426 O O   . PHE B 1 158 ? 22.340  -0.523  -48.201 1.00 51.68  ? 158  PHE B O   1 
ATOM   5427 C CB  . PHE B 1 158 ? 19.453  -0.165  -47.628 1.00 48.40  ? 158  PHE B CB  1 
ATOM   5428 C CG  . PHE B 1 158 ? 18.347  0.875   -47.637 1.00 46.10  ? 158  PHE B CG  1 
ATOM   5429 C CD1 . PHE B 1 158 ? 18.661  2.221   -47.681 1.00 43.97  ? 158  PHE B CD1 1 
ATOM   5430 C CD2 . PHE B 1 158 ? 17.030  0.500   -47.677 1.00 44.56  ? 158  PHE B CD2 1 
ATOM   5431 C CE1 . PHE B 1 158 ? 17.661  3.193   -47.742 1.00 45.84  ? 158  PHE B CE1 1 
ATOM   5432 C CE2 . PHE B 1 158 ? 16.021  1.450   -47.751 1.00 44.54  ? 158  PHE B CE2 1 
ATOM   5433 C CZ  . PHE B 1 158 ? 16.333  2.796   -47.781 1.00 44.83  ? 158  PHE B CZ  1 
ATOM   5434 N N   . LEU B 1 159 ? 21.681  -2.142  -49.650 1.00 53.01  ? 159  LEU B N   1 
ATOM   5435 C CA  . LEU B 1 159 ? 23.023  -2.730  -49.765 1.00 54.56  ? 159  LEU B CA  1 
ATOM   5436 C C   . LEU B 1 159 ? 23.921  -1.711  -50.445 1.00 56.18  ? 159  LEU B C   1 
ATOM   5437 O O   . LEU B 1 159 ? 23.542  -1.104  -51.455 1.00 56.30  ? 159  LEU B O   1 
ATOM   5438 C CB  . LEU B 1 159 ? 23.034  -4.043  -50.555 1.00 55.14  ? 159  LEU B CB  1 
ATOM   5439 C CG  . LEU B 1 159 ? 24.415  -4.708  -50.729 1.00 56.70  ? 159  LEU B CG  1 
ATOM   5440 C CD1 . LEU B 1 159 ? 24.332  -6.249  -50.637 1.00 55.53  ? 159  LEU B CD1 1 
ATOM   5441 C CD2 . LEU B 1 159 ? 25.085  -4.287  -52.030 1.00 56.00  ? 159  LEU B CD2 1 
ATOM   5442 N N   . ALA B 1 160 ? 25.113  -1.527  -49.882 1.00 58.09  ? 160  ALA B N   1 
ATOM   5443 C CA  . ALA B 1 160 ? 26.001  -0.449  -50.279 1.00 58.85  ? 160  ALA B CA  1 
ATOM   5444 C C   . ALA B 1 160 ? 27.432  -0.901  -50.179 1.00 60.92  ? 160  ALA B C   1 
ATOM   5445 O O   . ALA B 1 160 ? 27.833  -1.559  -49.210 1.00 62.10  ? 160  ALA B O   1 
ATOM   5446 C CB  . ALA B 1 160 ? 25.792  0.762   -49.414 1.00 57.86  ? 160  ALA B CB  1 
ATOM   5447 N N   . LEU B 1 161 ? 28.183  -0.562  -51.217 1.00 62.17  ? 161  LEU B N   1 
ATOM   5448 C CA  . LEU B 1 161 ? 29.619  -0.639  -51.210 1.00 64.28  ? 161  LEU B CA  1 
ATOM   5449 C C   . LEU B 1 161 ? 30.017  0.809   -51.417 1.00 64.54  ? 161  LEU B C   1 
ATOM   5450 O O   . LEU B 1 161 ? 30.167  1.258   -52.546 1.00 64.63  ? 161  LEU B O   1 
ATOM   5451 C CB  . LEU B 1 161 ? 30.091  -1.563  -52.322 1.00 65.50  ? 161  LEU B CB  1 
ATOM   5452 C CG  . LEU B 1 161 ? 29.785  -3.014  -51.929 1.00 66.48  ? 161  LEU B CG  1 
ATOM   5453 C CD1 . LEU B 1 161 ? 29.548  -3.883  -53.124 1.00 67.64  ? 161  LEU B CD1 1 
ATOM   5454 C CD2 . LEU B 1 161 ? 30.887  -3.593  -51.051 1.00 66.74  ? 161  LEU B CD2 1 
ATOM   5455 N N   . PRO B 1 162 ? 30.114  1.567   -50.313 1.00 64.71  ? 162  PRO B N   1 
ATOM   5456 C CA  . PRO B 1 162 ? 30.251  3.019   -50.394 1.00 65.24  ? 162  PRO B CA  1 
ATOM   5457 C C   . PRO B 1 162 ? 31.437  3.481   -51.221 1.00 67.47  ? 162  PRO B C   1 
ATOM   5458 O O   . PRO B 1 162 ? 32.525  2.937   -51.097 1.00 69.00  ? 162  PRO B O   1 
ATOM   5459 C CB  . PRO B 1 162 ? 30.401  3.432   -48.926 1.00 65.03  ? 162  PRO B CB  1 
ATOM   5460 C CG  . PRO B 1 162 ? 29.703  2.374   -48.182 1.00 63.55  ? 162  PRO B CG  1 
ATOM   5461 C CD  . PRO B 1 162 ? 30.079  1.123   -48.910 1.00 64.30  ? 162  PRO B CD  1 
ATOM   5462 N N   . GLY B 1 163 ? 31.202  4.476   -52.069 1.00 68.24  ? 163  GLY B N   1 
ATOM   5463 C CA  . GLY B 1 163 ? 32.214  4.958   -52.999 1.00 70.54  ? 163  GLY B CA  1 
ATOM   5464 C C   . GLY B 1 163 ? 32.160  4.274   -54.352 1.00 71.73  ? 163  GLY B C   1 
ATOM   5465 O O   . GLY B 1 163 ? 32.749  4.767   -55.311 1.00 72.65  ? 163  GLY B O   1 
ATOM   5466 N N   . SER B 1 164 ? 31.461  3.141   -54.438 1.00 71.95  ? 164  SER B N   1 
ATOM   5467 C CA  . SER B 1 164 ? 31.297  2.437   -55.707 1.00 73.24  ? 164  SER B CA  1 
ATOM   5468 C C   . SER B 1 164 ? 30.249  3.147   -56.561 1.00 72.96  ? 164  SER B C   1 
ATOM   5469 O O   . SER B 1 164 ? 29.325  3.777   -56.042 1.00 71.23  ? 164  SER B O   1 
ATOM   5470 C CB  . SER B 1 164 ? 30.893  0.972   -55.484 1.00 72.86  ? 164  SER B CB  1 
ATOM   5471 O OG  . SER B 1 164 ? 29.532  0.857   -55.085 1.00 71.16  ? 164  SER B OG  1 
ATOM   5472 N N   . ARG B 1 165 ? 30.410  3.037   -57.877 1.00 74.88  ? 165  ARG B N   1 
ATOM   5473 C CA  . ARG B 1 165 ? 29.470  3.631   -58.819 1.00 75.14  ? 165  ARG B CA  1 
ATOM   5474 C C   . ARG B 1 165 ? 28.190  2.817   -58.910 1.00 72.82  ? 165  ARG B C   1 
ATOM   5475 O O   . ARG B 1 165 ? 27.112  3.375   -59.123 1.00 71.77  ? 165  ARG B O   1 
ATOM   5476 C CB  . ARG B 1 165 ? 30.107  3.737   -60.202 1.00 76.99  ? 165  ARG B CB  1 
ATOM   5477 C CG  . ARG B 1 165 ? 31.364  4.625   -60.230 1.00 80.72  ? 165  ARG B CG  1 
ATOM   5478 C CD  . ARG B 1 165 ? 31.935  4.779   -61.645 1.00 83.37  ? 165  ARG B CD  1 
ATOM   5479 N NE  . ARG B 1 165 ? 30.945  5.270   -62.619 1.00 85.52  ? 165  ARG B NE  1 
ATOM   5480 C CZ  . ARG B 1 165 ? 31.197  5.433   -63.921 1.00 88.12  ? 165  ARG B CZ  1 
ATOM   5481 N NH1 . ARG B 1 165 ? 32.406  5.154   -64.415 1.00 90.90  ? 165  ARG B NH1 1 
ATOM   5482 N NH2 . ARG B 1 165 ? 30.241  5.878   -64.738 1.00 86.87  ? 165  ARG B NH2 1 
ATOM   5483 N N   . GLU B 1 166 ? 28.304  1.506   -58.715 1.00 72.43  ? 166  GLU B N   1 
ATOM   5484 C CA  . GLU B 1 166 ? 27.204  0.591   -59.027 1.00 71.25  ? 166  GLU B CA  1 
ATOM   5485 C C   . GLU B 1 166 ? 26.370  0.111   -57.821 1.00 69.34  ? 166  GLU B C   1 
ATOM   5486 O O   . GLU B 1 166 ? 25.317  -0.489  -58.007 1.00 68.87  ? 166  GLU B O   1 
ATOM   5487 C CB  . GLU B 1 166 ? 27.703  -0.583  -59.894 1.00 73.25  ? 166  GLU B CB  1 
ATOM   5488 C CG  . GLU B 1 166 ? 29.043  -1.181  -59.494 1.00 76.80  ? 166  GLU B CG  1 
ATOM   5489 C CD  . GLU B 1 166 ? 30.260  -0.434  -60.035 1.00 80.84  ? 166  GLU B CD  1 
ATOM   5490 O OE1 . GLU B 1 166 ? 30.348  -0.215  -61.264 1.00 83.50  ? 166  GLU B OE1 1 
ATOM   5491 O OE2 . GLU B 1 166 ? 31.147  -0.089  -59.218 1.00 83.14  ? 166  GLU B OE2 1 
ATOM   5492 N N   . ALA B 1 167 ? 26.831  0.381   -56.601 1.00 68.37  ? 167  ALA B N   1 
ATOM   5493 C CA  . ALA B 1 167 ? 26.052  0.152   -55.373 1.00 66.69  ? 167  ALA B CA  1 
ATOM   5494 C C   . ALA B 1 167 ? 26.430  1.255   -54.394 1.00 65.47  ? 167  ALA B C   1 
ATOM   5495 O O   . ALA B 1 167 ? 27.149  1.005   -53.431 1.00 66.03  ? 167  ALA B O   1 
ATOM   5496 C CB  . ALA B 1 167 ? 26.338  -1.226  -54.776 1.00 66.75  ? 167  ALA B CB  1 
ATOM   5497 N N   . PRO B 1 168 ? 25.983  2.493   -54.671 1.00 64.16  ? 168  PRO B N   1 
ATOM   5498 C CA  . PRO B 1 168 ? 26.382  3.678   -53.914 1.00 63.67  ? 168  PRO B CA  1 
ATOM   5499 C C   . PRO B 1 168 ? 25.708  3.800   -52.545 1.00 61.86  ? 168  PRO B C   1 
ATOM   5500 O O   . PRO B 1 168 ? 26.224  4.482   -51.669 1.00 61.88  ? 168  PRO B O   1 
ATOM   5501 C CB  . PRO B 1 168 ? 25.955  4.836   -54.831 1.00 63.66  ? 168  PRO B CB  1 
ATOM   5502 C CG  . PRO B 1 168 ? 24.815  4.310   -55.597 1.00 63.14  ? 168  PRO B CG  1 
ATOM   5503 C CD  . PRO B 1 168 ? 25.048  2.832   -55.761 1.00 63.66  ? 168  PRO B CD  1 
ATOM   5504 N N   . GLY B 1 169 ? 24.575  3.122   -52.373 1.00 60.00  ? 169  GLY B N   1 
ATOM   5505 C CA  . GLY B 1 169 ? 23.825  3.150   -51.136 1.00 57.98  ? 169  GLY B CA  1 
ATOM   5506 C C   . GLY B 1 169 ? 22.682  4.146   -51.221 1.00 56.10  ? 169  GLY B C   1 
ATOM   5507 O O   . GLY B 1 169 ? 22.649  4.997   -52.109 1.00 56.31  ? 169  GLY B O   1 
ATOM   5508 N N   . ASN B 1 170 ? 21.753  4.016   -50.283 1.00 54.06  ? 170  ASN B N   1 
ATOM   5509 C CA  . ASN B 1 170 ? 20.617  4.928   -50.114 1.00 52.43  ? 170  ASN B CA  1 
ATOM   5510 C C   . ASN B 1 170 ? 19.593  4.957   -51.259 1.00 51.35  ? 170  ASN B C   1 
ATOM   5511 O O   . ASN B 1 170 ? 18.745  5.863   -51.317 1.00 50.93  ? 170  ASN B O   1 
ATOM   5512 C CB  . ASN B 1 170 ? 21.111  6.357   -49.770 1.00 52.52  ? 170  ASN B CB  1 
ATOM   5513 C CG  . ASN B 1 170 ? 21.902  6.406   -48.458 1.00 52.41  ? 170  ASN B CG  1 
ATOM   5514 O OD1 . ASN B 1 170 ? 21.581  5.720   -47.499 1.00 53.73  ? 170  ASN B OD1 1 
ATOM   5515 N ND2 . ASN B 1 170 ? 22.947  7.205   -48.429 1.00 54.15  ? 170  ASN B ND2 1 
ATOM   5516 N N   . VAL B 1 171 ? 19.611  3.939   -52.122 1.00 51.51  ? 171  VAL B N   1 
ATOM   5517 C CA  . VAL B 1 171 ? 18.809  3.979   -53.350 1.00 50.77  ? 171  VAL B CA  1 
ATOM   5518 C C   . VAL B 1 171 ? 17.301  3.930   -53.043 1.00 50.30  ? 171  VAL B C   1 
ATOM   5519 O O   . VAL B 1 171 ? 16.503  4.488   -53.792 1.00 50.75  ? 171  VAL B O   1 
ATOM   5520 C CB  . VAL B 1 171 ? 19.247  2.914   -54.408 1.00 51.45  ? 171  VAL B CB  1 
ATOM   5521 C CG1 . VAL B 1 171 ? 20.730  3.041   -54.701 1.00 50.16  ? 171  VAL B CG1 1 
ATOM   5522 C CG2 . VAL B 1 171 ? 18.879  1.501   -53.987 1.00 50.15  ? 171  VAL B CG2 1 
ATOM   5523 N N   . GLY B 1 172 ? 16.917  3.305   -51.930 1.00 49.84  ? 172  GLY B N   1 
ATOM   5524 C CA  . GLY B 1 172 ? 15.525  3.357   -51.470 1.00 48.58  ? 172  GLY B CA  1 
ATOM   5525 C C   . GLY B 1 172 ? 15.071  4.756   -51.070 1.00 48.53  ? 172  GLY B C   1 
ATOM   5526 O O   . GLY B 1 172 ? 13.891  5.087   -51.179 1.00 48.19  ? 172  GLY B O   1 
ATOM   5527 N N   . LEU B 1 173 ? 15.992  5.579   -50.573 1.00 48.34  ? 173  LEU B N   1 
ATOM   5528 C CA  . LEU B 1 173 ? 15.666  6.956   -50.248 1.00 48.00  ? 173  LEU B CA  1 
ATOM   5529 C C   . LEU B 1 173 ? 15.556  7.766   -51.530 1.00 48.59  ? 173  LEU B C   1 
ATOM   5530 O O   . LEU B 1 173 ? 14.770  8.705   -51.603 1.00 49.26  ? 173  LEU B O   1 
ATOM   5531 C CB  . LEU B 1 173 ? 16.719  7.570   -49.300 1.00 48.49  ? 173  LEU B CB  1 
ATOM   5532 C CG  . LEU B 1 173 ? 16.815  7.030   -47.853 1.00 47.38  ? 173  LEU B CG  1 
ATOM   5533 C CD1 . LEU B 1 173 ? 18.120  7.469   -47.200 1.00 45.88  ? 173  LEU B CD1 1 
ATOM   5534 C CD2 . LEU B 1 173 ? 15.606  7.515   -47.053 1.00 46.53  ? 173  LEU B CD2 1 
ATOM   5535 N N   . LEU B 1 174 ? 16.349  7.405   -52.538 1.00 48.93  ? 174  LEU B N   1 
ATOM   5536 C CA  . LEU B 1 174 ? 16.301  8.060   -53.841 1.00 48.78  ? 174  LEU B CA  1 
ATOM   5537 C C   . LEU B 1 174 ? 15.020  7.670   -54.583 1.00 48.30  ? 174  LEU B C   1 
ATOM   5538 O O   . LEU B 1 174 ? 14.443  8.483   -55.318 1.00 47.90  ? 174  LEU B O   1 
ATOM   5539 C CB  . LEU B 1 174 ? 17.526  7.693   -54.672 1.00 49.47  ? 174  LEU B CB  1 
ATOM   5540 C CG  . LEU B 1 174 ? 18.850  8.233   -54.130 1.00 49.72  ? 174  LEU B CG  1 
ATOM   5541 C CD1 . LEU B 1 174 ? 20.030  7.672   -54.913 1.00 47.14  ? 174  LEU B CD1 1 
ATOM   5542 C CD2 . LEU B 1 174 ? 18.856  9.754   -54.124 1.00 48.06  ? 174  LEU B CD2 1 
ATOM   5543 N N   . ASP B 1 175 ? 14.571  6.432   -54.378 1.00 47.82  ? 175  ASP B N   1 
ATOM   5544 C CA  . ASP B 1 175 ? 13.236  6.023   -54.826 1.00 47.04  ? 175  ASP B CA  1 
ATOM   5545 C C   . ASP B 1 175 ? 12.196  6.959   -54.246 1.00 46.58  ? 175  ASP B C   1 
ATOM   5546 O O   . ASP B 1 175 ? 11.370  7.491   -54.968 1.00 47.24  ? 175  ASP B O   1 
ATOM   5547 C CB  . ASP B 1 175 ? 12.889  4.611   -54.388 1.00 46.69  ? 175  ASP B CB  1 
ATOM   5548 C CG  . ASP B 1 175 ? 13.764  3.566   -55.019 1.00 47.08  ? 175  ASP B CG  1 
ATOM   5549 O OD1 . ASP B 1 175 ? 14.461  3.872   -56.005 1.00 47.35  ? 175  ASP B OD1 1 
ATOM   5550 O OD2 . ASP B 1 175 ? 13.724  2.414   -54.546 1.00 47.05  ? 175  ASP B OD2 1 
ATOM   5551 N N   . GLN B 1 176 ? 12.209  7.149   -52.936 1.00 46.87  ? 176  GLN B N   1 
ATOM   5552 C CA  . GLN B 1 176 ? 11.237  8.047   -52.307 1.00 46.53  ? 176  GLN B CA  1 
ATOM   5553 C C   . GLN B 1 176 ? 11.339  9.463   -52.860 1.00 47.33  ? 176  GLN B C   1 
ATOM   5554 O O   . GLN B 1 176 ? 10.332  10.109  -53.136 1.00 48.54  ? 176  GLN B O   1 
ATOM   5555 C CB  . GLN B 1 176 ? 11.441  8.105   -50.810 1.00 46.44  ? 176  GLN B CB  1 
ATOM   5556 C CG  . GLN B 1 176 ? 11.334  6.756   -50.072 1.00 46.34  ? 176  GLN B CG  1 
ATOM   5557 C CD  . GLN B 1 176 ? 11.842  6.878   -48.661 1.00 46.29  ? 176  GLN B CD  1 
ATOM   5558 O OE1 . GLN B 1 176 ? 12.052  7.996   -48.172 1.00 47.15  ? 176  GLN B OE1 1 
ATOM   5559 N NE2 . GLN B 1 176 ? 12.050  5.742   -47.993 1.00 45.70  ? 176  GLN B NE2 1 
ATOM   5560 N N   . ARG B 1 177 ? 12.554  9.956   -53.002 1.00 48.10  ? 177  ARG B N   1 
ATOM   5561 C CA  . ARG B 1 177 ? 12.781  11.299  -53.553 1.00 48.93  ? 177  ARG B CA  1 
ATOM   5562 C C   . ARG B 1 177 ? 12.213  11.481  -54.982 1.00 49.59  ? 177  ARG B C   1 
ATOM   5563 O O   . ARG B 1 177 ? 11.671  12.539  -55.318 1.00 49.07  ? 177  ARG B O   1 
ATOM   5564 C CB  . ARG B 1 177 ? 14.283  11.604  -53.553 1.00 49.25  ? 177  ARG B CB  1 
ATOM   5565 C CG  . ARG B 1 177 ? 14.604  12.990  -54.106 1.00 51.06  ? 177  ARG B CG  1 
ATOM   5566 C CD  . ARG B 1 177 ? 16.074  13.253  -54.099 1.00 51.34  ? 177  ARG B CD  1 
ATOM   5567 N NE  . ARG B 1 177 ? 16.508  13.590  -52.765 1.00 53.38  ? 177  ARG B NE  1 
ATOM   5568 C CZ  . ARG B 1 177 ? 17.778  13.722  -52.396 1.00 53.93  ? 177  ARG B CZ  1 
ATOM   5569 N NH1 . ARG B 1 177 ? 18.744  13.533  -53.272 1.00 56.55  ? 177  ARG B NH1 1 
ATOM   5570 N NH2 . ARG B 1 177 ? 18.083  14.041  -51.149 1.00 53.46  ? 177  ARG B NH2 1 
ATOM   5571 N N   . LEU B 1 178 ? 12.360  10.450  -55.817 1.00 49.77  ? 178  LEU B N   1 
ATOM   5572 C CA  . LEU B 1 178 ? 11.819  10.464  -57.172 1.00 50.67  ? 178  LEU B CA  1 
ATOM   5573 C C   . LEU B 1 178 ? 10.292  10.543  -57.166 1.00 50.09  ? 178  LEU B C   1 
ATOM   5574 O O   . LEU B 1 178 ? 9.712   11.244  -57.983 1.00 50.55  ? 178  LEU B O   1 
ATOM   5575 C CB  . LEU B 1 178 ? 12.294  9.241   -57.970 1.00 51.28  ? 178  LEU B CB  1 
ATOM   5576 C CG  . LEU B 1 178 ? 12.050  9.187   -59.493 1.00 51.97  ? 178  LEU B CG  1 
ATOM   5577 C CD1 . LEU B 1 178 ? 12.708  10.357  -60.241 1.00 53.82  ? 178  LEU B CD1 1 
ATOM   5578 C CD2 . LEU B 1 178 ? 12.572  7.867   -60.067 1.00 51.82  ? 178  LEU B CD2 1 
ATOM   5579 N N   . ALA B 1 179 ? 9.651   9.807   -56.264 1.00 49.52  ? 179  ALA B N   1 
ATOM   5580 C CA  . ALA B 1 179 ? 8.196   9.928   -56.045 1.00 49.39  ? 179  ALA B CA  1 
ATOM   5581 C C   . ALA B 1 179 ? 7.822   11.348  -55.598 1.00 50.17  ? 179  ALA B C   1 
ATOM   5582 O O   . ALA B 1 179 ? 6.791   11.899  -56.002 1.00 51.30  ? 179  ALA B O   1 
ATOM   5583 C CB  . ALA B 1 179 ? 7.741   8.909   -55.021 1.00 48.06  ? 179  ALA B CB  1 
ATOM   5584 N N   . LEU B 1 180 ? 8.659   11.942  -54.754 1.00 50.29  ? 180  LEU B N   1 
ATOM   5585 C CA  . LEU B 1 180 ? 8.450   13.316  -54.316 1.00 50.53  ? 180  LEU B CA  1 
ATOM   5586 C C   . LEU B 1 180 ? 8.533   14.256  -55.519 1.00 51.82  ? 180  LEU B C   1 
ATOM   5587 O O   . LEU B 1 180 ? 7.701   15.151  -55.659 1.00 52.18  ? 180  LEU B O   1 
ATOM   5588 C CB  . LEU B 1 180 ? 9.476   13.713  -53.248 1.00 50.29  ? 180  LEU B CB  1 
ATOM   5589 C CG  . LEU B 1 180 ? 9.160   13.520  -51.767 1.00 50.24  ? 180  LEU B CG  1 
ATOM   5590 C CD1 . LEU B 1 180 ? 8.539   12.157  -51.468 1.00 48.71  ? 180  LEU B CD1 1 
ATOM   5591 C CD2 . LEU B 1 180 ? 10.420  13.780  -50.924 1.00 48.85  ? 180  LEU B CD2 1 
ATOM   5592 N N   A GLN B 1 181 ? 9.547   14.042  -56.360 0.50 52.44  ? 181  GLN B N   1 
ATOM   5593 N N   B GLN B 1 181 ? 9.527   14.053  -56.385 0.50 52.68  ? 181  GLN B N   1 
ATOM   5594 C CA  A GLN B 1 181 ? 9.733   14.793  -57.611 0.50 53.45  ? 181  GLN B CA  1 
ATOM   5595 C CA  B GLN B 1 181 ? 9.677   14.863  -57.605 0.50 53.68  ? 181  GLN B CA  1 
ATOM   5596 C C   A GLN B 1 181 ? 8.527   14.627  -58.544 0.50 53.85  ? 181  GLN B C   1 
ATOM   5597 C C   B GLN B 1 181 ? 8.493   14.642  -58.547 0.50 53.99  ? 181  GLN B C   1 
ATOM   5598 O O   A GLN B 1 181 ? 8.053   15.594  -59.142 0.50 54.53  ? 181  GLN B O   1 
ATOM   5599 O O   B GLN B 1 181 ? 7.999   15.588  -59.162 0.50 54.62  ? 181  GLN B O   1 
ATOM   5600 C CB  A GLN B 1 181 ? 11.039  14.361  -58.313 0.50 53.94  ? 181  GLN B CB  1 
ATOM   5601 C CB  B GLN B 1 181 ? 11.004  14.549  -58.316 0.50 54.37  ? 181  GLN B CB  1 
ATOM   5602 C CG  A GLN B 1 181 ? 12.270  15.214  -57.924 0.50 54.54  ? 181  GLN B CG  1 
ATOM   5603 C CG  B GLN B 1 181 ? 11.296  15.381  -59.588 0.50 55.89  ? 181  GLN B CG  1 
ATOM   5604 C CD  A GLN B 1 181 ? 13.614  14.487  -58.043 0.50 54.50  ? 181  GLN B CD  1 
ATOM   5605 C CD  B GLN B 1 181 ? 11.421  16.882  -59.332 0.50 58.54  ? 181  GLN B CD  1 
ATOM   5606 O OE1 A GLN B 1 181 ? 13.727  13.441  -58.676 0.50 54.82  ? 181  GLN B OE1 1 
ATOM   5607 O OE1 B GLN B 1 181 ? 12.257  17.329  -58.542 0.50 59.39  ? 181  GLN B OE1 1 
ATOM   5608 N NE2 A GLN B 1 181 ? 14.638  15.051  -57.419 0.50 54.58  ? 181  GLN B NE2 1 
ATOM   5609 N NE2 B GLN B 1 181 ? 10.600  17.666  -60.022 0.50 60.63  ? 181  GLN B NE2 1 
ATOM   5610 N N   . TRP B 1 182 ? 8.029   13.398  -58.638 1.00 53.06  ? 182  TRP B N   1 
ATOM   5611 C CA  . TRP B 1 182 ? 6.832   13.082  -59.397 1.00 53.25  ? 182  TRP B CA  1 
ATOM   5612 C C   . TRP B 1 182 ? 5.616   13.877  -58.943 1.00 53.64  ? 182  TRP B C   1 
ATOM   5613 O O   . TRP B 1 182 ? 4.817   14.315  -59.769 1.00 54.78  ? 182  TRP B O   1 
ATOM   5614 C CB  . TRP B 1 182 ? 6.526   11.578  -59.296 1.00 52.99  ? 182  TRP B CB  1 
ATOM   5615 C CG  . TRP B 1 182 ? 5.433   11.103  -60.201 1.00 52.85  ? 182  TRP B CG  1 
ATOM   5616 C CD1 . TRP B 1 182 ? 5.587   10.507  -61.410 1.00 53.23  ? 182  TRP B CD1 1 
ATOM   5617 C CD2 . TRP B 1 182 ? 4.019   11.167  -59.963 1.00 53.12  ? 182  TRP B CD2 1 
ATOM   5618 N NE1 . TRP B 1 182 ? 4.365   10.216  -61.952 1.00 53.59  ? 182  TRP B NE1 1 
ATOM   5619 C CE2 . TRP B 1 182 ? 3.384   10.606  -61.086 1.00 53.45  ? 182  TRP B CE2 1 
ATOM   5620 C CE3 . TRP B 1 182 ? 3.230   11.663  -58.919 1.00 52.92  ? 182  TRP B CE3 1 
ATOM   5621 C CZ2 . TRP B 1 182 ? 2.000   10.512  -61.197 1.00 54.38  ? 182  TRP B CZ2 1 
ATOM   5622 C CZ3 . TRP B 1 182 ? 1.858   11.562  -59.020 1.00 53.20  ? 182  TRP B CZ3 1 
ATOM   5623 C CH2 . TRP B 1 182 ? 1.253   10.985  -60.156 1.00 54.20  ? 182  TRP B CH2 1 
ATOM   5624 N N   . VAL B 1 183 ? 5.471   14.052  -57.635 1.00 53.34  ? 183  VAL B N   1 
ATOM   5625 C CA  . VAL B 1 183 ? 4.366   14.811  -57.065 1.00 53.39  ? 183  VAL B CA  1 
ATOM   5626 C C   . VAL B 1 183 ? 4.477   16.301  -57.428 1.00 54.90  ? 183  VAL B C   1 
ATOM   5627 O O   . VAL B 1 183 ? 3.493   16.924  -57.806 1.00 55.52  ? 183  VAL B O   1 
ATOM   5628 C CB  . VAL B 1 183 ? 4.252   14.545  -55.523 1.00 53.02  ? 183  VAL B CB  1 
ATOM   5629 C CG1 . VAL B 1 183 ? 3.365   15.549  -54.815 1.00 52.02  ? 183  VAL B CG1 1 
ATOM   5630 C CG2 . VAL B 1 183 ? 3.760   13.097  -55.278 1.00 51.50  ? 183  VAL B CG2 1 
ATOM   5631 N N   . GLN B 1 184 ? 5.669   16.872  -57.350 1.00 55.38  ? 184  GLN B N   1 
ATOM   5632 C CA  . GLN B 1 184 ? 5.841   18.253  -57.771 1.00 57.25  ? 184  GLN B CA  1 
ATOM   5633 C C   . GLN B 1 184 ? 5.415   18.471  -59.225 1.00 59.14  ? 184  GLN B C   1 
ATOM   5634 O O   . GLN B 1 184 ? 4.802   19.492  -59.545 1.00 60.03  ? 184  GLN B O   1 
ATOM   5635 C CB  . GLN B 1 184 ? 7.291   18.694  -57.586 1.00 57.32  ? 184  GLN B CB  1 
ATOM   5636 C CG  . GLN B 1 184 ? 7.661   18.905  -56.150 1.00 57.26  ? 184  GLN B CG  1 
ATOM   5637 C CD  . GLN B 1 184 ? 6.835   20.009  -55.520 1.00 58.65  ? 184  GLN B CD  1 
ATOM   5638 O OE1 . GLN B 1 184 ? 6.960   21.174  -55.901 1.00 60.19  ? 184  GLN B OE1 1 
ATOM   5639 N NE2 . GLN B 1 184 ? 5.975   19.649  -54.572 1.00 56.22  ? 184  GLN B NE2 1 
ATOM   5640 N N   . GLU B 1 185 ? 5.718   17.500  -60.089 1.00 59.54  ? 185  GLU B N   1 
ATOM   5641 C CA  . GLU B 1 185 ? 5.491   17.624  -61.533 1.00 61.59  ? 185  GLU B CA  1 
ATOM   5642 C C   . GLU B 1 185 ? 4.066   17.306  -61.961 1.00 61.12  ? 185  GLU B C   1 
ATOM   5643 O O   . GLU B 1 185 ? 3.593   17.826  -62.974 1.00 62.32  ? 185  GLU B O   1 
ATOM   5644 C CB  . GLU B 1 185 ? 6.449   16.700  -62.309 1.00 61.27  ? 185  GLU B CB  1 
ATOM   5645 C CG  . GLU B 1 185 ? 7.907   17.129  -62.229 1.00 63.77  ? 185  GLU B CG  1 
ATOM   5646 C CD  . GLU B 1 185 ? 8.908   16.070  -62.729 1.00 65.41  ? 185  GLU B CD  1 
ATOM   5647 O OE1 . GLU B 1 185 ? 8.482   14.925  -63.083 1.00 71.35  ? 185  GLU B OE1 1 
ATOM   5648 O OE2 . GLU B 1 185 ? 10.135  16.393  -62.742 1.00 70.12  ? 185  GLU B OE2 1 
ATOM   5649 N N   . ASN B 1 186 ? 3.387   16.446  -61.203 1.00 59.70  ? 186  ASN B N   1 
ATOM   5650 C CA  . ASN B 1 186 ? 2.130   15.854  -61.652 1.00 59.19  ? 186  ASN B CA  1 
ATOM   5651 C C   . ASN B 1 186 ? 0.904   16.032  -60.763 1.00 57.92  ? 186  ASN B C   1 
ATOM   5652 O O   . ASN B 1 186 ? -0.203  15.810  -61.214 1.00 58.05  ? 186  ASN B O   1 
ATOM   5653 C CB  . ASN B 1 186 ? 2.358   14.360  -61.882 1.00 58.73  ? 186  ASN B CB  1 
ATOM   5654 C CG  . ASN B 1 186 ? 3.336   14.100  -63.002 1.00 59.25  ? 186  ASN B CG  1 
ATOM   5655 O OD1 . ASN B 1 186 ? 3.068   14.453  -64.139 1.00 62.38  ? 186  ASN B OD1 1 
ATOM   5656 N ND2 . ASN B 1 186 ? 4.472   13.497  -62.688 1.00 58.05  ? 186  ASN B ND2 1 
ATOM   5657 N N   . ILE B 1 187 ? 1.092   16.412  -59.507 1.00 56.84  ? 187  ILE B N   1 
ATOM   5658 C CA  . ILE B 1 187 ? 0.010   16.319  -58.541 1.00 55.80  ? 187  ILE B CA  1 
ATOM   5659 C C   . ILE B 1 187 ? -1.077  17.359  -58.829 1.00 56.91  ? 187  ILE B C   1 
ATOM   5660 O O   . ILE B 1 187 ? -2.234  17.111  -58.522 1.00 57.45  ? 187  ILE B O   1 
ATOM   5661 C CB  . ILE B 1 187 ? 0.513   16.369  -57.067 1.00 54.35  ? 187  ILE B CB  1 
ATOM   5662 C CG1 . ILE B 1 187 ? -0.435  15.580  -56.160 1.00 53.17  ? 187  ILE B CG1 1 
ATOM   5663 C CG2 . ILE B 1 187 ? 0.687   17.807  -56.558 1.00 54.42  ? 187  ILE B CG2 1 
ATOM   5664 C CD1 . ILE B 1 187 ? -0.565  14.109  -56.547 1.00 49.69  ? 187  ILE B CD1 1 
ATOM   5665 N N   . ALA B 1 188 ? -0.717  18.479  -59.464 1.00 57.67  ? 188  ALA B N   1 
ATOM   5666 C CA  . ALA B 1 188 ? -1.710  19.487  -59.883 1.00 59.39  ? 188  ALA B CA  1 
ATOM   5667 C C   . ALA B 1 188 ? -2.794  18.872  -60.761 1.00 60.84  ? 188  ALA B C   1 
ATOM   5668 O O   . ALA B 1 188 ? -3.950  19.283  -60.686 1.00 62.09  ? 188  ALA B O   1 
ATOM   5669 C CB  . ALA B 1 188 ? -1.051  20.654  -60.608 1.00 59.63  ? 188  ALA B CB  1 
ATOM   5670 N N   . ALA B 1 189 ? -2.436  17.876  -61.578 1.00 60.71  ? 189  ALA B N   1 
ATOM   5671 C CA  . ALA B 1 189 ? -3.403  17.229  -62.466 1.00 61.70  ? 189  ALA B CA  1 
ATOM   5672 C C   . ALA B 1 189 ? -4.508  16.532  -61.689 1.00 61.70  ? 189  ALA B C   1 
ATOM   5673 O O   . ALA B 1 189 ? -5.569  16.283  -62.233 1.00 63.09  ? 189  ALA B O   1 
ATOM   5674 C CB  . ALA B 1 189 ? -2.700  16.227  -63.400 1.00 61.24  ? 189  ALA B CB  1 
ATOM   5675 N N   . PHE B 1 190 ? -4.255  16.216  -60.424 1.00 60.95  ? 190  PHE B N   1 
ATOM   5676 C CA  . PHE B 1 190 ? -5.230  15.537  -59.572 1.00 61.28  ? 190  PHE B CA  1 
ATOM   5677 C C   . PHE B 1 190 ? -5.944  16.500  -58.638 1.00 62.22  ? 190  PHE B C   1 
ATOM   5678 O O   . PHE B 1 190 ? -6.778  16.077  -57.841 1.00 62.31  ? 190  PHE B O   1 
ATOM   5679 C CB  . PHE B 1 190 ? -4.537  14.482  -58.717 1.00 59.67  ? 190  PHE B CB  1 
ATOM   5680 C CG  . PHE B 1 190 ? -3.784  13.460  -59.508 1.00 58.94  ? 190  PHE B CG  1 
ATOM   5681 C CD1 . PHE B 1 190 ? -2.521  13.735  -59.991 1.00 58.25  ? 190  PHE B CD1 1 
ATOM   5682 C CD2 . PHE B 1 190 ? -4.334  12.213  -59.758 1.00 59.93  ? 190  PHE B CD2 1 
ATOM   5683 C CE1 . PHE B 1 190 ? -1.813  12.778  -60.714 1.00 58.32  ? 190  PHE B CE1 1 
ATOM   5684 C CE2 . PHE B 1 190 ? -3.625  11.246  -60.480 1.00 58.60  ? 190  PHE B CE2 1 
ATOM   5685 C CZ  . PHE B 1 190 ? -2.382  11.533  -60.961 1.00 57.84  ? 190  PHE B CZ  1 
ATOM   5686 N N   . GLY B 1 191 ? -5.607  17.787  -58.730 1.00 63.22  ? 191  GLY B N   1 
ATOM   5687 C CA  . GLY B 1 191 ? -6.157  18.807  -57.837 1.00 63.85  ? 191  GLY B CA  1 
ATOM   5688 C C   . GLY B 1 191 ? -5.279  19.089  -56.631 1.00 62.96  ? 191  GLY B C   1 
ATOM   5689 O O   . GLY B 1 191 ? -5.604  19.950  -55.828 1.00 63.62  ? 191  GLY B O   1 
ATOM   5690 N N   . GLY B 1 192 ? -4.165  18.369  -56.491 1.00 61.67  ? 192  GLY B N   1 
ATOM   5691 C CA  . GLY B 1 192 ? -3.215  18.620  -55.402 1.00 60.69  ? 192  GLY B CA  1 
ATOM   5692 C C   . GLY B 1 192 ? -2.446  19.916  -55.580 1.00 61.31  ? 192  GLY B C   1 
ATOM   5693 O O   . GLY B 1 192 ? -2.239  20.357  -56.702 1.00 62.35  ? 192  GLY B O   1 
ATOM   5694 N N   . ASP B 1 193 ? -2.035  20.524  -54.463 1.00 61.07  ? 193  ASP B N   1 
ATOM   5695 C CA  . ASP B 1 193 ? -1.214  21.734  -54.433 1.00 61.62  ? 193  ASP B CA  1 
ATOM   5696 C C   . ASP B 1 193 ? 0.260   21.357  -54.249 1.00 60.85  ? 193  ASP B C   1 
ATOM   5697 O O   . ASP B 1 193 ? 0.666   20.972  -53.149 1.00 60.02  ? 193  ASP B O   1 
ATOM   5698 C CB  . ASP B 1 193 ? -1.659  22.589  -53.249 1.00 62.30  ? 193  ASP B CB  1 
ATOM   5699 C CG  . ASP B 1 193 ? -1.053  23.990  -53.248 1.00 64.38  ? 193  ASP B CG  1 
ATOM   5700 O OD1 . ASP B 1 193 ? -0.135  24.281  -54.055 1.00 67.61  ? 193  ASP B OD1 1 
ATOM   5701 O OD2 . ASP B 1 193 ? -1.511  24.810  -52.424 1.00 64.24  ? 193  ASP B OD2 1 
ATOM   5702 N N   . PRO B 1 194 ? 1.082   21.468  -55.309 1.00 61.10  ? 194  PRO B N   1 
ATOM   5703 C CA  . PRO B 1 194 ? 2.486   21.088  -55.098 1.00 60.24  ? 194  PRO B CA  1 
ATOM   5704 C C   . PRO B 1 194 ? 3.254   22.030  -54.149 1.00 60.33  ? 194  PRO B C   1 
ATOM   5705 O O   . PRO B 1 194 ? 4.335   21.676  -53.685 1.00 59.40  ? 194  PRO B O   1 
ATOM   5706 C CB  . PRO B 1 194 ? 3.072   21.121  -56.510 1.00 60.93  ? 194  PRO B CB  1 
ATOM   5707 C CG  . PRO B 1 194 ? 2.185   22.073  -57.274 1.00 62.19  ? 194  PRO B CG  1 
ATOM   5708 C CD  . PRO B 1 194 ? 0.825   21.924  -56.688 1.00 62.19  ? 194  PRO B CD  1 
ATOM   5709 N N   . MET B 1 195 ? 2.702   23.209  -53.866 1.00 61.50  ? 195  MET B N   1 
ATOM   5710 C CA  . MET B 1 195 ? 3.288   24.136  -52.891 1.00 62.53  ? 195  MET B CA  1 
ATOM   5711 C C   . MET B 1 195 ? 2.787   23.909  -51.459 1.00 61.19  ? 195  MET B C   1 
ATOM   5712 O O   . MET B 1 195 ? 2.986   24.765  -50.595 1.00 61.80  ? 195  MET B O   1 
ATOM   5713 C CB  . MET B 1 195 ? 3.010   25.595  -53.288 1.00 64.29  ? 195  MET B CB  1 
ATOM   5714 C CG  . MET B 1 195 ? 3.619   25.978  -54.613 1.00 66.55  ? 195  MET B CG  1 
ATOM   5715 S SD  . MET B 1 195 ? 3.464   27.732  -54.937 1.00 71.14  ? 195  MET B SD  1 
ATOM   5716 C CE  . MET B 1 195 ? 1.688   27.892  -55.232 1.00 73.31  ? 195  MET B CE  1 
ATOM   5717 N N   . SER B 1 196 ? 2.130   22.776  -51.215 1.00 59.37  ? 196  SER B N   1 
ATOM   5718 C CA  . SER B 1 196 ? 1.728   22.381  -49.871 1.00 58.13  ? 196  SER B CA  1 
ATOM   5719 C C   . SER B 1 196 ? 1.766   20.866  -49.724 1.00 56.15  ? 196  SER B C   1 
ATOM   5720 O O   . SER B 1 196 ? 0.728   20.196  -49.754 1.00 55.87  ? 196  SER B O   1 
ATOM   5721 C CB  . SER B 1 196 ? 0.336   22.892  -49.560 1.00 59.13  ? 196  SER B CB  1 
ATOM   5722 O OG  . SER B 1 196 ? -0.060  22.472  -48.275 1.00 60.52  ? 196  SER B OG  1 
ATOM   5723 N N   . VAL B 1 197 ? 2.972   20.336  -49.571 1.00 54.07  ? 197  VAL B N   1 
ATOM   5724 C CA  . VAL B 1 197 ? 3.174   18.911  -49.438 1.00 52.26  ? 197  VAL B CA  1 
ATOM   5725 C C   . VAL B 1 197 ? 3.688   18.608  -48.048 1.00 51.56  ? 197  VAL B C   1 
ATOM   5726 O O   . VAL B 1 197 ? 4.591   19.277  -47.554 1.00 51.70  ? 197  VAL B O   1 
ATOM   5727 C CB  . VAL B 1 197 ? 4.165   18.405  -50.468 1.00 51.91  ? 197  VAL B CB  1 
ATOM   5728 C CG1 . VAL B 1 197 ? 4.535   16.928  -50.189 1.00 50.92  ? 197  VAL B CG1 1 
ATOM   5729 C CG2 . VAL B 1 197 ? 3.583   18.589  -51.859 1.00 51.11  ? 197  VAL B CG2 1 
ATOM   5730 N N   . THR B 1 198 ? 3.093   17.596  -47.423 1.00 50.50  ? 198  THR B N   1 
ATOM   5731 C CA  . THR B 1 198 ? 3.461   17.179  -46.097 1.00 49.06  ? 198  THR B CA  1 
ATOM   5732 C C   . THR B 1 198 ? 3.873   15.739  -46.189 1.00 48.10  ? 198  THR B C   1 
ATOM   5733 O O   . THR B 1 198 ? 3.107   14.883  -46.659 1.00 47.88  ? 198  THR B O   1 
ATOM   5734 C CB  . THR B 1 198 ? 2.284   17.371  -45.117 1.00 49.81  ? 198  THR B CB  1 
ATOM   5735 O OG1 . THR B 1 198 ? 1.912   18.746  -45.122 1.00 51.93  ? 198  THR B OG1 1 
ATOM   5736 C CG2 . THR B 1 198 ? 2.645   16.994  -43.688 1.00 48.42  ? 198  THR B CG2 1 
ATOM   5737 N N   . LEU B 1 199 ? 5.103   15.465  -45.782 1.00 47.00  ? 199  LEU B N   1 
ATOM   5738 C CA  . LEU B 1 199 ? 5.530   14.085  -45.652 1.00 46.43  ? 199  LEU B CA  1 
ATOM   5739 C C   . LEU B 1 199 ? 5.074   13.598  -44.303 1.00 46.15  ? 199  LEU B C   1 
ATOM   5740 O O   . LEU B 1 199 ? 5.185   14.302  -43.321 1.00 46.29  ? 199  LEU B O   1 
ATOM   5741 C CB  . LEU B 1 199 ? 7.053   13.956  -45.775 1.00 45.68  ? 199  LEU B CB  1 
ATOM   5742 C CG  . LEU B 1 199 ? 7.705   14.628  -46.982 1.00 46.57  ? 199  LEU B CG  1 
ATOM   5743 C CD1 . LEU B 1 199 ? 9.223   14.431  -46.929 1.00 45.31  ? 199  LEU B CD1 1 
ATOM   5744 C CD2 . LEU B 1 199 ? 7.099   14.114  -48.287 1.00 45.52  ? 199  LEU B CD2 1 
ATOM   5745 N N   . PHE B 1 200 ? 4.556   12.388  -44.251 1.00 46.90  ? 200  PHE B N   1 
ATOM   5746 C CA  . PHE B 1 200 ? 4.341   11.714  -42.989 1.00 46.72  ? 200  PHE B CA  1 
ATOM   5747 C C   . PHE B 1 200 ? 4.706   10.257  -43.105 1.00 46.51  ? 200  PHE B C   1 
ATOM   5748 O O   . PHE B 1 200 ? 4.546   9.668   -44.150 1.00 46.10  ? 200  PHE B O   1 
ATOM   5749 C CB  . PHE B 1 200 ? 2.928   11.962  -42.395 1.00 47.58  ? 200  PHE B CB  1 
ATOM   5750 C CG  . PHE B 1 200 ? 1.764   11.257  -43.071 1.00 48.44  ? 200  PHE B CG  1 
ATOM   5751 C CD1 . PHE B 1 200 ? 1.582   11.272  -44.440 1.00 48.07  ? 200  PHE B CD1 1 
ATOM   5752 C CD2 . PHE B 1 200 ? 0.757   10.706  -42.281 1.00 49.38  ? 200  PHE B CD2 1 
ATOM   5753 C CE1 . PHE B 1 200 ? 0.452   10.678  -45.011 1.00 50.00  ? 200  PHE B CE1 1 
ATOM   5754 C CE2 . PHE B 1 200 ? -0.361  10.127  -42.836 1.00 50.51  ? 200  PHE B CE2 1 
ATOM   5755 C CZ  . PHE B 1 200 ? -0.520  10.108  -44.206 1.00 50.20  ? 200  PHE B CZ  1 
ATOM   5756 N N   . GLY B 1 201 ? 5.243   9.700   -42.031 1.00 46.78  ? 201  GLY B N   1 
ATOM   5757 C CA  . GLY B 1 201 ? 5.573   8.272   -41.988 1.00 47.10  ? 201  GLY B CA  1 
ATOM   5758 C C   . GLY B 1 201 ? 5.770   7.788   -40.568 1.00 47.58  ? 201  GLY B C   1 
ATOM   5759 O O   . GLY B 1 201 ? 5.812   8.600   -39.647 1.00 47.69  ? 201  GLY B O   1 
ATOM   5760 N N   . GLU B 1 202 ? 5.886   6.468   -40.405 1.00 47.98  ? 202  GLU B N   1 
ATOM   5761 C CA  . GLU B 1 202 ? 6.029   5.839   -39.118 1.00 48.84  ? 202  GLU B CA  1 
ATOM   5762 C C   . GLU B 1 202 ? 7.235   4.879   -39.101 1.00 49.17  ? 202  GLU B C   1 
ATOM   5763 O O   . GLU B 1 202 ? 7.516   4.205   -40.085 1.00 49.30  ? 202  GLU B O   1 
ATOM   5764 C CB  . GLU B 1 202 ? 4.741   5.107   -38.776 1.00 49.58  ? 202  GLU B CB  1 
ATOM   5765 C CG  . GLU B 1 202 ? 4.660   4.551   -37.364 1.00 50.94  ? 202  GLU B CG  1 
ATOM   5766 C CD  . GLU B 1 202 ? 5.224   3.144   -37.227 1.00 54.47  ? 202  GLU B CD  1 
ATOM   5767 O OE1 . GLU B 1 202 ? 5.507   2.488   -38.248 1.00 55.98  ? 202  GLU B OE1 1 
ATOM   5768 O OE2 . GLU B 1 202 ? 5.381   2.693   -36.081 1.00 56.37  ? 202  GLU B OE2 1 
ATOM   5769 N N   . SER B 1 203 ? 7.940   4.853   -37.976 1.00 49.44  ? 203  SER B N   1 
ATOM   5770 C CA  . SER B 1 203 ? 9.134   3.995   -37.774 1.00 50.24  ? 203  SER B CA  1 
ATOM   5771 C C   . SER B 1 203 ? 10.205  4.321   -38.822 1.00 49.50  ? 203  SER B C   1 
ATOM   5772 O O   . SER B 1 203 ? 10.645  5.475   -38.885 1.00 49.87  ? 203  SER B O   1 
ATOM   5773 C CB  . SER B 1 203 ? 8.735   2.511   -37.733 1.00 50.77  ? 203  SER B CB  1 
ATOM   5774 O OG  . SER B 1 203 ? 9.821   1.663   -37.282 1.00 57.46  ? 203  SER B OG  1 
ATOM   5775 N N   . ALA B 1 204 ? 10.603  3.355   -39.654 1.00 48.85  ? 204  ALA B N   1 
ATOM   5776 C CA  . ALA B 1 204 ? 11.603  3.598   -40.704 1.00 48.88  ? 204  ALA B CA  1 
ATOM   5777 C C   . ALA B 1 204 ? 11.116  4.630   -41.716 1.00 48.07  ? 204  ALA B C   1 
ATOM   5778 O O   . ALA B 1 204 ? 11.925  5.303   -42.361 1.00 47.53  ? 204  ALA B O   1 
ATOM   5779 C CB  . ALA B 1 204 ? 12.000  2.289   -41.419 1.00 48.91  ? 204  ALA B CB  1 
ATOM   5780 N N   . GLY B 1 205 ? 9.797   4.778   -41.845 1.00 47.96  ? 205  GLY B N   1 
ATOM   5781 C CA  . GLY B 1 205 ? 9.231   5.844   -42.684 1.00 47.57  ? 205  GLY B CA  1 
ATOM   5782 C C   . GLY B 1 205 ? 9.412   7.235   -42.105 1.00 47.44  ? 205  GLY B C   1 
ATOM   5783 O O   . GLY B 1 205 ? 9.558   8.222   -42.828 1.00 47.49  ? 205  GLY B O   1 
ATOM   5784 N N   . ALA B 1 206 ? 9.348   7.317   -40.783 1.00 47.68  ? 206  ALA B N   1 
ATOM   5785 C CA  . ALA B 1 206 ? 9.617   8.550   -40.055 1.00 46.70  ? 206  ALA B CA  1 
ATOM   5786 C C   . ALA B 1 206 ? 11.107  8.855   -40.100 1.00 46.49  ? 206  ALA B C   1 
ATOM   5787 O O   . ALA B 1 206 ? 11.500  10.008  -40.273 1.00 46.86  ? 206  ALA B O   1 
ATOM   5788 C CB  . ALA B 1 206 ? 9.127   8.420   -38.628 1.00 47.14  ? 206  ALA B CB  1 
ATOM   5789 N N   . ALA B 1 207 ? 11.950  7.828   -39.974 1.00 46.25  ? 207  ALA B N   1 
ATOM   5790 C CA  . ALA B 1 207 ? 13.399  8.013   -40.147 1.00 46.36  ? 207  ALA B CA  1 
ATOM   5791 C C   . ALA B 1 207 ? 13.686  8.584   -41.533 1.00 46.67  ? 207  ALA B C   1 
ATOM   5792 O O   . ALA B 1 207 ? 14.422  9.563   -41.673 1.00 46.09  ? 207  ALA B O   1 
ATOM   5793 C CB  . ALA B 1 207 ? 14.140  6.721   -39.941 1.00 46.83  ? 207  ALA B CB  1 
ATOM   5794 N N   . SER B 1 208 ? 13.035  7.981   -42.538 1.00 46.64  ? 208  SER B N   1 
ATOM   5795 C CA  . SER B 1 208 ? 13.070  8.438   -43.938 1.00 46.25  ? 208  SER B CA  1 
ATOM   5796 C C   . SER B 1 208 ? 12.699  9.912   -44.094 1.00 46.24  ? 208  SER B C   1 
ATOM   5797 O O   . SER B 1 208 ? 13.483  10.693  -44.642 1.00 46.47  ? 208  SER B O   1 
ATOM   5798 C CB  . SER B 1 208 ? 12.173  7.565   -44.790 1.00 46.53  ? 208  SER B CB  1 
ATOM   5799 O OG  . SER B 1 208 ? 12.693  6.233   -44.886 1.00 47.08  ? 208  SER B OG  1 
ATOM   5800 N N   . VAL B 1 209 ? 11.521  10.304  -43.606 1.00 45.57  ? 209  VAL B N   1 
ATOM   5801 C CA  . VAL B 1 209 ? 11.147  11.729  -43.545 1.00 44.85  ? 209  VAL B CA  1 
ATOM   5802 C C   . VAL B 1 209 ? 12.248  12.622  -42.964 1.00 46.00  ? 209  VAL B C   1 
ATOM   5803 O O   . VAL B 1 209 ? 12.564  13.696  -43.516 1.00 47.55  ? 209  VAL B O   1 
ATOM   5804 C CB  . VAL B 1 209 ? 9.829   11.941  -42.741 1.00 44.83  ? 209  VAL B CB  1 
ATOM   5805 C CG1 . VAL B 1 209 ? 9.527   13.444  -42.519 1.00 43.53  ? 209  VAL B CG1 1 
ATOM   5806 C CG2 . VAL B 1 209 ? 8.675   11.261  -43.454 1.00 41.60  ? 209  VAL B CG2 1 
ATOM   5807 N N   . GLY B 1 210 ? 12.827  12.211  -41.843 1.00 46.51  ? 210  GLY B N   1 
ATOM   5808 C CA  . GLY B 1 210 ? 13.897  12.994  -41.224 1.00 47.21  ? 210  GLY B CA  1 
ATOM   5809 C C   . GLY B 1 210 ? 15.115  13.104  -42.113 1.00 48.36  ? 210  GLY B C   1 
ATOM   5810 O O   . GLY B 1 210 ? 15.797  14.129  -42.134 1.00 48.49  ? 210  GLY B O   1 
ATOM   5811 N N   . MET B 1 211 ? 15.394  12.043  -42.861 1.00 48.48  ? 211  MET B N   1 
ATOM   5812 C CA  . MET B 1 211 ? 16.505  12.071  -43.811 1.00 49.65  ? 211  MET B CA  1 
ATOM   5813 C C   . MET B 1 211 ? 16.233  13.012  -44.984 1.00 49.22  ? 211  MET B C   1 
ATOM   5814 O O   . MET B 1 211 ? 17.141  13.674  -45.455 1.00 50.28  ? 211  MET B O   1 
ATOM   5815 C CB  . MET B 1 211 ? 16.874  10.659  -44.257 1.00 49.21  ? 211  MET B CB  1 
ATOM   5816 C CG  . MET B 1 211 ? 17.752  9.961   -43.198 1.00 50.79  ? 211  MET B CG  1 
ATOM   5817 S SD  . MET B 1 211 ? 17.796  8.178   -43.358 1.00 54.00  ? 211  MET B SD  1 
ATOM   5818 C CE  . MET B 1 211 ? 18.099  7.705   -41.654 1.00 50.55  ? 211  MET B CE  1 
ATOM   5819 N N   . HIS B 1 212 ? 14.982  13.135  -45.407 1.00 48.27  ? 212  HIS B N   1 
ATOM   5820 C CA  . HIS B 1 212 ? 14.642  14.136  -46.402 1.00 48.50  ? 212  HIS B CA  1 
ATOM   5821 C C   . HIS B 1 212 ? 14.773  15.561  -45.827 1.00 49.37  ? 212  HIS B C   1 
ATOM   5822 O O   . HIS B 1 212 ? 15.179  16.472  -46.558 1.00 51.56  ? 212  HIS B O   1 
ATOM   5823 C CB  . HIS B 1 212 ? 13.242  13.882  -46.988 1.00 48.11  ? 212  HIS B CB  1 
ATOM   5824 C CG  . HIS B 1 212 ? 13.145  12.623  -47.797 1.00 46.27  ? 212  HIS B CG  1 
ATOM   5825 N ND1 . HIS B 1 212 ? 13.774  12.464  -49.011 1.00 45.99  ? 212  HIS B ND1 1 
ATOM   5826 C CD2 . HIS B 1 212 ? 12.507  11.458  -47.549 1.00 46.39  ? 212  HIS B CD2 1 
ATOM   5827 C CE1 . HIS B 1 212 ? 13.517  11.255  -49.478 1.00 48.52  ? 212  HIS B CE1 1 
ATOM   5828 N NE2 . HIS B 1 212 ? 12.756  10.621  -48.605 1.00 46.49  ? 212  HIS B NE2 1 
ATOM   5829 N N   . ILE B 1 213 ? 14.475  15.764  -44.541 1.00 48.85  ? 213  ILE B N   1 
ATOM   5830 C CA  . ILE B 1 213 ? 14.705  17.084  -43.886 1.00 49.38  ? 213  ILE B CA  1 
ATOM   5831 C C   . ILE B 1 213 ? 16.198  17.437  -43.904 1.00 50.85  ? 213  ILE B C   1 
ATOM   5832 O O   . ILE B 1 213 ? 16.586  18.597  -44.074 1.00 52.18  ? 213  ILE B O   1 
ATOM   5833 C CB  . ILE B 1 213 ? 14.215  17.102  -42.407 1.00 49.02  ? 213  ILE B CB  1 
ATOM   5834 C CG1 . ILE B 1 213 ? 12.693  16.945  -42.318 1.00 48.34  ? 213  ILE B CG1 1 
ATOM   5835 C CG2 . ILE B 1 213 ? 14.597  18.409  -41.690 1.00 49.71  ? 213  ILE B CG2 1 
ATOM   5836 C CD1 . ILE B 1 213 ? 12.158  16.746  -40.889 1.00 47.26  ? 213  ILE B CD1 1 
ATOM   5837 N N   . LEU B 1 214 ? 17.032  16.415  -43.738 1.00 51.73  ? 214  LEU B N   1 
ATOM   5838 C CA  . LEU B 1 214 ? 18.484  16.577  -43.595 1.00 53.22  ? 214  LEU B CA  1 
ATOM   5839 C C   . LEU B 1 214 ? 19.275  16.462  -44.901 1.00 54.33  ? 214  LEU B C   1 
ATOM   5840 O O   . LEU B 1 214 ? 20.505  16.548  -44.875 1.00 55.65  ? 214  LEU B O   1 
ATOM   5841 C CB  . LEU B 1 214 ? 19.002  15.545  -42.589 1.00 52.79  ? 214  LEU B CB  1 
ATOM   5842 C CG  . LEU B 1 214 ? 18.409  15.642  -41.179 1.00 52.70  ? 214  LEU B CG  1 
ATOM   5843 C CD1 . LEU B 1 214 ? 18.911  14.481  -40.332 1.00 53.53  ? 214  LEU B CD1 1 
ATOM   5844 C CD2 . LEU B 1 214 ? 18.766  16.986  -40.538 1.00 54.22  ? 214  LEU B CD2 1 
ATOM   5845 N N   . SER B 1 215 ? 18.584  16.273  -46.033 1.00 54.60  ? 215  SER B N   1 
ATOM   5846 C CA  . SER B 1 215 ? 19.225  16.194  -47.345 1.00 55.26  ? 215  SER B CA  1 
ATOM   5847 C C   . SER B 1 215 ? 18.714  17.304  -48.257 1.00 56.59  ? 215  SER B C   1 
ATOM   5848 O O   . SER B 1 215 ? 17.545  17.345  -48.605 1.00 56.19  ? 215  SER B O   1 
ATOM   5849 C CB  . SER B 1 215 ? 18.975  14.827  -47.969 1.00 54.93  ? 215  SER B CB  1 
ATOM   5850 O OG  . SER B 1 215 ? 19.885  14.570  -49.022 1.00 54.58  ? 215  SER B OG  1 
ATOM   5851 N N   . LEU B 1 216 ? 19.612  18.198  -48.650 1.00 58.83  ? 216  LEU B N   1 
ATOM   5852 C CA  . LEU B 1 216 ? 19.229  19.455  -49.315 1.00 60.76  ? 216  LEU B CA  1 
ATOM   5853 C C   . LEU B 1 216 ? 18.348  19.306  -50.569 1.00 60.40  ? 216  LEU B C   1 
ATOM   5854 O O   . LEU B 1 216 ? 17.357  20.025  -50.706 1.00 60.61  ? 216  LEU B O   1 
ATOM   5855 C CB  . LEU B 1 216 ? 20.471  20.292  -49.647 1.00 62.32  ? 216  LEU B CB  1 
ATOM   5856 C CG  . LEU B 1 216 ? 20.235  21.795  -49.551 1.00 65.13  ? 216  LEU B CG  1 
ATOM   5857 C CD1 . LEU B 1 216 ? 20.030  22.185  -48.078 1.00 66.85  ? 216  LEU B CD1 1 
ATOM   5858 C CD2 . LEU B 1 216 ? 21.402  22.568  -50.190 1.00 66.26  ? 216  LEU B CD2 1 
ATOM   5859 N N   . PRO B 1 217 ? 18.724  18.418  -51.505 1.00 60.33  ? 217  PRO B N   1 
ATOM   5860 C CA  . PRO B 1 217 ? 17.894  18.145  -52.682 1.00 60.12  ? 217  PRO B CA  1 
ATOM   5861 C C   . PRO B 1 217 ? 16.407  17.810  -52.427 1.00 59.40  ? 217  PRO B C   1 
ATOM   5862 O O   . PRO B 1 217 ? 15.549  18.121  -53.274 1.00 59.73  ? 217  PRO B O   1 
ATOM   5863 C CB  . PRO B 1 217 ? 18.596  16.944  -53.303 1.00 60.03  ? 217  PRO B CB  1 
ATOM   5864 C CG  . PRO B 1 217 ? 19.996  17.128  -52.962 1.00 60.52  ? 217  PRO B CG  1 
ATOM   5865 C CD  . PRO B 1 217 ? 19.988  17.659  -51.569 1.00 60.85  ? 217  PRO B CD  1 
ATOM   5866 N N   . SER B 1 218 ? 16.108  17.182  -51.288 1.00 58.41  ? 218  SER B N   1 
ATOM   5867 C CA  . SER B 1 218 ? 14.733  16.823  -50.931 1.00 57.22  ? 218  SER B CA  1 
ATOM   5868 C C   . SER B 1 218 ? 13.917  18.008  -50.464 1.00 57.91  ? 218  SER B C   1 
ATOM   5869 O O   . SER B 1 218 ? 12.708  17.989  -50.565 1.00 57.06  ? 218  SER B O   1 
ATOM   5870 C CB  . SER B 1 218 ? 14.720  15.762  -49.842 1.00 56.20  ? 218  SER B CB  1 
ATOM   5871 O OG  . SER B 1 218 ? 15.141  14.511  -50.343 1.00 54.48  ? 218  SER B OG  1 
ATOM   5872 N N   . ARG B 1 219 ? 14.586  19.045  -49.973 1.00 59.59  ? 219  ARG B N   1 
ATOM   5873 C CA  . ARG B 1 219 ? 13.923  20.147  -49.282 1.00 60.69  ? 219  ARG B CA  1 
ATOM   5874 C C   . ARG B 1 219 ? 13.070  21.034  -50.168 1.00 61.22  ? 219  ARG B C   1 
ATOM   5875 O O   . ARG B 1 219 ? 12.157  21.689  -49.679 1.00 62.22  ? 219  ARG B O   1 
ATOM   5876 C CB  . ARG B 1 219 ? 14.964  21.003  -48.556 1.00 62.09  ? 219  ARG B CB  1 
ATOM   5877 C CG  . ARG B 1 219 ? 15.687  20.256  -47.433 1.00 63.05  ? 219  ARG B CG  1 
ATOM   5878 C CD  . ARG B 1 219 ? 14.748  19.847  -46.301 1.00 64.91  ? 219  ARG B CD  1 
ATOM   5879 N NE  . ARG B 1 219 ? 13.962  20.974  -45.797 1.00 66.14  ? 219  ARG B NE  1 
ATOM   5880 C CZ  . ARG B 1 219 ? 14.343  21.813  -44.830 1.00 68.61  ? 219  ARG B CZ  1 
ATOM   5881 N NH1 . ARG B 1 219 ? 15.499  21.668  -44.177 1.00 69.45  ? 219  ARG B NH1 1 
ATOM   5882 N NH2 . ARG B 1 219 ? 13.534  22.812  -44.497 1.00 69.58  ? 219  ARG B NH2 1 
ATOM   5883 N N   . SER B 1 220 ? 13.367  21.068  -51.458 1.00 61.43  ? 220  SER B N   1 
ATOM   5884 C CA  . SER B 1 220 ? 12.514  21.756  -52.412 1.00 62.04  ? 220  SER B CA  1 
ATOM   5885 C C   . SER B 1 220 ? 11.290  20.913  -52.815 1.00 60.84  ? 220  SER B C   1 
ATOM   5886 O O   . SER B 1 220 ? 10.471  21.360  -53.614 1.00 61.48  ? 220  SER B O   1 
ATOM   5887 C CB  . SER B 1 220 ? 13.325  22.163  -53.651 1.00 63.60  ? 220  SER B CB  1 
ATOM   5888 O OG  . SER B 1 220 ? 13.908  21.030  -54.299 1.00 65.17  ? 220  SER B OG  1 
ATOM   5889 N N   . LEU B 1 221 ? 11.150  19.716  -52.253 1.00 58.89  ? 221  LEU B N   1 
ATOM   5890 C CA  . LEU B 1 221 ? 10.072  18.798  -52.644 1.00 58.04  ? 221  LEU B CA  1 
ATOM   5891 C C   . LEU B 1 221 ? 8.975   18.648  -51.595 1.00 57.11  ? 221  LEU B C   1 
ATOM   5892 O O   . LEU B 1 221 ? 8.015   17.901  -51.807 1.00 56.78  ? 221  LEU B O   1 
ATOM   5893 C CB  . LEU B 1 221 ? 10.644  17.419  -52.961 1.00 56.98  ? 221  LEU B CB  1 
ATOM   5894 C CG  . LEU B 1 221 ? 11.819  17.330  -53.932 1.00 56.51  ? 221  LEU B CG  1 
ATOM   5895 C CD1 . LEU B 1 221 ? 12.124  15.896  -54.200 1.00 55.39  ? 221  LEU B CD1 1 
ATOM   5896 C CD2 . LEU B 1 221 ? 11.518  18.059  -55.223 1.00 57.24  ? 221  LEU B CD2 1 
ATOM   5897 N N   . PHE B 1 222 ? 9.122   19.327  -50.460 1.00 57.05  ? 222  PHE B N   1 
ATOM   5898 C CA  . PHE B 1 222 ? 8.063   19.387  -49.447 1.00 56.48  ? 222  PHE B CA  1 
ATOM   5899 C C   . PHE B 1 222 ? 8.216   20.613  -48.540 1.00 57.29  ? 222  PHE B C   1 
ATOM   5900 O O   . PHE B 1 222 ? 9.249   21.301  -48.564 1.00 57.52  ? 222  PHE B O   1 
ATOM   5901 C CB  . PHE B 1 222 ? 8.040   18.109  -48.607 1.00 55.27  ? 222  PHE B CB  1 
ATOM   5902 C CG  . PHE B 1 222 ? 9.258   17.924  -47.753 1.00 54.83  ? 222  PHE B CG  1 
ATOM   5903 C CD1 . PHE B 1 222 ? 10.448  17.480  -48.311 1.00 54.00  ? 222  PHE B CD1 1 
ATOM   5904 C CD2 . PHE B 1 222 ? 9.219   18.216  -46.379 1.00 55.26  ? 222  PHE B CD2 1 
ATOM   5905 C CE1 . PHE B 1 222 ? 11.571  17.325  -47.526 1.00 54.90  ? 222  PHE B CE1 1 
ATOM   5906 C CE2 . PHE B 1 222 ? 10.339  18.066  -45.583 1.00 53.88  ? 222  PHE B CE2 1 
ATOM   5907 C CZ  . PHE B 1 222 ? 11.519  17.621  -46.153 1.00 55.15  ? 222  PHE B CZ  1 
ATOM   5908 N N   . HIS B 1 223 ? 7.178   20.865  -47.740 1.00 57.19  ? 223  HIS B N   1 
ATOM   5909 C CA  . HIS B 1 223 ? 7.115   22.054  -46.892 1.00 58.37  ? 223  HIS B CA  1 
ATOM   5910 C C   . HIS B 1 223 ? 6.994   21.734  -45.397 1.00 57.12  ? 223  HIS B C   1 
ATOM   5911 O O   . HIS B 1 223 ? 7.496   22.486  -44.567 1.00 56.70  ? 223  HIS B O   1 
ATOM   5912 C CB  . HIS B 1 223 ? 5.972   22.970  -47.372 1.00 59.81  ? 223  HIS B CB  1 
ATOM   5913 C CG  . HIS B 1 223 ? 5.956   23.147  -48.858 1.00 61.88  ? 223  HIS B CG  1 
ATOM   5914 N ND1 . HIS B 1 223 ? 5.485   22.173  -49.717 1.00 62.74  ? 223  HIS B ND1 1 
ATOM   5915 C CD2 . HIS B 1 223 ? 6.413   24.150  -49.643 1.00 64.30  ? 223  HIS B CD2 1 
ATOM   5916 C CE1 . HIS B 1 223 ? 5.647   22.570  -50.964 1.00 63.01  ? 223  HIS B CE1 1 
ATOM   5917 N NE2 . HIS B 1 223 ? 6.196   23.773  -50.948 1.00 65.55  ? 223  HIS B NE2 1 
ATOM   5918 N N   . ARG B 1 224 ? 6.362   20.610  -45.063 1.00 55.67  ? 224  ARG B N   1 
ATOM   5919 C CA  . ARG B 1 224 ? 6.154   20.213  -43.666 1.00 55.24  ? 224  ARG B CA  1 
ATOM   5920 C C   . ARG B 1 224 ? 6.401   18.725  -43.478 1.00 52.84  ? 224  ARG B C   1 
ATOM   5921 O O   . ARG B 1 224 ? 6.420   17.966  -44.465 1.00 51.85  ? 224  ARG B O   1 
ATOM   5922 C CB  . ARG B 1 224 ? 4.721   20.539  -43.267 1.00 55.70  ? 224  ARG B CB  1 
ATOM   5923 C CG  . ARG B 1 224 ? 4.520   21.980  -43.045 1.00 59.16  ? 224  ARG B CG  1 
ATOM   5924 C CD  . ARG B 1 224 ? 3.053   22.337  -42.778 1.00 60.03  ? 224  ARG B CD  1 
ATOM   5925 N NE  . ARG B 1 224 ? 2.355   22.452  -44.040 1.00 63.71  ? 224  ARG B NE  1 
ATOM   5926 C CZ  . ARG B 1 224 ? 2.493   23.471  -44.887 1.00 65.37  ? 224  ARG B CZ  1 
ATOM   5927 N NH1 . ARG B 1 224 ? 3.305   24.482  -44.616 1.00 66.70  ? 224  ARG B NH1 1 
ATOM   5928 N NH2 . ARG B 1 224 ? 1.823   23.466  -46.031 1.00 67.12  ? 224  ARG B NH2 1 
ATOM   5929 N N   . ALA B 1 225 ? 6.596   18.300  -42.225 1.00 51.32  ? 225  ALA B N   1 
ATOM   5930 C CA  . ALA B 1 225 ? 6.876   16.880  -41.934 1.00 49.65  ? 225  ALA B CA  1 
ATOM   5931 C C   . ALA B 1 225 ? 6.208   16.366  -40.668 1.00 48.69  ? 225  ALA B C   1 
ATOM   5932 O O   . ALA B 1 225 ? 5.952   17.123  -39.737 1.00 48.95  ? 225  ALA B O   1 
ATOM   5933 C CB  . ALA B 1 225 ? 8.368   16.640  -41.857 1.00 49.38  ? 225  ALA B CB  1 
ATOM   5934 N N   . VAL B 1 226 ? 5.920   15.068  -40.658 1.00 47.22  ? 226  VAL B N   1 
ATOM   5935 C CA  . VAL B 1 226 ? 5.377   14.364  -39.502 1.00 46.08  ? 226  VAL B CA  1 
ATOM   5936 C C   . VAL B 1 226 ? 6.217   13.114  -39.320 1.00 45.81  ? 226  VAL B C   1 
ATOM   5937 O O   . VAL B 1 226 ? 6.344   12.319  -40.247 1.00 44.88  ? 226  VAL B O   1 
ATOM   5938 C CB  . VAL B 1 226 ? 3.901   13.940  -39.696 1.00 46.25  ? 226  VAL B CB  1 
ATOM   5939 C CG1 . VAL B 1 226 ? 3.410   13.122  -38.496 1.00 44.75  ? 226  VAL B CG1 1 
ATOM   5940 C CG2 . VAL B 1 226 ? 2.999   15.175  -39.922 1.00 45.54  ? 226  VAL B CG2 1 
ATOM   5941 N N   . LEU B 1 227 ? 6.821   12.969  -38.141 1.00 46.08  ? 227  LEU B N   1 
ATOM   5942 C CA  . LEU B 1 227 ? 7.640   11.798  -37.816 1.00 45.63  ? 227  LEU B CA  1 
ATOM   5943 C C   . LEU B 1 227 ? 6.966   11.034  -36.701 1.00 45.19  ? 227  LEU B C   1 
ATOM   5944 O O   . LEU B 1 227 ? 7.005   11.438  -35.542 1.00 44.56  ? 227  LEU B O   1 
ATOM   5945 C CB  . LEU B 1 227 ? 9.053   12.199  -37.388 1.00 45.97  ? 227  LEU B CB  1 
ATOM   5946 C CG  . LEU B 1 227 ? 9.946   12.770  -38.493 1.00 46.64  ? 227  LEU B CG  1 
ATOM   5947 C CD1 . LEU B 1 227 ? 9.691   14.288  -38.664 1.00 44.66  ? 227  LEU B CD1 1 
ATOM   5948 C CD2 . LEU B 1 227 ? 11.421  12.514  -38.195 1.00 45.96  ? 227  LEU B CD2 1 
ATOM   5949 N N   . GLN B 1 228 ? 6.346   9.919   -37.054 1.00 44.47  ? 228  GLN B N   1 
ATOM   5950 C CA  . GLN B 1 228 ? 5.682   9.101   -36.079 1.00 45.17  ? 228  GLN B CA  1 
ATOM   5951 C C   . GLN B 1 228 ? 6.569   7.954   -35.633 1.00 45.45  ? 228  GLN B C   1 
ATOM   5952 O O   . GLN B 1 228 ? 6.818   7.037   -36.410 1.00 45.91  ? 228  GLN B O   1 
ATOM   5953 C CB  . GLN B 1 228 ? 4.408   8.529   -36.691 1.00 45.54  ? 228  GLN B CB  1 
ATOM   5954 C CG  . GLN B 1 228 ? 3.446   9.608   -37.197 1.00 46.31  ? 228  GLN B CG  1 
ATOM   5955 C CD  . GLN B 1 228 ? 2.252   9.059   -37.964 1.00 46.97  ? 228  GLN B CD  1 
ATOM   5956 O OE1 . GLN B 1 228 ? 1.761   9.724   -38.867 1.00 50.19  ? 228  GLN B OE1 1 
ATOM   5957 N NE2 . GLN B 1 228 ? 1.799   7.841   -37.633 1.00 45.74  ? 228  GLN B NE2 1 
ATOM   5958 N N   . SER B 1 229 ? 7.010   7.971   -34.374 1.00 45.46  ? 229  SER B N   1 
ATOM   5959 C CA  . SER B 1 229 ? 7.726   6.822   -33.790 1.00 45.17  ? 229  SER B CA  1 
ATOM   5960 C C   . SER B 1 229 ? 8.998   6.459   -34.544 1.00 45.50  ? 229  SER B C   1 
ATOM   5961 O O   . SER B 1 229 ? 9.283   5.285   -34.750 1.00 45.20  ? 229  SER B O   1 
ATOM   5962 C CB  . SER B 1 229 ? 6.787   5.598   -33.692 1.00 46.11  ? 229  SER B CB  1 
ATOM   5963 O OG  . SER B 1 229 ? 5.648   5.917   -32.892 1.00 45.77  ? 229  SER B OG  1 
ATOM   5964 N N   . GLY B 1 230 ? 9.795   7.469   -34.908 1.00 45.24  ? 230  GLY B N   1 
ATOM   5965 C CA  . GLY B 1 230 ? 10.984  7.226   -35.702 1.00 45.37  ? 230  GLY B CA  1 
ATOM   5966 C C   . GLY B 1 230 ? 11.742  8.487   -36.019 1.00 45.62  ? 230  GLY B C   1 
ATOM   5967 O O   . GLY B 1 230 ? 11.154  9.578   -36.081 1.00 45.86  ? 230  GLY B O   1 
ATOM   5968 N N   . THR B 1 231 ? 13.051  8.335   -36.203 1.00 45.68  ? 231  THR B N   1 
ATOM   5969 C CA  . THR B 1 231 ? 13.968  9.458   -36.328 1.00 46.71  ? 231  THR B CA  1 
ATOM   5970 C C   . THR B 1 231 ? 15.165  9.032   -37.142 1.00 47.01  ? 231  THR B C   1 
ATOM   5971 O O   . THR B 1 231 ? 15.499  7.843   -37.163 1.00 48.78  ? 231  THR B O   1 
ATOM   5972 C CB  . THR B 1 231 ? 14.499  9.927   -34.930 1.00 47.25  ? 231  THR B CB  1 
ATOM   5973 O OG1 . THR B 1 231 ? 14.983  8.798   -34.192 1.00 48.65  ? 231  THR B OG1 1 
ATOM   5974 C CG2 . THR B 1 231 ? 13.425  10.631  -34.113 1.00 45.85  ? 231  THR B CG2 1 
ATOM   5975 N N   . PRO B 1 232 ? 15.805  9.982   -37.825 1.00 47.20  ? 232  PRO B N   1 
ATOM   5976 C CA  . PRO B 1 232 ? 17.021  9.681   -38.558 1.00 47.91  ? 232  PRO B CA  1 
ATOM   5977 C C   . PRO B 1 232 ? 18.231  9.482   -37.631 1.00 49.12  ? 232  PRO B C   1 
ATOM   5978 O O   . PRO B 1 232 ? 19.107  8.665   -37.927 1.00 49.93  ? 232  PRO B O   1 
ATOM   5979 C CB  . PRO B 1 232 ? 17.189  10.904  -39.468 1.00 47.79  ? 232  PRO B CB  1 
ATOM   5980 C CG  . PRO B 1 232 ? 16.562  12.022  -38.710 1.00 47.60  ? 232  PRO B CG  1 
ATOM   5981 C CD  . PRO B 1 232 ? 15.417  11.402  -37.950 1.00 47.19  ? 232  PRO B CD  1 
ATOM   5982 N N   . ASN B 1 233 ? 18.297  10.261  -36.545 1.00 49.58  ? 233  ASN B N   1 
ATOM   5983 C CA  . ASN B 1 233 ? 19.237  10.018  -35.466 1.00 49.93  ? 233  ASN B CA  1 
ATOM   5984 C C   . ASN B 1 233 ? 18.799  8.771   -34.728 1.00 50.67  ? 233  ASN B C   1 
ATOM   5985 O O   . ASN B 1 233 ? 17.672  8.294   -34.913 1.00 51.01  ? 233  ASN B O   1 
ATOM   5986 C CB  . ASN B 1 233 ? 19.322  11.206  -34.499 1.00 50.02  ? 233  ASN B CB  1 
ATOM   5987 C CG  . ASN B 1 233 ? 17.962  11.650  -33.979 1.00 48.96  ? 233  ASN B CG  1 
ATOM   5988 O OD1 . ASN B 1 233 ? 17.075  11.971  -34.759 1.00 48.37  ? 233  ASN B OD1 1 
ATOM   5989 N ND2 . ASN B 1 233 ? 17.794  11.661  -32.660 1.00 47.63  ? 233  ASN B ND2 1 
ATOM   5990 N N   . GLY B 1 234 ? 19.675  8.242   -33.884 1.00 51.67  ? 234  GLY B N   1 
ATOM   5991 C CA  . GLY B 1 234 ? 19.342  7.050   -33.097 1.00 51.86  ? 234  GLY B CA  1 
ATOM   5992 C C   . GLY B 1 234 ? 20.163  5.844   -33.510 1.00 52.49  ? 234  GLY B C   1 
ATOM   5993 O O   . GLY B 1 234 ? 20.918  5.902   -34.484 1.00 52.76  ? 234  GLY B O   1 
ATOM   5994 N N   . PRO B 1 235 ? 20.018  4.744   -32.765 1.00 52.66  ? 235  PRO B N   1 
ATOM   5995 C CA  . PRO B 1 235 ? 20.896  3.564   -32.899 1.00 53.56  ? 235  PRO B CA  1 
ATOM   5996 C C   . PRO B 1 235 ? 20.742  2.662   -34.148 1.00 53.25  ? 235  PRO B C   1 
ATOM   5997 O O   . PRO B 1 235 ? 21.688  1.932   -34.490 1.00 53.48  ? 235  PRO B O   1 
ATOM   5998 C CB  . PRO B 1 235 ? 20.620  2.774   -31.607 1.00 54.15  ? 235  PRO B CB  1 
ATOM   5999 C CG  . PRO B 1 235 ? 19.238  3.207   -31.173 1.00 53.40  ? 235  PRO B CG  1 
ATOM   6000 C CD  . PRO B 1 235 ? 19.011  4.597   -31.698 1.00 52.16  ? 235  PRO B CD  1 
ATOM   6001 N N   . TRP B 1 236 ? 19.593  2.730   -34.826 1.00 51.95  ? 236  TRP B N   1 
ATOM   6002 C CA  . TRP B 1 236 ? 19.227  1.721   -35.834 1.00 51.30  ? 236  TRP B CA  1 
ATOM   6003 C C   . TRP B 1 236 ? 19.015  2.250   -37.263 1.00 50.47  ? 236  TRP B C   1 
ATOM   6004 O O   . TRP B 1 236 ? 19.087  1.471   -38.228 1.00 49.65  ? 236  TRP B O   1 
ATOM   6005 C CB  . TRP B 1 236 ? 17.965  0.981   -35.387 1.00 51.08  ? 236  TRP B CB  1 
ATOM   6006 C CG  . TRP B 1 236 ? 16.835  1.899   -35.141 1.00 50.34  ? 236  TRP B CG  1 
ATOM   6007 C CD1 . TRP B 1 236 ? 16.510  2.481   -33.960 1.00 50.89  ? 236  TRP B CD1 1 
ATOM   6008 C CD2 . TRP B 1 236 ? 15.891  2.382   -36.098 1.00 50.02  ? 236  TRP B CD2 1 
ATOM   6009 N NE1 . TRP B 1 236 ? 15.418  3.298   -34.109 1.00 49.83  ? 236  TRP B NE1 1 
ATOM   6010 C CE2 . TRP B 1 236 ? 15.015  3.258   -35.415 1.00 49.84  ? 236  TRP B CE2 1 
ATOM   6011 C CE3 . TRP B 1 236 ? 15.699  2.170   -37.467 1.00 50.39  ? 236  TRP B CE3 1 
ATOM   6012 C CZ2 . TRP B 1 236 ? 13.956  3.905   -36.046 1.00 49.09  ? 236  TRP B CZ2 1 
ATOM   6013 C CZ3 . TRP B 1 236 ? 14.638  2.824   -38.097 1.00 49.26  ? 236  TRP B CZ3 1 
ATOM   6014 C CH2 . TRP B 1 236 ? 13.789  3.682   -37.383 1.00 49.31  ? 236  TRP B CH2 1 
ATOM   6015 N N   . ALA B 1 237 ? 18.756  3.553   -37.398 1.00 49.50  ? 237  ALA B N   1 
ATOM   6016 C CA  . ALA B 1 237 ? 18.298  4.145   -38.665 1.00 49.09  ? 237  ALA B CA  1 
ATOM   6017 C C   . ALA B 1 237 ? 19.417  4.380   -39.671 1.00 48.99  ? 237  ALA B C   1 
ATOM   6018 O O   . ALA B 1 237 ? 19.147  4.550   -40.849 1.00 48.75  ? 237  ALA B O   1 
ATOM   6019 C CB  . ALA B 1 237 ? 17.545  5.470   -38.413 1.00 47.93  ? 237  ALA B CB  1 
ATOM   6020 N N   . THR B 1 238 ? 20.663  4.414   -39.215 1.00 49.72  ? 238  THR B N   1 
ATOM   6021 C CA  . THR B 1 238 ? 21.795  4.567   -40.119 1.00 50.39  ? 238  THR B CA  1 
ATOM   6022 C C   . THR B 1 238 ? 22.963  3.686   -39.684 1.00 51.39  ? 238  THR B C   1 
ATOM   6023 O O   . THR B 1 238 ? 23.045  3.264   -38.533 1.00 51.23  ? 238  THR B O   1 
ATOM   6024 C CB  . THR B 1 238 ? 22.273  6.023   -40.223 1.00 50.74  ? 238  THR B CB  1 
ATOM   6025 O OG1 . THR B 1 238 ? 22.784  6.452   -38.951 1.00 53.10  ? 238  THR B OG1 1 
ATOM   6026 C CG2 . THR B 1 238 ? 21.135  6.949   -40.672 1.00 48.20  ? 238  THR B CG2 1 
ATOM   6027 N N   . VAL B 1 239 ? 23.830  3.389   -40.642 1.00 52.35  ? 239  VAL B N   1 
ATOM   6028 C CA  . VAL B 1 239 ? 25.129  2.780   -40.381 1.00 54.05  ? 239  VAL B CA  1 
ATOM   6029 C C   . VAL B 1 239 ? 26.189  3.671   -41.013 1.00 55.44  ? 239  VAL B C   1 
ATOM   6030 O O   . VAL B 1 239 ? 25.876  4.531   -41.842 1.00 55.12  ? 239  VAL B O   1 
ATOM   6031 C CB  . VAL B 1 239 ? 25.223  1.336   -40.953 1.00 54.83  ? 239  VAL B CB  1 
ATOM   6032 C CG1 . VAL B 1 239 ? 24.371  0.378   -40.130 1.00 53.67  ? 239  VAL B CG1 1 
ATOM   6033 C CG2 . VAL B 1 239 ? 24.809  1.292   -42.432 1.00 53.59  ? 239  VAL B CG2 1 
ATOM   6034 N N   . SER B 1 240 ? 27.437  3.490   -40.596 1.00 57.73  ? 240  SER B N   1 
ATOM   6035 C CA  . SER B 1 240 ? 28.556  4.184   -41.210 1.00 59.18  ? 240  SER B CA  1 
ATOM   6036 C C   . SER B 1 240 ? 28.934  3.510   -42.530 1.00 60.24  ? 240  SER B C   1 
ATOM   6037 O O   . SER B 1 240 ? 28.501  2.388   -42.818 1.00 59.98  ? 240  SER B O   1 
ATOM   6038 C CB  . SER B 1 240 ? 29.755  4.174   -40.265 1.00 60.89  ? 240  SER B CB  1 
ATOM   6039 O OG  . SER B 1 240 ? 30.248  2.856   -40.110 1.00 61.88  ? 240  SER B OG  1 
ATOM   6040 N N   . ALA B 1 241 ? 29.758  4.193   -43.321 1.00 61.36  ? 241  ALA B N   1 
ATOM   6041 C CA  . ALA B 1 241 ? 30.250  3.640   -44.575 1.00 62.70  ? 241  ALA B CA  1 
ATOM   6042 C C   . ALA B 1 241 ? 31.056  2.343   -44.360 1.00 64.28  ? 241  ALA B C   1 
ATOM   6043 O O   . ALA B 1 241 ? 30.898  1.381   -45.114 1.00 64.69  ? 241  ALA B O   1 
ATOM   6044 C CB  . ALA B 1 241 ? 31.087  4.674   -45.317 1.00 63.63  ? 241  ALA B CB  1 
ATOM   6045 N N   . GLY B 1 242 ? 31.897  2.307   -43.329 1.00 65.46  ? 242  GLY B N   1 
ATOM   6046 C CA  . GLY B 1 242 ? 32.668  1.089   -43.005 1.00 66.93  ? 242  GLY B CA  1 
ATOM   6047 C C   . GLY B 1 242 ? 31.792  -0.114  -42.670 1.00 66.12  ? 242  GLY B C   1 
ATOM   6048 O O   . GLY B 1 242 ? 32.045  -1.226  -43.116 1.00 66.98  ? 242  GLY B O   1 
ATOM   6049 N N   . GLU B 1 243 ? 30.750  0.115   -41.883 1.00 64.73  ? 243  GLU B N   1 
ATOM   6050 C CA  . GLU B 1 243 ? 29.853  -0.956  -41.460 1.00 64.12  ? 243  GLU B CA  1 
ATOM   6051 C C   . GLU B 1 243 ? 28.908  -1.414  -42.580 1.00 62.98  ? 243  GLU B C   1 
ATOM   6052 O O   . GLU B 1 243 ? 28.548  -2.587  -42.635 1.00 63.56  ? 243  GLU B O   1 
ATOM   6053 C CB  . GLU B 1 243 ? 29.063  -0.514  -40.222 1.00 63.07  ? 243  GLU B CB  1 
ATOM   6054 C CG  . GLU B 1 243 ? 28.012  -1.499  -39.712 1.00 62.43  ? 243  GLU B CG  1 
ATOM   6055 C CD  . GLU B 1 243 ? 28.585  -2.773  -39.131 1.00 64.25  ? 243  GLU B CD  1 
ATOM   6056 O OE1 . GLU B 1 243 ? 29.822  -2.896  -39.018 1.00 67.05  ? 243  GLU B OE1 1 
ATOM   6057 O OE2 . GLU B 1 243 ? 27.784  -3.661  -38.777 1.00 63.32  ? 243  GLU B OE2 1 
ATOM   6058 N N   . ALA B 1 244 ? 28.507  -0.508  -43.468 1.00 61.74  ? 244  ALA B N   1 
ATOM   6059 C CA  . ALA B 1 244 ? 27.705  -0.901  -44.634 1.00 60.91  ? 244  ALA B CA  1 
ATOM   6060 C C   . ALA B 1 244 ? 28.526  -1.806  -45.556 1.00 62.36  ? 244  ALA B C   1 
ATOM   6061 O O   . ALA B 1 244 ? 28.030  -2.816  -46.035 1.00 62.24  ? 244  ALA B O   1 
ATOM   6062 C CB  . ALA B 1 244 ? 27.196  0.321   -45.396 1.00 59.78  ? 244  ALA B CB  1 
ATOM   6063 N N   . ARG B 1 245 ? 29.780  -1.425  -45.784 1.00 63.53  ? 245  ARG B N   1 
ATOM   6064 C CA  . ARG B 1 245 ? 30.709  -2.195  -46.593 1.00 65.50  ? 245  ARG B CA  1 
ATOM   6065 C C   . ARG B 1 245 ? 30.953  -3.581  -46.007 1.00 66.50  ? 245  ARG B C   1 
ATOM   6066 O O   . ARG B 1 245 ? 31.025  -4.576  -46.728 1.00 67.36  ? 245  ARG B O   1 
ATOM   6067 C CB  . ARG B 1 245 ? 32.037  -1.442  -46.693 1.00 66.89  ? 245  ARG B CB  1 
ATOM   6068 C CG  . ARG B 1 245 ? 33.140  -2.209  -47.383 1.00 69.37  ? 245  ARG B CG  1 
ATOM   6069 C CD  . ARG B 1 245 ? 34.273  -1.291  -47.763 1.00 70.85  ? 245  ARG B CD  1 
ATOM   6070 N NE  . ARG B 1 245 ? 33.916  -0.398  -48.867 1.00 70.45  ? 245  ARG B NE  1 
ATOM   6071 C CZ  . ARG B 1 245 ? 33.883  -0.752  -50.151 1.00 70.82  ? 245  ARG B CZ  1 
ATOM   6072 N NH1 . ARG B 1 245 ? 33.567  0.150   -51.073 1.00 71.07  ? 245  ARG B NH1 1 
ATOM   6073 N NH2 . ARG B 1 245 ? 34.149  -1.995  -50.526 1.00 71.82  ? 245  ARG B NH2 1 
ATOM   6074 N N   . ARG B 1 246 ? 31.092  -3.630  -44.692 1.00 66.52  ? 246  ARG B N   1 
ATOM   6075 C CA  . ARG B 1 246 ? 31.326  -4.875  -43.984 1.00 67.72  ? 246  ARG B CA  1 
ATOM   6076 C C   . ARG B 1 246 ? 30.162  -5.858  -44.176 1.00 66.41  ? 246  ARG B C   1 
ATOM   6077 O O   . ARG B 1 246 ? 30.363  -7.036  -44.470 1.00 67.07  ? 246  ARG B O   1 
ATOM   6078 C CB  . ARG B 1 246 ? 31.519  -4.554  -42.510 1.00 68.08  ? 246  ARG B CB  1 
ATOM   6079 C CG  . ARG B 1 246 ? 32.028  -5.683  -41.675 1.00 70.78  ? 246  ARG B CG  1 
ATOM   6080 C CD  . ARG B 1 246 ? 31.441  -5.635  -40.273 1.00 71.45  ? 246  ARG B CD  1 
ATOM   6081 N NE  . ARG B 1 246 ? 30.810  -6.919  -39.983 1.00 72.78  ? 246  ARG B NE  1 
ATOM   6082 C CZ  . ARG B 1 246 ? 29.569  -7.095  -39.543 1.00 70.68  ? 246  ARG B CZ  1 
ATOM   6083 N NH1 . ARG B 1 246 ? 28.791  -6.070  -39.256 1.00 68.66  ? 246  ARG B NH1 1 
ATOM   6084 N NH2 . ARG B 1 246 ? 29.128  -8.333  -39.342 1.00 72.68  ? 246  ARG B NH2 1 
ATOM   6085 N N   . ARG B 1 247 ? 28.942  -5.362  -44.017 1.00 64.46  ? 247  ARG B N   1 
ATOM   6086 C CA  . ARG B 1 247 ? 27.755  -6.204  -44.154 1.00 63.56  ? 247  ARG B CA  1 
ATOM   6087 C C   . ARG B 1 247 ? 27.538  -6.657  -45.590 1.00 63.34  ? 247  ARG B C   1 
ATOM   6088 O O   . ARG B 1 247 ? 27.222  -7.826  -45.830 1.00 64.28  ? 247  ARG B O   1 
ATOM   6089 C CB  . ARG B 1 247 ? 26.515  -5.466  -43.650 1.00 61.57  ? 247  ARG B CB  1 
ATOM   6090 C CG  . ARG B 1 247 ? 26.556  -5.170  -42.163 1.00 62.12  ? 247  ARG B CG  1 
ATOM   6091 C CD  . ARG B 1 247 ? 25.316  -4.418  -41.692 1.00 60.33  ? 247  ARG B CD  1 
ATOM   6092 N NE  . ARG B 1 247 ? 25.481  -3.902  -40.338 1.00 61.16  ? 247  ARG B NE  1 
ATOM   6093 C CZ  . ARG B 1 247 ? 24.511  -3.343  -39.624 1.00 60.34  ? 247  ARG B CZ  1 
ATOM   6094 N NH1 . ARG B 1 247 ? 23.286  -3.246  -40.105 1.00 61.62  ? 247  ARG B NH1 1 
ATOM   6095 N NH2 . ARG B 1 247 ? 24.761  -2.891  -38.410 1.00 61.17  ? 247  ARG B NH2 1 
ATOM   6096 N N   . ALA B 1 248 ? 27.690  -5.728  -46.536 1.00 62.35  ? 248  ALA B N   1 
ATOM   6097 C CA  . ALA B 1 248 ? 27.563  -6.039  -47.958 1.00 62.31  ? 248  ALA B CA  1 
ATOM   6098 C C   . ALA B 1 248 ? 28.603  -7.078  -48.361 1.00 63.95  ? 248  ALA B C   1 
ATOM   6099 O O   . ALA B 1 248 ? 28.301  -8.006  -49.115 1.00 64.88  ? 248  ALA B O   1 
ATOM   6100 C CB  . ALA B 1 248 ? 27.710  -4.780  -48.796 1.00 61.22  ? 248  ALA B CB  1 
ATOM   6101 N N   . THR B 1 249 ? 29.825  -6.923  -47.858 1.00 65.18  ? 249  THR B N   1 
ATOM   6102 C CA  . THR B 1 249 ? 30.912  -7.875  -48.129 1.00 67.15  ? 249  THR B CA  1 
ATOM   6103 C C   . THR B 1 249 ? 30.662  -9.263  -47.511 1.00 68.36  ? 249  THR B C   1 
ATOM   6104 O O   . THR B 1 249 ? 30.979  -10.291 -48.109 1.00 69.72  ? 249  THR B O   1 
ATOM   6105 C CB  . THR B 1 249 ? 32.272  -7.332  -47.629 1.00 68.56  ? 249  THR B CB  1 
ATOM   6106 O OG1 . THR B 1 249 ? 32.552  -6.083  -48.266 1.00 67.70  ? 249  THR B OG1 1 
ATOM   6107 C CG2 . THR B 1 249 ? 33.404  -8.304  -47.950 1.00 70.07  ? 249  THR B CG2 1 
ATOM   6108 N N   . LEU B 1 250 ? 30.107  -9.292  -46.311 1.00 67.98  ? 250  LEU B N   1 
ATOM   6109 C CA  . LEU B 1 250 ? 29.776  -10.556 -45.660 1.00 68.89  ? 250  LEU B CA  1 
ATOM   6110 C C   . LEU B 1 250 ? 28.594  -11.226 -46.368 1.00 69.13  ? 250  LEU B C   1 
ATOM   6111 O O   . LEU B 1 250 ? 28.589  -12.444 -46.534 1.00 70.15  ? 250  LEU B O   1 
ATOM   6112 C CB  . LEU B 1 250 ? 29.492  -10.345 -44.157 1.00 68.42  ? 250  LEU B CB  1 
ATOM   6113 C CG  . LEU B 1 250 ? 28.907  -11.518 -43.360 1.00 68.39  ? 250  LEU B CG  1 
ATOM   6114 C CD1 . LEU B 1 250 ? 29.782  -12.759 -43.514 1.00 68.86  ? 250  LEU B CD1 1 
ATOM   6115 C CD2 . LEU B 1 250 ? 28.725  -11.145 -41.899 1.00 66.49  ? 250  LEU B CD2 1 
ATOM   6116 N N   . LEU B 1 251 ? 27.601  -10.449 -46.800 1.00 68.22  ? 251  LEU B N   1 
ATOM   6117 C CA  . LEU B 1 251 ? 26.471  -11.044 -47.510 1.00 68.45  ? 251  LEU B CA  1 
ATOM   6118 C C   . LEU B 1 251 ? 26.976  -11.682 -48.809 1.00 70.48  ? 251  LEU B C   1 
ATOM   6119 O O   . LEU B 1 251 ? 26.674  -12.854 -49.105 1.00 71.74  ? 251  LEU B O   1 
ATOM   6120 C CB  . LEU B 1 251 ? 25.369  -10.023 -47.795 1.00 66.44  ? 251  LEU B CB  1 
ATOM   6121 C CG  . LEU B 1 251 ? 24.149  -10.616 -48.533 1.00 66.24  ? 251  LEU B CG  1 
ATOM   6122 C CD1 . LEU B 1 251 ? 23.107  -11.134 -47.542 1.00 66.21  ? 251  LEU B CD1 1 
ATOM   6123 C CD2 . LEU B 1 251 ? 23.537  -9.601  -49.479 1.00 65.49  ? 251  LEU B CD2 1 
ATOM   6124 N N   . ALA B 1 252 ? 27.766  -10.914 -49.562 1.00 71.21  ? 252  ALA B N   1 
ATOM   6125 C CA  . ALA B 1 252 ? 28.404  -11.409 -50.778 1.00 72.79  ? 252  ALA B CA  1 
ATOM   6126 C C   . ALA B 1 252 ? 29.063  -12.743 -50.510 1.00 75.50  ? 252  ALA B C   1 
ATOM   6127 O O   . ALA B 1 252 ? 28.814  -13.711 -51.209 1.00 76.76  ? 252  ALA B O   1 
ATOM   6128 C CB  . ALA B 1 252 ? 29.428  -10.418 -51.292 1.00 72.95  ? 252  ALA B CB  1 
ATOM   6129 N N   . ARG B 1 253 ? 29.897  -12.799 -49.485 1.00 76.97  ? 253  ARG B N   1 
ATOM   6130 C CA  . ARG B 1 253 ? 30.580  -14.039 -49.144 1.00 79.79  ? 253  ARG B CA  1 
ATOM   6131 C C   . ARG B 1 253 ? 29.590  -15.182 -48.878 1.00 79.44  ? 253  ARG B C   1 
ATOM   6132 O O   . ARG B 1 253 ? 29.801  -16.309 -49.317 1.00 81.27  ? 253  ARG B O   1 
ATOM   6133 C CB  . ARG B 1 253 ? 31.491  -13.830 -47.933 1.00 80.46  ? 253  ARG B CB  1 
ATOM   6134 C CG  . ARG B 1 253 ? 32.302  -15.060 -47.559 1.00 84.35  ? 253  ARG B CG  1 
ATOM   6135 C CD  . ARG B 1 253 ? 33.148  -14.819 -46.341 1.00 86.39  ? 253  ARG B CD  1 
ATOM   6136 N NE  . ARG B 1 253 ? 33.689  -16.074 -45.805 1.00 91.96  ? 253  ARG B NE  1 
ATOM   6137 C CZ  . ARG B 1 253 ? 33.145  -16.799 -44.819 1.00 93.33  ? 253  ARG B CZ  1 
ATOM   6138 N NH1 . ARG B 1 253 ? 32.005  -16.420 -44.216 1.00 91.13  ? 253  ARG B NH1 1 
ATOM   6139 N NH2 . ARG B 1 253 ? 33.762  -17.922 -44.424 1.00 95.53  ? 253  ARG B NH2 1 
ATOM   6140 N N   . LEU B 1 254 ? 28.514  -14.886 -48.163 1.00 77.63  ? 254  LEU B N   1 
ATOM   6141 C CA  . LEU B 1 254 ? 27.526  -15.897 -47.795 1.00 77.72  ? 254  LEU B CA  1 
ATOM   6142 C C   . LEU B 1 254 ? 26.824  -16.519 -49.001 1.00 78.18  ? 254  LEU B C   1 
ATOM   6143 O O   . LEU B 1 254 ? 26.432  -17.682 -48.948 1.00 79.00  ? 254  LEU B O   1 
ATOM   6144 C CB  . LEU B 1 254 ? 26.484  -15.295 -46.838 1.00 75.54  ? 254  LEU B CB  1 
ATOM   6145 C CG  . LEU B 1 254 ? 26.993  -15.012 -45.424 1.00 75.28  ? 254  LEU B CG  1 
ATOM   6146 C CD1 . LEU B 1 254 ? 25.947  -14.290 -44.617 1.00 70.75  ? 254  LEU B CD1 1 
ATOM   6147 C CD2 . LEU B 1 254 ? 27.406  -16.316 -44.738 1.00 76.65  ? 254  LEU B CD2 1 
ATOM   6148 N N   . VAL B 1 255 ? 26.655  -15.737 -50.069 1.00 77.62  ? 255  VAL B N   1 
ATOM   6149 C CA  . VAL B 1 255 ? 26.008  -16.213 -51.304 1.00 78.15  ? 255  VAL B CA  1 
ATOM   6150 C C   . VAL B 1 255 ? 27.006  -16.615 -52.412 1.00 80.62  ? 255  VAL B C   1 
ATOM   6151 O O   . VAL B 1 255 ? 26.644  -16.659 -53.584 1.00 80.34  ? 255  VAL B O   1 
ATOM   6152 C CB  . VAL B 1 255 ? 25.004  -15.162 -51.865 1.00 75.61  ? 255  VAL B CB  1 
ATOM   6153 C CG1 . VAL B 1 255 ? 23.873  -14.967 -50.904 1.00 73.69  ? 255  VAL B CG1 1 
ATOM   6154 C CG2 . VAL B 1 255 ? 25.701  -13.847 -52.163 1.00 74.62  ? 255  VAL B CG2 1 
ATOM   6155 N N   . GLY B 1 256 ? 28.252  -16.909 -52.041 1.00 83.12  ? 256  GLY B N   1 
ATOM   6156 C CA  . GLY B 1 256 ? 29.253  -17.376 -52.992 1.00 85.91  ? 256  GLY B CA  1 
ATOM   6157 C C   . GLY B 1 256 ? 29.851  -16.335 -53.925 1.00 86.53  ? 256  GLY B C   1 
ATOM   6158 O O   . GLY B 1 256 ? 30.503  -16.687 -54.899 1.00 88.12  ? 256  GLY B O   1 
ATOM   6159 N N   . CYS B 1 257 ? 29.640  -15.056 -53.646 1.00 86.24  ? 257  CYS B N   1 
ATOM   6160 C CA  . CYS B 1 257 ? 30.207  -13.986 -54.472 1.00 87.33  ? 257  CYS B CA  1 
ATOM   6161 C C   . CYS B 1 257 ? 31.489  -13.479 -53.837 1.00 89.72  ? 257  CYS B C   1 
ATOM   6162 O O   . CYS B 1 257 ? 31.495  -13.163 -52.647 1.00 90.19  ? 257  CYS B O   1 
ATOM   6163 C CB  . CYS B 1 257 ? 29.216  -12.828 -54.621 1.00 84.66  ? 257  CYS B CB  1 
ATOM   6164 S SG  . CYS B 1 257 ? 27.826  -13.221 -55.683 1.00 83.81  ? 257  CYS B SG  1 
ATOM   6165 N N   . PRO B 1 258 ? 32.563  -13.323 -54.629 1.00 92.68  ? 258  PRO B N   1 
ATOM   6166 C CA  . PRO B 1 258 ? 32.617  -13.274 -56.096 1.00 93.77  ? 258  PRO B CA  1 
ATOM   6167 C C   . PRO B 1 258 ? 32.876  -14.632 -56.784 1.00 95.97  ? 258  PRO B C   1 
ATOM   6168 O O   . PRO B 1 258 ? 33.172  -15.622 -56.115 1.00 97.53  ? 258  PRO B O   1 
ATOM   6169 C CB  . PRO B 1 258 ? 33.792  -12.307 -56.356 1.00 94.76  ? 258  PRO B CB  1 
ATOM   6170 C CG  . PRO B 1 258 ? 34.545  -12.189 -54.993 1.00 95.17  ? 258  PRO B CG  1 
ATOM   6171 C CD  . PRO B 1 258 ? 33.912  -13.179 -54.056 1.00 94.41  ? 258  PRO B CD  1 
ATOM   6172 N N   . ASN B 1 265 ? 37.816  -5.911  -55.543 1.00 94.01  ? 265  ASN B N   1 
ATOM   6173 C CA  . ASN B 1 265 ? 37.250  -5.043  -56.573 1.00 92.99  ? 265  ASN B CA  1 
ATOM   6174 C C   . ASN B 1 265 ? 35.721  -5.056  -56.510 1.00 89.98  ? 265  ASN B C   1 
ATOM   6175 O O   . ASN B 1 265 ? 35.092  -6.093  -56.767 1.00 89.80  ? 265  ASN B O   1 
ATOM   6176 C CB  . ASN B 1 265 ? 37.738  -5.491  -57.953 1.00 95.07  ? 265  ASN B CB  1 
ATOM   6177 C CG  . ASN B 1 265 ? 37.239  -4.599  -59.088 1.00 95.35  ? 265  ASN B CG  1 
ATOM   6178 O OD1 . ASN B 1 265 ? 36.753  -3.489  -58.867 1.00 95.92  ? 265  ASN B OD1 1 
ATOM   6179 N ND2 . ASN B 1 265 ? 37.368  -5.089  -60.318 1.00 98.37  ? 265  ASN B ND2 1 
ATOM   6180 N N   . ASP B 1 266 ? 35.140  -3.901  -56.175 1.00 87.58  ? 266  ASP B N   1 
ATOM   6181 C CA  . ASP B 1 266 ? 33.684  -3.751  -56.017 1.00 84.59  ? 266  ASP B CA  1 
ATOM   6182 C C   . ASP B 1 266 ? 32.884  -4.152  -57.245 1.00 83.86  ? 266  ASP B C   1 
ATOM   6183 O O   . ASP B 1 266 ? 31.881  -4.857  -57.134 1.00 82.47  ? 266  ASP B O   1 
ATOM   6184 C CB  . ASP B 1 266 ? 33.336  -2.298  -55.701 1.00 83.12  ? 266  ASP B CB  1 
ATOM   6185 C CG  . ASP B 1 266 ? 33.757  -1.884  -54.315 1.00 82.49  ? 266  ASP B CG  1 
ATOM   6186 O OD1 . ASP B 1 266 ? 34.072  -2.781  -53.507 1.00 82.28  ? 266  ASP B OD1 1 
ATOM   6187 O OD2 . ASP B 1 266 ? 33.766  -0.662  -54.045 1.00 79.87  ? 266  ASP B OD2 1 
ATOM   6188 N N   . THR B 1 267 ? 33.322  -3.663  -58.403 1.00 84.48  ? 267  THR B N   1 
ATOM   6189 C CA  . THR B 1 267 ? 32.655  -3.914  -59.684 1.00 84.11  ? 267  THR B CA  1 
ATOM   6190 C C   . THR B 1 267 ? 32.331  -5.396  -59.871 1.00 84.10  ? 267  THR B C   1 
ATOM   6191 O O   . THR B 1 267 ? 31.216  -5.773  -60.237 1.00 83.12  ? 267  THR B O   1 
ATOM   6192 C CB  . THR B 1 267 ? 33.537  -3.429  -60.852 1.00 85.76  ? 267  THR B CB  1 
ATOM   6193 O OG1 . THR B 1 267 ? 33.721  -2.011  -60.744 1.00 85.83  ? 267  THR B OG1 1 
ATOM   6194 C CG2 . THR B 1 267 ? 32.893  -3.753  -62.194 1.00 86.05  ? 267  THR B CG2 1 
ATOM   6195 N N   . GLU B 1 268 ? 33.320  -6.222  -59.577 1.00 85.23  ? 268  GLU B N   1 
ATOM   6196 C CA  . GLU B 1 268 ? 33.204  -7.663  -59.695 1.00 85.96  ? 268  GLU B CA  1 
ATOM   6197 C C   . GLU B 1 268 ? 32.217  -8.239  -58.674 1.00 83.37  ? 268  GLU B C   1 
ATOM   6198 O O   . GLU B 1 268 ? 31.430  -9.132  -58.995 1.00 82.89  ? 268  GLU B O   1 
ATOM   6199 C CB  . GLU B 1 268 ? 34.596  -8.285  -59.507 1.00 88.33  ? 268  GLU B CB  1 
ATOM   6200 C CG  . GLU B 1 268 ? 34.798  -9.658  -60.138 1.00 91.30  ? 268  GLU B CG  1 
ATOM   6201 C CD  . GLU B 1 268 ? 36.231  -10.192 -59.925 1.00 94.20  ? 268  GLU B CD  1 
ATOM   6202 O OE1 . GLU B 1 268 ? 36.940  -10.410 -60.938 1.00 98.02  ? 268  GLU B OE1 1 
ATOM   6203 O OE2 . GLU B 1 268 ? 36.647  -10.377 -58.748 1.00 95.67  ? 268  GLU B OE2 1 
ATOM   6204 N N   . LEU B 1 269 ? 32.269  -7.728  -57.447 1.00 81.56  ? 269  LEU B N   1 
ATOM   6205 C CA  . LEU B 1 269 ? 31.427  -8.231  -56.360 1.00 79.70  ? 269  LEU B CA  1 
ATOM   6206 C C   . LEU B 1 269 ? 29.969  -7.872  -56.595 1.00 76.90  ? 269  LEU B C   1 
ATOM   6207 O O   . LEU B 1 269 ? 29.084  -8.715  -56.439 1.00 76.09  ? 269  LEU B O   1 
ATOM   6208 C CB  . LEU B 1 269 ? 31.907  -7.680  -55.009 1.00 79.49  ? 269  LEU B CB  1 
ATOM   6209 C CG  . LEU B 1 269 ? 31.146  -8.105  -53.745 1.00 78.60  ? 269  LEU B CG  1 
ATOM   6210 C CD1 . LEU B 1 269 ? 32.067  -8.170  -52.542 1.00 78.57  ? 269  LEU B CD1 1 
ATOM   6211 C CD2 . LEU B 1 269 ? 29.986  -7.152  -53.472 1.00 76.53  ? 269  LEU B CD2 1 
ATOM   6212 N N   . ILE B 1 270 ? 29.729  -6.625  -56.982 1.00 75.02  ? 270  ILE B N   1 
ATOM   6213 C CA  . ILE B 1 270 ? 28.379  -6.160  -57.244 1.00 72.79  ? 270  ILE B CA  1 
ATOM   6214 C C   . ILE B 1 270 ? 27.791  -6.917  -58.432 1.00 73.21  ? 270  ILE B C   1 
ATOM   6215 O O   . ILE B 1 270 ? 26.642  -7.364  -58.380 1.00 72.35  ? 270  ILE B O   1 
ATOM   6216 C CB  . ILE B 1 270 ? 28.338  -4.631  -57.481 1.00 71.82  ? 270  ILE B CB  1 
ATOM   6217 C CG1 . ILE B 1 270 ? 28.762  -3.896  -56.202 1.00 71.33  ? 270  ILE B CG1 1 
ATOM   6218 C CG2 . ILE B 1 270 ? 26.941  -4.180  -57.888 1.00 69.40  ? 270  ILE B CG2 1 
ATOM   6219 C CD1 . ILE B 1 270 ? 29.362  -2.514  -56.421 1.00 71.27  ? 270  ILE B CD1 1 
ATOM   6220 N N   . ALA B 1 271 ? 28.589  -7.081  -59.485 1.00 74.59  ? 271  ALA B N   1 
ATOM   6221 C CA  . ALA B 1 271 ? 28.177  -7.844  -60.659 1.00 75.20  ? 271  ALA B CA  1 
ATOM   6222 C C   . ALA B 1 271 ? 27.699  -9.256  -60.305 1.00 75.54  ? 271  ALA B C   1 
ATOM   6223 O O   . ALA B 1 271 ? 26.683  -9.711  -60.818 1.00 75.47  ? 271  ALA B O   1 
ATOM   6224 C CB  . ALA B 1 271 ? 29.314  -7.912  -61.662 1.00 76.94  ? 271  ALA B CB  1 
ATOM   6225 N N   . CYS B 1 272 ? 28.421  -9.950  -59.432 1.00 76.66  ? 272  CYS B N   1 
ATOM   6226 C CA  . CYS B 1 272 ? 28.015  -11.302 -59.026 1.00 76.83  ? 272  CYS B CA  1 
ATOM   6227 C C   . CYS B 1 272 ? 26.731  -11.287 -58.202 1.00 74.07  ? 272  CYS B C   1 
ATOM   6228 O O   . CYS B 1 272 ? 25.879  -12.155 -58.364 1.00 74.15  ? 272  CYS B O   1 
ATOM   6229 C CB  . CYS B 1 272 ? 29.134  -12.022 -58.258 1.00 79.00  ? 272  CYS B CB  1 
ATOM   6230 S SG  . CYS B 1 272 ? 28.667  -13.672 -57.551 1.00 81.62  ? 272  CYS B SG  1 
ATOM   6231 N N   . LEU B 1 273 ? 26.600  -10.307 -57.309 1.00 71.58  ? 273  LEU B N   1 
ATOM   6232 C CA  . LEU B 1 273 ? 25.389  -10.164 -56.501 1.00 68.75  ? 273  LEU B CA  1 
ATOM   6233 C C   . LEU B 1 273 ? 24.153  -9.979  -57.377 1.00 67.16  ? 273  LEU B C   1 
ATOM   6234 O O   . LEU B 1 273 ? 23.064  -10.438 -57.026 1.00 65.68  ? 273  LEU B O   1 
ATOM   6235 C CB  . LEU B 1 273 ? 25.507  -8.971  -55.540 1.00 67.40  ? 273  LEU B CB  1 
ATOM   6236 C CG  . LEU B 1 273 ? 26.276  -9.165  -54.238 1.00 66.93  ? 273  LEU B CG  1 
ATOM   6237 C CD1 . LEU B 1 273 ? 26.390  -7.834  -53.534 1.00 65.74  ? 273  LEU B CD1 1 
ATOM   6238 C CD2 . LEU B 1 273 ? 25.602  -10.170 -53.351 1.00 65.91  ? 273  LEU B CD2 1 
ATOM   6239 N N   . ARG B 1 274 ? 24.332  -9.294  -58.505 1.00 66.61  ? 274  ARG B N   1 
ATOM   6240 C CA  . ARG B 1 274 ? 23.237  -9.020  -59.432 1.00 65.55  ? 274  ARG B CA  1 
ATOM   6241 C C   . ARG B 1 274 ? 22.758  -10.261 -60.172 1.00 66.18  ? 274  ARG B C   1 
ATOM   6242 O O   . ARG B 1 274 ? 21.645  -10.287 -60.680 1.00 65.13  ? 274  ARG B O   1 
ATOM   6243 C CB  . ARG B 1 274 ? 23.641  -7.947  -60.441 1.00 65.55  ? 274  ARG B CB  1 
ATOM   6244 C CG  . ARG B 1 274 ? 23.672  -6.536  -59.862 1.00 64.03  ? 274  ARG B CG  1 
ATOM   6245 C CD  . ARG B 1 274 ? 23.674  -5.503  -60.970 1.00 64.41  ? 274  ARG B CD  1 
ATOM   6246 N NE  . ARG B 1 274 ? 24.751  -5.789  -61.914 1.00 67.18  ? 274  ARG B NE  1 
ATOM   6247 C CZ  . ARG B 1 274 ? 25.857  -5.064  -62.060 1.00 69.45  ? 274  ARG B CZ  1 
ATOM   6248 N NH1 . ARG B 1 274 ? 26.056  -3.964  -61.340 1.00 70.26  ? 274  ARG B NH1 1 
ATOM   6249 N NH2 . ARG B 1 274 ? 26.777  -5.443  -62.938 1.00 70.68  ? 274  ARG B NH2 1 
ATOM   6250 N N   . THR B 1 275 ? 23.591  -11.293 -60.233 1.00 67.76  ? 275  THR B N   1 
ATOM   6251 C CA  . THR B 1 275 ? 23.194  -12.539 -60.858 1.00 68.89  ? 275  THR B CA  1 
ATOM   6252 C C   . THR B 1 275 ? 22.351  -13.421 -59.934 1.00 69.02  ? 275  THR B C   1 
ATOM   6253 O O   . THR B 1 275 ? 21.806  -14.432 -60.371 1.00 71.02  ? 275  THR B O   1 
ATOM   6254 C CB  . THR B 1 275 ? 24.436  -13.357 -61.322 1.00 71.23  ? 275  THR B CB  1 
ATOM   6255 O OG1 . THR B 1 275 ? 25.171  -13.813 -60.180 1.00 70.46  ? 275  THR B OG1 1 
ATOM   6256 C CG2 . THR B 1 275 ? 25.339  -12.513 -62.232 1.00 71.30  ? 275  THR B CG2 1 
ATOM   6257 N N   . ARG B 1 276 ? 22.260  -13.072 -58.659 1.00 68.29  ? 276  ARG B N   1 
ATOM   6258 C CA  . ARG B 1 276 ? 21.641  -13.958 -57.677 1.00 68.33  ? 276  ARG B CA  1 
ATOM   6259 C C   . ARG B 1 276 ? 20.135  -13.764 -57.625 1.00 66.67  ? 276  ARG B C   1 
ATOM   6260 O O   . ARG B 1 276 ? 19.675  -12.619 -57.533 1.00 64.97  ? 276  ARG B O   1 
ATOM   6261 C CB  . ARG B 1 276 ? 22.230  -13.701 -56.280 1.00 68.22  ? 276  ARG B CB  1 
ATOM   6262 C CG  . ARG B 1 276 ? 23.650  -14.198 -56.095 1.00 71.20  ? 276  ARG B CG  1 
ATOM   6263 C CD  . ARG B 1 276 ? 23.687  -15.740 -56.048 1.00 75.18  ? 276  ARG B CD  1 
ATOM   6264 N NE  . ARG B 1 276 ? 25.030  -16.283 -55.926 1.00 77.86  ? 276  ARG B NE  1 
ATOM   6265 C CZ  . ARG B 1 276 ? 25.941  -16.265 -56.900 1.00 81.77  ? 276  ARG B CZ  1 
ATOM   6266 N NH1 . ARG B 1 276 ? 25.661  -15.723 -58.084 1.00 83.32  ? 276  ARG B NH1 1 
ATOM   6267 N NH2 . ARG B 1 276 ? 27.147  -16.802 -56.699 1.00 82.27  ? 276  ARG B NH2 1 
ATOM   6268 N N   . PRO B 1 277 ? 19.359  -14.867 -57.641 1.00 66.80  ? 277  PRO B N   1 
ATOM   6269 C CA  . PRO B 1 277 ? 17.936  -14.732 -57.363 1.00 65.87  ? 277  PRO B CA  1 
ATOM   6270 C C   . PRO B 1 277 ? 17.653  -13.870 -56.131 1.00 64.54  ? 277  PRO B C   1 
ATOM   6271 O O   . PRO B 1 277 ? 18.423  -13.873 -55.172 1.00 64.78  ? 277  PRO B O   1 
ATOM   6272 C CB  . PRO B 1 277 ? 17.480  -16.173 -57.144 1.00 67.27  ? 277  PRO B CB  1 
ATOM   6273 C CG  . PRO B 1 277 ? 18.395  -16.972 -57.962 1.00 68.82  ? 277  PRO B CG  1 
ATOM   6274 C CD  . PRO B 1 277 ? 19.717  -16.269 -57.921 1.00 69.03  ? 277  PRO B CD  1 
ATOM   6275 N N   . ALA B 1 278 ? 16.560  -13.119 -56.191 1.00 63.55  ? 278  ALA B N   1 
ATOM   6276 C CA  . ALA B 1 278 ? 16.167  -12.209 -55.126 1.00 62.36  ? 278  ALA B CA  1 
ATOM   6277 C C   . ALA B 1 278 ? 16.116  -12.911 -53.767 1.00 62.94  ? 278  ALA B C   1 
ATOM   6278 O O   . ALA B 1 278 ? 16.632  -12.394 -52.771 1.00 62.69  ? 278  ALA B O   1 
ATOM   6279 C CB  . ALA B 1 278 ? 14.803  -11.585 -55.463 1.00 60.95  ? 278  ALA B CB  1 
ATOM   6280 N N   . GLN B 1 279 ? 15.503  -14.090 -53.725 1.00 64.32  ? 279  GLN B N   1 
ATOM   6281 C CA  . GLN B 1 279 ? 15.330  -14.821 -52.458 1.00 65.30  ? 279  GLN B CA  1 
ATOM   6282 C C   . GLN B 1 279 ? 16.645  -15.328 -51.874 1.00 66.70  ? 279  GLN B C   1 
ATOM   6283 O O   . GLN B 1 279 ? 16.733  -15.532 -50.673 1.00 67.15  ? 279  GLN B O   1 
ATOM   6284 C CB  . GLN B 1 279 ? 14.341  -15.983 -52.622 1.00 66.30  ? 279  GLN B CB  1 
ATOM   6285 C CG  . GLN B 1 279 ? 13.912  -16.658 -51.324 1.00 66.35  ? 279  GLN B CG  1 
ATOM   6286 C CD  . GLN B 1 279 ? 13.363  -15.696 -50.291 1.00 64.41  ? 279  GLN B CD  1 
ATOM   6287 O OE1 . GLN B 1 279 ? 12.598  -14.789 -50.601 1.00 62.32  ? 279  GLN B OE1 1 
ATOM   6288 N NE2 . GLN B 1 279 ? 13.755  -15.898 -49.051 1.00 64.49  ? 279  GLN B NE2 1 
ATOM   6289 N N   . ASP B 1 280 ? 17.659  -15.531 -52.713 1.00 68.30  ? 280  ASP B N   1 
ATOM   6290 C CA  . ASP B 1 280 ? 18.986  -15.929 -52.229 1.00 69.94  ? 280  ASP B CA  1 
ATOM   6291 C C   . ASP B 1 280 ? 19.590  -14.825 -51.354 1.00 68.78  ? 280  ASP B C   1 
ATOM   6292 O O   . ASP B 1 280 ? 20.289  -15.114 -50.391 1.00 69.77  ? 280  ASP B O   1 
ATOM   6293 C CB  . ASP B 1 280 ? 19.934  -16.242 -53.390 1.00 71.18  ? 280  ASP B CB  1 
ATOM   6294 C CG  . ASP B 1 280 ? 19.620  -17.571 -54.077 1.00 75.05  ? 280  ASP B CG  1 
ATOM   6295 O OD1 . ASP B 1 280 ? 18.458  -18.046 -54.020 1.00 77.98  ? 280  ASP B OD1 1 
ATOM   6296 O OD2 . ASP B 1 280 ? 20.547  -18.138 -54.693 1.00 76.95  ? 280  ASP B OD2 1 
ATOM   6297 N N   . LEU B 1 281 ? 19.315  -13.565 -51.696 1.00 67.46  ? 281  LEU B N   1 
ATOM   6298 C CA  . LEU B 1 281 ? 19.767  -12.411 -50.907 1.00 65.97  ? 281  LEU B CA  1 
ATOM   6299 C C   . LEU B 1 281 ? 19.013  -12.302 -49.574 1.00 65.34  ? 281  LEU B C   1 
ATOM   6300 O O   . LEU B 1 281 ? 19.621  -12.182 -48.504 1.00 65.34  ? 281  LEU B O   1 
ATOM   6301 C CB  . LEU B 1 281 ? 19.619  -11.117 -51.733 1.00 64.95  ? 281  LEU B CB  1 
ATOM   6302 C CG  . LEU B 1 281 ? 20.849  -10.673 -52.552 1.00 65.63  ? 281  LEU B CG  1 
ATOM   6303 C CD1 . LEU B 1 281 ? 21.643  -11.822 -53.049 1.00 64.71  ? 281  LEU B CD1 1 
ATOM   6304 C CD2 . LEU B 1 281 ? 20.482  -9.744  -53.695 1.00 64.03  ? 281  LEU B CD2 1 
ATOM   6305 N N   . VAL B 1 282 ? 17.685  -12.331 -49.649 1.00 64.57  ? 282  VAL B N   1 
ATOM   6306 C CA  . VAL B 1 282 ? 16.836  -12.338 -48.472 1.00 64.10  ? 282  VAL B CA  1 
ATOM   6307 C C   . VAL B 1 282 ? 17.172  -13.515 -47.528 1.00 65.86  ? 282  VAL B C   1 
ATOM   6308 O O   . VAL B 1 282 ? 17.136  -13.371 -46.306 1.00 65.95  ? 282  VAL B O   1 
ATOM   6309 C CB  . VAL B 1 282 ? 15.345  -12.396 -48.885 1.00 63.41  ? 282  VAL B CB  1 
ATOM   6310 C CG1 . VAL B 1 282 ? 14.451  -12.657 -47.679 1.00 62.41  ? 282  VAL B CG1 1 
ATOM   6311 C CG2 . VAL B 1 282 ? 14.939  -11.111 -49.611 1.00 60.86  ? 282  VAL B CG2 1 
ATOM   6312 N N   . ASP B 1 283 ? 17.505  -14.671 -48.095 1.00 68.23  ? 283  ASP B N   1 
ATOM   6313 C CA  . ASP B 1 283 ? 17.894  -15.853 -47.305 1.00 70.07  ? 283  ASP B CA  1 
ATOM   6314 C C   . ASP B 1 283 ? 19.022  -15.575 -46.296 1.00 70.96  ? 283  ASP B C   1 
ATOM   6315 O O   . ASP B 1 283 ? 19.046  -16.156 -45.208 1.00 71.79  ? 283  ASP B O   1 
ATOM   6316 C CB  . ASP B 1 283 ? 18.335  -16.988 -48.229 1.00 72.07  ? 283  ASP B CB  1 
ATOM   6317 C CG  . ASP B 1 283 ? 17.180  -17.886 -48.688 1.00 73.58  ? 283  ASP B CG  1 
ATOM   6318 O OD1 . ASP B 1 283 ? 15.987  -17.631 -48.359 1.00 73.02  ? 283  ASP B OD1 1 
ATOM   6319 O OD2 . ASP B 1 283 ? 17.501  -18.870 -49.397 1.00 75.89  ? 283  ASP B OD2 1 
ATOM   6320 N N   . HIS B 1 284 ? 19.954  -14.699 -46.661 1.00 70.98  ? 284  HIS B N   1 
ATOM   6321 C CA  . HIS B 1 284 ? 21.113  -14.415 -45.827 1.00 71.98  ? 284  HIS B CA  1 
ATOM   6322 C C   . HIS B 1 284 ? 21.116  -13.004 -45.250 1.00 70.53  ? 284  HIS B C   1 
ATOM   6323 O O   . HIS B 1 284 ? 22.151  -12.515 -44.810 1.00 70.90  ? 284  HIS B O   1 
ATOM   6324 C CB  . HIS B 1 284 ? 22.390  -14.648 -46.638 1.00 73.70  ? 284  HIS B CB  1 
ATOM   6325 C CG  . HIS B 1 284 ? 22.640  -16.085 -46.961 1.00 76.25  ? 284  HIS B CG  1 
ATOM   6326 N ND1 . HIS B 1 284 ? 23.034  -17.003 -46.011 1.00 78.81  ? 284  HIS B ND1 1 
ATOM   6327 C CD2 . HIS B 1 284 ? 22.566  -16.761 -48.131 1.00 78.38  ? 284  HIS B CD2 1 
ATOM   6328 C CE1 . HIS B 1 284 ? 23.184  -18.184 -46.580 1.00 80.92  ? 284  HIS B CE1 1 
ATOM   6329 N NE2 . HIS B 1 284 ? 22.912  -18.064 -47.868 1.00 80.87  ? 284  HIS B NE2 1 
ATOM   6330 N N   . GLU B 1 285 ? 19.953  -12.367 -45.224 1.00 69.39  ? 285  GLU B N   1 
ATOM   6331 C CA  . GLU B 1 285 ? 19.838  -10.957 -44.818 1.00 67.88  ? 285  GLU B CA  1 
ATOM   6332 C C   . GLU B 1 285 ? 20.121  -10.754 -43.321 1.00 68.02  ? 285  GLU B C   1 
ATOM   6333 O O   . GLU B 1 285 ? 20.704  -9.737  -42.904 1.00 66.95  ? 285  GLU B O   1 
ATOM   6334 C CB  . GLU B 1 285 ? 18.431  -10.444 -45.150 1.00 66.28  ? 285  GLU B CB  1 
ATOM   6335 C CG  . GLU B 1 285 ? 18.381  -8.977  -45.432 1.00 65.77  ? 285  GLU B CG  1 
ATOM   6336 C CD  . GLU B 1 285 ? 16.978  -8.417  -45.436 1.00 64.08  ? 285  GLU B CD  1 
ATOM   6337 O OE1 . GLU B 1 285 ? 16.103  -8.987  -46.105 1.00 61.77  ? 285  GLU B OE1 1 
ATOM   6338 O OE2 . GLU B 1 285 ? 16.761  -7.378  -44.770 1.00 67.24  ? 285  GLU B OE2 1 
ATOM   6339 N N   . TRP B 1 286 ? 19.699  -11.736 -42.530 1.00 69.12  ? 286  TRP B N   1 
ATOM   6340 C CA  . TRP B 1 286 ? 19.747  -11.664 -41.086 1.00 69.62  ? 286  TRP B CA  1 
ATOM   6341 C C   . TRP B 1 286 ? 20.940  -12.413 -40.541 1.00 71.00  ? 286  TRP B C   1 
ATOM   6342 O O   . TRP B 1 286 ? 20.923  -12.858 -39.404 1.00 72.33  ? 286  TRP B O   1 
ATOM   6343 C CB  . TRP B 1 286 ? 18.440  -12.222 -40.509 1.00 70.31  ? 286  TRP B CB  1 
ATOM   6344 C CG  . TRP B 1 286 ? 17.308  -11.409 -40.961 1.00 69.41  ? 286  TRP B CG  1 
ATOM   6345 C CD1 . TRP B 1 286 ? 16.337  -11.760 -41.854 1.00 69.91  ? 286  TRP B CD1 1 
ATOM   6346 C CD2 . TRP B 1 286 ? 17.069  -10.049 -40.613 1.00 68.59  ? 286  TRP B CD2 1 
ATOM   6347 N NE1 . TRP B 1 286 ? 15.487  -10.697 -42.063 1.00 68.68  ? 286  TRP B NE1 1 
ATOM   6348 C CE2 . TRP B 1 286 ? 15.918  -9.634  -41.311 1.00 67.89  ? 286  TRP B CE2 1 
ATOM   6349 C CE3 . TRP B 1 286 ? 17.717  -9.136  -39.770 1.00 68.40  ? 286  TRP B CE3 1 
ATOM   6350 C CZ2 . TRP B 1 286 ? 15.394  -8.345  -41.185 1.00 66.72  ? 286  TRP B CZ2 1 
ATOM   6351 C CZ3 . TRP B 1 286 ? 17.198  -7.850  -39.647 1.00 66.93  ? 286  TRP B CZ3 1 
ATOM   6352 C CH2 . TRP B 1 286 ? 16.049  -7.466  -40.354 1.00 66.16  ? 286  TRP B CH2 1 
ATOM   6353 N N   . HIS B 1 287 ? 21.976  -12.556 -41.350 1.00 71.19  ? 287  HIS B N   1 
ATOM   6354 C CA  . HIS B 1 287 ? 23.199  -13.194 -40.906 1.00 72.82  ? 287  HIS B CA  1 
ATOM   6355 C C   . HIS B 1 287 ? 24.362  -12.218 -40.908 1.00 71.75  ? 287  HIS B C   1 
ATOM   6356 O O   . HIS B 1 287 ? 25.494  -12.636 -40.691 1.00 73.31  ? 287  HIS B O   1 
ATOM   6357 C CB  . HIS B 1 287 ? 23.549  -14.379 -41.815 1.00 74.98  ? 287  HIS B CB  1 
ATOM   6358 C CG  . HIS B 1 287 ? 22.543  -15.488 -41.790 1.00 77.22  ? 287  HIS B CG  1 
ATOM   6359 N ND1 . HIS B 1 287 ? 21.838  -15.830 -40.656 1.00 79.31  ? 287  HIS B ND1 1 
ATOM   6360 C CD2 . HIS B 1 287 ? 22.158  -16.362 -42.750 1.00 79.10  ? 287  HIS B CD2 1 
ATOM   6361 C CE1 . HIS B 1 287 ? 21.042  -16.851 -40.926 1.00 80.80  ? 287  HIS B CE1 1 
ATOM   6362 N NE2 . HIS B 1 287 ? 21.218  -17.193 -42.190 1.00 80.44  ? 287  HIS B NE2 1 
ATOM   6363 N N   . VAL B 1 288 ? 24.099  -10.938 -41.174 1.00 69.18  ? 288  VAL B N   1 
ATOM   6364 C CA  . VAL B 1 288 ? 25.171  -9.941  -41.290 1.00 68.53  ? 288  VAL B CA  1 
ATOM   6365 C C   . VAL B 1 288 ? 25.248  -8.982  -40.100 1.00 67.52  ? 288  VAL B C   1 
ATOM   6366 O O   . VAL B 1 288 ? 26.197  -8.211  -39.993 1.00 67.16  ? 288  VAL B O   1 
ATOM   6367 C CB  . VAL B 1 288 ? 25.077  -9.111  -42.596 1.00 67.43  ? 288  VAL B CB  1 
ATOM   6368 C CG1 . VAL B 1 288 ? 25.375  -9.976  -43.806 1.00 68.00  ? 288  VAL B CG1 1 
ATOM   6369 C CG2 . VAL B 1 288 ? 23.733  -8.419  -42.714 1.00 65.27  ? 288  VAL B CG2 1 
ATOM   6370 N N   . LEU B 1 289 ? 24.263  -9.026  -39.209 1.00 66.76  ? 289  LEU B N   1 
ATOM   6371 C CA  . LEU B 1 289 ? 24.296  -8.178  -38.016 1.00 66.29  ? 289  LEU B CA  1 
ATOM   6372 C C   . LEU B 1 289 ? 25.456  -8.587  -37.093 1.00 68.07  ? 289  LEU B C   1 
ATOM   6373 O O   . LEU B 1 289 ? 25.742  -9.783  -36.956 1.00 69.72  ? 289  LEU B O   1 
ATOM   6374 C CB  . LEU B 1 289 ? 22.963  -8.232  -37.264 1.00 65.01  ? 289  LEU B CB  1 
ATOM   6375 C CG  . LEU B 1 289 ? 21.827  -7.397  -37.856 1.00 62.29  ? 289  LEU B CG  1 
ATOM   6376 C CD1 . LEU B 1 289 ? 20.519  -7.667  -37.106 1.00 62.11  ? 289  LEU B CD1 1 
ATOM   6377 C CD2 . LEU B 1 289 ? 22.169  -5.925  -37.839 1.00 56.91  ? 289  LEU B CD2 1 
ATOM   6378 N N   . PRO B 1 290 ? 26.120  -7.595  -36.454 1.00 68.04  ? 290  PRO B N   1 
ATOM   6379 C CA  . PRO B 1 290 ? 27.293  -7.837  -35.594 1.00 69.72  ? 290  PRO B CA  1 
ATOM   6380 C C   . PRO B 1 290 ? 27.004  -8.528  -34.248 1.00 70.40  ? 290  PRO B C   1 
ATOM   6381 O O   . PRO B 1 290 ? 27.899  -9.153  -33.692 1.00 72.14  ? 290  PRO B O   1 
ATOM   6382 C CB  . PRO B 1 290 ? 27.852  -6.432  -35.368 1.00 68.97  ? 290  PRO B CB  1 
ATOM   6383 C CG  . PRO B 1 290 ? 26.655  -5.532  -35.479 1.00 67.12  ? 290  PRO B CG  1 
ATOM   6384 C CD  . PRO B 1 290 ? 25.770  -6.162  -36.512 1.00 66.66  ? 290  PRO B CD  1 
ATOM   6385 N N   . GLN B 1 291 ? 25.772  -8.420  -33.755 1.00 69.49  ? 291  GLN B N   1 
ATOM   6386 C CA  . GLN B 1 291 ? 25.362  -8.982  -32.472 1.00 70.38  ? 291  GLN B CA  1 
ATOM   6387 C C   . GLN B 1 291 ? 23.989  -9.649  -32.529 1.00 70.35  ? 291  GLN B C   1 
ATOM   6388 O O   . GLN B 1 291 ? 23.191  -9.393  -33.432 1.00 69.51  ? 291  GLN B O   1 
ATOM   6389 C CB  . GLN B 1 291 ? 25.297  -7.871  -31.414 1.00 69.73  ? 291  GLN B CB  1 
ATOM   6390 C CG  . GLN B 1 291 ? 26.429  -7.896  -30.397 1.00 72.46  ? 291  GLN B CG  1 
ATOM   6391 C CD  . GLN B 1 291 ? 27.670  -7.164  -30.856 1.00 73.92  ? 291  GLN B CD  1 
ATOM   6392 O OE1 . GLN B 1 291 ? 28.786  -7.616  -30.594 1.00 76.02  ? 291  GLN B OE1 1 
ATOM   6393 N NE2 . GLN B 1 291 ? 27.487  -6.017  -31.525 1.00 71.88  ? 291  GLN B NE2 1 
ATOM   6394 N N   . GLU B 1 292 ? 23.723  -10.497 -31.540 1.00 72.06  ? 292  GLU B N   1 
ATOM   6395 C CA  . GLU B 1 292 ? 22.374  -10.986 -31.254 1.00 72.00  ? 292  GLU B CA  1 
ATOM   6396 C C   . GLU B 1 292 ? 21.584  -9.783  -30.729 1.00 69.66  ? 292  GLU B C   1 
ATOM   6397 O O   . GLU B 1 292 ? 21.861  -9.282  -29.638 1.00 69.72  ? 292  GLU B O   1 
ATOM   6398 C CB  . GLU B 1 292 ? 22.443  -12.109 -30.202 1.00 73.92  ? 292  GLU B CB  1 
ATOM   6399 C CG  . GLU B 1 292 ? 21.100  -12.722 -29.756 1.00 74.66  ? 292  GLU B CG  1 
ATOM   6400 C CD  . GLU B 1 292 ? 21.263  -13.772 -28.632 1.00 78.05  ? 292  GLU B CD  1 
ATOM   6401 O OE1 . GLU B 1 292 ? 22.384  -13.912 -28.078 1.00 82.75  ? 292  GLU B OE1 1 
ATOM   6402 O OE2 . GLU B 1 292 ? 20.270  -14.464 -28.295 1.00 82.03  ? 292  GLU B OE2 1 
ATOM   6403 N N   . SER B 1 293 ? 20.621  -9.307  -31.515 1.00 67.53  ? 293  SER B N   1 
ATOM   6404 C CA  . SER B 1 293 ? 19.955  -8.057  -31.218 1.00 65.32  ? 293  SER B CA  1 
ATOM   6405 C C   . SER B 1 293 ? 18.484  -8.050  -31.599 1.00 63.81  ? 293  SER B C   1 
ATOM   6406 O O   . SER B 1 293 ? 18.012  -8.921  -32.323 1.00 64.56  ? 293  SER B O   1 
ATOM   6407 C CB  . SER B 1 293 ? 20.669  -6.918  -31.944 1.00 64.78  ? 293  SER B CB  1 
ATOM   6408 O OG  . SER B 1 293 ? 20.789  -7.161  -33.330 1.00 64.75  ? 293  SER B OG  1 
ATOM   6409 N N   . ILE B 1 294 ? 17.766  -7.070  -31.066 1.00 61.62  ? 294  ILE B N   1 
ATOM   6410 C CA  . ILE B 1 294 ? 16.445  -6.709  -31.551 1.00 59.96  ? 294  ILE B CA  1 
ATOM   6411 C C   . ILE B 1 294 ? 16.450  -5.220  -31.862 1.00 58.10  ? 294  ILE B C   1 
ATOM   6412 O O   . ILE B 1 294 ? 17.306  -4.495  -31.373 1.00 57.83  ? 294  ILE B O   1 
ATOM   6413 C CB  . ILE B 1 294 ? 15.311  -7.027  -30.538 1.00 60.34  ? 294  ILE B CB  1 
ATOM   6414 C CG1 . ILE B 1 294 ? 15.542  -6.325  -29.192 1.00 59.75  ? 294  ILE B CG1 1 
ATOM   6415 C CG2 . ILE B 1 294 ? 15.155  -8.539  -30.353 1.00 60.45  ? 294  ILE B CG2 1 
ATOM   6416 C CD1 . ILE B 1 294 ? 14.476  -6.661  -28.171 1.00 60.39  ? 294  ILE B CD1 1 
ATOM   6417 N N   . PHE B 1 295 ? 15.480  -4.790  -32.664 1.00 57.07  ? 295  PHE B N   1 
ATOM   6418 C CA  . PHE B 1 295 ? 15.361  -3.402  -33.157 1.00 55.96  ? 295  PHE B CA  1 
ATOM   6419 C C   . PHE B 1 295 ? 16.640  -3.024  -33.891 1.00 55.99  ? 295  PHE B C   1 
ATOM   6420 O O   . PHE B 1 295 ? 17.187  -1.927  -33.727 1.00 55.37  ? 295  PHE B O   1 
ATOM   6421 C CB  . PHE B 1 295 ? 15.038  -2.421  -32.018 1.00 55.52  ? 295  PHE B CB  1 
ATOM   6422 C CG  . PHE B 1 295 ? 14.089  -1.292  -32.421 1.00 54.46  ? 295  PHE B CG  1 
ATOM   6423 C CD1 . PHE B 1 295 ? 14.327  -0.519  -33.543 1.00 52.77  ? 295  PHE B CD1 1 
ATOM   6424 C CD2 . PHE B 1 295 ? 12.960  -1.017  -31.670 1.00 53.38  ? 295  PHE B CD2 1 
ATOM   6425 C CE1 . PHE B 1 295 ? 13.458  0.483   -33.904 1.00 52.30  ? 295  PHE B CE1 1 
ATOM   6426 C CE2 . PHE B 1 295 ? 12.098  -0.005  -32.035 1.00 53.60  ? 295  PHE B CE2 1 
ATOM   6427 C CZ  . PHE B 1 295 ? 12.348  0.745   -33.155 1.00 51.68  ? 295  PHE B CZ  1 
ATOM   6428 N N   . ARG B 1 296 ? 17.113  -3.966  -34.701 1.00 56.41  ? 296  ARG B N   1 
ATOM   6429 C CA  . ARG B 1 296 ? 18.308  -3.764  -35.470 1.00 57.00  ? 296  ARG B CA  1 
ATOM   6430 C C   . ARG B 1 296 ? 18.133  -4.422  -36.851 1.00 57.03  ? 296  ARG B C   1 
ATOM   6431 O O   . ARG B 1 296 ? 17.609  -5.547  -36.972 1.00 58.03  ? 296  ARG B O   1 
ATOM   6432 C CB  . ARG B 1 296 ? 19.496  -4.313  -34.692 1.00 58.87  ? 296  ARG B CB  1 
ATOM   6433 C CG  . ARG B 1 296 ? 20.750  -3.472  -34.817 1.00 61.06  ? 296  ARG B CG  1 
ATOM   6434 C CD  . ARG B 1 296 ? 21.097  -2.678  -33.576 1.00 62.08  ? 296  ARG B CD  1 
ATOM   6435 N NE  . ARG B 1 296 ? 20.029  -1.810  -33.150 1.00 62.03  ? 296  ARG B NE  1 
ATOM   6436 C CZ  . ARG B 1 296 ? 20.083  -1.018  -32.080 1.00 61.74  ? 296  ARG B CZ  1 
ATOM   6437 N NH1 . ARG B 1 296 ? 21.166  -0.938  -31.323 1.00 63.27  ? 296  ARG B NH1 1 
ATOM   6438 N NH2 . ARG B 1 296 ? 19.033  -0.282  -31.770 1.00 60.39  ? 296  ARG B NH2 1 
ATOM   6439 N N   . PHE B 1 297 ? 18.521  -3.692  -37.895 1.00 55.55  ? 297  PHE B N   1 
ATOM   6440 C CA  . PHE B 1 297 ? 18.186  -4.062  -39.265 1.00 54.74  ? 297  PHE B CA  1 
ATOM   6441 C C   . PHE B 1 297 ? 19.443  -3.999  -40.123 1.00 54.57  ? 297  PHE B C   1 
ATOM   6442 O O   . PHE B 1 297 ? 20.193  -3.018  -40.070 1.00 53.35  ? 297  PHE B O   1 
ATOM   6443 C CB  . PHE B 1 297 ? 17.090  -3.133  -39.789 1.00 53.65  ? 297  PHE B CB  1 
ATOM   6444 C CG  . PHE B 1 297 ? 16.012  -2.849  -38.775 1.00 53.27  ? 297  PHE B CG  1 
ATOM   6445 C CD1 . PHE B 1 297 ? 15.164  -3.860  -38.342 1.00 55.59  ? 297  PHE B CD1 1 
ATOM   6446 C CD2 . PHE B 1 297 ? 15.856  -1.580  -38.233 1.00 53.40  ? 297  PHE B CD2 1 
ATOM   6447 C CE1 . PHE B 1 297 ? 14.171  -3.601  -37.388 1.00 53.81  ? 297  PHE B CE1 1 
ATOM   6448 C CE2 . PHE B 1 297 ? 14.882  -1.321  -37.283 1.00 51.37  ? 297  PHE B CE2 1 
ATOM   6449 C CZ  . PHE B 1 297 ? 14.039  -2.341  -36.864 1.00 52.23  ? 297  PHE B CZ  1 
ATOM   6450 N N   . SER B 1 298 ? 19.662  -5.057  -40.902 1.00 53.89  ? 298  SER B N   1 
ATOM   6451 C CA  . SER B 1 298 ? 20.910  -5.255  -41.652 1.00 54.67  ? 298  SER B CA  1 
ATOM   6452 C C   . SER B 1 298 ? 21.226  -4.197  -42.718 1.00 53.60  ? 298  SER B C   1 
ATOM   6453 O O   . SER B 1 298 ? 22.355  -3.695  -42.799 1.00 54.28  ? 298  SER B O   1 
ATOM   6454 C CB  . SER B 1 298 ? 20.877  -6.621  -42.330 1.00 55.67  ? 298  SER B CB  1 
ATOM   6455 O OG  . SER B 1 298 ? 20.709  -7.652  -41.372 1.00 56.69  ? 298  SER B OG  1 
ATOM   6456 N N   . PHE B 1 299 ? 20.242  -3.875  -43.550 1.00 52.22  ? 299  PHE B N   1 
ATOM   6457 C CA  . PHE B 1 299 ? 20.466  -2.939  -44.648 1.00 51.38  ? 299  PHE B CA  1 
ATOM   6458 C C   . PHE B 1 299 ? 19.596  -1.725  -44.489 1.00 49.73  ? 299  PHE B C   1 
ATOM   6459 O O   . PHE B 1 299 ? 18.386  -1.802  -44.641 1.00 48.84  ? 299  PHE B O   1 
ATOM   6460 C CB  . PHE B 1 299 ? 20.273  -3.636  -45.975 1.00 51.64  ? 299  PHE B CB  1 
ATOM   6461 C CG  . PHE B 1 299 ? 21.283  -4.710  -46.181 1.00 51.41  ? 299  PHE B CG  1 
ATOM   6462 C CD1 . PHE B 1 299 ? 22.569  -4.381  -46.561 1.00 52.13  ? 299  PHE B CD1 1 
ATOM   6463 C CD2 . PHE B 1 299 ? 20.996  -6.011  -45.851 1.00 51.88  ? 299  PHE B CD2 1 
ATOM   6464 C CE1 . PHE B 1 299 ? 23.561  -5.358  -46.668 1.00 53.87  ? 299  PHE B CE1 1 
ATOM   6465 C CE2 . PHE B 1 299 ? 21.982  -7.000  -45.966 1.00 54.19  ? 299  PHE B CE2 1 
ATOM   6466 C CZ  . PHE B 1 299 ? 23.256  -6.662  -46.380 1.00 54.15  ? 299  PHE B CZ  1 
ATOM   6467 N N   . VAL B 1 300 ? 20.253  -0.617  -44.153 1.00 49.09  ? 300  VAL B N   1 
ATOM   6468 C CA  . VAL B 1 300 ? 19.596  0.646   -43.800 1.00 47.39  ? 300  VAL B CA  1 
ATOM   6469 C C   . VAL B 1 300 ? 20.402  1.804   -44.415 1.00 47.79  ? 300  VAL B C   1 
ATOM   6470 O O   . VAL B 1 300 ? 21.511  1.588   -44.924 1.00 48.53  ? 300  VAL B O   1 
ATOM   6471 C CB  . VAL B 1 300 ? 19.535  0.816   -42.253 1.00 47.25  ? 300  VAL B CB  1 
ATOM   6472 C CG1 . VAL B 1 300 ? 18.825  -0.362  -41.579 1.00 46.39  ? 300  VAL B CG1 1 
ATOM   6473 C CG2 . VAL B 1 300 ? 20.936  0.973   -41.683 1.00 48.25  ? 300  VAL B CG2 1 
ATOM   6474 N N   . PRO B 1 301 ? 19.861  3.036   -44.391 1.00 47.13  ? 301  PRO B N   1 
ATOM   6475 C CA  . PRO B 1 301 ? 20.609  4.176   -44.907 1.00 48.17  ? 301  PRO B CA  1 
ATOM   6476 C C   . PRO B 1 301 ? 22.042  4.273   -44.397 1.00 49.98  ? 301  PRO B C   1 
ATOM   6477 O O   . PRO B 1 301 ? 22.317  3.936   -43.251 1.00 51.28  ? 301  PRO B O   1 
ATOM   6478 C CB  . PRO B 1 301 ? 19.784  5.360   -44.428 1.00 47.43  ? 301  PRO B CB  1 
ATOM   6479 C CG  . PRO B 1 301 ? 18.395  4.864   -44.483 1.00 45.36  ? 301  PRO B CG  1 
ATOM   6480 C CD  . PRO B 1 301 ? 18.510  3.438   -43.969 1.00 46.24  ? 301  PRO B CD  1 
ATOM   6481 N N   . VAL B 1 302 ? 22.949  4.740   -45.251 1.00 51.24  ? 302  VAL B N   1 
ATOM   6482 C CA  . VAL B 1 302 ? 24.351  4.811   -44.908 1.00 52.56  ? 302  VAL B CA  1 
ATOM   6483 C C   . VAL B 1 302 ? 24.824  6.257   -44.926 1.00 53.43  ? 302  VAL B C   1 
ATOM   6484 O O   . VAL B 1 302 ? 24.380  7.055   -45.746 1.00 53.32  ? 302  VAL B O   1 
ATOM   6485 C CB  . VAL B 1 302 ? 25.206  3.915   -45.851 1.00 53.56  ? 302  VAL B CB  1 
ATOM   6486 C CG1 . VAL B 1 302 ? 24.971  4.270   -47.326 1.00 53.99  ? 302  VAL B CG1 1 
ATOM   6487 C CG2 . VAL B 1 302 ? 26.696  4.010   -45.490 1.00 54.42  ? 302  VAL B CG2 1 
ATOM   6488 N N   . VAL B 1 303 ? 25.707  6.605   -44.004 1.00 54.69  ? 303  VAL B N   1 
ATOM   6489 C CA  . VAL B 1 303 ? 26.287  7.941   -43.997 1.00 56.08  ? 303  VAL B CA  1 
ATOM   6490 C C   . VAL B 1 303 ? 27.351  7.920   -45.082 1.00 58.01  ? 303  VAL B C   1 
ATOM   6491 O O   . VAL B 1 303 ? 28.505  7.521   -44.874 1.00 59.83  ? 303  VAL B O   1 
ATOM   6492 C CB  . VAL B 1 303 ? 26.784  8.373   -42.583 1.00 56.34  ? 303  VAL B CB  1 
ATOM   6493 C CG1 . VAL B 1 303 ? 27.359  9.764   -42.596 1.00 57.00  ? 303  VAL B CG1 1 
ATOM   6494 C CG2 . VAL B 1 303 ? 25.627  8.343   -41.616 1.00 54.54  ? 303  VAL B CG2 1 
ATOM   6495 N N   . ASP B 1 304 ? 26.906  8.295   -46.278 1.00 58.67  ? 304  ASP B N   1 
ATOM   6496 C CA  . ASP B 1 304 ? 27.716  8.188   -47.505 1.00 60.27  ? 304  ASP B CA  1 
ATOM   6497 C C   . ASP B 1 304 ? 28.480  9.453   -47.848 1.00 61.70  ? 304  ASP B C   1 
ATOM   6498 O O   . ASP B 1 304 ? 29.344  9.424   -48.720 1.00 62.89  ? 304  ASP B O   1 
ATOM   6499 C CB  . ASP B 1 304 ? 26.824  7.813   -48.694 1.00 59.50  ? 304  ASP B CB  1 
ATOM   6500 C CG  . ASP B 1 304 ? 25.658  8.779   -48.897 1.00 58.46  ? 304  ASP B CG  1 
ATOM   6501 O OD1 . ASP B 1 304 ? 25.440  9.667   -48.049 1.00 58.27  ? 304  ASP B OD1 1 
ATOM   6502 O OD2 . ASP B 1 304 ? 24.949  8.645   -49.913 1.00 57.76  ? 304  ASP B OD2 1 
ATOM   6503 N N   . GLY B 1 305 ? 28.154  10.559  -47.183 1.00 61.89  ? 305  GLY B N   1 
ATOM   6504 C CA  . GLY B 1 305 ? 28.749  11.850  -47.507 1.00 63.64  ? 305  GLY B CA  1 
ATOM   6505 C C   . GLY B 1 305 ? 28.186  12.447  -48.785 1.00 64.17  ? 305  GLY B C   1 
ATOM   6506 O O   . GLY B 1 305 ? 28.849  13.246  -49.435 1.00 65.94  ? 305  GLY B O   1 
ATOM   6507 N N   . ASP B 1 306 ? 26.958  12.070  -49.135 1.00 63.61  ? 306  ASP B N   1 
ATOM   6508 C CA  . ASP B 1 306 ? 26.294  12.528  -50.362 1.00 63.40  ? 306  ASP B CA  1 
ATOM   6509 C C   . ASP B 1 306 ? 24.833  12.825  -50.039 1.00 61.54  ? 306  ASP B C   1 
ATOM   6510 O O   . ASP B 1 306 ? 24.490  13.984  -49.790 1.00 61.04  ? 306  ASP B O   1 
ATOM   6511 C CB  . ASP B 1 306 ? 26.429  11.491  -51.494 1.00 63.84  ? 306  ASP B CB  1 
ATOM   6512 C CG  . ASP B 1 306 ? 25.723  11.918  -52.783 1.00 65.22  ? 306  ASP B CG  1 
ATOM   6513 O OD1 . ASP B 1 306 ? 25.354  13.110  -52.920 1.00 69.26  ? 306  ASP B OD1 1 
ATOM   6514 O OD2 . ASP B 1 306 ? 25.544  11.060  -53.681 1.00 68.68  ? 306  ASP B OD2 1 
ATOM   6515 N N   . PHE B 1 307 ? 23.982  11.793  -50.021 1.00 60.23  ? 307  PHE B N   1 
ATOM   6516 C CA  . PHE B 1 307 ? 22.589  11.958  -49.587 1.00 58.52  ? 307  PHE B CA  1 
ATOM   6517 C C   . PHE B 1 307 ? 22.636  12.534  -48.183 1.00 58.01  ? 307  PHE B C   1 
ATOM   6518 O O   . PHE B 1 307 ? 22.007  13.549  -47.901 1.00 57.48  ? 307  PHE B O   1 
ATOM   6519 C CB  . PHE B 1 307 ? 21.809  10.630  -49.587 1.00 57.66  ? 307  PHE B CB  1 
ATOM   6520 C CG  . PHE B 1 307 ? 20.313  10.805  -49.427 1.00 56.72  ? 307  PHE B CG  1 
ATOM   6521 C CD1 . PHE B 1 307 ? 19.758  11.124  -48.191 1.00 55.67  ? 307  PHE B CD1 1 
ATOM   6522 C CD2 . PHE B 1 307 ? 19.461  10.666  -50.516 1.00 56.04  ? 307  PHE B CD2 1 
ATOM   6523 C CE1 . PHE B 1 307 ? 18.388  11.297  -48.048 1.00 54.26  ? 307  PHE B CE1 1 
ATOM   6524 C CE2 . PHE B 1 307 ? 18.101  10.833  -50.371 1.00 55.39  ? 307  PHE B CE2 1 
ATOM   6525 C CZ  . PHE B 1 307 ? 17.568  11.157  -49.132 1.00 54.80  ? 307  PHE B CZ  1 
ATOM   6526 N N   . LEU B 1 308 ? 23.403  11.861  -47.322 1.00 58.10  ? 308  LEU B N   1 
ATOM   6527 C CA  . LEU B 1 308 ? 23.713  12.332  -45.977 1.00 57.72  ? 308  LEU B CA  1 
ATOM   6528 C C   . LEU B 1 308 ? 25.107  12.898  -45.961 1.00 59.40  ? 308  LEU B C   1 
ATOM   6529 O O   . LEU B 1 308 ? 26.085  12.149  -45.942 1.00 59.82  ? 308  LEU B O   1 
ATOM   6530 C CB  . LEU B 1 308 ? 23.615  11.188  -44.961 1.00 56.59  ? 308  LEU B CB  1 
ATOM   6531 C CG  . LEU B 1 308 ? 22.244  10.525  -44.786 1.00 54.90  ? 308  LEU B CG  1 
ATOM   6532 C CD1 . LEU B 1 308 ? 22.335  9.418   -43.748 1.00 52.70  ? 308  LEU B CD1 1 
ATOM   6533 C CD2 . LEU B 1 308 ? 21.171  11.529  -44.396 1.00 52.19  ? 308  LEU B CD2 1 
ATOM   6534 N N   . SER B 1 309 ? 25.203  14.223  -45.946 1.00 60.62  ? 309  SER B N   1 
ATOM   6535 C CA  . SER B 1 309 ? 26.503  14.890  -45.975 1.00 62.95  ? 309  SER B CA  1 
ATOM   6536 C C   . SER B 1 309 ? 27.350  14.610  -44.732 1.00 63.93  ? 309  SER B C   1 
ATOM   6537 O O   . SER B 1 309 ? 28.570  14.641  -44.800 1.00 65.74  ? 309  SER B O   1 
ATOM   6538 C CB  . SER B 1 309 ? 26.335  16.398  -46.185 1.00 63.59  ? 309  SER B CB  1 
ATOM   6539 O OG  . SER B 1 309 ? 25.473  16.985  -45.216 1.00 64.14  ? 309  SER B OG  1 
ATOM   6540 N N   . ASP B 1 310 ? 26.697  14.352  -43.602 1.00 63.23  ? 310  ASP B N   1 
ATOM   6541 C CA  . ASP B 1 310 ? 27.372  13.969  -42.364 1.00 63.77  ? 310  ASP B CA  1 
ATOM   6542 C C   . ASP B 1 310 ? 26.423  13.038  -41.621 1.00 62.36  ? 310  ASP B C   1 
ATOM   6543 O O   . ASP B 1 310 ? 25.350  12.736  -42.131 1.00 60.93  ? 310  ASP B O   1 
ATOM   6544 C CB  . ASP B 1 310 ? 27.673  15.223  -41.540 1.00 64.88  ? 310  ASP B CB  1 
ATOM   6545 C CG  . ASP B 1 310 ? 28.849  15.053  -40.583 1.00 66.86  ? 310  ASP B CG  1 
ATOM   6546 O OD1 . ASP B 1 310 ? 29.218  13.912  -40.226 1.00 67.68  ? 310  ASP B OD1 1 
ATOM   6547 O OD2 . ASP B 1 310 ? 29.402  16.089  -40.175 1.00 69.76  ? 310  ASP B OD2 1 
ATOM   6548 N N   . THR B 1 311 ? 26.792  12.594  -40.425 1.00 62.69  ? 311  THR B N   1 
ATOM   6549 C CA  . THR B 1 311 ? 25.878  11.796  -39.606 1.00 61.83  ? 311  THR B CA  1 
ATOM   6550 C C   . THR B 1 311 ? 24.621  12.608  -39.278 1.00 60.98  ? 311  THR B C   1 
ATOM   6551 O O   . THR B 1 311 ? 24.678  13.822  -39.193 1.00 61.52  ? 311  THR B O   1 
ATOM   6552 C CB  . THR B 1 311 ? 26.513  11.352  -38.266 1.00 62.49  ? 311  THR B CB  1 
ATOM   6553 O OG1 . THR B 1 311 ? 26.693  12.497  -37.426 1.00 63.42  ? 311  THR B OG1 1 
ATOM   6554 C CG2 . THR B 1 311 ? 27.849  10.635  -38.482 1.00 62.48  ? 311  THR B CG2 1 
ATOM   6555 N N   . PRO B 1 312 ? 23.474  11.942  -39.113 1.00 60.45  ? 312  PRO B N   1 
ATOM   6556 C CA  . PRO B 1 312 ? 22.255  12.638  -38.684 1.00 60.04  ? 312  PRO B CA  1 
ATOM   6557 C C   . PRO B 1 312 ? 22.401  13.432  -37.386 1.00 61.07  ? 312  PRO B C   1 
ATOM   6558 O O   . PRO B 1 312 ? 21.748  14.462  -37.220 1.00 60.17  ? 312  PRO B O   1 
ATOM   6559 C CB  . PRO B 1 312 ? 21.271  11.499  -38.478 1.00 59.00  ? 312  PRO B CB  1 
ATOM   6560 C CG  . PRO B 1 312 ? 21.732  10.458  -39.403 1.00 59.29  ? 312  PRO B CG  1 
ATOM   6561 C CD  . PRO B 1 312 ? 23.218  10.520  -39.364 1.00 59.44  ? 312  PRO B CD  1 
ATOM   6562 N N   . GLU B 1 313 ? 23.230  12.939  -36.470 1.00 62.46  ? 313  GLU B N   1 
ATOM   6563 C CA  . GLU B 1 313 ? 23.507  13.660  -35.238 1.00 64.39  ? 313  GLU B CA  1 
ATOM   6564 C C   . GLU B 1 313 ? 24.164  15.007  -35.513 1.00 64.71  ? 313  GLU B C   1 
ATOM   6565 O O   . GLU B 1 313 ? 23.720  16.043  -35.010 1.00 64.65  ? 313  GLU B O   1 
ATOM   6566 C CB  . GLU B 1 313 ? 24.427  12.848  -34.331 1.00 65.31  ? 313  GLU B CB  1 
ATOM   6567 C CG  . GLU B 1 313 ? 24.842  13.627  -33.080 1.00 68.35  ? 313  GLU B CG  1 
ATOM   6568 C CD  . GLU B 1 313 ? 25.541  12.768  -32.042 1.00 70.15  ? 313  GLU B CD  1 
ATOM   6569 O OE1 . GLU B 1 313 ? 26.668  12.291  -32.334 1.00 75.04  ? 313  GLU B OE1 1 
ATOM   6570 O OE2 . GLU B 1 313 ? 24.971  12.596  -30.926 1.00 75.51  ? 313  GLU B OE2 1 
ATOM   6571 N N   . ALA B 1 314 ? 25.244  14.970  -36.283 1.00 65.37  ? 314  ALA B N   1 
ATOM   6572 C CA  . ALA B 1 314 ? 25.968  16.174  -36.679 1.00 66.66  ? 314  ALA B CA  1 
ATOM   6573 C C   . ALA B 1 314 ? 25.052  17.141  -37.428 1.00 66.35  ? 314  ALA B C   1 
ATOM   6574 O O   . ALA B 1 314 ? 25.069  18.345  -37.179 1.00 67.02  ? 314  ALA B O   1 
ATOM   6575 C CB  . ALA B 1 314 ? 27.178  15.803  -37.547 1.00 67.43  ? 314  ALA B CB  1 
ATOM   6576 N N   . LEU B 1 315 ? 24.247  16.594  -38.336 1.00 65.54  ? 315  LEU B N   1 
ATOM   6577 C CA  . LEU B 1 315 ? 23.316  17.377  -39.141 1.00 65.13  ? 315  LEU B CA  1 
ATOM   6578 C C   . LEU B 1 315 ? 22.198  18.009  -38.315 1.00 64.99  ? 315  LEU B C   1 
ATOM   6579 O O   . LEU B 1 315 ? 21.839  19.162  -38.558 1.00 65.03  ? 315  LEU B O   1 
ATOM   6580 C CB  . LEU B 1 315 ? 22.720  16.512  -40.265 1.00 63.98  ? 315  LEU B CB  1 
ATOM   6581 C CG  . LEU B 1 315 ? 23.665  16.042  -41.381 1.00 64.24  ? 315  LEU B CG  1 
ATOM   6582 C CD1 . LEU B 1 315 ? 22.939  15.165  -42.380 1.00 61.07  ? 315  LEU B CD1 1 
ATOM   6583 C CD2 . LEU B 1 315 ? 24.320  17.225  -42.086 1.00 65.40  ? 315  LEU B CD2 1 
ATOM   6584 N N   . ILE B 1 316 ? 21.635  17.277  -37.350 1.00 65.09  ? 316  ILE B N   1 
ATOM   6585 C CA  . ILE B 1 316 ? 20.590  17.878  -36.507 1.00 65.56  ? 316  ILE B CA  1 
ATOM   6586 C C   . ILE B 1 316 ? 21.177  18.950  -35.555 1.00 67.25  ? 316  ILE B C   1 
ATOM   6587 O O   . ILE B 1 316 ? 20.485  19.916  -35.214 1.00 67.86  ? 316  ILE B O   1 
ATOM   6588 C CB  . ILE B 1 316 ? 19.675  16.837  -35.752 1.00 64.61  ? 316  ILE B CB  1 
ATOM   6589 C CG1 . ILE B 1 316 ? 20.388  16.163  -34.577 1.00 65.60  ? 316  ILE B CG1 1 
ATOM   6590 C CG2 . ILE B 1 316 ? 19.109  15.769  -36.713 1.00 61.33  ? 316  ILE B CG2 1 
ATOM   6591 C CD1 . ILE B 1 316 ? 19.501  15.130  -33.825 1.00 64.57  ? 316  ILE B CD1 1 
ATOM   6592 N N   . ASN B 1 317 ? 22.444  18.806  -35.159 1.00 68.43  ? 317  ASN B N   1 
ATOM   6593 C CA  . ASN B 1 317 ? 23.084  19.773  -34.246 1.00 69.66  ? 317  ASN B CA  1 
ATOM   6594 C C   . ASN B 1 317 ? 23.485  21.074  -34.935 1.00 71.21  ? 317  ASN B C   1 
ATOM   6595 O O   . ASN B 1 317 ? 23.480  22.119  -34.303 1.00 72.36  ? 317  ASN B O   1 
ATOM   6596 C CB  . ASN B 1 317 ? 24.313  19.170  -33.546 1.00 70.41  ? 317  ASN B CB  1 
ATOM   6597 C CG  . ASN B 1 317 ? 23.960  18.024  -32.594 1.00 70.07  ? 317  ASN B CG  1 
ATOM   6598 O OD1 . ASN B 1 317 ? 22.793  17.746  -32.327 1.00 70.73  ? 317  ASN B OD1 1 
ATOM   6599 N ND2 . ASN B 1 317 ? 24.983  17.349  -32.085 1.00 72.03  ? 317  ASN B ND2 1 
ATOM   6600 N N   . THR B 1 318 ? 23.823  21.017  -36.218 1.00 71.69  ? 318  THR B N   1 
ATOM   6601 C CA  . THR B 1 318 ? 24.285  22.202  -36.944 1.00 73.52  ? 318  THR B CA  1 
ATOM   6602 C C   . THR B 1 318 ? 23.267  22.776  -37.928 1.00 72.98  ? 318  THR B C   1 
ATOM   6603 O O   . THR B 1 318 ? 23.554  23.772  -38.600 1.00 74.38  ? 318  THR B O   1 
ATOM   6604 C CB  . THR B 1 318 ? 25.592  21.908  -37.739 1.00 74.76  ? 318  THR B CB  1 
ATOM   6605 O OG1 . THR B 1 318 ? 25.358  20.860  -38.696 1.00 74.04  ? 318  THR B OG1 1 
ATOM   6606 C CG2 . THR B 1 318 ? 26.724  21.516  -36.785 1.00 76.16  ? 318  THR B CG2 1 
ATOM   6607 N N   . GLY B 1 319 ? 22.095  22.160  -38.032 1.00 71.31  ? 319  GLY B N   1 
ATOM   6608 C CA  . GLY B 1 319 ? 21.110  22.585  -39.023 1.00 70.99  ? 319  GLY B CA  1 
ATOM   6609 C C   . GLY B 1 319 ? 20.373  23.868  -38.671 1.00 71.69  ? 319  GLY B C   1 
ATOM   6610 O O   . GLY B 1 319 ? 20.216  24.207  -37.504 1.00 71.75  ? 319  GLY B O   1 
ATOM   6611 N N   . ASP B 1 320 ? 19.929  24.584  -39.698 1.00 72.51  ? 320  ASP B N   1 
ATOM   6612 C CA  . ASP B 1 320 ? 19.043  25.728  -39.539 1.00 73.43  ? 320  ASP B CA  1 
ATOM   6613 C C   . ASP B 1 320 ? 17.657  25.294  -40.010 1.00 72.16  ? 320  ASP B C   1 
ATOM   6614 O O   . ASP B 1 320 ? 17.490  24.862  -41.164 1.00 71.56  ? 320  ASP B O   1 
ATOM   6615 C CB  . ASP B 1 320 ? 19.536  26.912  -40.371 1.00 75.45  ? 320  ASP B CB  1 
ATOM   6616 C CG  . ASP B 1 320 ? 18.686  28.164  -40.179 1.00 77.75  ? 320  ASP B CG  1 
ATOM   6617 O OD1 . ASP B 1 320 ? 17.857  28.176  -39.238 1.00 78.66  ? 320  ASP B OD1 1 
ATOM   6618 O OD2 . ASP B 1 320 ? 18.857  29.138  -40.960 1.00 80.19  ? 320  ASP B OD2 1 
ATOM   6619 N N   . PHE B 1 321 ? 16.671  25.396  -39.115 1.00 71.45  ? 321  PHE B N   1 
ATOM   6620 C CA  . PHE B 1 321 ? 15.340  24.842  -39.369 1.00 70.10  ? 321  PHE B CA  1 
ATOM   6621 C C   . PHE B 1 321 ? 14.248  25.890  -39.330 1.00 71.12  ? 321  PHE B C   1 
ATOM   6622 O O   . PHE B 1 321 ? 13.077  25.555  -39.189 1.00 70.45  ? 321  PHE B O   1 
ATOM   6623 C CB  . PHE B 1 321 ? 15.043  23.708  -38.389 1.00 68.38  ? 321  PHE B CB  1 
ATOM   6624 C CG  . PHE B 1 321 ? 15.995  22.554  -38.504 1.00 67.15  ? 321  PHE B CG  1 
ATOM   6625 C CD1 . PHE B 1 321 ? 16.059  21.804  -39.672 1.00 66.38  ? 321  PHE B CD1 1 
ATOM   6626 C CD2 . PHE B 1 321 ? 16.837  22.216  -37.455 1.00 67.44  ? 321  PHE B CD2 1 
ATOM   6627 C CE1 . PHE B 1 321 ? 16.949  20.736  -39.794 1.00 64.73  ? 321  PHE B CE1 1 
ATOM   6628 C CE2 . PHE B 1 321 ? 17.722  21.142  -37.573 1.00 66.81  ? 321  PHE B CE2 1 
ATOM   6629 C CZ  . PHE B 1 321 ? 17.775  20.409  -38.750 1.00 65.38  ? 321  PHE B CZ  1 
ATOM   6630 N N   . GLN B 1 322 ? 14.627  27.153  -39.500 1.00 73.21  ? 322  GLN B N   1 
ATOM   6631 C CA  . GLN B 1 322 ? 13.654  28.237  -39.478 1.00 74.71  ? 322  GLN B CA  1 
ATOM   6632 C C   . GLN B 1 322 ? 12.313  28.251  -40.188 1.00 73.80  ? 322  GLN B C   1 
ATOM   6633 O O   . GLN B 1 322 ? 11.299  28.596  -39.578 1.00 74.93  ? 322  GLN B O   1 
ATOM   6634 C CB  . GLN B 1 322 ? 14.047  29.538  -38.759 1.00 77.05  ? 322  GLN B CB  1 
ATOM   6635 C CG  . GLN B 1 322 ? 15.404  30.145  -39.095 1.00 81.29  ? 322  GLN B CG  1 
ATOM   6636 C CD  . GLN B 1 322 ? 16.123  30.695  -37.858 1.00 87.03  ? 322  GLN B CD  1 
ATOM   6637 O OE1 . GLN B 1 322 ? 17.364  30.764  -37.834 1.00 91.62  ? 322  GLN B OE1 1 
ATOM   6638 N NE2 . GLN B 1 322 ? 15.350  31.088  -36.825 1.00 87.77  ? 322  GLN B NE2 1 
ATOM   6639 N N   . ASP B 1 323 ? 12.268  27.871  -41.455 1.00 72.56  ? 323  ASP B N   1 
ATOM   6640 C CA  . ASP B 1 323 ? 10.980  27.863  -42.142 1.00 71.35  ? 323  ASP B CA  1 
ATOM   6641 C C   . ASP B 1 323 ? 10.468  26.411  -42.283 1.00 68.60  ? 323  ASP B C   1 
ATOM   6642 O O   . ASP B 1 323 ? 10.009  26.020  -43.344 1.00 68.74  ? 323  ASP B O   1 
ATOM   6643 C CB  . ASP B 1 323 ? 11.067  28.646  -43.476 1.00 73.38  ? 323  ASP B CB  1 
ATOM   6644 C CG  . ASP B 1 323 ? 11.121  30.205  -43.270 1.00 77.76  ? 323  ASP B CG  1 
ATOM   6645 O OD1 . ASP B 1 323 ? 11.558  30.705  -42.193 1.00 81.29  ? 323  ASP B OD1 1 
ATOM   6646 O OD2 . ASP B 1 323 ? 10.720  30.946  -44.203 1.00 82.39  ? 323  ASP B OD2 1 
ATOM   6647 N N   . LEU B 1 324 ? 10.535  25.645  -41.181 1.00 65.69  ? 324  LEU B N   1 
ATOM   6648 C CA  . LEU B 1 324 ? 10.091  24.242  -41.122 1.00 63.09  ? 324  LEU B CA  1 
ATOM   6649 C C   . LEU B 1 324 ? 9.090   23.996  -39.990 1.00 60.31  ? 324  LEU B C   1 
ATOM   6650 O O   . LEU B 1 324 ? 9.242   24.525  -38.896 1.00 60.36  ? 324  LEU B O   1 
ATOM   6651 C CB  . LEU B 1 324 ? 11.284  23.314  -40.888 1.00 62.12  ? 324  LEU B CB  1 
ATOM   6652 C CG  . LEU B 1 324 ? 10.997  21.802  -40.944 1.00 61.25  ? 324  LEU B CG  1 
ATOM   6653 C CD1 . LEU B 1 324 ? 10.741  21.346  -42.363 1.00 60.17  ? 324  LEU B CD1 1 
ATOM   6654 C CD2 . LEU B 1 324 ? 12.124  21.023  -40.326 1.00 60.61  ? 324  LEU B CD2 1 
ATOM   6655 N N   . GLN B 1 325 ? 8.088   23.165  -40.256 1.00 57.29  ? 325  GLN B N   1 
ATOM   6656 C CA  . GLN B 1 325 ? 7.156   22.736  -39.242 1.00 55.38  ? 325  GLN B CA  1 
ATOM   6657 C C   . GLN B 1 325 ? 7.181   21.228  -39.145 1.00 53.44  ? 325  GLN B C   1 
ATOM   6658 O O   . GLN B 1 325 ? 7.092   20.537  -40.162 1.00 52.63  ? 325  GLN B O   1 
ATOM   6659 C CB  . GLN B 1 325 ? 5.745   23.200  -39.568 1.00 56.44  ? 325  GLN B CB  1 
ATOM   6660 C CG  . GLN B 1 325 ? 5.562   24.716  -39.612 1.00 56.87  ? 325  GLN B CG  1 
ATOM   6661 C CD  . GLN B 1 325 ? 5.612   25.282  -41.011 1.00 59.00  ? 325  GLN B CD  1 
ATOM   6662 O OE1 . GLN B 1 325 ? 4.944   24.792  -41.907 1.00 60.26  ? 325  GLN B OE1 1 
ATOM   6663 N NE2 . GLN B 1 325 ? 6.409   26.325  -41.207 1.00 62.50  ? 325  GLN B NE2 1 
ATOM   6664 N N   . VAL B 1 326 ? 7.317   20.719  -37.925 1.00 52.10  ? 326  VAL B N   1 
ATOM   6665 C CA  . VAL B 1 326 ? 7.365   19.285  -37.694 1.00 51.03  ? 326  VAL B CA  1 
ATOM   6666 C C   . VAL B 1 326 ? 6.383   18.867  -36.603 1.00 50.54  ? 326  VAL B C   1 
ATOM   6667 O O   . VAL B 1 326 ? 6.263   19.522  -35.576 1.00 50.88  ? 326  VAL B O   1 
ATOM   6668 C CB  . VAL B 1 326 ? 8.801   18.803  -37.341 1.00 51.10  ? 326  VAL B CB  1 
ATOM   6669 C CG1 . VAL B 1 326 ? 8.911   17.300  -37.494 1.00 50.39  ? 326  VAL B CG1 1 
ATOM   6670 C CG2 . VAL B 1 326 ? 9.807   19.441  -38.246 1.00 50.59  ? 326  VAL B CG2 1 
ATOM   6671 N N   . LEU B 1 327 ? 5.657   17.784  -36.868 1.00 49.57  ? 327  LEU B N   1 
ATOM   6672 C CA  . LEU B 1 327 ? 4.853   17.076  -35.872 1.00 48.68  ? 327  LEU B CA  1 
ATOM   6673 C C   . LEU B 1 327 ? 5.569   15.769  -35.563 1.00 47.60  ? 327  LEU B C   1 
ATOM   6674 O O   . LEU B 1 327 ? 5.829   15.004  -36.480 1.00 47.04  ? 327  LEU B O   1 
ATOM   6675 C CB  . LEU B 1 327 ? 3.448   16.797  -36.430 1.00 48.79  ? 327  LEU B CB  1 
ATOM   6676 C CG  . LEU B 1 327 ? 2.412   16.098  -35.543 1.00 49.51  ? 327  LEU B CG  1 
ATOM   6677 C CD1 . LEU B 1 327 ? 2.089   16.956  -34.304 1.00 50.42  ? 327  LEU B CD1 1 
ATOM   6678 C CD2 . LEU B 1 327 ? 1.159   15.793  -36.338 1.00 47.84  ? 327  LEU B CD2 1 
ATOM   6679 N N   . VAL B 1 328 ? 5.914   15.525  -34.298 1.00 47.34  ? 328  VAL B N   1 
ATOM   6680 C CA  . VAL B 1 328 ? 6.586   14.274  -33.910 1.00 47.45  ? 328  VAL B CA  1 
ATOM   6681 C C   . VAL B 1 328 ? 5.880   13.612  -32.728 1.00 47.75  ? 328  VAL B C   1 
ATOM   6682 O O   . VAL B 1 328 ? 5.226   14.288  -31.929 1.00 48.46  ? 328  VAL B O   1 
ATOM   6683 C CB  . VAL B 1 328 ? 8.078   14.493  -33.505 1.00 47.90  ? 328  VAL B CB  1 
ATOM   6684 C CG1 . VAL B 1 328 ? 8.820   15.250  -34.573 1.00 48.09  ? 328  VAL B CG1 1 
ATOM   6685 C CG2 . VAL B 1 328 ? 8.161   15.233  -32.215 1.00 48.64  ? 328  VAL B CG2 1 
ATOM   6686 N N   . GLY B 1 329 ? 6.015   12.298  -32.603 1.00 47.05  ? 329  GLY B N   1 
ATOM   6687 C CA  . GLY B 1 329 ? 5.510   11.638  -31.418 1.00 47.19  ? 329  GLY B CA  1 
ATOM   6688 C C   . GLY B 1 329 ? 5.824   10.182  -31.308 1.00 46.93  ? 329  GLY B C   1 
ATOM   6689 O O   . GLY B 1 329 ? 6.524   9.633   -32.148 1.00 46.57  ? 329  GLY B O   1 
ATOM   6690 N N   . VAL B 1 330 ? 5.275   9.567   -30.255 1.00 47.70  ? 330  VAL B N   1 
ATOM   6691 C CA  . VAL B 1 330 ? 5.527   8.168   -29.903 1.00 47.48  ? 330  VAL B CA  1 
ATOM   6692 C C   . VAL B 1 330 ? 4.259   7.500   -29.411 1.00 47.83  ? 330  VAL B C   1 
ATOM   6693 O O   . VAL B 1 330 ? 3.316   8.169   -29.019 1.00 48.90  ? 330  VAL B O   1 
ATOM   6694 C CB  . VAL B 1 330 ? 6.605   8.058   -28.793 1.00 47.84  ? 330  VAL B CB  1 
ATOM   6695 C CG1 . VAL B 1 330 ? 7.925   8.651   -29.269 1.00 46.82  ? 330  VAL B CG1 1 
ATOM   6696 C CG2 . VAL B 1 330 ? 6.160   8.759   -27.490 1.00 48.39  ? 330  VAL B CG2 1 
ATOM   6697 N N   . VAL B 1 331 ? 4.221   6.172   -29.449 1.00 48.10  ? 331  VAL B N   1 
ATOM   6698 C CA  . VAL B 1 331 ? 3.129   5.426   -28.824 1.00 47.78  ? 331  VAL B CA  1 
ATOM   6699 C C   . VAL B 1 331 ? 3.537   5.124   -27.396 1.00 49.35  ? 331  VAL B C   1 
ATOM   6700 O O   . VAL B 1 331 ? 4.706   5.314   -27.031 1.00 48.21  ? 331  VAL B O   1 
ATOM   6701 C CB  . VAL B 1 331 ? 2.783   4.129   -29.588 1.00 47.93  ? 331  VAL B CB  1 
ATOM   6702 C CG1 . VAL B 1 331 ? 2.250   4.466   -30.973 1.00 45.17  ? 331  VAL B CG1 1 
ATOM   6703 C CG2 . VAL B 1 331 ? 3.963   3.166   -29.633 1.00 45.79  ? 331  VAL B CG2 1 
ATOM   6704 N N   . LYS B 1 332 ? 2.583   4.660   -26.586 1.00 51.18  ? 332  LYS B N   1 
ATOM   6705 C CA  . LYS B 1 332 ? 2.827   4.447   -25.161 1.00 52.87  ? 332  LYS B CA  1 
ATOM   6706 C C   . LYS B 1 332 ? 3.802   3.315   -24.881 1.00 53.70  ? 332  LYS B C   1 
ATOM   6707 O O   . LYS B 1 332 ? 4.576   3.398   -23.925 1.00 54.40  ? 332  LYS B O   1 
ATOM   6708 C CB  . LYS B 1 332 ? 1.524   4.216   -24.405 1.00 53.90  ? 332  LYS B CB  1 
ATOM   6709 C CG  . LYS B 1 332 ? 1.661   4.273   -22.868 1.00 54.64  ? 332  LYS B CG  1 
ATOM   6710 C CD  . LYS B 1 332 ? 0.285   4.412   -22.185 1.00 56.99  ? 332  LYS B CD  1 
ATOM   6711 C CE  . LYS B 1 332 ? 0.327   4.164   -20.667 1.00 58.95  ? 332  LYS B CE  1 
ATOM   6712 N NZ  . LYS B 1 332 ? 0.052   2.717   -20.299 1.00 62.45  ? 332  LYS B NZ  1 
ATOM   6713 N N   . ASP B 1 333 ? 3.787   2.272   -25.709 1.00 54.21  ? 333  ASP B N   1 
ATOM   6714 C CA  . ASP B 1 333 ? 4.617   1.083   -25.453 1.00 55.08  ? 333  ASP B CA  1 
ATOM   6715 C C   . ASP B 1 333 ? 5.422   0.683   -26.678 1.00 54.41  ? 333  ASP B C   1 
ATOM   6716 O O   . ASP B 1 333 ? 5.221   -0.377  -27.235 1.00 55.36  ? 333  ASP B O   1 
ATOM   6717 C CB  . ASP B 1 333 ? 3.727   -0.075  -24.984 1.00 56.34  ? 333  ASP B CB  1 
ATOM   6718 C CG  . ASP B 1 333 ? 3.033   0.236   -23.684 1.00 57.05  ? 333  ASP B CG  1 
ATOM   6719 O OD1 . ASP B 1 333 ? 1.883   0.746   -23.708 1.00 56.60  ? 333  ASP B OD1 1 
ATOM   6720 O OD2 . ASP B 1 333 ? 3.655   -0.014  -22.633 1.00 56.42  ? 333  ASP B OD2 1 
ATOM   6721 N N   . GLU B 1 334 ? 6.349   1.546   -27.062 1.00 53.64  ? 334  GLU B N   1 
ATOM   6722 C CA  . GLU B 1 334 ? 7.163   1.379   -28.252 1.00 53.21  ? 334  GLU B CA  1 
ATOM   6723 C C   . GLU B 1 334 ? 7.970   0.088   -28.276 1.00 54.12  ? 334  GLU B C   1 
ATOM   6724 O O   . GLU B 1 334 ? 8.167   -0.488  -29.343 1.00 54.39  ? 334  GLU B O   1 
ATOM   6725 C CB  . GLU B 1 334 ? 8.162   2.539   -28.383 1.00 52.72  ? 334  GLU B CB  1 
ATOM   6726 C CG  . GLU B 1 334 ? 7.560   3.927   -28.721 1.00 52.86  ? 334  GLU B CG  1 
ATOM   6727 C CD  . GLU B 1 334 ? 7.039   4.037   -30.157 1.00 54.66  ? 334  GLU B CD  1 
ATOM   6728 O OE1 . GLU B 1 334 ? 7.235   3.096   -30.954 1.00 52.88  ? 334  GLU B OE1 1 
ATOM   6729 O OE2 . GLU B 1 334 ? 6.427   5.081   -30.501 1.00 55.59  ? 334  GLU B OE2 1 
ATOM   6730 N N   . GLY B 1 335 ? 8.469   -0.357  -27.129 1.00 54.58  ? 335  GLY B N   1 
ATOM   6731 C CA  . GLY B 1 335 ? 9.378   -1.502  -27.108 1.00 55.23  ? 335  GLY B CA  1 
ATOM   6732 C C   . GLY B 1 335 ? 8.758   -2.884  -27.096 1.00 56.38  ? 335  GLY B C   1 
ATOM   6733 O O   . GLY B 1 335 ? 9.412   -3.848  -27.473 1.00 56.88  ? 335  GLY B O   1 
ATOM   6734 N N   . SER B 1 336 ? 7.503   -2.985  -26.660 1.00 57.56  ? 336  SER B N   1 
ATOM   6735 C CA  . SER B 1 336 ? 6.877   -4.275  -26.334 1.00 59.20  ? 336  SER B CA  1 
ATOM   6736 C C   . SER B 1 336 ? 6.867   -5.253  -27.500 1.00 60.59  ? 336  SER B C   1 
ATOM   6737 O O   . SER B 1 336 ? 7.227   -6.425  -27.339 1.00 61.62  ? 336  SER B O   1 
ATOM   6738 C CB  . SER B 1 336 ? 5.443   -4.069  -25.840 1.00 59.65  ? 336  SER B CB  1 
ATOM   6739 O OG  . SER B 1 336 ? 4.637   -3.424  -26.816 1.00 58.65  ? 336  SER B OG  1 
ATOM   6740 N N   . TYR B 1 337 ? 6.448   -4.761  -28.665 1.00 60.62  ? 337  TYR B N   1 
ATOM   6741 C CA  . TYR B 1 337 ? 6.372   -5.559  -29.896 1.00 61.97  ? 337  TYR B CA  1 
ATOM   6742 C C   . TYR B 1 337 ? 7.654   -6.325  -30.168 1.00 61.44  ? 337  TYR B C   1 
ATOM   6743 O O   . TYR B 1 337 ? 7.618   -7.481  -30.560 1.00 62.39  ? 337  TYR B O   1 
ATOM   6744 C CB  . TYR B 1 337 ? 6.112   -4.625  -31.092 1.00 62.81  ? 337  TYR B CB  1 
ATOM   6745 C CG  . TYR B 1 337 ? 5.551   -5.282  -32.325 1.00 64.98  ? 337  TYR B CG  1 
ATOM   6746 C CD1 . TYR B 1 337 ? 4.237   -5.036  -32.718 1.00 66.81  ? 337  TYR B CD1 1 
ATOM   6747 C CD2 . TYR B 1 337 ? 6.323   -6.136  -33.108 1.00 66.95  ? 337  TYR B CD2 1 
ATOM   6748 C CE1 . TYR B 1 337 ? 3.704   -5.626  -33.865 1.00 68.16  ? 337  TYR B CE1 1 
ATOM   6749 C CE2 . TYR B 1 337 ? 5.790   -6.739  -34.251 1.00 68.56  ? 337  TYR B CE2 1 
ATOM   6750 C CZ  . TYR B 1 337 ? 4.475   -6.476  -34.621 1.00 68.00  ? 337  TYR B CZ  1 
ATOM   6751 O OH  . TYR B 1 337 ? 3.922   -7.058  -35.752 1.00 68.63  ? 337  TYR B OH  1 
ATOM   6752 N N   . PHE B 1 338 ? 8.785   -5.659  -29.973 1.00 59.87  ? 338  PHE B N   1 
ATOM   6753 C CA  . PHE B 1 338 ? 10.089  -6.191  -30.372 1.00 59.69  ? 338  PHE B CA  1 
ATOM   6754 C C   . PHE B 1 338 ? 10.643  -7.280  -29.468 1.00 60.45  ? 338  PHE B C   1 
ATOM   6755 O O   . PHE B 1 338 ? 11.610  -7.934  -29.826 1.00 61.08  ? 338  PHE B O   1 
ATOM   6756 C CB  . PHE B 1 338 ? 11.100  -5.049  -30.463 1.00 58.42  ? 338  PHE B CB  1 
ATOM   6757 C CG  . PHE B 1 338 ? 10.770  -4.074  -31.531 1.00 57.60  ? 338  PHE B CG  1 
ATOM   6758 C CD1 . PHE B 1 338 ? 9.931   -3.011  -31.273 1.00 55.49  ? 338  PHE B CD1 1 
ATOM   6759 C CD2 . PHE B 1 338 ? 11.244  -4.258  -32.818 1.00 56.99  ? 338  PHE B CD2 1 
ATOM   6760 C CE1 . PHE B 1 338 ? 9.601   -2.145  -32.260 1.00 55.38  ? 338  PHE B CE1 1 
ATOM   6761 C CE2 . PHE B 1 338 ? 10.908  -3.374  -33.821 1.00 55.74  ? 338  PHE B CE2 1 
ATOM   6762 C CZ  . PHE B 1 338 ? 10.101  -2.317  -33.537 1.00 54.89  ? 338  PHE B CZ  1 
ATOM   6763 N N   . LEU B 1 339 ? 10.031  -7.473  -28.307 1.00 60.74  ? 339  LEU B N   1 
ATOM   6764 C CA  . LEU B 1 339 ? 10.582  -8.356  -27.295 1.00 62.06  ? 339  LEU B CA  1 
ATOM   6765 C C   . LEU B 1 339 ? 10.345  -9.808  -27.629 1.00 63.74  ? 339  LEU B C   1 
ATOM   6766 O O   . LEU B 1 339 ? 11.142  -10.655 -27.271 1.00 64.74  ? 339  LEU B O   1 
ATOM   6767 C CB  . LEU B 1 339 ? 9.984   -8.038  -25.927 1.00 62.17  ? 339  LEU B CB  1 
ATOM   6768 C CG  . LEU B 1 339 ? 10.300  -6.648  -25.376 1.00 59.57  ? 339  LEU B CG  1 
ATOM   6769 C CD1 . LEU B 1 339 ? 9.619   -6.472  -24.037 1.00 58.00  ? 339  LEU B CD1 1 
ATOM   6770 C CD2 . LEU B 1 339 ? 11.811  -6.436  -25.276 1.00 57.84  ? 339  LEU B CD2 1 
ATOM   6771 N N   . VAL B 1 340 ? 9.247   -10.086 -28.317 1.00 64.71  ? 340  VAL B N   1 
ATOM   6772 C CA  . VAL B 1 340 ? 8.882   -11.457 -28.694 1.00 66.85  ? 340  VAL B CA  1 
ATOM   6773 C C   . VAL B 1 340 ? 9.727   -12.000 -29.849 1.00 67.88  ? 340  VAL B C   1 
ATOM   6774 O O   . VAL B 1 340 ? 9.609   -13.163 -30.201 1.00 69.27  ? 340  VAL B O   1 
ATOM   6775 C CB  . VAL B 1 340 ? 7.389   -11.547 -29.064 1.00 66.81  ? 340  VAL B CB  1 
ATOM   6776 C CG1 . VAL B 1 340 ? 6.545   -11.193 -27.863 1.00 67.48  ? 340  VAL B CG1 1 
ATOM   6777 C CG2 . VAL B 1 340 ? 7.050   -10.619 -30.216 1.00 64.94  ? 340  VAL B CG2 1 
ATOM   6778 N N   . TYR B 1 341 ? 10.584  -11.151 -30.413 1.00 67.99  ? 341  TYR B N   1 
ATOM   6779 C CA  . TYR B 1 341 ? 11.406  -11.480 -31.573 1.00 68.97  ? 341  TYR B CA  1 
ATOM   6780 C C   . TYR B 1 341 ? 12.884  -11.688 -31.229 1.00 69.93  ? 341  TYR B C   1 
ATOM   6781 O O   . TYR B 1 341 ? 13.750  -11.463 -32.069 1.00 70.18  ? 341  TYR B O   1 
ATOM   6782 C CB  . TYR B 1 341 ? 11.292  -10.352 -32.606 1.00 67.86  ? 341  TYR B CB  1 
ATOM   6783 C CG  . TYR B 1 341 ? 10.012  -10.374 -33.417 1.00 68.55  ? 341  TYR B CG  1 
ATOM   6784 C CD1 . TYR B 1 341 ? 8.937   -9.551  -33.084 1.00 68.10  ? 341  TYR B CD1 1 
ATOM   6785 C CD2 . TYR B 1 341 ? 9.887   -11.206 -34.536 1.00 69.67  ? 341  TYR B CD2 1 
ATOM   6786 C CE1 . TYR B 1 341 ? 7.764   -9.564  -33.834 1.00 68.30  ? 341  TYR B CE1 1 
ATOM   6787 C CE2 . TYR B 1 341 ? 8.720   -11.223 -35.297 1.00 69.46  ? 341  TYR B CE2 1 
ATOM   6788 C CZ  . TYR B 1 341 ? 7.657   -10.401 -34.940 1.00 68.76  ? 341  TYR B CZ  1 
ATOM   6789 O OH  . TYR B 1 341 ? 6.496   -10.400 -35.690 1.00 68.99  ? 341  TYR B OH  1 
ATOM   6790 N N   . GLY B 1 342 ? 13.191  -12.131 -30.016 1.00 71.28  ? 342  GLY B N   1 
ATOM   6791 C CA  . GLY B 1 342 ? 14.593  -12.355 -29.659 1.00 72.08  ? 342  GLY B CA  1 
ATOM   6792 C C   . GLY B 1 342 ? 14.962  -12.457 -28.193 1.00 72.64  ? 342  GLY B C   1 
ATOM   6793 O O   . GLY B 1 342 ? 15.958  -13.114 -27.862 1.00 74.43  ? 342  GLY B O   1 
ATOM   6794 N N   . VAL B 1 343 ? 14.199  -11.798 -27.320 1.00 71.42  ? 343  VAL B N   1 
ATOM   6795 C CA  . VAL B 1 343 ? 14.483  -11.828 -25.888 1.00 71.64  ? 343  VAL B CA  1 
ATOM   6796 C C   . VAL B 1 343 ? 13.854  -13.065 -25.250 1.00 73.02  ? 343  VAL B C   1 
ATOM   6797 O O   . VAL B 1 343 ? 12.632  -13.204 -25.236 1.00 72.64  ? 343  VAL B O   1 
ATOM   6798 C CB  . VAL B 1 343 ? 13.992  -10.553 -25.160 1.00 70.60  ? 343  VAL B CB  1 
ATOM   6799 C CG1 . VAL B 1 343 ? 14.410  -10.583 -23.704 1.00 70.42  ? 343  VAL B CG1 1 
ATOM   6800 C CG2 . VAL B 1 343 ? 14.553  -9.305  -25.831 1.00 68.79  ? 343  VAL B CG2 1 
ATOM   6801 N N   . PRO B 1 344 ? 14.691  -13.978 -24.732 1.00 74.38  ? 344  PRO B N   1 
ATOM   6802 C CA  . PRO B 1 344 ? 14.153  -15.142 -24.039 1.00 76.20  ? 344  PRO B CA  1 
ATOM   6803 C C   . PRO B 1 344 ? 13.239  -14.761 -22.880 1.00 75.87  ? 344  PRO B C   1 
ATOM   6804 O O   . PRO B 1 344 ? 13.504  -13.791 -22.168 1.00 74.46  ? 344  PRO B O   1 
ATOM   6805 C CB  . PRO B 1 344 ? 15.407  -15.863 -23.533 1.00 77.96  ? 344  PRO B CB  1 
ATOM   6806 C CG  . PRO B 1 344 ? 16.483  -15.433 -24.458 1.00 77.15  ? 344  PRO B CG  1 
ATOM   6807 C CD  . PRO B 1 344 ? 16.164  -14.008 -24.772 1.00 75.06  ? 344  PRO B CD  1 
ATOM   6808 N N   . GLY B 1 345 ? 12.158  -15.517 -22.729 1.00 76.66  ? 345  GLY B N   1 
ATOM   6809 C CA  . GLY B 1 345 ? 11.169  -15.269 -21.692 1.00 76.91  ? 345  GLY B CA  1 
ATOM   6810 C C   . GLY B 1 345 ? 9.904   -14.606 -22.201 1.00 75.54  ? 345  GLY B C   1 
ATOM   6811 O O   . GLY B 1 345 ? 8.883   -14.618 -21.508 1.00 76.44  ? 345  GLY B O   1 
ATOM   6812 N N   . PHE B 1 346 ? 9.956   -14.033 -23.406 1.00 73.80  ? 346  PHE B N   1 
ATOM   6813 C CA  . PHE B 1 346 ? 8.818   -13.257 -23.943 1.00 72.29  ? 346  PHE B CA  1 
ATOM   6814 C C   . PHE B 1 346 ? 8.041   -14.012 -25.001 1.00 73.29  ? 346  PHE B C   1 
ATOM   6815 O O   . PHE B 1 346 ? 8.620   -14.781 -25.774 1.00 74.09  ? 346  PHE B O   1 
ATOM   6816 C CB  . PHE B 1 346 ? 9.298   -11.927 -24.506 1.00 69.47  ? 346  PHE B CB  1 
ATOM   6817 C CG  . PHE B 1 346 ? 9.798   -10.993 -23.457 1.00 68.12  ? 346  PHE B CG  1 
ATOM   6818 C CD1 . PHE B 1 346 ? 11.104  -11.054 -23.024 1.00 67.97  ? 346  PHE B CD1 1 
ATOM   6819 C CD2 . PHE B 1 346 ? 8.948   -10.072 -22.877 1.00 67.03  ? 346  PHE B CD2 1 
ATOM   6820 C CE1 . PHE B 1 346 ? 11.556  -10.205 -22.050 1.00 67.74  ? 346  PHE B CE1 1 
ATOM   6821 C CE2 . PHE B 1 346 ? 9.393   -9.219  -21.907 1.00 66.45  ? 346  PHE B CE2 1 
ATOM   6822 C CZ  . PHE B 1 346 ? 10.695  -9.281  -21.492 1.00 67.24  ? 346  PHE B CZ  1 
ATOM   6823 N N   . SER B 1 347 ? 6.728   -13.783 -25.016 1.00 73.58  ? 347  SER B N   1 
ATOM   6824 C CA  . SER B 1 347 ? 5.826   -14.415 -25.965 1.00 74.47  ? 347  SER B CA  1 
ATOM   6825 C C   . SER B 1 347 ? 4.505   -13.671 -25.967 1.00 74.29  ? 347  SER B C   1 
ATOM   6826 O O   . SER B 1 347 ? 4.107   -13.126 -24.940 1.00 74.21  ? 347  SER B O   1 
ATOM   6827 C CB  . SER B 1 347 ? 5.584   -15.879 -25.579 1.00 77.00  ? 347  SER B CB  1 
ATOM   6828 O OG  . SER B 1 347 ? 4.630   -16.503 -26.436 1.00 77.90  ? 347  SER B OG  1 
ATOM   6829 N N   . LYS B 1 348 ? 3.824   -13.657 -27.112 1.00 74.34  ? 348  LYS B N   1 
ATOM   6830 C CA  . LYS B 1 348 ? 2.473   -13.103 -27.196 1.00 74.62  ? 348  LYS B CA  1 
ATOM   6831 C C   . LYS B 1 348 ? 1.470   -14.005 -26.475 1.00 77.22  ? 348  LYS B C   1 
ATOM   6832 O O   . LYS B 1 348 ? 0.408   -13.549 -26.056 1.00 77.60  ? 348  LYS B O   1 
ATOM   6833 C CB  . LYS B 1 348 ? 2.040   -12.913 -28.662 1.00 74.10  ? 348  LYS B CB  1 
ATOM   6834 C CG  . LYS B 1 348 ? 1.541   -14.188 -29.380 1.00 75.55  ? 348  LYS B CG  1 
ATOM   6835 C CD  . LYS B 1 348 ? 0.907   -13.882 -30.732 1.00 74.54  ? 348  LYS B CD  1 
ATOM   6836 C CE  . LYS B 1 348 ? 0.094   -15.063 -31.262 1.00 76.20  ? 348  LYS B CE  1 
ATOM   6837 N NZ  . LYS B 1 348 ? -1.130  -15.365 -30.461 1.00 77.13  ? 348  LYS B NZ  1 
ATOM   6838 N N   . ASP B 1 349 ? 1.820   -15.284 -26.340 1.00 79.51  ? 349  ASP B N   1 
ATOM   6839 C CA  . ASP B 1 349 ? 0.898   -16.315 -25.847 1.00 82.41  ? 349  ASP B CA  1 
ATOM   6840 C C   . ASP B 1 349 ? 0.904   -16.519 -24.324 1.00 84.13  ? 349  ASP B C   1 
ATOM   6841 O O   . ASP B 1 349 ? 0.131   -17.339 -23.807 1.00 86.26  ? 349  ASP B O   1 
ATOM   6842 C CB  . ASP B 1 349 ? 1.192   -17.646 -26.554 1.00 83.89  ? 349  ASP B CB  1 
ATOM   6843 C CG  . ASP B 1 349 ? 0.909   -17.590 -28.055 1.00 83.75  ? 349  ASP B CG  1 
ATOM   6844 O OD1 . ASP B 1 349 ? -0.139  -17.024 -28.439 1.00 83.60  ? 349  ASP B OD1 1 
ATOM   6845 O OD2 . ASP B 1 349 ? 1.726   -18.117 -28.848 1.00 84.04  ? 349  ASP B OD2 1 
ATOM   6846 N N   . ASN B 1 350 ? 1.782   -15.810 -23.611 1.00 83.43  ? 350  ASN B N   1 
ATOM   6847 C CA  . ASN B 1 350 ? 1.721   -15.744 -22.141 1.00 84.70  ? 350  ASN B CA  1 
ATOM   6848 C C   . ASN B 1 350 ? 2.013   -14.326 -21.634 1.00 82.32  ? 350  ASN B C   1 
ATOM   6849 O O   . ASN B 1 350 ? 2.222   -13.404 -22.429 1.00 79.98  ? 350  ASN B O   1 
ATOM   6850 C CB  . ASN B 1 350 ? 2.571   -16.859 -21.453 1.00 87.00  ? 350  ASN B CB  1 
ATOM   6851 C CG  . ASN B 1 350 ? 4.093   -16.747 -21.691 1.00 89.01  ? 350  ASN B CG  1 
ATOM   6852 O OD1 . ASN B 1 350 ? 4.620   -15.677 -21.992 1.00 87.90  ? 350  ASN B OD1 1 
ATOM   6853 N ND2 . ASN B 1 350 ? 4.804   -17.888 -21.490 1.00 97.90  ? 350  ASN B ND2 1 
ATOM   6854 N N   . GLU B 1 351 ? 1.993   -14.140 -20.321 1.00 82.47  ? 351  GLU B N   1 
ATOM   6855 C CA  . GLU B 1 351 ? 2.135   -12.810 -19.740 1.00 80.68  ? 351  GLU B CA  1 
ATOM   6856 C C   . GLU B 1 351 ? 3.584   -12.346 -19.654 1.00 78.34  ? 351  GLU B C   1 
ATOM   6857 O O   . GLU B 1 351 ? 3.846   -11.239 -19.222 1.00 76.94  ? 351  GLU B O   1 
ATOM   6858 C CB  . GLU B 1 351 ? 1.495   -12.777 -18.361 1.00 82.54  ? 351  GLU B CB  1 
ATOM   6859 C CG  . GLU B 1 351 ? 0.017   -13.143 -18.369 1.00 86.41  ? 351  GLU B CG  1 
ATOM   6860 C CD  . GLU B 1 351 ? -0.799  -12.222 -17.481 1.00 90.45  ? 351  GLU B CD  1 
ATOM   6861 O OE1 . GLU B 1 351 ? -0.915  -12.505 -16.259 1.00 93.27  ? 351  GLU B OE1 1 
ATOM   6862 O OE2 . GLU B 1 351 ? -1.303  -11.201 -18.018 1.00 92.46  ? 351  GLU B OE2 1 
ATOM   6863 N N   . SER B 1 352 ? 4.517   -13.205 -20.053 1.00 78.01  ? 352  SER B N   1 
ATOM   6864 C CA  . SER B 1 352 ? 5.919   -12.847 -20.173 1.00 76.20  ? 352  SER B CA  1 
ATOM   6865 C C   . SER B 1 352 ? 6.467   -12.240 -18.877 1.00 75.67  ? 352  SER B C   1 
ATOM   6866 O O   . SER B 1 352 ? 7.130   -11.205 -18.884 1.00 73.70  ? 352  SER B O   1 
ATOM   6867 C CB  . SER B 1 352 ? 6.108   -11.906 -21.363 1.00 74.28  ? 352  SER B CB  1 
ATOM   6868 O OG  . SER B 1 352 ? 5.606   -12.491 -22.558 1.00 73.95  ? 352  SER B OG  1 
ATOM   6869 N N   . LEU B 1 353 ? 6.179   -12.907 -17.764 1.00 76.86  ? 353  LEU B N   1 
ATOM   6870 C CA  . LEU B 1 353 ? 6.703   -12.517 -16.460 1.00 76.80  ? 353  LEU B CA  1 
ATOM   6871 C C   . LEU B 1 353 ? 8.111   -13.095 -16.336 1.00 77.21  ? 353  LEU B C   1 
ATOM   6872 O O   . LEU B 1 353 ? 8.279   -14.302 -16.237 1.00 79.27  ? 353  LEU B O   1 
ATOM   6873 C CB  . LEU B 1 353 ? 5.788   -13.037 -15.345 1.00 78.31  ? 353  LEU B CB  1 
ATOM   6874 C CG  . LEU B 1 353 ? 4.348   -12.501 -15.357 1.00 77.76  ? 353  LEU B CG  1 
ATOM   6875 C CD1 . LEU B 1 353 ? 3.486   -13.197 -14.306 1.00 80.01  ? 353  LEU B CD1 1 
ATOM   6876 C CD2 . LEU B 1 353 ? 4.311   -10.988 -15.155 1.00 74.61  ? 353  LEU B CD2 1 
ATOM   6877 N N   . ILE B 1 354 ? 9.118   -12.230 -16.339 1.00 75.66  ? 354  ILE B N   1 
ATOM   6878 C CA  . ILE B 1 354 ? 10.510  -12.674 -16.467 1.00 75.70  ? 354  ILE B CA  1 
ATOM   6879 C C   . ILE B 1 354 ? 11.305  -12.577 -15.162 1.00 76.65  ? 354  ILE B C   1 
ATOM   6880 O O   . ILE B 1 354 ? 10.928  -11.863 -14.228 1.00 76.31  ? 354  ILE B O   1 
ATOM   6881 C CB  . ILE B 1 354 ? 11.245  -11.901 -17.595 1.00 73.72  ? 354  ILE B CB  1 
ATOM   6882 C CG1 . ILE B 1 354 ? 11.153  -10.384 -17.379 1.00 72.01  ? 354  ILE B CG1 1 
ATOM   6883 C CG2 . ILE B 1 354 ? 10.648  -12.274 -18.949 1.00 73.01  ? 354  ILE B CG2 1 
ATOM   6884 C CD1 . ILE B 1 354 ? 12.194  -9.583  -18.131 1.00 70.57  ? 354  ILE B CD1 1 
ATOM   6885 N N   . SER B 1 355 ? 12.409  -13.315 -15.112 1.00 77.84  ? 355  SER B N   1 
ATOM   6886 C CA  . SER B 1 355 ? 13.305  -13.292 -13.970 1.00 78.87  ? 355  SER B CA  1 
ATOM   6887 C C   . SER B 1 355 ? 14.264  -12.129 -14.111 1.00 77.33  ? 355  SER B C   1 
ATOM   6888 O O   . SER B 1 355 ? 14.431  -11.573 -15.199 1.00 75.51  ? 355  SER B O   1 
ATOM   6889 C CB  . SER B 1 355 ? 14.106  -14.594 -13.885 1.00 81.14  ? 355  SER B CB  1 
ATOM   6890 O OG  . SER B 1 355 ? 15.195  -14.588 -14.798 1.00 80.84  ? 355  SER B OG  1 
ATOM   6891 N N   . ARG B 1 356 ? 14.913  -11.767 -13.013 1.00 77.95  ? 356  ARG B N   1 
ATOM   6892 C CA  A ARG B 1 356 ? 15.929  -10.722 -13.061 0.50 76.83  ? 356  ARG B CA  1 
ATOM   6893 C CA  B ARG B 1 356 ? 15.923  -10.728 -13.062 0.50 76.96  ? 356  ARG B CA  1 
ATOM   6894 C C   . ARG B 1 356 ? 17.062  -11.143 -13.994 1.00 77.05  ? 356  ARG B C   1 
ATOM   6895 O O   . ARG B 1 356 ? 17.588  -10.316 -14.743 1.00 75.80  ? 356  ARG B O   1 
ATOM   6896 C CB  A ARG B 1 356 ? 16.474  -10.399 -11.668 0.50 77.85  ? 356  ARG B CB  1 
ATOM   6897 C CB  B ARG B 1 356 ? 16.450  -10.422 -11.665 0.50 78.09  ? 356  ARG B CB  1 
ATOM   6898 C CG  A ARG B 1 356 ? 17.498  -9.275  -11.679 0.50 76.75  ? 356  ARG B CG  1 
ATOM   6899 C CG  B ARG B 1 356 ? 17.388  -9.241  -11.646 0.50 77.39  ? 356  ARG B CG  1 
ATOM   6900 C CD  A ARG B 1 356 ? 17.720  -8.666  -10.309 0.50 77.48  ? 356  ARG B CD  1 
ATOM   6901 C CD  B ARG B 1 356 ? 17.202  -8.363  -10.427 0.50 78.38  ? 356  ARG B CD  1 
ATOM   6902 N NE  A ARG B 1 356 ? 18.569  -7.478  -10.398 0.50 76.68  ? 356  ARG B NE  1 
ATOM   6903 N NE  B ARG B 1 356 ? 17.608  -6.994  -10.732 0.50 77.23  ? 356  ARG B NE  1 
ATOM   6904 C CZ  A ARG B 1 356 ? 18.167  -6.270  -10.805 0.50 74.29  ? 356  ARG B CZ  1 
ATOM   6905 C CZ  B ARG B 1 356 ? 18.870  -6.601  -10.892 0.50 77.76  ? 356  ARG B CZ  1 
ATOM   6906 N NH1 A ARG B 1 356 ? 16.908  -6.045  -11.166 0.50 72.05  ? 356  ARG B NH1 1 
ATOM   6907 N NH1 B ARG B 1 356 ? 19.879  -7.467  -10.763 0.50 79.33  ? 356  ARG B NH1 1 
ATOM   6908 N NH2 A ARG B 1 356 ? 19.044  -5.272  -10.848 0.50 74.23  ? 356  ARG B NH2 1 
ATOM   6909 N NH2 B ARG B 1 356 ? 19.125  -5.331  -11.182 0.50 76.22  ? 356  ARG B NH2 1 
ATOM   6910 N N   . ALA B 1 357 ? 17.422  -12.429 -13.954 1.00 78.45  ? 357  ALA B N   1 
ATOM   6911 C CA  . ALA B 1 357 ? 18.459  -12.977 -14.832 1.00 78.75  ? 357  ALA B CA  1 
ATOM   6912 C C   . ALA B 1 357 ? 18.101  -12.735 -16.288 1.00 76.79  ? 357  ALA B C   1 
ATOM   6913 O O   . ALA B 1 357 ? 18.926  -12.259 -17.066 1.00 76.17  ? 357  ALA B O   1 
ATOM   6914 C CB  . ALA B 1 357 ? 18.649  -14.483 -14.578 1.00 81.14  ? 357  ALA B CB  1 
ATOM   6915 N N   . GLN B 1 358 ? 16.861  -13.057 -16.645 1.00 76.15  ? 358  GLN B N   1 
ATOM   6916 C CA  . GLN B 1 358 ? 16.351  -12.842 -17.999 1.00 74.34  ? 358  GLN B CA  1 
ATOM   6917 C C   . GLN B 1 358 ? 16.319  -11.360 -18.375 1.00 71.76  ? 358  GLN B C   1 
ATOM   6918 O O   . GLN B 1 358 ? 16.436  -11.017 -19.556 1.00 70.51  ? 358  GLN B O   1 
ATOM   6919 C CB  . GLN B 1 358 ? 14.949  -13.439 -18.137 1.00 74.39  ? 358  GLN B CB  1 
ATOM   6920 C CG  . GLN B 1 358 ? 14.948  -14.948 -18.250 1.00 77.05  ? 358  GLN B CG  1 
ATOM   6921 C CD  . GLN B 1 358 ? 13.550  -15.556 -18.214 1.00 78.14  ? 358  GLN B CD  1 
ATOM   6922 O OE1 . GLN B 1 358 ? 12.667  -15.078 -17.494 1.00 79.60  ? 358  GLN B OE1 1 
ATOM   6923 N NE2 . GLN B 1 358 ? 13.353  -16.631 -18.974 1.00 78.37  ? 358  GLN B NE2 1 
ATOM   6924 N N   . PHE B 1 359 ? 16.149  -10.490 -17.376 1.00 70.81  ? 359  PHE B N   1 
ATOM   6925 C CA  . PHE B 1 359 ? 16.169  -9.039  -17.594 1.00 68.62  ? 359  PHE B CA  1 
ATOM   6926 C C   . PHE B 1 359 ? 17.577  -8.556  -17.956 1.00 68.40  ? 359  PHE B C   1 
ATOM   6927 O O   . PHE B 1 359 ? 17.752  -7.808  -18.921 1.00 66.90  ? 359  PHE B O   1 
ATOM   6928 C CB  . PHE B 1 359 ? 15.619  -8.290  -16.365 1.00 68.27  ? 359  PHE B CB  1 
ATOM   6929 C CG  . PHE B 1 359 ? 15.697  -6.782  -16.471 1.00 66.54  ? 359  PHE B CG  1 
ATOM   6930 C CD1 . PHE B 1 359 ? 16.387  -6.035  -15.522 1.00 66.81  ? 359  PHE B CD1 1 
ATOM   6931 C CD2 . PHE B 1 359 ? 15.089  -6.109  -17.515 1.00 65.06  ? 359  PHE B CD2 1 
ATOM   6932 C CE1 . PHE B 1 359 ? 16.465  -4.644  -15.617 1.00 64.05  ? 359  PHE B CE1 1 
ATOM   6933 C CE2 . PHE B 1 359 ? 15.176  -4.717  -17.619 1.00 63.16  ? 359  PHE B CE2 1 
ATOM   6934 C CZ  . PHE B 1 359 ? 15.867  -3.992  -16.665 1.00 62.84  ? 359  PHE B CZ  1 
ATOM   6935 N N   . LEU B 1 360 ? 18.573  -8.994  -17.196 1.00 69.94  ? 360  LEU B N   1 
ATOM   6936 C CA  . LEU B 1 360 ? 19.962  -8.639  -17.478 1.00 70.52  ? 360  LEU B CA  1 
ATOM   6937 C C   . LEU B 1 360 ? 20.384  -9.125  -18.863 1.00 70.42  ? 360  LEU B C   1 
ATOM   6938 O O   . LEU B 1 360 ? 21.069  -8.416  -19.594 1.00 69.20  ? 360  LEU B O   1 
ATOM   6939 C CB  . LEU B 1 360 ? 20.917  -9.234  -16.428 1.00 72.80  ? 360  LEU B CB  1 
ATOM   6940 C CG  . LEU B 1 360 ? 20.690  -9.014  -14.918 1.00 74.14  ? 360  LEU B CG  1 
ATOM   6941 C CD1 . LEU B 1 360 ? 22.013  -9.101  -14.152 1.00 75.81  ? 360  LEU B CD1 1 
ATOM   6942 C CD2 . LEU B 1 360 ? 19.991  -7.701  -14.606 1.00 72.37  ? 360  LEU B CD2 1 
ATOM   6943 N N   . ALA B 1 361 ? 19.976  -10.346 -19.209 1.00 71.68  ? 361  ALA B N   1 
ATOM   6944 C CA  . ALA B 1 361 ? 20.290  -10.925 -20.519 1.00 71.62  ? 361  ALA B CA  1 
ATOM   6945 C C   . ALA B 1 361 ? 19.603  -10.164 -21.644 1.00 69.35  ? 361  ALA B C   1 
ATOM   6946 O O   . ALA B 1 361 ? 20.199  -9.905  -22.688 1.00 68.91  ? 361  ALA B O   1 
ATOM   6947 C CB  . ALA B 1 361 ? 19.896  -12.395 -20.560 1.00 73.06  ? 361  ALA B CB  1 
ATOM   6948 N N   . GLY B 1 362 ? 18.339  -9.823  -21.430 1.00 68.27  ? 362  GLY B N   1 
ATOM   6949 C CA  . GLY B 1 362 ? 17.572  -9.071  -22.412 1.00 66.47  ? 362  GLY B CA  1 
ATOM   6950 C C   . GLY B 1 362 ? 18.118  -7.682  -22.701 1.00 65.06  ? 362  GLY B C   1 
ATOM   6951 O O   . GLY B 1 362 ? 18.024  -7.207  -23.828 1.00 64.04  ? 362  GLY B O   1 
ATOM   6952 N N   . VAL B 1 363 ? 18.683  -7.021  -21.692 1.00 65.30  ? 363  VAL B N   1 
ATOM   6953 C CA  . VAL B 1 363 ? 19.310  -5.707  -21.905 1.00 64.30  ? 363  VAL B CA  1 
ATOM   6954 C C   . VAL B 1 363 ? 20.505  -5.818  -22.869 1.00 64.86  ? 363  VAL B C   1 
ATOM   6955 O O   . VAL B 1 363 ? 20.714  -4.918  -23.673 1.00 63.78  ? 363  VAL B O   1 
ATOM   6956 C CB  . VAL B 1 363 ? 19.740  -5.020  -20.561 1.00 64.45  ? 363  VAL B CB  1 
ATOM   6957 C CG1 . VAL B 1 363 ? 20.674  -3.846  -20.810 1.00 63.06  ? 363  VAL B CG1 1 
ATOM   6958 C CG2 . VAL B 1 363 ? 18.519  -4.571  -19.764 1.00 62.99  ? 363  VAL B CG2 1 
ATOM   6959 N N   . ARG B 1 364 ? 21.268  -6.913  -22.814 1.00 66.65  ? 364  ARG B N   1 
ATOM   6960 C CA  . ARG B 1 364 ? 22.416  -7.052  -23.717 1.00 67.92  ? 364  ARG B CA  1 
ATOM   6961 C C   . ARG B 1 364 ? 21.948  -7.215  -25.170 1.00 67.10  ? 364  ARG B C   1 
ATOM   6962 O O   . ARG B 1 364 ? 22.645  -6.807  -26.097 1.00 66.79  ? 364  ARG B O   1 
ATOM   6963 C CB  . ARG B 1 364 ? 23.313  -8.240  -23.347 1.00 70.34  ? 364  ARG B CB  1 
ATOM   6964 C CG  . ARG B 1 364 ? 23.752  -8.351  -21.885 1.00 73.78  ? 364  ARG B CG  1 
ATOM   6965 C CD  . ARG B 1 364 ? 24.353  -7.059  -21.307 1.00 76.05  ? 364  ARG B CD  1 
ATOM   6966 N NE  . ARG B 1 364 ? 25.440  -6.507  -22.121 1.00 76.58  ? 364  ARG B NE  1 
ATOM   6967 C CZ  . ARG B 1 364 ? 26.742  -6.705  -21.917 1.00 78.36  ? 364  ARG B CZ  1 
ATOM   6968 N NH1 . ARG B 1 364 ? 27.186  -7.468  -20.920 1.00 79.68  ? 364  ARG B NH1 1 
ATOM   6969 N NH2 . ARG B 1 364 ? 27.609  -6.129  -22.737 1.00 78.99  ? 364  ARG B NH2 1 
ATOM   6970 N N   . ILE B 1 365 ? 20.774  -7.825  -25.350 1.00 66.91  ? 365  ILE B N   1 
ATOM   6971 C CA  . ILE B 1 365 ? 20.156  -8.013  -26.668 1.00 65.82  ? 365  ILE B CA  1 
ATOM   6972 C C   . ILE B 1 365 ? 19.442  -6.738  -27.115 1.00 64.02  ? 365  ILE B C   1 
ATOM   6973 O O   . ILE B 1 365 ? 19.443  -6.395  -28.298 1.00 63.11  ? 365  ILE B O   1 
ATOM   6974 C CB  . ILE B 1 365 ? 19.142  -9.194  -26.639 1.00 66.47  ? 365  ILE B CB  1 
ATOM   6975 C CG1 . ILE B 1 365 ? 19.867  -10.513 -26.363 1.00 68.11  ? 365  ILE B CG1 1 
ATOM   6976 C CG2 . ILE B 1 365 ? 18.354  -9.277  -27.942 1.00 65.02  ? 365  ILE B CG2 1 
ATOM   6977 C CD1 . ILE B 1 365 ? 18.933  -11.686 -26.116 1.00 69.31  ? 365  ILE B CD1 1 
ATOM   6978 N N   . GLY B 1 366 ? 18.834  -6.040  -26.159 1.00 63.43  ? 366  GLY B N   1 
ATOM   6979 C CA  . GLY B 1 366 ? 18.085  -4.807  -26.432 1.00 61.82  ? 366  GLY B CA  1 
ATOM   6980 C C   . GLY B 1 366 ? 18.932  -3.551  -26.570 1.00 61.10  ? 366  GLY B C   1 
ATOM   6981 O O   . GLY B 1 366 ? 18.472  -2.552  -27.121 1.00 60.15  ? 366  GLY B O   1 
ATOM   6982 N N   . VAL B 1 367 ? 20.154  -3.599  -26.047 1.00 61.79  ? 367  VAL B N   1 
ATOM   6983 C CA  . VAL B 1 367 ? 21.134  -2.527  -26.202 1.00 61.26  ? 367  VAL B CA  1 
ATOM   6984 C C   . VAL B 1 367 ? 22.439  -3.185  -26.650 1.00 62.62  ? 367  VAL B C   1 
ATOM   6985 O O   . VAL B 1 367 ? 23.415  -3.212  -25.917 1.00 62.99  ? 367  VAL B O   1 
ATOM   6986 C CB  . VAL B 1 367 ? 21.326  -1.739  -24.888 1.00 61.12  ? 367  VAL B CB  1 
ATOM   6987 C CG1 . VAL B 1 367 ? 22.178  -0.513  -25.131 1.00 60.35  ? 367  VAL B CG1 1 
ATOM   6988 C CG2 . VAL B 1 367 ? 19.970  -1.338  -24.302 1.00 60.05  ? 367  VAL B CG2 1 
ATOM   6989 N N   . PRO B 1 368 ? 22.441  -3.737  -27.873 1.00 63.22  ? 368  PRO B N   1 
ATOM   6990 C CA  . PRO B 1 368 ? 23.504  -4.637  -28.341 1.00 64.98  ? 368  PRO B CA  1 
ATOM   6991 C C   . PRO B 1 368 ? 24.868  -3.989  -28.492 1.00 66.05  ? 368  PRO B C   1 
ATOM   6992 O O   . PRO B 1 368 ? 25.878  -4.688  -28.462 1.00 67.43  ? 368  PRO B O   1 
ATOM   6993 C CB  . PRO B 1 368 ? 22.985  -5.125  -29.697 1.00 64.42  ? 368  PRO B CB  1 
ATOM   6994 C CG  . PRO B 1 368 ? 22.038  -4.099  -30.140 1.00 62.38  ? 368  PRO B CG  1 
ATOM   6995 C CD  . PRO B 1 368 ? 21.414  -3.525  -28.905 1.00 61.90  ? 368  PRO B CD  1 
ATOM   6996 N N   . GLN B 1 369 ? 24.901  -2.667  -28.629 1.00 65.78  ? 369  GLN B N   1 
ATOM   6997 C CA  . GLN B 1 369 ? 26.174  -1.958  -28.747 1.00 66.96  ? 369  GLN B CA  1 
ATOM   6998 C C   . GLN B 1 369 ? 26.758  -1.563  -27.386 1.00 68.01  ? 369  GLN B C   1 
ATOM   6999 O O   . GLN B 1 369 ? 27.907  -1.124  -27.317 1.00 69.37  ? 369  GLN B O   1 
ATOM   7000 C CB  . GLN B 1 369 ? 26.016  -0.729  -29.660 1.00 66.23  ? 369  GLN B CB  1 
ATOM   7001 C CG  . GLN B 1 369 ? 26.159  -1.034  -31.175 1.00 66.48  ? 369  GLN B CG  1 
ATOM   7002 C CD  . GLN B 1 369 ? 24.972  -1.781  -31.783 1.00 66.29  ? 369  GLN B CD  1 
ATOM   7003 O OE1 . GLN B 1 369 ? 23.889  -1.218  -31.953 1.00 63.91  ? 369  GLN B OE1 1 
ATOM   7004 N NE2 . GLN B 1 369 ? 25.187  -3.050  -32.141 1.00 66.71  ? 369  GLN B NE2 1 
ATOM   7005 N N   . ALA B 1 370 ? 25.994  -1.752  -26.304 1.00 67.75  ? 370  ALA B N   1 
ATOM   7006 C CA  . ALA B 1 370 ? 26.437  -1.348  -24.955 1.00 68.24  ? 370  ALA B CA  1 
ATOM   7007 C C   . ALA B 1 370 ? 27.519  -2.257  -24.380 1.00 70.05  ? 370  ALA B C   1 
ATOM   7008 O O   . ALA B 1 370 ? 27.444  -3.477  -24.501 1.00 70.89  ? 370  ALA B O   1 
ATOM   7009 C CB  . ALA B 1 370 ? 25.242  -1.292  -23.998 1.00 67.34  ? 370  ALA B CB  1 
ATOM   7010 N N   . SER B 1 371 ? 28.514  -1.652  -23.734 1.00 70.76  ? 371  SER B N   1 
ATOM   7011 C CA  . SER B 1 371 ? 29.555  -2.393  -23.034 1.00 72.67  ? 371  SER B CA  1 
ATOM   7012 C C   . SER B 1 371 ? 28.997  -2.998  -21.759 1.00 73.05  ? 371  SER B C   1 
ATOM   7013 O O   . SER B 1 371 ? 27.861  -2.714  -21.395 1.00 72.16  ? 371  SER B O   1 
ATOM   7014 C CB  . SER B 1 371 ? 30.716  -1.469  -22.686 1.00 73.55  ? 371  SER B CB  1 
ATOM   7015 O OG  . SER B 1 371 ? 30.282  -0.428  -21.842 1.00 73.72  ? 371  SER B OG  1 
ATOM   7016 N N   . ASP B 1 372 ? 29.796  -3.821  -21.081 1.00 74.90  ? 372  ASP B N   1 
ATOM   7017 C CA  . ASP B 1 372 ? 29.381  -4.443  -19.816 1.00 75.68  ? 372  ASP B CA  1 
ATOM   7018 C C   . ASP B 1 372 ? 28.938  -3.384  -18.806 1.00 74.73  ? 372  ASP B C   1 
ATOM   7019 O O   . ASP B 1 372 ? 27.893  -3.543  -18.173 1.00 74.47  ? 372  ASP B O   1 
ATOM   7020 C CB  . ASP B 1 372 ? 30.511  -5.285  -19.193 1.00 78.39  ? 372  ASP B CB  1 
ATOM   7021 C CG  . ASP B 1 372 ? 30.930  -6.467  -20.060 1.00 80.03  ? 372  ASP B CG  1 
ATOM   7022 O OD1 . ASP B 1 372 ? 30.267  -6.736  -21.081 1.00 78.89  ? 372  ASP B OD1 1 
ATOM   7023 O OD2 . ASP B 1 372 ? 31.939  -7.132  -19.711 1.00 84.69  ? 372  ASP B OD2 1 
ATOM   7024 N N   . LEU B 1 373 ? 29.729  -2.316  -18.661 1.00 74.28  ? 373  LEU B N   1 
ATOM   7025 C CA  . LEU B 1 373 ? 29.419  -1.233  -17.719 1.00 73.35  ? 373  LEU B CA  1 
ATOM   7026 C C   . LEU B 1 373 ? 28.166  -0.450  -18.092 1.00 71.06  ? 373  LEU B C   1 
ATOM   7027 O O   . LEU B 1 373 ? 27.363  -0.112  -17.227 1.00 70.52  ? 373  LEU B O   1 
ATOM   7028 C CB  . LEU B 1 373 ? 30.589  -0.261  -17.615 1.00 74.28  ? 373  LEU B CB  1 
ATOM   7029 C CG  . LEU B 1 373 ? 30.462  0.882   -16.594 1.00 74.28  ? 373  LEU B CG  1 
ATOM   7030 C CD1 . LEU B 1 373 ? 30.169  0.364   -15.182 1.00 74.47  ? 373  LEU B CD1 1 
ATOM   7031 C CD2 . LEU B 1 373 ? 31.729  1.722   -16.603 1.00 74.99  ? 373  LEU B CD2 1 
ATOM   7032 N N   . ALA B 1 374 ? 28.019  -0.142  -19.379 1.00 69.63  ? 374  ALA B N   1 
ATOM   7033 C CA  . ALA B 1 374 ? 26.866  0.603   -19.871 1.00 67.34  ? 374  ALA B CA  1 
ATOM   7034 C C   . ALA B 1 374 ? 25.581  -0.220  -19.737 1.00 66.58  ? 374  ALA B C   1 
ATOM   7035 O O   . ALA B 1 374 ? 24.528  0.324   -19.404 1.00 65.09  ? 374  ALA B O   1 
ATOM   7036 C CB  . ALA B 1 374 ? 27.086  1.030   -21.312 1.00 66.52  ? 374  ALA B CB  1 
ATOM   7037 N N   . ALA B 1 375 ? 25.677  -1.524  -20.002 1.00 67.08  ? 375  ALA B N   1 
ATOM   7038 C CA  . ALA B 1 375 ? 24.576  -2.450  -19.768 1.00 66.91  ? 375  ALA B CA  1 
ATOM   7039 C C   . ALA B 1 375 ? 24.203  -2.472  -18.292 1.00 67.53  ? 375  ALA B C   1 
ATOM   7040 O O   . ALA B 1 375 ? 23.029  -2.494  -17.938 1.00 67.42  ? 375  ALA B O   1 
ATOM   7041 C CB  . ALA B 1 375 ? 24.947  -3.862  -20.242 1.00 68.06  ? 375  ALA B CB  1 
ATOM   7042 N N   . GLU B 1 376 ? 25.203  -2.444  -17.428 1.00 69.10  ? 376  GLU B N   1 
ATOM   7043 C CA  . GLU B 1 376 ? 24.958  -2.450  -15.987 1.00 69.55  ? 376  GLU B CA  1 
ATOM   7044 C C   . GLU B 1 376 ? 24.268  -1.160  -15.532 1.00 67.19  ? 376  GLU B C   1 
ATOM   7045 O O   . GLU B 1 376 ? 23.356  -1.206  -14.717 1.00 67.18  ? 376  GLU B O   1 
ATOM   7046 C CB  . GLU B 1 376 ? 26.266  -2.702  -15.225 1.00 71.86  ? 376  GLU B CB  1 
ATOM   7047 C CG  . GLU B 1 376 ? 26.123  -2.867  -13.718 1.00 74.73  ? 376  GLU B CG  1 
ATOM   7048 C CD  . GLU B 1 376 ? 25.324  -4.109  -13.276 1.00 79.09  ? 376  GLU B CD  1 
ATOM   7049 O OE1 . GLU B 1 376 ? 24.882  -4.916  -14.130 1.00 79.61  ? 376  GLU B OE1 1 
ATOM   7050 O OE2 . GLU B 1 376 ? 25.145  -4.269  -12.041 1.00 82.78  ? 376  GLU B OE2 1 
ATOM   7051 N N   . ALA B 1 377 ? 24.674  -0.023  -16.089 1.00 65.15  ? 377  ALA B N   1 
ATOM   7052 C CA  . ALA B 1 377 ? 24.023  1.258   -15.803 1.00 62.92  ? 377  ALA B CA  1 
ATOM   7053 C C   . ALA B 1 377 ? 22.558  1.287   -16.239 1.00 60.90  ? 377  ALA B C   1 
ATOM   7054 O O   . ALA B 1 377 ? 21.738  1.926   -15.585 1.00 60.02  ? 377  ALA B O   1 
ATOM   7055 C CB  . ALA B 1 377 ? 24.786  2.390   -16.462 1.00 62.34  ? 377  ALA B CB  1 
ATOM   7056 N N   . VAL B 1 378 ? 22.235  0.620   -17.351 1.00 59.85  ? 378  VAL B N   1 
ATOM   7057 C CA  . VAL B 1 378 ? 20.855  0.518   -17.836 1.00 58.23  ? 378  VAL B CA  1 
ATOM   7058 C C   . VAL B 1 378 ? 20.021  -0.315  -16.859 1.00 59.10  ? 378  VAL B C   1 
ATOM   7059 O O   . VAL B 1 378 ? 18.941  0.107   -16.438 1.00 58.89  ? 378  VAL B O   1 
ATOM   7060 C CB  . VAL B 1 378 ? 20.764  -0.097  -19.271 1.00 57.77  ? 378  VAL B CB  1 
ATOM   7061 C CG1 . VAL B 1 378 ? 19.318  -0.359  -19.672 1.00 55.71  ? 378  VAL B CG1 1 
ATOM   7062 C CG2 . VAL B 1 378 ? 21.423  0.813   -20.299 1.00 56.62  ? 378  VAL B CG2 1 
ATOM   7063 N N   . VAL B 1 379 ? 20.529  -1.486  -16.489 1.00 60.26  ? 379  VAL B N   1 
ATOM   7064 C CA  . VAL B 1 379 ? 19.871  -2.329  -15.506 1.00 61.20  ? 379  VAL B CA  1 
ATOM   7065 C C   . VAL B 1 379 ? 19.633  -1.588  -14.181 1.00 61.89  ? 379  VAL B C   1 
ATOM   7066 O O   . VAL B 1 379 ? 18.540  -1.640  -13.616 1.00 62.06  ? 379  VAL B O   1 
ATOM   7067 C CB  . VAL B 1 379 ? 20.695  -3.602  -15.226 1.00 63.23  ? 379  VAL B CB  1 
ATOM   7068 C CG1 . VAL B 1 379 ? 20.151  -4.353  -13.990 1.00 64.32  ? 379  VAL B CG1 1 
ATOM   7069 C CG2 . VAL B 1 379 ? 20.721  -4.505  -16.457 1.00 62.01  ? 379  VAL B CG2 1 
ATOM   7070 N N   . LEU B 1 380 ? 20.644  -0.890  -13.683 1.00 62.23  ? 380  LEU B N   1 
ATOM   7071 C CA  . LEU B 1 380 ? 20.492  -0.196  -12.415 1.00 62.76  ? 380  LEU B CA  1 
ATOM   7072 C C   . LEU B 1 380 ? 19.489  0.962   -12.499 1.00 61.16  ? 380  LEU B C   1 
ATOM   7073 O O   . LEU B 1 380 ? 18.754  1.200   -11.554 1.00 61.75  ? 380  LEU B O   1 
ATOM   7074 C CB  . LEU B 1 380 ? 21.856  0.258   -11.869 1.00 64.08  ? 380  LEU B CB  1 
ATOM   7075 C CG  . LEU B 1 380 ? 22.854  -0.876  -11.553 1.00 66.33  ? 380  LEU B CG  1 
ATOM   7076 C CD1 . LEU B 1 380 ? 24.195  -0.328  -11.098 1.00 67.48  ? 380  LEU B CD1 1 
ATOM   7077 C CD2 . LEU B 1 380 ? 22.320  -1.856  -10.507 1.00 68.58  ? 380  LEU B CD2 1 
ATOM   7078 N N   . HIS B 1 381 ? 19.442  1.661   -13.627 1.00 59.92  ? 381  HIS B N   1 
ATOM   7079 C CA  . HIS B 1 381 ? 18.498  2.783   -13.839 1.00 58.76  ? 381  HIS B CA  1 
ATOM   7080 C C   . HIS B 1 381 ? 17.041  2.327   -13.956 1.00 58.18  ? 381  HIS B C   1 
ATOM   7081 O O   . HIS B 1 381 ? 16.119  3.006   -13.508 1.00 57.36  ? 381  HIS B O   1 
ATOM   7082 C CB  . HIS B 1 381 ? 18.894  3.542   -15.111 1.00 57.94  ? 381  HIS B CB  1 
ATOM   7083 C CG  . HIS B 1 381 ? 18.074  4.763   -15.381 1.00 58.51  ? 381  HIS B CG  1 
ATOM   7084 N ND1 . HIS B 1 381 ? 18.476  6.025   -14.994 1.00 60.08  ? 381  HIS B ND1 1 
ATOM   7085 C CD2 . HIS B 1 381 ? 16.888  4.923   -16.020 1.00 57.99  ? 381  HIS B CD2 1 
ATOM   7086 C CE1 . HIS B 1 381 ? 17.564  6.906   -15.375 1.00 59.97  ? 381  HIS B CE1 1 
ATOM   7087 N NE2 . HIS B 1 381 ? 16.589  6.264   -15.995 1.00 58.72  ? 381  HIS B NE2 1 
ATOM   7088 N N   . TYR B 1 382 ? 16.846  1.169   -14.572 1.00 58.30  ? 382  TYR B N   1 
ATOM   7089 C CA  . TYR B 1 382 ? 15.509  0.639   -14.847 1.00 58.12  ? 382  TYR B CA  1 
ATOM   7090 C C   . TYR B 1 382 ? 14.989  -0.360  -13.802 1.00 59.36  ? 382  TYR B C   1 
ATOM   7091 O O   . TYR B 1 382 ? 13.836  -0.803  -13.881 1.00 60.11  ? 382  TYR B O   1 
ATOM   7092 C CB  . TYR B 1 382 ? 15.489  -0.005  -16.241 1.00 57.11  ? 382  TYR B CB  1 
ATOM   7093 C CG  . TYR B 1 382 ? 15.316  0.988   -17.358 1.00 56.00  ? 382  TYR B CG  1 
ATOM   7094 C CD1 . TYR B 1 382 ? 16.411  1.598   -17.964 1.00 56.13  ? 382  TYR B CD1 1 
ATOM   7095 C CD2 . TYR B 1 382 ? 14.055  1.333   -17.798 1.00 54.74  ? 382  TYR B CD2 1 
ATOM   7096 C CE1 . TYR B 1 382 ? 16.243  2.515   -19.000 1.00 55.59  ? 382  TYR B CE1 1 
ATOM   7097 C CE2 . TYR B 1 382 ? 13.873  2.232   -18.840 1.00 55.40  ? 382  TYR B CE2 1 
ATOM   7098 C CZ  . TYR B 1 382 ? 14.963  2.829   -19.434 1.00 54.08  ? 382  TYR B CZ  1 
ATOM   7099 O OH  . TYR B 1 382 ? 14.746  3.729   -20.460 1.00 52.42  ? 382  TYR B OH  1 
ATOM   7100 N N   . THR B 1 383 ? 15.828  -0.733  -12.846 1.00 60.47  ? 383  THR B N   1 
ATOM   7101 C CA  . THR B 1 383 ? 15.374  -1.508  -11.715 1.00 61.63  ? 383  THR B CA  1 
ATOM   7102 C C   . THR B 1 383 ? 14.562  -0.624  -10.787 1.00 62.36  ? 383  THR B C   1 
ATOM   7103 O O   . THR B 1 383 ? 14.954  0.509   -10.502 1.00 61.80  ? 383  THR B O   1 
ATOM   7104 C CB  . THR B 1 383 ? 16.548  -2.082  -10.959 1.00 62.98  ? 383  THR B CB  1 
ATOM   7105 O OG1 . THR B 1 383 ? 17.251  -2.961  -11.834 1.00 62.01  ? 383  THR B OG1 1 
ATOM   7106 C CG2 . THR B 1 383 ? 16.090  -2.844  -9.723  1.00 63.77  ? 383  THR B CG2 1 
ATOM   7107 N N   . ASP B 1 384 ? 13.405  -1.137  -10.363 1.00 63.74  ? 384  ASP B N   1 
ATOM   7108 C CA  . ASP B 1 384 ? 12.650  -0.566  -9.245  1.00 64.48  ? 384  ASP B CA  1 
ATOM   7109 C C   . ASP B 1 384 ? 13.220  -1.193  -7.982  1.00 65.80  ? 384  ASP B C   1 
ATOM   7110 O O   . ASP B 1 384 ? 12.962  -2.358  -7.689  1.00 66.26  ? 384  ASP B O   1 
ATOM   7111 C CB  . ASP B 1 384 ? 11.143  -0.871  -9.365  1.00 64.77  ? 384  ASP B CB  1 
ATOM   7112 C CG  . ASP B 1 384 ? 10.297  -0.079  -8.360  1.00 65.85  ? 384  ASP B CG  1 
ATOM   7113 O OD1 . ASP B 1 384 ? 10.713  0.043   -7.195  1.00 68.67  ? 384  ASP B OD1 1 
ATOM   7114 O OD2 . ASP B 1 384 ? 9.221   0.443   -8.737  1.00 68.96  ? 384  ASP B OD2 1 
ATOM   7115 N N   . TRP B 1 385 ? 13.989  -0.421  -7.228  1.00 65.98  ? 385  TRP B N   1 
ATOM   7116 C CA  . TRP B 1 385 ? 14.687  -0.975  -6.072  1.00 67.95  ? 385  TRP B CA  1 
ATOM   7117 C C   . TRP B 1 385 ? 13.771  -1.301  -4.890  1.00 69.77  ? 385  TRP B C   1 
ATOM   7118 O O   . TRP B 1 385 ? 14.202  -1.950  -3.935  1.00 71.22  ? 385  TRP B O   1 
ATOM   7119 C CB  . TRP B 1 385 ? 15.884  -0.090  -5.691  1.00 67.85  ? 385  TRP B CB  1 
ATOM   7120 C CG  . TRP B 1 385 ? 16.879  -0.156  -6.775  1.00 66.41  ? 385  TRP B CG  1 
ATOM   7121 C CD1 . TRP B 1 385 ? 17.084  0.764   -7.753  1.00 65.36  ? 385  TRP B CD1 1 
ATOM   7122 C CD2 . TRP B 1 385 ? 17.735  -1.260  -7.070  1.00 67.27  ? 385  TRP B CD2 1 
ATOM   7123 N NE1 . TRP B 1 385 ? 18.044  0.318   -8.626  1.00 65.62  ? 385  TRP B NE1 1 
ATOM   7124 C CE2 . TRP B 1 385 ? 18.467  -0.923  -8.223  1.00 66.61  ? 385  TRP B CE2 1 
ATOM   7125 C CE3 . TRP B 1 385 ? 17.967  -2.502  -6.460  1.00 69.48  ? 385  TRP B CE3 1 
ATOM   7126 C CZ2 . TRP B 1 385 ? 19.413  -1.780  -8.786  1.00 67.25  ? 385  TRP B CZ2 1 
ATOM   7127 C CZ3 . TRP B 1 385 ? 18.908  -3.358  -7.022  1.00 70.13  ? 385  TRP B CZ3 1 
ATOM   7128 C CH2 . TRP B 1 385 ? 19.617  -2.991  -8.175  1.00 68.91  ? 385  TRP B CH2 1 
ATOM   7129 N N   . LEU B 1 386 ? 12.510  -0.883  -4.978  1.00 70.03  ? 386  LEU B N   1 
ATOM   7130 C CA  . LEU B 1 386 ? 11.463  -1.377  -4.082  1.00 72.18  ? 386  LEU B CA  1 
ATOM   7131 C C   . LEU B 1 386 ? 10.944  -2.762  -4.485  1.00 73.08  ? 386  LEU B C   1 
ATOM   7132 O O   . LEU B 1 386 ? 10.510  -3.533  -3.625  1.00 74.66  ? 386  LEU B O   1 
ATOM   7133 C CB  . LEU B 1 386 ? 10.294  -0.389  -4.020  1.00 71.72  ? 386  LEU B CB  1 
ATOM   7134 C CG  . LEU B 1 386 ? 10.267  0.535   -2.812  1.00 72.96  ? 386  LEU B CG  1 
ATOM   7135 C CD1 . LEU B 1 386 ? 9.159   1.567   -2.985  1.00 73.11  ? 386  LEU B CD1 1 
ATOM   7136 C CD2 . LEU B 1 386 ? 10.071  -0.298  -1.554  1.00 75.25  ? 386  LEU B CD2 1 
ATOM   7137 N N   . HIS B 1 387 ? 10.971  -3.060  -5.786  1.00 72.33  ? 387  HIS B N   1 
ATOM   7138 C CA  . HIS B 1 387 ? 10.504  -4.349  -6.319  1.00 73.27  ? 387  HIS B CA  1 
ATOM   7139 C C   . HIS B 1 387 ? 11.505  -4.874  -7.347  1.00 73.00  ? 387  HIS B C   1 
ATOM   7140 O O   . HIS B 1 387 ? 11.162  -5.060  -8.517  1.00 72.28  ? 387  HIS B O   1 
ATOM   7141 C CB  . HIS B 1 387 ? 9.114   -4.196  -6.964  1.00 72.75  ? 387  HIS B CB  1 
ATOM   7142 C CG  . HIS B 1 387 ? 8.129   -3.467  -6.106  1.00 73.40  ? 387  HIS B CG  1 
ATOM   7143 N ND1 . HIS B 1 387 ? 7.902   -2.111  -6.221  1.00 73.37  ? 387  HIS B ND1 1 
ATOM   7144 C CD2 . HIS B 1 387 ? 7.324   -3.900  -5.108  1.00 76.05  ? 387  HIS B CD2 1 
ATOM   7145 C CE1 . HIS B 1 387 ? 7.005   -1.737  -5.325  1.00 73.92  ? 387  HIS B CE1 1 
ATOM   7146 N NE2 . HIS B 1 387 ? 6.637   -2.805  -4.637  1.00 76.19  ? 387  HIS B NE2 1 
ATOM   7147 N N   . PRO B 1 388 ? 12.753  -5.117  -6.914  1.00 74.07  ? 388  PRO B N   1 
ATOM   7148 C CA  . PRO B 1 388 ? 13.838  -5.403  -7.856  1.00 73.81  ? 388  PRO B CA  1 
ATOM   7149 C C   . PRO B 1 388 ? 13.738  -6.740  -8.565  1.00 74.57  ? 388  PRO B C   1 
ATOM   7150 O O   . PRO B 1 388 ? 14.333  -6.909  -9.617  1.00 74.06  ? 388  PRO B O   1 
ATOM   7151 C CB  . PRO B 1 388 ? 15.088  -5.367  -6.978  1.00 74.99  ? 388  PRO B CB  1 
ATOM   7152 C CG  . PRO B 1 388 ? 14.598  -5.710  -5.607  1.00 76.88  ? 388  PRO B CG  1 
ATOM   7153 C CD  . PRO B 1 388 ? 13.218  -5.129  -5.515  1.00 75.91  ? 388  PRO B CD  1 
ATOM   7154 N N   . GLU B 1 389 ? 13.001  -7.682  -7.994  1.00 76.30  ? 389  GLU B N   1 
ATOM   7155 C CA  . GLU B 1 389 ? 12.895  -9.012  -8.567  1.00 77.35  ? 389  GLU B CA  1 
ATOM   7156 C C   . GLU B 1 389 ? 11.471  -9.332  -9.024  1.00 76.77  ? 389  GLU B C   1 
ATOM   7157 O O   . GLU B 1 389 ? 11.203  -10.456 -9.456  1.00 77.99  ? 389  GLU B O   1 
ATOM   7158 C CB  . GLU B 1 389 ? 13.385  -10.058 -7.560  1.00 79.95  ? 389  GLU B CB  1 
ATOM   7159 C CG  . GLU B 1 389 ? 14.756  -9.736  -6.937  1.00 82.07  ? 389  GLU B CG  1 
ATOM   7160 C CD  . GLU B 1 389 ? 15.679  -10.949 -6.856  1.00 86.53  ? 389  GLU B CD  1 
ATOM   7161 O OE1 . GLU B 1 389 ? 15.856  -11.497 -5.742  1.00 89.20  ? 389  GLU B OE1 1 
ATOM   7162 O OE2 . GLU B 1 389 ? 16.218  -11.358 -7.914  1.00 88.04  ? 389  GLU B OE2 1 
ATOM   7163 N N   . ASP B 1 390 ? 10.572  -8.349  -8.965  1.00 74.92  ? 390  ASP B N   1 
ATOM   7164 C CA  . ASP B 1 390 ? 9.181   -8.568  -9.342  1.00 74.53  ? 390  ASP B CA  1 
ATOM   7165 C C   . ASP B 1 390 ? 9.062   -8.757  -10.859 1.00 73.15  ? 390  ASP B C   1 
ATOM   7166 O O   . ASP B 1 390 ? 9.378   -7.843  -11.615 1.00 71.56  ? 390  ASP B O   1 
ATOM   7167 C CB  . ASP B 1 390 ? 8.307   -7.403  -8.896  1.00 73.65  ? 390  ASP B CB  1 
ATOM   7168 C CG  . ASP B 1 390 ? 6.874   -7.556  -9.344  1.00 73.71  ? 390  ASP B CG  1 
ATOM   7169 O OD1 . ASP B 1 390 ? 6.254   -8.568  -8.967  1.00 75.62  ? 390  ASP B OD1 1 
ATOM   7170 O OD2 . ASP B 1 390 ? 6.372   -6.683  -10.082 1.00 71.59  ? 390  ASP B OD2 1 
ATOM   7171 N N   . PRO B 1 391 ? 8.610   -9.946  -11.309 1.00 74.14  ? 391  PRO B N   1 
ATOM   7172 C CA  . PRO B 1 391 ? 8.583   -10.262 -12.742 1.00 73.17  ? 391  PRO B CA  1 
ATOM   7173 C C   . PRO B 1 391 ? 7.789   -9.310  -13.655 1.00 71.15  ? 391  PRO B C   1 
ATOM   7174 O O   . PRO B 1 391 ? 8.167   -9.133  -14.811 1.00 69.81  ? 391  PRO B O   1 
ATOM   7175 C CB  . PRO B 1 391 ? 7.969   -11.668 -12.763 1.00 75.02  ? 391  PRO B CB  1 
ATOM   7176 C CG  . PRO B 1 391 ? 8.306   -12.239 -11.457 1.00 76.62  ? 391  PRO B CG  1 
ATOM   7177 C CD  . PRO B 1 391 ? 8.132   -11.092 -10.518 1.00 76.19  ? 391  PRO B CD  1 
ATOM   7178 N N   . THR B 1 392 ? 6.704   -8.723  -13.149 1.00 71.15  ? 392  THR B N   1 
ATOM   7179 C CA  . THR B 1 392 ? 5.914   -7.742  -13.910 1.00 69.72  ? 392  THR B CA  1 
ATOM   7180 C C   . THR B 1 392 ? 6.698   -6.459  -14.135 1.00 67.99  ? 392  THR B C   1 
ATOM   7181 O O   . THR B 1 392 ? 6.656   -5.883  -15.225 1.00 66.46  ? 392  THR B O   1 
ATOM   7182 C CB  . THR B 1 392 ? 4.589   -7.381  -13.183 1.00 70.39  ? 392  THR B CB  1 
ATOM   7183 O OG1 . THR B 1 392 ? 3.759   -8.543  -13.107 1.00 72.77  ? 392  THR B OG1 1 
ATOM   7184 C CG2 . THR B 1 392 ? 3.826   -6.267  -13.907 1.00 68.17  ? 392  THR B CG2 1 
ATOM   7185 N N   . HIS B 1 393 ? 7.399   -6.009  -13.094 1.00 68.27  ? 393  HIS B N   1 
ATOM   7186 C CA  . HIS B 1 393 ? 8.203   -4.788  -13.184 1.00 66.81  ? 393  HIS B CA  1 
ATOM   7187 C C   . HIS B 1 393 ? 9.343   -4.990  -14.160 1.00 65.52  ? 393  HIS B C   1 
ATOM   7188 O O   . HIS B 1 393 ? 9.649   -4.105  -14.946 1.00 64.14  ? 393  HIS B O   1 
ATOM   7189 C CB  . HIS B 1 393 ? 8.774   -4.375  -11.815 1.00 67.76  ? 393  HIS B CB  1 
ATOM   7190 C CG  . HIS B 1 393 ? 7.819   -3.603  -10.956 1.00 68.24  ? 393  HIS B CG  1 
ATOM   7191 N ND1 . HIS B 1 393 ? 6.938   -4.212  -10.090 1.00 70.57  ? 393  HIS B ND1 1 
ATOM   7192 C CD2 . HIS B 1 393 ? 7.632   -2.271  -10.804 1.00 68.11  ? 393  HIS B CD2 1 
ATOM   7193 C CE1 . HIS B 1 393 ? 6.242   -3.290  -9.449  1.00 70.65  ? 393  HIS B CE1 1 
ATOM   7194 N NE2 . HIS B 1 393 ? 6.645   -2.103  -9.862  1.00 69.00  ? 393  HIS B NE2 1 
ATOM   7195 N N   . LEU B 1 394 ? 9.973   -6.156  -14.097 1.00 66.39  ? 394  LEU B N   1 
ATOM   7196 C CA  . LEU B 1 394 ? 11.108  -6.448  -14.961 1.00 65.78  ? 394  LEU B CA  1 
ATOM   7197 C C   . LEU B 1 394 ? 10.663  -6.578  -16.411 1.00 64.92  ? 394  LEU B C   1 
ATOM   7198 O O   . LEU B 1 394 ? 11.313  -6.059  -17.300 1.00 63.81  ? 394  LEU B O   1 
ATOM   7199 C CB  . LEU B 1 394 ? 11.833  -7.711  -14.495 1.00 67.16  ? 394  LEU B CB  1 
ATOM   7200 C CG  . LEU B 1 394 ? 12.448  -7.595  -13.098 1.00 67.81  ? 394  LEU B CG  1 
ATOM   7201 C CD1 . LEU B 1 394 ? 12.711  -8.971  -12.519 1.00 67.97  ? 394  LEU B CD1 1 
ATOM   7202 C CD2 . LEU B 1 394 ? 13.717  -6.746  -13.122 1.00 64.91  ? 394  LEU B CD2 1 
ATOM   7203 N N   . ARG B 1 395 ? 9.545   -7.261  -16.642 1.00 65.73  ? 395  ARG B N   1 
ATOM   7204 C CA  . ARG B 1 395 ? 8.979   -7.353  -17.982 1.00 64.87  ? 395  ARG B CA  1 
ATOM   7205 C C   . ARG B 1 395 ? 8.677   -5.972  -18.564 1.00 62.94  ? 395  ARG B C   1 
ATOM   7206 O O   . ARG B 1 395 ? 9.119   -5.653  -19.670 1.00 61.86  ? 395  ARG B O   1 
ATOM   7207 C CB  . ARG B 1 395 ? 7.720   -8.225  -17.975 1.00 66.10  ? 395  ARG B CB  1 
ATOM   7208 C CG  . ARG B 1 395 ? 6.934   -8.231  -19.307 1.00 65.84  ? 395  ARG B CG  1 
ATOM   7209 C CD  . ARG B 1 395 ? 5.620   -7.491  -19.168 1.00 65.99  ? 395  ARG B CD  1 
ATOM   7210 N NE  . ARG B 1 395 ? 4.556   -8.353  -18.682 1.00 67.34  ? 395  ARG B NE  1 
ATOM   7211 C CZ  . ARG B 1 395 ? 3.474   -7.930  -18.032 1.00 67.22  ? 395  ARG B CZ  1 
ATOM   7212 N NH1 . ARG B 1 395 ? 3.297   -6.648  -17.738 1.00 64.16  ? 395  ARG B NH1 1 
ATOM   7213 N NH2 . ARG B 1 395 ? 2.557   -8.816  -17.654 1.00 69.96  ? 395  ARG B NH2 1 
ATOM   7214 N N   . ASP B 1 396 ? 7.936   -5.157  -17.820 1.00 62.49  ? 396  ASP B N   1 
ATOM   7215 C CA  . ASP B 1 396 ? 7.606   -3.804  -18.259 1.00 61.10  ? 396  ASP B CA  1 
ATOM   7216 C C   . ASP B 1 396 ? 8.843   -2.906  -18.420 1.00 59.99  ? 396  ASP B C   1 
ATOM   7217 O O   . ASP B 1 396 ? 8.873   -2.029  -19.303 1.00 58.59  ? 396  ASP B O   1 
ATOM   7218 C CB  . ASP B 1 396 ? 6.597   -3.164  -17.302 1.00 61.61  ? 396  ASP B CB  1 
ATOM   7219 C CG  . ASP B 1 396 ? 5.197   -3.756  -17.440 1.00 64.25  ? 396  ASP B CG  1 
ATOM   7220 O OD1 . ASP B 1 396 ? 4.909   -4.396  -18.474 1.00 66.07  ? 396  ASP B OD1 1 
ATOM   7221 O OD2 . ASP B 1 396 ? 4.369   -3.577  -16.518 1.00 67.97  ? 396  ASP B OD2 1 
ATOM   7222 N N   . ALA B 1 397 ? 9.863   -3.135  -17.590 1.00 60.23  ? 397  ALA B N   1 
ATOM   7223 C CA  . ALA B 1 397 ? 11.108  -2.370  -17.662 1.00 59.59  ? 397  ALA B CA  1 
ATOM   7224 C C   . ALA B 1 397 ? 11.881  -2.712  -18.923 1.00 58.84  ? 397  ALA B C   1 
ATOM   7225 O O   . ALA B 1 397 ? 12.441  -1.835  -19.560 1.00 58.43  ? 397  ALA B O   1 
ATOM   7226 C CB  . ALA B 1 397 ? 11.961  -2.611  -16.423 1.00 60.23  ? 397  ALA B CB  1 
ATOM   7227 N N   . MET B 1 398 ? 11.901  -3.988  -19.289 1.00 59.60  ? 398  MET B N   1 
ATOM   7228 C CA  . MET B 1 398 ? 12.533  -4.449  -20.534 1.00 59.07  ? 398  MET B CA  1 
ATOM   7229 C C   . MET B 1 398 ? 11.898  -3.796  -21.765 1.00 57.59  ? 398  MET B C   1 
ATOM   7230 O O   . MET B 1 398 ? 12.586  -3.391  -22.692 1.00 56.45  ? 398  MET B O   1 
ATOM   7231 C CB  . MET B 1 398 ? 12.393  -5.975  -20.632 1.00 60.67  ? 398  MET B CB  1 
ATOM   7232 C CG  . MET B 1 398 ? 13.224  -6.666  -21.700 1.00 61.02  ? 398  MET B CG  1 
ATOM   7233 S SD  . MET B 1 398 ? 14.997  -6.550  -21.444 1.00 63.47  ? 398  MET B SD  1 
ATOM   7234 C CE  . MET B 1 398 ? 15.456  -5.478  -22.791 1.00 61.89  ? 398  MET B CE  1 
ATOM   7235 N N   . SER B 1 399 ? 10.572  -3.719  -21.776 1.00 57.15  ? 399  SER B N   1 
ATOM   7236 C CA  . SER B 1 399 ? 9.871   -3.032  -22.830 1.00 55.59  ? 399  SER B CA  1 
ATOM   7237 C C   . SER B 1 399 ? 10.335  -1.583  -22.883 1.00 54.39  ? 399  SER B C   1 
ATOM   7238 O O   . SER B 1 399 ? 10.656  -1.062  -23.953 1.00 53.46  ? 399  SER B O   1 
ATOM   7239 C CB  . SER B 1 399 ? 8.374   -3.093  -22.583 1.00 55.84  ? 399  SER B CB  1 
ATOM   7240 O OG  . SER B 1 399 ? 7.691   -2.305  -23.523 1.00 55.49  ? 399  SER B OG  1 
ATOM   7241 N N   . ALA B 1 400 ? 10.401  -0.948  -21.716 1.00 54.38  ? 400  ALA B N   1 
ATOM   7242 C CA  . ALA B 1 400 ? 10.790  0.461   -21.616 1.00 53.26  ? 400  ALA B CA  1 
ATOM   7243 C C   . ALA B 1 400 ? 12.207  0.715   -22.135 1.00 53.12  ? 400  ALA B C   1 
ATOM   7244 O O   . ALA B 1 400 ? 12.429  1.666   -22.878 1.00 53.50  ? 400  ALA B O   1 
ATOM   7245 C CB  . ALA B 1 400 ? 10.646  0.946   -20.176 1.00 53.24  ? 400  ALA B CB  1 
ATOM   7246 N N   . VAL B 1 401 ? 13.161  -0.133  -21.766 1.00 54.03  ? 401  VAL B N   1 
ATOM   7247 C CA  . VAL B 1 401 ? 14.557  0.017   -22.208 1.00 53.59  ? 401  VAL B CA  1 
ATOM   7248 C C   . VAL B 1 401 ? 14.650  0.067   -23.732 1.00 53.13  ? 401  VAL B C   1 
ATOM   7249 O O   . VAL B 1 401 ? 15.300  0.950   -24.306 1.00 52.07  ? 401  VAL B O   1 
ATOM   7250 C CB  . VAL B 1 401 ? 15.468  -1.142  -21.690 1.00 54.86  ? 401  VAL B CB  1 
ATOM   7251 C CG1 . VAL B 1 401 ? 16.779  -1.181  -22.459 1.00 54.21  ? 401  VAL B CG1 1 
ATOM   7252 C CG2 . VAL B 1 401 ? 15.738  -1.006  -20.204 1.00 54.24  ? 401  VAL B CG2 1 
ATOM   7253 N N   . VAL B 1 402 ? 13.966  -0.875  -24.376 1.00 53.12  ? 402  VAL B N   1 
ATOM   7254 C CA  . VAL B 1 402 ? 14.024  -1.034  -25.819 1.00 52.77  ? 402  VAL B CA  1 
ATOM   7255 C C   . VAL B 1 402 ? 13.329  0.136   -26.523 1.00 51.98  ? 402  VAL B C   1 
ATOM   7256 O O   . VAL B 1 402 ? 13.834  0.658   -27.518 1.00 51.40  ? 402  VAL B O   1 
ATOM   7257 C CB  . VAL B 1 402 ? 13.409  -2.398  -26.245 1.00 53.38  ? 402  VAL B CB  1 
ATOM   7258 C CG1 . VAL B 1 402 ? 13.220  -2.472  -27.760 1.00 52.42  ? 402  VAL B CG1 1 
ATOM   7259 C CG2 . VAL B 1 402 ? 14.284  -3.554  -25.742 1.00 53.50  ? 402  VAL B CG2 1 
ATOM   7260 N N   . GLY B 1 403 ? 12.174  0.540   -26.003 1.00 51.83  ? 403  GLY B N   1 
ATOM   7261 C CA  . GLY B 1 403 ? 11.421  1.641   -26.583 1.00 50.89  ? 403  GLY B CA  1 
ATOM   7262 C C   . GLY B 1 403 ? 12.060  3.000   -26.380 1.00 50.48  ? 403  GLY B C   1 
ATOM   7263 O O   . GLY B 1 403 ? 11.963  3.864   -27.245 1.00 50.41  ? 403  GLY B O   1 
ATOM   7264 N N   . ASP B 1 404 ? 12.705  3.192   -25.237 1.00 50.80  ? 404  ASP B N   1 
ATOM   7265 C CA  . ASP B 1 404 ? 13.324  4.462   -24.905 1.00 50.58  ? 404  ASP B CA  1 
ATOM   7266 C C   . ASP B 1 404 ? 14.608  4.690   -25.692 1.00 50.37  ? 404  ASP B C   1 
ATOM   7267 O O   . ASP B 1 404 ? 14.825  5.769   -26.256 1.00 50.31  ? 404  ASP B O   1 
ATOM   7268 C CB  . ASP B 1 404 ? 13.636  4.530   -23.411 1.00 51.85  ? 404  ASP B CB  1 
ATOM   7269 C CG  . ASP B 1 404 ? 12.395  4.684   -22.543 1.00 52.89  ? 404  ASP B CG  1 
ATOM   7270 O OD1 . ASP B 1 404 ? 11.335  5.024   -23.077 1.00 53.66  ? 404  ASP B OD1 1 
ATOM   7271 O OD2 . ASP B 1 404 ? 12.491  4.498   -21.307 1.00 54.68  ? 404  ASP B OD2 1 
ATOM   7272 N N   . HIS B 1 405 ? 15.466  3.679   -25.686 1.00 50.25  ? 405  HIS B N   1 
ATOM   7273 C CA  . HIS B 1 405 ? 16.721  3.652   -26.448 1.00 49.86  ? 405  HIS B CA  1 
ATOM   7274 C C   . HIS B 1 405 ? 16.498  3.857   -27.957 1.00 49.22  ? 405  HIS B C   1 
ATOM   7275 O O   . HIS B 1 405 ? 17.197  4.641   -28.605 1.00 48.44  ? 405  HIS B O   1 
ATOM   7276 C CB  . HIS B 1 405 ? 17.381  2.293   -26.173 1.00 50.51  ? 405  HIS B CB  1 
ATOM   7277 C CG  . HIS B 1 405 ? 18.616  1.997   -26.973 1.00 49.94  ? 405  HIS B CG  1 
ATOM   7278 N ND1 . HIS B 1 405 ? 19.702  2.842   -27.032 1.00 50.61  ? 405  HIS B ND1 1 
ATOM   7279 C CD2 . HIS B 1 405 ? 18.960  0.899   -27.686 1.00 50.19  ? 405  HIS B CD2 1 
ATOM   7280 C CE1 . HIS B 1 405 ? 20.650  2.289   -27.772 1.00 50.81  ? 405  HIS B CE1 1 
ATOM   7281 N NE2 . HIS B 1 405 ? 20.222  1.112   -28.187 1.00 51.74  ? 405  HIS B NE2 1 
ATOM   7282 N N   . ASN B 1 406 ? 15.521  3.144   -28.506 1.00 48.87  ? 406  ASN B N   1 
ATOM   7283 C CA  . ASN B 1 406 ? 15.311  3.115   -29.950 1.00 48.49  ? 406  ASN B CA  1 
ATOM   7284 C C   . ASN B 1 406 ? 14.379  4.171   -30.502 1.00 47.88  ? 406  ASN B C   1 
ATOM   7285 O O   . ASN B 1 406 ? 14.542  4.556   -31.659 1.00 47.71  ? 406  ASN B O   1 
ATOM   7286 C CB  . ASN B 1 406 ? 14.800  1.755   -30.373 1.00 48.31  ? 406  ASN B CB  1 
ATOM   7287 C CG  . ASN B 1 406 ? 15.823  0.700   -30.168 1.00 49.69  ? 406  ASN B CG  1 
ATOM   7288 O OD1 . ASN B 1 406 ? 16.897  0.775   -30.749 1.00 48.27  ? 406  ASN B OD1 1 
ATOM   7289 N ND2 . ASN B 1 406 ? 15.535  -0.262  -29.303 1.00 50.47  ? 406  ASN B ND2 1 
ATOM   7290 N N   . VAL B 1 407 ? 13.402  4.617   -29.711 1.00 47.78  ? 407  VAL B N   1 
ATOM   7291 C CA  . VAL B 1 407 ? 12.419  5.594   -30.205 1.00 47.01  ? 407  VAL B CA  1 
ATOM   7292 C C   . VAL B 1 407 ? 12.202  6.837   -29.336 1.00 47.43  ? 407  VAL B C   1 
ATOM   7293 O O   . VAL B 1 407 ? 12.344  7.958   -29.837 1.00 47.73  ? 407  VAL B O   1 
ATOM   7294 C CB  . VAL B 1 407 ? 11.052  4.938   -30.438 1.00 47.29  ? 407  VAL B CB  1 
ATOM   7295 C CG1 . VAL B 1 407 ? 10.102  5.955   -31.080 1.00 46.52  ? 407  VAL B CG1 1 
ATOM   7296 C CG2 . VAL B 1 407 ? 11.184  3.650   -31.302 1.00 46.19  ? 407  VAL B CG2 1 
ATOM   7297 N N   . VAL B 1 408 ? 11.840  6.678   -28.059 1.00 47.63  ? 408  VAL B N   1 
ATOM   7298 C CA  . VAL B 1 408 ? 11.405  7.850   -27.283 1.00 47.89  ? 408  VAL B CA  1 
ATOM   7299 C C   . VAL B 1 408 ? 12.536  8.860   -27.115 1.00 48.42  ? 408  VAL B C   1 
ATOM   7300 O O   . VAL B 1 408 ? 12.358  10.088  -27.319 1.00 48.77  ? 408  VAL B O   1 
ATOM   7301 C CB  . VAL B 1 408 ? 10.819  7.479   -25.893 1.00 48.44  ? 408  VAL B CB  1 
ATOM   7302 C CG1 . VAL B 1 408 ? 10.292  8.755   -25.177 1.00 47.90  ? 408  VAL B CG1 1 
ATOM   7303 C CG2 . VAL B 1 408 ? 9.705   6.383   -26.031 1.00 47.81  ? 408  VAL B CG2 1 
ATOM   7304 N N   . CYS B 1 409 ? 13.710  8.367   -26.754 1.00 48.42  ? 409  CYS B N   1 
ATOM   7305 C CA  . CYS B 1 409 ? 14.791  9.278   -26.447 1.00 48.96  ? 409  CYS B CA  1 
ATOM   7306 C C   . CYS B 1 409 ? 15.415  9.925   -27.681 1.00 48.98  ? 409  CYS B C   1 
ATOM   7307 O O   . CYS B 1 409 ? 15.711  11.141  -27.657 1.00 50.47  ? 409  CYS B O   1 
ATOM   7308 C CB  . CYS B 1 409 ? 15.801  8.619   -25.532 1.00 49.55  ? 409  CYS B CB  1 
ATOM   7309 S SG  . CYS B 1 409 ? 15.123  8.355   -23.872 1.00 50.26  ? 409  CYS B SG  1 
ATOM   7310 N N   . PRO B 1 410 ? 15.633  9.146   -28.753 1.00 48.95  ? 410  PRO B N   1 
ATOM   7311 C CA  . PRO B 1 410 ? 15.872  9.743   -30.068 1.00 48.27  ? 410  PRO B CA  1 
ATOM   7312 C C   . PRO B 1 410 ? 14.825  10.773  -30.505 1.00 47.68  ? 410  PRO B C   1 
ATOM   7313 O O   . PRO B 1 410 ? 15.216  11.804  -31.042 1.00 47.03  ? 410  PRO B O   1 
ATOM   7314 C CB  . PRO B 1 410 ? 15.871  8.536   -30.989 1.00 48.33  ? 410  PRO B CB  1 
ATOM   7315 C CG  . PRO B 1 410 ? 16.447  7.460   -30.126 1.00 48.97  ? 410  PRO B CG  1 
ATOM   7316 C CD  . PRO B 1 410 ? 15.772  7.682   -28.808 1.00 48.81  ? 410  PRO B CD  1 
ATOM   7317 N N   . VAL B 1 411 ? 13.528  10.513  -30.289 1.00 47.09  ? 411  VAL B N   1 
ATOM   7318 C CA  . VAL B 1 411 ? 12.505  11.541  -30.611 1.00 46.94  ? 411  VAL B CA  1 
ATOM   7319 C C   . VAL B 1 411 ? 12.698  12.815  -29.779 1.00 48.10  ? 411  VAL B C   1 
ATOM   7320 O O   . VAL B 1 411 ? 12.642  13.931  -30.309 1.00 48.49  ? 411  VAL B O   1 
ATOM   7321 C CB  . VAL B 1 411 ? 11.048  11.024  -30.467 1.00 46.38  ? 411  VAL B CB  1 
ATOM   7322 C CG1 . VAL B 1 411 ? 10.074  12.153  -30.476 1.00 46.74  ? 411  VAL B CG1 1 
ATOM   7323 C CG2 . VAL B 1 411 ? 10.698  10.050  -31.589 1.00 46.15  ? 411  VAL B CG2 1 
ATOM   7324 N N   . ALA B 1 412 ? 12.939  12.652  -28.479 1.00 49.01  ? 412  ALA B N   1 
ATOM   7325 C CA  . ALA B 1 412 ? 13.066  13.774  -27.572 1.00 49.36  ? 412  ALA B CA  1 
ATOM   7326 C C   . ALA B 1 412 ? 14.250  14.615  -28.002 1.00 49.89  ? 412  ALA B C   1 
ATOM   7327 O O   . ALA B 1 412 ? 14.170  15.837  -28.022 1.00 50.41  ? 412  ALA B O   1 
ATOM   7328 C CB  . ALA B 1 412 ? 13.231  13.308  -26.125 1.00 49.26  ? 412  ALA B CB  1 
ATOM   7329 N N   . GLN B 1 413 ? 15.331  13.950  -28.386 1.00 50.13  ? 413  GLN B N   1 
ATOM   7330 C CA  . GLN B 1 413 ? 16.530  14.642  -28.798 1.00 51.05  ? 413  GLN B CA  1 
ATOM   7331 C C   . GLN B 1 413 ? 16.319  15.448  -30.057 1.00 50.48  ? 413  GLN B C   1 
ATOM   7332 O O   . GLN B 1 413 ? 16.814  16.559  -30.153 1.00 50.18  ? 413  GLN B O   1 
ATOM   7333 C CB  . GLN B 1 413 ? 17.671  13.662  -29.026 1.00 52.13  ? 413  GLN B CB  1 
ATOM   7334 C CG  . GLN B 1 413 ? 18.975  14.371  -29.318 1.00 55.42  ? 413  GLN B CG  1 
ATOM   7335 C CD  . GLN B 1 413 ? 20.111  13.413  -29.399 1.00 61.45  ? 413  GLN B CD  1 
ATOM   7336 O OE1 . GLN B 1 413 ? 20.073  12.436  -30.176 1.00 65.31  ? 413  GLN B OE1 1 
ATOM   7337 N NE2 . GLN B 1 413 ? 21.135  13.655  -28.591 1.00 64.99  ? 413  GLN B NE2 1 
ATOM   7338 N N   . LEU B 1 414 ? 15.596  14.882  -31.022 1.00 49.47  ? 414  LEU B N   1 
ATOM   7339 C CA  . LEU B 1 414 ? 15.300  15.574  -32.269 1.00 49.21  ? 414  LEU B CA  1 
ATOM   7340 C C   . LEU B 1 414 ? 14.361  16.740  -32.038 1.00 50.12  ? 414  LEU B C   1 
ATOM   7341 O O   . LEU B 1 414 ? 14.589  17.842  -32.531 1.00 51.23  ? 414  LEU B O   1 
ATOM   7342 C CB  . LEU B 1 414 ? 14.656  14.612  -33.248 1.00 49.39  ? 414  LEU B CB  1 
ATOM   7343 C CG  . LEU B 1 414 ? 14.312  15.161  -34.639 1.00 48.72  ? 414  LEU B CG  1 
ATOM   7344 C CD1 . LEU B 1 414 ? 15.596  15.479  -35.409 1.00 50.23  ? 414  LEU B CD1 1 
ATOM   7345 C CD2 . LEU B 1 414 ? 13.443  14.181  -35.374 1.00 47.30  ? 414  LEU B CD2 1 
ATOM   7346 N N   . ALA B 1 415 ? 13.287  16.487  -31.308 1.00 50.06  ? 415  ALA B N   1 
ATOM   7347 C CA  . ALA B 1 415 ? 12.330  17.523  -30.976 1.00 50.60  ? 415  ALA B CA  1 
ATOM   7348 C C   . ALA B 1 415 ? 13.051  18.745  -30.442 1.00 52.23  ? 415  ALA B C   1 
ATOM   7349 O O   . ALA B 1 415 ? 12.767  19.866  -30.855 1.00 53.48  ? 415  ALA B O   1 
ATOM   7350 C CB  . ALA B 1 415 ? 11.338  17.006  -29.965 1.00 50.06  ? 415  ALA B CB  1 
ATOM   7351 N N   . GLY B 1 416 ? 13.996  18.533  -29.535 1.00 53.49  ? 416  GLY B N   1 
ATOM   7352 C CA  . GLY B 1 416 ? 14.701  19.630  -28.888 1.00 54.60  ? 416  GLY B CA  1 
ATOM   7353 C C   . GLY B 1 416 ? 15.714  20.372  -29.731 1.00 55.86  ? 416  GLY B C   1 
ATOM   7354 O O   . GLY B 1 416 ? 15.917  21.583  -29.543 1.00 57.17  ? 416  GLY B O   1 
ATOM   7355 N N   . ARG B 1 417 ? 16.399  19.661  -30.622 1.00 56.12  ? 417  ARG B N   1 
ATOM   7356 C CA  . ARG B 1 417 ? 17.339  20.308  -31.542 1.00 57.42  ? 417  ARG B CA  1 
ATOM   7357 C C   . ARG B 1 417 ? 16.565  21.140  -32.560 1.00 57.34  ? 417  ARG B C   1 
ATOM   7358 O O   . ARG B 1 417 ? 16.907  22.287  -32.819 1.00 58.53  ? 417  ARG B O   1 
ATOM   7359 C CB  . ARG B 1 417 ? 18.215  19.290  -32.290 1.00 57.62  ? 417  ARG B CB  1 
ATOM   7360 C CG  . ARG B 1 417 ? 19.166  18.437  -31.466 1.00 60.08  ? 417  ARG B CG  1 
ATOM   7361 C CD  . ARG B 1 417 ? 20.003  19.176  -30.438 1.00 65.47  ? 417  ARG B CD  1 
ATOM   7362 N NE  . ARG B 1 417 ? 20.940  20.115  -31.038 1.00 68.64  ? 417  ARG B NE  1 
ATOM   7363 C CZ  . ARG B 1 417 ? 22.094  20.516  -30.485 1.00 72.03  ? 417  ARG B CZ  1 
ATOM   7364 N NH1 . ARG B 1 417 ? 22.510  20.048  -29.304 1.00 73.10  ? 417  ARG B NH1 1 
ATOM   7365 N NH2 . ARG B 1 417 ? 22.867  21.382  -31.138 1.00 72.51  ? 417  ARG B NH2 1 
ATOM   7366 N N   . LEU B 1 418 ? 15.520  20.563  -33.131 1.00 56.32  ? 418  LEU B N   1 
ATOM   7367 C CA  . LEU B 1 418 ? 14.717  21.271  -34.122 1.00 56.81  ? 418  LEU B CA  1 
ATOM   7368 C C   . LEU B 1 418 ? 14.116  22.548  -33.523 1.00 57.53  ? 418  LEU B C   1 
ATOM   7369 O O   . LEU B 1 418 ? 14.175  23.603  -34.137 1.00 58.82  ? 418  LEU B O   1 
ATOM   7370 C CB  . LEU B 1 418 ? 13.595  20.379  -34.668 1.00 55.44  ? 418  LEU B CB  1 
ATOM   7371 C CG  . LEU B 1 418 ? 13.934  19.119  -35.478 1.00 55.38  ? 418  LEU B CG  1 
ATOM   7372 C CD1 . LEU B 1 418 ? 12.697  18.256  -35.619 1.00 53.77  ? 418  LEU B CD1 1 
ATOM   7373 C CD2 . LEU B 1 418 ? 14.479  19.423  -36.838 1.00 56.16  ? 418  LEU B CD2 1 
ATOM   7374 N N   . ALA B 1 419 ? 13.558  22.426  -32.320 1.00 57.49  ? 419  ALA B N   1 
ATOM   7375 C CA  . ALA B 1 419 ? 12.926  23.528  -31.599 1.00 58.45  ? 419  ALA B CA  1 
ATOM   7376 C C   . ALA B 1 419 ? 13.932  24.624  -31.276 1.00 60.07  ? 419  ALA B C   1 
ATOM   7377 O O   . ALA B 1 419 ? 13.684  25.803  -31.521 1.00 61.56  ? 419  ALA B O   1 
ATOM   7378 C CB  . ALA B 1 419 ? 12.291  23.017  -30.316 1.00 57.48  ? 419  ALA B CB  1 
ATOM   7379 N N   . ALA B 1 420 ? 15.076  24.216  -30.735 1.00 60.62  ? 420  ALA B N   1 
ATOM   7380 C CA  . ALA B 1 420 ? 16.176  25.136  -30.436 1.00 62.19  ? 420  ALA B CA  1 
ATOM   7381 C C   . ALA B 1 420 ? 16.674  25.892  -31.665 1.00 63.34  ? 420  ALA B C   1 
ATOM   7382 O O   . ALA B 1 420 ? 17.237  26.973  -31.530 1.00 65.36  ? 420  ALA B O   1 
ATOM   7383 C CB  . ALA B 1 420 ? 17.343  24.379  -29.792 1.00 61.95  ? 420  ALA B CB  1 
ATOM   7384 N N   . GLN B 1 421 ? 16.475  25.337  -32.855 1.00 63.00  ? 421  GLN B N   1 
ATOM   7385 C CA  . GLN B 1 421 ? 17.108  25.870  -34.053 1.00 64.13  ? 421  GLN B CA  1 
ATOM   7386 C C   . GLN B 1 421 ? 16.153  26.414  -35.120 1.00 63.93  ? 421  GLN B C   1 
ATOM   7387 O O   . GLN B 1 421 ? 16.472  26.435  -36.311 1.00 63.93  ? 421  GLN B O   1 
ATOM   7388 C CB  . GLN B 1 421 ? 18.053  24.812  -34.608 1.00 64.17  ? 421  GLN B CB  1 
ATOM   7389 C CG  . GLN B 1 421 ? 19.275  24.700  -33.709 1.00 66.17  ? 421  GLN B CG  1 
ATOM   7390 C CD  . GLN B 1 421 ? 19.969  23.382  -33.809 1.00 67.69  ? 421  GLN B CD  1 
ATOM   7391 O OE1 . GLN B 1 421 ? 20.504  22.880  -32.816 1.00 69.29  ? 421  GLN B OE1 1 
ATOM   7392 N NE2 . GLN B 1 421 ? 19.964  22.798  -35.000 1.00 66.91  ? 421  GLN B NE2 1 
ATOM   7393 N N   . GLY B 1 422 ? 14.995  26.883  -34.670 1.00 63.89  ? 422  GLY B N   1 
ATOM   7394 C CA  . GLY B 1 422 ? 14.099  27.656  -35.506 1.00 64.08  ? 422  GLY B CA  1 
ATOM   7395 C C   . GLY B 1 422 ? 12.830  26.945  -35.906 1.00 62.86  ? 422  GLY B C   1 
ATOM   7396 O O   . GLY B 1 422 ? 11.890  27.603  -36.344 1.00 63.55  ? 422  GLY B O   1 
ATOM   7397 N N   . ALA B 1 423 ? 12.788  25.616  -35.772 1.00 61.01  ? 423  ALA B N   1 
ATOM   7398 C CA  . ALA B 1 423 ? 11.624  24.860  -36.233 1.00 59.71  ? 423  ALA B CA  1 
ATOM   7399 C C   . ALA B 1 423 ? 10.440  25.092  -35.322 1.00 59.60  ? 423  ALA B C   1 
ATOM   7400 O O   . ALA B 1 423 ? 10.596  25.372  -34.143 1.00 60.63  ? 423  ALA B O   1 
ATOM   7401 C CB  . ALA B 1 423 ? 11.922  23.377  -36.331 1.00 58.27  ? 423  ALA B CB  1 
ATOM   7402 N N   . ARG B 1 424 ? 9.251   24.999  -35.892 1.00 59.17  ? 424  ARG B N   1 
ATOM   7403 C CA  . ARG B 1 424 ? 8.030   24.978  -35.122 1.00 59.28  ? 424  ARG B CA  1 
ATOM   7404 C C   . ARG B 1 424 ? 7.663   23.516  -34.934 1.00 55.93  ? 424  ARG B C   1 
ATOM   7405 O O   . ARG B 1 424 ? 7.397   22.796  -35.914 1.00 54.89  ? 424  ARG B O   1 
ATOM   7406 C CB  . ARG B 1 424 ? 6.958   25.724  -35.880 1.00 60.13  ? 424  ARG B CB  1 
ATOM   7407 C CG  . ARG B 1 424 ? 5.587   25.664  -35.270 1.00 63.12  ? 424  ARG B CG  1 
ATOM   7408 C CD  . ARG B 1 424 ? 4.619   26.510  -36.124 1.00 65.98  ? 424  ARG B CD  1 
ATOM   7409 N NE  . ARG B 1 424 ? 3.569   27.123  -35.324 1.00 70.94  ? 424  ARG B NE  1 
ATOM   7410 C CZ  . ARG B 1 424 ? 3.773   28.072  -34.416 1.00 73.55  ? 424  ARG B CZ  1 
ATOM   7411 N NH1 . ARG B 1 424 ? 4.991   28.542  -34.169 1.00 75.93  ? 424  ARG B NH1 1 
ATOM   7412 N NH2 . ARG B 1 424 ? 2.742   28.556  -33.746 1.00 75.49  ? 424  ARG B NH2 1 
ATOM   7413 N N   . VAL B 1 425 ? 7.671   23.064  -33.684 1.00 53.68  ? 425  VAL B N   1 
ATOM   7414 C CA  . VAL B 1 425 ? 7.548   21.622  -33.382 1.00 50.50  ? 425  VAL B CA  1 
ATOM   7415 C C   . VAL B 1 425 ? 6.282   21.347  -32.565 1.00 49.78  ? 425  VAL B C   1 
ATOM   7416 O O   . VAL B 1 425 ? 5.953   22.109  -31.678 1.00 49.77  ? 425  VAL B O   1 
ATOM   7417 C CB  . VAL B 1 425 ? 8.804   21.115  -32.601 1.00 50.58  ? 425  VAL B CB  1 
ATOM   7418 C CG1 . VAL B 1 425 ? 8.731   19.587  -32.343 1.00 47.55  ? 425  VAL B CG1 1 
ATOM   7419 C CG2 . VAL B 1 425 ? 10.091  21.476  -33.343 1.00 47.31  ? 425  VAL B CG2 1 
ATOM   7420 N N   . TYR B 1 426 ? 5.563   20.264  -32.868 1.00 47.98  ? 426  TYR B N   1 
ATOM   7421 C CA  . TYR B 1 426 ? 4.435   19.847  -32.045 1.00 47.26  ? 426  TYR B CA  1 
ATOM   7422 C C   . TYR B 1 426 ? 4.640   18.381  -31.711 1.00 47.02  ? 426  TYR B C   1 
ATOM   7423 O O   . TYR B 1 426 ? 4.940   17.577  -32.603 1.00 46.30  ? 426  TYR B O   1 
ATOM   7424 C CB  . TYR B 1 426 ? 3.095   20.035  -32.780 1.00 47.47  ? 426  TYR B CB  1 
ATOM   7425 C CG  . TYR B 1 426 ? 2.677   21.488  -33.009 1.00 47.46  ? 426  TYR B CG  1 
ATOM   7426 C CD1 . TYR B 1 426 ? 3.068   22.165  -34.153 1.00 47.71  ? 426  TYR B CD1 1 
ATOM   7427 C CD2 . TYR B 1 426 ? 1.890   22.148  -32.115 1.00 45.98  ? 426  TYR B CD2 1 
ATOM   7428 C CE1 . TYR B 1 426 ? 2.709   23.477  -34.375 1.00 48.45  ? 426  TYR B CE1 1 
ATOM   7429 C CE2 . TYR B 1 426 ? 1.518   23.468  -32.326 1.00 49.97  ? 426  TYR B CE2 1 
ATOM   7430 C CZ  . TYR B 1 426 ? 1.935   24.125  -33.471 1.00 49.81  ? 426  TYR B CZ  1 
ATOM   7431 O OH  . TYR B 1 426 ? 1.589   25.432  -33.718 1.00 51.64  ? 426  TYR B OH  1 
ATOM   7432 N N   . ALA B 1 427 ? 4.461   18.026  -30.440 1.00 47.11  ? 427  ALA B N   1 
ATOM   7433 C CA  . ALA B 1 427 ? 4.757   16.668  -29.970 1.00 46.07  ? 427  ALA B CA  1 
ATOM   7434 C C   . ALA B 1 427 ? 3.547   16.034  -29.299 1.00 46.80  ? 427  ALA B C   1 
ATOM   7435 O O   . ALA B 1 427 ? 2.691   16.723  -28.749 1.00 46.41  ? 427  ALA B O   1 
ATOM   7436 C CB  . ALA B 1 427 ? 5.937   16.672  -29.027 1.00 45.41  ? 427  ALA B CB  1 
ATOM   7437 N N   . TYR B 1 428 ? 3.510   14.705  -29.333 1.00 46.80  ? 428  TYR B N   1 
ATOM   7438 C CA  . TYR B 1 428 ? 2.401   13.936  -28.793 1.00 47.99  ? 428  TYR B CA  1 
ATOM   7439 C C   . TYR B 1 428 ? 2.912   12.601  -28.269 1.00 48.43  ? 428  TYR B C   1 
ATOM   7440 O O   . TYR B 1 428 ? 3.957   12.102  -28.700 1.00 47.25  ? 428  TYR B O   1 
ATOM   7441 C CB  . TYR B 1 428 ? 1.313   13.686  -29.864 1.00 47.80  ? 428  TYR B CB  1 
ATOM   7442 C CG  . TYR B 1 428 ? 1.735   12.739  -30.970 1.00 46.76  ? 428  TYR B CG  1 
ATOM   7443 C CD1 . TYR B 1 428 ? 1.633   11.364  -30.802 1.00 46.62  ? 428  TYR B CD1 1 
ATOM   7444 C CD2 . TYR B 1 428 ? 2.242   13.217  -32.175 1.00 45.48  ? 428  TYR B CD2 1 
ATOM   7445 C CE1 . TYR B 1 428 ? 2.040   10.484  -31.769 1.00 44.82  ? 428  TYR B CE1 1 
ATOM   7446 C CE2 . TYR B 1 428 ? 2.649   12.349  -33.164 1.00 46.52  ? 428  TYR B CE2 1 
ATOM   7447 C CZ  . TYR B 1 428 ? 2.542   10.965  -32.955 1.00 46.34  ? 428  TYR B CZ  1 
ATOM   7448 O OH  . TYR B 1 428 ? 2.970   10.074  -33.924 1.00 44.07  ? 428  TYR B OH  1 
ATOM   7449 N N   . ILE B 1 429 ? 2.180   12.049  -27.312 1.00 50.13  ? 429  ILE B N   1 
ATOM   7450 C CA  . ILE B 1 429 ? 2.305   10.627  -26.983 1.00 51.00  ? 429  ILE B CA  1 
ATOM   7451 C C   . ILE B 1 429 ? 0.937   10.032  -27.237 1.00 51.38  ? 429  ILE B C   1 
ATOM   7452 O O   . ILE B 1 429 ? -0.067  10.626  -26.872 1.00 52.67  ? 429  ILE B O   1 
ATOM   7453 C CB  . ILE B 1 429 ? 2.744   10.377  -25.536 1.00 51.68  ? 429  ILE B CB  1 
ATOM   7454 C CG1 . ILE B 1 429 ? 2.769   8.857   -25.270 1.00 52.58  ? 429  ILE B CG1 1 
ATOM   7455 C CG2 . ILE B 1 429 ? 1.807   11.099  -24.561 1.00 53.14  ? 429  ILE B CG2 1 
ATOM   7456 C CD1 . ILE B 1 429 ? 3.666   8.450   -24.136 1.00 53.96  ? 429  ILE B CD1 1 
ATOM   7457 N N   . PHE B 1 430 ? 0.899   8.901   -27.919 1.00 51.32  ? 430  PHE B N   1 
ATOM   7458 C CA  . PHE B 1 430 ? -0.347  8.258   -28.291 1.00 52.21  ? 430  PHE B CA  1 
ATOM   7459 C C   . PHE B 1 430 ? -0.606  7.110   -27.318 1.00 53.61  ? 430  PHE B C   1 
ATOM   7460 O O   . PHE B 1 430 ? 0.235   6.219   -27.181 1.00 52.94  ? 430  PHE B O   1 
ATOM   7461 C CB  . PHE B 1 430 ? -0.241  7.752   -29.726 1.00 52.02  ? 430  PHE B CB  1 
ATOM   7462 C CG  . PHE B 1 430 ? -1.479  7.096   -30.243 1.00 52.40  ? 430  PHE B CG  1 
ATOM   7463 C CD1 . PHE B 1 430 ? -1.663  5.724   -30.106 1.00 53.72  ? 430  PHE B CD1 1 
ATOM   7464 C CD2 . PHE B 1 430 ? -2.454  7.839   -30.884 1.00 52.74  ? 430  PHE B CD2 1 
ATOM   7465 C CE1 . PHE B 1 430 ? -2.811  5.100   -30.594 1.00 54.97  ? 430  PHE B CE1 1 
ATOM   7466 C CE2 . PHE B 1 430 ? -3.613  7.220   -31.374 1.00 55.25  ? 430  PHE B CE2 1 
ATOM   7467 C CZ  . PHE B 1 430 ? -3.788  5.849   -31.234 1.00 54.67  ? 430  PHE B CZ  1 
ATOM   7468 N N   . GLU B 1 431 ? -1.780  7.128   -26.669 1.00 55.29  ? 431  GLU B N   1 
ATOM   7469 C CA  . GLU B 1 431 ? -2.056  6.291   -25.503 1.00 56.86  ? 431  GLU B CA  1 
ATOM   7470 C C   . GLU B 1 431 ? -3.291  5.417   -25.583 1.00 58.10  ? 431  GLU B C   1 
ATOM   7471 O O   . GLU B 1 431 ? -3.645  4.779   -24.593 1.00 59.28  ? 431  GLU B O   1 
ATOM   7472 C CB  . GLU B 1 431 ? -2.221  7.175   -24.272 1.00 57.46  ? 431  GLU B CB  1 
ATOM   7473 C CG  . GLU B 1 431 ? -0.991  7.924   -23.874 1.00 56.79  ? 431  GLU B CG  1 
ATOM   7474 C CD  . GLU B 1 431 ? -1.164  8.624   -22.548 1.00 58.04  ? 431  GLU B CD  1 
ATOM   7475 O OE1 . GLU B 1 431 ? -2.267  9.168   -22.265 1.00 61.95  ? 431  GLU B OE1 1 
ATOM   7476 O OE2 . GLU B 1 431 ? -0.196  8.616   -21.773 1.00 59.71  ? 431  GLU B OE2 1 
ATOM   7477 N N   . HIS B 1 432 ? -3.959  5.383   -26.728 1.00 58.33  ? 432  HIS B N   1 
ATOM   7478 C CA  . HIS B 1 432 ? -5.140  4.539   -26.876 1.00 59.64  ? 432  HIS B CA  1 
ATOM   7479 C C   . HIS B 1 432 ? -4.801  3.194   -27.516 1.00 59.52  ? 432  HIS B C   1 
ATOM   7480 O O   . HIS B 1 432 ? -4.203  3.147   -28.590 1.00 58.92  ? 432  HIS B O   1 
ATOM   7481 C CB  . HIS B 1 432 ? -6.225  5.242   -27.698 1.00 60.07  ? 432  HIS B CB  1 
ATOM   7482 C CG  . HIS B 1 432 ? -7.398  4.365   -27.990 1.00 61.90  ? 432  HIS B CG  1 
ATOM   7483 N ND1 . HIS B 1 432 ? -8.221  3.879   -27.000 1.00 62.60  ? 432  HIS B ND1 1 
ATOM   7484 C CD2 . HIS B 1 432 ? -7.854  3.842   -29.151 1.00 62.61  ? 432  HIS B CD2 1 
ATOM   7485 C CE1 . HIS B 1 432 ? -9.157  3.121   -27.544 1.00 65.34  ? 432  HIS B CE1 1 
ATOM   7486 N NE2 . HIS B 1 432 ? -8.956  3.081   -28.849 1.00 64.16  ? 432  HIS B NE2 1 
ATOM   7487 N N   . ARG B 1 433 ? -5.213  2.112   -26.858 1.00 60.72  ? 433  ARG B N   1 
ATOM   7488 C CA  . ARG B 1 433 ? -5.062  0.759   -27.379 1.00 60.87  ? 433  ARG B CA  1 
ATOM   7489 C C   . ARG B 1 433 ? -6.327  0.371   -28.133 1.00 62.28  ? 433  ARG B C   1 
ATOM   7490 O O   . ARG B 1 433 ? -7.428  0.382   -27.567 1.00 63.90  ? 433  ARG B O   1 
ATOM   7491 C CB  . ARG B 1 433 ? -4.842  -0.202  -26.223 1.00 61.86  ? 433  ARG B CB  1 
ATOM   7492 C CG  . ARG B 1 433 ? -4.581  -1.627  -26.622 1.00 62.36  ? 433  ARG B CG  1 
ATOM   7493 C CD  . ARG B 1 433 ? -4.473  -2.500  -25.391 1.00 63.48  ? 433  ARG B CD  1 
ATOM   7494 N NE  . ARG B 1 433 ? -4.787  -3.896  -25.670 1.00 65.55  ? 433  ARG B NE  1 
ATOM   7495 C CZ  . ARG B 1 433 ? -3.898  -4.849  -25.940 1.00 65.43  ? 433  ARG B CZ  1 
ATOM   7496 N NH1 . ARG B 1 433 ? -2.593  -4.601  -25.962 1.00 62.73  ? 433  ARG B NH1 1 
ATOM   7497 N NH2 . ARG B 1 433 ? -4.330  -6.080  -26.176 1.00 66.85  ? 433  ARG B NH2 1 
ATOM   7498 N N   . ALA B 1 434 ? -6.175  0.023   -29.409 1.00 61.87  ? 434  ALA B N   1 
ATOM   7499 C CA  . ALA B 1 434 ? -7.313  -0.349  -30.243 1.00 62.63  ? 434  ALA B CA  1 
ATOM   7500 C C   . ALA B 1 434 ? -8.084  -1.470  -29.586 1.00 64.35  ? 434  ALA B C   1 
ATOM   7501 O O   . ALA B 1 434 ? -7.486  -2.419  -29.104 1.00 64.98  ? 434  ALA B O   1 
ATOM   7502 C CB  . ALA B 1 434 ? -6.834  -0.791  -31.606 1.00 61.74  ? 434  ALA B CB  1 
ATOM   7503 N N   . SER B 1 435 ? -9.410  -1.360  -29.569 1.00 65.67  ? 435  SER B N   1 
ATOM   7504 C CA  . SER B 1 435 ? -10.267 -2.418  -29.050 1.00 67.43  ? 435  SER B CA  1 
ATOM   7505 C C   . SER B 1 435 ? -10.116 -3.738  -29.814 1.00 67.95  ? 435  SER B C   1 
ATOM   7506 O O   . SER B 1 435 ? -10.346 -4.812  -29.270 1.00 69.69  ? 435  SER B O   1 
ATOM   7507 C CB  . SER B 1 435 ? -11.734 -1.970  -29.087 1.00 69.04  ? 435  SER B CB  1 
ATOM   7508 O OG  . SER B 1 435 ? -12.162 -1.690  -30.405 1.00 68.58  ? 435  SER B OG  1 
ATOM   7509 N N   . THR B 1 436 ? -9.733  -3.633  -31.079 1.00 67.10  ? 436  THR B N   1 
ATOM   7510 C CA  . THR B 1 436 ? -9.592  -4.761  -31.991 1.00 67.37  ? 436  THR B CA  1 
ATOM   7511 C C   . THR B 1 436 ? -8.234  -5.493  -31.912 1.00 66.46  ? 436  THR B C   1 
ATOM   7512 O O   . THR B 1 436 ? -8.055  -6.525  -32.545 1.00 66.75  ? 436  THR B O   1 
ATOM   7513 C CB  . THR B 1 436 ? -9.783  -4.246  -33.433 1.00 66.90  ? 436  THR B CB  1 
ATOM   7514 O OG1 . THR B 1 436 ? -8.870  -3.153  -33.671 1.00 67.09  ? 436  THR B OG1 1 
ATOM   7515 C CG2 . THR B 1 436 ? -11.208 -3.754  -33.626 1.00 67.70  ? 436  THR B CG2 1 
ATOM   7516 N N   . LEU B 1 437 ? -7.286  -4.967  -31.133 1.00 65.32  ? 437  LEU B N   1 
ATOM   7517 C CA  . LEU B 1 437 ? -5.917  -5.505  -31.085 1.00 64.35  ? 437  LEU B CA  1 
ATOM   7518 C C   . LEU B 1 437 ? -5.862  -6.989  -30.681 1.00 65.77  ? 437  LEU B C   1 
ATOM   7519 O O   . LEU B 1 437 ? -6.590  -7.425  -29.789 1.00 66.53  ? 437  LEU B O   1 
ATOM   7520 C CB  . LEU B 1 437 ? -5.064  -4.639  -30.138 1.00 63.49  ? 437  LEU B CB  1 
ATOM   7521 C CG  . LEU B 1 437 ? -3.574  -4.452  -30.406 1.00 61.93  ? 437  LEU B CG  1 
ATOM   7522 C CD1 . LEU B 1 437 ? -3.251  -4.520  -31.867 1.00 62.03  ? 437  LEU B CD1 1 
ATOM   7523 C CD2 . LEU B 1 437 ? -3.113  -3.129  -29.856 1.00 61.13  ? 437  LEU B CD2 1 
ATOM   7524 N N   . THR B 1 438 ? -5.012  -7.758  -31.368 1.00 65.61  ? 438  THR B N   1 
ATOM   7525 C CA  . THR B 1 438 ? -4.901  -9.226  -31.172 1.00 67.24  ? 438  THR B CA  1 
ATOM   7526 C C   . THR B 1 438 ? -3.632  -9.646  -30.412 1.00 66.83  ? 438  THR B C   1 
ATOM   7527 O O   . THR B 1 438 ? -3.450  -10.820 -30.061 1.00 67.60  ? 438  THR B O   1 
ATOM   7528 C CB  . THR B 1 438 ? -4.882  -9.973  -32.523 1.00 67.62  ? 438  THR B CB  1 
ATOM   7529 O OG1 . THR B 1 438 ? -3.823  -9.444  -33.331 1.00 65.40  ? 438  THR B OG1 1 
ATOM   7530 C CG2 . THR B 1 438 ? -6.214  -9.833  -33.244 1.00 68.55  ? 438  THR B CG2 1 
ATOM   7531 N N   . TRP B 1 439 ? -2.739  -8.687  -30.205 1.00 64.94  ? 439  TRP B N   1 
ATOM   7532 C CA  . TRP B 1 439 ? -1.613  -8.856  -29.301 1.00 64.72  ? 439  TRP B CA  1 
ATOM   7533 C C   . TRP B 1 439 ? -2.122  -8.797  -27.871 1.00 65.24  ? 439  TRP B C   1 
ATOM   7534 O O   . TRP B 1 439 ? -3.134  -8.151  -27.625 1.00 65.52  ? 439  TRP B O   1 
ATOM   7535 C CB  . TRP B 1 439 ? -0.620  -7.724  -29.512 1.00 62.71  ? 439  TRP B CB  1 
ATOM   7536 C CG  . TRP B 1 439 ? 0.062   -7.736  -30.820 1.00 62.00  ? 439  TRP B CG  1 
ATOM   7537 C CD1 . TRP B 1 439 ? -0.171  -6.901  -31.871 1.00 61.19  ? 439  TRP B CD1 1 
ATOM   7538 C CD2 . TRP B 1 439 ? 1.130   -8.604  -31.222 1.00 62.44  ? 439  TRP B CD2 1 
ATOM   7539 N NE1 . TRP B 1 439 ? 0.684   -7.195  -32.900 1.00 61.13  ? 439  TRP B NE1 1 
ATOM   7540 C CE2 . TRP B 1 439 ? 1.494   -8.235  -32.528 1.00 62.06  ? 439  TRP B CE2 1 
ATOM   7541 C CE3 . TRP B 1 439 ? 1.822   -9.642  -30.598 1.00 63.00  ? 439  TRP B CE3 1 
ATOM   7542 C CZ2 . TRP B 1 439 ? 2.512   -8.879  -33.230 1.00 61.92  ? 439  TRP B CZ2 1 
ATOM   7543 C CZ3 . TRP B 1 439 ? 2.839   -10.270 -31.286 1.00 63.11  ? 439  TRP B CZ3 1 
ATOM   7544 C CH2 . TRP B 1 439 ? 3.172   -9.893  -32.589 1.00 62.43  ? 439  TRP B CH2 1 
ATOM   7545 N N   . PRO B 1 440 ? -1.407  -9.429  -26.917 1.00 65.44  ? 440  PRO B N   1 
ATOM   7546 C CA  . PRO B 1 440 ? -1.876  -9.513  -25.532 1.00 66.30  ? 440  PRO B CA  1 
ATOM   7547 C C   . PRO B 1 440 ? -1.859  -8.173  -24.806 1.00 64.96  ? 440  PRO B C   1 
ATOM   7548 O O   . PRO B 1 440 ? -1.200  -7.243  -25.251 1.00 63.04  ? 440  PRO B O   1 
ATOM   7549 C CB  . PRO B 1 440 ? -0.871  -10.463 -24.885 1.00 67.08  ? 440  PRO B CB  1 
ATOM   7550 C CG  . PRO B 1 440 ? 0.345   -10.276 -25.644 1.00 65.40  ? 440  PRO B CG  1 
ATOM   7551 C CD  . PRO B 1 440 ? -0.092  -10.069 -27.064 1.00 65.37  ? 440  PRO B CD  1 
ATOM   7552 N N   . LEU B 1 441 ? -2.591  -8.089  -23.703 1.00 65.59  ? 441  LEU B N   1 
ATOM   7553 C CA  . LEU B 1 441 ? -2.736  -6.840  -22.974 1.00 65.02  ? 441  LEU B CA  1 
ATOM   7554 C C   . LEU B 1 441 ? -1.401  -6.299  -22.479 1.00 63.64  ? 441  LEU B C   1 
ATOM   7555 O O   . LEU B 1 441 ? -1.234  -5.074  -22.365 1.00 61.88  ? 441  LEU B O   1 
ATOM   7556 C CB  . LEU B 1 441 ? -3.684  -7.001  -21.783 1.00 66.89  ? 441  LEU B CB  1 
ATOM   7557 C CG  . LEU B 1 441 ? -5.157  -7.259  -22.149 1.00 69.83  ? 441  LEU B CG  1 
ATOM   7558 C CD1 . LEU B 1 441 ? -5.888  -7.943  -21.010 1.00 73.19  ? 441  LEU B CD1 1 
ATOM   7559 C CD2 . LEU B 1 441 ? -5.861  -5.950  -22.547 1.00 70.34  ? 441  LEU B CD2 1 
ATOM   7560 N N   . TRP B 1 442 ? -0.459  -7.193  -22.174 1.00 63.89  ? 442  TRP B N   1 
ATOM   7561 C CA  . TRP B 1 442 ? 0.796   -6.753  -21.569 1.00 63.40  ? 442  TRP B CA  1 
ATOM   7562 C C   . TRP B 1 442 ? 1.619   -5.853  -22.492 1.00 61.35  ? 442  TRP B C   1 
ATOM   7563 O O   . TRP B 1 442 ? 2.389   -5.034  -22.007 1.00 60.34  ? 442  TRP B O   1 
ATOM   7564 C CB  . TRP B 1 442 ? 1.634   -7.919  -21.023 1.00 64.43  ? 442  TRP B CB  1 
ATOM   7565 C CG  . TRP B 1 442 ? 2.306   -8.790  -22.015 1.00 64.35  ? 442  TRP B CG  1 
ATOM   7566 C CD1 . TRP B 1 442 ? 1.911   -10.039 -22.393 1.00 65.98  ? 442  TRP B CD1 1 
ATOM   7567 C CD2 . TRP B 1 442 ? 3.533   -8.527  -22.714 1.00 62.80  ? 442  TRP B CD2 1 
ATOM   7568 N NE1 . TRP B 1 442 ? 2.798   -10.562 -23.306 1.00 65.40  ? 442  TRP B NE1 1 
ATOM   7569 C CE2 . TRP B 1 442 ? 3.803   -9.655  -23.520 1.00 64.47  ? 442  TRP B CE2 1 
ATOM   7570 C CE3 . TRP B 1 442 ? 4.418   -7.436  -22.758 1.00 62.47  ? 442  TRP B CE3 1 
ATOM   7571 C CZ2 . TRP B 1 442 ? 4.925   -9.732  -24.359 1.00 63.40  ? 442  TRP B CZ2 1 
ATOM   7572 C CZ3 . TRP B 1 442 ? 5.536   -7.510  -23.590 1.00 61.28  ? 442  TRP B CZ3 1 
ATOM   7573 C CH2 . TRP B 1 442 ? 5.777   -8.653  -24.382 1.00 62.29  ? 442  TRP B CH2 1 
ATOM   7574 N N   . MET B 1 443 ? 1.446   -5.997  -23.805 1.00 60.82  ? 443  MET B N   1 
ATOM   7575 C CA  . MET B 1 443 ? 2.200   -5.198  -24.765 1.00 59.21  ? 443  MET B CA  1 
ATOM   7576 C C   . MET B 1 443 ? 1.695   -3.761  -24.847 1.00 57.49  ? 443  MET B C   1 
ATOM   7577 O O   . MET B 1 443 ? 2.366   -2.900  -25.432 1.00 55.51  ? 443  MET B O   1 
ATOM   7578 C CB  . MET B 1 443 ? 2.142   -5.827  -26.147 1.00 59.24  ? 443  MET B CB  1 
ATOM   7579 C CG  . MET B 1 443 ? 2.796   -7.202  -26.244 1.00 61.22  ? 443  MET B CG  1 
ATOM   7580 S SD  . MET B 1 443 ? 3.035   -7.701  -27.960 1.00 61.82  ? 443  MET B SD  1 
ATOM   7581 C CE  . MET B 1 443 ? 4.124   -9.122  -27.776 1.00 62.09  ? 443  MET B CE  1 
ATOM   7582 N N   . GLY B 1 444 ? 0.509   -3.515  -24.292 1.00 57.63  ? 444  GLY B N   1 
ATOM   7583 C CA  . GLY B 1 444 ? -0.018  -2.162  -24.157 1.00 57.07  ? 444  GLY B CA  1 
ATOM   7584 C C   . GLY B 1 444 ? -0.476  -1.548  -25.476 1.00 55.99  ? 444  GLY B C   1 
ATOM   7585 O O   . GLY B 1 444 ? -1.316  -2.115  -26.176 1.00 56.27  ? 444  GLY B O   1 
ATOM   7586 N N   . VAL B 1 445 ? 0.046   -0.360  -25.785 1.00 54.14  ? 445  VAL B N   1 
ATOM   7587 C CA  . VAL B 1 445 ? -0.194  0.294   -27.070 1.00 52.97  ? 445  VAL B CA  1 
ATOM   7588 C C   . VAL B 1 445 ? 1.074   0.129   -27.899 1.00 52.28  ? 445  VAL B C   1 
ATOM   7589 O O   . VAL B 1 445 ? 1.988   0.928   -27.767 1.00 51.01  ? 445  VAL B O   1 
ATOM   7590 C CB  . VAL B 1 445 ? -0.501  1.795   -26.896 1.00 51.94  ? 445  VAL B CB  1 
ATOM   7591 C CG1 . VAL B 1 445 ? -0.952  2.393   -28.224 1.00 50.85  ? 445  VAL B CG1 1 
ATOM   7592 C CG2 . VAL B 1 445 ? -1.546  2.005   -25.818 1.00 51.64  ? 445  VAL B CG2 1 
ATOM   7593 N N   . PRO B 1 446 ? 1.158   -0.941  -28.726 1.00 52.90  ? 446  PRO B N   1 
ATOM   7594 C CA  . PRO B 1 446 ? 2.433   -1.256  -29.355 1.00 52.46  ? 446  PRO B CA  1 
ATOM   7595 C C   . PRO B 1 446 ? 2.769   -0.374  -30.538 1.00 52.11  ? 446  PRO B C   1 
ATOM   7596 O O   . PRO B 1 446 ? 1.901   0.277   -31.098 1.00 51.42  ? 446  PRO B O   1 
ATOM   7597 C CB  . PRO B 1 446 ? 2.263   -2.709  -29.818 1.00 53.61  ? 446  PRO B CB  1 
ATOM   7598 C CG  . PRO B 1 446 ? 0.979   -3.168  -29.271 1.00 54.56  ? 446  PRO B CG  1 
ATOM   7599 C CD  . PRO B 1 446 ? 0.144   -1.936  -29.096 1.00 54.10  ? 446  PRO B CD  1 
ATOM   7600 N N   . HIS B 1 447 ? 4.055   -0.371  -30.872 1.00 52.20  ? 447  HIS B N   1 
ATOM   7601 C CA  . HIS B 1 447 ? 4.610   0.265   -32.051 1.00 52.49  ? 447  HIS B CA  1 
ATOM   7602 C C   . HIS B 1 447 ? 3.799   -0.046  -33.327 1.00 52.98  ? 447  HIS B C   1 
ATOM   7603 O O   . HIS B 1 447 ? 3.660   -1.205  -33.725 1.00 54.57  ? 447  HIS B O   1 
ATOM   7604 C CB  . HIS B 1 447 ? 6.047   -0.251  -32.177 1.00 52.93  ? 447  HIS B CB  1 
ATOM   7605 C CG  . HIS B 1 447 ? 6.870   0.415   -33.232 1.00 53.65  ? 447  HIS B CG  1 
ATOM   7606 N ND1 . HIS B 1 447 ? 7.474   1.639   -33.046 1.00 54.36  ? 447  HIS B ND1 1 
ATOM   7607 C CD2 . HIS B 1 447 ? 7.254   -0.010  -34.462 1.00 55.55  ? 447  HIS B CD2 1 
ATOM   7608 C CE1 . HIS B 1 447 ? 8.158   1.961   -34.130 1.00 53.25  ? 447  HIS B CE1 1 
ATOM   7609 N NE2 . HIS B 1 447 ? 8.050   0.973   -35.000 1.00 54.09  ? 447  HIS B NE2 1 
ATOM   7610 N N   . GLY B 1 448 ? 3.282   0.996   -33.972 1.00 52.38  ? 448  GLY B N   1 
ATOM   7611 C CA  . GLY B 1 448 ? 2.520   0.854   -35.203 1.00 52.16  ? 448  GLY B CA  1 
ATOM   7612 C C   . GLY B 1 448 ? 1.022   1.044   -35.051 1.00 52.53  ? 448  GLY B C   1 
ATOM   7613 O O   . GLY B 1 448 ? 0.337   1.311   -36.034 1.00 52.90  ? 448  GLY B O   1 
ATOM   7614 N N   . TYR B 1 449 ? 0.496   0.951   -33.834 1.00 52.66  ? 449  TYR B N   1 
ATOM   7615 C CA  . TYR B 1 449 ? -0.962  0.843   -33.664 1.00 53.69  ? 449  TYR B CA  1 
ATOM   7616 C C   . TYR B 1 449 ? -1.727  2.157   -33.491 1.00 53.60  ? 449  TYR B C   1 
ATOM   7617 O O   . TYR B 1 449 ? -2.914  2.156   -33.175 1.00 54.60  ? 449  TYR B O   1 
ATOM   7618 C CB  . TYR B 1 449 ? -1.294  -0.210  -32.599 1.00 54.55  ? 449  TYR B CB  1 
ATOM   7619 C CG  . TYR B 1 449 ? -1.015  -1.576  -33.163 1.00 54.16  ? 449  TYR B CG  1 
ATOM   7620 C CD1 . TYR B 1 449 ? 0.229   -2.154  -33.039 1.00 54.03  ? 449  TYR B CD1 1 
ATOM   7621 C CD2 . TYR B 1 449 ? -1.981  -2.248  -33.893 1.00 55.44  ? 449  TYR B CD2 1 
ATOM   7622 C CE1 . TYR B 1 449 ? 0.495   -3.393  -33.586 1.00 54.38  ? 449  TYR B CE1 1 
ATOM   7623 C CE2 . TYR B 1 449 ? -1.728  -3.472  -34.448 1.00 54.96  ? 449  TYR B CE2 1 
ATOM   7624 C CZ  . TYR B 1 449 ? -0.490  -4.042  -34.295 1.00 55.70  ? 449  TYR B CZ  1 
ATOM   7625 O OH  . TYR B 1 449 ? -0.241  -5.269  -34.859 1.00 56.70  ? 449  TYR B OH  1 
ATOM   7626 N N   . GLU B 1 450 ? -1.059  3.260   -33.793 1.00 52.53  ? 450  GLU B N   1 
ATOM   7627 C CA  . GLU B 1 450 ? -1.719  4.559   -33.985 1.00 52.59  ? 450  GLU B CA  1 
ATOM   7628 C C   . GLU B 1 450 ? -2.139  4.824   -35.444 1.00 52.51  ? 450  GLU B C   1 
ATOM   7629 O O   . GLU B 1 450 ? -3.023  5.641   -35.706 1.00 53.23  ? 450  GLU B O   1 
ATOM   7630 C CB  . GLU B 1 450 ? -0.772  5.674   -33.530 1.00 51.85  ? 450  GLU B CB  1 
ATOM   7631 C CG  . GLU B 1 450 ? 0.252   6.179   -34.565 1.00 50.32  ? 450  GLU B CG  1 
ATOM   7632 C CD  . GLU B 1 450 ? 1.469   5.287   -34.768 1.00 51.41  ? 450  GLU B CD  1 
ATOM   7633 O OE1 . GLU B 1 450 ? 1.403   4.058   -34.490 1.00 48.88  ? 450  GLU B OE1 1 
ATOM   7634 O OE2 . GLU B 1 450 ? 2.496   5.837   -35.246 1.00 48.23  ? 450  GLU B OE2 1 
ATOM   7635 N N   . ILE B 1 451 ? -1.486  4.141   -36.382 1.00 51.98  ? 451  ILE B N   1 
ATOM   7636 C CA  . ILE B 1 451 ? -1.585  4.459   -37.804 1.00 51.80  ? 451  ILE B CA  1 
ATOM   7637 C C   . ILE B 1 451 ? -2.995  4.299   -38.309 1.00 52.70  ? 451  ILE B C   1 
ATOM   7638 O O   . ILE B 1 451 ? -3.489  5.155   -39.022 1.00 53.06  ? 451  ILE B O   1 
ATOM   7639 C CB  . ILE B 1 451 ? -0.687  3.557   -38.671 1.00 51.73  ? 451  ILE B CB  1 
ATOM   7640 C CG1 . ILE B 1 451 ? 0.790   3.727   -38.290 1.00 50.49  ? 451  ILE B CG1 1 
ATOM   7641 C CG2 . ILE B 1 451 ? -0.877  3.900   -40.158 1.00 51.04  ? 451  ILE B CG2 1 
ATOM   7642 C CD1 . ILE B 1 451 ? 1.689   2.673   -38.877 1.00 50.66  ? 451  ILE B CD1 1 
ATOM   7643 N N   . GLU B 1 452 ? -3.629  3.194   -37.948 1.00 53.25  ? 452  GLU B N   1 
ATOM   7644 C CA  . GLU B 1 452 ? -5.022  2.939   -38.313 1.00 54.72  ? 452  GLU B CA  1 
ATOM   7645 C C   . GLU B 1 452 ? -6.016  4.032   -37.899 1.00 54.67  ? 452  GLU B C   1 
ATOM   7646 O O   . GLU B 1 452 ? -7.027  4.212   -38.563 1.00 56.14  ? 452  GLU B O   1 
ATOM   7647 C CB  . GLU B 1 452 ? -5.476  1.598   -37.738 1.00 55.77  ? 452  GLU B CB  1 
ATOM   7648 C CG  . GLU B 1 452 ? -5.299  1.432   -36.217 1.00 57.03  ? 452  GLU B CG  1 
ATOM   7649 C CD  . GLU B 1 452 ? -5.218  -0.038  -35.828 1.00 58.84  ? 452  GLU B CD  1 
ATOM   7650 O OE1 . GLU B 1 452 ? -6.274  -0.610  -35.505 1.00 60.90  ? 452  GLU B OE1 1 
ATOM   7651 O OE2 . GLU B 1 452 ? -4.109  -0.621  -35.890 1.00 61.60  ? 452  GLU B OE2 1 
ATOM   7652 N N   . PHE B 1 453 ? -5.730  4.744   -36.809 1.00 53.98  ? 453  PHE B N   1 
ATOM   7653 C CA  . PHE B 1 453 ? -6.574  5.841   -36.350 1.00 54.11  ? 453  PHE B CA  1 
ATOM   7654 C C   . PHE B 1 453 ? -6.355  7.106   -37.168 1.00 53.61  ? 453  PHE B C   1 
ATOM   7655 O O   . PHE B 1 453 ? -7.315  7.768   -37.546 1.00 54.83  ? 453  PHE B O   1 
ATOM   7656 C CB  . PHE B 1 453 ? -6.363  6.084   -34.845 1.00 54.03  ? 453  PHE B CB  1 
ATOM   7657 C CG  . PHE B 1 453 ? -6.853  4.947   -33.997 1.00 54.61  ? 453  PHE B CG  1 
ATOM   7658 C CD1 . PHE B 1 453 ? -8.172  4.861   -33.644 1.00 56.38  ? 453  PHE B CD1 1 
ATOM   7659 C CD2 . PHE B 1 453 ? -5.992  3.934   -33.604 1.00 54.23  ? 453  PHE B CD2 1 
ATOM   7660 C CE1 . PHE B 1 453 ? -8.633  3.787   -32.888 1.00 57.96  ? 453  PHE B CE1 1 
ATOM   7661 C CE2 . PHE B 1 453 ? -6.434  2.876   -32.854 1.00 55.47  ? 453  PHE B CE2 1 
ATOM   7662 C CZ  . PHE B 1 453 ? -7.758  2.797   -32.500 1.00 56.60  ? 453  PHE B CZ  1 
ATOM   7663 N N   . ILE B 1 454 ? -5.098  7.423   -37.450 1.00 52.40  ? 454  ILE B N   1 
ATOM   7664 C CA  . ILE B 1 454 ? -4.721  8.590   -38.262 1.00 52.14  ? 454  ILE B CA  1 
ATOM   7665 C C   . ILE B 1 454 ? -5.251  8.435   -39.678 1.00 52.68  ? 454  ILE B C   1 
ATOM   7666 O O   . ILE B 1 454 ? -5.662  9.424   -40.301 1.00 52.78  ? 454  ILE B O   1 
ATOM   7667 C CB  . ILE B 1 454 ? -3.165  8.758   -38.356 1.00 51.10  ? 454  ILE B CB  1 
ATOM   7668 C CG1 . ILE B 1 454 ? -2.529  8.881   -36.975 1.00 51.10  ? 454  ILE B CG1 1 
ATOM   7669 C CG2 . ILE B 1 454 ? -2.774  9.980   -39.196 1.00 50.65  ? 454  ILE B CG2 1 
ATOM   7670 C CD1 . ILE B 1 454 ? -3.048  10.005  -36.194 1.00 53.85  ? 454  ILE B CD1 1 
ATOM   7671 N N   . PHE B 1 455 ? -5.227  7.199   -40.195 1.00 52.33  ? 455  PHE B N   1 
ATOM   7672 C CA  . PHE B 1 455 ? -5.780  6.926   -41.527 1.00 53.05  ? 455  PHE B CA  1 
ATOM   7673 C C   . PHE B 1 455 ? -7.305  6.834   -41.539 1.00 53.97  ? 455  PHE B C   1 
ATOM   7674 O O   . PHE B 1 455 ? -7.906  6.872   -42.601 1.00 54.36  ? 455  PHE B O   1 
ATOM   7675 C CB  . PHE B 1 455 ? -5.130  5.685   -42.180 1.00 52.67  ? 455  PHE B CB  1 
ATOM   7676 C CG  . PHE B 1 455 ? -3.865  6.007   -42.931 1.00 51.96  ? 455  PHE B CG  1 
ATOM   7677 C CD1 . PHE B 1 455 ? -2.627  5.958   -42.302 1.00 52.03  ? 455  PHE B CD1 1 
ATOM   7678 C CD2 . PHE B 1 455 ? -3.911  6.410   -44.250 1.00 52.17  ? 455  PHE B CD2 1 
ATOM   7679 C CE1 . PHE B 1 455 ? -1.472  6.271   -42.994 1.00 51.23  ? 455  PHE B CE1 1 
ATOM   7680 C CE2 . PHE B 1 455 ? -2.748  6.725   -44.946 1.00 50.88  ? 455  PHE B CE2 1 
ATOM   7681 C CZ  . PHE B 1 455 ? -1.538  6.644   -44.327 1.00 50.43  ? 455  PHE B CZ  1 
ATOM   7682 N N   . GLY B 1 456 ? -7.920  6.713   -40.368 1.00 54.60  ? 456  GLY B N   1 
ATOM   7683 C CA  . GLY B 1 456 ? -9.376  6.788   -40.256 1.00 56.17  ? 456  GLY B CA  1 
ATOM   7684 C C   . GLY B 1 456 ? -10.118 5.484   -40.473 1.00 57.27  ? 456  GLY B C   1 
ATOM   7685 O O   . GLY B 1 456 ? -11.298 5.497   -40.801 1.00 58.46  ? 456  GLY B O   1 
ATOM   7686 N N   . LEU B 1 457 ? -9.442  4.358   -40.266 1.00 57.32  ? 457  LEU B N   1 
ATOM   7687 C CA  . LEU B 1 457 ? -10.068 3.040   -40.464 1.00 58.94  ? 457  LEU B CA  1 
ATOM   7688 C C   . LEU B 1 457 ? -11.298 2.779   -39.573 1.00 60.86  ? 457  LEU B C   1 
ATOM   7689 O O   . LEU B 1 457 ? -12.222 2.116   -40.003 1.00 63.07  ? 457  LEU B O   1 
ATOM   7690 C CB  . LEU B 1 457 ? -9.038  1.917   -40.308 1.00 57.87  ? 457  LEU B CB  1 
ATOM   7691 C CG  . LEU B 1 457 ? -8.266  1.557   -41.590 1.00 57.53  ? 457  LEU B CG  1 
ATOM   7692 C CD1 . LEU B 1 457 ? -7.294  2.660   -42.011 1.00 55.44  ? 457  LEU B CD1 1 
ATOM   7693 C CD2 . LEU B 1 457 ? -7.531  0.226   -41.416 1.00 56.43  ? 457  LEU B CD2 1 
ATOM   7694 N N   . PRO B 1 458 ? -11.305 3.272   -38.324 1.00 61.48  ? 458  PRO B N   1 
ATOM   7695 C CA  . PRO B 1 458 ? -12.516 3.188   -37.487 1.00 63.49  ? 458  PRO B CA  1 
ATOM   7696 C C   . PRO B 1 458 ? -13.796 3.759   -38.085 1.00 66.03  ? 458  PRO B C   1 
ATOM   7697 O O   . PRO B 1 458 ? -14.886 3.422   -37.609 1.00 68.27  ? 458  PRO B O   1 
ATOM   7698 C CB  . PRO B 1 458 ? -12.124 3.972   -36.232 1.00 63.22  ? 458  PRO B CB  1 
ATOM   7699 C CG  . PRO B 1 458 ? -10.616 3.826   -36.164 1.00 60.20  ? 458  PRO B CG  1 
ATOM   7700 C CD  . PRO B 1 458 ? -10.164 3.845   -37.579 1.00 59.91  ? 458  PRO B CD  1 
ATOM   7701 N N   . LEU B 1 459 ? -13.682 4.592   -39.117 1.00 66.48  ? 459  LEU B N   1 
ATOM   7702 C CA  . LEU B 1 459 ? -14.859 5.116   -39.826 1.00 69.03  ? 459  LEU B CA  1 
ATOM   7703 C C   . LEU B 1 459 ? -15.573 4.039   -40.689 1.00 70.68  ? 459  LEU B C   1 
ATOM   7704 O O   . LEU B 1 459 ? -16.741 4.188   -41.035 1.00 72.10  ? 459  LEU B O   1 
ATOM   7705 C CB  . LEU B 1 459 ? -14.474 6.344   -40.678 1.00 68.31  ? 459  LEU B CB  1 
ATOM   7706 C CG  . LEU B 1 459 ? -14.249 7.686   -39.967 1.00 67.21  ? 459  LEU B CG  1 
ATOM   7707 C CD1 . LEU B 1 459 ? -13.083 7.627   -39.013 1.00 66.37  ? 459  LEU B CD1 1 
ATOM   7708 C CD2 . LEU B 1 459 ? -14.014 8.775   -40.989 1.00 67.10  ? 459  LEU B CD2 1 
ATOM   7709 N N   . ASP B 1 460 ? -14.857 2.968   -41.031 1.00 70.90  ? 460  ASP B N   1 
ATOM   7710 C CA  . ASP B 1 460 ? -15.447 1.811   -41.724 1.00 72.18  ? 460  ASP B CA  1 
ATOM   7711 C C   . ASP B 1 460 ? -16.167 0.948   -40.693 1.00 74.22  ? 460  ASP B C   1 
ATOM   7712 O O   . ASP B 1 460 ? -15.527 0.270   -39.893 1.00 73.22  ? 460  ASP B O   1 
ATOM   7713 C CB  . ASP B 1 460 ? -14.348 0.999   -42.421 1.00 71.17  ? 460  ASP B CB  1 
ATOM   7714 C CG  . ASP B 1 460 ? -14.891 -0.156  -43.266 1.00 72.89  ? 460  ASP B CG  1 
ATOM   7715 O OD1 . ASP B 1 460 ? -16.098 -0.509  -43.166 1.00 76.14  ? 460  ASP B OD1 1 
ATOM   7716 O OD2 . ASP B 1 460 ? -14.083 -0.720  -44.038 1.00 73.42  ? 460  ASP B OD2 1 
ATOM   7717 N N   . PRO B 1 461 ? -17.508 0.945   -40.725 1.00 77.16  ? 461  PRO B N   1 
ATOM   7718 C CA  . PRO B 1 461 ? -18.243 0.294   -39.643 1.00 79.22  ? 461  PRO B CA  1 
ATOM   7719 C C   . PRO B 1 461 ? -18.104 -1.238  -39.648 1.00 80.03  ? 461  PRO B C   1 
ATOM   7720 O O   . PRO B 1 461 ? -18.275 -1.866  -38.601 1.00 81.48  ? 461  PRO B O   1 
ATOM   7721 C CB  . PRO B 1 461 ? -19.694 0.732   -39.892 1.00 81.41  ? 461  PRO B CB  1 
ATOM   7722 C CG  . PRO B 1 461 ? -19.764 0.965   -41.362 1.00 81.38  ? 461  PRO B CG  1 
ATOM   7723 C CD  . PRO B 1 461 ? -18.409 1.481   -41.764 1.00 78.51  ? 461  PRO B CD  1 
ATOM   7724 N N   . SER B 1 462 ? -17.767 -1.821  -40.799 1.00 79.61  ? 462  SER B N   1 
ATOM   7725 C CA  . SER B 1 462 ? -17.501 -3.259  -40.894 1.00 80.04  ? 462  SER B CA  1 
ATOM   7726 C C   . SER B 1 462 ? -16.255 -3.725  -40.131 1.00 78.73  ? 462  SER B C   1 
ATOM   7727 O O   . SER B 1 462 ? -16.019 -4.931  -40.035 1.00 79.93  ? 462  SER B O   1 
ATOM   7728 C CB  . SER B 1 462 ? -17.335 -3.673  -42.356 1.00 79.89  ? 462  SER B CB  1 
ATOM   7729 O OG  . SER B 1 462 ? -16.015 -3.446  -42.817 1.00 77.33  ? 462  SER B OG  1 
ATOM   7730 N N   . LEU B 1 463 ? -15.451 -2.794  -39.614 1.00 76.58  ? 463  LEU B N   1 
ATOM   7731 C CA  . LEU B 1 463 ? -14.196 -3.151  -38.956 1.00 75.13  ? 463  LEU B CA  1 
ATOM   7732 C C   . LEU B 1 463 ? -14.324 -3.324  -37.436 1.00 75.66  ? 463  LEU B C   1 
ATOM   7733 O O   . LEU B 1 463 ? -13.336 -3.656  -36.766 1.00 75.29  ? 463  LEU B O   1 
ATOM   7734 C CB  . LEU B 1 463 ? -13.103 -2.124  -39.292 1.00 72.80  ? 463  LEU B CB  1 
ATOM   7735 C CG  . LEU B 1 463 ? -12.628 -2.058  -40.749 1.00 71.93  ? 463  LEU B CG  1 
ATOM   7736 C CD1 . LEU B 1 463 ? -11.556 -1.010  -40.913 1.00 69.90  ? 463  LEU B CD1 1 
ATOM   7737 C CD2 . LEU B 1 463 ? -12.107 -3.408  -41.213 1.00 72.28  ? 463  LEU B CD2 1 
ATOM   7738 N N   . ASN B 1 464 ? -15.521 -3.091  -36.900 1.00 76.91  ? 464  ASN B N   1 
ATOM   7739 C CA  . ASN B 1 464 ? -15.841 -3.401  -35.496 1.00 77.80  ? 464  ASN B CA  1 
ATOM   7740 C C   . ASN B 1 464 ? -15.147 -2.541  -34.427 1.00 75.69  ? 464  ASN B C   1 
ATOM   7741 O O   . ASN B 1 464 ? -14.998 -2.961  -33.269 1.00 76.14  ? 464  ASN B O   1 
ATOM   7742 C CB  . ASN B 1 464 ? -15.612 -4.899  -35.211 1.00 79.05  ? 464  ASN B CB  1 
ATOM   7743 C CG  . ASN B 1 464 ? -16.484 -5.799  -36.084 1.00 81.75  ? 464  ASN B CG  1 
ATOM   7744 O OD1 . ASN B 1 464 ? -17.652 -5.485  -36.346 1.00 84.04  ? 464  ASN B OD1 1 
ATOM   7745 N ND2 . ASN B 1 464 ? -15.917 -6.920  -36.540 1.00 82.56  ? 464  ASN B ND2 1 
ATOM   7746 N N   . TYR B 1 465 ? -14.748 -1.329  -34.800 1.00 73.38  ? 465  TYR B N   1 
ATOM   7747 C CA  . TYR B 1 465 ? -14.251 -0.358  -33.813 1.00 71.42  ? 465  TYR B CA  1 
ATOM   7748 C C   . TYR B 1 465 ? -15.454 0.199   -33.083 1.00 72.85  ? 465  TYR B C   1 
ATOM   7749 O O   . TYR B 1 465 ? -16.573 0.142   -33.596 1.00 74.11  ? 465  TYR B O   1 
ATOM   7750 C CB  . TYR B 1 465 ? -13.484 0.794   -34.476 1.00 69.17  ? 465  TYR B CB  1 
ATOM   7751 C CG  . TYR B 1 465 ? -12.155 0.414   -35.085 1.00 66.43  ? 465  TYR B CG  1 
ATOM   7752 C CD1 . TYR B 1 465 ? -10.989 0.459   -34.338 1.00 64.43  ? 465  TYR B CD1 1 
ATOM   7753 C CD2 . TYR B 1 465 ? -12.069 0.024   -36.409 1.00 65.93  ? 465  TYR B CD2 1 
ATOM   7754 C CE1 . TYR B 1 465 ? -9.774  0.122   -34.893 1.00 63.09  ? 465  TYR B CE1 1 
ATOM   7755 C CE2 . TYR B 1 465 ? -10.865 -0.311  -36.981 1.00 65.00  ? 465  TYR B CE2 1 
ATOM   7756 C CZ  . TYR B 1 465 ? -9.716  -0.259  -36.223 1.00 63.56  ? 465  TYR B CZ  1 
ATOM   7757 O OH  . TYR B 1 465 ? -8.520  -0.600  -36.799 1.00 61.88  ? 465  TYR B OH  1 
ATOM   7758 N N   . THR B 1 466 ? -15.226 0.733   -31.889 1.00 72.40  ? 466  THR B N   1 
ATOM   7759 C CA  . THR B 1 466 ? -16.302 1.326   -31.114 1.00 73.85  ? 466  THR B CA  1 
ATOM   7760 C C   . THR B 1 466 ? -16.619 2.716   -31.642 1.00 74.05  ? 466  THR B C   1 
ATOM   7761 O O   . THR B 1 466 ? -15.900 3.261   -32.477 1.00 72.54  ? 466  THR B O   1 
ATOM   7762 C CB  . THR B 1 466 ? -15.959 1.426   -29.620 1.00 73.70  ? 466  THR B CB  1 
ATOM   7763 O OG1 . THR B 1 466 ? -14.981 2.445   -29.417 1.00 71.06  ? 466  THR B OG1 1 
ATOM   7764 C CG2 . THR B 1 466 ? -15.438 0.101   -29.097 1.00 73.37  ? 466  THR B CG2 1 
ATOM   7765 N N   . THR B 1 467 ? -17.719 3.272   -31.151 1.00 76.34  ? 467  THR B N   1 
ATOM   7766 C CA  . THR B 1 467 ? -18.153 4.614   -31.520 1.00 76.99  ? 467  THR B CA  1 
ATOM   7767 C C   . THR B 1 467 ? -17.163 5.675   -31.045 1.00 75.44  ? 467  THR B C   1 
ATOM   7768 O O   . THR B 1 467 ? -16.959 6.687   -31.718 1.00 75.10  ? 467  THR B O   1 
ATOM   7769 C CB  . THR B 1 467 ? -19.528 4.902   -30.923 1.00 79.41  ? 467  THR B CB  1 
ATOM   7770 O OG1 . THR B 1 467 ? -20.393 3.808   -31.233 1.00 81.38  ? 467  THR B OG1 1 
ATOM   7771 C CG2 . THR B 1 467 ? -20.118 6.194   -31.478 1.00 80.29  ? 467  THR B CG2 1 
ATOM   7772 N N   . GLU B 1 468 ? -16.549 5.431   -29.890 1.00 75.02  ? 468  GLU B N   1 
ATOM   7773 C CA  . GLU B 1 468 ? -15.576 6.356   -29.309 1.00 73.59  ? 468  GLU B CA  1 
ATOM   7774 C C   . GLU B 1 468 ? -14.321 6.412   -30.167 1.00 70.42  ? 468  GLU B C   1 
ATOM   7775 O O   . GLU B 1 468 ? -13.724 7.465   -30.333 1.00 69.37  ? 468  GLU B O   1 
ATOM   7776 C CB  . GLU B 1 468 ? -15.193 5.929   -27.882 1.00 74.35  ? 468  GLU B CB  1 
ATOM   7777 C CG  . GLU B 1 468 ? -16.313 6.025   -26.834 1.00 78.74  ? 468  GLU B CG  1 
ATOM   7778 C CD  . GLU B 1 468 ? -17.404 4.959   -27.003 1.00 84.04  ? 468  GLU B CD  1 
ATOM   7779 O OE1 . GLU B 1 468 ? -17.101 3.872   -27.560 1.00 86.07  ? 468  GLU B OE1 1 
ATOM   7780 O OE2 . GLU B 1 468 ? -18.567 5.211   -26.586 1.00 87.75  ? 468  GLU B OE2 1 
ATOM   7781 N N   . GLU B 1 469 ? -13.925 5.266   -30.704 1.00 69.00  ? 469  GLU B N   1 
ATOM   7782 C CA  . GLU B 1 469 ? -12.757 5.183   -31.573 1.00 66.66  ? 469  GLU B CA  1 
ATOM   7783 C C   . GLU B 1 469 ? -12.953 5.870   -32.925 1.00 66.10  ? 469  GLU B C   1 
ATOM   7784 O O   . GLU B 1 469 ? -12.000 6.392   -33.505 1.00 64.49  ? 469  GLU B O   1 
ATOM   7785 C CB  . GLU B 1 469 ? -12.374 3.726   -31.777 1.00 66.41  ? 469  GLU B CB  1 
ATOM   7786 C CG  . GLU B 1 469 ? -11.765 3.116   -30.542 1.00 66.10  ? 469  GLU B CG  1 
ATOM   7787 C CD  . GLU B 1 469 ? -11.591 1.616   -30.638 1.00 66.44  ? 469  GLU B CD  1 
ATOM   7788 O OE1 . GLU B 1 469 ? -12.463 0.939   -31.220 1.00 67.20  ? 469  GLU B OE1 1 
ATOM   7789 O OE2 . GLU B 1 469 ? -10.582 1.106   -30.113 1.00 67.00  ? 469  GLU B OE2 1 
ATOM   7790 N N   . ARG B 1 470 ? -14.181 5.856   -33.420 1.00 67.58  ? 470  ARG B N   1 
ATOM   7791 C CA  . ARG B 1 470 ? -14.522 6.542   -34.652 1.00 68.13  ? 470  ARG B CA  1 
ATOM   7792 C C   . ARG B 1 470 ? -14.416 8.042   -34.456 1.00 66.82  ? 470  ARG B C   1 
ATOM   7793 O O   . ARG B 1 470 ? -13.874 8.741   -35.300 1.00 65.79  ? 470  ARG B O   1 
ATOM   7794 C CB  . ARG B 1 470 ? -15.937 6.186   -35.101 1.00 69.89  ? 470  ARG B CB  1 
ATOM   7795 C CG  . ARG B 1 470 ? -16.160 6.474   -36.568 1.00 71.97  ? 470  ARG B CG  1 
ATOM   7796 C CD  . ARG B 1 470 ? -17.614 6.698   -36.948 1.00 75.57  ? 470  ARG B CD  1 
ATOM   7797 N NE  . ARG B 1 470 ? -18.131 7.935   -36.354 1.00 80.46  ? 470  ARG B NE  1 
ATOM   7798 C CZ  . ARG B 1 470 ? -19.176 8.027   -35.523 1.00 84.12  ? 470  ARG B CZ  1 
ATOM   7799 N NH1 . ARG B 1 470 ? -19.524 9.226   -35.045 1.00 84.70  ? 470  ARG B NH1 1 
ATOM   7800 N NH2 . ARG B 1 470 ? -19.894 6.949   -35.168 1.00 86.92  ? 470  ARG B NH2 1 
ATOM   7801 N N   . ILE B 1 471 ? -14.953 8.522   -33.337 1.00 67.28  ? 471  ILE B N   1 
ATOM   7802 C CA  . ILE B 1 471 ? -14.871 9.935   -32.943 1.00 66.75  ? 471  ILE B CA  1 
ATOM   7803 C C   . ILE B 1 471 ? -13.420 10.336  -32.708 1.00 64.38  ? 471  ILE B C   1 
ATOM   7804 O O   . ILE B 1 471 ? -13.009 11.423  -33.073 1.00 63.90  ? 471  ILE B O   1 
ATOM   7805 C CB  . ILE B 1 471 ? -15.707 10.215  -31.655 1.00 68.33  ? 471  ILE B CB  1 
ATOM   7806 C CG1 . ILE B 1 471 ? -17.207 10.022  -31.929 1.00 70.36  ? 471  ILE B CG1 1 
ATOM   7807 C CG2 . ILE B 1 471 ? -15.434 11.629  -31.116 1.00 68.14  ? 471  ILE B CG2 1 
ATOM   7808 C CD1 . ILE B 1 471 ? -18.026 9.703   -30.693 1.00 72.15  ? 471  ILE B CD1 1 
ATOM   7809 N N   . PHE B 1 472 ? -12.653 9.438   -32.107 1.00 63.14  ? 472  PHE B N   1 
ATOM   7810 C CA  . PHE B 1 472 ? -11.236 9.662   -31.842 1.00 61.37  ? 472  PHE B CA  1 
ATOM   7811 C C   . PHE B 1 472 ? -10.425 9.736   -33.149 1.00 60.17  ? 472  PHE B C   1 
ATOM   7812 O O   . PHE B 1 472 ? -9.652  10.670  -33.349 1.00 59.77  ? 472  PHE B O   1 
ATOM   7813 C CB  . PHE B 1 472 ? -10.729 8.536   -30.924 1.00 61.02  ? 472  PHE B CB  1 
ATOM   7814 C CG  . PHE B 1 472 ? -9.246  8.585   -30.616 1.00 58.96  ? 472  PHE B CG  1 
ATOM   7815 C CD1 . PHE B 1 472 ? -8.655  9.745   -30.145 1.00 57.76  ? 472  PHE B CD1 1 
ATOM   7816 C CD2 . PHE B 1 472 ? -8.463  7.443   -30.760 1.00 57.77  ? 472  PHE B CD2 1 
ATOM   7817 C CE1 . PHE B 1 472 ? -7.295  9.784   -29.849 1.00 56.22  ? 472  PHE B CE1 1 
ATOM   7818 C CE2 . PHE B 1 472 ? -7.111  7.461   -30.461 1.00 56.61  ? 472  PHE B CE2 1 
ATOM   7819 C CZ  . PHE B 1 472 ? -6.520  8.641   -30.000 1.00 56.71  ? 472  PHE B CZ  1 
ATOM   7820 N N   . ALA B 1 473 ? -10.589 8.740   -34.019 1.00 60.05  ? 473  ALA B N   1 
ATOM   7821 C CA  . ALA B 1 473 ? -10.009 8.762   -35.360 1.00 59.04  ? 473  ALA B CA  1 
ATOM   7822 C C   . ALA B 1 473 ? -10.341 10.060  -36.107 1.00 59.50  ? 473  ALA B C   1 
ATOM   7823 O O   . ALA B 1 473 ? -9.483  10.645  -36.757 1.00 58.19  ? 473  ALA B O   1 
ATOM   7824 C CB  . ALA B 1 473 ? -10.491 7.558   -36.160 1.00 59.52  ? 473  ALA B CB  1 
ATOM   7825 N N   . GLN B 1 474 ? -11.589 10.506  -36.024 1.00 61.31  ? 474  GLN B N   1 
ATOM   7826 C CA  . GLN B 1 474 ? -11.991 11.755  -36.667 1.00 62.52  ? 474  GLN B CA  1 
ATOM   7827 C C   . GLN B 1 474 ? -11.202 12.958  -36.117 1.00 61.93  ? 474  GLN B C   1 
ATOM   7828 O O   . GLN B 1 474 ? -10.896 13.895  -36.856 1.00 61.44  ? 474  GLN B O   1 
ATOM   7829 C CB  . GLN B 1 474 ? -13.513 11.981  -36.535 1.00 64.29  ? 474  GLN B CB  1 
ATOM   7830 C CG  . GLN B 1 474 ? -14.332 11.087  -37.461 1.00 65.93  ? 474  GLN B CG  1 
ATOM   7831 C CD  . GLN B 1 474 ? -15.851 11.261  -37.356 1.00 69.21  ? 474  GLN B CD  1 
ATOM   7832 O OE1 . GLN B 1 474 ? -16.393 11.679  -36.325 1.00 73.20  ? 474  GLN B OE1 1 
ATOM   7833 N NE2 . GLN B 1 474 ? -16.547 10.921  -38.439 1.00 73.11  ? 474  GLN B NE2 1 
ATOM   7834 N N   . ARG B 1 475 ? -10.883 12.928  -34.826 1.00 62.16  ? 475  ARG B N   1 
ATOM   7835 C CA  . ARG B 1 475 ? -10.094 13.989  -34.202 1.00 62.15  ? 475  ARG B CA  1 
ATOM   7836 C C   . ARG B 1 475 ? -8.670  13.962  -34.716 1.00 60.00  ? 475  ARG B C   1 
ATOM   7837 O O   . ARG B 1 475 ? -8.114  14.995  -35.032 1.00 60.12  ? 475  ARG B O   1 
ATOM   7838 C CB  . ARG B 1 475 ? -10.056 13.851  -32.678 1.00 62.51  ? 475  ARG B CB  1 
ATOM   7839 C CG  . ARG B 1 475 ? -11.238 14.452  -31.955 1.00 65.55  ? 475  ARG B CG  1 
ATOM   7840 C CD  . ARG B 1 475 ? -11.154 14.184  -30.439 1.00 65.29  ? 475  ARG B CD  1 
ATOM   7841 N NE  . ARG B 1 475 ? -9.862  14.617  -29.903 1.00 64.41  ? 475  ARG B NE  1 
ATOM   7842 C CZ  . ARG B 1 475 ? -9.155  13.981  -28.969 1.00 62.20  ? 475  ARG B CZ  1 
ATOM   7843 N NH1 . ARG B 1 475 ? -9.580  12.847  -28.416 1.00 59.34  ? 475  ARG B NH1 1 
ATOM   7844 N NH2 . ARG B 1 475 ? -7.987  14.492  -28.598 1.00 60.95  ? 475  ARG B NH2 1 
ATOM   7845 N N   . LEU B 1 476 ? -8.082  12.778  -34.784 1.00 59.13  ? 476  LEU B N   1 
ATOM   7846 C CA  . LEU B 1 476 ? -6.707  12.650  -35.236 1.00 57.74  ? 476  LEU B CA  1 
ATOM   7847 C C   . LEU B 1 476 ? -6.539  13.025  -36.709 1.00 57.51  ? 476  LEU B C   1 
ATOM   7848 O O   . LEU B 1 476 ? -5.590  13.725  -37.074 1.00 56.66  ? 476  LEU B O   1 
ATOM   7849 C CB  . LEU B 1 476 ? -6.195  11.237  -34.987 1.00 57.19  ? 476  LEU B CB  1 
ATOM   7850 C CG  . LEU B 1 476 ? -6.083  10.801  -33.527 1.00 57.21  ? 476  LEU B CG  1 
ATOM   7851 C CD1 . LEU B 1 476 ? -5.290  9.535   -33.460 1.00 58.04  ? 476  LEU B CD1 1 
ATOM   7852 C CD2 . LEU B 1 476 ? -5.427  11.847  -32.665 1.00 57.22  ? 476  LEU B CD2 1 
ATOM   7853 N N   . MET B 1 477 ? -7.461  12.567  -37.547 1.00 58.17  ? 477  MET B N   1 
ATOM   7854 C CA  . MET B 1 477 ? -7.497  12.971  -38.947 1.00 58.40  ? 477  MET B CA  1 
ATOM   7855 C C   . MET B 1 477 ? -7.518  14.497  -39.111 1.00 58.84  ? 477  MET B C   1 
ATOM   7856 O O   . MET B 1 477 ? -6.881  15.032  -40.012 1.00 58.72  ? 477  MET B O   1 
ATOM   7857 C CB  . MET B 1 477 ? -8.725  12.365  -39.636 1.00 59.57  ? 477  MET B CB  1 
ATOM   7858 C CG  . MET B 1 477 ? -8.688  10.835  -39.862 1.00 60.04  ? 477  MET B CG  1 
ATOM   7859 S SD  . MET B 1 477 ? -10.289 10.182  -40.428 1.00 61.35  ? 477  MET B SD  1 
ATOM   7860 C CE  . MET B 1 477 ? -10.264 10.720  -42.125 1.00 59.01  ? 477  MET B CE  1 
ATOM   7861 N N   . LYS B 1 478 ? -8.250  15.192  -38.242 1.00 60.09  ? 478  LYS B N   1 
ATOM   7862 C CA  . LYS B 1 478 ? -8.289  16.663  -38.250 1.00 60.63  ? 478  LYS B CA  1 
ATOM   7863 C C   . LYS B 1 478 ? -6.953  17.293  -37.853 1.00 58.82  ? 478  LYS B C   1 
ATOM   7864 O O   . LYS B 1 478 ? -6.515  18.260  -38.484 1.00 58.21  ? 478  LYS B O   1 
ATOM   7865 C CB  . LYS B 1 478 ? -9.371  17.186  -37.309 1.00 63.04  ? 478  LYS B CB  1 
ATOM   7866 C CG  . LYS B 1 478 ? -10.658 17.555  -37.977 1.00 67.19  ? 478  LYS B CG  1 
ATOM   7867 C CD  . LYS B 1 478 ? -10.690 19.026  -38.428 1.00 70.53  ? 478  LYS B CD  1 
ATOM   7868 C CE  . LYS B 1 478 ? -12.018 19.344  -39.159 1.00 73.25  ? 478  LYS B CE  1 
ATOM   7869 N NZ  . LYS B 1 478 ? -12.288 18.423  -40.341 1.00 74.22  ? 478  LYS B NZ  1 
ATOM   7870 N N   . TYR B 1 479 ? -6.325  16.771  -36.799 1.00 56.97  ? 479  TYR B N   1 
ATOM   7871 C CA  . TYR B 1 479 ? -5.039  17.310  -36.342 1.00 55.70  ? 479  TYR B CA  1 
ATOM   7872 C C   . TYR B 1 479 ? -4.023  17.210  -37.469 1.00 54.14  ? 479  TYR B C   1 
ATOM   7873 O O   . TYR B 1 479 ? -3.382  18.190  -37.831 1.00 53.98  ? 479  TYR B O   1 
ATOM   7874 C CB  . TYR B 1 479 ? -4.491  16.546  -35.131 1.00 55.02  ? 479  TYR B CB  1 
ATOM   7875 C CG  . TYR B 1 479 ? -5.257  16.697  -33.839 1.00 55.40  ? 479  TYR B CG  1 
ATOM   7876 C CD1 . TYR B 1 479 ? -5.793  17.920  -33.460 1.00 56.34  ? 479  TYR B CD1 1 
ATOM   7877 C CD2 . TYR B 1 479 ? -5.402  15.612  -32.965 1.00 54.84  ? 479  TYR B CD2 1 
ATOM   7878 C CE1 . TYR B 1 479 ? -6.485  18.060  -32.268 1.00 57.46  ? 479  TYR B CE1 1 
ATOM   7879 C CE2 . TYR B 1 479 ? -6.097  15.741  -31.764 1.00 56.13  ? 479  TYR B CE2 1 
ATOM   7880 C CZ  . TYR B 1 479 ? -6.640  16.969  -31.428 1.00 56.75  ? 479  TYR B CZ  1 
ATOM   7881 O OH  . TYR B 1 479 ? -7.330  17.126  -30.257 1.00 58.10  ? 479  TYR B OH  1 
ATOM   7882 N N   . TRP B 1 480 ? -3.909  16.018  -38.028 1.00 52.96  ? 480  TRP B N   1 
ATOM   7883 C CA  . TRP B 1 480 ? -2.952  15.744  -39.103 1.00 52.14  ? 480  TRP B CA  1 
ATOM   7884 C C   . TRP B 1 480 ? -3.204  16.589  -40.343 1.00 52.53  ? 480  TRP B C   1 
ATOM   7885 O O   . TRP B 1 480 ? -2.258  17.105  -40.939 1.00 51.90  ? 480  TRP B O   1 
ATOM   7886 C CB  . TRP B 1 480 ? -2.952  14.254  -39.476 1.00 51.81  ? 480  TRP B CB  1 
ATOM   7887 C CG  . TRP B 1 480 ? -1.875  13.450  -38.817 1.00 50.79  ? 480  TRP B CG  1 
ATOM   7888 C CD1 . TRP B 1 480 ? -0.914  12.743  -39.441 1.00 50.14  ? 480  TRP B CD1 1 
ATOM   7889 C CD2 . TRP B 1 480 ? -1.654  13.274  -37.412 1.00 50.92  ? 480  TRP B CD2 1 
ATOM   7890 N NE1 . TRP B 1 480 ? -0.102  12.126  -38.530 1.00 49.86  ? 480  TRP B NE1 1 
ATOM   7891 C CE2 . TRP B 1 480 ? -0.532  12.444  -37.271 1.00 49.82  ? 480  TRP B CE2 1 
ATOM   7892 C CE3 . TRP B 1 480 ? -2.296  13.739  -36.259 1.00 51.38  ? 480  TRP B CE3 1 
ATOM   7893 C CZ2 . TRP B 1 480 ? -0.019  12.076  -36.021 1.00 49.44  ? 480  TRP B CZ2 1 
ATOM   7894 C CZ3 . TRP B 1 480 ? -1.795  13.365  -35.018 1.00 51.02  ? 480  TRP B CZ3 1 
ATOM   7895 C CH2 . TRP B 1 480 ? -0.671  12.536  -34.912 1.00 50.36  ? 480  TRP B CH2 1 
ATOM   7896 N N   . THR B 1 481 ? -4.470  16.734  -40.733 1.00 53.21  ? 481  THR B N   1 
ATOM   7897 C CA  . THR B 1 481 ? -4.790  17.479  -41.940 1.00 53.70  ? 481  THR B CA  1 
ATOM   7898 C C   . THR B 1 481 ? -4.780  18.997  -41.680 1.00 54.58  ? 481  THR B C   1 
ATOM   7899 O O   . THR B 1 481 ? -4.501  19.781  -42.583 1.00 54.89  ? 481  THR B O   1 
ATOM   7900 C CB  . THR B 1 481 ? -6.117  17.030  -42.546 1.00 54.65  ? 481  THR B CB  1 
ATOM   7901 O OG1 . THR B 1 481 ? -7.157  17.142  -41.567 1.00 56.70  ? 481  THR B OG1 1 
ATOM   7902 C CG2 . THR B 1 481 ? -6.042  15.588  -43.026 1.00 52.43  ? 481  THR B CG2 1 
ATOM   7903 N N   . ASN B 1 482 ? -5.063  19.414  -40.450 1.00 55.34  ? 482  ASN B N   1 
ATOM   7904 C CA  . ASN B 1 482 ? -4.887  20.822  -40.066 1.00 56.11  ? 482  ASN B CA  1 
ATOM   7905 C C   . ASN B 1 482 ? -3.431  21.184  -40.112 1.00 55.19  ? 482  ASN B C   1 
ATOM   7906 O O   . ASN B 1 482 ? -3.074  22.272  -40.550 1.00 56.68  ? 482  ASN B O   1 
ATOM   7907 C CB  . ASN B 1 482 ? -5.390  21.089  -38.656 1.00 57.02  ? 482  ASN B CB  1 
ATOM   7908 C CG  . ASN B 1 482 ? -6.884  21.271  -38.586 1.00 58.48  ? 482  ASN B CG  1 
ATOM   7909 O OD1 . ASN B 1 482 ? -7.543  21.501  -39.592 1.00 62.15  ? 482  ASN B OD1 1 
ATOM   7910 N ND2 . ASN B 1 482 ? -7.424  21.188  -37.384 1.00 61.09  ? 482  ASN B ND2 1 
ATOM   7911 N N   . PHE B 1 483 ? -2.596  20.277  -39.629 1.00 53.56  ? 483  PHE B N   1 
ATOM   7912 C CA  . PHE B 1 483 ? -1.163  20.446  -39.701 1.00 53.29  ? 483  PHE B CA  1 
ATOM   7913 C C   . PHE B 1 483 ? -0.691  20.548  -41.169 1.00 53.74  ? 483  PHE B C   1 
ATOM   7914 O O   . PHE B 1 483 ? 0.087   21.443  -41.519 1.00 53.92  ? 483  PHE B O   1 
ATOM   7915 C CB  . PHE B 1 483 ? -0.437  19.288  -38.972 1.00 51.71  ? 483  PHE B CB  1 
ATOM   7916 C CG  . PHE B 1 483 ? 1.049   19.393  -39.041 1.00 50.54  ? 483  PHE B CG  1 
ATOM   7917 C CD1 . PHE B 1 483 ? 1.725   20.334  -38.264 1.00 52.81  ? 483  PHE B CD1 1 
ATOM   7918 C CD2 . PHE B 1 483 ? 1.780   18.593  -39.908 1.00 50.86  ? 483  PHE B CD2 1 
ATOM   7919 C CE1 . PHE B 1 483 ? 3.099   20.463  -38.346 1.00 51.08  ? 483  PHE B CE1 1 
ATOM   7920 C CE2 . PHE B 1 483 ? 3.158   18.717  -39.987 1.00 49.70  ? 483  PHE B CE2 1 
ATOM   7921 C CZ  . PHE B 1 483 ? 3.814   19.653  -39.209 1.00 50.12  ? 483  PHE B CZ  1 
ATOM   7922 N N   . ALA B 1 484 ? -1.176  19.635  -42.016 1.00 54.26  ? 484  ALA B N   1 
ATOM   7923 C CA  . ALA B 1 484 ? -0.898  19.673  -43.452 1.00 54.46  ? 484  ALA B CA  1 
ATOM   7924 C C   . ALA B 1 484 ? -1.311  21.012  -44.053 1.00 56.06  ? 484  ALA B C   1 
ATOM   7925 O O   . ALA B 1 484 ? -0.570  21.609  -44.814 1.00 56.30  ? 484  ALA B O   1 
ATOM   7926 C CB  . ALA B 1 484 ? -1.601  18.503  -44.175 1.00 54.16  ? 484  ALA B CB  1 
ATOM   7927 N N   . ARG B 1 485 ? -2.492  21.493  -43.696 1.00 57.75  ? 485  ARG B N   1 
ATOM   7928 C CA  . ARG B 1 485 ? -3.008  22.727  -44.269 1.00 60.06  ? 485  ARG B CA  1 
ATOM   7929 C C   . ARG B 1 485 ? -2.186  23.939  -43.842 1.00 59.44  ? 485  ARG B C   1 
ATOM   7930 O O   . ARG B 1 485 ? -1.928  24.807  -44.660 1.00 59.72  ? 485  ARG B O   1 
ATOM   7931 C CB  . ARG B 1 485 ? -4.476  22.951  -43.873 1.00 61.35  ? 485  ARG B CB  1 
ATOM   7932 C CG  . ARG B 1 485 ? -5.510  22.411  -44.853 1.00 64.97  ? 485  ARG B CG  1 
ATOM   7933 C CD  . ARG B 1 485 ? -6.971  22.764  -44.458 1.00 67.78  ? 485  ARG B CD  1 
ATOM   7934 N NE  . ARG B 1 485 ? -7.454  21.958  -43.319 1.00 72.93  ? 485  ARG B NE  1 
ATOM   7935 C CZ  . ARG B 1 485 ? -7.930  20.704  -43.391 1.00 74.16  ? 485  ARG B CZ  1 
ATOM   7936 N NH1 . ARG B 1 485 ? -8.022  20.064  -44.567 1.00 75.35  ? 485  ARG B NH1 1 
ATOM   7937 N NH2 . ARG B 1 485 ? -8.326  20.077  -42.269 1.00 73.32  ? 485  ARG B NH2 1 
ATOM   7938 N N   . THR B 1 486 ? -1.781  23.987  -42.566 1.00 58.50  ? 486  THR B N   1 
ATOM   7939 C CA  . THR B 1 486 ? -1.261  25.220  -41.946 1.00 58.58  ? 486  THR B CA  1 
ATOM   7940 C C   . THR B 1 486 ? 0.034   25.115  -41.114 1.00 57.60  ? 486  THR B C   1 
ATOM   7941 O O   . THR B 1 486 ? 0.554   26.127  -40.650 1.00 58.65  ? 486  THR B O   1 
ATOM   7942 C CB  . THR B 1 486 ? -2.334  25.789  -41.027 1.00 59.63  ? 486  THR B CB  1 
ATOM   7943 O OG1 . THR B 1 486 ? -2.520  24.900  -39.917 1.00 59.34  ? 486  THR B OG1 1 
ATOM   7944 C CG2 . THR B 1 486 ? -3.646  25.925  -41.779 1.00 59.76  ? 486  THR B CG2 1 
ATOM   7945 N N   . GLY B 1 487 ? 0.559   23.910  -40.906 1.00 56.33  ? 487  GLY B N   1 
ATOM   7946 C CA  . GLY B 1 487 ? 1.698   23.720  -40.011 1.00 55.07  ? 487  GLY B CA  1 
ATOM   7947 C C   . GLY B 1 487 ? 1.343   23.860  -38.546 1.00 55.28  ? 487  GLY B C   1 
ATOM   7948 O O   . GLY B 1 487 ? 2.215   24.060  -37.718 1.00 55.58  ? 487  GLY B O   1 
ATOM   7949 N N   . ASP B 1 488 ? 0.049   23.756  -38.238 1.00 55.62  ? 488  ASP B N   1 
ATOM   7950 C CA  . ASP B 1 488 ? -0.468  23.849  -36.888 1.00 55.49  ? 488  ASP B CA  1 
ATOM   7951 C C   . ASP B 1 488 ? -1.646  22.885  -36.753 1.00 55.50  ? 488  ASP B C   1 
ATOM   7952 O O   . ASP B 1 488 ? -2.611  23.023  -37.480 1.00 55.68  ? 488  ASP B O   1 
ATOM   7953 C CB  . ASP B 1 488 ? -0.915  25.284  -36.645 1.00 56.33  ? 488  ASP B CB  1 
ATOM   7954 C CG  . ASP B 1 488 ? -1.281  25.550  -35.224 1.00 56.13  ? 488  ASP B CG  1 
ATOM   7955 O OD1 . ASP B 1 488 ? -1.565  24.615  -34.459 1.00 54.63  ? 488  ASP B OD1 1 
ATOM   7956 O OD2 . ASP B 1 488 ? -1.304  26.726  -34.863 1.00 54.46  ? 488  ASP B OD2 1 
ATOM   7957 N N   . PRO B 1 489 ? -1.566  21.902  -35.834 1.00 55.76  ? 489  PRO B N   1 
ATOM   7958 C CA  . PRO B 1 489 ? -2.636  20.907  -35.732 1.00 56.80  ? 489  PRO B CA  1 
ATOM   7959 C C   . PRO B 1 489 ? -3.924  21.408  -35.107 1.00 59.54  ? 489  PRO B C   1 
ATOM   7960 O O   . PRO B 1 489 ? -4.930  20.706  -35.164 1.00 59.64  ? 489  PRO B O   1 
ATOM   7961 C CB  . PRO B 1 489 ? -2.022  19.807  -34.858 1.00 55.66  ? 489  PRO B CB  1 
ATOM   7962 C CG  . PRO B 1 489 ? -0.997  20.496  -34.043 1.00 55.12  ? 489  PRO B CG  1 
ATOM   7963 C CD  . PRO B 1 489 ? -0.488  21.645  -34.866 1.00 55.17  ? 489  PRO B CD  1 
ATOM   7964 N N   . ASN B 1 490 ? -3.903  22.600  -34.514 1.00 62.22  ? 490  ASN B N   1 
ATOM   7965 C CA  . ASN B 1 490 ? -5.106  23.179  -33.935 1.00 65.40  ? 490  ASN B CA  1 
ATOM   7966 C C   . ASN B 1 490 ? -6.065  23.666  -35.017 1.00 68.87  ? 490  ASN B C   1 
ATOM   7967 O O   . ASN B 1 490 ? -5.651  24.004  -36.126 1.00 68.13  ? 490  ASN B O   1 
ATOM   7968 C CB  . ASN B 1 490 ? -4.751  24.332  -32.985 1.00 65.94  ? 490  ASN B CB  1 
ATOM   7969 C CG  . ASN B 1 490 ? -3.853  23.892  -31.841 1.00 63.74  ? 490  ASN B CG  1 
ATOM   7970 O OD1 . ASN B 1 490 ? -4.309  23.294  -30.879 1.00 62.31  ? 490  ASN B OD1 1 
ATOM   7971 N ND2 . ASN B 1 490 ? -2.575  24.192  -31.944 1.00 61.99  ? 490  ASN B ND2 1 
ATOM   7972 N N   . ASP B 1 491 ? -7.351  23.693  -34.674 1.00 73.46  ? 491  ASP B N   1 
ATOM   7973 C CA  . ASP B 1 491 ? -8.385  24.247  -35.544 1.00 78.07  ? 491  ASP B CA  1 
ATOM   7974 C C   . ASP B 1 491 ? -8.243  25.775  -35.642 1.00 80.45  ? 491  ASP B C   1 
ATOM   7975 O O   . ASP B 1 491 ? -8.156  26.447  -34.608 1.00 81.54  ? 491  ASP B O   1 
ATOM   7976 C CB  . ASP B 1 491 ? -9.789  23.886  -35.023 1.00 79.50  ? 491  ASP B CB  1 
ATOM   7977 C CG  . ASP B 1 491 ? -10.280 22.536  -35.537 1.00 81.18  ? 491  ASP B CG  1 
ATOM   7978 O OD1 . ASP B 1 491 ? -11.348 22.491  -36.201 1.00 84.87  ? 491  ASP B OD1 1 
ATOM   7979 O OD2 . ASP B 1 491 ? -9.581  21.520  -35.304 1.00 83.19  ? 491  ASP B OD2 1 
ATOM   7980 N N   . PRO B 1 492 ? -8.206  26.331  -36.876 1.00 82.66  ? 492  PRO B N   1 
ATOM   7981 C CA  . PRO B 1 492 ? -8.165  27.805  -37.043 1.00 85.02  ? 492  PRO B CA  1 
ATOM   7982 C C   . PRO B 1 492 ? -9.424  28.547  -36.563 1.00 88.24  ? 492  PRO B C   1 
ATOM   7983 O O   . PRO B 1 492 ? -9.299  29.591  -35.929 1.00 89.91  ? 492  PRO B O   1 
ATOM   7984 C CB  . PRO B 1 492 ? -7.950  27.993  -38.553 1.00 85.31  ? 492  PRO B CB  1 
ATOM   7985 C CG  . PRO B 1 492 ? -7.522  26.634  -39.083 1.00 82.86  ? 492  PRO B CG  1 
ATOM   7986 C CD  . PRO B 1 492 ? -8.149  25.629  -38.174 1.00 82.00  ? 492  PRO B CD  1 
ATOM   7987 N N   . ARG B 1 493 ? -10.610 28.036  -36.898 1.00 90.30  ? 493  ARG B N   1 
ATOM   7988 C CA  . ARG B 1 493 ? -11.869 28.361  -36.183 1.00 92.73  ? 493  ARG B CA  1 
ATOM   7989 C C   . ARG B 1 493 ? -12.330 27.029  -35.558 1.00 93.58  ? 493  ARG B C   1 
ATOM   7990 O O   . ARG B 1 493 ? -12.083 25.957  -36.152 1.00 92.53  ? 493  ARG B O   1 
ATOM   7991 C CB  . ARG B 1 493 ? -12.922 28.944  -37.131 1.00 95.06  ? 493  ARG B CB  1 
ATOM   7992 N N   . ASP B 1 494 ? -12.966 27.057  -34.378 1.00 95.75  ? 494  ASP B N   1 
ATOM   7993 C CA  . ASP B 1 494 ? -12.866 25.865  -33.499 1.00 95.51  ? 494  ASP B CA  1 
ATOM   7994 C C   . ASP B 1 494 ? -13.907 25.575  -32.397 1.00 97.26  ? 494  ASP B C   1 
ATOM   7995 O O   . ASP B 1 494 ? -14.883 26.325  -32.206 1.00 99.61  ? 494  ASP B O   1 
ATOM   7996 C CB  . ASP B 1 494 ? -11.481 25.899  -32.832 1.00 94.26  ? 494  ASP B CB  1 
ATOM   7997 C CG  . ASP B 1 494 ? -11.186 27.219  -32.159 1.00 95.36  ? 494  ASP B CG  1 
ATOM   7998 O OD1 . ASP B 1 494 ? -10.021 27.388  -31.719 1.00 95.42  ? 494  ASP B OD1 1 
ATOM   7999 O OD2 . ASP B 1 494 ? -12.097 28.072  -32.062 1.00 97.07  ? 494  ASP B OD2 1 
ATOM   8000 N N   . SER B 1 495 ? -13.670 24.440  -31.711 1.00 96.19  ? 495  SER B N   1 
ATOM   8001 C CA  . SER B 1 495 ? -14.323 24.068  -30.436 1.00 96.93  ? 495  SER B CA  1 
ATOM   8002 C C   . SER B 1 495 ? -13.657 24.820  -29.274 1.00 96.25  ? 495  SER B C   1 
ATOM   8003 O O   . SER B 1 495 ? -14.355 25.444  -28.466 1.00 98.13  ? 495  SER B O   1 
ATOM   8004 C CB  . SER B 1 495 ? -14.234 22.547  -30.193 1.00 95.95  ? 495  SER B CB  1 
ATOM   8005 O OG  . SER B 1 495 ? -14.374 21.806  -31.400 1.00 96.47  ? 495  SER B OG  1 
ATOM   8006 N N   . LYS B 1 496 ? -12.323 24.679  -29.173 1.00 93.46  ? 496  LYS B N   1 
ATOM   8007 C CA  . LYS B 1 496 ? -11.392 25.670  -28.561 1.00 92.47  ? 496  LYS B CA  1 
ATOM   8008 C C   . LYS B 1 496 ? -10.424 25.214  -27.460 1.00 90.16  ? 496  LYS B C   1 
ATOM   8009 O O   . LYS B 1 496 ? -9.277  24.838  -27.743 1.00 88.31  ? 496  LYS B O   1 
ATOM   8010 C CB  . LYS B 1 496 ? -12.113 26.934  -28.057 1.00 94.86  ? 496  LYS B CB  1 
ATOM   8011 C CG  . LYS B 1 496 ? -12.454 27.875  -29.164 1.00 96.06  ? 496  LYS B CG  1 
ATOM   8012 C CD  . LYS B 1 496 ? -13.173 29.101  -28.669 1.00 98.24  ? 496  LYS B CD  1 
ATOM   8013 C CE  . LYS B 1 496 ? -13.230 30.106  -29.812 1.00 99.55  ? 496  LYS B CE  1 
ATOM   8014 N NZ  . LYS B 1 496 ? -13.941 29.588  -31.015 1.00 97.89  ? 496  LYS B NZ  1 
ATOM   8015 N N   . SER B 1 497 ? -10.908 25.238  -26.215 1.00 89.66  ? 497  SER B N   1 
ATOM   8016 C CA  . SER B 1 497 ? -10.068 25.565  -25.041 1.00 87.81  ? 497  SER B CA  1 
ATOM   8017 C C   . SER B 1 497 ? -9.128  24.539  -24.370 1.00 84.35  ? 497  SER B C   1 
ATOM   8018 O O   . SER B 1 497 ? -8.698  24.805  -23.227 1.00 85.35  ? 497  SER B O   1 
ATOM   8019 C CB  . SER B 1 497 ? -10.948 26.179  -23.944 1.00 89.88  ? 497  SER B CB  1 
ATOM   8020 O OG  . SER B 1 497 ? -10.136 26.695  -22.900 1.00 90.59  ? 497  SER B OG  1 
ATOM   8021 N N   . PRO B 1 498 ? -8.847  23.366  -25.011 1.00 79.93  ? 498  PRO B N   1 
ATOM   8022 C CA  . PRO B 1 498 ? -7.546  22.729  -24.800 1.00 75.36  ? 498  PRO B CA  1 
ATOM   8023 C C   . PRO B 1 498 ? -6.729  22.820  -26.109 1.00 72.43  ? 498  PRO B C   1 
ATOM   8024 O O   . PRO B 1 498 ? -6.900  21.990  -27.000 1.00 71.86  ? 498  PRO B O   1 
ATOM   8025 C CB  . PRO B 1 498 ? -7.941  21.276  -24.506 1.00 75.67  ? 498  PRO B CB  1 
ATOM   8026 C CG  . PRO B 1 498 ? -9.226  21.061  -25.400 1.00 77.62  ? 498  PRO B CG  1 
ATOM   8027 C CD  . PRO B 1 498 ? -9.697  22.472  -25.830 1.00 79.84  ? 498  PRO B CD  1 
ATOM   8028 N N   . GLN B 1 499 ? -5.884  23.844  -26.229 1.00 69.86  ? 499  GLN B N   1 
ATOM   8029 C CA  . GLN B 1 499 ? -5.053  24.041  -27.422 1.00 66.98  ? 499  GLN B CA  1 
ATOM   8030 C C   . GLN B 1 499 ? -3.771  23.200  -27.307 1.00 63.42  ? 499  GLN B C   1 
ATOM   8031 O O   . GLN B 1 499 ? -3.214  23.048  -26.219 1.00 62.95  ? 499  GLN B O   1 
ATOM   8032 C CB  . GLN B 1 499 ? -4.713  25.534  -27.636 1.00 67.42  ? 499  GLN B CB  1 
ATOM   8033 C CG  . GLN B 1 499 ? -5.904  26.431  -28.049 1.00 68.65  ? 499  GLN B CG  1 
ATOM   8034 C CD  . GLN B 1 499 ? -6.308  26.308  -29.523 1.00 68.11  ? 499  GLN B CD  1 
ATOM   8035 O OE1 . GLN B 1 499 ? -5.542  26.649  -30.438 1.00 67.66  ? 499  GLN B OE1 1 
ATOM   8036 N NE2 . GLN B 1 499 ? -7.522  25.838  -29.756 1.00 66.97  ? 499  GLN B NE2 1 
ATOM   8037 N N   . TRP B 1 500 ? -3.338  22.637  -28.432 1.00 60.42  ? 500  TRP B N   1 
ATOM   8038 C CA  . TRP B 1 500 ? -2.074  21.887  -28.534 1.00 57.60  ? 500  TRP B CA  1 
ATOM   8039 C C   . TRP B 1 500 ? -0.923  22.882  -28.678 1.00 55.85  ? 500  TRP B C   1 
ATOM   8040 O O   . TRP B 1 500 ? -0.786  23.516  -29.720 1.00 55.88  ? 500  TRP B O   1 
ATOM   8041 C CB  . TRP B 1 500 ? -2.131  20.979  -29.763 1.00 55.55  ? 500  TRP B CB  1 
ATOM   8042 C CG  . TRP B 1 500 ? -0.991  20.002  -29.943 1.00 52.86  ? 500  TRP B CG  1 
ATOM   8043 C CD1 . TRP B 1 500 ? 0.263   20.077  -29.424 1.00 51.93  ? 500  TRP B CD1 1 
ATOM   8044 C CD2 . TRP B 1 500 ? -1.024  18.811  -30.725 1.00 51.24  ? 500  TRP B CD2 1 
ATOM   8045 N NE1 . TRP B 1 500 ? 1.012   18.992  -29.814 1.00 50.05  ? 500  TRP B NE1 1 
ATOM   8046 C CE2 . TRP B 1 500 ? 0.245   18.207  -30.626 1.00 50.49  ? 500  TRP B CE2 1 
ATOM   8047 C CE3 . TRP B 1 500 ? -2.004  18.195  -31.505 1.00 51.69  ? 500  TRP B CE3 1 
ATOM   8048 C CZ2 . TRP B 1 500 ? 0.558   17.019  -31.280 1.00 50.49  ? 500  TRP B CZ2 1 
ATOM   8049 C CZ3 . TRP B 1 500 ? -1.698  17.006  -32.141 1.00 50.97  ? 500  TRP B CZ3 1 
ATOM   8050 C CH2 . TRP B 1 500 ? -0.431  16.432  -32.027 1.00 50.25  ? 500  TRP B CH2 1 
ATOM   8051 N N   . PRO B 1 501 ? -0.084  23.028  -27.640 1.00 54.55  ? 501  PRO B N   1 
ATOM   8052 C CA  . PRO B 1 501 ? 0.962   24.044  -27.723 1.00 54.07  ? 501  PRO B CA  1 
ATOM   8053 C C   . PRO B 1 501 ? 2.240   23.542  -28.396 1.00 52.45  ? 501  PRO B C   1 
ATOM   8054 O O   . PRO B 1 501 ? 2.531   22.343  -28.357 1.00 51.57  ? 501  PRO B O   1 
ATOM   8055 C CB  . PRO B 1 501 ? 1.220   24.373  -26.259 1.00 54.61  ? 501  PRO B CB  1 
ATOM   8056 C CG  . PRO B 1 501 ? 0.928   23.133  -25.533 1.00 54.03  ? 501  PRO B CG  1 
ATOM   8057 C CD  . PRO B 1 501 ? -0.037  22.322  -26.351 1.00 54.27  ? 501  PRO B CD  1 
ATOM   8058 N N   . PRO B 1 502 ? 2.992   24.439  -29.043 1.00 52.23  ? 502  PRO B N   1 
ATOM   8059 C CA  . PRO B 1 502 ? 4.259   23.989  -29.596 1.00 51.60  ? 502  PRO B CA  1 
ATOM   8060 C C   . PRO B 1 502 ? 5.216   23.429  -28.533 1.00 51.27  ? 502  PRO B C   1 
ATOM   8061 O O   . PRO B 1 502 ? 5.199   23.866  -27.374 1.00 51.51  ? 502  PRO B O   1 
ATOM   8062 C CB  . PRO B 1 502 ? 4.835   25.262  -30.244 1.00 52.85  ? 502  PRO B CB  1 
ATOM   8063 C CG  . PRO B 1 502 ? 3.674   26.151  -30.466 1.00 53.47  ? 502  PRO B CG  1 
ATOM   8064 C CD  . PRO B 1 502 ? 2.742   25.861  -29.331 1.00 53.42  ? 502  PRO B CD  1 
ATOM   8065 N N   . TYR B 1 503 ? 6.012   22.443  -28.944 1.00 51.26  ? 503  TYR B N   1 
ATOM   8066 C CA  . TYR B 1 503 ? 7.092   21.897  -28.140 1.00 51.22  ? 503  TYR B CA  1 
ATOM   8067 C C   . TYR B 1 503 ? 8.247   22.859  -28.222 1.00 51.77  ? 503  TYR B C   1 
ATOM   8068 O O   . TYR B 1 503 ? 8.695   23.188  -29.317 1.00 51.58  ? 503  TYR B O   1 
ATOM   8069 C CB  . TYR B 1 503 ? 7.543   20.530  -28.664 1.00 50.70  ? 503  TYR B CB  1 
ATOM   8070 C CG  . TYR B 1 503 ? 8.618   19.872  -27.817 1.00 51.18  ? 503  TYR B CG  1 
ATOM   8071 C CD1 . TYR B 1 503 ? 9.962   20.149  -28.020 1.00 52.64  ? 503  TYR B CD1 1 
ATOM   8072 C CD2 . TYR B 1 503 ? 8.281   18.978  -26.793 1.00 51.29  ? 503  TYR B CD2 1 
ATOM   8073 C CE1 . TYR B 1 503 ? 10.946  19.553  -27.233 1.00 51.40  ? 503  TYR B CE1 1 
ATOM   8074 C CE2 . TYR B 1 503 ? 9.243   18.392  -26.015 1.00 49.82  ? 503  TYR B CE2 1 
ATOM   8075 C CZ  . TYR B 1 503 ? 10.573  18.682  -26.238 1.00 51.36  ? 503  TYR B CZ  1 
ATOM   8076 O OH  . TYR B 1 503 ? 11.537  18.088  -25.460 1.00 52.63  ? 503  TYR B OH  1 
ATOM   8077 N N   . THR B 1 504 ? 8.713   23.296  -27.060 1.00 53.22  ? 504  THR B N   1 
ATOM   8078 C CA  . THR B 1 504 ? 9.874   24.160  -26.928 1.00 54.62  ? 504  THR B CA  1 
ATOM   8079 C C   . THR B 1 504 ? 10.879  23.493  -25.994 1.00 55.46  ? 504  THR B C   1 
ATOM   8080 O O   . THR B 1 504 ? 10.520  22.637  -25.193 1.00 54.26  ? 504  THR B O   1 
ATOM   8081 C CB  . THR B 1 504 ? 9.479   25.504  -26.329 1.00 55.90  ? 504  THR B CB  1 
ATOM   8082 O OG1 . THR B 1 504 ? 8.853   25.272  -25.063 1.00 56.18  ? 504  THR B OG1 1 
ATOM   8083 C CG2 . THR B 1 504 ? 8.511   26.252  -27.259 1.00 55.46  ? 504  THR B CG2 1 
ATOM   8084 N N   . THR B 1 505 ? 12.142  23.905  -26.081 1.00 57.44  ? 505  THR B N   1 
ATOM   8085 C CA  . THR B 1 505 ? 13.188  23.294  -25.256 1.00 58.34  ? 505  THR B CA  1 
ATOM   8086 C C   . THR B 1 505 ? 13.075  23.684  -23.779 1.00 59.72  ? 505  THR B C   1 
ATOM   8087 O O   . THR B 1 505 ? 13.486  22.920  -22.917 1.00 60.42  ? 505  THR B O   1 
ATOM   8088 C CB  . THR B 1 505 ? 14.608  23.636  -25.769 1.00 59.18  ? 505  THR B CB  1 
ATOM   8089 O OG1 . THR B 1 505 ? 14.804  25.052  -25.712 1.00 61.30  ? 505  THR B OG1 1 
ATOM   8090 C CG2 . THR B 1 505 ? 14.787  23.156  -27.172 1.00 57.30  ? 505  THR B CG2 1 
ATOM   8091 N N   . ALA B 1 506 ? 12.514  24.856  -23.490 1.00 60.87  ? 506  ALA B N   1 
ATOM   8092 C CA  . ALA B 1 506 ? 12.247  25.268  -22.116 1.00 61.86  ? 506  ALA B CA  1 
ATOM   8093 C C   . ALA B 1 506 ? 11.076  24.506  -21.489 1.00 61.34  ? 506  ALA B C   1 
ATOM   8094 O O   . ALA B 1 506 ? 11.235  23.857  -20.453 1.00 62.86  ? 506  ALA B O   1 
ATOM   8095 C CB  . ALA B 1 506 ? 11.965  26.766  -22.054 1.00 63.01  ? 506  ALA B CB  1 
ATOM   8096 N N   . ALA B 1 507 ? 9.892   24.622  -22.081 1.00 60.08  ? 507  ALA B N   1 
ATOM   8097 C CA  . ALA B 1 507 ? 8.674   24.090  -21.459 1.00 59.12  ? 507  ALA B CA  1 
ATOM   8098 C C   . ALA B 1 507 ? 8.486   22.616  -21.754 1.00 57.13  ? 507  ALA B C   1 
ATOM   8099 O O   . ALA B 1 507 ? 7.890   21.917  -20.958 1.00 57.37  ? 507  ALA B O   1 
ATOM   8100 C CB  . ALA B 1 507 ? 7.444   24.890  -21.888 1.00 59.30  ? 507  ALA B CB  1 
ATOM   8101 N N   . GLN B 1 508 ? 8.977   22.152  -22.899 1.00 56.05  ? 508  GLN B N   1 
ATOM   8102 C CA  . GLN B 1 508 ? 8.892   20.734  -23.298 1.00 54.54  ? 508  GLN B CA  1 
ATOM   8103 C C   . GLN B 1 508 ? 7.461   20.204  -23.280 1.00 54.18  ? 508  GLN B C   1 
ATOM   8104 O O   . GLN B 1 508 ? 7.206   19.040  -22.931 1.00 53.41  ? 508  GLN B O   1 
ATOM   8105 C CB  . GLN B 1 508 ? 9.818   19.872  -22.433 1.00 54.25  ? 508  GLN B CB  1 
ATOM   8106 C CG  . GLN B 1 508 ? 11.276  20.293  -22.523 1.00 55.50  ? 508  GLN B CG  1 
ATOM   8107 C CD  . GLN B 1 508 ? 12.160  19.642  -21.482 1.00 55.33  ? 508  GLN B CD  1 
ATOM   8108 O OE1 . GLN B 1 508 ? 12.195  18.420  -21.358 1.00 54.99  ? 508  GLN B OE1 1 
ATOM   8109 N NE2 . GLN B 1 508 ? 12.902  20.462  -20.746 1.00 56.58  ? 508  GLN B NE2 1 
ATOM   8110 N N   . GLN B 1 509 ? 6.533   21.046  -23.730 1.00 54.43  ? 509  GLN B N   1 
ATOM   8111 C CA  . GLN B 1 509 ? 5.124   20.673  -23.773 1.00 54.28  ? 509  GLN B CA  1 
ATOM   8112 C C   . GLN B 1 509 ? 4.786   19.742  -24.929 1.00 53.28  ? 509  GLN B C   1 
ATOM   8113 O O   . GLN B 1 509 ? 5.204   19.965  -26.056 1.00 52.63  ? 509  GLN B O   1 
ATOM   8114 C CB  . GLN B 1 509 ? 4.243   21.920  -23.855 1.00 55.07  ? 509  GLN B CB  1 
ATOM   8115 C CG  . GLN B 1 509 ? 4.199   22.725  -22.592 1.00 56.39  ? 509  GLN B CG  1 
ATOM   8116 C CD  . GLN B 1 509 ? 3.603   24.099  -22.784 1.00 57.70  ? 509  GLN B CD  1 
ATOM   8117 O OE1 . GLN B 1 509 ? 4.066   24.884  -23.604 1.00 59.88  ? 509  GLN B OE1 1 
ATOM   8118 N NE2 . GLN B 1 509 ? 2.592   24.404  -22.015 1.00 58.23  ? 509  GLN B NE2 1 
ATOM   8119 N N   . TYR B 1 510 ? 4.021   18.699  -24.618 1.00 53.03  ? 510  TYR B N   1 
ATOM   8120 C CA  . TYR B 1 510 ? 3.456   17.782  -25.586 1.00 52.47  ? 510  TYR B CA  1 
ATOM   8121 C C   . TYR B 1 510 ? 2.056   17.388  -25.100 1.00 52.84  ? 510  TYR B C   1 
ATOM   8122 O O   . TYR B 1 510 ? 1.674   17.742  -23.997 1.00 53.71  ? 510  TYR B O   1 
ATOM   8123 C CB  . TYR B 1 510 ? 4.335   16.543  -25.734 1.00 51.78  ? 510  TYR B CB  1 
ATOM   8124 C CG  . TYR B 1 510 ? 4.456   15.692  -24.487 1.00 52.08  ? 510  TYR B CG  1 
ATOM   8125 C CD1 . TYR B 1 510 ? 5.283   16.078  -23.443 1.00 52.84  ? 510  TYR B CD1 1 
ATOM   8126 C CD2 . TYR B 1 510 ? 3.756   14.491  -24.360 1.00 52.66  ? 510  TYR B CD2 1 
ATOM   8127 C CE1 . TYR B 1 510 ? 5.396   15.303  -22.293 1.00 53.34  ? 510  TYR B CE1 1 
ATOM   8128 C CE2 . TYR B 1 510 ? 3.865   13.709  -23.219 1.00 52.12  ? 510  TYR B CE2 1 
ATOM   8129 C CZ  . TYR B 1 510 ? 4.694   14.115  -22.193 1.00 52.13  ? 510  TYR B CZ  1 
ATOM   8130 O OH  . TYR B 1 510 ? 4.820   13.368  -21.051 1.00 51.49  ? 510  TYR B OH  1 
ATOM   8131 N N   . VAL B 1 511 ? 1.296   16.660  -25.914 1.00 52.38  ? 511  VAL B N   1 
ATOM   8132 C CA  . VAL B 1 511 ? -0.087  16.304  -25.562 1.00 52.42  ? 511  VAL B CA  1 
ATOM   8133 C C   . VAL B 1 511 ? -0.305  14.804  -25.570 1.00 51.74  ? 511  VAL B C   1 
ATOM   8134 O O   . VAL B 1 511 ? 0.343   14.073  -26.310 1.00 50.26  ? 511  VAL B O   1 
ATOM   8135 C CB  . VAL B 1 511 ? -1.125  16.961  -26.502 1.00 53.05  ? 511  VAL B CB  1 
ATOM   8136 C CG1 . VAL B 1 511 ? -0.991  18.493  -26.463 1.00 52.85  ? 511  VAL B CG1 1 
ATOM   8137 C CG2 . VAL B 1 511 ? -0.987  16.427  -27.929 1.00 51.86  ? 511  VAL B CG2 1 
ATOM   8138 N N   . SER B 1 512 ? -1.218  14.345  -24.725 1.00 52.94  ? 512  SER B N   1 
ATOM   8139 C CA  . SER B 1 512 ? -1.678  12.954  -24.798 1.00 53.01  ? 512  SER B CA  1 
ATOM   8140 C C   . SER B 1 512 ? -2.794  12.819  -25.834 1.00 53.39  ? 512  SER B C   1 
ATOM   8141 O O   . SER B 1 512 ? -3.792  13.556  -25.808 1.00 53.37  ? 512  SER B O   1 
ATOM   8142 C CB  . SER B 1 512 ? -2.161  12.452  -23.450 1.00 53.69  ? 512  SER B CB  1 
ATOM   8143 O OG  . SER B 1 512 ? -3.240  13.226  -22.971 1.00 56.60  ? 512  SER B OG  1 
ATOM   8144 N N   . LEU B 1 513 ? -2.599  11.882  -26.765 1.00 52.57  ? 513  LEU B N   1 
ATOM   8145 C CA  . LEU B 1 513 ? -3.627  11.529  -27.721 1.00 53.02  ? 513  LEU B CA  1 
ATOM   8146 C C   . LEU B 1 513 ? -4.319  10.247  -27.224 1.00 53.86  ? 513  LEU B C   1 
ATOM   8147 O O   . LEU B 1 513 ? -3.760  9.152   -27.301 1.00 52.83  ? 513  LEU B O   1 
ATOM   8148 C CB  . LEU B 1 513 ? -3.007  11.350  -29.112 1.00 52.24  ? 513  LEU B CB  1 
ATOM   8149 C CG  . LEU B 1 513 ? -2.457  12.616  -29.788 1.00 50.10  ? 513  LEU B CG  1 
ATOM   8150 C CD1 . LEU B 1 513 ? -1.938  12.282  -31.166 1.00 47.86  ? 513  LEU B CD1 1 
ATOM   8151 C CD2 . LEU B 1 513 ? -3.522  13.693  -29.871 1.00 49.78  ? 513  LEU B CD2 1 
ATOM   8152 N N   . ASN B 1 514 ? -5.515  10.408  -26.668 1.00 55.40  ? 514  ASN B N   1 
ATOM   8153 C CA  . ASN B 1 514 ? -6.310  9.282   -26.166 1.00 57.09  ? 514  ASN B CA  1 
ATOM   8154 C C   . ASN B 1 514 ? -7.792  9.629   -26.284 1.00 59.23  ? 514  ASN B C   1 
ATOM   8155 O O   . ASN B 1 514 ? -8.121  10.656  -26.877 1.00 59.43  ? 514  ASN B O   1 
ATOM   8156 C CB  . ASN B 1 514 ? -5.903  8.914   -24.730 1.00 57.34  ? 514  ASN B CB  1 
ATOM   8157 C CG  . ASN B 1 514 ? -6.049  10.064  -23.754 1.00 58.20  ? 514  ASN B CG  1 
ATOM   8158 O OD1 . ASN B 1 514 ? -7.072  10.731  -23.717 1.00 61.80  ? 514  ASN B OD1 1 
ATOM   8159 N ND2 . ASN B 1 514 ? -5.029  10.287  -22.943 1.00 57.70  ? 514  ASN B ND2 1 
ATOM   8160 N N   . LEU B 1 515 ? -8.682  8.796   -25.735 1.00 61.21  ? 515  LEU B N   1 
ATOM   8161 C CA  . LEU B 1 515 ? -10.124 9.020   -25.878 1.00 63.34  ? 515  LEU B CA  1 
ATOM   8162 C C   . LEU B 1 515 ? -10.615 10.245  -25.107 1.00 64.64  ? 515  LEU B C   1 
ATOM   8163 O O   . LEU B 1 515 ? -11.688 10.751  -25.398 1.00 65.85  ? 515  LEU B O   1 
ATOM   8164 C CB  . LEU B 1 515 ? -10.938 7.778   -25.463 1.00 64.68  ? 515  LEU B CB  1 
ATOM   8165 C CG  . LEU B 1 515 ? -10.789 6.513   -26.326 1.00 64.74  ? 515  LEU B CG  1 
ATOM   8166 C CD1 . LEU B 1 515 ? -11.767 5.445   -25.880 1.00 66.32  ? 515  LEU B CD1 1 
ATOM   8167 C CD2 . LEU B 1 515 ? -10.980 6.804   -27.798 1.00 64.64  ? 515  LEU B CD2 1 
ATOM   8168 N N   . LYS B 1 516 ? -9.831  10.709  -24.135 1.00 64.83  ? 516  LYS B N   1 
ATOM   8169 C CA  . LYS B 1 516 ? -10.154 11.919  -23.385 1.00 66.21  ? 516  LYS B CA  1 
ATOM   8170 C C   . LYS B 1 516 ? -9.658  13.150  -24.147 1.00 64.88  ? 516  LYS B C   1 
ATOM   8171 O O   . LYS B 1 516 ? -8.780  13.040  -24.989 1.00 63.69  ? 516  LYS B O   1 
ATOM   8172 C CB  . LYS B 1 516 ? -9.514  11.884  -21.992 1.00 66.35  ? 516  LYS B CB  1 
ATOM   8173 C CG  . LYS B 1 516 ? -9.735  10.581  -21.213 1.00 68.59  ? 516  LYS B CG  1 
ATOM   8174 C CD  . LYS B 1 516 ? -9.281  10.699  -19.741 1.00 69.34  ? 516  LYS B CD  1 
ATOM   8175 C CE  . LYS B 1 516 ? -7.753  10.527  -19.579 1.00 70.68  ? 516  LYS B CE  1 
ATOM   8176 N NZ  . LYS B 1 516 ? -7.263  10.728  -18.163 1.00 71.37  ? 516  LYS B NZ  1 
ATOM   8177 N N   . PRO B 1 517 ? -10.212 14.334  -23.853 1.00 65.52  ? 517  PRO B N   1 
ATOM   8178 C CA  . PRO B 1 517 ? -9.708  15.563  -24.487 1.00 64.87  ? 517  PRO B CA  1 
ATOM   8179 C C   . PRO B 1 517 ? -8.205  15.784  -24.287 1.00 63.35  ? 517  PRO B C   1 
ATOM   8180 O O   . PRO B 1 517 ? -7.642  15.280  -23.314 1.00 62.54  ? 517  PRO B O   1 
ATOM   8181 C CB  . PRO B 1 517 ? -10.499 16.667  -23.779 1.00 66.75  ? 517  PRO B CB  1 
ATOM   8182 C CG  . PRO B 1 517 ? -11.748 15.993  -23.302 1.00 68.06  ? 517  PRO B CG  1 
ATOM   8183 C CD  . PRO B 1 517 ? -11.335 14.598  -22.943 1.00 67.13  ? 517  PRO B CD  1 
ATOM   8184 N N   . LEU B 1 518 ? -7.569  16.530  -25.198 1.00 62.53  ? 518  LEU B N   1 
ATOM   8185 C CA  . LEU B 1 518 ? -6.126  16.807  -25.109 1.00 61.29  ? 518  LEU B CA  1 
ATOM   8186 C C   . LEU B 1 518 ? -5.744  17.243  -23.698 1.00 61.64  ? 518  LEU B C   1 
ATOM   8187 O O   . LEU B 1 518 ? -6.397  18.096  -23.107 1.00 62.92  ? 518  LEU B O   1 
ATOM   8188 C CB  . LEU B 1 518 ? -5.688  17.943  -26.042 1.00 60.73  ? 518  LEU B CB  1 
ATOM   8189 C CG  . LEU B 1 518 ? -5.401  17.749  -27.514 1.00 59.93  ? 518  LEU B CG  1 
ATOM   8190 C CD1 . LEU B 1 518 ? -4.701  18.995  -28.010 1.00 59.17  ? 518  LEU B CD1 1 
ATOM   8191 C CD2 . LEU B 1 518 ? -4.560  16.519  -27.771 1.00 58.35  ? 518  LEU B CD2 1 
ATOM   8192 N N   . GLU B 1 519 ? -4.670  16.650  -23.197 1.00 60.84  ? 519  GLU B N   1 
ATOM   8193 C CA  . GLU B 1 519 ? -4.032  17.027  -21.954 1.00 61.31  ? 519  GLU B CA  1 
ATOM   8194 C C   . GLU B 1 519 ? -2.601  17.451  -22.301 1.00 58.80  ? 519  GLU B C   1 
ATOM   8195 O O   . GLU B 1 519 ? -1.908  16.747  -23.022 1.00 57.72  ? 519  GLU B O   1 
ATOM   8196 C CB  . GLU B 1 519 ? -4.020  15.827  -21.002 1.00 61.34  ? 519  GLU B CB  1 
ATOM   8197 C CG  . GLU B 1 519 ? -3.241  16.035  -19.717 1.00 63.87  ? 519  GLU B CG  1 
ATOM   8198 C CD  . GLU B 1 519 ? -3.395  14.871  -18.739 1.00 65.04  ? 519  GLU B CD  1 
ATOM   8199 O OE1 . GLU B 1 519 ? -4.488  14.789  -18.111 1.00 72.07  ? 519  GLU B OE1 1 
ATOM   8200 O OE2 . GLU B 1 519 ? -2.432  14.067  -18.587 1.00 65.95  ? 519  GLU B OE2 1 
ATOM   8201 N N   . VAL B 1 520 ? -2.174  18.607  -21.798 1.00 58.07  ? 520  VAL B N   1 
ATOM   8202 C CA  . VAL B 1 520 ? -0.828  19.088  -22.002 1.00 56.33  ? 520  VAL B CA  1 
ATOM   8203 C C   . VAL B 1 520 ? 0.046   18.563  -20.874 1.00 55.86  ? 520  VAL B C   1 
ATOM   8204 O O   . VAL B 1 520 ? -0.300  18.691  -19.712 1.00 56.94  ? 520  VAL B O   1 
ATOM   8205 C CB  . VAL B 1 520 ? -0.778  20.639  -22.028 1.00 56.89  ? 520  VAL B CB  1 
ATOM   8206 C CG1 . VAL B 1 520 ? 0.624   21.111  -22.279 1.00 55.73  ? 520  VAL B CG1 1 
ATOM   8207 C CG2 . VAL B 1 520 ? -1.704  21.180  -23.099 1.00 56.81  ? 520  VAL B CG2 1 
ATOM   8208 N N   . ARG B 1 521 ? 1.177   17.970  -21.228 1.00 54.68  ? 521  ARG B N   1 
ATOM   8209 C CA  . ARG B 1 521 ? 2.169   17.517  -20.267 1.00 54.68  ? 521  ARG B CA  1 
ATOM   8210 C C   . ARG B 1 521 ? 3.499   18.173  -20.599 1.00 54.15  ? 521  ARG B C   1 
ATOM   8211 O O   . ARG B 1 521 ? 3.668   18.730  -21.679 1.00 53.75  ? 521  ARG B O   1 
ATOM   8212 C CB  . ARG B 1 521 ? 2.311   16.000  -20.332 1.00 54.05  ? 521  ARG B CB  1 
ATOM   8213 C CG  . ARG B 1 521 ? 1.006   15.282  -20.101 1.00 54.66  ? 521  ARG B CG  1 
ATOM   8214 C CD  . ARG B 1 521 ? 1.167   13.784  -20.184 1.00 54.74  ? 521  ARG B CD  1 
ATOM   8215 N NE  . ARG B 1 521 ? -0.127  13.107  -20.059 1.00 55.74  ? 521  ARG B NE  1 
ATOM   8216 C CZ  . ARG B 1 521 ? -0.334  11.826  -20.360 1.00 55.16  ? 521  ARG B CZ  1 
ATOM   8217 N NH1 . ARG B 1 521 ? 0.650   11.063  -20.827 1.00 53.23  ? 521  ARG B NH1 1 
ATOM   8218 N NH2 . ARG B 1 521 ? -1.545  11.314  -20.210 1.00 57.26  ? 521  ARG B NH2 1 
ATOM   8219 N N   . ARG B 1 522 ? 4.444   18.099  -19.672 1.00 54.43  ? 522  ARG B N   1 
ATOM   8220 C CA  . ARG B 1 522 ? 5.753   18.690  -19.870 1.00 54.60  ? 522  ARG B CA  1 
ATOM   8221 C C   . ARG B 1 522 ? 6.836   17.663  -19.612 1.00 54.75  ? 522  ARG B C   1 
ATOM   8222 O O   . ARG B 1 522 ? 6.805   16.986  -18.602 1.00 55.73  ? 522  ARG B O   1 
ATOM   8223 C CB  . ARG B 1 522 ? 5.911   19.915  -18.975 1.00 55.24  ? 522  ARG B CB  1 
ATOM   8224 C CG  . ARG B 1 522 ? 4.995   21.030  -19.414 1.00 55.62  ? 522  ARG B CG  1 
ATOM   8225 C CD  . ARG B 1 522 ? 4.909   22.185  -18.429 1.00 57.88  ? 522  ARG B CD  1 
ATOM   8226 N NE  . ARG B 1 522 ? 6.180   22.868  -18.305 1.00 58.94  ? 522  ARG B NE  1 
ATOM   8227 C CZ  . ARG B 1 522 ? 6.354   24.066  -17.751 1.00 61.43  ? 522  ARG B CZ  1 
ATOM   8228 N NH1 . ARG B 1 522 ? 5.321   24.764  -17.289 1.00 62.10  ? 522  ARG B NH1 1 
ATOM   8229 N NH2 . ARG B 1 522 ? 7.579   24.576  -17.686 1.00 60.71  ? 522  ARG B NH2 1 
ATOM   8230 N N   . GLY B 1 523 ? 7.754   17.513  -20.562 1.00 55.19  ? 523  GLY B N   1 
ATOM   8231 C CA  . GLY B 1 523 ? 8.916   16.663  -20.396 1.00 55.82  ? 523  GLY B CA  1 
ATOM   8232 C C   . GLY B 1 523 ? 8.670   15.261  -20.888 1.00 56.17  ? 523  GLY B C   1 
ATOM   8233 O O   . GLY B 1 523 ? 8.013   14.480  -20.230 1.00 57.76  ? 523  GLY B O   1 
ATOM   8234 N N   . LEU B 1 524 ? 9.221   14.944  -22.042 1.00 56.69  ? 524  LEU B N   1 
ATOM   8235 C CA  . LEU B 1 524 ? 9.027   13.648  -22.686 1.00 57.44  ? 524  LEU B CA  1 
ATOM   8236 C C   . LEU B 1 524 ? 10.060  12.721  -22.073 1.00 57.45  ? 524  LEU B C   1 
ATOM   8237 O O   . LEU B 1 524 ? 11.212  12.679  -22.537 1.00 57.86  ? 524  LEU B O   1 
ATOM   8238 C CB  . LEU B 1 524 ? 9.288   13.846  -24.181 1.00 57.16  ? 524  LEU B CB  1 
ATOM   8239 C CG  . LEU B 1 524 ? 8.628   13.126  -25.337 1.00 58.68  ? 524  LEU B CG  1 
ATOM   8240 C CD1 . LEU B 1 524 ? 7.129   12.911  -25.140 1.00 59.48  ? 524  LEU B CD1 1 
ATOM   8241 C CD2 . LEU B 1 524 ? 8.936   14.014  -26.594 1.00 57.52  ? 524  LEU B CD2 1 
ATOM   8242 N N   . ARG B 1 525 ? 9.696   12.040  -20.990 1.00 57.67  ? 525  ARG B N   1 
ATOM   8243 C CA  . ARG B 1 525 ? 10.655  11.176  -20.295 1.00 58.21  ? 525  ARG B CA  1 
ATOM   8244 C C   . ARG B 1 525 ? 11.985  11.879  -19.992 1.00 57.16  ? 525  ARG B C   1 
ATOM   8245 O O   . ARG B 1 525 ? 13.059  11.342  -20.263 1.00 56.82  ? 525  ARG B O   1 
ATOM   8246 C CB  . ARG B 1 525 ? 10.943  9.953   -21.166 1.00 58.29  ? 525  ARG B CB  1 
ATOM   8247 C CG  . ARG B 1 525 ? 10.596  8.645   -20.546 1.00 62.36  ? 525  ARG B CG  1 
ATOM   8248 C CD  . ARG B 1 525 ? 9.267   8.148   -20.999 1.00 67.00  ? 525  ARG B CD  1 
ATOM   8249 N NE  . ARG B 1 525 ? 9.287   6.699   -21.088 1.00 70.05  ? 525  ARG B NE  1 
ATOM   8250 C CZ  . ARG B 1 525 ? 8.265   5.957   -21.505 1.00 72.40  ? 525  ARG B CZ  1 
ATOM   8251 N NH1 . ARG B 1 525 ? 7.112   6.530   -21.870 1.00 73.60  ? 525  ARG B NH1 1 
ATOM   8252 N NH2 . ARG B 1 525 ? 8.399   4.633   -21.552 1.00 72.18  ? 525  ARG B NH2 1 
ATOM   8253 N N   . ALA B 1 526 ? 11.919  13.068  -19.409 1.00 56.67  ? 526  ALA B N   1 
ATOM   8254 C CA  . ALA B 1 526 ? 13.074  13.955  -19.381 1.00 56.14  ? 526  ALA B CA  1 
ATOM   8255 C C   . ALA B 1 526 ? 14.259  13.372  -18.632 1.00 56.20  ? 526  ALA B C   1 
ATOM   8256 O O   . ALA B 1 526 ? 15.364  13.439  -19.144 1.00 56.43  ? 526  ALA B O   1 
ATOM   8257 C CB  . ALA B 1 526 ? 12.697  15.339  -18.845 1.00 56.16  ? 526  ALA B CB  1 
ATOM   8258 N N   . GLN B 1 527 ? 14.045  12.783  -17.453 1.00 56.38  ? 527  GLN B N   1 
ATOM   8259 C CA  . GLN B 1 527 ? 15.175  12.267  -16.651 1.00 57.17  ? 527  GLN B CA  1 
ATOM   8260 C C   . GLN B 1 527 ? 15.808  11.064  -17.334 1.00 56.30  ? 527  GLN B C   1 
ATOM   8261 O O   . GLN B 1 527 ? 17.030  10.949  -17.423 1.00 56.13  ? 527  GLN B O   1 
ATOM   8262 C CB  . GLN B 1 527 ? 14.752  11.856  -15.225 1.00 58.19  ? 527  GLN B CB  1 
ATOM   8263 C CG  . GLN B 1 527 ? 14.413  12.988  -14.268 1.00 60.30  ? 527  GLN B CG  1 
ATOM   8264 C CD  . GLN B 1 527 ? 15.452  14.109  -14.244 1.00 64.02  ? 527  GLN B CD  1 
ATOM   8265 O OE1 . GLN B 1 527 ? 15.200  15.199  -14.779 1.00 65.87  ? 527  GLN B OE1 1 
ATOM   8266 N NE2 . GLN B 1 527 ? 16.622  13.857  -13.613 1.00 64.80  ? 527  GLN B NE2 1 
ATOM   8267 N N   . THR B 1 528 ? 14.962  10.162  -17.808 1.00 55.16  ? 528  THR B N   1 
ATOM   8268 C CA  . THR B 1 528 ? 15.444  8.963   -18.467 1.00 54.69  ? 528  THR B CA  1 
ATOM   8269 C C   . THR B 1 528 ? 16.116  9.283   -19.783 1.00 53.80  ? 528  THR B C   1 
ATOM   8270 O O   . THR B 1 528 ? 17.122  8.664   -20.132 1.00 54.43  ? 528  THR B O   1 
ATOM   8271 C CB  . THR B 1 528 ? 14.315  7.946   -18.658 1.00 54.27  ? 528  THR B CB  1 
ATOM   8272 O OG1 . THR B 1 528 ? 13.973  7.428   -17.375 1.00 57.03  ? 528  THR B OG1 1 
ATOM   8273 C CG2 . THR B 1 528 ? 14.752  6.790   -19.553 1.00 53.31  ? 528  THR B CG2 1 
ATOM   8274 N N   . CYS B 1 529 ? 15.610  10.258  -20.521 1.00 52.76  ? 529  CYS B N   1 
ATOM   8275 C CA  . CYS B 1 529 ? 16.259  10.559  -21.795 1.00 52.67  ? 529  CYS B CA  1 
ATOM   8276 C C   . CYS B 1 529 ? 17.576  11.303  -21.584 1.00 52.84  ? 529  CYS B C   1 
ATOM   8277 O O   . CYS B 1 529 ? 18.464  11.199  -22.406 1.00 52.46  ? 529  CYS B O   1 
ATOM   8278 C CB  . CYS B 1 529 ? 15.302  11.228  -22.787 1.00 51.57  ? 529  CYS B CB  1 
ATOM   8279 S SG  . CYS B 1 529 ? 14.038  10.052  -23.391 1.00 54.36  ? 529  CYS B SG  1 
ATOM   8280 N N   . ALA B 1 530 ? 17.715  12.014  -20.468 1.00 53.94  ? 530  ALA B N   1 
ATOM   8281 C CA  . ALA B 1 530 ? 19.017  12.578  -20.058 1.00 54.63  ? 530  ALA B CA  1 
ATOM   8282 C C   . ALA B 1 530 ? 20.039  11.469  -19.831 1.00 55.41  ? 530  ALA B C   1 
ATOM   8283 O O   . ALA B 1 530 ? 21.211  11.622  -20.140 1.00 55.57  ? 530  ALA B O   1 
ATOM   8284 C CB  . ALA B 1 530 ? 18.866  13.404  -18.788 1.00 55.54  ? 530  ALA B CB  1 
ATOM   8285 N N   . PHE B 1 531 ? 19.583  10.344  -19.284 1.00 55.60  ? 531  PHE B N   1 
ATOM   8286 C CA  . PHE B 1 531 ? 20.447  9.186   -19.099 1.00 56.09  ? 531  PHE B CA  1 
ATOM   8287 C C   . PHE B 1 531 ? 20.969  8.703   -20.461 1.00 55.86  ? 531  PHE B C   1 
ATOM   8288 O O   . PHE B 1 531 ? 22.173  8.584   -20.661 1.00 56.35  ? 531  PHE B O   1 
ATOM   8289 C CB  . PHE B 1 531 ? 19.692  8.075   -18.354 1.00 55.89  ? 531  PHE B CB  1 
ATOM   8290 C CG  . PHE B 1 531 ? 20.383  6.749   -18.368 1.00 55.31  ? 531  PHE B CG  1 
ATOM   8291 C CD1 . PHE B 1 531 ? 21.439  6.497   -17.521 1.00 57.29  ? 531  PHE B CD1 1 
ATOM   8292 C CD2 . PHE B 1 531 ? 19.952  5.743   -19.211 1.00 55.62  ? 531  PHE B CD2 1 
ATOM   8293 C CE1 . PHE B 1 531 ? 22.077  5.272   -17.525 1.00 57.97  ? 531  PHE B CE1 1 
ATOM   8294 C CE2 . PHE B 1 531 ? 20.579  4.505   -19.229 1.00 57.13  ? 531  PHE B CE2 1 
ATOM   8295 C CZ  . PHE B 1 531 ? 21.640  4.267   -18.382 1.00 57.47  ? 531  PHE B CZ  1 
ATOM   8296 N N   . TRP B 1 532 ? 20.054  8.481   -21.398 1.00 55.17  ? 532  TRP B N   1 
ATOM   8297 C CA  . TRP B 1 532 ? 20.398  7.927   -22.706 1.00 55.20  ? 532  TRP B CA  1 
ATOM   8298 C C   . TRP B 1 532 ? 21.153  8.928   -23.567 1.00 55.92  ? 532  TRP B C   1 
ATOM   8299 O O   . TRP B 1 532 ? 22.110  8.552   -24.223 1.00 56.53  ? 532  TRP B O   1 
ATOM   8300 C CB  . TRP B 1 532 ? 19.158  7.446   -23.467 1.00 53.39  ? 532  TRP B CB  1 
ATOM   8301 C CG  . TRP B 1 532 ? 18.538  6.193   -22.944 1.00 53.06  ? 532  TRP B CG  1 
ATOM   8302 C CD1 . TRP B 1 532 ? 17.408  6.098   -22.200 1.00 52.29  ? 532  TRP B CD1 1 
ATOM   8303 C CD2 . TRP B 1 532 ? 18.994  4.856   -23.149 1.00 51.85  ? 532  TRP B CD2 1 
ATOM   8304 N NE1 . TRP B 1 532 ? 17.139  4.788   -21.912 1.00 52.61  ? 532  TRP B NE1 1 
ATOM   8305 C CE2 . TRP B 1 532 ? 18.098  4.003   -22.485 1.00 52.24  ? 532  TRP B CE2 1 
ATOM   8306 C CE3 . TRP B 1 532 ? 20.085  4.295   -23.815 1.00 53.90  ? 532  TRP B CE3 1 
ATOM   8307 C CZ2 . TRP B 1 532 ? 18.247  2.618   -22.475 1.00 53.07  ? 532  TRP B CZ2 1 
ATOM   8308 C CZ3 . TRP B 1 532 ? 20.239  2.914   -23.798 1.00 53.88  ? 532  TRP B CZ3 1 
ATOM   8309 C CH2 . TRP B 1 532 ? 19.326  2.096   -23.129 1.00 53.91  ? 532  TRP B CH2 1 
ATOM   8310 N N   . ASN B 1 533 ? 20.738  10.191  -23.546 1.00 56.59  ? 533  ASN B N   1 
ATOM   8311 C CA  . ASN B 1 533 ? 21.278  11.205  -24.462 1.00 57.34  ? 533  ASN B CA  1 
ATOM   8312 C C   . ASN B 1 533 ? 22.477  11.951  -23.962 1.00 59.58  ? 533  ASN B C   1 
ATOM   8313 O O   . ASN B 1 533 ? 23.250  12.465  -24.764 1.00 60.58  ? 533  ASN B O   1 
ATOM   8314 C CB  . ASN B 1 533 ? 20.196  12.211  -24.846 1.00 56.73  ? 533  ASN B CB  1 
ATOM   8315 C CG  . ASN B 1 533 ? 19.061  11.560  -25.599 1.00 54.71  ? 533  ASN B CG  1 
ATOM   8316 O OD1 . ASN B 1 533 ? 19.252  10.508  -26.181 1.00 54.22  ? 533  ASN B OD1 1 
ATOM   8317 N ND2 . ASN B 1 533 ? 17.880  12.173  -25.584 1.00 51.42  ? 533  ASN B ND2 1 
ATOM   8318 N N   . ARG B 1 534 ? 22.642  12.039  -22.649 1.00 61.28  ? 534  ARG B N   1 
ATOM   8319 C CA  . ARG B 1 534 ? 23.732  12.821  -22.095 1.00 63.09  ? 534  ARG B CA  1 
ATOM   8320 C C   . ARG B 1 534 ? 24.730  12.000  -21.337 1.00 64.45  ? 534  ARG B C   1 
ATOM   8321 O O   . ARG B 1 534 ? 25.932  12.251  -21.446 1.00 66.10  ? 534  ARG B O   1 
ATOM   8322 C CB  . ARG B 1 534 ? 23.197  13.920  -21.191 1.00 63.68  ? 534  ARG B CB  1 
ATOM   8323 C CG  . ARG B 1 534 ? 22.193  14.803  -21.877 1.00 63.81  ? 534  ARG B CG  1 
ATOM   8324 C CD  . ARG B 1 534 ? 21.865  15.965  -21.034 1.00 66.21  ? 534  ARG B CD  1 
ATOM   8325 N NE  . ARG B 1 534 ? 20.700  16.659  -21.565 1.00 67.68  ? 534  ARG B NE  1 
ATOM   8326 C CZ  . ARG B 1 534 ? 20.689  17.926  -21.988 1.00 68.38  ? 534  ARG B CZ  1 
ATOM   8327 N NH1 . ARG B 1 534 ? 21.777  18.702  -21.907 1.00 68.16  ? 534  ARG B NH1 1 
ATOM   8328 N NH2 . ARG B 1 534 ? 19.548  18.431  -22.456 1.00 67.43  ? 534  ARG B NH2 1 
ATOM   8329 N N   . PHE B 1 535 ? 24.257  11.034  -20.555 1.00 64.62  ? 535  PHE B N   1 
ATOM   8330 C CA  . PHE B 1 535 ? 25.174  10.248  -19.745 1.00 65.87  ? 535  PHE B CA  1 
ATOM   8331 C C   . PHE B 1 535 ? 25.857  9.141   -20.534 1.00 66.91  ? 535  PHE B C   1 
ATOM   8332 O O   . PHE B 1 535 ? 27.078  9.043   -20.516 1.00 67.99  ? 535  PHE B O   1 
ATOM   8333 C CB  . PHE B 1 535 ? 24.531  9.657   -18.489 1.00 64.92  ? 535  PHE B CB  1 
ATOM   8334 C CG  . PHE B 1 535 ? 25.479  8.797   -17.719 1.00 65.04  ? 535  PHE B CG  1 
ATOM   8335 C CD1 . PHE B 1 535 ? 26.583  9.360   -17.117 1.00 65.37  ? 535  PHE B CD1 1 
ATOM   8336 C CD2 . PHE B 1 535 ? 25.312  7.418   -17.661 1.00 64.69  ? 535  PHE B CD2 1 
ATOM   8337 C CE1 . PHE B 1 535 ? 27.492  8.585   -16.439 1.00 67.33  ? 535  PHE B CE1 1 
ATOM   8338 C CE2 . PHE B 1 535 ? 26.222  6.627   -16.974 1.00 65.95  ? 535  PHE B CE2 1 
ATOM   8339 C CZ  . PHE B 1 535 ? 27.310  7.212   -16.363 1.00 67.36  ? 535  PHE B CZ  1 
ATOM   8340 N N   . LEU B 1 536 ? 25.092  8.292   -21.202 1.00 67.00  ? 536  LEU B N   1 
ATOM   8341 C CA  . LEU B 1 536 ? 25.698  7.130   -21.840 1.00 68.91  ? 536  LEU B CA  1 
ATOM   8342 C C   . LEU B 1 536 ? 26.735  7.488   -22.927 1.00 70.41  ? 536  LEU B C   1 
ATOM   8343 O O   . LEU B 1 536 ? 27.768  6.822   -23.033 1.00 72.06  ? 536  LEU B O   1 
ATOM   8344 C CB  . LEU B 1 536 ? 24.633  6.160   -22.362 1.00 67.54  ? 536  LEU B CB  1 
ATOM   8345 C CG  . LEU B 1 536 ? 23.991  5.192   -21.357 1.00 66.85  ? 536  LEU B CG  1 
ATOM   8346 C CD1 . LEU B 1 536 ? 23.177  4.154   -22.114 1.00 64.87  ? 536  LEU B CD1 1 
ATOM   8347 C CD2 . LEU B 1 536 ? 25.009  4.494   -20.452 1.00 66.89  ? 536  LEU B CD2 1 
ATOM   8348 N N   . PRO B 1 537 ? 26.470  8.523   -23.741 1.00 71.03  ? 537  PRO B N   1 
ATOM   8349 C CA  . PRO B 1 537 ? 27.505  9.069   -24.635 1.00 72.45  ? 537  PRO B CA  1 
ATOM   8350 C C   . PRO B 1 537 ? 28.802  9.469   -23.924 1.00 75.93  ? 537  PRO B C   1 
ATOM   8351 O O   . PRO B 1 537 ? 29.893  9.125   -24.400 1.00 77.36  ? 537  PRO B O   1 
ATOM   8352 C CB  . PRO B 1 537 ? 26.823  10.304  -25.234 1.00 71.62  ? 537  PRO B CB  1 
ATOM   8353 C CG  . PRO B 1 537 ? 25.393  9.960   -25.220 1.00 69.80  ? 537  PRO B CG  1 
ATOM   8354 C CD  . PRO B 1 537 ? 25.182  9.204   -23.943 1.00 69.61  ? 537  PRO B CD  1 
ATOM   8355 N N   . LYS B 1 538 ? 28.680  10.191  -22.805 1.00 77.97  ? 538  LYS B N   1 
ATOM   8356 C CA  . LYS B 1 538 ? 29.838  10.541  -21.967 1.00 81.00  ? 538  LYS B CA  1 
ATOM   8357 C C   . LYS B 1 538 ? 30.537  9.317   -21.417 1.00 83.13  ? 538  LYS B C   1 
ATOM   8358 O O   . LYS B 1 538 ? 31.749  9.336   -21.217 1.00 85.15  ? 538  LYS B O   1 
ATOM   8359 C CB  . LYS B 1 538 ? 29.440  11.440  -20.796 1.00 81.05  ? 538  LYS B CB  1 
ATOM   8360 C CG  . LYS B 1 538 ? 29.191  12.868  -21.194 1.00 81.64  ? 538  LYS B CG  1 
ATOM   8361 C CD  . LYS B 1 538 ? 28.912  13.751  -20.000 1.00 82.55  ? 538  LYS B CD  1 
ATOM   8362 C CE  . LYS B 1 538 ? 28.258  15.067  -20.443 1.00 84.20  ? 538  LYS B CE  1 
ATOM   8363 N NZ  . LYS B 1 538 ? 28.618  16.235  -19.562 1.00 85.73  ? 538  LYS B NZ  1 
ATOM   8364 N N   . LEU B 1 539 ? 29.780  8.259   -21.159 1.00 83.94  ? 539  LEU B N   1 
ATOM   8365 C CA  . LEU B 1 539 ? 30.344  7.063   -20.558 1.00 86.19  ? 539  LEU B CA  1 
ATOM   8366 C C   . LEU B 1 539 ? 31.276  6.385   -21.539 1.00 88.67  ? 539  LEU B C   1 
ATOM   8367 O O   . LEU B 1 539 ? 32.462  6.257   -21.286 1.00 90.56  ? 539  LEU B O   1 
ATOM   8368 C CB  . LEU B 1 539 ? 29.241  6.094   -20.106 1.00 85.25  ? 539  LEU B CB  1 
ATOM   8369 C CG  . LEU B 1 539 ? 29.669  4.733   -19.545 1.00 85.61  ? 539  LEU B CG  1 
ATOM   8370 C CD1 . LEU B 1 539 ? 30.770  4.879   -18.505 1.00 86.83  ? 539  LEU B CD1 1 
ATOM   8371 C CD2 . LEU B 1 539 ? 28.462  4.017   -18.963 1.00 84.83  ? 539  LEU B CD2 1 
ATOM   8372 N N   . LEU B 1 540 ? 30.748  5.965   -22.676 1.00 89.71  ? 540  LEU B N   1 
ATOM   8373 C CA  . LEU B 1 540 ? 31.533  5.134   -23.587 1.00 92.11  ? 540  LEU B CA  1 
ATOM   8374 C C   . LEU B 1 540 ? 32.564  5.936   -24.418 1.00 93.72  ? 540  LEU B C   1 
ATOM   8375 O O   . LEU B 1 540 ? 33.468  5.343   -25.003 1.00 95.21  ? 540  LEU B O   1 
ATOM   8376 C CB  . LEU B 1 540 ? 30.599  4.260   -24.444 1.00 90.71  ? 540  LEU B CB  1 
ATOM   8377 C CG  . LEU B 1 540 ? 29.736  3.241   -23.663 1.00 89.95  ? 540  LEU B CG  1 
ATOM   8378 C CD1 . LEU B 1 540 ? 29.073  2.225   -24.634 1.00 88.85  ? 540  LEU B CD1 1 
ATOM   8379 C CD2 . LEU B 1 540 ? 30.528  2.518   -22.582 1.00 88.08  ? 540  LEU B CD2 1 
ATOM   8380 N N   . SER B 1 541 ? 32.456  7.268   -24.426 1.00 94.29  ? 541  SER B N   1 
ATOM   8381 C CA  . SER B 1 541 ? 33.491  8.128   -25.017 1.00 96.03  ? 541  SER B CA  1 
ATOM   8382 C C   . SER B 1 541 ? 34.622  8.482   -24.031 1.00 99.43  ? 541  SER B C   1 
ATOM   8383 O O   . SER B 1 541 ? 35.566  9.182   -24.393 1.00 100.73 ? 541  SER B O   1 
ATOM   8384 C CB  . SER B 1 541 ? 32.873  9.415   -25.578 1.00 95.25  ? 541  SER B CB  1 
ATOM   8385 O OG  . SER B 1 541 ? 32.763  10.416  -24.580 1.00 95.25  ? 541  SER B OG  1 
ATOM   8386 N N   . ALA B 1 542 ? 34.507  8.026   -22.788 1.00 101.15 ? 542  ALA B N   1 
ATOM   8387 C CA  . ALA B 1 542 ? 35.584  8.124   -21.809 1.00 104.50 ? 542  ALA B CA  1 
ATOM   8388 C C   . ALA B 1 542 ? 35.871  6.705   -21.303 1.00 106.03 ? 542  ALA B C   1 
ATOM   8389 O O   . ALA B 1 542 ? 36.857  6.086   -21.717 1.00 107.73 ? 542  ALA B O   1 
ATOM   8390 C CB  . ALA B 1 542 ? 35.186  9.059   -20.667 1.00 104.17 ? 542  ALA B CB  1 
ATOM   8391 N N   . THR B 1 543 ? 34.992  6.208   -20.418 1.00 88.76  ? 543  THR B N   1 
ATOM   8392 C CA  . THR B 1 543 ? 34.877  4.770   -20.016 1.00 89.09  ? 543  THR B CA  1 
ATOM   8393 C C   . THR B 1 543 ? 35.736  4.377   -18.771 1.00 89.79  ? 543  THR B C   1 
ATOM   8394 O O   . THR B 1 543 ? 35.420  3.404   -18.053 1.00 90.09  ? 543  THR B O   1 
ATOM   8395 C CB  . THR B 1 543 ? 35.108  3.761   -21.224 1.00 89.29  ? 543  THR B CB  1 
ATOM   8396 O OG1 . THR B 1 543 ? 34.853  4.402   -22.483 1.00 89.29  ? 543  THR B OG1 1 
ATOM   8397 C CG2 . THR B 1 543 ? 34.196  2.527   -21.095 1.00 89.65  ? 543  THR B CG2 1 
ATOM   8398 O OXT . THR B 1 543 ? 36.754  5.010   -18.431 1.00 90.00  ? 543  THR B OXT 1 
HETATM 8399 C C1  . NAG C 2 .   ? 24.534  34.958  -1.043  1.00 82.88  ? 1    NAG C C1  1 
HETATM 8400 C C2  . NAG C 2 .   ? 24.748  35.634  -2.412  1.00 88.34  ? 1    NAG C C2  1 
HETATM 8401 C C3  . NAG C 2 .   ? 26.003  35.091  -3.119  1.00 89.83  ? 1    NAG C C3  1 
HETATM 8402 C C4  . NAG C 2 .   ? 27.225  35.152  -2.215  1.00 90.95  ? 1    NAG C C4  1 
HETATM 8403 C C5  . NAG C 2 .   ? 26.890  34.600  -0.828  1.00 88.70  ? 1    NAG C C5  1 
HETATM 8404 C C6  . NAG C 2 .   ? 28.035  34.738  0.181   1.00 89.02  ? 1    NAG C C6  1 
HETATM 8405 C C7  . NAG C 2 .   ? 22.999  36.699  -3.737  1.00 90.62  ? 1    NAG C C7  1 
HETATM 8406 C C8  . NAG C 2 .   ? 22.707  36.727  -5.213  1.00 90.61  ? 1    NAG C C8  1 
HETATM 8407 N N2  . NAG C 2 .   ? 23.562  35.574  -3.270  1.00 89.08  ? 1    NAG C N2  1 
HETATM 8408 O O3  . NAG C 2 .   ? 26.297  35.791  -4.311  1.00 90.22  ? 1    NAG C O3  1 
HETATM 8409 O O4  . NAG C 2 .   ? 28.195  34.280  -2.765  1.00 96.08  ? 1    NAG C O4  1 
HETATM 8410 O O5  . NAG C 2 .   ? 25.715  35.170  -0.283  1.00 85.06  ? 1    NAG C O5  1 
HETATM 8411 O O6  . NAG C 2 .   ? 28.833  35.872  -0.067  1.00 88.85  ? 1    NAG C O6  1 
HETATM 8412 O O7  . NAG C 2 .   ? 22.730  37.673  -3.016  1.00 90.69  ? 1    NAG C O7  1 
HETATM 8413 C C1  . NAG C 2 .   ? 29.179  34.873  -3.652  1.00 99.37  ? 2    NAG C C1  1 
HETATM 8414 C C2  . NAG C 2 .   ? 30.466  34.038  -3.562  1.00 100.31 ? 2    NAG C C2  1 
HETATM 8415 C C3  . NAG C 2 .   ? 31.534  34.468  -4.570  1.00 100.77 ? 2    NAG C C3  1 
HETATM 8416 C C4  . NAG C 2 .   ? 30.976  34.888  -5.938  1.00 100.92 ? 2    NAG C C4  1 
HETATM 8417 C C5  . NAG C 2 .   ? 29.645  35.646  -5.839  1.00 100.71 ? 2    NAG C C5  1 
HETATM 8418 C C6  . NAG C 2 .   ? 29.013  35.933  -7.210  1.00 100.38 ? 2    NAG C C6  1 
HETATM 8419 C C7  . NAG C 2 .   ? 31.217  33.007  -1.448  1.00 101.58 ? 2    NAG C C7  1 
HETATM 8420 C C8  . NAG C 2 .   ? 32.629  32.765  -0.974  1.00 101.80 ? 2    NAG C C8  1 
HETATM 8421 N N2  . NAG C 2 .   ? 31.029  34.094  -2.214  1.00 101.39 ? 2    NAG C N2  1 
HETATM 8422 O O3  . NAG C 2 .   ? 32.446  33.395  -4.731  1.00 101.50 ? 2    NAG C O3  1 
HETATM 8423 O O4  . NAG C 2 .   ? 31.931  35.698  -6.600  1.00 101.08 ? 2    NAG C O4  1 
HETATM 8424 O O5  . NAG C 2 .   ? 28.739  34.936  -5.003  1.00 100.19 ? 2    NAG C O5  1 
HETATM 8425 O O6  . NAG C 2 .   ? 28.627  34.762  -7.896  1.00 99.01  ? 2    NAG C O6  1 
HETATM 8426 O O7  . NAG C 2 .   ? 30.305  32.237  -1.124  1.00 100.43 ? 2    NAG C O7  1 
HETATM 8427 C C1  . FUC D 3 .   ? 27.626  37.290  2.377   1.00 138.89 ? 2502 FUC A C1  1 
HETATM 8428 C C2  . FUC D 3 .   ? 28.529  38.336  1.724   1.00 139.14 ? 2502 FUC A C2  1 
HETATM 8429 C C3  . FUC D 3 .   ? 27.942  38.789  0.389   1.00 139.29 ? 2502 FUC A C3  1 
HETATM 8430 C C4  . FUC D 3 .   ? 26.482  39.204  0.558   1.00 139.23 ? 2502 FUC A C4  1 
HETATM 8431 C C5  . FUC D 3 .   ? 25.710  38.077  1.237   1.00 138.89 ? 2502 FUC A C5  1 
HETATM 8432 C C6  . FUC D 3 .   ? 24.237  38.432  1.416   1.00 138.84 ? 2502 FUC A C6  1 
HETATM 8433 O O2  . FUC D 3 .   ? 29.827  37.817  1.530   1.00 138.99 ? 2502 FUC A O2  1 
HETATM 8434 O O3  . FUC D 3 .   ? 28.721  39.830  -0.156  1.00 139.26 ? 2502 FUC A O3  1 
HETATM 8435 O O4  . FUC D 3 .   ? 26.394  40.379  1.335   1.00 139.32 ? 2502 FUC A O4  1 
HETATM 8436 O O5  . FUC D 3 .   ? 26.301  37.777  2.486   1.00 138.75 ? 2502 FUC A O5  1 
HETATM 8437 C C1  . NAG E 4 .   ? 11.972  33.461  25.336  1.00 86.07  ? 701  NAG A C1  1 
HETATM 8438 C C2  . NAG E 4 .   ? 13.286  34.268  25.302  1.00 90.85  ? 701  NAG A C2  1 
HETATM 8439 C C3  . NAG E 4 .   ? 13.261  35.442  26.303  1.00 92.47  ? 701  NAG A C3  1 
HETATM 8440 C C4  . NAG E 4 .   ? 11.956  36.231  26.121  1.00 92.87  ? 701  NAG A C4  1 
HETATM 8441 C C5  . NAG E 4 .   ? 10.811  35.247  26.415  1.00 92.68  ? 701  NAG A C5  1 
HETATM 8442 C C6  . NAG E 4 .   ? 9.419   35.870  26.654  1.00 93.37  ? 701  NAG A C6  1 
HETATM 8443 C C7  . NAG E 4 .   ? 14.972  32.583  24.649  1.00 91.82  ? 701  NAG A C7  1 
HETATM 8444 C C8  . NAG E 4 .   ? 15.749  31.402  25.167  1.00 91.59  ? 701  NAG A C8  1 
HETATM 8445 N N2  . NAG E 4 .   ? 14.438  33.400  25.565  1.00 91.39  ? 701  NAG A N2  1 
HETATM 8446 O O3  . NAG E 4 .   ? 14.410  36.270  26.194  1.00 93.54  ? 701  NAG A O3  1 
HETATM 8447 O O4  . NAG E 4 .   ? 11.922  37.391  26.934  1.00 94.21  ? 701  NAG A O4  1 
HETATM 8448 O O5  . NAG E 4 .   ? 10.815  34.293  25.353  1.00 88.82  ? 701  NAG A O5  1 
HETATM 8449 O O6  . NAG E 4 .   ? 9.064   36.852  25.699  1.00 94.63  ? 701  NAG A O6  1 
HETATM 8450 O O7  . NAG E 4 .   ? 14.855  32.758  23.434  1.00 92.07  ? 701  NAG A O7  1 
HETATM 8451 O O13 A SCK F 5 .   ? 30.867  23.033  11.853  0.50 89.96  ? 901  SCK A O13 1 
HETATM 8452 C C12 A SCK F 5 .   ? 29.863  22.352  11.743  0.50 87.39  ? 901  SCK A C12 1 
HETATM 8453 O O14 A SCK F 5 .   ? 28.980  22.207  12.882  0.50 88.04  ? 901  SCK A O14 1 
HETATM 8454 C C15 A SCK F 5 .   ? 28.621  20.906  13.325  0.50 87.15  ? 901  SCK A C15 1 
HETATM 8455 C C16 A SCK F 5 .   ? 27.326  20.993  14.114  0.50 86.97  ? 901  SCK A C16 1 
HETATM 8456 N N17 A SCK F 5 .   ? 26.850  19.630  14.360  0.50 87.16  ? 901  SCK A N17 1 
HETATM 8457 C C20 A SCK F 5 .   ? 27.620  19.025  15.450  0.50 87.00  ? 901  SCK A C20 1 
HETATM 8458 C C19 A SCK F 5 .   ? 25.431  19.667  14.719  0.50 86.98  ? 901  SCK A C19 1 
HETATM 8459 C C18 A SCK F 5 .   ? 27.031  18.839  13.141  0.50 87.46  ? 901  SCK A C18 1 
HETATM 8460 C C11 A SCK F 5 .   ? 29.536  21.672  10.440  0.50 84.77  ? 901  SCK A C11 1 
HETATM 8461 C C6  A SCK F 5 .   ? 30.412  22.266  9.352   0.50 81.93  ? 901  SCK A C6  1 
HETATM 8462 C C5  A SCK F 5 .   ? 31.777  21.644  9.439   0.50 81.40  ? 901  SCK A C5  1 
HETATM 8463 O O7  A SCK F 5 .   ? 31.898  20.442  9.573   0.50 81.41  ? 901  SCK A O7  1 
HETATM 8464 O O4  A SCK F 5 .   ? 32.962  22.473  9.366   0.50 80.77  ? 901  SCK A O4  1 
HETATM 8465 C C3  A SCK F 5 .   ? 34.155  21.943  8.801   0.50 80.20  ? 901  SCK A C3  1 
HETATM 8466 C C2  A SCK F 5 .   ? 34.990  23.074  8.218   0.50 79.21  ? 901  SCK A C2  1 
HETATM 8467 N N1  A SCK F 5 .   ? 35.794  23.676  9.280   0.50 78.58  ? 901  SCK A N1  1 
HETATM 8468 C C8  A SCK F 5 .   ? 36.464  22.612  10.032  0.50 77.97  ? 901  SCK A C8  1 
HETATM 8469 C C9  A SCK F 5 .   ? 36.793  24.573  8.697   0.50 78.08  ? 901  SCK A C9  1 
HETATM 8470 C C10 A SCK F 5 .   ? 34.925  24.443  10.173  0.50 78.61  ? 901  SCK A C10 1 
HETATM 8471 O O13 B SCU G 6 .   ? 30.776  19.243  11.305  0.50 82.52  ? 902  SCU A O13 1 
HETATM 8472 C C12 B SCU G 6 .   ? 29.937  18.850  12.101  0.50 80.64  ? 902  SCU A C12 1 
HETATM 8473 C C11 B SCU G 6 .   ? 29.112  17.603  11.868  0.50 78.12  ? 902  SCU A C11 1 
HETATM 8474 C C6  B SCU G 6 .   ? 29.895  16.347  11.510  0.50 76.30  ? 902  SCU A C6  1 
HETATM 8475 C C5  B SCU G 6 .   ? 29.375  15.298  12.461  0.50 72.90  ? 902  SCU A C5  1 
HETATM 8476 O O4  B SCU G 6 .   ? 30.028  15.077  13.477  0.50 72.47  ? 902  SCU A O4  1 
HETATM 8477 O O14 B SCU G 6 .   ? 29.692  19.642  13.305  0.50 82.03  ? 902  SCU A O14 1 
HETATM 8478 C C15 B SCU G 6 .   ? 28.735  20.700  13.224  0.50 80.95  ? 902  SCU A C15 1 
HETATM 8479 C C16 B SCU G 6 .   ? 27.649  20.782  14.308  0.50 80.48  ? 902  SCU A C16 1 
HETATM 8480 N N17 B SCU G 6 .   ? 26.930  19.520  14.564  0.50 79.85  ? 902  SCU A N17 1 
HETATM 8481 C C20 B SCU G 6 .   ? 27.620  18.825  15.661  0.50 78.94  ? 902  SCU A C20 1 
HETATM 8482 C C19 B SCU G 6 .   ? 25.541  19.772  14.955  0.50 79.70  ? 902  SCU A C19 1 
HETATM 8483 C C18 B SCU G 6 .   ? 26.822  18.710  13.351  0.50 79.74  ? 902  SCU A C18 1 
HETATM 8484 O O1  . P6G H 7 .   ? 15.471  5.559   -12.104 1.00 81.95  ? 1901 P6G A O1  1 
HETATM 8485 C C2  . P6G H 7 .   ? 16.492  6.539   -11.806 1.00 81.17  ? 1901 P6G A C2  1 
HETATM 8486 C C3  . P6G H 7 .   ? 18.041  6.425   -11.797 1.00 80.08  ? 1901 P6G A C3  1 
HETATM 8487 O O4  . P6G H 7 .   ? 18.698  5.950   -10.458 1.00 78.83  ? 1901 P6G A O4  1 
HETATM 8488 C C5  . P6G H 7 .   ? 18.578  4.555   -10.126 1.00 76.64  ? 1901 P6G A C5  1 
HETATM 8489 C C6  . P6G H 7 .   ? 19.913  4.058   -10.235 1.00 76.15  ? 1901 P6G A C6  1 
HETATM 8490 O O7  . P6G H 7 .   ? 20.795  4.708   -11.318 1.00 74.74  ? 1901 P6G A O7  1 
HETATM 8491 C C8  . P6G H 7 .   ? 22.060  4.041   -11.507 1.00 72.30  ? 1901 P6G A C8  1 
HETATM 8492 C C9  . P6G H 7 .   ? 22.578  4.315   -12.932 1.00 70.21  ? 1901 P6G A C9  1 
HETATM 8493 O O10 . P6G H 7 .   ? 22.640  5.861   -13.384 1.00 69.06  ? 1901 P6G A O10 1 
HETATM 8494 C C11 . P6G H 7 .   ? 23.823  6.211   -14.095 1.00 67.10  ? 1901 P6G A C11 1 
HETATM 8495 C C12 . P6G H 7 .   ? 24.003  7.641   -14.119 1.00 68.10  ? 1901 P6G A C12 1 
HETATM 8496 O O13 . P6G H 7 .   ? 22.742  8.549   -14.365 1.00 69.46  ? 1901 P6G A O13 1 
HETATM 8497 C C14 . P6G H 7 .   ? 23.033  9.865   -14.941 1.00 69.67  ? 1901 P6G A C14 1 
HETATM 8498 C C15 . P6G H 7 .   ? 21.882  10.524  -15.540 1.00 68.63  ? 1901 P6G A C15 1 
HETATM 8499 O O16 . P6G H 7 .   ? 20.523  10.207  -14.834 1.00 70.08  ? 1901 P6G A O16 1 
HETATM 8500 C C17 . P6G H 7 .   ? 19.440  11.151  -14.963 1.00 68.91  ? 1901 P6G A C17 1 
HETATM 8501 C C18 . P6G H 7 .   ? 18.259  10.458  -14.594 1.00 69.15  ? 1901 P6G A C18 1 
HETATM 8502 O O19 . P6G H 7 .   ? 18.081  10.023  -13.070 1.00 68.75  ? 1901 P6G A O19 1 
HETATM 8503 C C1  . NAG I 4 .   ? 6.189   -17.968 -21.962 1.00 87.26  ? 601  NAG B C1  1 
HETATM 8504 C C2  . NAG I 4 .   ? 7.083   -18.843 -21.047 1.00 91.89  ? 601  NAG B C2  1 
HETATM 8505 C C3  . NAG I 4 .   ? 8.499   -18.950 -21.646 1.00 92.61  ? 601  NAG B C3  1 
HETATM 8506 C C4  . NAG I 4 .   ? 8.426   -19.614 -23.022 1.00 92.45  ? 601  NAG B C4  1 
HETATM 8507 C C5  . NAG I 4 .   ? 7.476   -18.807 -23.919 1.00 91.45  ? 601  NAG B C5  1 
HETATM 8508 C C6  . NAG I 4 .   ? 7.247   -19.479 -25.296 1.00 91.98  ? 601  NAG B C6  1 
HETATM 8509 C C7  . NAG I 4 .   ? 6.446   -18.857 -18.636 1.00 95.62  ? 601  NAG B C7  1 
HETATM 8510 C C8  . NAG I 4 .   ? 7.064   -18.743 -17.263 1.00 95.70  ? 601  NAG B C8  1 
HETATM 8511 N N2  . NAG I 4 .   ? 7.173   -18.367 -19.660 1.00 93.93  ? 601  NAG B N2  1 
HETATM 8512 O O3  . NAG I 4 .   ? 9.399   -19.654 -20.800 1.00 93.52  ? 601  NAG B O3  1 
HETATM 8513 O O4  . NAG I 4 .   ? 9.715   -19.753 -23.604 1.00 92.30  ? 601  NAG B O4  1 
HETATM 8514 O O5  . NAG I 4 .   ? 6.221   -18.516 -23.282 1.00 89.40  ? 601  NAG B O5  1 
HETATM 8515 O O6  . NAG I 4 .   ? 6.879   -20.853 -25.260 1.00 91.00  ? 601  NAG B O6  1 
HETATM 8516 O O7  . NAG I 4 .   ? 5.326   -19.373 -18.759 1.00 96.19  ? 601  NAG B O7  1 
HETATM 8517 O O13 A SCK J 5 .   ? 8.008   -8.097  -36.847 0.50 92.24  ? 951  SCK B O13 1 
HETATM 8518 C C12 A SCK J 5 .   ? 8.061   -6.879  -36.716 0.50 89.50  ? 951  SCK B C12 1 
HETATM 8519 O O14 A SCK J 5 .   ? 7.296   -6.085  -37.671 0.50 89.90  ? 951  SCK B O14 1 
HETATM 8520 C C15 A SCK J 5 .   ? 6.100   -5.393  -37.302 0.50 89.67  ? 951  SCK B C15 1 
HETATM 8521 C C16 A SCK J 5 .   ? 5.736   -4.353  -38.364 0.50 90.00  ? 951  SCK B C16 1 
HETATM 8522 N N17 A SCK J 5 .   ? 5.463   -3.000  -37.833 0.50 90.44  ? 951  SCK B N17 1 
HETATM 8523 C C20 A SCK J 5 .   ? 5.342   -2.058  -38.959 0.50 90.22  ? 951  SCK B C20 1 
HETATM 8524 C C19 A SCK J 5 .   ? 4.225   -3.015  -37.044 0.50 90.45  ? 951  SCK B C19 1 
HETATM 8525 C C18 A SCK J 5 .   ? 6.515   -2.508  -36.942 0.50 90.86  ? 951  SCK B C18 1 
HETATM 8526 C C11 A SCK J 5 .   ? 8.881   -6.225  -35.608 0.50 87.08  ? 951  SCK B C11 1 
HETATM 8527 C C6  A SCK J 5 .   ? 10.049  -7.095  -35.141 0.50 83.49  ? 951  SCK B C6  1 
HETATM 8528 C C5  A SCK J 5 .   ? 11.225  -7.009  -36.078 0.50 84.70  ? 951  SCK B C5  1 
HETATM 8529 O O7  A SCK J 5 .   ? 11.666  -5.926  -36.424 0.50 83.50  ? 951  SCK B O7  1 
HETATM 8530 O O4  A SCK J 5 .   ? 11.839  -8.240  -36.562 0.50 85.63  ? 951  SCK B O4  1 
HETATM 8531 C C3  A SCK J 5 .   ? 12.892  -8.225  -37.532 0.50 86.09  ? 951  SCK B C3  1 
HETATM 8532 C C2  A SCK J 5 .   ? 13.830  -9.411  -37.297 0.50 86.50  ? 951  SCK B C2  1 
HETATM 8533 N N1  A SCK J 5 .   ? 13.438  -10.612 -38.053 0.50 86.19  ? 951  SCK B N1  1 
HETATM 8534 C C8  A SCK J 5 .   ? 12.027  -10.950 -37.807 0.50 86.17  ? 951  SCK B C8  1 
HETATM 8535 C C9  A SCK J 5 .   ? 13.639  -10.365 -39.481 0.50 86.34  ? 951  SCK B C9  1 
HETATM 8536 C C10 A SCK J 5 .   ? 14.297  -11.739 -37.657 0.50 85.99  ? 951  SCK B C10 1 
HETATM 8537 O O13 B SCU K 6 .   ? 10.640  -3.844  -37.463 0.50 85.09  ? 952  SCU B O13 1 
HETATM 8538 C C12 B SCU K 6 .   ? 9.571   -3.263  -37.547 0.50 83.70  ? 952  SCU B C12 1 
HETATM 8539 C C11 B SCU K 6 .   ? 9.423   -1.756  -37.579 0.50 80.62  ? 952  SCU B C11 1 
HETATM 8540 C C6  B SCU K 6 .   ? 10.711  -0.975  -37.510 0.50 78.22  ? 952  SCU B C6  1 
HETATM 8541 C C5  B SCU K 6 .   ? 10.287  0.413   -37.894 0.50 74.52  ? 952  SCU B C5  1 
HETATM 8542 O O4  B SCU K 6 .   ? 10.355  0.643   -39.091 0.50 73.92  ? 952  SCU B O4  1 
HETATM 8543 O O14 B SCU K 6 .   ? 8.370   -4.069  -37.615 0.50 86.06  ? 952  SCU B O14 1 
HETATM 8544 C C15 B SCU K 6 .   ? 7.143   -3.632  -36.992 0.50 86.19  ? 952  SCU B C15 1 
HETATM 8545 C C16 B SCU K 6 .   ? 6.061   -3.425  -38.057 0.50 86.35  ? 952  SCU B C16 1 
HETATM 8546 N N17 B SCU K 6 .   ? 5.499   -2.050  -38.148 0.50 86.56  ? 952  SCU B N17 1 
HETATM 8547 C C20 B SCU K 6 .   ? 5.110   -1.791  -39.542 0.50 86.29  ? 952  SCU B C20 1 
HETATM 8548 C C19 B SCU K 6 .   ? 4.322   -1.958  -37.267 0.50 86.56  ? 952  SCU B C19 1 
HETATM 8549 C C18 B SCU K 6 .   ? 6.416   -0.965  -37.765 0.50 86.67  ? 952  SCU B C18 1 
HETATM 8550 O O   . HOH L 8 .   ? 28.993  17.916  19.766  1.00 36.68  ? 2503 HOH A O   1 
HETATM 8551 O O   . HOH L 8 .   ? 33.073  14.300  17.216  1.00 41.96  ? 2504 HOH A O   1 
HETATM 8552 O O   . HOH L 8 .   ? 17.631  14.669  28.712  1.00 50.15  ? 2505 HOH A O   1 
HETATM 8553 O O   . HOH L 8 .   ? 21.408  14.687  12.747  1.00 43.58  ? 2506 HOH A O   1 
HETATM 8554 O O   . HOH L 8 .   ? 22.131  20.042  7.278   1.00 47.18  ? 2507 HOH A O   1 
HETATM 8555 O O   . HOH L 8 .   ? 38.467  15.076  12.504  1.00 46.74  ? 2508 HOH A O   1 
HETATM 8556 O O   . HOH L 8 .   ? 18.905  11.543  13.196  1.00 51.88  ? 2509 HOH A O   1 
HETATM 8557 O O   . HOH L 8 .   ? 39.100  15.716  0.910   1.00 36.86  ? 2510 HOH A O   1 
HETATM 8558 O O   . HOH L 8 .   ? 25.762  14.977  27.923  1.00 46.84  ? 2511 HOH A O   1 
HETATM 8559 O O   . HOH L 8 .   ? 31.032  7.820   6.640   1.00 47.78  ? 2512 HOH A O   1 
HETATM 8560 O O   . HOH L 8 .   ? 39.756  20.184  16.407  1.00 44.86  ? 2513 HOH A O   1 
HETATM 8561 O O   . HOH L 8 .   ? 15.125  7.783   -4.561  1.00 45.67  ? 2514 HOH A O   1 
HETATM 8562 O O   . HOH L 8 .   ? 35.278  17.298  24.491  1.00 48.37  ? 2515 HOH A O   1 
HETATM 8563 O O   . HOH L 8 .   ? 33.776  11.696  -2.653  1.00 41.28  ? 2516 HOH A O   1 
HETATM 8564 O O   . HOH L 8 .   ? 25.056  18.351  28.821  1.00 45.83  ? 2517 HOH A O   1 
HETATM 8565 O O   . HOH L 8 .   ? 29.299  12.071  24.532  1.00 38.18  ? 2518 HOH A O   1 
HETATM 8566 O O   . HOH L 8 .   ? 44.126  24.373  10.096  1.00 52.23  ? 2519 HOH A O   1 
HETATM 8567 O O   . HOH L 8 .   ? 19.309  19.683  18.374  1.00 40.34  ? 2520 HOH A O   1 
HETATM 8568 O O   . HOH L 8 .   ? 32.427  16.577  32.470  1.00 33.63  ? 2521 HOH A O   1 
HETATM 8569 O O   . HOH L 8 .   ? 19.408  0.531   27.830  1.00 47.39  ? 2522 HOH A O   1 
HETATM 8570 O O   . HOH L 8 .   ? 52.771  9.543   21.960  1.00 47.56  ? 2523 HOH A O   1 
HETATM 8571 O O   . HOH L 8 .   ? 41.708  13.915  31.731  1.00 45.22  ? 2524 HOH A O   1 
HETATM 8572 O O   . HOH L 8 .   ? 42.989  7.431   14.100  1.00 46.60  ? 2525 HOH A O   1 
HETATM 8573 O O   . HOH L 8 .   ? 26.126  15.264  18.373  1.00 51.85  ? 2526 HOH A O   1 
HETATM 8574 O O   . HOH L 8 .   ? 47.407  7.707   18.135  1.00 48.94  ? 2527 HOH A O   1 
HETATM 8575 O O   . HOH L 8 .   ? 43.692  18.591  16.460  1.00 41.64  ? 2528 HOH A O   1 
HETATM 8576 O O   . HOH L 8 .   ? 46.886  10.672  11.049  1.00 49.31  ? 2529 HOH A O   1 
HETATM 8577 O O   . HOH L 8 .   ? 52.441  16.298  24.643  1.00 48.63  ? 2530 HOH A O   1 
HETATM 8578 O O   . HOH L 8 .   ? 14.284  20.592  14.081  1.00 44.60  ? 2531 HOH A O   1 
HETATM 8579 O O   . HOH L 8 .   ? 44.298  11.361  9.452   1.00 50.14  ? 2532 HOH A O   1 
HETATM 8580 O O   . HOH L 8 .   ? 53.527  25.737  8.640   1.00 48.29  ? 2533 HOH A O   1 
HETATM 8581 O O   . HOH L 8 .   ? 10.076  -3.321  6.504   1.00 58.32  ? 2534 HOH A O   1 
HETATM 8582 O O   . HOH L 8 .   ? 18.536  14.504  4.048   1.00 56.14  ? 2535 HOH A O   1 
HETATM 8583 O O   . HOH L 8 .   ? 20.131  17.574  2.316   1.00 50.85  ? 2536 HOH A O   1 
HETATM 8584 O O   . HOH L 8 .   ? 41.516  6.711   2.983   1.00 48.25  ? 2537 HOH A O   1 
HETATM 8585 O O   . HOH L 8 .   ? 40.972  16.726  21.781  1.00 53.47  ? 2538 HOH A O   1 
HETATM 8586 O O   . HOH L 8 .   ? 41.660  18.880  18.145  1.00 54.65  ? 2539 HOH A O   1 
HETATM 8587 O O   . HOH L 8 .   ? 36.759  12.538  6.783   1.00 42.88  ? 2540 HOH A O   1 
HETATM 8588 O O   . HOH L 8 .   ? 14.875  32.395  6.410   1.00 53.77  ? 2541 HOH A O   1 
HETATM 8589 O O   . HOH L 8 .   ? 49.923  22.968  25.038  1.00 44.67  ? 2542 HOH A O   1 
HETATM 8590 O O   . HOH L 8 .   ? 10.885  17.053  33.769  1.00 49.51  ? 2543 HOH A O   1 
HETATM 8591 O O   . HOH L 8 .   ? 39.402  27.796  26.709  1.00 43.31  ? 2544 HOH A O   1 
HETATM 8592 O O   . HOH L 8 .   ? 30.983  20.894  16.352  1.00 46.45  ? 2545 HOH A O   1 
HETATM 8593 O O   . HOH L 8 .   ? 32.898  19.011  29.065  1.00 52.33  ? 2546 HOH A O   1 
HETATM 8594 O O   . HOH L 8 .   ? 17.979  20.854  1.610   1.00 46.51  ? 2547 HOH A O   1 
HETATM 8595 O O   . HOH L 8 .   ? 11.507  0.783   10.480  1.00 51.92  ? 2548 HOH A O   1 
HETATM 8596 O O   . HOH L 8 .   ? 36.865  -4.867  14.273  1.00 56.06  ? 2549 HOH A O   1 
HETATM 8597 O O   . HOH L 8 .   ? 34.789  6.441   -10.871 1.00 50.01  ? 2550 HOH A O   1 
HETATM 8598 O O   . HOH L 8 .   ? 27.791  -1.386  37.409  1.00 52.92  ? 2551 HOH A O   1 
HETATM 8599 O O   . HOH L 8 .   ? 43.636  15.292  25.105  1.00 49.60  ? 2552 HOH A O   1 
HETATM 8600 O O   . HOH L 8 .   ? 43.250  9.450   11.347  1.00 43.96  ? 2553 HOH A O   1 
HETATM 8601 O O   . HOH L 8 .   ? 31.825  16.694  29.823  1.00 50.12  ? 2554 HOH A O   1 
HETATM 8602 O O   . HOH L 8 .   ? 37.643  9.541   4.430   1.00 44.82  ? 2555 HOH A O   1 
HETATM 8603 O O   . HOH L 8 .   ? 34.146  4.874   6.528   1.00 50.79  ? 2556 HOH A O   1 
HETATM 8604 O O   . HOH L 8 .   ? 33.154  23.465  13.373  1.00 57.41  ? 2557 HOH A O   1 
HETATM 8605 O O   . HOH L 8 .   ? 10.043  25.145  25.748  1.00 56.64  ? 2558 HOH A O   1 
HETATM 8606 O O   . HOH L 8 .   ? 34.648  -2.734  33.420  1.00 59.23  ? 2559 HOH A O   1 
HETATM 8607 O O   . HOH L 8 .   ? 28.828  -0.345  29.485  1.00 48.93  ? 2560 HOH A O   1 
HETATM 8608 O O   . HOH L 8 .   ? 23.654  8.652   48.169  1.00 48.40  ? 2561 HOH A O   1 
HETATM 8609 O O   . HOH L 8 .   ? 26.817  5.233   0.423   1.00 52.62  ? 2562 HOH A O   1 
HETATM 8610 O O   . HOH L 8 .   ? 32.527  20.453  6.139   1.00 50.58  ? 2563 HOH A O   1 
HETATM 8611 O O   . HOH L 8 .   ? 38.960  13.086  2.127   1.00 51.39  ? 2564 HOH A O   1 
HETATM 8612 O O   . HOH L 8 .   ? 38.526  11.912  4.839   1.00 42.69  ? 2565 HOH A O   1 
HETATM 8613 O O   . HOH L 8 .   ? 17.450  12.125  49.685  1.00 74.48  ? 2566 HOH A O   1 
HETATM 8614 O O   . HOH L 8 .   ? 36.137  1.578   37.116  1.00 51.79  ? 2567 HOH A O   1 
HETATM 8615 O O   . HOH L 8 .   ? 45.894  10.220  18.454  1.00 60.10  ? 2568 HOH A O   1 
HETATM 8616 O O   . HOH L 8 .   ? 29.579  25.540  15.500  1.00 43.14  ? 2569 HOH A O   1 
HETATM 8617 O O   . HOH L 8 .   ? 23.924  23.269  23.180  1.00 46.65  ? 2570 HOH A O   1 
HETATM 8618 O O   . HOH L 8 .   ? 46.184  12.694  22.847  1.00 46.87  ? 2571 HOH A O   1 
HETATM 8619 O O   . HOH L 8 .   ? 17.032  19.194  -0.888  1.00 49.06  ? 2572 HOH A O   1 
HETATM 8620 O O   . HOH L 8 .   ? 33.651  -1.777  41.626  1.00 46.84  ? 2573 HOH A O   1 
HETATM 8621 O O   . HOH L 8 .   ? 46.088  14.833  24.537  1.00 45.45  ? 2574 HOH A O   1 
HETATM 8622 O O   . HOH L 8 .   ? 36.066  9.309   0.691   1.00 47.56  ? 2575 HOH A O   1 
HETATM 8623 O O   . HOH L 8 .   ? 19.592  27.751  15.995  1.00 53.82  ? 2576 HOH A O   1 
HETATM 8624 O O   . HOH L 8 .   ? 28.747  22.755  35.499  1.00 62.49  ? 2577 HOH A O   1 
HETATM 8625 O O   . HOH L 8 .   ? 5.866   7.584   21.872  1.00 66.21  ? 2578 HOH A O   1 
HETATM 8626 O O   . HOH L 8 .   ? 50.350  17.674  26.437  1.00 62.49  ? 2579 HOH A O   1 
HETATM 8627 O O   . HOH L 8 .   ? 30.861  15.825  1.057   1.00 53.19  ? 2580 HOH A O   1 
HETATM 8628 O O   . HOH L 8 .   ? 15.690  -8.223  6.227   1.00 68.06  ? 2581 HOH A O   1 
HETATM 8629 O O   . HOH L 8 .   ? 18.363  21.372  -11.983 1.00 56.29  ? 2582 HOH A O   1 
HETATM 8630 O O   . HOH L 8 .   ? 4.062   0.020   4.646   1.00 65.78  ? 2583 HOH A O   1 
HETATM 8631 O O   . HOH L 8 .   ? 15.701  26.009  -16.168 1.00 57.56  ? 2584 HOH A O   1 
HETATM 8632 O O   . HOH L 8 .   ? 34.371  1.283   4.468   1.00 54.10  ? 2585 HOH A O   1 
HETATM 8633 O O   . HOH L 8 .   ? 40.655  12.276  33.625  1.00 45.10  ? 2586 HOH A O   1 
HETATM 8634 O O   . HOH L 8 .   ? 48.398  21.275  26.407  1.00 49.02  ? 2587 HOH A O   1 
HETATM 8635 O O   . HOH L 8 .   ? 40.588  -1.908  24.156  1.00 63.65  ? 2588 HOH A O   1 
HETATM 8636 O O   . HOH L 8 .   ? 11.693  27.257  12.247  1.00 56.39  ? 2589 HOH A O   1 
HETATM 8637 O O   . HOH L 8 .   ? 40.788  11.115  1.460   1.00 49.32  ? 2590 HOH A O   1 
HETATM 8638 O O   . HOH L 8 .   ? 29.739  20.246  18.816  1.00 48.99  ? 2591 HOH A O   1 
HETATM 8639 O O   . HOH L 8 .   ? 33.738  9.584   -3.620  1.00 62.10  ? 2592 HOH A O   1 
HETATM 8640 O O   . HOH L 8 .   ? 32.141  2.311   3.384   1.00 57.44  ? 2593 HOH A O   1 
HETATM 8641 O O   . HOH L 8 .   ? 31.522  23.529  16.191  1.00 52.94  ? 2594 HOH A O   1 
HETATM 8642 O O   . HOH L 8 .   ? 49.626  6.300   28.137  1.00 70.24  ? 2595 HOH A O   1 
HETATM 8643 O O   . HOH L 8 .   ? 43.601  16.003  36.218  1.00 59.66  ? 2596 HOH A O   1 
HETATM 8644 O O   . HOH L 8 .   ? 31.967  0.431   41.617  1.00 43.55  ? 2597 HOH A O   1 
HETATM 8645 O O   . HOH L 8 .   ? 35.410  15.571  -7.517  1.00 57.80  ? 2598 HOH A O   1 
HETATM 8646 O O   . HOH L 8 .   ? 32.949  0.956   44.430  1.00 52.82  ? 2599 HOH A O   1 
HETATM 8647 O O   . HOH L 8 .   ? 43.977  0.581   6.238   1.00 48.82  ? 2600 HOH A O   1 
HETATM 8648 O O   . HOH L 8 .   ? 42.494  17.120  23.917  1.00 56.15  ? 2601 HOH A O   1 
HETATM 8649 O O   . HOH L 8 .   ? 3.040   15.040  18.329  1.00 60.22  ? 2602 HOH A O   1 
HETATM 8650 O O   . HOH L 8 .   ? 25.267  4.290   46.047  1.00 55.17  ? 2603 HOH A O   1 
HETATM 8651 O O   . HOH L 8 .   ? 29.986  27.037  -6.307  1.00 57.19  ? 2604 HOH A O   1 
HETATM 8652 O O   . HOH L 8 .   ? 40.716  20.010  35.303  1.00 65.05  ? 2605 HOH A O   1 
HETATM 8653 O O   . HOH L 8 .   ? 45.456  8.082   29.756  1.00 54.52  ? 2606 HOH A O   1 
HETATM 8654 O O   . HOH L 8 .   ? 8.242   21.140  10.285  1.00 53.89  ? 2607 HOH A O   1 
HETATM 8655 O O   . HOH L 8 .   ? 31.416  25.148  -12.914 1.00 53.28  ? 2608 HOH A O   1 
HETATM 8656 O O   . HOH L 8 .   ? 8.181   11.192  27.428  1.00 57.03  ? 2609 HOH A O   1 
HETATM 8657 O O   . HOH L 8 .   ? 27.654  25.653  23.523  1.00 50.35  ? 2610 HOH A O   1 
HETATM 8658 O O   . HOH L 8 .   ? 46.857  8.765   27.101  1.00 55.23  ? 2611 HOH A O   1 
HETATM 8659 O O   . HOH L 8 .   ? 18.781  -9.050  17.037  1.00 78.74  ? 2612 HOH A O   1 
HETATM 8660 O O   . HOH L 8 .   ? 28.304  3.390   2.353   1.00 59.54  ? 2613 HOH A O   1 
HETATM 8661 O O   . HOH L 8 .   ? 22.416  28.390  -14.913 1.00 56.36  ? 2614 HOH A O   1 
HETATM 8662 O O   . HOH L 8 .   ? 27.585  7.548   -0.591  1.00 53.86  ? 2615 HOH A O   1 
HETATM 8663 O O   . HOH L 8 .   ? 29.733  7.345   -1.934  1.00 56.58  ? 2616 HOH A O   1 
HETATM 8664 O O   . HOH L 8 .   ? 29.030  2.007   45.713  1.00 53.53  ? 2617 HOH A O   1 
HETATM 8665 O O   . HOH L 8 .   ? 17.076  -2.979  33.936  1.00 61.50  ? 2618 HOH A O   1 
HETATM 8666 O O   . HOH L 8 .   ? 15.745  31.172  3.607   1.00 58.88  ? 2619 HOH A O   1 
HETATM 8667 O O   . HOH L 8 .   ? 22.705  19.723  45.497  1.00 56.15  ? 2620 HOH A O   1 
HETATM 8668 O O   . HOH L 8 .   ? 37.313  -6.691  16.302  1.00 53.49  ? 2621 HOH A O   1 
HETATM 8669 O O   . HOH L 8 .   ? 11.683  22.504  6.606   1.00 54.55  ? 2622 HOH A O   1 
HETATM 8670 O O   . HOH L 8 .   ? 25.729  28.894  -15.123 1.00 56.79  ? 2623 HOH A O   1 
HETATM 8671 O O   . HOH L 8 .   ? 27.786  4.270   46.957  1.00 52.35  ? 2624 HOH A O   1 
HETATM 8672 O O   . HOH L 8 .   ? 22.692  19.069  33.141  1.00 70.92  ? 2625 HOH A O   1 
HETATM 8673 O O   . HOH L 8 .   ? 6.715   20.004  11.575  1.00 58.63  ? 2626 HOH A O   1 
HETATM 8674 O O   . HOH L 8 .   ? 32.883  24.064  34.810  1.00 65.61  ? 2627 HOH A O   1 
HETATM 8675 O O   . HOH L 8 .   ? 27.230  8.639   7.549   1.00 42.53  ? 2628 HOH A O   1 
HETATM 8676 O O   . HOH L 8 .   ? 13.890  23.203  34.881  1.00 61.95  ? 2629 HOH A O   1 
HETATM 8677 O O   . HOH L 8 .   ? 5.670   11.269  13.537  1.00 54.42  ? 2630 HOH A O   1 
HETATM 8678 O O   . HOH L 8 .   ? 4.893   18.292  11.043  1.00 71.57  ? 2631 HOH A O   1 
HETATM 8679 O O   . HOH L 8 .   ? 25.261  -8.481  30.467  1.00 76.25  ? 2632 HOH A O   1 
HETATM 8680 O O   . HOH L 8 .   ? 36.790  1.644   34.486  1.00 60.31  ? 2633 HOH A O   1 
HETATM 8681 O O   . HOH L 8 .   ? 47.712  -0.171  12.281  1.00 59.22  ? 2634 HOH A O   1 
HETATM 8682 O O   . HOH L 8 .   ? 48.275  1.282   14.505  1.00 55.20  ? 2635 HOH A O   1 
HETATM 8683 O O   . HOH L 8 .   ? 40.642  26.222  19.404  1.00 56.32  ? 2636 HOH A O   1 
HETATM 8684 O O   . HOH L 8 .   ? 30.495  25.086  -15.555 1.00 59.89  ? 2637 HOH A O   1 
HETATM 8685 O O   . HOH L 8 .   ? 30.694  31.321  -7.450  1.00 52.81  ? 2638 HOH A O   1 
HETATM 8686 O O   . HOH L 8 .   ? 17.824  23.363  0.816   1.00 50.40  ? 2639 HOH A O   1 
HETATM 8687 O O   . HOH L 8 .   ? 15.538  1.426   1.308   1.00 56.86  ? 2640 HOH A O   1 
HETATM 8688 O O   . HOH L 8 .   ? 12.986  8.382   41.860  1.00 57.87  ? 2641 HOH A O   1 
HETATM 8689 O O   . HOH L 8 .   ? 34.443  27.284  11.002  1.00 65.18  ? 2642 HOH A O   1 
HETATM 8690 O O   . HOH L 8 .   ? 12.780  11.545  2.028   1.00 65.70  ? 2643 HOH A O   1 
HETATM 8691 O O   . HOH L 8 .   ? 51.279  6.954   3.367   1.00 53.27  ? 2644 HOH A O   1 
HETATM 8692 O O   . HOH L 8 .   ? 21.277  26.291  16.825  1.00 65.29  ? 2645 HOH A O   1 
HETATM 8693 O O   . HOH L 8 .   ? 16.142  22.887  32.935  1.00 61.43  ? 2646 HOH A O   1 
HETATM 8694 O O   . HOH L 8 .   ? 35.110  -3.539  31.205  1.00 75.37  ? 2647 HOH A O   1 
HETATM 8695 O O   . HOH L 8 .   ? 20.413  32.744  10.024  1.00 61.05  ? 2648 HOH A O   1 
HETATM 8696 O O   . HOH L 8 .   ? 52.465  13.598  3.823   1.00 53.97  ? 2649 HOH A O   1 
HETATM 8697 O O   . HOH L 8 .   ? 36.922  10.158  -15.289 1.00 57.49  ? 2650 HOH A O   1 
HETATM 8698 O O   . HOH L 8 .   ? 17.415  2.741   0.057   1.00 54.41  ? 2651 HOH A O   1 
HETATM 8699 O O   . HOH L 8 .   ? 52.852  8.874   3.818   1.00 52.19  ? 2652 HOH A O   1 
HETATM 8700 O O   . HOH L 8 .   ? 54.027  22.398  25.126  1.00 61.29  ? 2653 HOH A O   1 
HETATM 8701 O O   . HOH L 8 .   ? 25.000  22.304  29.757  1.00 53.33  ? 2654 HOH A O   1 
HETATM 8702 O O   . HOH L 8 .   ? 30.065  0.241   2.405   1.00 73.00  ? 2655 HOH A O   1 
HETATM 8703 O O   . HOH L 8 .   ? 48.651  4.251   27.264  1.00 63.27  ? 2656 HOH A O   1 
HETATM 8704 O O   . HOH L 8 .   ? 12.892  -9.337  4.393   1.00 61.25  ? 2657 HOH A O   1 
HETATM 8705 O O   . HOH L 8 .   ? 24.750  9.171   52.185  1.00 55.35  ? 2658 HOH A O   1 
HETATM 8706 O O   . HOH L 8 .   ? 55.039  19.754  3.180   1.00 71.34  ? 2659 HOH A O   1 
HETATM 8707 O O   . HOH L 8 .   ? 42.974  -1.050  19.678  1.00 59.67  ? 2660 HOH A O   1 
HETATM 8708 O O   . HOH L 8 .   ? 18.452  1.342   -2.999  1.00 57.70  ? 2661 HOH A O   1 
HETATM 8709 O O   . HOH L 8 .   ? 23.776  19.128  50.099  1.00 68.95  ? 2662 HOH A O   1 
HETATM 8710 O O   . HOH L 8 .   ? 33.491  33.691  14.766  1.00 81.19  ? 2663 HOH A O   1 
HETATM 8711 O O   . HOH L 8 .   ? 53.559  20.192  25.650  1.00 52.73  ? 2664 HOH A O   1 
HETATM 8712 O O   . HOH L 8 .   ? 34.280  23.175  18.670  1.00 46.63  ? 2665 HOH A O   1 
HETATM 8713 O O   . HOH L 8 .   ? 23.682  20.136  30.582  1.00 59.51  ? 2666 HOH A O   1 
HETATM 8714 O O   . HOH L 8 .   ? 21.371  32.300  -9.641  1.00 67.43  ? 2667 HOH A O   1 
HETATM 8715 O O   . HOH L 8 .   ? 14.931  -5.771  11.011  1.00 55.63  ? 2668 HOH A O   1 
HETATM 8716 O O   . HOH L 8 .   ? 19.057  23.048  38.501  1.00 60.88  ? 2669 HOH A O   1 
HETATM 8717 O O   . HOH L 8 .   ? 2.073   8.195   16.466  1.00 67.41  ? 2670 HOH A O   1 
HETATM 8718 O O   . HOH L 8 .   ? 37.817  8.383   47.790  1.00 53.13  ? 2671 HOH A O   1 
HETATM 8719 O O   . HOH L 8 .   ? 36.190  2.711   45.764  1.00 59.68  ? 2672 HOH A O   1 
HETATM 8720 O O   . HOH L 8 .   ? 48.262  25.494  23.422  1.00 61.97  ? 2673 HOH A O   1 
HETATM 8721 O O   . HOH L 8 .   ? 25.599  17.932  48.803  1.00 64.80  ? 2674 HOH A O   1 
HETATM 8722 O O   . HOH L 8 .   ? 26.847  -6.393  32.185  1.00 66.01  ? 2675 HOH A O   1 
HETATM 8723 O O   . HOH L 8 .   ? 53.612  11.167  2.863   1.00 57.53  ? 2676 HOH A O   1 
HETATM 8724 O O   . HOH L 8 .   ? 50.794  14.766  1.594   1.00 56.67  ? 2677 HOH A O   1 
HETATM 8725 O O   . HOH L 8 .   ? 36.222  4.849   39.014  1.00 53.75  ? 2678 HOH A O   1 
HETATM 8726 O O   . HOH L 8 .   ? 13.000  20.580  41.456  1.00 67.40  ? 2679 HOH A O   1 
HETATM 8727 O O   . HOH L 8 .   ? 20.444  18.895  47.816  1.00 65.29  ? 2680 HOH A O   1 
HETATM 8728 O O   . HOH L 8 .   ? 28.953  -5.247  35.954  1.00 59.09  ? 2681 HOH A O   1 
HETATM 8729 O O   . HOH L 8 .   ? 16.292  25.290  17.616  1.00 63.01  ? 2682 HOH A O   1 
HETATM 8730 O O   . HOH L 8 .   ? 41.722  0.050   4.692   1.00 56.39  ? 2683 HOH A O   1 
HETATM 8731 O O   . HOH L 8 .   ? 38.775  3.607   45.481  1.00 61.27  ? 2684 HOH A O   1 
HETATM 8732 O O   . HOH L 8 .   ? 46.709  1.769   3.483   1.00 54.11  ? 2685 HOH A O   1 
HETATM 8733 O O   . HOH L 8 .   ? 30.720  10.537  48.865  1.00 62.90  ? 2686 HOH A O   1 
HETATM 8734 O O   . HOH L 8 .   ? 45.119  3.309   44.967  1.00 66.55  ? 2687 HOH A O   1 
HETATM 8735 O O   . HOH L 8 .   ? 37.823  2.927   38.116  1.00 66.38  ? 2688 HOH A O   1 
HETATM 8736 O O   . HOH L 8 .   ? 52.244  4.328   3.561   1.00 60.51  ? 2689 HOH A O   1 
HETATM 8737 O O   . HOH L 8 .   ? 25.774  19.113  45.846  1.00 58.44  ? 2690 HOH A O   1 
HETATM 8738 O O   . HOH L 8 .   ? 41.483  1.017   40.059  1.00 60.07  ? 2691 HOH A O   1 
HETATM 8739 O O   . HOH L 8 .   ? 39.912  5.664   46.514  1.00 53.53  ? 2692 HOH A O   1 
HETATM 8740 O O   . HOH L 8 .   ? 15.558  20.856  42.966  1.00 83.33  ? 2693 HOH A O   1 
HETATM 8741 O O   . HOH L 8 .   ? 8.293   17.520  32.603  1.00 57.64  ? 2694 HOH A O   1 
HETATM 8742 O O   . HOH L 8 .   ? 11.923  13.956  39.961  1.00 56.44  ? 2695 HOH A O   1 
HETATM 8743 O O   . HOH L 8 .   ? 11.480  13.232  43.730  1.00 64.60  ? 2696 HOH A O   1 
HETATM 8744 O O   . HOH L 8 .   ? 36.642  16.506  38.350  1.00 51.79  ? 2697 HOH A O   1 
HETATM 8745 O O   . HOH L 8 .   ? 39.165  15.278  38.900  1.00 63.84  ? 2698 HOH A O   1 
HETATM 8746 O O   . HOH L 8 .   ? 41.665  13.365  36.045  1.00 63.97  ? 2699 HOH A O   1 
HETATM 8747 O O   . HOH L 8 .   ? 56.408  14.320  25.800  1.00 67.84  ? 2700 HOH A O   1 
HETATM 8748 O O   . HOH L 8 .   ? 50.112  2.323   25.278  1.00 62.23  ? 2701 HOH A O   1 
HETATM 8749 O O   . HOH L 8 .   ? 40.120  1.721   26.087  1.00 54.94  ? 2702 HOH A O   1 
HETATM 8750 O O   . HOH L 8 .   ? 46.434  2.359   40.346  1.00 62.02  ? 2703 HOH A O   1 
HETATM 8751 O O   . HOH L 8 .   ? 37.100  14.792  51.170  1.00 58.83  ? 2704 HOH A O   1 
HETATM 8752 O O   . HOH L 8 .   ? 37.146  17.319  43.884  1.00 64.06  ? 2705 HOH A O   1 
HETATM 8753 O O   . HOH L 8 .   ? 32.116  21.554  21.426  1.00 52.28  ? 2706 HOH A O   1 
HETATM 8754 O O   . HOH L 8 .   ? 40.278  27.389  16.983  1.00 51.62  ? 2707 HOH A O   1 
HETATM 8755 O O   . HOH L 8 .   ? 21.467  34.073  17.058  1.00 64.54  ? 2708 HOH A O   1 
HETATM 8756 O O   . HOH L 8 .   ? 25.953  24.590  25.229  1.00 55.27  ? 2709 HOH A O   1 
HETATM 8757 O O   . HOH L 8 .   ? 36.111  27.132  25.700  1.00 56.22  ? 2710 HOH A O   1 
HETATM 8758 O O   . HOH L 8 .   ? 45.919  21.400  27.866  1.00 64.03  ? 2711 HOH A O   1 
HETATM 8759 O O   . HOH L 8 .   ? 12.314  10.104  37.723  1.00 61.43  ? 2712 HOH A O   1 
HETATM 8760 O O   . HOH L 8 .   ? 14.018  4.926   36.759  1.00 72.62  ? 2713 HOH A O   1 
HETATM 8761 O O   . HOH L 8 .   ? 20.103  21.970  28.504  1.00 56.52  ? 2714 HOH A O   1 
HETATM 8762 O O   . HOH L 8 .   ? 21.943  24.992  23.174  1.00 54.16  ? 2715 HOH A O   1 
HETATM 8763 O O   . HOH L 8 .   ? 56.817  2.929   13.797  1.00 76.13  ? 2716 HOH A O   1 
HETATM 8764 O O   . HOH L 8 .   ? 44.638  1.989   18.790  1.00 51.55  ? 2717 HOH A O   1 
HETATM 8765 O O   . HOH L 8 .   ? 33.198  -5.042  35.394  1.00 59.98  ? 2718 HOH A O   1 
HETATM 8766 O O   . HOH L 8 .   ? 25.412  -5.392  39.028  1.00 58.44  ? 2719 HOH A O   1 
HETATM 8767 O O   . HOH L 8 .   ? 21.924  -6.298  36.101  1.00 63.15  ? 2720 HOH A O   1 
HETATM 8768 O O   . HOH L 8 .   ? 26.972  -6.722  35.156  1.00 61.72  ? 2721 HOH A O   1 
HETATM 8769 O O   . HOH L 8 .   ? 39.256  -5.622  17.433  1.00 62.10  ? 2722 HOH A O   1 
HETATM 8770 O O   . HOH L 8 .   ? 41.664  -6.821  15.049  1.00 69.31  ? 2723 HOH A O   1 
HETATM 8771 O O   . HOH L 8 .   ? 25.757  -6.376  21.411  1.00 66.23  ? 2724 HOH A O   1 
HETATM 8772 O O   . HOH L 8 .   ? 34.150  7.934   -1.333  1.00 56.20  ? 2725 HOH A O   1 
HETATM 8773 O O   . HOH L 8 .   ? 39.983  2.105   4.027   1.00 59.27  ? 2726 HOH A O   1 
HETATM 8774 O O   . HOH L 8 .   ? 37.392  2.539   5.174   1.00 59.08  ? 2727 HOH A O   1 
HETATM 8775 O O   . HOH L 8 .   ? 51.033  2.870   5.239   1.00 66.28  ? 2728 HOH A O   1 
HETATM 8776 O O   . HOH L 8 .   ? 48.736  -1.016  5.888   1.00 65.78  ? 2729 HOH A O   1 
HETATM 8777 O O   . HOH L 8 .   ? 51.001  3.088   7.606   1.00 48.74  ? 2730 HOH A O   1 
HETATM 8778 O O   . HOH L 8 .   ? 47.081  17.818  1.249   1.00 55.10  ? 2731 HOH A O   1 
HETATM 8779 O O   . HOH L 8 .   ? 58.963  20.965  8.560   1.00 57.95  ? 2732 HOH A O   1 
HETATM 8780 O O   . HOH L 8 .   ? 60.887  4.343   15.236  1.00 62.34  ? 2733 HOH A O   1 
HETATM 8781 O O   . HOH L 8 .   ? 58.771  14.735  23.313  1.00 65.60  ? 2734 HOH A O   1 
HETATM 8782 O O   . HOH L 8 .   ? 38.950  20.662  2.222   1.00 63.60  ? 2735 HOH A O   1 
HETATM 8783 O O   . HOH L 8 .   ? 37.273  19.311  -4.805  1.00 59.29  ? 2736 HOH A O   1 
HETATM 8784 O O   . HOH L 8 .   ? 35.782  0.436   1.635   1.00 67.15  ? 2737 HOH A O   1 
HETATM 8785 O O   . HOH L 8 .   ? 31.735  -8.316  11.027  1.00 67.39  ? 2738 HOH A O   1 
HETATM 8786 O O   . HOH L 8 .   ? 13.785  18.753  1.797   1.00 57.37  ? 2739 HOH A O   1 
HETATM 8787 O O   . HOH L 8 .   ? 14.107  20.208  -0.836  1.00 57.99  ? 2740 HOH A O   1 
HETATM 8788 O O   . HOH L 8 .   ? 12.597  27.656  -1.844  1.00 62.00  ? 2741 HOH A O   1 
HETATM 8789 O O   . HOH L 8 .   ? 12.117  25.854  6.212   1.00 62.39  ? 2742 HOH A O   1 
HETATM 8790 O O   . HOH L 8 .   ? 18.758  35.896  -2.004  1.00 67.14  ? 2743 HOH A O   1 
HETATM 8791 O O   . HOH L 8 .   ? 27.751  31.707  -11.858 1.00 54.70  ? 2744 HOH A O   1 
HETATM 8792 O O   . HOH L 8 .   ? 25.860  19.599  -16.758 1.00 70.20  ? 2745 HOH A O   1 
HETATM 8793 O O   . HOH L 8 .   ? 27.995  24.952  -16.151 1.00 61.36  ? 2746 HOH A O   1 
HETATM 8794 O O   . HOH L 8 .   ? 30.943  28.584  -10.757 1.00 51.49  ? 2747 HOH A O   1 
HETATM 8795 O O   . HOH L 8 .   ? 32.607  27.274  -12.266 1.00 55.32  ? 2748 HOH A O   1 
HETATM 8796 O O   . HOH L 8 .   ? 34.950  26.760  -10.424 1.00 55.72  ? 2749 HOH A O   1 
HETATM 8797 O O   . HOH L 8 .   ? 33.179  23.179  -11.785 1.00 60.95  ? 2750 HOH A O   1 
HETATM 8798 O O   . HOH L 8 .   ? 35.131  23.980  -10.225 1.00 61.04  ? 2751 HOH A O   1 
HETATM 8799 O O   . HOH L 8 .   ? 34.956  23.134  -7.447  1.00 49.67  ? 2752 HOH A O   1 
HETATM 8800 O O   . HOH L 8 .   ? 30.244  31.081  -11.529 1.00 54.62  ? 2753 HOH A O   1 
HETATM 8801 O O   . HOH L 8 .   ? 35.525  6.638   -13.526 1.00 73.77  ? 2754 HOH A O   1 
HETATM 8802 O O   . HOH L 8 .   ? 37.478  7.763   -14.697 1.00 68.51  ? 2755 HOH A O   1 
HETATM 8803 O O   . HOH L 8 .   ? 21.457  31.657  -12.046 1.00 68.24  ? 2756 HOH A O   1 
HETATM 8804 O O   . HOH L 8 .   ? 7.163   20.396  31.140  1.00 77.74  ? 2757 HOH A O   1 
HETATM 8805 O O   . HOH L 8 .   ? 2.926   17.532  18.681  1.00 62.71  ? 2758 HOH A O   1 
HETATM 8806 O O   . HOH L 8 .   ? 3.296   6.215   17.763  1.00 63.89  ? 2759 HOH A O   1 
HETATM 8807 O O   . HOH L 8 .   ? 7.848   -3.680  16.262  1.00 65.48  ? 2760 HOH A O   1 
HETATM 8808 O O   . HOH L 8 .   ? 4.351   11.389  10.480  1.00 65.98  ? 2761 HOH A O   1 
HETATM 8809 O O   . HOH L 8 .   ? 0.368   10.773  9.985   1.00 71.73  ? 2762 HOH A O   1 
HETATM 8810 O O   . HOH L 8 .   ? 1.314   4.893   7.773   1.00 61.92  ? 2763 HOH A O   1 
HETATM 8811 O O   . HOH L 8 .   ? 10.460  10.198  2.971   1.00 55.47  ? 2764 HOH A O   1 
HETATM 8812 O O   . HOH L 8 .   ? 12.006  2.378   -6.284  1.00 66.59  ? 2765 HOH A O   1 
HETATM 8813 O O   . HOH L 8 .   ? 20.732  0.230   -3.336  1.00 67.08  ? 2766 HOH A O   1 
HETATM 8814 O O   . HOH L 8 .   ? 24.762  -6.925  36.764  1.00 66.66  ? 2767 HOH A O   1 
HETATM 8815 O O   . HOH L 8 .   ? 26.934  16.407  14.784  1.00 68.81  ? 2768 HOH A O   1 
HETATM 8816 O O   . HOH L 8 .   ? 32.755  5.850   -9.373  1.00 74.22  ? 2769 HOH A O   1 
HETATM 8817 O O   . HOH L 8 .   ? 58.640  15.694  8.106   1.00 79.65  ? 2770 HOH A O   1 
HETATM 8818 O O   . HOH L 8 .   ? 9.320   8.858   36.245  1.00 71.58  ? 2771 HOH A O   1 
HETATM 8819 O O   . HOH L 8 .   ? 62.005  13.300  8.926   1.00 75.24  ? 2772 HOH A O   1 
HETATM 8820 O O   . HOH L 8 .   ? 60.388  18.535  9.536   1.00 76.37  ? 2773 HOH A O   1 
HETATM 8821 O O   . HOH L 8 .   ? 19.261  -6.112  28.058  1.00 63.56  ? 2774 HOH A O   1 
HETATM 8822 O O   . HOH L 8 .   ? 35.091  31.698  16.747  1.00 78.73  ? 2775 HOH A O   1 
HETATM 8823 O O   . HOH L 8 .   ? 50.125  0.344   16.240  1.00 70.85  ? 2776 HOH A O   1 
HETATM 8824 O O   . HOH L 8 .   ? 44.531  1.227   43.784  1.00 70.33  ? 2777 HOH A O   1 
HETATM 8825 O O   . HOH L 8 .   ? 5.205   23.939  16.663  1.00 74.03  ? 2778 HOH A O   1 
HETATM 8826 O O   . HOH L 8 .   ? 15.316  18.610  -4.960  1.00 75.44  ? 2779 HOH A O   1 
HETATM 8827 O O   . HOH L 8 .   ? 41.974  27.000  26.644  1.00 65.13  ? 2780 HOH A O   1 
HETATM 8828 O O   . HOH L 8 .   ? 19.731  5.976   46.764  1.00 69.44  ? 2781 HOH A O   1 
HETATM 8829 O O   . HOH L 8 .   ? 48.723  11.490  32.968  1.00 67.42  ? 2782 HOH A O   1 
HETATM 8830 O O   . HOH L 8 .   ? 46.107  5.419   43.107  1.00 68.17  ? 2783 HOH A O   1 
HETATM 8831 O O   . HOH L 8 .   ? 18.185  23.682  32.189  1.00 66.51  ? 2784 HOH A O   1 
HETATM 8832 O O   . HOH L 8 .   ? 16.866  33.849  6.461   1.00 78.71  ? 2785 HOH A O   1 
HETATM 8833 O O   . HOH L 8 .   ? 49.867  27.994  15.743  1.00 78.95  ? 2786 HOH A O   1 
HETATM 8834 O O   . HOH L 8 .   ? 24.443  36.272  12.128  1.00 71.00  ? 2787 HOH A O   1 
HETATM 8835 O O   . HOH L 8 .   ? 11.914  3.089   -11.576 1.00 67.40  ? 2788 HOH A O   1 
HETATM 8836 O O   . HOH L 8 .   ? 53.384  27.843  14.994  1.00 70.96  ? 2789 HOH A O   1 
HETATM 8837 O O   . HOH L 8 .   ? 21.193  24.393  31.767  1.00 64.78  ? 2790 HOH A O   1 
HETATM 8838 O O   . HOH L 8 .   ? 16.803  16.962  -5.286  1.00 69.03  ? 2791 HOH A O   1 
HETATM 8839 O O   . HOH L 8 .   ? 10.380  3.888   -9.885  1.00 66.70  ? 2792 HOH A O   1 
HETATM 8840 O O   . HOH L 8 .   ? 42.971  1.795   25.870  1.00 67.36  ? 2793 HOH A O   1 
HETATM 8841 O O   . HOH L 8 .   ? 9.336   0.314   27.596  1.00 69.15  ? 2794 HOH A O   1 
HETATM 8842 O O   . HOH L 8 .   ? 35.537  26.647  31.987  1.00 60.08  ? 2795 HOH A O   1 
HETATM 8843 O O   . HOH L 8 .   ? 17.488  -6.211  29.693  1.00 67.07  ? 2796 HOH A O   1 
HETATM 8844 O O   . HOH L 8 .   ? 19.179  33.963  7.789   1.00 72.59  ? 2797 HOH A O   1 
HETATM 8845 O O   . HOH L 8 .   ? 26.959  14.783  54.844  1.00 73.83  ? 2798 HOH A O   1 
HETATM 8846 O O   . HOH L 8 .   ? 19.880  -6.568  25.403  1.00 79.20  ? 2799 HOH A O   1 
HETATM 8847 O O   . HOH L 8 .   ? 22.904  -14.190 9.818   1.00 79.54  ? 2800 HOH A O   1 
HETATM 8848 O O   . HOH L 8 .   ? 11.693  7.656   37.893  1.00 69.41  ? 2801 HOH A O   1 
HETATM 8849 O O   . HOH L 8 .   ? 36.105  27.082  -4.353  1.00 72.56  ? 2802 HOH A O   1 
HETATM 8850 O O   . HOH L 8 .   ? 20.798  29.569  -13.258 1.00 70.26  ? 2803 HOH A O   1 
HETATM 8851 O O   . HOH L 8 .   ? 32.596  6.955   -6.425  1.00 67.00  ? 2804 HOH A O   1 
HETATM 8852 O O   . HOH L 8 .   ? 12.937  4.394   -14.021 1.00 77.49  ? 2805 HOH A O   1 
HETATM 8853 O O   . HOH L 8 .   ? 33.144  -7.199  13.450  1.00 63.91  ? 2806 HOH A O   1 
HETATM 8854 O O   . HOH L 8 .   ? 4.013   3.150   18.265  1.00 68.29  ? 2807 HOH A O   1 
HETATM 8855 O O   . HOH L 8 .   ? 30.892  11.728  51.396  1.00 68.85  ? 2808 HOH A O   1 
HETATM 8856 O O   . HOH L 8 .   ? 13.379  32.582  28.754  1.00 75.84  ? 2809 HOH A O   1 
HETATM 8857 O O   . HOH L 8 .   ? 13.790  20.528  -5.654  1.00 74.34  ? 2810 HOH A O   1 
HETATM 8858 O O   . HOH L 8 .   ? 35.155  8.156   -8.467  1.00 65.92  ? 2811 HOH A O   1 
HETATM 8859 O O   . HOH L 8 .   ? 23.349  27.422  23.603  1.00 71.17  ? 2812 HOH A O   1 
HETATM 8860 O O   . HOH L 8 .   ? 21.637  23.787  36.073  1.00 77.86  ? 2813 HOH A O   1 
HETATM 8861 O O   . HOH L 8 .   ? 2.559   26.944  21.798  1.00 65.09  ? 2814 HOH A O   1 
HETATM 8862 O O   . HOH L 8 .   ? 7.615   4.864   28.480  1.00 81.50  ? 2815 HOH A O   1 
HETATM 8863 O O   . HOH L 8 .   ? 22.159  -2.481  39.009  1.00 72.38  ? 2816 HOH A O   1 
HETATM 8864 O O   . HOH L 8 .   ? 33.509  28.712  22.335  1.00 71.41  ? 2817 HOH A O   1 
HETATM 8865 O O   . HOH L 8 .   ? 31.255  15.448  60.582  1.00 80.44  ? 2818 HOH A O   1 
HETATM 8866 O O   . HOH L 8 .   ? 12.641  16.294  46.299  1.00 73.60  ? 2819 HOH A O   1 
HETATM 8867 O O   . HOH L 8 .   ? 33.855  35.054  -8.726  1.00 76.55  ? 2820 HOH A O   1 
HETATM 8868 O O   . HOH L 8 .   ? 48.862  0.581   21.144  1.00 72.68  ? 2821 HOH A O   1 
HETATM 8869 O O   . HOH L 8 .   ? 24.479  32.875  -8.986  1.00 71.43  ? 2822 HOH A O   1 
HETATM 8870 O O   . HOH L 8 .   ? 12.530  5.403   -2.186  1.00 67.02  ? 2823 HOH A O   1 
HETATM 8871 O O   . HOH L 8 .   ? 32.204  6.464   -0.266  1.00 70.74  ? 2824 HOH A O   1 
HETATM 8872 O O   . HOH L 8 .   ? 33.420  17.861  38.693  1.00 65.04  ? 2825 HOH A O   1 
HETATM 8873 O O   . HOH L 8 .   ? 31.003  14.380  51.800  1.00 69.19  ? 2826 HOH A O   1 
HETATM 8874 O O   . HOH L 8 .   ? 42.783  -7.632  10.732  1.00 70.69  ? 2827 HOH A O   1 
HETATM 8875 O O   . HOH L 8 .   ? 19.429  25.057  25.035  1.00 65.35  ? 2828 HOH A O   1 
HETATM 8876 O O   . HOH L 8 .   ? 8.717   28.742  19.021  1.00 67.45  ? 2829 HOH A O   1 
HETATM 8877 O O   . HOH L 8 .   ? 26.816  -13.220 16.525  1.00 71.17  ? 2830 HOH A O   1 
HETATM 8878 O O   . HOH L 8 .   ? 28.933  23.653  42.267  1.00 74.11  ? 2831 HOH A O   1 
HETATM 8879 O O   . HOH L 8 .   ? 29.699  17.725  58.963  1.00 84.69  ? 2832 HOH A O   1 
HETATM 8880 O O   . HOH L 8 .   ? 45.184  10.643  38.182  1.00 77.47  ? 2833 HOH A O   1 
HETATM 8881 O O   . HOH L 8 .   ? 3.521   4.980   29.215  1.00 79.46  ? 2834 HOH A O   1 
HETATM 8882 O O   . HOH L 8 .   ? 16.964  25.251  22.286  1.00 66.66  ? 2835 HOH A O   1 
HETATM 8883 O O   . HOH L 8 .   ? 15.732  -12.407 6.989   1.00 67.69  ? 2836 HOH A O   1 
HETATM 8884 O O   . HOH L 8 .   ? 39.177  8.855   -5.697  1.00 70.88  ? 2837 HOH A O   1 
HETATM 8885 O O   . HOH L 8 .   ? 11.264  21.252  39.555  1.00 74.56  ? 2838 HOH A O   1 
HETATM 8886 O O   . HOH L 8 .   ? 0.489   12.819  17.447  1.00 65.04  ? 2839 HOH A O   1 
HETATM 8887 O O   . HOH L 8 .   ? 46.174  13.245  37.772  1.00 68.06  ? 2840 HOH A O   1 
HETATM 8888 O O   . HOH L 8 .   ? 27.428  23.883  39.936  1.00 82.96  ? 2841 HOH A O   1 
HETATM 8889 O O   . HOH L 8 .   ? 12.375  23.754  38.603  1.00 81.84  ? 2842 HOH A O   1 
HETATM 8890 O O   . HOH L 8 .   ? 12.992  29.769  -3.872  1.00 63.84  ? 2843 HOH A O   1 
HETATM 8891 O O   . HOH L 8 .   ? 16.542  20.096  -20.625 1.00 64.51  ? 2844 HOH A O   1 
HETATM 8892 O O   . HOH L 8 .   ? 12.978  -7.880  12.244  1.00 73.79  ? 2845 HOH A O   1 
HETATM 8893 O O   . HOH L 8 .   ? 61.497  16.202  19.950  1.00 71.49  ? 2846 HOH A O   1 
HETATM 8894 O O   . HOH L 8 .   ? 64.664  7.227   17.541  1.00 81.63  ? 2847 HOH A O   1 
HETATM 8895 O O   . HOH L 8 .   ? 5.704   -3.122  14.927  1.00 75.78  ? 2848 HOH A O   1 
HETATM 8896 O O   . HOH L 8 .   ? 13.261  39.239  25.604  1.00 79.59  ? 2849 HOH A O   1 
HETATM 8897 O O   . HOH L 8 .   ? 13.181  24.060  2.829   1.00 62.75  ? 2850 HOH A O   1 
HETATM 8898 O O   . HOH L 8 .   ? 10.392  30.279  -4.677  1.00 61.83  ? 2851 HOH A O   1 
HETATM 8899 O O   . HOH L 8 .   ? 14.705  -9.824  13.671  1.00 76.56  ? 2852 HOH A O   1 
HETATM 8900 O O   . HOH L 8 .   ? 39.849  13.169  -7.050  1.00 74.99  ? 2853 HOH A O   1 
HETATM 8901 O O   . HOH L 8 .   ? 13.710  23.100  1.351   1.00 56.59  ? 2854 HOH A O   1 
HETATM 8902 O O   . HOH L 8 .   ? 26.337  22.543  37.830  1.00 76.14  ? 2855 HOH A O   1 
HETATM 8903 O O   . HOH L 8 .   ? 21.052  -5.568  1.064   1.00 70.26  ? 2856 HOH A O   1 
HETATM 8904 O O   . HOH L 8 .   ? 36.510  5.302   2.966   1.00 58.14  ? 2857 HOH A O   1 
HETATM 8905 O O   . HOH L 8 .   ? 36.160  17.591  40.612  1.00 70.97  ? 2858 HOH A O   1 
HETATM 8906 O O   . HOH L 8 .   ? 19.932  18.695  52.415  1.00 62.89  ? 2859 HOH A O   1 
HETATM 8907 O O   . HOH L 8 .   ? 37.274  -4.832  26.432  1.00 64.80  ? 2860 HOH A O   1 
HETATM 8908 O O   . HOH L 8 .   ? 44.426  9.466   41.770  1.00 64.71  ? 2861 HOH A O   1 
HETATM 8909 O O   . HOH L 8 .   ? 6.420   5.100   0.623   1.00 73.54  ? 2862 HOH A O   1 
HETATM 8910 O O   . HOH L 8 .   ? 25.733  10.629  54.330  1.00 70.45  ? 2863 HOH A O   1 
HETATM 8911 O O   . HOH L 8 .   ? 24.550  13.544  55.348  1.00 56.25  ? 2864 HOH A O   1 
HETATM 8912 O O   . HOH L 8 .   ? 37.118  6.781   37.557  1.00 60.77  ? 2865 HOH A O   1 
HETATM 8913 O O   . HOH L 8 .   ? 18.243  21.681  43.701  1.00 74.50  ? 2866 HOH A O   1 
HETATM 8914 O O   . HOH L 8 .   ? 13.690  11.997  39.443  1.00 62.29  ? 2867 HOH A O   1 
HETATM 8915 O O   . HOH L 8 .   ? 38.125  4.237   34.462  1.00 60.61  ? 2868 HOH A O   1 
HETATM 8916 O O   . HOH L 8 .   ? 38.766  0.190   33.533  1.00 74.31  ? 2869 HOH A O   1 
HETATM 8917 O O   . HOH L 8 .   ? 46.281  3.963   35.216  1.00 69.16  ? 2870 HOH A O   1 
HETATM 8918 O O   . HOH L 8 .   ? 39.629  14.526  45.597  1.00 64.21  ? 2871 HOH A O   1 
HETATM 8919 O O   . HOH L 8 .   ? 16.523  -3.417  29.542  1.00 63.88  ? 2872 HOH A O   1 
HETATM 8920 O O   . HOH L 8 .   ? 7.812   14.443  34.783  1.00 67.03  ? 2873 HOH A O   1 
HETATM 8921 O O   . HOH L 8 .   ? 45.404  1.095   16.314  1.00 60.43  ? 2874 HOH A O   1 
HETATM 8922 O O   . HOH L 8 .   ? 36.718  -2.093  35.075  1.00 70.19  ? 2875 HOH A O   1 
HETATM 8923 O O   . HOH L 8 .   ? 26.307  -7.867  25.444  1.00 69.71  ? 2876 HOH A O   1 
HETATM 8924 O O   . HOH L 8 .   ? 38.331  7.698   0.448   1.00 61.42  ? 2877 HOH A O   1 
HETATM 8925 O O   . HOH L 8 .   ? 39.732  8.709   2.516   1.00 54.06  ? 2878 HOH A O   1 
HETATM 8926 O O   . HOH L 8 .   ? 49.749  0.935   4.161   1.00 69.81  ? 2879 HOH A O   1 
HETATM 8927 O O   . HOH L 8 .   ? 46.865  7.869   0.680   1.00 62.49  ? 2880 HOH A O   1 
HETATM 8928 O O   . HOH L 8 .   ? 45.411  11.438  -0.862  1.00 63.22  ? 2881 HOH A O   1 
HETATM 8929 O O   . HOH L 8 .   ? 51.659  17.066  0.585   1.00 64.18  ? 2882 HOH A O   1 
HETATM 8930 O O   . HOH L 8 .   ? 62.151  14.046  18.299  1.00 68.49  ? 2883 HOH A O   1 
HETATM 8931 O O   . HOH L 8 .   ? 37.025  21.733  -6.417  1.00 58.93  ? 2884 HOH A O   1 
HETATM 8932 O O   . HOH L 8 .   ? 40.403  19.647  -4.705  1.00 56.90  ? 2885 HOH A O   1 
HETATM 8933 O O   . HOH L 8 .   ? 33.086  -10.043 9.911   1.00 72.22  ? 2886 HOH A O   1 
HETATM 8934 O O   . HOH L 8 .   ? 12.763  20.606  4.671   1.00 66.54  ? 2887 HOH A O   1 
HETATM 8935 O O   . HOH L 8 .   ? 31.437  28.430  -8.037  1.00 54.89  ? 2888 HOH A O   1 
HETATM 8936 O O   . HOH L 8 .   ? 34.020  27.690  -8.122  1.00 59.62  ? 2889 HOH A O   1 
HETATM 8937 O O   . HOH L 8 .   ? 23.933  32.535  -4.506  1.00 65.75  ? 2890 HOH A O   1 
HETATM 8938 O O   . HOH L 8 .   ? 17.763  34.516  3.973   1.00 70.89  ? 2891 HOH A O   1 
HETATM 8939 O O   . HOH L 8 .   ? 20.103  34.142  -3.429  1.00 62.84  ? 2892 HOH A O   1 
HETATM 8940 O O   . HOH L 8 .   ? 30.895  19.342  -11.918 1.00 62.46  ? 2893 HOH A O   1 
HETATM 8941 O O   . HOH L 8 .   ? 34.666  20.382  -12.720 1.00 60.75  ? 2894 HOH A O   1 
HETATM 8942 O O   . HOH L 8 .   ? 33.036  16.191  -14.133 1.00 60.75  ? 2895 HOH A O   1 
HETATM 8943 O O   . HOH L 8 .   ? 19.917  14.363  1.699   1.00 60.55  ? 2896 HOH A O   1 
HETATM 8944 O O   . HOH L 8 .   ? 22.538  -2.997  1.978   1.00 66.71  ? 2897 HOH A O   1 
HETATM 8945 O O   . HOH L 8 .   ? 16.739  -8.857  10.114  1.00 68.30  ? 2898 HOH A O   1 
HETATM 8946 O O   . HOH L 8 .   ? 20.035  -13.911 8.824   1.00 74.76  ? 2899 HOH A O   1 
HETATM 8947 O O   . HOH L 8 .   ? 17.866  -12.690 7.734   1.00 68.69  ? 2900 HOH A O   1 
HETATM 8948 O O   . HOH L 8 .   ? 6.564   24.730  14.691  1.00 67.05  ? 2901 HOH A O   1 
HETATM 8949 O O   . HOH L 8 .   ? 7.049   24.860  26.328  1.00 78.81  ? 2902 HOH A O   1 
HETATM 8950 O O   . HOH L 8 .   ? 15.654  -7.063  24.584  1.00 77.01  ? 2903 HOH A O   1 
HETATM 8951 O O   . HOH L 8 .   ? 8.468   -1.626  23.841  1.00 71.71  ? 2904 HOH A O   1 
HETATM 8952 O O   . HOH L 8 .   ? 9.565   -7.428  5.299   1.00 70.92  ? 2905 HOH A O   1 
HETATM 8953 O O   . HOH L 8 .   ? 3.909   2.261   3.216   1.00 70.42  ? 2906 HOH A O   1 
HETATM 8954 O O   . HOH L 8 .   ? 9.787   6.411   0.831   1.00 54.45  ? 2907 HOH A O   1 
HETATM 8955 O O   . HOH L 8 .   ? 12.372  8.210   -0.380  1.00 66.98  ? 2908 HOH A O   1 
HETATM 8956 O O   . HOH L 8 .   ? 31.987  4.791   -5.168  1.00 61.02  ? 2909 HOH A O   1 
HETATM 8957 O O   . HOH L 8 .   ? 33.745  -5.587  38.208  1.00 63.20  ? 2910 HOH A O   1 
HETATM 8958 O O   . HOH L 8 .   ? 25.955  33.746  -6.132  1.00 70.85  ? 2911 HOH A O   1 
HETATM 8959 O O   . HOH L 8 .   ? 17.404  16.491  0.727   1.00 67.71  ? 2912 HOH A O   1 
HETATM 8960 O O   . HOH L 8 .   ? 41.083  12.914  -2.854  1.00 55.52  ? 2913 HOH A O   1 
HETATM 8961 O O   . HOH L 8 .   ? 12.949  6.537   -5.021  1.00 63.50  ? 2914 HOH A O   1 
HETATM 8962 O O   . HOH L 8 .   ? 59.424  8.176   22.372  1.00 73.30  ? 2915 HOH A O   1 
HETATM 8963 O O   . HOH L 8 .   ? 13.839  32.821  -2.556  1.00 64.34  ? 2916 HOH A O   1 
HETATM 8964 O O   . HOH L 8 .   ? 13.988  16.391  1.149   1.00 67.90  ? 2917 HOH A O   1 
HETATM 8965 O O   . HOH L 8 .   ? 9.745   32.256  28.292  1.00 76.49  ? 2918 HOH A O   1 
HETATM 8966 O O   . HOH L 8 .   ? 25.418  28.849  23.262  1.00 72.65  ? 2919 HOH A O   1 
HETATM 8967 O O   . HOH L 8 .   ? 36.324  -2.603  1.644   1.00 72.23  ? 2920 HOH A O   1 
HETATM 8968 O O   . HOH L 8 .   ? 46.941  -1.240  16.964  1.00 65.00  ? 2921 HOH A O   1 
HETATM 8969 O O   . HOH L 8 .   ? 37.709  16.956  -5.980  1.00 65.02  ? 2922 HOH A O   1 
HETATM 8970 O O   . HOH L 8 .   ? 38.335  17.659  -8.246  1.00 69.73  ? 2923 HOH A O   1 
HETATM 8971 O O   . HOH L 8 .   ? 0.725   10.216  17.875  1.00 64.01  ? 2924 HOH A O   1 
HETATM 8972 O O   . HOH L 8 .   ? 35.404  25.903  -6.680  1.00 62.43  ? 2925 HOH A O   1 
HETATM 8973 O O   . HOH L 8 .   ? 8.542   24.604  12.406  1.00 64.24  ? 2926 HOH A O   1 
HETATM 8974 O O   . HOH L 8 .   ? 22.028  0.032   -0.561  1.00 61.82  ? 2927 HOH A O   1 
HETATM 8975 O O   . HOH L 8 .   ? 14.166  30.355  -1.074  1.00 70.37  ? 2928 HOH A O   1 
HETATM 8976 O O   . HOH L 8 .   ? 54.469  17.605  1.857   1.00 70.77  ? 2929 HOH A O   1 
HETATM 8977 O O   . HOH L 8 .   ? 12.947  5.578   39.103  1.00 68.87  ? 2930 HOH A O   1 
HETATM 8978 O O   . HOH L 8 .   ? 57.144  3.392   16.751  1.00 77.23  ? 2931 HOH A O   1 
HETATM 8979 O O   . HOH L 8 .   ? 46.999  13.539  -1.487  1.00 64.65  ? 2932 HOH A O   1 
HETATM 8980 O O   . HOH M 8 .   ? 16.802  -3.341  -43.120 1.00 45.00  ? 953  HOH B O   1 
HETATM 8981 O O   . HOH M 8 .   ? 4.233   3.870   -34.009 1.00 50.22  ? 954  HOH B O   1 
HETATM 8982 O O   . HOH M 8 .   ? 23.442  -5.540  -33.982 1.00 45.85  ? 955  HOH B O   1 
HETATM 8983 O O   . HOH M 8 .   ? 3.445   7.647   -33.371 1.00 42.01  ? 956  HOH B O   1 
HETATM 8984 O O   . HOH M 8 .   ? 9.229   1.543   -68.487 1.00 50.47  ? 957  HOH B O   1 
HETATM 8985 O O   . HOH M 8 .   ? 10.803  0.036   -44.329 1.00 43.83  ? 958  HOH B O   1 
HETATM 8986 O O   . HOH M 8 .   ? 4.689   4.684   -48.541 1.00 38.20  ? 959  HOH B O   1 
HETATM 8987 O O   . HOH M 8 .   ? -3.345  1.106   -48.866 1.00 53.25  ? 960  HOH B O   1 
HETATM 8988 O O   . HOH M 8 .   ? 23.261  0.688   -53.443 1.00 57.20  ? 961  HOH B O   1 
HETATM 8989 O O   . HOH M 8 .   ? 6.485   23.924  -24.950 1.00 48.69  ? 962  HOH B O   1 
HETATM 8990 O O   . HOH M 8 .   ? 0.128   19.621  -47.089 1.00 56.69  ? 963  HOH B O   1 
HETATM 8991 O O   . HOH M 8 .   ? 4.426   1.250   -69.389 1.00 42.43  ? 964  HOH B O   1 
HETATM 8992 O O   . HOH M 8 .   ? 17.620  5.403   -35.187 1.00 57.59  ? 965  HOH B O   1 
HETATM 8993 O O   . HOH M 8 .   ? 17.216  -8.113  -48.867 1.00 51.02  ? 966  HOH B O   1 
HETATM 8994 O O   . HOH M 8 .   ? -0.915  3.792   -48.983 1.00 61.76  ? 967  HOH B O   1 
HETATM 8995 O O   . HOH M 8 .   ? -7.449  7.655   -45.064 1.00 52.48  ? 968  HOH B O   1 
HETATM 8996 O O   . HOH M 8 .   ? 9.233   -0.781  -61.159 1.00 50.46  ? 969  HOH B O   1 
HETATM 8997 O O   . HOH M 8 .   ? 11.950  10.207  -17.091 1.00 46.36  ? 970  HOH B O   1 
HETATM 8998 O O   . HOH M 8 .   ? 17.824  -2.661  -56.356 1.00 48.49  ? 971  HOH B O   1 
HETATM 8999 O O   . HOH M 8 .   ? 22.818  -0.433  -28.468 1.00 51.86  ? 972  HOH B O   1 
HETATM 9000 O O   . HOH M 8 .   ? 5.031   -3.789  -42.849 1.00 44.69  ? 973  HOH B O   1 
HETATM 9001 O O   . HOH M 8 .   ? 12.959  14.705  -22.980 1.00 46.76  ? 974  HOH B O   1 
HETATM 9002 O O   . HOH M 8 .   ? 14.729  -7.213  -49.197 1.00 53.85  ? 975  HOH B O   1 
HETATM 9003 O O   . HOH M 8 .   ? 6.888   -2.192  -51.126 1.00 55.16  ? 976  HOH B O   1 
HETATM 9004 O O   . HOH M 8 .   ? -2.733  -0.452  -68.973 1.00 51.77  ? 977  HOH B O   1 
HETATM 9005 O O   . HOH M 8 .   ? 5.890   -1.989  -29.497 1.00 50.75  ? 978  HOH B O   1 
HETATM 9006 O O   . HOH M 8 .   ? 7.897   1.183   -62.256 1.00 52.42  ? 979  HOH B O   1 
HETATM 9007 O O   . HOH M 8 .   ? 23.748  -3.145  -35.062 1.00 55.51  ? 980  HOH B O   1 
HETATM 9008 O O   . HOH M 8 .   ? 11.461  16.584  -23.212 1.00 46.49  ? 981  HOH B O   1 
HETATM 9009 O O   . HOH M 8 .   ? 25.609  -2.719  -47.183 1.00 61.20  ? 982  HOH B O   1 
HETATM 9010 O O   . HOH M 8 .   ? 15.397  2.554   -62.370 1.00 43.25  ? 983  HOH B O   1 
HETATM 9011 O O   . HOH M 8 .   ? 32.599  -1.846  -19.911 1.00 72.53  ? 984  HOH B O   1 
HETATM 9012 O O   . HOH M 8 .   ? 23.260  1.285   -36.809 1.00 45.48  ? 985  HOH B O   1 
HETATM 9013 O O   . HOH M 8 .   ? 9.664   3.182   -24.208 1.00 58.31  ? 986  HOH B O   1 
HETATM 9014 O O   . HOH M 8 .   ? 12.437  26.163  -28.152 1.00 50.74  ? 987  HOH B O   1 
HETATM 9015 O O   . HOH M 8 .   ? -0.519  7.826   -72.668 1.00 53.98  ? 988  HOH B O   1 
HETATM 9016 O O   . HOH M 8 .   ? 7.156   -8.365  -44.875 1.00 50.35  ? 989  HOH B O   1 
HETATM 9017 O O   . HOH M 8 .   ? -1.503  -1.299  -64.986 1.00 52.70  ? 990  HOH B O   1 
HETATM 9018 O O   . HOH M 8 .   ? 22.298  2.159   -48.035 1.00 54.69  ? 991  HOH B O   1 
HETATM 9019 O O   . HOH M 8 .   ? 4.749   -1.063  -43.655 1.00 48.58  ? 992  HOH B O   1 
HETATM 9020 O O   . HOH M 8 .   ? 13.855  6.599   -33.621 1.00 49.96  ? 993  HOH B O   1 
HETATM 9021 O O   . HOH M 8 .   ? 13.905  -7.854  -46.757 1.00 47.40  ? 994  HOH B O   1 
HETATM 9022 O O   . HOH M 8 .   ? 4.325   10.997  -65.300 1.00 53.62  ? 995  HOH B O   1 
HETATM 9023 O O   . HOH M 8 .   ? 19.821  -1.256  -37.818 1.00 50.55  ? 996  HOH B O   1 
HETATM 9024 O O   . HOH M 8 .   ? -3.202  -5.334  -45.364 1.00 65.08  ? 997  HOH B O   1 
HETATM 9025 O O   . HOH M 8 .   ? 10.131  -5.944  -64.692 1.00 63.75  ? 998  HOH B O   1 
HETATM 9026 O O   . HOH M 8 .   ? 8.238   -0.390  -67.431 1.00 51.38  ? 999  HOH B O   1 
HETATM 9027 O O   . HOH M 8 .   ? -5.305  -2.264  -49.153 1.00 58.67  ? 1000 HOH B O   1 
HETATM 9028 O O   . HOH M 8 .   ? -3.768  -10.784 -23.083 1.00 64.46  ? 1001 HOH B O   1 
HETATM 9029 O O   . HOH M 8 .   ? 2.020   0.167   -53.531 1.00 60.57  ? 1002 HOH B O   1 
HETATM 9030 O O   . HOH M 8 .   ? 8.452   24.921  -31.596 1.00 49.95  ? 1003 HOH B O   1 
HETATM 9031 O O   . HOH M 8 .   ? 17.357  1.444   -60.884 1.00 56.37  ? 1004 HOH B O   1 
HETATM 9032 O O   . HOH M 8 .   ? 10.894  -7.898  -5.611  1.00 55.97  ? 1005 HOH B O   1 
HETATM 9033 O O   . HOH M 8 .   ? -8.113  2.131   -50.976 1.00 71.29  ? 1006 HOH B O   1 
HETATM 9034 O O   . HOH M 8 .   ? 6.678   0.182   -64.927 1.00 54.13  ? 1007 HOH B O   1 
HETATM 9035 O O   . HOH M 8 .   ? -2.291  0.825   -37.060 1.00 56.23  ? 1008 HOH B O   1 
HETATM 9036 O O   . HOH M 8 .   ? 18.738  8.685   -27.892 1.00 53.45  ? 1009 HOH B O   1 
HETATM 9037 O O   . HOH M 8 .   ? 27.569  1.786   -37.924 1.00 51.32  ? 1010 HOH B O   1 
HETATM 9038 O O   . HOH M 8 .   ? -2.814  -3.867  -42.996 1.00 61.44  ? 1011 HOH B O   1 
HETATM 9039 O O   . HOH M 8 .   ? 11.956  4.065   -75.089 1.00 48.51  ? 1012 HOH B O   1 
HETATM 9040 O O   . HOH M 8 .   ? 1.932   -2.693  -53.216 1.00 58.10  ? 1013 HOH B O   1 
HETATM 9041 O O   . HOH M 8 .   ? 0.646   0.398   -56.152 1.00 46.10  ? 1014 HOH B O   1 
HETATM 9042 O O   . HOH M 8 .   ? 22.481  -1.328  -37.281 1.00 48.56  ? 1015 HOH B O   1 
HETATM 9043 O O   . HOH M 8 .   ? 21.029  7.108   -37.059 1.00 49.95  ? 1016 HOH B O   1 
HETATM 9044 O O   . HOH M 8 .   ? 18.913  -14.619 -42.904 1.00 69.37  ? 1017 HOH B O   1 
HETATM 9045 O O   . HOH M 8 .   ? -6.385  13.191  -26.455 1.00 52.97  ? 1018 HOH B O   1 
HETATM 9046 O O   . HOH M 8 .   ? 12.614  -4.055  -11.074 1.00 55.17  ? 1019 HOH B O   1 
HETATM 9047 O O   . HOH M 8 .   ? 4.634   -8.790  -39.706 1.00 58.28  ? 1020 HOH B O   1 
HETATM 9048 O O   . HOH M 8 .   ? -1.327  -3.055  -60.952 1.00 69.46  ? 1021 HOH B O   1 
HETATM 9049 O O   . HOH M 8 .   ? 13.655  -3.954  -56.251 1.00 57.64  ? 1022 HOH B O   1 
HETATM 9050 O O   . HOH M 8 .   ? -2.670  22.600  -57.992 1.00 58.71  ? 1023 HOH B O   1 
HETATM 9051 O O   . HOH M 8 .   ? 5.565   -2.942  -34.458 1.00 69.49  ? 1024 HOH B O   1 
HETATM 9052 O O   . HOH M 8 .   ? 25.252  7.634   -38.116 1.00 60.43  ? 1025 HOH B O   1 
HETATM 9053 O O   . HOH M 8 .   ? 6.531   16.903  -53.733 1.00 53.94  ? 1026 HOH B O   1 
HETATM 9054 O O   . HOH M 8 .   ? -8.154  -0.532  -45.667 1.00 66.70  ? 1027 HOH B O   1 
HETATM 9055 O O   . HOH M 8 .   ? -15.851 8.935   -45.464 1.00 56.81  ? 1028 HOH B O   1 
HETATM 9056 O O   . HOH M 8 .   ? -14.968 0.522   -53.262 1.00 63.64  ? 1029 HOH B O   1 
HETATM 9057 O O   . HOH M 8 .   ? -3.707  24.264  -51.116 1.00 63.82  ? 1030 HOH B O   1 
HETATM 9058 O O   . HOH M 8 .   ? 4.852   -13.206 -53.737 1.00 52.76  ? 1031 HOH B O   1 
HETATM 9059 O O   . HOH M 8 .   ? 16.124  -4.350  -57.406 1.00 48.45  ? 1032 HOH B O   1 
HETATM 9060 O O   . HOH M 8 .   ? 1.795   19.634  -60.059 1.00 58.13  ? 1033 HOH B O   1 
HETATM 9061 O O   . HOH M 8 .   ? -5.644  -3.799  -55.747 1.00 57.99  ? 1034 HOH B O   1 
HETATM 9062 O O   . HOH M 8 .   ? -1.131  -6.808  -45.140 1.00 62.53  ? 1035 HOH B O   1 
HETATM 9063 O O   . HOH M 8 .   ? 17.130  -7.798  -60.733 1.00 60.18  ? 1036 HOH B O   1 
HETATM 9064 O O   . HOH M 8 .   ? 23.887  9.859   -36.105 1.00 51.99  ? 1037 HOH B O   1 
HETATM 9065 O O   . HOH M 8 .   ? -0.498  7.064   -77.067 1.00 61.83  ? 1038 HOH B O   1 
HETATM 9066 O O   . HOH M 8 .   ? 19.177  6.064   -27.467 1.00 55.95  ? 1039 HOH B O   1 
HETATM 9067 O O   . HOH M 8 .   ? 12.595  -0.460  -68.647 1.00 48.73  ? 1040 HOH B O   1 
HETATM 9068 O O   . HOH M 8 .   ? 20.000  -8.320  -60.928 1.00 55.95  ? 1041 HOH B O   1 
HETATM 9069 O O   . HOH M 8 .   ? -0.738  -9.482  -56.480 1.00 56.94  ? 1042 HOH B O   1 
HETATM 9070 O O   . HOH M 8 .   ? 7.040   4.256   -25.069 1.00 66.53  ? 1043 HOH B O   1 
HETATM 9071 O O   . HOH M 8 .   ? 3.744   19.997  -28.443 1.00 54.79  ? 1044 HOH B O   1 
HETATM 9072 O O   . HOH M 8 .   ? 24.415  -2.466  -44.453 1.00 53.31  ? 1045 HOH B O   1 
HETATM 9073 O O   . HOH M 8 .   ? 15.164  2.500   -69.412 1.00 55.07  ? 1046 HOH B O   1 
HETATM 9074 O O   . HOH M 8 .   ? 11.521  26.746  -32.304 1.00 62.56  ? 1047 HOH B O   1 
HETATM 9075 O O   . HOH M 8 .   ? 23.983  1.288   -32.687 1.00 61.94  ? 1048 HOH B O   1 
HETATM 9076 O O   . HOH M 8 .   ? 24.522  -2.403  -59.428 1.00 67.79  ? 1049 HOH B O   1 
HETATM 9077 O O   . HOH M 8 .   ? -14.513 3.300   -61.198 1.00 68.82  ? 1050 HOH B O   1 
HETATM 9078 O O   . HOH M 8 .   ? -3.787  1.075   -30.533 1.00 58.31  ? 1051 HOH B O   1 
HETATM 9079 O O   . HOH M 8 .   ? 1.695   23.222  -19.710 1.00 60.85  ? 1052 HOH B O   1 
HETATM 9080 O O   . HOH M 8 .   ? 3.079   1.888   -20.441 1.00 63.36  ? 1053 HOH B O   1 
HETATM 9081 O O   . HOH M 8 .   ? 2.903   9.353   -73.464 1.00 59.39  ? 1054 HOH B O   1 
HETATM 9082 O O   . HOH M 8 .   ? -9.303  17.918  -27.176 1.00 70.38  ? 1055 HOH B O   1 
HETATM 9083 O O   . HOH M 8 .   ? 5.228   8.375   -64.234 1.00 65.12  ? 1056 HOH B O   1 
HETATM 9084 O O   . HOH M 8 .   ? 12.969  -4.402  -51.994 1.00 52.64  ? 1057 HOH B O   1 
HETATM 9085 O O   . HOH M 8 .   ? -1.538  24.732  -47.350 1.00 63.79  ? 1058 HOH B O   1 
HETATM 9086 O O   . HOH M 8 .   ? -5.742  0.299   -49.174 1.00 64.96  ? 1059 HOH B O   1 
HETATM 9087 O O   . HOH M 8 .   ? 5.624   8.956   -20.906 1.00 65.29  ? 1060 HOH B O   1 
HETATM 9088 O O   . HOH M 8 .   ? 5.604   -1.717  -22.259 1.00 54.53  ? 1061 HOH B O   1 
HETATM 9089 O O   . HOH M 8 .   ? 1.521   20.948  -18.548 1.00 56.16  ? 1062 HOH B O   1 
HETATM 9090 O O   . HOH M 8 .   ? 12.689  -5.279  -54.541 1.00 58.49  ? 1063 HOH B O   1 
HETATM 9091 O O   . HOH M 8 .   ? -7.062  23.631  -47.526 1.00 70.05  ? 1064 HOH B O   1 
HETATM 9092 O O   . HOH M 8 .   ? 7.082   11.589  -19.480 1.00 63.61  ? 1065 HOH B O   1 
HETATM 9093 O O   . HOH M 8 .   ? -4.163  -6.804  -34.279 1.00 60.79  ? 1066 HOH B O   1 
HETATM 9094 O O   . HOH M 8 .   ? 25.834  0.588   -36.437 1.00 52.66  ? 1067 HOH B O   1 
HETATM 9095 O O   . HOH M 8 .   ? 22.305  12.267  -32.031 1.00 75.20  ? 1068 HOH B O   1 
HETATM 9096 O O   . HOH M 8 .   ? 34.522  -2.288  -43.688 1.00 62.52  ? 1069 HOH B O   1 
HETATM 9097 O O   . HOH M 8 .   ? 18.476  15.158  -22.143 1.00 55.06  ? 1070 HOH B O   1 
HETATM 9098 O O   . HOH M 8 .   ? -19.381 0.833   -29.592 1.00 71.07  ? 1071 HOH B O   1 
HETATM 9099 O O   . HOH M 8 .   ? 10.915  4.754   -19.160 1.00 54.92  ? 1072 HOH B O   1 
HETATM 9100 O O   . HOH M 8 .   ? 2.728   -12.220 -47.305 1.00 63.26  ? 1073 HOH B O   1 
HETATM 9101 O O   . HOH M 8 .   ? -9.396  17.591  -33.917 1.00 67.52  ? 1074 HOH B O   1 
HETATM 9102 O O   . HOH M 8 .   ? -6.396  2.606   -24.155 1.00 60.27  ? 1075 HOH B O   1 
HETATM 9103 O O   . HOH M 8 .   ? -1.300  -10.022 -21.209 1.00 65.77  ? 1076 HOH B O   1 
HETATM 9104 O O   . HOH M 8 .   ? 16.153  -13.126 -21.520 1.00 71.74  ? 1077 HOH B O   1 
HETATM 9105 O O   . HOH M 8 .   ? -3.789  -3.894  -67.016 1.00 62.74  ? 1078 HOH B O   1 
HETATM 9106 O O   . HOH M 8 .   ? 13.854  -6.729  -33.954 1.00 59.15  ? 1079 HOH B O   1 
HETATM 9107 O O   . HOH M 8 .   ? 2.546   27.315  -23.789 1.00 69.97  ? 1080 HOH B O   1 
HETATM 9108 O O   . HOH M 8 .   ? 25.752  -13.095 -65.602 1.00 71.79  ? 1081 HOH B O   1 
HETATM 9109 O O   . HOH M 8 .   ? -12.357 2.611   -63.299 1.00 63.61  ? 1082 HOH B O   1 
HETATM 9110 O O   . HOH M 8 .   ? -12.142 -1.446  -52.318 1.00 76.94  ? 1083 HOH B O   1 
HETATM 9111 O O   . HOH M 8 .   ? -17.172 9.141   -42.916 1.00 61.54  ? 1084 HOH B O   1 
HETATM 9112 O O   . HOH M 8 .   ? -2.611  -0.385  -22.705 1.00 56.04  ? 1085 HOH B O   1 
HETATM 9113 O O   . HOH M 8 .   ? 11.414  21.874  -46.806 1.00 60.68  ? 1086 HOH B O   1 
HETATM 9114 O O   . HOH M 8 .   ? 14.530  6.105   -72.528 1.00 70.76  ? 1087 HOH B O   1 
HETATM 9115 O O   . HOH M 8 .   ? -5.112  1.915   -73.774 1.00 58.75  ? 1088 HOH B O   1 
HETATM 9116 O O   . HOH M 8 .   ? -3.478  -5.348  -56.958 1.00 67.58  ? 1089 HOH B O   1 
HETATM 9117 O O   . HOH M 8 .   ? 11.036  -14.358 -46.508 1.00 58.52  ? 1090 HOH B O   1 
HETATM 9118 O O   . HOH M 8 .   ? -5.715  -13.235 -35.003 1.00 70.85  ? 1091 HOH B O   1 
HETATM 9119 O O   . HOH M 8 .   ? 4.943   -5.431  -46.499 1.00 59.49  ? 1092 HOH B O   1 
HETATM 9120 O O   . HOH M 8 .   ? 0.047   -12.359 -51.330 1.00 75.20  ? 1093 HOH B O   1 
HETATM 9121 O O   . HOH M 8 .   ? 3.363   -11.780 -51.589 1.00 60.97  ? 1094 HOH B O   1 
HETATM 9122 O O   . HOH M 8 .   ? -14.863 17.123  -53.985 1.00 75.48  ? 1095 HOH B O   1 
HETATM 9123 O O   . HOH M 8 .   ? -8.404  19.596  -61.131 1.00 80.15  ? 1096 HOH B O   1 
HETATM 9124 O O   . HOH M 8 .   ? 23.297  -0.344  -45.584 1.00 52.03  ? 1097 HOH B O   1 
HETATM 9125 O O   . HOH M 8 .   ? 22.642  10.269  -53.082 1.00 65.06  ? 1098 HOH B O   1 
HETATM 9126 O O   . HOH M 8 .   ? 15.828  10.157  -56.854 1.00 52.76  ? 1099 HOH B O   1 
HETATM 9127 O O   . HOH M 8 .   ? 22.836  15.793  -46.041 1.00 53.29  ? 1100 HOH B O   1 
HETATM 9128 O O   . HOH M 8 .   ? 21.107  19.294  -44.092 1.00 64.82  ? 1101 HOH B O   1 
HETATM 9129 O O   . HOH M 8 .   ? 32.879  7.015   -42.985 1.00 63.08  ? 1102 HOH B O   1 
HETATM 9130 O O   . HOH M 8 .   ? 29.515  7.883   -40.278 1.00 59.33  ? 1103 HOH B O   1 
HETATM 9131 O O   . HOH M 8 .   ? 35.654  0.034   -44.741 1.00 68.10  ? 1104 HOH B O   1 
HETATM 9132 O O   . HOH M 8 .   ? 35.949  -1.050  -58.407 1.00 70.87  ? 1105 HOH B O   1 
HETATM 9133 O O   . HOH M 8 .   ? 10.643  -13.668 -49.045 1.00 63.82  ? 1106 HOH B O   1 
HETATM 9134 O O   . HOH M 8 .   ? 28.224  -3.798  -32.464 1.00 64.27  ? 1107 HOH B O   1 
HETATM 9135 O O   . HOH M 8 .   ? 26.700  8.709   -53.640 1.00 61.93  ? 1108 HOH B O   1 
HETATM 9136 O O   . HOH M 8 .   ? 7.994   0.402   -24.411 1.00 61.46  ? 1109 HOH B O   1 
HETATM 9137 O O   . HOH M 8 .   ? 22.979  7.093   -26.081 1.00 60.06  ? 1110 HOH B O   1 
HETATM 9138 O O   . HOH M 8 .   ? 21.399  15.531  -26.174 1.00 75.64  ? 1111 HOH B O   1 
HETATM 9139 O O   . HOH M 8 .   ? 7.310   27.752  -30.921 1.00 66.66  ? 1112 HOH B O   1 
HETATM 9140 O O   . HOH M 8 .   ? -7.649  4.618   -24.208 1.00 58.05  ? 1113 HOH B O   1 
HETATM 9141 O O   . HOH M 8 .   ? -6.155  -3.116  -34.133 1.00 76.08  ? 1114 HOH B O   1 
HETATM 9142 O O   . HOH M 8 .   ? -8.301  19.307  -29.345 1.00 59.88  ? 1115 HOH B O   1 
HETATM 9143 O O   . HOH M 8 .   ? -3.014  24.239  -23.748 1.00 65.99  ? 1116 HOH B O   1 
HETATM 9144 O O   . HOH M 8 .   ? 12.378  27.445  -25.453 1.00 57.21  ? 1117 HOH B O   1 
HETATM 9145 O O   . HOH M 8 .   ? -5.962  13.135  -23.083 1.00 62.63  ? 1118 HOH B O   1 
HETATM 9146 O O   . HOH M 8 .   ? -3.773  20.545  -20.346 1.00 54.60  ? 1119 HOH B O   1 
HETATM 9147 O O   . HOH M 8 .   ? 3.352   17.017  -17.012 1.00 58.87  ? 1120 HOH B O   1 
HETATM 9148 O O   . HOH M 8 .   ? 5.610   14.186  -18.748 1.00 58.49  ? 1121 HOH B O   1 
HETATM 9149 O O   . HOH M 8 .   ? 6.043   17.089  -15.924 1.00 64.40  ? 1122 HOH B O   1 
HETATM 9150 O O   . HOH M 8 .   ? 9.374   13.723  -17.981 1.00 56.51  ? 1123 HOH B O   1 
HETATM 9151 O O   . HOH M 8 .   ? 24.846  17.280  -20.438 1.00 66.13  ? 1124 HOH B O   1 
HETATM 9152 O O   . HOH M 8 .   ? 30.542  5.651   -26.917 1.00 65.85  ? 1125 HOH B O   1 
HETATM 9153 O O   . HOH M 8 .   ? 17.237  2.206   -67.816 1.00 75.56  ? 1126 HOH B O   1 
HETATM 9154 O O   . HOH M 8 .   ? 31.447  10.269  -45.394 1.00 66.13  ? 1127 HOH B O   1 
HETATM 9155 O O   . HOH M 8 .   ? -2.690  -0.691  -61.462 1.00 68.95  ? 1128 HOH B O   1 
HETATM 9156 O O   . HOH M 8 .   ? 32.757  9.365   -46.969 1.00 66.83  ? 1129 HOH B O   1 
HETATM 9157 O O   . HOH M 8 .   ? -1.510  -12.399 -29.221 1.00 71.99  ? 1130 HOH B O   1 
HETATM 9158 O O   . HOH M 8 .   ? -13.349 2.627   -27.274 1.00 66.26  ? 1131 HOH B O   1 
HETATM 9159 O O   . HOH M 8 .   ? 33.507  2.250   -47.365 1.00 68.47  ? 1132 HOH B O   1 
HETATM 9160 O O   . HOH M 8 .   ? 8.067   -15.601 -18.823 1.00 73.96  ? 1133 HOH B O   1 
HETATM 9161 O O   . HOH M 8 .   ? 25.426  6.954   -51.803 1.00 66.37  ? 1134 HOH B O   1 
HETATM 9162 O O   . HOH M 8 .   ? 15.032  5.270   -69.823 1.00 70.54  ? 1135 HOH B O   1 
HETATM 9163 O O   . HOH M 8 .   ? 21.049  -1.364  -52.810 1.00 57.73  ? 1136 HOH B O   1 
HETATM 9164 O O   . HOH M 8 .   ? -14.393 13.825  -33.713 1.00 68.27  ? 1137 HOH B O   1 
HETATM 9165 O O   . HOH M 8 .   ? -17.904 -8.535  -36.151 1.00 89.34  ? 1138 HOH B O   1 
HETATM 9166 O O   . HOH M 8 .   ? 4.864   26.613  -26.681 1.00 58.40  ? 1139 HOH B O   1 
HETATM 9167 O O   . HOH M 8 .   ? -10.689 23.352  -31.113 1.00 74.66  ? 1140 HOH B O   1 
HETATM 9168 O O   . HOH M 8 .   ? 4.272   -12.800 -49.350 1.00 70.58  ? 1141 HOH B O   1 
HETATM 9169 O O   . HOH M 8 .   ? 6.623   -7.895  -41.644 1.00 64.74  ? 1142 HOH B O   1 
HETATM 9170 O O   . HOH M 8 .   ? 4.861   24.319  -57.846 1.00 63.97  ? 1143 HOH B O   1 
HETATM 9171 O O   . HOH M 8 .   ? 18.362  20.844  -27.196 1.00 78.05  ? 1144 HOH B O   1 
HETATM 9172 O O   . HOH M 8 .   ? 1.599   -16.038 -17.903 1.00 75.31  ? 1145 HOH B O   1 
HETATM 9173 O O   . HOH M 8 .   ? -14.311 -8.238  -38.053 1.00 74.44  ? 1146 HOH B O   1 
HETATM 9174 O O   . HOH M 8 .   ? -0.328  0.800   -21.790 1.00 65.86  ? 1147 HOH B O   1 
HETATM 9175 O O   . HOH M 8 .   ? 3.631   0.050   -65.948 1.00 70.43  ? 1148 HOH B O   1 
HETATM 9176 O O   . HOH M 8 .   ? 1.609   7.030   -21.073 1.00 82.61  ? 1149 HOH B O   1 
HETATM 9177 O O   . HOH M 8 .   ? -1.507  -2.346  -67.454 1.00 69.69  ? 1150 HOH B O   1 
HETATM 9178 O O   . HOH M 8 .   ? 31.219  11.889  -43.493 1.00 70.83  ? 1151 HOH B O   1 
HETATM 9179 O O   . HOH M 8 .   ? -11.843 0.686   -26.216 1.00 61.15  ? 1152 HOH B O   1 
HETATM 9180 O O   . HOH M 8 .   ? 17.788  -5.471  -43.961 1.00 61.47  ? 1153 HOH B O   1 
HETATM 9181 O O   . HOH M 8 .   ? 38.979  -6.126  -61.887 1.00 78.61  ? 1154 HOH B O   1 
HETATM 9182 O O   . HOH M 8 .   ? 32.544  -8.598  -43.749 1.00 70.64  ? 1155 HOH B O   1 
HETATM 9183 O O   . HOH M 8 .   ? 22.191  9.795   -33.800 1.00 60.03  ? 1156 HOH B O   1 
HETATM 9184 O O   . HOH M 8 .   ? 0.956   -0.155  -63.798 1.00 69.43  ? 1157 HOH B O   1 
HETATM 9185 O O   . HOH M 8 .   ? 7.575   3.444   -71.504 1.00 62.94  ? 1158 HOH B O   1 
HETATM 9186 O O   . HOH M 8 .   ? -5.122  -6.558  -47.628 1.00 66.43  ? 1159 HOH B O   1 
HETATM 9187 O O   . HOH M 8 .   ? 36.512  -13.553 -52.269 1.00 86.67  ? 1160 HOH B O   1 
HETATM 9188 O O   . HOH M 8 .   ? 23.175  7.424   -53.334 1.00 66.87  ? 1161 HOH B O   1 
HETATM 9189 O O   . HOH M 8 .   ? 4.354   -20.488 -24.972 1.00 76.90  ? 1162 HOH B O   1 
HETATM 9190 O O   . HOH M 8 .   ? 16.066  16.370  -25.226 1.00 66.42  ? 1163 HOH B O   1 
HETATM 9191 O O   . HOH M 8 .   ? -15.273 0.478   -37.423 1.00 68.10  ? 1164 HOH B O   1 
HETATM 9192 O O   . HOH M 8 .   ? 17.558  -15.338 -20.781 1.00 78.87  ? 1165 HOH B O   1 
HETATM 9193 O O   . HOH M 8 .   ? -8.247  6.558   -23.639 1.00 65.32  ? 1166 HOH B O   1 
HETATM 9194 O O   . HOH M 8 .   ? 4.807   -9.752  -10.944 1.00 68.60  ? 1167 HOH B O   1 
HETATM 9195 O O   . HOH M 8 .   ? -17.354 11.865  -51.639 1.00 69.84  ? 1168 HOH B O   1 
HETATM 9196 O O   . HOH M 8 .   ? -12.081 -0.422  -63.385 1.00 74.13  ? 1169 HOH B O   1 
HETATM 9197 O O   . HOH M 8 .   ? -0.229  -6.860  -58.067 1.00 72.88  ? 1170 HOH B O   1 
HETATM 9198 O O   . HOH M 8 .   ? -13.311 15.777  -35.175 1.00 70.75  ? 1171 HOH B O   1 
HETATM 9199 O O   . HOH M 8 .   ? 32.314  14.299  -42.916 1.00 78.79  ? 1172 HOH B O   1 
HETATM 9200 O O   . HOH M 8 .   ? 1.626   -2.565  -19.551 1.00 64.99  ? 1173 HOH B O   1 
HETATM 9201 O O   . HOH M 8 .   ? 23.741  7.732   -55.958 1.00 70.60  ? 1174 HOH B O   1 
HETATM 9202 O O   . HOH M 8 .   ? -13.209 6.259   -66.751 1.00 76.01  ? 1175 HOH B O   1 
HETATM 9203 O O   . HOH M 8 .   ? 32.253  -9.411  -41.180 1.00 69.80  ? 1176 HOH B O   1 
HETATM 9204 O O   . HOH M 8 .   ? 30.735  -4.342  -36.410 1.00 74.23  ? 1177 HOH B O   1 
HETATM 9205 O O   . HOH M 8 .   ? 7.650   1.585   -6.877  1.00 73.19  ? 1178 HOH B O   1 
HETATM 9206 O O   . HOH M 8 .   ? 11.452  6.673   -17.385 1.00 74.59  ? 1179 HOH B O   1 
HETATM 9207 O O   . HOH M 8 .   ? 10.735  27.204  -29.749 1.00 70.12  ? 1180 HOH B O   1 
HETATM 9208 O O   . HOH M 8 .   ? 23.664  -6.686  -64.910 1.00 64.87  ? 1181 HOH B O   1 
HETATM 9209 O O   . HOH M 8 .   ? 0.668   30.384  -33.360 1.00 81.09  ? 1182 HOH B O   1 
HETATM 9210 O O   . HOH M 8 .   ? 9.353   27.282  -38.654 1.00 71.97  ? 1183 HOH B O   1 
HETATM 9211 O O   . HOH M 8 .   ? -3.063  -2.986  -21.917 1.00 66.42  ? 1184 HOH B O   1 
HETATM 9212 O O   . HOH M 8 .   ? 9.515   25.740  -48.154 1.00 83.12  ? 1185 HOH B O   1 
HETATM 9213 O O   . HOH M 8 .   ? 0.072   26.859  -51.536 1.00 69.79  ? 1186 HOH B O   1 
HETATM 9214 O O   . HOH M 8 .   ? 34.719  -4.552  -45.240 1.00 69.88  ? 1187 HOH B O   1 
HETATM 9215 O O   . HOH M 8 .   ? 27.878  6.627   -38.508 1.00 69.81  ? 1188 HOH B O   1 
HETATM 9216 O O   . HOH M 8 .   ? 2.025   7.749   -77.244 1.00 72.36  ? 1189 HOH B O   1 
HETATM 9217 O O   . HOH M 8 .   ? 5.072   -15.981 -17.981 1.00 72.23  ? 1190 HOH B O   1 
HETATM 9218 O O   . HOH M 8 .   ? 0.478   28.963  -52.839 1.00 77.01  ? 1191 HOH B O   1 
HETATM 9219 O O   . HOH M 8 .   ? -6.328  1.032   -70.440 1.00 73.82  ? 1192 HOH B O   1 
HETATM 9220 O O   . HOH M 8 .   ? -14.899 17.420  -47.086 1.00 74.26  ? 1193 HOH B O   1 
HETATM 9221 O O   . HOH M 8 .   ? 15.913  9.481   -67.807 1.00 72.39  ? 1194 HOH B O   1 
HETATM 9222 O O   . HOH M 8 .   ? 32.423  13.148  -49.558 1.00 69.41  ? 1195 HOH B O   1 
HETATM 9223 O O   . HOH M 8 .   ? 7.722   29.112  -42.140 1.00 79.82  ? 1196 HOH B O   1 
HETATM 9224 O O   . HOH M 8 .   ? 9.283   9.285   -63.070 1.00 67.49  ? 1197 HOH B O   1 
HETATM 9225 O O   . HOH M 8 .   ? 9.148   21.534  -57.219 1.00 72.98  ? 1198 HOH B O   1 
HETATM 9226 O O   . HOH M 8 .   ? 37.853  -15.110 -54.953 1.00 87.22  ? 1199 HOH B O   1 
HETATM 9227 O O   . HOH M 8 .   ? 11.067  12.892  -65.557 1.00 68.61  ? 1200 HOH B O   1 
HETATM 9228 O O   . HOH M 8 .   ? 26.802  1.977   -33.454 1.00 70.11  ? 1201 HOH B O   1 
HETATM 9229 O O   . HOH M 8 .   ? 14.872  24.690  -42.677 1.00 74.35  ? 1202 HOH B O   1 
HETATM 9230 O O   . HOH M 8 .   ? -13.480 19.456  -48.133 1.00 74.46  ? 1203 HOH B O   1 
HETATM 9231 O O   . HOH M 8 .   ? 5.347   -5.705  -60.707 1.00 67.89  ? 1204 HOH B O   1 
HETATM 9232 O O   . HOH M 8 .   ? 17.531  -2.299  -29.449 1.00 68.71  ? 1205 HOH B O   1 
HETATM 9233 O O   . HOH M 8 .   ? 36.422  -10.817 -53.210 1.00 83.20  ? 1206 HOH B O   1 
HETATM 9234 O O   . HOH M 8 .   ? 29.746  -4.575  -27.797 1.00 74.75  ? 1207 HOH B O   1 
HETATM 9235 O O   . HOH M 8 .   ? -8.129  2.321   -73.263 1.00 66.65  ? 1208 HOH B O   1 
HETATM 9236 O O   . HOH M 8 .   ? 34.497  -7.030  -44.263 1.00 70.09  ? 1209 HOH B O   1 
HETATM 9237 O O   . HOH M 8 .   ? 16.061  16.867  -56.154 1.00 66.26  ? 1210 HOH B O   1 
HETATM 9238 O O   . HOH M 8 .   ? -0.130  -2.694  -19.966 1.00 69.33  ? 1211 HOH B O   1 
HETATM 9239 O O   . HOH M 8 .   ? -4.262  -0.349  -72.423 1.00 65.58  ? 1212 HOH B O   1 
HETATM 9240 O O   . HOH M 8 .   ? 2.342   29.874  -31.220 1.00 69.34  ? 1213 HOH B O   1 
HETATM 9241 O O   . HOH M 8 .   ? -1.157  24.121  -19.718 1.00 58.54  ? 1214 HOH B O   1 
HETATM 9242 O O   . HOH M 8 .   ? 0.899   13.082  -71.348 1.00 58.56  ? 1215 HOH B O   1 
HETATM 9243 O O   . HOH M 8 .   ? 0.563   16.716  -67.672 1.00 72.86  ? 1216 HOH B O   1 
HETATM 9244 O O   . HOH M 8 .   ? 6.682   12.853  -64.381 1.00 59.82  ? 1217 HOH B O   1 
HETATM 9245 O O   . HOH M 8 .   ? -10.289 -2.431  -61.819 1.00 72.63  ? 1218 HOH B O   1 
HETATM 9246 O O   . HOH M 8 .   ? -17.789 12.783  -45.064 1.00 66.13  ? 1219 HOH B O   1 
HETATM 9247 O O   . HOH M 8 .   ? 14.495  7.128   -67.952 1.00 53.41  ? 1220 HOH B O   1 
HETATM 9248 O O   . HOH M 8 .   ? 16.675  -3.547  -66.490 1.00 62.81  ? 1221 HOH B O   1 
HETATM 9249 O O   . HOH M 8 .   ? 20.192  4.018   -62.416 1.00 67.70  ? 1222 HOH B O   1 
HETATM 9250 O O   . HOH M 8 .   ? -1.030  0.725   -75.413 1.00 60.04  ? 1223 HOH B O   1 
HETATM 9251 O O   . HOH M 8 .   ? 9.210   -8.780  -40.192 1.00 66.18  ? 1224 HOH B O   1 
HETATM 9252 O O   . HOH M 8 .   ? -4.483  -8.689  -42.753 1.00 72.22  ? 1225 HOH B O   1 
HETATM 9253 O O   . HOH M 8 .   ? -9.835  21.881  -51.988 1.00 67.49  ? 1226 HOH B O   1 
HETATM 9254 O O   . HOH M 8 .   ? 4.553   2.121   -41.083 1.00 56.70  ? 1227 HOH B O   1 
HETATM 9255 O O   . HOH M 8 .   ? -10.435 -0.979  -44.594 1.00 75.30  ? 1228 HOH B O   1 
HETATM 9256 O O   . HOH M 8 .   ? -12.062 14.198  -39.312 1.00 65.90  ? 1229 HOH B O   1 
HETATM 9257 O O   . HOH M 8 .   ? 28.448  5.628   -51.987 1.00 62.03  ? 1230 HOH B O   1 
HETATM 9258 O O   . HOH M 8 .   ? 33.313  0.526   -58.159 1.00 67.42  ? 1231 HOH B O   1 
HETATM 9259 O O   . HOH M 8 .   ? 29.873  6.716   -49.746 1.00 61.30  ? 1232 HOH B O   1 
HETATM 9260 O O   . HOH M 8 .   ? 18.869  12.904  -56.025 1.00 64.47  ? 1233 HOH B O   1 
HETATM 9261 O O   . HOH M 8 .   ? 6.166   23.688  -55.482 1.00 60.45  ? 1234 HOH B O   1 
HETATM 9262 O O   . HOH M 8 .   ? 4.982   22.120  -59.785 1.00 67.84  ? 1235 HOH B O   1 
HETATM 9263 O O   . HOH M 8 .   ? 22.711  15.812  -50.518 1.00 64.63  ? 1236 HOH B O   1 
HETATM 9264 O O   . HOH M 8 .   ? 22.495  17.414  -47.957 1.00 60.85  ? 1237 HOH B O   1 
HETATM 9265 O O   . HOH M 8 .   ? 10.123  23.975  -49.874 1.00 72.66  ? 1238 HOH B O   1 
HETATM 9266 O O   . HOH M 8 .   ? 19.848  9.936   -30.683 1.00 57.84  ? 1239 HOH B O   1 
HETATM 9267 O O   . HOH M 8 .   ? 22.746  9.806   -28.094 1.00 68.82  ? 1240 HOH B O   1 
HETATM 9268 O O   . HOH M 8 .   ? 24.196  1.377   -27.823 1.00 63.40  ? 1241 HOH B O   1 
HETATM 9269 O O   . HOH M 8 .   ? 26.144  -1.956  -35.809 1.00 62.22  ? 1242 HOH B O   1 
HETATM 9270 O O   . HOH M 8 .   ? 30.101  6.953   -42.811 1.00 60.89  ? 1243 HOH B O   1 
HETATM 9271 O O   . HOH M 8 .   ? 33.085  4.559   -41.864 1.00 56.53  ? 1244 HOH B O   1 
HETATM 9272 O O   . HOH M 8 .   ? 23.453  -17.304 -59.404 1.00 67.54  ? 1245 HOH B O   1 
HETATM 9273 O O   . HOH M 8 .   ? 19.786  -20.173 -56.468 1.00 69.80  ? 1246 HOH B O   1 
HETATM 9274 O O   . HOH M 8 .   ? 24.008  -8.880  -27.729 1.00 66.63  ? 1247 HOH B O   1 
HETATM 9275 O O   . HOH M 8 .   ? 23.893  -11.307 -25.765 1.00 68.05  ? 1248 HOH B O   1 
HETATM 9276 O O   . HOH M 8 .   ? 16.740  30.058  -33.553 1.00 72.10  ? 1249 HOH B O   1 
HETATM 9277 O O   . HOH M 8 .   ? 19.687  28.756  -36.429 1.00 81.37  ? 1250 HOH B O   1 
HETATM 9278 O O   . HOH M 8 .   ? 6.878   -0.368  -19.995 1.00 56.08  ? 1251 HOH B O   1 
HETATM 9279 O O   . HOH M 8 .   ? 4.851   -3.904  -21.313 1.00 60.82  ? 1252 HOH B O   1 
HETATM 9280 O O   . HOH M 8 .   ? 18.111  -13.126 -29.633 1.00 74.37  ? 1253 HOH B O   1 
HETATM 9281 O O   . HOH M 8 .   ? 15.688  -17.599 -20.162 1.00 61.32  ? 1254 HOH B O   1 
HETATM 9282 O O   . HOH M 8 .   ? -2.563  -16.568 -27.337 1.00 72.50  ? 1255 HOH B O   1 
HETATM 9283 O O   . HOH M 8 .   ? -3.787  -12.309 -25.954 1.00 74.69  ? 1256 HOH B O   1 
HETATM 9284 O O   . HOH M 8 .   ? -5.830  -10.732 -26.880 1.00 74.99  ? 1257 HOH B O   1 
HETATM 9285 O O   . HOH M 8 .   ? 16.930  -14.358 -11.487 1.00 71.36  ? 1258 HOH B O   1 
HETATM 9286 O O   . HOH M 8 .   ? 22.226  -5.954  -11.128 1.00 72.60  ? 1259 HOH B O   1 
HETATM 9287 O O   . HOH M 8 .   ? 23.054  -7.268  -18.258 1.00 76.91  ? 1260 HOH B O   1 
HETATM 9288 O O   . HOH M 8 .   ? 32.443  -4.376  -22.159 1.00 70.21  ? 1261 HOH B O   1 
HETATM 9289 O O   . HOH M 8 .   ? 18.010  18.063  -27.820 1.00 65.34  ? 1262 HOH B O   1 
HETATM 9290 O O   . HOH M 8 .   ? 18.102  15.033  -25.260 1.00 58.07  ? 1263 HOH B O   1 
HETATM 9291 O O   . HOH M 8 .   ? 16.043  15.291  -21.246 1.00 54.06  ? 1264 HOH B O   1 
HETATM 9292 O O   . HOH M 8 .   ? 14.495  29.478  -31.518 1.00 73.31  ? 1265 HOH B O   1 
HETATM 9293 O O   . HOH M 8 .   ? -7.480  -4.230  -26.778 1.00 68.10  ? 1266 HOH B O   1 
HETATM 9294 O O   . HOH M 8 .   ? -13.909 9.446   -28.501 1.00 68.76  ? 1267 HOH B O   1 
HETATM 9295 O O   . HOH M 8 .   ? -14.809 18.294  -41.047 1.00 72.48  ? 1268 HOH B O   1 
HETATM 9296 O O   . HOH M 8 .   ? -7.770  22.174  -31.981 1.00 65.60  ? 1269 HOH B O   1 
HETATM 9297 O O   . HOH M 8 .   ? -0.922  16.881  -17.366 1.00 73.44  ? 1270 HOH B O   1 
HETATM 9298 O O   . HOH M 8 .   ? 2.426   19.800  -16.515 1.00 68.63  ? 1271 HOH B O   1 
HETATM 9299 O O   . HOH M 8 .   ? 5.808   19.820  -14.845 1.00 73.48  ? 1272 HOH B O   1 
HETATM 9300 O O   . HOH M 8 .   ? 11.246  12.593  -16.247 1.00 63.01  ? 1273 HOH B O   1 
HETATM 9301 O O   . HOH M 8 .   ? 12.918  15.989  -14.669 1.00 62.43  ? 1274 HOH B O   1 
HETATM 9302 O O   . HOH M 8 .   ? 13.792  8.083   -13.957 1.00 73.73  ? 1275 HOH B O   1 
HETATM 9303 O O   . HOH M 8 .   ? 7.045   -5.096  -41.641 1.00 55.77  ? 1276 HOH B O   1 
HETATM 9304 O O   . HOH M 8 .   ? 22.591  5.520   -30.271 1.00 62.54  ? 1277 HOH B O   1 
HETATM 9305 O O   . HOH M 8 .   ? 3.593   11.192  -20.667 1.00 54.27  ? 1278 HOH B O   1 
HETATM 9306 O O   . HOH M 8 .   ? 13.951  17.956  -26.181 1.00 70.79  ? 1279 HOH B O   1 
HETATM 9307 O O   . HOH M 8 .   ? 14.994  17.653  -21.209 1.00 53.35  ? 1280 HOH B O   1 
HETATM 9308 O O   . HOH M 8 .   ? 4.766   7.981   -75.604 1.00 62.50  ? 1281 HOH B O   1 
HETATM 9309 O O   . HOH M 8 .   ? 1.000   17.382  -65.350 1.00 75.25  ? 1282 HOH B O   1 
HETATM 9310 O O   . HOH M 8 .   ? 21.644  5.112   -27.171 1.00 63.88  ? 1283 HOH B O   1 
HETATM 9311 O O   . HOH M 8 .   ? -12.315 11.636  -28.754 1.00 72.02  ? 1284 HOH B O   1 
HETATM 9312 O O   . HOH M 8 .   ? 7.061   25.100  -53.452 1.00 68.03  ? 1285 HOH B O   1 
HETATM 9313 O O   . HOH M 8 .   ? 38.680  -3.188  -61.630 1.00 83.72  ? 1286 HOH B O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'GLN B 322 HAS WRONG CHIRALITY AT ATOM CA' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 258 PRO PRO B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 FUC 1   2502 502  FUC FUC A . 
E 4 NAG 1   701  701  NAG NAG A . 
F 5 SCK 1   901  901  SCK SCY A . 
G 6 SCU 1   902  902  SCU SCT A . 
H 7 P6G 1   1901 901  P6G PEG A . 
I 4 NAG 1   601  601  NAG NAG B . 
J 5 SCK 1   951  951  SCK SCY B . 
K 6 SCU 1   952  952  SCU SCT B . 
L 8 HOH 1   2503 954  HOH HOH A . 
L 8 HOH 2   2504 955  HOH HOH A . 
L 8 HOH 3   2505 957  HOH HOH A . 
L 8 HOH 4   2506 958  HOH HOH A . 
L 8 HOH 5   2507 959  HOH HOH A . 
L 8 HOH 6   2508 961  HOH HOH A . 
L 8 HOH 7   2509 962  HOH HOH A . 
L 8 HOH 8   2510 963  HOH HOH A . 
L 8 HOH 9   2511 964  HOH HOH A . 
L 8 HOH 10  2512 965  HOH HOH A . 
L 8 HOH 11  2513 968  HOH HOH A . 
L 8 HOH 12  2514 969  HOH HOH A . 
L 8 HOH 13  2515 970  HOH HOH A . 
L 8 HOH 14  2516 972  HOH HOH A . 
L 8 HOH 15  2517 973  HOH HOH A . 
L 8 HOH 16  2518 974  HOH HOH A . 
L 8 HOH 17  2519 975  HOH HOH A . 
L 8 HOH 18  2520 979  HOH HOH A . 
L 8 HOH 19  2521 980  HOH HOH A . 
L 8 HOH 20  2522 983  HOH HOH A . 
L 8 HOH 21  2523 984  HOH HOH A . 
L 8 HOH 22  2524 985  HOH HOH A . 
L 8 HOH 23  2525 987  HOH HOH A . 
L 8 HOH 24  2526 988  HOH HOH A . 
L 8 HOH 25  2527 989  HOH HOH A . 
L 8 HOH 26  2528 991  HOH HOH A . 
L 8 HOH 27  2529 992  HOH HOH A . 
L 8 HOH 28  2530 993  HOH HOH A . 
L 8 HOH 29  2531 995  HOH HOH A . 
L 8 HOH 30  2532 996  HOH HOH A . 
L 8 HOH 31  2533 998  HOH HOH A . 
L 8 HOH 32  2534 999  HOH HOH A . 
L 8 HOH 33  2535 1001 HOH HOH A . 
L 8 HOH 34  2536 1003 HOH HOH A . 
L 8 HOH 35  2537 1005 HOH HOH A . 
L 8 HOH 36  2538 1008 HOH HOH A . 
L 8 HOH 37  2539 1009 HOH HOH A . 
L 8 HOH 38  2540 1011 HOH HOH A . 
L 8 HOH 39  2541 1013 HOH HOH A . 
L 8 HOH 40  2542 1014 HOH HOH A . 
L 8 HOH 41  2543 1015 HOH HOH A . 
L 8 HOH 42  2544 1016 HOH HOH A . 
L 8 HOH 43  2545 1017 HOH HOH A . 
L 8 HOH 44  2546 1018 HOH HOH A . 
L 8 HOH 45  2547 1020 HOH HOH A . 
L 8 HOH 46  2548 1022 HOH HOH A . 
L 8 HOH 47  2549 1025 HOH HOH A . 
L 8 HOH 48  2550 1026 HOH HOH A . 
L 8 HOH 49  2551 1028 HOH HOH A . 
L 8 HOH 50  2552 1029 HOH HOH A . 
L 8 HOH 51  2553 1032 HOH HOH A . 
L 8 HOH 52  2554 1033 HOH HOH A . 
L 8 HOH 53  2555 1040 HOH HOH A . 
L 8 HOH 54  2556 1044 HOH HOH A . 
L 8 HOH 55  2557 1045 HOH HOH A . 
L 8 HOH 56  2558 1046 HOH HOH A . 
L 8 HOH 57  2559 1047 HOH HOH A . 
L 8 HOH 58  2560 1048 HOH HOH A . 
L 8 HOH 59  2561 1050 HOH HOH A . 
L 8 HOH 60  2562 1052 HOH HOH A . 
L 8 HOH 61  2563 1054 HOH HOH A . 
L 8 HOH 62  2564 1057 HOH HOH A . 
L 8 HOH 63  2565 1058 HOH HOH A . 
L 8 HOH 64  2566 1059 HOH HOH A . 
L 8 HOH 65  2567 1060 HOH HOH A . 
L 8 HOH 66  2568 1061 HOH HOH A . 
L 8 HOH 67  2569 1063 HOH HOH A . 
L 8 HOH 68  2570 1064 HOH HOH A . 
L 8 HOH 69  2571 1065 HOH HOH A . 
L 8 HOH 70  2572 1066 HOH HOH A . 
L 8 HOH 71  2573 1067 HOH HOH A . 
L 8 HOH 72  2574 1069 HOH HOH A . 
L 8 HOH 73  2575 1070 HOH HOH A . 
L 8 HOH 74  2576 1076 HOH HOH A . 
L 8 HOH 75  2577 1077 HOH HOH A . 
L 8 HOH 76  2578 1078 HOH HOH A . 
L 8 HOH 77  2579 1079 HOH HOH A . 
L 8 HOH 78  2580 1080 HOH HOH A . 
L 8 HOH 79  2581 1081 HOH HOH A . 
L 8 HOH 80  2582 1082 HOH HOH A . 
L 8 HOH 81  2583 1084 HOH HOH A . 
L 8 HOH 82  2584 1087 HOH HOH A . 
L 8 HOH 83  2585 1089 HOH HOH A . 
L 8 HOH 84  2586 1090 HOH HOH A . 
L 8 HOH 85  2587 1092 HOH HOH A . 
L 8 HOH 86  2588 1093 HOH HOH A . 
L 8 HOH 87  2589 1094 HOH HOH A . 
L 8 HOH 88  2590 1095 HOH HOH A . 
L 8 HOH 89  2591 1096 HOH HOH A . 
L 8 HOH 90  2592 1098 HOH HOH A . 
L 8 HOH 91  2593 1100 HOH HOH A . 
L 8 HOH 92  2594 1101 HOH HOH A . 
L 8 HOH 93  2595 1103 HOH HOH A . 
L 8 HOH 94  2596 1104 HOH HOH A . 
L 8 HOH 95  2597 1105 HOH HOH A . 
L 8 HOH 96  2598 1107 HOH HOH A . 
L 8 HOH 97  2599 1109 HOH HOH A . 
L 8 HOH 98  2600 1110 HOH HOH A . 
L 8 HOH 99  2601 1113 HOH HOH A . 
L 8 HOH 100 2602 1114 HOH HOH A . 
L 8 HOH 101 2603 1115 HOH HOH A . 
L 8 HOH 102 2604 1116 HOH HOH A . 
L 8 HOH 103 2605 1117 HOH HOH A . 
L 8 HOH 104 2606 1118 HOH HOH A . 
L 8 HOH 105 2607 1119 HOH HOH A . 
L 8 HOH 106 2608 1123 HOH HOH A . 
L 8 HOH 107 2609 1124 HOH HOH A . 
L 8 HOH 108 2610 1125 HOH HOH A . 
L 8 HOH 109 2611 1128 HOH HOH A . 
L 8 HOH 110 2612 1129 HOH HOH A . 
L 8 HOH 111 2613 1130 HOH HOH A . 
L 8 HOH 112 2614 1133 HOH HOH A . 
L 8 HOH 113 2615 1136 HOH HOH A . 
L 8 HOH 114 2616 1137 HOH HOH A . 
L 8 HOH 115 2617 1138 HOH HOH A . 
L 8 HOH 116 2618 1141 HOH HOH A . 
L 8 HOH 117 2619 1142 HOH HOH A . 
L 8 HOH 118 2620 1143 HOH HOH A . 
L 8 HOH 119 2621 1144 HOH HOH A . 
L 8 HOH 120 2622 1145 HOH HOH A . 
L 8 HOH 121 2623 1146 HOH HOH A . 
L 8 HOH 122 2624 1147 HOH HOH A . 
L 8 HOH 123 2625 1148 HOH HOH A . 
L 8 HOH 124 2626 1149 HOH HOH A . 
L 8 HOH 125 2627 1151 HOH HOH A . 
L 8 HOH 126 2628 1152 HOH HOH A . 
L 8 HOH 127 2629 1153 HOH HOH A . 
L 8 HOH 128 2630 1154 HOH HOH A . 
L 8 HOH 129 2631 1160 HOH HOH A . 
L 8 HOH 130 2632 1163 HOH HOH A . 
L 8 HOH 131 2633 1164 HOH HOH A . 
L 8 HOH 132 2634 1165 HOH HOH A . 
L 8 HOH 133 2635 1171 HOH HOH A . 
L 8 HOH 134 2636 1172 HOH HOH A . 
L 8 HOH 135 2637 1173 HOH HOH A . 
L 8 HOH 136 2638 1175 HOH HOH A . 
L 8 HOH 137 2639 1177 HOH HOH A . 
L 8 HOH 138 2640 1182 HOH HOH A . 
L 8 HOH 139 2641 1183 HOH HOH A . 
L 8 HOH 140 2642 1185 HOH HOH A . 
L 8 HOH 141 2643 1187 HOH HOH A . 
L 8 HOH 142 2644 1188 HOH HOH A . 
L 8 HOH 143 2645 1189 HOH HOH A . 
L 8 HOH 144 2646 1191 HOH HOH A . 
L 8 HOH 145 2647 1193 HOH HOH A . 
L 8 HOH 146 2648 1194 HOH HOH A . 
L 8 HOH 147 2649 1196 HOH HOH A . 
L 8 HOH 148 2650 1197 HOH HOH A . 
L 8 HOH 149 2651 1198 HOH HOH A . 
L 8 HOH 150 2652 1199 HOH HOH A . 
L 8 HOH 151 2653 1200 HOH HOH A . 
L 8 HOH 152 2654 1201 HOH HOH A . 
L 8 HOH 153 2655 1205 HOH HOH A . 
L 8 HOH 154 2656 1206 HOH HOH A . 
L 8 HOH 155 2657 1207 HOH HOH A . 
L 8 HOH 156 2658 1208 HOH HOH A . 
L 8 HOH 157 2659 1209 HOH HOH A . 
L 8 HOH 158 2660 1213 HOH HOH A . 
L 8 HOH 159 2661 1215 HOH HOH A . 
L 8 HOH 160 2662 1216 HOH HOH A . 
L 8 HOH 161 2663 1217 HOH HOH A . 
L 8 HOH 162 2664 1220 HOH HOH A . 
L 8 HOH 163 2665 1221 HOH HOH A . 
L 8 HOH 164 2666 1222 HOH HOH A . 
L 8 HOH 165 2667 1227 HOH HOH A . 
L 8 HOH 166 2668 1230 HOH HOH A . 
L 8 HOH 167 2669 1233 HOH HOH A . 
L 8 HOH 168 2670 1236 HOH HOH A . 
L 8 HOH 169 2671 1237 HOH HOH A . 
L 8 HOH 170 2672 1238 HOH HOH A . 
L 8 HOH 171 2673 1239 HOH HOH A . 
L 8 HOH 172 2674 1241 HOH HOH A . 
L 8 HOH 173 2675 1244 HOH HOH A . 
L 8 HOH 174 2676 1245 HOH HOH A . 
L 8 HOH 175 2677 1248 HOH HOH A . 
L 8 HOH 176 2678 1249 HOH HOH A . 
L 8 HOH 177 2679 1251 HOH HOH A . 
L 8 HOH 178 2680 1252 HOH HOH A . 
L 8 HOH 179 2681 1255 HOH HOH A . 
L 8 HOH 180 2682 1256 HOH HOH A . 
L 8 HOH 181 2683 1257 HOH HOH A . 
L 8 HOH 182 2684 1258 HOH HOH A . 
L 8 HOH 183 2685 1259 HOH HOH A . 
L 8 HOH 184 2686 1262 HOH HOH A . 
L 8 HOH 185 2687 1263 HOH HOH A . 
L 8 HOH 186 2688 1264 HOH HOH A . 
L 8 HOH 187 2689 1267 HOH HOH A . 
L 8 HOH 188 2690 1271 HOH HOH A . 
L 8 HOH 189 2691 1272 HOH HOH A . 
L 8 HOH 190 2692 1273 HOH HOH A . 
L 8 HOH 191 2693 1274 HOH HOH A . 
L 8 HOH 192 2694 1275 HOH HOH A . 
L 8 HOH 193 2695 1276 HOH HOH A . 
L 8 HOH 194 2696 1277 HOH HOH A . 
L 8 HOH 195 2697 1278 HOH HOH A . 
L 8 HOH 196 2698 1279 HOH HOH A . 
L 8 HOH 197 2699 1280 HOH HOH A . 
L 8 HOH 198 2700 1281 HOH HOH A . 
L 8 HOH 199 2701 1282 HOH HOH A . 
L 8 HOH 200 2702 1283 HOH HOH A . 
L 8 HOH 201 2703 1284 HOH HOH A . 
L 8 HOH 202 2704 1285 HOH HOH A . 
L 8 HOH 203 2705 1286 HOH HOH A . 
L 8 HOH 204 2706 1287 HOH HOH A . 
L 8 HOH 205 2707 1288 HOH HOH A . 
L 8 HOH 206 2708 1289 HOH HOH A . 
L 8 HOH 207 2709 1290 HOH HOH A . 
L 8 HOH 208 2710 1291 HOH HOH A . 
L 8 HOH 209 2711 1293 HOH HOH A . 
L 8 HOH 210 2712 1294 HOH HOH A . 
L 8 HOH 211 2713 1296 HOH HOH A . 
L 8 HOH 212 2714 1297 HOH HOH A . 
L 8 HOH 213 2715 1298 HOH HOH A . 
L 8 HOH 214 2716 1299 HOH HOH A . 
L 8 HOH 215 2717 1300 HOH HOH A . 
L 8 HOH 216 2718 1301 HOH HOH A . 
L 8 HOH 217 2719 1302 HOH HOH A . 
L 8 HOH 218 2720 1303 HOH HOH A . 
L 8 HOH 219 2721 1304 HOH HOH A . 
L 8 HOH 220 2722 1305 HOH HOH A . 
L 8 HOH 221 2723 1306 HOH HOH A . 
L 8 HOH 222 2724 1307 HOH HOH A . 
L 8 HOH 223 2725 1308 HOH HOH A . 
L 8 HOH 224 2726 1309 HOH HOH A . 
L 8 HOH 225 2727 1310 HOH HOH A . 
L 8 HOH 226 2728 1311 HOH HOH A . 
L 8 HOH 227 2729 1312 HOH HOH A . 
L 8 HOH 228 2730 1313 HOH HOH A . 
L 8 HOH 229 2731 1314 HOH HOH A . 
L 8 HOH 230 2732 1315 HOH HOH A . 
L 8 HOH 231 2733 1316 HOH HOH A . 
L 8 HOH 232 2734 1317 HOH HOH A . 
L 8 HOH 233 2735 1318 HOH HOH A . 
L 8 HOH 234 2736 1319 HOH HOH A . 
L 8 HOH 235 2737 1321 HOH HOH A . 
L 8 HOH 236 2738 1322 HOH HOH A . 
L 8 HOH 237 2739 1323 HOH HOH A . 
L 8 HOH 238 2740 1324 HOH HOH A . 
L 8 HOH 239 2741 1325 HOH HOH A . 
L 8 HOH 240 2742 1326 HOH HOH A . 
L 8 HOH 241 2743 1327 HOH HOH A . 
L 8 HOH 242 2744 1328 HOH HOH A . 
L 8 HOH 243 2745 1329 HOH HOH A . 
L 8 HOH 244 2746 1330 HOH HOH A . 
L 8 HOH 245 2747 1331 HOH HOH A . 
L 8 HOH 246 2748 1332 HOH HOH A . 
L 8 HOH 247 2749 1333 HOH HOH A . 
L 8 HOH 248 2750 1334 HOH HOH A . 
L 8 HOH 249 2751 1335 HOH HOH A . 
L 8 HOH 250 2752 1336 HOH HOH A . 
L 8 HOH 251 2753 1337 HOH HOH A . 
L 8 HOH 252 2754 1338 HOH HOH A . 
L 8 HOH 253 2755 1339 HOH HOH A . 
L 8 HOH 254 2756 1340 HOH HOH A . 
L 8 HOH 255 2757 1341 HOH HOH A . 
L 8 HOH 256 2758 1342 HOH HOH A . 
L 8 HOH 257 2759 1343 HOH HOH A . 
L 8 HOH 258 2760 1344 HOH HOH A . 
L 8 HOH 259 2761 1345 HOH HOH A . 
L 8 HOH 260 2762 1346 HOH HOH A . 
L 8 HOH 261 2763 1347 HOH HOH A . 
L 8 HOH 262 2764 1348 HOH HOH A . 
L 8 HOH 263 2765 1349 HOH HOH A . 
L 8 HOH 264 2766 1350 HOH HOH A . 
L 8 HOH 265 2767 1357 HOH HOH A . 
L 8 HOH 266 2768 1396 HOH HOH A . 
L 8 HOH 267 2769 1398 HOH HOH A . 
L 8 HOH 268 2770 1402 HOH HOH A . 
L 8 HOH 269 2771 1404 HOH HOH A . 
L 8 HOH 270 2772 1408 HOH HOH A . 
L 8 HOH 271 2773 1410 HOH HOH A . 
L 8 HOH 272 2774 1413 HOH HOH A . 
L 8 HOH 273 2775 1420 HOH HOH A . 
L 8 HOH 274 2776 1422 HOH HOH A . 
L 8 HOH 275 2777 1423 HOH HOH A . 
L 8 HOH 276 2778 1426 HOH HOH A . 
L 8 HOH 277 2779 1433 HOH HOH A . 
L 8 HOH 278 2780 1434 HOH HOH A . 
L 8 HOH 279 2781 1437 HOH HOH A . 
L 8 HOH 280 2782 1440 HOH HOH A . 
L 8 HOH 281 2783 1442 HOH HOH A . 
L 8 HOH 282 2784 1444 HOH HOH A . 
L 8 HOH 283 2785 1450 HOH HOH A . 
L 8 HOH 284 2786 1453 HOH HOH A . 
L 8 HOH 285 2787 1454 HOH HOH A . 
L 8 HOH 286 2788 1457 HOH HOH A . 
L 8 HOH 287 2789 1459 HOH HOH A . 
L 8 HOH 288 2790 1465 HOH HOH A . 
L 8 HOH 289 2791 1469 HOH HOH A . 
L 8 HOH 290 2792 1470 HOH HOH A . 
L 8 HOH 291 2793 1473 HOH HOH A . 
L 8 HOH 292 2794 1474 HOH HOH A . 
L 8 HOH 293 2795 1475 HOH HOH A . 
L 8 HOH 294 2796 1476 HOH HOH A . 
L 8 HOH 295 2797 1478 HOH HOH A . 
L 8 HOH 296 2798 1480 HOH HOH A . 
L 8 HOH 297 2799 1481 HOH HOH A . 
L 8 HOH 298 2800 1486 HOH HOH A . 
L 8 HOH 299 2801 1491 HOH HOH A . 
L 8 HOH 300 2802 1493 HOH HOH A . 
L 8 HOH 301 2803 1495 HOH HOH A . 
L 8 HOH 302 2804 1498 HOH HOH A . 
L 8 HOH 303 2805 1500 HOH HOH A . 
L 8 HOH 304 2806 1501 HOH HOH A . 
L 8 HOH 305 2807 1502 HOH HOH A . 
L 8 HOH 306 2808 1505 HOH HOH A . 
L 8 HOH 307 2809 1508 HOH HOH A . 
L 8 HOH 308 2810 1509 HOH HOH A . 
L 8 HOH 309 2811 1511 HOH HOH A . 
L 8 HOH 310 2812 1512 HOH HOH A . 
L 8 HOH 311 2813 1513 HOH HOH A . 
L 8 HOH 312 2814 1514 HOH HOH A . 
L 8 HOH 313 2815 1515 HOH HOH A . 
L 8 HOH 314 2816 1519 HOH HOH A . 
L 8 HOH 315 2817 1520 HOH HOH A . 
L 8 HOH 316 2818 1529 HOH HOH A . 
L 8 HOH 317 2819 1531 HOH HOH A . 
L 8 HOH 318 2820 1534 HOH HOH A . 
L 8 HOH 319 2821 1538 HOH HOH A . 
L 8 HOH 320 2822 1543 HOH HOH A . 
L 8 HOH 321 2823 1545 HOH HOH A . 
L 8 HOH 322 2824 1546 HOH HOH A . 
L 8 HOH 323 2825 1551 HOH HOH A . 
L 8 HOH 324 2826 1553 HOH HOH A . 
L 8 HOH 325 2827 1554 HOH HOH A . 
L 8 HOH 326 2828 1555 HOH HOH A . 
L 8 HOH 327 2829 1559 HOH HOH A . 
L 8 HOH 328 2830 1560 HOH HOH A . 
L 8 HOH 329 2831 1561 HOH HOH A . 
L 8 HOH 330 2832 1564 HOH HOH A . 
L 8 HOH 331 2833 1571 HOH HOH A . 
L 8 HOH 332 2834 1573 HOH HOH A . 
L 8 HOH 333 2835 1574 HOH HOH A . 
L 8 HOH 334 2836 1576 HOH HOH A . 
L 8 HOH 335 2837 1578 HOH HOH A . 
L 8 HOH 336 2838 1581 HOH HOH A . 
L 8 HOH 337 2839 1584 HOH HOH A . 
L 8 HOH 338 2840 1585 HOH HOH A . 
L 8 HOH 339 2841 1588 HOH HOH A . 
L 8 HOH 340 2842 1593 HOH HOH A . 
L 8 HOH 341 2843 1598 HOH HOH A . 
L 8 HOH 342 2844 1600 HOH HOH A . 
L 8 HOH 343 2845 1602 HOH HOH A . 
L 8 HOH 344 2846 1603 HOH HOH A . 
L 8 HOH 345 2847 1608 HOH HOH A . 
L 8 HOH 346 2848 1610 HOH HOH A . 
L 8 HOH 347 2849 1611 HOH HOH A . 
L 8 HOH 348 2850 1615 HOH HOH A . 
L 8 HOH 349 2851 1617 HOH HOH A . 
L 8 HOH 350 2852 1620 HOH HOH A . 
L 8 HOH 351 2853 1621 HOH HOH A . 
L 8 HOH 352 2854 1624 HOH HOH A . 
L 8 HOH 353 2855 1629 HOH HOH A . 
L 8 HOH 354 2856 1632 HOH HOH A . 
L 8 HOH 355 2857 1635 HOH HOH A . 
L 8 HOH 356 2858 1636 HOH HOH A . 
L 8 HOH 357 2859 1640 HOH HOH A . 
L 8 HOH 358 2860 1645 HOH HOH A . 
L 8 HOH 359 2861 1648 HOH HOH A . 
L 8 HOH 360 2862 1651 HOH HOH A . 
L 8 HOH 361 2863 474  HOH HOH A . 
L 8 HOH 362 2864 475  HOH HOH A . 
L 8 HOH 363 2865 476  HOH HOH A . 
L 8 HOH 364 2866 478  HOH HOH A . 
L 8 HOH 365 2867 479  HOH HOH A . 
L 8 HOH 366 2868 480  HOH HOH A . 
L 8 HOH 367 2869 481  HOH HOH A . 
L 8 HOH 368 2870 482  HOH HOH A . 
L 8 HOH 369 2871 485  HOH HOH A . 
L 8 HOH 370 2872 488  HOH HOH A . 
L 8 HOH 371 2873 489  HOH HOH A . 
L 8 HOH 372 2874 490  HOH HOH A . 
L 8 HOH 373 2875 491  HOH HOH A . 
L 8 HOH 374 2876 492  HOH HOH A . 
L 8 HOH 375 2877 493  HOH HOH A . 
L 8 HOH 376 2878 494  HOH HOH A . 
L 8 HOH 377 2879 495  HOH HOH A . 
L 8 HOH 378 2880 496  HOH HOH A . 
L 8 HOH 379 2881 497  HOH HOH A . 
L 8 HOH 380 2882 498  HOH HOH A . 
L 8 HOH 381 2883 499  HOH HOH A . 
L 8 HOH 382 2884 500  HOH HOH A . 
L 8 HOH 383 2885 501  HOH HOH A . 
L 8 HOH 384 2886 502  HOH HOH A . 
L 8 HOH 385 2887 503  HOH HOH A . 
L 8 HOH 386 2888 504  HOH HOH A . 
L 8 HOH 387 2889 505  HOH HOH A . 
L 8 HOH 388 2890 506  HOH HOH A . 
L 8 HOH 389 2891 507  HOH HOH A . 
L 8 HOH 390 2892 508  HOH HOH A . 
L 8 HOH 391 2893 509  HOH HOH A . 
L 8 HOH 392 2894 510  HOH HOH A . 
L 8 HOH 393 2895 511  HOH HOH A . 
L 8 HOH 394 2896 513  HOH HOH A . 
L 8 HOH 395 2897 514  HOH HOH A . 
L 8 HOH 396 2898 515  HOH HOH A . 
L 8 HOH 397 2899 516  HOH HOH A . 
L 8 HOH 398 2900 517  HOH HOH A . 
L 8 HOH 399 2901 518  HOH HOH A . 
L 8 HOH 400 2902 519  HOH HOH A . 
L 8 HOH 401 2903 520  HOH HOH A . 
L 8 HOH 402 2904 521  HOH HOH A . 
L 8 HOH 403 2905 522  HOH HOH A . 
L 8 HOH 404 2906 523  HOH HOH A . 
L 8 HOH 405 2907 524  HOH HOH A . 
L 8 HOH 406 2908 525  HOH HOH A . 
L 8 HOH 407 2909 526  HOH HOH A . 
L 8 HOH 408 2910 536  HOH HOH A . 
L 8 HOH 409 2911 1001 HOH HOH A . 
L 8 HOH 410 2912 1002 HOH HOH A . 
L 8 HOH 411 2913 1003 HOH HOH A . 
L 8 HOH 412 2914 1004 HOH HOH A . 
L 8 HOH 413 2915 1006 HOH HOH A . 
L 8 HOH 414 2916 1008 HOH HOH A . 
L 8 HOH 415 2917 1009 HOH HOH A . 
L 8 HOH 416 2918 1014 HOH HOH A . 
L 8 HOH 417 2919 1016 HOH HOH A . 
L 8 HOH 418 2920 1017 HOH HOH A . 
L 8 HOH 419 2921 1018 HOH HOH A . 
L 8 HOH 420 2922 1020 HOH HOH A . 
L 8 HOH 421 2923 1021 HOH HOH A . 
L 8 HOH 422 2924 1022 HOH HOH A . 
L 8 HOH 423 2925 1023 HOH HOH A . 
L 8 HOH 424 2926 1024 HOH HOH A . 
L 8 HOH 425 2927 1026 HOH HOH A . 
L 8 HOH 426 2928 1027 HOH HOH A . 
L 8 HOH 427 2929 1029 HOH HOH A . 
L 8 HOH 428 2930 1031 HOH HOH A . 
L 8 HOH 429 2931 1032 HOH HOH A . 
L 8 HOH 430 2932 1034 HOH HOH A . 
M 8 HOH 1   953  953  HOH HOH B . 
M 8 HOH 2   954  956  HOH HOH B . 
M 8 HOH 3   955  960  HOH HOH B . 
M 8 HOH 4   956  966  HOH HOH B . 
M 8 HOH 5   957  967  HOH HOH B . 
M 8 HOH 6   958  971  HOH HOH B . 
M 8 HOH 7   959  976  HOH HOH B . 
M 8 HOH 8   960  977  HOH HOH B . 
M 8 HOH 9   961  978  HOH HOH B . 
M 8 HOH 10  962  981  HOH HOH B . 
M 8 HOH 11  963  982  HOH HOH B . 
M 8 HOH 12  964  986  HOH HOH B . 
M 8 HOH 13  965  990  HOH HOH B . 
M 8 HOH 14  966  994  HOH HOH B . 
M 8 HOH 15  967  997  HOH HOH B . 
M 8 HOH 16  968  1000 HOH HOH B . 
M 8 HOH 17  969  1002 HOH HOH B . 
M 8 HOH 18  970  1004 HOH HOH B . 
M 8 HOH 19  971  1006 HOH HOH B . 
M 8 HOH 20  972  1007 HOH HOH B . 
M 8 HOH 21  973  1010 HOH HOH B . 
M 8 HOH 22  974  1012 HOH HOH B . 
M 8 HOH 23  975  1019 HOH HOH B . 
M 8 HOH 24  976  1021 HOH HOH B . 
M 8 HOH 25  977  1023 HOH HOH B . 
M 8 HOH 26  978  1024 HOH HOH B . 
M 8 HOH 27  979  1027 HOH HOH B . 
M 8 HOH 28  980  1030 HOH HOH B . 
M 8 HOH 29  981  1031 HOH HOH B . 
M 8 HOH 30  982  1034 HOH HOH B . 
M 8 HOH 31  983  1035 HOH HOH B . 
M 8 HOH 32  984  1036 HOH HOH B . 
M 8 HOH 33  985  1037 HOH HOH B . 
M 8 HOH 34  986  1038 HOH HOH B . 
M 8 HOH 35  987  1039 HOH HOH B . 
M 8 HOH 36  988  1041 HOH HOH B . 
M 8 HOH 37  989  1042 HOH HOH B . 
M 8 HOH 38  990  1043 HOH HOH B . 
M 8 HOH 39  991  1049 HOH HOH B . 
M 8 HOH 40  992  1051 HOH HOH B . 
M 8 HOH 41  993  1053 HOH HOH B . 
M 8 HOH 42  994  1055 HOH HOH B . 
M 8 HOH 43  995  1056 HOH HOH B . 
M 8 HOH 44  996  1062 HOH HOH B . 
M 8 HOH 45  997  1068 HOH HOH B . 
M 8 HOH 46  998  1071 HOH HOH B . 
M 8 HOH 47  999  1072 HOH HOH B . 
M 8 HOH 48  1000 1073 HOH HOH B . 
M 8 HOH 49  1001 1074 HOH HOH B . 
M 8 HOH 50  1002 1075 HOH HOH B . 
M 8 HOH 51  1003 1083 HOH HOH B . 
M 8 HOH 52  1004 1085 HOH HOH B . 
M 8 HOH 53  1005 1086 HOH HOH B . 
M 8 HOH 54  1006 1088 HOH HOH B . 
M 8 HOH 55  1007 1091 HOH HOH B . 
M 8 HOH 56  1008 1097 HOH HOH B . 
M 8 HOH 57  1009 1099 HOH HOH B . 
M 8 HOH 58  1010 1102 HOH HOH B . 
M 8 HOH 59  1011 1106 HOH HOH B . 
M 8 HOH 60  1012 1108 HOH HOH B . 
M 8 HOH 61  1013 1111 HOH HOH B . 
M 8 HOH 62  1014 1112 HOH HOH B . 
M 8 HOH 63  1015 1120 HOH HOH B . 
M 8 HOH 64  1016 1121 HOH HOH B . 
M 8 HOH 65  1017 1122 HOH HOH B . 
M 8 HOH 66  1018 1126 HOH HOH B . 
M 8 HOH 67  1019 1127 HOH HOH B . 
M 8 HOH 68  1020 1131 HOH HOH B . 
M 8 HOH 69  1021 1132 HOH HOH B . 
M 8 HOH 70  1022 1134 HOH HOH B . 
M 8 HOH 71  1023 1135 HOH HOH B . 
M 8 HOH 72  1024 1139 HOH HOH B . 
M 8 HOH 73  1025 1140 HOH HOH B . 
M 8 HOH 74  1026 1150 HOH HOH B . 
M 8 HOH 75  1027 1155 HOH HOH B . 
M 8 HOH 76  1028 1157 HOH HOH B . 
M 8 HOH 77  1029 1158 HOH HOH B . 
M 8 HOH 78  1030 1159 HOH HOH B . 
M 8 HOH 79  1031 1161 HOH HOH B . 
M 8 HOH 80  1032 1162 HOH HOH B . 
M 8 HOH 81  1033 1166 HOH HOH B . 
M 8 HOH 82  1034 1167 HOH HOH B . 
M 8 HOH 83  1035 1168 HOH HOH B . 
M 8 HOH 84  1036 1169 HOH HOH B . 
M 8 HOH 85  1037 1170 HOH HOH B . 
M 8 HOH 86  1038 1174 HOH HOH B . 
M 8 HOH 87  1039 1176 HOH HOH B . 
M 8 HOH 88  1040 1178 HOH HOH B . 
M 8 HOH 89  1041 1179 HOH HOH B . 
M 8 HOH 90  1042 1180 HOH HOH B . 
M 8 HOH 91  1043 1181 HOH HOH B . 
M 8 HOH 92  1044 1184 HOH HOH B . 
M 8 HOH 93  1045 1186 HOH HOH B . 
M 8 HOH 94  1046 1190 HOH HOH B . 
M 8 HOH 95  1047 1195 HOH HOH B . 
M 8 HOH 96  1048 1202 HOH HOH B . 
M 8 HOH 97  1049 1203 HOH HOH B . 
M 8 HOH 98  1050 1204 HOH HOH B . 
M 8 HOH 99  1051 1211 HOH HOH B . 
M 8 HOH 100 1052 1212 HOH HOH B . 
M 8 HOH 101 1053 1214 HOH HOH B . 
M 8 HOH 102 1054 1218 HOH HOH B . 
M 8 HOH 103 1055 1219 HOH HOH B . 
M 8 HOH 104 1056 1223 HOH HOH B . 
M 8 HOH 105 1057 1224 HOH HOH B . 
M 8 HOH 106 1058 1225 HOH HOH B . 
M 8 HOH 107 1059 1226 HOH HOH B . 
M 8 HOH 108 1060 1228 HOH HOH B . 
M 8 HOH 109 1061 1229 HOH HOH B . 
M 8 HOH 110 1062 1231 HOH HOH B . 
M 8 HOH 111 1063 1232 HOH HOH B . 
M 8 HOH 112 1064 1234 HOH HOH B . 
M 8 HOH 113 1065 1235 HOH HOH B . 
M 8 HOH 114 1066 1240 HOH HOH B . 
M 8 HOH 115 1067 1242 HOH HOH B . 
M 8 HOH 116 1068 1243 HOH HOH B . 
M 8 HOH 117 1069 1246 HOH HOH B . 
M 8 HOH 118 1070 1247 HOH HOH B . 
M 8 HOH 119 1071 1253 HOH HOH B . 
M 8 HOH 120 1072 1254 HOH HOH B . 
M 8 HOH 121 1073 1260 HOH HOH B . 
M 8 HOH 122 1074 1261 HOH HOH B . 
M 8 HOH 123 1075 1265 HOH HOH B . 
M 8 HOH 124 1076 1266 HOH HOH B . 
M 8 HOH 125 1077 1268 HOH HOH B . 
M 8 HOH 126 1078 1269 HOH HOH B . 
M 8 HOH 127 1079 1270 HOH HOH B . 
M 8 HOH 128 1080 1292 HOH HOH B . 
M 8 HOH 129 1081 1295 HOH HOH B . 
M 8 HOH 130 1082 1351 HOH HOH B . 
M 8 HOH 131 1083 1352 HOH HOH B . 
M 8 HOH 132 1084 1353 HOH HOH B . 
M 8 HOH 133 1085 1354 HOH HOH B . 
M 8 HOH 134 1086 1355 HOH HOH B . 
M 8 HOH 135 1087 1356 HOH HOH B . 
M 8 HOH 136 1088 1358 HOH HOH B . 
M 8 HOH 137 1089 1359 HOH HOH B . 
M 8 HOH 138 1090 1360 HOH HOH B . 
M 8 HOH 139 1091 1361 HOH HOH B . 
M 8 HOH 140 1092 1362 HOH HOH B . 
M 8 HOH 141 1093 1363 HOH HOH B . 
M 8 HOH 142 1094 1364 HOH HOH B . 
M 8 HOH 143 1095 1365 HOH HOH B . 
M 8 HOH 144 1096 1366 HOH HOH B . 
M 8 HOH 145 1097 1367 HOH HOH B . 
M 8 HOH 146 1098 1368 HOH HOH B . 
M 8 HOH 147 1099 1369 HOH HOH B . 
M 8 HOH 148 1100 1370 HOH HOH B . 
M 8 HOH 149 1101 1371 HOH HOH B . 
M 8 HOH 150 1102 1372 HOH HOH B . 
M 8 HOH 151 1103 1373 HOH HOH B . 
M 8 HOH 152 1104 1374 HOH HOH B . 
M 8 HOH 153 1105 1375 HOH HOH B . 
M 8 HOH 154 1106 1377 HOH HOH B . 
M 8 HOH 155 1107 1378 HOH HOH B . 
M 8 HOH 156 1108 1379 HOH HOH B . 
M 8 HOH 157 1109 1380 HOH HOH B . 
M 8 HOH 158 1110 1381 HOH HOH B . 
M 8 HOH 159 1111 1382 HOH HOH B . 
M 8 HOH 160 1112 1383 HOH HOH B . 
M 8 HOH 161 1113 1384 HOH HOH B . 
M 8 HOH 162 1114 1385 HOH HOH B . 
M 8 HOH 163 1115 1386 HOH HOH B . 
M 8 HOH 164 1116 1387 HOH HOH B . 
M 8 HOH 165 1117 1388 HOH HOH B . 
M 8 HOH 166 1118 1389 HOH HOH B . 
M 8 HOH 167 1119 1390 HOH HOH B . 
M 8 HOH 168 1120 1391 HOH HOH B . 
M 8 HOH 169 1121 1392 HOH HOH B . 
M 8 HOH 170 1122 1393 HOH HOH B . 
M 8 HOH 171 1123 1394 HOH HOH B . 
M 8 HOH 172 1124 1395 HOH HOH B . 
M 8 HOH 173 1125 1399 HOH HOH B . 
M 8 HOH 174 1126 1409 HOH HOH B . 
M 8 HOH 175 1127 1412 HOH HOH B . 
M 8 HOH 176 1128 1415 HOH HOH B . 
M 8 HOH 177 1129 1416 HOH HOH B . 
M 8 HOH 178 1130 1421 HOH HOH B . 
M 8 HOH 179 1131 1424 HOH HOH B . 
M 8 HOH 180 1132 1427 HOH HOH B . 
M 8 HOH 181 1133 1428 HOH HOH B . 
M 8 HOH 182 1134 1430 HOH HOH B . 
M 8 HOH 183 1135 1431 HOH HOH B . 
M 8 HOH 184 1136 1432 HOH HOH B . 
M 8 HOH 185 1137 1435 HOH HOH B . 
M 8 HOH 186 1138 1438 HOH HOH B . 
M 8 HOH 187 1139 1439 HOH HOH B . 
M 8 HOH 188 1140 1441 HOH HOH B . 
M 8 HOH 189 1141 1445 HOH HOH B . 
M 8 HOH 190 1142 1446 HOH HOH B . 
M 8 HOH 191 1143 1447 HOH HOH B . 
M 8 HOH 192 1144 1449 HOH HOH B . 
M 8 HOH 193 1145 1451 HOH HOH B . 
M 8 HOH 194 1146 1452 HOH HOH B . 
M 8 HOH 195 1147 1455 HOH HOH B . 
M 8 HOH 196 1148 1461 HOH HOH B . 
M 8 HOH 197 1149 1462 HOH HOH B . 
M 8 HOH 198 1150 1463 HOH HOH B . 
M 8 HOH 199 1151 1466 HOH HOH B . 
M 8 HOH 200 1152 1467 HOH HOH B . 
M 8 HOH 201 1153 1468 HOH HOH B . 
M 8 HOH 202 1154 1477 HOH HOH B . 
M 8 HOH 203 1155 1482 HOH HOH B . 
M 8 HOH 204 1156 1483 HOH HOH B . 
M 8 HOH 205 1157 1485 HOH HOH B . 
M 8 HOH 206 1158 1487 HOH HOH B . 
M 8 HOH 207 1159 1489 HOH HOH B . 
M 8 HOH 208 1160 1490 HOH HOH B . 
M 8 HOH 209 1161 1494 HOH HOH B . 
M 8 HOH 210 1162 1496 HOH HOH B . 
M 8 HOH 211 1163 1499 HOH HOH B . 
M 8 HOH 212 1164 1503 HOH HOH B . 
M 8 HOH 213 1165 1504 HOH HOH B . 
M 8 HOH 214 1166 1506 HOH HOH B . 
M 8 HOH 215 1167 1510 HOH HOH B . 
M 8 HOH 216 1168 1517 HOH HOH B . 
M 8 HOH 217 1169 1518 HOH HOH B . 
M 8 HOH 218 1170 1524 HOH HOH B . 
M 8 HOH 219 1171 1530 HOH HOH B . 
M 8 HOH 220 1172 1536 HOH HOH B . 
M 8 HOH 221 1173 1537 HOH HOH B . 
M 8 HOH 222 1174 1539 HOH HOH B . 
M 8 HOH 223 1175 1540 HOH HOH B . 
M 8 HOH 224 1176 1542 HOH HOH B . 
M 8 HOH 225 1177 1550 HOH HOH B . 
M 8 HOH 226 1178 1552 HOH HOH B . 
M 8 HOH 227 1179 1557 HOH HOH B . 
M 8 HOH 228 1180 1558 HOH HOH B . 
M 8 HOH 229 1181 1562 HOH HOH B . 
M 8 HOH 230 1182 1565 HOH HOH B . 
M 8 HOH 231 1183 1566 HOH HOH B . 
M 8 HOH 232 1184 1567 HOH HOH B . 
M 8 HOH 233 1185 1569 HOH HOH B . 
M 8 HOH 234 1186 1570 HOH HOH B . 
M 8 HOH 235 1187 1572 HOH HOH B . 
M 8 HOH 236 1188 1575 HOH HOH B . 
M 8 HOH 237 1189 1580 HOH HOH B . 
M 8 HOH 238 1190 1582 HOH HOH B . 
M 8 HOH 239 1191 1587 HOH HOH B . 
M 8 HOH 240 1192 1589 HOH HOH B . 
M 8 HOH 241 1193 1590 HOH HOH B . 
M 8 HOH 242 1194 1591 HOH HOH B . 
M 8 HOH 243 1195 1592 HOH HOH B . 
M 8 HOH 244 1196 1594 HOH HOH B . 
M 8 HOH 245 1197 1601 HOH HOH B . 
M 8 HOH 246 1198 1604 HOH HOH B . 
M 8 HOH 247 1199 1605 HOH HOH B . 
M 8 HOH 248 1200 1606 HOH HOH B . 
M 8 HOH 249 1201 1609 HOH HOH B . 
M 8 HOH 250 1202 1612 HOH HOH B . 
M 8 HOH 251 1203 1623 HOH HOH B . 
M 8 HOH 252 1204 1625 HOH HOH B . 
M 8 HOH 253 1205 1628 HOH HOH B . 
M 8 HOH 254 1206 1631 HOH HOH B . 
M 8 HOH 255 1207 1641 HOH HOH B . 
M 8 HOH 256 1208 1642 HOH HOH B . 
M 8 HOH 257 1209 1643 HOH HOH B . 
M 8 HOH 258 1210 1646 HOH HOH B . 
M 8 HOH 259 1211 1647 HOH HOH B . 
M 8 HOH 260 1212 483  HOH HOH B . 
M 8 HOH 261 1213 486  HOH HOH B . 
M 8 HOH 262 1214 487  HOH HOH B . 
M 8 HOH 263 1215 527  HOH HOH B . 
M 8 HOH 264 1216 528  HOH HOH B . 
M 8 HOH 265 1217 529  HOH HOH B . 
M 8 HOH 266 1218 530  HOH HOH B . 
M 8 HOH 267 1219 531  HOH HOH B . 
M 8 HOH 268 1220 532  HOH HOH B . 
M 8 HOH 269 1221 533  HOH HOH B . 
M 8 HOH 270 1222 534  HOH HOH B . 
M 8 HOH 271 1223 538  HOH HOH B . 
M 8 HOH 272 1224 539  HOH HOH B . 
M 8 HOH 273 1225 540  HOH HOH B . 
M 8 HOH 274 1226 542  HOH HOH B . 
M 8 HOH 275 1227 543  HOH HOH B . 
M 8 HOH 276 1228 544  HOH HOH B . 
M 8 HOH 277 1229 546  HOH HOH B . 
M 8 HOH 278 1230 547  HOH HOH B . 
M 8 HOH 279 1231 548  HOH HOH B . 
M 8 HOH 280 1232 549  HOH HOH B . 
M 8 HOH 281 1233 550  HOH HOH B . 
M 8 HOH 282 1234 551  HOH HOH B . 
M 8 HOH 283 1235 552  HOH HOH B . 
M 8 HOH 284 1236 553  HOH HOH B . 
M 8 HOH 285 1237 554  HOH HOH B . 
M 8 HOH 286 1238 555  HOH HOH B . 
M 8 HOH 287 1239 556  HOH HOH B . 
M 8 HOH 288 1240 557  HOH HOH B . 
M 8 HOH 289 1241 558  HOH HOH B . 
M 8 HOH 290 1242 559  HOH HOH B . 
M 8 HOH 291 1243 560  HOH HOH B . 
M 8 HOH 292 1244 561  HOH HOH B . 
M 8 HOH 293 1245 562  HOH HOH B . 
M 8 HOH 294 1246 563  HOH HOH B . 
M 8 HOH 295 1247 564  HOH HOH B . 
M 8 HOH 296 1248 565  HOH HOH B . 
M 8 HOH 297 1249 566  HOH HOH B . 
M 8 HOH 298 1250 567  HOH HOH B . 
M 8 HOH 299 1251 569  HOH HOH B . 
M 8 HOH 300 1252 570  HOH HOH B . 
M 8 HOH 301 1253 571  HOH HOH B . 
M 8 HOH 302 1254 572  HOH HOH B . 
M 8 HOH 303 1255 573  HOH HOH B . 
M 8 HOH 304 1256 574  HOH HOH B . 
M 8 HOH 305 1257 575  HOH HOH B . 
M 8 HOH 306 1258 576  HOH HOH B . 
M 8 HOH 307 1259 577  HOH HOH B . 
M 8 HOH 308 1260 578  HOH HOH B . 
M 8 HOH 309 1261 579  HOH HOH B . 
M 8 HOH 310 1262 580  HOH HOH B . 
M 8 HOH 311 1263 581  HOH HOH B . 
M 8 HOH 312 1264 582  HOH HOH B . 
M 8 HOH 313 1265 583  HOH HOH B . 
M 8 HOH 314 1266 584  HOH HOH B . 
M 8 HOH 315 1267 587  HOH HOH B . 
M 8 HOH 316 1268 588  HOH HOH B . 
M 8 HOH 317 1269 589  HOH HOH B . 
M 8 HOH 318 1270 590  HOH HOH B . 
M 8 HOH 319 1271 591  HOH HOH B . 
M 8 HOH 320 1272 592  HOH HOH B . 
M 8 HOH 321 1273 593  HOH HOH B . 
M 8 HOH 322 1274 594  HOH HOH B . 
M 8 HOH 323 1275 595  HOH HOH B . 
M 8 HOH 324 1276 1005 HOH HOH B . 
M 8 HOH 325 1277 1007 HOH HOH B . 
M 8 HOH 326 1278 1010 HOH HOH B . 
M 8 HOH 327 1279 1011 HOH HOH B . 
M 8 HOH 328 1280 1012 HOH HOH B . 
M 8 HOH 329 1281 1013 HOH HOH B . 
M 8 HOH 330 1282 1015 HOH HOH B . 
M 8 HOH 331 1283 1019 HOH HOH B . 
M 8 HOH 332 1284 1025 HOH HOH B . 
M 8 HOH 333 1285 1028 HOH HOH B . 
M 8 HOH 334 1286 1033 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 350 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 350 B ASN 350 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-07-18 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Advisory                    
5 4 'Structure model' 'Atomic model'              
6 4 'Structure model' 'Data collection'           
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' database_PDB_caveat           
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' struct_asym                   
15 4 'Structure model' struct_conn                   
16 4 'Structure model' struct_site                   
17 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.auth_asym_id'                
2  4 'Structure model' '_atom_site.auth_seq_id'                 
3  4 'Structure model' '_atom_site.label_asym_id'               
4  4 'Structure model' '_atom_site.label_entity_id'             
5  4 'Structure model' '_chem_comp.name'                        
6  4 'Structure model' '_chem_comp.type'                        
7  4 'Structure model' '_pdbx_entity_nonpoly.comp_id'           
8  4 'Structure model' '_pdbx_entity_nonpoly.entity_id'         
9  4 'Structure model' '_pdbx_entity_nonpoly.name'              
10 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
11 4 'Structure model' '_struct_conn.pdbx_dist_value'           
12 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
13 4 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id'   
14 4 'Structure model' '_struct_conn.pdbx_role'                 
15 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
22 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'       
27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 27.5225 11.7897 16.7255  -.1492 -.2730 -.0474 .0068  .0054  .0340  1.2867 .7276 2.5147 -.0645 .0825 -.3060 -.0311 
.0043 -.0588 .0300 .0109  .0198 .1415 -.1241 .0202  'X-RAY DIFFRACTION' 
2 ? refined 7.9611  4.6044  -40.8283 -.1050 -.1106 -.0593 -.0204 -.0280 -.0737 .7986  .9387 2.7717 -.1205 .1132 .3888  .1375  
.0095 -.0478 .0194 -.0992 .0529 .1737 -.0139 -.0383 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1 A 1 A 542 A 542 ? 'X-RAY DIFFRACTION' ? 
2 2 B 4 B 4 B 543 B 543 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
ADSC      'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
# 
_pdbx_entry_details.entry_id                 2HA2 
_pdbx_entry_details.nonpolymer_details       
;SCK(901) AND SCU(902) ARE IN ALTERNATE CONFORMATIONS 
OF EACH OTHER.
SCK(951) AND SCU(952) ARE IN ALTERNATE CONFORMATIONS 
OF EACH OTHER.
;
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  B HOH 1173 ? ? O  B HOH 1211 ? ? 1.81 
2 1 O  A HOH 2850 ? ? O  A HOH 2854 ? ? 1.84 
3 1 O  B HOH 1113 ? ? O  B HOH 1166 ? ? 2.11 
4 1 OG B SER 203  ? ? O4 B SCU 952  ? B 2.14 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              433 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              433 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              433 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.26 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.04 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 72.60   -7.82   
2  1 SER A 196 ? ? -150.71 80.82   
3  1 SER A 203 ? ? 62.54   -119.74 
4  1 ASP A 306 ? ? -138.85 -91.34  
5  1 VAL A 407 ? ? -129.83 -61.35  
6  1 SER A 541 ? ? -66.01  67.32   
7  1 PHE B 47  ? ? 69.68   -3.37   
8  1 ALA B 62  ? ? -117.32 51.08   
9  1 CYS B 96  ? ? -140.62 10.21   
10 1 PHE B 123 ? ? 58.16   13.93   
11 1 SER B 203 ? ? 58.87   -119.64 
12 1 ASP B 306 ? ? -139.02 -82.45  
13 1 ASP B 323 ? ? -104.35 46.69   
14 1 VAL B 407 ? ? -128.99 -56.51  
15 1 LYS B 496 ? ? 126.84  -86.72  
16 1 ALA B 542 ? ? -123.99 -76.81  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LYS B 496 ? ? SER B 497 ? ? -145.70 
2 1 SER B 497 ? ? PRO B 498 ? ? 149.13  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    GLN 
_pdbx_validate_chiral.auth_seq_id     322 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 496  ? CG  ? A LYS 496 CG  
2  1 Y 1 A LYS 496  ? CD  ? A LYS 496 CD  
3  1 Y 1 A LYS 496  ? CE  ? A LYS 496 CE  
4  1 Y 1 A LYS 496  ? NZ  ? A LYS 496 NZ  
5  1 Y 1 B ARG 493  ? CG  ? B ARG 493 CG  
6  1 Y 1 B ARG 493  ? CD  ? B ARG 493 CD  
7  1 Y 1 B ARG 493  ? NE  ? B ARG 493 NE  
8  1 Y 1 B ARG 493  ? CZ  ? B ARG 493 CZ  
9  1 Y 1 B ARG 493  ? NH1 ? B ARG 493 NH1 
10 1 Y 1 B ARG 493  ? NH2 ? B ARG 493 NH2 
11 1 N 1 A FUC 2502 ? O1  ? D FUC 1   O1  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 259 ? A PRO 259 
2  1 Y 1 A GLY 260 ? A GLY 260 
3  1 Y 1 A GLY 261 ? A GLY 261 
4  1 Y 1 A ALA 262 ? A ALA 262 
5  1 Y 1 A GLY 263 ? A GLY 263 
6  1 Y 1 A GLY 264 ? A GLY 264 
7  1 Y 1 A THR 543 ? A THR 543 
8  1 Y 1 B GLU 1   ? B GLU 1   
9  1 Y 1 B GLY 2   ? B GLY 2   
10 1 Y 1 B ARG 3   ? B ARG 3   
11 1 Y 1 B PRO 259 ? B PRO 259 
12 1 Y 1 B GLY 260 ? B GLY 260 
13 1 Y 1 B GLY 261 ? B GLY 261 
14 1 Y 1 B ALA 262 ? B ALA 262 
15 1 Y 1 B GLY 263 ? B GLY 263 
16 1 Y 1 B GLY 264 ? B GLY 264 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 W NAG 501 n 
C 2 NAG 2 C NAG 2 W NAG 503 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-4DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 alpha-L-fucopyranose                                                        FUC 
4 2-acetamido-2-deoxy-beta-D-glucopyranose                                    NAG 
5 "2,2'-[(1,4-DIOXOBUTANE-1,4-DIYL)BIS(OXY)]BIS(N,N,N-TRIMETHYLETHANAMINIUM)" SCK 
6 'N,N,N-TRIMETHYL-2-[(4-OXOBUTANOYL)OXY]ETHANAMINIUM'                        SCU 
7 'HEXAETHYLENE GLYCOL'                                                       P6G 
8 water                                                                       HOH 
#